1B14A

Alcohol dehydrogenase from drosophila lebanonensis binary complex with nad+
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNTTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ALCOHOL DEHYDROGENASE
publication title The catalytic reaction and inhibition mechanism of Drosophila alcohol dehydrogenase: observation of an enzyme-bound NAD-ketone adduct at 1.4 A resolution by X-ray crystallography.
pubmed doi rcsb
total genus 97
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 1998-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b14A00
2EHDA 2GN4A 4EEZA 2RIRA 4DRYA 3ONDA 4RGBA 3DHNA 4RO0A 3DMTC 2R6JA 3GRKA 3UCEA 4RDIA 1LDGA 1G1AA 1MUUA 4G5HA 1UP7A 3G3EA 1NM5A 4Y9DA 2O7QA 3GZNA 1HL3A 1HYHA 1VPDA 1XSEA 2GN9A 3TFQA 3BYZA 1Z45A 1U4OA 1E1LA 1LSUA 2W98A 1LTHR 4CUKA 3GEMA 4CLDA 4R54A 3SXPA 3M1LA 3HDQA 4HWKA 1R4NB 2J3IA 3QV1A 1ADCA 2FN7A 5HS6A 2VCYA 3DMYA 1ZUD1 4GVXA 1V0JA 3FR8A 4AJEA 1IY8A 3T7EA 3DZBA 1ISHA 2ZB4A 4Y6PA 1GYRA 4IQ0A 2PK3A 4E2WA 2IZZA 1YBVA 3PLNA 5EESA 3DZFA 2WD7A 1NX6A 1P74A 2YQ4A 1D4FA 4GSLA 4AJJA 3W4KA 1ZK1A 2PWZA 4M89A 2FPGA 3QVSA 2Y1OA 2P68A 4AJ1A 3UOGA 2WDZA 2WYVA 4L4XA 4Q9NA 1MLDA 1HSZA 2YHUA 4GVLA 3TSCA 2Q46A 5H82A 4XYBA 4FJ2A 3PJGA 1DIGA 1GL3A 1DHRA 4DXHA 2EV9A 3CKYA 4TWRA 1HDXA 3FPCA 1T25A 4AJ2A 1AXGA 1JN0A 2C5EA 1LSSA 3L6DA 2VZ0A 3SJUA 4OAQA 2PTGA 2J3KA 5ER9A 3DBLB 4CLOA 2RAFA 3V1TC 2E4AA 4EUEA 3WGYA 3D4NA 1WMBA 5I7FA 5AXCA 3DXFA 1Q7BA 3W8DA 1LDBA 5A1TA 9LDTA 2PGDA 5BNTA 4MKRA 2ZIZA 3AFMA 3LSYA 2VT3A 2NU6A 2XF8A 5HS4A 3RUIA 3SLGA 4NDNE 3PHGA 3I5MA 4TRMA 3GVIA 4N54A 1E5LA 3W6UA 5KVQA 1O8CA 1E7QA 2VHVA 3PZRA 3FI9A 2FR8A 3I4CA 1H94A 3VVCA 4BNXA 2E37A 2BGKA 4TZTA 4GBJA 3ZHBA 1SMKA 5JMPA 2PH5A 1BGVA 1UDAA 3L9WA 4R4JA 1XU7A 4UUPA 2HU2A 3BMOB 4N18A 2WSBA 4ROSA 4PN3A 4RVGA 5CP8A 4XRGA 1ONOA 2Q1SA 4GX0A 4IZHA 3CMCO 4D7AA 1YO6A 4FC6A 1IL0A 3I52A 4OSPA 3L4BC 4GWGA 3H8VA 4IDEA 3I4FA 4W6ZA 4ITUA 1Q7GA 4XQEA 4JN6B 2JHGA 5DCYA 5LC1A 5L45A 3GAZA 1R6DA 2BD0A 4E6PA 2YFHA 4XQCA 4KDFA 2JAPA 4UVEA 3B70A 2VOJA 4DTIA 3H2ZA 5L53A 1R15A 1ONPA 3F46A 4E5MA 3VOSA 4PG4A 1M66A 4XJTA 3C7CB 4YEDA 3PLRA 4WEOA 1DC6A 4CUJA 1Y7TA 2X9VA 3QWBA 5JS6A 5HRUA 1GYPA 4XA8A 4YT4A 4PZEA 4DPMA 2XXJA 4MVJE 4Q3BA 1ZKMA 2DC1A 3JD3A 3JQBC 4J0FA 2QX7A 4D3SA 3FBTA 1RM4A 5A3VA 1VL0A 2PA3A 4WECA 1YDEA 3GUYA 3O26A 4FSHA 1ZSYA 2C20A 3TZCA 5G2OA 4IXTA 3PHIA 4KWHA 4YQZA 3IUPA 4B3JA 1K6JA 1Q2XA 1X0VA 4B4VA 2A92A 3C1AA 1E3EA 2X86A 3H7AA 2E49A 1IHYA 1PWXA 3LU1A 4PLWA 1NWHA 4LSWA 2DBRA 3ZWAA 2UUPA 2C2YA 4NJMA 5JC1A 1BW9B 4O63O 3ICCA 4XB2A 1I36A 2G76A 4L0QA 2Q2WA 5ITVA 3ZWMA 1BXZA 1TI7A 4ID9A 4II3A 1NFQA 4PVCA 3K6JA 1D1SA 3WMWA 4IDBA 1ML3A 1NR7A 3E6AA 4DPLA 1ZNQO 4BIIA 2NVWA 4FR5A 4KUHA 2W2KB 2Y1GA 5BSGA 1TT5B 5EERA 5KIAA 1M6HA 1AHIA 1E7WA 1BDBA 3G49A 4AJIA 1HDZA 3INGA 1G0OA 2VTDA 1EUDA 4FOOA 4IDCA 3M2TA 3PYLA 3LF2A 3TQHA 1UDCA 5JMWA 3ZW9A 4IIVA 3GR6A 5BT9A 3WWYA 3WFJA 4ALLA 2Q45A 3K31A 2GYYA 4CLRA 4HX5A 4EGFA 5I9MA 4GH5A 3PIDA 4OMUA 2CDBA 3DZJA 4FFRA 4I9NA 1EE2A 1H6DA 3I9NA 1UAYA 1KC1A 3IKTA 4WLUA 4LK3A 4BNJA 1P1RA 3OJOA 3JQAB 2BH9A 2GERA 1FDVA 1IPEA 1DJNA 1P3DA 2B36A 4LMPA 5AVOA 5TSDA 3OJFA 2ZTUA 4J1TA 1GDHA 2EG9A 3DBHA 1R12A 2V6FA 2YHIA 4OXYA 4DIFA 5L7TA 1LQTA 4GL4A 3WMXA 3KYCB 3JQAD 3C8MA 3ZU3A 4CMGA 4NBUA 4UUMA 4WLOA 1E1NA 5BNFA 3GFGA 3ZNQA 5GZ1A 2HMUA 2X6TA 3WR5A 2D1YA 4BO3A 1YOVB 1DOHA 1C1DA 4HNGA 1NAIA 3W4IA 1FDTA 1KETA 1LC0A 1NVMB 2VZ8A 4EJMA 5JO0A 5JPIA 1ZJYA 3P2YA 4UVIA 4BMNA 3RBVA 2DM6A 3N74A 1EQ2A 2OMEA 1EZ4A 1N9GB 2JAHA 4GSKA 3ONFA 2Q49A 3GAFA 1E6UA 4DBVO 1HDYA 1R4MA 4UEKA 3C1OA 3OBBA 4R41A 2B4QA 1O9BA 2P4HX 1YJQA 1H93A 2Q99A 5JBIA 3FHLA 1Y5MA 4CM5A 1UXJA 3HADA 3HWRA 3UUWA 1R0SA 1PR9A 4R51A 3VKUA 3GPIA 5DP2A 3HFSA 1H0KA 4KTVE 3RUCA 1EK5A 4JX8A 4RF5A 3H5RA 1PU2A 1HKUA 2JFGA 3LLSA 1I0ZA 4O5OA 1X14A 4E5PA 4CM4B 4D3DA 2WJPA 4XWYA 3KETA 2AQIA 2C2XA 4BNLA 2P4QA 1XDWA 5JNLA 1CDOA 1B8VA 3JQ8A 3QVWA 2J3HA 5G0TA 2PLAA 2I67A 4BV8A 2RH4A 4K6FA 3RVDA 3X2FA 3NGLA 3JSAA 2X8LA 4PLGA 2NVBA 1PS0A 4FFOA 2HJRA 4E0BA 5FWNA 2O23A 4YT2A 1PL7A 3JQGB 4CM1A 1NYTA 5ILGA 1PIWA 4IJUA 1H9BA 4BNZA 2X58A 4OYRA 4ZGWA 5ITWA 1V35A 4CM9A 5BSFA 1QV6A 2OL4A 4HFNA 4FC7A 4I5EA 3RI3A 4A2CA 3V8BA 2DBZA 3NT2A 1P0FA 1P0CA 2OP1A 3JQ9C 5DOVA 4E3ZA 3BAZA 3BHMA 3CZRA 3QHAA 2NM0A 2Y0DA 4DREA 4J4HA 3FBGA 3C1TA 3K5PA 2ZQYA 4ZQBA 3JD1A 2PZLA 3JYNA 4WCFC 1E3JA 2Z1MA 5CG1A 1B0AA 3GZ4A 1HZJA 2BKAA 2HK8A 5EJ2A 5C37A 1BRMA 2J5KA 1O5IA 5B4VA 5I9NA 1K6XA 1KYQA 1I10A 4YTEA 4IJWA 3VDQA 2IYPA 2B37A 4IQ8A 4J4TA 2CVZA 2O3QA 3JQFC 1WPQA 2PY6A 4A03A 4JBHA 2VRCD 1V3UA 5G0WA 4DPKA 2E82A 5COAA 3L4SO 4WCFB 4LN1A 4QX6A 2ZK7A 1I2BA 4ND4A 3WNQA 3OETA 3UICA 3O03A 3WGTA 3K92A 5AXAA 4YB8A 4Z0HO 4IDFA 5TGDA 4U6QA 3BMCA 1L1FA 1T4BA 1JDJA 4H3VA 3D3WB 4YYZA 3H65A 4PVDA 2CDCA 1NVGA 2NU8A 4BQRA 3OEYA 3DZHA 4XR4A 3TZ6A 2NU9A 3IQDB 5DOZA 4Z9XA 1GQYA 2BFPA 1JWBB 2O3UA 3KYDB 3PK0A 3RFTA 4CQLB 1C1XA 1TEHA 1EVIA 3MTJA 3RU9A 1B16A 4OQZA 5KJEA 4HP8A 5AQ1A 1NNUA 3H4VA 4BNUA 3DQPA 4KUGA 3MWEB 2ZTMA 5GY7A 3ZI0A 3H5NA 1QLJA 5TT1A 4Z9YA 