3KVYA

Trapping of an oxocarbenium ion intermediate in up crystals
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
293
structure length
290
Chain Sequence
DLVQLCNPHIAAMKEDILYHFSLSTSTHDFPAMFGDVKFVCVGGSPSRMKAFIKYVAMELGFAADYPNICEGTDRYAMFKVGPVLSVSHGMGVPSIAIMLHELIKLLYHAHCSGVTLIRIGTSGGIGLEPGSVVITRQAVDPCFKPEFEQIVLGKREVRNTDLDEQLVQELARCSAELGEFPTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQDYLRAAYAAGIRNIEMEASVFAAMCNACGLRAAVVCVTLLNRLEGDQISSPHDVLAEYQQRPQRLVGQFIKKRLMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uridine Phosphorylase
publication title Glycal formation in crystals of uridine phosphorylase.
pubmed doi rcsb
source organism Bos taurus
total genus 103
structure length 290
sequence length 293
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kvyA00
2A8YA 1ODIA 5CXSA 2B94A 2RJ3A 2ISCA 3KVRA 4FFSA 4DA0A 4DAEA 3EEIA 3BGSA 1PKEA 1VMKA 3KVVA 2I4TA 4QFBA 1TCUA 3NM6B 4D98A 1OU4A 3P0EA 4DABA 1PR0A 3OOHA 1K3FA 2AI3A 3ONVA 3FAZA 1RT9A 1RXYA 4TXMA 4QASA 1RR6A 4D8VA 4YMLA 4F2PA 1Y1QA 4GLJA 4L6IA 4M1EA 4WKBA 2AI2A 1VHJA 2QSUA 2BSXA 5CCEA 1PR2A 4BMXA 1Z5NA 1SQ6A 5B7PA 3PNPA 4RJ2A 1OUMA 5IFKA 4P54A 1Z34A 1ODLA 3MMSA 5F77A 3KVYA 1OTYA 4TS9A 4OGKA 1FXUA 4LDNA 1OV6A 3DDOA 1I80A 3FWPA 4MCIA 1Y1SA 1A9PA 4WKPA 5JPCA 4R2WA 4EB8A 4BN0A 1ULAA 1A9RA 4BMYA 1WTAA 2AC7A 1CB0A 1M73E 4GMHA 1JE0A 4YNBA 4L5AA 1T8YA 5F7XA 2OECA 5DK6A 1OVGA 1U1CA 3UAWA 1JDTA 1PR1A 3P0FA 1G2OA 5F78A 4F1WA 4LZWA 1V3QE 3UAVA 3UT6A 4M3NA 4WKCA 3TL6A 2HWUA 4OGLA 1JPVA 1NC1A 4QARA 2QPLA 2QTTA 1JP7A 3NM5A 4G41A 4JOSA 4TTIA 2Q7OE 1Z33A 1Z5OA 3NM4A 1SD1A 3E9RA 4WKNA 4L5YA 3FB1A 1YR3A 1SD2A 1V45E 2HSWA 1Z5PA 2A0XA 4DA6A 4PR3A 2OC9A 3OZDA 4E1VA 5I3CA 1XE3A 3INYA 1LX7A 1PWYE 4TXLA 1V2HE 3IOMA 1C3XA 4IP0A 3KUKA 3BJEA 5KB3A 4LNAA 3FOWA 1Z37A 1RSZA 4MCHA 5C80A 3KU4A 1A9OA 3OZCA 2A0YA 2H8GA 1PR5A 1K9SA 4PNPA 1OTXA 5CYGA 1RFGE 3LGSA 1Q1GA 3QPBA 3O6VA 4EARA 1JDSA 1ZL2A 2QDKA 5EUBA 2HRDA 4G8JA 5CXQA 1YBFA 4TTAA 1Y6QA 4TXHA 5K1ZA 4BMZA 1JYSA 5B7NA 4JP5A 3EUEA 4F3CA 4M7WA 1U1DA 4OY3A 1V4NA 4U2KA 3D1VA 4YO8A 4TTJA 4I2VA 3E9ZA 4DARA 1VHWA 4KN5A 1T8WA 3MB8A 4DANA 1Y6RA 1RXCA 1TD1A 2ON6A 3KHSA 1T8SA 1RXSA 2OC4A 4LNHA 1ZOSA 4QAQA 5CYFA 1PK9A 4QEZA 4NSNA 4DA7A 2HN9A 3PHCA 3OOEA 4X24A 5CCDA 4UC0A 1B8OA 1JDZA 1PR6A 4DA8A 4L0MA 3K8QA 3T94A 5F76A 3E0QA 1TGVA 1VFNA 1RCTE 4MARA 5F7JA 1ODJA 3GGSA 1T0UA 2I8AA 4OEHA 3LBAA 3ENZA 1NC3A 2XRFA 2P4SA 1RXUA 4D8YA 4F2WA 4L5CA 4TXJA 3UAZA 4TXNA 1PF7E 4D9HA 4DAOA 3OPVA 3NBQA 3OF3A 1U1GA 1QE5A 4G89A 1NW4A 1CG6A 1TCVA 3EMVA 4K6OA 4WKOA 4QATA 4H1TA 4TYMA 3UAYA 3DF9A 1PW7A 5B7QA 2AI1A 4OF4A 4R2XA 1YRYE 3SCZA 1U1FA 1Z39A 4NY1A 4NS1A 5EFOA 1A69A 1B8NA 1A9QA 5FAKA 3DJFA 4LKRA 2PGAA 1Z38A 3DP9A 1JDUA 3O4VA 5IU6A 1PK7A 4R31A 1A9TA 3FNQA 5ETJA 3U40A 4TS3A 3IEXA 1JDVA 5F73A 1LVUA 1Z35A 3GB9A 1PBNA 5F7ZA 5B7GA 2OXFA 1ECPA 5F7OA 1V48A 2A0WA 3BL6A 3EUFA 1YQQA 3F8WA 1PR4A 3PNSA 1T8RA 3ODGA 1ODKA 1N3IA 3UAXA 1TGYA 3OZBA 4YJKA 4F3KA 3K8OE 1Z36A 4D8XA 3DPSA 3BSFA 3OZEA 2GUWA 1V41E 3C74A 3FUCA 1JE1A 1ULBA 1U1EA 2QTGA 1RYZA 2IQ5A 1LV8A 1YQUA 1Y1TA 3OCCA 3LA8A 1K27A 1SJ9A 1Y1RA 3PHBE 4GLFA 1A9SA 4ECEA 5EPUA 4JWTA 4OJTA 4GKAA
chains in the Genus database with same CATH superfamily
1IB0A 3JQAD 4TT8A 1E1QA 2GBFA 2YXNA 1OX4B 2J3JA 3K9HA 4KZPA 2WHRA 4I50A 2FMIA 2IIVA 4P34A 4YRPA 5LU8A 4LWZA 2H1RA 3VPBA 1M1ZA 4NF2A 3M5DA 1DOZA 1F2DA 3U0BA 4DGSA 3L8MA 3QPUA 3LUBA 3G2JA 4EITA 3H65A 5EXTA 5AJHA 1A8PA 5BRNA 3GBPA 5E8RA 4MYUA 4FFSA 4HNAB 4JH0A 3H8VA 4LCBA 5FT9A 1NQUA 3GG2A 1XQWA 2ZB3A 4Y2UA 4PZDA 1Z9BA 4II3A 1ARZA 2AHRA 5CNJA 3MWKA 5CXXA 1AF7A 3VPSA 3GJ4A 5BVHB 3H1EA 4JA0A 2O2EA 3R2JA 2PAAA 3D0OA 4L6AA 1ZD3A 2WMDA 3E82A 1PZEA 3G7UA 4YFVA 3UNXA 4IWNA 2EQAA 3LQQA 1AS0A 5L3ZA 5T57A 1IJKA 1AKQA 1G6Q1 2ZQYA 5HJ2A 3OT1B 4D41A 1QRSA 2QBYA 2JFGA 1UT8A 2JIZD 1QIMA 5FWYB 4GRDA 3KEGA 4QYWA 1FYDA 4BRWA 4YMIA 3DEHA 5CHYA 5BO5A 4GVXA 5CX1B 1A50B 1JLHA 4NBRA 1VI6A 2ZUDA 4JR2A 4KN9S 2OWDA 4PS1A 5PNTA 4BNDA 2OZKA 1H0RA 2REBA 3GDHA 2XY4A 3HA2A 2X0FA 5JSKA 4RD1A 3HCPA 5EI5A 1Z8NA 3RSGA 3I4LA 3PIRA 1L5VA 3UG7A 3NAMA 3A9TA 3PI6A 3AFMA 1YS1X 3EZ7A 2OCXA 1KOLA 3WJ2A 3H75A 3M2PA 4ZVVA 5IAKA 4EI7A 3NDIA 3TUZC 3FCCA 2OGWA 1GZHB 1Q7CA 1A5ZA 3E7FA 5FLXA 4OQ4A 4BVJA 3QWAA 2OBFA 3VXKA 3B1VA 4BMPB 3DKKA 1ZSVA 2BCJQ 3BXXA 3EGEA 3CNOA 2HU2A 3L0SA 1M5RA 3ZDFA 4RZIA 1AZSC 3LLCA 1EX9A 1LVHA 4MGKR 4S2UA 5C5CA 2EJCA 4O1MA 4MVYA 2GZ1A 3RVRA 2BSXA 3KQLA 1U63A 1QMPA 3KD2A 2J45A 5BNTA 1QGED 2LWIA 3FW1A 4PRLA 2JKVA 1G4UR 2V7UA 3KLMX 4R8LA 4RNCA 4TTQA 3TTXA 3HFRA 2YYAA 1NN5A 5L3RA 3KPUA 3LDUA 5B7PA 1N2CB 1T9GS 4G1BA 1XLWA 1I2MA 2PSSA 3NIDB 3EXIB 4KN8A 1IY2A 1X13A 2CGEA 2YY7A 4OMCA 3U9SA 1SHKA 4G4IA 1VKNA 1YL6A 2IWRA 2V3CC 3HDJA 3CF4G 1XDZA 2VRCD 1U3GA 2P3OA 4W5RA 2G9NA 3OA2A 5LMCA 3DEFA 3KXIA 1GGEA 1F4VA 2V58A 4F21A 1M6WA 1QE0A 3FM9A 3R7FA 4O5AA 1FDUA 3BCUA 3L6DA 1NI3A 5IMBA 3WGHA 2CZGA 3PPWA 1GZ5A 5KNBH 1QU2A 3T3OA 1PNOA 3D0RA 3TLBA 3ZD7A 1U31A 4WUVA 4TUYB 3B8HA 3L2OB 1NGSA 2V7WA 3MYYA 4HB0A 1Y48E 5G0WA 2VJKA 2BLNA 4L8GA 1W0JD 4MKFA 4PLFA 1OZAA 5HM8A 