3KVYA

Trapping of an oxocarbenium ion intermediate in up crystals
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
293
structure length
290
Chain Sequence
b'DLVQLCNPHIAAMKEDILYHFSLSTSTHDFPAMFGDVKFVCVGGSPSRMKAFIKYVAMELGFAADYPNICEGTDRYAMFKVGPVLSVSHGMGVPSIAIMLHELIKLLYHAHCSGVTLIRIGTSGGIGLEPGSVVITRQAVDPCFKPEFEQIVLGKREVRNTDLDEQLVQELARCSAELGEFPTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQDYLRAAYAAGIRNIEMEASVFAAMCNACGLRAAVVCVTLLNRLEGDQISSPHDVLAEYQQRPQRLVGQFIKKRLMQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine Phosphorylase
molecule tags Transferase
source organism Bos taurus
publication title Glycal formation in crystals of uridine phosphorylase.
pubmed doi rcsb
total genus 103
structure length 290
sequence length 293
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kvyA00
5IU6A 4TS3A 2A8YA 3OZDA 4P54A 3FUCA 4L5YA 4PNPA 3DP9A 1A9OA 1Z35A 4NSNA 4WKOA 1PWYE 4LNAA 4TTJA 1B8OA 4OGKA 4BMXA 1YRYE 1T0UA 1RYZA 3FOWA 5B7GA 3PHBE 1LVUA 1U1EA 2B94A 4QEZA 1SD2A 4DABA 3NM5A 2A0XA 3ENZA 1U1DA 3OOHA 1Z34A 3EEIA 4QATA 2P4SA 1T8RA 5KB3A 4TXMA 4OEHA 4YO8A 5B7QA 1CG6A 4RJ2A 1TCUA 1RT9A 3U40A 3OZEA 1I80A 3SCZA 3BSFA 4DA0A 1ODIA 5K1ZA 1PW7A 1TCVA 4IP0A 1RXUA 4LKRA 4BN0A 2QTGA 1T8WA 4PR3A 1G2OA 4MCHA 3EMVA 2OECA 4LZWA 1TD1A 1U1FA 1Y1RA 4D8XA 5EFOA 1OV6A 1VMKA 4EB8A 4M7WA 1LV8A 5EPUA 1SQ6A 3LBAA 4L5CA 1ZOSA 3DPSA 1YR3A 1Y1QA 4DA6A 4R2WA 4L6IA 5CXSA 1LX7A 2GUWA 1A9PA 1PR5A 4X24A 3E9RA 3PNPA 4NY1A 1Z5PA 1Y1TA 3DDOA 3TL6A 5DK6A 1RXYA 1ODLA 5CCDA 3BL6A 4NS1A 3BJEA 4R2XA 1Y6RA 1Z5NA 1K27A 1ODKA 2IQ5A 2OC9A 1JP7A 4TXHA 4DA8A 3PNSA 1VHWA 2QDKA 2HN9A 2A0WA 5CXQA 1VFNA 4WKNA 1JE0A 1PK9A 1V48A 4JWTA 4L5AA 1TGVA 1V2HE 4E1VA 1SD1A 1A9TA 2HRDA 3EUEA 3IEXA 1Z38A 2QPLA 1Z36A 4BMYA 3FB1A 4WKBA 3KVVA 3LA8A 3E9ZA 5F7ZA 3GB9A 4MARA 1T8SA 3T94A 4M3NA 1NW4A 1OTXA 3UT6A 3OPVA 1CB0A 4L0MA 5CYGA 2A0YA 3KVRA 3UAVA 3IOMA 1NC3A 4TS9A 3NM6B 1K3FA 3UAZA 1XE3A 4GLFA 3UAYA 3LGSA 4D8YA 4D9HA 1K9SA 1A9SA 4DAOA 4D8VA 5F7OA 3OOEA 4DARA 1SJ9A 3F8WA 1ZL2A 4QARA 5F7XA 3O4VA 3DF9A 3K8OE 3C74A 1Y1SA 1JDUA 1Z39A 5CCEA 1V4NA 4TXLA 1PR1A 4GKAA 3NM4A 1JDSA 1OVGA 1JE1A 1PR4A 5B7PA 5JPCA 4OF4A 3UAXA 4TYMA 3K8QA 1U1CA 5I3CA 2XRFA 1JPVA 1V45E 3D1VA 2AI1A 1PF7E 4JP5A 4OJTA 1JDVA 4BMZA 4TTAA 2HWUA 2H8GA 4UC0A 2RJ3A 5EUBA 4G89A 1OUMA 4FFSA 2QTTA 1RXCA 1Z33A 5F78A 5F77A 3MB8A 4F3KA 3MMSA 1WTAA 4K6OA 4WKPA 1RSZA 1FXUA 1M73E 5F73A 1RXSA 1VHJA 4G8JA 2AC7A 4QAQA 4D98A 1Q1GA 4TXNA 2HSWA 5B7NA 3GGSA 1Z37A 4R31A 5F7JA 5ETJA 4F3CA 1T8YA 1JDTA 1A9RA 4DAEA 1NC1A 4F2PA 3FNQA 3EUFA 4JOSA 5CYFA 1N3IA 1V41E 4GMHA 3NBQA 4OGLA 1ECPA 2I8AA 4TXJA 2AI2A 1PK7A 1ULAA 1QE5A 1RR6A 2PGAA 3P0FA 4WKCA 5F76A 1JDZA 4EARA 4YNBA 4ECEA 1PR2A 4GLJA 3KU4A 1YQUA 5C80A 1B8NA 1A9QA 1RCTE 1YQQA 3OF3A 1TGYA 2ISCA 3QPBA 4QFBA 3P0EA 1ODJA 4MCIA 1C3XA 1Z5OA 2AI3A 3FAZA 2ON6A 3PHCA 2QSUA 3KHSA 3FWPA 3ODGA 1V3QE 4OY3A 1OTYA 1PKEA 4YMLA 4LNHA 2I4TA 3KVYA 3O6VA 1U1GA 4LDNA 3BGSA 2OXFA 3E0QA 2Q7OE 4DA7A 1Y6QA 3INYA 4KN5A 3UAWA 4QASA 4F2WA 5IFKA 4H1TA 4F1WA 1RFGE 4TTIA 4G41A 4M1EA 4DANA 3DJFA 3OCCA 3KUKA 3ONVA 1A69A 5FAKA 1OU4A 1PR6A 3OZBA 1JYSA 1YBFA 2BSXA 4YJKA 4U2KA 3OZCA 4I2VA 1ULBA 1PR0A 1PBNA 2OC4A
chains in the Genus database with same CATH superfamily
3V3KA 2AKAB 4PPGA 2ZJYA 4R40A 1H1LA 4YRTA 5F5NA 3NI2A 4UU8A 2KYRA 2ZVPX 3OZGA 3QVVA 1EE9A 3ANMA 3BHMA 4HTFB 1GRRA 2ODAA 2ZVQX 3LYUA 4MQ4A 1VI6A 3KYIB 1RQ7A 4KDEA 4RF5A 4P4GA 5C3MA 4RANA 1SCBA 1L1EA 2QR5A 4HRVA 4JYPA 3BAZA 4X1OA 3C24A 4RVDA 3C8HA 5FA6A 3TZEA 2CXSA 1KE2A 3CWQA 5FBHA 5KTPA 1AQJA 2JFFA 1DQZA 1U3FA 4FOLA 1ZUHA 5AXAA 2WY2D 4D26A 1CT9A 1VMDA 4YONB 1SR8A 2J6HA 1RQ2A 1GYPA 3CUVA 2WI8A 2ZTUA 4QULA 3HO8A 4H0FA 1YFZA 4P36A 4N5MA 2FPOA 2OORA 2EGGA 1D2HA 1G63A 2PIAA 1AHNA 2J9FB 1OE0A 3E4DA 2XE8A 3NH6A 2C4KA 3PUVA 4NARA 2GRUA 4YJHB 2AQKA 3KDPA 4U3JA 1C8LA 5ALNA 4B6PA 2I7DA 2XGGA 1DCMA 2HIHA 1J8MF 3I72A 1L5SA 1EX9A 3HY3A 3K1TA 1WXEA 4EJ0A 5L9AA 4FKMA 4EMTA 1KFEB 2M6SA 1YA6A 1Y9EA 2X7HA 3V8BA 5AVOA 4OEHA 2BJVA 2QMZA 1R6BX 4U9HS 3GLHB 5H70A 1VXRA 3R5JA 4B74A 4IIUA 3P45A 2UVPA 1G0OA 5DN6A 3ZGNA 7ADHA 4KRFA 3RSHA 3WLEA 1K68A 1X15A 2FSUA 1KK2A 3ADOA 3FZYA 3H5WA 3JQGB 4MVYA 2GX6A 4ASUD 2V6MA 4DA4A 3SCZA 3L6UA 4CM7A 1TOAA 2BKUA 2G9UA 3WWZA 5H68A 2DBVO 1I51A 4HQLA 4LVNA 4RMJA 4L3WA 1J09A 1IXRC 2VHWA 1ESEA 3SE7A 3R0IA 4INAA 5DLQC 5DI3A 4KJZA 4M1KA 4G8CA 3ZE8A 3A2NA 4LCJA 3F6SA 4TUYA 1ULTA 4HPWA 5IDQA 3AIMA 1A2BA 3QENA 1P73A 2ZB7A 3VXKA 4RU1A 1HQCA 4UXJA 3NHUA 2WHEA 4HLCA 4M98A 1EP2B 2GD6A 1KERA 3NYRA 5EIXA 3LQ2A 1TKRA 1KPIA 4WWHA 4TWJA 1DEKA 5DEIA 3HCDA 1WCXA 1OZ0A 3EJWA 3IIMA 4IG9A 4MPDA 4OUDA 4RL4A 2YN4A 2VJNA 4EF4A 2NO4A 3K0SA 4BL5A 2FAXA 4BQFA 3E48A 3JWPA 5HM8A 2EW1A 3DEAA 2CWWA 3ANLA 3DGFC 4ZOLF 4E1AA 2XVZA 2TYSB 4ZICA 2OSVA 3WGKA 1C29B 2F59A 1TM7E 4EKNB 3IIJA 1IN6A 1OV6A 2Q27A 1Y8QA 1JPUA 1OU0A 4EB8A 2NSJA 2FUG6 3L0OA 4P35A 1P19A 4L5CA 1E5VA 1ZOSA 3THWB 2W37A 4RH3A 3VZBA 1EVYA 3GO4A 2CNBA 4ZGWA 1FCJA 1NI5A 1UQRA 2VHXA 4GP7A 3ILSA 4JD5A 4BB5A 1NAIA 1ZD9A 1XCGB 4XTRA 2HQSA 4F8YA 4KQEA 1YKGA 3O5AA 3A4LA 3H9CA 