1B14A

Alcohol dehydrogenase from drosophila lebanonensis binary complex with nad+
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNTTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALCOHOL DEHYDROGENASE
publication title The catalytic reaction and inhibition mechanism of Drosophila alcohol dehydrogenase: observation of an enzyme-bound NAD-ketone adduct at 1.4 A resolution by X-ray crystallography.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 97
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 1998-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b14A00
1U2GA 4F6CA 4LISA 3TN7A 4IS2A 1P9LA 1BVUA 4AJPA 3GZNB 4HFRA 2O2SA 3HWRA 1T2EA 1O95A 5JMPA 2Z95A 3A9WA 4GAEA 3UH1A 1KY5A 3RVDA 9LDBA 4ND3A 3WR5A 4RZIA 4WPGA 4NDNE 3DAPA 3EHEA 2HLPA 3OJOA 1PJCA 4YAKA 3OIGA 3WLFA 1RPNA 2HK7A 1CRWG 1H6DA 4YB8A 1P1IA 4MKRA 4R4JA 1QR6A 1P1RA 3H7AA 1Q0HA 1RM0A 1N2SA 3VZSA 3K2BA 1GU7A 1EUZA 2B35A 3GFGA 5G0SA 2GR9A 2VRBA 5FI5A 2C82A 3I4FA 4MPDA 3NAQA 3TFOA 2AEJA 1WNTA 1OC2A 4YA6A 1I2CA 1NQAO 1TT5B 2DBVO 3CMCO 4E30A 3K8ZA 4CLOA 4IPTA 4TZKA 4CMEC 1ADBA 1BGVA 1YXMA 4LRTB 3RC7A 3GR6A 3V1YA 3NT4A 3A06A 4I5DA 4WGGA 4GBJA 4Q39A 5G2OA 3ZV6A 4AJEA 4B4UA 5I8ZA 3IDSA 3VPGA 3W6UA 5A1TA 1EE2A 3PDJA 1GPDG 3OICA 5KTKA 1R4MB 3ZNNA 5BNIA 3GNTA 1E6WA 1C1XA 4KZPA 4IXWA 3NV9A 1LLUA 4PZDA 2O4UX 1GEGA 4Q3NA 3HDYA 4OH1A 3T7CA 4PIVA 1G0NA 2BFOA 3VC7A 1EQ2A 1ULSA 4ALJA 1BHSA 1HE3A 5HBRA 5A9SB 4DBZA 1UXKA 2ZCUA 3ETEA 4YVFA 3B70A 2Y93A 3MJCA 4ALMA 1YBAA 4F3YA 2CF6A 4CJXA 1PQUA 4QTZA 2X4GA 2X86A 4FDAA 3LT2A 3KZVA 5FFFA 4CLXA 4D45A 1LRLA 3IMFA 3HSKA 5L7WA 5KJEA 1QV6A 1YL6A 3FN4A 3G1TA 4CODB 4IDBA 3U0BA 5F5NA 3IP3A 1E7RA 4YT4A 3GUYA 3VPXA 1N7HA 3TZQA 4CMEA 1ISMA 3RJ5A 5KNLA 4KUEA 3FHLA 3GDOA 4XIJA 1F8FA 3O38A 1TXGA 3RUCA 4A26A 1H94A 2D59A 3H9EO 3E8XA 1Q2XA 2VRCA 3ZU3A 5MGBA 3D7LA 2YV3A 1Y7TA 3IJRA 3WLEA 1JVSA 2WYUA 3BAZA 3OJ0A 5BSHA 2QZZA 5HRUA 4BMNA 1XEAA 3OP4A 3CE6A 3QW2A 1NWCA 1V6AA 4JBHA 4IGEA 4R9SA 1IE3A 2Q2WA 5JAQA 4GSKA 1DAOA 2Y1CA 4HFNA 1J4AA 2C20A 4CUKA 5GZ6A 1R4NB 1E1NA 3KYCA 2FR1A 1DRUA 1I32A 1PGPA 4IINA 1A4IA 2QYSA 3KXDA 4E12A 1HYHA 2X9VA 3H5NA 3BA1A 4XKJA 4CR7A 2NNLD 2Q1SA 2F1KA 5C3MA 4M86A 4GWGA 5T6BA 5C37A 3BMCA 4WLNA 4BS9A 5KWEA 4YQZA 3ZNOA 5F5LA 5HS6A 1ENYA 4CMJA 4DIOA 2C7GA 1AE1A 2ZJ0A 2FPIA 3SJUA 5TNXA 2JD1A 3BTSA 4ZGWA 1F8GA 3ZDFA 1W4ZA 2YDYA 1GYQA 1JKFA 2X22A 5IDWA 3OJFA 4MKXA 4PLCA 1E3SA 3G49A 3FR7A 4F46A 4UVDA 5EMHA 5CG2A 4UVEA 3GVHA 2C2YA 4J90A 1N92A 3QLJA 4Q3AA 4BKRA 3QA9A 1EMDA 2E4AA 3JQDA 1BW9A 1BMDA 1H9BA 4Y67A 2GNAA 3M2PA 1HWYA 3LT4A 4AJ2A 1E3WB 4CMHA 2C5AA 5B4TA 1ONNA 1D1SA 1LSJA 1JLLA 2FR0A 2CF5A 1PR3A 3ZW9A 1HYGA 1DIRA 3W4JA 5IDXA 1PL7A 1VJ0A 2OUIA 2VZ8A 2D5CA 2OBYA 3EYWA 2Q4EA 3VVCA 1GL3A 4U8GA 5LCXA 1H2HA 4TRNA 2W4QA 1EVIA 5G4KA 3WMWA 1YS4A 1Y8RB 2GGSA 5I9NA 5DCYA 3OM9A 2ZQYA 1Z75A 3GNSA 1UP4A 1XU9A 1KC3A 2B37A 1ZIDA 5KVVA 6LDHA 4IQ8A 3ITDA 3IKVA 2VUTA 2W8ZA 4OOEA 2RCYA 1HDOA 2BH9A 1HRDA 3GEMA 4XJSA 2CVZA 4FSHA 5F21A 5T57A 5AYVA 1WDKA 3OBBA 3FBTA 4M8SA 4MOWA 5IZCC 4R1SA 3QVWA 4HUJA 2I65A 3F1KA 3RI3A 4EYEA 2QRJA 2CVOA 3ONFA 5A02A 4Q3DA 4U0JA 1DOHA 4ZD6A 2GDZA 2VHXA 5DOVA 4L0QA 2J5KA 2X0IA 4HX5A 1ZJYA 1MP0A 2GZ3A 4M54A 4U5QA 1DC4A 1XHLA 2HMVA 1ISIA 4LCEA 4MVJE 5DBFA 5G0WA 2DPHA 3C7DB 4IUYA 1I3NA 1QYWA 4CV1A 1NAIA 3TNLA 5CDSA 2PGLA 3F47A 2I9PA 5I7VA 3JYQA 4G81A 5KVSA 1CF2O 3JQ9C 4Y6SA 4W82A 5CEFA 1CETA 2W2LD 1VSUA 3RSHA 2ILTA 4RLHA 2DBRA 4XZ3A 3SC6A 3VH4A 1PS9A 3BHIA 4NBUA 5TSDA 1X7GA 4RVFA 3NRCA 2J5QA 2C5EA 4WOKA 1V3VA 3LC1O 3N7UA 1SO8A 2O48X 1S6YA 4RVUA 2JHGA 4P22A 3I1JA 5A3VA 3WYCA 1JN0A 4YQYA 3C85A 5DULA 5IZCA 1MC5A 3WXBA 2QX7A 1J5PA 4W4TA 1QP8A 5TQVA 5ICSA 5H83A 4JBGA 4XWYA 4CQMB 1EUDA 3AOGA 1IL0A 3PGXA 4FJ0A 3WGGA 2B69A 1HE4A 3GK3A 5KVCA 3ETGA 2G0TA 3V2UA 3RKRA 3ZWPA 1YL7A 4R5MA 2BGLA 4RGBA 3DTTA 4XYEA 3IOYA 3M2TA 4IZIA 1DLJA 2IXBA 3O03A 3F3SA 1P1FA 1T26A 1ZJZA 4FFMA 2NSDA 3QRWA 4XB2A 5THKA 1CQIA 3JQBA 3WFIA 4Q9NA 4OJNA 2Q4BA 5A4DA 2E37A 4GGPA 2JCVA 3GGGA 2GCGA 4PZEA 2P2SA 2JAPA 2CDAA 2PWZA 3ITKA 4E31A 5A06A 2CDCA 2R6JA 2QRLA 4XA8A 3KETA 1H6BA 3OA0A 2BELA 1R15A 4G2NA 1I30A 1P0CA 4TKLA 3U4HA 4GLOA 4ZU3A 1KVQA 1NWHA 1DBVO 1E0DA 2XOXA 3BXXA 5F1PA 4WLEA 4E2YA 2WMDA 1SPXA 2VHZA 3LLVA 1IUKA 3KSUA 5TIIA 2EGGA 3M6IA 4DXHA 5JW6A 4TRRA 3AM4A 3U9LA 4LK3A 1B0AA 5EINA 2W2LA 1H5QA 3BTUA 3NJ8A 3WNQA 4RL6A 4IJVA 1GD1O 3G3EA 4E5MA 4YT8A 4YEDA 1A71A 4RDIA 1Y6JA 2J3HA 4IJKA 4BQPA 1HSOA 2FOIA 5FEUA 2BFAA 1JDJA 1VI2A 1K89A 1NX6A 3C24A 3W8FA 1VJTA 3BMQA 4CM8A 4I5GA 3ZHXA 3QVXA 5COAA 4BNHA 5MDHA 4GSLA 3JQAD 1KBZA 1A5ZA 1Z7BA 3GGOA 4UVGA 1HETA 1IPEA 3QJ5A 4PLFA 1YE3A 4K1LA 2D3TA 3TFQA 2YJZA 1KY4A 1BRMA 3ZV3A 4CUJA 2VT2A 2Z1MA 4H16A 3WTBA 3E9NA 2RAFA 4BNIA 2AA3A 2VHVA 4NG5A 3KO8A 2HUNA 4OM8A 5GZ3A 4AJLA 4D46A 1O6ZA 4KQXA 5TGDA 4BO7A 4JIGA 4E21A 1FMCA 4W9NC 5F1KA 2YQ4A 1IZ0A 2EHDA 2EJVA 4MP6A 5KIAA 2D0IA 3P7MA 2UAGA 3V1TC 4FD3A 5AOVA 1Q0QA 1Z73A 2YDXA 4O59O 1MG0A 3ROMA 5JDCC 2CY0A 1MFPA 4J7UA 4DPKA 3ZHBA 4UVIA 4NU5A 3PQEA 4Y6RA 2VT3A 2QQ5A 3GVPA 1NAHA 