3HLKA 4MQFB 1M1YE 3E61A 4RTRA 2VT2A 3P52A 3VDQA 1LVGA 1KFBB 4NJEB 5TMPA 1TDJA 2NYVA 3TW4A 1BDHA 1SA0B 1JQAA 2DBVO 2R84A 2YXEA 1G3IA 1GGMA 5JAMA 1HO3A 2PZMA 2TS1A 4AO6A 4AS3A 2W90A 3GUVA 5HCNA 5H80A 2CWWA 2B7LA 1B74A 3OFNA 5K3CA 5BW5A 4AKGA 3IUBA 1D6JA 1U0GA 4NVRA 1KH1A 2OD9A 4DY4A 4N7JA 5JAHA 3WGGA 3DULA 1PQ4A 2VQ6A 1S9HA 4X93A 5BYBA 3T4XA 4JBXA 5AW8A 3HJHA 1GZ6A 4Q93A 5IAGA 1ULTA 3E22B 3KB1A 2Y1FA 3S99A 3WNVA 2J3HA 6AT1A 3IEVA 3T0GA 1RD4A 1N5OX 4IGAA 4UNQA 3M0EA 4TQGA 1RC8A 2G8NA 2V4UA 3OZIA 2FXVA 2PEZA 4BMCA 1YACA 5AHWA 3OECA 4YCMA 1WABA 3RTCA 1OLOA 4EYGA 5AW1A 1E8NA 2FSFA 2Q7DA 3W8DA 4H7DA 3FBTA 3UMSA 4KSCA 5AI9A 3KXKA 2DZDA 3WB2A 4J0JA 4C0WA 4C7OA 3P9KA 2WFZA 4BO5A 5KKNB 4ER5A 1PZNA 4XB1A 1PSDA 4PBTA 1P1JA 3WIEA 5KX5B 3P0RA 5FTJA 2PDAA 2C2YA 3WKEA 1FRZA 5FLEX 5HILA 5BNWA 3E84A 3RR2A 3KKKA 1OLSA 1QVAA 4P33A 4D44A 1AQ6A 2FPXA 3PFKA 5HP4A 1AA9A 1WXFA 4HYQA 4WRRA 1D2MA 3HKDB 4EQ6A 2R8EA 3WL8A 1IEQA 5EE1A 5TLSA 2GF0A 1IPHA 3W90A 2FN8A 3JYHA 1FCJA 2XNCA 2CMDA 2HA3A 2VRWA 1D8AA 1R6AA 3NUGA 4PPGA 3R44A 1N6KA 3P2OA 5LQAA 2Q8QA 3F6SA 3L01A 2NZXA 2CNWD 5DRTA 5AW6A 1G55A 1QAMA 4I1RA 3JYNA 3UWSA 4Y67A 4FR0A 3N5KA 1JQJC 3PTAA 4JLPA 3CUWA 4RTNA 3I5YA 3HV2A 2GRAA 3RHSA 5KQLA 1UZAA 4KQIA 1JAIA 5EQTA 5L40A 1PL7A 4BQFA 2Q1SA 1OSNA 4IJQA 5BN4B 4MYTA 1I6WA 1YV9A 2I3GA 4TWIA 1R66A 1M2EA 4OHZA 2VK2A 3F1KA 5CBPA 5KB3A 4FGLA 1DWQA 2GBCA 2P68A 4QWMA 4EWLA 4YRKA 2ZJ6A 5CB8A 5DO9A 4BNMA 1RBQA 1AQUA 1YR7A 4ENTA 2VXYA 4JOBA 5HCUA 2AZTA 3KXDA 4V0MA 3TR5A 2WKRA 2WJHA 2QJOA 1JU9A 5WRFA 1VGVA 3N2GB 2A0YA 1U28A 1Z0FA 3OWXA 5JDIC 5TXGA 2XAAA 4ZOLB 1P2SA 1D6SA 3ABOB 3LL4A 3MRXA 5BUCA 5E1MA 1TVKB 3C3CA 1IPFA 1NIPA 2H85A 4GXQA 4L02A 5A5EA 5IPFA 1USGA 3CPHA 3T9BA 1DC5A 2I7DA 3MOGA 2P9QA 1LQTA 4V0KA 3RWMB 1OT5A 2B2CA 3HDVA 3GLHB 2BELA 4DDTA 1XRSB 1N2EA 4OAPA 4II7A 3Q2KA 4BE7B 1M6NA 1PJAA 1Q6YA 4A2CA 4D4HA 1F06A 4OLFA 4C4OA 1RLUA 4WEOA 1R12A 1T9HA 4UHJA 3ZXXA 3VKHA 4O4HB 1EFUA 4PX5A 2LRHA 1L4KA 4GSKA 2PM8A 2VF8A 3IYLW 1AQLA 4FCWA 2HF8A 1TU3A 1AGRA 1NOIA 2JLCA 3QEOA 4A5OA 3A4YA 4U2CA 1UP4A 3PRKE 4HNAA 5LMUB 3JZAA 3QJYA 2HR1A 4CTNA 3I72A 2W6JD 2FCRA 3A1WA 3M89A 3FGNA 3MUEA 4GEGA 3FVRA 4WOPA 4X44A 5BVHA 3E7PA 4F8JA 4IBOA 4OFBA 1C7IA 1JAYA 3H18A 4RSGA 3K1ZA 2B82A 3WJAA 5HUQA 1RMTA 3EBLA 1DAMA 1O6ZA 2FAXA 2EZ8A 1UPTA 3OT1A 1A9ZA 4J0HA 1X2BA 5GM1A 2GYWA 3E9ZA 3MBKA 1NBME 3M5PA 1QWSA 3KEMA 1S3SA 3LY9A 5CX1A 2P9YA 3GRZA 1QUFA 3QLUC 3K0AB 3QX7A 2CK3D 1BVHA 1SXJB 1IVYA 4HC4A 3Q0TA 1Y6RA 2WD8A 2NVUB 5C31A 2GPSA 3DEZA 4IH1A 3SEAA 5KU7A 4TSRA 2PSHA 2FWIA 3MCVA 5GOTA 5JG7A 3KHSA 2H2AA 2C9ZA 1JILA 2OO5A 4UPVA 1IN8A 4Q9DA 5LLSA 5HIAA 2FHSA 3KALA 1XTZA 3QM1A 4QUBA 5CEJA 5IVIA 4U00A 3NCTA 1HT1E 3ZW7A 4CL0A 4DDKA 1WCWA 2WJZB 4O4IB 4D9EA 2W2KB 3FZYA 4E70A 4DLRA 1EFTA 2F1OA 3L40A 2IHVA 1NJSA 1XK6A 2XCIA 4H4DA 1QCYA 4JMLA 4QT0A 1XZIA 1C0KA 1CZHA 3B3AA 3F67A 4Q4AB 4HRXA 4NXMB 3X2SA 1VXRA 4UBMA 1MV8A 4WN3A 5FTLA 5JXJA 1OI7A 2Q1YA 4MRMA 3T06B 3IKVA 3EULA 3SDZA 2YUIA 2YYYA 2EG9A 1ZWLA 2X5NA 5AI5A 3T7AA 2V4ZA 2XIQA 1Q0RA 4O59O 3LX4A 3MT8A 2MYNA 5F7JA 2EJBA 1A8IA 1DTSA 2Q9BA 3DCYA 1IE3A 1SBHA 2TYSB 2MIIA 1WVGA 2VTDA 1U0LA 3KTAB 3WHKA 1NUAA 1N2CA 3O47A 3L4BC 1XA0A 5BWCA 3EXIA 1RHKA 4WECA 4AQDA 4DSZA 1AGPA 1UFKA 4N40A 2X1MA 4KO2S 5KYUB 4NARA 2YHIB 2ZDHA 5AM0A 3B5JA 4N76A 2PIDA 4N5NA 5G41A 1T5HX 5DOZA 3VGJA 1SCUB 1KNXA 1PF7E 3G89A 1P45A 5G3ZA 4ZJUA 3RT7A 3PF9A 4IMJB 5B3LA 2IXDA 4KODA 5HRCA 5ICEA 5JC8A 4OHOA 3WI7A 4MS3B 3LRPA 4CHGA 1EHIA 3PHIA 5KNDD 1BJKA 1TCVA 3ZCUA 5BUQA 4WESB 2QXYA 2FV8A 1N7IA 1LLUA 1RVDA 3HLYA 3V1TC 3WBBA 4MQFA 1BKDR 4TQUS 4YCCA 5HFNA 2PUAA 2IY8A 4L7VA 3IALA 3U4AA 4NJEA 5F3WB 1J0BA 1JIKA 3ELBA 4REMA 5FNVA 1SA0A 1L4GA 2EWVA 2JFWA 4R9VA 1U9IA 5JRZA 5LLDA 1IMOA 1UJ2A 2H5LA 1UMCB 1SBYA 1D6NA 4Q1AA 5TVGA 5B1IA 3U9TA 2FPGB 5BSVA 1ZGBA 4HPWA 2CXHA 3VAAA 1XHFA 4DV1B 4CV3A 4H7EA 1Z22A 4BLOA 2VUTA 4OBEA 4DR2B 2YTZA 2E4VA 1T9CA 4PLZA 1SUDA 2A86A 3HJBA 4GLLA 2G06A 4JASB 4M7OA 3JQFA 1K5PA 2C8LA 5EFOA 2C7OA 4M8LA 4EMTA 1R0YA 4UHFA 1KO8A 3Q3EA 2J30A 3ZWQA 5L4LA 4FMDB 5FEMA 1NT2A 5EJ2A 3B2QA 4PLVA 3S2UA 3WP1B 1VG0B 1ZM9A 2GBPA 5AICA 1PVVA 5ES4B 1CR2A 2QJTA 2QTFA 4XIIA 1NBAA 3CX7A 1M1NB 4LA4A 2M1ZA 1VL5A 3NEJA 2Q9UA 1F7VA 3J7TA 1LBIA 2QRZA 1IN4A 2YINC 3KX2A 5E6UB 3VR2D 1JDVA 1YGYA 1DPGA 7ABPA 4GSLA 5IZ4A 3H2KA 4CXMA 3H8JA 1YJAA 3LT4A 3H3FA 4IJKA 2DR0A 4REQB 1JU4A 5ECWA 5DNCA 4S04A 4D7AA 1N34B 2W2TA 5EZYF 4F12A 1LJLA 4NU5A 2HK9A 2AZXA 2YXPX 1VG8A 2GTHA 3VFDA 3R6DA 3L0PA 4EW3A 3PUKA 5JAUA 2R7LA 5FWAA 5H81A 5IUJC 4JVSB 2A35A 3F9CA 1RI1A 2I78A 2I6QA 3TFQA 4CMGA 1GYRA 1D2AA 2AN4A 3PENA 4K03A 5DNAA 3WIUA 4BLWA 7ADHA 1PDVA 1B8PA 2HJRA 3HYNA 3K4HA 3HKDA 4QBFA 5LOVF 5AHRA 5E0OA 2NUAB 3ANMA 2NZYA 4BQQA 2JCYA 3SC2B 3ZDXB 1PJZA 3GAMA 4NCHA 3IP7A 3A9UA 2XKBA 1MH9A 1O0CA 2GZDA 1L5MA 1AM4D 1D2CA 1VHDA 2R48A 3CSDA 4OK6A 1QIJA 4M36A 3NANA 4DVJA 5B6PA 1OB2A 2PLRA 5B4UA 1P7ZA 3HCCA 4J3NA 3DL7A 2O3JA 3W5SA 2OLJA 3C3JA 3BERA 1DEKA 2YS6A 1SVUA 2GHQA 3JSXA 1Y4AE 4MIEA 5J58A 3OZEA 3H1TA 4HQFA 1THTA 3KCNA 3IERA 3SXPA 2O2GA 1I2AA 1DRVA 2YVUA 1VMEA 