4MH0R

Selective activation of epac1 and epac2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
162
structure length
150
Chain Sequence
EYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLAFLESSAKSKINVNEIFYDLVRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective activation of Epac1 and Epac2
rcsb
source organism Mus musculus
molecule tags Signaling protein/gtp-binding protein
molecule keywords Rap guanine nucleotide exchange factor 4
total genus 39
structure length 150
sequence length 162
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4mh0R00
4E09A 2WJJA 2AFHE 3KJIA 1W1WA 4Y0AA 5L8VA 3REGA 3FB4A 2R9VA 1N0UA 4C0QC 3CUEF 2JLRA 3GJ3A 2VP2A 4WOPA 1HV8A 121PA 1H65A 4LBWA 4PHTA 3THYA 5JJKA 4HYYA 2FNAA 1E2GA 1ZW6A 4CVNA 3VTKA 5DIFA 5IF9A 2ORIA 5L3QA 4RFSA 4IKEA 1XP8A 1JQLB 3BIFA 3MGCA 2Q3MA 3ND8A 1KGDA 5KDLA 4LV5B 1JR3E 2ZRBA 2IEYA 3PQCA 4TLEA 3K70D 1IN5A 2J0SA 3MD0A 5J40A 1CRPA 1OPXA 4CGZA 1I4LD 1FQJA 2BDTA 1ZP6A 5GJVC 4JL6A 1E69A 2O8DB 2GJ8A 4LJ9A 5SZIA 3VR6A 2V6JA 3WNCA 3PENA 1NKTA 2BJWA 2OSBA 3WNDA 1XTRA 4Z8XA 4OI2A 3RWOA 4QGAA 2FZLA 4LYAA 2J5XA 3KXIA 2WTUA 2ZJAA 4EJSC 2NTYC 3U44B 1VHLA 5EUQB 3B2EA 4PZLA 1TUIA 4IHQA 1E2PA 5JS7A 1LFDB 3UPUA 1SHKA 2IYWA 1ZM3A 1OLOA 1QHYA 1VIAA 1FNMA 4BUJA 4KFSA 2WKPA 5TVKA 4QBFA 1DAIA 4RD2A 4XVQA 3AUXA 4OK6A 2O0HA 3KQNA 2NZ8A 2H17A 3A4NA 4IDPA 2RGNC 3LQRA 1R7RA 1RYFA 2R2AA 1NLZA 4FN5A 2H1LA 3A8TA 1T8TA 4DDTA 1XMSA 3WNBA 1LVGA 1Q1ZA 2FPKA 3C15C 4IOMA 2W0MA 4URZR 2KB0A 1IM2A 3A58B 5GJBA 2ZI9A 5C4GB 1JI0A 2ZJ5A 1KYIA 2R6AA 1ZIPA 1XD9A 3K0CA 5JEEA 2FGJA 1GZSA 1VHTA 4I1VA 1T3SA 4JBYA 5JRZA 4CF7A 1MO3A 1KI6B 1IY1A 3EPHA 2OAP1 3WHLA 1XD2B 4C7OA 3A1UA 3EXAA 4C0JA 3EZ6A 3IHWA 4H1UA 1M8PA 3K9NA 2FSHA 3AEZA 1S2MA 2VHTA 2WJHA 1N6RA 3UKDA 2HF9A 3LLMA 2GBLC 3KFVA 3OEED 3SOPA 5KYKA 1FX0B 221PA 5AR1A 1GNQA 5FBVB 4JJZA 1YE8A 2PH1A 3FWYA 1X8JA 2ZRPA 2FN4A 1HE1C 1ZINA 2I4IA 2IL1A 2ORVA 3QG5A 4ZKDA 4CEHB 1CJMA 2RGAA 2DYKA 1ZRHA 3T06B 4ZCIA 3KTAA 4MKGA 1QHGA 1KJYA 1JB1A 1CR0A 1GP2A 1U0JA 2GETA 1Q57A 3OEEA 1OKKA 4G5SA 1ZYUA 2NO7A 2QZ4A 3ASYA 2PLFA 1YU9A 2GCPA 3FFAA 4B3GA 1G21E 1G8GA 2GXSA 1X1RA 3D31A 2XOKA 3L0OA 1E1QD 1JQJC 2JJ2D 4TMTA 5C1BA 5EJEA 5L3SA 5KPDA 4DHEA 2ZROA 4GZMA 4AY2A 3PEYA 2PT7A 4LJ7A 1K5DA 4JLNA 2CK3A 4KFRA 4TWZA 5FL3A 5EXXA 1FP6A 4B76A 1IJFA 4AD8A 2VPPA 4M8NE 2QAGB 1E9DA 4TTQA 1MR3F 1S9DA 3NBXX 5EQTA 1JR3A 1ZNZA 2HDNB 4OJQA 2Q3HA 5DYIA 1YQTA 3F3YA 1NVWQ 4RZ2A 4KSBA 5L3VA 3NEJA 3OZXA 1Q1BA 2O8CA 1YR6A 2AKAB 3N2IA 3WYFA 1G4AE 2ZETA 2OUKA 3A4LA 4QGHA 3RS5A 5KDOA 1KI3A 4O3MA 1DG1G 4RJLA 4URYR 1MV5A 2W58A 2XZOA 4QHYA 4YMSA 2QAGA 1OHHA 4GOJA 4HAUA 2EFCB 1GITA 1AGPA 3KXKA 4QKQA 2FZ4A 4MYCA 1UEJA 3TH5A 4ZV4A 2H7VA 1VTKA 3BRWD 4RFVA 3NIBA 4Q1BA 3ECCA 4XSHA 1U0HC 2E1RA 2CNWA 2NO9A 4C0HA 3AUYA 2G0NA 2D3WA 2ODEA 4PPFA 1UDWA 3LX8A 4CT4B 3CRW1 3GP8A 5C18A 4LSGA 2OLKA 2QPAA 5IHPA 2F1HA 3KTAB 3ICQB 3IO5A 1SGWA 4P4SA 3TR0A 1JXOA 1VG9B 2AD5A 4O2RA 2WZQA 1OH6A 2OCYC 2GVZC 2VL7A 3GEIA 1UBGA 3FDIA 3GJ6A 4XTCS 1W4CA 2PCJA 5SZHB 4A2PA 2G1JA 2XTNA 1COWD 5L3SB 2IWHA 5DGXA 1TTTA 1FX0A 2PMKA 1NJFA 4F92B 2QM8A 1U98A 4BFUA 2N42A 5K8IA 4R2IA 1OFTA 2QNRA 4K46A 4GNKA 3GLIB 2ZI3A 1U9IA 3R9WA 5J5CA 1N6HA 2XSZD 3EASA 2HJVA 5E7MA 5FBWB 4B3DA 4QL3A 4JJKA 2BVNA 4B3BA 2JAQA 5DI3B 1W4BA 2CJWA 2D62A 1OB5A 4D25A 1KI8A 3PEWA 4AIIA 4PC6A 4JYCA 4Q4AB 1P4SA 2YYZA 1G17A 3G82C 1RFLA 2YWFA 3CLVA 1UBCA 3T1TA 2YNMA 5TV2A 2A30A 1OSNA 3P4YA 4KYUA 4NBSA 2GJKA 2GWHA 2X19A 3M6AA 3I72A 1QHNA 3PUXA 4OHXA 1W36D 1D5CA 4TZ0A 4KI0A 5B64A 3VKGA 2BOVA 4IDHA 4NCHA 1AA9A 3H1TA 5GJWC 3KDSE 1TQ4A 1X1SA 1UBEA 5C2JB 4RD4A 4OKSA 4TN1A 5KNBA 2RCNA 1CRQA 2CJWB 2ZRGA 2X2EA 4GZLA 3HDTA 1CU1A 1HUQA 2QQEA 3BFXA 2A3RA 4H9GA 4TYPA 1ESMA 4GP7A 1OXTA 2NO0A 1R0WA 3SJCA 2VRWA 3CRRA 4LBVA 3EZFA 1TL7C 3NC0C 3FFBA 2XTZA 1OXXK 4TMXA 3GFOA 4S35A 1OB2A 1CIPA 1L2TA 3ZVLA 4AG5A 4L15A 5JSZA 4KLNA 2ZYTX 2VH5R 3GLGA 4QXAA 2FSGA 4WIAA 3UMRA 2GVDC 4HAYA 2QT1A 4HAWA 4ZCLA 5KOYA 2UKDA 4JBWA 5A4JA 3EWSA 4Q9JA 4LJYA 1S1CA 1QHIA 3FMPB 3THWA 2BM0A 4TTPA 4A1FA 2EWWA 2QTFA 1IY0A 3ICEA 3X2SA 1YKSA 5KNCA 5IRCD 3IEUA 4B33A 2AXPA 1F2UA 1XWIA 1NG1A 4M1SA 5KSYA 1LS6A 4RY2A 2ORWA 4DWJA 4B43A 2FG5A 5LD2B 1E9BA 3EAQA 3DMDA 2J41A 3DPUA 3K0CC 3VNVA 3KB2A 4DLWA 4KLZA 1A4RA 3CONA 3CH5A 4WXPA 2ZUDA 4N0DA 1NMYA 2IX3A 1DBSA 1Z3IX 1HQCA 4TLAA 1XRJA 1CR4A 2FU5C 4UJ3A 2CLCX 2CVFA 4DLTA 4V0LA 5JWOA 4BASA 3WMGA 4QOSA 4RVCA 3JZAA 3GFPA 2IC5A 3SI7A 2ZAMA 2DFTA 3LW7A 2G3YA 4D2IA 2MSCB 1G6HA 4FD2A 4LOAA 2ZE6A 3THYB 1YVDA 3VHXA 5EP2A 1FP7A 1I4TD 4DLRA 4LPKA 4EJSA 1CJKC 5EP4A 3AQ4A 3CF0A 4C7OB 2WOOA 2Q0HA 1IQPA 4A6PA 3RRMA 4B32A 2HXYA 3O8RA 2GCNA 4P32A 4PHFA 2FPMA 4NPHA 3AVYA 3OIWA 4IFBA 5HTKA 2BBWA 3RS3A 1E79A 5F98A 2W0SA 2G0TA 4LJAA 4PHGA 3SU8A 1XTKA 4IW3B 3V4RA 2JA1A 3GLGB 4FI3C 3SYKA 1G41A 1PV4A 1FOEB 4ACBA 2A78A 3SQXA 2BKEA 2RGEA 3AKDA 3R7WA 3QIAA 2P0EA 1U94A 3BB4A 2JATA 3Q72A 2GEVA 1S96A 3QVVA 4DLUA 4MITA 1M7GA 4RD6A 8OHMA 3MFYA 2A5FA 4CEHA 1R4AA 3GJ8A 4ABYA 3NWJA 1VECA 3K0AA 2ONJA 3L0PA 4EPRA 1EFHA 4FCWA 1EX7A 