1XWFA 1X0VA 4Z0TA 2PFGA 3DTYA 4ID9A 3RUEA 4D7AA 3PLNA 2OL4A 3AY3A 3HNPA 3BIOA 3C7CB 2PY6A 4L73A 1R16A 3NGXA 1WWKA 1K3TA 2BGKA 3WQQA 3LT0A 1K6JA 3QE3A 5C7LO 4FGSA 5L7TA 2X5KO 2OP0A 2AQIA 1VKOA 1AXEA 1ZK1A 4DYVA 3H2SA 3NDIA 5G0TA 1TLTA 3GFBA 3KEQA 4JP3A 2Q45A 4K6FA 4RZHA 3FF4A 3GY0A 1VL0A 3HFGA 1D3AA 3RROA 3VAZA 4BGVA 4CM4A 1RWBA 4D41A 1ENPA 4BGIA 3D64A 1AGNA 2B36A 3SBOA 1A7AA 4W9NA 2EW8A 4RPHA 4FFOA 3KYBA 3WJAA 4CM9D 1Y9AA 4BO6A 3LC7O 3IL2A 3W1VA 1PJ3A 1JWAB 2ZJ1A 1N9GB 3CEAA 3O8QA 5JDCA 2JKVA 3ZWXA 3QSGA 1N1GA 5ENDA 2VNSA 3GNQA 3B1FA 3FNFA 2HU2A 3AM3A 4P38A 3KYDA 4FN4A 1D7OA 2V6GA 4IY1A 4OGWA 4XB1A 3GHYA 4CMAA 4PN3A 3S2FA 2BLLA 2UDPA 2DTDA 3K5PA 1Y81A 2NVBA 1Y5RA 3H3JA 2AEFA 3F1LA 3NJ4A 4P4NA 4XJTA 4ONEA 2O50A 3A1NA 5DP1A 3RKUA 3RC2A 4RQUA 2Y66A 1I33A 4CM1A 4CM3A 2CMDA 1WAMA 1B15A 3WMXA 4BKPA 3VPFA 2YV2A 4P4GA 4RJTA 3KOUA 5BSEA 2CZCA 4RPLA 5ES3A 3DZJA 4QO8A 1VL8A 3L4BC 3JV7A 4L8VA 4G65A 1MXFA 1ZH8A 3KTDA 2PD6A 3WQRA 3PLRA 3A4VA 5JBIA 2HJRA 1NVTA 2GF2A 4E5KA 3S1LA 4AJ1A 3IIEA 1SOWA 4OAQA 1PSDA 4K28A 3MWDB 4IIVA 1PEDA 4A03A 4D3FA 4HV4A 4PCVA 4XYGA 4BNFA 1UUFA 3VHRA 1TT5A 4KQWA 4QO7A 1UAYA 1EFKA 4GQAA 4OSOA 2EXXA 4PG6A 4ZQEA 3H9QA 1IZ9A 2PA3A 3KSZO 3WS7A 4RF5A 3HUDA 4AICA 4I5EA 4AJKA 3PWSA 4IMPA 4UAGA 2ZATA 2DQ4A 3VDRA 3I23A 2I6TA 4XR4A 3C1OA 3ORFA 2H1SA 3BTVA 1YBMA 2IZZA 1R4MA 4R1TA 5JO9A 2ZTLA 1X7DA 3WGOA 1V8BA 1GV1A 1Q0LA 1SEVA 3WX0A 4DC0A 3OETA 2Q50A 4A10A 1GPJA 4A0SA 1KS9A 3PJDA 1GUZA 3VTZA 3F4BA 4HBGA 4DYDA 3C1TA 3L4BA 4FPXA 5A9SA 4KWIA 2EKPA 4WLOA 1PGOA 1ISHA 4PRLA 4J1QA 2ET6A 3NKLA 4KTTE 4ZQGA 8ADHA 5A5EA 1UDBA 1BDBA 1XQ1A 3R0IA 4ZJUA 1B7GO 2CDBA 2NU6A 3COSA 5JAMA 1N5DA 4BUCA 1BDMA 2XXBA 3MOGA 1WDLA 2NQTA 1NBOA 1D8AA 1E1LA 1KVRA 3KM0A 4J49A 4CMCA 2OP1A 3R6DA 1DIBA 2AG8A 1R37A 2PD3A 2X6TA 3RUDA 3E5MA 2O2YA 1IY8A 3H3FA 3JQ8B 3PHHA 4FBGA 4JQCA 3Q6IA 1SMKA 3BYZA 3ROPA 3RFTA 4NFSA 4O5OA 3R3JA 4QT0A 2FRDA 2PH3A 3EVTA 1DLIA 3ZHYA 1ADFA 3FD8A 1GUFA 1PS8A 1OOEA 1IOLA 1KEWA 4XD2A 1O0SA 1EVJA 4AVYA 3CZMA 5JDIC 4DQXA 3AUAA 3WWYA 1UH5A 5B12A 1P45A 3FRJA 4FFNA 1WDMA 2O7QA 2ZB8A 3PRJA 1LDYA 5IJZA 1PJLA 4GKBA 3V2GA 3WGZA 5FYDA 2PR2A 4EITA 5JO0A 4E5NA 3JQAB 3HJAA 2P5UA 2D2IA 4TSKA 4DPMA 2YFQA 1R4NA 3Q9NA 5DDIP 4E2XA 4ZQBA 3T4EA 4YRBA 1XYGA 1ZFNA 5B37A 1HSZA 3PFWO 5T8KC 3KVOA 4ITUA 4J43A 3ZU5A 5IDQA 1HE2A 4PVCA 4CLRA 4QSMA 1I5RA 2WE7A 1UXGA 1BVRA 3OA2A 4BNXA 2GN9A 3FTNA 3FPLA 1QKIA 5H81A 2JD2A 2GYYA 4U0KA 5L9AA 5EJ2A 1T4DA 3OHSX 2VCYA 3PQFA 3ZHZA 4OXYA 5IF3A 1N8KA 4XQCA 5ER6A 4WCFB 5AVOA 2PGDA 2V6BA 5JMWA 1UAGA 2GUGA 4JROA 3WGHA 4B3JA 2QW8A 3LF2A 2AE2A 3AU9A 4URFA 2GO1A 1V9LA 1YJQA 4OXKA 3ENNA 3ROKA 5TT1A 1LU9A 1SB8A 1YQDA 3UGKA 5K0ZA 5JDIA 3OECA 4WEOA 3WOHA 2ZYDA 1MB4A 3L6EA 3CUKA 1VRWA 4BNMA 3N58A 4M89A 1GTMA 2G1UA 1LSSA 1O8CA 3FNHA 4FCCA 4H7PA 4XDYA 3ONDA 1XIVA 2X7HA 4K6CA 4MKZA 1T2FA 4XRGA 1QYXA 3LF1A 4INAA 5A04A 1E3WA 4Y9DA 1KEVA 4UVHA 5T8KA 1WXDA 2HRBA 4R54A 1GV0A 1B3BA 1ZMTA 1F17A 3D0OA 1B8UA 3DAFA 5GMOA 1H6CA 1XG5A 2YHUA 3PK0A 5JXWA 3DL2A 3WFJA 3PFFA 4XGNA 4U6SA 4CQMD 3Q11A 4BV9A 5JYDA 1WZIA 3D5TA 2WD8A 1MGOA 3KEOA 4YBZA 3TJRA 3WYBA 1Y8RA 1UXIA 2FZWA 1C0KA 5EESA 2A4KA 3W8DA 4BO0A 4RQTA 5CDUA 4WEQA 3K96A 3ZU4A 1U28A 4TMFA 3UXYA 1A27A 1BSVA 4ZHSA 2PKRA 1KVUA 4J7XA 1X14A 4PLTA 5DP2A 4EI2A 2IRWA 4J16A 5L4NA 4J9UE 1HZJA 3GVCA 3SLGA 4A2CA 1ZBQA 4NHEA 4NJMB 4IDDA 1M67A 2JL1A 4Q3BA 2GERA 1PL6A 1PTJA 4KDEA 3GRKA 4BKOA 3ETDA 1MX3A 4ZQHA 4MJLA 3WTCA 3ZWOA 3CPSA 1L1FA 4OIMA 2NADA 3DZGA 4CLHA 3U5TA 2HCTA 5T67A 1ZW1A 2GD1O 4IZHA 4KWHA 1LTHR 5TX7A 1CYDA 3JYPA 4LSMA 1J0XO 1P1KA 3IQDB 4BIIA 2G76A 3DZIA 3D4PA 2VTEA 1WW8A 4AJHA 2O7SA 3ZWCA 1NR1A 2J5RA 4RPGA 3EGOA 4E13A 1GUYA 1JWBB 3CZRA 2VWQA 4J1NA 5G0UA 4CL8A 3CXRA 5L45A 1R66A 3MJVA 4O6VA 2CSUA 1HEUA 2VZ0A 4OKIA 4NPCA 2BI7A 3F5QA 1XLTA 1B16A 4HY3A 1A9YA 4UUOA 5DOZA 1YDEA 3RU9A 3UCXA 3WGIA 1TA4A 3FI9A 4ALLA 1PGJA 3C8MA 5L40A 1XSEA 3RUAA 2BF7A 3FNEA 4OKNA 4JJGA 4DLBA 5IDYA 1YL5A 3ANNA 2ZIZA 4MINA 1N1EA 3UF0A 3QHAA 1I0ZA 4R1NA 4IDEA 2W2KB 1DC3A 1XR3A 1LQUA 2DPGA 5LDGA 4CQMA 3K6JA 4I9UA 3CINA 3SVTA 3CTMA 1UR5A 1IHYA 1UZMA 3GT0A 4RO0A 1JAXA 3HQ4O 2UYYA 5LC1A 1V3TA 1YDWA 4L4RA 4CR6A 4QXMA 1GYRA 4FOSA 3GGPA 3B6ZA 2E48A 2QRKA 4DQVA 3NGLA 4YJFB 4YAIA 1T2AA 4ZQFA 1XKQA 1Y1PA 3L6OO 4RF4A 3I9MA 3U3XA 2J8ZA 1FDUA 1OAAA 3QQPA 2GZ2A 3OIFA 4FB5A 3MWEB 1NQ5A 1K5HA 1DSSG 4Z9FA 2Q1TA 3FR8A 1YH3A 2IZ1A 2VYVD 1EDZA 1HTBA 1ZSYA 4TROA 4UUMA 4B8ZA 4BHTA 4ZVVA 3Q0EA 2FPGA 5JYEA 5EIOA 2CUKA 5ITWA 1T2DA 4NNJA 3VPHA 5CPFA 4C7JA 3ZWWA 4CQLB 3DHNA 3JQ6A 1YB5A 3UN1A 5I9MA 2EKLA 3WSVA 1ENZA 3O4RA 3BHJA 5KCZA 5F3RA 3DAGA 3DDNA 1I10A 5CDTA 3H6KA 2PV7A 4IIUA 2P68A 5I7EA 4KOAA 1FF9A 1BXGB 1Z74A 3RFXA 1Y8QB 3AI2A 2GZ1A 2HK9A 1YONA 4DRYA 1T24A 4L75A 4ZRMA 2W90A 4D43A 3RJ9A 4WASA 5TC4A 4IDGA 1DHRA 1FK8A 2YV1A 3LT1A 3RD5A 1GQYA 3B20A 3QWAA 7MDHA 4MVJG 3H9GA 4E6PA 5AXAA 2ZB7A 3KLMX 1YVEI 1QRRA 1E7WA 8LDHA 5U4QA 1X7HA 2FZEA 4IDAA 4BNJA 5JAZA 4NFHA 5JSFA 4GX2A 4U6QA 1NQTA 3Q1LA 1CDOA 1OBFO 2H6EA 2VWPA 4CLDA 2NVWA 3PQDA 4LSWA 3OF2A 3JQBC 4PLZA 3RQSA 