2A1UB

Crystal structure of the human etf e165betaa mutant
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
252
structure length
252
Chain Sequence
LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVERAIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTEDLVAKLKEIGRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Electron transfer flavoprotein alpha-subunit, mitochondrial
publication title Stabilization of Non-productive Conformations Underpins Rapid Electron Transfer to Electron-transferring Flavoprotein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 75
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2005-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2a1uB00
3ND6A 1Q11A 2VTBA 1WXHA 3IOEA 4ARIA 4EG8A 1D2RA 3IUEA 3QTBA 4MW9A 3X1KA 1WXIA 2PG3A 2QTMA 3CVXA 1EUQA 1O94C 1N75A 1S4MA 2E89A 1N2BA 3FNRA 3MUEA 1ULHA 4MW4A 4KR9A 4ZT3A 5HUHA 1X6VA 2QJFA 1O0BA 4S1OA 1U7DA 3ZUGA 2YY5A 4R2MA 1K4KA 3UK2A 4U7JA 4PBRA 2DETA 3G59A 4ZT6A 3TNJA 1UFVA 4QRDA 1WY5A 4MVWA 4XFJA 3INNA 5LM3A 3COWA 1KQNA 1O96B 1FYDA 5TEVA 2YWBA 4G5FA 3CLUD 1U3DA 4MVYA 4G6ZA 5J59A 3VRHA 1QTQA 1M8JA 2EJCA 1NP7A 1N2OA 3IMGA 5DB4A 1ZUNA 1RQGA 5J58A 2BYTA 2YXNA 4ARCA 4H3SA 1GPMA 1KAMA 1R6TA 2V0CA 1EFPA 4K0RA 4ZCQA 1T9GS 4MVCA 4MUFA 1O95D 3AIIA 1ZH0A 4YBRA 3TZEA 2PIDA 2ZP1A 1JIJA 1TYBE 2JAXA 1KORA 1QQTA 4L2IB 3IMEA 5HG0A 1PFVA 2CUZA 3CLTC 1QRTA 1NI5A 1NZJA 1KH1A 3GMIA 3FWKA 1EFVA 1Q15A 1Q77A 1EE1A 2VTBB 1KH2A 1R6XA 4MWDA 3AG6A 3CLSD 3DV2A 3G6KA 2G36A 4RUKA 4WSOA 1YIAA 4GU5A 4EG3A 3CVVA 4MW6A 5J5AA 3ISJA 1QU2A 4F3RA 1MC1A 1TYAE 1O0CA 2J5BA 2I1LA 2O8VA 1WOYA 4MQ6A 3UY4A 2A1TR 2CFOA 3PNVA 3CA8A 3ZXIA 4MAFA 2E21A 1MBZA 1IHOA 1QRSA 1M1ZA 5HUJA 2CT8A 1N2GA 3RK0A 1IVSA 1P7PA 1LW7A 3OP1A 1IH8A 3A05A 4NDAA 2X1LA 4KR7A 1OWOA 2PFSA 4OUDA 2A4MA 1Y42X 2A1UA 4MWCA 4ZT5A 4BWVA 4HJRA 4EG7A 2HZ7A 1TEZA 4HPWA 5H16A 3FY4A 3I05A 5AHWA 