4MH0R

Selective activation of epac1 and epac2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
162
structure length
150
Chain Sequence
EYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLAFLESSAKSKINVNEIFYDLVRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/gtp-binding protein
molecule keywords Rap guanine nucleotide exchange factor 4
publication title Selective activation of Epac1 and Epac2
rcsb
source organism Mus musculus
total genus 39
structure length 150
sequence length 162
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4mh0R00
2XXAB 4RCYA 3OE7D 4UXJA 2F55A 2VHTA 3GLGA 1CR4A 3KXLA 2IYWA 3ND9A 3OE7A 1M6NA 2RKOA 2FGKA 5GVSA 4HUQB 1QDEA 3KB1A 2C9OA 4Z54A 2P67A 4DB2A 1MABB 4JLVA 4JJZA 4C4PA 1II9A 2KI5A 1IAQA 1XDBA 2LWIA 3U6KA 4KO8A 2JJ1D 1SXJE 2QUZA 3AKYA 3CRW1 3MFYA 1R8QA 3LW7A 2RGXA 1UDXA 4QGAA 2ZJ8A 5EE9A 1P61B 4PC6A 4DRZA 3FYHA 5TY0A 1H8HD 4A8JA 2CL7X 1QHHB 5AWFC 5AUOB 4RD4A 1BOFA 1H8HA 4D4KA 5BN4A 4PAQA 2GXSA 1KMQA 1OB5A 4M1KA 4PC7A 1E2LA 1FX0A 2QT0A 1E0AA 3T5DA 2N46A 4WZAE 4PO9A 4CDGA 4UNRA 1GITA 3QI2A 3KXIA 4XTCS 1EFTA 4HDOB 5L3RA 3SYKA 4CEIA 4G5RA 2AD1A 4JLAA 1OLOA 4KI0A 2JJ2D 2A7QA 5KDLA 4Q9HA 1W2GA 1U99A 1WE2A 2AK2A 4DVGA 1Q1EA 2JJ2A 3PCRB 1E3MA 1VHLA 5HPYB 2CEAA 4BGDA 3AKEA 1G3IA 1AS2A 1EXMA 1OJLA 3NDPA 1KK0A 3QF4B 3T1OA 2WAYA 2W2XA 1FUKA 4M9ZA 4MKFA 1U90A 4PHTA 3CH5A 3R8CA 2O8FB 4KHZA 2FEMA 4P4UA 1U8ZA 1XTJA 3UKDA 2OM2A 3W6PA 2BMFA 3N70A 3SEAA 4U5XA 5JI3E 4IHQA 1E9CA 1ZIOA 4AKGA 3SC3A 4HAUA 2ZI3A 3SU8A 1DE0A 5FOSA 3ZDQA 4ACAA 2ECKA 3BD9A 3TW8B 1Z47A 2ASEA 3QKUA 2NMVA 1IBRA 2PBRA 4KVAA 5F9FA 2I3BA 1IY2A 1CXZA 2BEJA 2R6GA 1NNEA 1ZIPA 3BERA 4ERNA 3GJ8A 1IY1A 2GXQA 2ZJYA 1B0UA 4GZMA 3S1AA 1WB9A 3JZMA 2OE2A 4IVPA 5K8LA 3W5JA 1JB1A 2OUKA 1U2RA 3VHXA 1XXHB 2ZYVX 3NIBA 1EFUA 1L7VC 4B74A 1W36B 1GILA 5KNBA 2QP9X 1GL9B 2WJGA 3CR8A 3BH0A 4HB0A 3RANA 4AKEA 1G3UA 3E70C 2QPAA 2WIBA 2J0QA 2BBOA 4BFUA 4Q18A 4Q1CA 4GBMA 3ADDA 4D0NA 2F3RA 1XJ0A 2FSIA 5CLQA 1JBKA 1M1YE 2PZEA 3WP0A 1DAMA 1KNXA 3HU3A 1WMSA 2CHGA 4IXNA 3IEUA 3LV8A 4P4SB 1Z63A 2QBYB 2VHUA 2KBFA 3O8RA 5DI3B 1ZRHA 1BIFA 3AF3A 3CB4A 5DLQC 1RKBA 3QPVA 3BFVA 2HCJB 5BYJA 1WF3A 2DYKA 5EP1A 3NG1A 1VKJA 3FKQA 3EA5A 1KAOA 2AXNA 1LY1A 2OFXA 1VCOA 3GJ7A 3TQFA 2P5TB 3B9QA 4J0QA 4A8JC 3LY5A 1T0JB 2GF9A 2OG2A 3EZ9A 4PPNA 2GK7A 4QKQA 4LV8B 2CHQA 3EZ6A 2HXSA 1P9RA 3C7KA 2EU8A 221PA 4M0LA 5IHPA 5G41A 1N6NA 1M2OB 3BS4A 3CRQA 2Z43A 4UNNA 3KQHA 4EFNA 2IW3A 1ZUHA 2G0TA 3DOEA 1N6OA 4KVGA 2ZE6A 4NONA 4I1OA 1UPTA 2RAPA 1MRSA 3DPUA 3ND8A 2XZLA 2IYLD 1VG1A 3A4MA 1TQ6A 4NP6A 1UBGA 4Q1BA 1T3SA 2N42A 1F48A 2MMCA 3A37A 1KSFX 4Q1DA 4XIGS 2BC9A 2X19A 2V9PA 1CR1A 5IRCD 1QHIA 2QM8A 4JKIA 4TZ0A 2GRJA 3ZVNA 2AR7A 2DFLA 4JBXA 3CKLA 2XJ4A 2FFBA 1YZTA 3MGCA 1GG2A 1N6RA 4IOJA 4BFSA 3K8YA 4YQFA 5L3QB 2Y8EA 4US2R 1JR3D 4KXFB 4C0SA 3F8TA 5BN3A 4WZ6A 2Q3FA 2CVFA 2QTFA 1JR3A 2QAJA 4NCIA 2HJGA 1E98A 4PR0A 5F2EA 5HKKA 3W90A 3H4MA 1YZLA 4FI3C 3I32A 4IRUB 4U00A 4URUR 3NXSA 2BMDA 1R5OA 4B2IA 1SXJC 3FGNA 3CX6A 4OQLA 4OJKA 3LQRA 1Q1BA 3PUXA 3P26A 4UKDA 3I3SR 2D7CA 5SZHB 421PA 1Z8FA 4Q4AA 1N6LA 2NPIA 5KSZA 4EIWA 2J87A 3QXJA 4XWKA 5IF9A 2QTHA 2LKDA 3IIJA 4Q1AA 2F1IA 1E0SA 3OIYA 4PAMA 3CRMA 3OIUA 3K09A 1SVKA 5FPTA 1SVMA 4BE7B 1JNYA 2EFHB 4DLTA 4W5HA 3WXMA 3WHLA 2HJVA 2GJ9A 4IOLA 4DUGD 1VCNA 2GVZC 3ZS9A 4FW9A 1GP2A 5HE9A 1VPLA 3BBPA 1L8QA 4HLUA 1PUIA 2FU5C 4TYPA 4G1UC 1DAHA 1P2VA 4JSTA 4PPQA 1XTIA 2EFEB 4A0FA 1E2IA 3K0FB 2RB4A 4HZUB 4RFSA 1OYWA 2ZRLA 2J7KA 4QBFA 1OFUX 1Z5ZA 3WHKA 1E9BA 1E4VA 5LD2C 1D9XA 2FPLA 2PT7A 3CR7A 1CJTC 3U4QB 4Q4JA 3QPWA 2GETA 3RABA 1CF4A 2HV8A 1CR2A 3W8NA 4V03A 1W47A 2B7CA 1GVNB 2RGEA 2XZPA 4BZQA 3KQUA 4DB4A 2F3TA 1N0VC 4KAXA 5AJXA 1M8PA 4TMVA 3HYTA 3VKHA 3FOZA 1P73A 3K9GA 5JI2E 4LV5B 4D26A 1FQJA 3LBIA 5TB5A 4Z51A 1T5LA 2BCGY 2F43B 5FUVA 1UJ2A 3H1TA 2WPDD 1E0KA 3TGPA 1IN4A 1OXUA 2CLSA 2ZETA 5HR5A 1VMAA 1HEIA 3L82B 2WWFA 2IBMA 4JIMA 1Z06A 1S9HA 1D9ZA 1DOAA 1ZUIA 4A6XA 2FZLA 3H84A 1G3MA 5KNCA 2K5UA 5JWRA 2OLKA 3EG5A 5FPHA 3T12A 1J8YF 2FDCA 1W44A 1IN6A 4OHVA 4QC2A 1L4UA 4ASUD 4IEIA 2BKUA 3AGPA 2QP3A 1TQ2A 3PEYA 3CRRA 1FTSA 2R8RA 5CK4A 2NOAA 3PENA 4JYCA 4ASUA 3AVOA 3UATA 4PPGA 5KDOA 3B82A 1VECA 2UKDA 1CJKC 1S3SA 1MRNA 1G291 4BEJA 3RC3A 1TTTA 2G77B 1P5ZB 2V3CC 2RCNA 3DM9B 3EZFA 2GCOB 4DEXA 1NN3A 1ZM9A 5HZHA 3K70D 3QG5A 5B2ZA 4A8JB 5E7JA 1KSHA 4ZI3A 2WOJA 4Q7KA 2QA5A 5DO9A 3X1ZA 4QNMA 4Y0AA 4NPHA 1GL6A 2VYFA 4BLSA 3FVQA 4NBSA 3IKJA 4XWAA 4YONB 1L4YA 3WBKA 2OBMA 4DJTA 5J4KA 4TTPA 3V00A 1G7RA 3T06B 2EQBA 2IF0A 1A7JA 4DDVA 1TU3A 2V1XA 3P20A 4AKHA 1M7HA 5FTMA 4F7WA 4URXR 1SVIA 4DLZA 2QRNA 1U8YA 1I4LD 2OCYC 2VIIA 1X86B 2XITA 1HTWA 1G8PA 1ZU5A 4RD2A 5FH9A 1TF2A 3B1ZA 4LRWA 4O25A 2A3RA 721PA 2FOLA 3AKCA 4HAXA 1YJ5A 2NO6A 5FBLB 2OFWA 2CE7A 1NVXQ 2XTNA 3TR5A 3TSWA 4HLUC 2Z4RA 3IHLA 1KO8A 4NCJA 1IQPA 3B1WA 3LWNA 3SN6A 3KQNA 1E2MA 3MWJA 2JGNA 3UWKA 4C0BA 2GAAA 2PH1A 4B32A 2JLZA 1NN0A 3QQ5A 3GPLA 3KFXA 3X1XA 3GLIA 1T9HA 4Q19A 4Q1EA 1NJGA 2FZ4A 2WM9B 4QNRA 2G1KA 1K5GA 4HLDA 3ZGXA 4QM6A 4WOPA 2O8EA 4PSVA 5LB4A 