1LLDA 4B3HA 3IUPA 1DO8A 1FJHA 2OMEA 1KC1A 4DTIA 1WZEA 2FPPA 2X23A 1ZSVA 3AFNA 2BD0A 4QECA 1DHTA 3C3XA 5AXDA 4W99A 3NUGA 1NPDA 4JCOA 3I9KA 3IUSA 3GH3A 5H82A 4GVLA 3E18A 1Q1NA 3GN2A 4EEZA 4BNLA 4CR8A 4PLGA 3U4CA 3Q2KA 2PZMA 5ICMA 1ZXBA 4TQGA 3PWZA 3VZPA 1IULA 1P44A 2Y0DA 3P5SA 2SCUA 4IJWA 4BO5A 4C7KA 1GAEO 3WQSB 2I3GA 1KVSA 4PLVA 4JBIA 2PD4A 2W98A 5EL0A 5EERA 4A73A 4BQRA 1P3DA 2F00A 3GQVA 3HG7A 4EJMA 1J6UA 3DFUA 4UEJA 5HTOA 4UEOA 1W8DA 2FN7A 5C5IA 3AM5A 4OL9A 4D3DA 1VC2A 1ZXLA 3AUUA 5L3ZA 4BGEA 1LDEA 5DCWA 3HFSA 4ALNA 1GQQA 1FDTA 4HNGA 4BO4A 5DT9A 4B7XA 3H65A 4CMIA 1AHIA 2AG5A 1ISJA 4H15A 4RCVA 3QIVA 4FJ2A 3LVFO 4BKUA 3H8VA 4ZICA 4RPJA 3QP9A 3RIHA 2FHSA 2VWGA 3UCEA 2GN4A 4R69A 2DLDA 4KUHA 1J49A 2YHIB 4ILKA 2BFMA 2NACA 2CFCA 4DUPA 3PXXA 1RM4A 1TEHA 3ZH2A 3EK2A 4B79A 2B0JA 4BO8A 1CERA 4I9NA 4U7WA 1JKJA 3L07A 3QWHA 1HZZA 1P31A 1GCOA 2WTBA 4OMUA 5COBA 3LQFA 1EK6A 3JCZA 3ZCXA 3S2GA 2AEMA 4J2HA 3AW9A 4LW8A 4Z9YA 3F5SA 2GN6A 2O3QA 1ID1A 1XDWA 5JC8A 4GH5A 1LDGA 4GL4A 3MZ0A 3PJFA 2V65A 1U4OA 4NK5A 2ZYAA 1ZK3A 1LSUA 4NR0A 3RU7A 1QYDA 5B4UA 1GR0A 1F12A 4Q3EA 4B4OA 3NYWA 2QG4A 5DCUA 4UULA 3K30A 4HP8A 4J4TA 3TF5A 3E5RA 1TT7A 4WKGA 5DN9A 2H63A 5G4KB 5JE8A 4FW8A 1QMGA 3UVEA 4FOOA 4E5PA 4YAGA 1M6WA 5KOIA 5JCJD 1HE5A 1NYTA 2O3TA 5KJ6A 2VUUA 3U49A 3VKUA 4DLLA 3L77A 1CQJA 2WJPA 2PKQO 4S3MA 1RKXA 1QLHA 3PGJA 4WLUA 1OMOA 4KUGA 1H93A 4FJ1A 3DOJA 3ICCA 2P9CA 1CJCA 1GADO 4DVJA 1EBFA 1LLQA 4BNUA 1DIHA 2Y1FA 1U3WA 1B2LA 1MXHA 3HB4X 4AJIA 3I6IA 2OZPA 3PZBA 1LJ8A 4GWKA 2XF8A 2NU8A 6ADHA 1O89A 2C07A 2RHCA 3PHLA 4CV3A 5GZ1A 5BT9A 3NDJA 5COQA 2NU7A 3ZU2A 1ADCA 1T25A 5HA5A 4BGUA 5JAIA 3UCFA 4I9HA 2V6MA 1I8TA 2Q1UA 4BNVA 3E9QA 5DNAA 4XIYA 1EK5A 1QORA 3D5QA 4IBOA 4ZN6A 1U3UA 3JD4A 2OFPA 2YQ5A 2A35A 1X1TA 3AY7A 1EBUA 4FC7A 1ZMOA 4E3ZA 5JC1A 4PRKA 2OHXA 1HLDA 1ONPA 1R0SA 1EFLA 3BMOB 2ZQZA 4Z0PA 1DJQA 4XQGA 1U1IA 3QWFA 4MVJD 1IB6A 1NXQA 3GMDA 2WM3A 3MJSA 4ND4A 3DBVO 1NHGA 4MIYA 1NM5A 1SAYA 3RWBA 4AFNA 2VZ9A 4WE3A 2J3KA 4IJUA 1HDYA 2VHWA 3JQ8A 4DPLA 2ZTMA 2B4QA 1C0IA 2Y67A 4BB6A 1UXHA 3WNVA 2Y05A 1LLCA 1SC6A 4YJGB 2EKQA 4B4WA 2JCXA 2RH8A 1LA2A 3D4OA 3BMNA 4MVJP 4HXYA 2G82A 3FWZA 3DZHA 4HWKA 5THQA 4NK4A 1WVGA 5KJFA 2NM0A 1CIVA 4B8WA 3V8BA 1XQ6A 3X2FA 4YJHB 1UDCA 2NVUB 3TPCA 3E82A 1E77A 2ZTUA 4FFRA 1HYEA 3DBRB 4WNCA 1PIWA 5JFOA 4R16A 1P1JA 4NFYA 5JCJA 4YACA 1WMAA 4L9RA 4GVXA 3JQAA 3WICA 3S2EA 1C14A 2RIRA 3GAZA 4IGFA 2IYOA 1Z7EA 3H5RA 5DBIA 5TT0A 1E92A 4IM7A 5HWSA 2C0CA 1D4FA 4W7IA 1R0KA 4R3WA 2FSVA 4Y6PA 1SEPA 2PKQP 1GZ6A 3LC2O 2I3AA 3MJEA 1HKUA 3LDHA 3VTFA 3GZNA 4J4HA 1DXYA 2ZTVA 3HDHA 1DFIA 4HADA 2HAEA 3LK7A 4UUNA 5AQ1A 5EN4A 2JFHA 5L7YA 1DEHA 3S55A 1NVMB 4GKVA 3VH3A 5ITVA 2DBZA 2VWHA 3VKVA 3I3OA 4RORA 1UXJA 3IP1A 2PH5A 4XYLA 1EQUA 1AHHA 3PYMA 4IDCA 1O5IA 2E82A 3KSDO 3GHHA 4E33A 1B8VA 4BNTA 2LDBA 1EDOA 3I9OA 3WGYA 3AK4A 3RBZA 5HM8A 1ZCJA 4Y98A 1GZ3A 3ZW8A 3MTJA 3MTGA 4QFDA 4L4XA 2GASA 1PU2A 4BB5A 2O3JA 2WD7B 4EUFA 2FWMX 2EP7A 2GSDA 4MVJA 3RC1A 2X9GA 5L51A 4XYBA 1P0FA 4GMFA 1S7CA 3MEQA 2WSBA 1QYCA 5BNTA 1YB1A 4JJFA 4FGWA 3I9NA 1U4SA 1HT0A 4D0RA 3DOOA 1IHXA 3QY9A 3GF4A 2POQX 2DTEA 2EV9A 2HMUA 4B3IA 3W8EA 1JVBA 1LC0A 2AQ8A 2BRUA 1U3TA 1VKNA 1I2BA 1KERA 3P2YA 5I9LA 1F0YA 4RVSA 3NDRA 3P19A 1YO6A 4WCDA 1KETA 2GRAA 4R01A 4H3VA 1O9BA 4CM9A 3FNGA 3DBLB 3TL3A 4Z3DA 3AUSA 2TMDA 1JAYA 1XGKA 1ZO8A 1T1RA 1U5CA 4FC6A 4MIEA 3EVNA 1VLLA 3FSRA 2UUOA 4KP7A 4A5OA 3GG9A 4GX5A 4O0LA 5DZSA 1CEQA 2A92A 3U4DA 2AE1A 2FSSA 1HDXA 3ZV5A 2R00C 2VUSA 2Y99A 3DWFA 5KVQA 3D3WB 3NTRA 3OIDA 3ASVA 4Z3KA 3OQBA 3LYLA 4ROSA 1M2WA 3RBXA 3WSWA 3PWKA 1ZKMA 2BKAA 3PHJA 2XPCA 5DBGA 5BSGA 1BXZA 5C7IO 5A03A 2JHFA 3LLSA 2AQKA 2Z5LA 4RV9A 3TL2A 3TZ6A 1HF3A 4S1VA 2DFVA 2CD9A 4BNGA 5ENVA 1C3VA 3MJ4A 1LQTA 2HDHA 4NIMA 3WDSA 4BL5A 3S2IA 2OGUA 1PX0A 4LGVA 4JP2A 4YT5A 1YBVA 1OFGA 1C0PA 1E7SA 4E4YA 4BNYA 1TI7A 2LDXA 2DAPA 2EIHA 3QVOA 3DBHB 3LU1A 4J1SA 5TF4A 1M6HA 2Q49A 3GRPA 2NUAA 4D79A 3X2EA 2DUWA 2GLXA 3ICPA 1FDWA 1Q7GA 5IG2A 2OOSA 1EEHA 1HDZA 1Q7BA 1E5QA 1NVGA 1EE9A 5T64A 3BZUA 2J3JA 2R00A 1B3RA 1NNUA 1PZGA 3VOSA 3D3EA 2HQ1A 3EZLA 3GMSA 4CM5A 3R1IA 1U5AA 3LSYA 2WDZA 1VPDA 4PLWA 2DTXA 1L7DA 2I66A 3F46A 2W2KA 4I8XA 3KYDB 2HSDA 2HO5A 2X58A 1IPFA 3NEPX 1ENOA 1L7EA 2O3UA 3M1LA 2NTJA 4N5LA 1PJSA 3U4IA 3IKTA 4R1UA 5B4VA 4CMGA 1YQXA 3INGA 3JQGB 1HDCA 1P1HA 2IEBA 3FBGA 1C1DB 1E7QA 3PPIA 3OJEA 3JTMA 4XYMA 3WWZA 2IXAA 3WIDA 5TJ9A 1HL3A 2DM6A 2Z1NA 2FY8A 4HFMA 3RC9A 4FIZA 2NWQA 4YJFA 4RF2A 3L9WA 4KDFA 4JNKA 4GI2A 4EJ6A 1PZFA 1ONOA 2VRCD 4OQZA 3PHGA 3FPCA 4QFCA 4PG5A 2EWMA 1Y5MA 2Y68A 1ADGA 4IQ0A 4WECA 3TZCA 2NTVA 2DU8A 2R2GA 1R12A 5ER9A 3C1AA 2O3SA 3OH8A 1DAPA 2HJSA 3GDFA 4DL9A 4OQYA 4EW6A 3EMKA 3DXFA 2B4TO 1FDVA 1BG6A 1PGNA 3JD2A 3I6QA 2G5CA 4XQ9A 3G17A 4DGSA 4YR9A 3E48A 3QWBA 2PNFA 4YTEA 4DIFA 1H6AA 1BXKA 4WLVA 3JYNA 4E5YA 4CQLA 3DZFA 3ZNPA 4YAEA 4NH4A 2DFDA 4ALKA 2ZK7A 4D44A 4EUHA 1DFGA 2BGMA 1MC4A 3GPDG 2CNBA 2OORA 1ZUD1 4C4OA 1H2BA 2EEZA 2H5LA 1WMBA 1VSVA 4R41A 1LNQA 1PJ4A 4RLSA 3TRIA 3ZNQA 1ORRA 3TQHA 1BXGA 1DC6A 3UW3A 3HZZA 1Y8QA 