4MH0R

Selective activation of epac1 and epac2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
162
structure length
150
Chain Sequence
EYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLAFLESSAKSKINVNEIFYDLVRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rap guanine nucleotide exchange factor 4
publication title Selective activation of Epac1 and Epac2
rcsb
source organism Mus musculus
molecule tags Signaling protein/gtp-binding protein
total genus 39
structure length 150
sequence length 162
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4mh0R00
2GHIA 2O8DA 1CULC 4M9ZA 3VR5A 1UDWA 2BBOA 2RMKA 3QXXA 4S35A 1U9IA 2GXQA 4GMXA 5KPJA 3WP0A 1XWIA 1NIPA 4A2QA 1YR7A 2ZR9A 3Q72A 4C9BA 5BQ5A 2IX3A 2W6JD 4FMDF 3U7GA 5D3MA 4URUR 4V03A 1Z06A 3VR6A 3MCAA 3FKSD 3K53A 4DLSA 2PCJA 1JECA 2NO9A 4UNRA 2BIFA 1SZPA 1P7CA 2R6CA 4M1KA 2DFLA 4AYTA 3LW8A 1GUAA 3NDPA 4TT3A 4OHXA 5DHAA 2YWEA 4X8MA 4OHVA 1UFQA 3IO5A 3K0FA 4IJMA 1IN8A 1Q3HA 2VSXA 3X1ZA 4QM7A 4HDQB 1W4AA 1II8B 4RD0A 4JLDA 4NMMA 3C5HA 1ELOA 1VHTA 4YMVA 5GJWC 4LYJA 4B48A 1E2FA 2ZSEA 3NKVA 2WOJA 2NZ8A 2P0EA 3TUZC 1M1YE 4YC7A 1YR8A 1SVLA 2CLSA 1IAQA 1Z5ZA 4QJ3A 3ADBA 4O3MA 2XJ4A 1KI4A 4IDPA 1N6OA 1LV7A 3OZXA 5DISB 2A30A 1DAIA 2ZSBA 1KZ7B 4F91B 4C7OA 1I4DD 2IHBA 4MRRA 1FNMA 5BYJA 1EXMA 4TMVA 1KMQA 4BFVA 6Q21A 1TPZA 5FPSA 4BFSA 4JLMA 2F9MA 3SHFA 1YZNA 1LF5A 1OFUX 5K8UA 1Q3TA 4YLGA 1F2TB 5FOSA 2QQEA 2VP4A 3IIJA 1Z0KA 3H84A 2HT6A 4NZYA 4NH0A 2O0JA 1HA3A 2NPIA 2EYQA 2WM9B 2XTZA 3LAWA 4LBWA 1ZIOA 4LYFA 1KMHA 1VG1A 1W2GA 3T61A 2JLZA 2JGNA 4Q7KA 5HKKD 4IXNA 4FCVA 5CLQA 3AP1A 1PVOA 2D4HA 1CJUC 2G3YA 4QHTA 3GFPA 4N0DA 3DKPA 4URZR 1T3SA 4V0LA 3KQKA 4NCKA 1GSIA 4JLJA 1OFHA 5FR1A 2VHTA 4XD7D 5FOWA 3FKQA 2ODWA 3SBDA 2O8BA 1KJWA 2A78A 5JBQA 1OH7A 3OFND 2OO7A 1SULA 5KSPA 4ESVA 3B78A 3QI2A 4PO9A 1J70A 1MABB 3GMTA 5EJEA 4ESHA 5KO2A 1DAKA 5SZKB 4LBYA 2F1IA 2FSGA 4ZCLA 4BZPA 1V43A 1FPMA 1KY2A 2ZJ2A 5CK5A 3V4RA 1TU4A 1GRQA 1LTQA 2NO1A 2EQBA 3DKVA 3MWKA 5AR1A 1AA9A 3KFXA 1M7GA 3CRQA 4G5OA 5C1BA 3A6PC 1GFIA 1E9SA 2ZJ5A 1PLKA 2J87A 1WRBA 2IW3A 1G6OA 1TUEA 2J59A 4MDEA 2FOLA 1XTQA 4WXRA 1NMZA 3TSZA 4LYAA 5FL7D 4IOLA 3A1UA 1N5IA 1FNNA 4DSNA 3P1JA 1QF9A 1XMIA 2HJGA 2AXNA 2FSIA 1KZGB 4Q19A 2BM1A 2YOHA 4JBYA 2F1JA 3Q85A 1GVNB 3L0SA 1O87A 3X1DA 4V0NA 4OBEA 2QE7D 1I4LD 2YVUA 2QNRA 3OIYA 4FMBB 3EWSA 1OJLA 1TF7A 1ZM2A 2QPAA 1UKZA 1YZKA 1BKDR 1Q0UA 3VKWA 3VHXA 5DLQC 3LVQE 4KFUA 4KVGA 3FKSA 3R20A 1US8A 1UAAA 2WZQA 3QXJA 3LQQA 4PHTA 2GJAA 5JCPA 3ECCA 4TTPA 4F38A 2FEMA 3GLHA 4QKQA 4DCNA 4AY2A 2CXXA 3DO6A 1EG7A 2X77A 1E9CA 2NGRA 5TB5A 2JLWA 1RRPA 4G5RA 4ZDJA 4I1VA 1YRBA 1E2EA 4NE2A 3AVUA 1Y3AA 1ZUHA 3VKHA 2J0UB 5FI0B 4NL4H 4PQYA 2EFEB 3SYLA 2Q3HA 2REOA 1CRPA 3OE7D 1CXZA 1RYHA 4C0LA 1SVOA 3U4QB 4ZI3A 3ADCA 5H8WA 2WAYA 2IT1A 4P4TA 5AJYA 1SKYE 5DN6A 3IHLA 5EXTA 3B6EA 1XMJA 1OYYA 2CHGA 3IEVA 1DTSA 2OLKA 4LJ9A 4Q4HB 2GCPA 3RRNA 1MRNA 1XCPA 5A4JA 3VR4A 4DLWA 2XJ9A 2ODBA 4I4LA 5CITA 4B3XA 1HY3A 1TMKA 4A0GA 4HB0A 1NG1A 4PHHA 4RZXA 2ZSFA 2BBWA 1ZNXA 2A3RA 2BDTA 4BECA 2CVFA 2JASA 4MH0R 1ZIPA 3O8CA 2QM7A 2X2EA 4GOJA 4OI4A 3F8TA 4POAA 1SHZA 2GVZC 2XNDD 4DJTA 4QJ4A 2OZEA 2QPOA 5HKKA 3ND8A 4D6PA 5H68A 3KJGA 5LD2C 4ACBA 1KI7A 3KJEA 1G7RA 1N6NA 2ZE8A 4ITRC 5FH9A 4MUBA 4L5BA 4P4UA 3BB1A 1NN3A 4ZI2A 2DPXA 3ZD6A 1E94E 2NPFA 4O0MA 5FFMA 2G6BA 1ZNWA 1P75A 2A5DA 4ON9A 5CYPA 4EJSC 4D4LA 1W0JA 2N42A 1OIWA 5FBLB 5C46F 2Z5FA 5ANRB 3BK7A 4PZZA 4OQMA 1QHHB 4LJ5A 1Q57A 3GLGA 1R0XA 1CJVC 1TL7C 1NSFA 4AK9A 1D2NA 4FINA 1ZAKA 3BB4A 2C9CA 3EZ9A 4PC6A 5TMPA 1RJ9B 1FQKA 3AB3A 3MLEA 5GJCA 4Q9KA 3TSWA 3I1FA 3LFUA 2W0MA 2DYKA 4JLAA 5FPHA 1ZM4A 2OG2A 3U60B 1YKSA 3EZ7A 4KBFA 3D6TB 5FPYA 4PHGA 1N25A 4DLVA 4TLCA 1UBCA 4B3BA 1UBGA 3SBEA 3KQUA 1JR3A 1G8FA 3DPUA 1HUQA 2ZITA 3O8BA 2ORIA 2AKYA 1NVXQ 2JLQA 4B2LA 1W1WA 1KO5A 3QKRB 2JJ2A 2OAQ1 5CB6A 4NDZA 2VH5R 2OXRA 2WWGA 3PUVA 1WE2A 4JZKA 2ZS7A 1U90A 1E2MA 3FVQA 3OEHA 3AF1A 4CT5A 3L8YA 1HH4A 4C0SA 3OAAA 4Q1EA 3AF0A 4B33A 1OYWA 4NYMQ 2XXAA 3SJCA 2ZI7A 2P3SA 4Q02A 2HT1A 2BJVA 2OHFA 4A15A 5JRZA 3QVVA 2Z4RA 4LV6A 1YJ5A 4QFMA 3NIBA 3RVBA 2F43A 1A4RA 2DFNA 1Z3IX 2O0HA 1GWNA 1GL9B 3TQFA 1R5NA 4CVNA 3U5ZB 1WB9A 3NH6A 2XOKD 4CZ2A 2IYWA 4A8JC 4D25A 3FWYA 2Z4SA 2WJHA 3L0IB 4BLSA 2QQ0A 4O2RA 1G18A 3T5GA 3UMFA 4HUTA 4Q7LA 5LBIA 2Q21A 1RZ3A 4PQFA 2FE4A 1N6HA 1E2PA 2OUKA 3SS8A 4GRAA 2KE5A 1H8HD 1P61B 3GCGA 1XTJA 1H65A 4RFSA 3BB3A 3GLIB 3JZMA 4R98A 5DO9A 1Z2CA 5L3SB 2GBLC 3B1ZA 4FMCB 3KFVA 1Q44A 4QGHA 3B60A 5FOUA 2KBEA 1DAHA 4KO8A 1YHNA 3CUEF 4HAVA 3W6NA 4A1FA 4G0NA 4EFNA 3U7EB 3EPKA 4XTRA 2GXSA 1YVDA 3U7FB 8OHMA 2FWRA 3SYNA 3ZZUA 1EFRD 3MSXA 4BE7B 4QBIA 5JMTA 2ZRJA 2BCGY 4IDOA 3AM1A 2IYZA 4OI0A 3HU2A 4BQSA 2BWJA 2CL6X 4LZZA 1MO4A 1E1RA 3EZ2A 3CRW1 1E9AA 4CEJA 3QKUA 2A5YB 3VKGA 3P4XA 1SGWA 2HXSA 4WA7A 4LHZA 2AXPA 5AWFC 3WP1B 1OIVA 3EASA 3B7GA 4TLEA 5E7MA 1Z29A 1BS1A 4F92B 1IXSB 1QG4A 2G1KA 3BWDD 3THWB 3SQWA 1Q1ZA 2TMKA 2YYZA 1WF3A 2PBRA 2GZAA 5HPYB 1FX0A 4RCYA 1T5IA 2QP4A 3O8DA 3ZDQA 1WQ1R 4LJ4A 1ANKA 3I62A 4I1UA 3NDBB 3DZ8A 2QP3A 2YKGA 