4MH0R

Selective activation of epac1 and epac2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
162
structure length
150
Chain Sequence
EYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLAFLESSAKSKINVNEIFYDLVRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rap guanine nucleotide exchange factor 4
publication title Selective activation of Epac1 and Epac2
rcsb
source organism Mus musculus
molecule tags Signaling protein/gtp-binding protein
total genus 39
structure length 150
sequence length 162
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4mh0R00
3QXSA 4IEEA 2BC9A 4DVGA 4TMXA 3HU1A 2VP2A 2FH5B 3RWMB 5K8IA 3AM1A 2IYWA 2ZRNA 3I73A 4QFMA 4V0KA 1HURA 1EX7A 2KE5A 2ZJZA 4QL3A 2CVHA 2CHQA 1FUKA 3OAAD 2J9RA 4TL7A 1UDXA 3PITA 1XZQA 4DCVA 3LBHA 5IT5A 3PCRB 4JVMA 2G0TA 1FZQA 4OK5A 4AC9A 3U5ZB 4XH9B 1R8QA 1D6JA 1YR6A 2P5SA 2CCGA 3FKQA 4CEJA 1HT1E 3EA5A 2BCJQ 1DS6A 1ONBA 1DADA 4QJ5A 2YZ2A 4BGDA 4DLRA 4QJ3A 1VYTA 1ZC4A 1EESA 5G53C 1KDRA 3ECCA 2W83A 3ZS9A 2AFIE 1ZM3A 3P4YA 4JL5A 3B6EA 2ZRBA 4C0HA 3TLXA 4EQ6B 3VQTA 4ZCMA 5FPTA 1KI8A 1P2SA 4E07A 2WVJA 4RJLA 1AKEA 4OKSA 1W4RA 4Q7LA 3R7WA 1WE2A 4LJ8A 1JQJC 3QUSA 2NO7A 3BH0A 2QGZA 3BK7A 4I1VA 4URZR 1KI1A 4NYMR 4CEHA 2CJWB 2MMCA 1CXZA 3JVVA 5LD2B 4HAXA 3HU2A 1XZPA 2OHFA 2V1UA 1CS4C 1OH5A 4GMXA 3FKSA 2AN9A 2QP3A 2B92A 4Q1FA 3KKOA 4TTPA 3AVVA 3CPHA 2QNRA 2L0XA 1XXHB 2G83A 1HY3A 1NN1A 5CLLA 2IYXA 4NE2A 3BFVA 4TMZA 3Q85A 4Q1BA 2C9OA 4A0GA 2BDTA 3L2OB 1ZIOA 2GJ9A 1S2MA 2P6UA 1QG2A 2BEJA 1OXTA 1EFUA 3BJIC 4IDNA 4ZI3A 1G41A 1ZVQA 4XVQA 1KYIA 2IYTA 1AA9A 4HB3A 5G3ZA 5FL3A 3L0SA 1KKLA 3BB3A 4R7ZA 1P61B 2GCOB 3EZFA 1NSFA 4JKIA 1KZ7B 2A5JA 3QKRB 5JWOA 1NVWQ 1Q20A 2GDJA 2GF0A 1E2JA 4X8LA 4POAA 2ZJ2A 4NMMA 3LDAA 5FTJA 2Y8EA 3GFTA 2WJHA 1FTNA 4FD2A 3NEJA 4IKEA 3VR6A 2WZQA 4LZZA 2V6JA 2Q6TA 3D3QA 3W5IA 3ZVRA 4EPRA 4HAZA 5DH9A 5CIWA 4OQLA 1NG1A 4PXAA 2YVUA 3OEED 5AR1A 1BMFA 4PZYA 3W9YA 5CJPA 1UBCA 1TX4B 1WRBA 5LB2A 2X2EA 3AV0B 4A36A 1MO5A 4AKGA 2PJRA 1ZD9A 2QRNA 2Z43A 3L8YA 1IJEA 4R9UC 4OI4A 1XTJA 1F2TA 2VSOA 4P31A 1OSNA 3QNUA 4Q00A 2ATVA 2PZFA 3EIEA 1OIXA 3KL4A 3WBKA 1D2EA 5L3SB 3THWB 1CF4A 3WYGA 4BQSA 2O0HA 4F91B 4OI2A 5E7IA 1IONA 2O8BA 4DLZA 1LF5A 4JLVA 1KAGA 4ZKEA 1GNPA 4QM6A 2WHXA 5SZJA 1JPNA 4G5RA 2B8WA 2ATXA 1IAQA 4LGMA 3Q72A 2IK8A 2XZPA 4NCJA 3NVAA 4I81A 4DCUA 4G3XA 4BFTA 3IDQA 3RDPA 4CW7A 1Q3HA 2CL0X 2WSSA 4Z8YA 2ZRPA 5FOUA 4BRWA 2C9YA 4EAQA 2AL7A 1LV7A 1QHNA 2HV8A 2XX3A 4DWJA 3HPQA 5B2ZA 3K0SA 3ND9A 2QE7D 3ZLJA 2RAPA 1LW7A 3OE7A 3VKGA 3C41J 1TF5A 4HDCA 4QGHA 4PQRA 3NC0C 1XWIA 1KI6B 5FR1A 2GZAA 4MYTA 3QJYA 2WAYA 4MRPA 4TYWA 3SBDA 5IK2A 1X8JA 1ELOA 4AD8A 2UZIR 2UKDA 5JLJA 1HV8A 4Q7KA 2QU8A 4Q9LA 1DEKA 1OPXA 1Z6XA 4YONB 1IY0A 2R62A 5CM8B 3T1OA 1MABB 1N6LA 4CYMA 1P75A 1Z3IX 2FEOA 1AJEA 5J4KA 1EXMA 3B1ZA 2FFHA 1U0LA 1I2DA 1E79D 5EZ6B 4EPWA 4TLAA 1MRNA 3B9PA 2WPDA 4UXHA 1N6PA 4MKGA 4BZXA 2R6CA 2IS1A 2KWIA 5GJWC 1Q1BA 1IN7A 2GK7A 5FPHA 1ANKA 3SNHA 2A30A 3GLGE 1KJWA 5EP2A 1US8B 2EVWX 2J7KA 3SI7A 2YOHA 1ZP6A 4ILEA 1G8GA 3PVSA 5FTNA 1WXQA 2ZR0A 3LFUA 3W5JA 1UJ2A 3F0TA 4Q9IA 1GNRA 3IIKA 3UWOA 1XJQA 3CPEA 2O8DA 2HCJB 2J5XA 2K5UA 4JZKA 2Z83A 2GJSA 3I5YA 3W3AA 1RRPA 4L5BA 4NCKA 1W0JD 4BFUA 5K8UA 1K6MA 4DKXA 1YRBA 2ZRLA 1R8SA 4D0GA 3EPHA 4NPHA 4QGAA 1FQKA 5TY0A 2V7QA 4IXNA 1FFHA 3CW2A 1P9NA 5BN4A 1NF3A 5CJ2A 3VFDA 2IS6A 1DAFA 2GVZC 1XX6A 2FSFA 4IVRA 1HT2E 1DVRA 3QEJA 2ZAMA 5CIQA 1Z0FA 2JATA 4HAWA 1T4GA 4B34A 2DHRA 1F2UA 1E2NA 3K0AA 3ZGXA 1WBDA 2Z6VA 4UQOA 1AIPA 2FGKA 3L82B 4BFXA 4DUGA 1WB9A 2WJIA 3BAFA 3U44A 4YMSA 2CL6X 4P32A 4RZ2A 2FPKA 2P6RA 5JJKA 2C77A 1LB1B 5AJZA 1U98A 1TF7A 3CRQA 2BCGY 1UFQA 2QMHA 4Q18A 2DFTA 3T12A 3HJNA 1WDTA 4D4JA 1JR6A 4YDSA 1KDPA 2CVFA 2FEMA 5HKKD 1XD8A 1OHHD 4N0DA 4RSGA 5AJYA 3CLVA 3IPXA 4Z1MD 4F92B 2E1RA 2CCKA 1XTRA 4HLQB 3R7WB 1OKKD 3UATA 1N6RA 2P3SA 5JI2E 1W4CA 4I99A 4P3YA 2CK3A 4DB2A 2ORVA 4B3DA 4FINA 2V1XA 2VTKA 4A92A 4PTLA 3W6PA 1Z6TA 1VECA 4GOKA 1TQ4A 1KI3A 3M6AA 4ZKDA 3R8FA 1KSHA 1AS3A 4Q9JA 4Q4LA 3KB2A 1ZUHA 3HR8A 1G64A 4KV9A 4NYMQ 2A2ZA 4MKIA 1W47A 2ZS7A 3OF5A 2VSFA 3RS3A 5A0FA 1IM2A 2P6NA 3GJ5A 3B82A 3JZMA 2WKRA 2CEAA 1ZINA 2QTFA 4RD2A 3OEHD 4TTRA 5H70A 1F60A 5BW8A 3TR5A 4E5UA 1FOEB 2JLYA 1NNEA 2OBNA 4CEIB 4A6PA 4PZLA 1R5NA 4DLUA 2WAXA 3EWAA 4G0NA 4RCZA 3TAHA 2VP6A 5JWRA 3BGWA 5DI9A 2DYKA 3SZRA 4K8OA 3RS5A 2ZE8A 3MJRA 4C2TA 4QG7A 4PANA 4GNKA 2PMDA 3K8YA 3VAAA 2O8EA 1R10A 2ZI6A 4IDHA 1VPLA 4M1KA 1DE0A 3WRYC 3KKPA 3U61B 2N1BA 4BRUA 2FF7A 4P0TA 4QJ4A 4XWAA 1SGWA 4JLOA 3I62A 4LUCA 821PA 1S4QA 3FMOB 3TK1A 2XXAA 3H1TA 1L8QA 2ZRHA 2DWOA 4XOIA 2C98A 2DB3A 5FR2A 1XDBA 3FFBA 3UG6A 4UNRA 3BB1A 4B2PA 3H2YA 3LQQA 1AKYA 3RRYA 2RMKA 2FG5A 2OLJA 3QPWA 4OHWA 4QXAA 4QBIA 1YE8A 2WBLC 4TL6A 1XD2A 3AF4A 5FL7A 3V4FA 3ZD7A 2WJGA 2EFEB 2ECKA 3D6TB 4PC1A 2WM9B 1W7AA 3ZD6A 3CPJB 4LHWA 4O25A 3FMIA 3KQHA 4TYQA 4HB4A 2GXQA 3QKSB 3RHFA 2BM1A 1X8LA 1IN5A 2WWIA 1P73A 2BMDA 3PV0A 4QHYA 4A1FA 4S35A 1FMLA 4KLNA 3SFVA 3NH9A 4B73A 1FL9A 5FUYA 3DPUA 3RVBA 1XTQA 2A5DA 3VMFA 4A8JB 2FZ4A 2ZE7A 1T3SA 1QHXA 1NLYA 