4FX2A 2IEYA 1B26A 1E20A 1E89A 3OPYA 4MUJA 3HBAA 4GXNA 1Z2DA 1I6WA 4PICA 2WT9A 5DGDA 4A92A 2JF0A 5AHOA 3SM3A 1S9HA 1PR5A 3I4CA 2IK8A 5FOXA 4DNQA 1K7EB 1DMRA 1VG1A 4MS3B 3HE3A 2Q3LA 3TNLA 1C8VB 1DP4A 4IR7A 2Q41A 3WK5A 3PCXA 3KALA 1QR6A 3WMEA 4II3A 4OYHA 4DKXA 4Y6PA 4FWIB 3T6KA 1IATA 2P2YA 2X41A 2O1EA 4JR1A 4M8KA 5ITZA 1ZOIA 1P33A 2WJYA 3CONA 5AKYA 3HJAA 1QV6A 2GFQA 2QM7A 4DOMA 5IT0A 1MJNA 2I3BA 4RVUA 5DYGA 7YASA 4JJIA 3NHAA 5CCDA 3VPGA 2B5VA 4HX9A 4JMLA 2ZSHA 3HNOA 1L5NA 3K71B 4J2OA 1N6KA 3L7KA 4LCEA 4RY0A 2BFAA 3PGJA 4S3MA 5I4IA 2J6BA 1AUXA 4UFPA 1NDQA 2PLNA 3Q7SA 3OT5A 4TYPA 3SR4A 1AGXA 1AKRA 1K97A 4ZT4A 3VVBA 5JNSA 4R3NA 5CK4A 2O5CA 1LF0A 5MN4A 4MQMA 4QYMA 1U2RA 1SZPA 4HSGA 3KR0A 1ZN7A 4E2YA 5K0BA 1T1GA 5JNUA 2NT4A 3KPVA 4TKUB 1NNLA 1YMUA 2Q2WA 4YRRA 2IU0A 1YL6A 1OH8A 1T9GR 2BFCB 3SE0A 2AL7A 1VIAA 3OZIA 3ZTTA 3BCHA 4JC5A 1U31A 4A0QA 4HDKA 1HLPA 1ZH2A 3L7MA 3M5CA 1YHNA 4R5MA 2ZUTA 5JG7A 1VSBA 1RS0A 1WXFA 2CN1A 2BGUA 3DTNA 3AU8A 2GSDA 3IURA 4U2CA 4F12A 3TCXB 5CT5A 1AY0A 3RBVA 3RARA 1YB4A 1NUAA 1E2HA 3AHEA 1Y8ZA 1VB5A 1L7QA 8ADHA 3QOYA 3WAGA 1LF5A 2C29D 2GASA 3KEGA 4NXNB 4KIWA 3ZCXA 1FYFA 1PZHA 4WXHA 4OK6A 1US8B 2BT4A 3OOSA 5AH0A 1VPEA 3CNOA 2GSWA 4UDXX 3RW9A 1CVRA 2XWQA 5E3JA 2QL5A 4EMSA 3V8MA 3KSUA 2I3ZA 1NUSA 3LOPA 3T35A 1CIJA 1JT2A 2PKYX 1HNNA 2WU1A 3LRTA 1BS9A 1QG2A 2WJAA 3PC8C 2EZTA 4P7JA 4GL2A 1RYHA 4AYWA 4LFBB 3U3XA 3OTHA 1J2TA 1TQ4A 1Z45A 4NU5A 2O3UA 4U7TB 4TGLA 3T5AA 1FXWF 1Z6AA 3FBGA 2QPAA 3GEGA 3IPXA 1FUEA 2VO1A 4A0SA 4GX0A 3UV7A 1DTWA 3W5HA 1PUIA 3GD7A 1OYWA 2F43B 2AE2A 1NQOA 3QU9A 1K3FA 3K09A 5F4BA 3UAZA 1WPGA 3BGVA 1QFZA 3PXDA 3BK2A 5K0EA 3ASZA 3WRYA 1UPXA 3EIHA 2EXXA 1AF7A 3HS3A 4JT8A 4KBFA 3WLIA 2REQB 4HEA1 1N0WA 5LA6F 4OATA 5KTRA 3JYHA 4CFZA 4IIBA 1L7OA 3N2LA 4EZIA 1SVKA 4D8VA 2OXRA 1PQWA 4LUCA 4BEJA 5CA1F 2ZB3A 3HFJA 2HLDA 1YHYA 4FGZA 1JR3A 4NPCA 1XA0A 4ZVPA 3VZRA 4Q3BA 2HRQA 2IXAA 2QVZX 3G2KA 5EJ6A 4U7PB 2R4TA 2OAQ1 4FJ2A 5T8KC 4DL9A 2IGBA 2ZLBA 3T0FA 2ZUFA 3T3PB 2C7QA 2ZRQA 2PT7A 3JAWB 1ESDA 1OCEA 2Q1XA 4EUNA 1VHTA 2VDVE 4HAVA 5DGTA 1IPEA 4AT1A 2FFJA 4DTIA 1QMPA 3RWOA 3JPWA 3RAPR 2B21A 3WNZA 1GKIA 5KNDD 2CXUA 1WV0A 4LYDA 1UOOA 2HWYA 3CCBA 2PBLA 5IK2A 4BX8A 2A5JA 3H2BA 1E9EA 4QX6A 1W0KD 4A0FA 1LPAB 5LZ7A 4UBLA 2XMGA 3BERA 4NPHA 3DTTA 3IYLW 3G0DA 1O57A 1P5HA 1VL5A 4DWOA 1RZRD 3ZCRA 2HD4A 4P33A 2IXGA 1TAGA 2SECE 3G1UA 4JEUA 2C5HA 2Z30A 2AD1A 1GZ4A 4IHJF 3CR7A 4PLTA 3E82A 1BCSB 3ZDRA 4P4SA 1DUSA 4BTEA 1L5RA 2BFEA 2GN9A 1P0QA 2ZSUA 1UWVA 2X3UA 2GEJA 2OV2A 1ZISA 3BXXA 4FHZA 3QY9A 4ZHSA 2H1OA 4P93A 1ICEA 2CY0A 1RPJA 2IKSA 2P78A 4U5XA 3GEMA 4ETMA 1MJFA 4EHNA 4YP0A 1I01A 3G5LA 1PTJC 4YLEA 2X3YA 2FN3A 5FQOA 4ZC8A 1T5DX 2FEPA 5FBVB 1J00A 3M3DA 3Q2IA 5A3JA 3EDYA 2GM4A 2XB9A 3QX7A 1QZ3A 5LQAA 2FPGB 2HCRA 4JZKA 2J59A 2D5LA 1CFJA 1KAHA 2I6TA 2M2IA 2ZIVB 3AUYA 3WYCA 1GP2A 5T57A 1MHPA 3PE3A 5FLKA 3QY0A 1PYGA 5BSTA 3TVDA 2CCJA 1QVZA 1U6IA 4D3ZA 1YQWA 1Y3IA 4RXTA 1SVMA 2FSHA 2HWKA 4DV6B 4WJKB 1DAGA 4O4LA 1OFUA 2J3DA 3OQPA 4QLBA 3MT0A 3BVPA 2EZ8A 2BFCA 5J47A 3JD4A 1NW3A 4B3MB 5K2MA 3WP1B 4DYHA 4RTMA 4EUEA 4BATA 5DCYA 5FFFA 5HE8A 2H48A 2NTJA 4DJAA 5TMDA 4CU2A 3VPAA 4PSCA 1DDGA 2RI6A 5JSYA 3EXFA 1Z33A 4MV0A 4N7MA 3TI9A 4PYQA 3C6QA 4OVKA 4BJ5A 1Z22A 1QF9A 3B1XA 2GEKA 4EG7A 3DUFA 4YJGB 1SKQA 2QAGB 2C0QA 1MVNA 1XHFA 3PHGA 2OB2A 5HDBB 3EC1A 5AKLA 2O8CB 1D4ZA 3GELA 2G09A 3ST7A 4J94A 4MEJA 4PAWA 3MMSA 1SWVA 4A23A 1ISMA 3JASB 3O83A 4U7JA 1Q0UA 3SQXA 3JQRA 5FDFA 4YREA 3CG0A 4Q5IA 4X41A 5FOWA 3M2PA 1OLXA 4Q4LA 2BD0A 1DRJA 4LC1A 1UXGA 1VYHA 5A3VA 1TO1E 1BHO1 4I8XA 4KWIA 1TF5A 3VR6A 1M73E 1N2XA 2FP4B 3TK1A 1SUDA 3ZX4A 5IKXA 4ZIRB 1EUCA 1VHJA 3LL7A 2C0PA 4L8LA 4IIJF 1TW2A 4HC4A 2BMVA 5COBA 5KCMA 3CUSA 3PT9A 5CM2Z 1XRMA 4KKXB 3ZC3A 1LPPA 2C92A 3TLYA 2WU3A 1G2PA 4L4XA 3IDAA 2WM3A 5BVHA 4MI9A 4TMTA 5A9RA 1JZSA 1Z3IX 1HSOA 2PWYA 3FUWA 2D5IA 1YBHA 1RBMA 3VHRA 1FRFS 3WNDA 4MKZA 5TE9A 3EUAA 5AM0A 1AKWA 2QRJA 2EKQA 4G86A 1DARA 2ZUDA 3W5VA 1PLKA 3QSYA 1WPQA 4DMGA 3G2IA 5BURA 1K88A 5CYFA 1C1DA 3RF7A 4BJ1A 4RTJA 1RCUA 5KOJA 3RT1A 1KTVA 4IDOA 3THXA 5JCOA 5GP1A 4TXJA 3UPDA 3TIIA 3IV7A 2DFPA 2ODBA 1P1CA 4J0GA 4W8GA 2WVHA 4NBUA 4P53A 1M8KA 1QC5B 2OBMA 4CCYA 4OQDA 1DBWA 3NDIA 3G9QA 3D4OA 3VOBA 2Y1FA 5EUCA 2MU1A 3EQ6A 4DREA 3VSCA 4OLFA 4YRJA 2BCJQ 1MHTA 2BGGA 4UBOA 2P65A 2WDPA 3CT6A 4Z54A 4JQSA 4YROA 3K9FC 3NV7A 2YWCA 1JG4A 1EWVA 1DAIA 3TPCA 3KHKA 3RNLA 1HMPA 4O1HA 3HPRA 5D7BA 4QUJA 2WTNA 3KKMA 4ZCSA 3SF0A 4BV8A 3UFXB 1NN1A 1QHIA 2HB6A 2I2XB 1XRJA 4ICIA 1QGED 1KY4A 2OFFA 4ENTA 5JAIA 4V0MA 3D3JA 3M1YA 2I0FA 1JNXX 1KA9H 4YACA 1MRNA 4QGGA 2ZJBA 4NABA 4W1RA 4EOGA 4D7AA 4EI2A 1D5CA 2EYQA 3DM9B 3GUVA 4TLCA 2HRBA 4QPJC 5AYVA 1UCFA 3AV3A 3RI3A 1VRVA 1Z5OA 1Y7HA 3FKSA 4FGJA 1LBHA 3ZQKA 3W5CA 3KOWA 3O03A 2YNMA 1EFTA 2WZCA 1O58A 2VP3A 4K9QA 4EP1A 3WJAA 5BXYA 4GOJA 3S5UA 4GYKA 3VYUB 4IKEA 1Q84A 5DLYA 3C5CA 1E7MA 1QGDA 3ROGA 3L02A 3MWEB 3TSCA 1NJ6A 1WMFA 3G2HA 2FJ0A 4U8HA 1X8LA 3IKVA 3BE8A 4HDMA 2AEFA 1GKYA 1ZIXA 5G4LA 3QX3A 4MPTA 3TO5A 2QJOA 2QUIA 2CJFA 3TPZA 1FP1D 3G5UA 3WTBA 3ECCA 4H15A 4P34A 2CEAA 