5JI2E 2J3EA 2B6HA 2ZROA 2GJSA 1QBKC 1E0JA 1YZLA 2QL6A 1QVRA 3LWNA 1J90A 1IN7A 1RFLA 5B57C 2UZIR 3IILA 4EIWA 4MYHA 5DI9A 3CX8A 1M7BA 2I1VB 3U6BA 4XJXA 1XJ0A 3H4MA 1TF2A 1U0HC 2QAGA 1Q1EA 3ZIAD 1U98A 1UF9A 4G5QA 3Q8XB 4L8GA 2BC9A 4NCHA 1FW6A 1G4AE 2X2FA 2ZAMA 3IDQA 4FD2A 3B9PA 1ZM9A 2QSYA 4RZUA 1LF0A 1OH5A 4HLUC 2CJWB 2E1RA 4G1UC 1S2MA 1XTSA 4QGFA 3KTAB 1S1MA 2ECKA 5C4GB 1ZCBA 1FMLA 2JIZA 3RS5A 2GJ8A 3FFBA 4TQUS 5B58C 1DAGA 3SN6A 1ZUIA 3G82C 1TUIA 4DDWA 3UWOA 5CM8B 5H70A 5LD2B 1GILA 4D81A 4JYBA 2Y8EA 3B13B 4W9MC 2WWYA 1P9RA 3GLFE 2HLDA 1OXSC 3LDAA 5FPKA 5EUQB 1R5OA 3TKLA 4NYJR 3RC3A 5HE8A 3TAUA 1NVWQ 2KJQA 5BN4A 1DG1G 3FFAA 4LWZA 3EA5A 4EJSB 2IYVA 4IDQA 1GZSA 4KODA 4DXAA 2VF7A 2O52A 1Q1QA 2EWWA 3GFOA 2R2AA 3IUYA 2VF8A 2ZYTX 1SVIA 4XTCS 2R65A 3C16C 5GJVC 4EPRA 2ZE7A 1CU1A 1Z6TA 3SQXA 1P73A 1XJCA 3DDCA 4HAUA 4ERNA 3PEYA 3QKSA 1N6PA 2XOKA 1A5TA 4DLUA 4TSFA 4NBSA 5CDFE 3WBKA 3I5XA 1NVVQ 1X1RA 2GCOB 5IK2D 1OB2A 1WMSA 1ESMA 1LVGA 3PIRA 3GJ5A 4TL6A 5J4VA 3NBYC 2IF2A 3GJ0A 4IVQA 3REGA 2AL7A 1AJEA 2RB4A 2N1BA 4JLNA 3QKTA 5FUVA 2JCSA 2PT7A 2FSHA 4IHQA 1FFHA 2B21A 1P9NA 4U7DA 4URYR 2V8OA 3EIHA 1N0VC 1MH1A 1R0YA 4KI0A 3Q7PA 3LBIA 5EQTA 3R7WB 2PEZA 4GP7A 3I8XA 2ZRLA 3LH5A 5DSZA 3UK6A 5CJ2A 1EFRA 4QC2A 3A1VA 2G0TA 4AURA 1CBUA 3CNLA 1E4VA 5KDOA 2GJ9A 5AUOB 5J5CA 3EA0A 4TLDA 1N3BA 2IL1A 3VAAA 2IS6A 5JCZA 1XEXB 4PZYA 3SR0A 5C2JB 4DIEA 3MG9A 3QEJA 3IBGA 3ZVMA 2UZ3A 2W6IA 4PFSA 3K9GA 4V0MA 5F9FA 3THYB 1T91A 4EUNA 1Z0JA 2F6RA 4W5HA 1A82A 3IQXA 821PA 2NQ2C 3FOZA 1UM8A 5FTKA 3K0SA 4A8JB 4GNKA 2QTFA 1NSTA 3LV8A 3ZJYA 2OBMA 4L9SA 4A0RA 1D9ZA 2YHSA 2DHRA 2KBFA 4PC2A 2NO7A 2JLVA 3K9HA 3ZQ6A 3LX5A 2FFHA 5JJKA 2P65A 1JXOA 5FL3A 1Z6YA 2Q9AA 3K0AB 3LBNA 5KDLA 4LDJA 5DE3A 3NHBA 4IEIA 4W5JA 2HDNB 2P5SA 1II8A 1R8SA 3WHKA 2I3BA 3TVTA 1GTVA 2OV2A 1NMXA 2OM2A 2GILA 3CWQA 1Z6AA 4US0R 1FQJA 2XZOA 3AUXA 1Z2AA 3QJYA 3ZIAA 1AGRA 3RWMB 3SEAA 3ICEA 4C0KA 4PQRA 1B0UA 2OCYC 4YMSA 1A1VA 2HYDA 2XZLA 1R10A 2X1VA 1WA5A 1GNPA 2J7KA 2R6AA 2AWOA 2FJUA 2G0NA 4NYMR 5DIFA 3GEEA 4RJLA 2AFHE 3VR1A 4D4KA 4OHWA 2B8WA 4LJ7A 3NH9A 1IXZA 4WVFA 1WXQA 3TW4A 2F55A 4RVCA 2ERXA 4QBGB 2IK8A 4ZCIA 1JQJC 3A4NA 1UDXA 2CCKA 3OIVA 5FTLA 2DCUA 2QMOA 1BO6A 4B35A 5JSZB 2VYFA 2WWIA 1KI9A 2NZJA 1F2TA 5CLLA 2VP0A 2X19A 3C8UA 2RGEA 3LO5A 1QVAA 4IDNA 4WXPA 3RS7A 5G3ZA 2QY9A 3WNDA 1VG0B 1TF5A 4DCUA 4Y0VA 4C30A 3BFKA 1FUUA 4CIDA 2XNSA 4PO1A 1ETUA 2JJ1A 2W00A 1KI3A 2Z0MA 3PV0A 2JLYA 2W2XA 4JVNA 4BPBA 2IHYA 1QRAA 1AN0A 1Z08A 3MAAC 2C04A 5JI3E 3N5CA 3U44B 3NC0C 4LV8B 3MWJA 1O3YA 1XRJA 2OE2A 4BRWA 2ZRIA 5BN5A 3CONA 2I4IA 4G5SA 5EXXA 5F3WB 2GVDC 3TVDA 2IWHA 1Z0AA 1P5ZB 1GAJA 1EGAA 2VA8A 4JJKA 2BHRA 5L3QB 4E09A 2WKPA 2CDNA 1CR2A 1XXHB 2ZQ5A 3LNCA 4QGGA 3FHCB 4P33A 4Q4AB 4UXHA 3NHAA 1MABA 4M2LA 1KAGA 4M1WA 3U3OA 1DBSA 1N5JA 3C5CA 4M9QA 3X1WA 2QP9X 4BFTA 1CJMA 2H5EA 1GDDA 1XTIA 4OKSA 4Q9JA 2YC2C 4D0NA 2RH5A 3LBHA 4DEXA 3EW9A 2CEAA 1ZUNB 4MGKR 3ZLJA 2O5VA 1KO4A 1UEJA 4RD6A 2HUPA 2C95A 2J5XA 4B6FA 4DT1A 2FMXA 3FDIA 4B47A 1JB1A 1F5NA 1COWA 4WBSA 5CJPA 1DOAA 5AUNB 1XFAA 3BERA 2F3TA 2VPPA 3FMPB 1XX6A 4JLKA 3GPLA 1PUJA 2H1LA 3SI7A 1KOFA 1RRFA 4Q00A 3T1TA 2G88A 1YE8A 1JEDA 3OESA 4DWJA 4BFWA 1P6XA 1A2KC 2EU8A 2DR3A 3BORA 2R44A 1GOTA 4TQ9A 4D0LB 4PPNA 1VCOA 2UKDA 3B1XA 1KIMA 3P32A 4CW7A 5AK0A 4KSCA 5E4FA 1OB5A 3U3JA 4FIDA 1X1SA 3K9LA 4B43A 5F98A 4PTLA 2V55B 4JSTA 1XF9A 2CCGA 1KSJA 4OI2A 3TNFA 1KO1A 4TLBA 5DYIA 2XTNA 3VQTA 3PJRA 4MDFA 4EKDA 3RRYA 3EPLA 1Q1BA 1XNJA 4KJZA 1XCMA 3QPUA 1U0LA 1VIYA 3T5DA 4M1SA 2GK6A 5J4YA 1EK0A 4DDVA 1TQ6A 1VG8A 2GCNA 2ZJAA 1FZQA 4OQXA 3DL0A 5JHGB 1E9BA 4PO8A 4NP6A 2WWFA 4E22A 3CRRA 4JS0A 3MWLA 3RS0A 4BFUA 1FP7A 2JDID 2J0UA 3RLFA 5EUMA 3SNHA 3I73A 3KKNA 3DMDA 4PSVA 2YWFA 1M8PA 2WBLC 2D7DA 3SFVA 1Y63A 2JLRA 3E1SA 1QHNA 1PV4A 1E79D 2YWHA 3U4QA 4Q4LA 3KKOA 4C2TA 2FF7A 3BBPA 3KXIA 4IVRA 3ZYCA 1HV8A 2EWVA 2ZRPA 3IKJA 4LPSA 4ZCMA 4QL3A 3A1SA 1YU9A 2MSEB 4RKFA 5HCNA 4EPYA 1Z0IA 1W46A 2JJ8A 3R8CA 4CYMA 4OI1A 1JBKA 4QGAA 4Q4HA 3SJAA 421PA 1E1QD 3IGFA 2WPDA 4OK3A 3OEEA 3CZPA 1OE0A 4DBLC 2ZUBA 4YDHB 1BMFD 5JWOA 1IY1A 1VMAA 3GJ3A 4D4JA 3K09C 2V6IA 3EG5A 1P60A 2QA5A 2ZI4A 3I4LA 2IYYA 4BLQA 5SZIA 3QQ5A 3R9IA 3LY5A 2NO0A 1G5PA 2BBTA 4MRVA 1TQ4A 4M1MA 2ZE6A 4B2PA 3WMEA 4Q18A 2CNWD 4PZLA 4Q01A 1HEIA 2QI9C 3L2OB 4XVUA 3DMNA 4V0OA 2J0QA 3RS2A 4DT1B 3HPRA 2C77A 2YOGA 2FDCA 1OH6A 1T5LA 5FOXA 5B2ZA 2WVJA 4M1OA 1R8QA 1QG2A 4Q4JB 2ZYUX 2Z83A 2P67A 2VO1A 2ODEA 4P0TA 4RSGA 3SJBA 3LA6A 4UNPA 1G291 3CX6A 621PA 2D06A 5EXSA 2RGXA 3SU8A 2IYXA 4JL6A 1DELA 2CLDX 4TYYA 2HF9A 1T8TA 1QHHA 4DCTA 4DDTA 5KOYA 1EESA 3KXLA 4UJ5A 5E7JA 1E0KA 4H9GA 1DE0A 2E9SA 2FA9A 1KHTA 1S3SA 2W6JA 1RJ9A 1NN1A 3F3YA 4PC3A 2O8CA 3J81k 4TYNA 2H57A 4LHVA 4LJ6A 1Z0DA 3AVTA 5A0FA 1W47A 4C0BA 2QZ4A 2NMVA 3KKPA 2Z6VA 2VP2A 3GFTA 4GSYA 3K70D 1G41A 3DHWC 1EFTA 3LVRE 2RHMA 5CIQA 4TMXA 1E2LA 1S1CA 3M0EA 4DSOA 3QNUA 2R6DA 1P2TA 2DFTA 3TSOA 3ZVLA 3KL4A 2XITA 3QKRA 1KI1A 1GKUB 5FR2A 5JWRA 1T4GA 1RC8A 5EE5B 4BLTA 1OKKD 1N6RA 3AVPA 3CPEA 3PUYA 3TK1A 4CEIB 2VRWA 2VLIA 3PXGA 3SHWA 