3U44A 4HUQB 1IN4A 3ZDQA 2FJUA 2IXFA 1LNZA 1Z0AA 3HR8A 5G3ZA 3V4FA 4WZBE 5KUTA 3CF6R 1IXRC 3ZQJA 1DAMA 5CB6A 2QN6A 3VQTA 4GMXA 1N5IA 4JLBA 4B73A 1NN1A 2FSIA 1RZ3A 4Q4LA 4XOIA 3R7WB 1NVXQ 5JI2E 2WSSD 4W5WA 4CRWB 1K6MA 4IJMA 3O47A 4G5RA 1RPZA 4RD3A 3CR7A 3N2EA 1AKYA 2R6DA 2XNDD 4MKIA 2CCKA 4RD0A 5DHAA 2VP4A 4L9WA 1N6NA 5TDHA 1KI6A 3DZDA 4LC1A 4B3FX 1ZM2A 4HATA 3K70C 1RVDA 2IYZA 3TMKA 1OFIA 1ZNXA 2XJ4A 1KO1A 4UKDA 3RS7A 3C5HA 3O8BA 1AQYA 3OFND 3WP0A 5CM9C 2B92A 3QF4A 2QBYB 1DVRA 2AK3A 2CEAA 1DEKA 1COWA 5HE9A 3SYNA 3GJ5A 4DCVA 2GRJA 4V0OA 2AX4A 1E2JA 3Q7QA 2PBRA 2VSFA 1KOFA 4GPTA 4NL4H 3TQCA 3UWKA 4DDWA 2ZS9A 2QTHA 4GOKA 4BZQA 3DL0A 4E22A 2ZU0C 1F48A 4QJ3A 3WRYC 2AXNA 2WIAA 4BLRA 3TVTA 3HP1A 5A5GA 2F43A 2QGNA 3UIEA 3HU2A 1Z2AA 1AIPA 2IT1A 4BECA 1S0UA 4EFNA 5SZKB 2YWEA 1U2RA 1N25A 1NIPA 1S8FA 1X86B 3GLIE 2VP9A 4R9UC 1Z63A 1Q1EA 1TPZA 2G9NA 2UVQA 1OF1A 5CK5A 3NH9A 3QEOA 1JEDA 1SVSA 2GCOB 2IUUA 3ZD7A 3K70B 3FHTA 1T5IA 2J87A 3HPQA 4LRWA 1XD2A 4G0NA 4Y0VA 4DDUA 3RC3A 1Y63A 4X8MA 3C41J 1Z6YA 1Z2CA 4FCTA 4NYJR 2PJZA 1TADA 1LF0A 3NXSA 5SZJA 4PQFA 1E0SA 2XB4A 1XJ0A 3SDZA 2A7QA 4EAQA 1O87A 3DOEA 5BN4A 3JVUA 3CBQA 5CDFE 5HR5A 1OIXA 2WPDA 3HU1A 4WBSA 3I62A 2ZRKA 3RWMB 4NP6A 1QVRA 1I4DD 1E2IA 4GI7A 1Z83A 1K5GA 3M0EA 4A0HA 3EC1A 2PEZA 1GOTA 3W6PA 4ZI3A 5J4YA 2CHVA 4K8OA 1FZQA 3I1FA 1R5BA 2YV5A 4PQYA 3PFIA 2XX3A 4IOKA 3DZ8A 1P61B 1PZNA 4TSFD 2V7QD 1P9RA 1GRQA 3RRYA 3W90A 2ZUBA 2YWGA 1BYIA 4JS0A 4TLBA 1TQ6A 2IYUA 1E2LA 2Q9BA 4DUGA 3P4XA 1OH7A 4IRUB 4DIEA 2KSQA 5F3WB 1G3RA 2GNOA 4WVFA 1D2NA 2O8BA 3L0SA 4TMWA 4DEXA 3KFXA 1YZTA 2EWVA 4HB3A 4BZPA 621PA 2DPXA 4CEJA 4ARZA 4EKDA 5DN6A 1M34E 4EPYA 2PMDA 4B44A 2GTPA 1KDTA 1AGRA 4IOLA 1FPMA 1XTIA 3BWDD 1BMFD 1ZC3A 1JJVA 1SXJD 1VIYA 2HJGA 1JAIA 3MWLA 1QRAA 3IGFA 4NCIA 1BKDR 1SXJB 3GPLA 4CYMA 4WAUA 2ONKA 3CPEA 4JLPA 3HR7A 4LWZA 2QMOA 2XZPA 3B13B 2O8DA 3MJRA 2A5YB 4OHYA 5FOVA 4ZDIA 1XJQA 2OFWA 2O0KA 4HB0A 5L3RA 4HDCA 2ZJBA 3RS4A 4DLYA 2BMFA 2W2XA 4JLVA 4BLSA 1W7AA 2HCBA 3AVOA 3QPVA 2I1QA 4TL9A 1OYWA 1Z0KA 3ADBA 1I2DA 1DOAA 4OQNA 1UKYA 2W2TA 4YMTA 1ZAKA 1EFUA 1KNXA 5BYJA 5AUQA 1KMHA 5DN6D 4CT5A 1E2DA 3EX7C 2W00A 2BEKA 1SVIA 2QY9A 1OIVA 4GRAA 4DEYA 3TSOA 4LBZA 1NBMA 4LUCA 3K0FB 1SXJC 3CRVA 2C03A 3ADDA 1T0HB 2Z0MA 2IYSA 2TMKA 1GFIA 3VKWA 5B30A 2QP4A 2C98A 5HKKD 2BMEA 4N0EA 2HYIC 3SFZA 1WMSA 2GXUA 3E70C 3ZJYA 5CJ2A 3EA5A 1HH4A 4GP6A 4E5UA 1Z29A 3KZ1E 3AP2A 1RRFA 4TZ6A 1WBBA 1UADA 1BS1A 5AK0A 2Y8EA 4TQ9A 3PJRA 5FTKA 3QPUA 1J2JA 4YDHB 4A9AA 1G8PA 1YR9A 4KBFA 1GKUB 2QMEA 3L82B 4US0R 1LV7A 3AVWA 1KMQA 1KIMA 1N6IA 3QQ5A 2YC4C 2J0UA 2GK6A 3SQWA 4G5GA 1KY2A 2XXAB 2FV8A 4Q47A 3LLUA 4KSCA 4UNNA 4LJ4A 1IN8A 1EWQA 1XMVA 2MSDB 4RCZA 4Q1DA 2BBTA 3CNOA 4IVRA 2WJVA 1NG9A 1XCPA 4KJZA 2ANBA 4A8JA 5EUMA 1RIFA 1XTSA 3B78A 3O8CA 3UK6A 1RW4A 2ZRIA 2IA5A 2VYFA 3RRZA 4HLDA 1R0YA 2QL6A 4IXMA 1WQ1R 4J0QA 4L16A 4MGYR 1J8YF 4Q9KA 2GHIA 1EXMA 3MSXA 1Q20A 2ZSBA 2B7CA 3U61B 3T5DA 3EPKA 3T5GA 3AGPA 2V6IA 1T0JB 2N1BA 4LY6A 5JRJA 3D7MA 3R8CA 1AS3A 2CL0X 4KBGA 3BERA 1W4AA 4DJTA 1ZVQA 4EUNA 3AP1A 4U5XA 3RYTC 5CYPA 3K0FA 2OFOA 4BFWA 3WYGA 3J81k 3KKMA 3W8RA 1DO2A 1E99A 3B60A 1XF9A 1Q1QA 3K09A 4LK2A 2CK3D 4DB2A 4POAA 4HZUA 2W6IA 1GM5A 2XITA 3DO6A 3Q8XB 1ZNWA 4LHXA 1HE8B 3TW4A 4LZZA 5HPYB 3QF4B 4TMZA 1RJ9A 1E0JA 1ZD1A 2ZJZA 4EPTA 1J7KA 1NVVR 4D0NA 5JS8A 3BC1A 3AF4A 4HAZA 1E2EA 3O8DA 4V0MA 3CR8A 1E9CA 4JMPA 4TL7A 4D26A 3H0KA 5AUPB 2ZE8A 4P0TA 3F0TA 5FTLA 4OK3A 2IWRA 1W0JD 5FPTA 1YR8A 4AYWA 5CYOA 4QRHA 1J90A 3U7GA 2AK2A 1TQ2A 2OT3B 4FIDA 4B3CA 1G291 4IEEA 1XEWY 4PO8A 4JVLA 2MSEB 1US8B 1N2CE 4JVSB 1R0ZA 1G8FA 3LD9A 1BYUA 2CL6X 2OCPA 2ZYVX 5EP3A 3NG1A 5FUWA 1GSIA 4U00A 2FDCA 5HZHA 4QFMA 3CNLA 3B9PA 1LS1A 2OHFA 1E9RA 4M1TA 1YRAA 1Z0JA 4UXHA 2CCJA 4HLUA 2CHQA 4NCJA 1YZGA 1P6XA 2XGJA 1FNNA 1EFRD 4OBEA 3U3JA 2FEOA 4FXPA 3FOZA 2P5TB 5AWFC 4MUBA 1FFHA 2O0JA 3IIKA 2ZYUX 1IXSB 2VSOA 2PJRA 1HEIA 1NF3A 2ZSDA 3TW8B 3OAAD 3EIEA 1X6VA 3ZLJA 3P20A 4I4LA 3EWAA 3NBYC 2IEZA 4OL0A 3LW8A 1KAGA 4LV8B 2R62A 1EX6A 1E3MA 1G3UA 4UNRA 4B34A 2IYQA 1KI1A 3QNUA 1KTVA 2GZDA 1N6KA 5EXTA 2B8TA 5E95A 521PA 1EFRA 3RAPR 3U7FB 3OIVA 4B2IA 4DLXA 3QJYA 3IIMA 3ND9A 1HY3A 3Q85A 3OESA 3QOFA 3I73A 3D6TB 1OFUX 4X8LA 2C95A 4L5BA 1MOZA 1G5PA 4YXWD 3TUIC 4Q48A 4NYIQ 2NO1A 3WP1B 1VKJA 3EPLA 4HDQB 4C0LA 2GESA 1W4RA 1CXZA 2IYXA 4PANA 4OQXA 4DCTA 3VAAA 1TU3A 1D6JA 2EFDB 4PSKA 4I1SA 4PHHA 2Z43A 2DWOA 2OBMA 2ZRMA 2DB3A 4AKGA 1WCV1 2RGXA 3OAAA 1XXHE 2C9CA 1DAKA 4Z54A 1KMHB 4UXIA 3QUSA 2ODBA 2BCGY 1SHZA 1IXZA 2IYYA 5ANRB 3LQQA 2ZJ8A 1NKSA 4A0RA 1MABB 1E9EA 2OBNA 1W5TA 2GBLA 2A5JA 1QVAA 2VBCA 3CX7A 2Q3FA 3CX8A 3KQLA 1VPLA 4EPVA 3KJHA 1KNQA 2AHOA 3HPRA 3QVUA 4PAMA 3FKQA 2QUZA 1LB1B 1C1YA 1Z6GA 3CZPA 3EZ9A 2XB2A 1TEXA 3NDBB 4A36A 4R98A 2NPFA 1W0KD 3TSZA 2EYQA 4EQ6B 4L4UA 2VP6A 2D7DA 4NE2A 1VG1A 2P65A 3MUFA 1KO4A 1CEEA 3ADKA 3I4LA 5CIWA 3B82A 2YC2C 3KKNA 5CK4A 1L8QA 3EG5A 2QGZA 2WSMA 2KWIA 2JLZA 2QROA 1A2KC 2ZE5A 2XOKD 5B57C 1JPNA 2VP0A 3MAAC 3NBFA 3RDPA 1TNDA 4NYIR 4YONB 4OI1A 3VR5A 2QTVB 1G64A 3VR3A 1MO4A 1F60A 2WMNB 5GVRA 