4DE5A 1ISGA 2WM8A 1GT6A 1PZMA 2H1IA 2VDWB 1CD5A 4ADSG 2GWHA 2CDAA 3OD1A 4IIUA 3DDZX 1W46A 3QBJA 4R0NA 4FZJA 2VA8A 4TLAA 1GY8A 2TMDA 4QLAA 2BF7A 1XN1A 5DWQA 1NQXA 5REQB 3IR5A 4MS1B 3GWGA 1L5HB 3CLRC 3IA7A 3AZQA 3HYLA 2GM3A 1UDCA 1V3UA 3LIPA 4EMUA 4CEIA 1P7PA 1A2BA 3MBOA 4HRAA 4KDRA 1B8VA 2DOKA 3C4VA 4CKBA 3I62A 1WP9A 4XOUA 1EUYA 1CIJA 2OV3A 2IE8A 1R0XA 1G63A 1TVKA 1WQ1R 2WYWA 3FJOA 3GEGA 3OWHA 5DH9A 5TY0A 3O3NB 1C4XA 4W7SA 4XPZA 1SUBA 3QE2A 4QLOA 2H4FA 2PANA 1MX5A 4IFBA 3GLHA 1R18A 3TQCA 3A1TA 1E1DA 2WZQA 3CNHA 3OIGA 3L6CA 3V8BA 4XVQA 1ZJJA 3G0GA 4M87A 3TLGB 1NVVR 4KO8A 5JI2E 3C3MA 2C5BA 3R9XA 4ZQGA 2W42A 3A1CA 4JBLA 4MXDA 3EY9A 3FYSA 3UK6A 3EJWA 3OPMA 3GOQA 3REFA 5CXSA 1DJOA 1S4MA 3RUCA 1ESDA 3FIUA 4YRGA 5JFOA 5BWNA 4ZHQA 3UQYS 1CQPA 3URMA 1W96A 4K9OA 2JJQA 4U5XA 4JT2A 3HDQA 4WXEA 1NDQA 3U1VA 1JEAA 3EEIA 2XDQB 5KJ6A 4QFDA 1JFVA 1BXZA 1NRIA 3KUCA 5AKHA 4Q7JB 2P3SA 3GFTA 3Q12A 3QVSA 3F5DA 5LP6B 2WUGA 3ED5A 5DM60 2XCRB 1SXHA 5D1HA 3B20A 5TEWA 4A8PA 4JQZA 5EHXA 4PE5B 2RH8A 5CDFE 2A2ZA 2XZLA 1OT3A 1S2LA 1SELA 3AEXA 3EMBA 4RZQA 2Q99A 3VTAA 2Q3LA 3KTFA 1VI5A 4G84A 4D57A 1GPLA 3C1AA 5HIIA 4I14A 4ND7A 2E4ZA 4L75A 3F6YA 4NU8X 2VCEA 2XNSA 3KVVA 2Z95A 3K0AA 2DTDA 2GTIA 1F4LA 2L17A 5FBHA 2YVAA 3KKPA 1S2OA 3EGVA 1UKCA 1K97A 3RLFA 4QFBA 3TJZA 3ZCQA 4CIDA 4Y6GB 3V8NA 4A1FA 1ULZA 1OU4A 1WXXA 1ZK4A 2ZPUA 1NQTA 2BZGA 1E9EA 3INNA 1JZQA 3Q7PA 4GPZA 5IT0A 1SHTX 2HSJA 4KRXA 4H3HB 4HQOA 1BFKA 3QFTA 4EG6A 2QSYA 4OBBA 1M0SA 2PX0A 4Y6QA 2G04A 3VA7A 3ROMA 1GKLA 2PBZA 3ZZUA 1G3QA 1U0NA 1H2HA 5J9FA 1HTBA 1JVNA 3B1WA 4O4IA 3IPRA 2DHRA 2W2KA 2FG6C 2IHUA 1HI9A 1JTVA 2CXSA 1ZICA 4BKPA 5FIUA 1YKGA 4FI3F 4YCJA 3RBZA 1PFWA 3VPAA 2D4HA 1WXQA 2Q6LA 3KYDB 3QJGA 4B80A 2ZT5A 2OQ2A 4MYSA 4BXOB 1EYZA 2UVPA 1NMEA 2AI2A 1N7GA 2VDKB 3WGUA 3OQHA 4IS3A 2QPOA 5LCXA 1ISHA 2WIAA 2IZ0A 2PKWA 3TIIA 4TSKA 4CW7A 5CCEA 1FMCA 1AD2A 2FETA 3A9WA 1A3CA 3RNLA 2X7XA 5AI0A 2LCQA 5KYUA 1BVYF 2YHIA 4NATA 1XYVA 1GGKA 1KMNA 4MWBA 3HVIA 2E37A 1SCUA 4L08A 4HVTA 1GNSA 4ZTBA 1NVKA 5E7QA 4RJLA 2H54A 5AIBA 3H4MA 3HJFA 1N2GA 3AP1A 3DVAB 4Q0MA 4YJFB 3QSYA 5H16A 4MS3A 5KAPA 1E7YA 1ULHA 2C3PA 2QT1A 1BVUA 4R8VA 4WESA 4PHTA 2IX3A 1L3CA 2RCNA 3PPIA 4NU6A 2PBLA 5LBUA 4EMSA 2O2DA 4RY8A 4ND8B 1KR5A 5C7LO 3KJXA 4G5QA 4RY2A 1AB5A 3RJMA 3DOOA 5JYCA 3GLIB 1JJBA 1GTRA 1P1RA 1W6RA 3LZ6A 4CEJA 1YO6A 2XX3A 3A6ZA 1CZOA 2GGSA 2VATA 3L46A 5FL7A 3HXMA 4TYYA 4HAUA 2WW8A 3GRCA 3PJDA 4RH1A 1UMCA 1RABA 2D2FA 2AXPA 3K9GA 3UFBA 5IG2A 3O8CA 2FPGA 2O3QA 4QPZA 1CY4A 1L8OA 3G2MA 4YT8A 5DNYB 4BMYA 1ECFA 5IXJA 3EMKA 4E2FA 2JLRA 4JYZA 2A59A 3EFOB 3AVWA 3ADKA 4DEXA 2RMKA 1TK3A 1Y6ZA 2COEA 3D5QA 1DQSA 3QYFA 1GSAA 1UDWA 2DGDA 2IY7A 4RDHA 4Y9RA 2UYCA 2C7RA 4K05A 5KDOA 2PGJA 1U1CA 1E2GA 2NWQA 5A4JA 2BGWA 1DEOA 2ISQA 3PK0A 1U9ZA 5BXQC 3PYLA 1PR1A 1IUNA 1W76A 4MEAA 5AW9A 2FUCA 1XRJA 4RK1A 4QJBA 4OXQA 4AG3A 1M1NA 5CAEA 2Z9BA 3WDKA 1UOPA 5FLKA 2GCNA 3QUTA 1JLRA 4IVPA 5E6UA 3THYA 4EY4A 3UT6A 1DBWA 2V8OA 1EDOA 3FWHA 3D5TA 5C8YB 1J2YA 1YXMA 1E9RA 1IHXA 3R5SA 2FZKA 4FILA 2WICA 3I0ZA 1N2ZA 3LCVB 4M22A 1FTGA 4REQA 4TOIA 3SKYA 3TQOA 3USZA 2ZXEA 4ZYUA 1NC1A 3DW3X 3V8EA 1HDGO 2QN9A 2C2BA 2ZB4A 1FP4B 4N01A 1I4OA 1VP3A 2V5VA 2A7XA 3DQPA 4NHOA 3MT0A 4R7GA 1M66A 4PW0A 4YI5A 3FUTA 3RVPA 2X40A 3E18A 4A8JC 2VRCA 3SS8A 2DMRA 3P32A 5IH7A 3BB1A 2A88A 1RIFA 2J0VA 3MLBA 4XH9B 1P6UA 4H1VA 5DYWA 2QX6A 1JA1A 4B7CA 4RPGA 3M1LA 5C4MA 4XWTA 2PGOA 3FB1A 2CVQA 1Z8HA 3DVLA 4L5YA 4LSMA 1EEHA 4YAFA 4G2TA 5KYVA 1T2NA 5JWRA 2IS2A 3QFHA 2CF5A 4J0DA 3AG6A 3NFYA 1YIAA 1SUWA 4LGYA 3RCBA 2OC9A 4ND4A 3FHJA 4PQYA 4PC1A 2WSMA 2QTLA 3EIWA 1XPUA 4G0WA 1JHAA 4IQGA 4NS4A 1Y3IA 2XTZA 3JYQA 4LKOA 4PYLA 4K7JA 4JQCA 2BFEB 4WZAB 3UJ8A 3UKDA 4YV7A 1E4VA 3MJ4A 4AKEA 1RYFA 2A9FA 3K0EA 3P0HA 3FWKA 4ALIA 3HP1A 2QOEA 3W8RA 4R0MA 2C2KA 5C3MA 4AUMA 4WKPA 2Y1OA 4HSGA 2VDWA 4NCJA 2OM2A 4I3HA 2F48A 2IYXA 4M88A 1SVIA 5SZJA 2H1OA 3CGGA 1E58A 3BJEA 4YMGA 2FSSA 5REQA 4MS1A 4HGRA 1L5HA 3GCXA 4AC9A 3OEYA 2CBXA 2BDTA 4BN4A 3S2YA 3RWBA 2B78A 2ZVJA 2IV2X 4B4DA 5C80A 3FCSB 5JASA 1A9OA 3MNFA 1HL7A 4IO1A 4F9EA 4FW9A 3TLXA 1OFGA 3EG9B 1IK6A 2V6IA 4G0ZA 3OE4A 1Z3CA 4FX5A 2CVPA 3LGSA 2DPYA 4EY8A 3AV3A 3RRZA 4NIMA 1WMSA 2G83A 4I9HA 4XRGA 4UPDA 4B81A 2HNBA 3NIFB 3TLGA 5HRAA 1L8XA 3URKA 3VX4A 4TLLB 5I47A 5B37A 3A1UA 3NBZC 4X0EA 3GGJA 5K4HA 3U6BA 3IMEA 1RAEA 2D8AA 1QLHA 1PKXA 2WIFA 4JGBA 5CXQA 3ZCXA 4P3OA 3HABA 4G5SA 3P96A 4JYCA 3I34X 4RSMA 4D79A 3I8XA 3DOHA 1KHTA 4OU5A 3O8QB 4LBYA 1YCFA 2YQ4A 1ACJA 1ZUD1 2D00A 2FG5A 1WSWA 1OPXA 3LUCA 3DUFB 1KFJB 1UINA 2QGFA 4LXIA 2G76A 3HL0A 1TEVA 4KFSA 3SJCA 4DCOA 1MHPA 2WFMA 3CZ9A 1UKYA 1MD9A 1OPRA 3CLHA 2ZRJA 4L5BA 4GMKA 5LP6A 1MAVA 5JFGA 4I66A 1V8DA 4N65A 3UJDA 4XSVA 2Q4TA 2ZRBA 1SBIA 1HQYE 1WQ4A 4K0RA 4EPTA 2IXFA 3F6EX 3H83A 3BWXA 3HXQA 3FR8A 1E59A 2BONA 2C4WA 3EVZA 4KE8A 1GRNA 3H9UA 2WD7B 3LIIA 1VHQA 4DARA 1VCIA 3GDOA 3FOZA 2Y4NA 1IRXA 2BI7A 2Q3CA 1UJ6A 3EAGA 3P5SA 3TTUA 4R2MA 1W7AA 3DP7A 4TN1A 2OGSA 4H35A 3FCEA 3Q3VA 2ORWA 2ZE6A 4ETNA 4LQ4A 1NVBA 2W6CX 5CG2A 3THYB 2E6KA 7YASA 1X8LA 3IVMA 2J9ZB 2ON6A 1RU3A 3QVXA 