3ADDA 3WP0A 2HF9A 2O5VA 1AN0A 3PUYA 2QG6A 4TMKA 5JJLA 3QEOA 2A9KA 4DLXA 1AZTA 3EW9A 1TQDA 2ZSAA 1PJRA 3CX8A 5TDHA 3BERA 4A2WA 4B43A 3CNLA 1DAGA 4JLDA 2QENA 5CYPA 1C1YA 1O87A 4OYHA 3U4QB 2F7SA 4JBYA 1NKTA 2VP4A 1VCMA 4FMDF 4IRUB 4CT5A 1ZU4A 4Q4HB 1YZLA 4US0R 5IHPA 3GLGB 2OCYC 2RH5A 1A1VA 1II0A 3DVLA 3K0CC 4GL2A 3SJAA 3CH4B 5D3MB 1N6IA 3E70C 3BD9A 4KAXA 2C9CA 5EE9A 2CBZA 2F1RA 3OFND 2ERYA 1EFRD 4M4SA 5LB4A 5F9HA 4PAMA 1JR3D 3NWJA 4KODA 4GMDA 4ZCLA 1RE0A 1CJUC 3QOFA 1IN4A 1E9CA 3NHBA 4Q19A 5BYJA 2IWHA 1XEWX 3RRMA 1XMVA 5UKDA 5KO2A 3AP2A 3TUJC 1XCMA 3DKPA 3BB4A 4NCIA 3I8XA 4M21A 1JQLB 3UANA 2EYQA 4TYYA 1U99A 1H8EA 3EC2A 4X8MA 5EP1A 2B8TA 121PA 2A5YB 1KNQA 1GL6A 2BMJA 5KDOA 2H8KA 3N5CA 1ESMA 1A5TA 3C5HA 4Y0AA 2IF2A 3Q7PA 3NEYA 3QE0A 4V0MA 5KNCA 1JBKA 4TN1A 1VTKA 1FQJA 3HYRA 2D7CA 1WF3A 5L3RA 5J47A 5A4JA 3OZXA 2XZLA 3B5JA 3TIFA 1Z0DA 1DG3A 1Z28A 3Q3JB 4KVAA 2ZXUA 2H92A 4PC7A 2C03A 1GG2A 2OAQ1 3P20A 5LDDC 2F1HA 5DN6D 4BLOA 2DFNA 4V03A 2QA5A 4FMCF 4DT1B 4V0ME 1X3SA 2AK2A 2IUTA 2Z5FA 4DLYA 1VHTA 3IBYA 4DSTA 1YR7A 3KJHA 1KSFX 2IYLD 3W8RA 2JIZD 4P4TA 1F2UB 4QNMA 1HQCA 1W36C 4FCWA 4BZQA 2VLIA 3K0AB 2F55A 5JZVA 1YZKA 3IEUA 2O52A 5H8WA 2Q3MA 4JS0A 1GIAA 2XNSA 3U44B 1UBFA 1J70A 1Z2AA 1ZMXA 4A4DA 1K8RA 3N2IA 3ZVMA 4DIDA 1YRAA 1U8ZA 1VIAA 5JHGB 3DZDA 1DO0A 1R5OA 4UXJA 1AQUA 1L7VC 2GZDA 2ZU0C 4KXFB 4MH0R 2PCLA 4DLWA 1ZNYA 4BFYA 1UDWA 1KMHB 3WY9A 1E2QA 3LBNA 4FI3C 4DB4A 2XZOA 1N5KA 4A0FA 1DAIA 4G01B 4FMDB 4TLBA 5FPKA 5JEEA 3QIAA 3PENA 3DMNA 2VHQA 2FU5C 3E2IA 1LF0A 3PUWA 3PUXA 3EXAA 4HUTA 5C18A 3QG1A 2CNWA 1QF9A 1TF2A 2AD1A 2FN4A 1NSTA 1S0UA 4HDOB 2WWXA 1KZGB 4GPTA 4IFBA 3FDIA 3OEEA 3AGQA 1YZTA 4PPNA 4TQAA 1L4YA 4BLPA 4D0NA 4IDQA 2QT1A 3EX7C 1W4BA 3O47A 3U3KA 2EQBA 1ZCBA 2RCNA 2ORWA 2YNMA 1Z6GA 1Q0UA 4IOKA 2C78A 3RC8A 3U6KA 3GFOA 4JKYA 2WSMA 2GA8A 1QHSA 2QN6A 4KJZA 4TZ0A 2IW3A 2ZI9A 4ARZA 1W4AA 3K70C 1XMIA 2EWVA 1R0YA 3GJ3A 1ZM2A 3CNOA 1J2JA 2HJVA 2XNDD 3EZ2A 3EZ9A 3KKMA 4QHTA 5F3WB 2FMXA 2VF8A 1TUIA 1B23P 3DL0A 4P4SB 2BBWA 2ZJAA 1S8FA 3TBKA 2GNOA 4US2R 3AVQA 3GP8A 1CRQA 5KUTA 2ZI4A 4UKDA 5KDLA 1CBUA 1KMQA 2W0MA 4F4IA 2FJUA 5HE8A 2YC4C 1PLKA 1PLLA 3A1VA 3G82C 4KVGA 3FMPB 3KTAA 4CZ2A 1KY2A 4OHVA 2A78A 3RRZA 1P9WA 4FMCB 1Q1QA 1N0WA 3QG5A 1S1CA 3V4RA 2H18A 4JVNA 5L3QB 3R9XA 2ZPTX 1H65A 1IN8A 4LRWA 1R7RA 4AG5A 3B1XA 1W46A 2O0KA 2WIAA 5FBRB 3C15C 1OFHA 4C3ZA 3SE0A 1K5GA 4AKHA 2LKCA 4E03A 1FNMA 4AKEA 4TYPA 4QBFA 5EXSA 4EDHA 1GFIA 1KI4A 2ZANA 3P27A 2GEVA 4L15A 5G3YA 2QROA 4URUR 3TQFA 4EJSA 2QBYB 4OK3A 2ZYWX 2C95A 2HT1A 3VNVA 1E79A 1TAGA 1CP2A 5B57C 3E1SA 2XB2A 4B3BA 1E3MA 1EX6A 4ERNA 2MMGA 4P33A 2V54A 1ZM7A 5FH9A 2MSDB 1A82A 4IOJA 2HLDA 2JJ1D 2ODNA 2ZRGA 1GITA 2ZS9A 1ESNA 3E5HA 4HZUA 2YOFA 2W2XA 3CF0A 2CHGA 4M2LA 1TQ6A 3SR0A 1FPMA 5GJCA 1LTQA 4PO9A 2IL1A 2NPIA 3EIQA 4B3FX 1W0KA 1GILA 2JA1A 2KSQA 4V0OA 4FN5A 1F6BA 3AF0A 2FX3A 1Q21A 2PX0A 3U6BA 1CR4A 1XMSA 1M7GA 1KO1A 4HSEA 3CKLA 4URVR 2GXAA 2GJAA 2IYUA 4BLSA 1SXJC 4LHZA 1VMAA 3FPAA 4CDGA 1E98A 5KU1A 4DDTA 2G1KA 2QPTA 2XOKA 4AWXA 1VG8A 1Z0AA 1LNZA 3B60A 1KNXA 2XEXA 3P4XA 1S1MA 2ZRFA 3R9IA 2CMKA 2J0UB 1X1RA 4I1UA 1OT3A 2GRJA 3LXXA 2Q9CA 4U5XA 1Y3AA 3LW7A 2VRWA 1EFCA 3X1XA 3T35A 3AVWA 2NO1A 1J8YF 4PPFA 2F9LA 2I3BA 3GJ8A 3D7MA 3ZIAD 1TTTA 1G8PA 3VR4A 5GADl 2JLXA 1Z47A 3LVQE 3SYLA 2ZE5A 2CE2X 1UEIA 2CLDX 2W6JA 2X19A 4F93B 4XD7A 5FOSA 4DDUA 1D9XA 5JS8A 3AH8A 2O8FB 5E95A 1JECA 3OESA 3I92A 1VYUA 1X1SA 1E2FA 5CYOA 2IHBA 2YHSA 4IJMA 4ITRC 4V02A 2R2AA 3IIJA 4MDFA 1CR2A 1GL7A 1Z0JA 1NN5A 3W90A 4JIMA 1OHHA 1ZM4A 4FMBB 3RAPR 3RYTC 3FOZA 1S3GA 2CLSA 2F1JA 2FFAA 4PSKA 3U2QA 2ZJOA 2D74A 3BH7A 3I3SR 2HUPA 4YDHB 4G1UC 4A2PA 2VH5R 1EWRA 1P2UA 1LFDB 4JT2A 4RFSB 3KDSE 2PEYA 4MKFA 5EXPA 3WNBA 5IDVA 1G5PA 2D62A 4TWZA 4N3NA 2H7VA 5CITA 421PA 1T6NA 4MGIR 2IA5A 2J7PD 4KCGA 1Y63A 1RJ9B 4B33A 5JEDA 5KDDA 1CRPA 2QTHA 1G3QA 2IS4A 5TB5A 2FPMA 1XP8A 5FUWA 1CTQA 4TLDA 3MUFA 1QVAA 1N25A 1MV5A 2HEIA 2W58A 2H1LA 3K0CA 2E87A 4GOXA 4II7A 4JBWA 3UXMA 5E3HA 4E22A 3KQNA 4NTZA 3UK6A 3SBEA 3GFPA 3GD7A 5DE3A 1W44A 621PA 2IT1A 3CZQA 5B30A 4D80A 4DDWA 3VU9B 2HT6A 1HYQA 5TARA 3OEHA 3GLFA 3IO3A 4IHQA 4HATA 1YZNA 4YMTA 3EA0A 1E0KA 2W0SA 2ZVPX 4WXPA 2AK3A 3AKEA 3GMTA 4EFNA 1CJMA 3P1JA 1TU4A 3DMDA 3LWNA 3Q5EA 1XPRA 4ASUD 2BHRA 4K81B 2IXGA 2P65A 5HZKA 1G8YA 1WP9A 3QI2A 3TNFA 1DO2A 2V9PA 4RD4A 4QHSA 4ZPXA 2ZVQX 5JRZA 3GJ6A 5B64A 3GLHB 4MDEA 3WRXC 2CCJA 1RW4A 2OCBA 3B1VA 1E2IA 3BFXA 3W8NA 1XPOA 4GZMA 3GLFE 1E0SA 1E69A 4C0JA 5FBVB 2IBMA 3KQUA 5B58C 4QRHA 1GKUB 2IXFA 3ZH9B 1E9DA 5SZIA 2ZREA 2DBYA 2GK6A 1Q22A 4C7OA 4B2IA 4M1OA 1XTSA 1XBTA 2I4IA 4Z54A 2W6IA 2J59A 1GWNA 1U9IA 4UNQA 1KDOA 4C0BA 5J40A 2ZYTX 4B6EA 4ARZB 1BOFA 3B2EA 4LYJA 1DARA 4LYHA 2AWOA 4TT3A 1P2VA 5EE1A 2RGNA 5EJEA 4TLEA 1VCNA 2ZR9A 1E1QA 1JJVA 2BOVA 2BKUA 1CJVC 6Q21A 1ZC3A 3ETLA 3MFYA 4HLUA 1G6OA 3QENA 1QHYA 1OXSC 2OAP1 4PSVA 4Q47A 2JDIA 3FHOA 4LV8B 3SS8A 2BVNA 1YQTA 4PAQA 3KJEA 3THYA 3CRVA 1T91A 4H9GA 4HI0E 3U3OA 4F4CA 4JJZA 4I4LA 1KO4A 2ONKA 1YHNA 4JVLA 5JMTA 1E2PA 1UKYA 2ZUCA 3QXCA 5KPJA 2OFOA 1UKEA 