4FZJA 3IOCA 4HK4A 5KHAA 2B7LA 2DPLA 1CT9A 3RFFA 3ND5A 1K4MA 1EFPB 1FFYA 4NATA 1JECA 4ND7A 3SZGA 4ZCRA 2X0KA 3CVWA 3IVGA 5TS2A 1X8XA 3BL5A 2J07A 3MLBA 1JIKA 4AQ7A 5IJXA 1T6ZA 1GN8A 3CLRD 4MW2A 3SEZA 1KP3A 1EFVB 3HL4A 3SYTA 2ZUEA 5KWVA 2PZBA 3DPIA 3COZA 1N78A 3FH0A 3IVCA 1TYCA 2Z3VA 2A86A 3RK1A 2V0GA 2A7XA 3Q12A 3JXEA 5DASA 2JANA 2VXOA 3ZJUA 2QUHA 3HV0A 2RE8A 3KT8A 4PY2A 1JMVA 4MUNA 1G8GA 3ZXSA 4CQNA 4Q93A 3LE8A 4RPIA 3SDBA 1OWLA 1IFXA 1I2DA 3CLSC 3A4IA 4J76A 2GM3A 3N05A 1ILEA 1F7VA 3G5AA 4K03A 4CT0A 4ZT7A 2QUIA 3P52A 1JZQA 3KT0A 2ZUFA 3TS1A 4YMIA 4EF6A 3HMQA 4MW1A 3H9BA 4UZFA 2RD2A 3P0JA 3CVYA 4OUDB 1J70A 3TQIA 1JEEA 2A1UB 4MUHA 1WKBA 2Z08A 1M8PA 1MB2A 2YWCA 1U7XA 1JHDA 4F4HA 1JEDA 2BTEA 3N9IA 4DNXA 2PXHA 1H3FA 3IH5A 2DEUA 1TFUA 1WQ3A 4MVXA 4Q16A 4MUEA 5K0TA 1MJHA 1B6TA 1JZSA 1F9AA 2A84A 1HYBA 4AS1A 3UOWA 1YUNA 1EUYA 1N2HA 4NX2A 5TEWA 1YUMA 2XRZA 2X1MA 1F4LA 2WQ7A 1WXEA 1PFYA 3NBKA 1PG0A 4YP7A 3AL0C 2OV4A 1NYLA 3PNBA 4MUKA 1QU3A 4ZT2A 3HGMA 1COZA 4ND6A 1NUUA 3FOCA 1J1ZA 3AKZA 3ZGZA 2AKEA 1O94D 1N3LA 3TQOA 3D6UA 3CLRC 1WZ2A 1H3NA 1U0BB 1EJ2A 4ZCPA 4U63A 1MB9A 1N2EA 1I6LA 1TYDE 1M8KA 3A2KA 1QJCA 2CYAA 2EL7A 4U8HA 4ZCSA 3VGJA 3X1JA 1R6UA 2PZ8A 4MLPA 1QRUA 1H3EA 1XNGA 1NUPA 1GTRA 4QBTA 1MRZA 5DEOA 1ZH6A 4EG6A 2O5RA 1TQ8A 3AG5A 3N8HA 5K0SA 2PZAA 2A88A 1T6XA 1N2IA 1T9GR 2IJGX 3LCJA 2DUMA 2QTNA 2DXIA 3C8ZA 3M5WA 1KR2A 1YIDA 5JBNA 1PFWA 3RHSA 3ZIUA 1K92A 3MLAA 3RJZA 3CLUC 1ZJWA 4EG4A 4HJXA 1M8FA 2QJOA 1MAUA 2E18A 3A04A 3NBAA 3PRHA 4I6GA 3RBAA 2HGZA 1H1TA 1O97D 1YULA 2DERA 3QE4A 5IHXA 1I6MA 1WXGA 3CLTD 5DK4A 2CV1A 1EXDA 1BS2A 1VBMA 2IELA 4JZYA 3SP1A 2C5SA 3CR8A 1G8HA 3H97A 1O95C 2GOYA 4X0EA 1NSYA 2CV2A 4DDHA 3COVA 4PBSA 1QNFA 2D54A 1GLNA 1K97A 4UZEA 4ZT4A 1J09A 2J4DA 4PBTA 2J08A 1T6YA 3MMXA 4JXZA 3MXTA 2DLCX 1IQRA 4XSVA 1XNHA 2TS1A 1GTSA 3L92A 1DNPA 1PG2A 1NURA 4DLPA 5F23A 2R5WA 3PXUA 4P2BA 2XRYA 3DO8A 4JFAA 