3W3AH 3L3BA 4EZIA 5TPZA 1DSSG 4D3DA 3BA1A 4D9CA 5AFSA 1QYXA 3K6KA 4XFKA 3D6TB 4AXBA 4K87A 4R2KA 2K7ZA 1C1HA 4NG5A 3EC1A 1QX4A 4MWSA 2FSGA 5IC6A 3FBWA 4YJHA 1OFHA 1RQLA 4TM8A 3KYDA 4W5WA 5IW8A 4F2HA 4QVKA 5A4AA 4Q00A 1E9AA 1C7ZA 2PXCA 2CLHB 3U13A 3OMLA 3BFJA 4HHEA 3W8NA 2KW5A 4AL4A 4BXOA 2IS1A 3YASA 3B1YA 3PX2A 3T95A 3IKTA 1Z13A 5KQPA 4YPFA 3H5IA 2PIAA 1DHTA 2Z3ZA 1U6KA 4CT0A 2X0IA 1KFKB 221PA 3JQ7B 2H51A 1YC5A 2H8KA 1JIJA 2FKAA 1ISFA 4YRMA 4ZQHA 2NU8A 1XF1A 1XKTA 1U3FA 2XRFA 5FULA 2HCFA 2X5KO 3VNRA 4DW8A 3OJEA 4J07A 5LDDC 4OQQA 4RQAA 4YCBA 5BW8A 1T1GA 3DVAA 4OXYA 4YJFA 1NKSA 4AJJA 3W7AA 1WB4A 1ZNXA 3KLPX 3OF3A 4URUR 5H3LA 1Z6QA 4B6RA 2HQSA 4D8TA 1D5WA 2OQRA 1URPA 4NEHB 4B17A 4ND8A 2NMVA 1M34B 1K8RA 2QAGC 3DEKA 3MJEA 4O6VA 4TROA 1FP7A 4XQCA 4B2LA 3CURA 4JB2A 2GA9A 3BF8A 3U3JA 1I7QB 3WAGA 3GLIA 3FUWA 1YK0A 3QELB 5BOSB 2K2QB 1NU6A 2D2XA 4H1TA 3LHDA 3IEMA 3TB4A 3T4EA 5TJHA 1KZ4A 5ENVA 2DJ5A 1RQRA 2GETA 2DBQA 2ZVPX 3FNFA 3Q6MA 3D7MA 4Z4EA 4PO8A 4ONEA 2AI1A 3IUSA 4MDEA 3CA8A 3ZZMA 1I5OA 2MSKA 1WV1A 1TXGA 2XUDA 4R2XA 3EFOA 3C5EA 4B4UA 3I9V6 1MEOA 2IPAB 1ES9A 1P19A 1RPTA 1SBZA 4QRHA 2D13A 1U1FA 1WW8A 2YASA 1RJWA 4MO9A 4R6XA 4UD2A 4X54A 1SRRA 5EP4A 5BV1A 4DR7B 3JTMA 3TAHA 3M6VA 4BN5A 4DQDA 5FAKA 3HQ4O 5TMBA 3QWHA 1KJ8A 3FSEA 3IDSA 3TM5A 1HL3A 1GKYA 4EJ0A 3OLQA 2FQWA 5KOJB 1K6IA 2QHXA 4IUYA 4ZI3A 4Z9YA 2R6FA 3WBKA 1KPGA 3OE7A 4YP5A 5DYGA 3LECA 3BKWA 2JFPA 3PGLA 4US0R 1GL3A 4OHCA 4JU8A 1SCKA 4YREA 2O59A 3C8HA 3QENA 1YT5A 3V3TA 1FLDA 4IQFA 4A15A 4C20A 1IEVA 1P4RA 2P1ZA 4L8YA 1T15A 3KJZA 1WAMA 4BLTA 3AYXB 1IMJA 2P7HA 3HDYA 5BWLA 2V5AA 1OFUX 1HC7A 1BQ3A 4UEQA 3E8MA 4RIHA 4ZYTA 4W5JA 3GI1A 3ANNA 1EUQA 5E3HA 2RSLA 3EUFA 4ECAA 1KL7A 3KDSE 2A84A 4RIEA 3WNQA 3L18A 3TIXB 1W0CA 4BYMA 4W8OA 3HUUA 1ENYA 4M8KA 4MLCA 3E9DA 1M2VB 3CLRD 3DDCA 3R0QA 5CNKA 4NJOA 5EVJA 4ZCQA 3SDBA 5CG1A 4O02B 2J48A 3F73A 4CQJA 5FQNA 3A11A 3HP4A 3X44A 2I7CA 1B16A 1S8NA 2HDHA 3CNQS 3H6GA 3EE6A 4MKIA 1H2ZA 1JRLA 2OFOA 3AUUA 3KEOA 1KJIA 1UBLS 4I8IA 1N0UA 3B78A 3L1HA 1T8TA 4U8HA 3AVTA 4DIEA 1PV4A 2BFEA 4WZAA 3KKZA 1PJRA 5L3VA 3GLSA 2J0QA 2ZBQA 3KYCB 1PFUA 3OQ1A 3TRHA 5DDIP 3WYAA 2HWYA 4KNYA 1THMA 2HT1A 2JD1A 4CR8A 1ACLA 4GX1A 2OILA 5LDGA 1NJ1A 4PXSA 4MV6A 1NAIA 3NBFA 4M89A 2NXNA 2PKXA 4MVXA 4PNEA 3HJCA 2GLTA 4E15A 2Q4DA 4INPA 1SR8A 4LRYA 3K94A 2NNWB 1TOAA 1W94A 4EEKA 5IEJA 4IVQA 1KP3A 4CKEB 1Q0UA 3V8VA 4JJIA 2C4HA 2QROA 4F8YA 4GBJA 3EAFA 4NULA 4E33A 2IQ5A 1MNAA 3WV5A 3HFSA 2BH9A 2UZ1B 4UDNA 4C7MA 1ETHA 1HSZA 2H17A 3ADPA 4J8PA 1WZEA 3QXJA 1LBQA 3D2LA 4DNPA 1K3TA 3MMNA 3EG9A 1TJPB 1P80A 1MORA 1WPXA 3A4TA 4CGYA 5GZ1A 5L7TA 4XOIA 4FXOA 1AVTA 1GTG1 2B4KA 2DRIA 5E0KB 2FRDC 3DH0A 4HY3A 4D0NA 1OV4A 1MNQA 2N3ZA 2SKEA 3FROA 4OI2A 5A4DA 4E5PA 1K5HA 2B4QA 3HCBA 3OLWA 5EPUA 4OJTA 3MEQA 4GKAA 4IVNA 2ODQA 4TWAA 1I33A 2O5CA 3CRVA 3OX1A 3Q9SA 1Q0ZA 3LC1O 2ZSFA 3RBVA 2JAHA 1AKMA 3IQDB 3R5HA 2GNAA 3FGOA 3O8QA 1E60A 4OXRA 4RDIA 4DYVA 1TT7A 2N1BA 1QWOA 2E48A 2R8BA 4EL5A 4QPDA 2VAPA 1Y7PA 1XTSA 2FFAA 2X8AA 3DUFA 3EIFA 2RH5A 4GI3A 5DTEA 3VDNB 2FW1A 4CR6A 5JRDS 5C3UA 2G1JA 5K9ZA 1MG5A 5LZ4A 4FJ1A 1EVLA 2WMNB 2NUTB 2XUIA 3NBAA 5LXTA 2RAFA 4DPKA 4Y6OA 4I6EA 4IFIA 3VU9B 1GPWB 3IAS6 4AJ9A 1M10A 2PSJA 1MC5A 4C21A 3R23A 1ZD4A 2JFVA 4D43A 4IYJA 5IC5A 1E5QA 4BWFB 1P8JA 3BXOA 3A6GA 1I8TA 2WD7A 3H9EO 5J5AA 4I4CA 4ZPXA 1PLJA 5EWJB 5JECA 4EY3A 3CTMA 3HCOA 2QU7A 2YHSA 3RVBA 3HY6A 3GZJA 4NRDA 2FEPA 2FK8A 1GPJA 2HLHA 4AI6A 2VJBA 1E2HA 1JL3A 2ZJFA 4W1QA 4QECA 4RPHA 1XRRA 3H5RA 5AQ1A 3V33A 1CQWA 1PDOA 3TQHA 4OA5A 3IDOA 4INJA 5GONF 4TSFA 1ZLXA 3JALA 4TWRA 3N6VA 1ENOA 2EL9A 2OOSA 4Y3UA 1N0HA 3TNJA 4GM1A 5A2GA 2GPYA 4EYQA 3WRWA 5KJ1A 1GCOA 3N28A 1YQWA 1KY2A 1EK0A 2XUAA 3NORA 3PA8A 1UBSB 3LG2A 1PV2A 1V1MB 3ETGA 5SYAA 3RRBA 1K08A 3BICA 1SURA 2JBAB 2AFIE 3SQDA 3O8RA 3DV9A 4TGLA 4RFSB 3TXYA 3ZWYA 5FA5A 1FLNA 4GD3Q 2ZCJA 5K03A 4M0CA 4B3HA 4ZTUB 2Y0BA 3OWOA 5D85A 3O95A 1C1XB 3LBNA 1Z2NX 4QTUB 4E11A 1G66A 1XTTA 2PWBA 5CFZA 5IWAB 1HYQA 5KPJA 1KDVA 3FFBA 3OLXA 1EJ2A 1SUAA 2B36A 3V55A 3FCOA 2CL0X 2VUSA 4R51A 1QH8A 4EGJA 4C2BA 1DKMA 1HE3A 1Z6PA 2ZULA 1II8B 1TKAA 4D02A 1FK8A 5HDQA 1G8MA 3NWJA 1AUQA 3PE6A 4G8DA 4DIDA 3OT4A 3RLIA 2XW6A 3NEYA 4FCCA 3GFRA 1TAGA 5IFKA 1L7AA 1K4YA 3EZ9A 3OF2A 4KPEC 1LF5A 2HHAA 4PLYA 4WDQA 4L95C 1Y9DA 1E1LA 3COPA 2ZRPA 1J0XO 2VNIA 5SV2A 5HKKD 2ZSHA 1W47A 4NH4A 3OQ6A 3UHPA 1GRRA 4PSCA 1OXMA 1L7BA 3I05A 1GUYA 2AMFA 2PLFA 2A1IA 5L6LB 1YK1A 4FFVA 1YRHA 3PEYA 2OFFA 4OIMA 4E32A 3GCDA 2FRXA 3NXSA 1TIBA 2IIPA 2ZAIA 3QVUA 1I5RA 3PA6A 4IXNA 2W4IA 5G0SA 4RZSA 3E35A 5KWJA 2FDXA 3TOXA 3BMCB 2BUCA 5GVRA 1LQUA 3KJFA 1AV7A 1FUYB 1P75A 5CW2A 3X2EA 1JQKA 1ZNZA 4JJ7A 3E7DA 3G8AA 1Q3TA 2O05A 4OHVA 4OSPA 4F4IA 4YCSA 4AJ1A 3WNDA 2BI4A 1HEIA 3BF7A 3PL1A 3D8HA 1V4BA 4JBNA 4H27A 5C5EA 1CU1A 2CSXA 4DCJA 1T3SA 5JPIA 1EK2A 1NV9A 1VPLA 3DYVA 2ZRGA 2YNMC 5EPOA 5EMLA 1QFZA 2IZ6A 2Q5LA 2PRJA 2J5KA 1W52X 2Q2QA 1Z8FA 3AERB 2IXAA 4LDQA 4PZZA 4QDKA 3ZTTA 5TQJA 2C9DA 3FNBA 8AT1A 2FDCA 2MTBA 1GG8A 2WNIA 4KLAA 4N54A 4YV2A 3KBBA 2QP9X 4X9XA 4EDHA 3GDWA 2B1GA 5KOJA 4FNOA 1J0CA 