4DRZA 1OJLA 2GAAA 3BWDD 1JEEA 4KFRA 2GTPA 3REFA 5FTLA 4LV5B 3W6OA 3AVPA 1M2OB 1TEVA 4YQFA 5EE5B 1FP7A 3OIVA 4WZ6A 4AKIA 4B75A 1RPZA 3K9GA 4TQUS 3K53A 2AFHE 3WMEA 2OFWA 3CX6A 2QSZA 3KX2A 4QKQA 5GJBA 1Z08A 4AI6A 3PUZA 1SVOA 3X1YA 3AF3A 5TVKA 4FW9A 2H5EA 3VKHA 1NVUQ 3KKQA 3KXKA 4NH0A 3K0EA 1V43A 2VBCA 3MSXA 1F48A 2G1JA 1Q1EA 1EFRA 2VHUA 3RSLA 1G3RA 3WP1B 2VHJA 4KSCA 3ADBA 1HH4A 2P2LA 3PEYA 3TSWA 4YMVA 4M1YA 1QHHA 1G8HA 4ZIRA 2EFDB 3ADCA 5DYIA 3QKTA 3GJXC 1NLZA 4L9SA 4TSFD 3HR7A 2Q9BA 3CF2A 1DAEA 3FB4A 2OV2A 5FUVA 2V8OA 3F5FA 4JBXA 4CEJB 2BKEA 1SKQA 5GVSA 4E09A 2OBLA 3AVUA 1N6NA 1YU9A 1U94A 1FP6A 2GKSA 3ICEA 2NO9A 4WIAA 1NBMA 3UMSA 4Q01A 1IXRC 3I72A 3L0OA 5C4MA 5C2JB 3NKVA 4HAYA 3KJGA 2WJVA 5FOXA 1XF9A 2ODEA 1G3IA 3FKSD 4Q1AA 4EPXA 1OB2A 4B76A 4H1VA 3WNCA 1QRAA 4GZLA 4JLKA 2J41A 2MSEB 2VEDA 3U3JA 2YV5A 3KXIA 1U0JA 2RGGA 2QTVB 3AVOA 3DO6A 2ANCA 3KUCA 3TW4A 4D82A 1RVDA 1HEIA 1LVGA 1XRJA 3V00A 1IBRA 4OK6A 1X86B 1R0XA 1NBME 4C0KA 4CEHB 4DDVA 5JHHB 3KKNA 1E2LA 3ZVLA 2DPXA 2ZM5A 2BBOA 4TYNA 2NZ8A 3BIFA 2J0SA 4B3GA 4MUAA 4EJSC 2VP0A 3H0KA 3KFXA 2ANBA 4TMTA 4XIGS 5F2EA 4QM7A 1SZPA 3LNCA 4RD1A 3TE6A 2J3EA 3V9PA 4DHEA 3TSOA 1Z8FA 5EE3A 3THXA 3RLFA 1ZNWA 5SZKB 4AK9A 4BASA 1AGRA 4JLNA 1U8YA 5ELXA 3RABA 2OLKA 3PEVA 4PO8A 2ZJ5A 2IXEA 4OJQA 3MWKA 1KDTA 3QVVA 4NONA 1JEDA 4YMWA 1P72A 1E32A 1OXVA 3PEUA 1GDDA 5AK0A 1FTSA 3VX3A 4L16A 4DXAA 3A1TA 3NC1C 4Q7MB 1HE8B 2D3WA 2ZAOA 4IW3B 3K1JA 2YKGA 4O2LA 3TVDA 3K0FA 5HE9A 1BMFD 2G6BA 2ZUDA 3OIWA 1RIFA 4D81A 1T0JB 3IGFA 1KI2A 4N1AA 1COWA 2FWRA 2PLRA 4CVNA 1N5IA 3VNUA 3FFAA 2IYZA 2RGDA 2VF7A 1OV4A 5TXGA 1OF1A 3M1IA 5FOVA 5GJVC 2F3TA 1BKDR 3S1AA 1U90A 5JECA 4U00A 1SXJA 2XITA 5J4LA 3SHWA 3TMKA 4B71A 4D4LA 3GJ0A 4W7SA 3FTQA 3LLMA 3SYNA 1E1RA 3I4LA 1SULA 2VO1A 4JYBA 2LKDA 3U3RA 5EQTA 1F2TB 4D6PA 1W2HA 1BYIA 1MH1A 2GCNA 2ZIAA 2QRZA 3L8ZA 2DCUA 2XSZA 3GLFB 2Z4SA 1HE1C 1IY1A 3WYFA 3FGNA 2X8AA 1OH8A 1SXJE 2O8BB 1VG1A 2FOLA 1NI3A 4ABYA 3SFZA 4Q7JB 4C4PA 2BBTA 2NG1A 1W48A 3QF4A 4XSGA 1OH6A 2QAGC 5BYKA 3A37A 4LHVA 1R2QA 3LY5A 3KQKA 2QMUA 4D26A 4YXWA 3QQ5A 4N0EA 1TNDA 4QBHA 1NRJB 3BXZA 3DM9B 3B9QA 1W2GA 2KBEA 1E2KA 2BJWA 3X1WA 4AG6A 4JLPA 2GF9A 5IK2D 5F98A 1NL3A 4AURA 1XNJA 4HZIA 4JJKA 2YC2C 4C7OB 2R44A 1H8HA 2JEOA 3A4MA 1CJTC 3GEIA 4LV6A 1ZBDA 1R0ZA 1T5LA 3ADKA 4ACAA 3L43A 5LPNA 5JI3E 4IXMA 1U81A 3RS4A 1BIFA 3WXMA 3QY0A 2O8CA 1XMJA 1I2MA 2WPDD 5CK5A 2OE2A 4BZPA 1N5JA 2D06A 3UG7A 521PA 3QKUA 4Q1CA 2JJ2A 3A4LA 2NIPA 5CLQA 1G4UR 2PMKA 2QL6A 2WIBA 4W5WA 2G0NA 3ZS8A 4ESHA 4C0QC 1W36B 3DKVA 1D2NA 4MA4A 1JJ7A 2PJZA 1VG9B 1IXZA 2YJTD 3PXGA 3LLUA 3IILA 3F8TA 4M1SA 3PQCA 4W5JA 3CRMA 4JLAA 4Z8XA 2OT3B 2R6GA 3CH5A 1NJFA 2R6AA 5IF9A 1KIMA 4F38A 5J5CA 3THYB 3OAAA 5K8LA 4DCSA 1Z6AA 4KU4A 3Q5DA 1U8AA 3PJRA 3MG9A 4CIDA 1JAIA 3B13B 4LX0A 3CONA 4IDOA 3MJHA 1R6BX 1FUUA 3H4MA 3NDPA 3PFIA 4LC0A 2KBFA 4DCTA 3GLIA 1J7KA 5D3QA 4DSOA 2V7QD 3K09C 4RCYA 2O8DB 4OL0A 2OO7A 2ZTSA 4RZXA 4DEYA 1XTKA 3B78A 4J0QA 2GETA 4IVPA 1E9BA 3GQBA 4OHXA 3PG5A 4HB2A 1M1YE 5KTYA 2N46A 2Q3FA 2CJWA 3WNDA 4LHXA 3L0PA 2WTUA 4ZO4A 3HP1A 4M8NE 1GUAA 1VIYA 4MYCA 3CUEF 5EUMA 1KOFA 4LJ9A 3A58B 1GRRA 3LQRA 2OXCA 3K70D 1EG7A 3GLIE 2MSCB 3LVRE 1NIPA 1XXHA 3QXHA 1U9IC 4OHYA 5FPSA 3RSOA 2GCPA 4M9XA 1OXUA 3AB3A 1QHHB 4F7WA 4ZIRB 4ZDWA 4ZI2A 1P4SA 1OFUX 5FI0B 3FYHA 1JAHA 2HYDA 3TVTA 1ZAKA 2OM2A 3UPUA 3OIYA 1A2BA 2RGNC 1VYVA 5L3VA 3K70B 1OFTA 3EARA 2P67A 2J87A 4RY2A 4EFMA 2FSIA 4HLUC 4NU0A 4UJ3A 2JLWA 4D4KA 3QKRA 2CK3D 3MD0A 2QP4A 4GFDA 1KSGA 1P60A 3ZZTA 3NBZC 3M0EA 2F43A 2AKYA 4I1SA 5JWHA 1JNYA 1G1MA 4B3CA 2PEZA 1P3JA 2QORA 3O8DA 4LPKA 4ZDIA 2PT7A 2YWHA 1ZRHA 1Z07A 4TL9A 1II8A 1CIPA 1ZUIA 3B85A 1MO3A 2GJ8A 4IFEA 1NVVR 1OE0A 3SU8A 4DEXA 3IEVA 1FX0A 4Z51A 1CULC 3IHLA 4OQFA 5CB8A 1ZD1A 1SHKA 4Q03A 2WMOB 4Q9HA 1SVLA 2AXNA 1WBBA 4WXRA 1B0UA 4BFVA 2WWWA 3X2SA 4EIWA 1M7HA 2EW1A 2ZSDA 3QXXA 4PHGA 4BFWA 5L3SA 3THWA 3TQCA 4D2IA 2ZETA 4M1TA 4Q21A 1Q1ZA 2OBMA 1M8PA 1G5TA 3WHKA 3SHFA 5E7JA 2WWFA 4MUBA 4UXIA 2EFCB 2F1IA 1OYWA 4LCBA 1UBGA 4UNNA 4JSYA 1QHGA 3KZ1E 3C16C 2REOA 2CE7A 4TL8A 3O8CA 4RZ3A 4OBEA 1TADA 3A36A 1G7CA 3F3YA 4WAUA 4OI1A 1S3SA 2ZSBA 3B1WA 4JVSB 2PCJA 3MWYW 3ZYCA 3K0FB 4JL8A 1CEEA 3MWJA 3IKJA 4I1OA 4NBSA 3QBVA 2ZITA 1R4AA 4B35A 1OB5A 3I8SA 1DAHA 4LJ6A 1OIWA 2KI5A 3LX8A 3TGPA 4WBSA 3JZAA 2O8EB 4LY6A 1DAMA 2RB4A 3RS0A 4XWOA 1HUQA 2AXPA 1WA5A 3DEFA 5DI3A 2BV3A 2QT0A 2VP9A 1X8KA 2J45A 3S1AB 4ZDJA 5FL7D 1S9HA 4EKDA 1G8FA 1SXJB 3ZQJA 4Q4AA 3VTKA 4DLVA 4AIIA 4CRWB 2HDNB 3T1TA 2XXAB 3T61A 2DWPA 1MT0A 3DDCA 2QE7A 2OCPA 2BMFA 3UIEA 1AGPA 1TUEA 1Z2CA 1DTSA 1GRNA 2ZRCA 4V0LA 3CR7A 1Z29A 2AKAB 4JSTA 2SHKA 1QHIA 3CO5A 2BBSA 1XD2B 1G7SA 2W00A 4BFSA 1N2CE 1VDZA 3CWZA 4MRVA 4TTQA 2YWGA 4JL6A 2ZR7A 4OQMA 5KSZA 2ZRKA 2VA8A 1ZW6A 1KK3A 1MOZA 4M1MA 3SJZA 5G41A 4O2RA 4LBZA 2FNAA 4O3MA 4MRNA 1US8A 4NCNA 3AKDA 3WHLA 2J0QA 3LXRA 4RD0A 3LO5A 3HU3A 4KFSA 1P5ZB 1KHTA 1OW3B 1NMYA 2B21A 2DR3A 2GAOA 4R2IA 3IPYA 1SQ5A 4JLBA 1DG1G 1Q3TA 2C8VA 4A15A 1E2EA 3U3MA 2QUZA 4MYUA 1AS0A 3SOPA 1JB1A 1Z0IA 1N5LA 4IDPA 4Q02A 5HCNA 