3WGQA 1NHWA 1DIGA 2I76A 1YOVB 4BVAA 4YRAA 4XDZA 2HMWA 2WWRA 3JSAA 4D0SA 3RAJA 2WYWA 2FR8A 5CDGA 1ZNQO 2Y0CA 2Q2QA 4P4LA 3VH2A 1DC5A 1ZEJA 4I5FA 3S8MA 1PZHA 1T1SA 4NU6A 4J7CA 4J3FA 1D1TA 1ISGA 3MCVA 3VDQA 3JYLA 2X1HA 4DBVO 1ZK2A 3DR3A 4A27A 4UREA 4HKTA 2C2XA 1PJTA 3VZRA 3SC4A 3JQ7B 4YYZA 3GPIA 1GFSA 4WJZA 1MG5A 3DZBA 1UJMA 2BMAA 2I67A 3ZZNA 3K73O 3RASA 1PWXA 4PG4A 3DB2A 1EVZA 3E03A 3H2ZA 3DEYX 3L9XA 3PJEA 5TJHA 4W7HA 3SEFA 5A9RA 1E1KA 1HDRA 2X9NA 3EZYA 3G1UA 1U7TA 1JQBA 4YXFA 2A9FA 1WPQA 1SOVA 3AI1A 5L4LA 2PZLA 4DIBA 3I4CA 3K2EA 2AMFA 4MVJM 3OJLA 3FWNA 4NJOA 3H5AA 3K9QO 4M1QA 4A7PA 4CV2A 3NT5A 1R0LA 4DC1A 4EZBA 4MP3A 4L76A 3ZWMA 3QWIA 4BNZA 3PIDA 1LC3A 4NMHA 3STHA 2B5WA 5JY1A 2AHRA 1LRJA 3ON5A 3GG2A 1XU7A 4CLRB 1YQGA 4BO3A 3B1KA 1LSOA 5BNFA 1W6UA 1UP7A 1DJNA 2YZ7A 5KJCA 1I36A 4WLFA 1GY8A 4LCJA 2BI8A 5B1YA 3WGTA 1YGYA 5IXYA 5CPBA 3UOGA 1EVYA 1CWUA 2JCYA 2GN8A 3OEWA 2I99A 1YJ8A 2PZJA 3A14A 1QG6A 5CDYA 1I2ZA 4O1MA 1F06A 1YRLA 2IODA 2OO5A 2YHIA 3OQ1A 1T4BA 4ND5A 4DQUA 3H9UA 1QXSA 2OXIA 1T2CA 5JNLA 1U8FO 4Z9XA 3FTPA 3FCOA 4PZCA 1VE9A 3ABIA 3ZN2A 5IN5A 5TLSA 1DFHA 5TRTA 4CMKA 4CLOB 2YFHA 4MIOA 3KUXA 4R51A 3RUIA 3NTQA 1E3LA 1KVTA 3GDGA 3RFVA 2Y1OA 2IZ0A 4UUPA 1VJ1A 1JKIA 1K6XA 3JD0A 5KKCA 1AXGA 1BWSA 1E1MA 3DZKA 4JN6B 3CMMA 4HNHA 4FFLA 2EW2A 3V2HA 3HHPA 1NR7A 4TVOA 3GVIA 5CG1A 3D4NA 1HDGO 1YB4A 3D1LA 4CPDA 1C1XB 2X8LA 1PGQA 1JA9A 2O23A 1W0CA 4BOYA 3P2OA 2HKIA 3I52A 1PL8A 1YWGO 1NPTO 2DKNA 5I8WA 4CUZA 3I83A 3M1AA 4KMSA 7ADHA 4PLHA 1RYEA 3DQPA 3TZHA 1W73A 2GPTA 3DMYA 4QUKA 1MA0A 4IMRA 1X1EA 1EZ4A 1H0KA 3PIIA 4LMRA 4N5NA 5A05A 2BHLA 1X13A 4RVGA 3B1JA 4GLLA 2YUTA 3GA0A 1JU9A 2X0JA 1QLJA 4UEKA 5AXBA 4GX0A 4AJNA 1A7KA 2VNAA 3JQEA 4R9RA 3CKYA 2QIOA 3TSCA 5ILOA 4RVHA 4JJIA 1GEEA 3VH1A 4DLAA 5A9TA 1KEPA 4IS3A 3AJRA 3C7AA 5BR7A 4FS3A 2X0NA 1X15A 3ROQA 1DRVA 3AI3A 1TB4A 2QYTA 5AXCA 4JLWA 1ZEMA 2EF1A 4FR5A 2QHXA 2RHRA 1MV8A 2Q46A 4E32A 1KEUA 1ZK4A 3OEYA 4JGBA 2VYVA 1O94A 4CLEA 1ULUA 3MJTA 1DIAA 1FXSA 5L4SA 3BMOA 4BO1A 4YCAA 3TOXA 5K9ZA 1ZK0A 2Y1DA 3RUFA 2IE0A 3KYCB 4NZ9A 4TKMA 1GDHA 1I3MA 4YRDA 1B8PA 2D1YA 2D4AA 4ZRNA 4EBFA 3ADPA 2UUPA 1R6DA 2JFGA 1WP4A 2HRZA 5FF9A 4YPOA 4GPD1 1ZZEA 5L95A 2A94A 1A4UA 3L6DA 1PQWA 1LXCA 4IXTA 4XRRA 3RCBA 3BMCB 4K9DA 2Q3EA 5G4LA 4YJGA 3DHEA 3ZWBA 1U9JA 2PTGA 4RF3A 1I3LA 2X0RA 2RH4A 2B5VA 3UICA 3JYOA 3GC6A 5A5FA 3JQCA 2WEKA 3VZQA 2IDZA 5EQDA 3GN1A 4YJHA 4E2WA 2NVUA 4MVJI 5C7OO 5IXSA 2TMGA 5FI3A 4YJDA 4II3A 3GOHA 3DBRA 3Q3CA 1PJ2A 2OBNA 1N9GA 2HMTA 3F4LA 4B7CA 4EJ0A 3KB6A 3PVZA 4GGOA 1B26A 1GYPA 2NTNA 3NX4A 4XGKA 4LVCA 4R3NA 2I5PO 4IQGA 2D5AA 5K6AC 4J0FA 1MFZA 3QV1A 1KYQA 2EGHA 1OI7A 3GVXA 4AG3A 4XR9A 1BW9B 1SB9A 3CSDA 3JQ9A 1BTOA 2AXQA 4XQEA 2RBEA 1XCBA 1Z45A 5JPIA 4NBVA 4EUEA 3QVSA 3UKOA 1PJBA 1UP6A 3K92A 3ANLA 4I08A 1UZNA 5BSFA 5F1OA 4Z0HO 4CM6A 1H9AA 1HXHA 3EC7A 4TZTA 3UFXA 5BQFA 5HS4A 4NBTA 4KTVE 1NFRA 1Z6ZA 5IZ4A 1WLYA 2EG9A 4MVJH 1IYZA 2BFPA 4BMVA 3AUTA 3NT2A 3EW7A 4DA9A 5CEEA 4K26A 1ZVMA 4GX1A 4PG7A 4TWRA 3W4IA 4AJJA 1LRKA 2XXJA 5ADHA 4BO9A 2J6IA 5JY6A 1K6IA 2HMSA 5IN4A 2ZKLA 1UDAA 4DMMA 1LDNA 1P33A 2YW9A 5I7FA 3PJGA 4O63O 3GEGA 4L74A 2DC1A 4XCVA 3EUWA 4WK6A 3ZGYA 1EUCA 2O3RA 2J3IA 2WD7A 3W4KA 4BNWA 4LRSB 4OXNA 3INRA 2XAAA 2JAHA 3E1KA 3LZ6A 3ZWNA 4RDHA 2WE8A 3ST7A 3ZV4A 1LDMA 2FMUA 2P9EA 3PI7A 5L53A 1RM5A 3DFZA 3E6AA 5DF1A 4OO3A 5K6AA 2EP5A 3L0DA 1NP3A 1OZAA 5CEJA 3OQ6A 3OFSA 5U9CA 1U2DA 4N7RA 1V35A 4OYRA 2Q2VA 1DB3A 1NASA 1Z82A 3O9ZA 2AW5A 4MVJF 5KJ1A 3GZ4A 4YDRA 1U7HA 4TRJA 3WB9A 3R3SA 1NTOA 3UAGA 1XELA 3WJ7A 3SX2A 4EGFA 2B4RO 5FWNA 2EERA 2IEDA 3IAHA 1I3KA 3L4SO 1E6UA 1KIFA 4NI5A 2NV6A 3DBLA 4JK3A 4J6FA 4OOFA 3DO5A 3KLPX 3CIFA 1AN9A 4J91A 4YWJA 5CAEA 4B7UA 2JD0A 4CMBA 4G5HA 5JLAA 3VVBA 1A72A 1G1AA 1OC4A 4TVBA 1LUAA 3GEDA 3U62A 4N5MA 3DMTC 4IDFA 3PYLA 1DPGA 4J1TA 2DT5A 4CL3A 4N54A 4YAJA 3D3WA 1E3JA 1UZLA 1M75A 1LI4A 3AY6A 3MOIA 3WIEA 4M55A 3JQFC 3PTZA 1B14A 3HN7A 3KHUA 2C54A 4ND1A 1PZEA 4ZA2A 4WCFC 2Y0EA 5T5QA 3RBVA 2ZB3A 4N18A 3KBOA 3JD3A 1N7GA 2PZKA 3GAFA 3T4XA 2Y1EA 1Q7CA 3SLKA 4OHUA 4MO2A 4RPKA 3F6YA 2V6FA 4AL4A 2PK3A 3NTOA 1LBEA 2PGJA 3G79A 2H9IA 1SZJG 2FP4A 1X0XA 2WYVA 3T7EA 4J2OA 4NBWA 2Q99A 3UHAA 1LEHA 2VOJA 4CM7A 3DBHA 3BHMA 1E5LA 1RJWA 1I24A 1RM3A 1M66A 3HADA 1LX6A 1P77A 4D3SA 2VHYA 4BV8A 4Z6KA 4LN1A 2DUUA 4EDFA 2V7PA 1G6KA 2UV8A 4CMIB 2C7VA 4XX0A 3RUHA 3ZWVA 1PJQA 2E49A 3EDMA 2O4CA 3DMTA 1V3UA 4F6LA 2JFFA 3W6ZA 1JTVA 4AJOA 3H9JA 5GY7A 4RVDA 3I9LA 2NU9A 4II2A 4PVDA 3VPSA 1SBYA 3JQFA 2VYND 4NQZA 1E7MA 4GMGA 4W6ZA 3H4VA 4WCFA 1ARZA 3PDUA 2JJYA 1A9ZA 3ENKA 1PQPA 3KV3O 2ZCVA 4PFJA 1PS0A 3JQGA 1AUPA 1VL6A 3ANMA 1C1DA 5A3JA 3DONA 3UUWA 3WYEA 3KRTA 2YYYA 4XEHA 5TS3A 3ZI0A 2DBQA 4PLPA 1DRWA 2P91A 3TZKA 1I01A 5I7SA 1E3EA 5JS6A 1LDBA 4F45A 3E9MA 5CFZA 4QEDA 3ZWAA 1K2WA 4R68A 1F14A 1QV7A 4Y8VA 4QX6A 1E7YA 4M87A 2G17A 4QQRA 1GQ2A 4D42A 1V0JA 1GZ4A 2YY7A 5EQFA 3BMQB 3PEFA 4CM8B 4BO2A 2Y1GA 3WG9A 2NQ8A 3DC2A 3ULKA 2P5YA 3DOCA 2Q1WA 3ADOA 3O26A 1MLDA 3EY4A 3TWOA 4E2ZA 3JD1A 3F9IA 2AQHA 5CP8A 1DDOA 3PYXA 4WNIA 3TDKA 4P8RA 