1QBKC 2CDAA 4RHTA 7GPBA 2R1VA 1MRSA 1X87A 3J7TA 5JD5A 5KTOA 3CVXA 1JNYA 2WUGA 4C0KA 2VDOB 3IMEA 1PX0A 4WFIA 3JYOA 4IDBA 1U28A 1SCQA 1VKNA 1A98A 3HVIA 4G4IA 4CE6A 5FX2A 1Z17A 4U4AA 1MTOA 2MSNA 3MW8A 4BCDA 5C37A 1D9XA 3QWFA 1TVMA 1ILEA 5IHXA 2PT6A 4GI1A 3TIXB 3CFYA 4DIOA 4IOJA 2XEDA 2V9PA 3JXEA 3NC1C 4F2WA 1EFRA 1K8XB 2C04A 1XDGA 4YX9A 4CLRA 5JQWA 3OM0A 3KL4A 4MR7A 3FSGD 2J3IA 1ZGZA 3TX2A 3UMCA 1PW5A 1L9XA 3Q2OA 3OCCA 4E4RA 5DKFA 3S0JA 4JU9A 4OV6B 3WSWA 2DQKA 4KH1A 1OU4A 2DHEA 3U3DA 1LEHA 2IVZA 2OD9A 3KJQA 1VJ0A 1QU2A 1UODA 5B3JC 2P9ZA 1DXOA 3I6ZA 3E0XA 4YJKA 5KJ1A 2AN9A 4B1FA 3PS9A 2X1HA 5DI3B 2E9SA 2V96A 3AKCA 3RT7A 1GOTA 5CLIA 2CHUA 4L8VA 2W8BA 3UT5B 1PR0A 3VDRA 1WP4A 4PO1A 4FFWA 1X9IA 2FCAA 4TLLB 4GG1A 2F3RA 3GJ8A 3VPCA 1V2GA 4E88A 3B13B 2ZROA 4JLWA 3LOUA 2HK6A 3UXMA 3WGVA 3SHQA 3P0RA 4F72A 1E79A 1X92A 3I39X 3OY7A 5EJMA 1FDSA 3GCXA 3TOCA 5TB5A 2WTBA 1KEZA 1T0HB 3DL7A 4ALNA 2PCLA 3BFVA 4NENB 3EZ7A 3F7OA 1UQUA 2WYIA 2ECOA 3CUUA 3JZMA 1U7WA 2G25A 2X7JA 3OCXA 3OTIA 3PRKE 2YJ3A 1DJPA 4MQUA 3S1SA 1JDJA 4JCCA 3EPLA 2BP7B 1KBOA 4HKTA 3W5UA 3LDHA 1NXWA 2WJJA 2XQVA 5I47A 5KJ6A 4YUXA 2DMRA 2MSCB 4QTYA 5K8LA 3HCCA 1W34A 2J0QA 1Z6YA 3B5JA 3KT8A 1XQ1A 3OESA 3U31A 5KTSA 4TTRA 1G98A 2HJSA 4LIPD 4AM8A 3DC2A 4HBZA 5AK0A 4MRMA 1JUDA 5KYWA 3JCZA 4DABA 5KTTA 3PLNA 4NAVA 4RD6A 4X1IA 2OT3B 3BN3A 4QDJA 1GQYA 1R0XA 1MG0A 2Y1XA 3EVZA 4OHUA 2EZ9A 1JHYA 2RCYA 3LUPA 1H3FA 3R3SA 3KUXA 2O2EA 2IXBA 1S8FA 3TEJA 3HWRA 4U6QA 1QO0A 2JIOA 1S1CA 1YJ8A 3MQ4A 3R7FA 1TLLA 4ODIA 5JAMA 2F00A 4KW7A 2VPTA 2VP2A 3OICA 3O9VA 4Q9LA 3HJFA 3EIUA 3M8KA 2UYQA 4JFRA 4FE3A 4CMGA 5FJJA 4D0LB 1PW7A 2D5AA 2J4CA 5I9BA 5E0KB 4GVXA 3GGCA 2HEGA 1IIBA 5JCOC 1TJ5A 5GVRA 4JB3A 1KU6A 1H6AA 4O4HB 5BSRA 5DO9A 1YACA 4WXMA 2QTGA 3RB8A 3TTSA 2O8CA 3SSMA 1IM2A 3MUNA 3E81A 3PUHA 2ONYA 1EDZA 3ZI4A 4DUYB 1XJQA 1Z28A 3C8MA 5JBNA 3HM9A 3X1JA 3GIDA 4JP8A 4GT1A 1E2BA 2PK3A 4QD3A 2P1DA 2ZCUA 3UANA 1H66A 1XSEA 2CSUA 4WNIA 1RAHA 1XROA 3BMXA 1J99A 3E58A 4Y2HA 5E4FA 2XF2A 1FE8A 4CPDA 1UOQA 5TQ0B 1TYBE 5ICCA 2V7EA 5TLSA 3VR3D 4EZBA 2A0UA 3D3QA 2FWAA 3GLQA 2MDTA 3WLPA 4MB2A 3CW9A 2ZRKA 4OI4A 4EHDA 1QHNA 1BD3A 1CY7A 1V8ZA 4NECA 5CPFA 4DLVA 2H59A 1E77A 1S7CA 2Q3FA 3A7EA 4CMIB 4DZTA 4JLDA 3IV9A 2IPOA 3EVGA 4JP2A 2CF5A 4NZNA 5JS6A 1JA1A 1I14A 1Q3KA 1ZITA 2RB4A 4GDFA 5JZOA 3KT0A 3RRJA 2X6TA 4ZVRA 1DELA 1YUMA 4HXEB 4Q7MB 3MQ2A 4A91A 1N2SA 1M33A 1T91A 4KPGA 3SOPA 3FI9A 4HAYA 4YP5A 3RJZA 2NYAA 4L6IA 5AICA 1JMVA 3BS4A 1DO2A 2BBOA 2QRKA 4MUEA 2IHBA 4YAEA 1XZIA 5EP1A 1GSHA 2IIPA 2OV3A 3JD0A 1U8AA 4FPXA 5DOVA 4DWWA 3GFSA 4B8ZA 3OIYA 4DNFA 5JATA 4IVRA 3U4DA 1OKKA 2Z2XA 3E2PA 4GPTA 4MI6A 4OK5A 1OC2A 3ROTA 1X7DA 1ZC3A 4BYMA 5KVSA 3W2GA 4QTTB 4P58A 1Z75A 5FH9A 2QXUA 3BEDA 1U2QA 4ZDKA 4TPKA 3J80A 4AIRA 4HDNA 1ZKDA 3B6MA 4AJJA 4PF1A 2Z2ZA 3DE0X 1U28C 4NZOA 2OZLB 3VH3A 4IH9A 3UPUA 1MO6A 2BFDB 2VJBA 1QPBA 1E59A 1Q0ZA 1WEKA 1K6JA 3OX3A 1AKVA 3ICEA 4EG8A 1ZOPA 3T3OA 2ID9A 4Q82A 2CXQA 2W2LA 3JQFA 3LX6A 4FMCB 1I7LA 3KKKA 1Y7LA 4OHVA 4NH4A 1OILA 5CB6A 4JQYA 1SULA 4FNOA 2ZJZA 5JCJA 4WVLA 4A8JC 4NV3A 1FP7A 4B3SB 3EPHA 1LPNA 3I1JA 2ZYSA 3P9YA 3A2KA 1KKUA 5HKBA 1F1JA 1FNMA 1UZLA 4UPDA 3ITKA 4UMEA 2Q3EA 5CK5A 1QBGA 1ZO8A 1HE8B 1M1XB 4AY4A 1RLTA 1H9CA 3HBJA 1GU1A 1U5CA 7AT1A 4ZAXA 3KXIA 2JRLA 5BNWA 4WECA 3NT4A 4EPXA 5G1PA 4R1TA 3IRVA 5EOVA 1H8HD 1H2XA 1TC1A 1TRKA 2DOKA 1L4FA 2D2VA 1BVYF 1Z8HA 2RDMA 4E5DA 2NNWB 3ENQA 5KVVA 4KODA 1X1AA 5CFNA 5I7FA 2HTFA 4QNMA 5LOVA 2R6FA 4NPAA 4HZUA 4XXHA 2DBQA 3AOGA 2OOSA 3ZDFA 3COSA 1NVVQ 3HYSA 3PHHA 4PBSA 4YCAA 5GM1A 2ETXA 3RK4A 5JADA 5AOAA 2LTAA 5FL3A 2VNIA 5G3ZA 2XXAB 3T95A 1NY6A 1KSJA 1ODFA 3O3NB 3F7MA 4OMCA 1JHXA 1NTOA 1U0EA 3C1UA 3EXAA 3SJ7A 4DG8A 1NFFA 5AI8A 2C98A 3V33A 3QYAA 3DL4A 4IEFB 3MD0A 1L5WA 2QX9A 2ISQA 4DJDC 4L8GA 2QW0X 3OZTA 3IESA 4RMNA 5CVUA 1UAAA 1RPAA 4KQGA 3Q5EA 4M3NA 2H7CA 5ER9A 4PYMA 1NW4A 4YMSA 1GG5A 5DNDA 2HDOA 3UT6A 4ILKA 5KJCA 1P1KA 4UZFA 2PKEA 4JS0A 4EJMA 1IQUA 2PWPA 2VRNA 2Q8QA 1EGMB 1P0CA 3RBZA 1HYGA 3ZV6A 3OH8A 5C34B 1Z4IA 3LO8A 3A1FA 2DHCA 5ALHA 1W2HA 1Q1BA 5HQTA 2VYVA 3R3JA 2XUGA 5HWSA 3U5ZB 1JJIA 2PRZA 3N2ZB 3T5BA 1Q21A 4ENWA 1NUTA 1CVLA 1UUFA 1H4QA 1PR9A 3FHCB 4YP9A 4E1BA 2Q6TA 3MGKA 3Q8WA 3FF4A 1B8UA 3KDSE 4TUYB 3HVKA 3WGQA 1LW7A 1BZYA 1G0NA 2YIVX 4FBLA 4MW7A 1M7BA 2B6HA 3D2LA 1NF2A 2XY4A 2X7XA 1V3TA 3COVA 2W83A 3IJEB 3VU9B 1JR4A 4JGIA 1C3OB 1UWKA 2HSJA 4QFCA 2X4GA 4QGAA 1BU5A 1DAKA 1Y8CA 3RFCA 1RACA 3ZGXA 5KSWB 3K8OE 1Q3TA 2HNKA 1MKYA 3KZCA 3B6KA 4FMCF 4HYYA 4MHOA 3RVMA 1K8ZB 3VPXA 4KP7A 3ZDAA 3O4GA 1M6VA 5KJEA 4LYHA 1OOEA 4JXXA 1Y7TA 3ZU3A 4PX3A 5CRIA 1NZJA 3ZR4B 2IY7A 1JF8A 3ROKA 3MMZA 4A1FA 4K9DA 1UJ2A 2G6BA 1Z26A 2NO5A 1P77A 4C7OA 1HL3A 4F7DA 2YWGA 2VI5A 3NT2A 4OM7A 4DY4A 4F3YA 4I3GA 4DJFC 3MTGA 3G7UA 1JDSA 1U8ZA 4OTZA 1KR2A 3C5HA 3KKPA 2WM2A 1Y1KE 4EB6A 1IJFA 1Q1ZA 5EWLA 4NDAA 1J1UA 3NDJA 4HGZA 3ZWOA 5BNIA 3GZ4A 1P91A 1CV2A 1ECLA 4BNTA 1U7HA 2G63A 2VRBA 4LJ4A 4GIBA 3MINB 2W6CX 3WYGA 1F9AA 3I8SA 1MV5A 1HE1C 1G5FA 1NVVR 4Z99A 3RTBA 4JL8A 2AI1A 3EC7A 1CY0A 1FP4A 1KP3A 4M9RA 1X7XA 3VTFA 1DLIA 4EG5A 4MVJH 