3NV7A 5KCMA 3S3TA 5TGTA 4TS1A 1XJQA 1V47A 3FIUA 1J20A 1O5TA 3N2YA 5FO1A 4EG5A 5H7XA 2QTRA 2CYBA 2GKSA 3DLAA 2X3FA 3FDXA 1IRXA 1U3CA 3FETA 3GUZA 4NAHA 5EKDA 1Q19A 2HMAA 4I6JA 1SURA 1OBCA 3F3MA 4OJMX 3U1VA 2NZ2A 3IDFA 1OD6A 3Q10A 3ND7A 1M8GA 3SZ3A 1KAQA 2A1TS 1XNJA 4KR6A 3UMVA 1OBHA 1MOPA 4EFKA 3HZRA 4G5YA 1F7UA 1OWNA 4R2LA 2IP1A 3FHJA 3ILVA 2QUJA 3UC5A 4DE5A 4MW5A 2QUKA 4QREA 2DR2A 3ZJVA 1LI7A 1WQ4A 3H05A 3KFLA 1A8HA 1MAWA 1KKUA 4MW0A 4DDMA 5FNZA 2E0IA 4ZCTA 2CYCA 3H99A 1OWMA 3OTWA 3HFJA 1KH3A 1O97C 4MWEA 2NSYA 3CVUA 1NUQA 4KPUA 3E27A 4MUJA 2OQ2A 2WQ6A 1YI8A 1VBKA 3LOQA 4YP5A 1WJGA 3GLVA 1JGTA 4MUGA 1N77A 3QTTA 3P0HA 2AG6A 4CDMA 4MWBA 2QJTA 1IQUA 1OWPA 1G59A 4MULA 1N1DA 2J09A 3K9WA 3D6VA 2AZXA 3IMCA 2CSXA 3SEQA 1I6KA 4CDNA 4JYZA 1JIIA 5LLTA 2D13A 3ZJTA 1G8FA 4EG1A 1KQPA 1WXFA 4DDKA 1O6BA 3PNYA 3TZLA 1J21A 3IOBA 1J1UA 1VL2A 3IVXA 1GAXA 4WNYA 4E1AA 1VLHA 4YP6A 3COYA 3KT6A 1JILA 5FO0A 2JA2A 1NUSA 1GZUA 1O96A 3FG9A 3L93A 4DJAA 4NAUA 1KP2A 2H29A 2Z09A 4R0NA 4EGAA 2WB2A 4XFDA 1VBNA 4J75A 1NUTA 3Q4GA 3VU8A 2D5BA 3H9CA 4NZPA 5LFAA 4GRIA 1LI5A 3AFHA 2CV0A 3FI0A 1M83A 1V8FA 5BNZA 3K32A 3X1MA 3KT3A 4JXXA 2H2AA 4L2IA 1IQ0A 4MW7A 1KQOA 4MUIA 3ELBA 2WSIA 4I6EA 4KKVA 3P0IA 3IUBA 4KPUB 1PFUA 3IODA 4A91A 1N2JA
chains in the Genus database with same CATH superfamily
2JH9A 1I2MA 2ZRAA 2QN9A 3A6ZA 3P2KA 3LSTA 4PG4A 1W25A 1WE2A 3W4KA 4W8HA 5JNLA 3C0KA 3L7IA 3EPKA 5F7JA 3DULA 4FFWA 3FYUB 3QVJA 4P35A 4KQ2A 3I04M 3UGJA 1M72A 2X9GA 3H1FA 3LECA 3GRYA 3T3PB 2XYRA 3T6KA 3K0AA 3CVXA 5AM2A 1C0PA 5LUAA 1XWIA 3NHUA 4AF7A 1M5UA 3N75A 1QPZA 1GGEA 2W6ZA 1N2BA 3O91A 3CWQA 1X1EA 5CK4A 1JQDA 1DTWA 3L6RA 3GJZA 1E2IA 1DAHA 3KLPX 4MKRA 3BCSA 2WJWA 3IX7A 1IOVA 2QJFA 3AHGA 2WDPA 4MUBA 3EVBA 3OT1B 4KUGA 3LYHA 4TS3A 2R7KA 2PAFA 2B5VA 3EGDA 4II2A 4R2MA 4ZZ1A 2C8LA 3S1AA 2FFJA 1ZCJA 1XVIA 1N6OA 3ECCA 3KU1A 3SC4A 4FCTA 2P6MA 4LC0A 4RK5A 5A4JA 2AYXA 