3PL5A 3E9NA 4F9GA 1W29A 2IEZA 2XHEA 3HXLA 3IP8A 2LZ0A 2QRQA 4DZRA 1HZZA 1G8JA 1XAHA 2R11A 2ERCA 2AJBA 4KW7A 4LZWA 1ND6A 5JC1A 3WAJA 1ZVJA 2X2OA 2I6UA 3HADA 4P6VF 4B76A 1X3SA 4DMLA 4I55F 4CKWB 4W1RA 2JRCA 4E7OA 1N6LA 4YWJA 1JU3A 2RH9B 3WRYA 2XVAA 4E46A 3MWYW 3P4YA 3PJEA 4BNZA 3FKJA 4YT4A 4JQSA 4TYQA 3IE1A 4JOSA 3IO5A 3CEPB 4G6ZA 4DR4B 3CINA 4AP9A 4ZTZB 2VQSA 3RUDA 3CBQA 1RXVA 2RHJA 5HQTA 1Z5OA 2NM0A 5FPHA 3FTNA 4HP8A 2PN1A 4M9SA 1F8UA 3GGDA 3GXOA 4J0FA 3WDSA 3RIYA 3B1ZA 3ZIAD 3GRVA 3IUPA 4QXMA 4YRQA 3ROXA 4CT5A 5CVTA 2K7FA 4FNGA 3JVEA 1M2VA 5ESRA 1CEEA 1Q74A 4BY9E 4FNMA 3NHMA 1QRDA 1RC1A 3GVPA 4XCVA 2CNLA 2PMBA 5EZYB 2D6FA 1LRJA 4MYDA 1BHSA 2HSWA 4QOHA 2WWXA 3ZI4A 2HA5A 1UM8A 4GUDA 3HM9A 1C9EA 2RHDA 4CWAA 1IC6A 4NBNA 3U61B 2C59A 2KQUA 2JIPA 1FU8A 2ERXA 2IF0A 1E5XA 1T8UA 3DUWA 4M0PA 1KMQA 2BJHA 2EDCA 3QPCA 4Q3NA 4XB6B 1GCIA 1KZ7B 3B85A 1JG3A 3DKRA 5AM1A 5HBRA 5BSGA 3UY4A 1GRCA 4F3TA 1JIVA 2WHXA 5IK2D 1NR5A 2CDRA 4BNGA 3PEUA 2OUKA 1T0IA 3MOSA 2L69A 3M70A 5EAIA 1Z68A 3ZDEA 5K4GA 2Y1CA 4BNVA 4ZYLA 5HZMA 2WA2A 5F4BA 2H2FA 3HRKA 2WF8A 3Q3HA 5HIMA 3I04A 2RBKA 4TQAA 5KSOA 1KK1A 1SVOA 3GJYA 5HUJA 1IOZA 4RK0A 3GFGA 4ZGWA 1GHTA 1QVRA 1XTKA 2ZGVA 3D5EA 1YMVA 2BHLA 3WXMA 5GZ6A 3SXJA 4NFSA 2WIGA 2IXTA 3R8XA 2AEFA 3HDGA 2GCEA 1QHYA 1EBUA 3O1IC 2PMWB 3V9PA 4RIGA 2X3YA 3ETHA 4MRAA 1ZGCA 3EBPA 4MIOA 4PNPA 2WQ6A 4MI6A 3OD5A 1YB2A 3NHFA 1RE0A 3BGDA 3L8ZA 3OCZA 4ZJZA 1H8EA 3EVGA 4QU8A 3HCDA 3PITA 3VC3A 4R5MA 1A7UA 2F3UA 1FNNA 3L43A 4HPXB 1GA1A 2P2CA 4L3WA 4PO3X 4BEVA 2X9QA 4OJKA 4RF2A 1U6JA 3KQWA 4OP1A 1EP9A 3BGWA 3B89A 5FYQA 5TS3A 2XODA 2YJ3A 2VT3A 2C78A 3WZMA 4LY0A 4UU7A 5KC9A 3CV3A 4QG3A 3BZWA 2YOHA 1FLVA 2R8ZA 1RNLA 1WDWB 2ZSAA 3AOEC 3W0LB 3PJRA 1Z2DA 2MWMA 4Q82A 1NL3A 2HZ7A 2R8PA 4QOGA 4U2EA 1N36B 5LYJA 5L8VA 4U2FA 1MJGA 5DM2A 5EFZA 2Q07A 4FKZA 1AMUA 2BEUB 4UZFA 3RFCA 5GADl 2NUTA 1CP2A 1XCPA 1R9MA 3G88A 1GSOA 4K2HA 3A3NA 1C7RA 1TUIA 4HXYA 3TSWA 3VU9A 5E1DA 4M0FA 3C85A 4JV5B 2ZRFA 3MGKA 1OASA 4HV4A 1W4LA 1QHXA 4ZPJA 3NO4A 2YDXA 3KVNA 5C37A 4YMTA 4QPCA 1UC4B 3DAOA 4U6SA 1H4QA 3U37A 2C83A 1K86A 4WQMA 1YZ3A 3SIWA 3IQXA 3TUIC 2AMJA 1CUUA 4UBKA 5FFFA 1E66A 2FXIA 1KY3A 2RGUA 2YCBA 2DJIA 3PD0A 4BHTA 3QMVA 1T8WA 4CLOB 2PBFA 4L15A 4YRRA 4M2LA 3HN7A 3NHSA 3B48A 1H1TA 3O3MB 4MJXA 3SZLA 1NF9A 1TIPA 4JKYA 5AK5A 4TKVA 1SB9A 5KNDH 3IEIA 3TVDA 5FX2A 1PG2A 3I5AA 5ESXA 2A57A 4FVTA 2ILTA 1XZPA 4N8DA 4IDAA 2VNSA 3BDAA 4KE7A 5KPDA 3HZOA 2JAWA 4O5OA 5SY6A 4HLQB 1OIWA 2HU5A 3VU8A 2ZZKA 1DAEA 4S1VA 4JD5A 3B6IA 3W2FA 5A2QA 3CY6A 2LKDA 3V2IA 2C97A 4KXUA 3BHJA 2J32A 5AXBA 1C2YA 4QM7A 2JBAA 1BS1A 4ITVA 1YA6A 2WVAA 3I9JA 1AT1A 4RFSA 4UBNA 1XJCA 4MUKA 3T7KA 1J22A 1QOQB 5ADWA 5AVZA 1TF5A 3EIHA 4TYWA 1C1XA 1J5PA 1BHQ1 3GT4A 4V3CA 1JPNA 4JVOA 1T4DA 1LY1A 2JCVA 2B7CA 2FGJA 2XNHA 4QM6A 1L5ZA 2E82A 3L9WA 1XD9A 4PAOA 4CFZA 5KTTA 5J23A 3KQHA 3GGSA 1ECLA 2RIRA 3RODA 4KITB 1II8A 5KREA 3QLUA 1WLSA 5JS1A 4XEUA 3AY0A 1UAYA 1BQ4A 2HBYA 1H22A 4NMHA 5MN5A 2BMFA 2AW3A 2GSWA 5HGXA 2F4VB 4I19A 1LPMA 3UUFA 1LLFA 3T1TA 1RXUA 3KSMA 1KBOA 5FH9A 1X2EA 1VA4A 2FH5B 3PLNA 3AU8A 4OKNA 5I7AA 2FFRA 1Y7HA 3TBFA 2BM8A 3BMQA 4ZVRA 1SKBA 4UHCA 5TT0A 4DG5A 2OAQ1 3LHIA 3ED1A 1P2DA 3HVKA 3TIFA 4CLHA 4Z3OA 3IILA 4IDHA 3STHA 4WH0A 3W2TA 4XWKA 1DXOA 2QLNA 3W5VA 7MDHA 1NBMD 3ESQA 4FYXA 1DHRA 3G82C 2CNBA 4QATA 6ADHA 3X1MA 1ZHOA 1GCAA 2YIDA 3DL0A 1U8XX 4CF4A 1E9DA 1JHUA 3GLTA 3PC3A 5EKXA 5CCXA 1QF9A 1YU6A 3LVRE 3LBIA 3L7KA 1NVWQ 4TMFA 2GFIA 1ZUNB 5HEKA 1NY5A 2GN0A 4YWHA 2XA1A 4PONA 3L4BA 3V4RA 1P7VA 3VZDA 3GVHA 4XM2A 1JKMA 1DINA 2VP2A 3K6SA 5IZCC 4IOKA 4M9QA 3WFJA 3AERA 2G67A 4B6FA 3OSUA 3RC3A 2B98A 3A4VA 2HA6A 4CMBA 5KYTA 3U4CA 2N1MA 2O14A 4IHKA 5ITVA 4JB3A 1U7OA 2AW5A 2JHAA 2PG3A 2C2GA 5DBFA 3R74A 3UO8B 1AZWA 1UEJA 2ZBDA 3BBLA 5JCZA 1P9RA 4QX6A 3DP9A 3N2EA 2QD4A 4XM0A 1A5BB 5IAJA 5IU6A 5C4GB 3I61A 4DLWA 3M4YA 2XNDD 3WX0A 2SBTA 2B2NA 2WYVA 2JVKA 4UCFA 3T9CA 3A2KA 4HZUB 4CKWA 1CUHA 4HWRA 5FUYA 1COWD 4TKUB 3L8YA 2HPHA 3A3YA 4K9RA 1D8TA 1NNSA 4GEKA 4JLAA 4MP8A 4MCAA 4RHXA 2V6FA 3GNTA 1RZ3A 5MFPA 4IINA 4MHTA 1U3VA 4DV3B 1YVPA 4PINA 4HNUA 4QWWA 4XJVA 2W6PA 2A5DA 2I2CA 1OWOA 3HUFA 4UEWA 1O58A 2ZRAA 2HIGA 2WYOA 3T7RA 4C3UA 3DD5A 3K09A 5AVYA 2HXYA 4RD3A 5BR4A 3PLRA 5IVHA 2DWQA 5DW0A 1VBKA 1PJQA 2X0DA 4PAGA 3THRA 5T4BA 3H2BA 2I3BA 2WZCA 5ALTA 1N6IA 5FUBA 5EZYA 1A76A 4C3ZA 1QBGA 2GCOB 3EOZA 2PA3A 1P3Y1 2QZPA 5FEUA 4DPMA 2LTAA 3HB1A 1E6LA 4JP2A 3AFNA 1QRUA 1UDXA 3WMXA 2FYTA 2G6TA 1WUYA 5DVZA 1Q17A 4XKJA 4N7MA 1NPYA 3K72B 1LC3A 3UEOA 4BP3A 1SCNE 5A03A 1PRYA 5FOSA 4DSTA 5LOVA 1H8HD 3SDSA 3EAQA 3IT0A 3IUEA 1PT8A 1OWMA 2PVSA 1Z25A 1F1JA 3U60B 1P2UA 2ZAOA 2VL7A 2VZLA 4FDAA 3ZN2A 1EZ4A 2HOQA 1KH2A 1JB1A 2CE7A 5C18A 3UCFA 4KPFC 1QIDA 1U2SA 1IDN1 2QP4A 1HE2A 3TKAA 3TEJA 1W2HA 4DMHA 1O94C 4PNZA 2FSUA 4J76A 4P32A 2AOVA 2YJ5A 2J9FB 4UZEA 5L51A 1K6MA 1R6DA 4A8JB 4B7XA 4NCXA 1OBVA 1L5KA 3VGPA 1ZS9A 1RYZA 5TSDA 1PGOA 1F2TB 4OL0A 1UEIA 3R6WA 3T0FA 3UOAB 1J21A 1ZI6A 4YJGA 1YL5A 5KC8A 3MJVA 1YR9A 1OREA 1E63A 3WADA 3R9IA 3AR7A 5CB4F 4TRJA 1ZWKA 1AZLA 3A1DA 1U4NA 4PG8A 2EDAA 