1O87A 3UK6A 4DUGD 1JIXA 1SM4A 2PXXA 1G20A 2VATA 5DBHX 3F1LA 3VR5H 3ZV5A 4KTVE 5JPIA 4Y3UA 4N76A 3JVVA 4JK3A 5CHYA 2H8GA 2AJDA 4JI5B 4O4HA 4Q01A 2PMFA 2CXNA 2ZM6B 2JGEA 2RJ3A 1U2TA 5EUBA 3TNJA 1T5TA 2Q5FA 2AN1A 3EGDB 3S28A 1PT6A 2J9GA 4ZQCB 2CXOA 5HMLA 5JHHB 1G5RA 3ZHYA 2OZKA 5HEKA 4GMGA 5H82A 4IV5A 3VUEA 1M2VB 3LW7A 5IDYA 4KR2A 3TKLA 1NN5A 1S3GA 4UE6A 3TW0A 3MGGA 1IE3A 1YR1A 4YCCA 4G5YA 6ABPA 5BV1A 1ENZA 3EW9A 1NMXA 2FSVA 4HAOA 2ZFUA 2E85A 2FR1A 2HMAA 4JJZA 1UDBA 1ZK3A 1SB8A 3O1JC 3QLUA 1Z12A 4C2AA 2HV9A 3AEUA 4TLEA 3GOHA 1OXKB 1B7GO 4JV5B 4LMBA 4R54A 1P2TA 2HV8A 1NPYA 1ECCA 2J67A 2OCPA 3DGEC 3LHFA 3MPUA 3SHVA 1E61A 3W9BA 1QZTA 4V0SA 4BKPA 3U44B 1RSZA 2ZCJA 1D5WA 3VR4D 1XJ5A 1FMFA 3ZZMA 5JECA 2W58A 2R87A 3VNRA 4C7MA 2ENUA 3SICE 3T7KA 3W2FA 4B2IA 4MWCA 4LRTB 3PVCA 5JO9A 2PMEA 1FW6A 4TXNA 2L19A 2WIBA 4ZQFA 1ZH8A 4LTNA 5A4DA 1DPFA 1PU2A 2R7NA 4G97A 4NTZA 4NVRA 5E1DA 1GNVA 5B6JA 4KR3A 4PC1A 2FSPA 2WSSA 1GPLA 3NIFB 1UKVY 1T1IA 2IZ0A 2RHMA 2QK4A 1W5FA 1GJRA 1YNOA 1NXSA 3PR1A 4M1OA 4R16A 1Z7WA 5ALWA 5BPFA 4I3HA 5GZ3A 3B60A 3N7TA 4F91B 1DUIA 1F9EA 1MJGA 2XNHA 3RCBA 3SYNA 3ZJVA 1OWNA 4LRQA 1VB3A 4LF5B 1BU8A 4WFJA 3ZGLA 4YJ2B 2NZUG 1RLMA 2CXPA 4QG3A 3I61A 1BWPA 1Z83A 4WFQA 1LTKA 3K4PA 4L0QA 1EWQA 2NVWA 1U6JA 1KAOA 1NV9A 4Y2QA 1V11A 2WFLA 3H5LA 3VV2A 5CEEA 5JASA 5KYUB 2HF7A 1NLUA 4MA0A 3V8EA 3LP6A 4LDPA 4OKIA 4KNYA 3TRKA 4MHSA 2JHPA 3PX3A 1KAMA 1ZD8A 3FVTA 4KFTA 1Z2EA 4A5SA 3PTAA 1S8OA 4BZXA 1P6QA 1W9MA 1TMYA 2CJXA 3IAM1 4LWQA 5EIWA 1Q19A 5FV4A 2QL6A 1YNSA 1N25A 3F8SA 4HQ6A 1V8FA 4RKQA 1QOQB 5E7JA 2FXVA 3D6JA 4LWZA 1ORIA 1XJCA 4ZRMA 3GA0A 1Y89A 3RPEA 4HYTA 4TTQA 1YB7A 5A7GA 3ZWYA 5JT1A 2XRMA 2PFGA 5CHEA 1Z4JA 2JZCA 4KAXA 2D0OB 5KIAA 3GPIA 4NFHA 2DQYA 3KZVA 1NN3A 3P0EA 1KE1A 1EJ6A 2X9VA 2LRHA 5BR8B 1E9AA 1SCJA 2HQBA 3HU1A 3OZAA 1YB1A 3RTAA 4GKKB 2UXCB 3MD9A 2PZMA 1QHYA 3K96A 4EO7A 3WYEA 3OZRA 3BILA 3C6XA 4JT4A 1YJXA 3HC7A 4DYVA 2IUTA 5JEDA 3C85A 4QA9A 1V43A 2J0VA 3QKWA 2EF1A 3KHSA 4B0PA 1GY8A 3KPYA 4BNKA 2Q62A 1IULA 3B2EA 3AGQA 3L04A 1HNZB 5IC6A 5HNKA 3MTEA 4XWKA 4RTOA 4JU8A 5AI4A 3X1YA 5LMZA 2RARA 1PBTA 2XOKD 4IIGA 3W79A 1Q0QA 1H2AS 3CRZA 1FEZA 1XZHA 3OY2A 1AIPA 1PNRA 2QRLA 5BN4B 1X70A 1CBUA 3C7KA 4RESA 4Y18A 8MHTA 2UYOA 2E4UA 3FSEA 3GVXA 4Q1EA 3RJTA 1E5XA 3FNBA 2G0TA 1CQIA 3BT7A 5BMVB 3HG7A 2WVGA 1CIVA 4IHKA 4XUGB 4A6EA 4IKOA 3E05A 3K1JA 2V8OA 1PS8A 1J07A 1JQ5A 2GM5A 3AEYA 2ZXEA 4OOFA 5C1PA 1YJCA 2QG6A 5KU1A 1HQYE 1V95A 3FKSD 1P7YA 1P7ZA 2VPZA 5AXCA 1E6KA 5JDCC 3SFZA 4ESVA 2QP3A 1F2TA 4UVHA 5EZYA 1QX3A 2EV9A 7MDHA 3SD7A 2G06A 3MWKA 3VR1A 1KSHA 1TK9A 2YBDA 3LY9A 3ORFA 3QFTA 5J2TF 3S8EA 2W9XA 3NGMA 2PRYA 1IBRA 5L7YA 3TSWA 3VC7A 4HFNA 1E69A 3STTA 5HFNA 2OHHA 4DWVA 2ZRCA 3OQBA 4F6RA 4AF7A 2QORA 4MVJF 1RYBA 3SK0A 1XDBA 1G64A 3GLIB 3D0RA 3PGLA 2V6JA 4JI6B 5KSYA 2QSZA 5I7AA 4RKRA 1LLDA 1PBNA 1SUWA 2BF7A 2ZUVA 5CIWA 3C48A 4YMTA 5IABA 2GR9A 4YUVA 1CUUA 2QD5A 4KIFA 3S55A 3VRHA 4R71A 4HMPA 1JFLA 1KZ6A 3UJHA 4YN3A 4I99A 2R6CA 1FVXA 1GFZA 5IVKA 4EPVA 1RTTA 3AKEA 3LUJA 4UDNA 2HU7A 3MK31 4HUQA 1ADJA 2BFOA 3P26A 4QWMA 4TTJA 1P5JA 3AVPA 1MH9A 3BIOA 4PZCA 4CEHA 4P3XA 5EMLA 5L3QB 4YT8A 4OFXA 1G3UA 1KDZA 5AFSA 2MR6A 1IBKB 1YIOA 2YW2A 3R77A 2WIAA 2JK1A 4RFSA 4ZA2A 1XRPA 2GN1A 3RS8A 5G0VA 3L49A 4BLQA 4N0DA 4H16A 4CR8A 3HUFA 2YINC 3PEUA 4D74A 2XHZA 4TYQA 4W9NC 2DKOA 4IFEA 4DA8A 4ER7A 3S70A 1EXDA 3VNVA 3W78A 3OOJA 3P1JA 5CP8A 4M38A 3HU2A 2KLHA 2EATA 2QYHA 1KZHA 1DDOA 1LXCA 4TQUS 1IBLB 1JJFA 3CVUA 2Y8EA 3HJCA 5FUYA 2M9MA 4BMNA 1ZGBA 2EJWA 1B6TA 3MOIA 5AW7A 3KM0A 3QX9A 5GONB 4RLHA 4F2HA 4CV1A 1PZNA 3E35A 3TG8A 4KMOA 4K46A 1N0VC 3QFHA 3KK0A 2P0AA 3GFBA 4ZODA 5HUHA 3UJCA 5HIAA 3N0VA 1X7GA 2R751 3SGLA 2GM3A 5IARA 5KYTA 1O08A 4RNDB 1GGFA 2IW1A 2B5WA 3DM5A 4CIXA 1L7PA 1T4GA 1TIPA 1XLTC 4N5HX 4WK0B 3ELYA 2WTMA 4XVHA 5CUQA 1I8TA 2AV6A 2Z5GA 5K1ZA 5KYVA 3GQVA 4QOSA 2CBZA 2HT1A 4C7BA 3D7SA 4BQIA 1MDBA 3M2TA 1WUYA 5JAZA 3GAAA 1RFLA 2MYTA 3LPDA 4GSLA 2BMJA 3NWOA 5T3UA 2HI0A 4G0UA 3H6GA 2JD2A 1BDHA 1QRSA 1EUYA 4N12A 2M98A 2ZR9A 3AB7A 4DXHA 4P5DA 5L53A 3M5PA 4MCHA 1H4SA 4P6VF 1MFZA 2I99A 3RVDA 1M72A 3TXYA 1YRLA 2E1RA 2J1LA 2E1PA 1T1JA 6PFKA 2PRSA 1WSAA 1JEEA 1ISSA 1QVWA 3AP1A 3RKRA 3RYHA 3TOVA 5CDTA 1I3MA 1U1FA 2P90A 1XVTA 1NOKA 3BBLA 4YDSA 5EJ2A 2EGUA 2YOHA 1FU7A 3ZLVA 2HX1A 2PVCA 2O50A 3O94A 2PZEA 5EIFA 3SXUB 3BWDD 4DBZA 1LS6A 2CF6A 3PK0A 4M54A 4CTOA 2HY7A 2XGSA 3UWPA 1SVIA 1VCOA 3TB4A 1AHHA 1I1QB 1JZTA 3WMWA 2B37A 2GCNA 3TZCA 2GPYA 4LV6A 5CEJA 2W2KB 1DXHA 5MDHA 1EH5A 4K81B 1D7OA 4BZZA 1IPFA 1JQBA 1WCWA 4H2DA 3F6BX 3CX8A 4AXBA 1V3VA 4RSMA 1ESMA 1N8KA 1RADA 2QU8A 3HCEA 3L84A 1RE1A 4AN1A 3ZDXB 4UBNA 3HV2A 3ZNOA 4CTKA 3IUMA 3OMWA 1W6RA 5JO0A 1AUOA 3R7AA 1TA9A 2JBAA 4YQFA 1JA0A 1XB2A 3K9LA 1QCYA 3BDVA 1NW5A 3CKYA 4YC7A 5HFAA 5SZIA 4NU0A 5HS6A 2UUBB 4QFDA 1I1OA 3N3BC 4LV5B 1OF1A 1BMTA 4P1ZA 1N33B 2E4YA 2FE1A 1A9PA 1UJMA 1SU4A 2CJWB 2H6EA 1ORWA 2H18A 3H97A 3ZG6A 4UU7A 3D4LA 3JRWA 2ZQZA 2ZW9A 1KTIA 4CL8A 4WL0A 5AVQA 4TKUA 2PLRA 4ND8B 2D8MA 4C0JA 5DX0A 4DT1A 2BSQA 2MOKA 1WOYA 2GH1A 4JB2A 4FS8A 3RAJA 2WHYA 1PL8A 