4MRNA 4MA4A 4JL8A 4N3NA 1Z47A 1P2VA 2CK3D 1NBMD 3C4JA 4KHZA 1F48A 4ARZB 2PMKA 2ZAOA 3QUSA 1HE8B 1J8YF 1QDEA 4PANA 2QGNA 2OLJA 1G19A 4J0QA 4B76A 4ASUD 2DWOA 2NG1A 1E2HA 3NTUA 3W5JA 1J7KA 3WNBA 4C0AC 3I3SR 1N5LA 4B32A 2G1JA 5P21A 4AG6A 1IN6A 1XPRA 1U8AA 4NPHA 3EXAA 2J7PD 3M1IA 4C0HA 3EAQA 1IM2A 2QT1A 5HTKA 2J46A 5E3HA 1H8ED 1KGDA 2VHQA 3MFYA 4HAWA 3K70C 2YINC 1E9FA 2RGDA 2K5UA 1P9WA 4IRUB 4EFMA 2WTUA 1KK3A 3WYAA 4M1YA 2GF0A 3GLIA 1XTRA 5L3SA 3K8YA 3W90A 2IYQA 4FMCF 2PLRA 4B3CA 3BD9A 4ZV4A 2ZYWX 3H86A 4GI7A 1NKTA 4KSBA 1ZC3A 1XB2A 3KJHA 2B7CA 4LC1A 1NNEA 1LS6A 3GJ8A 1G9XA 3T1OA 1DO0A 4XD7A 2QT0A 1W2HA 4HB2A 4PAMA 4Q5IA 4XSGA 2RGNC 5KU1A 2OESA 2WV9A 3OFNA 4UNSA 1W4RA 4OQLA 3JVVA 1G5RA 3BGWA 1SKYB 2V3CC 3EC2A 4R2HA 2QSZA 2GEDA 1IY2A 5IRCD 4JKYA 5UKDA 2CL7X 3N2IA 1N6IA 4CF7A 3NWJA 2JAQA 1RRCA 2ZRFA 3IO3A 2FPLA 1KI2A 2Q6TA 1BIFA 1OLOA 1P62B 1KYIA 2O8CB 2A5FA 4CEHB 4FWTA 3THWA 3KB1A 1HQYE 3B1WA 2AFIE 3NXSA 4IXMA 1N2CE 2ZJBA 3IPXA 1UKEA 1TX4B 5LB4A 1K5DA 5HCIA 1TQDA 2D62A 1FOEB 1IJEA 1M34E 1QHGA 5FL7A 5IHPA 4DSTA 5EP3A 2C96A 3TUIC 2C03A 3UATA 4JVLA 2REXB 1IONA 2RHDA 5J40A 2RGAA 2MSCB 2PZEA 3UMSA 5BYKA 4M9SA 1RYFA 4FWIB 3CNOA 5GADl 3U7HB 1R0ZA 2J0VA 2QE7A 2Q0HA 1X86B 4I1SA 1NLZA 4NCJA 5EE9A 5FTMA 3B2EA 4K8OA 4DHEA 1NY5A 4HAYA 5TVKA 1PLJA 4IOJA 2IS1A 2A2ZA 1KO8A 1X6VA 3M4YA 4K46A 4Q7JB 1SQ5A 1A7JA 1G17A 4W7SA 3BFXA 2MSDB 3SJZA 4KBGA 1CJTC 3QPVA 4BFYA 3W9YA 5IF9A 1JPNA 4HAZA 4A2PA 4DLZA 4WZBE 2EFGA 1LNZA 2ZI9A 4XWAA 4ACAA 1SXJD 1ZVQA 2CJWA 4YMWA 1IQPA 2NIPA 1G7TA 1TAGA 2ZJYA 1II0A 2GTPA 1CF4A 1ZM3A 3RRZA 4F7WA 4IEEA 2BJWA 3KTAA 1S9HA 2GDJA 4TZ6A 1Q22A 4URWR 5B64A 4GP6A 4JYCA 1KSGA 2OBNA 2PJZA 2QM8A 1M6NA 1TNDA 3CRMA 4QRHA 3OE7A 4EAQA 1JQLB 2AK2A 2WAXA 1AKYA 3PEUA 4GPTA 1ODFA 2FFBA 1GL7A 4Z8XA 1E6CA 2C2HA 2Z43A 3ETLA 4HAXA 4KCGA 5TV2A 2FPKA 1G8GA 2G9NA 5JZVA 2ZU6A 3MUFA 3Q9LA 5TXGA 2XSZD 4LHWA 4EJSA 5FBQB 5SZHB 4FXPA 1GRRA 1HQCA 4XOIA 4X8HA 4QG7A 4GFDA 4XWKA 2BEKA 2LKDA 1CKEA 3CKLA 1KNQA 4MGYR 2EFHB 1D9XA 2B92A 5LPNA 2ZPTX 1LY1A 3EIEA 4BFZA 2WSMA 3K0CC 3TR0A 4D82A 2XTMA 3U3MA 2YJTD 3W5IA 1ZC4A 3QG1A 3D3QA 3HYTA 4LY6A 4X8OA 5KNCA 1R0WA 2BCJQ 5DH9A 1OXTA 2L0XA 2ZUCA 4RD3A 1OXXK 4KXFB 4P4SB 4ZIRB 2GCOA 2Q9CA 2NOAA 4S2EA 1NY6A 2D2FA 1SXJC 3CW2A 4LJAA 5DI3B 3TLXA 1GITA 3L0PA 3ZZTA 4BLRA 1XEWY 2I1QA 1S0UA 3X1YA 1LB1B 1V5WA 5G40A 3BFVA 5KTYA 3U6KA 2IC5A 2CMKA 3HU3A 2XNDA 3FMFA 4M1TA 3VR3A 4AYXA 4B6EA 1J99A 3LXRA 1VCIA 1PLLA 3KB2A 3TBKA 2R6FA 4DDUA 1G8YA 2VP9A 2ZYVX 3E5HA 1MO3A 3E70C 4FCTA 3R7WA 2QBYB 4MYUA 4TYPA 4P31A 2IUTA 3C7KA 1NBME 4TN1A 5J4KA 5J47A 1K5GA 2HEIA 4R71A 1YQTA 5EXPA 3N2EA 2JA1A 1E9DA 4LUCA 2J45A 3VMFA 1WCV1 3VTKA 1YZUA 1U94A 3QXCA 4HLCA 3THXB 1XEXA 1G21E 4LK2A 5FTJA 1NLFA 1X8JA 3V9PA 4C4PA 3CIOA 4OHYA 1D5CA 1OHHD 4N1AA 3THYA 1F3OA 1Z6GA 4LYHA 3MGCA 1VYUA 5B30A 2PEYA 5A5GA 3W6OA 2ZETA 5JS8A 2ZE5A 4HDCA 1W4BA 4QHYA 5CDFA 4A8JA 4IDHA 5FOVA 2D7CA 1ONBA 2EFCB 1WP9A 4WOPA 3B82A 4A92A 3K70B 1OT3A 2GF9A 3F0TA 3FGNA 4PXAA 3CPJB 5EZ5A 1D8TA 3HP1A 4B73A 1W44A 3LQRA 3T06B 3KXKA 1P2UA 3SOPA 2V1UA 3K0AA 1R5BA 5L3VA 1ZCAA 2OSBA 2GBLA 2XX3A 2VBCA 1EWRA 3B5JA 2J41A 3BC1A 1MRSA 4BASA 4Z51A 1NN0A 1OIXA 2B8TA 1G16A 5FPTA 3EPJA 4E07A 1GM5A 2ANCA 2CBZA 3EZFA 3DM9B 4U00A 1QZXA 2Q3FA 4FCWA 4KU4A 4JKIA 2ANBA 5KPDA 3OIWA 1GIAA 4F4CA 4HLQB 1E9EA 2ZTSA 5L3RA 4LGMA 2IA5A 4JIMA 2R9VA 5FUWA 3AP2A 5TARA 3IBYA 4KYUA 2QUZA 4R2IA 1GRNA 2OAP1 1T9HA 5LB2A 1HYQA 4G5GA 2ZR0A 3BXZA 4OJKA 2N46A 2ZU0C 2WJVA 3RANA 2RKOA 4US1R 1W7AA 4M9XA 1XD2B 1E0SA 2BOVA 3FHOA 2JATA 4JLOA 4A2WA 1MO6A 2PMDA 5DGXA 2ZXUA 2PT5A 2DWQA 1Q20A 2GZHA 5JSZA 4F4IA 1J8MF 3L43A 3UANA 3WRYC 1H8HA 4JT2A 2E87A 4YXWD 1ZD9A 1DAEA 1VDZA 2ONJA 1S9DA 2GRJA 4WW0A 4AI6A 3ASYA 3RDPA 3HU1A 2O8EB 4B3DA 5J4LA 4AC9A 2IS4A 4I99A 3MWYW 3TH5A 4IW3B 4JVSB 4M53A 3EPHA 3U44A 3X2SA 3KJIA 5D3QA 1GNQA 1OF1A 2Q9BA 3CNNA 4QNRA 3GLFB 4TTQA 2H16A 3JZAA 5E95A 2XAUA 1YZTA 4EPVA 4IOMA 521PA 4RZ2A 5KUTA 1S3GA 1OFTA 3RS4A 4L4UA 4XWOA 5L3QA 1NKSA 4Q4AA 1XXHA 1Z0FA 2P2LA 4MYCA 4TMKA 1SXJE 3T35A 1E3MA 3UPUA 2IWRA 5FUXA 4HLUA 3GJ6A 2KWIA 4LC0A 4JBWA 4Q1BA 3PEWA 3QENA 3AF3A 1RE0A 2RAPA 2WIAA 4H1UA 3C14C 2IXEA 1MO5A 4M0LA 3KQNA 3O8RA 4TT3D 1S96A 4TTRA 4Q03A 2ZUDA 4NYIQ 2DY1A 3QVUA 3EARA 3NC1C 4U02A 2IYTA 2R8RA 4HZUA 4JMPA 1X8LA 3HR8A 5JEEA 5AUPB 3ZS8A 1K8RA 4IKEA 3ICQB 2ERYA 3I8SA 1KY3A 3R8FA 3AVXA 4XH9B 1CR1A 3QF7A 4B75A 1BH2A 3P4YA 2DFKB 2HYIC 1G7SA 2F3RA 1OW3B 2FN4A 4IOKA 1AQYA 1KK1A 2IS2A 4HI0E 4LBZA 1DS6A 2UVQA 3LRPA 1KK0A 1F2UB 1OHHA 2BBSA 1MR3F 1ZM7A 4MRPA 1XZPA 1VHLA 5G3YA 4LRWA 1U9IC 1FP6A 4DVGA 3IIMA 3FHTA 4QM6A 1CEEA 1E2DA 4Y0AA 3PENA 4TL7A 4KITB 4AG5A 1QHXA 1RIFA 3NEJA 1HT2E 3VX4A 4BWYA 5F9HA 3TRFA 1SXJB 3EC1A 1AIPA 1C1YA 3BJIC 3PUXA 2IYUA 1KDTA 3K9NA 4HUQB 3L8ZA 1BYIA 2VSFA 1XJQA 2WKQA 1RW4A 3QOFA 1E2NA 1TQ2A 4Q47A 4OQNA 3WRXC 1N6LA 2BEJA 1VYVA 1X8KA 3PEVA 3IEUA 5FBRB 2AD5A 5AJXA 5KNDA 2B7BA 4NHOA 4JJZA 4PAQA 2YV5A 5IDVA 2ZVQX 1DVRA 1KJYA 1K6MA 3AGQA 1MOZA 1GNRA 4BEJA 1W5SA 2QU8A 4OL0A 5KYKA 2ZRKA 1I2MA 1VIAA 1DG3A 1L4YA 4Q9HA 5DHFA 