3D6FA 4CM4B 1Y1LA 3AONB 5DGIA 1WNFA 5JVDF 5ITSA 1UOQA 2QUKA 4FT2A 3JD0A 4ZQFA 3FZGA 4XDZA 1V7CA 5EGSA 5JH7F 1XTBA 2F6RA 1KRXA 1ZY2A 1HH4A 3E27A 5K6RA 4CMJA 1RZUA 1UZUA 4ZEMA 1PAUA 4GMGA 1TRHA 2C00A 2IYRA 4NCKA 2GYYA 2R7AA 1GNPA 5JMTA 2UUOA 3AX6A 2XI4A 3I6YA 4CTKA 1OCEA 2BEUA 1YVRA 3FPGA 1VCHA 3VJRA 3FTDA 3R3VA 2ZE7A 1P2TA 1YASA 1N3LA 2GCIA 1Q20A 4JELA 1S8FA 1UH5A 4KO4S 2ZYHA 4M1TA 4RJJA 2ICAA 3SIRA 4EP1A 4CPDA 3AEZA 5I3ZA 4HGZA 2I3ZA 2QRLA 4NMMA 2VYND 1SCIA 2JK1A 2JHPA 1XZHA 2G28A 5J4HA 1HDZA 4Z7OB 3VVBA 1AF4A 4HATA 1GU0A 1NQWA 2AIRA 4CZ2A 3GEPA 2E5LB 2VVTA 4M55A 1M1YB 3OUUA 3Q3CA 4W6QA 4JC5A 3SYTA 2PRKA 4H4EA 5B2EA 3GLVA 1FX1A 3EXFB 5FBVB 4UATA 1TYCA 4J90A 4IG9A 3T1YB 5J4KA 3TTVA 1VXOA 2C1ZA 4O0MA 1PLLA 2AOXA 2R1VB 3ITKA 2D1RA 1QZTA 2FN7A 1L5LA 5HJEA 5CIWA 3GELA 3O03A 4FDUA 4ZGGA 5LQUA 1TJ3A 3FCXA 2ZXFA 1Z2EA 4OSEA 4A10A 4XA8A 3VJLA 4KREA 1W1IA 5IDVA 1V3TA 3UV7A 2BFCB 4ISBA 4C2TA 4XD7A 2VHWA 1EI9A 1GGHA 3FMPB 4X7PA 4CV1A 3QA3E 4H59A 4D82A 2QLBA 1SKYB 2HHJA 3D7SA 1XBTA 1Q7BA 2EEPA 5ABPA 2O8FA 3JQ9C 4XPIA 1E2MA 1JA0A 5P21A 1BOFA 4LVCA 2ZR8A 3FI0A 3OTIA 1IQUA 1S3IA 1XTIA 2NPOA 3VOAA 1FQOA 1JIUA 3GR6A 1GWNA 3AIMA 4GLJA 1FTNA 2FW8A 1NUTA 3RJTA 3B9BA 4LFBB 4REOA 1RJGA 2HQRA 2OZEA 4RZXA 2FW0A 3CIOA 3DBLB 3PC8A 4RF3A 4C06A 3H4IA 3TLKA 3WICA 3CC8A 1RQXA 2WA1A 3DMYA 3LWZA 3B82A 3NDPA 4MWTA 2I65A 3W5HA 2BEKA 4HEA6 3GAZA 3LLUA 4UXJA 1V6SA 1PEYA 3HWX1 1Y3AA 3IXLA 2GK4A 3ZUPA 3TLJA 3PJGA 2VZEA 3FFTA 2L82A 2ES4A 1KQFA 1C3VA 2OESA 1W9HA 5K0SA 3LT2A 1DT3A 1ZINA 2ACKA 4W8GA 4X1KB 5AVQA 2YNMD 1EMDA 1RWPA 5D01A 4Y2RA 2C9OA 4XRRA 2QMUA 3H99A 3VDMA 2OHXA 3S4YA 4U9UA 4D80A 3OTOB 1S8OA 1W35A 5A5VA 5EA2A 3AL0C 3TVTA 1NXVA 3WYGA 4FGZA 2XBLA 3MWJA 3ZBUA 5HJ5A 1DS6A 5EZ6B 4Y7CA 4GH5A 2UU9B 2TSYB 3L4SO 1INLA 5EHNA 3TPZA 1GFWA 3ETEA 3QUCA 4BO8A 4C6TB 2B6NA 2X8JB 1G5IA 2VK8A 3FWPA 1OX6A 2VI5A 2X23A 3A04A 4F4JA 1HYEA 2OPBA 3QWFA 3EGDA 3EF3A 5BMVF 1OA1A 2F3QA 3D2AA 2JVJA 4ZVMA 3PXUA 4JBIA 1MRZA 1LRLA 1ZN8A 2ID7A 4ILEA 1ZUNA 3SFZA 1QORA 3VQTA 2XGMA 4E14A 1LS1A 4II2A 1BFUA 1ZN7A 3CUVA 1VC2A 4IIEA 2XKJE 3LCRA 1WTAA 4GWKA 1KYXA 2P2ZA 3H1PA 4OQNA 2AC7A 1T36B 1V39A 4GMHA 1HR0B 1F6WA 1KY4A 4WJZA 4J0QA 5IXYA 4C4PA 2LW7A 3SR3A 1XU4A 5EY5B 4PX9A 5HS4A 1AKTA 5PGMA 5BORA 1KI1A 2WIBA 3P9SA 1CRWG 1LNQA 4Y2SA 4PHCA 4ARBA 2AD1A 2DF8A 3Q7SA 3VZSA 3W5BA 2OXCA 5B36A 3KAQA 3P0FA 2BJVA 4P2GA 1O6BA 1U8YA 1YDMA 2BTOA 2AN3A 4C87A 1R0CA 2X0JA 1Z6YA 4R05A 2G7ZA 2WF6A 2QAGB 1H42A 4HZUA 1YFLA 4V02A 4MH0R 2ZR9A 4I9NA 4MRPA 3QE3A 2DH5A 3OO0A 4TKUA 4KRGA 5DKFA 4UASA 3RVJA 4N3GA 3ILXA 2GEBA 3F6BX 1BKYA 3LX5A 1U9JA 1EG2A 2Z08A 3TOVA 4J7CA 1PYGA 1FDOA 4TTRA 4RULA 1O0BA 3JAKB 4XB2A 4ZXFA 1DAKA 1WSAA 1ZMXA 2O0MA 3VR6D 4EYEA 5K51A 2EIHA 4QIHA 4H1WA 2PMEA 2PX2A 3PC4A 4WKGA 4A6PA 1WEHA 4PXYA 1R8YA 2QZSA 4PLTA 5H7XA 3JZIA 1FMTA 1KFCB 1Z3IX 2KBEA 2CUKA 1FB5A 2W6MA 3O7MA 4YEDA 5HKKA 2GCOA 5D86A 2ETXA 4KV9A 3OIFA 4P38A 5F35A 1CUYA 3ZNNA 1CY6A 1M33A 1BX1A 1Z5PA 2JH8A 2E4UA 3L8DA 4C0HA 5JQGB 5ICFA 4BAGA 3ML1A 3KS9A 4BUZA 2XBMA 1M6EX 1H1LB 1KMIY 1UDBA 3N87A 2ODPA 1KJWA 3ZJTA 5JXWA 2GXAA 1ZL0A 4X3OA 1SEVA 4RZUA 3BXPA 4RV4A 4PFJA 1LJ8A 2FEOA 1QHFA 4AJHA 5I3CA 1YTUA 2W8BA 4P0PB 1Y8RB 2XUZA 1P4AA 3CRMA 2V7QA 4NEQA 4PV7A 3SZUA 5ADVA 1YH3A 3PUXA 4OK5A 3I0NA 3H4VA 2FW7A 4BVHA 5LNK6 4TXLA 4LY3A 3GFVA 4FONA 3CKLA 2VQ3A 1E3IA 4HDRB 2CFCA 1KVQA 3CEHA 3VR1A 2J9FA 4Q24A 4A8JA 1K7XB 5AKIA 4DCVA 1CRZA 1E1CB 5FD8A 2OQVA 1RPNA 4Z3KA 4GU5A 1R0RE 4OMFG 2HPVA 4ZC8A 1KZ1A 3AWIA 3RS0A 2DHDA 4FGJA 3C3EA 3ELUA 2ZUWA 4W4TA 5DMXA 5DLQC 4NZYA 3LTEA 1H1DA 5C1DA 4W82A 3VM6A 2JI8A 3AKYA 3KR2A 4BLSA 3ES9A 1BHO1 1IQ0A 4HH3C 1JHDA 3T7IA 1A27A 1RIIA 5CYGA 3SM3A 3FVWA 4CM4A 4ED9A 4QPPA 4JC0A 1RE1A 2CLDX 2X8BA 2VSQA 4PICA 3TRJA 4KXFB 4WY8A 3TXXA 4EHLA 1ATZA 3T4PA 4RM2A 1IXKA 4GYWA 1B23P 1A2QA 4G9EA 3R3SA 4HUQB 4IDBA 3C3KA 3ANXA 4BNLA 1ENZA 2HZBA 4YCLA 3ZG6A 1MKYA 4YJ3B 3OKCA 1Y6QA 5CA0F 1OXXK 2QY6A 3IO3A 3A6LA 4KNVA 3KJNA 2D4AA 5B58C 1IZYA 2PX4A 3H5WA 3GUUA 4Y2PA 4OHUA 2WJIA 4MJLA 2RHLA 3VH3A 2V9PA 4FP9A 5KTOA 1LI4A 4K0KB 1V6AA 2O2JA 3EFEA 3DOJA 3HCAA 4CU5A 3NHKA 2Q5EA 1G98A 3G2QA 5AVVA 2AFRA 4FIDA 3UHAA 2I6FA 4O4JB 1I7LA 3LOQA 2YQZA 2FUG1 2I8LA 3NG1A 5KHLB 1N32B 1PBTA 3H7AA 1M1YA 2W0MA 4MVJD 3EXFA 1BE6A 1R1DA 4LV8B 4YR9A 2PWZA 1JF8A 1HDYA 2B5OA 2QPAA 4F6LA 3OJXA 5AW4A 2AGVA 1EFHA 3H05A 4E5DA 1W9MA 3DZBA 4LYGA 4BJ1A 4G0QA 5JEDA 3ZKWB 1CUEA 1TO2E 3BZUA 1FYFA 2QM7A 3DZJA 3BRWD 1W88B 3BWDD 3P71T 4TVOA 1I2DA 4P5EA 3VSDA 1O4WA 3HNRA 2FRVA 4OQFA 2H63A 1TYBE 3QUBA 4HFMA 4GR5A 2AZ4A 3OKFA 1R5BA 3VHQA 1SKMA 2ZIFA 2I2FA 3AVOA 3A3OA 2A5LA 3ORHA 3M3DA 2OC4A 1JT2A 4KVZA 4NYIR 2W0SA 1A4UA 4BFSA 1V0JA 3OJFA 5EOVA 1VE6A 4H16A 5COQA 1ZIDA 4X61A 4F04A 5FTWA 4DA7A 2V0GA 2GTPA 1UKEA 4GX2A 1E9VA 1PT5A 1CTQA 2I2BA 2IW3A 2G88A 2MMCA 1UIRA 3NGLA 1W4CA 3GPIA 5KNLA 1L8QA 4OBWA 1TC2A 2GKSA 1ANKA 3DBLA 4H3KB 5BYKA 1U0BB 4MUXA 1L4MA 2IVZA 2XIJA 3PGA1 5DX8A 3DR5A 3QSGA 1C41A 2F59A 2O8EA 1X94A 1MLDA 4IEIA 1RQPA 4B3XA 2AFHB 2C3MA 4DBVO 2P40A 2PS0A 2HMUA 4J6EA 5JMOA 1NUUA 3A4LA 5DF1A 1QFMA 2CXNA 3BJZA 