2CNKA 2GPAA 1F1BA 4UPVA 2X0IA 4C2BA 2W0MA 5BT9A 2R48A 4MVJA 1PJ2A 3I53A 3U7IA 8LDHA 3DDOA 1SY7A 4DBLC 4X00A 1U7UA 2O0MA 1U9IC 2GM9A 4QTZA 5E7MA 3IAHA 1SD5A 2IDZA 2NN3C 3KQOA 2CLEB 1UOPA 1EI9A 3NW9A 4JJ6A 1DWOA 3WB1A 5J2TA 4G09A 2ZJ2A 3L6DA 3BL6A 4MGHA 1WZCA 1KS9A 3MJTA 1YK1A 3UWDA 3NBUA 6CHYA 1N0IA 2YYZA 1ODKA 4FGKA 2QPOA 1M2WA 4Q3OA 4TV8F 3NNNA 1YR2A 3VPBA 2RAFA 2XQKA 2CB0A 2ZP1A 3B3QA 5UKDA 2JLRA 3GHHA 3QKTA 4ZCIA 4GP9A 5CXQA 3F2VA 4PINA 4NBLA 3RIXA 3TGWA 5BV8A 2J7PD 1GFSA 1K63A 2QLNA 1KDOA 4JIGA 2A14A 3S8MA 2L69A 2OPBA 1GLVA 4OA5A 3HVHA 4WLEA 4LYEA 5FPHA 4HLQB 2JC3A 1QMGA 3O8OA 3QH4A 1ZK0A 1GILA 1XA4A 1XTKA 4IF4A 4GECA 3LUDA 2XUPA 4WMLA 3IEXA 2GRJA 3C3AA 4U2FA 3OU7A 1UXHA 4KN8A 4MV4A 1Z0KA 3BD7A 3SC2A 1DJMA 1ODTC 1YT5A 2QAGC 3O8NA 5JXJA 3C8DA 3DLTA 3UK1A 1JILA 1T6ZA 1W5AA 4FFOA 1NWCA 3RKUA 3UA4A 2DETA 2FPPB 2R00C 5DX8A 5TQ2A 4P92A 1UZMA 2JAWA 2FWPA 3EZYA 1OZGA 3BMCB 2AJLI 4BN4A 4R1OA 4CM9D 3RROA 3D31A 3FZQA 3NTUA 2FJUA 4HRXA 3IH5A 4GVPA 1KFBB 4C7JA 4LI3X 3VPFA 1NA5A 5KWJA 4RWZA 4BE9A 1TM2A 2QMUA 2QD3A 3OPVA 3AYXB 4L76A 3WB2A 3JQAA 2P62A 1RAAA 1EA5A 1NBMD 1OWMA 4ZOCA 3V2IA 4K6KA 3RQIA 2N3ZA 5AQ1A 4GDMA 3NEYA 3WMGA 3AEXA 3R7DA 3OIDA 2WABA 4XYLA 1ARZA 3MJ4A 4WE3A 2EARA 1N92A 1M5UA 4IHJA 2QQ5A 2XLBA 3EDMA 2JKYA 4JVOA 2G9QA 1E2NA 1ZPDA 1B74A 5EJGA 3GHYA 4ZO7A 4Q1BA 3UA3A 4WNCA 2CV2A 1E1KA 3DZFA 1DRKA 4HN9A 4BVLA 5CDYA 1PE0A 1DOAA 5LYYA 3RBAA 1GUBA 4F4HA 2BBSA 3DHWC 4FLMA 1CUWA 5A6VA 1MW8X 4BCBA 3FHLA 2ZEJA 3O0TA 4FOSA 4JLUA 4E5SA 2EGHA 3AF6A 3FGOA 1QCZA 5EMKA 4AS3A 4UE2A 2JI7A 1HG0A 3C74A 3SZOA 3UKJA 5DYTA 1GD1O 1Y1SA 2GCOB 1HDCA 5EHQA 1CJCA 3E8MA 3PNLA 5IJ0B 3IFSA 1DIHA 3SR3A 1LD3A 4FYMA 5ICGA 3RYCA 2LKCA 1KJNA 1ZK2A 2HA2A 4IJWA 4EJSB 5H7XA 5BPHA 4HOYA 2YNMD 3KQWA 1IN8A 1C30A 1VZ2A 2WJ6A 4JLNA 2EFJA 2YJ6A 3I09A 2J9RA 1VA5A 4P86A 4QYWA 4ENVA 2K2WA 1EM8B 4MIYA 1EFLA 1TMGE 4G37A 2Y4NA 4NBRA 1QHSA 3NBYC 4FFMA 4UBJA 2YY6A 2XPCA 5FI3A 4YRPA 3ADBA 3GDFA 3R3ZA 3GGOA 1L5OA 3ZWAA 5G4KA 2JVIA 2W6PA 1KEKA 4NX2A 1L5HB 3LCMA 1G5PA 3F49S 3NAMA 2XBMA 4LXYA 4LQDA 4D4KA 1XQVA 5F35A 1EVKA 1GL3A 2ZR0A 4B4WA 2YIJA 2XVMA 1TTHA 1PCXA 2AQ8A 2YZNA 3V7UA 1VA4A 2LE0A 2DEUA 3UMSA 1WHTB 4L9RA 2NVBA 3D1VA 3SC4A 1Q0LA 4H3HB 3L0YA 4K87A 2PH3A 3EWAA 1VPTA 3SQOA 3V8RA 2P9GA 3CRMA 2OAEA 2QM8A 1OPRA 3EDRA 5JD4A 1NW6A 5IZ4A 1C1YA 5JPDA 4C6HA 2GPTA 2EG9A 2I3DA 4YO7A 4EH1A 1EFPA 3E3LA 1W4LA 2AC2A 4GFDA 3SG0A 1G17A 3PP8A 4CL0A 3DP7A 4KQHA 4JOQA 3MJVA 3MBKA 2LCFA 2C5LA 5K0CA 3D6TB 5JJKA 2XDQA 4OAPA 4Y6SA 2PUGA 2QRHA 5BRJA 3MRTA 1XCBA 2XYRA 1QQ6A 3DZBA 4LZAA 1SVLA 1BIFA 4B47A 1LA2A 2XTAA 5A9TA 1X6VA 5GONF 3ZXIA 1S2NA 4MW6A 4WNYA 3BGOS 4NYMR 4KLAA 5F78A 3V55A 1AZTA 4D8WA 2HTEA 1VJCA 1N7JA 5ICFA 3HB0A 3OP4A 3VTAA 1T2EA 4ARBA 1GEEA 1JQAA 5CB8A 3FDXA 2EWMA 2APJA 2CDRA 4HEQA 5AM1A 1R6UA 4ABTA 3SHFA 1UMDB 3GC6A 3A26A 4QGFA 1HDEA 5CYPA 1XXHB 2Z43A 3FM9A 1YJBA 4KGDA 4RD2A 1BXGA 3LQ4A 1P5FA 1PAUA 1XBTA 2F4NA 3QEJA 3IHWA 1TEXA 3HBLA 4FC6A 3H5IA 3WZLA 3V7FA 1KMHA 5F98A 5K20A 4LRWA 1U7PA 4QVKA 1T2UA 3NBFA 2X5KO 1MZVA 1VL6A 3ZHCA 1LSOA 1X3LA 1TFUA 2J30A 3AGPA 3PWTA 4WBXC 2V5UA 1X7YB 3WQBA 2AC7A 1GTL1 1H8ED 2WMOB 5GPBA 4MYUA 2ECPA 1H94A 3LXRA 4Y7CA 3TM4A 2JI8A 3CF4G 3BQMB 1ITZA 1Z37A 4IUYA 1CRZA 4G26A 4IIDA 5F51A 4QGSA 1QFJA 5DWDA 1TEZA 2OYRA 1MC4A 3O8DA 3QBJA 4QTUB 4L5JA 2FFRA 3PUIA 4DAEA 2WF9A 4F2PA 5C3UA 1PWHA 3EUFA 1P62B 4YCLA 4NMHA 3AC0A 4D45A 2B5OA 3OO0A 3WLRA 1TYDE 3MS2A 1XD9A 4FEGA 5BN4A 1H65A 3HJNA 1NT2A 3NBQA 1P4RA 1SVOA 1NF3A 1CXZA 3M6UA 2Q0SA 5LDHA 1RIIA 3RWMB 1KJ8A 3H05A 3Q7QA 3FPHA 4PRYA 1T6YA 1X8XA 3ZWDA 2IDJA 4LN1A 4AZWA 4ZCTA 3EQZA 4QUHA 3AL0C 1QDLB 3HJUA 2HUNA 4Q3KA 3W2IA 1X8JA 5KJFA 1EB8A 3P19A 1XPJA 3JVIA 3M89A 3M6WA 1SNYA 4UFOA 2J5BA 3QF7A 4PEVA 4LK3A 1GSOA 3PCRB 3PC7A 3U37A 1R00A 2Q4BA 4XWWA 4KQJA 4EARA 4FR5A 1QF6A 2SHKA 2IHVA 4HNQA 1NVXQ 2VDNB 1XLUA 4X8LA 4PLHA 4NZ9A 3ASYA 3IUSA 2V4MA 2AF3C 5M04A 2IHKA 3KTAB 5LP6F 1LZLA 2DUUA 1IHXA 3Q87B 1H42A 4IIEA 2NZ2A 1I9GA 1EWYA 4XQCA 3V97A 1R0YA 1FTNA 2B2CA 2AFRA 1FNSA 1O95D 5F5XA 4JMPA 4I5FA 1SIWA 2NMVA 2ZQYA 5TY0A 2XE7A 4E32A 5ALQA 5T4FA 1UDRA 3BF8A 4FYIA 1Z16A 4KLZA 3F6CA 1G7CA 4X3PA 1IU9A 3B12A 3TG2A 3N75A 1SQSA 1O54A 3JS5A 1YULA 4EVIA 2ODNA 3A8TA 3VR6H 1MIHA 1ZI6A 2IH4A 1GG8A 1NE2A 3GUCA 4M1WA 5ALLA 1SKUA 4LDQA 1BROA 4RHEA 4N0PA 3BWYA 5K0NA 1KBZA 1M5RA 3IIIA 1XU7A 3DLHA 4KIJA 3PG5A 3QYFA 1OTYA 1P2VA 2IZ6A 2QI9C 3D2CA 3R5SA 4QYSA 3ZW9A 4XIGS 1QIDA 2G9ZA 4URHA 1E7WA 1EZ1A 3HCPA 3HVJA 1U8YA 1J33A 4BQNA 1MOSA 4BKMA 1G3IA 4PR0A 3HB5X 1IUPA 2V58A 3DE4X 1NSTA 3G2JA 3CPSA 3Q8XB 3R3VA 4PCVA 1R50A 2GPJA 5ARCA 1O5TA 4Q9DA 3BFPA 1EE2A 3QG5A 3NUQA 3KD3A 2JANA 4UTZA 2QTZA 3Q3HA 5IFKA 1KEVA 1UIMA 4H1TA 1FYEA 4PZAA 3COWA 4GE3A 2PSJA 3QP9A 3LPCA 3SQDA 4H7KA 2P6RA 4HT3B 2F1RA 4P22A 1LBEA 2FW9A 2P9BA 2Q9AA 3B1ZA 3LBFA 4G5OA 4F1JA 2JFWA 5AIAA 3COPA 1RCFA 1UM9A 3D3WB 3JALA 3P9QA 1PJQA 1KQNA 5A71A 1EE1A 4RACA 1WL8A 2QRVB 5HIJA 4D9IA 1SOUA 4Z2YA 2QTMA 4FWBA 3EGOA 1POXA 2VYCA 3DCIA 4UVEA 3WGNA 4Q7LA 3DC7A 3CZMA 1RWOA 1I5EA 1OBFO 3N76A 4MRMB 3CVVA 3PFKA 3TJZA 1WF6A 2VPQA 3DEYX 