4MH0R

Selective activation of epac1 and epac2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
162
structure length
150
Chain Sequence
b'EYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLAFLESSAKSKINVNEIFYDLVRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rap guanine nucleotide exchange factor 4
publication title Selective activation of Epac1 and Epac2
rcsb
source organism Mus musculus
molecule tags Signaling protein/gtp-binding protein
total genus 39
structure length 150
sequence length 162
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4mh0R00
1NJGA 4JLMA 2CE7A 3WNDA 1HUQA 1E4VA 3NH9A 3ZIAA 2CXXA 1P61B 2BJWA 1EWQA 5G53C 3X1YA 2Q3FA 2HJVA 4ASUA 1IN7A 5FTKA 2Q21A 3B1YA 1E2MA 3LBNA 4GMXA 4CEIA 2AL7A 3G5UA 2D74A 4WA7A 1S3GA 2IYQA 4MDEA 4L9WA 2W6IA 1ZM7A 3B1ZA 4YXWA 5C46F 2FSFA 2EVWX 5CK5A 3AKDA 3RS5A 1KDRA 3FFAA 2GETA 1U81A 2GZHA 3A37A 1G5PA 2VHQA 3SOPA 1PJRA 4DDTA 4MH0R 4E5UA 1CKEA 3HPRA 4GI7A 2SHKA 3L0OA 1YR9A 3VQTA 1Z6TA 1PVOA 1PUIA 1Z6GA 4C0AC 3FMPB 1E9AA 1NF3A 1P9WA 4QKQA 5EUQB 2GF9A 1HT1E 4URVR 1XEWY 1BYIA 3H0KA 1AJEA 1KTVA 1G5RA 4QXAA 4Q9LA 1D2EA 2CL6X 2O8FB 3IHWA 3QENA 4JLDA 2OCYC 3I73A 1ZAKA 4H1UA 4B3CA 3ND9A 1LS1A 1PLKA 4I1UA 1M7HA 5FOVA 4PO9A 2VP5A 4TLEA 1P6XA 2CCKA 5L3SA 3CX6A 2FDCA 2OBMA 2Q3MA 4JLKA 4GDFA 4PC1A 2V3CC 2ZU0C 1T91A 2HF8A 4LHYA 5KSPA 3RAPR 1KNXA 5AK0A 3HDTA 4PHTA 2XXAB 4EFNA 3TE6A 2C04A 4LX0A 2JLYA 3MWYW 3AVVA 1BMFD 4I1VA 5FPKA 4LOAA 3BFKA 4V03A 2DBYA 2XSZD 3N2IA 1EX6A 1BH2A 1PLJA 3AVTA 1OH5A 3CRVA 2RGAA 2W6JA 3BOSA 5FOUA 1F2TB 2FFQA 2EFHB 3FMIA 1W4CA 1YE8A 2ONJA 3SBEA 3WY9A 1HEIA 2ZVPX 5AR1A 1JXOA 2EU8A 2VEDA 4QC2A 1MRSA 4U02A 3AVOA 4JLVA 4EJSB 2IWHA 3KUCA 1SGWA 4JLOA 2JLQA 3ZZ0A 1CS4C 4B73A 4B47A 5JRZA 4DLSA 2OFXA 1G4UR 2IUTA 4I4LA 4I1SA 2W2XA 4JS0A 1QHSA 1QHYA 1SVWA 4OHYA 3F3YA 4AIIA 3G0HA 1UF9A 4P32A 3S1AA 1A1VA 4GMDA 3VNVA 2A5YB 2GXSA 1T3HA 4A2QA 1RE0A 2WVJA 2XNDD 5BYKA 4LHZA 2O8EA 2GVZC 1T8UA 4R2HA 1JPJA 3GLFE 4MRSA 3NDPA 4PQRA 1XTKA 4Q03A 4KFRA 4A6PA 1F6BA 2OEPA 4OBEA 4A0GA 3DOEA 2VHJA 5JHGB 3WHKA 1CR0A 4IDOA 3CRMA 3PXGA 2CNWD 2EW1A 4I81A 3QBVA 4UNRA 4QJ3A 4A4DA 1XP8A 2FOLA 1JEEA 3MAAC 4Q7MB 4GL2A 1W0JD 1W36D 1CJTC 2CLSA 2CLDX 3I4LA 3P4YA 3PUYA 1SXJD 3CONA 1U8YA 4B34A 2WJVA 3C8UA 1OB2A 2XJ4A 3KB2A 1SHKA 1J70A 2GCPA 4HAVA 3Q5EA 1E2KA 4IDPA 2BEJA 4W7SA 4JL8A 2QM8A 3OE7A 1AZTA 5FR1A 3WYFA 5BN3A 4TLDA 1C4OA 1E6CA 1AK2A 4Z51A 1GL7A 3K70D 1Q3HA 3KJGA 1JJVA 2OBLA 2F55A 2REXB 3OF5A 1JJ7A 1DO0A 1Q20A 4O2LA 1IOZA 1N6IA 1X6VA 5J4KA 3HYRA 3U2QA 3C14C 2D4HA 2CHVA 4MITA 1XNJA 5G3YA 5JJLA 2G88A 2YKGA 3RS3A 2VHTA 4D4JA 2D7CA 1W36C 4HDQB 3QF4A 1KO7A 1SXJC 2Q6TA 4XWKA 4P4UA 4IOLA 2RKOA 3B82A 1RRPA 1E99A 3VNUA 2YZ2A 3QKRA 2G3YA 2TMKA 4DWJA 4BWYA 2ZETA 2MMGA 4Q7KA 2PT5A 5A0FA 2PZEA 3HWSA 4MKIA 4P0TA 1QG2A 1W5TA 1E9EA 2AXNA 5FBVB 5KOYA 2IYWA 1FUKA 3NBFA 4F4CA 1IXRC 5AUPB 2BWJA 1KO4A 3OEED 4XD7D 3BH7A 4RD2A 3SJAA 4CGZA 2QTHA 2DFKB 4RD0A 2QL6A 5E95A 1JAHA 4B3XA 3WBJA 1YQTA 3W8RA 2OHFA 2GA8A 3PVSA 4LGMA 3H84A 3ECCA 4QBGB 1ZNYA 1IJEA 2EWWA 3K0AA 2ZR7A 2CK3A 2HEIA 1KY3A 4TMZA 4DDUA 2NOAA 2XZPA 4NYMR 5J4LA 1NMYA 2V4ZA 3SJCA 1EESA 2ZSEA 3KDSE 4HAYA 1K6MA 3DL0A 5EXSA 5LPNA 3C5CA 2WICA 3VR3A 1EX7A 3BJIC 1KK2A 1EWRA 1PUJA 2ZE5A 1NIPA 1U0LA 3PITA 4MUAA 4DRZA 1IQPA 1VKJA 1J90A 4HB0A 4QGFA 4IOJA 3P26A 2P5TB 2J7PD 1QHNA 5DSZA 2WWGA 3RS7A 3PIRA 3KQHA 4LZZA 1OKKD 1QVRA 2W2VA 4GOXA 2IF2A 4HZUB 4JYCA 3FHTA 3HPQA 4XWOA 1J2JA 1KI1A 2KI5A 1XX6A 2IXFA 1U9IA 2VA8A 1A2KC 3DKVA 1VECA 1W44A 2QAGC 1RJ9B 5AJWA 1KSGA 1GNQA 1II8A 5LDDC 1OFIA 3DMDA 4DDWA 3DDCA 1JI0A 2B7CA 4DDVA 5J4VA 3TMKA 3IILA 4P31A 1SVKA 2WJHA 1E9BA 1NBMA 1UPTA 4JKIA 2BMFA 5AUQA 4KU4A 4QNMA 3ZS9A 1ZW6A 5HTKA 1VPLA 2W83A 5FL7A 3VR5A 3M1IA 2XTZA 5HCIA 4X8MA 4LI0A 2YWEA 4XJXA 4PC2A 3CWZA 1DAFA 3IGFA 3P20A 1E2LA 3QXXA 121PA 1UAAA 4MGZR 2O52A 3X1DA 4B6EA 1LF5A 2F9MA 4Q01A 4ZIRB 4ZKDA 1OXXK 1GWNA 3U44A 2G6BA 3K0FB 2Y8EA 1U2RA 2UZIR 2Z83A 3QEJA 2F1JA 2OLJA 821PA 1OYWA 3A1UA 4GPTA 5IK2A 2W58A 3HU3A 1SVLA 1Z47A 2Z6VA 3U3KA 3SBDA 3QPUA 5JLJA 4GOJA 3PEWA 1AKEA 5J40A 4NYIQ 1OXUA 1VCIA 1XEFA 4TSFD 3AM1A 4Q4AB 2H16A 4QOSA 2RCNA 4O0MA 1OPXA 4US2R 3GLGA 3GLFB 1P72A 1UDWA 1NN1A 1IN8A 1TEXA 2GF0A 3MJHA 3R20A 4KFUA 5DHAA 5JCZA 4WOPA 4DT1B 4BFTA 3W5IA 4C7OB 2FV8A 3ZD7A 2V1XA 1FUUA 3L82B 4QRHA 3ZYCA 2GK7A 2YC4C 4MKGA 2BBSA 4NH0A 1SKYE 3OIYA 1XPUA 3TNFA 4A0RA 3CX8A 1FPMA 3FPAA 2NMVA 1H65A 2FSGA 2F1HA 2ZANA 4TMWA 4L8GA 3ZVLA 4DCVA 4YQFA 5CDFE 3ND8A 1ZM9A 3GJ5A 1KJZA 3KXLA 3ONWA 3UMSA 2QU8A 3CRRA 3X1WA 3W6PA 1H8EA 1VG8A 3B9QA 4NBSA 4RVCA 1N6OA 2WOOA 2VBCA 4P4SA 4LK2A 2MMCA 1KAOA 2IEYA 5DGXA 3VAAA 1W49A 3RS2A 3ADKA 4IW3B 4JT2A 1IXSB 3TBKA 4LY6A 3BFVA 2QE7D 4AY2A 3AEZA 4ZCIA 1KMHA 3AF0A 5DN6D 1OHHA 3GJ4A 1S9HA 2JJ2D 1OW3B 4Y0AA 1FW6A 1XZPA 1G8FA 3ZQ6A 3AGQA 1A2BA 3TSOA 1GVNB 4AD8A 1U90A 2GNOA 1KZ7B 3PFIA 4DLRA 2FZLA 4ZCMA 2R8RA 5F2EA 1YJ5A 3NH6A 1W36B 1W46A 2XJ9A 2ZRCA 3C16C 5AJXA 2OILA 2DWQA 2DHRA 3QVVA 3QI2A 3NBZC 3THWB 4C0KA 1FNMA 1OH8A 3ADDA 1OB5A 1K8RA 4YC7A 1VYTA 4BZXA 5D3MA 3K70B 2ZPTX 