1SAYA 3WXBA 4R9RA 5IXYA 2DLDA 2F1KA 1R0LA 1I32A 3GN2A 5BSEA 1YONA 5JDCA 1LDMA 1B7GO 5DF1A 4CL3A 3D7LA 1PJ2A 1ZVMA 1EEHA 1PZFA 4H15A 3HDJA 3RUHA 3WYCA 4OGWA 3IOYA 2JCXA 5LDGA 4JGBA 4OH1A 3GG9A 3JQ6A 2ZCVA 5A5EA 1SC6A 2D4AA 4GPD1 3ASVA 2HMWA 3JYPA 2PR2A 3WYBA 1YQXA 4RLSA 1B8UA 1ISMA 5AXDA 2G17A 4FIZA 1PL6A 2RBEA 1Z75A 4AJLA 2AEFA 2QQ5A 1WWKA 3ETDA 1XQ1A 5ADHA 2NQ8A 3RWBA 3ZDFA 2CFCA 8ADHA 1SOVA 2AA3A 4YJHA 1EFLA 2Y1CA 1EVYA 2YQ5A 2X7HA 4DGSA 3RBZA 4TMFA 4NHEA 3COSA 2WYWA 4IUYA 1ENZA 1TXGA 2I65A 3NUGA 4E5NA 4OKIA 2PGLA 3O4RA 3U4CA 1CIVA 1ENYA 1HYEA 1BXKA 5TT0A 1GPDG 5HWSA 2O48X 1WAMA 3AK4A 2GD1O 1PZEA 4RF2A 5U4QA 4WPGA 4B7XA 4X54A 1WW8A 2Q4EA 1PGJA 1QMGA 3OA0A 1KVRA 5JYDA 2G82A 4WCDA 3PQEA 3I83A 4M54A 1HDRA 4TRJA 4YAJA 3ZNOA 2H1SA 1GU7A 1G0NA 1DO8A 3UCFA 1HSOA 1P33A 4MVJD 1CWUA 1XGKA 3U0BA 4B79A 4UREA 1NHGA 1EVZA 4F6CA 1DRVA 5IFLA 4LVCA 2B35A 3UW3A 3UFXA 3WBFA 2NTJA 2DAPA 4O0LA 3PWKA 1DIAA 1ZFNA 2DT5A 2QG4A 2QRKA 3GLQA 3OQBA 3RUEA 5CPBA 5GZ3A 3R3JA 2FZEA 2WD8A 4NG5A 3JQ7A 1IULA 1QP8A 1Y8RB 1U3WA 1Y6JA 1Q0LA 4MVJG 3K9QO 1ZCJA 1LC3A 2EJWA 3NEPX 4IGFA 4CM8B 4XGKA 3LYLA 4RV9A 1HDGO 5LCXA 2VUSA 1ZXLA 1GEEA 2ZJ1A 1AXEA 4PGFA 3F5QA 1HWYA 2EP7A 2YV2A 4TRNA 3HB4X 1YRLA 4XRRA 4R1NA 5JDIA 5EINA 4B4WA 4NR0A 2VZ9A 3RUAA 3VTZA 4D42A 1DBVO 4UEJA 1LJ8A 4BUCA 4DWVA 2GZ1A 1UZMA 2D8AA 2DPGA 4C7JA 4D41A 4IJVA 3BMNA 2JHFA 5C3MA 1CRWG 1SEVA 3G0OA 4XGNA 2JCVA 2ZYAA 3RC9A 4XD2A 3KVOA 4E2YA 4M8SA 3AFNA 4MP6A 1T1RA 1T26A 3OP4A 5CDGA 1O0SA 4A10A 4I8XA 3WIDA 3QVXA 1P44A 3PI7A 4KDEA 1TT7A 2BI7A 2I3GA 1ULSA 4Y6SA 3Q0EA 4BO1A 4C7KA 4DUPA 3CZMA 3S2FA 2WEKA 3GPDG 5KTKA 4P22A 3VKVA 3DTYA 1DC3A 4WLEA 2JD2A 2WWRA 3VAZA 4K1LA 4CQMB 4Z3KA 3DWFA 4BVAA 5BR7A 1SCUA 1EBUA 4UVGA 1GQQA 4AICA 2VHWA 1N7GA 2B4RO 1QR6A 1P45A 1RYDA 4WLVA 2EJVA 4JJFA 2X5OA 4JJGA 2YV3A 3GOHA 1JKFA 4CQMD 4E2XA 4B3HA 3KV3O 1GD1O 4GMFA 3PHLA 3QRWA 3AI2A 5A4DA 5LDHA 5JLAA 3GY0A 4DIBA 4E5KA 3WLEA 2X0NA 3E18A 1GZ3A 1H6BA 1U28A 1A7KA 2GF2A 5T64A 2O4CA 5JY6A 1CQJA 2AEJA 3EZYA 1I3LA 4PLYA 1HXHA 3CMMA 4CJXA 3EYWA 3D3WA 5C7IO 2EW8A 2ZJ0A 4IPTA 1DRWA 3IJPA 5FF9A 2GNAA 3GC6A 1WLYA 1GAEO 2PGJA 4PLTA 2YDYA 5DNAA 1T2FA 3FRJA 4LISA 3ZCXA 1R0KA 1VKOA 4KMSA 5I7SA 4NBRA 4IDAA 1QV7A 3UCXA 4P4GA 4WOKA 3WJ7A 3V1UA 3ADPA 3PHJA 4NNJA 2EP5A 3SX2A 4A7PA 4DA9A 1YXMA 2DBVO 4D44A 3WICA 2CDAA 2QYTA 5HA5A 2V6MA 4J9VA 2OZPA 3OM9A 3U62A 3WDSA 1DIHA 2QZZA 3M6IA 4TROA 5A04A 4BNGA 4CUZA 4CMHA 2B5VA 3ZWCA 4J9UE 1PGOA 1KEPA 2WTBA 1BG6A 2TMDA 3TNLA 4CPDA 3F1KA 1CF2O 2ZB8A 3EVTA 3JYLA 4N5NA 5T67A 2QZ9A 3EUWA 3SBOA 5JFOA 1IB6A 1U3UA 1LDYA 2EERA 2UV8A 3VC7A 4AJ4A 3DHYA 3WGZA 3OH8A 2P9GA 4BGEA 1T2DA 4MVJH 4PCVA 5A05A 5DP1A 5I8WA 1SNYA 2YYYA 3N58A 3PGXA 5TIIA 3OA2A 5U9CA 1GV1A 4FOSA 1X0XA 3OEWA 3RBXA 3LLVA 3HG7A 1ZMTA 3Q2KA 3OHSX 3DC2A 4CV2A 1UXGA 4CM3A 1BXGB 4IBOA 4WGGA 2HDHA 4G81A 1T2AA 1Z82A 4FJ1A 3VH3A 3E1KA 4FW8A 4WNCA 3CSDA 1VI2A 2X9NA 1KVQA 3O8QA 4KUEA 2IODA 4ZVVA 1IOLA 3JD0A 4MO2A 3RJ5A 3I9LA 3DDNA 3ZN2A 2PZKA 4BO0A 1U3VA 5JO9A 3WLFA 3NAQA 4AVYA 2IZ1A 3L9XA 4E13A 4MVJA 2HK7A 3U4IA 1UDBA 3DBRA 2X0JA 3RFXA 3V2GA 3LC1O 1HLDA 4OO3A 3W1VA 3QVOA 3GDOA 2TMGA 2VTEA 4IM7A 4R1TA 1LSOA 4BGUA 4QT0A 3MJCA 1O89A 5H83A 4GX2A 1EDOA 2GO1A 5F21A 1TLTA 5L95A 5K0ZA 4J7CA 2NVUB 1YL7A 4PRKA 4MIYA 5JCXA 3I23A 4CM6A 4FJ0A 3VH4A 1X7HA 2Q2QA 4QXMA 4CMBA 3INTA 1YL5A 4U8GA 5THKA 1WDMA 1PSDA 4JNKA 3OJEA 1WZIA 3U9LA 3ZWYA 4LSMA 3PPIA 3LQFA 4OOFA 5G0UA 4YXFA 3U5TA 4RPKA 3HDYA 1GUFA 1P1JA 1Q0QA 5MGBA 3OQ6A 2J5RA 1CEQA 4BNVA 3BMQA 4J7XA 2J6IA 4CMIB 3KOUA 3KM0A 3RQSA 4E31A 4IJKA 2PZMA 3RIHA 4PLPA 1TB4A 2C7GA 1O94A 1GEGA 2H9IA 3GNQA 3H9JA 4PFJA 4A73A 1LLQA 2C5AA 3DFUA 4FN4A 4DLLA 1F0YA 4JP2A 4JQCA 1DAOA 3GRPA 4FPXA 3A28A 5FYDA 1ORRA 1PZGA 1X7DA 3TRIA 3E9QA 5CEJA 4GKBA 4P4NA 2BFOA 1NFFA 3K30A 1F8FA 4NJOA 2OP0A 1NAHA 1B8PA 5BNIA 5CDSA 1CETA 3ENNA 1A9YA 5JW6A 4XIYA 2ET6A 3SC4A 4EUFA 4XQGA 2P2SA 1LLCA 1WMAA 3ABIA 4BOYA 4TRRA 2Y1FA 1E3WB 2EXXA 4RJTA 1H2BA 2GSDA 1EBFA 5COQA 1U3TA 5G0VA 2PD6A 2AW5A 4JIGA 2FPIA 3GN1A 4J49A 3B20A 5T6BA 2YFQA 3WGQA 4YDRA 2YW9A 4JCOA 5JAIA 3Q6IA 1DRUA 3GVXA 1MXHA 1U5CA 4WE3A 2CVOA 3ZNPA 3ZWNA 1Z7EA 1NQTA 4RZHA 2CF6A 3PZBA 5H81A 1L7DA 2BRUA 3G17A 4W9NA 4C4OA 4UUOA 5A9SA 1JU9A 2Y93A 4BNMA 4FGWA 1OOEA 5L40A 3GDFA 1Q0HA 3MOIA 4EZBA 4WLNA 1SB8A 3FNEA 3NGXA 2FWMX 3FR7A 5F5LA 2Q50A 5TLSA 2LDXA 4ALJA 1XQ6A 3VPXA 3EDMA 1W6UA 4FCCA 2Y68A 4RPLA 4OJNA 2P5YA 1A4IA 3Q3CA 2GN6A 3WG9A 1SBYA 1GR0A 3P7MA 2W8ZA 3E82A 5EQDA 4WEQA 1HE2A 4G2NA 2WE7A 5IJZA 3TFOA 4EITA 2ZYDA 1Y8QB 5CEEA 5DN9A 5F1PA 3JQDA 3PWZA 1DFGA 3F3SA 4PG7A 5G4KB 4TZKA 3GQVA 4P38A 1ADFA 1I3MA 2IE0A 5TRTA 5IG2A 2DKNA 3ONEA 3DAFA 1UXHA 6LDHA 2VNAA 5KWEA 3IIEA 2AXQA 2PKRA 3KHUA 1H6AA 1KOLA 4GKVA 3CTMA 3PYMA 4JLWA 1D3AA 5JDCC 5IF3A 1LUAA 2P9EA 3AM5A 2ZTLA 2A9FA 2QYSA 3Q11A 5TF4A 3RUDA 4JBIA 2X4GA 4S1VA 4XCVA 4ZQEA 2UVDA 4A26A 1DB3A 5F5NA 1U4SA 2POQX 3ANNA 2D5AA 1P1FA 5L7WA 1RPNA 3AUSA 1WNTA 1Z6ZA 3E03A 4NU6A 2XOXA 1XCBA 3VH2A 3OF2A 2D0IA 3DO5A 2E48A 2IEDA 3F4LA 3HJAA 3P2OA 3PRJA 3QY9A 4GLOA 4Y8VA 1U5AA 