4L57A 4O4JB 4UXIA 5AI6A 4PG8A 4M7PA 1QS0B 4BMCA 1QX4A 3LA6A 1L4KA 5GMOA 5BNFA 5CD1A 4RVHA 3QWBA 3ETEA 4YRGA 2JLAA 2FZWA 3GP3A 3OZDA 1RQXA 2BGTA 1YI0A 1JH8A 4HZIA 5KNCA 3OBBA 4MWBA 4UBIA 3FTNA 4QYIB 2ZIXA 3E22B 3HUEA 5K8TA 4HS4A 2NYRA 2YJZA 4UOQA 2OA0A 4LNAA 2G5CA 1WB4A 4MEBA 3ZD6A 5L3SB 1PJBA 1FDRA 2Y27A 3F6EX 1T4DA 3F46A 1MENA 4M1MA 1O4WA 2HQRA 2OILA 2WKRA 1B8OA 4B7XA 1W4ZA 3O3OB 3BHNA 1JTFA 1DCFA 4EG4A 2EL7A 3P20A 4J8PA 3VDMA 4UUBA 4LC9A 2NUTB 1XMJA 2EEPA 4HWSA 1GRNA 1GPWB 2GARA 1BHQ1 4DYDA 2AYXA 1BE0A 2JHCA 1YS4A 3B6IA 3LXMA 1RYZA 4FCCA 1UZUA 1ULZA 2PVSA 5DNEA 4CZ2A 3SVLA 3VR4A 4AMYA 5FBRB 4M21A 1U1EA 1TF7A 5LZ4A 2KJQA 3AVYA 4DMMA 2V7UA 4OMUA 2I6XA 3O26A 3ENWA 4JGBA 4KVAA 1T26A 1I4DD 3GY0A 3MSXA 4H60A 4HK4A 4N54A 1ONNA 4JWKA 3RFVA 5HHTA 3HYLA 1Q7CA 4EA6A 1QKJA 4JVMA 2I7TA 2Z9DA 1VC2A 1Z73A 2O3RA 3AHDA 4HADA 4YO8A 2CC2A 3OZVA 3TLJA 1SKMA 5K4AA 3WAKA 3PSHA 2HHHB 1V71A 4LJRA 4URXR 4RPIA 3FRIA 1OWPA 4NULA 4F97A 2VT2A 2Q1YA 2IIBA 2HPVA 1F38A 2EFDB 3JWIA 4KIUA 1EFHA 4DA0A 4BP9A 3HL4A 3DQQA 3NCHA 2L0XA 3BMNB 3P9CA 4CGZA 2WJ3A 4IEEA 1Z2CA 2A9RA 2VT7A 2X8LA 2PUTA 2VJCA 3L1UA 4BGEA 1NXXA 4PPFA 3IVAA 3QEMB 4FILA 2P9HA 4UM9D 1NASA 2PKCA 1OROA 1WSBA 1F8GA 2VBIA 4EY6A 3KQUA 2FSSA 4D57A 3FBWA 2BTQA 4BB6A 2JFPA 4ACAA 3C7DB 2VIIA 4BVAA 3NANA 1GPKA 5JSHA 1ZK4A 4MV5A 4WK2B 2AJ8A 3KQKA 4V38A 5TPZD 1U4NA 3R3HA 4QM7A 2A0KA 2CLOB 1Q44A 4PSKA 1RW4A 3GRUA 3MOSA 3OIVA 5A0FA 3GV0A 2QT0A 5D7NA 4EENA 3KQSA 4ENPA 3WNBA 1GPDG 5SY9A 1PT5A 3A04A 4PSUA 1BHJA 3DB1A 5FPTA 3F96A 3VDQA 1VIYA 3BCRA 3LYLA 2VCHA 3QTBA 1DIAA 3JZIA 1TA0A 4MQEA 1OFGA 1CZOA 2PO5A 4AG6A 5IS2A 4X20A 4AROA 3BB4A 5CX4A 4RY9A 4CKCA 4QECA 5B1YA 3OI7A 1YRBA 3GLRA 3O8OB 4O4IF 4WLOA 5LDGA 1IRXA 3ZE7A 3G89A 1NXTA 2H2AA 3I58A 3QXSA 4A1OA 5CW1A 5H81A 4DQUA 3KDAA 1TK2A 1X9GA 1IQRA 2O2YA 4JR2A 4RPLA 9LDBA 2YX1A 4RA6B 1YS2X 4NFYA 3R5FA 1MB9A 2OO3A 1NX9A 4M46A 1VOTA 5TMEA 3P0JA 4AJEA 4BVEA 5KWIA 2AXEA 2I87A 4QVIA 1MIOB 2GVNA 3CX3A 4TMXA 3KL2A 2VHQA 3KBBA 3CXRA 1U2PA 1LFDB 1Z56C 3HBMA 4DSTA 4ZMSA 1KZ1A 3ED1A 4KXVA 4U7DA 1XEXA 3HB9A 2G40A 3P4UA 2G6TA 1A1SA 1EHYA 1ZCZA 3E5RA 3UN1A 1R3DA 3IEVA 3K0CA 2SKEA 4RHYA 1Q1AA 1T2VA 4RQTA 4PHCA 4GPIB 3NHWA 4IDHA 4Z9BA 4WCFC 4ARAA 3T1QA 2QM3A 1QG4A 1LNSA 4J1TA 1B0UA 3I6MA 1R9GA 2I2DA 2BFBB 3MWLA 4JB8A 5EMMA 3WKCA 2ONKA 1XZCA 4XB6B 2HUPA 3LQYA 5SY6A 3ZOZA 3V1UA 1V7ZA 3AF4A 4ONEA 1UMCB 4RHFA 4CKCB 1T1SA 3F3YA 1KMIY 1U0OC 2J45A 4KN9S 2JLXA 2ZR7A 1H85A 1LKZA 3C8UA 2BDTA 1D4OA 2V45A 3NB0A 1FTQA 1JBKA 2X23A 3DOJA 1JEQA 5E1MA 2QDKA 3ZQ4A 1YI8A 2HN9A 3EXIA 2BGRA 2VUTA 2WNHA 4MI3A 1Z0UA 1T2NA 4QO7A 3HJHA 3KB2A 4U9UA 3F67A 3KQLA 1V48A 4JWTA 3OKAA 3I12A 3OWOA 2XCLA 4FT2A 4HSEA 4OXIA 4RX1A 4YA6A 5G1OA 4KPUA 1WQ4A 3VO1A 5MFZA 2G5GX 2YKGA 1TKAA 3VOSA 4Y1FA 4JKOA 1XG5A 1A9TA 2JH8A 1O96B 1AZSC 1S2MA 2D1YA 2XMZA 3EUEA 3JYLA 4DQKA 2AG5A 3D0QA 5LBUA 3H0KA 1AGNA 2ZYRA 1RQPA 4BMYA 3FB1A 2IPMA 3AM1A 3GLGB 2O8VA 1IL0A 3RSLA 3PJEA 2AEEA 1EP3B 3WBFA 4KK3A 3WRWA 1WZ2A 5IJXA 1XDUA 4UASA 1SUFA 3USZA 3WJ7A 3R6LA 4EHKA 1UP7A 5IAOA 5GJBA 2BFBA 5K0LA 3E1SA 1ZLXA 3HJTA 2PXCA 5GV7A 4C7KA 2Z8YA 2WSSD 4AO8A 2DFVA 2HIMA 4PQFA 5D3ZA 3WYAA 2EX0A 3WQSB 4CKYA 4ZVNA 9LDTA 4PQYA 5FUVA 4PIMA 2RH5A 3HMQA 1WMDA 4YP7A 1IK6A 1CB0A 3KE8A 5A2GA 2PX0A 4K6HA 1UBNA 2KSQA 1HSZA 3R0VA 4KDRA 2WA1A 4MW5A 4IDDA 3MRXA 1E18A 2O57A 3CR3C 1NC3A 2IHNA 4C05A 1FQOA 1TT7A 2WC1A 4ECAA 1KI8A 3W6NA 3HZRA 4US0R 4KR6A 4QODA 3IAS1 4MQEB 1MO4A 3GMTA 3LGSA 4MEAA 3SXJA 3X1XA 5HUQA 3CZ4A 4N6GA 1K9SA 2FRXA 1Z6TA 3PDUA 2FPIA 4RIIA 3ZZTA 2OQ2A 5FHQA 3WLNA 2IOYA 3L0BA 1AKNA 2X9GA 2ZBPA 1J56A 1Y5RA 2VTEA 5BNZA 3W6PA 4GE0A 4DG9A 2X76A 1BH2A 2VOJA 2RHJA 4QT4A 3QOFA 1CNFA 2OPHA 2HBYA 1DKMA 2GLTA 3GG9A 4FDVA 5IBPA 2GN2A 1V5EA 4HAZA 3B51X 4AZTA 4CF5A 4YBZA 1ADBA 1DG3A 1EBUA 1G5IA 2ORWA 3JQAD 3FDZA 3JVDA 4K6OA 1JLRA 3BJMA 1FLAA 4WCVA 1X7ZB 1IY8A 2HC9A 1K0FA 1U2ZA 3A4MA 3CSSA 2GZSA 5DYYA 4COOA 4M37A 1BN6A 4K40A 5J1SB 2BEWA 4OQ4A 4C0HA 1TK3A 1WR8A 3ESZA 3B5EA 3DAHA 1PR1A 2F64A 3GLHE 2G8NA 5I9LA 4I81A 2YNMC 3MBOA 2FEWB 4EYEA 1GDHA 1VSQA 1NVGA 1MAAA 1G8FA 3L0IB 3K05A 4L50A 4PBTA 3U7HB 1Z13A 3AR5A 2PANA 3H9BA 4IY1A 5DHSA 3UAVA 3K4QA 5A9SA 4X5OA 3UAXA 4DIFA 4TYMA 4FGLA 1SG0A 1Q14A 1DQPA 1VGQA 1O7JA 4YXWD 4LJYA 1E1LA 1W4BA 2WWHA 4DQXA 3AR9A 3F4KA 1J9GA 2IW3A 4ZI3A 3QBTA 5EQJB 1J97A 3CIOA 1W5BA 5DH9A 2FG7C 1XDZA 2HA3A 5L3VA 2GKGA 3ZLJA 1KMCA 1EBFA 5BRAA 1K06A 2PRJA 4B6SA 3FROA 1ZM9A 1ZSNA 3KPUA 3C14C 3L07A 5IULC 4MKGA 3OQNA 2J4DA 3QU2A 1UJ6A 1FFYA 2OCLA 2HLPA 4ALIA 4MYCA 5U4XA 1JHOA 4ZXFA 3LPMA 3IB6A 2B9EA 4I9NA 4KHZA 5BR7A 4E4YA 4XIJA 1SKAA 1B0AA 1FL9A 4OQXA 2ZSBA 3ME5A 4QXQA 3LSTA 4YRDA 3WGOA 4Y2PA 3IMKA 1F12A 5FUQA 3A6PC 4TL7A 2JAPA 1D09A 1W4RA 3EGXA 3PEEA 2EP7A 3BMOA 1DQNA 1ZMRA 4Z3KA 2EX4A 2FPMA 3AW8A 1FJGB 2FKAA 1PGQA 2H4HA 3LT2A 3M33A 2D1QA 1PFGA 1SXHA 3WR5A 2EBFX 1XKLA 3ETGA 4I2NA 1NKTA 2QBYA 4IZOA 4F9EA 3MB8A 3P5SA 1LLFA 5A9SB 3ZYCA 3GLVA 4CUZA 1BS2A 1YVPA 1KI9A 1FP4B 4QXPA 1JX6A 1ZJ5A 1SBYA 1E2PA 1KP9A 1W76A 4NBNA 5LQCA 1XRRA 5I7WA 5GGXA 3QZUA 4WKPA 4UBKA 3AILA 4OHWA 3OPNA 4KXNA 