1B14A

Alcohol dehydrogenase from drosophila lebanonensis binary complex with nad+
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNTTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic reaction and inhibition mechanism of Drosophila alcohol dehydrogenase: observation of an enzyme-bound NAD-ketone adduct at 1.4 A resolution by X-ray crystallography.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords ALCOHOL DEHYDROGENASE
total genus 97
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 1998-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b14A00
2YDXA 3I5MA 4I9HA 1NQ5A 3UF0A 3PFWO 4IZIA 3K9QO 3UCFA 4CR8A 3MJCA 3CXRA 2XPCA 5ICMA 4CM5A 4ESOA 2HRBA 2J5RA 3VH2A 4XQ9A 3PQFA 1KVQA 4H7PA 2NQ8A 3QWAA 5JMPA 4RORA 1B2LA 1V6AA 5A1TA 4YAIA 4DREA 3ULKA 2PZLA 4IJVA 4NJMA 4EZBA 1ZFNA 2NU9A 3D5TA 4TRNA 4PG8A 2IDZA 2OOSA 4CMBA 1FDUA 2JCXA 4YB8A 4LVCA 1LTHR 1QLHA 1HWYA 4J1QA 3MEQA 1VL0A 1ZO8A 2AQHA 1SZJG 4DVJA 5A03A 5JSFA 3NDJA 3VZSA 2CY0A 3DAFA 1Y1PA 1E6UA 3QA9A 2EKPA 3KV3O 2C20A 4AJOA 4GX0A 4CMCA 2C54A 3UVEA 4TVOA 5BT9A 1X7HA 4BGEA 3W4IA 1H2HA 1ONNA 4BNNA 4Z6KA 4E2ZA 2PA3A 1NAIA 4AJEA 2ZQYA 2LDXA 1NX6A 4K26A 3ZWXA 4J0FA 5IN5A 3PYXA 1KEWA 1T1RA 2HMWA 3TPCA 4XYLA 4CPDA 2X0RA 1XIVA 4YJDA 3FI9A 1J49A 4FFLA 2EGGA 3IS3A 3LT4A 4RF2A 3JQDA 5AXBA 1M6HA 1SB9A 3HE3A 1NFQA 1YB5A 4PGFA 3PTZA 1GZ4A 2GUGA 1D7OA 4YJHB 3WNQA 1H9AA 2Q99A 3EDMA 1R0KA 2DM6A 3WFIA 2W2KA 1HYEA 4NMHA 1B8UA 4M55A 4RF4A 3HB4X 3PLRA 2PKQP 1VKOA 3QVSA 4IMPA 2FPPA 5EERA 1I10A 3I9JA 4RVDA 1Y8QA 3DB2A 5A3JA 1B7GO 5TS3A 3UOGA 1V35A 2B4QA 1K6XA 5I9NA 4O59O 4N5NA 4P4LA 3RFXA 3JQ8B 2HRZA 4GVLA 4ROSA 4MVJD 5TX7A 2DKNA 2YDYA 4JCOA 4Z0HO 2RAFA 4LMPA 2GGSA 4I9NA 2HU2A 3CMCO 4KUEA 3HN7A 3ZWBA 1BW9B 4MINA 1PIWA 1ZXBA 2ZJ1A 3BZUA 4INAA 2BGKA 4GSLA 4L8VA 4QUKA 4FFRA 4F6LA 3ASVA 2GLXA 3ZV6A 3PEFA 3OP4A 2D8AA 4Z0PA 3S55A 2VUSA 3WSVA 2AW5A 3PGJA 4LMRA 2RHRA 4B79A 2G17A 4BL5A 3RFVA 3K2EA 2QRJA 4JJGA 4BNGA 3VDRA 1E7WA 4R54A 5COQA 2OXIA 2NVUA 2CSUA 3IQDB 1GD1O 1ZMTA 4WNIA 1NHGA 3QWFA 2W98A 4DPMA 1CERA 3ONDA 1JLLA 5JAMA 2BI8A 1W6UA 2NACA 3BTUA 1GZ6A 3GR6A 4MVJH 3ROQA 1GL3A 4J7UA 3GK3A 4FC7A 3E82A 2FR0A 4WECA 4BO8A 1LXCA 3C85A 4KDEA 3I4CA 4MKXA 4DLLA 1NVTA 3JQ9C 4DPLA 1QSGA 3WGQA 1T2EA 3H9EO 4S3MA 1ULUA 3QWBA 1FDVA 4ID9A 2W90A 3C8MA 1CWUA 1FDSA 3RU9A 4W99A 2VWGA 2WE8A 4OQZA 1FMCA 3OEYA 4OKNA 5BR7A 3GHHA 4HFRA 3BHMA 4M1QA 4Y9DA 4R69A 3DTYA 3PP8A 4GBJA 4TRRA 3K6JA 4AJ1A 4DRYA 4URFA 4YT4A 2VHZA 3H7AA 4OQYA 3PHJA 3QVOA 4XYBA 4RVHA 4J16A 2X9GA 5ILGA 1KVRA 2Y99A 4GLLA 4J1TA 4DQVA 1E6EA 4RPKA 3QQPA 3R6DA 4FFNA 3PYLA 1BDBA 2ET6A 3W8EA 4F6CA 2UUOA 3MZ0A 3DMTC 4E13A 4ZD6A 4RQTA 5DDIP 3ZV4A 4NBWA 3PWKA 4GPD1 3ETEA 2WD8A 2H6EA 1UDBA 1O5IA 1E3IA 4WCFB 3TJRA 1CYDA 1HE2A 2Y67A 1I33A 4NFYA 4XQCA 1I36A 3BHJA 4CV1A 1XA0A 1ONOA 2I99A 1NPTO 4YJFB 1L7DA 4BNUA 4NU6A 1Z7BA 1LC0A 3INRA 3PWZA 3C7CB 4PIVA 1JWAB 4J7XA 1E1NA 4IY1A 1KS9A 4AVYA 3W1VA 1PJBA 4NJOA 3KBOA 2WD7A 3GQVA 3O4RA 4RDHA 5CP8A 2NTJA 4IDDA 4MP8A 4B7UA 3ZHZA 3I9KA 4BO1A 4DMMA 1Z73A 2NU8A 1S6YA 3FNFA 1QORA 3AM5A 3OIGA 4BVAA 4D79A 1HDYA 3JD1A 5F3RA 3I9LA 1PL8A 4NI5A 5GMOA 2AHRA 3FRJA 2DPGA 3MOGA 1GV1A 1KY4A 3LT2A 4PVCA 4RO0A 4BOYA 3DBHA 1LSOA 3MJTA 4L75A 1Q7BA 2PNFA 3GVXA 2NSDA 4YRDA 1K89A 1SO8A 1E3WB 1WNTA 2I5PO 4I5EA 4EEZA 1DRUA 5ES3A 5JAQA 1I2CA 1U3WA 3G1UA 3L4SO 1Y7TA 3BMNB 1U2DA 1GUYA 1P1IA 3FBGA 1RYEA 2JD2A 5DBFA 4JBIA 4BIIA 5CG1A 3P2OA 3IUPA 2JJYA 1PZGA 3IMFA 1U7HA 4IDCA 1GQQA 3O8QA 1HRDA 4UVGA 1L7EA 5FWNA 2EP5A 4CUZA 1F06A 1FJHA 2Z95A 3X2FA 1Z7EA 2O3JA 4NBTA 4M49A 4H15A 4EUEA 1DIHA 3GZNB 4U6SA 3KSZO 1C1DA 1EVJA 4MJLA 5JBIA 1XU9A 2PWZA 3BAZA 1P9LA 4FQ8A 3UFXA 4E5NA 2P9EA 2BGLA 1E7YA 2AG8A 3AJRA 5COAA 5FI5A 2WDZA 4OH1A 1LEHA 2I76A 1A9ZA 2EWMA 4YAEA 4L74A 5FI3A 1PTJA 4IQ8A 2JD0A 3D3WB 3JQFA 2O3SA 2FOIA 3P2YA 3EYWA 5L53A 4YJHA 4EITA 2C59A 1KETA 3ST7A 3LLVA 4QSMA 4BUCA 1PEDA 4DTIA 2X0NA 5JDCA 2Q3EA 3M1LA 3AU9A 3SEFA 5BSEA 3HZZA 1ZZEA 3RUIA 4CQMD 3FBTA 3H5AA 3ETDA 1YJ8A 1I30A 2YHIB 1VSVA 4J0EA 1ENPA 2Q4BA 2NLOA 3V5NA 4FOSA 3RSHA 4IZHA 1Z6ZA 1ISIA 2VNSA 5EIOA 3ZV5A 4A27A 3L9XA 4GMFA 5I8WA 4JIGA 2OP1A 1DB3A 4RGBA 4J6FA 3H65A 4NIMA 4PLGA 3ZWNA 2DTDA 1P31A 1I3LA 3HADA 3PXXA 4N7RA 2O3UA 5L51A 4BHTA 2FMUA 4WASA 2OZPA 1R4MB 1T2DA 3D3WA 2BGMA 2AEMA 3RASA 3LDHA 3RBZA 3D4NA 4J91A 4P8RA 1A4UA 5CDYA 1HDXA 3AU8A 1Y9EA 4RV9A 2HDHA 3UKOA 4NJMB 1R16A 4E5KA 2DBZA 4TZKA 5B4UA 1PJ2A 1XYGA 2YFHA 5I9LA 3ENNA 4N18A 4AJKA 3T4XA 5TT1A 4N54A 1WP4A 3RD5A 4XJSA 4D45A 1BSVA 1X15A 3O38A 3OECA 4CLOB 4YR9A 5B1YA 3WLFA 2PKQO 1JDJA 1ZSYA 4Y8VA 1PQWA 2O50A 1HDZA 3L4BA 1ZBQA 3GOHA 1VJ0A 2GZ3A 2IE0A 3Q3CA 3R0IA 4CMKA 3FNEA 1DC4A 1R4NA 2X0IA 4J1SA 3LVFO 4D42A 5AQ1A 5IAAA 5EQDA 1VI2A 1N1GA 2P4HX 1W4ZA 4OMUA 2WJPA 2QQ5A 3GEMA 4JLWA 3DAPA 1ADGA 1C1DB 4IDEA 2H1SA 4CL8A 3AM4A 3R1IA 2DUUA 1DSSG 3LZ6A 4OXKA 4XQEA 3WMXA 1V3UA 3KLMX 1GZ3A 2XXJA 1M75A 2H5LA 2VTDA 5CDSA 3PJGA 1XHLA 1XLTA 3HDHA 5A05A 1KEPA 3FWNA 3HWRA 1PZFA 4E2XA 1FK8A 3IIEA 5I7EA 3ICCA 2JL1A 3QHAA 3B20A 4BNHA 1C0LA 1ML3A 1PWZA 4FCCA 