4OL9A 1R4NA 4YAIA 4F6LA 4MIEA 4B7UA 3EHEA 5IDQA 1BVUA 1Y9EA 1Z7BA 4PG5A 1KY5A 1DLJA 1KY4A 3PGJA 4TQGA 4W7HA 4RZIA 3VPSA 4Z0TA 4NFSA 4YJFB 5KVCA 4J90A 2D59A 2NADA 3W4JA 4BO9A 5IZCA 2DFVA 3LT1A 1NXQA 2W90A 4Q3CA 1ZO8A 1NPDA 2GASA 3P5SA 1N2SA 1PGNA 3V1YA 3HQ4O 4ESOA 4J91A 3RCBA 2JD0A 5TJ9A 4UULA 1GV0A 3ON5A 5DBGA 1W73A 1JAYA 1J4AA 1ZSVA 1BMDA 1J6UA 2QRLA 3KRTA 4Q3EA 2C07A 3ZHZA 2I99A 2FPPA 4I9HA 1JW9B 2XAAA 4YJGB 1N92A 3DBLA 5K9ZA 4GQAA 1PJBA 1ZZEA 4UVDA 2CMDA 1NQAO 4GGPA 1HDCA 3BTOA 1CQIA 3BXXA 2QIOA 3L6OO 4RL6A 4J43A 1JQBA 2O2SA 4D45A 3L07A 1OBFO 2X1HA 4JP3A 3HN7A 1I3KA 3HHPA 3LDHA 7MDHA 3OICA 2VYVD 4NMHA 4CR6A 3AI3A 3L77A 2AEMA 3F5SA 4OM8A 1T24A 1ZEJA 3QWIA 3U4HA 5TC4A 2AQKA 2DUWA 4N5LA 3CEAA 5IDXA 3K96A 4Q3AA 4KWIA 3RUFA 1BHSA 1JKIA 4B7CA 5JY1A 5KJFA 4W99A 3S2IA 4W82A 2O2YA 4LW8A 1DFIA 4L74A 5JDIC 1KEUA 5A9RA 2H5LA 1V3TA 4TVBA 1PJ4A 4ZJUA 4BL5A 5GMOA 1QYCA 2NV6A 4BNTA 1GPJA 1OI7A 3IKVA 3ZV6A 1JAXA 4ZN6A 1ISJA 1GADO 3S2EA 4LGVA 1Y1PA 2VUTA 3FWZA 4HY3A 5DT9A 3BA1A 4BQPA 3BMOA 4DBZA 3WNVA 1ZK3A 5F1KA 3ZHXA 3D64A 1U9JA 3G1UA 4FFNA 2Y1EA 1E7YA 1PL8A 3ZWXA 1KERA 1WDKA 4LCEA 3VZPA 3WX0A 4BNFA 4XYLA 1EDZA 4KP7A 3E5MA 2O4UX 4R68A 4RVSA 1A5ZA 3E48A 1VKNA 3EW7A 2EIHA 4IDDA 3SEFA 3PEFA 4B3IA 4GI2A 3TPCA 4OIMA 2IDZA 4R5HA 5JSFA 2X5JO 3OIGA 1AHHA 5IAAA 4KZPA 1H9AA 3VPHA 3PTZA 3WJAA 2YV1A 4FD3A 2Z5LA 1X1TA 1U2DA 3BHIA 3DBVO 3A14A 3EGOA 2HAEA 4RORA 5ICMA 4I5GA 1CJCA 4DQUA 1UXKA 1HRDA 1XEAA 3QSGA 3ZNNA 5COBA 3U4DA 4GWKA 2DU8A 4XR9A 1I33A 3KO8A 2X0IA 1C0IA 3GHYA 3ZWBA 3JQCA 3D5QA 4NBVA 5F1OA 3WIEA 4BO4A 3FTNA 1F14A 1OZAA 3S8MA 4WOJA 3AUUA 2EKPA 4PLZA 3KYBA 3UHAA 8LDHA 5JYEA 1JVBA 4MKZA 2NTVA 3EK2A 1N1EA 3S1LA 1DSSG 1NPTO 1P9LA 2VHXA 3ULKA 1YJ8A 3D3EA 3O9ZA 3FF4A 4QFCA 2VWQA 1G6KA 1IHXA 2FMUA 4BGIA 4GLLA 4MIOA 1DDOA 1E77A 4LRSB 5BSHA 1E1KA 1U8XX 4YT8A 2FP4A 3OJ0A 4UUNA 3FNGA 5ER6A 1XLTA 1LLUA 4GMGA 3GFBA 2PH3A 2EWMA 3S2GA 1YL6A 3M1AA 2PKQP 3AW9A 4U6SA 1BW9A 5DCWA 4BO6A 2VT2A 3A4VA 2VQ3A 3ORFA 3WQQA 1AUPA 1ID1A 1K0UA 3RC7A 4RPJA 4PG6A 3KUXA 4IZIA 3DAGA 3N7UA 4XDYA 5K6AA 1YQDA 3PXXA 5HM8A 4DYVA 1HYGA 4AG3A 5JCJD 4XYEA 4HKTA 3A1NA 1B3RA 4MVJM 2BMAA 3DZKA 4CR8A 2W2KA 1TT5A 1PJCA 1J0XO 2ZQZA 3TOXA 5MDHA 2O3RA 3X2EA 1F17A 1KVTA 2Q1WA 3M2PA 1NR1A 2F00A 3WBBA 2OBYA 5CPFA 2HMTA 3W8FA 3JD2A 3ITKA 4RVFA 3NYWA 1LNQA 4E32A 1FJHA 2Q2VA 4ZA2A 2FSSA 1K5HA 4BS9A 2VWHA 1T2EA 4FBGA 3GGOA 3NV9A 1V8BA 1N5DA 1PS9A 4XJSA 3SJ7A 4YRAA 3IMFA 1SZJG 3OMLA 5IDYA 3H5AA 2CNBA 4PIVA 3ASUA 5IN5A 3RD5A 3GZNB 4TKMA 4KTTE 4IINA 4ZD6A 4A27A 2A35A 2FR0A 3B6ZA 4QSMA 5DDIP 3QWAA 1V6AA 4DVJA 3QJ5A 3JQAA 3ROMA 2FR1A 3U49A 5KVSA 3F9IA 2W2LD 3LT0A 2DTDA 4IQGA 3KSDO 4F46A 2NUAA 3MJEA 3NJ8A 1YS4A 4JK3A 3CIFA 3QVTA 3HNPA 3KYCA 1LDNA 3V2HA 1BSVA 2GDZA 3DHEA 5ES3A 2FOIA 1NHWA 1XU9A 3QE3A 2HRBA 4R3WA 5KJ1A 2WM3A 1PQWA 3AY6A 1D1TA 3E9MA 1T4DA 3TJRA 4KQWA 1M67A 3PWSA 3OJLA 1YOVA 4YQYA 3GGGA 3IP1A 1CYDA 2VWPA 3NT4A 2PV7A 1W0CA 2WD7B 3WSVA 3ZWWA 3EZLA 5CFZA 1I2ZA 2Z95A 3PVZA 1QRRA 1NP3A 2V6GA 3GA0A 4ND5A 3ZH2A 1ISIA 2X0RA 1N9GA 3B1FA 4LMRA 3IP3A 3NDIA 1PGPA 2R00A 5T8KA 3ZV4A 2EEZA 3KZVA 5CDTA 1XKQA 4J6FA 4AJOA 1R16A 1C0PA 5IZ4A 1KC3A 1DPGA 3VZSA 1E0DA 4CLOB 4DMMA 1UXIA 3DFZA 1M76A 2GUGA 2X23A 1X15A 3DOCA 4L4RA 1LBEA 1JLLA 2CF5A 1RJWA 4CM4A 3ROPA 1YE3A 1HLPA 1ZW1A 2NSDA 4J1SA 1OC4A 5C5IA 4P4LA 4MVJI 3RKUA 4DQXA 1E5QA 1WP4A 4EDFA 1B15A 1MC4A 3QW2A 3DB2A 3MJTA 3BIOA 3WOHA 1DEHA 4U0KA 1SPXA 1LEHA 2O50A 2FRDA 2NLOA 1T1SA 3KLPX 4NH4A 3HZZA 2FSVA 1VSUA 1PQUA 5KKAA 4AFNA 3IUSA 3JQGA 1NPYA 1QYVA 3AWDA 4Y67A 4NQZA 2DFDA 3WFIA 9LDBA 4FFMA 1JA9A 1GCOA 2PNFA 4QTZA 3ADOA 4J2HA 3QIVA 2GR9A 1I3NA 4ZQHA 2BGMA 1VJTA 3HE3A 4BO2A 1H5QA 1GY8A 1SB9A 1LSJA 1P77A 2AE1A 5IXSA 4HFJA 1YDWA 5B12A 1DAPA 1YKFA 4PLFA 3RU7A 3LC7O 1YB4A 5I8ZA 4ZRMA 4L75A 1P1HA 1VC2A 1MV8A 2I6TA 2JKVA 1RM3A 4I5DA 1B26A 2VRCA 3JQ9A 2IRWA 2Q4BA 3IC5A 3QA9A 4DL9A 4DMLA 3TDKA 2HUNA 3GGPA 2C29D 2ZYGA 2OORA 3PP8A 2GRAA 4ALKA 1KVUA 4W9NC 4WK6A 4BKPA 1ZEMA 4ND2A 4J1QA 1ADGA 4WCFA 1KEVA 1YB1A 4RVDA 1OMOA 1ZK4A 3O38A 1AE1A 2AQHA 1OAAA 3Q9NA 4TSKA 3CPSA 5KVVA 4R16A 3ROKA 5L9AA 4BKUA 3DR3A 5L7YA 3H9GA 5HTOA 4YPOA 5EL0A 1UAGA 4ZRNA 1E7MA 3JQFA 3NTOA 1QSGA 3IDSA 3WGOA 2JL1A 4D79A 3G1TA 2Y66A 2GZ3A 4DYDA 4EYEA 3PFFA 3DL2A 1MP0A 2J8ZA 3NDRA 3PJEA 3TZKA 5EQFA 3VZQA 1QLHA 1A27A 3ITDA 4L9RA 1LDEA 3KYDA 3RFVA 4WKGA 1GTMA 1FDUA 2A4KA 3AOEA 1BVRA 3JV7A 4CQLA 3AUAA 3DZGA 2AMFA 4YAGA 1WVGA 1U8FO 4H16A 4NPCA 3H6KA 1GCUA 4E33A 3GT0A 4E5YA 4M49A 4U7WA 1K89A 3PQFA 4P8RA 4RF3A 1EVJA 5AXBA 3NRCA 3MOGA 3S55A 1EE9A 4NJMB 2P5UA 3ZHYA 4J3FA 3D0OA 4GX5A 3MJSA 3UVEA 2FHSA 3IL2A 3UXYA 2NTNA 4D46A 1PWZA 4A5OA 3WGIA 1BTOA 3EY4A 3K73O 4L8VA 4M86A 2ZATA 2NQTA 4O1MA 4MVJP 1E92A 1FF9A 5L4LA 1MXFA 3T4EA 4NI5A 1LU9A 2Y99A 3KSZO 2JFFA 5B4TA 4IMRA 3VHRA 4IS2A 1GQ2A 5G0SA 4RDHA 2HJSA 3QWHA 3PFWO 2I9PA 4K6CA 4YAKA 2HRZA 3I6IA 4RVHA 3L0DA 2FY8A 1PTJA 3Q2IA 4XDZA 4CLRB 5L3ZA 1I2CA 2P9CA 2W2LA 3UKOA 1DHTA 4DLAA 2UYYA 4WUVA 1DIBA 2HSDA 3HB5X 1H6CA 2WYUA 4QO8A 3VZRA 2C59A 4RPGA 3IAHA 3GMSA 5ENDA 4GAEA 