5J5VA 6PFKA 1CULC 2BKAA 3IE2A 1UPXA 5JRJA 5H82A 3ESBA 3JQRA 4BNHA 1UM9B 4OM8A 1QG4A 3OFSA 3PWTA 3FYDA 4P3KA 1AKYA 3DE7X 4L9WA 3ECCA 4YXWD 1UXGA 3F7TA 4X6YA 4WIAA 4CMAA 1DCTA 3OPVA 3PXXA 3NBQA 1O4VA 1PZGA 2A5GA 3OU2A 4DJEC 1P5HA 3OKAA 5FDFA 4ZQBA 1BG6A 3RBAA 1H3EA 4FU0A 3PB3A 2HNKA 4EUFA 2Y9MB 3TQFA 1NR1A 4MULA 2IZ5A 4NKRA 2X8JA 4C6TA 2AMVA 1SNYA 4ZVPA 3NONA 3G0HA 4Z7NB 5JW6A 1EGVB 1L6RA 1QQ5A 3CZMA 3LBYA 4R01A 2VCHA 3N70A 1I9CA 2VH1A 3MCWA 4KO1S 4PZUA 4MMXB 1MV5A 3FPBA 5LIPA 3RE1A 4MK4A 3DDNA 4L72A 2WDPA 4XWOA 3NIGB 2X4LA 2Q9AA 2H4JA 4QNNA 5DW3A 3TMKA 1JMKC 2VYVA 5DNWA 4ARIA 2FMXA 4HDSA 1DO2A 1NF3A 3MAGA 4CJXA 5KTPA 2FG7C 2IPMA 2F17A 3KP1A 1RP1A 3BIXA 3D31A 2P9HA 3CE9A 1PNVA 1T36A 2I7VA 1YRYE 3ZHTA 5C8VA 3S1AA 1E79D 2O4UX 3V3KA 1GXSA 2Q4OA 3N7UA 4E94A 2C0CA 5AR1A 1QHEA 3UWDA 4PYJA 4Q7QA 4ZT3A 2LKCA 4GMDA 2QXUA 2OD7A 3UC9A 5JBQA 1R0KA 2O4CA 4GDFA 3I58A 4IJ6A 3EDMA 3EGOA 3G0DA 4IDDA 1KSGA 3JAMA 4GLBA 4N0DA 1NASA 3HU3A 1RM4A 1RKXA 3KFLA 2ZUFA 2H4WA 3VPXA 4EUKA 2QAGA 5DRYA 2LBPA 5ETJA 2FZCA 1ZXXA 5FOQA 3ZZ1A 3Q10A 1WKCA 4FHEA 1V8OA 2JA2A 4Q15A 5A3JA 3HV0A 4O4LF 3ZH2A 5LL6P 1VBFA 1A82A 1XWWA 2B37A 2DUNA 2PGXA 1T9BA 3OZRA 1XP8A 1G291 1UK8A 4OVKA 1OROA 5H1YA 4EO9A 2ZSUA 2ZE5A 4QBKA 1ZOIA 3R0IA 3SIXA 4BNTA 4QUAA 3I45A 4R2JA 5H9VA 3JAKA 3QF7A 1L4LA 1QP8A 3N0VA 2H1FA 2P30A 4QUGA 1Q11A 3BYZA 1CUFA 4WY5A 1XG5A 1HNXB 1HSOA 1DV1A 2XB9A 4I0WB 4INZA 4UCXA 1ZRMA 3T7DA 1V48A 2A0WA 3A2NA 3OY7A 4NESA 5HF9A 1O94D 4I55B 1AUPA 1B00A 3RTDA 4B8WA 2ODWA 1YNOA 2I6XA 4N7BA 3I5UA 4H6WA 4A23A 3A32A 4YJKA 4YQFA 2QLLA 2HMYB 2P65A 3CPEA 3K8OE 4L8WB 3OZTA 2AYYA 1H1LA 3AUKA 2VBGA 3O8DA 1MX9A 4HB2A 2B0CA 1GNTA 1NBMA 4RPKA 1A1VA 4BB5A 1VLVA 1R4MB 4MKGA 1JQ3A 1TTPB 4HS9A 3I2YX 2XXJA 3WKDA 2OYRA 5A06A 2BYTA 1Q1EA 1Y8RA 3QWBA 4P1ZA 5HRUA 2AF3C 3BSFA 4ZZ2A 4X64B 4FJ2A 2JIOA 5JT1A 3T15A 2KJQA 3PIDA 5JAOA 1UC8A 1DCMA 3E2PA 1C2TA 3FPLA 4HDRA 4XM1A 1U90A 4CM1A 5JO0A 1QTQA 1ZNYA 3C74A 1QVZA 1XVVA 1EVIA 2R96A 3HBNA 4IOMA 4MW9A 1M1UA 4MWDA 2QMHA 4PYMA 5ENZA 3WKBA 3QW4B 4B45A 4DA9A 4EHNA 4EKNB 4YAWA 1X7YB 2I6TA 2CXTA 5BQPA 2EW1A 3PDWA 4DC1A 3RRNA 1C9NA 1Y1TA 4CEHB 1YC2A 3N0XA 3A26A 5T3YA 1L1FA 3PD7A 4AM8A 1N2SA 3JV7A 1SG0A 3B3FA 1SWVA 3I01A 3U5TA 3EIUA 2AZMA 2JATA 3Q41A 4Q4CA 2Q3BA 1YZYA 4R8MA 1VIDA 1G8PA 5DGTA 4WJLA 4B74A 2V6MA 2Z5GA 3E5NA 3F90A 3H8WA 5LYYA 3ON5A 5JNRA 5K6TA 3PWZA 3TFOA 1FP6A 1LLQA 4XARA 3DZIA 4HUQA 4WLVA 1QTRA 2XMZA 1DLIA 1SZCA 1NHWA 2QI9F 2RC5A 2ZOSA 3AHGA 1NN1A 3BK7A 3PTLA 3UJ7A 4YJ3A 4U6NA 5A5GA 3C4JA 1M76A 3WLTA 3UMCA 3O8LA 1Q44A 1Z2OX 2J4FA 3T7EA 4EX6A 1F9EA 3T41A 1P60A 3MERA 3U26A 5ALNA 1YDHA 2VRBA 1JZTA 2QG9A 3ONWA 2NQ2C 3F3MA 3FYUC 4RS4A 1NWHA 1PI3A 2F9FA 2PT9A 4Z0PA 4DL9A 1KDOA 1J0EA 1UR5A 1Z88A 2PKQO 2XUGA 3KVRA 5DE3A 1GQSA 1Z56C 1UOEA 1XAJA 5HQJA 4K46A 4EFNA 5FI5A 4O4JA 1EIWA 2NU9A 2I33A 3TZKA 3K1TA 4M76B 3A37A 2VJMB 3COSA 4I1YA 2XMGA 3DKPA 4YB8A 4TLMB 2QTBA 4A4DA 5GINE 4JVLA 2CLKB 5ALJA 1Q19A 4AY6A 1HX7A 3G59A 2Q3MA 2IVFA 1H8HA 1MO3A 1VQ1A 1Z5WA 2CYCA 1QKKA 1PKEA 2EFYA 1KFEB 2FJ0A 3BCSA 3ND9A 3UAOA 3MTBA 4A7PA 2ZUUA 1I3NA 1W1WA 1AK2A 2YYZA 1Y89A 1K8XB 2PR7A 3U1TA 4EBFA 2G4CA 2IS6A 5JCJD 1BKSB 3J81k 3A6PC 4BC1A 5LQJA 2PUEA 3ANYB 4O2AB 3P2YA 1SVKA 3ANSA 5CNMA 4AECA 1CYDA 2A92A 2G1UA 4OFXA 1IXSB 2PUBA 4IIJB 4COKA 2ZJ0A 2AI3A 1T4GA 2ET6A 4MGHA 1FBNA 2ZRHA 4K6HA 4KP7A 5LQNA 4HVLA 5NULA 1XP5A 4E08A 1KI8A 1WZUA 2DHCA 2F1RA 1N25A 2WABA 4ZU1X 1SUFA 2OBYA 5BNZA 1LBHA 2O7NA 4E6EA 5HOQA 4WCDA 4ZP1A 4KLNA 3ZBQA 2WSSA 4TRRA 4UM9D 4Y2QA 5IM4A 2CD9A 1O0SA 5GONA 2TMKA 3IBYA 5JHHB 4JLKA 1EZZA 1IM2A 3BIWA 1LW6E 2QN3A 3FCUB 3KV1A 3OCYA 1AQIA 1F2VA 3S29A 3AWDA 2YCLA 3QUAA 2DFNA 2O6HA 3PHJA 4H6VA 4NYMQ 1ONBA 4IIBA 4HLCA 4JLDA 2BEJA 4XTRA 4RABA 4DUZB 1Z17A 2EARA 3F7NA 4ALLA 1PR2A 1X77A 1W73A 3EDOA 3WGMA 1U7UA 1YE8A 1PUJA 3O7WA 3ONEA 4FIZA 1EJ6A 1XOIA 2AG8A 4UOQA 2A9KA 3DVSX 3RFUA 3I8SA 1FRFS 4PG5A 3UH0A 1V71A 1XEWX 4DNQA 4UTRA 1UM9A 4ZOQI 1CB7A 5LZ9A 3TGLA 3EZFA 2O5VA 4RADA 1KC3A 1SOAA 1T10A 2WDZA 3TSAA 3G9ZA 3PDJA 3QKWA 5LBIA 1VCOA 1D1SA 3RYFB 5KYKA 1DRWA 4GX5A 1UBGA 3PFCA 5F77A 1OTYA 2BM1A 2C5GA 1Y4UA 3Q87B 2EZTA 2FPPB 3F5QA 1H2FA 1OV6A 1NMSA 2RG7A 3EARA 2C98A 2JHGA 2CL5A 2EF1A 1AURA 2AWOA 3LUPA 4MW1A 2C96A 4MW7A 3GGCA 2OZLA 4GUAA 3UXEA 1HETA 3AUSA 1F20A 4JKOA 1N7JA 5GVSA 2B6HA 1ZO8A 2FUEA 3ZXSA 4L3OA 1BU5A 1FNCA 1CEQA 1YJ5A 3ENKA 1TMYA 2X58A 5I9TA 1PWEA 3L1UA 3GP5A 5FBWB 5AJYA 2BM9A 4W5QA 1J8FA 1PJ3A 1QK3A 3KHTA 3R7BA 4BN0A 1V1RB 1TKRA 5JYBA 1A9RA 1UK9A 2P67A 2PA0A 4FEAA 1K7CA 4L4YA 3H9BA 3ESDA 3R3HA 5J5CA 3SHVA 2LE0A 4EI8A 5L53A 2K6GA 1QV7A 1EUZA 3D43A 2V98A 3VKUA 4GAEA 1R88A 2MCFA 4X5OA 3I04M 4JQYA 4FHFA 1RTKA 4TMYA 5B3AA 1O2DA 1D1QA 3WSTA 2ZJZA 3MELA 2V7BA 4X97A 4MRVA 4A9AA 5DTMA 4K9MA 3L07A 4LGCA 3GZ4A 5AKGA 1GGVA 4Z4HA 5I7EA 2P27A 4AICA 3QKRB 4HDKB 4CIBA 1QCDA 3PBKA 3BM5A 3GDFA 3VV2A 5IJAA 2BKLA 2FQ1A 2R6GA 1YZHA 4H77A 3H5OA 2E21A 4X7MA 2P35A 2HM7A 4WKCA 3WWPA 3O1LA 4AY5A 1L7PA 1A97A 1B7GO 1F1BA 3OTGA 1C9MA 4NYJQ 3UV3A 2RKOA 2XGJA 1XRPA 3ENNA 3JWEA 4EG4A 2ZI7A 3MCTA 1NI4B 1MRSA 2EKDA 2R8OA 