2POQX 3AOEA 1TI7A 4UAGA 2P91A 4CUKA 3PVZA 4KQWA 3H3FA 2W2LD 1ADBA 1WZIA 4CM7A 2BFPA 1JKIA 5IDQA 1EQ2A 5B12A 2B5WA 1PWXA 1UDCA 1SNYA 3PK0A 5IXYA 1M66A 4Y6PA 5HBRA 2A35A 1XQ6A 1O6ZA 4FSHA 3HFSA 3PYMA 3OQBA 3U09A 3M2PA 4AL4A 2BD0A 1YDEA 4FN4A 2UUPA 4OO3A 1CQIA 3DBVO 1E3LA 1HTBA 4HX5A 1UP4A 4B4UA 2D2IA 1MUUA 1R15A 3CPSA 4IGFA 3JQAD 3RVDA 1N8KA 2E6UX 1E7QA 1N92A 3A4VA 1GCUA 1PJTA 2J3KA 4FPXA 4DIOA 4ZHSA 1PS0A 3BIOA 1GQ2A 3HN2A 1SOVA 3JQ8A 4BMVA 3KSDO 2NNLD 2BFAA 3VPXA 1LUAA 3B1KA 5EQFA 4R1TA 2FPGA 2X0JA 4Z9XA 5KJEA 4JXKA 4LSMA 3W8DA 1MFZA 2A4KA 2IXBA 3JSAA 2X58A 5KJCA 5L9AA 1O0SA 2O7SA 4M8SA 2RBEA 4LN1A 1X13A 1N7GA 2C7VA 3AUUA 4DWVA 1CDOA 1P1KA 4BO2A 3GLQA 1DLIA 5TJ9A 2HK7A 3R3SA 4JP3A 3ZH2A 4EJ0A 3KEQA 5IZCC 4IBOA 5FYDA 1DOHA 3OICA 2CDBA 3JD0A 1P33A 3LSYA 1LI4A 5ER9A 3RBVA 4BKRA 4ILKA 4IGEA 1U8FO 3QP9A 4ZQHA 4EJ6A 2P9CA 1OAAA 4I1IA 1EFKA 3GAZA 3UW3A 3PLNA 4FR5A 4ZJUA 1R6DA 1P0CA 3TZCA 3VDQA 5THQA 4BMSA 1CIVA 3QY9A 1RKXA 4CM4B 1WWKA 4K9DA 2FPIA 3HNPA 1AHIA 4ZRNA 2DT5A 5JDCC 4GX2A 5T67A 1NWHA 4OGWA 3HB5X 2PD4A 3PJFA 4FIZA 4CMIB 3OJLA 4YEDA 5DCUA 1QR6A 1DJQA 3UCXA 2EERA 4F45A 5HTOA 3G17A 5I7FA 3AI1A 4U7WA 4RVFA 4R9SA 5DT9A 3AUAA 1Y9AA 3KB6A 1I2ZA 2IEDA 2FN7A 4A0SA 5TIIA 2ZTLA 4ALMA 1YONA 3CEAA 1UAGA 3GPDG 1A7AA 4J3FA 4D3SA 2AEJA 1T24A 2Q2WA 4C7JA 1VM6A 1QG6A 4XR9A 5KVQA 2EF1A 1EUCA 1GADO 4CM4A 4Z9YA 1C3VA 2XAAA 5JNLA 1ONPA 1LX6A 3PPIA 1ZSVA 2B36A 3GH3A 1W8DA 3F1KA 3F4LA 3H9QA 2WYUA 3KUXA 3RUHA 1B3RA 1PL7A 1NPYA 2DVMA 4O1MA 2R6JA 4FS3A 5KVVA 3I23A 3FSRA 5HS6A 5KKAA 5AXAA 4FGSA 3RUCA 1DHTA 3I1JA 4ALNA 3CH6A 3DZBA 3D1LA 4NK5A 1BDMA 2RHCA 4MKRA 5MGBA 5TC4A 1DAOA 1H6CA 1UZLA 1CRWG 2QHXA 2AA3A 4OXNA 4Q3AA 3EW7A 1ZSNA 3OJOA 4XRGA 5BSGA 5G0VA 4KQXA 4PRKA 2D5AA 2GASA 1WMAA 3FN4A 3TOZA 1KC1A 3PHHA 4E21A 4PN3A 1EMDA 1PGQA 4NBRA 4AJLA 3RU7A 2X23A 1LU9A 3RJ5A 2A94A 3WBFA 4IPTA 2JCYA 4ZQGA 4BNJA 1I3MA 4GL4A 3IDSA 4Z3DA 3CTMA 3WX0A 5KIAA 4UUPA 4FJ2A 4GWGA 3ONFA 3VKVA 5JO0A 4WOJA 2GRAA 1LRLA 1BXZA 1UH5A 3V1UA 3GVHA 2PZMA 3S1LA 4D41A 5CPBA 1A27A 3EK2A 4UVHA 4J43A 2OGUA 5CPFA 3GEGA 1OC4A 2Y1DA 3P7MA 1YO6A 3LF2A 3DZJA 4YA6A 4BNMA 3HUDA 4NFSA 1ZCJA 2YHIA 2C29D 2AE1A 3AFMA 1PS9A 2BH9A 4IJWA 4IINA 1I2BA 1JVBA 4UVIA 2V65A 3KTDA 1NYTA 1ZMOA 4MO2A 3IJRA 3H3JA 2Y68A 4U5QA 3DONA 4WLVA 3EAGA 4JBHA 1GYPA 5DCYA 1IZ9A 3CIFA 2RH4A 2NTVA 2Y1FA 3GFBA 2ZB3A 2EJWA 2EHDA 1KOLA 4XYMA 5L4NA 1KC3A 1B15A 1X7GA 1YVEI 2CDCA 3KO8A 4BB6A 1X0VA 5A9TA 4A2CA 3AI3A 1ULSA 1EDOA 4I5GA 1O95A 2Y1GA 3TZ6A 2QRLA 5L7YA 3NDIA 2ZB7A 3CZMA 3VZQA 5IF3A 4TVBA 1NQAO 5CDGA 1ISMA 3IUSA 3Q9NA 3WGTA 2BLLA 4QO7A 4ZQBA 3SBOA 3EMKA 3EVTA 2PLAA 4LVUA 4NG5A 2GZ2A 2WYWA 2ZYGA 3KZVA 4ZN6A 3AWDA 1YQGA 1HYHA 1R0SA 2WTBA 3C24A 3OQ6A 3Q9UA 1N7HA 3S2FA 2UAGA 3GDFA 1XDWA 2V6FA 4CMAA 3K96A 2QRKA 1SOWA 3FPCA 2DBQA 4XQGA 3WJAA 1UR5A 5AVOA 4WOKA 2D1YA 1YL5A 2HO5A 4R51A 4D46A 3OA0A 3D4PA 1EFLA 3BMQB 1MXHA 3JYLA 4KP7A 5B37A 9LDBA 1EEHA 4QECA 5JS6A 1PQUA 2VT2A 3WYBA 3GRPA 4P38A 2F1KA 4RPJA 3VKUA 2HMSA 3DBHB 2Z1NA 2DTEA 4RJTA 2CF5A 2V6GA 3GVCA 1JAYA 2DUWA 3NT2A 5IZCA 1U8XX 1OC2A 3BTVA 1MFPA 4YQZA 4BO6A 1GTMA 5KOIA 3OJEA 3TNLA 2JFGA 3K31A 3L4BC 2YUTA 4BNFA 2JKVA 4KWHA 1AXGA 1E7MA 1T25A 1GEGA 3AUTA 1HDRA 3WYEA 4A7PA 1BVRA 2AQ8A 4PLPA 4RVSA 2AQKA 3JYPA 4M54A 1HE5A 1UP7A 1KVTA 2P68A 2AXQA 3M6IA 4MIEA 4B7CA 3B1JA 4DBVO 3L77A 2ILTA 3N7UA 4R5MA 4DIFA 4DXHA 4YWJA 4YJFA 2DBRA 4CLHA 1E3WA 1EBUA 1K5HA 2WE7A 3NT5A 3WICA 4OL9A 4J4TA 4PG4A 1JW9B 4RF5A 5CHEA 3GFGA 4IS2A 4KMSA 4RZHA 1JKJA 2C07A 4U6QA 8ADHA 2Y66A 4YQYA 4FDAA 4O6VA 3RQSA 1IY8A 4PRLA 5A02A 1KIFA 3GNQA 3PDUA 1LJ8A 1F0YA 1GEEA 3U4CA 3Q0EA 3GRKA 4HFJA 3ROPA 4ALKA 7ADHA 2GNAA 5ER6A 4B4WA 2X8LA 2X22A 4YT2A 4TZTA 4ZA2A 1GQYA 3U49A 1ARZA 4J49A 3IJPA 4WE3A 4AG3A 2I65A 1E7SA 2JHFA 3WB9A 3GVPA 3A28A 3IP3A 4AJJA 2JFHA 3QVTA 3ANNA 1R12A 1LSUA 2VQ3A 4PLHA 1JKFA 1HEUA 1LQUA 4XD2A 4ZVVA 3MTJA 3VPFA 3H9GA 3EY4A 1UUFA 3RKRA 5L4SA 4YJGA 1VPDA 1WMBA 3VVBA 5KJ6A 3KLPX 2PK3A 4XGNA 2Y0EA 3WQRA 4KTTE 2Q46A 1T2AA 4XB1A 1TA4A 2OO5A 3N74A 1P0FA 1SC6A 1YBMA 3ZN2A 1PJSA 4DUPA 1P1FA 4W7HA 2GO1A 5AXDA 1PR9A 4LSWA 3VAZA 1B14A 1O89A 2GYYA 4A03A 4BO5A 4TQGA 3A14A 1XR3A 3S2EA 4AJIA 3WS7A 3KRTA 4FJ0A 4B7XA 1UP6A 3PGXA 3JYQA 1RPNA 1XSEA 5DZSA 4L4XA 2ZYDA 3EVNA 3I83A 2VN8A 3NEPX 3H8VA 4WCFC 3T4EA 1EVYA 4IMRA 4ALLA 1W0CA 5CEEA 3STHA 4Z9FA 4MVJG 3F4BA 4PG5A 4MP6A 5T8KA 2NM0A 3M2TA 3ZNOA 3K5PA 1ADFA 2UYYA 1LDEA 1EK6A 3TZHA 5J23A 4U0KA 5K6AC 2VRBA 2VWQA 1ENZA 4XJTA 1T2FA 3VPGA 3GG9A 4GX1A 4E4YA 1GR0A 1PGOA 3Q11A 3JV7A 2HMUA 2P2SA 3ZWVA 1WDKA 3V2GA 2VRCD 1LSSA 2Y93A 1YKFA 3OSUA 5GZ1A 4CLDA 4OOFA 2PV7A 1FF9A 1KEVA 3GGOA 1A72A 3GUCA 1ADCA 3RCBA 3ZW8A 3L6EA 1MXFA 1PJ3A 4HNGA 2X6TA 3RUEA 1UXIA 2ZTVA 4CLOA 2WEKA 3AY6A 5DCWA 1YWGO 3E6AA 4BKUA 1X14A 4HWKA 4KUHA 5AYVA 1HSOA 3DZKA 4UVEA 1T26A 3OBBA 1B8PA 1ZIDA 1H6BA 5A9SA 2FZEA 3TF5A 4FOOA 4J9VA 1TLTA 3BHIA 1J5PA 5L45A 4GKBA 4N5LA 3H9JA 4FFMA 1ZK4A 1O8CA 2PGDA 4AJNA 4NH4A 1LDGA 2YV2A 4CM1A 1TT7A 3WGIA 3NX4A 3OQ1A 3VZRA 4XDZA 1DEHA 2HMTA 2YV1A 4MVJI 3D0OA 1JA9A 2B83A 4LRSB 3OIFA 