3I92A 2W6JD 4C0AC 1ETUA 3U2QA 2I3BA 3FTQA 5H8WA 4BFYA 4MDFA 2VEDA 2YHSA 2ZRNA 4QBIA 5FR1A 1E4YA 4C4PA 1T9HA 3F8TA 4GDFA 2WAYA 1A5TA 2BJVA 3E2IA 4G5QA 1KK1A 2GJSA 4BLPA 5KDDA 2ZJ2A 3KUDA 4UNQA 1TX4B 2ZITA 2YOGA 2I1VB 1PVOA 2GK7A 2RGBA 4URVR 2A5GA 4FMCF 2QSZA 2R8RA 2AFIE 3SS8A 3DOFA 1BIFA 1KY3A 1E1RD 4K81B 4DSNA 2V3CC 2R6GA 2OG2A 3I3SR 5DI3A 3U6BA 2GDJA 4OQMA 1II9A 4YMWA 2RB4A 2IXEA 2ZRHA 2ERXA 1L4YA 1H8HD 4MYTA 4AWXA 4P4UA 4D4MA 2AN9A 1II8B 2FF7A 1XEWX 3GJ4A 3HWSA 1VG8A 4R2HA 1HQYE 2BBSA 2JGNA 3ZVRA 4Q1AA 1E2NA 1F2TA 1G6OA 2GEDA 1AN0A 2CDNA 2FGKA 5FTMA 3GLGE 4OQLA 3U3MA 2GAAA 5BWMA 4TL8A 5KTYA 1Z0FA 4B6EA 1ODFA 4F93B 1GNRA 3TNFA 4M21A 3NTUA 5HZKA 5EE1A 2AR7A 4YLGA 1OKKD 1II0A 1DAFA 2XSZA 4MRNA 4QG7A 4PSAA 1N5KA 4US1R 3B1VA 1HT1E 4JSTA 3CB4A 1QF9A 3NHBA 4F38A 2GJ9A 3DEFA 2J7KA 4D6PA 3ADCA 4MYHA 4EFMA 1EGAA 3OHMA 1R0XA 2BM1A 3RHFA 3X1ZA 4DT1A 1Q21A 1WF3A 2JCSA 2D2FA 3QG1A 5LB2A 5FOXA 5JWHA 2R6CA 1KZGB 3CKLA 1II8A 2RHMA 1AK2A 2O8BB 4LYFA 4GBMA 3LBIA 4BPBA 2HLDD 1SKYE 2DWQA 4XWOA 4YMUA 4IVQA 1DAGA 3RS2A 4DLZA 4X8OA 3I61A 4ZO4A 3SC3A 3K0EA 1UJ2A 2ODWA 2JLXA 2P6UA 2ZRJA 1MH1A 2HUPA 4JLKA 4DVGA 2ZTSA 3AF0A 2ZIAA 2QG6A 5FI0B 5M04A 2JDID 2IHYA 1QBKC 1AS0A 1NBME 3K9LA 3LH5A 2IS6A 3EIHA 3FPAA 4PC2A 1XCMA 2C2HA 2F9MA 1NVUQ 4MRRA 2O8FA 1NRJB 3CPJB 4HUQA 4JIMA 1EFCA 1FL9A 2WBLC 3A1SA 5FBQB 2ZQ5A 4OJKA 5EE9A 1GAJA 2FFHA 2CLSA 1UDXA 2R65A 2ZUCA 3BAFA 3U3OA 1UEIA 5JJLA 5LBIA 3IBGA 2C96A 1ZCAA 1CULC 2DHRA 2W83A 4ZKEA 4A15A 1S3SA 1VCIA 3QY0A 3Q3JB 1WRBA 1SVKA 4IVPA 1G3MA 2BCJQ 4JLDA 2ZVPX 3VU9A 3WRXC 4DCNA 3VR2A 3W34A 1W36B 2ERYA 2W2VA 1G19A 2ZSFA 2HF8A 4M53A 2IYRA 1CS4C 1TF2A 2C99A 3B1ZA 1MT0A 4F4IA 1L7VC 1YZKA 3QXCA 3LFUA 1XPUA 4L8GA 3K09C 1SKYB 3SHWA 1ZM7A 2WWFA 2PEYA 2J0UB 2CHGA 5EE5B 3QE0A 4G5OA 4IDNA 1YZQA 2G77B 1HT2E 2OILA 4BRWA 3AVQA 4M9QA 3GJXC 4A0FA 2QPTA 5DHFA 4AK9A 4MGIR 3T12A 4D81A 4PO1A 2EFHB 5DISB 3EIQA 1KSGA 3QI2A 2IUTA 2YVUA 3K1JA 2WPDD 4GMDA 4NYMR 4TQUS 1DE0A 1ELOA 2YINC 4QHTA 2VA8A 4US2R 2QENA 4UXJA 1XX6A 4I1OA 3SZRA 1V43A 1DTSA 1CR1A 2REOA 3SR0A 1XFAA 2QMUA 1SVMA 5CB8A 2VLIA 2O8FB 4N3NA 2X1VA 3WYAA 1XJCA 2ZI4A 2ZU6A 1VYUA 1W2GA 1E2QA 4CW7A 4QM7A 3QBTA 1WXQA 1X8KA 4BFXA 1GTVA 2QE7D 2ZI7A 1E79D 5H68A 1D9ZA 4PC3A 5FFMA 3QKTA 1FTNA 2BV3A 3M4YA 3THXB 2OAQ1 5FR2A 3IQXA 4I81A 1MRSA 1E4VA 3DM5A 4KYIB 4PPQA 4Q02A 4QBGB 1Z28A 3CWZA 4NYJQ 2H18A 3TKLA 3EZ7A 5JSZB 5FL7A 4X8HA 2DY1A 4PPNA 5EXSA 5KSPA 2F9LA 3AF1A 5JEDA 4ASUA 1MO5A 1J99A 2ZEJA 2JLYA 4FWTA 3K8YA 2G1KA 2G6BA 1N5JA 3FYHA 1NN0A 2P67A 3E1SA 2JLQA 4ERNA 3CIOA 4A4DA 1LF5A 4URWR 5EE0A 2QAJA 3VX4A 4FINA 2R6FA 3KL4A 4ZPXA 4D4LA 1MO6A 2WJGA 4WW0A 4DKXA 3B7GA 2RGCA 1ESNA 2A2ZA 2EQBA 5F9FA 1DPFA 2KBEA 2VF8A 4Q7MB 1UKZA 2ANCA 1CTQA 2IHBA 3TAHA 3ZS9A 2IYLD 4FMDF 5AUNB 1T3LA 3FGNA 4XWAA 4W7SA 2DFKB 2OE2A 2XZLA 3D3QA 2GXQA 1J70A 2JJ1A 3AF3A 4TT3A 5G53C 2IS4A 3TJZA 4NCKA 2EW1A 2BC9A 3U7HB 1ZMXA 2ZI5A 3GLHA 3CX6A 3OFNA 5DYGA 3A1WA 5AJVB 5AJXA 1G8YA 1IY2A 1GRNA 1PUIA 3PUZA 4MKFA 1QHHA 2QSYA 4PC1A 5KSOA 4B48A 1M7BA 2V54A 1G7RA 4JT4A 1NY5A 4FWIB 4B2PA 2F43B 2AL7A 3WMEA 4TYWA 1ZD9A 4BRUA 1NBMD 2IS2A 4HLQB 4M2LA 1PUJA 1Q0UA 4MYUA 4TYYA 4O25A 4LPSA 4RKFA 3GLFA 2YOFA 5D3MB 2JLVA 3KJEA 1GL7A 2WWGA 3X1WA 3TE6A 1G20E 5JZVA 3NKVA 4JLAA 3QSYA 3IILA 5FTNA 3WXMA 1G1MA 1E6CA 3RNLA 1WE2A 4XVUA 4RZUA 4W9MC 1N6LA 1XBTA 5FBRB 1F6BA 4B3XA 1UFQA 4LBYA 4LJ6A 2ZRCA 1KK2A 2DFNA 3RLFA 2XEXA 3RRNA 1G7SA 1XZQA 3BH0A 1VCNA 3I5XA 3AV0B 3BH7A 1NJGA 4BQSA 5B58C 6Q21A 3MWYW 5HCIA 1DAEA 2C77A 1X8LA 3FE2A 4OI4A 1DS6A 4FMDB 1M7HA 4BFTA 3UATA 4AKEA 3UXMA 4AKIA 4IEIA 2IW3A 3VFDA 1VYTA 2O8CB 4M9ZA 1SVOA 3REFA 1P73A 2VTKA 4OHZA 1D2EA 2YWHA 2FPLA 2ZANA 3IPXA 4F4JA 2PZGA 4LYJA 2O5VA 4TLCA 5FOUA 2AWOA 2E9SA 5EXPA 4CZ2A 1G16A 3QBVA 4OK5A 5BN3A 4BFVA 2R44A 1KK3A 1GKYA 1OV4A 2BMJA 2Z4RA 1D8TA 4KFUA 2WSSA 5FI1B 1W46A 2NGRA 4JVMA 1G8HA 2WVJA 5FOSA 5CITA 3A36A 3EA0A 4P33A 2A5DA 1P9NA 3B1WA 1E94E 2K5UA 4ITRC 4V03A 4Q9HA 3K0SA 4AI6A 3CRQA 1XMIA 2XNDA 4WA7A 2CVHA 1IONA 3LA6A 5LB4A 3GMTA 4RD1A 1EK0A 1UKEA 2OM2A 3FKSD 5KPJA 1P7CA 4EQ6A 5DO9A 1P3JA 2F1RA 3ZZUA 3P1JA 4Q03A 2V7QA 3QXXA 4A92A 2P3SA 4HB4A 2ZJYA 3ETLA 4V02A 4LV6A 1ONBA 2IYTA 2VP5A 2Z4SA 4PO9A 5BXQC 5J4VA 1VDZA 1RRGA 5CJPA 1W0JA 1Z22A 5FPHA 4MH0R 3P27A 2WJIA 5C46F 1R5NA 1U90A 5DH9A 2BWJA 2YZ2A 4YDSA 3KKQA 4KFTA 1JNYA 1Z0IA 1NI3A 2Q21A 5DI9A 1Q12A 5K8UA 1E2FA 1GKIA 2G83A 3LNCA 3VHLB 5TXGA 4LI0A 1NLYA 2UZIR 1I2MA 4Q21A 1IAQA 3TIFA 3GLHE 3CPHA 3QKUA 3WBJA 2BIFA 1U0LA 2ATVA 1GL6A 2ZR9A 3DVLA 3SN6A 1CJTC 2VHQA 2QMHA 1ZD8A 2AWNA 3B85A 4LHYA 2F1JA 5LD2C 3QKSA 2RGNA 1ZBDA 2D06A 1E2HA 4MQBA 3Q9LA 1XMJA 1TMKA 4B2LA 1E2KA 5JJIA 4D82A 3SJAA 4MRVA 4M1WA 2B8WA 1BOFA 2RMKA 5E3HA 1XU4A 3VU9B 2OLJA 3MCAA 1GDDA 2MMCA 2XTMA 5DE3A 1PLKA 2P6RA 3AKCA 2J7PD 2ZVQX 3HYTA 4Z1MA 4NDZA 3T1OA 1FMLA 5JFGA 2C9OA 1U9IC 2ZS8A 5K8TA 1FUUA 3VR1A 1GNPA 4TTRA 4G01B 4Z51A 1C4OA 1QDEA 1ZU5A 4WZ6A 4OHVA 5FH9A 3HJNA 2V9PA 5FUYA 3TR5A 4FW9A 4Q7LA 2EYUA 4BGDA 3H4MA 4ZDJA 4M0LA 3PUYA 3B1YA 2RAPA 3T61A 1US8A 2BMDA 3EC2A 5HKKA 3IEVA 3KQUA 