4UNNA 4BRWA 4FCTA 1D8TA 2FPLA 4M4SA 2ZAMA 1W1WA 2IYRA 4NYJR 4Q4HA 2N46A 1C1YA 2QTFA 2G9NA 3D31A 4PPFA 2CJWA 1Z08A 2J7KA 4OQXA 4K46A 4UXIA 5GVSA 1BKDR 2WSSD 4EPXA 3SFZA 3AF4A 1DAIA 1AN0A 3LBHA 2ZRKA 1CU1A 2OAP1 2VF8A 4B43A 1E1QA 2A5JA 2JIZA 2QT1A 1ZMXA 3OFNA 4TTRA 1KI6A 2WM9B 1NVVQ 1CIPA 2NO1A 1E2QA 2IYVA 2W00A 1R0ZA 2VPPA 2VTKA 3FGNA 5A4JA 4Q1EA 2WWXA 1PV4A 2NO0A 3EZFA 4F38A 4S35A 3CZPA 4QM6A 1F2UA 2ZS9A 1SVSA 1Q21A 4KJZA 4RY2A 4DLYA 1G6OA 5EP4A 2GXUA 4PZZA 4QGHA 2AHOA 4OK3A 1Q22A 4EPRA 5SZIA 2QTVB 4CIDA 1FX0A 4EPWA 3U6BA 3W8NA 3GLHE 3I8XA 5F3WB 1KKLA 3K0CC 4NCHA 1GRQA 3TKLA 2XB2A 3WYGA 3OIUA 3LLUA 4LYFA 5FBQB 2WAYA 1E94E 1E0AA 3OIWA 4Q5IA 1TX4B 2JGNA 5IF9A 3W3AA 3ICQB 1GNRA 4QBFA 4L16A 4PSKA 4BRUA 5CIWA 5FTMA 3CF0A 4Z1MA 3RC3A 2A5FA 4LC0A 1NY6A 4QHTA 2F9LA 1NKTA 4A15A 1Q1BA 2C78A 1DAHA 2WKQA 4QJ5A 2W2TA 3LA6A 2DFNA 2QAGB 4G01B 4BFWA 4F7WA 3SHFA 1ZC4A 1JR3A 4IKEA 2EQBA 4UNQA 3VR4A 4WZBE 3GFPA 4JLPA 8OHMA 1N6LA 5JEEA 1AZSC 1TF5A 1NN3A 3EAQA 4M22A 2IF0A 2J45A 2AR7A 2P6UA 2JJ1A 3EWSA 4OKSA 4JBWA 4LYJA 3TAHA 4D4MA 4RKEA 2KWIA 1KNQA 3B1WA 3IUYA 2XXAA 1TAGA 2OXCA 4XTCS 1M2OB 2CVFA 2WJJA 4IJMA 1XRJA 3A8TA 4D0GA 2WAXA 4Q47A 5KU1A 5DYIA 2QZ4A 5C18A 1G1MA 2QUZA 3W6OA 5EZ6B 1DS6A 2QY9A 2IA5A 2OCPA 5FFMA 4B48A 2FGJA 2WWHA 1Z0IA 1E1RA 1F2TA 2RAPA 1P62B 4Z54A 1GKYA 4XWAA 3IO3A 2IS4A 3F8TA 1X86B 2BIFA 4P4TA 5KSOA 1CR4A 1WE2A 4D2IA 2GILA 3PEUA 2ZRPA 3ASZA 2OM2A 4TMKA 2QQEA 1UBEA 1RFLA 3RC8A 5KDLA 3C7KA 3QE0A 4U5XA 4NP6A 4BLTA 1AQUA 2GEVA 2GJAA 3Q85A 4M1TA 3CNNA 3REGA 3QBTA 4BQSA 2PBRA 1X8JA 3A4MA 4MRVA 2ZRFA 2ZSDA 1SKYB 1CJUC 4LV6A 4EJSC 5BN4A 2B92A 5CM8B 3HP1A 3OAAA 4AKEA 4DBLC 2IS1A 3ZVNA 1T3LA 1MT0A 3BE4A 1CJMA 2NPIA 2ZJAA 4RD4A 3N70A 5HZKA 4QGGA 1OE0A 1ZNWA 3RS0A 4EPTA 3PEVA 4TL9A 2IYXA 4D0LB 3WP1B 2Z4RA 3KXKA 3SR0A 4PSVA 5FTLA 2BKUA 3NG1A 2R65A 4TZ6A 1W0KA 2PH1A 2PX0A 2XTMA 4QHYA 1VCNA 1XCMA 2EYQA 3N5CA 1EFCA 3BORA 3LXXA 2PCJA 2UZ3A 3PUZA 4IDQA 5EE0A 2QMOA 3TQCA 2D7DA 4JIMA 4URXR 2Q9AA 3NDBB 2NO6A 1ZD9A 5JEDA 4HB4A 1HQYE 2GCOB 1P3JA 1FP6A 3DEFA 3EG5A 4X8LA 2KJQA 5CIQA 1JECA 2QP3A 1KZGB 1JXMA 4ARZB 2VSFA 3E1SA 1IN4A 2QBYB 3RNLA 5B58C 3OIVA 1NMXA 4TYPA 5AWFC 4Q4JA 3L0SA 3MD0A 3B60A 1IAQA 2J59A 2ZUCA 5KNDA 1EK0A 3MGCA 1XD8A 4DKXA 2GJSA 1XCPA 2OESA 5GJVC 3CM0A 4G5OA 4A8JB 3B9PA 3C15C 4A36A 5AUNB 4PO1A 1ZRHA 3TGPA 1T0JB 2NGRA 4HYYA 3AF1A 5LBIA 3PV0A 1OYYA 2IUUA 1II0A 2BV3A 2WPDA 4CW7A 2XZLA 3HU2A 4TQ9A 2BBWA 3BD9A 1FP7A 3OZXA 4IVQA 3KQNA 3A1WA 4B35A 4M0LA 4Q48A 3FE2A 2A5DA 3VU9B 2J0SA 1NLZA 1CR1A 1M34E 4D82A 4PC3A 4HAUA 4PPGA 5JSZB 2V1UA 1XJ0A 4FIDA 4MUBA 4PHFA 3THOA 4TTPA 4W5HA 1G16A 2G1KA 1I2DA 3DO6A 3QNUA 1Z6AA 3DVLA 2IYYA 2G0TA 1JQJC 3GD7A 3IEVA 1DE0A 3GLHB 2H8KA 3L8ZA 1YZTA 2R62A 4RCYA 1OFHA 4F92B 3TR5A 2QI9C 1ZINA 2WKPA 3THYB 4BLOA 4IDHA 4NKRA 4F4IA 1G21E 2QMEA 1HE1C 3SE0A 4A2WA 1XCGB 3L0PA 2FGKA 3THXA 4BFVA 4ACBA 5KNBA 3OHMA 1NSTA 3GEIA 3T61A 5LD2C 1TTTA 2VO1A 4HZUA 2QRZA 2QPAA 4OK5A 2PEZA 3T5DA 5FI1B 5TARA 5FPHA 2VP0A 4LSGA 2JDID 4WZ6A 2P5SA 3GJ7A 3KJEA 1LVGA 2QQ0A 1KI9A 2KBEA 4CEJB 2ODWA 2FFBA 3ZLJA 2R6CA 4OJKA 2WJIA 4DSNA 1RJ9A 5E7JA 2VH5R 6Q21A 1NSFA 4KHZA 4KAXA 2AFIE 2F6RA 4YMSA 1DAEA 5HE9A 3HYTA 2JLRA 4POAA 3BERA 1UM8A 2D3WA 4RD3A 4YLGA 4XVQA 5CITA 2ZSFA 4JZKA 3B7GA 4MA4A 4FN5A 2WV9A 3BFXA 4DCUA 521PA 3LX8A 3BH0A 1YU9A 2IW3A 1TQ2A 1YVDA 2X8AA 3A58B 2WMOB 5L8VA 3CX7A 3T06B 3B85A 4ZV4A 1R0WA 3JVVA 4J0QA 3T15A 3QKTA 4CVNA 1NKSA 3LO5A 2ANCA 3EW9A 3TQFA 3SEAA 4HB3A 4UKDA 3ZZUA 1DARA 2BBOA 5G40A 4B32A 1ZIPA 1KO1A 2F3RA 1CJVC 2A3RA 2V8OA 4QL3A 3MMPA 3SN6A 1R4AA 2FEMA 5DH9A 5HPYB 4LV5B 3C41J 4HUTA 1NNEA 5DI3A 1ZD1A 2P67A 2C9CA 3AF3A 3RRNA 4LJ9A 2OUKA 1ZP6A 3B13B 1JB1A 4KV9A 4A1FA 4W9MC 3U60B 5JHHB 4AKHA 4TQAA 3SS8A 3J81k 1WBDA 2V6JA 2ZE6A 3FKSD 3ZS8A 2ZIAA 1BMFA 2A30A 2ZRLA 2QA5A 4MGIR 3GP8A 5B57C 1NMZA 3N2EA 1Z06A 3UG7A 5ANRB 2XSZA 3K09C 3LV8A 2NQ2C 4DT1A 5K8LA 2R2AA 1KMQA 1Z0AA 2ZTSA 2KB0A 4IVRA 4FMCF 3AKYA 3AVQA 3U7EB 3SQXA 4AK9A 1G41A 4OHXA 4A2PA 1BS1A 2FEOA 5AJVB 4P33A 3JVUA 1L4UA 3ZGXA 1LF0A 2C8VA 1F60A 4G1UC 4DCTA 3O8RA 3NKVA 2B21A 2ANBA 1NN5A 3QJYA 2NIPA 1ZYUA 1ETUA 1EFTA 1QRAA 2O8CA 1MO6A 4L5BA 2DFLA 1Z0JA 1DVRA 3SU8A 2ZI9A 1XZQA 2JLVA 1G5TA 2W0SA 4JBYA 2KSQA 1E96A 2RGCA 1D2NA 3EZ2A 1NL3A 3KKPA 3DZDA 3LLMA 4KVAA 4ZDJA 5FTJA 3WYAA 5JFGA 2C5LA 2ZYVX 1RW4A 4PPQA 2IWRA 2XNDA 2KE5A 2HYDA 3RVBA 3OEHD 2O0JA 2FJUA 1Q57A 5AJZA 2QT0A 3VMFA 1R6BX 1P75A 2BC9A 3K9NA 5TXGA 1P9RA 4JKYA 2GEDA 3K8YA 5EP1A 4MYTA 3IEUA 4G5GA 1E2EA 1HA3A 3QKSA 3KQKA 2RH5A 3BK7A 2CNWA 2WSMA 4B76A 1N6PA 1QVAA 2IK8A 3K9LA 3SYNA 4RFSB 5FR2A 1W0JA 2JCSA 1SXJA 2JATA 3MWLA 4M9XA 3T1OA 4LC1A 2H17A 2GK6A 4PR0A 2JASA 2IX3A 2ZU6A 3B5JA 4Q1FA 3THWA 2HT6A 3TR0A 3AVWA 3TSWA 2JLUA 2NTYC 2ZRIA 3H2YA 3H4MA 5DHFA 4C30A 1RKBA 3DPUA 1Z22A 1T4GA 1ZU5A 1KSFX 2X19A 1QDEA 4YDSA 3WMGA 3E70C 3BAFA 3SI7A 3R8FA 2ONKA 3LRPA 2XOKA 4AYTA 4ZI2A 5BN5A 4F93B 3KTAB 3UMRA 3EPLA 3EZ7A 4FCVA 1EG7A 1W4BA 1CRQA 3CB4A 4M8NE 1KDTA 2IT1A 2VP9A 4LHVA 4V0MA 1XB2A 1QF9A 3W9YA 4LBZA 4DSOA 3LQQA 1LB1B 1JEDA 1W2GA 1H8HD 