3H6KA 1C14A 5TRTA 4B3JA 1WZEA 1MG5A 5KVCA 1XU7A 4QQRA 1DLJA 5KVSA 2VUTA 1LNQA 1PQPA 3IL2A 3L6OO 2GSDA 3HDYA 3EUWA 4WUVA 3VC7A 1SAYA 2O3RA 4E12A 3TOXA 5H81A 2NVWA 5JO9A 1BXGA 5L40A 4E5MA 5IJZA 4M87A 3DBLA 4PLCA 1HLPA 4LCJA 2ZJ0A 5T57A 5EJ2A 2I66A 3QWIA 3DHEA 4CUJA 1JQBA 1N2SA 5DBIA 1EE2A 2YHUA 1NBOA 1TB4A 1YOVA 3U4IA 3GHYA 4YAKA 3AOGA 3S8MA 1AGNA 1VSUA 3RFTA 4FFOA 2JAPA 1MC5A 5CFZA 3DC2A 3C1TA 2OBYA 1PU2A 1R66A 2G0TA 4S1VA 5G4KA 3TN7A 3JQGA 2VZ8A 1V3VA 2O3TA 5GY7A 1E5QA 4BKQA 2IODA 1ID1A 3P5SA 1F14A 2VYVA 2GN4A 2I67A 1ISFA 4IDAA 1GYRA 1J4AA 2FSVA 4EI2A 4OJNA 4OSPA 4A26A 1C1XB 4DIBA 2EW8A 3GG2A 4HUJA 1UXKA 3ETGA 3TQHA 5JMWA 1DFHA 1UJMA 3C1OA 3PRJA 1Q2XA 4QTZA 3I9NA 3H5RA 5JW6A 1NTOA 4CQLA 3UCEA 4L4SA 1O9BA 1Y8QB 1UXJA 1GY8A 2ZK7A 3IC5A 1O94A 1GYQA 3ZCXA 4JJFA 1DRVA 1F8FA 1XG5A 1HDCA 4PLWA 4IUYA 4RL6A 3TZKA 5HM8A 4NR0A 1ORRA 3JQGB 1AE1A 2OUIA 3DTTA 2EW2A 2YW9A 4Y67A 2C2YA 3K73O 1HETA 3A06A 1Y8RB 3WJ7A 2BHLA 3DHNA 3BMCB 3RBXA 4D43A 4EUHA 5K6AA 1XWFA 2PD6A 4CLRA 2R00C 3AY3A 2IRWA 1JVSA 4KOAA 1ZK0A 1RM0A 2BMAA 1SMKA 4HADA 3JYOA 2D5CA 1VJTA 1LRJA 3NTQA 5F1PA 4MIYA 4YCAA 4PG7A 2I6TA 3S2IA 3SC6A 3K92A 4ZRMA 4AFNA 1RM4A 2Q1SA 3DBRB 3PHLA 2C5AA 2AG5A 3E9MA 1F17A 5B4VA 1V8BA 2Q1TA 4AICA 1GDHA 1LDBA 4BMNA 2PZJA 3JQAB 5FF9A 2CMDA 2YYYA 3E9NA 4G81A 1R4MA 3G1TA 4PZEA 4CMGA 4EEXA 4IQGA 4R01A 2VUUA 5TSDA 1EUDA 1HT0A 3FPLA 1P1HA 4J1NA 3RUFA 2WD7B 3PQEA 5IN4A 4B3IA 1SEVA 3ZHYA 3NT4A 1Q7GA 3WIEA 3FHLA 3JQAA 5T5QA 3KETA 3ZWOA 2DTXA 3MWEB 3HSKA 3QIVA 4OM8A 1JAXA 2GD1O 4JX8A 1JU9A 3SC4A 2VZ9A 3ORFA 1HYGA 2O23A 4ND1A 2Q4EA 2OP0A 1XELA 2A9FA 3V2HA 1U4OA 5IDYA 4QT0A 5C7OO 3MOIA 1NPDA 3DO5A 1BMDA 1NVMB 5TT0A 1GFSA 3BMCA 3FR7A 2VZ0A 3WLEA 4GVXA 2HKIA 1TXGA 2BF7A 2YY7A 5G0TA 5H82A 4NDNE 1HLDA 2D4AA 1E92A 3BTSA 1QYWA 2J5QA 3KYCA 4CV3A 3DHYA 2NV6A 3QVWA 3RKUA 4DLBA 1VLLA 3IOYA 2TMDA 4J9UE 4CLEA 4CMEA 4PZDA 3E5RA 5G0WA 3C7AA 5DN9A 2YFQA 3D7LA 3FF4A 4ZU3A 4EW6A 2HQ1A 3DMTA 5ILOA 2R2GA 5CDTA 5LCXA 3D5QA 4RQUA 4BNTA 2EG9A 1DDOA 1AN9A 4IIUA 5I7SA 2CNBA 4R3WA 2PH3A 4NPCA 2LDBA 2FRDA 1X1TA 3WGYA 4D3DA 1KVUA 2PGJA 1IPFA 5MDHA 5IG2A 5A5EA 2FWMX 4BO9A 3U5TA 2X9NA 2VT3A 1X0XA 1ZVMA 4FW8A 5L95A 2OL4A 1XQ1A 2PZKA 5C37A 4HXYA 3OA2A 3F46A 2AQIA 4XX0A 5C7LO 5TNXA 1VL8A 2DBVO 2GN6A 1H0KA 1RJWA 1B16A 1U2GA 2PR2A 5KKCA 3PQDA 1QP8A 3CKYA 4XIJA 4GWKA 1ZJYA 3LK7A 3TFOA 4D44A 1HZZA 3LC2O 4QX6A 1DC5A 3I6QA 2VOEA 4J2HA 2C7GA 3INGA 3RC2A 3TZQA 1YDWA 4A73A 4FB5A 4YAGA 1QYXA 3AOEC 4XGIA 2PTGA 4AJ2A 5B4TA 3ANLA 1FXSA 3QSGA 3SVTA 3I3OA 4TKLA 3RAJA 1XCBA 4IDBA 4A5OA 1OI7A 4XIYA 3LT1A 3ENKA 3AY7A 3OHSX 1T4BA 5DOVA 6LDHA 5JAZA 1UAYA 1Z74A 3KYDA 4I5FA 4W4TA 4F3YA 1QYVA 2GR9A 4P4NA 3ZNNA 1LBEA 3WFJA 3JQBC 1ZK1A 1E7RA 3GAFA 4GLOA 2EIHA 3VPHA 4Z3KA 2QW8A 4GI2A 4KTVE 5JY6A 1DPGA 3ITKA 1KY5A 3VVCA 1PJ4A 1QV7A 3WBBA 1Z82A 1P77A 5GZ3A 3ZU4A 2RCYA 3ZWCA 1TEHA 1R4NB 1ZUD1 2J8ZA 5U1PA 4R5HA 3RIHA 3FD8A 3E9QA 3ASUA 3VH3A 4GX5A 3HDQA 1GPJA 1ZJZA 3LC1O 4L0QA 2VNAA 1S7CA 5G0SA 4D7AA 1K0UA 5K9ZA 2VTEA 2DLDA 2VYND 1WPQA 3JQ9A 2FSSA 2OHXA 4GAEA 4LGVA 3QJ5A 4D0RA 3UAGA 5AOVA 4OAQA 4MPDA 4ZQEA 4I5DA 2BKAA 3U4DA 4BGVA 2Y1OA 1E0DA 3PZBA 4RPLA 1KERA 3MCVA 3WMWA 3OF2A 4NZ9A 4HY3A 1N9GA 1NFFA 2HSDA 2QZ9A 3JQ7A 3PIDA 3UICA 2O2YA 3JD4A 3EZYA 4NQZA 4D3FA 5JYEA 1VRWA 2W8ZA 1X1EA 4BS9A 2BELA 4K28A 4TRMA 3G79A 4XA8A 1BVUA 4WLEA 1QKIA 1WXDA 3FTNA 1VKNA 1WVGA 1EDZA 1AUPA 4OXYA 3MJEA 4R16A 1YBAA 2GPTA 2WYVA 3NRCA 2ZB8A 2E48A 5C5IA 1IL0A 1CEQA 2PFGA 3D4OA 1Y5RA 3GA0A 4MVJE 2CVZA 4PCVA 3RC1A 4CM8B 2JCVA 4FJ1A 2O4UX 5EN4A 5BNFA 1A5ZA 1G0OA 2NVUB 3W4KA 2J3IA 1HXHA 3AI2A 2HCTA 1QV6A 3HG7A 1MB4A 3CE6A 4B3HA 4IIVA 3ZWYA 4RPGA 4A10A 3NUGA 1IHYA 1ISGA 5KJFA 2CF6A 1VJ1A 1DC6A 4XR4A 1CF2O 3ZZNA 1P44A 2BFOA 4EBFA 2X1HA 4MIOA 1RM5A 1H6DA 3UXYA 4BNVA 2QYSA 1WDLA 5GZ6A 5JE8A 1U7TA 3BTOA 1ISHA 2Y1EA 1BTOA 5I7VA 1BW9A 1YRLA 4II2A 4K6CA 1P74A 4DYVA 3H5NA 1IYZA 4Y6SA 4MKZA 1EBFA 3JYNA 3NGXA 4AJ4A 1YQXA 5BSFA 1IHXA 3KEOA 3ZU3A 4CV0A 3MWDB 4E2WA 5A3VA 3G3EA 2UV8A 4NU5A 2NWQA 3V1TC 4FC6A 4II3A 4CQLB 1U4SA 2B4RO 3BMQA 1U5AA 3I6IA 2BRUA 1BWSA 4L73A 3T7EA 1IULA 3VH4A 3RC7A 1NQTA 4KZPA 3U0BA 4HBGA 1NR7A 4HNHA 2RH8A 2VHYA 3JD2A 2XF8A 3OMLA 3DOJA 2R00A 5G2OA 1IE3A 1MLDA 3ZW9A 4IM7A 3GN1A 2J5KA 2EXXA 1UZMA 1A7KA 3Q1LA 3ZGYA 1A4IA 4MVJA 3ZHXA 5A9RA 3ZWAA 1Q0LA 4K6FA 4HV4A 3VOSA 5U9CA 4WEOA 1U28A 2GF2A 3DXFA 1G1AA 3EHEA 3OETA 1YOVB 3QVXA 3CUKA 3WSWA 1I8TA 4RDIA 2PGLA 4MDHA 3WXBA 4UUNA 4BGUA 1ZH8A 1F8GA 2PKRA 1K6IA 2HLPA 1JN0A 3NAQA 5F5LA 4BNWA 2WSBA 1U3UA 3CINA 5G4LA 1PJLA 3GN2A 3R3JA 4MVJP 3DDNA 4ZICA 2O3QA 4LISA 3W6ZA 4IJKA 3OJ0A 4IS3A 3HJAA 3RC9A 1ISJA 2TMGA 1PJQA 5EMHA 4R41A 1PSDA 1GV0A 4BNZA 5KNLA 4UEKA 1P3DA 4ND4A 2OBNA 4W6ZA 1LQTA 4XYGA 1R37A 2D0IA 4UULA 3ZWPA 4RVGA 1GU7A 4I8XA 1GPDG 1T2CA 4W7IA 1V0JA 3OEWA 4JQCA 1QLJA 5L4LA 3P19A 1AXEA 1I24A 1SBYA 2D3TA 3DFZA 3GNSA 3LU1A 4UUOA 4TKMA 3ZWMA 4CODB 5A9SB 3GDGA 4GQAA 4E33A 3RI3A 2Q49A 1MGOA 3EGOA 4ND3A 1DAPA 1DC3A 3E48A 2UVDA 1UZNA 4DLAA 2JAHA 2NU6A 1PJCA 1ZK3A 4RZIA 4DPKA 1X7DA 3V1YA 4CV2A 1Y5MA 5THKA 