4C0BA 5TY0A 2P5SA 2WWYA 5FL7D 1OXVA 4YXWA 2NOAA 4PX9A 3ZS8A 3N70A 3V9PA 5GADl 2HT6A 4YC7A 1EG7A 2J0QA 2X8AA 2FA9A 2RH5A 1Q3TA 2IUSA 3WMFA 3R9XA 4OQFA 1O3YA 5FPYA 4LCBA 2CE2X 2WKQA 3DDCA 4Q1EA 5AJZA 4AG6A 1RRCA 1QHHB 3W6NA 1YJ5A 3X1XA 3C5CA 2XXAA 4Q19A 3BOSA 4F91B 1N3BA 3SE0A 3GLIA 4DBLC 1XPRA 1RKBA 1UBFA 2ZRFA 3LO5A 3TUZC 5BN5A 1HTWA 1P5ZB 3MWKA 5JCPA 1FQKA 1KZ7B 2QAGC 4HB2A 4NKRA 5D3MA 4HZUB 1ZCBA 1QZXA 1S3GA 4M1OA 3NDPA 4KV9A 1IHUA 1P75A 2OESA 3LBHA 2H8KA 4QHSA 2L0XA 5IT5A 5E7IA 3PEUA 3FMOB 1U99A 421PA 5JHHB 1W5SA 4DXAA 4P3YA 4PPGA 1RE0A 1E0KA 4BWYA 4PTLA 5P21A 4BEBA 2IF2A 3LVQE 4HSEA 1IN7A 4MGZR 4XD7A 3SJZA 5JHGB 3SEAA 3ZVNA 3GLHB 2B7BA 1D9XA 1RRPA 1OXSC 2FMXA 4LGMA 4NTZA 1OIWA 4M22A 3OF5A 3W5IA 5JI3E 3K9GA 1W2HA 1G4UR 2LKDA 1B0UA 3GCGA 1Z08A 4OHWA 1W44A 1T3HA 3SBDA 4R71A 4LYHA 2F1IA 4XJXA 5D3QA 4A8JB 4KAXA 1L4UA 2GXAA 1IN6A 1G5TA 4FCVA 2NIPA 1G9XA 3EPJA 4EDHA 1W0KA 5DLQC 4IXNA 2W6JA 4O0MA 3M1IA 4URXR 2CE7A 4Q4HA 1IJEA 1GVNB 1XTJA 4PFSA 3K0AB 4JZKA 4JL8A 3CW2A 3W6OA 3EW9A 3Q5DA 4QGFA 1YR7A 1EWRA 4PSVA 4XD7D 4HEJA 1FUKA 3QKRB 4PXAA 3T1VA 4EFLA 1BO6A 1NP6A 2Z6VA 3KKPA 4I99A 4PAOA 1OYYA 5FPKA 4HAVA 1XPOA 4LX0A 2PZFA 3K9HA 3DM9B 3QPWA 4ZDWA 3T35A 5B2ZA 1E32A 4FMBB 3X1DA 1NN5A 1PLLA 4Z8YA 4B6FA 3UMSA 3PEVA 4BEJA 3TSWA 1OJLA 1DELA 3QENA 3T15A 1AS2A 1P9WA 3NH6A 3BFVA 1J8MF 2FFAA 4M4SA 5G40A 4NCNA 2PX0A 3U7EB 2ZR7A 5BYKA 4MGKR 4QJ5A 4KCGA 4W5JA 4LJ8A 2ZJOA 4MRPA 4KXFB 3FHCB 3PCRB 3PIRA 2ATXA 1Z6TA 4IDQA 1D2MA 2OXRA 3LY5A 4NHOA 1E1RA 1W47A 2PL3A 1SVWA 4MRSA 4JT2A 4JLOA 2IK8A 4AURA 1H8HA 3LV8A 721PA 4NMMA 2HV8A 1XCGB 5G41A 1OHHD 2CL7X 3HU3A 1TF5A 3RSOA 1P2UA 2QRNA 3MRSA 5G3YA 2C78A 4GOXA 3QF7A 4HLUC 2P6NA 4KVAA 2DBYA 1VCMA 2D74A 2ZSAA 3L0IB 1QG2A 2J59A 4NZYA 2CCGA 1Y3AA 1TEVA 3LBNA 4A0GA 4C3ZA 4NH0A 4E03A 1M2OB 3B1XA 1MKYA 2GCOA 2DFLA 2QEQA 4DT1B 1NMXA 4CEIA 3BK7A 4TQAA 3CWQA 4C2TA 1F2UB 1KDRA 2F3RA 1P72A 1TUEA 2H92A 2HLDA 4DIDA 1P2VA 1R8QA 3WY9A 1WDTA 4JKYA 4IFEA 3UMFA 4UNPA 3JZMA 1N0WA 5JWRA 3U3RA 2N46A 4Q9LA 3QXHA 1ZUHA 2P2LA 3GD7A 2ZAOA 1QG4A 4ZDKA 3W9YA 1Q44A 1NNEA 2CNWD 3D8BA 4D4JA 1Z8FA 1SULA 4TMKA 2JLUA 1NMZA 2WWXA 4EJSB 5J4LA 1M74A 5EE3A 1XXHB 4F4CA 3R9IA 1NIJA 4LDJA 2IBMA 5F9HA 1KI4A 1WA5A 4CEIB 2WIBA 3G0HA 4O2LA 3GLFB 3GEEA 2ZXUA 1T91A 3NBZC 3A37A 2GF0A 3T34A 3U3KA 1VG0B 4A6XA 1JEEA 2LKCA 4CDGA 3THOA 5FBLB 1AM4D 1FTSA 1G3QA 1P2TA 2CBZA 3AVPA 1AJEA 3VKHA 4B71A 3AVTA 2V55B 3FVQA 4UQOA 3AH8A 3W3AA 4PQRA 2F7SA 1KSHA 4NONA 4D0GA 2KJQA 1YHNA 1KDPA 1E9SA 4BE7B 4S2EA 5TARA 1RC8A 1R6BX 2ZREA 3JVVA 4E07A 1AZTA 4YMVA 4TYNA 3IO3A 4UNSA 1XEXA 4XIGS 4EIWA 3L2OB 2RKOA 4KHZA 4EPXA 1KI7A 2F55A 2V1UA 1OH8A 1DADA 4FMCB 1YZLA 3VNUA 1Z06A 3C7KA 1HURA 2J9RA 5BW8A 1P60A 5K8LA 2QP9X 2B6HA 3BJIC 1NN3A 1XNJA 3PR1A 5FTJA 4G3XA 4M1MA 3LRPA 3TUJC 3IQWA 4UJ5A 2X2FA 2CXXA 2GZAA 1SVLA 3GJ0A 3WHKA 4C2UA 3GEHA 4Q1CA 1FMJA 1OE0A 2D2EA 3ASZA 1CBUA 5E7JA 2WAXA 3SFVA 5KU1A 1R5OA 2FX3A 2PZEA 2WWWA 5KSZA 2UZ3A 1KKLA 3OIYA 3VMFA 4V0ME 3IKJA 5EZ6B 4D0LB 4G1UC 3C14C 1G3IA 1E98A 3I5YA 4A8JC 5A0FA 1WB9A 1YZNA 3BD9A 3CNNA 1ZJ6A 1TU4A 5IDVA 4TLDA 1E2MA 2QE7A 3K53A 4CIDA 4KU4A 3B9QA 2ZRDA 1KAOA 3RSLA 2J45A 3FHOA 2QBYA 1JXMA 1JECA 4HZIA 1LY1A 1V5WA 3C16C 2FOLA 1OXUA 1GUAA 2NMVA 3MMPA 1ZUNB 2RHDA 3HYRA 1E1QA 2JJ2A 2PT5A 4HDOB 4TYQA 1CF4A 2OXCA 5KO2A 2OZEA 5H70A 2VHJA 4Q66C 2Z5FA 1SQ5A 1UKVY 2A9KA 4DZZA 4ZI2A 1AQUA 4DSUA 2ASEA 1KI9A 5TMPA 2KE5A 4HI0E 5CDFA 5J4KA 3IPYA 1JR3D 2QP3A 2QM7A 4ZCMA 2ZSEA 4ZIRB 3VX3A 3BGWA 1MRNA 4Q18A 2GEUA 4I1UA 1B23P 5H1YA 4XTRA 4JYBA 2OO7A 4C30A 2NPIA 3RABA 2JEOA 2G88A 3Q7PA 2HEIA 2XAUA 1DG3A 3H2YA 1N6PA 3BS4A 3U6KA 2FH5B 3BH6A 3VR4A 1ZIOA 4Q7KA 1Z5ZA 3BFKA 3KJGA 4DCSA 3ZD6A 2FEMA 3U4QB 4ARZB 1WBDA 3MWJA 1H8EA 4LHZA 3ZGXA 1NY6A 1P62B 4XWKA 4BLOA 2HCJB 3I32A 3LX5A 4BFSA 1Z47A 5FOTA 3W8NA 2BKUA 2F6RA 4LJ5A 1T4GA 1Q22A 2PX3A 3IDQA 1IOZA 2D7CA 1IBRA 2ZS7A 1YZUA 3MJHA 5JBQA 2NO6A 4TL6A 4GSYA 2J3EA 2GA8A 3BE4A 1MABA 3PVSA 4RFSB 4XSGA 4Q4JA 2XNSA 4AYTA 3AVUA 2KBFA 4BLQA 3X1YA 3SBEA 3S1AA 1H8ED 3F5FA 4Q9IA 1N0VC 4CEJB 3DKVA 4MUAA 4B35A 4QM6A 1T5LA 3ZZ0A 2EFEB 4ON9A 3FMFA 1XEFA 5F2EA 5GJCA 2V1XA 1XXHA 1QHXA 1UPTA 1LTQA 5C4MA 4AYXA 2GZHA 5HE8A 2OEPA 2AKYA 3CZQA 2H57A 4C9BA 2ZE7A 2D4HA 1VCOA 4Q01A 1CJUC 1JR6A 2PCLA 3PITA 4Q1FA 4RZ3A 3PG5A 2B21A 5JMTA 3UWOA 4N1AA 1JBKA 1C9KA 3CO5A 3OEHA 3GQBA 1Z6AA 3FMIA 3W3ZB 5TB5A 5AUOB 2DR3A 2EVWX 2C9YA 3DMNA 5FUXA 2VF7A 1WP9A 3GFTA 3BXZA 2H16A 4ACAA 1F3OA 1KSJA 3L8YA 3B5JA 2REXB 2WHXA 3G5UA 2DCUA 5IK2D 1NLFA 1CR2A 2SHKA 2FSFA 1G5RA 3TQFA 2VHCA 4DDVA 1VMAA 3A4MA 4H1VA 4DSOA 3U5ZB 3LXXA 5L3QB 2ODNA 3A1TA 2QPOA 4JLMA 4JLJA 3AB3A 1HA3A 1ZUIA 1BH2A 4JL5A 2WKRA 2ZRLA 3B6EA 1EFTA 4BZXA 4OI0A 2QQ0A 1BMFA 1KHTA 1Z07A 4B75A 1F2TB 3C8UA 2X77A 2FE4A 3BB3A 3ONWA 4JSYA 4WXRA 3FKSA 4KO8A 1U8AA 1ANKA 3BORA 4GFDA 4QGGA 5IK2A 1E0AA 3A1VA 4M1YA 4D4KA 4HLCA 4KITB 2VQSA 1VYVA 2WV9A 3S1AB 1OFHA 1SZPA 1LW7A 1P2SA 3QXJA 4RKEA 3U4QA 2J0VA 5DNYB 3QKSB 2ECKA 1UAAA 2HYDA 1GIAA 2JDIA 4KVGA 3TBKA 2BEJA 2OBLA 2FFBA 2ZR0A 4AKHA 1TQDA 1JJ7A 4MA4A 4XH9B 2RGGA 