1PR9A 3CH6A 5U1PA 3HB5X 4ND2A 3BTOA 3ONEA 3SJ7A 4LVUA 2PLAA 2P4HX 1GCUA 2C59A 1QSGA 3DHYA 3HN2A 4PG8A 4DREA 4PLYA 4FFPA 3AOEC 4TRMA 4OSPA 3K31A 4LMPA 1QYVA 2CVQA 2UVDA 2VOEA 4BMSA 5ILGA 1ZSNA 4NJMA 4ESOA 4M49A 5J23A 1SNYA 1JW9B 4WUVA 1YOVA 3WBFA 4AJ4A 3HE3A 3WBBA 4X54A 3PHIA 4B4VA 3U09A 1FDSA 3HDQA 1SCUA 2ZYGA 1HLPA 1P74A 3EAGA 3PP8A 2C29D 4BKQA 4R5HA 5KKAA 3IS3A 2VQ3A 4FQ8A 1E6EA 2DVMA 4BNNA 5IAAA 4EEXA 4WOJA 3ZWYA 1YKFA 2VYNA 4JXKA 4DMLA 3HDJA 3IC5A 4I1IA 3INTA 2P9GA 1K0UA 3GLQA 4J0EA 4Q3CA 3N74A 2E6UX 3JQ7A 2VTDA 3ASUA 3PZRA 4PGFA 4E0BA 4ALIA 3QVTA 4DWVA 2NLOA 3SXPA 3TOZA 3I9JA 1E3IA 1G0OA 4NBRA 3V5NA 4CV0A 1ISFA 4CM4B 3BMNB 1C0LA 2D8AA 4MP8A 1VM6A 3AFMA 3AOEA 1RYDA 2EJWA 2P4QA 5LDHA 4HFJA 2HK8A 1NFQA 1MUUA 2X5OA 1U8XX 5G0VA 4J4BA 5IFLA 1PWZA 3V1UA 3Q9UA 1NFFA 1KOLA 2QZ9A 2ZB4A 3I5MA 3GUCA 3O8QB 3OMLA 9LDTA 1NPYA 5JCXA 1U3VA 5EPOA 4MDHA 3Q2IA 1M76A 2VN8A 3G0OA 1XA0A 3OSUA 3A28A 1NQOA 3AU8A 1TVEA 3AWDA 4J9VA 2B83A 2IYPA 4XGIA 2X5JO 3IJPA 5CHEA 4YT2A 1Y9EA 4L4SA 4BNKA 4JX8A 1ML3A
chains in the Genus database with same CATH superfamily
1R6BX 1CY6A 2JHCA 4Q5IA 1QH0A 4CKEB 4F6CA 2FAXA 5JTTA 1NUUA 1P9LA 2BFBA 2GPJA 3GEIA 4AJPA 1KBOA 3L0ZA 3BZBA 2PYZA 4HAOA 4W1SA 3PITA 4N5HX 4UXIA 1CJUC 1CZHA 2WSSD 2X13A 4WACA 1VZ3A 2R87A 3KS9A 4XLLA 1L6RA 1TJNA 5AW7A 2HTFA 2BFWA 1Q7RA 4EK9A 1KY5A 3SEZA 2ZJBA 3FYTA 2WUFA 4RZIA 1IDOA 5AOAA 3ZJ4A 4Z4GA 3OE4A 5LYJB 1ZUWA 1YJAA 3PUXA 1T9AA 1XYYA 4ETIA 4B3SB 3TLAA 3OZUA 3S5JA 4JVOA 3QPUA 1Q74A 3DW3X 5FWAA 2J7PA 1YRYE 1X9IA 5ED0A 3KAJA 1C7IA 3PC4A 4R4JA 2BDUA 1P1RA 1SCIA 4JLOA 1D6MA 3L93A 1JLMA 2F1RA 3JVIA 2FF7A 3K2BA 5JCOA 5G0SA 2XDQA 5FFNA 2GVNA 2LCQA 4TGLA 5FI5A 1H2XA 3R3YA 4DEXA 4HNVA 5HSGA 4LY9A 4C3OB 2C4MA 2YC2C 2QL6A 3TFOA 1QFJA 1O87A 1PNVA 4H7KA 2QP3A 5LR6A 3L02A 1IQUA 2FPMA 3QKIA 2K7FA 1P8JA 3QTLA 5IT9A 3KPWA 4XWGA 1M0WA 3I0ZA 4CMEC 1YXMA 4R2IA 4REOA 3M49A 4LDPA 4UFOA 3NT4A 4I5DA 4GBJA 4Q39A 4AJEA 1A5SB 4B4UA 4YXWA 4Y9RA 5FNZA 1JUDA 3KJFA 1YR2A 3OX4A 3K0HA 1NI3A 4P92A 3W6UA 2ZIEA 5J2UF 3ADCA 3NZEA 1EE2A 1GPH1 1UIRA 1F1BA 1V43A 1GPDG 1NMXA 2EWVA 2GD0A 3OICA 3TGWA 4ENWA 2VIIA 1CIPA 5KTKA 1IJFA 2HQBA 1WSDA 1IBRA 4H3SA 1E6WA 3P2KA 4PZDA 2EZ9A 4X0EA 4YRQA 5G1OA 4Q3NA 4GLJA 4L8YA 1FA9A 4PIVA 2XGMA 2ZYIA 3HXTA 4J3JA 5DN6A 4JS0A 3LY9A 4E1VA 5HBRA 4DBZA 1CS0B 4YVFA 3O4JA 3HYTA 3DEZA 4HH1A 4QAQA 5CYFA 4FWBA 4UTVA 4GF5A 1T9ZA 4ALMA 4BJHB 5GJWC 2CF6A 4ZCQA 1H3NA 1T36A 5DNWA 1CR0A 2CLDX 3MMXA 4FDAA 4K6HA 2H0QA 1CT9A 3KP1A 4TN5A 1LRLA 1MO5A 3EW9A 3HSKA 1CFZA 1C4KA 1J39A 1G64A 4M9SA 3WFZA 3LVQE 2Z5GA 3LPMA 1QV6A 5K3DA 3K0EA 1C2TA 3G1TA 5CXSA 4U02A 4CODB 4IDBA 2XY4A 2C0PA 3R7LA 5AM2A 3CVYA 3FVTA 2ADMA 2DR0A 4KI7A 7GPBA 3CRZA 3QGMA 1XRMA 3E5NA 1P1CA 1EFPB 2XE6A 4PPGA 1H2AS 2VYQA 4GBED 3TZQA 5KNLA 1XZDA 2DUNA 3EZNA 4KUEA 3FHLA 2A9RA 3GDOA 4H7HA 4XIJA 5HX7A 1V7ZA 3RS3A 3RUCA 1H94A 2ZRBA 3NP9A 4NHOA 3H9EO 4BN0A 1JE1A 3O6VA 2IW1A 2WRZA 5MGBA 1KJJA 4JI0B 4YYEA 1AKEA 1YV9A 2RHHA 2ZI3A 3D7LA 4L72A 3RWOA 3TD6A 3WLJA 4ZZ3A 3F8SA 3QG1A 1ZONA 1QGUB 3R0QA 4HZIA 4L5CA 4OBWA 2QU8A 2WWGA 2VLBA 5ALSA 3GLIB 3TDMA 1XPUA 3BAZA 1EGQA 4WDRA 3OJ0A 4ABYA 3MC1A 2CXXA 2YWJA 3IKMB 5EZYA 1EB8A 5HRUA 4X95A 3CE6A 3QW2A 2NO7A 4IGEA 2B30A 4QVKA 3N0XA 1XAHA 1F38A 1ZLXA 5DK4A 5FUXA 3UANA 4GSKA 4H7DA 3ZVLA 2ZT6A 3BK1A 4QXQA 1YCFA 1FRFS 1NBHA 5FOSA 5GM2A 1DRUA 2YHSA 1MDBA 3RYTC 1A4IA 2XVZA 4OUDB 7REQA 1F0NA 1C5KA 5A0VA 3NWBA 1EXDA 2X9VA 1REQB 3USES 2NNLD 3WMFA 3CIOA 4Q47A 2WBLC 1EESA 4LBWA 5T6BA 4HGPA 2J4CA 5C37A 3JAWB 3JARA 3QBJA 4LGMA 4ZOLA 5KWEA 4DKJA 2IF2A 1E8NA 3TSWA 1ENYA 1YS7A 1GNQA 3HMKA 4WDQA 3KQYA 2OM6A 4B82A 4DIOA 4P31A 5KYUB 2QMZA 5FR1A 1DKNA 3LDUA 1Q0PA 2ODTX 2ORYA 1U7DA 4H6PA 1OW3B 1QV9A 4RXMA 1V7QA 4CHTA 2IVFA 5CITA 2ODEA 1FZTA 3AF0A 4LKOA 1ZD3A 5I4KA 1E3SA 4MHTA 3EH2A 4A0RA 3VC1A 4AZVA 3ZCQA 1CUEA 2KPOA 5HRCA 3ZK9A 2G9VA 2C2YA 3GJZA 1N92A 4B9EA 1GZ7A 1Y3FE 2FX3A 5EGNA 1EP1B 3D8BA 1AO0A 3HJHA 3WGNA 1U9YA 1EMDA 2E4AA 2QRMA 1U5BA 3JQDA 4HYTA 2W37A 1TQ8A 4WCVA 2FFAA 4M8NE 1XRSB 4RTJA 4MMZB 1IIRA 2YZGA 1ZM3A 5AVYA 2GNAA 4ZU1X 2XOKA 1HWYA 3LT4A 5FTKA 3W5JA 3P2JA 1RABA 3BIFA 1DT3A 1OF1A 3LNCA 3FZEA 5DWQA 4XWKA 1D1SA 1UFQA 5K3FA 4BQSA 3QJYA 2D2FA 1OR8A 1MOQA 1V39A 2FR0A 2NG1A 3OFJA 3QU7A 4R31A 5AWFC 3L1IA 3ECSA 4XTRA 4JQSA 2HA2A 3VPBA 4V0SA 1P7YA 2ZVQX 3R3WA 4WINA 3S44A 3W4JA 4YMLA 4JEUA 5C81A 4X3PA 2OBYA 3DP7A 1T0IA 1CY2A 1KJ8A 1G5RA 3H8JA 1RC0A 1H2HA 5G4KA 4HAWA 1UDRA 1X1CA 4L08A 4ZT6A 2CBGA 4JOCA 4ZARA 3SZOA 3V97A 4EKDA 5I9NA 5DCYA 5LQCA 4ZVNA 1Q92A 3S7ZA 1OFUA 1DKUA 3TDNA 1XU9A 5C18A 1KC3A 3SF8A 2XWBF 1Y4DE 3IKVA 2IU4A 2RCYA 4EJFA 3VOTA 3THWB 3HO1A 1IHUA 2YBDA 3C5VA 3GEMA 4DIDA 3PNPA 4XJSA 5CUQA 4JZYA 3RT1A 1CUDA 1SZDA 2Y71A 4L7QA 4F5YA 1O0CA 1RADA 2VP4A 1CJSA 4OH7A 3OBBA 5D3MA 5AYVA 2BONA 2PX5A 1JXQA 4M8SA 2NPOA 5EKTA 4BC1A 3OPMA 4ESEA 2EBFX 1QCCA 1NVAA 1QK4A 3EC1A 3F1KA 1OLXB 4NOKA 2QRJA 3LUPA 3H42B 4EYEA 4F2HA 3NHWA 4NJEB 4L2IB 4Q3DA 2G5GX 2JCGA 3IULA 2HQOA 4KJZA 4KO4S 4YP9A 3ZVNA 3A3OA 1I7PA 1TJPB 1WMEA 1Y7PA 3IURA 3F2VA 3LUJA 2J6BA 