3K1AB 4CG0A 3MTDA 1DUSA 1YS4A 5C31A 3KFXA 4A0HA 3INNA 3GNQA 1WOMA 3IALA 4RHYA 3UATA 4B35A 4Y3UA 1JR4A 1NDQA 1GY8A 3PCRB 5GZ1A 5LQMA 2VP0A 3LGXA 2PSFA 2VJPA 2CEKA 4IXTA 4JP2A 5K1ZA 3VPBA 4MDFA 3BFXA 2JGAA 1NY5A 3JQBA 3THWB 2G0AA 4HQKA 2GK6A 4LV6A 4AJ2A 4AY6A 2REXB 4RSRA 3IMGA 1A8SA 2JFQA 5SYNA 2QM7A 3SZOA 2C9BA 4FNGA 1JKFA 3EVAA 3L40A 4K6KA 2Q1YA 1PWYE 4XQ0A 4AJNA 4B73A 4ETIA 3CINA 1AF7A 3KUCA 5KPJA 5B2FA 1DG9A 1L7DA 1NQ5A 4RF4A 1K3TA 2C59A 4YAFA 1IJEA 4PNHA 1UPFA 4P80A 2PD6A 4EAQA 3V4PB 3W8FA 3DYVA 2PA0A 1G6HA 1NHWA 1NAHA 2QE7A 1F06A 3S5UA 3WIEA 1PFVA 5LP6B 2R6R1 4LYJA 1OCEA 4BNXA 2PUJA 1YAHA 1RLTA 3AESA 4HGRA 4B43A 1MMFB 2CGEA 4CETA 1NI5A 1SBZA 4M99A 4DNOA 3NHAA 4QU0A 4YV7A 4YRLA 2B5WA 4BKRA 2XGJA 1JAYA 1GFSA 1PBTA 1HTTA 2X0JA 4HAZA 5CX1B 1UOQA 3B9PA 5AVUA 2BSQA 3I0ZA 1CUHA 5AUPB 2HQ1A 3D4LA 1TLLA 3K4HA 3EIFA 3G6KA 3ZYZA 3L4KA 4PC6A 1OIWA 5LYJB 5BQPA 1MN6A 1L7MA 2J3JA 3TM4A 5BN5B 3ZLUA 3A06A 2JLQA 2HWKA 4GC9A 2LUOA 1TO6A 3DOHA 4ZO4A 3H2ZA 3WG9A 1EDOA 1ARZA 2BKLA 2H2WA 2VJMB 3IB3A 4XVHA 3PRYA 3FDZA 2BFOA 4GZ5A 1E77A 4ZEMA 4NH4A 4ARZB 1D2EA 1J7KA 3O4FA 2V5UA 4B6RA 2DH5A 1ZR4A 4RK1A 2XMGA 3UOGA 1PJQA 1MRSA 3HH8A 4FBGA 1BJTA 3F6BX 5IDQA 3PXGA 1AZWA 1U1DA 2B0JA 2OV6A 2PMKA 4TL8A 4Y0VA 3SZUA 5JZBA 2VQEB 1IH8A 3A05A 3QWAA 1V9CA 2X1LA 3K7EA 3R7DA 1NASA 4Q1DA 2ZKIA 1VG0B 2ZR9A 1TJPB 4XIIA 5F2KA 3OTHA 3VTAA 4E7OA 2ID8A 4GMDA 1Y33E 2F3RA 3ZHYA 3SHTA 1K7YA 2H16A 1RAFA 3A3NA 2ORVA 1QHNA 4HK4A 3LC0A 2HYDA 2EKDA 3GT7A 1E6UA 1NVVQ 2AF3C 2DPLA 2V7QA 8GPBA 3ZWNA 2XQKA 1K8QA 2GLUA 4V1CA 4Y2QA 2QRVB 3TEMA 2CKMA 3UK0A 1YA6A 2C92A 4HFJA 4GP9A 3SZGA 5BORA 1QG6A 3GG2A 1PU2A 2O2XA 3CPJB 3PV0A 2JCBA 3MLBA 1ZG3A 1DTEA 2BTQA 4HFRA 3T3MB 1OTHA 1B6RA 2AYYA 5IJXA 3EVNA 4BO4A 3CXRA 4JVSB 2H92A 2OYSA 3SEZA 2GTIA 2AG1A 1VXOA 1CZNA 1RP1A 2C7OA 3MWEA 2XE6A 1U2DC 4PZUA 3X44A 3O74A 4R83A 5ICMA 1NX9A 1RFLA 2IQ5A 4JC4A 4KQJA 4RTKA 3R9WA 