5FPSA 1T6NA 2RGDA 1GRRA 3GLFE 1A2BA 4QC2A 3PV0A 1UF9A 4HAXA 3SHFA 4DCUA 1ZM9A 3AVXA 1PJRA 1FW6A 2OFXA 3T1QA 4M1KA 3BB1A 3UANA 4A2QA 4ESHA 3LDAA 4DLVA 2GKSA 4MKHA 3NEYA 2ZYWX 3H84A 3AKYA 3AGQA 4Q7JB 4Q4JB 4DLSA 4NYMQ 1KO7A 5HCNA 2GF9A 3PUWA 4QNMA 2WOJA 1TAGA 1N5LA 1A7JA 1JAHA 3KXLA 5LPNA 1W49A 4IOJA 1CP2A 4ESVA 2WWHA 5AJWA 3KQHA 1CLUA 2ZRAA 5EZ5A 1NVVQ 3NC1C 2WWIA 1KO5A 1RJ9B 5DSZA 4Q5IA 3C4JA 2WMOB 2C8VA 2JIZD 3IIJA 3TRFA 4BLTA 4PAQA 1XEXB 3OIUA 4U02A 1K8RA 2NG1A 4JBXA 1KKMA 2HT1A 3KB1A 2QT0A 2REBA 5BQ5A 4PC7A 4QBHA 2VIIA 3EZ2A 3RC8A 4RCYA 4EPWA 3QKRA 1XD8A 2OCAA 5KNDA 1SXJA 1TF7A 4MDEA 1XDBA 3R8FA 1KSFX 4A2WA 3KQKA 3U60B 2JJ1D 3QXSA 3Q5EA 3NVAA 1KJZA 4DB4A 4HUTA 1F5NA 2MMGA 3PXGA 4PZYA 3ZYCA 5FOWA 3TAUA 3GJ7A 2JIZA 4C0SA 4P31A 2J7PA 4Z1MD 1GILA 2GILA 1JPJA 4GT1A 3DKPA 4RZXA 3L8ZA 4V0KA 2WICA 3UG6A 4IDOA 5LDDC 1XZPA 3I8SA 5FUVA 2H5EA 3ZQ6A 5KHOC 3E5HA 4U7DA 1DAHA 2YJTD 2GAOA 5JLJA 2ZM5A 3MLEA 1YRBA 1KI2A 3DHWC 2NQ2C 3OE7A 1GG2A 1Q3HA 2OV2A 1R2QA 2V4ZA 1Z6XA 3W5JA 4LC0A 4P4TA 2QA5A 1KDOA 2QRZA 1U81A 4M9SA 4PR0A 1G7TA 1W48A 1XB2A 3QEJA 1ZM4A 1R10A 4II7A 4WZAE 1AKEA 4QNRA 5CLQA 3PUVA 1DARA 4TMVA 3LWNA 3ZZTA 3ZIAD 2O8EA 3KUCA 2E87A 2DWPA 2Q9CA 2EFGA 2WJYA 3NHAA 1G18A 1NL3A 2F3TA 2Z83A 3CM0A 4JKIA 2V8OA 3KKOA 3N5CA 4R7ZA 1AZSC 3V00A 2VHUA 3LVRE 1GL9B 2VSXA 3LAWA 3OE7D 4JVNA 1Z0DA 1CJVC 1SKQA 3TK1A 3ZVMA 1KJWA 1CKEA 4BFZA 4Q4AA 1E96A 4B74A 2Q9AA 2PLRA 1QHSA 4AC9A 1A82A 2IXGA 2NZJA 1OT3A 2XJ9A 3I8XA 3B8HA 1E9AA 2FFQA 4F7WA 3AP3A 1U8YA 1OH5A 2YOHA 4KODA 4ASUD 1NSFA 3WBKA 2LCFA 4C0KA 2JLSA 5CIQA 1E9FA 4DC9A 3L43A 5AJYA 4LHVA 1ZC4A 3ZH9B 1JALA 1EESA 1RYHA 5CLLA 5EP1A 1HYQA 1S9HA 4L9SA 4QJ4A 2O8EB 1R8SA 4URUR 4D80A 2CMKA 1PLJA 3ZIAA 3AKEA 1UM8A 3KX2A 4Q4HB 2J1LA 4LHWA 4P4SB 4TT3D 3SJBA 2KI5A 2JLWA 1KK0A 2JASA 5J47A 3UG7A 3LXRA 2GJAA 1ZU4A 4A82A 1N6OA 4DSTA 3OEHD 2IF0A 2JJ8A 3SYLA 4DRZA 2HXSA 3A6PC 3IHLA 4XVRA 5CM8B 4PZZA 2EU8A 3EARA 3SNHA 1A1VA 2WM9B 2YKGA 2O52A 3MG9A 4RSGA 5ELXA 3RVBA 2BBOA 5GVSA 2IS1A 4ILEA 1SXJE 5E4FA 821PA 3THWB 2BHRA 2OCBA 5JECA 2FWRA 1KO8A 3TGPA 2AD1A 1G7CA 3H86A 3AF2A 3P26A 2Q6TA 3RANA 4TSFA 3CF2A 1U8ZA 1W36C 4NU0A 2QORA 1OW3B 1T8UA 3THXA 2QI9C 1S4QA 5J4HA 1M1YE 4OYHA 1NSTA 4DUGD 2QU8A 3P32A 3BBPA 4W5HA 4M9XA 2J46A 3TVDA 3CH4B 2ZPTX 3RS0A 4YQFA 3CRMA 1XTQA 4ZIRA 1ZNYA 3IUYA 1X3SA 4Q00A 2ZI6A 4B47A 3AM1A 3IBYA 2VO1A 2IYVA 4GL2A 1DO0A 2C5LA 3AVVA 4V0NA 5UKDA 1S1MA 2CLDX 3TLXA 1GWNA 2C04A 3R20A 5JCZA 2W6ID 2LWIA 1M6NA
chains in the Genus database with same CATH superfamily
3BF8A 4E09A 1PGPA 1J9GA 3H5RA 1OCEA 2P9EA 3FUTA 5JH7B 2AFHE 1GR1A 1W1WA 4YJFB 1KR2A 4CF4A 1D6MA 2OQRA 3FB4A 5MFZA 1Q1GA 3JQDA 2R68A 4LJLA 4EYOA 2JRCA 4CODB 5F5XA 5ALFA 5AICA 4LBWA 1Y9ZA 3JQPA 2C7BA 4OHMA 1QQAA 5CVCA 3ZE0B 1YOBA 3KBBA 2J3HA 3ZK8A 1M2WA 5IARA 1T8PA 2I6SA 1XGKA 3LUBA 1ZG3A 4WVLA 3AU8A 2Q5FA 1CQXA 1EJ2A 1K0UA 4JC0A 4RQTA 4CM9D 4BXOB 1TK9A 4NK5A 1XP8A 5A05A 1JG3A 3BIFA 2MSWA 3H05A 4NJEB 4NSNA 5ESWA 5KDLA 4YRIA 1RXIA 2WSYB 4N5HX 3PQCA 2AMLA 3Q9UA 4TLEA 1IN5A 3D6AA 3MD0A 2PUFA 2R8ZA 1OPXA 1WNTA 4P3PA 5BURA 2BDTA 2PL5A 2LDXA 4LXIA 3OP4A 2Q8PA 1JHRA 3CLTC 2FOIA 2FWJA 3WNCA 2RAUA 4X6UA 4BNVA 1H69A 3EQ8A 4IHAA 1GA6A 1XTRA 1N2SA 3MWEA 3OHPA 4N9WA 5AI0A 5TPWA 2HSDA 2VAMA 1IH8A 1ORVA 2ADOA 2J5XA 5ALDA 5CX1B 4GBJA 2HA5A 4EJSC 3ADOA 1KZ1A 4YO7A 3GO4A 3OCYA 1H2BA 1YDEA 2VS1A 3B2EA 1JEAA 1NU8A 3HH8A 1TUIA 3KZXA 3O1HB 4MKRA 4PZLA 1E2PA 1X94A 2X3UA 4CU2A 5JS7A 1LFDB 2XQFA 1OLOA 1FNMA 4ROSA 3T95A 2WKPA 3VSAA 3BWVA 4QBFA 4UM8B 4EHDA 1MC5A 3DAPA 2NZ8A 3HZZA 3LKZA 3QW2A 1RYFA 2R2AA 3A8TA 1SBTA 5DTQA 1MF7A 4YBRA 1Q1ZA 3UAYA 2GRAA 4URZR 3DTVA 1J1IA 1PGJA 4G67A 5TQVA 4KN9S 6GPBA 2CJYA 4E32A 3IALA 5C4GB 3G8YA 1X2EA 3P52A 3CBGA 1E7RA 5ALZA 5JEEA 4ZGGA 2P35A 2X9LA 1L5RA 3AI2A 2EEPA 4J76A 3DNMA 2ZUTA 1I0ZA 2AFRA 1EQAA 3G02A 3TE7A 3WQHA 1I6LA 1P7ZA 4TTJA 4AJOA 1KI6B 4QUKA 3EPHA 1K88A 2G82A 3A05A 5TEWA 1O54A 1ODSA 1PGNA 5GM2A 3WHLA 1V7CA 4BO4A 2AG0A 4KXMA 2O06A 3EZ6A 4H1UA 1XZKA 2X4LA 2JJYA 1S2MA 3NKLA 4LYYA 1MJFA 4NQRA 4H6WA 4ARVA 3W90A 3KFVA 3SOPA 3VNQA 1CWUA 1CRZA 5IJ9A 4JI0B 5F52A 3ZDBA 4TS1A 2D5IA 1AY0A 3A9WA 5JNTA 1NXTA 1GNQA 1YE8A 3FWYA 3ZWCA 3WGTA 2FN4A 3KEOA 5BOSA 3TLGA 3HXPA 3E3MA 1EWKA 1X39A 4Z7NB 1JJBA 2WINI 5BNZA 3LZCA 4BO2A 4ZQGA 5AVZA 2H1SA 3ZU4A 3BJZA 5CA1F 1GQFA 4LY0A 4RENA 1CJMA 2RGAA 1R1DA 4HY3A 4NZMA 3FDFA 4QUEA 1C7QA 1RC1A 4XJSA 1C8VB 3BMOA 1QHGA 2M98A 4IV8A 3PYLA 4L5CA 4MRMB 3OFJA 3LOPA 3INGA 3P2IA 3OD5A 3PTZA 3QX9A 1KJYA 3GVXA 4RA9B 5FB3A 3QPBA 1NMQA 1GUBA 1GUDA 3JYOA 1CYEA 4MV5A 3ZBQA 2O6LA 4A3SA 4EG0A 5CAEA 4KMOA 2Q3CA 3OPYI 1KMNA 1ZYUA 4XWWA 2QUKA 3KYCA 2GXSA 4JNKA 1QO0D 1DRKA 3H2JA 3L0OA 4ZARA 3TRHA 3PPYA 2AFHB 3SSOA 4RM2A 4DIMA 5EJEA 5L3SA 2ZROA 3JQEA 4EB8A 4P93A 4ZJPA 1K5DA 3SC2A 2VHYA 1R8JA 2VAWA 3PKJA 3QITA 4M99A 4X1YB 3SNKA 1CUXA 4RH0A 4RCVA 3AZPA 5EQTA 3V1YA 5CP8A 3GT3A 1EINA 3VNAA 1YMVA 1ZNZA 5ADWA 4OJQA 2Q3HA 1U2DC 3VYTB 5DYIA 2AOUB 3TVYA 3UUFA 1YQTA 4ALJA 2ECQA 3DNFA 3QH4A 4L27A 1YIAA 2AMFA 3AXSA 4M9CA 4KSBA 2YCLA 3HGQA 2CN1A 4PYRA 4BO9A 