1KYQA 3TDKA 4JP2A 5I8ZA 5ADHA 2X5KO 1D3AA 1WAMA 3DR3A 3NYWA 4OSOA 2OORA 3WGZA 4PLTA 3HQ4O 6ADHA 4HFNA 1HDOA 3IAHA 1HE4A 4EGFA 3KSUA 5KWEA 1YH3A 4XCVA 1LLUA 5JY1A 2PH5A 4GKVA 1PZHA 3ZNPA 4CR6A 5BSHA 1WLYA 4RVUA 4O0LA 1YB4A 4BKOA 4XKJA 2BFMA 1E5LA 1VC2A 2CUKA 2ZATA 1K6JA 1NQOA 1TVEA 4CM8A 5IFLA 1NASA 1Q7CA 3UN1A 4E3ZA 3KOUA 5JYDA 1NR1A 3K30A 2C2XA 1FDTA 3FR8A 4ALJA 2IYPA 1LLQA 3H2ZA 1P1JA 3PFFA 5G4KB 3B6ZA 4YRBA 2P5YA 1B26A 4AJHA 1OBFO 1ZKMA 5U4QA 4RPHA 3WQQA 4U0JA 4W9NC 3DWFA 4PVDA 3PJDA 1D4FA 3I9MA 4NBVA 5HRUA 2ZB4A 2I9PA 1Z75A 1A9YA 4MP3A 4DQUA 4CQMB 1N9GB 3U9LA 3K8ZA 1E1LA 4BNXA 2AEFA 3WGHA 4X54A 4PLZA 4EUFA 4JK3A 3SXPA 2VOJA 2VWPA 3PHGA 1OZAA 2YQ4A 4O63O 3WDSA 2G82A 1U3VA 3LC7O 5HS4A 1HDGO 1NP3A 2Q50A 2VHXA 3RROA 2WWRA 2V6MA 4YAJA 5A4DA 3G0OA 3WIDA 2ZTMA 4QFCA 1W73A 4XRRA 2BI7A 2FR1A 2J6IA 1T1SA 4CMIA 4GH5A 7MDHA 1DFGA 1YGYA 3DZHA 2IYOA 3LLSA 5KJ1A 1DIBA 2WMDA 4J4HA 4PLFA 3D64A 3BMOB 3UGKA 4BO0A 1YXMA 2EEZA 3K2BA 5CAEA 1YBVA 1TT5B 2HMVA 5BNIA 3GY0A 2ZCUA 4WKGA 3INTA 3C7DB 3ITDA 5L7WA 3U3XA 3GDOA 4GSKA 3ZV3A 1DFIA 2DU8A 3EC7A 4RF3A 3NJ8A 1YB1A 4IDGA 4I08A 3UUWA 3IP1A 4RLHA 1TT5A 3B1FA 3GGGA 3SJUA 3W6UA 3KYCB 2FP4A 1LLCA 2Q2QA 1CETA 3ADOA 1HKUA 3QV1A 4FD3A 5TF4A 1MC4A 4ND5A 4EJMA 5TJHA 1NM5A 4UVDA 2H63A 3I4FA 3KHUA 5ITVA 1YE3A 3SX2A 4R1NA 3ZU2A 1Q0QA 3B70A 4OOEA 1LSJA 4R4JA 3OM9A 1XGKA 3PIIA 3OIDA 4JROA 5T6BA 3WQSB 4UREA 4GGPA 4PG6A 5F1KA 1HL3A 4H16A 1XKQA 5ENVA 1RWBA 1H6AA 4BB5A 2P4QA 4OHUA 4ALIA 1I01A 5FFFA 2O2SA 3DAGA 4Q3NA 1DIRA 3PWSA 4K1LA 4LK3A 2AMFA 1GUFA 1ZW1A 4HKTA 3ROKA 2FZWA 3FCOA 1F12A 3NKLA 4PLYA 4ZGWA 1DO8A 2A92A 3WR5A 4IXWA 5EPOA 3U62A 9LDTA 3W4JA 2B35A 2X5OA 4CMJA 1U5CA 1NHWA 3DBRA 3F6YA 5KTKA 2NUAA 1J6UA 1C0KA 2OFPA 3KM0A 5K0ZA 2HK9A 2P5UA 1U1IA 1YS4A 2GN8A 1UXHA 3DQPA 4CM9D 3CMMA 3GMSA 5JLAA 5JC1A 5IDXA 4LW8A 4Y98A 3JQEA 4QEDA 1Y8RA 4R1UA 5JPIA 4TWRA 1EZ4A 1K3TA 1EUZA 1P45A 4IXTA 1I3NA 1WDMA 1E3SA 4CM3A 1L1FA 3BXXA 3ICPA 3WWZA 4J2OA 4WPGA 4D0SA 1U3TA 2Y0DA 3MJVA 5I9MA 1ENYA 4PLVA 4Z0TA 4DMLA 4YDRA 5TGDA 4KWIA 3VTFA 3NV9A 2O7QA 3RWBA 2RIRA 1OFGA 1PS8A 2EKQA 3FTPA 4Q3EA 1V3TA 3DZGA 4O5OA 1G6KA 5ICSA 3E5MA 1IOLA 1C1XA 4E2YA 2Q45A 2EP7A 2V6BA 1Z45A 4YBZA 2B0JA 4LRTB 4TMFA 4YT8A 2VHWA 1E77A 4E30A 4UEJA 4CMHA 4R68A 3ROMA 1LC3A 1QRRA 2CDAA 3GC6A 4OKIA 1ZK2A 3UH1A 5DULA 3KYBA 3PHIA 2AE2A 1J0XO 1Q1NA 5DBGA 5CEJA 1ZEJA 3F9IA 4M89A 4G65A 1H2BA 2UDPA 1M2WA 2H9IA 5LDHA 1KVSA 4L76A 3JQFC 3LT0A 1M67A 4Q3BA 1Q0HA 5C7IO 4E32A 5IDWA 4OYRA 3H4VA 3KVOA 5IXSA 5JCJA 2DPHA 3DFUA 5T64A 1HZJA 5JFOA 2O48X 4WEQA 3WWYA 5IZ4A 3GF4A 4BO4A 1EQUA 4XWYA 3WGOA 3C1AA 4MVJF 3F5QA 5CDUA 4WLNA 1SPXA 3IKTA 1BG6A 2J3JA 4XZ3A 1R0LA 3F5SA 4W9NA 2ZTUA 3V8BA 4U8GA 1PL6A 4BQRA 1PR3A 3TSCA 3PZRA 3ONEA 4BNLA 5A04A 4Q9NA 1ENOA 3IKVA 4E5PA 1HF3A 5JDIC 1MP0A 2HJSA 2GCGA 3JCZA 5DF1A 3ZI0A 4TSKA 4DYDA 1KBZA 3GGPA 5ENDA 2B5VA 4OIMA 4WNCA 3C3XA 3KXDA 3WTCA 3ZWWA 3CZRA 3LYLA 4JJIA 4YRAA 3W8FA 3DMYA 2O4CA 1NVGA 1JTVA 1SB8A 1MV8A 2VYVD 2F00A 2I3GA 4DBZA 1SEPA 2G5CA 4CMEC 3X2EA 4BQPA 2C82A 4IQ0A 5JXWA 4AJPA 2FHSA 1PGPA 4GGOA 3MJSA 4LCEA 3L9WA 4L9RA 4UUMA 4QXMA 5AXCA 3N58A 4JGBA 2XXBA 5HA5A 4BNKA 4YT5A 5LC1A 3WG9A 3M1AA 3PJEA 2QIOA 4BV9A 2Q1WA 2C0CA 2G76A 3EZLA 1E1MA 1VL6A 1ZXLA 3NDRA 5JDIA 4YYZA 1I0ZA 2E82A 3E8XA 4EDFA 5CEFA 4E0BA 1Y6JA 1BGVA 2GERA 1MA0A 3OH8A 4R9RA 3RJ9A 3WGGA 3JQ6A 1IPEA 2Y1CA 5G0UA 3VHRA 4J4BA 3GZNA 3ZU5A 1E3EA 2G1UA 3WTBA 1IUKA 1QXSA 3DBLB 4IJUA 1B0AA 5KCZA 2CVQA 2VYNA 3L07A 1G0NA 3TRIA 1K2WA 1EK5A 1SCUA 2HJRA 2E37A 1YQDA 1Y81A 3GUYA 3O8QB 1A71A 3L6DA 4I9UA 2HK8A 3SLKA 2QZZA 2C5EA 2DC1A 3E03A 1B8VA 4CL3A 1H9BA 4XEHA 4GMGA 4PZCA 3E18A 4HFMA 2X86A 4KDFA 4P4GA 1ZEMA 2IZ1A 3ZHBA 4H3VA 4RCVA 1H93A 5DNAA 1GCOA 4RLSA 3DZIA 4UEOA 2YQ5A 3JTMA 4DA9A 2V7PA 3VZPA 4DL9A 2HAEA 2NQTA 1PX0A 5L3ZA 1N1EA 4L4RA 1YL7A 2ZYAA 3FNHA 3LF1A 1JWBB 2GN9A 1NXQA 3AW9A 4B8ZA 3U4HA 5ITWA 4ND2A 4FGWA 2NVBA 3L0DA 4C7KA 1BXGB 4TRJA 2ZKLA 1YL6A 3TFQA 5BNTA 4XYEA 3NTOA 2ZCVA 5A06A 1U9JA 2ZIZA 2EJVA 4E31A 1DIGA 3Q2IA 3QLJA 2E4AA 4N5MA 1NFRA 1FDWA 3BYZA 4NHEA 1LDMA 1UXGA 3QRWA 4F46A 2HUNA 5JCJD 3G49A 5JAIA 2ZQZA 3ZDFA 4XGKA 2J3HA 5CG2A 1DRWA 1IB6A 1YJQA 2CFCA 4YACA 4JNKA 1XEAA 3AFNA 3GMDA 5TQVA 1IZ0A 4KUGA 4WK6A 3RUDA 1C0IA 3VPSA 4J90A 2CD9A 4CJXA 3SJ7A 1D8AA 1BHSA 3NJ4A 2IEBA 2EKLA 3BMOA 3FWZA 4JBGA 2E49A 4MVJM 1H94A 3KYDB 1QYDA 1E1KA 4NNJA 1RYDA 2VWHA 1DXYA 1MX3A 3D3EA 3T7CA 1DJNA 3WNVA 3PI7A 3CSDA 1HE3A 1DIAA 2QG4A 4P22A 3TWOA 1DHRA 3E1KA 4C4OA 1GUZA 1B3BA 2CVOA 4WGGA 2X5JO 3DOCA 2YJZA 3BMNA 3GPIA 5DP1A 1OOEA 3DL2A 4J7CA 3TL3A 4QFDA 4CQMA 2Q1UA 1QYCA 4W82A 1T4DA 3JD3A 4Q3CA 4YXFA 1NAHA 4DC0A 4YVFA 3VTZA 2PY6A 1LA2A 3UHAA 5EESA 1CQJA 2PD3A 3NTRA 1EVIA 4R1SA 5A5FA 1EVZA 4WJZA 4YPOA 1LDNA 1LLDA 4G5HA 4YTEA 5EL0A 3GEDA 5JCXA 3DZFA 3O03A 3FNGA 3OJFA 3WOHA 3GZ4A 2IXAA 5TLSA 4BNIA 3COSA 5F5NA 3Q6IA 5L7TA 2B37A 2D59A 3DOOA 4M86A 4B8WA 4Y6RA 4HP8A 1BRMA 4WLOA 3JQCA 1D1TA 3LQFA 3JQ7B 5LDGA 4EYEA 3MTGA 3QWHA 2VRCA 1I5RA 2GDZA 3ADPA 8LDHA 2EGHA 3PDJA 4WCFA 4CM6A 1H5QA 1UDAA 1GAEO 3JQBA 2JD1A 2YZ7A 