1JQKA 2G3YA 4GH5A 3VC2A 4CM7A 2JANA 2VXOA 4NMHA 4DJ5X 3T7JA 1BEUB 1YCGA 4YCAA 5IBCA 2WYWA 1Y9EA 2ZRKA 3EGCA 5IYZB 4P5PA 3ROQA 2V7BA 2WDZA 3T7KA 1A71A 1XN4A 1JPJA 3WGUA 5HKAA 4I36A 4LSMA 3BFPA 5AUQA 1JEYA 5KO2A 4BYGA 3SDBA 4XGRA 3TQFA 3IBSA 4UMDA 5GTDA 2VNSA 1J06A 4YMUA 1KC1A 5LL6P 2F55A 1ODIA 3ER9A 2G5TA 2QVXX 3ECAA 5CDYA 2VHUA 4JLVA 1AGXA 2YZ2A 1V43A 1J0XO 1OI4A 4TLAA 1KS9A 1PAUA 2F9LA 1DDOA 5ALJA 2WY2D 5T8KA 4YMTA 5THKA 2EG5A 3RYFB 2Z2ZA 2B78A 3H9BA 2OORA 4JQZA 4IV8A 3C74A 1FFEA 2FE4A 2EJBA 2EBWA 3DV0A 2B1JA 1QKIA 4MUHA 1XVLA 5G3YA 2YWHA 3QLVA 4OBWA 5DTMA 3UGQA 4RO0A 4C43A 2FQQA 3QNUA 3ZWCA 1XRRA 2QNRA 1WABA 2I6FA 4FWTA 5DF1A 1XEAA 1PK9A 3WB1A 2F9FA 4ZRMA 4UTRA 1W87A 1ES9A 2PXHA 4D9JA 3DF7A 2QG6A 1NMQA 1GUBA 2DP4E 2JBAA 4ZHQF 4JP8A 5FYDA 4HO1X 4WH0A 5LBIA 4AK9A 3LC2O 4BLOA 1I4WA 1E9VA 5JCOC 3KQLA 3SYRA 3L4JA 4J0FA 1P60A 2O7RA 4CKEA 4CCYB 1GNSA 1UPTA 1Y80A 2DHCA 1ZD5A 2FLVA 4KQKA 3VC3A 4D9FA 1PR4A 4QDTA 4AB1A 4XQEA 3LP8A 4CMAA 4ZMSA 3SIXA 2AUTA 3GH3A 3Q3IA 4RL6A 1NBOA 2FJUA 4U02A 3VO9A 5CT4A 3NWJA 3P9KA 2BTOA 3KYIB 3PKZA 3GV0A 2IZ5A 2KJQA 1SD5A 2Q28A 4XPIA 1COZA 4OHWA 3P8ZA 1PFKA 4QUAA 3ZGZA 3GP5A 3ES9A 3WFZA 3HADA 5LLSA 3RVSA 2QD5A 4X7MA 2ILTA 5CXXA 4ZJYA 1NG9A 4P81A 3C7AA 1RWMA 2Z04A 4TTQA 1GPKA 4PO3X 3FM9A 1NG1A 1T4MA 1QPGA 3IP5A 1CDEA 3IVAA 1L5SA 4C0WA 2GPYA 1E1CA 4A82A 4CHGA 1HX7A 2GCIA 2JD0A 3AHFA 2QTVB 4P3OA 4C6HA 1KZ1A 3UMFA 2OHFA 4M0FA 2IQIA 3PA8A 4BUJA 1N2EA 2EIXA 3LO8A 1U7OA 2JFOA 3NTQA 4DRZA 3EWIA 3WGNA 5KQGA 2R8OA 2G72A 1NFFA 4RSMA 3R3JA 3VGJA 4F9GA 3DL2A 4Q4CA 5BSVA 2TMDA 3ZK9A 5FOWA 3UO8B 4DLVA 1XVAA 2ZE6A 2QZZA 3DZBA 3RT7A 3T3EA 5F73A 4QXOA 1W6RA 3SJBA 1WXQA 1ZZGA 4TKUA 1VKOA 4ND3A 2ZJ3A 4DW8A 1K5DA 1T3TA 2A88A 4I1RA 3DD1A 3WWPA 2WVAA 2BW0A 2O0JA 3G5LA 3R77A 1DCFA 1GSHA 1R0KA 1MA0A 3D02A 1KYYA 3D6FA 3K1AA 2PMBA 3PKJA 4IGEA 1RXCA 3VMMA 2VNKA 4DLXA 1WB6A 3LUJA 3E3MA 4HNTA 1PFWA 5HTOA 