4R69A 1Q7CA 2HKIA 2DTXA 5L4SA 5IZCC 4OKNA 1VSVA 3UGKA 3WGGA 4IS3A 3DBHB 5THQA 3I9KA 5AYVA 4MP3A 1ZH8A 2YHIB 3C7DB 3F47A 2VOEA 1KEWA 1FMCA 3WS7A 5C7OO 2AE2A 2ZB3A 1MX3A 1QXSA 1GUYA 5ICSA 2OOSA 3E5RA 2IZ0A 4M55A 1Y81A 4ZICA 4ALMA 5JAMA 1C1DB 1IYZA 1PX0A 3FNFA 4EI2A 1M75A 2CSUA 4BHTA 5KNLA 4NBWA 1JWAB 5KCZA 1I24A 4JJIA 4EW6A 3LT2A 2BF7A 4E30A 5JXWA 4OXNA 1R66A 1R4MB 3H9QA 4MJLA 3K8ZA 5A9TA 3DZIA 3QQPA 4AJPA 3WGHA 4XGIA 1RKXA 4XYMA 2JJYA 1Y8RA 2CZCA 4NU5A 5IDWA 3FPLA 2O3SA 4DIOA 4JROA 3KLMX 3WSWA 4D43A 3D1LA 4CM8A 4F3YA 4BMVA 3B1KA 1EFKA 3WB9A 4FGSA 1NASA 4YCAA 4CLEA 1DLIA 2H63A 2V65A 3R6DA 3HDHA 3RROA 5A3JA 5FI3A 4XEHA 3PQDA 5L51A 1MB4A 3NDJA 4Q3NA 1N1GA 3GG2A 2GLXA 1LI4A 2O3TA 1ZXBA 2DUUA 3ZU2A 3OECA 3JQ8B 5TQVA 4ALIA 1V9LA 2OXIA 4XKJA 3TZHA 5F3RA 4CV0A 3K2EA 3Q1LA 5EPOA 4QUKA 4BNYA 4I1IA 3ST7A 1FXSA 3T7CA 2UUOA 1IPFA 4XX0A 2YUTA 1ZBQA 3KEQA 3H3JA 5A06A 2I66A 1PJSA 4BO8A 4XB1A 3DAPA 2OGUA 4FFLA 4M87A 4AL4A 3W6ZA 2X9GA 5ILOA 3NKLA 3AM3A 1QKIA 1ZSNA 3PJDA 4UEOA 1LQUA 1VL8A 1RYEA 2PD4A 3GVHA 1D7OA 3EAGA 3R0IA 4FFPA 4GGOA 3WYEA 3JCZA 4BB6A 3LZ6A 4BB5A 1I5RA 4CM9D 2NNLD 3KEOA 4BV9A 2D5CA 3W8EA 1W8DA 1P31A 1UP6A 4CQMA 3TL3A 3QP9A 2G1UA 1ADBA 4XQ9A 4Y98A 4WJZA 3P19A 1Y5RA 3PYXA 4JBGA 5FI5A 2QW8A 2OFPA 2NACA 4UAGA 5U1PA 4H7PA 4RQTA 3C85A 3GH3A 2VRBA 1I30A 1IUKA 1E3SA 1HETA 4J0EA 5I7EA 4Z6KA 3MJVA 5A5FA 1D8AA 4RPHA 1U2GA 1H2HA 1HZZA 2C7VA 4XIJA 3I1JA 1HDOA 4D0RA 1NQ5A 2DTEA 4CMEA 4N5MA 4Z0PA 3WQSB 1KBZA 3GEDA 1ULUA 1GUZA 3DOOA 1WXDA 3CE6A 3U09A 3MWDB 1HE3A 3BMCB 4E2ZA 1IZ9A 2LDBA 1VE9A 1UJMA 3KSUA 4OOEA 1P1IA 3SC6A 4L4SA 3TWOA 4IIUA 3KBOA 5KKCA 1MA0A 1MG0A 1QYXA 3AOGA 4CMKA 3MEQA 4ND1A 1PEDA 1VL6A 1QORA 2Z1NA 4HV4A 1NTOA 5K6AC 1C1XB 1LX6A 2VYND 4YT5A 2GPTA 2HLPA 2RCYA 2DVMA 3QLJA 3EC7A 1Y9AA 3RAJA 3OQ1A 4EBFA 1KS9A 1SO8A 1XG5A 2YZ7A 4N7RA 2HQ1A 3Q9UA 3CINA 2GZ2A 1GZ6A 3KB6A 3IJRA 3ZZNA 2RHCA 2CVQA 4W7IA 1XHLA 2ZKLA 1HEUA 1K6IA 3MTGA 3ROQA 1ENPA 1S6YA 3GDGA 4R01A 1E6WA 3DMTA 3C7AA 4XZ3A 1ZJZA 3DOJA 4FDAA 4RLHA 1Z73A 2J3JA 5B1YA 1C14A 5JC8A 2IYOA 3I3OA 4TKLA 2RH8A 1PJTA 2Q1UA 3DONA 3MZ0A 5J23A 3RASA 4GX1A 3VPGA 3WTCA 2PZJA 3CH6A 5B4UA 3FSRA 2BFMA 4URFA 2R2GA 2B0JA 2W4QA 3JQEA 1BXGA 1O95A 1YVEI 3WWZA 4S3MA 5CDYA 3AU9A 4FB5A 1PS8A 4BKQA 1LRLA 4YJHB 4CR7A 1AGNA 3ZWOA 4DC0A 3GVPA 5I9LA 4Q39A 4YR9A 2O7SA 4NIMA 4NZ9A 2ILTA 1MFZA 4K9DA 4Z9FA 4WLFA 1A7AA 1MG5A 1P1KA 1VJ1A 2AHRA 2BI8A 2PFGA 2JD1A 5G4LA 3TOZA 4EJ6A 3ZWPA 3HFGA 2Y05A 3NTQA 1GYQA 4M1QA 4ALNA 1YQGA 1E3IA 2IXAA 4BMSA 2DPHA 5A02A 2FZWA 4B4OA 1WZEA 2BHLA 3B1JA 1C0KA 4NK4A 2QRJA 2R00C 3ZV5A 5T8KC 4I5FA 3E8XA 1VM6A 4INAA 4KOAA 5A03A 4CMJA 5AOVA 1X13A 2NVUA 2PKQO 3DEYX 3ETGA 5JE8A 1A71A 5KOIA 1EK6A 1N7HA 4PLVA 2XPCA 3CUKA 3JQ7B 1ENOA 2B83A 3HUDA 2VUUA 2EGHA 3C3XA 2HMSA 3F4BA 4PLHA 2D2IA 3ZU5A 1ISFA 4EUHA 3GNSA 4YJDA 4CMIA 2IXBA 3H2SA 4HADA 1QG6A 4J1NA 1HF3A 3OFSA 4CMAA 3OIDA 4W4TA 4CV3A 1SOWA 4IMPA 5CAEA 4PZCA 4G65A 1L7EA 5TX7A 4XYGA 3TL2A 3TN7A 4UVHA 1EUCA 3D4PA 1TVEA 5FFFA 1PJQA 5DBIA 4CODB 3BMNB 1S7CA 1YBAA 1YWGO 3HN2A 1E3WA 1YBMA 2C54A 3KXDA 1C3VA 1HTBA 4HNHA 5JAQA 1YGYA 5DULA 2CY0A 3ZW8A 1QYDA 1ZMOA 2B69A 2Y67A 4KQXA 5DZSA 5EMHA 1XA0A 3V2UA 4NBTA 4E12A 1XELA 3L4BA 4OSOA 3I9JA 4I08A 2ZB7A 4IDGA 5TNXA 2AQ8A 4CM7A 3TF5A 2JFHA 3I6QA 3E9NA 1PJLA 3UF0A 4BO7A 3L6EA 1DC4A 4II2A 2NU7A 4BNKA 2I5PO 1XYGA 3GUCA 4YRDA 3K2BA 1QYWA 4R1SA 4D3FA 4IXWA 2VN8A 3JTMA 4YWJA 5C7LO 3A9WA 3STHA 3VH1A 4PG8A 4ZQGA 4K28A 4CV1A 5TS3A 1CERA 1F06A 3PJFA 4PZDA 1MGOA 1BWSA 5EIOA 4DQVA 4BNNA 2C0CA 3PDUA 2OUIA 3ICPA 4QFDA 1EMDA 3JQBA 2ZCUA 2OO5A 4MINA 4QEDA 3HSKA 1Y8QA 3OSUA 3GNTA 3AOEC 3IS3A 3D5TA 3FTPA 4L73A 1PGQA 4Q3DA 5G4KA 4DC1A 4BKOA 2DBQA 1XR3A 5GZ6A 3FN4A 3WTBA 4YAEA 4CL8A 2WE8A 2VYNA 3INRA 4ONEA 4WASA 1N8KA 5FEUA 4R9SA 5EN4A 1XWFA 2ZTVA 3BZUA 1UUFA 5DCUA 1SEPA 3ZWVA 4E21A 1I01A 3JYOA 2UAGA 1VLLA 4U5QA 4U0JA 2EKLA 4F45A 3UH1A 4B8ZA 1DJQA 3BHJA 3BTVA 3RC1A 3KTDA 2JCYA 3RJ9A 1KVSA 2HK9A 2IEBA 4LCJA 3F6YA 3NT5A 1RM0A 1YB5A 4MKXA 2O3JA 1K2WA 3R3SA 1W4ZA 4QECA 3R1IA 5CHEA 3GVCA 2Y0CA 1UR5A 3LT4A 2B5WA 1RWBA 1BDMA 1ONNA 1ARZA 4BNWA 1C0LA 2G5CA 1K3TA 4Z3DA 1V3VA 5ENVA 2VHZA 1TA4A 4HBGA 1NVTA 1U1IA 1J5PA 1OC2A 3H3FA 1Z74A 4YJFA 1RM5A 3NJ4A 2VHYA 4BKRA 3UN1A 1M6WA 2SCUA 4O59O 1GZ4A 4HXYA 1DC5A 1IZ0A 1ZK0A 5KJCA 1E3LA 5HBRA 1E1MA 4YRBA 4K26A 1LA2A 5JAZA 2UDPA 6ADHA 4R1UA 2RHRA 4NK5A 1ZIDA 3EVNA 1U7TA 3F1LA 3O8QB 3VVBA 3ENKA 1FDWA 5BQFA 2BLLA 4J2OA 1U7HA 2OBNA 3SLKA 4ILKA 3AJRA 4RCVA 4R5MA 4RVUA 4WNIA 2DQ4A 2X22A 4PLCA 4EJ0A 4YVFA 2B4TO 4YJGA 2VWGA 1LRKA 4IGEA 2C82A 4PRLA 3BTSA 3FD8A 1NWCA 1ISGA 3DBRB 3JD4A 3U3XA 5CDUA 3UAGA 2VYVA 1PZHA 3FWNA 1A9ZA 1NBOA 4BNIA 1E7RA 5CG2A 1E6EA 3RKRA 1EQUA 4A0SA 1NQOA 1WDLA 3EMKA 2HO5A 4NFYA 4YA6A 1O6ZA 3PHHA 2D3TA 4MVJF 3LK7A 4B8WA 1GFSA 2YDXA 2NWQA 4BGVA 4BO5A 1ZK2A 1KIFA 5I7VA 2BELA 1HE5A 4RF4A 4Y6RA 3AY7A 2P91A 1R37A 4J7UA 3ZV3A 1IE3A 1T2CA 4RQUA 2V6BA 4LRTB 1UP4A 3MCVA 3AY3A 2YY7A 3MJ4A 1LXCA 4FQ8A 4QO7A 3ETEA 2V7PA 1JKJA 4DLBA 4ZQFA 1UH5A 5KJ6A 2Y0EA 2EW2A 4MOWA 2Q3EA 3BMQB 4YACA 1OFGA 2I76A 