1WW8A 3O26A 1PZEA 3TL2A 3ON5A 4WLUA 3GNTA 2Y0CA 3AK4A 5C3MA 3F3SA 5DP2A 1MG0A 2IZ0A 4Q3DA 4YJGB 3I52A 1RM3A 3A1NA 3ABIA 4QO8A 4B4VA 4BV8A 3RUAA 4ZQFA 3H9UA 2QX7A 3A9WA 4NBUA 4DC1A 2B4TO 2DFVA 2SCUA 4G2NA 2JFFA 3ANMA 1NNUA 3AM3A 1NWCA 2DAPA 1LDYA 3GVIA 1D1SA 3I9OA 3OFSA 1E6WA 3F47A 1PGJA 5H83A 2NU7A 1EE9A 2QYTA 3HFGA 1BXKA 1M76A 2XOXA 5EINA 4ONEA 2DFDA 3SLGA 2GZ1A 4BKPA 2W4QA 1HSZA 3MJ4A 2VCYA 4XDYA 4NK4A 4DGSA 1CJCA 4MOWA 1LRKA 3O9ZA 3Q2KA 5COBA 3H2SA 4JN6B 5F1OA 1V9LA 4DQXA 4E6PA 3GT0A 1AHHA 2FR8A 4BNYA 1VE9A 4XB2A 2EV9A 2DQ4A 1N5DA 2X7HA 4CM9A 5T8KC 5JC8A 2X9VA 4PFJA 4WCDA 4CR7A 4IDFA 1KEUA 2IZZA 4R3NA 5DOZA 1QMGA 5BQFA 5FEUA 2OMEA 3DEYX 3F1LA 1M6WA 1PGNA 4WLFA 4NFHA 1ZNQO 2Z5LA 1DBVO 2VHVA 4Q39A 5F21A 4E5YA 2Z1MA 1I32A 1C0PA 1E3JA 3V2UA 4BGIA 2P9GA 3QW2A 2NTNA 4B4OA 3AUSA 2I3AA 2YV3A 3HDJA 4BO3A 1OMOA 2WM3A 4CLXA 1P1RA 4ITUA 4TROA 2JHGA 1I3KA 3WYCA 4BO7A 2X4GA 2W2LA 3BA1A 2Q2VA 2NADA 4CLRB 2FY8A 3NGLA 3ZNQA 3QE3A 3HHPA 2Y05A 2CZCA 2W2KB 2B69A 4FFPA 4FBGA 5HWSA 3S2GA 3VH1A
chains in the Genus database with same CATH superfamily
1NJ8A 1L4GA 2VPTA 3PFWO 3UF0A 4O4LA 4M1OA 1RZRD 3P4XA 2GAJA 3DEHA 3UCFA 4NMLA 2O8EA 3QEOA 1YJBA 4FYHA 1PBTA 4TTQA 2MU1A 4W5QA 3AF2A 3JASB 2XPCA 5JCOC 4HGYA 5ICMA 1KARA 4FOPA 1TF2A 2A5DA 6YASA 1U7ZA 5BW4A 2J5RA 1LV7A 4XQ9A 1OWNA 5EJ5A 4H7PA 3QWAA 1SKAA 4PC7A 4H9GA 3TTVA 4YAIA 1OWMA 2FZ4A 5DBOA 1O57A 1SBTA 5CT8A 4GOND 3BKWA 2NU9A 1IJEA 4NPHA 4Q1CA 4EY5A 3RFUA 5GJBA 1IWOA 2ZUBA 1AJEA 1BHJA 3BGWA 3WO1A 4RD0A 1GJRA 2WFZA 4P81A 2JCXA 2G7ZA 3E7WA 4LVCA 1QLHA 4HEJA 5CVVA 5JVDA 5LU8A 3MEQA 1VL0A 5J59A 5IHXA 1BKDR 4IEFB 3MQ4A 4BE4A 1K9SA 3DAFA 3HU5A 4N7BA 1VPEA 1E6UA 4I2NA 4W5JA 2ZG6A 3T38A 3FIJA 1SK9A 3E7PA 4N0QA 1JQLB 1P75A 1XRMA 3E0QA 1TZCA 2RI0A 2XVXA 4TVOA 5BT9A 4UD6A 4JI0B 1FP6A 2IYEA 3W4IA 2HHJA 3P9CA 4J0KA 1XXHA 2PA3A 3ZY3A 4DA8A 2ZQYA 2GBFA 2IT1A 3MT0A 3ONNA 4GI1A 2WJ3A 4HQFA 1BKSB 1CCWA 4G8CA 4K26A 2FPSA 4NE7A 3PYXA 2ZAYA 2J3EA 2OLKA 3DHWC 1U04A 3UJBA 3O8RA 1S2DA 3M1IA 3MWKA 4RACA 4CPDA 3H3XA 3HCAA 2YIVX 4YGXB 3HYNA 3GLFA 1WXQA 3VR4H 3UC9A 2GM4A 3V4ZA 1ZAYA 3M6VA 3RTCA 5AXBA 3PNQA 3R75A 3WLHA 1SB9A 4LYAA 1C7JA 1USWA 1NFQA 1WXWA 2XQKA 4MS3B 3FVQA 2GUGA 5T4EA 3FM9A 1DCFA 1RXEA 2GPNA 2CK3D 1H9AA 2JAQA 1Y82A 2Q99A 3DNFA 2D1TA 3EDMA 3NHZA 1OXVA 4X3OA 5LQJA 2DM6A 1CYEA 4NMHA 1G3UA 3PFNA 1RQGA 5AKGA 1C9DB 3GRYA 4P7FA 4UFNA 5EERA 1YFJA 2F6RA 3T3GA 2I7TA 3BWYA 4ESEA 1V1RA 1ZD2P 5TS3A 5I9NA 2SHKA 1TMYA 2O8BA 3CR8A 3SYNA 4P4LA 2WWTA 3AX6A 3MUFA 5LR6A 4ROSA 3ZY5A 3DF9A 4MWDA 1C4WA 1GTL1 1HK7A 4MVJD 1SQ6A 2YDYA 4HNAA 5K3DA 2RAFA 3WI7A 2GGSA 4WBNF 3LPCA 3RGGA 4ATNA 5AM5A 4IIBA 4UBOA 2WKWA 2O6HA 1DUIA 4JT8A 5SY4A 3KQLA 1YR7A 4FP9A 4S1NA 3A1UA 2BGKA 1RQLA 3KSBC 4QUKA 1R0XA 4ZDKA 2VP3A 4OBEA 3ZV6A 1M9NA 1ZOPA 3A0RB 5IC5A 4QDXA 3RHZA 1GSHA 1UBLS 1VA5A 1E20A 1WU8A 3L01A 1YDGA 5BSUA 3LG2A 3KT8A 2AW5A 1YUBA 3PGJA 4LMRA 2RGXA 4PQYA 5MFPA 3P94A 3TLEA 2G17A 4BL5A 4ZI2A 2FN9A 3AKCA 1CUVA 1AB6A 2P78A 2QRJA 3K2EA 3N1UA 3LUFA 1BEEA 1Q0ZA 2E5FA 4LYYA 4MGHA 1GD1O 4IZ6A 4CDRA 2W98A 1RR6A 2AXPA 1CERA 2QVZX 2YJ4A 3EQ9A 3VGJA 5KOHA 3T7JA 5E6SB 2BI8A 2OCGA 2K7FA 3NHSA 1W6UA 3AEYA 1F2TA 2Q7OE 3BTUA 1GZ6A 1GL3A 2PUCA 3GK3A 3NBXX 3Q3IA 4FC7A 4A8PA 2F2TA 2PVCA 4LJKA 3D6HA 1I0LA 1OQAA 4TTSA 4WECA 5DHTA 1LXCA 3Q12A 3V97A 3I4CA 1VPVA 5CA0B 1I6WA 2F90A 4PC3A 5DGTA 1SVWA 3ESAA 2CFSA 1QSGA 3F6PA 4DPLA 4XWWA 1SXJE 1VZ3A 1T2EA 3MUEA 4AF7A 1RRGA 3EEOA 3E84A 4Q1BA 4EO9A 3ZI4A 3FMVA 3C8MA 3RLFA 3U3RA 1JYFA 5HZMA 4LNUA 4OKNA 1PVVA 4FMCF 4FSDA 2ZYIA 4LQCA 3ZU6A 4CI0B 4EHKA 4M1QA 4LF8B 4NG4A 2J31A 4YHBA 3SI7A 2O2EA 1OFIA 1B0ZA 1OAOA 3JX9A 1X42A 4QHTA 3RANA 3REGA 1EHCA 2ANCA 4XDHA 4AIIA 3HWSA 4YNBA 2D2EA 5DWQA 5EZYF 1EYZA 4JOBA 5FBHA 4XYBA 4C6TA 5CFLA 2H52A 4RVHA 3FYTA 1JJ7A 4O2RA 3WWDA 3ZK9A 5AVYA 1P62B 2BM8A 1IOWA 3PYLA 2ET6A 1T0BA 2GBIA 4LRXA 2JH3A 4P33A 4ZT3A 4ZD6A 2ZDHA 2ZRHA 4UHKA 1AG9A 4X1IA 3ZQKA 2CCGA 1MENA 1P9WA 2H6EA 1JKJB 2H2DA 3U4MA 4QASA 4BJHB 4YUWA 2OKGA 1G6Q1 3LTNC 1CJSA 1CIJA 4Q9LA 1N75A 3RSZA 1NJFA 1I33A 1O87A 4CV1A 1EX1A 1U1EA 4G4SP 4TTPA 1UEJA 2BTEA 1LC0A 3INRA 1SXHA 5AW0A 4RHFA 3K2IA 3C7CB 4M99A 2YY6A 1XZ8A 3MJDA 1E1NA 1VYUA 4HAWA 4X95A 2AD1A 5EWLA 4AVYA 4CG2A 3NRBA 4E08A 1RHUA 2A9JA 2I3ZA 3QBEA 4IHJB 2D62A 2XNCA 3GQVA 1KYZA 5IAGA 5C8DA 2EWVA 3FHOA 5CP8A 3IUYA 3GEPA 4R8SA 1IHPA 5D6OA 1UWCA 5K3AA 3FCYA 3FYHA 3EULA 5LVAA 1N2CE 1K5PA 1JS1X 4MHOA 1S6YA 3DBIA 1J2TA 1E96A 1QORA 2WFLB 3FPFA 4G0XA 3SSMA 5FORA 2G4CA 2IP4A 1M7HA 3I9LA 4EF5A 2NO0A 2JKYA 4NI5A 4LQDA 3ZE8A 2DPGA 5LZ8A 1AKQA 2GBLC 4BEWA 5CB4B 1R6BX 2JGIA 3MJTA 4L75A 4OHOA 1UK6A 1XLWA 2PNFA 3W3AD 5ALGA 2Q3JA 4YRDA 3ZY6A 4DC9A 3INNA 1L7AA 4RZUA 2F59A 2FUCA 4I5EA 2WT4A 1JHXA 4LI3X 3CYFA 3V3TA 3H0KA 3BMNB 3T61A 4RPIA 4D9HA 1XRSB 2X4IA 3IAXA 1GUYA 1BQ4A 2X7JA 3G2IA 3HR8A 3OVMA 4TVKA 5DNCA 1RYEA 1YU9A 3K09A 5HIIA 4E2FA 2QRVA 4REQB 2YOHA 4BIIA 3P2OA 2C9MA 4Q9JA 3KU1A 1RI3A 2HCFA 3RSGA 4I1RA 1I4LD 3AUKA 2HT6A 3NBUA 3COZA 3DTVD 2FDRA 1L7EA 4IIXA 5A71A 3U19A 2GDJA 2INGX 5A7GA 4UPEA 3QGMA 1U94A 