1XU4A 3ZH9B 2H17A 2WWYA 2CXXA 2GILA 3HDTA 4R7ZA 1MOZA 5JWOA 1F5NA 1SXJB 1LNZA 2G9NA 5B58C 2CVHA 4Q01A 4AC9A 4IEEA 2ZXUA 3BWDD 2O52A 1VHTA 3EWAA 3CWQA 3VR3A 2EVWX 4YDSA 1G9XA 4DLXA 2OEPA 2QNRA 2R2AA 3TAUA 2JJ8A 4B2LA 2RGCA 3L43A 4V0KA 4AYWA 3SDZA 1H8ED 5FBQB 4LYHA 3S1AB 4OKSA 3VTKA 2D4HA 4EUNA 3QKSB 5JS7A 1E2EA 1H8EA 3R9WA 3U7GA 5DNYB 4G01B 4Q03A 3Q7PA 2CCKA 3QBTA 2IUTA 4M1TA 5G3ZA 4DC9A 1Q12A 4JBYA 4O3MA 2X2EA 4OI4A 2IYQA 3WRXC 1JJ7A 3LRPA 3RHFA 4PPFA 5JECA 1XZPA 1ODFA 2HLDA 4LJAA 3WBJA 4E09A 2BBWA 1J8MF 1IXZA 2CLDX 4Q48A 1XEWY 4LK2A 1FOEB 4FMCB 1IN5A 5EE3A 3G0HA 4YC7A 2OO7A 3D3QA 3HU2A 2F7SA 3TQCA 3HP1A 1YZQA 1OSNA 2JEOA 1IXSB 1E2DA 2DFNA 5GJWC 2GCPA 2QE7D 2O8BA 1P75A 4ARZA 5LD2B 2IUSA 4Q47A 2BWJA 2ZJ5A 5G53C 3FMFA 1OH5A 2OCBA 3TAHA 1TADA 2QE7A 3QIAA 1RPZA 4PANA 3LX5A 1ZUNB 2AFHE 3KKNA 4LPKA 3LBNA 4L4UA 1Q57A 2NO1A 1TF7A 3NHAA 5TXGA 2ERYA 2IWRA 1F6BA 3LD9A 1XEWX 4UXHA 2P3SA 1XWIA 2YNMA 5G40A 3ZD6A 1G8GA 1EWRA 2WIAA 3C14C 4ON9A 2VF7A 1P2TA 3GLHE 1ELOA 5DIFA 2REOA 2HT1A 1CS4C 5GADl 1V5WA 3RS0A 2IHBA 4OQMA 1Z3IX 4TMTA 2EW1A 1BH2A 3LLUA 1R7RA 1R0ZA 1KY2A 4LY6A 4DT1A 2VP0A 4IDPA 3PG5A 3CX8A 4U02A 4OHXA 2WWIA 1SKQA 2GAOA 1CULC 3ECCA 4MYUA 5AJYA 1OFTA 2FA9A 1XP8A 2FFAA 1JAHA 5KU1A 2BEKA 4LV6A 2WV9A 4DLWA 3UANA 4B44A 5BXQC 5CITA 4E07A 2R6FA 1QHSA 1MT0A 5GJVC 2JIZD 1XD2A 2GNOA 2O8DA 1ESMA 5C2JB 2XAUA 3TKLA 2YINC 1IONA 2Q0HA 2JIZA 3U7HB 4XVUA 4YMSA 2N1BA 1SVOA 3H2YA 2C77A 3K9LA 2VL7A 5HCNA 3ADCA 1I2DA 1JPNA 1QVRA 3IUYA 2QGNA 3HYRA 2OZEA 4EJSC 5K8UA 1G3QA 1DO0A 4O2RA 1RRFA 1NMXA 3SE0A 4B73A 4TYWA 1E9AA 1NY5A 1TF5A 3CO5A 3MG9A 2GJAA 4NYIR 4TQAA 2AHOA 2IYYA 4G0NA 3KKMA 2QQEA 3UWOA 3BH7A 3DMDA 2GBLA 3H0KA 1YZGA 3VKWA 4LYAA 2A5DA 1AKEA 4TYYA 4GOXA 1EFCA 2FX3A 1WCV1 3GLGE 2IYSA 5LPNA 1IJFA 2CJWB 3K9HA 4JLMA 1GKYA 2J41A 2RGNA 3ZZTA 4EPXA 2VO1A 2ORWA 3WMGA 4PFSA 3A6PC 2QP4A 3D31A 5CM9C 5EP4A 3GLHA 2KJQA 4LCBA 3FWYA 3VR2A 1R8SA 3BGWA 3HPQA 1JI0A 1G17A 4URWR 5E7MA 3G5UA 4QJ3A 1OIWA 1Z2AA 3R20A 1NLFA 2H8KA 2MSDB 2C95A 4RKFA 1Z0IA 3LX8A 2WJHA 4GMDA 4ZIRA 3KQKA 1KNQA 1II8A 4PTLA 4ITRC 5H1YA 2HXYA 4HAWA 3T5GA 1U8AA 4TMWA 3RNLA 3B13B 2ZIAA 1DG1G 4JL5A 5TV2A 4BZXA 5FI1B 3U2QA 2ZSEA 1SVWA 1XJQA 1ZNYA 3MWKA 1RJ9A 1KO5A 2HT6A 3AGQA 4KFSA 3THYB 3KX2A 3T35A 4M1MA 1Z22A 2W58A 2ZROA 5AUPB 4XH9B 5GJBA 1XF9A 2BVNA 1KJZA 1Z0FA 1E32A 1ONBA 2OBLA 2Z4SA 1RIFA 2EFCB 4WIAA 3C41J 4GI7A 1N3BA 2QRZA 1NLZA 1E0JA 2OT3B 4C7OB 3B8HA 8OHMA 2E9SA 1MH1A 2FSGA 2GXUA 4NYMR 4XVQA 1XX6A 1G4AE 2XNDD 3VX4A 3CUEF 4DLRA 1GUAA 5AJWA 2V54A 2F1HA 1N6KA 3FB4A 2XNDA 4X8MA 2X2FA 4C0QC 5JS8A 1E9FA 1KJYA 4CEJA 3I61A 1YRBA 4Q4HB 3VAAA 2ZRPA 3QXSA 4KFRA 3TUIC 5J47A 4E03A 1E2KA 1T3HA 4LBWA 4URYR 5SZJA 3VFDA 4LC1A 1P4SA 3Q5DA 4B33A 3U3RA 1S3GA 3BFXA 2ZVQX 3P1JA 1DG3A 1VIYA 1W5SA 4QFMA 3E5HA 4BFYA 1U0HC 2DWQA 2JLWA 1I2MA 4G3XA 1IXRC 2P65A 2SHKA 2ZRDA 1W4AA 4L9WA 3AEZA 1XTQA 4CVNA 3RYTC 3I73A 3AUYA 4A82A 2AXPA 4TLDA 3L0IB 4HAZA 1Q0UA 3HWSA 4NYIQ 4QBIA 4WVFA 5D3MA 4C0AC 3QPUA 1E9DA 1US8A 2JJ1A 3FMPB 2Q21A 1SQ5A 1XTKA 1KDPA 3CBQA 3EIHA 4JVNA 3WNBA 1WA5A 1DARA 2YZ2A 1H65A 1DAEA 1Q22A 1UADA 3A36A 4G5GA 2ZRCA 5H70A 4G5OA 3CZQA 3T15A 5A4JA 2GXAA 4JLBA 1P72A 2VP5A 3W3AA 4JL8A 4N0DA 3AF0A 3U61B 1Z0AA 4DCTA 2OXRA 2WOOA 3SR0A 4OHYA 2BMEA 2PX3A 1G20E 2NO9A 1ZC4A 3QBVA 3SFZA 3VMFA 5KSPA 4GL2A 4RY2A 4A2WA 1XPUA 4D4MA 1P6XA 2ZS7A 4MYCA 4ACBA 1KKLA 3UIEA 3IEVA 5HTKA 4BRUA 2OBNA 2YOHA 3K0CA 1KSGA 3CPHA 2FPMA 1K8RA 2A9KA 1W4BA 4GP6A 4QGFA 2GDJA 4DLSA 1Z29A 4ESHA 2XGJA 5DYGA 2IA5A 1RFLA 2DCUA 4ZI2A 4FMBB 4BLRA 3EIQA 4URVR 2MSEB 4KLZA 3CNOA 2AKAB 1G64A 1TNDA 3KDSE 2IXEA 4R98A 3AQ4A 2BJVA 5GVRA 4AURA 2ZRJA 5L8VA 4XD7D 2ODNA 3QOFA 5EXXA 3L8YA 3D6TB 3RDPA 1XB2A 1JXOA 1E2GA 2QMOA 2ZYUX 4QJ4A 4ZCIA 5C4MA 5C18A 4XD7A 2AX4A 4PC3A 2ZTSA 1F2TA 4AWXA 3QE0A 2WKQA 4B3BA 1E4YA 2QMHA 3U3KA 4L16A 4D82A 2HYIC 3KKPA 1KGDA 4EJSB 5KPJA 4W7SA 1IN8A 4EQ6A 3GLFA 1XJCA 1JALA 4HI0E 3GJ5A 2D2EA 3I8SA 1ZAKA 5H68A 4IW3B 2P6RA 5L3VA 3RS5A 1DELA 4AY2A 1JJVA 1VCIA 2Q9CA 2YV5A 1U0JA 4NZYA 2QSZA 3KUCA 2C99A 2WKPA 5IT5A 3FKSD 3ETLA 3CX7A 1KMHA 1ZD8A 2ZREA 3UG7A 3WMEA 3FKSA 1OT3A 1XNJA 3L0SA 1PUJA 4NE2A 2FJUA 2OFOA 4LBZA 4EPWA 4KYUA 1QHGA 4F91B 3I5YA 3OEHD 2Q6TA 4OQNA 1P2SA 3JZAA 2QI9C 1Q20A 1OH8A 4QL3A 3OEHA 2GJ8A 1AJEA 3EX7C 4KU4A 3CONA 5JSZB 3FHTA 2O8CA 2PCJA 2NTYC 3RS4A 5H8WA 5HCIA 4QHSA 4CIDA 1G4UR 2IHYA 2ZJ2A 3KQLA 3BC1A 2CK3D 2DWOA 2F9LA 2AFIE 1G18A 1JR3E 1OYYA 3IPXA 3KKQA 5FL7D 3JVVA 4LYJA 5GJCA 4E22A 4XWOA 5IK2D 6Q21A 2CK3A 1KI6A 2ZJAA 3I8XA 3M0EA 4TMZA 1HY3A 2WAXA 4LDJA 5FL7A 5IK2A 1V43A 2YOFA 3CF2A 5EE1A 3K1JA 1KK3A 1T3LA 3ZVRA 1Q44A 1MKYA 4BWYA 1XFAA 1F3OA 1HT2E 2QEQA 3GCGA 4PHFA 3BRWD 5FL3A 4BRWA 1XD8A 4YDHB 5JLJA 1ZYUA 3ASYA 1FPMA 4H9GA 2VSXA 1HT1E 3TNFA 1KO7A 2OAP1 2YC2C 1CU1A 3FFAA 2J0UA 4DCSA 1E96A 3NVAA 3WYAA 4EKDA 4LHZA 3KXKA 2H18A 1VCMA 3P4XA 3ZVLA 4MYTA 3QVVA 1ZM4A 2ZJOA 3SZRA 1W49A 3HU1A 4MGZR 1X1SA 4FMDF 4HB2A 3NBYC 2GHIA 4Q9JA 2ZRAA 3UMFA 2XEXA 3K53A 3WY9A 4TYNA 4I81A 4KFTA 2ZR7A 5L3SA 1N5LA 3K0CC 4A92A 1OKKD 1S0UA 3C5CA 1T4GA 4HATA 