4AJKA 4CMCA 1I8TA 5T5QA 1X7GA 2EKQA 3AM4A 3RSHA 1F12A 3VTFA 3BTUA 1UZNA 3QWFA 3SVTA 4ZU3A 4FS3A 2CD9A 2X5KO 2BFAA 1B3BA 1E7SA 4LVUA 5B37A 3LC2O 1DIRA 2GCGA 2I3AA 3A06A 5T57A 3GMDA 3CXRA 4I9UA 4CLXA 3DTTA 3ZU4A 4BNHA 3VDRA 4J16A 1DFHA 4HFRA 2XXBA 3NX4A 4ND3A 4E4YA 1PJ3A 3H9EO 2A94A 3G79A 4OHUA 5L4NA 3FCOA 3TZQA 3AU8A 3AUTA 3T4XA 1FK8A 3I9MA 5CEFA 4J4BA 2YJZA 4O6VA 2GGSA 1UZLA 1VJ0A 4R3NA 1PR3A 2E6UX 3V5NA 2G0TA 3H9UA 2AG5A 1HE4A 4IY1A 2AG8A 1JTVA 2EF1A 1DXYA 1AN9A 3PIIA 4OXKA 1Q1NA 3LVFO 3JYQA 1JVSA 2Y1DA 1EUZA 1A72A 5A9SB 2WMDA 1FDSA 4JXKA 4AJHA 4ZHSA 3GK3A 4AJNA 4CMEC 2Q1TA 4QQRA 3AI1A 2HMVA 2PD3A 1PQPA 4MP8A 1LRJA 2QHXA 1B2LA 1F8GA 3NTRA 4B4UA 1A4UA 4YBZA 3C24A 3ANMA 5TJHA 3GEGA 2H6EA 3ZGYA 3D4OA 4TVOA 4D0SA 1M2WA 3OIFA 1XIVA 3I9OA 2OHXA 4MDHA 5JCJA 3RC2A 4L76A 2J5QA 1MC5A 2VNSA 3GF4A 3ANLA 1NFRA 5DBFA 3LF1A 1LLDA 4MPDA 1MFPA 3FNHA 4EEXA 5IN4A 1YH3A 2GN8A 4OQYA 2CUKA 4HUJA 1B14A 3GHHA 1HT0A 2BGLA 4NFHA 3PDJA 2HCTA 4CLHA 3WQRA 1VRWA 4HFMA 3VPFA 1X1EA 1J49A 7ADHA 2EGGA
chains in the Genus database with same CATH superfamily
2R6AA 2QMUA 5FTMA 4MLZA 4DRYA 5KNBA 2GZRA 4RGBA 3HMKA 4Q9IA 1L4KA 1MF7A 2Z3WA 3UCEA 5FV4A 4YUAA 5FQOA 4RDIA 5H5JA 1LDGA 2J1LA 1JG4A 3BPSA 4HYEA 1NF8A 3QU7A 3COPA 2WNSA 4P6VF 1XJ0A 3G3EA 1VECA 3ZXXA 4DHEA 3MLAA 2JATA 1NM5A 1QGAA 1IRIA 2X3YA 2XVMA 4WNAA 4Y9DA 1HL3A 1HYHA 1XSEA 1Z47A 4PSKA 4KC0A 5LLSA 1FA9A 3KUDA 3RV3A 3TFQA 5A71A 4W1SA 4F38A 2J3MA 1T5LA 4KPFC 1QP7A 1QHSA 1K06A 3AHJA 1LSUA 3DHWC 5DX1A 1K3UB 5DNCA 2C2MA 4ZYXA 1LTHR 2Z43A 3GEMA 3AR4A 3HU2A 5AW1A 1C9JA 3DFFA 1SXJE 4HWKA 4KYVA 4X6YA 4ZZ1A 2RE8A 2XWSA 2H4WA 3L49A 2FN7A 1RXWA 2YBDA 3K0BA 1KR5A 2VCYA 3O84A 5DM2A 3SGLA 4AJEA 3C8ZA 4MS1B 5IVDA 4U3JA 3TMYA 5CFPA 2QBYA 1FFBA 1PVVA 5I7RA 2A1TS 3L84A 3IOMA 4Z4QA 1GYRA 2Q3MA 1RFLA 2QVLA 5A0FA 2K2WA 1MTOA 3ACCA 3LFUA 3LWBA 2PSFA 3FGNA 2OGWA 2HPAA 5JTTA 1YBVA 4MDFA 3MVEA 3B3AA 4LZOA 4FWIB 3AF4A 4GSYA 1NXOA 1VE6A 4NG4A 4H9GA 3W4KA 3E5NA 4M89A 3QVSA 2Y1OA 3KCQA 4UMDA 1FTQA 3LCUA 3X1JA 4GS5A 4BMXA 4D4KA 1YV9A 1XJQA 4MULA 2HTEA 4L4XA 1VP3A 2E5WA 4CZ2A 5H82A 3UYKA 4XYBA 3BB3A 3QYAA 3R24A 3WA6A 1XWIA 4L2IB 1Y5LA 3I2IA 1JH8A 2JANA 1DIGA 3KQQA 4U7JA 4ZP1A 3EIOA 3P9ZA 2WY2D 3SYMA 4YCSA 2UUCB 4TWRA 1YF3A 1QZZA 1T25A 1AXGA 3FFBA 1JN0A 1PLLA 5FBHA 3DVSX 3DDSA 4IMJB 4AJ2A 4OAQA 2PTGA 5ER9A 4RTRA 2WYIA 5A2QA 5AP9A 1S2IA 1EVQA 2RAFA 4FYMA 4DCNA 2Z8ZA 4R81A 2O5EA 5DTRA 2DT8A 5EWJA 4HG2A 1Z56C 3ROEA 1YQUA 2VJPA 4HDMA 1LDBA 3QUAA 4YRQA 2G06A 4HVTA 4WAUA 4RXMA 5IW8A 4RSGA 3W3AD 5FULA 2ZIZA 3AFMA 4C3UA 3WRXC 4EY8A 2IX3A 3THXA 1T8PA 3L8EA 4KQCA 3EPLA 1WY7A 1YZ3A 1J39A 5BMOA 3OUTA 3PHGA 1NXTA 1NVAA 1THZA 4GM0A 4BFVA 4N54A 1KJZA 1VKZA 1YACA 2QM8A 2RHWA 5KVQA 2EJBA 1TQHA 1E7QA 2VHVA 1NW5A 3SX0A 1T4CB 3B6KA 3ESQA 4H1VA 5EHQA 5LBUA 3X1XA 3BX1A 1PK7A 3K9GA 3LBNA 5LQSA 4EGJA 4EHAA 1VBKA 2ZUVA 1YHZA 2JHCA 4BYMA 1J00A 4LKRA 1O6GA 4I9GA 5DIFA 2HCRA 3IE1A 4TZTA 4TYYA 1AS0A 1G63A 1N57A 1HYQA 1P2FA 1Q11A 2XIQA 3NASA 1L7XA 4NXNB 3ABSB 2ASEA 4ATNA 3BQ9A 5CA1A 1MNAA 1SQ6A 3KDSE 4I4TB 4TLCA 1ZY2A 5DNEA 3V34A 2QRHA 1UDAA 3L9WA 2HDWA 2OFOA 4R4JA 1H2ZA 4DILA 4UUPA 1C4WA 4QBFA 4GBGA 5FBLB 721PA 1UZUA 3EIQA 4RVGA 4IZHA 2IBSA 3CMCO 4D7AA 4P7FA 1YO6A 2QZ4A 4AZ0B 2RIPA 3L0SA 4K6GA 1IL0A 3MOSA 4JYPA 3FYHA 5GADl 3AZPA 2Q7DA 3KQOA 1Q7GA 4ITUA 5L45A 5A6SB 4ETNA 5KWJA 2BD0A 1TF5A 4KU4A 4KDFA 2JAPA 1ZD3A 2QVCA 4UHHA 3VR1A 1RZRA 2CGEA 2VOJA 1LB1B 3BUSA 2ZYVX 3J81k 2YY6A 4RA9A 1R15A 4LPSA 1ONPA 3F46A 1IUPA 1DCFA 1SUFA 1I4WA 3N7TA 4KYTA 1NSTA 4BCDA 4PG4A 1GPUA 1HLFA 2N9UA 3B9PA 3BCUA 1NI5A 2I3DA 3KDAA 3KFXA 1ZQ1A 2V0GA 2RAUA 2B7BA 3HJGA 5ALFA 3PLRA 2B20A 2VSFA 4P3OA 5FIUA 1DC6A 1XK7A 2VP6A 3GRUA 3QWBA 2PXXA 3UUEA 4YUZA 3K9NA 3IH5A 3LZCA 4YT4A 1B0PA 1M1ZA 4PZEA 3D8HA 3FOAA 3IAAA 2JEZA 4MVJE 1ZKMA 2DC1A 2OLEA 3JD3A 4FNGA 2OO5C 5EXSA 3VYWA 5HIIA 4D3SA 3MTEA 1OI3A 2Q6TA 1VL0A 4LGYA 5SV2A 4DABA 3DTVB 4WECA 4F9FA 1K4MA 4XUCA 3GUYA 3H18A 1BKDR 1BXRA 3O26A 3Q15C 4FSHA 1Q6YA 3C5EA 3UT5B 4P86A 4A91A 1GZUA 1VCIA 2C20A 4WNYA 5CB4A 4ZV9A 5HTKA 1NL3A 1E98A 1Q2XA 2O7VA 4B4VA 1Z2EA 4C08A 5LUAA 1VCMA 4HLQB 4NESA 2J4FA 2O9JA 5K0BA 1RHKA 2A92A 4HN2A 5LOVF 3EPKA 4Q24A 4OLJA 1SCIA 3RWOA 2GZMA 4LSWA 3LL7A 5JAHA 2C7BA 5E4FA 3ZCUA 3LGAA 1OY1A 2UUPA 2C2YA 4MKGA 4C76A 3JR7A 4JLMA 2IPAB 1OE0A 1BW9B 1P61B 1T5HX 2O7RA 3DV2A 3ICCA 4MUAA 4UBOA 1I36A 2R8RA 3FWPA 1R0YA 4N0QA 1NBHA 4RQBA 4K1XA 3ZWMA 3OKAA 2QTNA 2M6SA 3K6JA 4PVCA 3ILXA 1D1SA 3OZ7A 1W5TA 3K8YA 3THYA 1G20E 3RIYA 3EXG2 4ZEXA 1AUXA 4ZYWA 2QX4A 1HQDA 4WN9B 4JQZA 4R2WA 2XT0A 3C98A 1IN7A 1X94A 3T9CA 5TE9A 5H9WA 1FFAA 4JC0A 4NQRA 4OLAA 2C4HA 1U7DA 1YR1A 5BSGA 2VKQA 2OQ2A 4G9BA 1S02A 2WZQA 3G49A 1J7JA 1S8NA 4LRXA 3K0FB 4IX9A 3DZ8A 3FGZA 1EUDA 2ONZA 1M9NA 1PZXA 4IDCA 3AVXA 3M2TA 3REGA 3ZW9A 2V0NA 3CG4A 5HE9A 4KRFA 4XUEA 4AXXA 2I8LA 2C3OA 4OBBA 2F6RA 5JSZA 5EXXA 5F2EA 3UMCA 4P4UA 1X2EA 5CIQA 2WHRA 3QKUA 2CL6X 1XC7A 2TMYA 3PIDA 3ZKAA 4OMUA 2CDBA 3DZJA 4FFRA 4B35A 4K9PA 1EE2A 2E55A 3P2EA 3BAFA 1XROA 3ASYA 3CO0S 1N0HA 2ZSKA 3IAXA 4TL9A 1G21E 1U8YA 