4UOEA 2AEMA 1A27A 2AVNA 1IN5A 2ZUUA 1QF9A 1QS0A 1TM7E 2AOVA 2JIBA 2XX3A 3G2QA 4QARA 1PSZA 1EE9A 2GM9A 3CLUC 3DJFA 3OH8A 3QELB 3WL7A 2Q2NA 1BYIA 2FRDA 2Y6VA 4YAEA 5AOCA 1L8XA 2P2DA 2WTXA 1T2DA 1PGQA 5IJAA 3TWOA 4AKTA 3OCWA 4LJ7A 3R6TA 3QE4A 5AM4A 5JLAA 1TM3E 3GRVA 2VNIA 3NETA 3G5TA 1X86B 4TV8F 5F98A 4J2TA 3JPYA 2PJUA 1ZL0A 1U9IC 2CFIA 2Q5HA 2FMKA 3C5CA 2O2HA 1FTWA 3MD0A 3Q3VA 4FYMA 4P7FA 3W78A 3WL8A 3HYLA 2ASEA 3WMFA 2CV2A 4DDHA 2YQ5A 2IDKA 1G0OA 1EX7A 1X0VA 4PBSA 1JN0A 4CQLA 4HH0A 2FR1A 3A11A 4M46A 4FFBB 3O2JA 1GILA 4B3MB 2J08A 4Q19A 4R81A 1SCDA 1M1NB 3KYCA 1M0EA 3I3SR 1HKUA 4B4VA 2DCMA 2MIIA 5JNTA 2PWAA 3FIJA 4BQQA 1PZXA 3LXRA 4NF2A 1EVZA 3HKCA 2VPTA 1BXRA 2RGUA 3D7NA 3HKBB 3CN9A 4JB3A 4IDPA 3EEBA 3N2GA 3R3UA 4ZVMA 2I65A 1X92A 4C6TB 3T3IA 2HA2A 3LL4A 2R8XA 1DRVA 3JAWA 1ZI8A 1QRUA 1KNXA 1SBQA 1Q7TA 4DWJA 1E1LA 2OBLA 2GKSA 2X3FA 3C3JA 1GNRA 1OW3B 2INGX 2XUIA 1S2MA 4MV5A 4B4KA 4TT3A 1CZLA 1V6CA 3IFSA 3QVSA 1I7DA 3GUZA 4JY7A 2W7TA 4MDHA 1SC9A 1L0BA 2ANCA 3LH5A 1PP4A 1TOAA 2F3UA 4OFXA 4RY0A 5BVGB 5FLKA 2JCYA 2EJUA 4LDRA 4ARZA 4GX5A 4NDNE 1W0KA 1P0FA 3LYAA 1FNNA 1CIPA 2H59A 3ELWA 1RJ9B 3NORA 5LQRA 3GPDG 2FRXA 2G8LA 1ETHA 1T3GA 5F4ZA 3O8QB 4XCVA 2QDXA 4WDQA 1OXBB 1D2NA 2G5CA 1KJJA 3BWVA 5BV8A 1R5NA 4F9FA 1CE8B 2IFTA 5BOVA 1KJ9A 3LV8A 5AVJA 4PZYA 1Z8NA 3L07A 4FE7A 1V3TA 4U7GA 4EK9A 1DRJA 1KFEB 3ORRA 4I2NA 1RRMA 4N65A 4FSHA 4Y2UA 3IAM1 2WIKA 3ETHA 3DBHA 2XQIA 4JOQA 4JJKA 3VSCA 5B2EA 4IDEA 1QUFA 2ZSDA 3AETA 3EFOB 3CVJA 3TD2A 4KIUA 1M6VB 1ZP6A 4ER5A 3H9QA 1GD1O 1GKYA 2NYUA 1J8FA 4TTTS 1MC4A 1RD4A 3VR3D 3DZGA 4PGHA 2JGMA 5J2UB 4B6PA 1QGZA 4OREX 5AVRA 2O1SA 1PJRA 3H99A 1ISJA 1GNVA 1NNSA 3B2QA 3VOBA 5JMWA 3MOIA 1REQB 4RLFA 2NYVA 4CJXA 4Z53A 3KD3A 5CBPA 5F1OA 1I9CA 4JYCA 1C1XA 3R5XA 4KPUA 5JHHB 1VKRA 3E27A 4DZZA 1HE4A 4Y2XA 1GZ5A 2ES4A 1ZCBA 3AHIA 3GAMA 4H35A 4NZMA 1J2RA 5B36A 2WIAA 2ZRGA 4TRMA 3N5KA 4V24A 2PO5A 1QVAA 