4NYJR 3RRYA 4DT1B 3UXMA 3OIVA 4F93B 3A1VA 1OKKA 4OYHA 1P2UA 1ZMXA 4JS0A 1NMYA 4WW0A 5LBIA 4B43A 1Z08A 2ZUBA 3IPYA 3VU9A 2PEYA 3THWA 1OF1A 1R4AA 3Q85A 2WWHA 3ZLJA 2PMDA 3KL4A 3RS2A 2IYVA 1BYIA 1COWD 3FFBA 2PZGA 2R9VA 5KSYA 3DZ8A 1XD2B 1P9WA 4C9BA 1COWA 3BORA 1PVOA 2O8DB 2H1LA 2X77A 5KUTA 1HH4A 2PJZA 2D7DA 4W5WA 1D2MA 2RGDA 3E1SA 4GDFA 4MGYR 1DTSA 3VQTA 2WJVA 2WJJA 3W6NA 1GDDA 3RSLA 2HF9A 4TL6A 3GFOA 1DVRA 1GNQA 4V0ME 3AVWA 2ZI9A 5B30A 3B1YA 4NKRA 4OQFA 2I4IA 1E2FA 2WMNB 1NVVR 2J0VA 3BK7A 2P0EA 4RZ2A 1TU4A 4UQOA 5F98A 2BKEA 4IOKA 2QORA 3EPJA 5E3HA 3AVUA 1ZC3A 4B76A 1J99A 1OW3B 2XB4A 4GPTA 2OHFA 4M9QA 1X6VA 4TLAA 3CPEA 1LS1A 1Z0DA 1Z6AA 4MYHA 1GKIA 5JCPA 4RD3A 1D5CA 3NKVA 3P4YA 2QGZA 1O87A 3DVLA 1KZ7B 4Q7JB 4CYMA 1N6PA 3KTAA 1GZSA 3ADBA 3B1XA 1II0A 2QM7A 4Q7LA 2WWGA 3GLHB 4DUGA 1D2EA 1SVSA 2PX0A 4RVCA 2V1UA 3L0PA 1RRCA 3ZQJA 1FMLA 2C5LA 3NH9A 3TK1A 2P2LA 3GEIA 5J4YA 3Q3JB 2B7BA 4IXMA 4KYIB 3BIFA 4PAOA 5EXSA 3EW9A 1Z0JA 2GEDA 4RCZA 4Y0VA 1II8B 2ZU6A 2IL1A 2DPXA 2V6IA 3IHWA 4U7DA 1MR3F 3K0SA 1Q21A 2IXFA 4GNKA 5EJEA 3ICEA 2QMEA 1GL7A 4M53A 4FWTA 3B2EA 1FQKA 4YMWA 1YKSA 1NSTA 4PQFA 1AKYA 4JVSB 4CT5A 4XOIA 1ZVQA 4IOMA 1RJ9B 2ZYWX 3QKTA 1T91A 1KI2A 3A1SA 4TLCA 3SBDA 1Z28A 2IXGA 4NH0A 4US0R 3AUXA 5FBVB 4A0RA 1GOTA 521PA 2Q3MA 2CNWD 4DSOA 3CNNA 4Z8XA 2ZI6A 2VA8A 2XOKD 5EXTA 2JLSA 2HCBA 1KDOA 2CNWA 1XCMA 2H57A 3EIEA 5EUQB 3ZIAD 3F5FA 2LCFA 4MKIA 4LSGA 3B60A 4RD1A 2XOKA 3DKPA 4V0MA 4XJXA 2BDTA 3ZIAA 1T8TA 1TEXA 4BZPA 2WPDA 1D2NA 1NVUQ 3O8BA 2GZHA 3WNDA 5CM8B 3U3JA 1RYHA 1E69A 3W8RA 1NI3A 4LJ5A 1ZNXA 2C8VA 2FF7A 2PLFA 3MCAA 4OI1A 2XTMA 4TYQA 3GLGB 1OV4A 1YR9A 3F3YA 3TLXA 3VKGA 3DO6A 2C96A 4BFXA 3IIMA 1NVWQ 2MSCB 2VLIA 4QG7A 5JCZA 2OAQ1 3THOA 2ANCA 3GLIE 1Z6TA 4QXAA 4YLGA 2CLCX 3C16C 5FPKA 4LHXA 4LZZA 2V7QD 3MWYW 3THXA 1UBCA 4HUQA 3RRMA 1X3SA 1ZM3A 2YHSA 4Q00A 2V7QA 4H1VA 2HUPA 3B9PA 3GP8A 1UEJA 2Z6VA 3U60B 3GJ0A 1MABA 2WICA 4OBEA 3TRFA 2F1RA 3V4FA 3TMKA 2BM1A 4UXIA 3PXGA 2H7VA 2OCPA 2LKCA 2QT1A 3U44A 4D80A 1BYUA 1E9SA 4B47A 4W5JA 4MKGA 1I4DD 4JJKA 1FX0B 1RW4A 2JLQA 4HUTA 4M9SA 4OK5A 2P5SA 4S35A 5BYKA 4BFTA 3WP1B 1ZINA 2B21A 4LX0A 1ZNZA 3EPLA 2R44A 5KYKA 2IF2A 3NWJA 1KO4A 1GRQA 1YVDA 1Q3TA 4WXRA 4CEIB 3T1TA 3Q9LA 4MDFA 5AUNB 4GOKA 4URZR 2JLVA 2IUUA 5FTLA 3K09C 3MWLA 4DCUA 3EXAA 1EX6A 2KE5A 2ZVPX 4JLNA 3QUSA 2XTZA 3EA0A 1N5KA 3IBGA 1G8FA 5FOWA 5FFMA 2XZOA 2AWNA 5E95A 5FOUA 3K0EA 1KDTA 4B3XA 2NO0A 3IDQA 3AVTA 4F4JA 4HAYA 4A2PA 2HYDA 2DY1A 2CDNA 4G5SA 1Z6GA 4Q66C 3GMTA 3TR0A 1KI9A 1JR6A 1FUUA 3LAWA 2R62A 4OK6A 4D25A 4K8OA 3VR1A 4BPBA 5KOYA 1OXVA 1F2TB 1KK2A 2O8FA 5AR1A 1W0JD 5BW8A 2VSOA 3EZ2A 2WWWA 3KB2A 4IDOA 5HE8A 4C0KA 1GRNA 4L9SA 3UG6A 3TVTA 3PITA 4K81B 1BMFD 2YJTD 5F3WB 1S1CA 3M1IA 5DYIA 4B3DA 1EGAA 2A5JA 1DBSA 3RAPR 1BMFA 1J2JA 1R10A 2FG5A 3SJAA 4MRPA 2J1LA 1E2HA 2GK6A 4JSYA 4RJLA 2V4ZA 2RH5A 4V0LA 1VG8A 1G1MA 2VQSA 2C98A 2TMKA 3G82C 3RWOA 1A1VA 2PLRA 2QN6A 4JVMA 4M4SA 4MKHA 2ZUCA 4JBWA 1YHNA 2HEIA 3OFND 2EFDB 2OCAA 4TL9A 3SJCA 1SULA 4JLPA 4L5BA 1P62B 2C9CA 4MUBA 2W0MA 3V4RA 4PZYA 1E1RD 4D2IA 4PO8A 1UBEA 2ZE5A 1W48A 1J7KA 1E1RA 4X8OA 4AG5A 1AQYA 2C2HA 4I1SA 2XJ9A 2C04A 5JJKA 1GM5A 2O8CB 3EARA 4QHYA 5JEEA 1QZXA 3X1DA 1VYUA 3WYGA 2FN4A 1ZBDA 3CW2A 1TUEA 3EWSA 3NBXX 5TMPA 2DHRA 4WAUA 2OLJA 5JRZA 3UPUA 2ANBA 3LVQE 4P4SA 2QBYA 3GJXC 5DI3A 4IDQA 4ABYA 2IYTA 4B3FX 2G1JA 5FPYA 2JLXA 1CP2A 4M21A 5JEDA 3Q5EA 1NG1A 2JA1A 4FCTA 3K70C 1SKYE 5JMTA 2JLYA 1YR8A 3SQXA 3A4NA 3FHOA 4PHGA 4DLYA 1YU9A 4A0HA 1F60A 1OH6A 1U98A 3HR7A 1LW7A 2FE4A 3IGFA 3O8CA 4NCKA 4TTQA 4US1R 4B2PA 3ZJYA 2ZRNA 5CB8A 5JBQA 2WVJA 4TL7A 2YVUA 1M34E 1UM8A 4ZPXA 1N0WA 3SQWA 1HE1C 1R0XA 1T8UA 3GEHA 3Q7QA 4OHZA 4W9MC 1RZ3A 2EYUA 3U6BA 1PV4A 3B78A 3U7FB 1R0YA 4TZ6A 1G7SA 1R6BX 3SHFA 4F38A 2B8WA 4IFEA 5FOTA 1CKEA 2J9RA 2GKSA 4RZUA 1ZCAA 4D4JA 2GTPA 2KWIA 1LFDB 5CYPA 1IHUA 1LV7A 4GOJA 3NC1C 2ZI7A 3SNHA 3AVQA 1KY3A 3THWB 2A5GA 1XD9A 4II7A 3SBEA 5TVKA 3NBZC 1E9EA 2O0HA 4YMVA 2KBEA 3MSXA 4Z8YA 3RS7A 3TH5A 2JASA 2ATXA 3TSZA 4KFUA 3AVYA 1LF0A 5BQ5A 5L3QA 4NL4H 1RC8A 3NEJA 4RD0A 3VNVA 2RMKA 4KCGA 1P3JA 1CJVC 1N2CE 4OJQA 4DKXA 2ZE8A 1JEDA 3IO3A 2DBYA 1M7BA 1SHZA 5CJPA 1KI1A 3VX3A 1IY0A 4Q9IA 3RLFA 2CL6X 2NIPA 4FINA 5FUWA 4NHOA 1PLKA 4QRHA 4Q4AB 1KTVA 2GA8A 2AN9A 1YR6A 3RC8A 4Q1FA 3GFPA 2PJRA 3A58B 2BOVA 3BXZA 3QKRA 4PZLA 4Q7MB 4ZKDA 1NMZA 2ZSDA 1E9RA 1ZW6A 1UAAA 1Q3HA 2QENA 2ZSBA 1OFHA 2KSQA 2CE2X 3B7GA 4DDTA 1FL9A 5KNDA 3ICQB 2J3EA 3J81k 5KHOC 1TMKA 2G0NA 3CWZA 3KTAB 1VTKA 3CM0A 2J5XA 5KTYA 1DAFA 4M2LA 1OXSC 4LJ6A 3CZPA 2JCSA 3SI7A 4I1VA 2W6ID 5DE3A 1KKMA 4MQBA 4BLOA 4FCVA 3PFIA 3BFKA 3GFTA 3REFA 1N25A 2GF0A 2W6IA 2ZQ5A 4HSEA 4RFSB 3MJRA 3SYNA 1LB1B 3AH8A 4IVQA 4F4CA 3K0FA 5JRJA 4AKIA 4CW7A 1GKUB 1AGPA 1SVLA 4HZUA 2ZR0A 5JHGB 4TMXA 2O0JA 2ZE7A 1AS0A 5FR1A 2GJKA 1S9DA 2JLRA 4Q4JB 5J4VA 1DADA 1VYTA 2ONJA 4DBLC 3OIWA 1WRBA 5TARA 3SJBA 3M6AA 2YWFA 3ADKA 4DDWA 1T5IA 4TTRA 1DEKA 621PA 4JYBA 2R6DA 3FMIA 2IS6A 1OB2A 3RVBA 1XRJA 1EFHA 4L15A 5KDDA 4AYTA 4P3YA 1QHXA 1C9KA 2ZITA 3DM5A 1J70A 5J4HA 2JAQA 3GQBA 2FSFA 