2QEQA 3ZS9A 2C8VA 3QXSA 4MQBA 4LSGA 1NJGA 4MGZR 5JJLA 1ZNZA 2OILA 4LHYA 1I4TD 3A4MA 2FGJA 4NONA 4TL8A 1G3MA 5EE3A 3GQBA 2C5LA 3T1QA 4M22A 3RWOA 3DVLA 2AX4A 4OJQA 4M8NE 2F9LA 2ZJOA 3I92A 1T0JB 5IK2A 5HR5A 4EPWA 1D6JA 1M2OB 4H1VA 2G83A 3A8TA 4GMDA 2C98A 3I5YA 2REBA 2FX3A 3QF4B 1ZYUA 1U81A 1VCNA 4ILEA 3HJNA 4YXWA 2PCLA 2WJGA 3H0KA 2QPTA 1JALA 1UBEA 4OHZA 3N70A 3CF6R 1XZQA 1YRAA 3A36A 3F5FA 3GD7A 3W8NA 2D74A 3QBVA 5G53C 2JLUA 1KKLA 3SFZA 2JLSA 4LPKA 4QHSA 4M4SA 1IHUA 4Q1AA 5FBVB 1XU4A 3DM5A 5H1YA 4D2IA 2X8AA 3KQLA 5ELXA 1L4UA 2RGGA 4HZUB 4Q4JA 4LX0A 4QBFA 4QJ5A 2WKRA 4RZ3A 5EP1A 1AM4D 4V0KA 1G4UR 4D0GA 1EX7A 2YOFA 3Q5EA 2ZI6A 4GOXA 3LD9A 4ZKDA 2W2TA 3QXHA 3ZH9B 2D2EA 5CB8A 4TYWA 2CVHA 2WWHA 4HEJA 4Q48A 5JRJA 4PPGA 4Z1MD 121PA 4A36A 1FUKA 1E9RA 2YWGA 4KFTA 1VG9B 4GOKA 2ZRBA 3AUYA 5TDHA 4MKHA 2A5GA 4A4DA 2C9YA 1E4YA 1LS1A 3AVOA 1XD8A 4TL9A 4C2UA 3R9XA 1JJVA 1Z28A 2ZREA 4JSYA 3TQCA 1NMYA 4RCZA 4NCIA 2J1LA 4Q1FA 5F2EA 2D3WA 2YNMA 3W6PA 1SHKA 2AD1A 3NVAA 2P6RA 4AKEA 1YR9A 1EX6A 2ZJ8A 1TEVA 3T15A 4TZ0A 1AK2A 2ZI5A 2BMFA 1UADA 1G8PA 4HSEA 4LJYA 1W0KD 4Q9LA 4BZXA 5DN6D 4KLZA 221PA 1UEIA 2HF8A 3Q7QA 3RNLA 1PUIA 1UKYA 1BOFA 2YC4C 2ZSAA 4NCNA 4PC7A 5KSYA 2O0KA 4HLDA 4CEIA 4DCSA 3S1AB 2HJVA 3B85A 1RPZA 1IOZA 1BYUA 3ADDA 1AGPA 4CRWB 4UJ3A 1KAOA 1CLUA 3KX2A 2ZS8A 2GEVA 4FI3C 4ARZA 1AS2A 1JR6A 3O47A 2FPMA 2OFOA 4MKFA 2GZDA 1GL6A 2J9RA 4B2IA 4KYIB 2ZRHA 2ZR7A 1SVSA 1E2GA 1N0UA 1ZD8A 3RS3A 3MD0A 2ORWA 4DCVA 3CPHA 3WBJA 5BN3A 2WJJA 2J0SA 2BVNA 2GXAA 3V4FA 4DC9A 2W0SA 3LX8A 4Q21A 3JVUA 1VYTA 4P3YA 4URVR 3VU9B 5BXQC 1ZU5A 2FSFA 2WSSD 4R9UC 4GDFA 5J4HA 2AR7A 3NBXX 4C0QC 3G0HA 2CCJA 2YZ2A 4A6PA 1NVVR 3AP3A 4PSKA 1S4QA 2VTKA 1QHYA 2O8FB 1G3RA 1RVDA 5HZKA 4EDHA 3IIKA 3U2QA 3AH8A 4EQ6A 1UKVY 1KK2A 1W0JD 3D31A 3X1XA 3A58B 1DADA 4YDSA 2O8DB 4EFLA 1G3UA 3CZQA 1CR4A 1Z07A 1NF3A 1XDBA 1AKEA 3LXXA 3AVQA 2OEPA 3ZGXA 2IBMA 3MJRA 3TGPA 3MMPA 4KFRA 4FMDB 1NVUQ 2CHVA 4NTZA 5D3MB 3AKYA 2XGJA 2FNAA 2FGKA 3CH5A 3L0OA 4A82A 2PJRA 4QXAA 4G3XA 2ZVPX 4B44A 4Q7MB 5CK4A 2AK3A 4IFEA 3GEHA 1LFDB 4CEHA 5AJWA 4D4MA 3C41J 3K0FB 1HTWA 3FMIA 1OPXA 3IPYA 5KSOA 1JR3D 3H1TA 1UPTA 1KKMA 3WYGA 4YMUA 1DEKA 4U5XA 1P4SA 3IHWA 5FTNA 1UBFA 2EYUA 2DBYA 1OXUA 2JJ2D 4KVAA 2ZRGA 4K81B 3VNVA 1ZNYA 2BM0A 1P72A 3OEHD 3TJZA 4PAOA 1N6KA 1G5TA 1YR6A 3OAAD 3GJ4A 4NYIR 4A9AA 4DIDA 1R6BX 4BGDA 1L7VC 3Q5DA 1NI3A 1ZP6A 3KKQA 4Z1MA 3RHFA 1OXVA 3UKDA 3SE0A 1L2TA 2EW1A 1R7RA 2V9PA 5GVRA 4EPTA 3HDTA 4XSHA 2EVWX 5C4MA 4C7OB 3UG6A 4CT4B 3TE6A 1ESNA 2OBLA 3Q3JB 3W3AA 3K09A 4I1OA 3C15C 4DB2A 2EFDB 3UMRA 2KSQA 3OF5A 1PJRA 2KB0A 2WMNB 3T1VA 1G64A 2P6NA 1GG2A 2QRZA 2VHCA 4NYJQ 4QNMA 2ZRNA 4TLAA 2AKAB 4JL5A 1HE1C 4V02A 4PPFA 3UXMA 2VSOA 4RY2A 3RSLA 3B9QA 2PZFA 4WZAE 4PSAA 4US2R 2IXGA 2ZRCA 1NN5A 4AKIA 4B34A 4CDGA 1W0KA 3WXMA 1KMHB 2JDIA 1U8ZA 2FEOA 4A0FA 2OFWA 4ZDKA 3PG5A 2H8KA 4ZDWA 3CR8A 2BMEA 2OFXA 1P3JA 1ZMXA 5HZHA 1CIPA 3IQWA 3AF2A 1T8UA 3CX7A 2CL0X 2ZRMA 1E79A 1JJ7A 3AQ4A 1E69A 4A6XA 2NTYC 2QTVB 2A7QA 4D80A 2G77B 1Z83A 2O8BB 2V6JA 4OYHA 4EQ6B 2V4ZA 2LWIA 3FB4A 1E1QA 2BMDA 2SHKA 1DPFA 2BV3A 1E2QA 3WYFA 2W2VA 4DKXA 2AN9A 2GXUA 1IN5A 5K8LA 3W34A 4IVPA 1E1RD 1BMFA 3I61A 2WICA 4AKGA 3GLHE 1NJFA 2V1XA 4GL2A 1Z63A 4P4SA 3NG1A 4ZIRA 2WSSA 5DI3A 3PR1A 5KDDA 3G5UA 1W4CA 2ASEA 1SVMA 1EFHA 4E5UA 4P32A 3BOSA 2QORA 2CNWA 2H18A 3QG5A 4KFSA 3OIUA 3BRWD 1GP2A 3PFIA 1XTKA 1NRJB 5JWHA 2FH5B 3BS4A 3FYHA 1T0HB 2OXCA 3PUWA 4JLVA 4RD1A 2CE2X 2NO6A 2GKSA 4TMZA 4LOAA 1HURA 1AZTA 5DNYB 2QBYA 3KUCA 1NLYA 2OCPA 3KDSE 3AF4A 3PVSA 4EPXA 4ZKEA 3CF2A 4LHXA 3GJ7A 1CR0A 1G8HA 5FUYA 4DLTA 4HATA 1FL9A 5TY0A 1T6NA 721PA 3WHLA 1W5TA 3THXA 4LI0A 1AQUA 1KSFX 3RSOA 1TADA 1JPJA 1ZD1A 1US8B 1NP6A 1XEFA 1G20E 2WWWA 1VCMA 2IUUA 4HB3A 3ASZA 5FBWB 3GLHB 2P6UA 3ZVRA 5IT5A 3GLIE 1QHSA 4ZDIA 3RABA 5JEDA 1TEXA 2JIZD 5AJZA 4B3GA 2PX0A 4BZQA 1VPLA 1W49A 4KAXA 2GETA 1E99A 2DB3A 3V00A 5LDDC 3VHLB 1W36D 4UXIA 5EP4A 3BH7A 5JECA 2XB2A 1I2DA 4L15A 1NG9A 1KDOA 2HLDD 1E32A 3T34A 1MT0A 1J2JA 2C9OA 2WJYA 4KV9A 2R6GA 1E2KA 4BLPA 2F1HA 1OKKA 1XMSA 2FFAA 4C3ZA 2QMUA 1OH8A 1KSHA 4UXJA 4HB4A 1JAIA 3GLGE 2DWPA 4MYTA 4N0EA 3VR2A 1KNXA 3VFDA 3FMOB 2CK3A 2RGNA 1NBMA 2BKUA 4JVMA 1XPUA 2GAOA 3W8RA 5SZJA 2QAGC 1XBTA 3RC8A 1JXMA 4TSFD 3DOFA 4Q1CA 2QG6A 2ZS9A 4KLNA 4ASUA 5JFGA 2ZIAA 2IYLD 1IJFA 1N5KA 1ZRHA 2ZANA 3PQCA 2WMOB 1PZNA 1U99A 2GWHA 4B3FX 1XD2A 4UNNA 5EZ6B 4AIIA 1TTTA 1KDRA 2J7PA 2FU5C 3TIFA 3WMGA 2GEUA 3NBZC 1JR3E 4ABYA 1M7HA 4OQFA 2HCBA 2PH1A 2WJIA 4B71A 4QOSA 1L8QA 2MMCA 1H8EA 1B23P 1F60A 3CB4A 1Z22A 1W36C 1VECA 1Q21A 2QN6A 4UQOA 4TQAA 5KSZA 1LW7A 3QSYA 2ATXA 4DEYA 4URXR 1N0WA 1OSNA 4JLBA 3KZ1E 1SVWA 3AKDA 4C0JA 2O8EA 2V54A 2QTHA 3WY9A 2AWNA 2OCAA 1IXRC 3HR7A 2FZLA 1R2QA 1OV4A 1CS4C 1NL3A 1UJ2A 5JS7A 4FN5A 3ZZ0A 3EWAA 3CR7A 3M6AA 4QBHA 1Z8FA 3GLFA 1KI6A 2FG5A 3GLGB 3SZRA 2W6ID 2LCFA 2WWXA 1ZW6A 1T3HA 1G3IA 1U2RA 1JAHA 3P27A 1P2SA 2P5TB 4DZZA 4E03A 4F93B 4HDOB 3LW7A 3A1TA 4LBVA 1YZQA 2IYSA 3LLUA 4DLRA 2QENA 2V7QD 2CHQA 1ZBDA 1CTQA 3NBFA 3EIQA 3CO5A 2JEOA 2ZSDA 2QMHA 3A1WA 2A9KA 2H7VA 4PR0A 