1NI3A 2XNSA 3K9HA 2NPFA 3FDIA 2ZUDA 2OV2A 4XIGS 4NDZA 3M0EA 2FH5B 1XMIA 3ASYA 3QEOA 3ICEA 1WRBA 1R8SA 3OEEA 4XD7A 2XZOA 3I62A 3AUYA 3FHCB 1XD2A 3QY0A 4LHXA 5KTYA 1T8TA 3IIKA 1G6HA 2HCJB 3BB4A 3I8SA 4IEEA 2O8BA 1D9XA 4AG5A 1GL9B 3KJHA 4FXPA 5LD2B 2D06A 4Z8XA 1E2DA 4K8OA 5G3ZA 4BPBA 1P2SA 3EPKA 5A5GA 1IN5A 3CF2A 5CM9C 2GVDC 5GJBA 4FW9A 3O47A 2GEUA 5HE8A 3KFVA 1L2TA 3Q72A 4OHVA 2QAGA 1FNNA 1P2UA 2QSYA 3AF2A 3GFTA 3IBYA 2QP4A 2IUSA 2CL7X 1A5TA 1D2MA 3RRZA 5H68A 4LJ5A 1GL6A 1E98A 3PQCA 5CYOA 3FVQA 5AJYA 4LBVA 1X3SA 1OV4A 3L8YA 2MSDB 1XPOA 2CBZA 4RD1A 4R98A 1ZCAA 3QXSA 1KKMA 2C03A 2ZI3A 3ZVRA 3GJ8A 3FMOB 2J7PA 4NYJQ 5B2ZA 1N5LA 2ZJYA 1V43A 4BLRA 5L3QB 1G4AE 2BMDA 1OKKA 4HUQB 3CRQA 4DXAA 4URWR 1NJFA 1VMAA 4BECA 3E2IA 4KITB 4IFBA 4US1R 1DPFA 4CEIB 2GHIA 2H92A 2RGNA 4JLBA 3WNCA 1KI8A 5TY0A 2PZFA 1TEVA 5EQTA 1Z28A 1KO8A 721PA 4UNPA 3KKOA 4FMDF 1L8QA 3X1XA 3UANA 4FD2A 4U00A 2O0KA 3L0IB 4URYR 2OFOA 3RSLA 3QXCA 1ZUHA 2H1LA 1KYIA 3CIOA 2RGNC 4LPSA 2PLRA 1XXHE 3GPLA 5JJKA 3TVDA 1NVWQ 3GLIE 1TADA 4Q19A 3RANA 3DZ8A 4RZXA 1FOEB 2JA1A 5EE1A 1HTWA 1SVIA 3P32A 4DCNA 2F1RA 2CL0X 2PLFA 3RLFA 3A1SA 5KPJA 2LWIA 3B8HA 1GITA 4NCIA 4WIAA 5JZVA 4OQFA 2FFAA 1NG9A 4G5SA 4V0KA 3REFA 5L3SB 2AFHE 5CDFA 4YMUA 1A4RA 3CNOA 4BUJA 3LY5A 1AA9A 4RKFA 2RHMA 3O8CA 3DOFA 3CR7A 3VHXA 4GP7A 2IHBA 1N6RA 1YHNA 3NHAA 3EPHA 4PQFA 1HH4A 4KBFA 3TVTA 1TL7C 3I92A 2X1VA 4XSHA 1Z07A 1YZQA 3QQ5A 2AWOA 4B3GA 4TSFA 1E0JA 2R6DA 4QNRA 3PCRB 3C4JA 3QXJA 4QHSA 3WXMA 3A6PC 4JSYA 4US0R 3MRSA 1XMVA 3TJZA 2ZAOA 2YWHA 5BW8A 5EP2A 2PT7A 3BIFA 5JBQA 4RZ3A 1RYFA 1AS2A 2VHUA 5FL3A 4N0DA 3AP1A 3CWQA 5GVRA 1BOFA 3LD9A 4MRNA 2CVHA 1NG1A 3LFUA 4YMWA 4PAMA 3LH5A 4DB4A 4Q1CA 3A4NA 2RGEA 2BEKA 5J4YA 4LYHA 4JBXA 1R8QA 4W5JA 2P2LA 4QFMA 4V0NA 5SZKB 4BFUA 3MUFA 5DNYB 3I1FA 1DTSA 621PA 3H1TA 3S1AB 2CE2X 3AVYA 3GEHA 1WMSA 1SVMA 2ZYWX 3U3JA 3UWOA 4TLAA 3FKQA 2OCBA 2O8EB 2OAQ1 3U6KA 4AKGA 3E5HA 2BOVA 4CEHB 5FUYA 1WF3A 4WW0A 1QHHB 2QORA 2QE7A 2B8TA 1R7RA 4A8JC 2DCUA 4MRRA 4XH9B 1E32A 2HLDD 1X1RA 1KSJA 3LVRE 4XVRA 3MCAA 5DN6A 2JJ2A 3TW4A 3M6AA 4ZPXA 1S96A 2ZYUX 2FPMA 1J99A 5HR5A 1R5BA 3EX7C 4RZUA 3RS4A 1YZLA 3EIHA 2QGNA 4PX9A 4HEJA 4KSBA 5F98A 1N5JA 1Y63A 2DFTA 2EYUA 4B44A 4QJ4A 1VIYA 4F91B 4A92A 1E79D 1E2HA 1ZM2A 1R10A 1ESMA 1CLUA 3RABA 4BGDA 1G291 1XWIA 3EARA 1D9ZA 1QZXA 3RRYA 3GLHA 2DPXA 4WBSA 5FOTA 4B75A 2QAJA 1UEIA 3GJ3A 4C0SA 2WTUA 4GSYA 2NZ8A 3THYA 2GJ9A 4QG7A 2VHCA 4PFSA 4CF7A 4AKIA 4S2EA 3K0CA 1HYQA 2FF7A 2WSSA 3NBXX 3NTUA 1WXQA 1GIAA 2CLCX 4C0QC 4GOKA 3IKJA 4JVLA 1UBCA 3WRXC 3ZDQA 5EUMA 4OI1A 2O8DB 2DWOA 1ODFA 3BGWA 3SJBA 1TQ6A 4R2IA 3UG6A 2QPOA 5KHOC 2WBLC 4EAQA 5HKKA 4PTLA 1YKSA 1CF4A 2BJVA 1Z0KA 2ZM5A 4OYHA 1Z6XA 4JVMA 2MSEB 2HT1A 5KNCA 5IRCD 2VF7A 4B2IA 1P2VA 3MJRA 4AG6A 5DI9A 4WVFA 2ZRAA 3U5ZB 4D4LA 3V9PA 4RJLA 3W5JA 1GDDA 1COWD 1G3RA 3Q8XB 4A0FA 4C0BA 5JI3E 1YRAA 3GFOA 4JLJA 2GTPA 4V02A 1CXZA 1XTIA 2G83A 5IDVA 5JCPA 2O8FA 4I1OA 1XTJA 4DJTA 4UXJA 1MABB 2CEAA 1SQ5A 2ZS7A 3DM5A 1T0HB 2QG6A 2J1LA 5EXTA 1F5NA 1I4LD 4BFYA 4LBYA 3MLEA 1W47A 4TMXA 3SYKA 2BMJA 4M2LA 3EWAA 3O8DA 3QVUA 1XXHB 3SYLA 1G7TA 2R6GA 3CPHA 4ACAA 3GLIB 4JVSB 1YZUA 4NYIR 1UADA 1EFRD 4EKDA 3FMFA 1KJYA 3VR6A 4KBGA 4DLUA 3R9IA 3ADCA 4DLTA 1OH7A 3B1VA 2YJTD 3BB3A 4ZDWA 1GRRA 4MYUA 4TLCA 3NVAA 4A0HA 1HURA 4HZIA 2E87A 2IHYA 1IHUA 2NG1A 3QG1A 1OFUX 2WIAA 2YOHA 2F43B 3B78A 1SVOA 4HI0E 2QRNA 3D7MA 2YC2C 4EJSA 2BBTA 4EDHA 4MKHA 5HCNA 3W90A 1S9DA 1SHZA 2QP9X 4B71A 2IS6A 1VYUA 3QPVA 3MSXA 4PC7A 5GJCA 2A7QA 2AK2A 5DYGA 3MG9A 2YHSA 2B7BA 1GKIA 3CBQA 4L9SA 4V0LA 4ZDIA 2PX3A 4TT3D 1I4TD 3T1QA 1AQYA 1TMKA 4U7DA 1JR3E 1OIWA 4MGKR 3NIBA 2PEYA 3EIQA 4Q1AA 3RDPA 2V7QD 1UKYA 3AKCA 3IHLA 1G7SA 4IEIA 4O25A 4PAOA 2H57A 3Q5DA 3IQWA 4Q66C 4DIDA 1S3SA 3PEYA 2C9OA 2IYTA 4A6XA 3HJNA 4DUGD 1D5CA 3VKWA 5JECA 4KFTA 5KUTA 4DSTA 2AKYA 2ZQ5A 1IY2A 1EFHA 2BMEA 1XMSA 2HYIC 1OSNA 2GCNA 1E2IA 2D2EA 2OCAA 5KSZA 5FOWA 3EXAA 3K1JA 1QHGA 4FWTA 2WIBA 1N3BA 2R44A 1G9XA 1T3SA 1VCMA 3NWJA 4DEYA 4TQUS 2VP2A 4TMVA 1NLFA 2JJ8A 4ZI3A 2JLXA 4LWZA 4RFSA 3UPUA 3QXHA 3K0EA 1QBKC 4AWXA 2XAUA 4TZ0A 2AD5A 4M1OA 2D62A 4YMTA 5C1BA 4Q02A 1GTVA 5TB5A 4CYMA 1YR7A 2ORWA 2Q9CA 1TQDA 2IYZA 5KYKA 4V0OA 3NEYA 3CKLA 4L15A 2P0EA 4E09A 2BVNA 4C0JA 4YDHB 5ELXA 4Z8YA 1DADA 3EA0A 3X1ZA 1NVVR 2QPTA 4ON9A 1TPZA 1Z2CA 3HR8A 1EGAA 4M1YA 1LY1A 5E7IA 3WNBA 1ZNXA 3BC1A 3Q9LA 2FNAA 4HLDA 4JT4A 1HE8B 3KTAA 2J0QA 2WJYA 3NHBA 1XTQA 4Q7JB 1EFUA 1WBBA 2LKCA 2NO9A 2ZI5A 4JSTA 3FOZA 2A2ZA 4Q4LA 2B8WA 1R5NA 4Q9KA 4KI0A 2J41A 4B6FA 3OESA 5GJWC 3T1TA 3U7FB 1Z0DA 4C2TA 1B0UA 3M4YA 1JPNA 1E2PA 5EE5B 3LW8A 2JLZA 4BEJA 3VKGA 3AP3A 4DLZA 4QM7A 2OE2A 1K5GA 1LFDB 1OFTA 3BRWD 3UWKA 3AUXA 4HAWA 3LNCA 4BFSA 2FSHA 2G1JA 3ZZTA 5J47A 1G8GA 1XD9A 4GZMA 4IXMA 4LBWA 3KQUA 4PPNA 4EPYA 2XX3A 4HLQB 1AGRA 5LB2A 2GJ8A 2GXQA 2IEZA 2F3TA 2ZRMA 2ECKA 1IJFA 2IYLD 2GWHA 5JWRA 2YVUA 3R7WB 1N0UA 1FFHA 1UEJA 4TMTA 1IM2A 1XTSA 1NVXQ 2REOA 4NL4H 2JLSA 2QROA 1MR3F 4F4JA 3ZIAD 2EWVA 1M8PA 3KUDA 4QBIA 5KDDA 1XF9A 2CJWB 1P5ZB 3IPXA 4CZ2A 4ASUD 2WKRA 4N0EA 4TL8A 1R2QA 