4HX5A 1MP0A 3ESRA 5EJEA 4M54A 3WKAA 4U5QA 5AVUA 1LKZA 2OO7A 2HA5A 3CUSA 3Q85A 4LNUA 3SEAA 4OHCA 4QG7A 4YRZA 1ISIA 2H31A 4UUBA 1NGSA 3KKLA 5LQDA 4MVJE 5DBFA 5G0WA 2DPHA 2LKCA 3F6PA 4IUYA 2PUCA 2WM9B 2YFKA 3CZAA 1QGYA 1NAIA 2NSYA 4QWWA 5CDSA 1VIDA 1VHJA 4FMBB 3HCFA 2OM2A 3K5HA 1F3LA 5CHYA 5J5CA 3PPWA 3RC8A 5F52A 1FLVA 1K75A 1N2IA 3OE5A 4BECA 3A3PA 4CEIA 1HFWA 1VSUA 3H86A 3O7MA 3AO0B 1F7UA 3HM2A 1IY9A 1H5UA 1PS9A 2H1RA 3OIVA 5A7GA 1GA1A 5H02A 3U5ZB 3CU5A 5FLYA 4ZO8A 3ACDA 1JHRA 2JW5A 5CU7A 4TWBA 3NRCA 1BWPA 4V0MA 2J5QA 4DCPA 5BMOA 4J2TA 5ESWA 1M1NA 4KX5A 2BN4A 3OFNA 2GRJA 2XVXA 3TAHA 3A9CA 1ZCZA 1MNAA 4IICA 1GNSA 1SO8A 4MUHA 1ORIA 1C7ZA 2J0UB 3O0DA 4P22A 4RD3A 3L0IB 5DKFA 3DKPA 4NE2A 3DKIA 1XTSA 2EC5A 3DVSX 1ZBDA 3PPVA 5IZCA 1ESNA 2J46A 2BUBA 2C3OA 5ICSA 1YDGA 5H83A 3NEJA 1EUDA 3AOGA 1IL0A 4FWIB 4FJ0A 3WLOA 1WY5A 1IVSA 3KOXA 1PNRA 2IIBA 2OAEA 4IEEA 4LTDA 1ZC3A 1TYCA 4DCJA 5KVCA 1JEEA 3C8DA 3CVWA 4QU0A 5CFMA 2AKEA 2BGLA 5EZSA 3DTTA 2OESA 4ITRC 3IOYA 3DOEA 1QJCA 4G1VA 2XBMA 1K2VN 4O5AA 5IMSA 4YN3A 3F3SA 1P1FA 3PQ5A 3QUAA 4FFMA 2JHPA 3QRWA 2BMJA 1CUYA 1P2SA 2VXBA 3RIGA 2K2WA 4H7EA 4L4UA 3CZ5A 4WOPA 2Q4BA 1THMA 4EPTA 2A5FA 4XM1A 3I8OA 1XQWA 4NESA 3WO0A 2K4MA 4H9GA 1E62A 3HC7A 4G1UC 3O8BA 3DFKA 5HK8A 3LP6A 1G42A 3FDFA 3ITKA 4MUBA 1SWWA 5A06A 2CDCA 2CL7X 1WMDA 2YVLA 4C43A 2QZ4A 1H6BA 1A7UA 4PPYA 4M6WA 1P4JA 1PK7A 3TXYA 1N3IA 1NP7A 5HCUA 3W5VA 1NWHA 1DBVO 1M2VB 1R6XA 3L7CA 1G4HA 4HR7A 5CA1B 2W2MA 3LLVA 5JISA 4KNVA 5BVHA 2II6A 2GEKA 2X76A 3MINA 2IOQA 1EHYA 2EGGA 2Q8PA 4ANFA 4N7JA 4FKMA 1Q1QA 1WUIS 1MQSA 3EG9A 4LK3A 3LHIA 5AP9A 5EHGA 1H5QA 1N5OX 3BTUA 3FGPA 4NENA 2IZ6A 4JJ7A 1IWBB 1TKRA 3PDIA 4Q16A 5FUWA 5FPYA 5G02A 3GA5A 4C7BA 1SUPA 4JUBA 2C7PA 1T5IA 3DMDA 2O20A 3EVCA 3OMXA 5EP2A 2Z6VA 3L1VA 1E59A 3U3OA 3IRUA 4RDIA 5KHOC 1OH6A 1L7PA 4PHFA 5ABPA 4BQPA 1I6WA 2W83A 2CXHA 4Z7OB 5LP1A 3FWHA 1K89A 1NX6A 2QXUA 4L9AA 2IITA 4LYYA 4MYUA 2PUVA 5HK9A 3DKVA 3NYIA 1JTEA 5LYJF 4GKKB 1J8MF 4B0PA 3JQAD 1XFDA 3R24A 2XYHA 4RH3A 4JI5B 3B9QA 3IVMA 2FGKA 3WMGA 1Z4IA 3KQKA 5ADUS 1JFLA 3ZCVA 3TFQA 2ZDQA 3QU5A 3OE1A 2C7OA 3AM1A 1KY4A 2O2EA 1PTKA 3GFFA 3RV3A 1IOZA 2Z57A 4H16A 4HLUA 2AA3A 4ZI7B 1HTTA 1P9WA 2JFXA 4L8WB 4PHTA 3KO8A 3U3KA 1WPXA 2YJGA 3RPEA 3NWOA 1O6ZA 4AJLA 3QEAZ 5TGDA 2VO1A 4UTOA 1ODFA 1HORA 1NW9B 5EP4A 3UFBA 4BO7A 4E21A 2ETXA 2YQ4A 1M2FA 3PHBE 2EHDA 1Q21A 2P8JA 3D6AA 5KIAA 4JXXA 4JNCA 5DEIA 3HKBA 2UAGA 3V1TC 3HY4A 1T4GA 2FPPB 1NVVQ 1O96A 1Z73A 4DNFA 2GZDA 5LXTB 3K1YA 3A1CA 1G21E 1WM1A 1DWPA 2FSPA 3QMMA 4Q4HB 3ROMA 2DLNA 4PQFA 1YZNA 1SBCA 4DPKA 4UVIA 3PQEA 4QL3A 4CCSA 4I66A 5K8JB 2G4LA 1YIOA 3C16C 4Y6RA 1T8PA 2JEYA 3D81A 2ZSIA 3T3IA 1NAHA 1UBHS 2PNJA 3PICA 3TVDA 4N6OA 3DTYA 1X94A 1D5WA 1UBNA 2X2PA 3AY3A 1C30A 5BMVA 4JCCA 5HQTA 3RRZA 1RXYA 4IWYA 2RGDA 4JQYA 4P83A 4MRPA 4W5NA 1K6JA 1KP3A 1RHQA 2CCKA 2WF9A 4AG6A 5A0TA 2EFJA 2HIGA 4DY6A 4FGSA 1XRPA 3H3XA 2AQIA 1AXEA 1UPXA 3KOYA 4MKIA 1YZLA 1FDRA 1XP5A 4G9EA 4X8MA 3O9MA 3ORRA 3EZ6A 5EWLA 5FRDA 3F9CA 1D0VA 4GC5A 4JP3A 3HP7A 4F9FA 1Z13A 2CUZA 2XUFA 1R64A 4K6FA 4G0VA 3GY0A 1VL0A 3HFGA 5LNK1 4EO7A 3K9GA 3F0TA 1Z0JA 1E66A 2H5JA 1RWBA 3OOYA 4JAVC 5K3SA 4BGIA 1XTQA 3VX3A 1ZRNA 1DO2A 1KAOA 1RPTA 2B36A 1MORA 2WJAA 5LQMA 3SBOA 3AFGA 1JQ5A 1NXOA 1EFAA 5LUAA 1TZJA 4CKYA 3MCUA 3L4KA 3HCEA 4CM9D 3DS8A 4RMIA 1X6VA 1ODCA 1FTWA 1QIKA 2A5DA 1JWAB 2QJTA 3RSFA 3IL2A 4H60A 1N9GB 4BDTA 3L6CA 5FDFA 5JDCA 4MUKA 2VTBB 1NA5A 1N1GA 2VNSA 4TVOA 4WERA 4GMKA 2Z4SA 3FNFA 5DTQA 5BWLA 4OGWA 5JZOA 4IY1A 1BVYF 2HA6A 3M0EA 3GHYA 3NIFB 4C5CA 4BZZA 4MK4A 2UDPA 4F1WA 1THZA 3HR7A 2AEFA 4FX5A 2GQ0A 1UJ6A 3A27A 4BLUA 3A36A 3QFHA 3SXUA 2YJNA 1RR6A 1L1QA 1DRKA 3A1NA 1K0FA 3T54A 1GZVA 3THSA 1QIIA 4N76A 3OCXA 1VHWA 1YFLA 1WAMA 1B15A 3AB3A 3QKWA 3TR6A 3VPFA 4BKPA 4E1BA 1OLSA 3KOUA 3DDCA 4ZYTA 3BM5A 3U9TA 3DZJA 3V4FA 3L4BC 4R1OA 1A9PA 1HOXA 2V5AA 3LUHA 1F6WA 5DO9A 2QM0A 4G65A 1XCPA 3FYSA 4UMVA 3N2GA 1ZH8A 1U2SA 2IX9A 1YQTA 2RGCA 3PLRA 1OWLA 3R9WA 4DARA 2HJRA 2REQA 3AVTA 1YSCA 3S1LA 1JAZA 1WKBA 1V4VA 3A1SA 3F97A 1N6NA 4ENPA 1PSDA 2JJ1D 3VV2A 5CURA 5JXGA 4XGRA 5B5SA 3GCDA 4A03A 3KB1A 4EYQA 2G83A 2GEDA 4FSXA 3WGUA 2H1CA 4PCVA 4R1LA 4YRKA 5AI0A 2VDQB 4KQEA 4ZV4A 2H54A 5LKAA 4PZYA 3GLGE 1RMTA 3QY0A 4LVNA 2QRPA 4ZYXA 1FC0A 2C96A 2CHUA 3DBOB 3CNOA 1UOPA 2BM8A 3T5TA 2CWDA 3KSZO 1XROA 1NOJA 2JVKA 4Y2RA 3HUDA 3WB2A 2FRDC 4HZUA 4NBNA 4AJKA 1U99A 1WQ3A 3EVGA 4BLPA 3CX7A 1Y5IA 1IBKB 4DWOA 3T35A 2IOYA 4HGOA 4IILA 5LZ9A 1OTYA 3WK6A 2H1SA 3CNBA 4MPPA 5FUMA 2IZZA 3WA7A 3OURA 2AX3A 4AKIA 2GVDC 4R1TA 1IHDA 2C58A 2GZRA 2NU7B 3MHPA 4U7DA 2HGZA 1EK1A 5L3SA 1SEVA 5AJUA 3PC8A 4KAXA 4KB5A 3TQCA 2JGFA 2VP3A 4C4PA 3QMPA 1GPJA 1XC7A 4MPTA 2YNMD 2I6GA 1DTSA 1GUZA 3B1XA 5AKXA 3HVRA 3F4BA 5C8XA 3IPAA 1D1QA 1XWIA 3B3QA 4NYIR 1MA3A 4PRLA 4B17A 5C4MA 2ET6A 3RJTA 3VOAA 4C6SA 4RGVA 1CR2A 3OP1A 1XQ1A 3ZI7A 1MC1A 3QEOA 4D9GA 2JI4A 1N5DA 1Q6ZA 3MOGA 1L8OA 2UXCB 3H6GA 5DM2A 2CE7A 4C0HA 1PR4A 1D8AA 5IH7A 4CMCA 4QGSA 1OYYA 2FG5A 2X6TA 1J24A 1N5MA 3F8TA 3ND8A 4ZYVA 2XE7A 3WHKA 3IPYA 2IWHA 2O2YA 3DNFA 