3DV0A 3B38A 4KOEC 4RIEA 1XD8A 2JCGA 3J7AC 5DJ5A 3ES9A 4GOOD 3TDKA 1CU1A 3KEOA 4V1CI 1LH0A 3R40A 4I0WB 4ETNA 4G23A 1YDWA 4DLTA 1UXOA 3E53A 1IONA 2V7BA 3L6CA 2ZB2A 1NVEA 2WLTA 1G9SA 1UF9A 3PC3A 3PXGA 1UEXC 3HL0A 4PNHA 3W0LB 3L5KA 5CA1B 3CU5A 5KPDA 2A5GA 2FY8A 1D2CA 4H4EA 4HUQB 4K9KA 1JDTA 1SCUB 2Z2KA 4B3BA 4I5DA 3ZK8A 4ZK2A 1AMUA 1E2UA 3H5AA 4Q1FA 3WXMA 1BMDA 1W36D 3N2EA 3DMTC 3IT3A 2OCXA 1C0LA 1UPUA 3OT1A 4UUPA 5D1NA 1C7FA 5CFZA 2FETA 1S2OA 2YS7A 3LDFA 4LY9A 2YUTA 4PHFA 3FTDA 2JVKA 1FFHA 4KQ2A 4O2BB 1QO9A 1SZDA 3QK7A 5DB4A 4KMSA 4IGFA 1VQ1A 5EJIA 1IWOA 3T5MA 3QKIA 2XNDA 2CZCA 4X3CA 2V98A 3S7ZA 1MB4A 1J2JA 4RK4A 5CEFA 3V42A 4OXNA 1Y4UA 2Z09A 3NLLA 2N46A 1XTSA 4UHJA 1LB1B 1T36A 1X1RA 5C1BA 3JVUA 4WKCA 2TMKA 3RU3A 4QU0A 1JA9A 4YJHA 5AJVB 3ZYZA 1XV5A 3GJ5A 4DCJA 4DMRA 3IAM6 1AQIA 1EJ2A 1W1WA 3AQ4A 1B0PA 1XC7A 3IGFA 2OCGA 5E6UA 3TXXA 3A05A 2YHIA 4W8HA 1TECE 5E38A 4DNOA 3ZDEA 1YASA 4A7PA 1U2DC 3TW4A 3WIVA 4AS2A 4MWSA 3QWIA 4FSHA 4S1WA 4RCYA 4GLJA 2WYVA 3KU4A 4G5HA 2QTLA 5MGNA 1YQUA 3ACBA 3L7NA 4FK8A 4M0CA 1XYYA 2NO6A 4B8WA 1YBVA 1OLXB 3TRHA 1YQEA 1M0SA 2ST1A 2XH8A 4PYLA 3C3PA 1YQQA 1IJKA 3A14A 2JGJA 4QJIA 4DPMA 1G8KA 1ODCA 3AKYA 4DSAA 4HEA6 3IXQA 3A4TA 1U3TA 5HKAA 3REQB 1V8BA 3IXLA 4WH0A 5FI1B 5ENZA 3HGMA 4JBIA 4ZJYA 1A77A 3HY6A 2CDCA 4M86A 1BRTA 1E7QA 1NDUA 1C3XA 2VWHA 4IOLA 4RK5A 4X64B 4AVYA 5HJ5A 1JVSA 4IX9A 1F2TB 3RE1A 1LTQA 5AVJA 1V6SA 2H2GA 1PGOA 2POCA 3DFZA 4FYXA 3A6LA 4O1IA 3TLMA 2GETA 1HOTA 1A8HA 1QTNA 1VHDA 3QE4A 3MWDB 2A7XA 1F6BA 2CT8A 1RC8A 3ZW8A 2BM8A 1SC4A 2A5FA 1U02A 3HM2A 3GH1A 4LBYA 4UTOA 4N49A 4X54A 4H7IA 4EW3A 4Q00A 5JEEA 1A8IA 1CEQA 2XVYA 3RUIA 1E1QA 1NJ1A 5EJ4A 3CXUA 3AKZA 2JCYA 3SMVA 3UJ3X 3QM1A 4HLUC 4F86A 2EDAA 4EYOA 2OWDA 4J9UE 1JKXA 4HGNA 5FULA 5DSZA 3V8VA 1Z6PA 2NAPA 2PHZA 1USUA 1RJ9A 3PIRA 3T1VA 2CFTA 4PXSA 3DHEA 3AJ9A 4LFAB 3BKWA 6LDHA 5A0TA 1VKOA 5ELMA 3GJ0A 4E14A 4CCYB 5A4MS 2HXSA 4KYVA 1BRMA 3I8XA 5KZMB 5DU2A 3EOZA 1IHUA 3HEMA 4QFMA 1JFSA 2INGX 2E5FA 2LD4A 3GLTA 4M53A 2ZWOA 3FFWA 5FUMA 1M54A 1Y7IA 3MZ0A 4FQ5A 4G41A 5H9VA 3KXLA 3OM9A 4G5FA 4JZYA 2XMRA 5K3DA 3U81A 4C08A 4RENA 4EW1A 4LRYA 3ZI7A 2VBCA 3ONVA 1DU4A 2P27A 1L5ZA 3OFVA 2VTVA 1RBQA 1AGPA 2O0LA 1XEAA 4I1SA 5IAAA 1E62A 2M6RA 4KFSA 3G23A 2YIDA 4NBKA 4MRSA 1PJTA 4Q1CA 3E7PA 1PRYA 4I2VA 4ARZA 4EWLA 1EFAA 2I1WA 1LPMA 1UBTS 2V9CA 2VYQA 3QMVA 3CGWA 2ZRAA 2IV3A 1W7AA 5HOQA 4D4LA 2I5PO 4BLSA 3ECSA 3L0ZA 2O5RA 5CFLA 2W00A 3AUAA 4C5BA 5BORA 4LF7B 3W1WA 4RTNA 2Z6AA 3WZ2A 2ECKA 3WKEA 4G4SO 3D43A 3X1ZA 1Z15A 1UMDA 3KP1A 5LBTA 1JWLA 4NC9A 4QG7A 4KLNA 1A9OA 1ZN2A 3FZEA 4CFYA 1I2MA 5LMUB 1E0AA 5HIKA 3I6IA 5JARA 1YL7A 3K6SA 1E9FA 1KMHB 3PTLA 1CQPA 1IG3A 5CDSA 2H5EA 1HYHA 4JBHA 1EINA 2JVJA 4MYRA 2X77A 2CLFB 4PG7A 4XGQA 3ZVLA 1TUBB 2DHRA 4P4NA 3I01A 3UTCA 1T13A 3Q1KA 3K0AA 1CUJA 2IC5A 3C3YA 3LT5A 4MW9A 4N5IX 2VKTA 1HT1E 5CT8A 1DADA 2Q6IA 2WBLC 4IXTA 4B6GA 1XVLA 4X1YA 3CM0A 4LAFA 3UF0A 1BN7A 1NQUA 2BGIA 2QQFA 3DOHA 4LJ6A 2WJVA 3PZBA 5HXAA 3HJRA 1QIMA 1W52X 2BN4A 2ZI9A 4FFBB 1WNFA 4NZYA 3ZV3A 1O5OA 4RV5A 4F4JA 3ZBTA 4B35A 4O8ZA 5KB3A 1K92A 1DQRA 1K3UB 2HMVA 2R66A 1HLGA 1THGA 1YR8A 2W2XA 3AUUA 3EAQA 3QA9A 4LZLA 3A10A 4EB0A 4R51A 1U65A 2TSYB 2WKSA 3AJ8A 4RD0A 3T5CA 4TKLA 2DZDA 2HJ9A 5ITWA 2WMNB 1XJ0A 5EUMA 2F67A 2O4UX 4QPZA 4ENRA 3S2ZA 2JB9A 3HDQA 3OC6A 3PQ5A 5EHZA 2HR1A 1I80A 3DBLB 2HT6A 4G0MA 4X65B 1EIWA 2H51A 1JN0A 3EGVA 3AVWA 4CM4A 3A1DA 3CKLA 1XF1A 4ARCA 1SVNA 2CEKA 3BJIC 1FIUA 1ULUA 3SS7X 1E6UA 4JNCA 3U6KA 3OE1A 2NXCA 4RLSA 3UOAB 1XMQB 1R8QA 2OBYA 4LGMA 2C9CA 2XTJA 2VEDA 3ND6A 2JIPA 3Q98A 2QYSA 2P75A 3M6AA 4TQGA 3GCDA 2FUEA 1BDIA 3CH6A 3F97A 3VBEA 4D9JA 4P0QB 2VHVA 3ICCA 3LWNA 3D54D 4Q9NA 3TX6A 4XVCA 3ZGZA 3LQKA 4RZ2A 4GR9A 3C7AA 3AVTA 2X5JO 4BP8A 3KELA 4HO1X 1ICIA 4DJ5X 3KZXA 1U7OA 4ILEA 3IKLA 3MHPA 1W75A 2BKXA 2ERXA 3G0HA 1Q0TA 1JU4A 5EFOA 1BE1A 4XD2A 5E4YA 10MHA 1KXZA 4WASA 3DE3X 4KXLA 5JZMA 2R85A 5BWNA 1I3OA 3GLUA 5HIMA 3NRCA 2PX5A 4CI0B 5A02A 1HT3A 4RLQA 1LBTA 4OG2A 3EWNA 4PXAA 3FNFA 4I50F 3RVOA 3D8TA 3GGGA 3WWEA 3B85A 4KMRA 3FPKA 5ALOA 1OC4A 3PTZA 5KSPA 4H4DA 3B7GA 1SAYA 3O2SB 3PDIA 3HKCA 3Q4GA 1W6UA 1ONPA 3IT2A 4ZEWA 1XVAA 4GOMD 2JIBA 1W73A 2PCJA 2XJ9A 3OPQA 2QUBA 2D5CA 4R2WA 2PKQO 3L8EA 2IFTA 1GXSB 1N1EA 2ACVA 1SBHA 3ET5A 3D5EA 3IEPA 3N8NA 4YRLA 4CW7A 4F93B 3PR3A 5C46F 5K0JA 1V8DA 2CXXA 1M1NA 2OV1A 2DUWA 4IV8A 4M1YA 2ZR8A 5LD2C 4A0GA 2KBFA 2B98A 3A1TA 3CF4A 3KWFA 3ZJUA 1ORTA 2VLIA 1H8EA 1VSUA 3T7EA 4LC0A 5EZQA 4ZCPA 4RELA 1I2CA 2FKNA 4RK1A 5CURA 2UAGA 4YQZA 4KFUA 1YMQA 4D80A 1N8TA 1WULS 5C5EA 2XYHA 2Q5QA 1YUNA 3G8BA 4KPYA 4FYPA 4Q93A 4YLGA 5EE3A 5TF0A 3AM4A 1E9CA 3FYSA 3Q2KA 4HFJA 2QGNA 3T7RA 3WNCA 5BW8A 2BMWA 1R5BA 4IBOA 7REQB 1ODLA 2IKQA 2VNHA 5JBQA 2OP0A 2XITA 1IRIA 1XCMA 2ZRPA 1NQ5A 3FPBA 1MF7A 4CQMB 2JLWA 4IFTA 3D4BA 1CVIA 3CLTC 1RWPA 4BNHA 3GRRA 4A6XA 2YCBA 2ZE6A 2AFIE 3PGA1 4MGEA 3WY9A 3L7JA 3KZKA 2H11A 1Y4DE 4KWCA 3A25A 5EIBC 1QH9A 4WY2A 2DYKA 5EFZA 5EZ6B 2WVJA 3AEUB 1DXQA 4E51A 2BDEA 3G2QA 3ZUPA 1VLZA 4HX5A 5IJAA 1V16A 5D6NA 4W5RA 2VEOA 3M6VA 4ZZ1A 3PIDA 3BTUA 3RIMA 1Z18A 3A6HA 