4LJ4A 3EA5A 5H1YA 2ZRNA 4BLPA 2ZEJA 5B30A 2W6ID 3BB1A 3BH6A 4RD6A 4MDFA 5L3QA 1KI6B 2HF9A 4YXWD 1Z0FA 2WWYA 2J0UB 3F0TA 2QENA 4HUQA 3EIEA 4MQBA 5DO9A 2ZI4A 1Q0UA 5E7MA 3VR2A 1DOAA 2JDIA 4GBMA 1TU4A 3R9WA 1F2UB 3KJIA 4KVGA 3RWOA 1OJLA 1LNZA 1II9A 1WB9A 2E1RA 1GAJA 5DE3A 1L4YA 1IBRA 1I2MA 4PANA 4LJ6A 4NMMA 1RZ3A 1FX0B 4RFVA 5FBWB 3T34A 1M74A 1NRJB 2AX4A 5FPTA 1W4RA 1M6NA 4BFZA 2F1IA 1TU3A 1VDZA 1ZBDA 4PZLA 4O3MA 3SDZA 3U3MA 3KKNA 5FUWA 4BLSA 2H7VA 1DEKA 1N0VC 4OI4A 1BYUA 1GNPA 1NN0A 3I5XA 4ERNA 2GRJA 1F3OA 1N25A 4M9ZA 1TUIA 4NYMQ 3UKDA 4ZIRA 3UXMA 4BE7B 1XFAA 3W3ZB 3K0FA 2Z43A 1M7GA 3T5GA 3UATA 3K09A 4B3BA 2BKEA 4UJ5A 1OF1A 5P21A 3KX2A 2OZEA 1G3IA 1UBFA 1E9SA 4AURA 3V00A 1G8YA 4H1VA 4LJ7A 1ZUNB 1ZM3A 4NCKA 4Q4AA 4JL6A 1S0UA 2OLKA 2ASEA 3VX3A 1Z8FA 3A1TA 1G17A 1E4YA 2FSIA 3GLFA 1P73A 4OI0A 2L0XA 1TF2A 3D3QA 3ZVMA 4HDCA 1YZNA 2HDNB 4C7OA 4LJYA 3BS4A 3FKSA 3ZJYA 2BHRA 4QBHA 3AQ4A 3D8BA 2W6JD 3U61B 4NTZA 2ODNA 1XBTA 3IBGA 4LRWA 3MWJA 3BWDD 4UJ3A 4KYUA 1TQ4A 4UQOA 5FBRB 4EQ6B 1WCV1 1FMJA 2FZ4A 3IIJA 3LQRA 4NE2A 3AB3A 5BQ5A 5TVKA 2VL7A 4UXHA 5FPSA 4AI6A 1QHXA 1XMJA 4KXFB 1N5KA 2ZREA 1W2HA 4G5QA 2I1VB 3FTQA 4E22A 1W7AA 1YZKA 4R7ZA 1RPZA 3CUEF 5TDHA 2VQSA 2VYFA 4BFXA 4MGYR 4OK6A 3B6EA 2VLIA 2ZROA 5FTNA 5JWOA 1BIFA 3MFYA 1U94A 3WP0A 2P3SA 4OI2A 4HLCA 2E9SA 2PMDA 5H70A 1ZUIA 1WA5A 4JLNA 3B1XA 2FFHA 3PJRA 2ZI7A 4B3FX 4Q1DA 2AKAB 5IT5A 4CEHA 1XEXB 3OEHA 4L4UA 1J8MF 5KPDA 3CH4B 1QHHA 1FQKA 1P9NA 3I72A 4Q1BA 1IXZA 4XVUA 1JR6A 2R9VA 1UJ2A 1G18A 2JEOA 5SZJA 1OLOA 4Q00A 1ZM4A 2ZXUA 2DB3A 2AK3A 5C4GB 4EFMA 1P2TA 3U7HB 1KGDA 1V5WA 1XU4A 4HATA 3K53A 4PSAA 1NIJA 3DM9B 2CDNA 5E3HA 1J8YF 5K8TA 3H86A 3AVPA 3OE7D 1P60A 4GNKA 3VKHA 1FMLA 2PMKA 2ZJZA 3CPEA 4ZKEA 3VX4A 1Q44A 1R0XA 4ITRC 1UFQA 3CF6R 3KB1A 2YNMA 2ZRJA 3W6NA 5DIFA 2IS2A 1ONBA 1Y3AA 1U0HC 1Z2AA 3L43A 2OBNA 4PC6A 4Q4JB 2W0MA 4Q9IA 1XPRA 1MO4A 2O5VA 2V54A 3A36A 1XJQA 3IIMA 3QUSA 1D6JA 4OQLA 2A5GA 2JAQA 2ZE8A 3FFBA 4M21A 4O2RA 2LCFA 3AP2A 4DHEA 1DAKA 1MH1A 4KCGA 2CHQA 3UK6A 3CH5A 2XGJA 1SULA 4HLUA 3EZ9A 4FINA 3ZH9B 4B3DA 5JS8A 3TUZC 3I5YA 3TRFA 3FB4A 2XOKD 1N2CE 1UDXA 2FX3A 4Q18A 3RYTC 4C9BA 5JJIA 2ZE7A 2ZSBA 3SQWA 1DBSA 2XTNA 1CJKC 1ZU4A 1UBGA 2EFEB 2O8DA 3QIAA 2Z4SA 2KBFA 2IYUA 3NEJA 4FMCB 1E0KA 3O8BA 3U4QB 5TMPA 1E69A 4BZPA 4ILEA 3SZRA 4IOMA 5C2JB 5K8IA 1RRCA 1H8HA 2HUPA 3Q7QA 4HLUC 5F9HA 3LAWA 4KO8A 5KO2A 4OQMA 1SXJE 1T9HA 3U3OA 5EZ5A 4LYAA 3GJ0A 4BLQA 1ZNZA 2XEXA 2CK3D 1MOZA 1OIXA 3BBPA 4II7A 5EXPA 5FUXA 4DLXA 5HZHA 1EXMA 1G7RA 4ZO4A 2ATXA 1LTQA 4G5RA 4Q7LA 1VTKA 2BCJQ 2RGXA 1R5OA 4GFDA 1YRBA 4M1KA 4C4PA 3PUXA 2P6RA 3EZ6A 3V4FA 2ZITA 3W34A 4TL6A 4DVGA 1X1SA 2RMKA 2Z5FA 3KL4A 5CK4A 4DSUA 4M1MA 5UKDA 4N3NA 4M53A 1MABA 2ZR9A 3FYHA 1HY3A 4G0NA 3HU1A 2LKDA 2IXGA 1G7CA 1US8B 1RRGA 2ORVA 1SKQA 1W5SA 2EFDB 1S2MA 4D0NA 1O87A 1XJCA 4GT1A 4V0ME 4AYXA 1E9RA 4TLBA 1XXHA 4MKFA 1S1MA 2DWPA 5JWHA 3AGPA 1Z6YA 4CT4B 2BDTA 5D3QA 3GLIA 1NVUQ 2JLWA 1UKEA 4M9SA 4KLZA 5CB8A 4NCNA 3TW8B 2C95A 3THXB 1A7JA 4IHQA 3PR1A 1WP9A 2ZRHA 4TWZA 1ZIOA 3ZQJA 2D2FA 1LW7A 3I61A 1GUAA 3NC1C 1OXSC 2V55B 2A78A 1Z63A 1B23P 5J4HA 4DCSA 4DIEA 2OFWA 1E9DA 1CEEA 1MO3A 2C9YA 2F43A 4LUCA 1SZPA 4B33A 1BO6A 1GSIA 3TSZA 3JZMA 1NBMD 5B64A 1I4DD 2BCGY 3LWNA 1G8HA 5JRJA 2QEQA 1T6NA 3HR7A 3AV0B 5FL7D 5M04A 5EE3A 2WJGA 2VP6A 4C2UA 2FA9A 2J5XA 1NLYA 4C3ZA 3U7GA 5CLQA 1U9IC 4NCJA 2Q3HA 2G77B 1CBUA 2Q9BA 2RHDA 3MWKA 4FCWA 4JJZA 1UKZA 1W48A 1PLLA 2V9PA 3JZAA 3NC0C 1KY2A 2WHXA 3K70C 4H9GA 1AKYA 3G82C 2B6HA 5BXQC 3KFXA 4EFLA 1RIFA 3V4RA 2DYKA 1TF7A 1DO2A 3RWMB 2VSOA 3F5FA 4XTRA 3TLXA 4GRAA 1E2NA 4TN1A 1RVDA 1L7VC 3AKEA 4KODA 4R71A 1KSHA 2G0NA 4OQNA 1S8FA 4KSCA 5IK2D 1AS3A 2ZRDA 4FI3C 5JS7A 4ESVA 2DR3A 2N1BA 1VHTA 3EC1A 3LBIA 1T5IA 3Q7PA 3PUVA 5DI3B 5J5CA 5GADl 1OH6A 3CO5A 1KK0A 2IL1A 5L3RA 1ESNA 4LCBA 1NBME 4ZCLA 1KI2A 2GCOA 3RRMA 4DB2A 1G20E 1U99A 1E0SA 4URUR 4QGAA 4PO8A 1UKVY 1ZVQA 4MYCA 4C0LA 4NZYA 4ARZA 1XEWX 2QBYA 4IFEA 3I32A 3ETLA 3QF7A 1G64A 3VHLB 5F9FA 3VFDA 4HDOB 1YR8A 2CCGA 5EE9A 1S1CA 3WHLA 4JLAA 2YV5A 5EJEA 3K0SA 4LJ8A 3FWYA 3ZD6A 4URZR 2GESA 2OT3B 4WZAE 1H8ED 4Q21A 1G19A 4A8JA 4HAXA 3IDQA 1KJWA 1P4SA 2ZJ8A 1LV7A 4WXPA 4JYBA 2O8CB 2YWGA 2AD1A 1CRPA 2GZAA 1JNYA 2PL3A 4P3YA 5CYPA 1KHTA 1VG0B 1E2FA 2IC5A 1JQLB 4D80A 2Q0HA 2GKSA 1Q12A 3TUJC 3T1VA 3GLGE 4PHHA 1VYVA 1HQCA 1N6NA 1E2JA 3CZQA 1ANKA 2C98A 1Z29A 4DZZA 3VU9A 1OHHD 3D6TB 1IY0A 4JJKA 4X8OA 4XOIA 4FMDB 2PJRA 2HJGA 5JSZA 3EASA 1WQ1R 5IHPA 4ZDKA 1GRNA 5CLLA 2YWFA 1Z3IX 1FL9A 3DHWC 4OJQA 2HLDA 2J9RA 2EFCB 1CR2A 5JMTA 4CT5A 4KYIB 2ATVA 3QKUA 3QKSB 2REBA 4K81B 1TNDA 1RYHA 4X8HA 1O3YA 4RSGA 2QMHA 1YR6A 3VR1A 3R9XA 1KIMA 1AM4D 2ZJ2A 4IVPA 4DLWA 1RRFA 1Q1ZA 1U8AA 3I3SR 1M1YE 1GG2A 2C99A 1J7KA 1E79A 1SXJB 1U98A 3SNHA 4PAQA 4B2PA 1QHIA 4ABYA 3LW7A 2WOJA 2MSCB 1X8LA 4M1SA 2EFGA 5KSYA 4BASA 5KDOA 3AVUA 3LXRA 1KOFA 3R7WA 5FOXA 2RGBA 3IPYA 2J3EA 1DAMA 1ZD8A 3FHOA 2QM7A 4MYHA 5E4FA 1WDTA 3PG5A 4UNSA 2X2FA 2V6IA 1E1QD 2JIZD 5DISB 5FOSA 5C4MA 3QF4B 2C77A 1KK1A 2WWFA 3OFND 4R9UC 4A9AA 221PA 2ODBA 1KDPA 5BWMA 1GM5A 4TTQA 