3JQ8B 2HSGA 1BN6A 4FBGA 4N7MA 2DH5A 3NKFA 4K8RB 3IBFA 3ROPA 3CRQA 2VJNA 2QTVB 3RFTA 5I3ZA 4AI6A 3L6BA 4NFSA 1CUVA 4IZ6A 3C3EA 5FI0B 3SHFA 2VSOA 1SPBS 3MD0A 3R3JA 1T8RA 4D8XA 1BH6A 5FA6A 1TFUA 5CXXA 5HCIA 3U4MA 1E4VA 3FF1A 1TQDA 1GLGA 1OOEA 1KEWA 3ABRB 2WKPA 4AVYA 5CLLA 4R7TA 4EHJA 4DQXA 1ACJA 3I05A 4XSHA 1WTAA 1UH5A 5E8RA 3WWYA 1P45A 4FFNA 1WDMA 1CU1A 1M8JA 2O7QA 2ZB8A 3PRJA 3S7TA 3UMYA 4OHRA 3RGWS 5IABA 1IJKA 1MIOA 2PR2A 2HC9A 2VH1A 3OUZA 4NOMA 1XYVA 2PEZA 3RVRA 4BBJA 2D2IA 1NE7A 1JLKA 2JAQA 1RJEA 4P0PB 3I32A 4MROA 5CM8B 2E5WA 2BAGA 2AV6A 3BCRA 4LXXA 4AF8A 4DXDA 5T8KC 1N25A 1XA3A 1O6FA 2FH5B 2ZSJA 2ZS7A 1PYDA 4IZOA 2EJCA 3HSYA 1DTEA 1RYHA 3CF4G 3GLVA 3ZU5A 1HE2A 5I48A 5CJPA 5LZ4A 3STXA 4Z86A 5J63A 1A98A 3F6RA 3QUBA 3I2JA 2WG2A 5KTSA 1L8XA 4N65A 1HYBA 4PSCA 1Z4JA 4ZVQA 1T4DA 4EJ2A 3OHSX 1NT2A 4IG4A 4IFBA 4BVGA 1TTTA 1QBGA 1AO3A 1UMCB 2WJVA 3B3JA 5EJMA 5G3ZA 3ZHZA 4TZ0A 1ANKA 1YS6A 2FZVA 2VATA 3EVFA 4MI1A 1U28C 3AIMA 1A9OA 3MTAA 4MVCA 4L8GA 2JLAA 2AX4A 5CW1A 5JMWA 2WT9A 3WGHA 4JROA 3EPLA 3KZ1E 4X45A 4B3JA 2QW8A 1GXSA 3NCTA 4LE1A 1W1WA 4URFA 1MAVA 1V9LA 3H1FA 1YJQA 1ZC4A 3F5FA 3JALB 3ZK7A 1KJWA 4M9QA 1RHRA 4PXYA 2PVSA 3ROKA 3ENVA 5B1EA 3KQMA 4X8OA 4ECAA 5BY2A 1TMYA 3NEAA 5K0ZA 1Q19A 5TF0A 3WOHA 3RVOA 3NIDB 2ZYDA 4MNTA 3CUKA 4D0NA 4AF7A 2NO0A 3FNHA 4H7PA 4XDYA 1PFYA 5B3JA 3ONDA 4C7VA 1OYOA 4K6CA 2CXPA 2XECA 4Z4HA 1QAQA 1RYZA 5KI6A 3CY6A 1XK6A 3N8GA 3VA7A 3N6XA 3LF1A 3EXIB 4OP3A 1AVTA 4X3CA 3ZV7A 1Z0DA 4KRFA 2YC4C 1T8SA 2PS0A 3GUUA 3SC2B 1WXDA 1E9RA 2HRBA 1GV0A 5TQ0B 4IG9A 1QO0D 1F17A 1IRIA 2ZU0C 3IHKA 4Q7EA 4TT3A 2YJ5A 3L18A 2B99A 2BHTA 5FBHA 2KS6A 5JXWA 3B8HA 4LVOA 5IARA 1W5AA 3I0NA 5LB4A 3ZDCA 1BN7A 4U6SA 2FPRA 2ZU6A 4UKDA 3IEXA 1W5SA 3WYBA 2ZIFA 2WD8A 3KEOA 4YBZA 1RZVA 5EESA 2A4KA 3W8DA 4HVCA 5CDUA 3EXG1 1VI5A 4WEQA 1Z6QA 4L4SA 2AZDA 5DP2A 4J7XA 2XUAA 3UMBA 4KK4A 2OCBA 1TTQB 4IH1A 4A2CA 4G1EB 1UK8A 3MGGA 4X1KA 4AQ7A 4IDDA 1M67A 4QJBA 2GERA 2MR6A 4WNAA 4OQFA 5DTMA 3BH7A 5F9FA 4BKOA 4UNQA 5IP5A 3RTDA 4ILEA 5IEJA 1EINA 2HQSA 5IKEA 2JGLA 1J0EA 1O6GA 4GZLA 3WTCA 3EFEA 4IDNA 3BQMB 8ATCA 5D1HA 3JU3A 1TX4B 3U5TA 1FSZA 5CX4A 1AN0A 1FMLA 2J3DA 2J4DA 1QIDA 4X7MA 3ND5A 1NL3A 1ZW1A 2GD1O 2RJNA 2Y2UA 1LTHR 4GRAA 5EMKA 1JIQA 3MK31 3VU3A 2XUZA 2R6AA 2IPXA 1G7RA 3GQBB 4A0FA 1WETA 2JVIA 3DEJA 3C5EA 2PKWA 4BIIA 5HF5A 3U6KA 3QA3E 4XDHA 4UUAA 2Q5QA 4RHYA 4PHGA 1TJYA 4YJ2A 1LWOA 2FWPA 4OL0A 3RK1A 4Y0VA 2HMAA 3LK6A 3R3UA 3UAZA 1XEFA 4HN2A 3DL0A 2GYWA 3AXSA 3OZ7A 3T5BA 3CZRA 4TQAA 2I2AA 2WMOB 3TS1A 4FWTA 1BKDR 1YVPA 4LWPA 4J1NA 5G0UA 1BCSA 3CXRA 4CL8A 1R66A 3MJVA 4O6VA 5L45A 2VZ0A 1HEUA 4OKIA 2FEMA 2XWPA 1AOXA 2VCHA 4NPCA 5ITSA 7YASA 2NUAB 2LW7A 4EAAA 1XQXA 3A0UA 1QRAA 2V7WA 1P2BA 4HY3A 1A9YA 5LBTA 2Z2IA 2YVKA 3MPUA 5KYYA 2X5XA 1YDEA 4ZI7F 1CY1A 4RA6B 2WKWA 3GEPA 2UZAA 1XXHB 2IOHA 4QU9A 3RODA 1SGWA 4FD2A 5CVEA 3UCXA 4B3FX 3WGIA 1TA4A 1ZMBA 4MJXA 1H05A 1ZJ4A 4ALLA 2Q29A 4ZEWA 4BTEA 4RQBA 3RUAA 4P84A 2TS1A 4QUHA 4R2MA 3FNEA 4BX3A 1QG2A 5IDYA 5HKAA 1T0HB 2J0EA 3QHAA 4R1NA 3AR8A 1EGMB 2G5PA 4P3XA 4QJ4A 4WZ6A 2W2KB 1LQUA 3TBFA 3QYPA 4NNOA 4HWSA 1MABB 4CQMA 3T1TA 3KQUA 2XCQA 2C9ZA 3A4IA 1CTQA 1Y89A 4LKRA 3IO3A 2JIBA 4BKMA 3R3VA 1NJ6A 1SC1A 3DM5A 4RPCA 2CCGA 2QL9A 3OD5A 4H3HB 2UYYA 3GFOA 4IJ6A 5LC1A 4GT1A 4KLZA 4L4RA 4CR6A 1N2EA 5KYXA 1W46A 2XDAA 4QXMA 1GYRA 3QVUA 2R44A 1FUUA 1P91A 3A1DA 3AEXA 5KKNB 1LS1A 5ELXA 2ZAMA 4L1KA 3NTXA 3BMXA 2BFFA 3A10A 3GJXC 1XKQA 1Y1PA 3LCVB 4RFVA 3QBDA 3B85A 3L6OO 5KAMA 1JR3E 4U7FA 2PJRA 1IWOA 3DEKA 3Q6MA 2GZ2A 2UZ3A 3D6NB 4DR2B 5F77A 1AF7A 1C8BA 4YREA 1NONA 4W6ZA 5F7ZA 1ZOPA 3TTVA 2XBLA 3ONWA 1WUYA 3W6NA 4PZPA 2PFKA 2IZ1A 2VYVD 2IHJA 2AMLA 3CUTA 4HF7A 4UUMA 2IH4A 4G1CA 2G08A 4G8BA 4HEHA 2FPGA 3QUCA 4CGZA 4JODA 1E2PA 1LF0A 1O58A 3BWDD 4UD6A 4UBLA 4DA6A 5JJ5A 5JYEA 2CUKA 3OHPA 4MLDA 5ITWA 4PPQA 4NCXA 3F7OA 2FYTA 1T9GR 2D13A 3B60A 4C3ZA 2ZRCA 3TNFA 2R8ZA 2PJDA 4UW9A 5AW9A 4KVGA 2ONJA 4JB0A 5I9MA 2ZBFA 3NB0A 3MUEA 1ENZA 3C1UA 4ZMBA 1ACLA 5GOZA 1TZBA 4CTKA 5CDTA 1XNRB 3Q87B 4PYNA 4Q9HA 3W2TA 1W76A 4IIUA 5ED4A 4IJ5A 4Y18A 1FF9A 1VCHA 3EA4A 3IP5A 5FOUA 1JJVA 3HWX1 3RFXA 4D0LB 2FVYA 1KJZA 1LPBB 2D0DA 2ZIGA 3NPAA 1KMHB 4HQ6A 4LDJA 3RYFA 4LYJA 1KE1A 1N2XA 3RWMB 2OQIA 3RD5A 1GQYA 2O0LA 4KQCA 4TYQA 2D8MA 4X91A 3ER8A 4OP2A 2R6FA 1PFKA 1CUHA 4YHHB 3P2MA 3QX3A 2QTCA 4M1SA 1W4AA 3C5CA 1YVEI 4GZ5A 1DTWA 1E7WA 2ALJA 1X7HA 5G53C 5GJBA 2DYKA 4E94A 3CYFA 3D59A 1JIIA 3HU3A 3KJQA 2C8KA 4NFHA 2PQ2A 4B3CA 4P7GA 4RJJA 4B5LA 2H6EA 1OBFO 2HXYA 1BGWA 3EIUA 1PV2A 1A5AB 4Q9JA 5HFAA 3L1JA 4C4RA 5FJJA 1YFJA 1DEOA 3RQSA 1LLDA 4B3HA 2PU5A 3IUPA 4FSDA 1QFZA 2PRKA 3GZTB 5LSAA 4MWGA 4ND6A 5DNYB 3LBHA 1WZEA 1HPLA 1NDHA 5DMHA 5BXQC 4P08A 1SUCA 2D00A 3L7IA 2D1SA 4QECA 4BFSA 5EC8A 2VBIA 1WQ1R 4BGDA 4RK1A 4QPDA 1KDVA 1OCEA 2HLHA 4R8SA 3G2MA 3L8MA 4KXNA 2OXTA 3TRFA 3GH3A 4EL5A 4GVLA 2EARA 3HGTA 1KMIY 2ZS8A 1NLZA 5H68A 1AH2A 1BQ4A 2YL2A 4BNLA 1IN1A 1GLVA 1N8SA 4PLGA 2Z8YM 5HZHA 4GPBA 1HZZC 2ZANA 4GYKA 2V0CA 2POCA 5ICMA 2ZE5A 1P44A 1GKKA 2Y0DA 3CLRD 1HH4A 1VJDA 4IJWA 1QK3A 5DX0A 