4KHZA 3DHWC 1E2DA 4WA7A 2R65A 2F9MA 1SVKA 1MKYA 4KO8A 3LH5A 4NKRA 3G0HA 3AVYA 1Z5ZA 3AKYA 2C96A 2O8CB 4NZYA 2ZI5A 1U2RA 1UBEA 4HLCA 4WOPA 1GOTA 5KPDA 2VQSA 2OSBA 5FFMA 1L4UA 1J99A 4G5GA 5CK4A 4KYUA 2YYZA 2IHYA 1DBSA 2G9NA 1W0JA 5BN3A 2JLRA 2NZJA 1YKSA 2FFQA 5DSZA 1Z06A 2GHIA 2RGBA 2ZI3A 3AUXA 3T5DA 1PZNA 1TU3A 1VHLA 1H8ED 2PL3A 1C4OA 2LWIA 1NMZA 3LA6A 1SVSA 5SZHB 3RWOA 1A2KC 2C04A 3CF6R 2ZS8A 2VHCA 1G4AE 2D2FA 2OFXA 1V5WA 2R8RA 3AF2A 3MRSA 4X8HA 2D7DA 1LS1A 2QM8A 4WZAE 2X1VA 3A6PC 1Z0KA 3GPLA 2DFLA 4LPSA 1HQYE 3IUYA 3UMFA 1SVWA 4PR0A 3ZVNA 1G6HA 2EFGA 3B1YA 3UMRA 4JLMA 4Q66C 3RANA 2NMVA 2QP9X 3GLIB 1NG9A 2ODBA 4A82A 4MGKR 5K8TA 2B6HA 2OESA 2CXXA 5KNDA 2QMEA 4HB0A 1EK0A 3RNLA 3P32A 2QAGA 4PPQA 4TQ9A 3CBQA 1ZD8A 2GBLC 1WCV1 2NO0A 3KXLA 2VL7A 1AZSC 4KITB 5DISB 5HTKA 5EE0A 1DELA 3MLEA 5JCZA 4U02A 2XGJA 3WYAA 2ZEJA 5J4VA 2BEKA 5HKKA 2RKOA 2F6RA 2IC5A 3AP3A 2C99A 1E9EA 4QGFA 4YC7A 4Z1MA 4B2LA 4DCNA 5CB6A 1TMKA 3VHXA 4CF7A 1OKKA 1E4YA 5E7MA 4DSUA 1G20E 3EZ6A 3KB1A 1A4RA 4A2QA 3KQLA 4JMPA 5DHFA 3CIOA 2QQEA 2IUSA 1RYHA 4PHHA 1G3UA 3D31A 4LOAA 4Q9KA 2C2HA 5H68A 1G16A 4HUQA 4M9ZA 3SN6A 2FA9A 1E0JA 2FFBA 4LHYA 1XEWY 2PH1A 3BC1A 4ACBA 4ESVA 4CEIA 1Z83A 3M4YA 1UEJA 4IVQA 3MAAC 2G77B 3JVUA 2A3RA 2I1VB 5CDFA 1FW6A 4K46A 4LYAA 2F43B 4KSBA 4RFVA 2GZHA 2I1QA 2A5FA 2AHOA 4OQNA 4QC2A 1IOZA 2CNWD 4PPGA 3MCAA 3T15A 2XTMA 3SEAA 4TZ6A 1NN0A 1R5BA 4NYJR 4RVCA 4RD6A 1II8B 1IHUA 3C5CA 4AYXA 1EGAA 2WKQA 1O3YA 4URYR 5JSZA 1KK1A 2UVQA 4M1WA 1P7CA 3FVQA 3EC1A 3KUDA 4GBMA 1IJFA 4LDJA 4YMUA 1MRSA 1FX0B 1G19A 2H57A 2NQ2C 1G9XA 2ZRIA 3BRWD 4URXR 2JAQA 5CDFE 1T0HB 3NDBB 5BQ5A 5DIFA 1T3HA 1QDEA 3IIMA 4NDZA 1Z63A 3A1SA 3K09A 4FCVA 3U60B 3N70A 4UNSA 5LD2C 2IF0A 1UM8A 4EPTA 2JLZA 3AVXA 4ON9A 1CR0A 721PA 1G7RA 2NOAA 4GRAA 1NVVQ 2QZ4A 1CKEA 5AJWA 2CL7X 4DSNA 3TSZA 1GSIA 1G17A 2ORIA 2ODWA 1KTVA 2R6DA 3QKSA 3ASYA 1SKYE 4ZDKA 4XVRA 2QMOA 1II9A 1YR8A 2W2TA 3FWYA 3ZZUA 4EUNA 4KBFA 3RS2A 3EAQA 4BUJA 1NVXQ 4M9SA 4C2UA 2IWRA 1JALA 1K5DA 4TMWA 2XB4A 5EXXA 3U7HB 4A8JA 2B7CA 2NGRA 3MMPA 2PLFA 4B48A 1OXXK 4IOMA 1IQPA 5JFGA 2VSXA 5JRJA 2WWGA 2ZE6A 2X2FA 3IQWA 1JPJA 3G5UA 2YINC 2Q3HA 1TQ2A 1NIJA 3QSYA 2IYVA 1M7BA 2VHTA 1WMSA 2BMEA 2WOOA 3FE2A 3TRFA 2YOGA 1ETUA 2QPOA 2CDNA 5DI3B 4FWIB 1PVOA 1TEXA 4MYHA 3EASA 2RHDA 5L8VA 4GT1A 1GL9B 3LAWA 4GOJA 3U4QA 4Q4AB 3KTAB 4LC1A 2JASA 4MITA 3BE4A 1UKZA 4Q4HA 4B74A 1KY3A 4S2EA 1KO8A 3GLGA 1N0VC 2ZU6A 3NXSA 1KJYA 5HPYB 3ND8A 1D2MA 3CM0A 5D3MA 2PZGA 4B3XA 5M04A 4NYIR 4BEBA 4DLTA 3NG1A 1EWQA 4XTRA 1UF9A 1PV4A 4LBYA 1ZNXA 2EYUA 2EU8A 5DNYB 1GVNB 2ZRDA 2NO6A 4DJTA 3LD9A 2FGJA 2HLDD 1G5RA 1IXSB 4NHOA 1F5NA 3FMFA 3U7FB 4D25A 1GZSA 4EJSB 1NMXA 3U7EB 4MQBA 3TAUA 4LYFA 1OLOA 2ZYVX 1N0UA 4BPBA 2QI9C 1W0KD 4XJXA 1S96A 3OFNA 1G18A 1G7TA 1JR3A 2OEPA 1FNNA 1KSJA 2OXRA 2OG2A 5H1YA 4PC3A 2FE4A 5LBIA 2OUKA 2QM7A 4AY2A 1GRQA 4HZUB 1MO6A 221PA 2RGEA 3T06B 4W9MC 4B44A 5BWMA 2GEUA 2NPFA 3PUVA 3U7GA 1PLJA 2XOKD 1XEFA 2HF8A 4PC2A 4LSGA 3VR1A 2WWHA 2UZ3A 1GNQA 4JLJA 1XJCA 4M53A 4LK2A 1ODFA 1W5TA 2A7QA 1JR3E 4BLTA 4Q1EA 3I32A 1E2GA 1E2MA 4LBVA 3PIRA 1LY1A 5JJIA 3I1FA 4DT1A 1QVRA 5KHOC 1UPTA 4QNRA 4B6FA 3K9LA 3CB4A 2AX4A 4R71A 2GWHA 3GEEA 2ZQ5A 1EFHA 3AQ4A 4URWR 2WJYA 2FSHA 5FOTA 4D0LB 4LBWA 4QBGB 4Q4JA 4HEJA 5KOYA 2QSYA 3AP1A 4OHZA 4GDFA 3ONWA 2W6JD 5DN6A 4XD7D 1U0HC 4DC9A 2OILA 1KI9A 3VR3A 1YZGA 1N6HA 1CR1A 2BJVA 2RHMA 4FCTA 3THOA 1YJ5A 5IRCD 2ZYUX 3LRPA 4RD3A 2JIZA 3P26A 2JJ8A 2YWFA 4F4JA 2ZRAA 3T34A 1KK2A 1KMHA 1E96A 2IYQA 2XJ9A 4G5QA 4LJAA 3MGCA 5HCIA 3UKDA 3EPLA 3LX5A 1KO7A 3LW8A 4OQXA 1RRCA 1XEXA 1FMJA 2YWEA 3ASZA 4XWKA 3EPKA 1GM5A 2QAGB 1XTIA 3HPRA 2IUUA 5P21A 3EIHA 3K9HA 5KYKA 2FSGA 4JYCA 1SVIA 3RS7A 3SJCA 3GEHA 2F3RA 2QAJA 4M9QA 2GEDA 5KSPA 2PX3A 3HDTA 1G21E 2N42A 4MKHA 4U7DA 2IX3A 5KSOA 2KJQA 2VP5A 2IEYA 1E0AA 3AUYA 4PQYA 2ASEA 4C9BA 5TMPA 4QOSA 3MWLA 4AYWA 5JCPA 1MR3F 5EZ5A 4BLQA 1E6CA 2BIFA 4FWTA 5A5GA 4C0AC 1E9RA 2D4HA 1Z22A 5ANRB 1I4LD 4HUQB 1TPZA 4MRRA 4HYYA 3SJBA 1JI0A 3CR8A 2OZEA 1ZNZA 3WBJA 3NBFA 1BS1A 3GCGA 4M0LA 2RGCA 2XAUA 3BS4A 4PSAA 2B7BA 3H84A 2H16A 1AK2A 4HDQB 3W3ZB 1IN6A 2BWJA 3T5GA 4P4SA 1DOAA 1DAKA 2GILA 3TH5A 1MO4A 3CWQA 4BE7B 2A5GA 3Q9LA 1BH2A 4BECA 4XSHA 1NLFA 1SHZA 3ZQ6A 4UNPA 1P6XA 4DLSA 2QEQA 4PFSA 2ZRJA 2WSSD 2XNDA 5JSZB 1Q57A 1D8TA 1HTWA 2Z0MA 1SKYB 3CNNA 2JLUA 1RKBA 3OE7D 5E4FA 3UWKA 4FIDA 2Q21A 4XTCS 1KKMA 2Z4RA 5L3QA 1P2TA 2W6ID 4L9WA 4LJYA 4NYJQ 3TUIC 3DM5A 5TV2A 5G40A 2BM0A 3NIBA 5FUXA 1P9RA 2GBLA 3D8BA 4WVFA 3BH6A 2JLSA 3A4NA 4KLZA 5DHAA 4C0SA 2IYRA 2PBRA 1AS2A 3WMFA 2WJJA 1NKSA 2PZEA 4TT3D 2WV9A 5F9FA 1W36D 2QBYA 3GJ7A 1D5CA 1C9KA 1E1QD 2DFKB 4MGYR 4PHFA 1A7JA 4WW0A 1YZQA 3QBTA 4ZV4A 2RGXA 1RC8A 3AGPA 4TMVA 2DY1A 2JDID 1QG4A 1UAAA 1XB2A 2HJGA 3IHWA 1AQYA 1S9DA 1J90A 2D2EA 4EFLA 1Z6YA 1KGDA 2EWWA 5JS7A 4R98A 2EFHB 3SQXA 4MGZR 1ZU5A 1ZCAA 3QVUA 1XFAA 3ZJYA 1PUJA 4IEIA 4PQFA 3SC3A 3C4JA 1XJ0A 5CM9C 1GTVA 1CU1A 2G88A 4Y0VA 4PC6A 4OI0A 1RYFA 5AJVB 4TSFA 2JJ1A 4A0RA 4RZUA 2GVDC 2ONJA 5KNBA 2VPPA 1X6VA 1E2HA 1W1WA 3BBPA 3RC3A 4KI0A 3OHMA 3LBIA 4O0MA 