4Y0VA 2ZJOA 2OXRA 1FZQA 2ZRBA 4JVNA 2ZJ5A 1IN6A 4W5WA 2RGGA 1AGPA 1GOTA 3GJ6A 3QKRB 4IXNA 1NP6A 4CEJA 4C0HA 2OSBA 1KO5A 2FWRA 2Z0MA 1KK3A 2XITA 3GQBA 3TUIC 4CRWB 2ZYTX 4D26A 2J0UA 4RZ2A 3CNLA 4YONB 4DEXA 2GDJA 3P1JA 3C5HA 2NO7A 1JBKA 2ZSAA 2ZS8A 3QPWA 1VIAA 5LB4A 1FTNA 2YYZA 1DAGA 2HXYA 5HKKD 2UVQA 1Q3TA 4KLNA 3QG5A 3CLVA 3CR8A 4LV8B 2BM0A 3AVXA 1AIPA 1KI7A 3GMTA 1S4QA 3K0AB 5EP3A 4Z1MD 4NONA 1G3MA 2ORIA 1N5IA 1E3MA 3NXSA 1MKYA 2CHGA 4RCZA 5CJ2A 1XD2B 2AWNA 3WBKA 2WWWA 1COWA 1JAIA 1CP2A 2O8BB 1GFIA 2J46A 1VCOA 5BYJA 2C2HA 2AN9A 2QSZA 2UKDA 1G3QA 1JR3D 3KXIA 1CULC 1MV5A 3CRW1 5H8WA 2H5EA 4Q9HA 1E9FA 4FMBB 2GAAA 4PZYA 2RB4A 2FMXA 4D6PA 3NBYC 2JJ1D 1FTSA 1GP2A 1OXTA 2ZRGA 2GBLA 4JL5A 2YINC 3KKQA 3LDAA 3QOFA 1DG1G 2GXAA 1T5LA 2FE4A 2O0HA 4HSEA 1EFRA 3EPJA 2R6AA 4IDNA 2I4IA 2N42A 3U3RA 2FN4A 4LPKA 4E03A 2ERYA 5CJPA 3RHFA 2VRWA 1XTRA 2OG2A 3TH5A 1II8B 1P7CA 1U8ZA 2GBLC 1E1RD 3AH8A 1OIVA 4OHWA 3R8CA 3SFVA 1LS6A 4EQ6A 4IOKA 2ERXA 4DC9A 4LDJA 1K5DA 4E07A 1QG4A 2GJKA 2GZDA 2WZQA 2ZI6A 1KDOA 4AYWA 4TYYA 5G41A 4B2LA 1GILA 2QN6A 4IRUB 2F7SA 2FPKA 2ZR0A 3LX5A 4TT3A 1R0YA 3K9GA 2OO7A 2P65A 2GAOA 2VP4A 4EIWA 1TUEA 4LJAA 2YOGA 4A82A 1VG1A 2BM1A 4M1WA 4D4KA 3OAAD 1YZGA 4ESHA 5JI2E 1Q1QA 3QSYA 1W4AA 4WXRA 1DELA 2H18A 2V7QA 4PHGA 4EPVA 1E9CA 3U44B 3RSOA 4MRPA 2FU5C 1ZC3A 1PZNA 1NY5A 2X2EA 2I3BA 1W0KD 4G3XA 4JMPA 4KFSA 3SJZA 5FPYA 4DUGA 3B2EA 3DMNA 4M9QA 3IQXA 1XEXA 3GEEA 3DKPA 3VTKA 1E2GA 4FWIB 4TYQA 3GLGB 2QGZA 5SZHB 2ZVQX 1ELOA 4D81A 1Q1EA 1GKUB 1OXVA 2CMKA 2PJZA 3WRYC 2DY1A 1CTQA 4TYWA 2X77A 1KI3A 4OHZA 4DLVA 1ZJ6A 2IXEA 4NU0A 2RGDA 5DLQC 4HAZA 2WWIA 1Z5ZA 1GZSA 3PUWA 1A82A 5FI0B 2J0VA 1N0WA 3CW2A 2XB4A 3SC3A 3P27A 4WAUA 4NHOA 4HB2A 4BZQA 2QNRA 2R6FA 3EC2A 3BXZA 1RC8A 4TYNA 1Z83A 1OT3A 1U0JA 1N6HA 1FQJA 1KAGA 3KZ1E 4LHWA 1VG9B 1XDBA 4I99A 2AXPA 1IY1A 3LVQE 1M7BA 3KKMA 1AS0A 4P4SB 2HCBA 2ZJBA 2ZUBA 1ZCBA 2ODEA 2HXSA 2WPDD 3TIFA 1G8PA 3WMEA 2PZGA 1IONA 2NZJA 3PENA 4OL0A 3SHWA 3T35A 3GJXC 2C96A 3IO5A 4PXAA 3WMFA 2CCJA 5AUOB 5FH9A 3L2OB 2A9KA 1KMHB 2P6NA 3KQLA 1MO5A 3Q3JB 3UMFA 3CPJB 1X8KA 1HT2E 3ADBA 4PQYA 1N6KA 3T12A 1KI4A 4Q9JA 3U4QA 2I1QA 2VIIA 2QMUA 4EUNA 3GCGA 1HV8A 3X2SA 1MRNA 2K5UA 4BEBA 2IBMA 4CDGA 2HV8A 3A4LA 4NPHA 4AC9A 421PA 5FBLB 5TV2A 3P4XA 5EXXA 4TL7A 5K8UA 1F48A 3TK1A 4GP6A 1DG3A 2PCLA 4N1AA 2VSXA 5FUVA 4B74A 3TAUA 2IYSA 5D3MB 5L3VA 3A1VA 4YMVA 1JALA 2YOFA 4D25A 4XSGA 4Q4HB 2FG5A 1G3UA 5CB6A 1C9KA 3UIEA 1VHLA 2J87A 2WMNB 1US8A 4GZLA
chains in the Genus database with same CATH superfamily
2PSDA 3PXXA 2VQ6A 1HUQA 4GM1A 3NH9A 2WA1A 2CXXA 1SEPA 4FFDA 3F78A 5EGNA 2Y71A 3S27A 2AR9A 3EQ2A 3U7IA 1CETA 3MFQA 2Q1WA 4YCBA 4EY7A 1ZGGA 4WKNA 5G53C 1ND6A 4Z3OA 4BN4A 2Q3FA 1LPNA 4BU1A 1IN7A 2Q21A 3B1YA 1E2MA 1OI4A 3LBNA 4GMXA 2AL7A 3MWEA 2D74A 3FWKA 4WA7A 1SUIA 5KWEA 2PZMA 1EHYA 5DHTA 5AVUA 1CR6A 5HIKA 1XTPA 3KUKA 1N2HA 3DFMA 1FJHA 2HWYA 2I5PO 5C46F 5ADHA 2CYAA 3UA4A 2B30A 3L8EA 2C3UA 5TRTA 3RFCA 3GUVA 4DA4A 3RS5A 4TV9B 2AI1A 2V98A 3NIDB 4RK1A 5I7RA 4J0GA 5FPQA 4B5LA 3HPRA 3A6JA 1B0PA 2JHGA 5DBOA 4NICA 1I36A 2OKCA 1REQB 3G8YA 1Z6GA 2P91A 5FQNA 3WJAA 3KM0A 3PXCX 4O5AA 2QVGA 3RC9A 1G98A 4QKQA 4DV0B 1VL6A 4LXQA 4E31A 3U3ZA 1NR1A 3VH2A 1B43A 3L6DA 4ZYYA 5MDHA 4QXAA 2J85A 4Q9LA 4YAEA 3HYCA 3ON5A 3OZTA 4EF5A 1TZKA 3QENA 3SEQA 4KWIA 1N9ZA 3I73A 3IJPA 1P6UA 3ND9A 2ASVA 4YAJA 4YUZA 1SO8A 5EZSA 4DNPA 1M7HA 1NI5A 1SY7A 2I71A 3GJSA 2YV3A 5BUCA 1P6XA 2CCKA 3EF3A 3X3HA 1EUQA 4IINA 1YFZA 5FNVA 2PWYA 4AMYA 5JNUA 3GT4A 4HNAB 1ZO8A 3CZCA 1GU0A 5D7NA 1QC5A 4OHOA 4UARA 3TE6A 3K96A 2XBLA 4LX0A 1ZIDA 3HY6A 3M49A 3UAGA 2VTBA 1IXKA 5CHYA 1ID1A 3AVVA 1Q11A 1C3VA 5FPKA 2HMUA 2R85A 2W8BA 3QYJA 2I2XB 1QOZA 2Y1GA 3E1GA 4V03A 1XN4A 2AMFA 2H2WA 2XSZD 3STWA 3TAXA 1J8FA 5EGSA 2JI4A 2O2XA 2VP3A 1YI1A 1FFCA 3GNSA 3K8QA 1PLJA 4NFSA 5F5XA 3B5IA 4UBLA 2EFHB 1GAWA 2Q27A 1G38A 1W2WB 3WY9A 4MV6A 2ZVPX 2Z3VA 5AR1A 2Q50A 4U02A 3PQ2A 4QC2A 3A1CA 3RF7A 2QI9F 3AVOA 1FFAA 4EJSB 2VJQA 2XB8A 1OWPA 4Z0PA 2IWHA 3BMOA 1MTZA 5HS4A 4X63A 1B0AA 1P5HA 1VKNA 2JLQA 1QCCA 3FYUB 3KYJB 4J7XA 4B47A 2H0RA 4JS0A 2IUTA 1L5HB 3MS4A 1SVWA 2XH8A 5DNDA 1FP1D 1DIRA 2C3OA 5EJGA 4XM0A 2HF2A 5DNAA 1AO3A 3G0HA 3J7AC 1QLHA 2A0YA 4P32A 2PZ8A 1WDWB 3N2NA 4GMDA 2F1KA 3S1AA 2GXSA 4E6EA 3J81A 1IFXA 4BQIA 3JQPA 2XNDD 4ZXPA 5IUJC 2O8EA 4D8WA 2IH4A 1X1TA 2KQUA 4R2HA 2PZBA 5TQJA 3F7MA 3GLFE 2YMQA 4MRSA 3BTSA 3OTIA 4KR3A 3KETA 1ECGA 2OEPA 1V8BA 1C8KA 2VDQB 4OBEA 2BH2A 4FEYA 5FHQA 2HZBA 3HKBA 1N5MA 2ZWIA 2R8XA 5JHGB 2HFKA 1B74A 2QJWA 3PXGA 1BMTA 3OQIA 5JTTA 1T6ZA 5BV0A 2NQ8A 3QBVA 4UNRA 4C4OA 2D6FA 4DQUA 2HF7A 2YIJA 1SC3A 1G4HA 5BOVA 3CSSA 1IB0A 4XA8A 2UU9B 2HXGA 1R0LA 3AINA 2RHGB 1JSLA 4X1KA 2CLDX 3P4YA 5KOJA 3OQOA 1SXJD 1F0YA 2DR2A 4BQFA 4IGAA 3ZNQA 2HQBA 5HQ3B 1QP4A 3C3JA 1HETA 1JE1A 1SHKA 2IP4A 2PGXA 4HAVA 1CZKA 1E2KA 4R81A 2BEJA 3GAZA 2QM8A 3A2LA 1AZTA 3ZU5A 5AKEA 5BN3A 5BO5A 4Z51A 1EGMB 2M2IA 1JHYA 1WCIA 1Q3HA 2NTVA 3DAHA 1JJVA 1LK5A 2OBLA 2RAUA 3KJGA 5T3YA 2A0UA 4DC0A 2GPBA 1XKQA 3K94A 3OF5A 5HWSA 5I5EA 1QGZA 5H4HA 1FVHA 3COYA 2E89A 