5GJBA 2LKCA 1G6HA 2FV8A 4MRSA 2H92A 4W5WA 5JLJA 3DOEA 3BH0A 3EZ6A 1YZGA 4DLXA 2IYRA 1Z6XA 1AS3A 3EX7C 3A4LA 4DUGD 4RFVA 3AV0B 2MMGA 1X3SA 4Q1DA 3B1YA 4TMWA 3QEOA 1WDTA 4LCBA 1EWQA 1ZINA 3NEYA 2XEXA 2CLCX 3H2YA 2ONKA 2ZJZA 3LLMA 1DARA 3ADKA 4WIAA 1XPOA 5EE0A 3UG7A 3R9WA 2XXAB 1ZU4A 5K8TA 3E2IA 3ND9A 4TMTA 1AS0A 3B8HA 1ZJ6A 1F2UA 1T3LA 5C18A 4UNQA 4DB4A 4OK5A 2QRNA 1CP2A 3K0CA 3T12A 2VHJA 2F43B 1QHIA 5K8IA 5L8VA 2ZRAA 4R7ZA 3TAHA 3QPWA 4GT1A 1E98A 1AZSC 3RYTC 1NIJA 1SXJA 5GVSA 2RGCA 3U3KA 1D2MA 4DLYA 4HUQA 3ZVNA 1JEEA 1FTNA 1XCGB 4GZMA 1XP8A 3RRMA 4ZO4A 2HCJB 3B1VA 5AUQA 2JLXA 2QMEA 5CM9C 4RFSB 4G01B 3CH4B 4D26A 2JJ1D 2VP6A 3TMKA 1JNYA 2BKEA 1KJZA 2GJKA 4PX9A 2F7SA 4YQFA 1Q12A 1KO7A 5JJIA 1KI8A 4FW9A 3BIFA 2ODNA 1D2EA 1C9KA 1XEWX 1IY0A 2XSZA 1SVKA 3A37A 3CF0A 2IEZA 1E0AA 3TR5A 1R4AA 5BW8A 3FTQA 3SDZA 5HE9A 4XIGS 3AVVA 5BWMA 2C99A 4MGIR 4I81A 4WZ6A 2IUSA 4CEJB 1KI6B 2WOOA 2H17A 4BLOA 4DRZA 3SYKA 3CRVA 4XVQA 3AGPA 3CWZA 4YONB 1U8YA 3ONWA 5G41A 3MRSA 4Z8YA 1E2JA 2OT3B 4NKRA 4RKEA 3ZQJA 3THOA 3KUDA 4JT4A 4MUAA 2RCNA 4X8LA 3QF4A 3W3ZB 1U0JA 4YMTA 1DAFA 1FX0B 1COWD 2QGZA 1TU3A 2OCBA 3P26A 1GKYA 3BE4A 4PPQA 2ZRDA 3QY0A 2WHXA 4BEBA 1RKBA 3QE0A 4L9WA 3DZDA 2GNOA 1W48A 2PLFA 2VIIA 2RGBA 4BFXA 2C78A 4WAUA 3FPAA 1GKIA 3TUJC 1II9A 1DO2A 3AEZA 4UKDA 4PC1A 3QIAA 3REFA 2PX3A 2HXYA 2VP5A 2PZGA 3HPQA 1G3QA 1FMJA 2A5JA 2QAGB 5AJVB 3KKMA 2F1RA 3VNUA 1G7CA 4OK6A 4DSUA 2V7QA 1XMVA 3K1JA 2GAAA 2VQSA 1VTKA 2W58A 1EFUA 1MKYA 4HYYA 3KQHA 3ZD7A 3BH6A 1M74A 1C4OA 1RRGA 4TWZA 5KHOC 1MV5A 4LV5B 2VEDA 1CJKC 1FTSA 4DUGA 3CM0A 4CGZA 2XB4A 1SKQA 4TYQA 3UWKA 3BAFA 3HWSA 3WNCA 1E2IA 3CLVA 5M04A 4O25A 3QBTA 4NU0A 1W36B 2GK7A 2QROA 4RD4A 2CE7A 2HV8A 2KI5A 2W83A 4PHFA 5DYGA 3UIEA 4B74A 4O2LA 2BMJA 4L16A 4II7A 3D8BA 1EFCA 3DEFA 3AKEA 5EP2A 1XXHE 4JLPA 3L82B 3I32A 3MJHA 2GESA 5JHHB 2ZI3A 3D7MA 3SC3A 3PITA 4GZLA 1F6BA 2IEYA 2ATVA 4V0ME 4Q66C 3S1AA 2WPDD 2XZPA 4JBXA 4RD2A 4Z54A 4Q9IA 2QAJA 3TW8B 3OEED 3QKSB 3VX3A 4AYWA 3OHMA 2PL3A 3U61B 4GBMA 1S8FA 3P20A 5CYOA 3GP8A 3U3RA 2FZ4A 1CRQA 1KDPA 2IXFA 5CIWA 4MKIA 1VKJA 5EE1A 1E96A 2Q3MA 4MITA 2GA8A 3AKCA 1HT1E 4BUJA 3FE2A 5E7IA 3RAPR 4A0HA 4AKHA 1DAMA 4M21A 3GJXC 4MKGA 2ZEJA 3I72A 4XVRA 1IBRA 2ORVA 2R62A 3VU9A 1G1MA 2AHOA 2VL7A 3WMFA 4F4JA 1IN4A 3PCRB 4AD8A 4ZPXA 2FFQA 1WBDA 4HZIA 3HYRA 2ZM5A 1JI0A 3GEIA 4AWXA 1XD9A 2VHUA 1KTVA 3AVYA 2WIBA 4BRUA 2IF0A 3K0EA 4IFBA 3AVWA 4LJ8A 2O8FA 5KNBA 1A2BA 1OFIA 1WBBA 5FI1B 3CBQA 3PUZA 5FOTA
chains in the Genus database with same CATH superfamily
2GHIA 2Y77A 1RCUA 3V4SA 5KQGA 4ZO9A 2YWJA 1JAZA 2Q0QA 4M9ZA 2MOKA 2Z57A 3VR5A 3ZWOA 2ZBEA 3OY2A 1NSYA 1HDRA 1B6GA 3MUOA 3D6MA 3DL2A 3C7DB 1N77A 1YR7A 1C0LA 1TZKA 5KBYA 4EL5A 1I80A 2VPYA 3ZHUA 2AS0A 2VT3A 5I7OA 4V03A 3E7WA 3VR6A 1N7GA 1NVFA 4A2CA 3FKSD 2Z09A 2A0YA 2P6PA 2I71A 2PCJA 3E9MA 3JD0A 4L0MA 4B4DA 3NMUF 1JECA 1OAAA 5AVVA 5EJGA 3LXUX 1VE9A 4MWZA 3MOSA 1DJLA 2OQVA 5K3FA 3SK0A 3VHQA 5ITVA 3U80A 4NENB 1DC4A 4IJMA 3VUFA 1Q3HA 4QM7A 2K2QB 4E33A 4F2HA 4IO1A 1PDVA 5CJJA 1ELOA 1V96A 7GPBA 3VAZA 4JFAA 3LWBA 4BNZA 4B6PA 4FGKA 1PZGA 1GQYA 1UP7A 4OLJA 2XH8A 1DCFA 2NZ8A 4G4IA 2QL7A 3RJMA 5IPFA 2Q2VA 5LQRA 1SVLA 3B12A 1RLTA 4QTYA 3ADBA 2YV4A 2XJ4A 4O3MA 1KI4A 3TAXA 1Q0RA 3LC1O 4MRMA 1RSZA 2ATEA 2J3MA 5DISB 3SS9X 1JL3A 1USVA 3MHTA 3BT7A 1PWHA 1KZ7B 5DZSA 3RTGA 2J85A 4M0DA 1I4DD 2WT4A 4RVOA 4MRRA 4WECA 1FNMA 4RTQA 2X7JA 1X9GA 4BFVA 3L6UA 1CUJA 5FPSA 5GOZA 2I29A 3E3AA 4BO6A 2C2KA 3U4MA 2C07A 1CSEE 1FP2A 2I54A 2PJDA 3DGFC 1WPGA 5T7BA 3WLKX 1NUPA 3DFFA 1ZK3A 4ZJYA 3T0GA 4CKBA 5FOSA 3MS2A 3IIJA 1RXSA 3EXHB 3H84A 5JO0A 2YCLA 2A4KA 3T7TA 1ORDA 1QYRA 3L3BA 2EXXA 2NPIA 1BX1A 1AGYA 3QRWA 4MS3B 4QXPA 1FYDA 1ZGAA 4BVEA 4ZYXA 2GO1A 3FUXA 2OCIA 5DSXA 5E6RB 1WXWA 3RC7A 4LYFA 3RHSA 1VG1A 4N8EA 1JQDA 2I3DA 4QQFA 4D8WA 2JLZA 1R6DA 4QUJA 1QYXA 5LZ5A 4RLSA 2BFCB 1JMYA 1KL7A 2I4TA 3A9TA 2WNIA 3CLUD 3L6BA 1Q7RA 1T5OA 4WKPA 2D4HA 1CJUC 4A26A 1PVOA 4M8LA 2E85A 3LPMA 4N0DA 5DWVA 4ZC8A 2Q8NA 1UUFA 3HN7A 3QNWA 4NOKA 4H7IA 6REQA 4V0LA 2PD6A 3KQKA 4JJEA 4LISA 3LI2A 4N5IX 4NCKA 5BOVA 4R16A 2QTVA 1P45A 3DLIA 4XD7D 4WCDA 3IKMB 3FKQA 5F78A 4E70A 2O8BA 1KJWA 1L6RA 2V7UA 3OFND 3CQ9A 4X93A 4OOFA 5KSPA 4J8PA 4KC0A 2QV0A 1O57A 2X8LA 1C2YA 3B78A 1QLWA 1L5NA 1QX4A 1GKKA 5A04A 1MABB 2NXNA 2D8MA 2VZEA 3WYEA 5EJEA 1Y1PA 2NTEA 1R74A 1E5XA 1A9XA 2VDLB 3H8JA 5SZKB 3KEQA 1EQ2A 4ZCLA 3KR1A 1GZ6A 1KEUA 1KY2A 1CUHA 2XQJA 3DE2X 4LOHA 1GRQA 2EEPA 4FQ5A 3WTBA 3DE5X 1BEUB 1T1SA 1R66A 2IIQA 4R81A 2IV3A 5C1BA 5I7RA 4K28A 2J87A 4IDBA 4KGDA 4YRJA 4QU5A 1QGUA 4WESB 3RYCA 1MENA 3HY4A 4HYTA 4EL0A 2EQAA 4RHCA 3GYGA 4G9BA 4HRXA 4J9UE 1XTQA 3S4YA 1NMZA 3L1HA 4XGQA 4RFLA 1LNQA 3NYIA 1N5IA 3BK1A 4WJLA 2WJZB 3P1JA 1I6KA 1QF9A 1XMIA 4JB8A 2CV1A 1H5UA 2OD9A 2VAXA 3CLUC 2FOXA 2R25B 3QVGB 3I5MA 2BM1A 2YOHA 2RG7A 5AKJA 2F1JA 2NZWA 3HP4A 5ERXA 4J7CA 1NZJA 5ALYA 4DIDA 1EGMB 4J0HA 4V0NA 2EP8A 4TKZA 5AW7A 1DCKA 1PW7A 2DOKA 4R5HA 5IDQA 2YVUA 1TLFA 2JZOA 1QM5A 1N2JA 1VOTA 2A88A 2YWRA 3DTYA 3N8HA 1A4UA 4P7GA 4BX2A 5KVVA 1VLVA 2PS0A 3R77A 4BP1A 