1E94E 4EQ6A 2O0JA 4US1R 2R6FA 3TR0A 3I61A 2FPLA 1E9SA 4FXPA 2WWYA 3TW8B 5JBQA 4NP6A 3KJIA 4LJ5A 3C8UA 3I5XA 2J0UA 8OHMA 1E9FA 2QGNA 4C30A 3AEZA 3K9NA 5AUNB 5FPYA 2XJ4A 4KFUA 5BN5A 4KBGA 5FOWA 4L4UA 3N2EA 2FDCA 1XU4A 1BYUA 1KAOA 1OYYA 2XTZA 1T8UA 3KFVA 3NHAA 4NYIQ 3TUZC 1OH7A 2XTNA 4QGGA 1GKIA 1NY6A 1T9HA 3O8BA 4A0HA 1W49A 2JLVA 3SYKA 3ZZ0A 3J81k 4A9AA 4WZBE 4DUGD 4G5OA 5EUQB 5FTMA 1EFTA 1G291 1Q12A 3R9WA 4EPYA 2PT5A 3CRW1 3FHTA 5KSYA 5FTKA 3C7KA 3Q7QA 3QPUA 2O8FA 2GJKA 1NBMD 2QPAA 1QBKC 4A8JC 1KJZA 3LV8A 4GSYA 4DBLC 4PAOA 4KYIB 3AF1A 2HXSA 2FZLA 3ZIAA 1DPFA 1ZJ6A 4PZZA 5J4YA 4GP7A 1RZ3A 1G3MA 5FI1B 2ZSEA 3C14C 1T8TA 2TMKA 3IO5A 1R0WA 3SDZA 1XCPA 3DOEA 3REGA 1VCIA 1ZYUA 5DGXA 1N6KA 1UADA 1XXHE 1M34E 2GCOA 2W2VA 4HLDA 3A8TA 5EP4A 3VR5A 3O8RA 2QQ0A 5C1BA 5AWFC 2V3CC 4RFSA 3A1UA 2ZUBA 2J46A 1ZUNB 3CRRA 3Q8XB 1N6OA 5HR5A 3HWSA 2ZROA 2JCSA 1JXMA 2HXYA 4BEJA 1VKJA 4Q4JB 1GKYA 2J1LA 5GVRA 1RJ9A 1XPUA 3TKLA 4DIEA 2R9VA 4C0LA 5DLQC 2WMNB 4BLRA 3X1ZA 3H86A 2NTYC 1AM4D 2OCAA 3X1DA 3OIUA 2HYIC 5HZHA 1P62B 3VU9A 2AD5A 5EP3A 5AUQA 4NL4H 3NTUA 1JXOA 2J7PA 3RRNA 1LS6A 1NN3A 2AR7A 3QPVA 2ZI7A 3VHLB 3WMGA 1WQ1R 3BFKA 4EPVA 4H1UA 2CHVA 4BFZA 1XEXB 4PHTA 2P5TB 2G3YA 2IEZA 4TLCA 1XD9A 3THXB 4LI0A 4B47A 2H17A 2JGNA 2Q9AA 1COWD 2KB0A 1YVDA 3GLHA 5DYGA 2QY9A 3DOFA 3PR1A 3T1QA 2ZJBA 2GXSA 1M6NA 1XCGB 3PEWA 4JT4A 2V6IA 1OFIA 1SXJD 2WICA 2RGAA 2X77A 3B7GA 4OJKA 2ZRMA 4ASUA 3A1WA 2V55B 3AVTA 1T3LA 1Q44A 1E1RD 2AWNA 2Q0HA 3QXJA 3T1VA 1PUIA 1ZM9A 1I4DD 1YR9A 4BWYA 2VYFA 1E9AA 1KO5A 2WKPA 2ZJYA 3GLHE 4PO1A 1KI6A 3CX7A 4AYTA 5FBWB 2ZJ8A 2XSZD 2ERXA 1HA3A 4GP6A 2P0EA 5AJXA 2IYSA 2IS2A 2V4ZA 3NBXX 5DO9A 1VG0B 1E4VA 1YZUA 2HCBA 4HAUA 1I4TD 4PX9A 5AUOB 4RKEA 1W5SA 1KK0A 4HAVA 1NJGA 1RRGA 4GI7A 1GP2A 4P4UA 4V0NA 1MABA 2C5LA 4MRSA 4XVUA 3IQXA 4RKFA 2JLQA 1NY5A 3R20A 3BOSA 3BORA 2ZSFA 1QZXA 1E99A 3W6NA 4DZZA 4YXWD 3L0IB 1RRFA 3CZPA 3QF7A 3W34A 4Q48A 3NBYC 2GESA 4B32A 5FBQB 4CGZA 1BO6A 4G5SA 5C46F 2LCFA 1L2TA 2CLCX 5BXQC 2REXB 4CT4B 4M22A 4UJ5A 1J8MF 3QF4B 1M74A 3R8CA 3GJ4A 1KI7A 1H8HD 5FBLB 2FV8A 4X8OA 4ZCIA 2J0VA 2IYYA 4NCHA 1OIVA 1NP6A 3TJZA 3FHCB 1TL7C 4KFTA 5EXTA 1SVMA 2WOJA 4LWZA 3B8HA 3IBGA 4LJ7A 4Q1DA 3VX4A 1ZIPA 3EG5A 4W5HA 2REBA 1N3BA 2VIIA 3NH6A 4L8GA 1VCOA 2DWQA 1CLUA 1GAJA 3DZ8A 5AUPB 4LJ4A 1T5IA 2JJ2D 1F3OA 1D9ZA 4R2HA 3VKWA 3SQWA 2GXUA 1CJKC 4Q5IA 3AKCA 4YLGA 3ICQB 3HYTA 3EZ7A 2E9SA 4A6XA 4IOLA 3VR2A 1UKVY 1RFLA 4D4MA 3EPJA 5C4GB 5J4HA 3ZDQA 1IY2A 3EWSA
chains in the Genus database with same CATH superfamily
4JEMA 4IEEA 3CVOA 3ZWNA 1H42A 4TMXA 3AEYA 3HU1A 2VP2A 3RWMB 2IYWA 4ZCRA 1L7EA 1HURA 1WABA 2CVHA 2CHQA 2CXSA 2FPXA 2Y1FA 3LK7A 4TL7A 4HPWA 1HGXA 3PITA 4HX5A 5FRDA 3RTBA 4GLJA 3RF6A 5U1PA 2NVBA 2FR8A 1LNQA 1H69A 4XH9B 4E31A 3TFOA 4JUCA 2HIMA 1R8QA 4U7TB 2P5SA 3WGVA 2UYQA 1S4MA 4ENWA 1EXDA 5AI6A 1K5PA 3DL2A 1QJCA 2YYYA 5BVGA 3PNBA 3ZU3A 1DADA 1J09A 4XM1A 2XVMA 3KPUA 4CNBA 1VYTA 4GPD1 1EESA 3ZK8A 2C29D 5CB0A 1SCJA 3R2JA 2C4WA 5DLPA 3P4YA 3WRYA 2ZRBA 4C0HA 4ZCMA 2B4TO 3HEMA 1KYXA 4NOJA 3DTYA 3QJ5A 4QAQA 4HWSA 3E1KA 4LF7B 3R7WA 4OKSA 1M2FA 4Q7LA 4Q82A 2QTVA 4OX9B 3E05A 3OQ1A 4EHAA 3D6HA 3BH0A 2H2GA 2OD9A 4X64B 1SU7A 1SRQA 3I0ZA 3FFTA 2CLFB 2R7AA 4I1VA 2LR0A 1GFZA 3BMNA 4FNAA 4FOSA 4NYMR 4S0ZA 2C7RA 4CEHA 2OAGA 1CXZA 4NZNA 4HAXA 1J2TA 1TZCA 1L5LA 4GMFA 1A98A 1OZ0A 5JAPA 2V1UA 2GS9A 4CF6A 1JFVA 1T2EA 4Q1FA 3HY3A 3QBJA 2FPUA 1D7AA 1X7WA 4DIKA 4IQ8A 2BFFA 5AKIA 2QNRA 2VG8A 2X3YA 1CLEA 2PRYA 2L0XA 1YONA 3RUCA 1XXHB 2G83A 1C29B 1HY3A 1E5QA 3GYBA 4BMDA 5JISA 3ZCQA 4IR7A 3IRVA 3YASA 4FYYA 1COZA 3SJUA 4RPCA 3TR6A 3ZEIA 3I01M 4ZODA 5DYNA 2YX1A 2IV7A 1FZTA 4HEHA 4X71A 1B73A 2XKJE 1S2MA 3OOHA 4OP3A 1QG2A 1H0KA 4WY5A 5E6SB 3MT7A 1ZCFA 4XUCA 3TBHA 2E4ZA 1V7ZA 4IDNA 5I7VA 1ONOA 1Z7EA 1ZVQA 4J4BA 1I6LA 3ZHTA 1GDTA 3OE5A 4O02B 1AA9A 1JU9A 1KAEA 3IAEA 3LSTA 4OB7A 4R2MA 1H2BA 4JNKA 5PNTA 1YV9A 4R7ZA 3C98A 3RSHA 2AF3C 3G13A 1ES9A 3EZFA 4G8DA 1NSFA 4JKIA 3NVKI 2GDJA 1GKLA 2GF0A 4J9UE 2C7OA 3QELB 7REQB 1S8AA 2GBFA 1J56A 1U6IA 2P7IA 2QTBA 2FPGB 4N39A 3RVSA 3HBMA 4YWJA 4GR9A 4AX4A 3OE1A 2H0RA 2OCLA 4FD2A 1UMDB 3NEJA 1F38A 3SC4A 3W6UA 5KTOA 2V6JA 3D3QA 3ZE1B 1B8OA 2IE0A 3QLEA 4O1HA 2W48A 4OQLA 1S2DA 4F2DA 3S3TA 1AO3A 3K5IA 3DT9A 5C53B 4PZYA 2ZWOA 1VHDA 3ZHRA 3G6KA 3LSYA 5CJPA 3RSCA 1NDUA 2TS1A 2KX7A 5AI5A 5FEMA 2X2EA 3HO8A 5DPMA 2YY6A 3EF0A 2GX6A 4A36A 1L4BA 4F45A 3CE9A 2I33A 4H59A 3L8YA 4YJHA 2FVYA 4DKJA 4JQZA 3O2NA 4Y9DA 1X87A 4ZZIA 5HNKA 1LPPA 3WK6A 1U8XX 1SEVA 2K4MA 2PZFA 2XZTA 3EIEA 2O7SA 2AMVA 3KL4A 4M0DA 1D2EA 1YS1X 1Y89A 4X0EA 5C5IA 1DMRA 4BNVA 4F91B 3BVPA 1T8RA 3L6RA 2XCSB 2O8BA 1TIKA 4DLZA 1NXXA 3B1JA 4RK5A 1LF5A 4HVLA 1DJQA 4JLVA 1Y1RA 2CN1A 1LSSA 1SOVA 4GYWA 2NWQA 1GNPA 2FZCA 3E58A 3IPCA 4C6HA 3DAGA 4PZUA 5SZJA 3U31A 4PEVA 2EERA 2YWCA 3K3PA 5KNLA 1NV8A 4RQTA 1NVGA 3TECE 2IK8A 1GXSA 3LVFO 3ET5A 4J7UA 4RF2A 5SY6A 4BLWA 2C4KA 4G3XA 5ICFA 3F4KA 3PDWA 3ZDDA 3RC1A 3L7BA 4M98A 1QHNA 4LSZA 3OFKA 4DWJA 3K0SA 2VR1A 4LFCB 1NT2A 3ZLJA 1LW7A 1ZN2A 4GMGA 4ZVOA 4XWYA 3TSYA 5TSDA 3C41J 2VJYA 