2Z43A 4IF6A 1ZYUA 2ZDQA 4HUQA 1R15A 5I9TA 1YJCA 5TQJA 3LBYA 2HJ9A 3WYNA 5ECGC 4W63A 4YJ2A 1Z83A 1SUEA 1ULUA 1JP7A 1E20A 3QHPA 4NEHB 1E89A 1NLZA 3AI3A 3SQXA 3VVCA 1LUAA 1SCIA 1SHTX 1GPBA 2AHOA 3WC4A 4KYIB 2YBDA 3EH2A 4WUTA 2IS6A 1F1JA 4L6CA 5LA6F 3I9NA 3PNYA 3BZWA 1P1FA 3RTDA 4LYEA 3QVLA 1AUXA 2JH8A 2W6CX 3H5TA 1K1EA 1U2TA 3MERA 3GGDA 4DVGA 3KP1A 3QKIA 4KP7A 2B8NA 4DMFA 4LXUA 4M1SA 1UPBA 4LHYA 2XGGA 4INOA 5U1PA 3F8SA 4DLWA 1ADCA 4POAA 1MO6A 2DECA 4WZ6A 1K0FA 4NMWA 3PDIA 5BN4B 1V4VA 5I7OA 4B74A 3VR6A 2AFIE 3AO0B 2Q9BA 4M36A 3FNGA 4NAUA 4BMOB 3NIWA 4C0BA 1NRWA 2WB2A 4FBLA 4KRYA 3Q0IA 2LZ0A 3B9QA 4OHYA 4E08A 1UK7A 4BQEA 4YH1A 2DFNA 4HRAA 1NJSA 5DNEA 1E3WB 1XP8A 4D4JA 4LYDA 3T3OA 1SRRA 5ALKA 1AHNA 2H06A 3JQ6A 5E95A 3RYCB 2XQGA 1NJ8A 1XXHA 1M83A 1P1BA 2I33A 3DMDA 4FXOA 1GFZA 4JROA 1DBSA 4HQLA 5JXJA 1CF2O 3K32A 3IKMB 3IPCA 1BIFA 2P7IA 5JUWA 3LXXA 3L9XA 3HJRA 4CIYA 2G77B 1RWKA 5LMZA 2C2KA 4TLDA 1CIJA 1Q22A 4RACA 3ZV4A 4BU1A 2H17A 1DCKA 5I9LA 1U28C 5D3QA 2XA1A 3IS3A 1T2NA 1VJ0A 4WOBA 1WCV1 4US1R 2PD4A 1F48A 4QRHA 5YASA 3WSVA 5IDVA 5CA1F 1DX9A 1SKQA 2P67A 3QUBA 1KOLA 3IMKA 4E30A 1PYGA 4D4HA 3HPRA 3ABZA 4PAWA 4PC3A 2G5GX 2F8TA 4BNDB 2PG3A 2QRQA 1U5BA 4OHOA 4WKBA 1S4MA 3FYDA 4W9RA 5DN9A 4CIWA 1XAGA 4F2DA 2WE7A 1HEUA 2AMLA 1KYXA 4GKBA 5DJ5A 4MW4A 4J03A 1TAHA 1U2QA 3QA3E 1ISMA 4HY3A 3ZNOA 4HLDA 3A6GA 4N3AA 2PLWA 3SS8A 1YOVB 1BH6A 3QRWA 3SQMA 3UV3A 4WXMA 3SEFA 3PLAE 2OXEA 4CKWA 3PX3A 3QKSA 2XI4A 3BCHA 4P7GA 1N0UA 2GFQA 2FKAA 4KK3A 4WCDA 4IIGA 3DG9A 3SQNA 3VAAA 1GKIA 3JTEA 4WKOA 1CP2A 4JMLA 4JVOA 4NOKA 1UMBA 4MYRA 4PR0A 1KSFX 3V8PA 4PX3A 4EPTA 1BWQA 1L1EA 1PUIA 2XVMA 2CHUA 3L8MA 3ONFA 1EGVB 1XTQA 3IIEA 3UCFA 4BJ3A 5JSFA 4FFNA 1MW8X 2OCXA 1RABA 1MNQA 4F5EA 1N6KA 3QKRA 3EIQA 5A4MS 4GMXA 3D1JA 2IYNA 4FU0A 3WWEA 2VPQA 3NTOA 3R4CA 5KDOA 4MPTA 4WI1A 3U3KA 1UJ4A 1Z25A 4CTMA 1GEEA 1E4YA 3T1HB 1X7DA 3AUKA 1TVEA 2QTLA 3TE7A 