3S55A 4YAWA 3N2IA 4IVNA 3FG9A 3G3EA 3O3NB 2YZMA 1JDZA 4MR9B 4B6OA 1PWEA 3V2UA 2W2KA 2ZETA 2OUKA 5EUBA 2TYSB 3O2SB 2IEDA 4Z9XA 2OAGA 3S2IA 1KI3A 1SBZA 1JB9A 3INNA 5KDOA 2HSEA 4RJLA 3AYZB 2W58A 3M9WA 4O4HB 2NYRA 4FUTA 2QAGA 4CIYA 2H1OA 1DFHA 2YRWA 3TW6A 3KXKA 1JDTA 1R4MA 4DCGA 3TH5A 4YUWA 1W75A 4MPTA 2XZTA 1ZSYA 2BGMA 3SXPA 1C4WA 1CEQA 1N8NA 2R96A 3JTEA 4NBRA 4EYEA 5BMVF 2N47A 4PM4A 5JIBA 2DUUA 3L1IA 4GKKB 4JC8A 4U63A 4FYKA 2K7ZA 4Y0NA 4UBMA 3BA6A 4K6KA 3VVCA 1O5OA 2GSDA 1WSBA 3PHJA 5AI6A 4JJ7A 1UDWA 4PPFA 3KSRA 1IYZA 5AP9A 1ULHA 1BROA 2QQGA 2C1EA 1JLLA 5C18A 5IHPA 3KTAB 2B5OA 3IP5A 4Q34A 3IO5A 1SGWA 5AKIA 2GF2A 1X42A 3N8GA 1JXOA 1SB8A 4CF5A 5LYYA 1KHHA 1QG0A 2BZ0A 2G8NA 4HQRA 4LDNA 3J7AC 2JHFA 3AR2A 1L4BA 1PNRA 1PT9A 2OCYC 3MS4A 5J2UA 3QLTA 1V4BA 1MXFA 1DX9A 1ZD4A 3GI1A 3L0ZA 3MTDA 2PCJA 1Z5OA 4OKIA 4IDEA 1HBJA 4ZT2A 3UGJA 1COWD 1S2GA 1TTTA 5E1OA 1E3TA 2ETVA 3F46A 5GQSA 4JITA 2PMKA 2YNMD 4F92B 1U98A 1JKJA 5K8IA 5BSTA 5JSFA 1OFTA 4INAA 3K16A 4DMFA 1LWNA 2I2CA 1OU0A 2VT6A 4GNKA 4W82A 5T3YA 3NT2A 4G0MA 3WDSA 3CE6A 1ZJYA 3EASA 3EBOA 5HKLA 2DR2A 4HDSA 3D4NA 4JJKA 4QL3A 3LPAA 5I4IA 2BVNA 4B3BA 3L7CA 1A97A 4O4JF 5JJBA 3ZJ5A 2OK8A 2DC1A 4TLLB 4AF7A 1W4BA 3IVXA 4A8HA 3QPAA 5LJIA 1V25A 1WCIB 1EP2B 3B52X 4KQKA 2KS6A 4PC6A 4X90A 1VJ0A 3URKA 4AIIA 4D3SA 5HYVA 2DXIA 2G4VA 1UWCA 1THZA 3GAAA 4KI7A 4OGGA 1RFLA 3CLVA 1U5AA 1FDSA 5ALXA 1AUQA 1BOOA 2YNMA 3OPXA 4UMVA 5IAOA 2A30A 2W6ZA 4KYUA 4LSZA 4Q1VA 2NLOA 3OX2A 4AZ3B 1AH2A 2X19A 5EIHA 3H4IA 4FHEA 4CCAA 3DWEX 1M1UA 3PUXA 3T38A 4CMJA 2OO3A 1QJCA 3KAPA 3OOSA 4JC4A 2BOVA 4TN5A 3GJQA 2H0AA 5F51A 3TCXB 4F72A 3JASA 1I2CA 1YE3A 1EDZA 1V39A 1WKBA 2I03A 2JBHA 3MTIA 4PV7A 3H6GA 2MR6A 3AEQA 3FPGA 3ER6A 1T25A 1J9EA 2RCNA 5T8KC 1CRQA 2ZRGA 2IH5A 3U9LA 2C59A 2QQEA 1E8NA 1EZ4A 3LO8A 5CNIA 3BFXA 2Q5CA 4L7QA 1A9RA 2V7BA 5AVOA 5B2EA 3IPCA 3T52A 1JLLB 4TYPA 5DYTA 1YBHA 1KFJB 3N3AC 5GP1A 2Q50A 2VRWA 2XQJA 5IKOA 4C7BA 1CY6A 2EJWA 3K9QO 1TL7C 5JXHA 1HEYA 2XTZA 1O2DA 3FYSA 2XZDA 5DX8A 1RS0A 2FPWA 5EKSA 3OBBA 1OB2A 1G20A 2D1QA 4OA5A 1L2TA 3ZVLA 7ABPA 3PJGA 2XNHA 4G85A 3ZWVA 1V1MA 3ONEA 4MI9A 2FSGA 4QXAA 3UMRA 4UQPA 3ZHQA 3PWSA 4KZPA 2GVDC 3DVRX 2I3GA 1PDOA 2EERA 4Z0HO 3DVAA 5B37A 5C52B 2QN2A 2VYQA 3JAKB 1ZGHA 3KK0A 3GVCA 2A0WA 4Q9JA 4LJYA 4QOGA 1S1CA 1SCBA 2OD2A 3THWA 1S2DA 1R9NA 4TTPA 3BHMA 4LDRA 2EWWA 2P2SA 2QTFA 3FCCA 4Y2RA 2CHUA 2D2VA 4D9HA 2VPWA 3OOWA 3ETNA 3K92A 2ZULA 3PC8A 4MV6A 4DDKA 1P1CA 4B33A 4PR3A 1F2UA 1XZEA 1JA0A 3OMWA 3OX4A 1DEOA 4LOIA 2P11A 4Z3OA 1SUDA 3DMDA 4FS3A 4Q39A 2ZQYA 3KPYA 2JGLA 3VNVA 3R0ZA 1NXXA 4HEA1 1YUBA 4E21A 3KLBA 3ZKAA 2P30A 4IJQA 1NMYA 2IX3A 1DBSA 5KTMA 1Z3IX 2N75A 5A3SA 3UGQA 1U8UA 4B3RB 5EJ2A 4G1BA 2CLCX 2CVFA 3ZWDA 4ZZ1A 4V0LA 2QN1A 1SHLA 1P5FA 1L3IA 1Z16A 2GBIA 5JWOA 1SKUA 1XV5A 1DXQA 1EBUA 4BP8A 3ENZA 1DQPA 1X74A 2IC5A 2PSHA 2WA2A 1YZYA 3BWBA 1X9IA 3PGMA 2G3YA 1NAIA 1DIAA 2MSCB 4D2IA 2IIQA 2BM8A 4C21A 4TRJA 4N8SA 2YZNA 5CYFA 2BGKA 3V33A 3DPSA 3LUDA 4CR7A 2XAAA 3F71A 5KIAA 1QK3A 2HPAA 4CMEA 2ZCUA 3VHRA 3GYBA 4LPKA 1PAUA 5KNDD 3AQ4A 3EVAA 3V7NA 4MS3B 1Y6FA 4PXSA 4JHLA 5IBPA 1U1FA 2WOOA 3OQNA 4A6PA 4B32A 2GM4A 2QJWA 2GCNA 3Q88A 3MIZA 4WINA 5A9SB 5BN3B 2JJQA 2WP8J 1CHDA 4WY2A 4QPJC 1ODTC 5HTKA 1MHTA 2WHPA 3BSFA 1E79A 4G0QA 4M0UA 2HRBA 2G0TA 3OEWA 5FNVA 3SU8A 1U8FO 3GDOA 4EYGA 3CT4A 2JA1A 1DO8A 4H18A 5IKMA 4Y9RA 3TZEA 4HUJA 1G41A 3JVIA 1PV4A 1XSEA 2A78A 2QN9A 3V48A 4CLXA 1X7WB 4IQ0A 1E2UA 3SQXA 1A3CA 3I52A 4F4FA 4OVKA 2JATA 4WWHA 3BCRA 3Q72A 5BR7A 1LDBA 4AJ2A 1MTOA 2BL4A 1JEQB 1R0CA 1U4OA 3O93A 4EW1A 4F2GA 5IJ0A 1M7GA 3AT1A 2HKIA 4RD6A 3MFYA 3LHKA 4TLMB 4QPPA 4ABYA 3JWHA 3L05A 3PNKA 1M5TA 3K31A 2YIVX 3VYSB 1BMTA 1EX7A 4PGAA 1L1EA 1IN4A 2PPVA 1IHPA 1J2TA 3C3KA 3V4FA 4BU0A 1R6XA 4Z4GA 2HV9A 3MTQA 3CF6R 1IXRC 5F73A 5FA5A 4QGSA 5JTUA 2QN6A 4JA2A 2JFHA 3ETCA 4GMXA 4E1VA 1V2GA 1LPBB 2FSIA 2I4OA 2OGUA 2VDKB 3F3SA 4IIGA 4LMBA 4MOWA 4Q4LA 1M0TA 4XOIA 4YV1A 2QJTA 3CVUA 3ETGA 3P9CA 1EVYA 4IJMA 3UMBA 1YHZA 1UKAA 4HP8A 2FZKA 1CE8B 3GGOA 1T5SA 3LP5A 4LCEA 3O47A 5DGDA 3FPBA 5AXCA 5HFNA 4MWDA 4AG3A 1AC5A 2AN1A 5JBIA 3DBHB 3OZTA 3UYKA 1A71A 1CUVA 1T3ZA 2I80A 2DP4E 4L9WA 1HZZC 1UCFA 1QKJA 3DZDA 1ZL0A 5DHAA 3M1YA 1CFJA 4HATA 4YCAA 3TQQA 2Q2WA 1OFIA 2YXDA 1KVUA 1WXHA 1LRJA 1SUAA 3RADC 1YO6A 3C5HA 1GZ3A 3O8BA 3COSA 1AQYA 3LDGA 2QUBA 5TS3A 1JAZA 5K2MA 4F5EA 4CIVA 1GTMA 2I0FA 2QBYB 3OT1A 4YP6A 2P6PA 3WBBA 2GRJA 5I6DA 2AX4A 3OWXA 5FAKA 2PBRA 2VPTA 2VSFA 1LSJA 3TQCA 4CQMA 1C3OB 3IE0A 5HG0A 1DAPA 2ZS9A 2ALJA 2GS9A 2H2IA 2QTHA 1HRDA 3KOXA 1LXCA 2X9VA 4M7PA 3UM9A 1MJHA 2ZTLA 3DL0A 1B4DA 4E22A 2EGUA 4F6CA 2D2XA 3DXZA 4UTOA 4H2DA 3TVTA 2K7FA 4RWZA 3HU2A 2A59A 5HF5A 1Q2UA 1FXWF 4BECA 4QU9A 1VFPA 2BKAA 3N5KA 5SZKB 3ZNPA 2BF4A 2YWEA 1VKRA 1JIUA 4E3WA 3FLBA 1HLPA 2GD1O 3GLIE 5F35A 1PI3A 1Q1EA 1PJ3A 1TPZA 3HI4A 3RVNA 2HM7A 4ZMRA 2EOAA 3D8SA 3KR1A 3TPFA 2WHYA 2GCOB 1UJ4A 1R00A 1UQTA 1KYQA 3D5TA 1TT5A 4YJ2B 4KE9A 3D2LA 2J87A 2X4GA 3FSRA 3HPQA 3IPAA 2H2DA 1BCSB 1FYFA 1Z0SA 3AOEA 4ENPA 3ZHSA 2VXBA 5K3EA 4KXLA 2PJZA 5HS6A 1VL2A 2L2QA 