1TF5A 5AXDA 4QGHA 4D02A 5HRUA 3CPSA 1LRJA 1P4JA 3IOYA 4BMVA 3HFSA 1Z36A 1C81A 3CLHA 1J5XA 2IH4A 1GLVA 2WHQA 2RH8A 3O7WA 4XIJA 5JLJA 4C20A 4ZEVA 5G0SA 4CJXA 1LRKA 4DMUB 3P5SA 1USIA 1MABB 3ZGZA 5JE8A 2AG5A 2CV1A 4KR3A 3GP5A 5CNKA 2HA2A 1U0LA 3Q98A 1NBHA 3EDCA 4H4EA 1GPNA 3DVQX 1L1EA 4FFWA 2IH5A 2NO5A 4D9IA 3Q3VA 4MKGA 1R9GA 2ICAA 4OREX 4MJ3A 1KU0A 2R6CA 3MCUA 4J0GA 4YGYA 1DEOA 2EKZA 3BXHA 3WGLA 2V4UA 2JGAA 2J3QA 4GXRA 2KWIA 3R7LA 4IJVA 2GK7A 5BW4A 1WD5A 2A30A 1S8OA 4MGHA 5DBIA 3X1JA 4BAUA 4Z4QA 4KO1S 2IZ7A 2J7KA 5CBPB 3TX6A 1SUFA 5LXTF 2QN1A 4BBJA 4HG2A 2W43A 4PS0A 4U39A 2P3LA 2YXBA 3HCBA 4ND6A 2VF4X 5LQJA 1WXQA 2FEXA 2IY8A 1GNSA 2R8YA 5HBRA 4LW8A 4DA8A 3O9ZA 1R8YA 1RIIA 5A3QA 4PYNA 2JD2A 1T9DA 2Z83A 1FS6A 3VPHA 3KETA 2AC7A 3QZUA 1DC6A 4ZMBA 1UPBA 1R27A 2QZ9A 4ATNA 1WM1A 4PBSA 4FT2A 4E5KA 4NNJA 1VJRA 1I7QB 3EPHA 3VJRA 1BDJA 3A2LA 4NPHA 3VOSA 2ZG6A 4A0SA 3ILYA 4IIYA 1TA4A 2XT6A 5HOEA 4PQEA 2BSAA 4BO9A 5JZMA 3P45A 4JUAA 1P4RA 1O1YA 1NF3A 2J08A 2R5WA 5BN4A 4DMKA 5I9NA 1HT2E 3EEBA 2ZJ3A 3UJ7A 1DVRA 3QEJA 2ZAMA 4DQUA 1H2WA 1UKCA 1Z0FA 1UFKA 1NOJA 1XVIA 4HAWA 4B34A 3R5JA 2DHRA 4FFOA 1PZMA 3TCXB 2H06A 1T9GR 4Y2QA 1JU4A 4I3GA 3K0AA 3L84A 4W1QA 1VSUA 3RODA 2G67A 1PZHA 3RC7A 3I30X 1AIPA 2BFBB 5CA0F 2MYUA 3L82B 3RYIA 4DUGA 2WSIA 2BFEA 1DTEA 3BAFA 5BVGB 1DQZA 4G9EA 5TT0A 4OLJA 3II6X 4EP1A 2FPKA 4EENA 4JYZA 1QNFA 3F49S 3RIEA 4PLTA 1J0CA 2GK4A 1TYAE 3Q1LA 1EB8A 1U98A 2WYIA 3B2NA 3CRQA 3EVTA 4RACA 4AJHA 4YY3B 1XV5A 4Q18A 3DOJA 4QXMA 3QFFA 6GPBA 1L7NA 2PZBA 3E2PA 1NUHA 3BCRA 3O94A 2OV1A 4UM5A 3PC7A 1RAFA 1IUKA 5I9BA 3ZNNA 3L8DA 3SYMA 3V46A 5B36A 4E4TA 4RSGA 3ETEA 3LKVA 5AJYA 4Z1MD 1KH2A 4OFXA 4ZHQF 5HGJA 3R7WB 3WB2A 3H1AA 3E48A 4WDRA 3UATA 1TVKB 4ZVQA 5JI2E 1W4CA 4I99A 1UJ5A 3VU3A 3E15A 2ET6A 2NV0A 3CLTC 3ESBA 4PG4A 4ZZ1A 8ADHA 2IEIA 2WILA 1EVZA 4DCCA 3BMNB 2GDZA 3H87A 4CM1A 2VTKA 4PTLA 4GOKA 3SG0A 3T6KA 1L5YA 3G49A 2IV3A 2BMWA 1UFOA 2C5AA 2O1XA 5JRDS 3G0OA 5BSGA 1VXOA 1X7WB 1WEHA 1UZLA 3HB0A 4S0XA 2WFLB 3C7TA 3PNYA 3KB2A 3HR8A 2E4UA 3H6HA 3JV7A 1BD4A 4N0QA 3MW8A 2A2ZA 3S2SA 1W47A 1KS2A 1K06A 2ZS7A 3OF5A 1PKEA 4CLRA 3QNMA 3SX0A 3TL2A 1U4SA 3DC7A 3EVNA 2P6NA 3I9V6 3OQBA 4MO9A 3LCUA 1DIHA 1GYQA 1RYNA 4MVJG 4Y2RA 3JZMA 4EUSA 3G2PA 1NVDA 4ZOEA 4ED9A 2QTFA 4LOIA 2WJ3A 3TR5A 4E5UA 5CHYA 3BDAA 2BEUA 2Z3VA 4UDNA 4RK4A 4EIWA 1FRQA 4G0NA 4RCZA 2IXBA 1HFWA 3FLEA 2GN2A 2BR4A 2Q5CA 4EYKA 1G66A 1RWPA 5KIAA 3MOIA 4P86A 4K8OA 5CIYA 1AKMA 3GZNA 3FYTA 5ALPA 1JDJA 3FTFA 2YHBA 1C8LA 1Z8DA 3K8YA 3VAAA 4L4ZA 1R10A 2AI1A 4IDHA 3BJEA 4YHBA 1FYVA 4BDTA 4OA8A 2BHTA 4OHUA 4BCBA 3WRYC 5DHTA 1TZBA 1NKVA 2GYYA 2HU7A 4XWAA 1CEXA 3HDVA 3IVRA 3KNZA 4LUCA 2Q9UA 4W4TA 3BQNB 821PA 3TK1A 1SU8A 4I1IA 5I3ZA 2ZRHA 2C98A 1ITZA 3UG6A 1XDBA 4L95C 1UKBA 3FROA 3PUHA 3VH4A 5JUWA 4EFDA 5DSTA 1SHTX 1GTZA 3LQQA 4YJHB 1U1DA 4KHPB 2OLJA 2B4YA 3QPWA 1TCCA 3HB5X 4OHWA 4WK0B 1VLZA 3JQAA 3WIOA 4QBIA 4CKBB 3EIFA 2MCFA 5FL7A 3ZX5A 4CM7A 3ZD7A 2ISSD 3GZ4A 3IURA 3D6TB 4ZI5A 3G0DA 4UBOA 4GVLA 3TTTA 4W5RA 4DLNA 1XDWA 1JFSA 3D6MA 1U04A 2P11A 4O25A 5AKGA 3FMIA 3JQ9A 3BJZA 1GTG1 3GUVA 4H6WA 2IKSA 1ZISA 1QFMA 2L17A 3DEYX 4K6KA 5EC8A 3PTLA 2Z58A 5EJAA 4G4GA 4BJ6A 4G2TA 4PX2A 1QOZA 1WO8A 1P73A 4DV7B 2O54A 2BMDA 4ZMSA 5BSVA 4A1FA 1K68A 4G8JA 3QSGA 1FMLA 3SFVA 3NH9A 5BR1A 5FUYA 4IVNA 4Q3KA 3V7NA 3RVBA 3Q6IA 5DT9A 1ZGJA 3EDRA 3NVDA 3GUHA 3UB2A 5IG2A 1UEXC 2HCRA 3ZW8A 1NLYA 1C3XA 4UZFA 5B4VA 3NQ41 3WP0A 1YQDA 3ADDA 3BEOA 3RKUA 3WO1A 4C4XA 1ZBQA 2X8WA 3PD7A 4R68A 1JIQA 2ETXA 3QFCA 2OPBA 3JYLA 5I9TA 2EJUA 5IH7A 2GHQA 2ZSAA 3RYFA 4JLDA 4F8EA 2Y93A 1O87A 2QYTA 3AEUA 4YQZA 1XQ6A 4OYHA 3X2FA 3U4QB 4NC9A 4FMDF 2VP4A 1VCMA 4CT5A 1SIBE 3WWCA 1GR0A 1VBKA 2Y1WA 3OQHA 4D9MA 1JDTA 1WUHS 1YL5A 2BFCA 3DKKA 4AS2A 2JK0A 2RH5A 4JK3A 5A4AA 3BGOS 3L6BA 3LL7A 2CVOA 3UA4A 1AD2A 1GV0A 1II0A 3GGGA 4I66A 4Y6PA 3D6NB 4BP8A 1N6IA 4WUTA 4WJLA 3UNXA 3BD9A 1LSJA 2F1RA 4R51A 3OFND 2ERYA 1EFRD 3N3BC 4PAMA 2Q0SA 1JR3D 3SX4A 1W35A 2VSQA 2GAFA 3CHYA 4CUZA 1RE0A 2VUHB 4Q19A 1E9CA 5BYJA 4HDMA 2IWHA 4LEIA 1XEWX 2C2XA 5LQAA 3E8XA 3AR3A 4CL3A 1KFEB 1KJQA 2VK4A 2I2XB 2CD9A 1ORWA 5BVHB 3FCAA 3UANA 2O0MA 4JI5B 2EYQA 3TZ6A 1H8EA 4M0KA 3L40A 1EA5A 2C2ZA 4BVJA 1EXWA 1NUAA 4I9NA 2J9FB 2OXTA 4CMKA 1UT8A 3P52A 4X44A 1MLDA 3H5OA 2H8KA 1ODSA 2WJZB 1BHJA 4A6DA 4L5YA 1L5HA 3QE0A 4DBZA 5KNCA 3NW9A 5AVKA 5ED4A 1VTKA 1FQJA 3PNPA 1Z4MA 4QULA 3D5QA 1P77A 4HQKA 3CINA 2OYSA 2GA9A 4BMOB 2PU5A 4BVGA 5J47A 2A9RA 3FETA 3G8CA 3IUEA 3LF1A 2XZLA 1I6KA 1TD1A 5AVJA 4UE2A 1PQPA 3VBCA 3OX2A 2H92A 4PC7A 5BT9A 3TIXB 1V39A 1ZITA 2P27A 4JODA 4R8KA 4REQA 3ZQUA 3ZZNA 1FUYB 2VVTA 3H19A 4FHGA 4WA8A 4B8ZA 4XWWA 1ZJJA 3D4IA 5BN4B 4K9DA 2W6NA 1OFGA 4DT1B 4TTIA 1DKNA 4DYVA 2O50A 4YRFA 4DLYA 3ZJTA 1YVRA 3L7CA 2I6XA 1XPJA 3KYBA 5DM2A 3RSSA 5IEJA 4LVUA 4AWBA 3G2MA 3G3EA 2H31A 3JQPA 3GAMA 5H80A 5BPFA 4P4TA 2PAFA 4W63A 3RTCA 1I1HA 2QD5A 1A3CA 3RM3A 3K0AB 2F55A 1YZKA 4UMFA 5E8RA 4Q9DA 1HF3A 2P9TA 3EF1A 1KPGA 4BNLA 1CUCA 1FFAA 1QX4A 3E9NA 1J06A 2JHAA 4MQ4A 4YJFB 4C3OB 1KVQA 4BKOA 4GGPA 4A4DA 3U16A 3ZVMA 2ZYHA 