1W46A 2ORIA 1JEEA 2ZANA 2FSHA 3Q72A 4I1UA 5G3YA 5K8TA 3LDAA 3QF7A 4HZIA 5JWHA 1HA3A 1SGWA 1HURA 1FP7A 1G16A 121PA 1AQUA 1U0LA 1A2BA 3KJHA 4HLCA 1UKYA 1O3YA 1RE0A 3OZXA 2ZRMA 5AUQA 3UMRA 4MDEA 5LDDC 5FI0B 2BCJQ 3RS3A 1A2KC 2QSYA 5DH9A 2QROA 3UMSA 2GCNA 5CYOA 4TSFD 1KDRA 5AJVB 4DHEA 3B6EA 2YC4C 3W9YA 3GLFE 1NP6A 2B6HA 3THXB 4TSFA 1WXQA 1QF9A 2Z83A 1E1QD 2XX3A 1K5DA 5EXPA 4Q5IA 1EWQA 4LJ8A 1OXXK 1E1QA 1U9IA 3LXXA 3AF4A 5DGXA 3TJZA 1KI8A 1XZQA 4MGKR 2WHXA 3TUZC 1IJEA 2YWGA 4P4TA 1OXTA 2ZM5A 4LYFA 3U44B 1KOFA 1AK2A 2IEZA 2GCOA 4EFMA 5D3QA 3K70B 4DIDA 1N6IA 4ZO4A 3LVRE 5FOVA 2GBLC 1NRJB 1KI7A 1W7AA 4XSGA 3EZ7A 1MO5A 3AF2A 4CEHA 2V55B 1ZM2A 2IYUA 5E7IA 2G6BA 4GP7A 3AM1A 2RGNC 1JQLB 1GNRA 2W83A 3LW8A 2KB0A 2WBLC 3BAFA 1JXMA 2EYQA 4QGGA 2D2FA 3N2EA 2J46A 4B3CA 3BH6A 3FDIA 5CDFE 1FZQA 2BBTA 1ZNWA 1W4CA 4DIEA 1T0HB 4XTRA 3DKVA 4A9AA 1NBME 1LF5A 2ERXA 2R65A 3AB3A 3QENA 4L8GA 1QG4A 2IS1A 3C15C 4RSGA 5C4GB 4PHHA 2QZ4A 3X1YA 2NGRA 2VHQA 4HB3A 3WYFA 4BUJA 3I92A 1ZD1A 4I99A 4NTZA 2V8OA 2WZQA 1IOZA 5J5CA 1R5BA 1NY6A 1RRPA 3DEFA 3EC1A 1G41A 1PLJA 4NYMQ 5CK5A 3U5ZB 5DN6D 1WP9A 3AVXA 4IDHA 3R7WA 3CNLA 1NJFA 4FXPA 1UKVY 3GLIB 5DN6A 3FE2A 4QBHA 3N5CA 4UJ3A 1XTRA 2O8EB 2E1RA 4FMCF 2R6AA 2I1VB 1X8LA 1KSJA 5JJIA 1VIAA 2CL0X 1JECA 3FPAA 5EE0A 4CZ2A 4LC0A 1SXJD 3DDCA 4A6PA 1W2HA 2IYXA 2X1VA 3GD7A 4JMPA 3PUVA 3CLVA 1N6HA 1SXJA 4PC2A 4RKEA 2Q9AA 5DSZA 3X2SA 3BB1A 1XMSA 1G5TA 2VP4A 4TLEA 3DOFA 4ZDJA 4JT4A 3CIOA 2IX3A 1NLYA 2GEVA 4NCNA 1NF3A 4OHWA 3KJIA 3HJNA 2CCJA 1E6CA 5B57C 5DHAA 3QKSA 1XCPA 1TL7C 4A36A 2JLUA 1X8JA 3O47A 1IN7A 3A1TA 1DAKA 3PUYA 2XB2A 4NMMA 5FPSA 2OILA 1G3RA 2F9MA 1G6HA 4DZZA 1YZKA 1YZNA 3MJHA 5CLLA 5CDFA 4GFDA 1NBMD 3PEUA 4TQUS 1C1YA 1I4TD 1W1WA 1XMJA 5J4LA 1NBMA 4BFZA 2BV3A 5J40A 2CMKA 4PQYA 1ZM7A 2E87A 4B35A 2NPFA 1HV8A 3MRSA 1GTVA 3BOSA 2X8AA 4DSTA 2O8BB 4ARZB 4DWJA 2WKRA 3M4YA 4PSKA 1XBTA 1KAGA 2ONKA 3B1VA 1JAIA 1R0WA 1X8KA 4S2EA 1GSIA 4CGZA 4B48A 1A82A 3NBFA 2CHVA 1S1MA 3ASZA 4DLVA 3PJRA 1U9IC 1KI3A 1CLUA 3BB4A 3TE6A 3ZS8A 5FR2A 1G8YA 2V6JA 3SJZA 2QY9A 4POAA 5FUYA 3AKDA 2J0SA 4ZV4A 3RSOA 2OV2A 1BO6A 4BFWA 1LS6A 2EWVA 4AD8A 1PLLA 4DLUA 3ZYCA 2GEUA 1Z6XA 2VF8A 1R2QA 2FWRA 1D8TA 2GVDC 1Y63A 4GT1A 4MGIR 5F9HA 3KKOA 4LJYA 1YQTA 5CJ2A 4EPYA 2QAGA 1ZP6A 1TQDA 2RHMA 3O8DA 4BASA 4JL6A 2BMJA 4RFVA 2ZSFA 4V02A 4P0TA 1E79D 1TUIA 2VSFA 1HE8B 4R2IA 1UDWA 1EFRD 2IT1A 4BLPA 3UK6A 3ZVMA 5DI9A 3QEOA 1GRRA 3ZD7A 1E79A 1XEXA 2ZSAA 3CPJB 1EFRA 3QG1A 3BE4A 4M22A 4KV9A 5ANRB 1AN0A 2D62A 1CBUA 2FMXA 3D8BA 4MRSA 3W6OA 1SHKA 1QVAA 2QG6A 1Z2CA 3SFVA 5DISB 3W34A 5ELXA 3SHWA 1S96A 2VBCA 2IEYA 4UNQA 4KSBA 2ZEJA 1N5IA 4MRRA 2RHDA 3P32A 3A1WA 1E94E 4IKEA 5AK0A 5FBRB 3FMOB 1G6OA 4BEBA 3IILA 4AK9A 2UVQA 1RRGA 2FV8A 2Z5FA 1F2UA 2L0XA 3QY0A 4EFLA 5HKKD 1YRAA 5FTJA 2W0SA 3WNCA 1FFHA 4JLDA 2D3WA 4C2TA 1EG7A 1GIAA 1G19A 2G3YA 2QTVB 2YWEA 1QRAA 4LPSA 4DCNA 1OH7A 2ZAOA 2O5VA 5JZVA 3T34A 2YOGA 2REBA 3EASA 1FMJA 1MV5A 4BFVA 5JFGA 2D74A 3NTUA 1SKYB 2P6NA 2GESA 3VNUA 4TN1A 5EQTA 2CJWA 3QKRB 2Q9BA 2J45A 1QBKC 2FGJA 3VR4A 1UKZA 3N2IA 5EP2A 1UKEA 4ZDWA 3VHLB 4CT4B 2IWHA 821PA 5KPDA 3L2OB 2GJSA 1NIPA 4D6PA 4ZIRB 1S8FA 1KZGB 2H92A 3MMPA 4M1WA 4AI6A 3CF0A 5FUXA 5FBWB 4WXPA 2VRWA 4LHYA 2YKGA 4LI0A 4MRVA 4V0NA 3PVSA 2W2TA 3V9PA 5K8IA 2PMKA 1Q1QA 3KJEA 3MLEA 4OL0A 3AF1A 4FD2A 5KSOA 1JPJA 1CJUC 2IYRA 1MO3A 3C4JA 3QVUA 3PUZA 2P6UA 2CCGA 5M04A 3AV0B 5CIQA 4UNPA 4WZBE 3E2IA 2GWHA 4Q21A 5UKDA 2VP9A 3CRVA 2FEOA 3TW4A 3THYA 2ATVA 1UFQA 3Q8XB 1D6JA 2ZS9A 3C8UA 4QM7A 2EFGA 4NYJQ 4E5UA 4JLKA 3TUJC 1Z0KA 2B92A 4B71A 2JATA 1CTQA 4MITA 2IS4A 1TX4B 2QL6A 4DCVA 4ZDIA 3NDBB 2REXB 4DDUA 1A4RA 1CIPA 2ODBA 2W00A 1S4QA 4C7OA 1LTQA 4XVRA 1LVGA 4P33A 4QGHA 5TDHA 4EPRA 1YZUA 4CEJB 1JQJC 2IK8A 4ILEA 3K0AA 3C5HA 4Q9KA 2XXAA 4JLOA 2AL7A 2Z0MA 3R8FA 4FN5A 4Q4HA 3QNUA 4EAQA 1G8HA 1GWNA 1NKSA 3EAQA 4PC1A 1EESA 4B3GA 1HQCA 3IBYA 1WBBA 2ZAMA 3HPRA 3T1VA 2C03A 2QAGC 3NH6A 1MO6A 1P9NA 3WMFA 2D06A 5D3MB 1NL3A 3P27A 1NVVQ 3CF6R 1US8B 1NKTA 2WJIA 3OESA 4C0JA 4D0LB 3DZDA 5FOXA 4YMUA 2W2VA 2IC5A 5SZIA 3VR5A 1M74A 1KK1A 4LJ4A 4O2LA 4X8LA 4LBYA 2QQ0A 2A30A 1VG0B 4GMXA 1QHHA 1FP6A 2OSBA 3A8TA 4JVLA 4QHTA 1XMVA 3U3OA 3IQWA 3LQQA 1UF9A 1CEEA 5EZ6B 1M7GA 2A5FA 4HYYA 4LGMA 4A15A 2BIFA 1XXHE 1FTNA 3BB3A 2QU8A 3LO5A 2PT5A 3ZQ6A 4MA4A 3GJ4A 4MH0R 4F92B 1X1RA 2OXCA 2ZI4A 1NG9A 1HYQA 2QMUA 2G88A 3EPKA 4IVRA 2NZJA 4B75A 2FFHA 4CEHB 4HAVA 4YXWD 2FPKA 4BQSA 4C0HA 1CRQA 4YXWA 3PEVA 1VG9B 3I72A 2ZJBA 4AIIA 4GZLA 2QPTA 4MRNA 4Q4LA 3MD0A 4TWZA 2UZIR 3TBKA 4EDHA 4C30A 2WTUA 2F1JA 3QF4A 2B8TA 1DS6A 3FHCB 3GJ6A 5IDVA 1E2QA 1OPXA 1W5TA 2NG1A 3FTQA 1C4OA 2WSSD 2ZRKA 3D7MA 4JT2A 4NU0A 4IDNA 4R9UC 2AD5A 3X1WA 2A78A 4BECA 2C9YA 4LHVA 4ZCLA 5FTNA 2WSSA 4IJMA 1G7CA 4PXAA 4PSAA 2EWWA 1W0JA 1G21E 1N5JA 4KJZA 2ZRIA 4TMKA 4CRWB 4G5QA 3LXRA 1TAGA 4TT3D 3R7WB 1VYVA 3IO5A 2YYZA 2FFQA 3U3MA 4EQ6B 3GLFB 5AJZA 4WA7A 4TT3A 1U94A 1GNPA 4EJSA 2VHCA 1OHHD 2GZDA 2G83A 3PQCA 1L2TA 3H86A 1E2JA 1GFIA 2ZJZA 2NZ8A 1OHHA 1XCGB 1CRPA 1AIPA 1XEFA 2H5EA 2ZUDA 4LBVA 5P21A 3ZZUA 1AZSC 