1AKRA 3JW8A 5LD2C 4C4XA 3CB2A 1FW6A 3GOQA 1IN1A 1GVNB 1TUIA 2O3JA 2Q4OA 1S9HA 4M49A 4QQNA 2QQFA 2I62A 4AY6A 2ZAOA 2C61A 3GZNB 2IBMA 4YRCA 4C4ZA 1EVJA 4P7KA 3OY2A 3UFXA 3VPAA 1JIVA 3EVAA 1SD1A 3TR0A 4Y2RA 3EQZA 5COAA 1WOMA 1W52X 3TUJC 3CIOA 4CCWA 2IS1A 2NP7A 3NBZC 1W2GA 1ZHFA 1TZBA 1VECA 1Z4OA 4H18A 4QYXA 5FI3A 2X2FA 1P6UA 4QOIA 4RWEA 4FYWA 1PFKA 3EYWA 3OU2A 1DJOA 1KETA 3G6WA 3LLVA 4QSMA 4B0OA 2P2YA 1Y3DE 4LJ7A 1PEDA 4RH1A 4MR8B 4DTIA 1JDUA 2FE4A 1WXFA 1YZLA 2X6RA 2W2PA 1S2MA 4G5QA 5BSEA 5ELXA 3HZZA 1ZZEA 2R7LA 3D02A 1JG2A 3RUIA 4CQMD 4TKVA 5JUWA 1VYHA 3FBTA 4TX1A 4RTRA 1XQWA 1YR2A 4QNRA 2JLAA 4EELA 2WSSD 3OD5A 1T34A 4DLTA 4EARA 1YJ8A 1H8HD 1I30A 2HT1A 5BVGB 3JWHA 1VSVA 3GEHA 3WJ1A 2CGEA 4M1ZA 2IC5A 1BIFA 1P7PA 4J0EA 1GAXA 2GS9A 4DLSA 3PDHA 1ISIA 1UWVA 2VNSA 5EIOA 4A27A 1ABBA 3L9XA 3LI2A 2CL6X 2VDVE 2R11A 3DEZA 2CE7A 1DB3A 3KQMA 1WNFA 2HJVA 1KH3A 1HO3A 4M1EA 1Z34A 1J1UA 4QSHA 6REQA 5JH7B 4N7RA 4M76B 9GPBA 5A4IS 2FMUA 2X8JB 1EVEA 3KQQA 1O0CA 2ZS8A 3TB4A 1L4YA 3OPVA 3CZ4A 4RJIA 1KQNA 1KK3A 2V7TA 4C88A 1R4MB 5IAJA 1W7AA 3D3WA 1GPNA 3T3IA 1GRQA 3CH7A 1KRXA 1FFCA 1NVXQ 5ARCA 1A4UA 2UXCB 2BTOA 2OHFA 3AU8A 3GQBA 4RV9A 4D9NA 3OEEA 1THTA 1SOAA 1E5DA 1FYXA 1Q7EA 1UPAA 4ZP1A 5LNK1 2PZBA 3I5YA 1N34B 5K3CA 4K6HA 1US8B 1L1RA 1ZG3A 3DMRA 1TPYA 3E8SA 1HG1A 1NU6A 3GCWA 2RHJA 1FS4A 2QT9A 3HCRA 4AJKA 5BUSA 4OFZA 4OP3A 1A9RA 3IP8A 3JASA 3RD5A 4XJSA 1MAWA 1QE0A 2FGJA 2IUSA 3AESB 3AHDA 3TMYA 3SXJA 1T9DA 3H7IA 3NYRA 1XWWA 1Y1LA 2H2AA 1OU4A 4Y9RA 2GPWA 2O50A 1HDZA 3L4BA 4D99A 5F2OA 1ZBQA 5IARA 3TLXA 1IM5A 3TCXB 2QMHA 4L6CA 4GEKA 1NJ1A 1CFJA 1U0LA 3AC0A 1YHNA 1KNQA 3OEHD 4CMKA 3ZI7A 1M5RA 1DC4A 1HR0B 4BFUA 4J1SA 2Q2OA 2QJRA 3B8EA 2PKCA 5IAAA 3GAAA 5EQDA 1L4BA 2P4HX 1N1GA 4MV9A 4LNUB 4CEHB 1XDZA 5TQJA 2PMFA 4LHZA 4RESA 1T3SA 4M83A 1EG2A 3R3WA 1XTQA 4F7WA 4MROA 5CGQB 9ABPA 4BFVA 2QP3A 3AINA 3R1IA 2FOLA 2YJ5A 4G4GA 2EFEB 2DUUA 4DUYB 3G2JA 4A8JB 2FSHA 4FWBA 1XRJA 4O2BB 5EZYB 3KLMX 3MWDA 1QYRA 1VG9B 1W4LA 1M75A 5FEMA 3STXA 4HNTA 3L02A 4EHAA 4YMIA 2VTDA 4Q1EA 3RTGA 1V7PC 1XLTA 3HDHA 3X44A 3HWRA 4XDGA 1VKZA 1CUXA 1MW9X 3GLTA 1WTCA 2JL1A 3Q41A 4H17A 1C0LA 1VI6A 1VSTA 4MA0A 1BOOA 2POQX 4MQ4A 1J42A 4UAGA 5ALUA 1AA6A 1HQCA 3GCGA 1JLLB 3PVZA 3V9PA 1XZAA 1WZIA 4CM7A 2BFPA 3MK31 1E62A 1EQ2A 1RYMA 2R6AA 2Y1WA 2D1FA 4TQUS 4OJTA 5B12A 2IH2A 1NOKA 2DMRA 1Z17A 1PWXA 2WSIA 1CUGA 1PEKE 4JXJA 1RTKA 2HXGA 5ARDA 3LY7A 2GKGA 1QP0A 4RIFA 3ORSA 4I1SA 5HBRA 3TDMA 1XQ6A 3TIGA 2QM7A 3PYMA 3GLSA 3S40A 1BJKA 3FSGA 1AS0A 3QU4A 4UMDA 4AL4A 5J5AA 4BMZA 4DM3A 3SWWA 3FIUA 5K0BA 2YOFA 4LYJA 2HU8A 2Q0HA 3I0MA 1J8MF 2P9FA 3K9GA 2GOYA 4EQ6A 4A16A 5LJIA 4XD7D 1VIYA 1GCIA 4L15A 3TVTA 2HCJB 2JIZD 3CPSA 2Q8NA 3JQAD 1PJ8A 1JI3A 4PZ9A 1XAIA 1N8KA 2E6UX 3P4UA 3ZHOA 1N2GA 1BXRB 1N92A 5AJZA 5BNZA 5IJ9A 1QGZA 1GCUA 3QUAA 5ALLA 1TFRA 3U7QB 4U2DA 2HI0A 2J3KA 4FPXA 4GF5A 3BIOA 5ENZA 1LVHA 3C3KA 1M2OA 1GQ2A 3NTUA 4QGFA 1MX1A 2GPBA 4KQ2A 3G7NA 1QIJA 3IMCA 2O1WA 4NYMQ 2X4LA 1VHWA 2X0JA 2JCBA 3HPRA 4JXKA 1NSFA 3KAKA 4XWTA 4HNQA 1MFZA 3T1TA 2A4KA 3C14C 3JALB 3F97A 2WIJA 4LF7B 2FPLA 1VLJA 1XD2B 4OLHA 1ABFA 3HEAA 4WK4B 2X77A 2ZUUA 1O0SA 3F7OA 1T5DX 5E6UB 2YV5A 2AEEA 4P5DA 3KPUA 4EB3A 3O0DA 4P5EA 4LQLA 1XVVA 2IA5A 5KU7A 3L8CA 2XRMA 1CDOA 1WA5A 2EWWA 4BO2A 3GLQA 1DLIA 2MWMA 1XDGA 2Q4RA 4P34A 1CUHA 5B1DA 4BQEA 4Z2YA 3ZH2A 3RLIA 4NMMA 4KX5A 1P7CA 2QN8A 3K0BA 3NBFA 3OICA 4IBOA 1P33A 3QELB 1LI4A 4KLNA 5CLQA 5ER9A 5C32A 2P7HA 4Y2TA 3IVCA 3CLRC 1M6EX 3O8NA 1QHNA 1MX5A 2NZ2A 1QMPA 4NBSA 4NZPA 5GVRA 4EJ6A 5BYKA 3VA7A 1ITZA 4UBIA 1OAAA 2B99A 3CPEA 4PEVA 4M8IA 2WHPB 1FP4A 2DBYA 2JJ1A 2VVTA 3RPEA 2AZMA 1BDHA 1R6DA 1ONSA 1RLUA 4LJ6A 4KIUA 4J16C 4QUIA 5FPTA 3DBOB 1CSEE 3AF3A 5J63A 1U3CA 4QBKA 3F90A 3GEBA 1WWKA 2HR1A 4DV6B 5J1TB 1ZUNB 4N6NA 2XF2A 4C0BA 3VU8A 3AHFA 4KXUA 3HNPA 2H2WA 3VKFA 3PD0A 1K6MA 1AHIA 5G1NA 1LY1A 1PT8A 3EEFA 3MAGA 5JDCC 2XKBA 2GRJA 4B47A 4DWWA 1DU4A 4PSAA 3PJFA 3RT9A 1F5SA 4N12A 1Y33E 1D0IA 5EJ6A 3NTXA 4YEDA 2XDAA 5DCUA 3TRHA 4G1EB 3BRWD 2XUFA 2CCJA 1TVKB 1W2HA 2Q0QA 4P3YA 5HTOA 3SIXA 4F21A 2ODQA 4YECA 4ER6A 3G17A 3AI1A 3L7JA 1IEQA 5BWOA 4UDYX 2XMCA 4JSYA 1ND5A 1I2ZA 2EOAA 3IYLW 3KVYA 5CDHA 5K3EA 2Z58A 2XGMA 2X1LA 2ZTLA 5GV7A 4A4DA 1YONA 1BHO1 4J3FA 2AEJA 1T24A 2WF6A 1C5KA 4C7JA 2XQJA 2BGWA 1RKBA 1FYVA 3HY6A 3USCS 5JNLA 2GA8A 2CE2X 1ZOLA 5CT6A 1AU9A 3PPIA 4HQNA 4I55F 4JVOA 5LIRA 2J6BA 3DUFA 4D98A 4X66B 2B36A 2RHTA 3GH3A 5FNZA 2YIDA 3F4LA 2RH9B 4NCIA 2WYUA 3Q3JB 4BLUA 1KO5A 3Q8KA 1S3SA 1B3RA 4JR1A 2KQUA 4LDJA 3VTKA 1NPYA 3WYAA 1AGPA 1XZEA 1N3LA 3I23A 4PXAA 1KO4A 5KKAA 4G84A 5HFNA 1P29A 3V8RA 4B6RA 5IEBA 4L9SA 1G5HA 3ZE9A 4OXXA 3UWDA 4LPKA 4G86A 2VBGA 2IOFK 4BX9A 1DHTA 3ROFA 2OGSA 4ZV9A 2IU4A 1UKCA 3MIIA 3OT1B 1CD5A 4NAUA 4ALNA 4Q15A 1OR8A 2CUTA 3DZBA 3MBOA 2JZNA 1BDMA 3T9BA 4MKRA 1HFWA 2VHCA 1TM4E 2BF4A 3OCUA 1H6CA 2ZU0C 4OB6A 1CRWG 2AA3A 1US8A 1KJ9A 4OXNA 2W11A 1OJ7A 4MI3A 1UC8A 4YRPA 4EA6A 4X94A 4P7GA 5G0VA 3NWOA 3PT9A 2BKEA 4KQXA 1DKPA 1KC1A 2I7CA 2OV3A 2TMYA 3FX2A 3GFSA 3T5GA 5B6IA 2QXTA 5GPBA 3B52X 5DHAA 1ZC4A 