1KFJB 3GCDA 4G1FA 1ZM2A 2X4DA 1YZKA 3ZE1B 3ZTTA 4YUWA 2IOHA 2QRHA 4N39A 1XDGA 3VHXA 4KVGA 3AY6A 4QZVA 3FMGA 1FP4A 4ZALA 2BF4A 1QJ4A 3LQQA 5EVJA 4HRAA 4K6FA 2QN9A 1TZMA 4QAJA 3VGJA 3WK8A 3CW8X 4HPJB 4F38A 4QKQA 1RQ7A 4HBZA 1UC8A 1I14A 5GINE 1REQA 1E3TA 5TB5A 1KF0A 4G5RA 1F5SA 1PR1A 2CWWA 4KLCA 1K7CA 1RPTA 1FLNA 4QFMA 5JXHA 3NOQA 4S1WA 3FF4A 1WW8A 2GTIA 4Y7CA 1ZUHA 2H48A 5DYNA 4E2WA 1SKBA 2NN3C 2P69A 2WSYB 5FI0B 5IAOA 3LUDA 1BG6A 1YK1A 4H0CA 4BHTA 4KN6A 4MKXA 3RK4A 2BW0A 3EGXB 3QBDA 4PO3X 3PFCA 2XKKA 1M2WA 5DK4A 1CHNA 1O5TA 3T4XA 4J1QA 1PR5A 4H7KA 2WAYA 5DNVA 1YJCA 2GUGA 3IHLA 3OOYA 3E8XA 2DBVO 4RENA 3B6EA 5EXTA 5LN1A 1OYYA 2CHGA 3IEVA 4JOQA 3EVNA 5KI6A 2OLKA 4I5FA 5DLYA 5EIXA 1PBNA 4J7UA 3EEIA 4HNVA 1GG5A 4E5PA 2GB4A 3H5OA 1XCPA 6REQB 2OB2A 5A4JA 3DCNA 3MJEA 1XC7A 2AIRA 2NP6A 2IFTA 2BFEB 2ODBA 1EA7A 4ECAA 1EPUA 3OJFA 1C2TA 4TVBA 4KYVA 4CPDA 1O9HA 1NXTA 4DIBA 1QPGA 3VBCA 4AZSA 4LVCA 1TA9A 2R6HA 4HGNA 1N75A 5BV8A 1PQPA 1Y82A 2X5KO 3GNQA 5EKDA 3ORHA 4JXKA 1NXSA 2ZSFA 2IXTA 2ACVA 4OQ4A 1JILA 3ICCA 3AEQB 3KT8A 4JU9A 4RGQA 5J58A 3WJ1A 3VO8A 4MH0R 1TAQA 1N5DA 2VQDA 3O8CA 2QM7A 1IOVA 3TNDA 2FW0A 2X2EA 2BFDB 3KOZA 2JFFA 3F8TA 4GOJA 5GM1A 1SHZA 1RHJA 4UVIA 2V6FA 4LZWA 4BX0A 3D2CA 4NBNA 2OZEA 3T52A 3ND8A 1A5AB 1PD1A 1Z3CA 1G1AA 1ZI8A 1SK8A 3FYUA 1K4MA 5H68A 4AZ3A 1V8OA 1Y8QA 5EMHA 2CHEA 3BWYA 1J7JA 4L8FA 3K1YA 4MMZB 2XXJA 2ZE8A 2VJYA 3DKIA 4YQEA 1PWEA 1W75A 4AJJA 4DNFA 2WT9A 1E4EA 3IX7A 4DBLE 2DPXA 3ZWQA 4KLAA 1TKCA 3U4AA 1E94E 1TC1A 4MPTA 4O0MA 2NPFA 1P75A 3FHLA 5CYPA 4CG0A 5CNJA 4YAKA 1W581 1P0FA 3GGSA 2N42A 5A5DA 4YRKA 5C46F 3WO1A 1HXHA 1X87A 2UDPA 3OFJA 2NTNA 4PZZA 1C3OA 2G06A 1IWOA 1IE3A 3VYVA 1IZYA 1DO8A 1LTHR 2J9XB 4XYLA 1D2NA 2FPUA 2G67A 1JIKA 4YUXA 3AK4A 1ULHA 4WLUA 3EZ9A 2E2WA 5GJCA 3FOAA 4UQLA 3E48A 3I1FA 1UQTA 2FP4A 4D8YA 2V3WA 2W0MA 4LECA 4EHBA 1SQSA 1EU1A 2P6OA 5FPHA 2IE8A 4ALLA 4EWLA 1KY4A 4OB8A 3DLCA 4KBFA 3JTMA 1PR0A 4PBRA 5FPYA 4I8DA 2QRKA 3BXEA 4P1ZA 1UBCA 1UBGA 2OLEA 2WYVA 3SBEA 3KSRA 4CFZA 3B6KA 4C1NA 3DPUA 1WZCA 3EXG2 1VLJA 1ZZGA 2ZITA 3STYA 4ENWA 5JNWA 4WCFA 4ONEA 4N6GA 2JJ2A 4XDGA 2X22A 5AXCA 2RE8A 3K8QA 5J1SB 3ZVKA 2OXRA 3BIJA 1BJTA 2ZS7A 1U90A 2JFNA 3RQIA 1E2MA 4KV7A 5SY9A 3OEHA 1Z5VA 1CY1A 2FMKA 5IC5A 1SXIA 4Q1EA 4KWHA 5K3EA 4EDFA 4G56A 4UEWA 5AKZA 3FHJA 1IZ9A 4QUDA 1SBIA 5EGNA 3OQ1A 3MSCA 3IESA 4Q02A 2HT1A 5C3MA 1R16A 2Q07A 2C58A 3NHMA 5JRZA 4F9FA 1JSZA 1CEYA 3ON5A 4HQRA 4KPYA 2J9ZB 1V25A 4QUBA 2G07A 5D6OA 2IVZA 4LV6A 4O1HA 4DV3B 1YJ5A 3QKWA 1L3CA 3AI3A 4G0ZA 4LXTA 1P0IA 1XALA 3P2YA 1EDEA 1JDPA 4PZPA 5JG7A 2O0HA 1Z3IX 1IVSA 1KORA 5EIOA 1JEQB 4CIBA 2WUDA 2XOKD 4XCXA 1RHRA 1D1TA 3I6BA 4Y6GB 2Z4SA 2WJHA 3L0IB 4A8JC 4D25A 2XT6A 1E1LA 1R15A 1G21A 4OMCA 4O2RA 4C04A 4MCJA 3TKAA 3IAS6 4Q7LA 1ZRMA 2Q21A 5JMPA 4PQFA 4HUTA 2H1OA 5LP6B 1FTQA 5AHKA 5D87A 1G20B 4XXHA 3VR0A 1VJRA 3VSEA 2KE5A 4L73A 1JJFA 2B8EA 4NLLA 1XTJA 3RIMA 3DS8A 2BMVA 1EE2A 2WG1A 3JD1A 4RFSA 3JZMA 2OOSA 4R98A 4YRBA 1Q44A 2B3TA 2FVYA 2ZSIA 4FR5A 4PX3A 1DAHA 4ZOLA 5FOUA 3WRWA 3H2ZA 2N0SA 3CUEF 4HAVA 1DX4A 4RS3A 3AIKA 1I0LA 3EZGA 3OWHA 1DJNA 4RJ2A 4D99A 3ACDA 4XTRA 3GU3A 3UBMA 1PR9A 3ROEA 2L17A 1YVDA 4GLBA 2K6GA 5JVDB 2CLMB 5BMVF 3ZZUA 1Y6ZA 3MSXA 4BE7B 4F2WA 1GCOA 2R97A 4QBIA 4ZI7F 2BCGY 1BCSB 3ZCPA 3ZGOA 3QEBZ 4NBLA 3RU3A 2Z04A 3SY8A 2HA6A 4A7PA 1OLUA 2JFPA 2UUOA 1I3NA 4FFRA 2EHJA 4HC4A 4YXFA 2TECE 5EY5B 4ADSG 2PSFA 3EZ2A 1EUCA 3IPAA 1E9AA 3B7WA 4JODA 4H16A 1Z25A 2A5YB 3EWIA 1TAUA 3WP1B 4WA7A 4ZICA 2J3HA 4WSOA 4IR7A 4BVBA 4TLEA 4X00A 3NRJA 1GUBA 4UUBA 4HH1A 4IHJB 3REQB 2VWGA 4ANFA 3U62A 4BMPB 2G9RA 4N01A 4R2LA 3SQWA 3H05A 1Q1ZA 2YYZA 2FP4B 1IWPB 1LC3A 5ERYA 2GBPA 3SJUA 1NNI1 1H85A 5TPWB 5HPYB 1UC9A 2NWQA 2CDAA 1E3WB 4XYGA 3EPPA 2X4LA 2OHVA 4HWTA 5HOQA 2QP4A 3VXKA 3ZDQA 3BRWA 1WQ1R 2A94A 1B6RA 1DTWA 4LJ4A 4R31A 4D9MA 3I62A 2V5VA 1PNVA 1N9GA 2H1FA 2XMGA 1R1DA 4RL6A 1IVYA 2GJSA 3IXMA 3SC6A 4RETA 4WCFB 1U2ZA 4IUDS 3F3MA 5F1KA 4OJMX 2Z3VA 5BNZA 3LUKA 4MYRA 1FQOA 3GWZA 2P1RA 2PR7A 3BMXA 1URPA 3KQTA 1IN7A 1WXGA 2MCFA 1DZ3A 2BYTA 1EIZA 4EIWA 1OTHA 1HNXB 3JYPA 5ILQA 3CX8A 4N41A 3ICVA 4P38A 4AY6A 3ZYZA 4XJXA 3IBFA 4JHXA 4ZT5A 3W6UA 4D43A 4V38A 2HREA 2BSAA 5HQ3B 3ZIAD 1UF9A 3AJ9A 4D1YA 3TRDA 3NV7A 4L8GA 2TMGA 4BAZA 4DJAA 3LUBA 1FW6A 1GN8A 2FB9A 2VPZA 2ZAMA 3DMTC 5AOAA 3IDQA 5DM60 4CG3A 1E3IA 4EYKA 1ZN9A 2XMPA 3OLWA 4QDJA 4RZUA 4QULA 1N1MA 4HS9A 3PQ7A 4YIHA 2CJWB 1RYEA 3PL1A 5G1PA 1VJDA 4C05A 3H8SA 3W3AH 1HQDA 1AKMA 1XTSA 2NV2B 3FOBA 2HHCA 4QGFA 4NJMB 1Y4SA 1ZCBA 3OJOA 4OP1A 1X2BA 2WE8A 3RS5A 2J6CA 2GJ8A 3B70A 3URMA 3SLGA 3N8DA 1CUYA 1DAGA 3BVPA 3OQOA 2HMUA 2DH5A 3SN6A 5H02A 4CTNA 1TUIA 3DZFA 3AHGA 5IAKA 1QH1B 1EVQA 5H70A 3UB3A 5LD2B 1FRQA 4OIMA 3GBPA 1I4EB 3H4IA 4YJDA 5K01A 2O8NA 3WIDA 3GLFE 2HLDA 1J07A 3TLMA 1TVMA 3LDAA 1V2GA 4RIFA 5EUQB 5KKCA 4XLTA 5F52A 3RC3A 3U48A 1VDMA 2P68A 3GEPA 5HE8A 3TAUA 1JHYA 1MAHA 2I2CA 5K9ZA 2G5PA 4EY6A 1MDBA 3EA5A 1WZEA 3FPFA 4MX8A 3GGJA 5AHOA 1SQ0A 1WW2A 2O52A 3GT3A 3JRXA 2EL9A 4QU0A 5JQGB 3GFOA 2R2AA 3WIEA 4J2TA 4AM8A 1W30A 4FR0A 3NX4A 2ENWA 