4QJ5A 1KMHB 1XPOA 2H16A 1VDZA 1W36D 3OFNA 1J90A 1XXHA 4EPTA 4KITB 1TQ4A 2PL3A 3R9IA 1BKDR 4JKYA 3LA6A 4OQXA 3QXHA 2ZU0C 2VH5R 3DMNA 4Q9LA 4F4IA 1ZU4A 1ESNA 5BWMA 3IQXA 1Y3AA 3OHMA 4HB4A 4HLQB 3PR1A 2F6RA 2PEZA 1CJMA 4BLTA 3LLMA 2NO7A 4ZKEA 2GZAA 2ZPTX 4ZDKA 5A0FA 1XPRA 3B85A 2ZR9A 3WRYC 2NQ2C 4HDQB 5JSZA 3SYLA 1ZJ6A 4GRAA 4KBFA 2HLDD 1AA9A 3LNCA 1EX7A 1KYIA 1KI6B 1KJWA 1NSFA 2O0KA 4M9XA 2BBSA 2ODWA 2ZYTX 4KLNA 4M1OA 4PQRA 5EZ5A 3HR8A 4A1FA 4LJ9A 2BJWA 1Z6YA 4OI0A 2DB3A 1HQYE 4KBGA 5HZKA 2ORVA 1P60A 2AKYA 3KFVA 2VP2A 5LB2A 4TL8A 1DPFA 3T61A 2C78A 2MMGA 1WBDA 1E99A 1ZCBA 1CR0A 5JHHB 4N3NA 1R5NA 4PO1A 1YE8A 4YMTA 4RD6A 2XSZD 2QPOA 5DHFA 2BHRA 2A5YB 1QHYA 2VPPA 1RYFA 4N1AA 2J0UB 4C0LA 2XSZA 3NC0C 4M8NE 4WBSA 4B6FA 2DWPA 3IIKA 4KODA 3PUWA 1ZD9A 3I5XA 3QXCA 3OF5A 5EE5B 3AVPA 2IS2A 5E4FA 2DR3A 1EK0A 3TVDA 5CIWA 4XSHA 3TSOA 1NN1A 2FNAA 5CB6A 1W0KD 3AVVA 1P7CA 4FWIB 4DSUA 4Z1MD 1AGRA 5L3SB 3EPHA 1OE0A 1TPZA 2XNSA 1OIXA 4ESVA 1K6MA 1W0KA 2AWOA 3NHBA 4Z1MA 4A0GA 1DAIA 2PZFA 2J7PD 2JDID 1QG2A 1A5TA 4NDZA 1Q1ZA 1UEIA 4FCWA 1KI4A 1T6NA 2J7PA 2JDIA 4I4LA 5FTKA 2QAGB 1YR7A 4D0GA 2WMOB 2WWXA 4HDCA 3VU9B 1IM2A 3AP3A 4A4DA 1OFIA 1Z83A 3LFUA 3QJYA 1QHNA 1WDTA 3LBHA 5C46F 1DAGA 3EC2A 2DFTA 3MUFA 4GSYA 4C2UA 3QXXA 1XEXB 3F0TA 1BS1A 2HDNB 4CF7A 5JJLA 3ONWA 1E2PA 4Q02A 4DXAA 4RZXA 4M1SA 1KO1A 2CBZA 2FH5B 1SZPA 1AZTA 3OAAD 4UJ5A 1W4RA 4M1YA 3QEJA 4D4LA 3W3ZB 4D81A 2WJYA 1XMIA 3OAAA 4A2QA 2ODEA 3A1UA 1XTSA 4TQ9A 4LOAA 2IYZA 2RGBA 2AK3A 3I4LA 4FMDB 4KSCA 4IFBA 2ZI5A 4MUAA 4AYXA 3PEWA 1F2UB 2ZRGA 3QSYA 3KUDA 4K46A 3BJIC 1FNNA 1ETUA 3AP2A 4R71A 2RGAA 1GAJA 3AP1A 3DL0A 4OI2A 3RRNA 5EP3A 2UZ3A 3KZ1E 4ZCMA 1NN5A 3I62A 1G7TA 1N0UA 3TIFA 4NCHA 4PX9A 3RWMB 4O0MA 1ANKA 2ZRHA 4B6EA 4QOSA 1W36C 3SS8A 3L0OA 3R9XA 3REGA 1FW6A 5B64A 2W6JD 3B5JA 3RRZA 4HEJA 3LH5A 5EUMA 3CH4B 3JVUA 1B23P 2W6JA 3SOPA 4UNSA 4LUCA 4EPVA 2ZS8A 2R6CA 4LWZA 5BN5A 2YWHA 2WSMA 2ZRFA 4RZ3A 3GEEA 4P32A 3W5IA 4OK3A 2BM0A 2RGGA 1KHTA 3KJGA 4C3ZA 4X8HA 1RVDA 1TEVA 4N0EA 2J59A 1S2MA 3VR6A 3OEED 2PCLA 1WQ1R 3U4QA 3OEEA 1NIJA 4QBGB 5SZKB 5C1BA 4H1UA 1HUQA 4DSNA 1E2NA 1G5RA 2Q3HA 2DFKB 3MAAC 4TLBA 4DEYA 1KIMA 3GJ3A 3DHWC 4LHWA 1AM4D 1OIVA 4PZZA 4LJ7A 3T1QA 4JZKA 1AS3A 2VP6A 1G5PA 2VEDA 4B34A 1PZNA 3A4LA 3PIRA 2F43A 2HF8A 3L8ZA 5KO2A 4JLJA 4P31A 3ZZ0A 1U81A 2VTKA 4FIDA 1FNMA 5A5GA 1PJRA 4AG6A 4V0OA 4R2HA 2I1QA 3K9NA 2OESA 4BLQA 3I1FA 1MO4A 3U7EB 1DO2A 1UBFA 3PV0A 3NEYA 1Z07A 2VHJA 2ZRBA 3K0AB 2A2ZA
chains in the Genus database with same CATH superfamily
4K26A 3EBOA 4UXJA 3DE0X 3ZEIA 3WYBA 3NEPX 4LTDA 5A6SB 2GCEA 1K3TA 3HSSA 4G56A 4L02A 4P7FA 1WW8A 4KOAA 4PV7A 3WLTA 4C89A 2PIDA 4RTRA 2B4QA 3BWCA 2YMMA 3BHMA 2W70A 1J42A 5JSYA 2FJPA 4LVNA 4YREA 3H1GA 5LQKA 4HL6A 2EL9A 3CMMA 1IWOA 1MABB 4JJZA 4U3JB 4C4PA 1PO7A 3COYA 3ZX4A 4FOLA 3GFGA 2KI5A 1SU4A 4GOLD 1IAQA 1XDBA 4O3FA 3RHZA 3UBMA 3ZQ4A 4YJ2A 4FOPA 1RWVA 1MC4A 3S4YA 2EX4A 3PXCX 2RGXA 4ECAA 1BKYA 3QLUA 3W2IA 5TY0A 2FWJA 3E3OA 2CL7X 1SUSA 2X8LA 4I8DA 2J4CA 4QUDA 3VU3A 1SC3A 4B17A 5F51A 1ENPA 4B3IA 2KX7A 4HBGA 2VATA 5CW2A 4ZYUA 4Y1EA 1SUEA 4AP9A 2XUKA 3IQDB 3UYLA 2GXSA 1KMQA 4WZBB 5HDBB 2IDMA 3X1MA 1RCUA 1E5QA 1DEXA 3QLVA 5EMHA 1SBZA 1I5OA 3IA2A 4A0SA 4HDRA 4AVYA 5G1NA 3P94A 2QT0A 2GD6A 3PTZA 3T5PA 2E4YA 3C1TA 1Q7TA 2C2KA 4PGGA 4WZAE 2OKGA 3WV4A 3JRNA 2DULA 1QQ5A 2BKXA 2P4EA 2YWJA 4BV2A 4CDGA 1ODJA 3NYWA 4JGIA 3I23A 4RQTA 5BVHA 4HDOB 4GR4A 4W1SA 3JQAB 4DCPA 2F2TA 1FF9A 2ZWAA 1IJBA 2MWMA 3DD1A 3IXMA 4G5RA 1OLOA 4JLAA 2JJ2D 1L8AA 4OCZA 3VPFA 2PS9A 3PE6A 1MENA 4I1RA 3IMEA 4FT4A 4Q9HA 5BR8B 4I4TB 1PD1A 2NU7B 2X23A 2FRDA 3FDFA 4X6XA 5KOJA 3OOYA 3PCRB 3IEXA 4PNEA 2OD9A 3I3OA 1FFDA 1TM7E 2VHZA 2D8MA 3AKEA 4MVJH 2J9ZB 3GWGA 3PXAA 5DVZA 5IBRA 4TN5A 1G3IA 1O0CA 4DTCA 1LC0A 1LDMA 1EXMA 4TKUA 4FFNA 3COZA 4C14A 4DQXA 3T1OA 2WAYA 2IOFK 2QV7A 4MKFA 4X24A 3C4VA 3O3CA 1ZR2A 2P9HA 3IAFA 9MHTA 1RXVA 4FMPA 4PHTA 4OFZA 3KOZA 4MAMA 3CH5A 2PU5A 4YX9A 2O8FB 2R751 2FEMA 2X6QA 3B6MA 3IUMA 1WCIA 1DI0A 3MERA 2WB2A 4WOBA 2BMFA 3K6KA 4S0XA 4WCFA 3FN4A 1CZOA 1O08A 2H08A 3RE1A 3SEAA 3O9VA 5HX7A 2NT4A 2ACWA 2J33A 3SC3A 4GD3Q 4HAUA 4BQEA 5AESA 3SU8A 3IP9A 4KXUA 3UMGA 4EY7A 3M6IA 3K2IA 1L5VA 5FOSA 3NJ4A 1A7AA 1M3SA 1ONSA 3PHLA 4E5KA 3T34A 1GTG1 3BD9A 2VI5A 4G84A 5LCXA 4MRMA 4E5YA 2NMVA 1FCJA 5JMOA 4W9RA 4KH1A 2I3BA 1IY2A 1GRVA 4IQ0A 4MO9A 1CXZA 4JHLA 1FDSA 4XFKA 2GOYA 3JVEA 2WU1A 3KOXA 1ZIPA 1J24A 2EBWA 5EOVA 2ZT6A 3RSGA 4N5NA 2GXQA 4PZDA 3S1AA 1RYNA 2PZ8A 1BAPA 4ZI7F 3JZMA 2H4HA 2X5KO 1PBNA 3CLHA 3QRWA 3HVIA 1X87A 2AB0A 1GTMA 3C3PA 1HTTA 3N2NA 3VAYA 4QGSA 2OUKA 5KYUB 3OC6A 3ZG6A 5IKXA 1U2TA 4KXLA 4H3HB 4TKZA 1W36B 3JYLA 1GILA 1P3DA 2RONA 3SR3A 5DV9A 2HWUA 4N3BA 4YPVA 4MJ7A 4HB0A 4O29A 5FXMA 1QU3A 3HXMA 2X1HA 4G9GA 2L18A 3FPGA 3QPBA 1CVRA 2JBAB 2V7EA 2EP7A 4XQ0A 2I3ZA 1I3MA 2AJCA 2CUZA 4JC0A 4CNQA 2J0QA 3ODPA 5KOHB 5C8ZA 1QCYA 5CLQA 3SHTA 3IP7A 4H3VA 3OECA 3PJFA 2XQKA 4O2AB 1LKZA 4Y9TA 1ILWA 1XQYA 4WCDA 2DOKA 3BXEA 3N2YA 3NETA 2AMLA 4QD3A 1VP9A 4P4SB 1VA4A 4BVAA 2I2AA 2H4XA 2QBYB 2DUWA 2OC4A 4GX2A 3CSSA 