4BRSA 5F2NA 2PMWB 2JLBA 1EUCA 1VIAA 3FUCA 2R4UA 4WXHA 3FCXA 2AW3A 3WADA 3NHPA 1M1UA 5HF6A 3ER8A 2WDZA 1WSDA 3TL6A 4LZLA 2IPLA 3BXEA 5KI6A 1UDWA 4QUKA 4DIOA 2GERA 5GOZA 3TAXA 5C52B 1VP9A 1E2QA 1ZD3A 5HJEA 2B61A 3U7JA 2NTNA 1MV8A 4DB4A 1XRLA 4EG6A 2I8LA 1DWUA 1UBRS 2CY0A 2X41A 4LZPA 3GCWA 5FBHA 2G9QA 2CD7A 1YOVB 3A32A 3QV2A 3DMNA 2VHQA 2FU5C 2WG1A 4FNGA 1TKCA 1LF0A 3WI7A 3EXAA 3FM9A 3PNSA 1X15A 3L5OA 5GONF 5ADVA 3OOWA 2CXUA 3DT8A 3N75A 5JMWA 2EL9A 1TF2A 3SDSA 1V25A 2AD1A 3FCEA 1UMCA 1RP7A 4HDOB 5HXAA 3V4LA 1N2ZA 4AZ3A 4K86A 2V4MA 2FWNA 4PPNA 1L4YA 1GUFA 2QT1A 2FW7A 4D6YA 1NYLA 2ORWA 2YNMA 3VA7A 1W76A 1Q0UA 2V7UA 1JDBC 2YR0A 3DMPA 4W8GA 1F6WA 4YUVA 2WG0A 1SCUB 3DZCA 3IS3A 5HFAA 5JH7F 1NE7A 3IAS1 4GMHA 3VYWA 3IUMA 4OQZA 1T2NA 4UTRA 5A2QA 1T2CA 3K1AB 1CDDA 2WAOA 3F6CA 3KUUA 4KJZA 1O8CA 2Y2VA 3VPFA 4ENTA 2IW3A 2ZI9A 4ARZA 4YRIA 1JDPA 3EFBA 3V2HA 3D4BA 3K70C 1XMIA 1EFPA 4MMZB 5EKUA 3LUGA 4L08A 3ER6A 2P9HA 1M6HA 3H2ZA 5L6MB 2RJNA 4ZQCB 4ZVMA 4ZJYA 4K88A 4O33A 4MLDA 4WLUA 1V1JA 1H23A 1T8SA 2AEMA 3A9RA 4TT8A 3W6ZA 5DF1A 5KUTA 2ZI4A 4IMJB 4UKDA 5E6UA 5B3JA 4L4SA 1N2CA 5K4GA 2P79A 3UPDA 5DTIA 3V8QA 5JBNA 1U31A 4F3RA 3DYIA 1PLLA 1YQUA 2XTAA 3OTQA 1EDDA 1G8MA 3FMPB 1NGSA 1QG6A 3BMCA 1KY2A 3RR2A 4UBJA 3U13A 4EKNB 1N0HA 2GKGA 3T9FA 4CMIA 3C1AA 4OHVA 3ZNQA 2HWXA 2ZAGA 3QG5A 4ZU1X 5I6DA 3V4RA 1I94B 2H18A 4DW8A 1BVYF 2PL9A 1V8BA 4M0MA 3VOAA 1IN8A 1C9DB 3M1AA 2DETA 3JQAB 4AG5A 1JQEA 1UXOA 2O3JA 2O0KA 4LNHA 5FBRB 5HM8A 4MVJI 4E7PA 2O48X 3T1HB 3GDWA 3OM9A 4I9FA 2P6OA 4DUPA 3RQSA 4OHCA 4YRJA 5HS4A 4QFDA 4AKEA 2VDWB 1X80B 4ZYLA 5IJAA 3KWMA 4EDHA 3SC6A 1GFIA 2BY4A 1P74A 2GEVA 4GLFA 1XK7A 3D0OA 1K92A 4GX2A 3V6MA 1PAUA 1G1AA 2ZYWX 4WK6A 2HT1A 1BE1A 1ZJ5A 2I3GA 2KLBA 3O3NB 4PY2A 5TQ2B 5F21A 1LBIA 2Q3DA 3FDXA 3GDOA 2XB2A 3FDZA 1MT3A 2FKAA 4P33A 1XLWA 2HWUA 4V2UA 1NR7A 3TXXA 3I3OA 4UU0A 4KDRA 4EKYA 2BSQA 3WYEA 1AKRA 5EJ8A 1XKTA 1A82A 2JVJA 2HLDA 5G0VA 2IJGX 4UCWA 3ANLA 1ESNA 3E5HA 4KIGA 4L5AA 3O26A 3UYKA 4DA7A 3CF0A 2CHGA 3SR0A 3C2QA 1NNI1 4Z2AA 1LTQA 4PO9A 1PJTA 5TPWA 1FFXA 4EKIA 5LQMA 1JKMA 2YDYA 3Q10A 5B53A 1JG3A 1GILA 3E81A 4OD0A 5F33A 4YRTA 1VM6A 2IZ5A 2SKDA 4FN5A 1T1EA 5BYBA 1E7MA 3RYFB 4RZSA 1H6CA 1R00A 5KYUA 3AEUB 3LCRA 4AIRA 4PRYA 3U6BA 1XMSA 4R3UC 1KO1A 2ID7A 3NHJA 1C1DB 5JAZA 5FUQA 4ZQIA 4TZTA 2GJAA 1SXJC 1YF3A 2EKBA 3WYNA 2R1VA 4IUCS 2BFCB 1E98A 4WJZA 3U7RA 4DDTA 4ALIA 4HBGA 2O7RA 5TLSA 2GPWA 4D0RA 3N8IA 5E0OA 3AJEA 1YMQA 3F6BX 2XEXA 2JGLA 2PTGA 3UQYS 3UJAA 3LCCA 2J0UB 4YJ3F 4I1UA 4BZZA 2ONCA 4YV1A 2VRCD 3T3PB 4EDFA 4DNPA 1IBMB 1XRRA 1Y3AA 2I99A 2Z04A 2JFFA 1XYYA 4MVJF 4NDNE 4RVOA 5ALXA 2VRWA 1GZ7A 3WA6A 4NJMA 2ZR8A 4TS3A 4UAVA 1SELA 3T38A 4JJ6A 3BMQB 4PICA 4WEOA 4YRRA 4AJJA 3ENWA 2F9LA 3GJ8A 3CQ9A 3AHCA 3H8JA 3IXLA 3H9BA 1SZJG 3A4VA 5J2TF 3SBOA 3SGLA 1TTTA 1NC1A 2O0LA 1PTKA 3HVIA 2E6KA 2HR1A 4CMHA 2GYUA 1DU4A 2Q28A 3WISA 2JLXA 5DRTA 3SYLA 5F76A 2ZE5A 3SZLA 1UEIA 2CLDX 3U48A 4MQFB 3TZKA 3H9QA 4KO4S 4DDUA 1L5HB 4ZEOA 2O05A 1E2UA 3OESA 3D6FA 3PZBA 3THSA 3TMYA 4E2YA 1H1LA 2KS6A 3AJAA 2A84A 2HIAA 3IBTA 3Q6MA 4I8XA 4IWNA 3RPEA 2CJYA 4B17A 4PN7A 4MDFA 1GQFA 4AUMA 1WPRA 3VNQA 4QDXA 3PXEA 1T1SA 2HHLA 4JIMA 4U9HS 1A97A 1JIXA 1ZM4A 5CFPA 4J3FA 3RYTC 1YB2A 1KL7A 3FGOA 3ROKA 1VL5A 2QQ5A 2NU8A 2D2XA 2J67A 2Q5IA 1VL1A 4PSKA 3U2QA 1P2BA 3T3NA 3V6LA 2HUPA 2R8EA 4AECA 1OGIA 3VU0A 3JASA 2VH5R 1EWRA 1D1TA 5IVKA 1E6KA 1DLIA 1JJIA 1U7TA 2WM2A 4FYJA 1JYFA 4TKUA 3W04A 4CUKA 5GPBA 3PPWA 2AZMA 1TXGA 2D62A 3KKLA 2C4HA 4I9UA 4EBFA 1LTKA 5CA1B 2B2CA 4TVKA 421PA 4YAGA 5GIOE 3D1VA 4MGIR 2IA5A 4KCGA 1BHQ1 3GF4A 3RHZA 4B33A 2H07A 2NZ2A 2ZZNA 1Y8RA 5TB5A 3O9VA 1XP8A 1VJGA 2VC2B 3PSHA 1CTQA 2H4HA 3MUFA 2PYIA 1BXZA 2PKQO 1E4OA 2W58A 2H1LA 3MSCA 4JBWA 4IG4A 5E3HA 3GFPA 3GD7A 1ZEMA 4FYMA 4BVLA 3CZQA 3O2SB 2WB4A 3ITKA 4M38A 1TKAA 3ROFA 4ZCQA 5TARA 1JEQA 2C8KA 3EA0A 1E0KA 1YRLA 3KOXA 5DZSA 2YW9A 3PGXA 2R8PA 3GMTA 3TNJA 3ACDA 1OBCA 3P1JA 4N40A 4Y1RB 4YT8A 5ILOA 3LWNA 3ZPXA 1N92A 5I4CA 1ULBA 3JAKA 3GHHA 5HZKA 3GWGA 5C3MA 2YIVX 1MFPA 2AG1A 2CNKA 4KXMA 1DWQA 4ZGBA 3MYRA 2V9PA 4MR8A 4ZPXA 1R18A 3AJ9A 2CCJA 1GPDG 1WBJB 4RMJA 2PYZA 4UEQA 2SNIE 3C45A 1E2IA 3NANA 2EQAA 1UJ4A 1UMCB 1E1YA 5B58C 4QRHA 3STTA 2MT9A 4DA0A 4O8CA 3ZH9B 4IL5A 4TWRA 2BR5A 1P2GA 1NF8A 2V9ZA 2XIJA 3DB2A 4Z4HA 1X14A 4BKMA 3E5RA 2XRMA 3GFVA 2FETA 1XTSA 3TOZA 2YWRA 5HIAA 1NAIA 3CKMA 4YQYA 1R12A 1XG5A 2W6IA 1AUOA 4HGQA 5B3AA 2YIJA 1C1XB 2J59A 4LVNA 3EEOA 1U9IA 3L1UA 3N2KA 1KDOA 4GKBA 1J25A 2VNSA 2ZYTX 5EWLB 4WCDA 5TJ9A 4ARZB 1N34B 4LFAB 4EMTA 1JEOA 4UHKA 1UBKS 3WIDA 2IP1A 4LYJA 1ECPA 1DARA 1EM8A 2G9ZA 4Y9TA 1Q0TA 3GFBA 1XCBA 2I34A 1H2EA 1P2VA 4K1XA 2RGNA 1PJBA 3DE6X 3RG8A 1MRZA 4CIXA 3ZWOA 5EJEA 4F3NA 4TLEA 4C1BA 3OECA 4HDNB 3PWZA 1D4OA 3JALB 3K7EA 1TK3A 1CDOA 1R3DA 4BMYA 2Y1CA 2AB0A 3PXDA 2VNHA 3IRUA 4F6CA 2HPVA 4EVIA 4DQLA 3SQDA 2EJWA 4DG9A 1K0UA 2OAP1 4PSVA 1MORA 1G2PA 4Q47A 4YCSA 4R8VA 3LL4A 4PAQA 1D2HA 4XZ3A 1K8QA 3U39A 1GLNA 5H82A 5A06A 1T91A 1KWGA 2H4YA 1UOQA 1V1RB 4IXTA 2AEEA 1E7SA 3DJFA 3EVFA 4ZYUA 3RS8A 1J0EA 3I6BA 4JVLA 