3RRJA 1I94B 3VR4H 3NVMB 4PEVA 1R9NA 3BIXA 2LZ0A 1HTBA 3P9CA 4KAAA 3O8NA 4DLUA 4I1RA 4NBSA 1YA6A 4YECA 1J42A 2YFKA 3I5XA 2UZ1A 2DMRA 1X1RA 1XXLA 4M60A 4QXOA 3X2EA 1WMSA 4BVJA 1ESMA 1LVGA 3PIRA 4BRSA 1G8SA 1OOEA 5J4VA 1BX0A 4WGGA 3TZBA 3HH8A 3NBYC 2Y1WA 4QWWA 3R6LA 4RM2A 3NVDA 1ZSNA 3M89A 3TOXA 4AJ2A 3EEFA 4EJ6A 2RB4A 1AJEA 4IMIB 3FFXA 4JLNA 4BYGA 5FUVA 2VYND 3OCCA 2ZTMA 4WL0A 2GK3A 4DMFA 2B21A 2ZUVA 1P9NA 2XGSA 5EGSA 4D3YA 3VYWA 6GPBA 1M10A 4CLRA 4G8JA 2V8OA 1VBFA 1N0VC 4F97A 4NMLA 5THQA 2QLBA 1JQ3A 2PEZA 2Q2OA 2V7WA 4YVFA 2ZRLA 4RNCA 5DSZA 3SEFA 2M9MA 2I34A 2CEKA 4QC2A 4HV4A 5I3CA 1ZXLA 1RXIA 2G0TA 1N5RA 1CUEA 1CBUA 3L7MA 1GTMA 3CNLA 3RKRA 1E4VA 5KDOA 2GJ9A 2VDUE 1ISMA 3AQIA 3SQMA 2IS6A 1KOLA 2Y4NA 3GFQA 5IC4A 4DMHA 3D43A 3SM3A 2GRUA 4CM8A 5C2JB 4TZTA 3ZVMA 1PZMA 1WSWA 2UZ3A 1N1EA 4K05A 1SZJG 5AI5A 3WKEA 2AJDA 2P7HA 1JZSA 5ALMA 3A9CA 5FLEX 2H52A 3IQXA 4HNHA 821PA 4M0EA 2ZUFA 2NP7A 2EW8A 4C4XA 3B3QA 3HRKA 3BG5A 4FBMA 1RT9A 4DUPA 1AHNA 3HG7A 3HBLA 3GZ4A 1W8IA 1V6AA 2JD0A 3ZHVA 5IXJA 2ZBFA 3FLBA 4RGYA 1J2EA 5FWYA 3MINA 4PC2A 1KC3A 3TN7A 1V4VA 4DMGA 4UAGA 1QAOA 2FX5A 3LX5A 1PYOA 4MV9A 4XQEA 3TINA 2FFHA 1U0SY 4BTLA 4IY1A 5C8YB 5HIKA 2V6BA 4OFZA 1QXSA 1F3LA 3TCKA 1PWXA 3N7UA 3OKCA 2YW2A 3NHBA 4Y6OA 4AZWA 2SECE 1DKQA 3NYQA 4PNPA 3GUHA 4A8PA 1II8A 3ZCVA 1TM3E 1R8SA 2WWVD 3WHKA 1Y7IA 3ZWPA 2I3BA 3EXIB 4OVKA 3DC7A 1NMXA 2YMQA 2GILA 3RVQA 1W94A 1FRNA 1Z6AA 2AR9A 4ZO7A 4ZQIA 1M72A 4O02B 1QFMA 1QPBA 1FQJA 1SNYA 3L5KA 3AUXA 2JIDA 3NAQA 3RWMB 1IHDA 1KYTA 5LBTA 1BVRA 2WTBA 3T0FA 1KYVA 4C0KA 4PQRA 1B0UA 2QG9A 1K3TA 1UKAA 2ZIEA 2VSQA 4Z9YA 2R5WA 2PXCA 5H5JA 4AJNA 1UP4A 1D09A 2HYDA 2X1VA 4B6RA 4YT8A 4CLOA 2J7KA 4LYGA 5ER9A 5CDUA 3S8MA 1WTAA 2G0NA 3G0BA 4NYMR 4RJLA 4X1KB 1PI3A 2NT3A 2ZYSA 8MHTA 1TM1E 1Z6QA 1YB2A 1EXWA 2Q5IA 1A2QA 4CM4A 4IV8A 2F17A 2A35A 4QBGB 1UDXA 3I1IA 3TQHA 5F23A 3JAWA 4QYWA 2WD7B 4TWIA 4JSRA 1QF6A 4B35A 5JSZB 2WWIA 2NUAA 1IFXA 1F2TA 2LDXA 3AOEC 3C8UA 1YL5A 4WXPA 5G1OA 2E18A 4GS5A 5C80A 3TFOA 2RG1A 1TF5A 1Q0SA 1ZPDA 3DAFA 2DVMA 2Y0PA 3BFKA 1JHOA 4YCBA 1PV1A 1ETUA 3P9SA 2JJ1A 1BVUA 1KI3A 2Z0MA 2JLYA 4G86A 3HJHA 4OQDA 1SA0A 4MZDA 3RJ9A 4DLKA 3IAXA 3VPAA 2DGDA 3S1LA 1CG6A 2IHYA 2UZ4A 1T8YA 3RGGA 1QRAA 5CA0F 1Z08A 2QJTA 4KDCA 1GSHA 2BPOA 1EXDA 2Q3BA 3FVWA 4MGEA 3QEAZ 2I2AA 3O31A 5HF6A 2DERA 4DJDC 3COVA 2UUCB 1VIMA 4BRWA 4EHJA 3WQQA 5F3WB 1XNHA 1WETA 2GVDC 2EJTA 2FP3A 3TVDA 3VO1A 5CFPA 1H3EA 1U11A 1P5ZB 2XMZA 3LOUA 1GAJA 4G89A 4QTXA 1SCDA 4HTFA 2WF9A 3ZGLA 2BHRA 3ZOZA 4E09A 1NXPA 3LNCA 4FYMA 3GEMA 3KQUA 3FHCB 3NHAA 4MW9A 4G09A 3U3OA 1WX1A 4U7GA 3C5CA 1O5IA 2VXOA 1MRZA 1N3LA 3O83A 1LEHA 1XRSB 2C0PA 1CJMA 2H5EA 2JFHA 4JP8A 2YXPX 2AFHB 3B1KA 2GVNA 2ZB3A 2PV0A 1IYZA 1V16B 5BSVA 2CEAA 5EFOA 4R2MA 4RHXA 3GDWA 2CLIB 1UEJA 4RD6A 4H7DA 2J5XA 4JC8A 4B47A 1KJJA 3FDIA 4OBWA 5ESXA 5FYQA 3ILSA 4AX4A 3MINB 3A9SA 3PE3A 5EHIA 4JLKA 3ZBPA 5CFOA 1WLYA 2CUTA 1PVDA 1XCJA 2H1LA 3C4VA 4RXMA 3SI7A 1FQWA 1PJLA 2JHAA 2Q45A 3WB2A 4F3RA 2JJQA 1JIJA 1CUXA 4LFCB 2E55A 1P6XA 1A2KC 4K8RB 4TSKA 1YC2A 4U6SA 4X66B 4BNWA 1NFFA 3K72B 3MF4A 1GOTA 4INPA 4TQ9A 4WNYA 3TYXA 1S2IA 2BLLA 5FO1A 3B1XA 5KREA 1TQ8A 5EMJA 4K9DA 4M1ZA 1PTJA 3U3JA 1GEEA 1PIWA 3KXDA 2GD0A 5DCWA 1KIAA 4WNCA 1MOSA 3AX6A 3S99A 2RHJA 2P4UA 2I1WA 4JSTA 4MI6A 4X7PA 4ZVLA 4ED9A 2D7JA 2CCGA 1V9SA 4OI2A 1S2OA 3W5UA 4F6RA 4Y2HA 3OPMA 4KYTA 1Y6QA 3QLJA 3DV0B 4EA9A 1C9NA 3K16A 4FHEA 1JS1X 1PT6A 4ZO8A 3MJFA 1XJ5A 3VDRA 4Q4DA 4MWGA 1ESZA 4LOKA 2W2OA 1VIYA 3EJ6A 4G23A 1DU4A 1K3FA 2ZJAA 5LFAA 3KQPA 1M2VB 1S2DA 3I05A 4W82A 2BR4A 3CC8A 3ZNPA 3EW7A 1A9RA 4NP6A 4XDZA 4DF3A 4ZT7A 4PCUA 4ZQGA 1C30B 2YV1A 3MWLA 3T3PB 3RS0A 4LZLA 4B7XA 4BFUA 2IU0A 5KTTA 1KH3A 1VA4A 2WA2A 1Z2EA 4WY5A 3R6WA 4E5DA 2BFPA 3FR7A 3P2IA 4ISBA 1EFVA 3QJGA 2QLFA 4KMSA 1Y63A 4HX5A 3SFVA 4UPEA 5IYZB 4IIUA 4O4JF 1PBTA 3KKOA 4RVUA 1MQSA 3BWEA 3A1NA 3HVJA 3KXIA 1O95A 3NFRA 1HV8A 4ENUA 4ZCMA 4IIDA 4Y67A 1YDMA 2UZ0A 1JG3A 2GBGA 1NURA 2MSEB 3EC7A 3LP5A 1DI0A 1UPUA 4GD3Q 4R2WA 1RKVA 4LZAA 1JBKA 3KWLA 4KIWA 4NFLA 1QE0A 3E35A 5H3HA 1SC1A 1J21A 4PY2A 4KOEC 4AMYA 4P2BA 2OMKA 5D3KA 3UGQA 4DBLC 3QUTA 3GGDA 2QVZX 5LVAA 5JWOA 3HY3A 2WHYA 2XUFA 4ZO6A 1IY1A 2XBLA 3ZTWA 4LF6B 3HCNA 3Q12A 3EUEA 2YYYA 4KO3S 2ECPA 2FMFA 5LQSA 2ZZNA 4BLQA 3OT5A 2E82A 2GPWA 2FPSA 2GPTA 5SZIA 3R9IA 5H3CA 1EUDA 1G5PA 4MRVA 2E4XA 4N8SA 5DXJA 4BCDA 3CUYA 1K98A 5CFMA 4B2PA 1J6UA 2QTNA 2A67A 2AOVA 2C94A 3ICPA 1DNPA 1XDDA 4G07A 4MMXB 4QYIA 2CNWD 1G55A 1NZDA 3OSZA 5B5SA 3FYSA 1HEIA 5F1OA 1BU5A 3L2OB 4E14A 5JPIA 2HQRA 3UOGA 3ZXXA 2J0QA 3QOYA 4DOMA 3EYAA 1EH5A 4BX9A 5FOXA 4KN5A 1WBJB 2P4HX 2WVJA 4Q4JB 5DU2A 2XMQA 2Z83A 3OLVA 2P67A 2C5AA 2Q6VA 4RSGA 1WDWB 3R5KA 4UNPA 2GF2A 2O2JA 4FYIA 4Q3NA 1UBNA 2PAAA 3SU8A 3RYIA 1DELA 5HDBB 2IHNA 1H6DA 3I2YX 5K4HA 2AI2A 3HRIA 4LXGA 3BD6A 1QCDA 4YK7A 5EIEA 4LY3A 3S2UA 1T8TA 1AMUA 2HPAA 4TXJA 5ICEA 2UYOA 1HO3A 3WMXA 5KOYA 2W11A 2Q1UA 4UCWA 2GEFA 4CHTA 4H9GA 5ABPA 4KDRA 1SCUA 5NLLA 2E9SA 2FA9A 3WYNA 1SC9A 2W6JA 5FEUA 4X1YB 1NN1A 2A1TS 3R9XB 2O8CA 5EAIA 6NULA 4TYNA 2H57A 3C45A 