4NFYA 4UEOA 5I7FA 3AJRA 1GSAA 3O8RA 1JEYA 3AF3A 3DKKA 1NVGA 4O2BB 1RKBA 1QFXA 3QBEA 3NBMA 4A0QA 1NV8A 1Z88A 2ADOA 3BFVA 3JY6A 3KQPA 5JCXA 1C50A 1VLHA 4B4UA 1GTL1 3NLLA 3NG1A 3BDAA 4DRXB 1PAUA 2R2GA 3GU3A 3CA8A 1Z35A 1C3VA 2OK7A 2JCBA 1G21B 4TKVB 3EZ9A 4K9LA 4ZAGA 5DDIP 2GK7A 2GYYA 4LV8B 3UFBA 3ER8A 4EB3A 3EZ6A 1EWVA 3S68A 4K03A 1L0BA 1ZK3A 2EU8A 3AIIA 1S7CA 3TLZA 2CJFA 2Q0XA 2KLHA 3KIPA 1O7JA 5C8YF 5JADA 4IFIA 5LR6A 2IGBA 1E58A 1M2OB 4CIVA 1S4MA 5AW2A 5KCMA 4LG1A 3UA4A 3H7AA 4EFNA 1J8VA 3MRTA 4OHMA 2V8BA 1KYYA 1PR9A 1TJNA 1CRLA 1K3UB 1I4EB 4WNCA 4OGKA 2CFOA 2ZE6A 4KVGA 5KJ6A 4KJXA 4NOLA 4XGQA 2I91A 3DPUA 3R7AA 3TFWA 2IYLD 5IASA 3LQKA 4HDSA 1TQ6A 4Q3AA 3MQ2A 2NM0A 1CUAA 1T6YA 2CXPA 4HADA 9ATCA 3F3MA 1T3SA 2FRDC 2N42A 2HR1A 3G8BA 1Y8RA 1UWLA 1KSFX 1NRXA 3JSXA 4JP8A 1A88A 4GWKA 3ZCXA 2V9PA 3AZQA 1LVHA 4P7BA 1UKAA 1EK6A 1FNBA 2QM8A 1TECE 2V3WA 2Z58A 5FNVB 5CB4B 5JFOA 3ZVNA 4QJ3A 3PGLA 1JLMA 1IOLA 1FTGA 4L1KA 3MGCA 1GG2A 4UHCA 3QW4B 2FSVC 3K8YA 2BGWA 2D1TA 4KXFB 4IYRA 2ENUA 1R6TA 3ZHVA 4Q7QA 5BN3A 4S04A 3B36A 2Q3FA 1I7SB 3SFTA 1JIVA 4R0MA 1JR3A 4IQ4A 2IKQA 5KYYB 5DX8A 2Y1KA 1EGQA 1F14A 3I32A 3HGQA 4URUR 4HG2A 2PWYA 2BMDA 5GPBA 1QQ7A 3K1TA 2Q0SA 3L8MA 1E89A 1IIRA 1R5OA 1YDEA 1ORDA 2GEJA 4OQLA 1WO8A 3KLNA 1C3EA 4RPHA 3PUXA 2HNKA 3P26A 3WJAA 4U7WA 1W5AA 1NDUA 4Q4AA 1NQ5A 3UXEA 1L4GA 2NPIA 4A6EA 1T6XA 4AJPA 4LRTB 4Y9RA 4N40A 5IH7A 1VE5A 4KZPA 2XQFA 5IF9A 2WIDA 2YBEA 4MVJP 4CLRB 3LDUA 4Q1AA 3V3TA 3K1YA 1Z4IA 3WLPA 1ZOIA 3HVHA 3QVOA 3U1BA 1ZCFA 5DCWA 4B4WA 3OIUA 4EG0A 1SVKA 3QMVA 4KIUA 1T15A 1X7YB 5P8WA 4BE7B 5JO0A 5DW3A 1RXWA 4HWOA 3GEPA 4W5HA 4EG1A 3QW2A 2XD9A 5IBQA 3PPYA 3TJRA 4DUGD 1I13A 5DWDA 2FMIA 2M6RA 3JQBA 4LNAA 5I4KA 3ZS9A 4AF8A 1HKUA 4OXKA 4TYPA 3GUYA 3ZI0A 4LJSA 3SXPA 1O95A 4HZGA 1N2IA 2QD4A 2D1SA 5KAPA 4JSTA 1SBCA 2CNNA 3D59A 2Q1TA 4HMOA 2G71A 3LWDA 4QWWA 5F33A 4ETWA 1M8JA 4ZAXA 4PX3A 1ZOPA 5B3JA 2ZRLA 1FRZA 3QHQA 4FE7A 1KQNA 5L4SA 5IS2A 1ZMTA 5T6MA 4KQCA 4PBRA 3N74A 4GVPA 4E5NA 1EUYA 4ZVTA 1FU7A 1YULA 2QTMA 3WHKA 1SUFA 1E9BA 1E4VA 3IAUA 1MVOA 5FI5A 4H18A 1SKMA 1CJTC 1UFRA 2GYUA 4DS3A 3T3HA 3WLKX 1CF4A 1WD7A 3ENKA 2N1MA 1X7XB 4J7CA 3G1UA 1U1IA 3W8NA 4I3GA 3CKYA 4M9CA 4E08A 3LLCA 4ZMSA 1ONNA 2COUA 1NFRA 2YZ7A 1F2DA 4KAXA 1AOXA 5AJXA 1VDMA 3UOAB 4LZNA 1TKAA 4TMVA 1DBVO 3CJRA 2G72A 2RKBA 4J4HA 3P52A 3VKHA 1FE8A 1U1DA 1IUNA 4MW6A 4BC1A 3FOZA 3K9GA 5CJJA 2PRYA 1C7FA 5CLFA 2VNAA 3H65A 4IMPA 1FW8A 3BMCA 1VGRA 4NNOA 1F1JA 1W8IA 4LMPA 1CNEA 3H5VA 3TGPA 1OXUA 4F1JA 1Z5OA 2CLSA 4UE6A 2H2WA 3PDWA 5AHXA 4RSHA 1CRWG 3BQMB 1HEIA 5JDIA 1VM6A 8AT1A 5KWSA 4CBVA 2XQJA 3SMVA 2CDCA 1DOAA 5B6IA 3VYWA 1J1ZA 1VI6A 1CRZA 1G3MA 2OGZA 3H84A 4N3GA 4OQQA 2OLKA 4L8YA 2JPDA 3HADA 4ZVLA 5FPHA 3TL3A 5K4GA 3ZWMA 5BV1A 5JPDA 2IIPA 1C3JA 1W44A 2Q3JA 1L3CA 1SNYA 1SCNE 2Q8PA 3B7PA 2H59A 2UDPA 3JQQA 5AO9A 1HSZA 3T9DA 3ZY2A 4JJGA 2YN4A 1BDJA 2J9XB 3F4KA 4A23A 2AF4C 4IEIA 3AGPA 1P8JA 3E9RA 1GQSA 2XE8A 4YK7A 2RC6A 1FTSA 3CRRA 5DP2A 3P2IA 2RHGB 5FBKA 4ASUA 1PI3A 1EXWA 1OLSA 2GD2A 4PPGA 4WDRA 4ZVMA 2R1TA 3A2NA 3ZV5A 1UK7A 2IZZA 1G291 5ESXA 5HRCA 4LRUA 4BEJA 1UMDA 3HH8A 2G77B 1P5ZB 4FS8A 5IJ0A 2V3CC 1G5QA 2H3EA 3DM9B 1X0VA 1P1RA 1QO0D 2V97A 1NN3A 1ZM9A 3Q88A 2XADA 4X65B 3K70D 2Z9CA 1M76A 3QG5A 5C1DA 1J49A 3DO5A 2NWQA 5E7JA 4NPAA 3OFSA 5EIFA 1KSHA 2WOJA 4Q7KA 2IVZA 4BEVA 4C1NA 2FPGA 2ZJFA 4BBJA 3QEBZ 4NF2A 5BWOA 3A6FA 3JQCA 5HQJA 4Y0AA 4AJNA 1J33A 2JHGA 1GL6A 2NO4A 2ROQA 4BLSA 3AZOA 3IKJA 2VLBA 3WBKA 3D5EA 1L7AA 4HDRB 4OGFA 4TTPA 1GEEA 4G23A 5ALXA 2EQBA 3ZC3A 1XRRA 2IF0A 1E4EB 5KJFA 4WFQA 3MIZA 1M7HA 3KT6A 1CUYA 3BIXA 4URXR 4H4DA 1SVIA 3QY9A 5BVHB 4IS2A 2IOFA 4WNYA 1U7UA 5F73A 3KDPA 4UREA 3V7UA 3IVGA 4HJRA 2WFLB 1HTWA 4IDEA 4NWIA 1SA0A 5KOJB 1V4VA 4N48A 4X84A 5EVJA 1LBQA 4K1XA 2CLFB 1TF2A 1DXOA 2V7UA 2XTJA 3A1DA 1C29B 3B1ZA 3IIIA 4N47A 4NH4A 3TEJA 1CY1A 2J3JA 1YACA 2JAXA 3OZRA 2XTNA 4JJ4A 1B93A 4MKZA 1ZX1A 2BSXA 3IOBA 3IHLA 3TSWA 1KO8A 5HGXA 1K3FA 2Q7DA 4OBXA 3MEQA 3SSNA 3T4PA 5A4DA 3FLAA 4XDYA 1YS6A 1NU8A 4ZGGA 5K8JB 2XCTB 4LGVA 4IJ5A 4MVXA 5EIBC 4A1OA 4LZJA 9ABPA 3ZDBA 1NF2A 3CURA 4IMIB 1NN0A 3QQ5A 2G0AA 2JAPA 3UY4A 1T9HA 3H5TA 2GZ1A 1THGA 2E4WA 1SMKA 3DV0A 2G1KA 2H85A 4WCFB 4D96A 1YXMA 1C2TA 4PSVA 1XU4A 1ZRNA 4YMLA 2H17A 2WWYA 4O4JB 1N7GA 1K7SN 3HDTA 4O0LA 1MORA 2HPZA 4R7ZA 5JAMA 5JWOA 2Y1FA 1LNZA 1G60A 3VR3D 3HE3A 3AEYA 1FP4A 3NDIA 1AU9A 3HVUA 4NOKA 4UFOA 1U2DA 1XE3A 3O8NA 3CWQA 1KC3A 3G23A 1OU4A 2EVWX 1CUWA 4YDSA 3BWXA 2QNRA 3L6BA 3PF8A 4DLXA 5JAOA 3MS4A 4G1MB 4V0KA 5CYFA 5FBQB 1WIWA 4MJ3A 3EOZA 3S1AB 4QUAA 5LFAA 1NF9A 1ZH2A 3GVCA 3VPHA 3QKSB 2ATEA 1KEPA 4XIJA 4BDTA 2FZWA 2VJYA 4EUNA 5JS7A 4R2MA 3A3YA 3O73A 4W63A 1SK8A 3DVSX 3HY6A 3EQ2A 4EA6A 1N8NA 2Z9BA 1O1YA 1UP7A 4IGAA 1H94A 4FZ5A 3W4KA 1T5DX 2HDWA 4X45A 1EH5A 1VC2A 4OI4A 5TR9A 5LN1A 1CIVA 3LRPA 2D0DA 3NO4A 3O91A 4P9NA 4LE1A 5LA6B 5JECA 4D41A 1WXIA 1ODFA 1XZPA 3BFPA 3I04A 3NBUA 3WBJA 5I8PA 1ZN9A 3IC5A 2IHVA 4MICA 5CG1A 1ZJ4A 3N2LA 4AZSA 4FMCB 3D0OA 1RR6A 3OD1A 3D3QA 4OYLA 2F3UA 4NZMA 3WMXA 1DIHA 1NXPA 4TUYB 3L40A 4YACA 