4LK3A 4BB0A 3TSAA 5BN3B 1TGVA 3AR5A 1U4NA 2FEAA 5LXTB 2GERA 1FDVA 1P3DA 2X1LA 4H7IA 5AVOA 2ONKA 5CIWA 4J1TA 3DBHA 4AO8A 3QITA 2WKSA 3AW8A 2V6FA 2I2BA 1XVLA 4RY2A 5H0IA 2HSZA 1FNDA 3T3MB 2M2IA 3R0QA 1TPYA 2H4HA 4HEA1 4NBUA 4B7ZA 1VJGA 4WLOA 1E1NA 3GBSA 5BNFA 1FP1D 4DIMA 2CBGA 2HMUA 4BJ3A 1RJDA 2XOEA 1GNTA 3UGQA 2JGAA 1YQQA 4BO3A 3HEAA 1PK8A 5LWQA 1XRPA 5DEOA 4GRIA 5JAUA 2J33A 3IX7A 4ENQA 1NAIA 4CEHB 1E69A 3W4IA 5AFSA 4EJMA 4EPVA 1ZJ6A 1FRNA 2WTMA 1ZJYA 3A9SA 3QENA 4KBGA 3N74A 1N2JA 1UJNA 1DCKA 4M9CA 1UBNA 3RNLA 2XKBA 1GNRA 3CZ4A 4JXXA 1GVNB 1DT5A 5GONF 3UK7A 2Q5FA 3GAFA 2GZDA 2XQIA 4X7RA 5JZBA 3IEKA 3RAEC 5EIBD 3HABA 2DR0A 2QUHA 2R6R1 3OBBA 4LJAA 2VP3A 1E18A 1O9BA 1TF2A 1ZHHA 2R84A 5KS2A 3IGFA 5HIKA 4X65B 1H93A 1KK2A 3LIIA 2Q99A 5JBIA 4GL2A 5AVXA 3MTDA 3NVAA 5K8IA 2ID4A 3U4QB 3HADA 2WHPA 3HWRA 4FYKA 4GM1A 3CSSA 3UUWA 3HPRA 4Q00A 2HDNB 3GPIA 3BIXA 5DNDA 3G0IA 4B84A 5K45A 2Z4RA 1GWNA 3RUCA 2O8BB 3DDCA 5K2OA 3RODA 3H5RA 1TMKA 4MTCA 3ZHQA 5KYXB 1I0ZA 1Q2UA 4O5OA 4E5PA 1IATA 1TAGA 2KMLA 4XWYA 3KETA 2B94A 1RDFA 3D6VA 4L4YA 2VBGA 4I19A 4EF4A 2XCOA 1R3UA 1RYHA 3WL3A 2ZG6A 4F7WA 4X84A 1KKMA 4JHXA 3IEVA 1US8A 1P9OA 1U8ZA 3GLVA 3NGLA 1EJ6A 1QMPA 3ZHCA 2N75A 2WRZA 4JT8A 1P9WA 521PA 2BFNA 2C1EA 1AA6A 3GLIB 4IKEA 3UK1A 3N7AA 4UBJA 4YT2A 2WHEA 1T5IA 5CXQA 2GB4A 1N2IA 1WW3A 1NG9A 3IUEA 4BX3A 1AZLA 4OYRA 2CNKA 1PFVA 2B6NA 3OZFA 2R65A 4W63A 3F3MA 1G8MA 4FC7A 3TLCA 4A2CA 1GL7A 1P2VA 3NT2A 1WSWA 1P0FA 3STWA 4YCLA 2Z8YM 4LHYA 2IV7A 1APBA 3F73A 1OXMA 3BAZA 3QHAA 3S68A 2Y0DA 4DREA 2R62A 4EDHA 4PZUA 1Q0PA 4OYHA 3GLUA 3C1TA 1C80A 4EQZA 1SXJD 5ALMA 1OU0A 3JYNA 2Z1MA 5LQUA 1I5EA 3H5OA 1B0AA 5JJKA 4I1RA 1JZSA 2WLSA 5HK8A 2H1WA 1BRMA 1DTSA 3JU3A 2Z5FA 4AZWA 1E9VA 1K6XA 5I9NA 2J3QA 4YTEA 2IYPA 3IBYA 2A5DA 2B9EA 2Y1WA 3H2JA 4G4SP 4RHTA 4RMJA 1SBTA 1L7MA 3UAVA 2PY6A 4EG8A 2AJLI 4JBHA 1SOMA 1V3UA 3C6KA 3UJ7A 3HU1A 2PSSA 2VJBA 5GM2A 4D9GA 1PCXA 4YGXB 2FPKA 1UQRA 2JJ2A 4R31A 4Z1MA 5ULLA 4QX6A 1P17A 4B43A 3B8EA 4IEIA 1QCCA 3OETA 4JLUA 1SA0B 2XEXA 2VZEA 5KNCD 1VB5A 4TL7A 5AXAA 2BISA 3JQQA 2QMEA 1YQWA 3KJQA 3KKOA 1N9ZA 3KU4A 4OKSA 3DXZA 4I2VA 2HR1A 1QU3A 5KQLA 3D3WB 3NUQA 1E1DA 1GLVA 1F8YA 1QIEA 2NU8A 3FWKA 3OZXA 3S2FA 2J6HA 5H8WA 4O4HA 4BY9E 1V8ZA 4LC0A 5HIAA 2BBSA 4V24A 2ZIWB 3RIEA 1KARA 2JBAB 3L7JA 4XR4A 5DOZA 2INGX 4Z9XA 3UWSA 3QE2A 1GQYA 3B36A 1USUA 3RPEA 1PW7A 3G59A 3Q0IA 3QG1A 4DW8A 1C1XA 2JC3A 1TEHA 1EVIA 3BWYA 3MTJA 4LJ5A 1SIBE 1A9TA 3RU9A 4OQZA 4OK5A 4MW0A 1FNNA 1CB7A 1MO3A 1UDRA 2ACVA 4ZYZA 5AQ1A 3D7NA 5BR1A 1YZVA 4DR4B 3UJCA 5ABPA 4OQFA 7MHTA 3MWEB 3S99A 5DHTA 1EU1A 2OBLA 3R6GA 3UFBA 2CDRA 5GV7A 2QTMA 4BLWA 4BAGA 3H1TA 1F0PA 2G6TA 3N75A 4NU8X 4H3SA 1I32A 3GN2A 2RGCA 4G5XA 3TQIA 5BSEA 2B1QA 1W36D 4YV7A 2AFIE 1LDMA 4C3OB 2XOKA 3RHTA 3ZW7A 1WULS 4Q4HB 1PJ2A 1XZKA 1PZFA 4ZFNA 1DWQA 4KGDA 3KHSA 3RUHA 3WYCA 2JKYA 2JBHA 3U7FB 2JCXA 3P2JA 1GGMA 4OH1A 3JQ6A 1S7GA 2ZCVA 4DJTA 1NM5C 4HX9A 1SC6A 4MV4A 3SJCA 3RSSA 3MYRA 1JAIA 2BJWA 2HMWA 5AIAA 2DKFA 4X8MA 1CG6A 3D0KA 4V3CA 5AJVB 3W2HA 2HA4A 4HXEB 3A1TA 2C77A 2B1GA 1PL6A 4IIYA 4URUR 1DT3A 4CKWB 5HBGA 2MINA 2AN9A 2GZAA 4JJKA 5EP1A 3NVMB 3RHSA 1WWKA 2GYVA 1PVOA 2J6BA 2XMZA 1VHDA 5REQB 5ADHA 2IU6A 2Y0BA 4C6RA 3AL3A 1KMQA 2CFCA 1XJWA 3KR1A 4A0GA 4TV9B 8ADHA 4MW7A 1EFLA 1NJ6A 1V5GA 1Y9ZA 2Y1CA 3AWIA 4TMFA 3GQBA 3MMSA 1SG0A 2WYWA 1TUBA 1QAOA 1JEEA 1TXGA 4PEVA 4L0CA 2I65A 2RG7A 2W2MA 4OLFA 1VJ5A 3NEAA 5LXTA 3QPDA 3O4RA 2QP4A 1FU8A 2GYWA 2W6OA 5BW4A 1ETHA 4CDRA 4X8LA 1WAMA 4FGLA 1I4OA 1PZEA 3B1XA 4HRVA 4WPGA 1YS2X 3WL8A 4COKA 4DMCA 1FYXA 4TV8F 4YAKA 1M8PA 2AXNA 2JH3A 3H0CA 4MGHA 1WW8A 1OZHA 2VH2A 4QU8A 2FYTA 5FTKA 4F92B 5TMPA 4TS1A 5CH3A 4RW0A 4RNDB 3BG5A 5IH7A 3EIHA 3PQEA 4WCDA 4TXNA 4EL5A 1T5BA 2VT7A 4TRJA 3T3EA 5JS8A 2XQVA 3ZNOA 4GZLA 2H1SA 1GU7A 2KB0A 3BWVA 3TLJA 3FNBA 1HSOA 2YCBA 4U63A 4MVJD 2FX2A 2XGOA 1CWUA 3DDWA 4QEZA 1GUDA 4B79A 3IUYA 1VPWA 5IT4A 2IUFA 4II7A 5CH5A 4TYQA 1JDTA 4F6CA 1AMOA 3P9RA 1XVAA 3R5FA 2IKQA 4LVCA 1QGZA 3FIJA 4BDTA 3UFXA 1D09A 5J2TA 5I7OA 2D54A 2IUTA 1FS4A 1K6EA 1R0BA 5DXAA 4P98A 3BXGA 3FPHA 5KYGA 1RXIA 4DLWA 5JTUA 2QF7A 2PL9A 1MB9A 3GLQA 2QRKA 1EZZA 2JA1A 2RGXA 5CFRA 2BHTA 5JASA 3ZCRA 4KIWA 4NG5A 1DUIA 5HZMA 1P4GA 2XDQA 2Q6LA 3AHGA 4U2BA 1QP8A 4QZVA 3DEHA 4MWDA 1U3WA 4NOJA 4V2IA 4Q4AB 3OSZA 4ZC1A 5KQGA 1FXUA 1Y37A 3ICEA 3NATA 1GT6A 4MVJG 3BD8A 1VL2A 1LC3A 4GLJA 2EFHB 4XGKA 4A36A 3K4QA 5HUHA 2VUSA 2IV2X 1RQXA 2ZJ1A 1DVRA 4MR9A 3F5QA 1JA0A 1HWYA 1ODCA 3PXCX 3Q7QA 3VJLA 3HB4X 5AW7A 3IQIX 1JFLA 4D74A 2GJKA 5EINA 1OJLA 4B4WA 2NYVA 1DKUA 3VNRA 4C4RA 1OI2A 2VZ9A 4GF5A 3VTZA 1ZM4A 1J2EA 2LXNA 1LJ8A 2DPGA 4OUDB 4JI3B 4LV6A 4ARZA 1V16A 1Q84A 4LOIA 2QVGA 2M6LA 1Q14A 5P21A 1U2ZA 2Q5CA 1ZHOA 2JHAA 1UPFA 4XGNA 3OTWA 1ZD5A 1NBAA 4E2YA 1JPUA 1JHYA 3BDIA 2Z0MA 3E2PA 1RRMA 3LUKA 1F6WA 1UPXA 3T5TA 4I8XA 1G5PA 3CLVA 1WCIA 2NUPA 2R5WA 1DBQA 1P44A 3PI7A 1QFZA 1CUGA 1HT3A 2CLLB 4KDEA 4WD3A 1CK4A 1JXMA 1D2RA 1JEOA 3BWBA 3GFVA 1PRYA 5AW5A 3EXEB 1TKCA 2Y1LA 2WEKA 1AQNA 5CIYA 1TAUA 3P94A 2PX0A 3FMPB 4TZ6A 5KTKA 3OY2A 3V9AA 