5HFJA 3VR2D 5HRAA 3EGCA 5JMTA 4FEYA 2OFOA 3V7YA 4D92A 3GZJA 1XZFA 2PKXA 4GM4A 4DMCA 3DE4X 1IXYA 4F9FA 2WTXA 2GTPA 1YQXA 4MVXA 3IEIA 4CMGA 4MW5A 3REFA 5LOVA 3OFSA 1M2OB 4KLRA 4EG7A 4JFAA 3PQ5A 2H0AA 1QRSA 1XA3A 3K53A 4M87A 3WMEA 1ZMBA 2JGIA 1XRPA 3CX6A 5GJBA 5K4HA 4AI6A 3IHTA 3ZXUB 4FVTA 4QTTB 4BNIA 1DRWA 3LWDA 2YNMC 4TRRA 1FBTA 1W6RA 3NHZA 5GAJA 3TKYA 4B8YA 3VKHA 2NU6A 3N5KA 1C0EA 1UK6A 3VV3A 3MSXA 1F48A 1EFRA 1L4LA 4YROA 1G3RA 5JAQA 4I50B 5AO9A 3OY7A 4G0WA 4DPKA 3FDZB 2P2LA 1EWTA 4KPYA 2WU8A 3JWIA 4IH4A 1H9CA 5ALVA 4KGXA 3AERB 4XARA 3PEYA 1I30A 1FJ2A 1SVNA 4X97A 4I5FA 1G8HA 2AR0A 5SY4A 5AMXA 3GXOA 5DYIA 3VM6A 3QKTA 3NCTA 1F8YA 1NLZA 2C0PA 2VRBA 3OSZA 5GTDA 2O59A 4GICA 5ALUA 3E3MA 1U4OA 5TPWB 1DAEA 4PFJA 3EODA 1R4MA 4K9PA 4KMOA 3PYMA 2MSKA 2OV2A 3CO0S 5FUVA 2V8OA 1CZNA 3HBJA 4RGBA 3GVPA 3C3CA 1SKQA 4BNHA 4HXGA 2FZKA 5GVSA 1JT9A 3T7SA 4Y2GA 3A9VA 1WW8A 2OBLA 1N6NA 1R16A 5B3JC 3K0KA 1NE2A 5KZMB 2NO9A 4Z3OA 2D3TA 4R8MA 5DBFA 3U49A 4M54A 4Q01A 1PJCA 1Y3CE 4I1YA 5CW1A 3UMSA 3L0OA 1U2EA 1WQ4A 5C2JB 4MIEA 2IYFA 2YH2A 1ZUNA 3FWHA 4DMHA 1X9HA 4QVKA 5K01A 4KXVA 5FOXA 3D4PA 3OFVA 1LK0A 1V6CA 2TMDA 1V6AA 3FKSD 1Q11A 1XLVA 1PJ8A 1YACA 3N2GA 1AVTA 4Q1AA 1H0RA 1X42A 5FWDA 3WNCA 4EPXA 3RT9A 2VEDA 3U3JA 4YACA 6REQA 3KXIA 1U0JA 1SQ0A 2RGGA 2XI4A 3IXMA 4B5KA 3UMMA 3PL1A 2IZZA 3KUCA 3WLHA 1RVDA 4EYGA 4NULA 4OSPA 1BXKA 3VPDA 1HEIA 5F2OA 5TF4A 4KPUB 1IBRA 1U63A 2PUGA 4FGSA 1UZNA 4C0KA 1EFVB 3VDQA 4NZPA 2ZBQA 1MDBA 5F77A 1H05A 3CG4A 2BTEA 4BE4A 1ZJYA 3ZVLA 3OQOA 1HC7A 3R6GA 5DJ5A 3BIFA 4TYNA 4B3GA 2CNDA 5LA6F 4YAFA 2XXBA 5CDUA 1KFCB 2Q5JA 5AXAA 5F4ZA 1Z6PA 4OHKA 3C3DA 3CR3C 3KJNA 4LZOA 4TMTA 5F2EA 4QM7A 3LNCA 2VPWA 4RD1A 3RIYA 3ZKAA 3T4EA 5KJEA 2EDAA 1GGKA 3OLXA 3THXA 3E9CA 2D5LA 2H3HA 1EJ2A 3F3KA 3IA2A 1AGRA 3H18A 4MQLA 3D2LA 2X9QA 3HVUA 3IR6A 3NAGA 3NNNA 3OQPA 3PEVA 3EWNA 2IXEA 2NXWA 1C8VB 3GJRA 3JQCA 3E2MA 2J5BA 4X1KA 1GEGA 3QVVA 5AYVA 3TVYA 3LT1A 3PEUA 4LRYA 1GDDA 1HRDA 1H9AA 2BEWB 1NM5A 1W9HA 3MJDA 3JQGA 3NC1C 3MRVA 4PRKA 2NU8B 3AJ8A 4H77A 4B79A 5T4HA 2YKGA 5CH8A 1N36B 5CDSA 3KYCA 1BMFD 1ISGA 1GPLA 3EJWA 3IPLA 4E5PA 3H5RA 3EW7A 4YRNA 1DDIA 4BMPB 4BO0A 1T0JB 1VMIA 4Y6SA 2VAPA 1XQ9A 1COWA 2X9NA 4IHJA 2Q6KA 1N5IA 4DPMA 1PQYA 2AOVA 4EEZA 2B94A 2BELA 1OV4A 3GELA 3DW1X 3M1IA 4WCFA 5FOVA 4BTLA 2GLTA 1LQTA 1SN7A 3O93A 5JXHA 3K92A 5A0VA 1UDAA 5HFNA 4R3NA 3EGOA 3FW1A 4OEHA 3LYUA 3NNDA 3SHWA 4J7CA 4B71A 3GJ0A 3FTQA 4XSVA 3NHWA 4AP5A 1YUBA 2FEPA 1UP6A 1Y82A 3DYBA 3HJHA 1SULA 1Y8CA 1Z17A 3A28A 1J21A 3G1TA 3NCHA 2A8YA 1CUEA 3MJFA 1N7IA 5DYWA 4CMEA 1T4BA 2Z08A 5IC5A 5EQTA 1KOGA 2IIBA 1NURA 4XFJA 1Z0ZA 3ILXA 3SOZA 4BN0A 5CEFA 3GT4A 1JEQB 3EH1A 1P0PA 2I7XA 4HLNA 5ALQA 4HGPA 4N7RA 4OSOA 1IY1A 3K4HA 3FGNA 3WYFA 5C5DA 1SXJE 1OH8A 3ETNA 1VG1A 1V9LA 1NI3A 2JGFA 4MQ5A 2QZZA 1GKKA 3OHPA 2BDEA 3SFZA 3U81A 4FILA 4C4PA 1W48A 2YZNA 4FX5A 2QAGC 4MR8B 5D84A 1IEWA 2HK8A 2WYWA 1R2QA 3SY8A 4CM9D 4N8SA 4R16A 3HA3A 1GYPA 3L8FA 4UFOA 5AT1A 1NF9A 4YXWA 1OQAA 1AHHA 4N5MA 4OJYA 3TFQA 4CETA 3OPYB 1KY5A 4N0EA 1DEXA 1R0LA 3KALA 3GUYA 1A88A 3B9QA 1GUYA 1U8CB 3DE2X 3GVHA 1QZZA 2E85A 5AKEA 5FA8A 2H54A 4I1PA 1V41E 5H8WA 1XNJA 5IKEA 3D7SA 3NHMA 2YC2C 4JJKA 4BVAA 2Y0EA 3MXTA 3RH0A 2R44A 1UBOS 1QTRA 1JF8A 1HDOA 1V45E 2B9VA 2OD2A 2VRNA 1RMQA 2J3MA 1Z3CA 3R4CA 3LC1O 3WGTA 1XMJA 2ZIZA 5TRTA 2H2IA 2FRDA 2WPDD 1AC5A 1SOMA 1OLXA 3U4AA 1SUSA 3UG7A 5C1PA 1TEHA 1QQTA 2FW6A 3C8MA 3A4LA 3B48A 3JD1A 4M76B 5KVAA 1RWKA 1T9CA 4W5WA 3VU8A 3ZS8A 4U7WA 1JIKA 5CCXA 3FUUA 4HVAA 1REQB 2EJBA 1FYDA 1OYOA 2ZUSA 3DCNA 4M9UA 4MA4A 3HM2A 2ZULA 3PXGA 5KOJA 1Z74A 1RYYA 1XHFA 1ZSNA 2FHPA 2VUSA 3O0TA 4X90A 4OXXA 5EFZA 4JLAA 3UC9A 5IYZB 2AJDA 1NJFA 2R6AA 2ZK7A 3CLRD 3KWLA 5IF9A 1IHXA 5F5XA 4F38A 5J5CA 5CD9A 1QK4A 3OAAA 2QRQA 1DWPA 2PNJA 4DYHA 2AN5A 2CNBA 2ZTUA 5JPDA 4KU4A 1YO6A 1U8AA 1XQYA 2P6MA 1JAIA 3GRCA 3L8MA 3QVLA 1SC9A 4OPMA 3B7WA 3MUOA 4LISA 4AVYA 1R6BX 3H4MA 4LC0A 5HDQA 4DCTA 3A14A 2B69A 2ZJ4A 4J8PA 4PLPA 4YT2A 2I2DA 2OBYA 2V7QD 3K09C 4Z99A 4DA9A 4RTPA 1HWYA 1FJHA 4FYWA 3WGQA 4MWGA 1QRUA 3IV9A 4RMHA 1E9BA 3VR0A 1E3EA 1KYTA 1P9OA 2B78A 4J0CA 4BCDA 1M1YE 3OUTA 2FDRA 2N46A 1L7XA 1WXFA 2Q3FA 3D43A 4JR0A 2CLOB 3WNDA 4BKRA 4ZO4A 5LMNB 1X9IA 1YDGA 5D3ZA 1PSWA 3GH3A 3KHKA 4BXOB 1CJSA 2JIDA 3CUEF 1KOFA 1WDMA 3JVIA 5ALFA 3RJ5A 1EDBA 3A1DA 1A9PA 5ISMA 2NU6B 2RAUA 4IRXA 5ITZA 2MSCB 4B7XA 4D43A 1CVRA 3QOYA 1LRLA 3GEPA 1UBSB 3SIRA 1U9IC 5LD2C 4GPZA 4PG8A 5FPSA 1GNLA 1KMMA 4BJHB 2FUNB 4MA5A 4URHA 2I7VA 3VR3D 2Y1KA 1FP1D 1LC0A 3E8SA 4H6PA 1MX5A 5KVQA 1I6WA 4QTUB 5FI0B 3PXUA 3TVTA 2HYDA 1DDGA 3EQ8A 4D74A 4H7FA 3HP4A 1Y7HA 5AXBA 2RGNC 1VYVA 4YHHB 2IIPA 2VDQB 2GPSA 4G5FA 3KKKA 4G6ZA 2A9OA 4QUBA 1A27A 4JI4B 4ARVA 4GWLA 3NUGA 4RY2A 1DZ3A 2VF2A 2Y1EA 3PPYA 4QDJA 4UJ3A 1H3EA 2BW0A 3A7EA 1RZVA 2HIHA 4WXMA 4D8TA 2XYHA 3MRXA 1GPKA 1P60A 5J2UA 1CRZA 1G5FA 5IZCC 5JWHA 4RJJA 1B26A 1TJ5A 3EQ9A 5CUQA 2DBVO 2Q7DA 1PV1A 3SQOA 1I36A 2PEZA 5LKRA 1JHZA 1QGDA 4KQ1A 5A5EA 4J3JA 4PFKA 4QPZA 4TKZA 3N2GB 4L4RA 1J1ZA 4LDPA 1Z07A 1LX7A 4TL9A 1II8A 3M6XA 2ADMA 1KR2A 1GU7A