3LDAA 3EGDA 1MU0A 1R4AA 3INYA 1VPTA 2W98A 4A73A 2VR1A 1WEHA 2F00A 3EFOA 4XIIA 3M4ZA 2AK3A 3BJIC 4D4IA 4HT3B 4EJMA 3VNQA 3SYTA 2DBYA 4QOFA 5KSZA 1ZI6A 3ZVRA 5HTOA 1U2RA 2CDNA 4YLGA 2VK2A 3FYUB 4NEQA 5KQSA 3AM5A 2MSKA 4OL9A 4X85A 1BFUA 4U3JA 4HH0A 2EBWA 1G5TA 4UU8A 5HP4A 1KWGA 2VJYA 4HDMB 1KGDA 3KUKA 5DCWA 4ALNA 1FDTA 4PTLA 1FBTA 4BO4A 4QBIA 2AG5A 3H5WA 4RCVA 4HS4A 3QIVA 3H8VA 4UBJA 2JIQA 1S8OA 4NE7A 1CE8A 1MJGM 2PG3A 4I1YA 2EZ4A 3ZGLA 3PE4A 1C7FA 4HN4B 5LQJA 2FHSA 4E6EA 2GN4A 5LUBA 3GL9A 3KQOA 2FW8A 1J49A 2YHIB 3EF1A 1MO4A 2NACA 4NAVA 4YS6A 1FRQA 4DUPA 2H4HA 5CTJA 5AW0A 1RM4A 1V8OA 3BXHA 5F2EA 3KJIA 5K3AA 1GT91 1WSBA 3DWIA 1COWD 1H22A 4I9NA 1KORA 2OV4A 2ZRAA 1N2HA 1JKJA 3SZLA 4DLRA 4YAOA 4CHGA 1GG5A 2YASA 4OMUA 1GCOA 3NOQA 1QTRA 1SQ0A 3L0PA 1EK6A 3V3TA 1XN4A 3ZCXA 5JATA 4A6DA 3QQ5A 4EARA 1F3OA 3SSMA 3D7RA 2R6DA 2BBWA 3WLPA 2J3LA 5JC8A 3HCPA 3V8NA 1ZXXA 2ZYAA 1U1GA 1N2BA 2G5TA 2WJHA 4NR0A 3RU7A 3HB7A 4M1YA 4AZ3A 1QYDA 5LOVB 5FHRA 3E4CA 4RESA 3TQQA 2NUTA 3A11A 3EGWA 4RK7A 5DCUA 3BXEA 5ETJA 1K7SN 1TT7A 5G4KB 2HNBA 1SG6A 3QI7A 3TZLA 4HQLA 3AVUA 1P75A 2X6RA 5LL6P 1QMGA 4QC2A 5K0JA 4N6NA 5BQOA 4NQRA 5G1PA 3CX8A 3UAYA 4GPTA 2I6QA 4N3BA 5E1BA 2O3TA 4U8HA 3O93A 1U3DA 2HYIC 2EKZA 4DLLA 2GXUA 1Z38A 3OQIA 1CQJA 3K9CA 2DPLA 2PKQO 5FOQA 3HPQA 1U3GA 3PGA1 3IDQA 1X1BA 1KI1A 3PS9A 4WLUA 1WD5A 2HRQA 1H93A 4GMHA 3DOJA 3ICCA 3L40A 4P5DA 4R81A 3R7DA 4M2LA 2AYZA 1GG2A 1DKLA 1GADO 2JLSA 1EBFA 1GNVA 2VJDA 2EDCA 2XQIA 2ZJZA 3OT1A 5AKEA 4B44A 4EGCB 1DZIA 4ZVOA 2AXEA 2Y1FA 1SC4A 2QUIA 2M6KA 4YAUA 3WLNA 4AJIA 1V47A 2OZPA 1DI0A 3VO2A 1ZM9A 4I4LA 1UQRA 2XF8A 2NU8A 1FP6A 3VPAA 5MHTA 1GTG1 5DGCA 2OB1A 4NDZA 5DEOA 2XNCA 4P4TA 2QQGA 4EY6A 1ATIA 1KRHA 2UZ1B 1RJGA 2ETVA 2IKQA 2XUQA 5COQA 1CUSA 4ER0A 2PO5A 4PO8A 1S1CA 2ZUTA 3MSCA 3M1YA 1K1EA 1VYHA 1YA6A 1Y4AE 1DNPA 2Q1UA 2WHXA 5CD9A 5JBNA 3SDZA 4RE6A 3ZHUA 1AHPA 3E9QA 2ZJYA 2E18A 2C3YA 3VU1A 4LHSA 3MJRA 2J0VA 5BQXA 3RARA 2YQ5A 2A35A 2RAUA 3AY7A 4JC5A 2YR0A 4E3ZA 3TMKA 3K16A 1MO3A 3EULA 2AW3A 4PRKA 1LK7A 2OHXA 1HLDA 2GO7A 3K0CA 2PH1A 2VF5X 1DAMA 4HYQA 4QOGA 1A9RA 4OFBA 2WAMA 1QDEA 1N5IA 2G04A 3EIQA 3LBYA 4IO1A 1OBCA 4CDRA 1XZGA 1NXQA 1N6IA 5FJIA 2QUAA 3GUZA 1V37A 3MJSA 4UTZA 4FGJA 3L7BA 2P2YA 3V8MA 1A4RA 1SAYA 2CDRA 2V4MA 2VZ9A 4UC0A 4WE3A 1Q77A 3D6HA 3E7DA 1N4AA 3TIVA 4B3XA 2E0IA 4EHNA 2XUDA 3WADA 4RTRA 1W44A 3GRUA 4BB6A 4DMFA 4HDKA 3WNVA 1T1IA 5ALWA 3O9VA 1QCYA 4EGQA 3PJRA 1GIAA 1A2QA 3OU6A 4IDQA 5BPHA 4KHPB 2XT6A 1RC1A 1PW7A 3IA7A 2JCXA 1PVDA 3D4OA 3RC1A 2XMPA 2G82A 3FWZA 4I6GA 1A4XA 4C3UA 3LI2A 1YCGA 1O2DA 3N6RA 3E2MA 4N5DA 3VKGA 4Z54A 3ZDEA 1HDIA 2PCLA 4RX1A 1XQ6A 1YOBA 3CCFA 2JJMA 1PV1A 1U04A 1YASA 2VKQA 1G20A 3G2NA 4OU5A 3EGEA 4QGBA 3A1EA 3N2ZB 2FRXA 3E4DA 1ZH6A 2M6LA 4JYAB 2BKUA 2B9EA 1PIWA 3EQ9A 4L28A 5T4FA 3LDFA 4R16A 3NC0C 3R75A 1XZIA 1SBQA 1D6NA 5FH9A 5JFOA 3CTPA 4D74A 3GXBA 1AS3A 4JBLA 4RVNA 2PEYA 1C14A 1ST3A 4QDKA 1VI6A 3D8SA 4BYMA 4ZDIA 2HR1A 1W36C 1C3LA 1QQTA 4N0DA 4H4CA 4W7IA 2P9YA 3FSJX 3HEBA 1WSAA 2XV1A 5CFNA 2YICA 3NOVA 3OEEA 3HBFA 1Y6RA 1YZYA 1Y3CE 1FQJA 3OLCX 2GJKA 5ELMA 3GZNA 3OCYA 4OVKA 4JYZA 2AOTB 1FLNA 5AIBA 3IXMA 4HADA 1SOMA 3LK7A 4IMJB 1FX0A 3KTAB 4MS4B 1OXXK 3AILA 4HJRA 5AQ1A 3TBHA 5C5EA 2JFHA 2PUHA 2PZGA 1JXAA 3BG5A 3FVQA 3J7TA 3LBAA 5L7YA 3EOAI 3WWCA 4PBTA 1GSIA 5D86A 3QLUA 5ITVA 2G72A 1Z6XA 2VWHA 4INZA 5LP6C 3VH3A 3BKWA 5FUQA 3I3OA 2X8BA 3K70C 5F1YA 1G6Q1 2PH5A 4XYLA 3COVA 3N2IA 3V7NA 4TS3A 1O5IA 3AC0A 3KSDO 5EA2A 1Y8ZA 1LBIA 1JDSA 2CMHA 3GHHA 4E33A 4MTCA 4BNTA 1AJEA 8MHTA 1RAFA 2OAQ1 5EE5B 5C80A 1P6QA 2ODQA 1MRSA 2XUKA 3FGOA 4GZ3A 3FX2A 1GZ3A 2GBIA 3ZW8A 3MTJA 3QJGA 4KREA 1V2GA 2ATIA 1DWOA 3E7WA 4L4XA 4A91A 1EUCB 2PQMA 1S8FA 1ZD1A 2CZQA 3EVBA 5LLDA 2FWMX 1U11A 5FBVB 3SG0A 5L51A 3ZOKA 1E2QA 4AQYB 3FXAA 4FONA 3KEFA 2XNKA 4YGXB 3UV7A 1NN3A 1S7CA 2W6JA 1G60A 2WSBA 3IGFA 1EWKA 1NJ1A 3AZOA 3QLTA 4TMZA 1XZCA 3SOPA 4AULA 4MWZA 2CV1A 2Q4RA 2Y1XA 4TLEA 2R1VA 3PWTA 1IHXA 3QY9A 4FBLA 2ZBPA 2DX7A 3ZW7A 1ZG3A 2DTEA 3M4XA 3GT4A 1IONA 3AW8A 4CT4B 2A9JA 2IZ5A 3QXHA 4GR9A 1NZDA 1VKNA 1I2BA 1XMPA 2HXSA 2QUZA 1KERA 1E2DA 1EVEA 3PUKA 3VOBA 1F0YA 1XRNA 4O4IB 5TE9A 4DT1A 3UENA 2IPMA 3MT8A 4R01A 4B2IA 1O9BA 1ZH4A 4BXOB 4Z3DA 1U0TA 4CI0B 1XGKA 1TU4A 1ZO8A 2ARKA 1M6NA 1W88B 3RYIB 3M5CA 4JH0A 1IJEA 3BXPA 4AY2A 5K8IA 4AQDA 2VT6A 3GCWA 5EMNA 4MLZA 4LZAA 4WMLA 1RMQA 5A4MS 2REXB 1EBBA 1U6IA 4DR5B 3U4DA 4RGQA 3UAXA 2YWEA 3QNUA 1Z5NA 3VV3A 3BA6A 4OPMA 1O96B 1TE2A 2Y99A 4W8OA 1NW4A 2R79A 3TIIA 2PIAA 1CF4A 3OIDA 3IVAA 3OQBA 4N41A 1AQYA 2R8BA 3RBXA 3WSWA 3E3NA 4IV0A 5H7XA 4DJTA 3T1VA 2XPCA 4NCHA 1KQGA 5BSGA 1Y8AA 1JMYA 5BSRA 5C7IO 3RVJA 3BKXA 3MPOA 2G9ZA 2ZIUB 3O73A 3LLSA 3G0CA 2CLMB 1TAQA 4PS1A 3OPNA 1J9EA 3EDCA 1SVUA 1HFEL 5SY9A 1XALA 5B2EA 1VMEA 2H4FA 3KPJA 4BNDB 3T9FA 4JT9A 2AR7A 3B5JA 4I4IA 4C6TA 2XMDA 2B3DA 3M4YA 4X7PA 2HDHA 3WDSA 3THXB 3C8ZA 4RACA 3ZGXA 4O8ZA 1A77A 1PX0A 1NE2A 2FP4B 1OFGA 1PKXA 5AKIA 2H3EA 4ID3A 4E4YA 2XWJI 1AA9A 4IX1A 4I50F 1TI7A 2LDXA 1BC5A 1FVHA 2DAPA 3AV3A 1R8XA 3I5AA 3JVUA 4KGXA 4O1IA 4FR2A 4BX0A