1F2VA 1MAUA 1PYDA 5H16A 1TUIA 2IP4A 2QAJA 2J0UA 4Z3KA 5BR7A 3ZD8A 2FSIA 5FOSA 2P1RA 1N7GA 2VHWA 1QR6A 2Z58A 4Q7MB 2EJVA 2X5OA 4B0PA 3GA5A 4OHFA 1XX6A 2YV3A 5LZ5A 4RFSA 3WRWA 4CQMD 3OLWA 2ZBUA 3PBKA 1T1GA 2VDMB 1G9SA 1MMFB 1MO2A 5DGIA 4E1AA 3MXTA 1UPBA 2BDEA 1FU7A 1ZUNA 3EARA 4KPUA 4ACBA 5LDHA 3W5CA 4RAQA 4NAHA 5IH3A 3I01M 5E6RB 4E5KA 3X1WA 4A3SA 2RI0A 1RHMA 1XRNA 3E18A 1PT9A 4DUGA 2EHJA 4EJSA 1A7KA 3RABA 1Z0SA 2GEDA 2OBMA 2O4CA 5JY6A 4NJEA 3V32A 3EZYA 4M76B 2Q9CA 2A2ZA 4QYMA 5B1HA 1JB1A 1U0OC 3EYWA 1YA4A 1LF0A 4B46A 3D3WA 3LHIA 1IMJA 2ZJ0A 2QN8A 4IPTA 1DRWA 1LV7A 1WLYA 1B76A 2P27A 1GAEO 2XMCA 2EWWA 1X8JA 3IJ5A 5E3JA 4LHEA 3HCDA 3BXOA 2OO3A 3VO8A 2BGRA 5KAMA 3V46A 3AVOA 3N6RA 2QG9A 2XHEA 5HF6A 1YVPA 1QV7A 1SVUA 1QH9A 1W4RA 3WJ7A 4RE6A 2FUEA 3PHJA 2R9VA 4A7PA 3PKIA 4J3NA 4DA9A 4EELA 4G5YA 1YXMA 3R75A 2UYCA 4MZXA 3TDNA 3VRHA 3O2SB 4D5GA 2DB3A 1XMIA 4PQFA 1N6KA 1ZONA 2KW5A 3E61A 4PPGA 4TQ9A 2CDAA 1JEQB 2QYTA 1WMFA 5HA5A 5HF8A 2R0QC 4OI0A 1T5OA 3IQWA 2AFHE 2OZPA 3RK4A 3OM9A 1UODA 3G9TA 3ZDYB 3S2UA 4NICA 5A04A 3ANSA 1Z5OA 1GDDA 4BNGA 4M3NA 2QV0A 1GPKA 1VHWA 2XCTB 1MEEA 1JDPA 1W5AA 3F1KA 4A8PA 4CPDA 2I8CA 1K7CA 2C99A 2CW5A 4QJIA 2ZE6A 3E2MA 3OZAA 3EUWA 2BCJQ 4LZJA 5I48A 1KTIA 1P4HA 1W52X 2UV8A 1LDYA 3OOEA 3NMUF 4NZPA 3CRQA 3KBBA 2P9GA 2XT9A 4HRYA 2DHQA 4L3OA 4B6GA 4MUBA 4X0EA 3VGPA 5BXQC 3N58A 1YR2A 1E9FA 1JU3A 1C30B 4FOSA 3O4JA 3HZOA 4MQEB 3OEWA 4PO9A 3LLVA 2I7DA 3MGKA 3MILA 4B32A 2PQMA 3C43A 1KE2A 3CW8X 3RSQA 1OXSC 4JLNA 3IBCA 4IBOA 4WGGA 5IBQA 3ZVRA 2HDHA 3FVRA 3TRHA 3OJCA 4J1TC 4DM3A 4YAUA 1WL8A 1JIJA 2G0NA 3MUNA 5KYTA 4P7GA 4Y9UA 2QVZX 3N07A 1LD3A 3E9RA 3NBAA 3PQ8A 4GRDA 1QHYA 2A1IA 3ENZA 4PZAA 3L6UA 4TLDA 3T52A 3OQJA 1O95D 3CLRD 2A6PA 3JASB 1U90A 4ZVVA 2HHLA 5FPPA 1SBHA 4P58A 3SFTA 5BMVB 1RBZA 1JHPA 3H6HA 1CE8B 3A11A 4MO2A 1GGFA 1ZN9A 2ZRKA 2BEJA 4BO0A 2FDCA 2VJLA 3N2IA 1RRGA 4DTCA 2FWNA 3T0GA 4QLBA 3NAQA 1HNZB 2FZKA 4Q1AA 4H1TA 1S0UA 2G63A 1EGQA 3HA5A 3LP6A 2CUTA 1Z2NX 4JBNA 4QHSA 4QTTB 4E13A 5JISA 2GPBA 3DWIA 3GRAA 5FWYA 3RFXA 1Q5PA 3LC1O 2VEOA 2D1TA 4EQ6A 1M74A 2QRNA 3KC2A 4NCJA 3W1VA 5LQRA 1KORA 1DIOB 1LSOA 4QT0A 3FWYA 3IHLA 3OPVA 2JAUA 3SJBA 1YU6A 2OWEA 4I66A 4I55A 4ZO8A 4ARUA 3U7GA 3GU3A 1R64A 4HL6A 2C9CA 1N36B 3UG6A 5KAPA 2AK2A 4YREA 3WGLA 4J7CA 1PFUA 2NVUB 4Q4CA 4P3KA 5LQKA 5JCXA 3ZE9A 3B53X 1G1MA 1NLFA 1ODLA 2VF8A 1J1UA 4B7AA 3TLGA 1X7HA 3JVDA 3GEEA 4XVHA 4J8PA 4QXMA 4DSOA 5ELXA 3I8SA 2C4NA 3KR9A 3HNOA 3EOAI 1IXRC 1J09A 2HJHA 5D6OA 2TRSB 1WDMA 2BCEA 4YV0A 5A0VA 3OJEA 1AK1A 1ORDA 4KQ1A 5LM3A 4BP8A 2XTZA 1Y6GA 4YXFA 4BDSA 5LLDA 2CXSA 1KFJB 1BZYA 1P1JA 2DP4E 3HDYA 1DOZA 1A9OA 1KYIA 2J9FA 1LWOA 4Q7JB 3ROZA 2CJWB 2HQBA 2Q3HA 4J7XA 1T3TA 1SURA 2GXQA 2FXVA 1UT8A 2Z2YA 3KOUA 3OE4A 4KV7A 3DOHA 3RQSA 4IJKA 5DHPA 3O74A 4YP6A 2C7GA 1M2FA 2PAFA 1ZH4A 3TMKA 2FN4A 1ZWKA 2X8AA 1DELA 1LLQA 3QELB 4FN4A 3OUUA 4FDLA 4ND6A 5JJ5A 4PHTA 4XIGS 4QYXA 3F97A 5EHZA 1Y42X 1W9MA 2C92A 3BBLA 2ANCA 3PGLA 5IKXA 1SHTX 1X7DA 4MV6A 2CKMA 2FZCA 2BFOA 1YCGA 3K30A 1F8FA 4HDNB 2OP0A 1ZRMA 4NJOA 4E7PA 5AUPB 3P0HA 4XIYA 4DCTA 3ABIA 4L9SA 4N82A 3ZQ4A 3M70A 3EQ6A 1AB5A 3I53A 1H2BA 3QKIA 1HM5A 5COQA 1TVKA 3HJFA 4FOTA 4DDTA 3GJTA 4LBWA 4BFZA 4JIGA 4OK3A 4J49A 4ZDWA 3QOXA 4L28A 2HN9A 4QIHA 4QPNA 4C0BA 4JVOA 2J7PD 2R6HA 1UXOA 1JMKC 3C3DA 1JDNA 4UUQA 4QXPA 4WL0A 2WB2A 3ZWNA 1Z7EA 4GMDA 1SKUA 3LOUA 4KH1A 3O93A 1VSBA 1M6VB 4JJ6A 3G17A 2NU7B 4Q34A 3N39C 1W8IA 4YR7A 2IPLA 4YXWD 3HU3A 4BNMA 1WKVA 3LS2A 5FLYA 3A2KA 4WLNA 1SB8A 1W85A 4BFUA 2HU7A 5FRDA 2FWMX 3TIXB 1RZVA 1TC2A 4JOSA 3A1VA 5AKIA 4RJIA 3JRNA 2WMOB 5IPFA 1XPRA 2X8JB 4PYQA 4GYYA 1W6UA 3IKMB 4RVCA 2XZDA 3DL7A 1MX9A 2HSWA 1FSZA 4TLEA 3EEYA 5J5CA 4YMGA 2J4DA 2YN4A 3OI7A 3PPYA 5D1NA 2PMEA 3DT9A 4F91B 3RJZA 3WG9A 4PGGA 2PZBA 2ADOA 5HKKD 1GLGA 2W8ZA 3SR4A 2E5FA 5EQDA 4WEQA 3G9UA 3FYCA 3SU8A 3GPCA 4N49A 4G2NA 4L22A 2P2GA 4DLYA 3HA7A 1YZHA 5E4YA 4DSUA 2O8EB 3EDQA 3IV9A 3CN7A 1VI6A 3JARB 2Q62A 4H7JA 4D8TA 4KO3S 1GTG1 4MVXA 3E84A 5BO5A 3HCNA 1MT3A 4OHWA 4V0NA 5H4HA 3SEAA 4Z9AA 2N42A 4C87A 1A69A 3S0JA 4UOZA 2B8TA 3KUCA 3JAWA 4OX9Y 4IZOA 4C3VA 1KRXA 2PUDA 5ALPA 4NKRA 1ZL2A 5AD1A 4RHYA 2EKDA 1KI7A 1PD0A 2BKXA 4C1NA 3C48A 4TOIA 5C4IA 4MV8A 3CTMA 2CD7A 3NANA 3ISVA 5AM1A 5M3BA 2FG7C 1KZ9A 2P9EA 3AM5A 2CVPA 3X1YA 2ZTLA 2A9FA 3ZOKA 2W2XA 5FPKA 3ZS9A 2B7CA 2WU8A 4ABTA 3SPXA 3SYLA 4BCCA 2WIBA 3FKQA 4S35A 1U4SA 4HJRA 1IN6A 1SKBA 1UJBA 1XZ8A 3DUWA 1OSNA 2VJMA 2YWEA 3MQ4A 2BZ0A 4PCUA 5K3EA 3G13A 5L7WA 1OYYA 1PZMA 3H0EA 1JNXX 1ODSA 3E03A 1RSZA 2R8ZA 1M8GA 2ZP1A 1DX6A 5KQSA 4Y8VA 5TY0A 1SXQA 1U7UA 1X9HA 2PUEA 2G4VA 1N3IA 4OL9A 3JSXA 2C9OA 1OBCA 1L7VC 1TQDA 3C70A 5KINB 1QONA 3G0CA 2PVPA 1TCVA 2NIPA 2I9KA 4RZSA 2CXTA 2QG6A 1RCTE 4OY3A 1BVUA 4M83A 3I73A 2QN2A 4FTWA 3PDIA 1A2KC 4LQCA 1Z7BA 2RGNA 3UAOA 5C4MA 2PXHA 2QTCA 2PXAA 3PU6A 4M1OA 1J42A 1DBPA 1XD9A 4FSDA 4MA0A 1KY4A 4PQEA 5DBHX 5AOBA 5I51A 3FNQA 4N48A 4TQGA 4J0GA 1XCLA 5JLJA 2W6JA 1KYYA 1N5KA 3IT0A 2NAFA 5AJZA 2NADA 3Q1KA 1XMSA 5IZCA 5AKHA 1Y1QA 2ZRAA 4L85A 1GG9A 2R7NA 2N3ZA 4HNRA 5FA6A 