2C59A 1DIBA 1P5ZB 3ZVRA 1JG3A 2QPLA 4OAOA 1MO2A 1Z2AA 4M49A 5KQPA 2QTVA 2YWHA 3PXBA 5LMCA 1APBA 1MX5A 1ZNQO 2E4VA 1FZTA 4KC0A 5LQMA 1C9NA 2ZBGA 2PFKA 1ZJYA 3HVUA 2GA8A 3RU2A 1JT9A 3AU9A 5KYKA 2X8JB 4Z4QA 2AUTA 2ACKA 3HGTA 2M1XA 5I7HA 2PMWB 3RU9A 5JR3A 2PBFA 1ZUNB 2C83A 1CNMA 3H1GA 3F7TA 4GXTA 4QPPA 3TSZA 1R6DA 1LJLA 1SHLA 3AIKA 1CERA 2C8KA 3PA6A 4EKEA 2CKDA 1N5MA 3FOCA 5DGIA 3T94A 1F0YA 5H0IA 3ZU2A 2YHUA 3AI7A 5AVKA 4B6QA 3ZDBA 3JSXA 4K86A 3DBIA 1SBQA 4ZOBA 3BL8A 1YJ5A 5CYGA 5DHRA 1L3IA 1G21B 5DMXA 2VUHB 3W8EA 4YUWA 4MR8A 3DFKA 4TQ9A 4FS3A 4EKDA 3WBJA 1UR5A 3MN1A 4PE5B 4HY3A 1CUFA 1E1NA 3A32A 4Q7KA 1V8PA 4L16A 3VSEA 1GL6A 1CC1S 4JLBA 1FFXB 3AK4A 3M9WA 4F4FA 3LPAA 1WM1A 3AY7A 4BLPA 4KACA 1VJRA 3D6NB 2X2PA 1C2YA 1NIPA 4WLNA 4ZAWA 3UAYA 3BXOA 4XZ3A 5KKAA 4M0DA 3K5PA 3QEMA 4YRFA 3CLSC 1BTOA 2C9BA 1QSGA 3QPWA 4X95A 2ZYVX 1ZBQA 4LMPA 4DFDA 3RIHA 5HF8A 4HUTA 1E0SA 4FUQA 3HYRA 1X8KA 4H59A 4M6WA 2ZWPA 5GTDA 4DC9A 2C5GA 5JH7B 5MN6A 1H3EA 2G71A 3OUZA 1SC3A 1LC0A 2IZOA 4HS9A 3R8CA 4JLAA 4P5EA 3L7BA 4BUJA 4KQIA 5BWOA 5BN1A 1OXSC 1JIVA 3O4FA 4O63O 2XZDA 1UAYA 2TMYA 2Z8YM 5LOVB 3T06B 4GZ3A 5IWAB 2J0UB 1FDIA 1U0JA 4BLRA 1ETHA 5FOVA 1R4AA 3K0AB 5JS7A 5LQRA 1M1ZA 3T3MB 2QLFA 2Z04A 3I9OA 4B4UA 2BGWA 4Q12A 4X66B 5LQNA 3NAZA 4E94A 1TZJA 2WIDA 3IB3A 2I33A 5A6SA 2R2AA 2ARKA 2QB5A 1QRRA 3LZ6A 4JLVA 2GF9A 4CN8A 1X1BA 1FSPA 5AVVA 1YL5A 1L4GA 1HE2A 2CJYA 1WX1A 3DEIA 1SXJC 1DOHA 3DYIA 4S2UA 2XB2A 3B36A 1OBVA 4FZ5A 3WGZA 1WUJS 1EDOA 2W4MA 1H23A 4WAUA 3CE6A 3QF4B 5DCUA 1ZM7A 3ZE9A 3Q5GA 3LKDA 1CKEA 2JJMA 2O2JA 2XRFA 3K2EA 5FR1A 4AD8A 1HDIA 4P31A 2B82A 1CX9B 3VM6A 3MG9A 1NJFA 4MIKA 4WHMA 2GAAA 3GLIE 3KBOA 1P3Y1 1GTVA 1ZU5A 2QGFA 5FNZA 3CN9A 3ROQA 4EVQA 5BMVA 1WXXA 3HR4A 3D02A 1KI7A 2H9IA 1DBRA 3DBRA 4J29A 3SX4A 6YASA 3MMXA 4G6ZA 2C4TA 1ZL0A 3N05A 3O2NA 1DZ3A 5KNCH 2RJNA 4RC9A 3EFEA 4CM3A 5BQFA 1XU4A 2OGUA 4PLGA 4S12A 5AI9A 1JDVA 2XIJA 2E7ZA 1E2GA 1TA4A 4FCWA 5JDCA 1E1RD 3FCXA 1GIAA 5J1TB 4H6PA 2XTMA 3JQQA 1ILWA 4BS9A 4QOHA 4E15A 3ZHTA 1WCIA 1L7MA 2LBPA 3ZZ0A 4DV2B 1QB8A 2QN1A 2ZJ0A 3FMGA 3R8FA 1R0SA 4DLKA 4TMZA 1I7DA 2CL6X 5E6SB 2WKPA 3UNXA 2QTTA 4F04A 4WZBB 1S2IA 2GNOA 4L9AA 1T3TA 3B5IA 4BAGA 4BNDA 4O2BF 1E5TA 4FMPA 4J3JA 1N6OA 2QV0A 2EEZA 3KYCB 3EXG2 5YASA 4B3FX 5KREA 2P5YA 1VI5A 1TIKA 2YVLA 2GB4A 1JG1A 1ND5A 1GKUB 2ZI5A 1M2GA 2BM9A 1M6NA 5JTTA 3AIIA 4OB6A 1U90A 2BAGA 1P1IA 3R4CA 1KZ7B 4E3WA 5CA1A 2ZUBA 2AVNA 2JIRA 4QQ8A 1EIZA 4OP3A 3DMPA 2QE7A 3Q5DA 4NBSA 4UAVA 3T7SA 1E6LA 3FMFA 3A70A 4ZYTA 2WFMA 3NIBA 3Q3CA 1ZONA 4B3DA 4NLLA 4FEAA 4MW0A 2V03A 3IXMA 4V0LA 5F73A 3QBEA 4DA9A 1RXSA 4IUBS 3UATA 2B7BA 2MSWA 3EA5A 3Q3IA 5LMNB 2YQ5A 1N7GA 4XKJA 3ZI0A 2OB1A 4KQ6A 2VYND 3E9DA 3RABA 1F6DA 1Y48E 3BWBA 3D1LA 3K9WA 4G1VA 4D6XA 3GGSA 2QN3A 3LUHA 4KG7A 3CISA 3TLCA 3V4SA 2AD5A 5KOHB 2HYDA 4MWDA 2A1UA 1T2FA 2P79A 2O9JA 1R4NA 5DNYB 4GICA 8GPBA 4B84A 1L8OA 1TU3A 2FSGA 1CUYA 1A9RA 2EJCA 1UP6A 3OWHA 1AS3A 2REQA 4Z4FA 3WK4A 2FMHA 3IAFA 4KXYA 4GI5A 3T5DA 2RC5A 5HKLA 3VOAA 4FFVA 1J20A 3IUJA 2D3WA 1IN1A 3OCUA 2CCGA 2F9LA 3VTKA 1R4MA 3NHJA 1SCAA 3QEOA 4ZEMA 1FW8A 2J3KA 3RTGA 3FMIA 2FRDC 4MP3A 2EKDA 1QE0A 2FW6A 4I50B 3PENA 4ID9A 2AWOA 2KQUA 4JQOA 3EZNA 2PUBA 3T3NA 1M1UA 2VFAA 5G0WA 1L1RA 2AXQA 4G1CA 1EVQA 1E7RA 3FVVA 1C5KA 1DG9A 1GPYA 1T0JB 3KXKA 5IMBA 3P2KA 3KR9A 5F76A 1ORDA 4HDNB 1WKVA 2BHSA 1VLLA 5GZ6A 2XGOA 5HKKA 1ZSVA 3WFIA 3ZHQA 4JA2A 2PYDA 1P7PA 3NTXA 2Y67A 3RYIB 1AO0A 4MMXB 4MUMA 1U8FO 5EKXA 2QUHA 1PR2A 5LSAA 1MUUA 3HHEA 2PR2A 1N2BA 4GEKA 2Z4SA 3Q0EA 3TSYA 4DM3A 4F45A 3FCUB 1G5QA 2EJVA 4M9CA 2MINA 2HA6A 4P98A 4YJ2F 5LB4A 3UJAA 2X22A 5TGDA 1ND6A 4MB6A 1QGZA 1YS1X 1A9QA 2HU2A 2O0JA 1Z4LA 2ODQA 1XDDA 3OF3A 1BOOA 1BMFA 1Q20A 2YXDA 2B1QA 2OLJA 4Y2GA 2P2ZA 4EYQA 3UXHA 5K7SA 2C7PA 4QFBA 1ACLA 2BMEA 1JKMA 4PIPA 2AUMA 4M99A 4NMXB 1C1HA 1TQ8A 1ZGCA 5AESA 2VUIB 3QBVA 4D9FA 4DDWA 2G0NA 4GQBA 1UK7A 3T3EA 2GHRA 4BNIA 5GJWC 2L42A 3NATA 5I48A 1RM0A 3DWIA 4GD3Q 1O89A 3IUBA 2WSIA 3KV3O 1H0RA 3TJRA 1OPXA 1BJTA 2WA2A 3QA3E 5IZCA 3RREA 3JWHA 1D0IA 3UT5A 1F20A 3ZNQA 2JD1A 3ODGA 1SXQA 2E4XA 4PBRA 4X85A 1OHHA 2RAPA 2J6IA 1G19A 5D00A 4BGDA 1Z7YA 4YCSA 3NALA 4RIGA 2Z95A 5JMPA 4YMLA 2EIXA 4LEIA 3TRIA 2BHNA 1F17A 1NG1A 4FJ0A 4RGYA 1SQ0A 3WFJA 5BV0A 1YQXA 1UC4B 3RD5A 3IA7A 2ZIGA 2ICAA 1N6IA 1L4MA 1X7WB 5K0GA 5K4GA 2Y0PA 2IYOA 3EXFB 1MJ5A 4O2RA 3FNEA 4NL4H 1H1TA 4QUEA 4RADA 3CLRC 3VBCA 4JDUA 4KBYA 4FN5A 4KRYA 4BWGA 2FMKA 5FTNA 2Q7OE 4DA7A 5AJUA 1IMJA 5IJ9A 3IKTA 3IBTA 3QXGA 1A5AB 4HGYA 1WAMA 1N1MA 1JGTA 3I9FA 1SKYB 3GQBB 1ZOLA 1OFTA 2UZ3A 4TROA 2FFHA 4KGXA 1S7GA 4KYUA 3G13A 1OXMA 1TLFA 1XTPA 3ZS9A 3GZNA 4J16A 3AP2A 4EF6A 1XALA 2A6PA 1KO7A 2V6BA 1M1YB 2LP4Y 3Q6MA 2JAUA 3LCVB 4ZIRA 2BR5A 1BXGB 4BGUA 2YV4A 4LKOA 1SHKA 3A0RB 2X8AA 3L93A 1NXVA 2ZJ3A 3TQIA 1CZKA 4HDMB 2G08A 3CZAA 3ISVA 2ZI4A 5BQPA 1G291 2WNSA 3RTCA 2JZNA 3FKJA 1N32B 2RBKA 4JKIA 1E1CB 1O0SA 4QUKA 1P9NA 3ZVMA 3DR5A 3FUCA 1W44A 1YGYA 2GYWA 2KM1A 3NTVA 3FTPA 4MTCA 5D5HA 2XUZA 3GFTA 4MS1B 3ELUA 2NLOA 4LSWA 3UMVA 2UZ1A 4E2FA 4F6CA 1O94A 1Y98A 2C1XA 3B7WA 3EF0A 3B3AA 5AK3A 1K2WA 3L9XA