3QKIA 5H4GA 4FLMA 5A3VA 3TEMA 2BR5A 3OJ0A 4R9NA 1LX6A 3H0CA 2P1DA 2YNMA 4I55A 4V03A 4LZZA 4Q4HA 2OY0A 4AYTA 3UGQA 2XZOA 2EATA 4NAHA 3X2FA 1MJGM 4B6OA 4CMIB 1BO6A 2P6OA 3CBGA 1ODTC 3B3QA 2B35A 2JLQA 2YW9A 3IPXA 4FZVA 4DG8A 3ZVRA 3OMXA 4FXPA 1V45E 5CDFA 4WHMA 2A0XA 4BFYA 4YMVA 4JC8A 1BJRE 3VISA 2FZ4A 2AEMA 3RHZA 2QNBA 3T3DA 5IFLA 3K16A 4D26A 2NP6A 3VVCA 4HH1A 3K30A 3OBIA 2DM6A 4JU9A 3CLTC 1Z0SA 4KR0A 1AC5A 2NTVA 5LKAA 1X6VA 2AN1A 3LW8A 3DGEC 5AKZA 5AW2A 1WW3A 3B53X 3GVIA 3IXQA 2RE8A 1P7YA 4RGVA 4M1MA 3WGJA 5A1TA 1GPUA 3I9KA 1BDJA 1UJNA 1PWYE 2QL9A 1FXWF 1T1SA 3L8FA 4Y9SA 4ZDWA 3ND8A 1VB3A 3VHXB 3ZQUA 4E22A 4X7BA 5IABA 4Z4IA 3IOMA 1MDFA 2I2WA 1X9GA 4W5TA 1FZTA 2V7TA 3GK3A 3VDRA 3ZW9A 4ND3A 3CZPA 2CLCX 1J1IA 3RWOA 1SXJE 3W9UA 1UEXC 1SXGA 3PQ5A 3TTYA 3W6UA 4CEHA 2JIDA 1TZBA 2GPJA 2O20A 2X3FA 3R0XA 1W5SA 3IV6A 4X94A 2LUOA 1KJYA 4MQ6A 3T7TA 5EEHA 2XTAA 1CSEE 3MCUA 1ZMRA 5JD4A 3C7DB 1UJ4A 2FQQA 2GXSA 3NH9A 4FSXA 3Q7IA 1DCFA 3KFXA 2QDXA 4D46A 1Q1GA 1A5SB 5L3SB 3L9XA 2Q45A 3B6KA 4KGZA 1FUEA 1E64A 3IPCA 1AHNA 1E1RD 1XZBA 1PFYA 3IVCA 4RJKA 2DVMA 3D8BA 1FL9A 1USVA 1FW6A 4S1OA 3L93A 1BCRB 1G4AE 2QW1A 2JS7A 4UCWA 5JDCA 3VR6A 2TMGA 4TXHA 3VR3A 4PGHA 1KQOA 3F49S 3IVAA 1JYSA 4Y1RB 4KQXA 3AF2A 3WGIA 1FPQA 4U7HA 4EZBA 2BM0A 5DP2A 5JVDB 9LDBA 1C8LA 1UFRA 5LC1A 1E8MA 4R9RA 4QZVA 4OYRA 1W2WB 2WRZA 1U7XA 2G80A 3K2BA 4IJVA 4QGFA 2X76A 2G07A 1ZD2P 2C2XA 3A9VA 4HDQB 2NW6A 4PRKA 4WK6A 4NG4A 4XUCA 5JH7B 2B4AA 1JEEA 2FP3A 1KSHA 1LNZA 1M6HA 2CCKA 2XXAB 2BAGA 5DT9A 2IEIA 2Z8YA 3K7EA 3R0VA 4JLWA 2GB4A 3VI3B 4KWTA 2XOKA 3IPAA 1IPEA 3UIEA 1YJCA 4AJNA 3FKSA 4LUCA 1B26A 4OAOA 1JXMA 4PPQA 1J5EB 1D9XA 3GN2A 4JL6A 4Q1VA 3G9XA 2YJNA 4AQ7A 1SKAA 2YWJA 3FY4A 1IULA 1JSZA 2V3VA 3OM8A 4QC2A 4UREA 3ILYA 4ZT4A 4C2AA 3PNMA 4IRXA 5I4CA 2I1VB 3RTEA 4GVPA 4FOOA 1GV0A 2HRZA 1QP7A 3PIIA 3K35A 4WERA 5E95A 1G2IA 1YOBA 1JFTA 2YV5A 1P0MA 1E6MA 3D6JA 3ID6C 1ZR4A 3DXFA 1US8B 3N8NA 4M0DA 4ND5A 2ZYDA 1S7CA 2WSBA 3Q6NA 1VL0A 1P2BA 4V3BA 2JFOA 4W7HA 3RF7A 5C8XA 5LSAA 1E1YA 4C0BA 3HWWA 2IUUA 3AHHA 2VR1A 4OP2A 1LDBA 4BASA 4H7KA 1YIOA 3NCHA 1GTL1 4H4CA 1FP2A 5DI3B 3HEMA 3PQ2A 3VO8A 1MUUA 5JO9A 1NLMA 1M67A 1FDIA 1CUZA 5CCDA 5IYZB 2ZR7A 1DV2A 1GZUA 1Q3KA 2O7RA 5CT8A 1ZBDA 2W6ZA 4DM3A 3JW8A 1XHEA 5CW1A 3OM0A 3TH5A 4BRZA 1DUIA 1ZK1A 2DXIA 1TAHA 3MJDA 1IK4A 2VHQA 4J7XA 4QBIA 4AUNA 5KHAA 5B1EA 5LZ2A 5L4NA 3SS7X 2APJA 5AXAA 4LHWA 3DLIA 3SSOA 5IULC 3L49A 3PGMA 3PUIA 4ENVA 1QIFA 1E4EB 2P78A 3VO1A 4PBSA 1GQRA 2F2TA 1XFAA 1SVSA 4FR2A 3F4LA 5BQOA 3ZLVA 4ES6A 3FHTA 1TTQB 3RYFA 1P5ZB 4C4XA 1NNUA 1QDEA 2F00A 2RBGA 4PAWA 1H6DA 1X80B 1CJSA 1WY5A 2Y68A 1DDGA 3AESB 1SN7A 3UB2A 1T9AA 2EP5A 2FPPA 4XQ9A 2FPWA 3IULA 3N75A 3QNWA 4OATA 3PVSA 3TZHA 4BV9A 1OH7A 2WF5A 1PJLA 1IN1A 1Q3HA 1EWTA 1R8XA 5FF9A 2J3KA 3INRA 4OO3A 4BCCA 1CV2A 3BULA 4CDMA 4KR7A 3AETB 5ALWA 1QIHA 1GJRA 3QVLA 4WADA 4MVJA 2IJGX 3CJTA 3H11B 3OQMA 1N77A 3AM1A 1O57A 2FWMX 3PXAA 2EGHA 4C4ZA 4UUMA 1G21B 4CYMA 1X0VA 2GK3A 3OKPA 4JJKA 4Q21A 3WO1A 4YAOA 2BI8A 4DIFA 2XVMA 3R8FA 1WMEA 5BN5A 4OI1A 2O2SA 4QDUA 4OX9Y 2XGGA 3D6NB 4G1EB 1ABEA 3BRWA 4H7FA 5AW5A 1XR3A 1JG1A 1K0FA 1KEVA 1NJ5A 1RLTA 1E32A 2BGRA 2Q2OA 3HB0A 4HQ0A 4ITUA 2M6LA 4EJFA 3GD5A 3H2YA 1PHRA 3OUTA 3ZHOA 5FOVA 5CJPA 1YUNA 2V1XA 4KBFA 1NVEA 2H5IA 2PZ8A 3WLQA 4YROA 4I1SA 2Z8XA 2PRIA 5HIJA 1YR8A 2BFOA 4AZVA 4TMTA 4N3AA 4K8RB 1FSGA 4J1TC 4RK5A 4G56A 4F6CA 3DJFA 4WNCA 4ZAWA 3AEQA 5FWXA 4HDKA 1PDWA 2RGCA 2YMLA 4QD3A 5FPPA 2ZWPA 2KHZA 5HKBA 5MFZA 2D1QA 4UM9B 3VKFA 1UAGA 5IBCA 3FNQA 3N6XA 3A2LA 1KQNA 5IT4A 1EK6A 3HMKA 3IEXA 3C16C 2XUKA 4Z9XA 2ZU0C 1KP9A 3MSXA 2W6NA 5J59A 1Q16A 4HYYA 4L0QA 2F8SA 3RGGA 2X77A 4AG5A 3TLZA 4OKIA 1OE0A 1U8CB 5F1KA 1NI4A 4ZVTA 1IBRA 1YZKA 3WIDA 1FYXA 1Y1PA 3QX3A 2VPTA 4D3XA 1CNEA 1UBTS 2EP7A 2IGTA 3MRTA 1S4QA 4R71A 4RCZA 5T5QA 2O8CB 5EUQB 5F7OA 1L5WA 1GDDA 1XROA 2GAIA 3QPDA 2B3DA 2EIXA 1OJLA 2H1CA 2P1RA 2R1TA 2WLSA 4KPGA 4PG6A 4PGAA 3G0OA 4YXWA 2CMFA 4IDEA 1WSBA 3R5FA 5EXSA 4ALMA 2Z3VA 3A6HA 1ZNWA 1ZZEA 2JIMA 2VUIB 4UU1A 2X86A 3CMCO 1TGYA 1V4VA 1R6VA 3HFGA 1XCLA 4P4LA 4V38A 4C4TA 5LN1A 3N8DA 2YRWA 1Z7WA 3REOA 3ENWA 1FSFA 4RU1A 4WE3A 1MZVA 1Z15A 3AHCA 4ZCPA 4WMLA 3C70A 4NQZA 1EFRD 3ELDA 4EAQA 5LPNA 2ZS9A 3PVCA 3G9TA 1M0TA 2JZNA 4MAFA 2Z56A 4IO0A 5DBIA 1S3GA 1XWFA 3HM2A 3G7SA 4KHZA 4UJ3A 2AJ8A 3UBMA 3VHXA 3LVFO 2M6SA 2QENA 4BU0A 3NXKA 1HE4A 2Z2KA 5AMXA 3RC9A 1QFSA 4KAJA 2OV4A 5EL0A 4J0CA 5GPBA 1P1CA 3LQ1A 1E79A 1XCOA 1NNI1 3F9RA 1FFAA 2WVHA 2RGNA 4MAAA 3WKAA 1S96A 1OIXA 1K9VF 2C31A 2NYUA 3JVVA 4DLYA 4DSAA 4HRYA 1OXUA 4X1IB 1BDMA 2JZCA 4XDHA 5EKUA 3SMQA 1RI4A 3UZUA 13PKA 4BIMA 4DMMA 2JAOA 4WW0A 4NBVA 1B0ZA 1N1MA 2C99A 1G16A 2H3HA 1LV8A 3FSRA 3QA9A 3K05A 4Z7QB 1BWRA 3LHFA 3M6LA 2CHGA 4IHAA 2CNOA 4EHKA 4XIFA 1AN9A 4GM4A 4DDHA 1K27A 2R62A 3H5AA 1NE2A 1CUVA 3IURA 2O57A 4FFDA 4MHOA 3M4ZA 3AI7A 2OKCA 3D0KA 3H97A 4FFWA 5L3SA 3Q5GA 4LOAA 1R9GA 2XJ4A 4GOLD 1KPHA 4ECEA 4N39A 2GS9A 3MWLA 1WCXA 4D3SA 3SX0A 1VLHA 1BCRA 1ESEA 2HIHA 3DFIA 4IJUA 4LBWA 5CB4A 5CLIA 5B2ZA 2DPHA 3PR3A 4QBHA 4YRDA 1QTIA 1ZRSA 2EJTA 5KNBD 1XYYA 1CLEA