3W5CA 1L6RA 1TK9A 2I2WA 4S3MA 1V48A 4G85A 1IXSB 3HCEA 1OI7A 3PR2B 4ERXA 5CDSA 3ISTA 4LS3A 3MS2A 1P75A 2BLNA 1YQUA 2P0AA 5K03A 1XTPA 2JFGA 1V7CA 2OCBA 3AC0A 1PFQA 1TADA 1YB4A 1CG6A 1F20A 1EWYA 3FLEA 3FWZA 3MXTA 1ZUNB 4LPKA 5DMXA 5A7HA 4DBVO 4OQEA 3IT1A 4BUCA 1HLPA 4JBNA 1VBMA 3FTCA 4DA6A 1ZD2P 5TXGA 2MT9A 1GFZA 3HEAA 3IERA 3IR7A 4BVFA 3F98A 1XEWX 3LF2A 4DANA 2YNMA 4YRBA 1BJRE 3R7LA 2H11A 1CEXA 1KJ9A 3ZD6A 1SC1A 3C3AA 2EKDA 4AJIA 3C14C 1NU6A 2VF7A 4XASA 4RIFA 4WBNB 4IY1A 1IULA 1P2TA 1NLMA 5DIFA 2REOA 2IZ1A 1ZMOA 2QTAA 1OXBB 1QVZA 1ADBA 1V5WA 3ET4A 1QKJA 4C1BA 4R31A 2ZYGA 3LLUA 1NOKA 1R0ZA 5KQPA 5JD4A 5DTQA 4LY6A 1P17A 2VP0A 1HRDA 3KQQA 4FDVA 3OZFA 3VO1A 2BGLA 3IXQA 2BFFA 1GPYA 2JI7A 2WWIA 2GAOA 4ZALA 5CLGA 1DRUA 2PS3A 2PSHA 5AJYA 3KCNA 2FA9A 2JGRA 3P71T 4TZTA 4I08A 3OBBA 5ARDA 4LV6A 4BU0A 5GIPE 2AVNA 1YMQA 3A0RB 4ENVA 2QYTA 3LTNC 1JUDA 5D84A 2BHSA 1Y8RB 1GY8A 4YT4A 1A8PA 1MT0A 3OPYB 4UM9D 2IHTA 1DL5A 1Z2PX 3KSZO 2IZOA 1XD2A 2B99A 2Y1WA 3EVAA 3OCUA 4N7MA 1PQPA 4RWZA 1ESMA 2P9FA 3OUZA 4EYOA 1W85A 2O8DA 1JPUA 3K8QA 4CU5A 4D0SA 2JIZA 2VYQA 2X9LA 5DTEA 4ZFNA 1E20A 3H2YA 5GM2A 4RAQA 2C77A 3K9LA 1E5TA 1YDMA 2GZ2A 3PSHA 1I2DA 3IUYA 3RKUA 1L7MA 2YFYA 2QZZA 2EBFX 2AOUA 2R5FA 3JQ6A 5F5LA 4RMJA 3WRVA 4TYWA 1K97A 2GS9A 3SE0A 3USZA 1NY5A 4DM7A 1XMXA 3B38A 4RS3A 2HGZA 1BFDA 2PFKA 1R15A 1L5HB 2GJAA 3FNEA 2GT1A 4BQOA 5JNVA 2IYYA 4CDNA 3KKMA 2QQEA 2IVFA 2ST1A 5CNKA 3CVVA 3DMDA 2GBLA 1YZGA 3DP7A 3TL6A 3HUDA 4D8XA 2VH2A 3H4VA 3QVGB 4FE4A 3DT9A 5LQDA 2BKVA 4KB5A 4R3UC 4MQUA 3S3TA 1LD3A 1X1CA 1LWOA 3HN6A 1CHNA 2J30A 1URPA 1Q11A 1D6SA 1WS6A 2ORWA 2VO1A 4DARA 4LW8A 2PVCA 5CM9C 1ZUWA 5EP4A 4CF4A 2GN1A 3UJDA 4H4EA 2ONZA 1PNQA 3V7NA 3JZFA 3FUVA 4FUQA 4ZZIA 5EIEA 4LISA 3NOOA 5JVDA 4D9KA 4KDCA 4ALMA 1MN6A 1PFWA 3G13A 3G5UA 2HF2A 4M0PA 4MR9A 3TXXA 5BV7A 1E60A 3AUUA 1EVIA 3E2PA 2W8ZA 1N2GA 3R3XA 4PWYA 3K0KA 2VWQA 4ER6A 1UWKA 4GOMD 1N5OX 5BW6B 3I9MA 2CXHA 2WJHA 1B0ZA 3CRZA 2I22A 4G4GA 4ZIRA 5EJAA 3NCTA 2XCLA 3A3OA 1YZFA 3AHGA 1Y4ZA 2HXYA 3AESB 1PVVA 3JS5A 4B09A 1M1ZA 1QK5A 3O1HB 1U8AA 1CQJB 1C0IA 1AQJA 5HF5A 1QIFA 1DG1G 1WZ2A 3AUTA 5TV2A 3QYFA 3GA5A 5HBRA 3Q7SA 4ZD6A 2QVGA 4JFRA 1XJQA 3AO0B 2PAAA 5AI9A 1WZUA 5L45A 3T35A 4M1MA 4BNLA 4JP3A 5EZYA 3RKSA 2W58A 1V7ZA 2ZROA 1QF7A 4FUTA 3NVMB 4KKXB 3WWEA 3Q12A 5AUPB 2C8LA 2SBTA 1RYDA 1QCCA 2QW1A 3LBYA 5FKJA 3ZJ4A 2Z8YA 3L7OA 4MV9A 1KJZA 3KQWA 4BVKA 1RIFA 2COKA 2QTBA 4Z9BA 4FN4A 2DHQA 3RF6A 2CFRA 3C41J 2EHJA 3P0FA 5IAAA 1E0JA 5IZCA 2OT3B 3B8HA 2E9SA 2FG6C 3L0CA 4ND4A 3ZCTA 1CUBA 2J08A 3DXXA 1WV0A 3LC2O 1G4AE 4NEQA 2YNMC 3VX4A 4XCVA 1EP9A 4CV3A 1JZTA 3BM5A 2WDZA 2V54A 5K8CA 2XNDA 3PFWO 3N28A 1QIEA 2J07A 3GCWA 3E5RA 5JS8A 1E9FA 4FIZA 4CEJA 1Z5WA 3VAAA 4LKRA 1T6BY 4KFRA 4E2WA 4FHDA 1GA1A 3BMCB 1M0TA 1P9OA 3BN3A 1E2KA 3VFDA 4LC1A 3Q5DA 1MNAA 4B33A 3RCBA 1CEYA 5AM0A 4JI6B 3T9EA 2YVQA 4MS3B 1V6AA 5IM4F 1DG3A 2H4ZA 3TDMA 3ZHZA 1U0HC 5BMVB 4RETA 1I2MA 3H4IA 1EIZA 2DXIA 1NR1A 2JIQA 3MHPA 2ZRDA 2HLHA 3P9IA 1XTQA 2QL9A 4QOGA 1JFLA 2O19A 5IVHA 4TLDA 4NYIQ 5GINE 3HWSA 4GBJA 1TRKA 1KY5A 4WVFA 4C0AC 3QPUA 1E9DA 2QU7A 3I6YA 2HHCA 2ONYA 3TEFA 2LIPA 5FV7A 1SQ5A 4BXOB 3O90A 3EIHA 3NP7A 3WNBA 2Z30A 1WA5A 1OLSB 3CBGA 2R1TB 3TLMA 3I2KA 3DE1X 1XMOB 4JJIA 1I2ZA 4Y1RA 1UMDB 2O57A 1E6UA 1FB5A 3L8EA 4OB8A 5JMPA 3LP6A 4C2BA 1RM0A 3PB3A 4JLBA 4L51A 3PLNA 1A7UA 5T6BA 1FRNA 2VUTA 2YWDA 4N0DA 3U61B 1J8FA 3DNFA 2WOOA 3SR0A 2VPIA 4FNGA 5CX1A 4BNIA 2BMEA 2FPGB 2PX3A 3QBVA 5K2MA 4GL2A 2DUMA 3N6XA 3RYIA 2ZS7A 3CRNA 4R9NA 1P9LA 2AMFA 4EA7A 3IQEA 1N2OA 4LF8B 1TD9A 4OMDA 4RTMA 4ZYWA 2OBNA 3BDIA 3R8FA 1AQ6A 3AOEA 1UZAA 1P77A 3QLJA 4GP6A 2GDJA 1LFAA 3NHLA 3E6AA 4QGFA 5DYGA 4ZT6A 1XRMA 2IA5A 4MWDA 3L18A 4RVOA 1NHWA 2C5EA 1V2HE 1Z45A 2OVBA 3KR0A 3RASA 3EIQA 2IU0A 1J07A 2GCIA 3OH8A 2MSEB 3R7NA 1KS9A 1PJTA 3ZQKA 2AKAB 5CLHA 3DWFA 2J31A 3KDSE 2TECE 3TRIA 1SA0B 1SD5A 1U6KA 2JHFA 1QRSA 3H17A 4MIKA 2W48A 1VXRA 3GYBA 2FMKA 3N58A 5GOZA 3SKYA 3AUKA 5IULC 3TCNA 3PFFA 1GUFA 1I3NA 2QMOA 2B1JA 2ZYUX 4QJ4A 4R5MA 4ZCIA 5C4MA 2ZTSA 4AWXA 2YYYA 4GM0A 2VAPA 4LWPA 1MT3A 4A16A 5INTA 4EGAA 1U28A 1UOQA 1P7VA 3R5XA 2WKQA 4B3BA 4PLGA 1IBLB 1OWOA 4FYMA 3ZHSA 5HK8A 1RAFA 4JQZA 4YLYA 5FWDA 3ZX5A 2DUUA 2POQX 1SPXA 4RPCA 1YUBA 3STHA 3WK5A 3ZLUA 4EW1A 4FFLA 1LPNA 3P2MA 3E7PA 1IN8A 4EQ6A 1KZ6A 2QVZX 3DV0B 1JALA 3RIGA 1UT6A 1UZLA 1XAGA 3NUZA 3NU1A 2E1PA 2BZ1A 4MW7A 1KJIA 5EGSA 1ZAKA 4Z86A 1LLDA 4IW3B 4D6XA 5C8DA 2P6RA 1AMNA 3T5CA 1J5PA 1QAOA 4DRYA 4NZYA 1XZGA 2Q9CA 2CFCA 3CLRC 3KUCA 4BQFA 1NNUA 2V98A 1FP4B 1IE3A 3ETLA 3FNHA 4D92A 3T3DA 5HM6A 1K6JA 1DWPA 3WMEA 2VPTA 1KFBB 2NXCA 1I36A 2GFQA 1JDUA 1PYDA 3EGCA 3QMWA 5HF9A 2CMDA 5K0LA 1UM9B 1MJGA 2QSUA 3EGEA 4GAEA 2BHLA 1YI8A 3C45A 4ZRNA 3V2IA 1G59A 2Q6TA 4E33A 1P2SA 2FW8A 1PK8A 3GZTB 4WGGA 5F76A 3HV2A 1Q20A 1OH8A 4BMSA 4QL3A 4Z4FA 3MLAA 1AJEA 3RVQA 4KR9A 4QXPA 4EVIA 3A06A 1OVGA 4RV5A 4Y2SA 4PG4A 1G4UR 1RZRD 1DTWB 4RESA 2DF8A 2DWOA 3D7LA 2F9LA 1PTJC 1G18A 2AFIE 3KKQA 5FL7D 3H9UA 3U3DA 4GW3A 4LYJA 4ENPA 1RHJA 2VT6A 4XWOA 6Q21A 5B1EA 3HTXA 3I8XA 3RQSA 3HA2A 