1IWPB 4X6XA 3I0ZA 5SZJA 3SEZA 1MFZA 1ZLXA 2XB4A 3DT8A 2UUOA 1FDRA 4BC0A 1O87A 1P9OA 5BN4A 1AUOA 1NURA 1OAOA 1GUFA 2VPZA 3HU1A 4M9UA 4RK1A 3T3MB 3TXAA 4BJ5A 4E2FA 3H2GA 2WQZA 1SUWA 4NP6A 1QVRA 1EJBA 4YCJA 1VBKA 1GZ7A 2AVNA 2FPPB 1EWYA 1DBQA 4PQYA 2X9NA 3OEYA 3H5TA 3PDHA 5C1DA 4IJVA 1A27A 1O96A 1P9RA 1Q7EA 3C8HA 3PP8A 4KPUB 5K4AA 1P7PA 1XJ5A 2PX6A 2PY6A 2YWGA 2P2DA 3K1TA 3KQYA 3LVBA 4IJKA 1MN6A 3ZDYB 2IYUA 3N0TA 2Q9BA 3IA2A 3O8OB 1PZXA 4NBNA 4QLOA 3NDJA 4QUHA 1YBVA 3L93A 4IRUB 1JJAA 2B8NA 4CLRA 5CVJA 5J3JA 1G3RA 3MJTA 2GNOA 3HO8A 3NV7A 2AJTA 3B38A 3T5MA 2O8BA 4QOEA 4OUDB 2ZYGA 3UV7A 3ZHBA 1FQWA 2EHJA 3DWGA 3OQIA 3OZAA 5AVUA 3KFXA 4HDMB 4YCNA 2C4MA 5A03A 4K7JA 4MIEA 3IRUA 3P9SA 1GPBA 3HJFA 3P7MA 2JCVA 1ODCA 2C2WA 1NVEA 1WMBA 4YROA 2O7NA 3G2KA 5C7YA 4F2WA 2J9FA 1M34E 1QIDA 4EPYA 1P4RA 1K63A 2Q2VA 1DLJA 3L7JA 3MJDA 4IOLA 4WLFA 2J5RA 1XTIA 1FPMA 1SXJD 1VIYA 1GGNA 1JAIA 5L7YA 3ZBPA 3HTXA 3FAZA 4IXTA 3G23A 2FFJA 1RFGE 2DM6A 3S1LA 4DLBA 2BFEB 1K97A 4CFSA 1BCSA 3ZTWA 1YB5A 5T6BA 1D1QA 5DP2A 2HQBA 4LWZA 5DM0A 4D8VA 2XMZA 3V3KA 1TA0A 2OP0A 5CH3A 5EWLB 4CV3A 1V11A 4EHFA 4J0GA 3WXBA 3X2EA 3MRVA 3C7DB 2GM5A 2DMRA 4OHYA 5FOVA 2E55A 1CQWA 2R6HA 1XJQA 2WHQA 3JQ7A 3N2NA 4JXJA 4IILA 1UBOS 1SOAA 2GHQA 2O0KA 4HB0A 4BVAA 2J3KA 1M33A 3LT1A 3RS4A 4YLYA 2ODQA 3V2IA 4L2IB 4DLYA 2W2XA 1NVMB 1OX6A 4WCVA 1ISSA 4E6EA 1D0SA 1NT4A 2MSLA 3QUAA 4ZT4A 4JB0A 1OYWA 3WGVA 1WLSA 1ZH4A 4UPEA 1KWGA 3UPTA 4ZYZA 4P5EA 3W78A 1G1AA 1DOAA 1H6BA 1I2DA 3ADPA 4BO0A 1GJRA 1UKYA 2W2TA 4RHYA 2I2BA 5C1IA 2YMMA 4JBHA 1KNXA 2I4LA 2K2QB 4KG7A 1KMHA 1ULTA 4W8HA 3M9XA 2VNAA 3K05A 2GN0A 1BVRA 4I9FA 3RHSA 3Q4GA 4FE3A 5B3AA 4BKRA 4E2YA 4DEYA 5K05A 3F73A 1LUAA 3TSOA 3IPRA 4LBZA 4ALIA 1OR8A 1VSBA 4LXQA 4K9QA 5EJ5A 5IF3A 1IZZA 4LFAB 4COKA 2CDBA 4WCFC 3IV7A 1GFIA 2PWYA 5AM1A 1Z5WA 5CFNA 2DE0X 1C9YA 5B4UA 3LCJA 3ICCA 1TT7A 2GXUA 4COOA 1B14A 4DTIA 1ITZA 5BSRA 5A4DA 2NXEA 4E5UA 4TRRA 3WGUA 3L1VA 1RRFA 2LNDA 3PGXA 3PL5A 1UADA 4KWHA 3JARA 1WBBA 1DC4A 3AEKA 1H5NA 4CKBB 2OORA 1GA4A 3PI6A 4LOJA 3JVEA 4UTPA 5CAEB 2O3QA 5FTKA 2MYUA 4A9AA 1L7BA 4AICA 1YR9A 4PIMA 2PPLA 3CT6A 3RYFB 5JW6A 3NM6B 3K6SA 4J0IA 2QVCA 5A4KA 4LK3A 1YE5A 3QQ5A 3HA5A 3KPJA 1Y33E 1Q6ZA 1F0NA 3N05A 3Q2OA 3TRIA 2J0UA 3V1UA 4MW2A 5IH7A 1QC5A 2GK6A 2BFFA 5A4MS 1ZKMA 3LT2A 2E3JA 1Z4PX 2FV8A 2I1LA 3ITKA 3KYJB 1AT1A 4UNNA 1IN8A 1PTJC 1TIKA 2LIVA 2WYVA 3G5MA 3R6DA 5FWXB 2F9FA 4ENSA 1UM9A 4IVRA 2WJVA 4J0KA 5ABPA 2WEKA 3NALA 1T9KA 4J90A 4A8JA 3EHEA 3O8CA 3RAFC 2CNOA 2ZRIA 2VYFA 1F3LA 3SSNA 1LNSA 4N5DA 4HLDA 3WQSB 4V1CA 1I3OA 2QL6A 5EIXA 1W5AA 3VJKA 4IXMA 1PK8A 1ESZA 4L16A 3VO9A 4MGYR 4YT8A 4O02B 1SFRA 4Q9KA 3B3QA 4RK0A 2DHQA 1A77A 4DR1B 4RSHA 1PDWA 1T0JB 4HH1A 2UZ4A 4LY6A 4XB1A 4CKCA 1AS3A 3RG8A 4AY5A 5DLPA 1W4AA 3H8JA 3OQVA 5BYBA 3QLUA 3AP1A 2EX4A 3L4SO 1P19A 4FEYA 4I55A 5I7OA 3G0BA 3RVOA 5D1NA 1C0PA 1TW3A 4UDOA 1W581 2OFOA 5IULC 4NBUA 3KKMA 3W8RA 1XF9A 4R5MA 1T2CA 3NETA 4F6LA 4EO7A 1OZHA 1ZNWA 3NBUA 1P29A 2I8CA 1S6YA 3OE4A 1G5QA 2PQ6A 1X8XA 5FX2A 3GN2A 5HPYB 1CUGA 4TMZA 3P94A 1ZD1A 2PFSA 3JARB 4U0KA 3QFFA 1C14A 4D0NA 1QSGA 4ZQIA 3RCBA 1BGXT 4BY9E 1E2EA 1Y81A 5KINB 4D26A 4FGSA 2INGX 5M3BA 2QHXA 5AUPB 1F7UA 1PT6A 2ZE8A 5TRTA 2D2IA 2R6R1 3IEIA 3JYPA 4ME6A 2JANA 4U2BA 3BXOA 5FPTA 3TTWA 1FUEA 1YR8A 5L3ZA 4AYWA 1C0IA 3IMKA 2H6EA 5CYOA 1XQ9A 1Y37A 3STTA 2AUMA 2OT3B 4JJ8A 4IMRA 4UUOA 1JQAA 3BDAA 1YFJA 4P53A 3LZ6A 4PO8A 1F51E 3PNSA 3T0GA 4ETWA 1N2CE 4DC1A 4ML3A 1PYGA 5D86A 4JVSB 1T1RA 1TM4E 4I6JA 3LD9A 4BQEA 4F3YA 3WTCA 1W8IA 5KTOA 5KNLA 1KOLA 3ZHOA 1KQPA 3ZX5A 1E3WB 1V3VA 5FUWA 2ABWA 5HKOA 1H4TA 3NPMA 1T35A 5KB3A 2FDCA 1H3EA 4TPKA 4H35A 3ZHYA 4EKEA 1P7WA 1YC5A 1E9RA 1H2FA 4O8CA 1ZD2P 2P27A 1QYDA 3A3YA 3INTA 3FVWA 4TZKA 1PD0A 5JSUA 3HBNA 2CCJA 4UXHA 4G4JA 4BQIA 5THXA 4RK4A 1P6XA 2JLXA 2XGJA 3CEAA 1F1BA 2PMWB 4A7PA 1EFRD 3OZRA 3KSAC 4M1QA 1GSOA 4NQZA 3NEPX 3S2SA 2G0AA 1ATZA 4MUBA 2JGJA 1FFHA 3CZ9A 4QUDA 3IIKA 5JV5A 1JJIA 1IXSB 2HRCA 4MTLA 4DR5B 2PJRA 2Y1OA 3OAAD 3O1IC 1BC5A 1KJNA 3P20A 4BKPA 2FPRA 4RGVA 1KDYA 2Y67A 2O1WA 4UULA 3DKKA 4PCUA 4NCBA 1RAHA 1UBSB 3DBHA 3F67A 1O08A 1G3UA 4XI9A 3JQ9C 1K8QA 2GERA 2IYQA 1KI1A 3QNUA 4WZBA 3NFRA 2BELA 2AH5A 1I2AA 1ZH0A 2B8TA 5EXTA 1EFRA 3ULKA 5CG1A 3R6TA 4FLFA 4MI6A 3WKBA 2B3TA 3QJYA 1G20B 4RBNA 1UOEA 2J07A 3I73A 1U3DA 1UP7A 4PLPA 1F0PA 3PC4A 3PLRA 3ZIDA 4MUXA 3TUIC 2UUAB 4NYIQ 4O4IF 3MHPA 2HBQA 2B34A 2JGIA 1C1DB 4MA0A 3M34A 1XU9A 1W4RA 3H65A 4DCTA 4OQXA 3EGDA 3BZBA 3KTOA 2JBAB 4YQZA 1YMQA 2JVJA 4MVJD 5B6PA 4C43A 5GZ1A 3HCDA 1E6EA 3LXMA 4MO9A 5K0FA 4PSKA 3RTCA 4OBBA 1JDPA 3LHSA 1M1XB 2Z43A 3NDRA 4V38A 3RKSA 4LE0A 3QSGA 4QLBA 3LPDA 3HL0A 2DB3A 3M3PA 4UM9D 4FNAA 2RGXA 1AB6A 3UJAA 1M6HA 2I2XB 3NHUA 3OF2A 3IR5A 4GM0A 4OGLA 1Y8CA 2BCGY 3C85A 4EG5A 3IA7A 3IBTA 2XUQA 4RU1A 5CBPA 1O9HA 5TS2A 4YV2A 1W5TA 2A5JA 3PFWO 1QVAA 3CX7A 2W2MA 1NM5A 3IAHA 2Z4TA 4UNIA 3KQLA 5DHQA 2R85A 5DYNA 3B3JA 2AHOA 3GQVA 3HPRA 1PU2A 1RBYA 3DV9A 5EPOA 2XB2A 2WAMA 4A36A 5DBIA 3EZ9A 5BSFA 3SOZA 3STXA 4G0WA 3NHFA 1IQ0A 3X3HA 4I55F 5AOAA 4PG5A 1G38A 1OGJA 1P5JA 