3IDOA 5E7QA 2PYDA 1U8EA 4Z0TA 2HBQA 3IVGA 2PRYA 3C1OA 3CU5A 3ICOA 4BAUA 3EGIA 3AVTA 3NR2A 1AUPA 5T67A 3Q0TA 4FOTA 4KWEA 3UMYA 3A6KA 3PNVA 4W6ZA 4FFWA 1IZ7A 4OV6B 3ZIDA 3QX9A 4X90A 4EGCB 1EFTA 3LVRE 1IAVA 1S1CA 1GUFA 1XWFA 4DQDA 1ZOOA 4DSOA 4D9NA 3QNUA 4GKAA 3MQ4A 2RGUA 2AI1A 2EERA 3AXSA 3LT4A 4RXUA 5HQJA 3KL4A 2XITA 3QKRA 2OZLA 3RSSA 4B46A 1T9GS 2OCDA 1W85B 4EI2A 3LXMA 5JWRA 1RC8A 5EE5B 1N6RA 1R9MA 2IYEA 2JIMA 4LZOA 4JT8A 4DKJA 3VJKA 3TK1A 2VJAA 3BMNB 3DW1X 4HY3A 2G9ZA 2VRWA 2VLIA 3BQMB 3DYIA 4NE7A 3RUDA 3SHWA 4MRNA 2FQWA 3QEMA 4MA4A 1UK9A 1KWKA 1DX9A 3GLIA 4PLWA 1NBMD 2UYGA 1UDRA 3KT3A 4IHAA 5C32A 3DYBA 4O4IA 4PANA 4RVDA 3SEZA 4B76A 4ENRA 4XGNA 4CKEA 4MSUA 2DWOA 1CUDA 2NG1A 1E2HA 2WUEA 3W5JA 4DA6A 3WGGA 4NBWA 1R3UA 1JRLA 4EJFA 4YDRA 1KP3A 2ZBUA 5BT9A 1D6SA 1KH1A 4FHGA 2HH9A 1F4LA 3EXAA 3WLAA 2YTZA 2J7PD 1UZAA 5JDIA 4Z4QA 3TJMA 4C0HA 3G7NA 2NVBA 1DKNA 4IX9A 4JYMA 4Q1VA 1IM2A 5DOVA 5LUAA 5IJ0A 2E5LB 1SRRA 2FPXA 2X0KA 1H8ED 2VHQA 3V2IA 4AN0A 1FNSA 4ZP1A 2RGDA 3RTAA 5LU9A 1JAXA 1P81A 3C6BA 4L9RA 4QQKA 3RSGA 3I6ZA 1YRQA 3H5TA 4IRUB 4EFMA 1HOTA 1DOZA 4QXRA 3IP7A 1U3TA 2E7ZA 4WK0B 5J3JA 4P82A 2IHZA 5TPZD 1VHQA 1DUSA 5SYAA 2HFKA 1T5BA 4O4LF 5HKLA 2PLRA 3QV1A 4DAEA 3AETA 3S28A 3IQZA 4KSBA 3RFXA 2ODPA 1XB2A 4KR7A 5ALXA 3OJCA 3KJHA 3MT7A 4O2AB 1LS6A 3GJ8A 3H18A 1TDJA 3PYMA 1DO0A 3UGTA 1GDTA 1E4OA 4RPJA 4Z0PA 1W2HA 5DTRA 2VOEA 4TMFA 4QECA 1Y3IA 5KU1A 3IJ5A 5ED0A 3FPCA 1JF8A 3MTJA 1G5RA 3KYDA 4Y1RB 5L40A 1SKYB 2LVBA 3DVAB 2RK3A 4EG3A 3ZLUA 4RU1A 2QSZA 1IY2A 2HK7A 3UA3A 5IVPA 2QTTA 1Y4AE 2PUTA 4HDAA 4K88A 2SBTA 4HNRA 1XT6A 3GGGA 3K1AA 4CF7A 3TLGA 1XDWA 2ZYRA 4DM4A 4N6OA 3EGDB 2ZRFA 4G2TA 4UM5A 2D0PB 4M0KA 3N6VA 4X85A 3IO3A 2Q0SA 4OHMA 4RIEA 4BMNA 1OLOA 1PX0A 1R8XA 4B85A 1KYIA 5LC1A 2JD1A 2A5FA 2NYVA 3DAPA 4UFNA 3OF3A 3KB1A 4PCLA 3B1WA 4X20B 2XZDA 4FWTA 4QQRA 4EI9A 1KEEB 3UJBA 3IPXA 1UKEA 2PQ0A 1TX4B 1KBOA 4RMJA 1K5DA 3AUTA 5B2EA 1TQDA 3D0QA 2D62A 3NBUA 1IJEA 2V6GA 2HZBA 3ECAA 3R5HA 3WKBA 2IZ5A 5FL7A 4FUQA 5BQFA 5F7XA 1MP0A 3W5CA 5EP3A 5BN1A 3FTPA 3TUIC 3O8QB 5A2GA 2REXB 1FFSA 5KX5B 4WLNA 1JZTA 4JA0A 2K7FA 3COJA 1DBRA 3W4KA 2HR1A 3UMSA 5LYJB 3GVXA 1RYFA 5DLDA 1JFFB 4QXMA 3HA2A 1R0ZA 4HGRA 4LW8A 2QE7A 3EY9A 3LBYA 3ELWA 4DIKA 3A6ZA 5K8CA 4B4VA 1DWQA 3NHFA 1S2LA 2BF7A 3B2EA 3KDPA 3VJMA 4ZCQA 1WPRA 3GDHA 3QEMB 4IOJA 5GV8A 2A2ZA 5D3ZA 1W6RA 3E5RA 4K46A 4U0KA 2AGVA 5DEIA 4W7SA 4CT0A 2Q5OA 4IRMA 2O3QA 1QP8A 2A86A 5CXXA 1T9BA 5H4HA 3Q3GE 3FUUA 1R0KA 1TJ3A 4NC9A 4O4IB 3TD2A 2QUKA 4A2PA 4IO0A 4NBRA 4LKOA 1LNZA 1PDOA 5ALJA 1OR8A 1EYZA 4XWAA 2FW7A 3L4BA 4P92A 2HK8A 4YMWA 1IQPA 2NIPA 4FYWA 1TAGA 1EWTA 1NQUA 3HBNA 3TL6A 3EF0A 3VVLA 4K6MA 5CVTA 2BJWA 1Z4LA 3FTCA 2EX1A 3ABQB 1IHXA 1TVCA 3AIIA 4Y9RA 3HMQA 4BB5A 5T8KA 1CQWA 4RM3A 5B64A 2VFAA 4FGLA 4GL4A 4JYCA 4N8DA 1I51A 5DK6A 1U6KA 5LUBA 2QM8A 4LRTB 4PG5A 4DTIA 1JHXA 3AHJA 4YTEA 4KBYA 4BX8A 3M6WA 4EAQA 2J5KA 3LQ2A 1E8DA 1T1RA 1R9GA 3PEUA 2Q1YA 4GPTA 1ODFA 2XYQA 1E6CA 5DP2A 1YZ3A 2GCEA 1STOA 1C0KA 1RWQA 1Q7EA 2PZBA 3A0RB 3KL2A 1QRRA 2FMUA 5B1DA 3C8DA 5EHNA 1QGYA 2RI0A 1UMDB 1CFJA 4F9GA 4EJSA 1WJGA 3FDJA 3AERB 2A0FA 1JWBB 4UMEA 1EE1A 4XOIA 4Z2YA 3DLHA 4IXDA 2E4YA 2OZKA 2DR0A 3P9XA 3V7YA 4RLFA 5AKHA 1Y3CE 1KNQA 3SGLA 1PSDA 2WQ6A 2C7VA 4JNKA 2W4QA 4X63A 1GNTA 1ST3A 2B92A 2IZOA 3ZKAA 2ZPTX 3OUUA 1VJCA 4BFZA 3TR0A 3K0CC 1F1BA 3O9VA 4ND2A 4ZJZA 4G26A 9ATCA 2IIPA 1V95A 4LY6A 5BR1A 2Z8YM 3HVHA 2BCJQ 1B6TA 2JIBA 1OXTA 2ZUCA 4RHEA 5KZMB 2O0MA 2R6ZA 4KXFB 4P4SB 2C4HA 5CB4A 2GCOA 5JRDS 1MX9A 1Y9EA 2C5FA 4ZV9A 3VSDA 2W6QA 1QO7A 3I09A 4LJAA 4J16A 5DI3B 1GITA 1NR1A 2Z5VA 4JJ7A 4PCAA 5L3ZA 3L0PA 3G49A 4XIIA 1MB0A 4D9BA 4G97A 5A7FA 1BQEA 5KTYA 2X8JB 3Q3CA 1E3JA 2CMKA 2O2ZA 4M1TA 5ERGB 3W9UA 4AWAA 5K8UA 1J99A 1FS6A 3LXRA 1VCIA 4URFA 3LPNA 1XQWA 2ZDGA 3BE5A 1G5HA 1L1RA 4PX2A 3RD5A 3RKUA 3SC2B 4JDPA 3WLOA 2PDAA 5AQEA 4YLYA 3SPXA 4EB6A 5JQWA 2HU5A 5ALDA 4CQMB 4U7FA 4LXXA 2QIOA 2VAVA 5J4KA 1K88A 1UMBA 5EI5A 2Z2YA 4QIHA 3WGVA 4ZEVA 4GPAA 1DKUA 3MTEA 1DFIA 4ZVQA 3V8EA 2CLLB 1YZUA 2J9FA 2XCUA 1L5FA 5FTJA 2H2WA 1RZRA 1UMCB 1W93A 2VAWA 1PJ4A 3A4YA 3AUUA 3L0CA 1HQKA 1LX6A 3HXLA 3RG8A 4C4PA 1D5CA 4OHYA 4N1AA 2HHAA 4FD3A 1F3OA 3P9IA 5JISA 3THYA 4B31A 1DBQA 1AMOA 2QUBA 4EA7A 1CUBA 2Q2NA 4S0ZA 5A5GA 2JIOA 4LYEA 4B3SB 5I7UA 3IMKA 5JS8A 1RAFA 4HDCA 5CDFA 3DLPX 4OHOA 3V97A 4YJGA 4R5MA 4X94A 4GGOA 2YIJA 2VRBA 3OLYA 1ONBA 5CVEA 1QTNA 5WRFA 3TSCA 3U9LA 1E3LA 3K70B 1VA5A 2DQ4A 3DDSA 5CLGA 4PXAA 5JSQA 1MIHA 2P9QA 4P7BA 5CH3A 4M86A 3NIWA 5EZ5A 2FUG6 2H5JA 2VHEA 3JYLA 2ECQA 5AM1A 4B73A 4CM5A 3WLEA 3T06B 2IJGX 5IT0A 1P2UA 2NVWA 4RUKA 2EF0A 3WYBA 1GPMA 2XX3A 3B5JA 1KMMA 1P9OA 4UU7A 1QQTA 1I10A 3BICA 1KJ9A 1NF2A 1YRLA 1JHPA 1DBWA 1BE1A 1YR1A 3F5SA 3N8KA 4IG9A 4LX8A 4MRAA 4YI3A 2P2CA 3F9CA 3THSA 3OTIA 2ANCA 2CBZA 2FWIA 3QMVA 3U0BA 4BJ6A 2C2ZA 1JFRA 1XTUA 3L0ZA 2HQSA 2CB9A 2ANBA 2DFVA 1GIAA 1FP1D 3IAAA 2QRUA 2IA5A 4C6TA 3TZHA 7REQA 2WLTA 3D2BA 1Y5IA 2H3HA 2W2KA 2FUG1 1T4BA 3IBYA 4DGQA 1J8QA 3TG8A 1FDTA 1ZRSA 1P44A 4F5ZA 4HDKA 1GT6A 1M2GA 4I4TB 4QODA 1NQ5A 4MV7A 1BXGA