3COWA 4JX8A 3L0YA 1CR6A 4TMZA 1TUGA 1V43A 3DLHA 3CF2A 1T24A 3Q41A 4CFSA 1U04A 3DMHA 2I66A 3K1JA 3WIBA 4HJXA 3JALA 1OWNA 4JP1A 5BQPA 4BWYA 1MHTA 1Q6ZA 4JCCA 3VBEA 4OG2A 1F3OA 1XTUA 2RH9B 2WABA 3PR3A 1NV9A 4D99A 4TWRA 3N8DA 1ZYUA 5C1PA 3C3JA 2HK9A 2VSXA 2G5GX 3BRWA 3BL8A 3HLTA 1U2GA 4U8HA 1QE5A 1KMCA 1VJTA 3NDJA 1F5SA 4R8RA 4WFKA 2H7XA 5AJHA 1P3Y1 1J9EA 4DCSA 1HM5A 2PWPA 3FYCA 1X80B 2ZAGA 2UUBB 1QCZA 3E18A 3I6IA 3OM9A 3F78A 2Y2UA 1ZM4A 2ZJOA 1WPQA 5FFFA 1W49A 2ISCA 4FMDF 5IAOA 3ENWA 3O2QB 4HMQA 5KTMA 4Q9JA 3CZ4A 3H2IA 4JSRA 3TI7A 4G81A 3UMFA 1RWBA 3NT5A 1CLEA 3E9MA 4I81A 2I8AA 3N7AA 2VHXA 1N5LA 3HWX1 4XARA 5F1KA 2WHQA 3G79A 4MWOA 3OU7A 1W76A 1OKKD 4O1HA 3DL2A 3KCQA 5ESRA 1JLHA 5FLEX 3UXMA 1THTA 4JBLA 4JUCA 2C7OA 2AMJA 4WWHA 2BFFB 4RY0A 1ZMXA 4B43A 2FMFA 1SBYA 3WSTA 4B6QA 2N3ZA 4L4RA 1U31A 3THWA 4PONA 2ZDHA 5JNLA 3INTA 3ZLJA 2PMDA 3BJZA 3KL4A 3LO8A 3RS2A 3R6WA 1OROA 1COWD 2D2VA 3FFBA 3FETA 1FRFS 3G0DA 3DMFA 3V4ZA 1YJ8A 1ECPA 2DT5A 2R9VA 3C3XA 4C4AA 3DZ8A 5KSYA 1QZ3A 1IHOA 1XD2B 3PSAA 5EFOA 2O8DB 2X77A 1NRWA 1U28C 2D7DA 3F6PA 3ZCVA 1EK1A 4W5WA 2WNIA 1KRXA 4M0UA 1YBHA 3TFQA 1KP2A 3QU7A 4RKYA 4GDFA 3K32A 4IV8A 4GWLA 3HM2A 2AOUB 3F2IA 4HN9A 2ACVA 5FLKA 2F3QA 3GFOA 3VH3A 3GFVA 2Y4OA 1KP9A 1Z13A 4C7VA 4D3DA 4NJEA 4NZ9A 4OQFA 3FWPA 2I4IA 2I6QA 4TKLA 2WMNB 4ESHA 4RZ2A 3UCFA 1TU4A 2XYRA 2CHEA 2HCRA 2Q8NA 3F6BX 1WLYA 1TM3E 4IOKA 3F9CA 3KTOA 1ZC3A 5F5XA 1J99A 3AVUA 2XB4A 2XEDA 5I7HA 2OHFA 3JAMA 1N77A 3PNVA 1HO3A 1NPDA 2W8BB 4I5GA 1Z0DA 3HKBB 3L1JA 1LWNA 3D8HA 1ENYA 4CYMA 4DPLA 4RORA 5KOYA 2FMHA 2Y77A 1ZZEA 3ADBA 2B25A 4COKA 1II0A 2QM7A 2QTZA 2QJRA 4Q7LA 3IHKA 4KIFA 3ZZNA 2M9MA 2X0DA 4DUGA 1D2EA 1SVSA 4EHHA 1VBFA 5JVDB 1I8TA 1B6RA 3LY7A 4JZYA 4UTNA 4AJJA 1XT6A 5ES3A 4ZAYA 1D0SA 5A7FA 1K06A 3CPSA 3QWAA 3F4BA 3KWJA 1R66A 1PR3A 1QH8A 3GEIA 4MR9B 4K0RA 4IXMA 3WIOA 2IU3A 2RARA 4DA9A 5M5BA 3GJSA 2GBIA 2X9VA 4RJ2A 1U6IA 1VJ0A 3W0LB 1JFFA 2WTEA 3DT6A 5BR7A 2QRJA 4DA7A 2BFWA 3JWGA 5DGIA 4A27A 2O54A 3K0SA 4O33A 4BBZA 1ZEMA 4D44A 5LQUA 3HL0A 4EATA 4YMWA 4W7HA 1YVRA 1NSTA 2CFIA 2JAUA 3VO9A 4JVSB 1TTPB 1RKQA 3F1LA 3KOYA 4XOIA 5KCZA 3C2QA 4OMFG 1T91A 2VVTA 1KI2A 3A1SA 4LY0A 2JZOA 4R1QA 4AF7A 1EWKA 3ABZA 4KK4A 3C43A 4YQZA 4EI8A 2WR8A 1GOTA 521PA 2Q3MA 4DSOA 4BNUA 1WHSB 2BI7A 3EGIA 5FYQA 1XTBA 1QGDA 2MINA 1OWMA 2ZI6A 2Z5GA 1VLJA 3O4JA 2HCBA 4R1LA 2CNWA 2EJBA 5EUQB 1U2GC 5LZ5A 3F5FA 3ZIAD 2WF9A 4DLAA 1HORA 2LW7A 1IQ0A 1RXEA 3B60A 1WW3A 5FJJA 1JIQA 1KTIA 3UF0A 2BDTA 4X7MA 1HNZB 3CVWA 3UV3A 1AKNA 1DXYA 3OPQA 2HXGA 1UQUA 4TKMA 3GFRA 4XJSA 3B52X 3IVRA 4YRAA 4YV2A 3F96A 3OIDA 3U3JA 3QTBA 1EFPB 3ABIA 5BSWA 1E69A 4DILA 4CIXA 4TWBA 1Y89A 4FR2A 5ALLA 4JNKA 4EPWA 4YPOA 4OI1A 4R8KA 3RJMA 2GZRA 1HSOA 2H1VA 4UHDA 1LQ2A 2F8TA 1UT8A 2FKNA 3AL0C 3IIMA 3LT5A 3NHYA 3G0IA 2MSCB 4RGBA 3W04A 3WGZA 2GPBA 4EG5A 5JCZA 4YT8A 2RGUA 2HHJA 2ANCA 1O9BA 2HRQA 2CVQA 4QLAA 2JFQA 4QXAA 1LPSA 2CLCX 3C16C 2DGDA 5ESDA 3GLIE 3NAZA 3WGMA 1ZIDA 1ATZA 3MWYW 2PQ6A 3PGXA 3X0DA 2VHVA 3THXA 2XH8A 3IPCA 4YP6A 1REQA 5A4IS 5B2FA 1TAHA 3HKEA 3JVIA 4H1VA 4MTCA 3TE7A 3Q8MA 3GP8A 1I5EA 3LU1A 4PG8A 3HKCA 3U60B 1HYBA 3IB3A 4IIXA 4KGXA 2Q3DA 5ICEA 3TRFA 2F1RA 1QGAA 2I2DA 1QIGA 2P7HA 2CJPA 2H7VA 4KKVA 2QT1A 4LFBB 4R05A 1BYUA 1E9SA 5C5IA 1ACMA 4JBIA 4L0QA 1G8MA 3N0WA 3VR6H 3QU9A 1T29A 1S3FA 4P5DA 5AKJA 3JASB 2CVOA 3SYTA 1WTCA 3WB2A 4ZYLA 3Q8KA 1JEAA 1FLNA 1QIMA 2Y93A 1WDWB 3QXGA 4Y1RB 1NMQA 2O4UX 5FLXA 4JJKA 2JLQA 4HUTA 4WDQA 4XCQA 4I19A 4CTNA 3BTSA 3FHJA 4NOMA 4PM4A 3EPLA 3ZD8A 1U1FA 4GXTA 5KYKA 4CKCA 1WETA 3HV0A 2YXNA 4H6XA 4WXRA 4C05A 5DHSA 3RC1A 2DJIA 4TTJA 5A3QA 4RF4A 4CEIB 3E7DA 4GI2A 3NVDA 4BB0A 2P27A 5AUNB 3K09C 3TOXA 4RJIA 4ZWNA 2J5QA 3ELWA 4IUCS 3TZEA 3EXAA 1EVEA 5A05A 1LEHA 4CIYA 1BCSB 3OCWA 3VPBA 2C82A 3DUFA 3M3HA 1XUOA 4TTVA 2XTZA 1ZHOA 4YLEA 2H2IA 3U13A 3IBGA 2O8BB 1F0KA 5FFMA 2XZOA 1PT8A 3MFYA 4MYDA 3KE9A 1CDZA 3HFJA 3ZWWA 4PSUA 4X7RA 4XIFA 3ZBUA 3DZGA 1OFGA 3G1WA 1ZN7A 2CYBA 1JR6A 3OJFA 1R4ZA 1CZNA 3NHRA 4HNTA 5KB3A 2BONA 4OK6A 1KR5A 4JJFA 2BTEA 1DQRA 1GT6A 1VB5A 1ODCA 1XDDA 2CYAA 3EFBA 1KK2A 3QEMA 4GM1A 2V9ZA 4J1NA 3WGKA 3MJ4A 3EZ2A 5BW8A 2WWWA 1LDNA 3KB2A 3IE2A 2WJ6A 5CLJA 6REQB 4QXRA 2R6HA 4WQMA 1LPMA 4HTFB 4C0KA 5IXSA 2PUGA 2ZBGA 1UK8A 5F3RA 5FLYA 2V0CA 3PITA 5AVUA 2CZGA 1RWQA 2YJTD 2A6PA 1S1CA 3AB7A 1NM5A 3FTFA 4IIEA 5BOVA 1VSTA 3ZH2A 3VAZA 2YZMA 1DBSA 3IS3A 1UJ5A 1BWRA 2FZKA 1J2JA 3OCVA 4UZFA 3T4EA 1I7NA 2J1LA 4JSYA 4HQLA 4YJDA 2J6IA 2Q2NA 1CW2B 1VG8A 2RH5A 1A69A 2C98A 2VQSA 3RWOA 3U0BA 3ZHTA 5HUJA 3ZJVA 2PPVA 2TMYA 4JVMA 1F8XA 4M4SA 4MKHA 3KLBA 1C0KA 5IT9A 1R27A 1XNHA 1YHNA 2HEIA 2K6GA 4JBWA 5LP6A 1XZJA 2PV0A 3SX2A 1SULA 2VJDA 3AJ8A 3CUUA 4ZO8A 4LMRA 1P62B 4CN9A 1HE3A 2C9CA 5IKOA 1DDOA 2W0MA 3TQSA 1ENZA 1ZCZA 4WLFA 5F23A 5CM2Z 3UAOA 1GT91 1WBJB 3DLIA 5KS2A 1CUJA 5K4AA 1VL1A 5ALRA 2QTRA 5ADUS 2WZBA 1GAWA 3WL4A 1J7KA 4NFHA 4LXGA 3ND6A 4XE5A 1CNMA 2FSPA 5ENDA 1Y3DE 3MGKA 2NAPA 4KDRA 2HA5A 2YV1A 1L9XA 3INYA 1AQYA 3EZLA 2VQEB 1MX3A 1N3IA 3LUBA 4C7MA 3HZHA 3WX0A 5EJFA 5JEEA 1QZXA 1AZWA 4Z0NA 3TNDA 5GV8A