1IDOA 3HYRA 1N5RA 3QVMA 3EXHB 2CHVA 4UHCA 5JFOA 1KEEB 2WJ6A 5JJLA 1JDTA 2TYSB 4D4JA 2Z1MA 3FHJA 5CFPA 2OORC 4HDQB 1KY5A 1G55A 1PJSA 1SHTX 4ETWA 5M29A 1YA4A 4CNQA 4EYOA 1C9YA 4CV1A 1RRPA 1P77A 1E99A 3VNUA 2RGUA 2YZ2A 2TMKA 5BRJA 4CMCA 2B8NA 4RANA 1PO7A 2PZEA 4EJMA 3TLGA 2JGRA 2PUTA 3BHNA 4LDAA 1P1FA 1W5TA 1E9EA 3C3KA 1TCVA 2E5FA 3IR6A 3NBFA 4LZLA 4O29A 1F14A 5TF4A 3SX0A 2W6NA 2BWJA 1KRWA 4BX0A 3O75A 1R4ZA 3BH7A 1THGA 4RA9B 4XD7D 3SJAA 4NOMA 2WTXA 4YWJA 4I9HA 5E95A 3GUHA 5AHXA 5FD8A 4ETIA 3UXHA 2X2OA 4UTNA 3AU9A 4M3NA 3VSAA 2R6ZA 2WVAA 3WFIA 3PVSA 1X87A 4LGMA 5K3FA 3ZHBA 1YJAA 2I1WA 3C4QA 2HGSA 2E7ZA 2MT9A 3K0AA 1GEEA 1O58A 5GM1A 2HEIA 5DM4A 3E4CA 2QG4A 1FJXA 2PAAA 1VP3A 1AT1A 2HK7A 5DWDA 4IZ6A 4DDUA 3H04A 4D3FA 4CLOB 2CHFA 1NMYA 3SJCA 1EESA 3GL9A 4AZTA 1RJEA 1MAAA 3PIIA 1YBVA 1UXKA 1OCEA 4N54A 3QTTA 1C1HA 2B6NA 2QU7A 1FFXB 1M66A 1GL3A 1R8XA 3LK7A 1M75A 3H1EA 4WLUA 1EJBA 1JWAB 5K0FA 2M6SA 3URMA 5LZ9A 1U0LA 4Y1RA 3TW6A 4QOJA 3WAGA 4HB0A 3FFXA 2EEPA 4IOJA 1L4MA 3OPVA 4Y2VA 3EN0A 3RV3A 2VEOA 4HX2A 2G8NA 3IP7A 3VGPA 2IXAA 3PIRA 4B09A 4D1YA 4ZHQA 1TZ2A 1L8XA 1JU3A 2IF2A 1FFDA 1WZ2A 3M6MD 1IE3A 4RETA 3HPQA 1UXGA 3LC0A 2JS7A 4XWOA 2V8BA 3F7OA 4A6DA 2Z6QA 4K26A 1O8BA 4HGQA 4QAJA 1C0LA 2O2IA 1ZH2A 4ND8B 1Y4AE 3SXJA 2B3TA 5HVNA 3KHUA 1C1XA 3B7PA 1GNQA 2H8GA 3M3PA 3RVJA 4P3PA 1M2FA 1ZI6A 3PCTA 5LDDC 2GAFA 4OEHA 4OQPA 3DDCA 1EVEA 1AF7A 3H11A 4MS1B 3JQGB 1B6GA 2YS6A 5ALRA 3BRCA 3TG8A 1FSPA 1ZUD1 4IJVA 4TXMA 2DM6A 3NU1A 1SVKA 1WU8A 1X80B 1UPTA 2WJHA 4KH1A 1BD4A 2BMFA 4UVGA 4Y6SA 4WOJA 4XPIB 2LIPA 1ZW6A 2RB5A 3DVRX 3HXOA 3HZZA 2I2DA 1N77A 2W83A 4KJXA 1DKPA 4QXRA 3WJ1A 3FTFA 2O5EA 3U26A 3OQNA 3OX4A 3USZA 3WDKA 4LI0A 5EJIA 2DSTA 2ONYA 4EARA 4XJXA 2VBFA 1Y4UA 4W6QA 4ESOA 4PC2A 3CWZA 2XWJI 1DAFA 2OENG 3SKVA 4B8ZA 4ZO6A 4YAKA 4KFCA 2R8OA 4ZTUB 5EMMA 1VGVA 1WY7A 2XGOA 2XUHA 3ZIDA 4B6EA 4RF3A 5CX1A 4D3SA 4KXQA 1N3YA 2CDRA 3SVLA 3LCVB 4RK5A 5F7ZA 3R4CA 1MDFA 5C7LO 3U44A 2IJGX 1NZJA 3ZCQA 3AEQB 2D2IA 1B26A 1MJ5A 5ENDA 1PSWA 3NAZA 1JXQA 1SQFA 3IQDB 2F1JA 3QNMA 1IRXA 5ALFA 3SQOA 821PA 1OYWA 3A1UA 1LDEA 5DU2A 3HU3A 4IUBS 2FCRA 3U3KA 1GYPA 3SBDA 4MQUA 4GOJA 2V6BA 3KDAA 1E7SA 3KPYA 4Q05A 3UMVA 3F5DA 2OD2A 2YVKA 4P3XA 1ADGA 1GGNA 3GP3A 2Q1TA 4Q4AB 2H16A 1T34A 4TSFD 5A3SA 3AM1A 4US2R 4CFSA 1H9CA 1NKVA 3OG9A 1UBHS 3H0CA 1UFKA 4DM3A 2JJQA 4YAUA 1TVEA 2NU8A 5GPBA 3SMQA 5A6VA 4K3UA 4CR6A 4DT1B 2Z3WA 5J47A 2O54A 3OZIA 1J8VA 1VJGA 2PWBA 4RY9A 3L93A 3LT1A 3GFSA 1ZR2A 3ZJVA 1ZN7A 2ETVA 4CJXA 1DRUA 3RFUA 2EW8A 2QX8A 1SU4A 2HO4A 3LUHA 3TSCA 3PFFA 3ZYCA 2YC4C 4ZJZA 2BBSA 3K4QA 2PUHA 2UVPA 3D6HA 1XPUA 1UWVA 3EXFA 1E3QA 4A0RA 3AESB 4CN8A 1FPMA 3OPYB 3Q10A 1IH8A 1U1DA 1SNYA 3RAGA 5ADWA 4L8GA 4RTKA 1KMMA 1UMCA 4ZZIA 1HFEL 3JTEA 3GDGA 2W2KA 1KJZA 2MINA 4BNKA 3JAKA 4E5DA 3X1WA 3EC7A 3W6PA 5DX0A 1L4KA 5F7JA 3Q2OA 2O2YA 4NBSA 2WOOA 2VBCA 4N6GA 1JJFA 4ND6A 2XUQA 4AXBA 1KAOA 4DV3B 3DOHA 1EI9A 2WIJA 5DGXA 3SHQA 1X8XA 4MCJA 3ADKA 5JCOC 4IW3B 1IXSB 1ES9A 3FROA 1JHVA 1V41E 3TBKA 1CHNA 4Q7EA 1RBZA 4EUHA 3AEZA 2ZXFA 6AT1A 4KL8S 4U6SA 1FDUA 4ZOEA 1EBBA 4F11A 1DCFA 1YDEA 2CJFA 3C2QA 2FSUA 1K2WA 3W5HA 4F1WA 5IANA 5HK8A 1PAUA 1G8FA 1FPQA 2G9ZA 1GPYA 4DLLA 3BXPA 2H5LA 4WLEA 3ZQ6A 2D00A 3TSOA 1CE8B 1GVNB 3ZR4B 4TZKA 4AD8A 4ZCMA 2Y1OA 4OLBA 1JBEA 2H65A 2K2QB 4ZVQA 1W36B 3H05A 2IZ1A 3E9YA 2RJNA 3FF4A 5I6DA 1Y8RB 5JS2A 5B6IA 1GSHA 1DP4A 4GLJA 4DNXA 1ZIYA 3R7SA 1FMFA 2IH5A 5KIAA 3NBZC 4KLCA 3MIZA 3PYLA 4C0KA 3R5TA 2P90A 2VPIA 2JFOA 1IEWA 4BZXA 3W4JA 2HJWA 3K70B 4FCTA 2HK9A 3JX9A 4LJKA 4G6ZA 1T3TA 3CLSD 1OT5A 4FFLA 4R7TA 3D31A 3BA6A 4L4XA 4OQXA 4UXIA 1M2GA 1BKDR 2GYYA 2WSSD 9MHTA 4EPXA 5I8ZA 3KPJA 5DLYA 2G09A 1OX5A 2OZVA 1AN0A 1EWKA 5INTA 3HBNA 2OAP1 2D1RA 5BN5B 1E1QA 3K9CA 4FT2A 2FZVA 1V5IA 3C48A 2WB4A 4B40A 3ZNPA 1E2BA 4X95A 3GGJA 4XKJA 2NO1A 1E2QA 2W00A 5PNTA 3FGNA 2NQTA 5A4JA 4Q1EA 2WWXA 4F38A 2VDWA 3CZPA 4E7PA 4F4FA 1Z7BA 1XCJA 3CWCA 3P2YA 3WX0A 2ZUFA 1NBIA 3ML1A 5EP4A 2GXUA 4E1BA 3EGOA 1DHTA 1NJ8A 3EVTA 3TLZA 5CEJA 3JQ8A 5KNCD 2FPIB 4EPRA 4CIDA 5IN5A 3U6BA 3HJRA 3I8XA 3PE6A 3KAPA 3A28A 5AW2A 5E6UB 1KKLA 4JUAA 3TZCA 2QN1A 3MNFA 3VM6A 4F71A 3LUFA 2RHTA 1VZ2A 4HBZA 2C4WA 4LYFA 1J1UA 3OIWA 2JFPA 3OT4A 3GJRA 3K9BA 3ICQB 3DE5X 3JSAA 4QBFA 4L16A 1G59A 2CXOA 5C52B 1MX5A 3F5QA 4YREA 5C7YA 3JRXA 2P62A 4QHTA 1FP2A 1P7ZA 2WNHA 3SQMA 4LKOA 3BQ9A 4MUKA 4WESA 3C5EA 4P7FA 1IJKA 1ADFA 3LA6A 2DFNA 3DO8A 4F7WA 2WFLA 1FLVA 2H2DA 4HWKA 2XMSA 3BJMA 1KMNA 1ZWKA 4IV8A 4NBNA 3ZK9A 5DULA 2A9QA 3EY9A 1YULA 1O03A 2WTBA 4MHSA 4TTAA 1NN3A 3EAQA 5JZBA 2Q5IA 4M22A 5IAAA 4OKSA 1VA5A 4HVAA 1CS0B 1O94D 1W5AA 2H2FA 3TAHA 1SCJA 4J0FA 4LISA 1KNQA 3ND6A 4NMXB 3B1WA 3IUYA 3ZJTA 1CVLA 2D1FA 2XXAA 1XVAA 2HHCA 3C3DA 4N82A 4HMQA 2GTIA 3FNGA 2EP8A 1V1MA 4JEUA 1EFKA 2R1ZA 4QO8A 2HL6A 3UAVA 1A5SB 3WKEA 5ICEA 1CQJB 3PTAA 1G1MA 5CM2Z 2OZPA 1QIKA 1ZKDA 5EZ6B 1C8LA 1PGJA 4RPHA 3G8AA 1Z2NX 2P0YA 5F2KA 5GZ1A 2OCPA 4XEHA 5AVQA 3K0KA 3LLCA 4PXYA 2RAPA 3ZLBA 4POOA 1AGYA 2GKGA 1JAYA 3MMSA 3OZAA 4L76A 4NU8X 3SS9X 4WFKA 2HBQA 2Z58A 2BIFA 3GEPA 1OBCA 1XYYA 