4AJLA 3Q6NA 1SUWA 2J9FB 2EQAA 2ZYHA 5DI9A 1OFUX 4BWVA 4H7KA 4UUAA 2AOWA 3QTBA 4V0QA 3C3AA 4B87A 2C84A 5DSZA 4ZQGA 2HJWA 3JZMA 1J2EA 3IDSA 3LQQA 3NU1A 2HADA 4GL4A 4I8DA 4Z3DA 3F8TA 3A6GA 2XUHA 4G1FA 4F2GA 1Z6QA 4Q7KA 4UUPA 1JR6A 1AQ6A 4JLNA 2NYVA 3DFMA 3HB1A 4BCDA 4AQYB 4LHSA 4KVGA 5BRJA 4V38A 4WOJA 5G40A 4JBNA 2YWXA 4LJSA 3W5DA 4NZMA 3GVHA 1A27A 1E9SA 1BOFA 2VDWA 3PUYA 2YWBA 3HU1A 2C97A 3W2TA 5B53A 2B9EA 1P2SA 2OGUA 4RXUA 3S5UA 2Z30A 3L7BA 1N2JA 1ZM4A 1YR8A 3LF2A 4B3BA 2CMFA 2J09A 4I4LA 2ORWA 621PA 1JFLA 2KM1A 1QE3A 4KGVA 2C29D 2AE1A 3AM1A 4IINA 2Q3CA 1DBPA 3N0WA 4PONA 1I2BA 3LUGA 2DERA 1L5OA 1G8SA 1J9ZA 1RZUA 3C4JA 3H1EA 1GGVA 2BWJA 1DX6A 3B8HA 1L4LA 3GU3A 1SIWA 1NIPA 3IJRA 4TTRA 3H3JA 2DSNA 4U5QA 4WLVA 1ZH4A 3H0CA 3EAGA 3CIFA 1MORA 2RH4A 2VHTA 3FPKA 3TJMA 1M7GA 1AH2A 2EJWA 2IW1A 1FNBA 4EY3A 4YP5A 5L4NA 1KC3A 1P3Y1 4G23A 4R31A 3KO8A 1CRPA 5EG5A 5B2FA 2KHZA 5A9TA 1O7JA 1XRPA 5GINE 1ZU4A 4B31A 3GV0A 1Q0RA 4IEIA 4NYJR 1ULSA 2NSJA 1H2WA 4I5GA 4KKVA 4U9HS 1JEAA 1M5TA 3M6UA 1KHTA 4WN3A 3MT7A 1S8NA 2CHGA 4WT7A 4EGQA 1JDTA 2ZKIA 3ZJ4A 2OQVA 2J9GA 4DR3B 5CDGA 2RKWA 2X8BA 2WR8A 3SBOA 2AG1A 4NG5A 4HHEA 6AT1A 3UGJA 1CB0A 3AVPA 1M6VB 4HI0E 1YQQA 1YQGA 1XWIA 1HYHA 2R4TA 3C24A 3OQ6A 4JVSB 3WNBA 1X74A 3IOCA 5IBRA 1NLFA 2PYIA 1KZYC 2O5VA 4IYJA 2UAGA 3GDFA 3A1DA 5ALJA 4CMAA 1KBOA 3FPCA 4IG4A 4LWPA 1IWBB 1JXQA 1YE8A 1XPUA 4MMXB 1W4BA 5AVOA 4WOKA 4EG1A 1YL5A 2HO5A 4D46A 1FX0A 1L5GB 4TL7A 2ZR0A 1MJNA 3I6MA 2R86A 3WFZA 5IWCA 1N5IA 3KWFA 4UOQA 4KOEC 5KSZA 2VT2A 1G8FA 3WYBA 2HSEA 4MICA 1KAHA 2F1KA 3COPA 4RPJA 4LX8A 4MTLA 3R7DA 2CF5A 1V25A 2IUEA 3GVCA 4X1OA 2V8OA 1JAYA 3BH7A 5BUQA 3F8SA 1L4FA 2I4RA 4KYTA 1GWNA 2GPJA 1EI9A 1P4HA 3OMWA 3AZQA 4N40A 1G4UR 1R6TA 1WW3A 3TNLA 4V0ME 4BO6A 3GYBA 1UOQA 5HX7A 1NVDA 3DJFA 3L7KA 4KWHA 2UZ3A 3BQNB 2XMPA 3GIDA 2Z2KA 3WYEA 4RVSA 3HXQA 1TAUA 2CHUA 5IS2A 2QX9A 2ZRPA 4LK2A 2ZRLA 1YR6A 1QM5A 2XLCA 4F9GA 1C7EA 2CZQA 4B7CA 1UCFA 3E3MA 3QBJA 1HV8A 2V54A 2EHJA 4R5MA 3HVRA 4FE3A 1RYBA 2W9XA 4KAXA 3TRDA 3VO1A 3ANXA 4JFRA 1E3WA 1T6BY 3GCZA 3NV7A 4GZLA 1TZ2A 3VC1A 4JYCA 2FYTA 1QJ4A 2B2NA 2WWGA 3H4TA 3MGAA 1ISPA 3GFGA 3ORHA 3DM5A 1CUAA 1KJJA 4KMSA 4P35A 3W7VA 4F8EA 8ADHA 1TIKA 4O6VA 3RQSA 4BBJA 3QVGB 4KR9A 2YYAA 1SKMA 2OO5C 1RLMA 4RW0A 2JGRA 3GNQA 1KSJA 1SCBA 3DQQA 1PNRA 4KXWA 3ROPA 3L0PA 1P81A 3R5HA 3PDIA 1ZH0A 4FM9A 3BD8A 2JI6A 2X22A 3TDNA 4C22A 4V24A 2JK0A 1KZGB 4J49A 4E5UA 3RSCA 3SJCA 2WAAA 2ECOA 4P0QB 1IDOA 3MPOA 5MN6A 1EVKA 1NDQA 2R5NA 2YH2A 1E7SA 4INJA 4WKNA 2ZITA 3RGWS 2ZM6B 3SE7A 4RKYA 1QQTA 2OSBA 4S1PA 4BB9A 4F8JA 4AJJA 4LAFA 3E58A 2IHYA 1R12A 1LSUA 4KAJA 5ITZA 1JPNA 1NVFA 1S01A 1ZUWA 3F5MA 3FYUA 3L7NA 2OZVA 2C4VA 1V1MA 1IM8A 4JP5A 4WOPA 1IG0A 2VJLA 3ET4A 3TIVA 4QDTA 3GFTA 1J2YA 2ZBFA 1AS3A 2CKDA 5C3UA 3RKRA 2DY0A 3N8GA 1M2OB 1VPDA 2VF5X 5FHRA 3VVBA 3DTNA 4P2GA 1CS0A 3N76A 4MQBA 1KDYA 2PK3A 3LKDA 4DJFC 1XU4A 1R4ZA 2Q46A 3OIVA 3CX4A 2VRNA 4ZOAA 5EIHA 5I4CA 4PIPA 2HWYA 4CF3A 4MVXA 1Z5GA 2MJLA 3LHFA 3M4ZA 2QSYA 3ZN2A 2REBA 1PJSA 3DGFC 3L7DA 3L1KA 4MRPA 1NXXA 2HCRA 3W0LB 4WTOA 5BW6B 4AY5A 3DOUA 2Q6TA 3OZAA 5AVWA 1UFKA 5F3WB 3K70C 4A03A 3ZVLA 1HQDA 2IXDA 3HWX1 3OT5A 3HB0A 2O0KA 1DQSA 1YC5A 3SBDA 2F4VB 1L2TA 1UKVY 3KRTA 3WS7A 1UP6A 5KDDA 4EKYA 3JYQA 1Y4AE 2GKOA 1DC8A 2AVDA 5IAEA 3THXB 1GUDA 2VP6A 5DZSA 4KBYA 1K4YA 3T54A 4A6PA 1J8FA 4HDCA 4W1QA 3G23A 1ZRSA 1DV2A 3BX1A 3NEPX 3P5BA 2BAGA 1EVYA 4MQFA 4WCFC 3VM6A 5FOVA 2WWHA 4JQOA 4C6SA 3T1QA 3O8OB 2Q5HA 3EVZA 4Z9FA 4LBVA 2O8CA 3CF4A 4U4AA 2DWOA 1VSQA 2OZKA 1ADFA 2XDQA 3K5PA 3Q0TA 4UAUA 1EWYA 4U2BA 3TW8A 4CKCB 3CJRA 4G9EA 2QL5A 1FP7A 1W0KA 2VRBA 3U7HB 1KI6A 2AJCA 1H4QA 3GG9A 2VBFA 4V3BA 4GX1A 1SKYE 3SC3A 4WOCA 3RS9A 2FPOA 3UANA 1PGOA 1Q16A 3Q11A 3JV7A 2VO1A 2W0MA 2HMUA 2VLIA 2P79A 3OOEA 3ZWVA 2I6XA 2Q9CA 8MHTA 1Y9JA 4JLKA 4Q02A 2Y93A 2VA9A 1YKFA 1G291 3OSUA 1TC1A 4EJFA 2QTBA 4OOFA 3UT6A 5HSGA 4TMVA 3AETB 5INTA 1SUPA 2B8JA 5CVDA 1KEVA 1ZPDA 2C4TA 3OHPA 3EIEA 1DAMA 2IWRA 4BP9A 1ZGZA 2XB6A 3MJRA 1T5IA 3NHUA 4ZT5A 2ZTVA 4KYUA 5SYNA 3U7IA 5CNMA 2Y1XA 2WUVA 4CLOA 4L0DA 4MIKA 4DJJA 3FB4A 4HLQB 3PFHA 2I22A 4ENUA 3CCFA 4E11A 4KBGA 2WTMA 3OFNA 4CEJB 2XBMA 5JANA 1HSOA 3DZKA 5B1HA 5I9TA 2J9YB 2CBXA 1MCZA 2OM2A 1QCCA 3GT3A 3O94A 3SEAA 1GG8A 1GA6A 1OXBB 1TLTA 2EDCA 2HWKA 4J9VA 3RSFA 3H9JA 2FJPA 1QRTA 2L42A 4YMHA 1O8CA 3ZV7A 1HA3A 4PZYA 4CM1A 2HQBA 4EG0A 2WLTA 2X5XA 2CXOA 2NXCA 2PVPA 4L8FA 3VZRA 2F48A 4Q7LA 4XDZA 2HMTA 1Z22A 5DT2A 3U1VA 1V96A 4S05A 3TGLA 3QUSA 3OIFA 2I1WA 1WSDA 1G5PA 4CXMA 2VI5A 2X8JA 2J59A 3GFOA 2H57A 1XU7A 4QQRA 1XD8A 2PQ6A 3FUWA 5KVSA 2KW5A 4GLJA 4GVPA 5C31A 2WJ4A 1M8PA 2GSDA 3BWCA 1N8SA 3AW8A 4Q4JB 2B34A 3VC7A 1JQDA 3G13A 3KKPA 3IT0A 3CU5A 1S4MA 3PCRB 4BZXA 5H81A 2VBIA 4LZPA 4RDXA 4AMBA 3G0BA 2Z6AA 5CB4A 3OZIA 1G17A 2OD7A 5M04A 2FQWA 2PRSA 2ZR8A 3LKBA 2QOEA 3QV2A 3G7SA 4NDZA 1TTHA 3RVQA 2QLLA 3CLKA 1QPGA 5DASA 5HQ3B 3GLHE 3IBCA 4H6XA 1TQHA 5T57A 3QWIA 2OV8A 3DHEA 1D2EA 1PWYE 4C6RA 1LV8A 2FXIA 1NBOA 1UPCA 1ZQ9A 3LLCA 2B5OA 1YOVA 4YUVA 3TLZA 1JI0A 3U4IA 3EIWA 3AOGA 4TKVB 4Z9BA 