1YE8A 3KG2A 2IV3A 4F72A 5BUQA 3SFVA 3IMGA 4D9NA 3V1YA 1T1IA 1V11A 2C5FA 3JWGA 4ND8A 3O5AA 4ESOA 1JPJA 2JD0A 2ZBQA 5KWVA 2I4OA 3PNSA 4NOLA 3PUHA 1FX0A 1L3CA 3LNTA 3PF9A 1YUMA 1BMDA 5E6SB 1QPZA 3KV1A 1EM8B 3P4XA 4Z7QB 3L4EA 2JA2A 1BU5A 3GJZA 1XCJA 3KRTA 3MPUA 5GM1A 2DX7A 3GEPA 1PE0A 4YRIA 3R0ZA 4BMDA 4NC9A 3KJNA 5HZGA 2XAAA 2OPHA 2GAJA 2POCA 4N47A 3ZJUA 5B36A 4MWSA 1P4RA 4R2KA 3M4NA 1CKEA 1FS5A 1PJBA 4JYMA 4ZHQB 1Y0BA 3HWSA 1W59A 5GVSA 2CMDA 1NQAO 1HDCA 3BTOA 3CEMA 4JJ4A 2Q3LA 3LBIA 4WWHA 2QIOA 2WJJA 3ETCA 4J43A 4V0MA 4AZTA 5ECDA 1GKKA 1NZJA 3DWGA 5FTJA 3HN7A 1I3KA 3HHPA 3OICA 4QXAA 4CR6A 2H52A 3AI3A 2HY7A 3WDMA 2PYZA 3LO5A 1OLSB 3RH0A 3QWIA 1WHSB 3OQIB 5DGDA 2AQKA 2DUWA 4CIAA 4N5LA 3FYUB 3PEUA 3WHLA 3AEUB 3DE3X 4JQOA 2CT8A 3B1VA 3PENA 3VYUB 4IVQA 3BL6A 3Q7RA 4GOOD 1JKIA 1BHSA 3CNEA 2Q5OA 3LMKA 5HMMA 5E3IA 3V7YA 3DLBA 2O2YA 2VJNA 2FHPA 3O3OB 1F5SA 1L1EA 2BZSA 1DFIA 5GV8A 4DEXA 5CJPA 5IHXA 5JU6A 2XZTA 1KEUA 1B00A 1V3TA 4TVBA 4BJ5A 3WHIA 5AKYA 1YJ5A 4WXEA 3DO8A 5HJ2A 2OCKA 4CKCA 1GPJA 1NMSA 1OI7A 1RP7A 3AKCA 3N5CA 1JAXA 4L5JA 1R5OA 3KFLA 3UMFA 2YZGA 4WZAA 1Y1PA 3FWZA 1YULA 3RFCA 4R71A 1TRKA 2Q0XA 3BA1A 4MSUA 2BFEA 2BEVB 2GT1A 2BGWA 5F1KA 3ZHXA 2BM1A 3A32A 1H4SA 1UBCA 4FFNA 1AUOA 1E7YA 2ACWA 1KERA 1D4OA 2R5FA 1A5TA 2AZTA 4H3KB 3JPYA 4KBYA 2DPLA 4LS3A 2IOFA 3ZQ6A 4XIIA 4ER5A 4AMBA 1A5ZA 3IMEA 3O3NB 3ADDA 4G3XA 3N70A 2CLDX 5D7NA 4AKEA 3M9XA 1AURA 2QMOA 1ICIA 4J2TA 3UTDA 4GI2A 3TPCA 4OIMA 1D2GA 1Z08A 1E9EA 1JFVA 2G83A 4A8TA 5JJBA 5IAAA 2WPNA 4P35A 1RIIA 3ZD6A 4FD3A 1R1DA 1XOIA 5FPTA 4F4FA 4RD4A 1U2DA 3GJ3A 2IHZA 4RORA 4ZVSA 2WQ6A 1Z63A 4OMFG 3CUUA 4IKOA 4I5GA 1UCFA 4EGSA 4HNAB 2HWXA 2O8CA 3ZNNA 1AUVA 1HRDA 1XEAA 3M81A 2I7TA 4M37A 4RMNA 5COBA 4GWKA 2DU8A 4XR9A 2R1VA 3LQ1A 2X0IA 4WXMA 2WP8J 4F85A 3JQCA 3GRVA 4G6ZA 3WDKA 1ORTA 5BORA 4OB6A 4X7BA 4CT4B 5KMGA 1UKZA 1F14A 2BFWA 2W83A 4AY5A 5LOVA 2EKPA 4O1IA 2OD2A 1LS6A 4K9SA 1Q1ZA 3UGTA 4CU5A 3E3OA 3Q8LA 1X8XA 2JI4A 4HDRA 4Z4HA 2QI9C 4EJSC 2QVYX 2AOUA 1DSSG 1GXSB 2CZQA 4X8HA 3S1LA 3H75A 3SBEA 3GPBA 2DKOA 4RQAA 4EABA 2ZYSA 3D3EA 4AX4A 1PQ4A 5B57C 4BPBA 1XQWA 4GW3A 2NPFA 3J80A 4GLLA 1DDOA 1OCEA 1VLZA 2OHOA 5BSHA 4UJ5A 1CJKC 3P9SA 1KTVA 3B60A 4ZDIA 4OHMA 4LFBB 3O6VA 3IUNA 1G4HA 3ZWKA 3M9WA 4DCSA 4D8YA 1F20A 1N5OX 2VSXA 4K40A 2A8YA 2ANBA 2VP0A 1JQKA 2WJYA 2AEEA 2PKQP 4I50F 4O2LA 5K2MA 1SVLA 4BO6A 3TS1A 2FWBA 4OMDA 3UJBA 3UTCA 1WLSA 2C4MA 1ID1A 2JCGA 2QQGA 1GTJ1 4HDKA 5EOVA 1IVYA 4Q1VA 2ZUEA 4JV5B 3QF4B 4IOLA 3UMJA 2PU7A 3ZI7A 2VAPA 3IIIA 3N7UA 4RKWA 2ZT5A 3PXXA 1ZOIA 3KDPA 1E1CA 4XDYA 3UJ8A 3ZDXB 2O59A 4B80A 4XYEA 4GOLD 3A1NA 5C53B 2XRMA 2NZXA 4MVJM 1GRCA 3AKEA 2BMAA 4LDAA 4CR8A 7YASA 2R44A 4JB2A 3FVWA 4HUQA 5HVNA 4RTQA 2B8JA 3AB7A 3AF2A 3HZHA 1L5OA 3M2PA 5CXXA 4B6FA 4DA4A 3EBPA 1NR1A 2I6UA 1W88A 2F00A 4TKZA 3ZU6A 4FMDB 2QRPA 3W8FA 3JD2A 3A36A 1DG3A 3IURA 4RK7A 1LNQA 3ELUA 2CFSA 1FJHA 4QJ4A 4ARVA 3ELDA 5J4KA 4FSXA 5JXHA 3ZC3A 2VWHA 5ICSA 2MJLA 3LBYA 4NEQA 1N0WA 2QAGA 2WUFA 1AHPA 3IMFA 1ZRNA 1VPVA 2J9XB 2ZJOA 1LF5A 3H4MA 3OMLA 3QOFA 4Y2QA 1X8LA 5FUXA 1WHTB 3HXLA 2GEUA 1P19A 1EGAA 3ASUA 4HHEA 4NL4H 3GZNB 3LUDA 5JH7B 4TKMA 4KTTE 3WL6A 1EBBA 4ZD6A 4EBBA 1KP2A 4A27A 1UKCA 2M1XA 4CBVA 3BHNA 3JX9A 3T7RA 1V6AA 4ENSA 2MDTA 3ZDCA 3JQAA 3ROMA 2FR1A 3HGTA 1RQPA 2LIVA 3P2IA 4JA2A 2DTDA 4YC7A 3L1HA 2CC2A 5EZQA 5AICA 1WUKS 4F46A 1XRMA 2FOXA 2V3WA 4FU0A 4JK3A 1V5WA 4MEJA 1KFBB 3CIFA 1KDOA 5HKBA 3KYCA 2OA0A 4EO9A 3HZRA 2NO1A 5HQ3A 1OGYA 4H31A 3I2HA 2FOIA 3L7MA 1O9GA 1HDEA 1PR4A 2MHCA 3LCCA 2YOFA 3JRWA 3MAJA 3MWLA 1ISSA 1JVNA 3NFRA 4MJ7A 4TM7A 1RC0A 3A9CA 3E9MA 1BS2A 3QJYA 3T1VA 3PWSA 2QJFA 4GUAA 5EYPA 3GGGA 1HGXA 3C7KA 3IP1A 1OR8A 2VWPA 8AT1A 4ARIA 4GU5A 4R0VA 3WSVA 1O58A 2BEKA 3JALA 4LBZA 3CRVA 1QRRA 3V2IA 2V6GA 4ND5A 2WV9A 3ZH2A 1NQXA 3BSYA 3OPYB 2D7DA 1Z33A 1E1RA 4NYJR 1T3GA 2KSQA 5JSHA 3VR2A 4KNVA 4OFBA 4LMRA 4XFKA 4D6YA 4TQAA 4HNVA 2G0AA 3K9BA 3VDNB 1JZTA 5B1DA 1YZTA 1REQB 2PCJA 3ZV4A 5T8KA 1ZGCA 3SJAA 3TVDA 3NYIA 1QQTA 2VJOA 3CEHA 3M1IA 3OZBA 4KVGA 4OHRA 5A4IS 1ZGAA 2I71A 1C0PA 5AJUA 3AILA 3D59A 4LOAA 4H17A 4C22A 5EP2A 4MTLA 4QULA 3A2NA 3MK31 3VBCA 4L4RA 4YAWA 4W9RA 2WAOA 5IJ0B 1YE3A 1ZW1A 2HGZA 4J1SA 3ZOZA 3TI9A 4IH1A 2CBZA 5I5GA 2IHBA 2YJ4A 1UMDB 4RIHA 1B15A 4XPZA 1WBJB 1V6CA 2WG0A 3DB2A 4LQDA 3F5MA 5H1YA 1NYQA 4LRWA 5HJEA 4EVRA 1M1YB 1Q91A 4FCTA 4OGGA 1MIOA 1Q22A 4Y1FA 4EHLA 4NH4A 3HZZA 1J9ZA 2EIXA 3B1ZA 3E53A 4LA4A 4UARA 3ZQUA 4AFNA 5JT1A 3NTXA 2XGJA 3OCZA 1AU9A 4R8LA 2P4UA 1R7RA 3R5TA 5KNCH 3RC3A 1C8BA 1NYLA 2P7HA 4EK9A 1EVLA 4L78A 4OB7A 2K5UA 4ECEA 1YE5A 3QIVA 1DBIA 1R00A 3QNWA 4KEAA 4MKFA 4X7PA 4B6QA 6REQB 1W5FA 3GDWA 2PWPA 4KK3A 1L5VA 2F9LA 4IJQA 2VHQA 5IVKA 2I2DA 1NN5A 1YDWA 2NV2B 3QPAA 3AXSA 1G9XA 3IV6A 4HH3C 5JD3A 4O2AF 821PA 2WHQA 4M0FA 2PH1A 3TLEA 1LPAB 2WWVD 5CDFE 1A8PA 1QKJA 2CFRA 4HZUB 5I8ZA 4LI3X 1BJTA 4ZAFA 3CLSC 1QIIA 1TTPB 1VC2A 5KTOA 1M0TA 2XYGA 4I5DA 5BRNA 1B26A 3DP9A 4RTJA 3K09A 4KWEA 1FL9A 3IC5A 3TDKA 1FSGA 2HUNA 4BNDB 4R7ZA 4B3XA 2VSOA 1DAMA 3G82C 2RB5A 4OHXA 2P3LA 2CKDA 2GRAA 5TPWB 1T36B