5HF6A 2FPOA 4GZ5A 5DNCA 5HIJA 5HIAA 2D7DA 3NIGB 4QO7A 3MUFA 3VGJA 3CZCA 4R81A 3VR2D 1XL0A 3RQIA 1C3VA 1MJGM 2YC2C 3FLMA 5CH8A 5IMSA 1PSWA 4GR5A 1N2CA 2NYVA 1N57A 3FJOA 2JLZA 5B57C 2VP0A 3CPSA 4JLSA 1EAYA 3KAKA 3JYQA 3LS2A 1J97A 1JXAA 1UMCA 1F60A 2NQ8A 5GVRA 3VR3A 1E1NA 2C5FA 3U2QA 2I3BA 1V71A 4ZGBA 4KPYA 3K73O 4CIWA 4MDFA 1BXZA 1Q7CA 1YL6A 2W6OA 4JX9A 3D02A 3ZU6A 2V96A 2WJWA 4R3WA 5C32A 1GY8A 4IP0A 4R2WA 5EEHA 1U7WA 1KK1A 1VRCA 2A35A 2XVZA 3HLYA 4IZ6A 1ZOOA 2PFKA 3G49A 4R8KA 4UNQA 5AO9A 5KDDA 2YOGA 4FYPA 1I2BA 3FMVA 1FNSA 1Q77A 3BEDA 1U65A 2GK7A 1RI5A 2RGBA 3F78A 3E8SA 3I9V6 2VSNA 3HCRA 2A5GA 2J3QA 1MD9A 3NATA 4PX3A 2GPBA 5JS6A 4ZVOA 2QSZA 1XN1A 3HN2A 3OD1A 3DOFA 1BIFA 2BFMA 1KY3A 2ZAYA 3JXEA 4K81B 4ABTA 2M32A 3ZJVA 2Z2YA 1T8RA 4OQMA 3F5MA 4TXMA 2QXUA 2FMKA 2AEEA 2IXEA 4MYTA 2ERXA 1P74A 1H8HD 2YXPX 3CEJA 1TVMA 3CUUA 3O3CA 4P4UA 5JLAA 3DDOA 1XEWX 2UZ0A 4QUIA 1ND5A 3LQ2A 4YMLA 5ED0A 1SELA 3AUSA 4TV8B 4DYHA 3LYUA 1PQ4A 3PUKA 1YS6A 1E3DA 4Q1AA 3VR5D 3R5KA 3RU9A 1E2NA 3ZVRA 1G6OA 5U1PA 5F1OA 1FW8A 2OHJA 4F4DA 1EVEA 3A32A 5A6SA 2FSVC 5BYAA 4V1CI 1O95C 2P3QA 1I7QB 1KEVA 3PIIA 3A1DA 4W8GA 3A6EA 5BWMA 2XWQA 2VJMA 1Q0ZA 5B1HA 1KZHA 1JG1A 4TL8A 5HOQA 1V47A 3HQ4O 1MX1A 2X7XA 5JNRA 6ADHA 2OHGA 1TMOA 5F2KA 2Q5JA 4Q7EA 3V8PA 1TK2A 3MRTA 2AR7A 5BWBA 1YIOA 3TRDA 1RXWA 1RRKA 2D1RA 1SIBE 4MRNA 1Y9AA 3USES 1N5KA 3V97A 2QDXA 1TQHA 5CBKA 6ABPA 2PD4A 1TCVA 2J7KA 2NV2B 4I1IA 1HFWA 2CVZA 3ZLTA 4KQXA 3OHMA 3A2LA 1R0XA 2BM1A 4FFVA 1Q21A 1WF3A 3ZBUA 1KMIY 2JCSA 1KYTA 2EL9A 5LB2A 2YQ4A 4Y2XA 2X8WA 5FOXA 1KZGB 2FUG6 4FS8A 1II8A 2WTBA 1ZK1A 2ADFA 3DB2A 4LYFA 4WLEA 4WLVA 3T1NA 4I3HA 2GDZA 3TEMA 2REQB 2YIMA 4U7GA 3OE5A 1A98A 3C3CA 4W99A 2BF7A 3SEFA 4YMUA 2FHSA 3W9BA 3KYDB 3IEXA 2JI4A 2VQ6A 2W48A 5LMNB 1JG7A 4CV1A 3V8VA 3K0EA 1UJ2A 3O73A 2Q0QA 2O1EA 2Q1SA 3E03A 3K8OE 4O33A 5AKGA 2QI9F 3A6HA 4G2TA 2ZTSA 2JBWA 3STHA 4UHCA 1ZIXA 4FGLA 4UATA 3MIIA 3E0XA 3SDBA 3VO2A 4A5SA 4F6RA 4HVCA 2QLJA 1QX3A 3L6BA 2IP2A 2JDID 4EO9A 4F2DA 2RJ3A 4I1PA 4CL2A 2AN5A 3O2NA 3RF7A 2IS6A 4Q05A 1XCMA 2C2HA 5CNJA 5K3FA 4F3NA 3ISVA 2XTJA 4WBNA 1FL9A 2WBLC 4WBNF 4UMFA 2FPGA 2EZ8A 5EE9A 2XMCA 2FFHA 3TZCA 1RYNA 3COJA 1P5HA 2F17A 2R65A 2ZUCA 3A6ZA 1A9PA 3MTJA 3U3OA 3G17A 1QWOA 3U81A 3IOYA 5LBIA 2D0IA 1Q91A 1Z62A 4A6DA 4RESA 3C2QA 4M89A 5WRFA 2VZ9A 4CQMD 4HTFA 4FFRA 2V6GA 3M8KA 3Q8MA 3H42B 1DTWB 3V4ZA 1WRBA 4IO0A 5KJEA 4GYWA 3UJ7A 1APBA 4EZBA 3K1YA 3ICVA 2PWZA 4DWWA 1YASA 1T9GS 3BMQA 1YGPA 2WW8A 2WT4A 3GFFA 3K15A 5E6SA 2VJOA 4OP2A 2FUCA 2AFIA 1TF2A 3JQBA 3QXCA 4EVIA 1DIHA 5JMOA 3KPVA 4REQA 4C4OA 1BXRB 2YQ5A 4XGQA 1SHUX 3SHWA 4NI5A 1ZM7A 3QHPA 4U4AA 2CHGA 4DA7A 5DGCA 4DMGA 2PFGA 3EMKA 3PQFA 2OK7A 4YP5A 3N2GA 4QPCA 1YZQA 3CSSA 4IYRA 4ZJYA 1G21B 4YAIA 1TAUA 3O83A 3HVRA 1P1BA 4HQNA 1XRNA 2QPTA 3EGOA 3BWXA 4AK9A 2BSQA 3T12A 4D81A 4DRYA 3DJYA 3DF7A 4ESOA 2XODA 4ZYXA 3IIEA 3AXTA 2YVUA 4Y9SA 4EEKA 1U5BA 4BKOA 3R4CA 4N47A 3GDGA 5H83A 1DE0A 2QTMA 1I9CA 3W0LB 2QENA 1LBIA 1ABEA 3SZRA 3A1NA 1GCOA 1SA0B 3CUKA 3V6MA 1DI0A 1DTSA 1N9GB 1SBYA 3SR0A 1A9OA 1WQ3A 3N2KB 4BMCA 4C01A 1SVMA 4L75A 5AVYA 2HSJA 2PMCA 3LPLA 3VMMA 3FWNA 1QKIA 4DSAA 3CSDA 3EOBI 4QT0A 1DKNA 2ZU6A 3OWOA 4P0PB 1RZRD 2Z1MA 1E2QA 4ZOLB 3CURA 3QBTA 5BPHA 1X8KA 1E7MA 1B43A 3TO5A 1NF2A 5H68A 2HJHA 4PC3A 1X70A 3ZV4A 3M4YA 2PGLA 2ZDQA 3MXTA 3I1JA 3S2GA 4BL5A 1EHIA 3II6X 5HJ5A 1J49A 2OAQ1 4QECA 2PX4A 3MVEA 4OAQA 5AJTA 2HFKA 1T9GR 2IE0A 1TJ4A 1BKYA 2HZ7A 2ISCA 3AUJB 4FVTA 3TN7A 4BQRA 3CVXA 1PR5A 5CLJA 1U2TA 2H1HA 2P5UA 3DM5A 1J25A 1N0IA 4LRXA 2HDHA 4L3VA 2M2IA 5IKXA 1I7NA 4TSKA 3X2FA 2VJNA 3SWWA 3T54A 1J2YA 1O96B 4W5TA 1EEHA 1FSPA 3U4IA 1C3JA 1TZJA 1E7YA 2O1XA 2EW2A 3ESZA 4G26A 4YALA 5C5IA 5JEDA 1MO5A 3OLYA 4ERXA 2E4XA 5D6OA 4FTWA 2G1KA 1BXGA 4I5EA 2HAEA 4BGVA 1P0FA 1WL8A 2UYOA 5B5SA 3G6WA 5J58A 4KNWA 1O6FA 1V8PA 1XYYA 1KE1A 2VNJA 3CIOA 2ZT5A 1LF5A 3JY6A 1M1NA 3E27A 4ZTBA 3ZJUA 3UKJA 1XA0A 4CM6A 5CGQB 4D4LA 4M0MA 2QL7A 1YB7A 3I0NA 4IMPA 3WICA 1ULSA 4KQ2A 4DCJA 4GICA 4CE6A 1PFUA 3AI3A 2KPOA 1DPFA 1JZTA 3KAQA 5HJ7A 1NASA 4Q7MB 1UBTS 1IU9A 1CTQA 1W5FA 2IHBA 3TAHA 4FMDF 3ZS9A 4YP9A 1T3LA 4AWBA 2I6GA 3ENKA 4BRZA 2VK2A 2XD9A 2GXQA 2OM6A 4TT3A 1FCJA 1JQKA 4WT7A 4XPIA 3HU5A 1NP3A 2DAPA 5EQDA 5KAPA 2VYVA 4DBZA 4NCKA 1BMDA 1QQ7A 2Q1WA 1ZMXA 3U7HB 3GLHA 3OFNA 1NC1A 2CYBA 3K4QA 5AJVB 1BX0A 3G88A 5AJXA 1G8YA 2I1WA 2P1RA 3C7TA 1FQOA 4OOEA 4YAFA 2XUGA 4MMYB 1C7JA 4PC1A 4YRLA 4ZO8A 1TCBA 3U7JA 3WL3A 3ZV6A 1FNCA 1G4HA 1KAEA 4AJPA 1JEYA 2IP4A 5LJLA 2OB2A 2PZAA 2F43B 3WMEA 1B6SA 2FQXA 4DNXA 1N4AA 5CD1A 1E3SA 1ZUD1 2CC2A 4EAAA 4UCXA 4HLQB 3AETB 4P0QB 2W2NA 1PUJA 1R66A 4M2LA 3L9WA 4OSOA 4RS3A 5HIMA 5TDHA 3RVQA 1NJ1A 5F1KA 3CB2A 3SFTA 2Z8ZA 2EIXA 1RP1A 1CNFA 4EUKA 1G20E 5EKUA 2AG6A 4JLAA 4FFLA 3QSYA 1Q92A 1IIBA 4M9RA 5IC4A 1E6CA 3B8EA 3NAMA 2NU9A 4IHJA 4RZUA 5BV7A 1N6LA 3GQBB 3KDAA 5IHXA 4KR6A 1Y4DE 1SCUB 1F6BA 3ZLVA 3CG4A 1RM5A 4ETIA 3R74A 2AQ8A 2I76A 3D3WB 4DCCA 2ZRCA 2DFNA 1KZ6A 2BTQB 3DE7X 2XNJA 2VJKA 2CXPA 4ILKA 4L28A 2DKNA 4UAUA 10MHA 4IJ5A 1XZQA 3I5XA 1KETA 4J2OA 1O94C 1CZRA