3EPHA 1P7VA 1PG2A 5AVRA 2VQ6A 1Z63A 1C8LA 1WCXA 1A04A 3NUZA 1YVDA 2BJVA 3QOFA 3JQGA 2ROQA 1OXTA 2R5WA 3ZZTA 3H2GA 2O3TA 3P45A 3FCEA 4E1AA 3A2KA 3PQ8A 1GNLA 2H5EA 3R3UA 1ID1A 5JTTA 2VJAA 4UBKA 4RETA 4KN6A 1K7XB 2P5TB 2ZI5A 4DWJA 4F04A 3RC8A 4EI2A 4LCBA 1YKSA 3GJ4A 4OI1A 2FFQA 3CRNA 4DIBA 3VSAA 4POOA 2JGDB 2PZFA 2QVYX 4BVKA 1UJMA 3C1OA 1BMFD 3PRJA 4QTZA 2CLMB 2LKCA 3KS9A 1WMFA 3UV7A 5BXQC 4G01B 5JW6A 4QJIA 5IKOA 2EKDA 4BNDB 4WGFA 4DMGA 1PDOA 3CHYA 1QGOA 1ACJA 2J5XA 1O94A 2XUZA 16PKA 2E18A 3ABQB 3E81A 4IV8A 2X4DA 3CRW1 4HEHA 3KKQA 5DHRA 4DCUA 3GLGA 3N70A 1QWSA 4OLBA 4O4JF 4RU1A 3TZKA 4NR0A 5E3JA 1H8ED 1HE1C 1IFXA 1NMSA 2EW2A 2R8BA 2YW9A 4GG1A 3A06A 2G9NA 1FXUA 3EF1A 2QMUA 3TBKA 1E5VA 1RLIA 3RBXA 3BMCB 2DULA 5BVHB 4I99A 1YS2X 3KHTA 4LJ8A 2XUIA 4CLRA 2P4UA 3CF4G 5BUCA 3UWMA 3I62A 3JRXA 3M3HA 4ZI5A 1ZK0A 4OHWA 1RM0A 1C1YA 3CJQA 1WBJB 2ZSJA 3IILA 4LOKA 4Q4LA 1GKUB 3JYOA 3RK0A 1LRJA 2PSDA 3NTQA 4RJKA 1QHEA 4Q9KA 2R6HA 1W1IA 2I6TA 2IDMA 3V4SA 3SC6A 3K92A 1WF6A 5H3LA 1GTG1 1VB5A 1RM4A 2Q1SA 3FPGA 4NC9A 1XAGA 1FNDA 1V8BA 1LDBA 1QS0B 3KPWA 3RF6A 2F9MA 4N7JA 5I7UA 3HBFA 5JQGF 4ETWA 1ANKA 2CMDA 3O1LA 4JUDX 1LPSA 4DY4A 5C8ZA 2NO7A 1ZINA 4US2R 4RTKA 2O8DB 4EEXA 1NZDA 2OC4A 4IQGA 1O9GA 2KX7A 3BE6A 2QRMA 1U0BB 1GKIA 1P5HA 3WGVA 5FFNA 3O2QB 3FROA 4RD3A 4CU5A 4J1NA 4L22A 2UXBB 3PQEA 2E5WA 5IN4A 4CFSA 3DE0X 5JWHA 5B1EA 2OAGA 3B51X 1NJSA 4INPA 1E6KA 3A6ZA 1RCTE 4LOHA 4NEGA 4QUEA 3BMXA 1YA6A 1C9KA 3RH0A 1VFPA 2DTXA 3VHXA 5GVSA 3HSKA 1Q21A 4OBWA 1JAXA 3OWXA 2GD1O 1NW6A 5HQ3A 2WKPA 2HWXA 1SQ0A 3ORFA 1NW8A 1IQRA 2Q3BA 3QYPA 1RC0A 2BKVA 2OP0A 4AU1A 1V16B 1XELA 2A9FA 3OO1A 4IUBS 3V2HA 4PF1A 1U4OA 4QT0A 4PM4A 4ENQA 2ZI7A 3MOIA 3R0XA 1NPDA 1BFKA 3WA6A 4FFBB 4QATA 4BX0A 5FA6A 2HBZA 3CURA 4A23A 4D9EA 1ESZA 1F4VA 1GFSA 5E38A 4FYMA 2B4YA 3KEFA 2HKIA 1TXGA 3I6BA 1FPQA 4ZEVA 4EY4A 5H82A 4CDNA 3U1TA 1HLDA 1JDBB 2FPWA 4EBBA 5E3HA 3R4CA 5CT5A 3NNNA 2QGNA 4V1CA 4DLBA 1BN7A 3BS4A 1I94B 4J9UE 2P4EA 3PC3A 2VJCA 4CLEA 2EX4A 2JS7A 3A9SA 3CVJA 3E5RA 5BMVB 3GYGA 5B3LA 1CUZA 1UINA 2QLMA 1JSRA 3FF4A 3G2MA 4ZU3A 3DMTA 4JUBA 3LO8A 4M88A 2ZJZA 2R2GA 5JIBA 2CVHA 2N0SA 1LNZA 3TG8A 3CLHA 3O75A 1OBCA 2H1WA 1KYTA 3I09A 4C7OB 2EG9A 1XT6A 4IIUA 3NHFA 2CNBA 2OXFA 1HGXA 3YASA 4D80A 4O2AB 3KPVA 3Q3HA 2YZKA 3HMKA 3L8DA 3CA8A 3BT7A 2X9QA 1KVUA 2P90A 1IPFA 2QJFA 3WV5A 2ZXUA 5A5EA 3I5UA 2ZB2A 1FLVA 2JLCA 3AL3A 2F9LA 4KQGA 1TVKA 1X0XA 1ZVMA 3ZBPA 4COOA 4B4DA 2OL4A 3DLAA 3HV2A 1U0HC 1XTKA 4V03A 3UMYA 1MW8X 4HXYA 1YBFA 3M4NA 4XX0A 1E0JA 3CEPB 2GN6A 2O8NA 1RJWA 1TU3A 4OGLA 2IYQA 1U2GA 2QG9A 2Q3DA 3NATA 4FHCA 3PQDA 2W2XA 5KMGA 4I4NA 3AV3A 4XIJA 1NF9A 3TFOA 1LS6A 2TRSB 4D44A 4LOIA 1C7FA 4JSTA 1LNSA 2GN2A 4QX6A 4EHJA 4JZKA 4KLCA 4CHGA 1HEIA 1N2BA 4NYJQ 3IR7A 2NUPA 2VSOA 1I80A 4DMFA 4ZC8A 5MGNA 2GJ4A 4FB5A 4G41A 3P2JA 1QYXA 1X2EA 4KHZA 4MS1B 4AJ2A 4K86A 5LD2B 3RS8A 3SVTA 2EYQA 3PKZA 2WU4A 3DLTA 3ABSB 3UK7A 2P6MA 2JLUA 1XCBA 2BLNA 3S3TA 3ISVA 1Q17A 4LSGA 5BW8A 3LBAA 5C4MA 1D2RA 1XJ0A 4LJ4A 3T5PA 4YCNA 1UPBA 4IILA 2QN1A 1JMKC 2V5UA 1HOXA 1XL0A 1NVVR 1RD4A 1XNJA 1PUXA 3QELA 2FZLA 5DO9A 3RIMA 4XVQA 1UQTA 4YRGA 3IVGA 3VNAA 2Z8XA 4IV0A 2GR9A 3EUEA 3WFJA 2IUTA 1JIUA 4GLOA 4R8VA 4WN9A 1I2AA 4GI2A 4ZVNA 3K9LA 3KSRA 4LJAA 2FK7A 1RI1A 1TQ4A 4MCHA 3LFUA 3QE0A 4EVIA 2IXGA 1ZBDA 3ITKA 1F51E 4RWZA 2V4MA 1SXQA 1QP7A 1WUJS 1M74A 1Z82A 5GZ3A 2J4CA 1WR8A 1V48A 1CS4C 2HJHA 3BZWA 2RCYA 4OL0A 1SN7A 3NAMA 4H0NA 1R4NB 4FNGA 3BM5A 3FD8A 2J48A 5H8WA 4P08A 4ACAA 1SURA 3T7IA 2B98A 2O59A 1ZJZA 4L0QA 5SZKB 3QEMB 3NEAA 3URMA 2XSZA 1IUPA 3FETA 4JT9A 4UTVA 1IN5A 5G0SA 1EWRA 4E88A 1K0UA 3N2ZB 2QTLA 3JQ9A 3VOBA 3R6LA 3C8UA 1QBGA 1SBCA 3MFYA 1VCIA 1JPVA 2BKAA 5FOTA 3TSOA 4PZ0A 2EYUA 2ON6A 3PZBA 1KERA 4TKUB 1QQ5A 3HC7A 3N6XA 2XUQA 4ZI7A 5C1DA 2AOTB 2BGTA 2GAIA 3CC8A 3IP5A 3OF2A 2YN4A 4I81A 4LOJA 4TTJA 1NFFA 1WG8A 3JQ7A 2WAMA 2W6PA 1PK8A 2GD0A 3QE4A 2QVXX 3PIDA 4DQLA 1GQSA 4TTIA 2Z2ZA 2QE7A 4NQZA 4IVPA 1VRWA 4JJAA 5CU7A 2PQMA 2Z09A 1Z4IA 4BS9A 2PQ0A 5KSWB 4JL5A 4K28A 1RP7A 4TRMA 4YRSA 3DHVA 4GYYA 4OUDB 4B6QA 1FDOA 2XB8A 2PVSA 3LHKA 3KSAC 3W8NA 2FSGA 5HR5A 1EDZA 1T29A 2NIPA 1JSCA 2QVGA 2GPTA 1XRRA 2E48A 3T06B 1CEQA 3D4OA 1Y5RA 2VNHA 3GA0A 3P0JA 4PCVA 4WH0A 2BCJQ 4CM8B 4ZRDA 2FWPA 1MO3A 2WOJA 1W85A 2VHJA 5EN4A 5HF5A 1A5ZA 1UBEA 3W4KA 1L5HB 3ZXIA 5GIPE 2HCTA 1ZW6A 3K4PA 1MB4A 1OYWA 3N0RA 4NP6A 3HZOA 4YQFA 3SG0A 1F6BA 5K3OA 2CXQA 2BCGY 5KYXB 4B3HA 2GPSA 2Q2NA 5FO1A 3E9CA 4B82A 3ZWYA 1ISGA 5KJFA 1RMTA 1OTXA 1DC6A 2C2ZA 4JVMA 2FW6A 2PT7A 2RG7A 3ZZNA 4F1KA 4MW4A 3F9RA 3JWIA 4GBGA 1ZAKA 2UZIR 5K3FA 2HL6A 2BL4A 2NGRA 2W6ID 5J5CA 2IYZA 4TQ9A 4RABA 4AZWA 4BNVA 4D1YA 4CIYA 3U31A 3BWDD 1WDLA 4C04A 1U7TA 1A7UA 3FXAA 1SOMA 4J0GA 2VQFB 1FXWF 4S0ZA 1CY4A 1QK5A 1YDMA 3NWPA 3AESA 4K6CA 2DX7A 1UFOA 4U7TB 4Y6SA 3T1NA 1T8TA 1EBFA 4ISBA 3NGXA 1YQXA 4QDUA 1EDBA 3TM4A 2BEWB 4Q1DA 3OEED 3G3EA 4OAOA 2ZYSA 2UV8A 3ESRA 3V1TC 4MUJA 4CQLB 3UBTA 4PGMA 4WJLA 3EE6A 3QVMA 3EQ7A 1Q91A 1IY1A 2B4RO 4Z4EA 2BPOA 2MR5A 4AQ7A 2JGKA 2BEWA 2NXNA 3VH4A 3AF6A 3RC7A 4RV5A 1NQTA 2JLBA 2A5GA