4QDTA 1HYGA 1CR4A 4D2IA 5D1HA 3T3OA 2ZJ7A 2ZUEA 3JU3A 4M8IA 3LXUX 2F9FA 4A03A 1SXHA 2JZCA 5E4TA 2ZBRA 2OM2A 3A9VA 3JXEA 3A6KA 4MMZB 1YONA 1RFLA 3LQ2A 3RC8A 3DHNA 1WV0A 1T4MA 3JSXA 2GD2A 4U5XA 4GECA 4M1TA 2X1MA 4BLTA 5CBKA 4ZHSA 2ZATA 3QBTA 1DBVO 3UZUA 6REQA 1A88A 2A1UB 3D7KA 4C05A 1KWKA 3MJSA 3ABZA 4MRVA 2ZSDA 1SKYB 2JCYA 4EJSC 5BN4A 3EIOA 5EVCA 1ZOPA 2DPHA 5MF6A 2QRGA 1T8SA 3HJGA 1RLJA 4LTDA 1KAHA 2RDMA 4Y2UA 2ZJAA 3KUUA 5FQOA 4BXOA 3ED5A 3FYUC 3RS0A 1ZNWA 5HZKA 3DLCA 3PEVA 4TL9A 5CH5A 4B79A 2B4QA 2C4NA 1SBQA 3EMVA 4B1FA 1BDBA 2BKUA 3NG1A 4GX1A 5FTLA 2R65A 2XTMA 4KGXA 3CUWA 4DBLE 2AUNA 5HK9A 2CMDA 6YASA 4BRSA 2DPMA 4OX9Y 1T43A 4EY6A 4IUCS 4URXR 1RYZA 5IEBA 1C1DA 2NSDA 1QO0D 2YN0A 3DW1X 3IKLA 3R5KA 1JEJA 5JEDA 3KR2A 1FP6A 4RHCA 3M4JA 4OQYA 3IQFA 1Q14A 3U4GA 3F7NA 3O03A 2QP3A 4FFMA 5DHRA 5C53B 3QQPA 5K6RA 1IVSA 4F4HA 1XRNA 1JJBA 1E5QA 2Z08A 1GPAA 2YS7A 3A3PA 1EFDN 1DJPA 4E33A 1PYOA 4IWYA 2BEVA 1PF7E 5DW3A 4KXWA 4CODB 1ODCA 4JI8B 4LF8B 3W1EA 4QPZA 2D5CA 5F33A 4HADA 1IWBB 2QUKA 1KVTA 2WHPB 4Y1FA 5H3HA 1C8VB 3QEBZ 1D1PA 1UODA 4UM9B 4CLRA 2FPSA 4N39A 1XFDA 3A9WA 4HEQA 3D8SA 3DE3X 1TA4A 1XCPA 4QUBA 2YIVX 1NZDA 2LD4A 2OESA 5HZMA 2SBTA 3CM0A 2NNWB 1T2DA 4BUZA 4Z0TA 3RIMA 2WFZA 2Q3CA 2B5WA 4AW9A 1A3CA 4BLUA 5AUNB 4PO1A 5AM2A 2ICAA 4W6ZA 4C6RA 1DX4A 3PDCA 5JAIA 4V2UA 5LBIA 2IZZA 3HU5A 3NGLA 1IBMB 2C2BA 1II0A 3SFTA 1PK7A 1P2DA 4CW7A 4FWBA 1O5IA 5B58T 4DG9A 4Q9NA 2QD1A 2BBWA 1UXOA 2I2WA 3OZXA 4MV9A 4O4LF 5ECYA 5K3DA 5HOEA 3KQNA 4HDMA 3EXEA 4B35A 4OFWA 3GMIA 4MUMA 4DA7A 3FE2A 2A5DA 3TIGA 4UUMA 1R0CA 3DV0B 1CR1A 1ICIA 1U5CA 1MVOA 2J6CA 3IERA 3M6UA 3N8IA 1IVYA 4RVOA 4RU1A 1X19A 1U8EA 4AUEA 4A8PA 4XQCA 1SWVA 3RPEA 5C5CA 4AZ0B 2JAPA 1I2DA 1GPJA 2AHRA 1OI7A 4IRMA 3QNUA 4NZ9A 4AQYB 1Z6AA 3DVLA 4FYVA 4QUGA 3SZ3A 4Z7QB 1VDMA 3GD7A 1H4QA 2VUIB 1G5IA 5T64A 4F06A 1NU8A 3FR8A 4ENPA 1MA0A 4H4EA 1OOEA 2H8KA 3L8ZA 1Y6FA 1Y1SA 4GQBA 5JIBA 2HPHA 1OFHA 1VGQA 1IQRA 1TIBA 2WKPA 3IUNA 3E2PA 4FYWA 4QU8A 4BBAA 1ECJA 2O2EA 4BLOA 3PXAA 3D8UA 3THYB 4NKRA 4IIUA 5JPIA 2FMKA 3HCRA 5CT9A 1E3LA 2QMEA 2UUPA 3JD1A 3PJGA 1QGUB 5BOSA 1Z26A 2FDXA 4KRFA 3S2IA 1GPBA 4IH1A 4WKBA 3L0PA 1RXSA 4TOIA 1VI2A 4PG4A 3O6VA 4BFVA 1KEZA 3SIXA 4YAIA 5LZ2A 3BF8A 1NDHA 1ZD2P 3OHMA 1NSTA 2FHPA 4MVXA 1TW3A 1MNQA 3UGJA 4INJA 3JR7A 1OI3A 2O50A 4MV3A 1UBSB 4G1VA 3AHDA 7ADHA 5TARA 5THQA 3VR2D 1AURA 2VP0A 1FP4B 1P7VA 3FPBA 3N7TA 4WZBB 3T3NA 2DH5A 4PO3X 1UOOA 1KI9A 1M1UA 2Y68A 2P2GA 3E27A 2R6CA 5JAMA 3OA0A 1RJ9A 2I9PA 2GN2A 4LWPA 3S29A 1XKXA 5JRDS 2EJTA 4X7BA 3RS8A 5G0VA 3SQNA 5LNK6 3NWBA 1DAEA 1E3IA 2JLRA 3BERA 1HC7A 2ILVA 3BMNB 1V25A 5F3DA 1HFWA 2IXTA 5JADA 5JNVA 4DXDA 3B7GA 4MA4A 1W9HA 5HF5A 5TPZD 1R3DA 3PHLA 1NYRA 4CMBA 3EHEA 2XT9A 3L02A 1RXEA 2BZGA 5FWNA 1FEZA 1YVDA 5EZYB 4DR2B 3NDJA 3QOWA 3DC2A 4BFCA 1NUUA 1B15A 4U3JA 3QKTA 1NKSA 3LO5A 3EW9A 3MQ2A 2VRBA 4NBUA 1RBMA 4UW9A 3T9DA 3ZZUA 4AJ2A 2BBOA 2WZCA 5DHUA 1L9XA 3KQQA 3TOZA 5CLGA 5JMWA 1RDFA 2ZULA 3C6MA 2HA7A 4HX5A 4ZI7B 1CJVC 1NUSA 1ONOA 1Z6ZA 2V8OA 3ANYB 3DB1A 4MV8A 4X1YB 1YT5A 1DMSA 4JELA 5A9SA 5HPYB 1LWOA 4WNAB 2QVCA 3ER6A 3JQ6A 2C9CA 3CLUD 3QLVC 3R7BA 1W59A 3W05A 4E3WA 1ZHHA 1MMFB 1CZHA 3WYBA 1U3UA 4YR7A 1KPHA 4JMLA 4DREA 2C9ZA 1X39A 3GX1A 4GX5A 2M1ZA 5HKLA 3TDNA 4A1FA 4W9MC 2HW8A 4AKHA 3SS8A 2QGFA 4BGIA 3J81k 1CSEE 1QKJA 3K1YA 1Q0TA 2DUUA 5KQMA 3JALB 4ZK2A 2HU5A 3GV0A 4R40A 5B3AA 2GFQA 1IEVA 1W75A 4FGWA 4QEZA 5IAJA 3R4VA 3AI3A 4OFXA 3TCXB 3N2EA 1SA0B 4PU0A 2B8JA 4IX9A 3UG7A 1NP3A 3LV8A 1XLTC 3G2JA 2AF4C 4GNRA 3FNQA 3SBXA 5BR8B 2R2AA 2YW2A 3HUDA 1ZBQA 3F6BX 2YR0A 1Y7HA 2KB0A 4IVRA 4FMCF 3AKYA 1QGDA 1DC4A 2QRMA 3MRVA 3O1IC 1QZZA 1XVLA 2B61A 2DP4E 2WJPA 3F3KA 2HCRA 3FIUA 3GXOA 3MERA 1FRNA 3ACDA 4HWSA 2HV9A 4KQEA 4RTNA 1LF0A 2C8VA 5E7QA 5G0SA 3EODA 2E3JA 2P2YA 3IP9A 3K5WA 4AN4A 4CM4A 3HBFA 2QRLA 4F3KA 4MAAA 1EFTA 4KVZA 4DS3A 3D3EA 2DFLA 3I64A 1MAVA 5BYBA 1CFZA 3EXG1 3SU8A 3BKXA 4ML3A 2BFEB 3O74A 1Y6GA 2KSQA 3NFYA 3W2FA 1E96A 2BF4A 2RGCA 4CQNA 1HOXA 1NL3A 3AERA 2I67A 1KETA 4LSWA 3LLMA 4KVAA 3WGLA 4ZDJA 3CU5A 1KQ3A 1U2PA 3QVWA 5EKUA 5KKNB 4LHEA 3T3HA 2C5LA 4RQUA 3ZCUA 1BEZA 1Z4NA 1GCAA 4Q4CA 1X38A 3JQDA 3BMCB 2QN7A 2EC5A 2CNLA 3LZCA 3S44A 3W0LB 1PTKA 4EP1A 1UOQA 3FF1A 5C3MA 4YI5A 2Z9DA 1P75A 2BC9A 4C7OA 1Q1NA 1ZA1A 4X7PA 3K8YA 5EP1A 3IEUA 4UD6A 1KDVA 1JEYA 1E2EA 1HA3A 1EH5A 2MJLA 3KZXA 2RH5A 3GNLA 5FUBA 5K0LA 1BFUA 2ARKA 3OCJA 1UJ6A 4ATNA 4F72A 1QVAA 3RCBA 1HZJA 1NW3A 5BT9A 4EB6B 2CVPA 2HQOA 3SYNA 3GARA 2AG6A 4H6VA 5ELMA 2BGLA 3BWVA 3RGWS 3LP6A 1PNVA 2OORA 4WCFB 3AUAA 2VSYA 3QKWA 5ALXA 3GPDG 4KG7A 1QP7A 2C8JA 3QE3A 4M9XA 3T1OA 4LC1A 2CZCA 2H17A 2HSWA 2JASA 1WKVA 3DDUA 1WEKA 5K0JA 3OC6A 1PKEA 1P74A 4Q1FA 3THWA 3QE2A 4OGWA 1Y3IA 1Q7RA 3CZAA 3ONNA 5LZ8A 3H4MA 4HKTA 5DHFA 1TVKB 1GFZA 4C30A 4LE2A 1I7SB 2C9BA 2P8JA 3DPUA 4FS3A 2NVOA 4EKNB 5JATA 1K9VF 3IMKA 3LHSA 4FX5A 4LMAA 5IT4A 1Y89A 5GGXA 5JZMA 3UJ6A 1XYVA 2H1OA 1QYXA 2W2LA 4Z3DA 3T5CA 3CMCO 2O0MA 4JLWA 4EG4A 4UBMA 4R9VA 1LQUA 4IJWA 2DUWA 1CK4A 3E70C 1ZOOA 3O3MB 1LLFA 2VXCA 4JJ6A 3NRBA 3RJ5A 2X3FA 3KTAB 2ISSD 3FPCA 4NK5A 3EZ7A 2AFRA 1CRQA 4QAQA 3S28A 5AXDA 2VP9A 1WXDA 4V0MA 3M6LA 1KJIA 1QF9A 3AEUB 3KVOA 4FSHA 2AW3A 3STUA 1JPVA 3T5TA 1BN7A 1U9JA 1WCWA 2C8LA 4RYLA 1LI7A 3RTCA 4CKBA 4HQNA 2XNSA 5B5SA 3FDIA 1VPWA 3I2FA 5A4MS 5K20A 3USCS 3DLBA 3IQEA 1SG0A 3M0EA 4IIFA 2FH5B 4PCVA 5TF0A 4B7AA 4F5DA 4ZEMA 1KVRA 3ASYA 1MXFA 4O8ZA 3FJOA 1RLTA 1XCOA 2CW5A 1BQ4A 2FWAA 1F0KA 3CF4A 3OJLA 4MA5A 2XZOA 1IEQA 3HY3A 2G82A 3LYAA 4AFNA 1EUDA 1S3FA 2WR8A 1T8TA 2H2IA 2ZWPA 2X6TA 3H9GA 3NM4A 4TWRA 3L01A 5FP0A 1G6HA 3RI3A 3V6LA 1XCLA 3I8SA 5FWYA 4LS3A 3GB9A 4AG5A 1NRXA 5FWDA 1GL9B 2NXJA 5LD2B 1ZGCA 4FSXA 4FR2A 3L6EA 1U7PA 5BQXA 4QFCA 2DECA 4U9UA 1GTG1 4RNDB 3GNQA 3F4KA 1X14A 3LOPA 4J6FA 4LZOA 3QWHA 2XTJA 2M1XA 5FT9A 3SP1A 1NLUA 2YDXA 4E5VA 3AF2A 2QK4A 3C7CB 1QFYA 2QP4A 3H17A 3RGGA 2IDKA 2IUSA 2NTJA 4X90A 5CU7A 1YL6A 2INGX 4ZOLA 5H68A 3RRZA 3O31A 1E98A 5AJYA 3PNKA 1HORA 1OV4A 1WHTA 3HB7A 4J07A 5EWLB 4C06A 4DEVA 4O1MA 1FXSA 1ULZA 3DCNA 4RPIA 4ZO9A 5IVPA 4M46A 1ZCAA 3IXQA 5C5DA 2IY8A 1ULSA 3HZRA 2ZI3A 5A5VA 3I4CA 3ZVRA 3GJ8A 4IYRA 2W90A 2DQYA 4ZAWA 3WK5A 2Z5GA 4IDGA 5L3QB 2HH9A 2JW5A 4QDZA 2VHZA 2BMDA 1HEYA 2C0CA 2KHZA 2VPWA 4BCCA 3D7RA 1NJFA 1VMAA 1I5RA 3E2IA 3PD7A 4BJ5A 4KITB 5AOBA 1GR0A 3H7AA 2C61A 1IM8A 2RGNA 3WNCA 4DV2B 3N6XA 3T9CA 2PZFA 4EHDA 1GRVA 1OTXA 1TMOA 4MVWA 3IBSA 3KE9A 4CQLA 1EJ6A 3GA0A 3NZEA 3X1XA 4WLOA 3UANA 1NAIA 1QQAA 2GCEA 2O57A 1TMYA 2O0KA 3NI2A 4B7ZA 3RSLA 3P94A 3HP4A 4NV0A 1NQOA 1RJFA 2JI9A 3HA2A 2HRCA 2PKYX 3WE7A 3CIOA 4LPSA 2OHXA 4LOLA 5IABA 3CUUA 2JGJA 2BR3A 2OHOA 4LMPA 4TKVB 3GK3A 4LOHA 2H0AA 4U0JA 5JJKA 4NJMA 2YYYA 2AN4A 2PRIA 4Q19A 1SZCA 3DZ8A 1FOEB 2VC2B 1FY2A 4M87A 1BXZA 2HKIA 4RMNA 5EE1A 1GRCA 3P32A 4DCNA 1HYHA 2F1RA 3SJUA 4U6QA 2VLBA 1OBVA 2PLFA 3HEMA 4U8GA 5KPJA 2LWIA 2P9FA 3B8HA 4I2NA 2QTLA 4N8EA 4ER0A 1FDOA 4HXGA 1U0OC 1AKTA 3QVTA 4UFOA 1Y9EA 1ECLA 2RJ3A 3S8MA 1JH9A 2NUBA 1XF1A 5IFLA 5L3SB 1NUTA 2M6LA 5L9AA 3L4EA 1GXSA 4MWOA 4RQBA 1XZDA 2RHMA 1S8OA 1U8CB 3DOFA 1Z3CA 3SR3A 4IWNA 1N6RA 3ZDEA 5LQKA 4PQFA 3SOZA 3CNHA 2DU8A 1CY6A 4KBFA 1SCBA 3UHAA 5LFAA 1TL7C 1V95A 1TE2A 2X1VA 1CY2A 1MDBA 3IVMA 2GN0A 1AD2A 4ZALA 1EWVA 1Z7EA 3QQ5A 4LSZA 4KRYA 4LQLA 1E0JA 1W35A 4EI8A 1EGQA 3OETA 1VPDA 3L9XA 4L5AA 3FUWA 4OIFA 5LA6B 2WDPA 2GEJA 3PHBE 1KTIA 2VNHA 4FFNA 4QNRA 3A4VA 3QXJA 4JWKA 1WF6A 3GUUA 3A6PC 4JSYA 5U4QA 2H59A 1XMVA 3GLUA 4GWGA 5CA0F 4RF4A 1FRFS 1H0SA 2VPZA 3ZU4A 5DCUA 3RTGA 5JCOA 4YRIA 4WOCA 1XK7A 3MS7A 4RZ3A 3U81A 1VL2A 4H0CA 2R6JA 3EDMA 4ZP1A 4N0DA 3AP1A 3WLLA 3KNZA 3L05A 3OOEA 2CBGA 3HDVA 2YX1A 2GPSA 3KHTA 4YMWA 4Q1CA 2HQSA 3AIMA 3KEQA 4GOLD 4AO8A 2AR0A 1UMDA 1P0PA 2I6GA 3HDHA 4LYHA 1ISRA 4C03A 3LLVA 3MTJA 4W5JA 4XWGA 5D6OA 1QIEA 4OP2A 2ZB7A 2ZKIA 3RU7A 1FMCA 4BQPA 2P30A 2R60A 2KS6A 1GSOA 4ES6A 4E1AA 3AVYA 3GEHA 1WMSA 2PBLA 3JYHA 4F46A 1SVMA 2XF2A 1JYFA 1YHYA 2ZYWX 4I8DA 2XCIA 3GFBA 4RSMA 4TLAA 1NXTA 1NUAA 3FKQA 3NNNA 2OAQ1 4JDUA 3RT9A 5K6TA 5EJMA 2H2AA 2I78A 3WB0A 4IV5A 3HYSA 1WF3A 1XGKA 1MB4A 1PJAA 2ABWA 2JCXA 1ORRA 1W88A 5IJ0A 3DHEA 4S12A 5ALLA 1KSJA 3VPGA 1AMOA 4MQLA 4XYGA 3IE2A 2JJ2A 3CUSA 4ZOLF 3MPUA 1X70A 2ZYUX 3DTVD 3Q1LA 4ZVNA 1TO6A 2G5GX 1YZLA 2FEPA 2B98A 2QGNA 3PI6A 1MJGA 4PX9A 5E6SB 3NWOA 2G6TA 4EGJA 4NBLA 1RRKA 3B6MA 2V58A 3MQFA 1VIYA 4A92A 1E79D 2XRMA 3QHAA 4NDAA 5DCWA 2O8FA 4RTLA 1ESMA 1HTBA 3MT8A 2XIJA 1XWIA 4BGDA 5BQOA 2BHLA 2WW8A 3VPDA 4AROA 3WYDA 4WBSA 2ZIXB 5CFNA 3KQWA 3NUQA 1UH5A 2H4HA 5JQGA 5K8VA 2CXHA 2NZ8A 4GZ3A 4ZOBA 4QG7A 4RDHA 3TM4A 3QNWA 3Q9SA 4AKIA 3TXYA 1MU0A 4BWGA 3ROKA 3PB3A 2WF5A 1HYQA 1WETA 3PPWA 3GEDA 2XCRB 4DR7B 2BHSA 2F90A 3GRAA 2YY7A 3FM9A 4JJ8A 4FEAA 3H4TA 1JHUA 1GA1A 3WIEA 4GOKA 4JQCA 3IKJA 3P9XA 4Y18A 1UBCA 2NP7A 5BMVB 5A3JA 1HSZA 2J3DA 3VVCA 2VYQA 4X3OA 3BXHA 3U56A 2CSUA 2NO4A 4E3ZA 3EPRA 4R2IA 3UG6A 1CQIA 2QPOA 4DKJA 1AC5A 4XOUA 4GO1A 4TV9A 1NBOA 4YK7A 2VJMA 3GRZA 4TKLA 1N9GB 1PL0A 1TM5E 3R44A 3FAZA 4NLLA 3TGWA 1K7CA 2A7XA 2BJVA 4ZJYA 2ZM5A 2X0EA 1I7DA 2HT1A 5ADVA 1Q0RA 2QN3A 2VF7A 1NM5A 4BNXA 4AG6A 1QIGA 4L27A 1R0BA 2AG1A 3RASA 4GH5A 3CJTA 3V9PA 5AKGA 5C1OA 4X44A 8MHTA 1OWMA 1GDDA 3TTXA 2BTOA 1G3RA 3BHMA 4HT3B 1EBUA 5IKMA 4V02A 2GTPA 1W8IA 5JCPA 2XHEA 1EK2A 3DD5A 4ZVMA 3BIJA 4DPKA 2D2VA 4I1OA 4DJTA 3FNHA 3HO6A 3WG9A 4EHLA 1YBFA 3TFOA 4I55F 3SQDA 2E4XA 2VJBA 4MKRA 1V9SA 1M2KA 1T0HB 2DOKA 3R5FA 4AKTA 4BFYA 4LBYA 1FNSA 1MENA 4U2EA 3SYKA 2J3HA 4PZAA 1UQRA 1KGSA 4ZEOA 1H6DA 1EE2A 1XXHB 3K73O 3DNMA 3FZYA 1G6KA 1DXHA 1P2BA 3GLIB 1BDIA 2PGJA 3M70A 1LJUA 2ZGVA 1X2EA 1UADA 2XDWA 1E3WB 2XE4A 3FMFA 2O5RA 2W6CX 3KC2A 2YJNA 4G4JA 4JFAA 1IIRA 4RPGA 1FCJA 2R47A 5JAPA 1NSYA 4L8YA 4OXNA 1C7RA 3BB3A 2YJTD 4GICA 5TPWB 3SS7X 1AUXA 4JQOA 4HTAA 1WBJB 4C88A 1APBA 4TLCA 3NVAA 4ZMBA 2UAGA 1F4PA 3W8DA 1ESEA 4HZIA 5C8YA 2E87A 5IMSA 1E1CA 2E2WA 2IHYA 3G88A 4EUKA 3QG1A 4E2ZA 4P4LA 3B78A 2F43B 1X7HA 2JFXA 1EDBA 2PD6A 4LRQA 5CFRA 4MULA 1SK9A 4H4CA 3QUAA 4H0FA 3TCKA 2V7XA 3HN6A 4EJSA 2C7VA 5HCNA 5KWSA 3NUZA 4E12A 4PC7A 3BFJA 2B4TO 2OGUA 1EDEA 3ELUA 3FYUA 2B7BA 1GKIA 3MG9A 4L9SA 4V0LA 3ZGVA 2HPAA 4E88A 3LBFA 4WWHA 3K5IA 4XIYA