4PQEA 1JG3A 3WIVA 1WVIA 2PN1A 4I4TA 4KNWA 1W4ZA 4LJKA 5MHTA 1IZ7A 5AIAA 5HRUA 4DV6B 1H6CA 5E2BA 5KB3A 1RLOA 4MIEA 1NBHA 1RQ2A 1ZOPA 5E9JA 3ZCQA 1NC1A 3GEIA 1T0JB 2R48A 4OHCA 2Q0XA 4ZOLA 5K0CA 4Q66C 4L85A 3RRZA 2QYHA 1BVUA 3OOJA 4XKJA 1M7HA 5F33A 4N39A 1KH1A 3ZDYB 4BN0A 1EFVA 2BGRA 1PYDA 2YRXA 3AERB 3IDZA 1IB0A 4QATA 1Q57A 2F90A 1QP8A 3U4QA 3L6OO 3MIZA 4N3CA 1HO3A 5GADl 3WNBA 1XEXA 4URYR 4O29A 1QYCA 4FX5A 4MUXA 4XGKA 4Q4JA 4ZZ3A 2HEGA 3RKRA 2OQIA 2C7VA 3H2GA 4KAXA 3R6DA 1VHDA 1YIAA 2LDXA 2V7VA 1VDMA 3I1YA 4N3NA 3K1JA 4MW6A 3ISJA 5ELLA 3HVKA 1HC7A 3E84A 4JOCA 2WC1A 4L9RA 4HX5A 5AW0A 2MDTA 3QBVA 1NR7A 5IPFA 4C0XA 3SHQA 2PS3A 2XTJA 1SC1A 1JZTA 4CHTA 1JBKA 4L5AA 4PLYA 3Q2KA 1YGYA 1ZJ5A 3ON5A 3P0EA 4DADA 5C5IA 3T4UA 2P9ZA 2RI0A 1NVEA 3IE0A 4OQYA 1AHHA 3O3MB 4GDMA 1SCUA 2NQTA 5CPFA 3QVXA 2NP6A 4QAQA 3K09A 3QVGA 1BW9A 3SBEA 4DIBA 5CDFE 5DNAA 4JHXA 3WGHA 2QSJA 3BGVA 1NQTA 4MUAA 3EAFA 2ZIEA 1JMKC 1H23A 1ND5A 1T4BA 2PQ6A 1ATZA 3D5TA 3KE8A 1T0BA 3OP1A 3QXHA 5A7HA 4D79A 3HCDA 2FQYA 4K2HA 5JJ5A 4MEAA 1WDKA 5FUBA 5EWLB 4ZI3A 3NRBA 4LJYA 3LWZA 2IOHA 3TJRA 5AHWA 1YACA 3LO5A 5ITZB 1BE1A 4ZFNA 3Q9NA 3KXIA 2ZTVA 4DQDA 4MRNA 2B7LA 2PS9A 2R751 1R0CA 3EJ6A 1HYEA 1PR3A 1YCFA 2QPTA 1B1AA 1MDBA 3BD7A 5DNDA 3AGPA 5DMHA 1KXZA 3JVDA 3FLBA 3JAMA 1Y3CE 2AX3A 2GARA 2EZ8A 3RS8A 4QOIA 4UPVA 3KQNA 3CC8A 1DC7A 3PI7A 4IHJF 3TSZA 4GLOA 1CR4A 4F21A 3B36A 1J0DA 2O07A 3G89A 2RHBA 2GBCA 2YQ4A 1YE8A 3CCCA 1E8NA 2HSGA 3WRYC 4MEBA 1KEZA 5F1YA 1JIKA 1JSXA 2G71A 4HWOA 3ZLTA 5B6PA 5I3CA 1K08A 1JHPA 4NHEA 1SELA 4XM0A 1OLUA 3GVCA 4ASUD 3TZKA 2IV2X 2A57A 1EK2A 4MGEA 2Y3IA 1NI4B 1NT2A 3K16A 1W2WB 2Z5GA 5CGQB 3ABOB 1Q95A 3COZA 3M6WA 2WKRA 3PPWA 5LR6A 3RHTA 4H7KA 1DWUA 4Z54A 1RZVA 1VJ5A 4IV5A 4RMJA 1DKPA 2ZJ2A 4AROA 5IBRA 4TYQA 3QEJA 1J9EA 2A7XA 2G08A 2I4TA 3F49S 3Q12A 1UFQA 3ZJUA 2QL5A 2JLXA 3GJ8A 4Z8XA 4KRGA 5BOSA 1BFKA 2CMGA 1E5XA 3KT8A 3L05A 4JOBA 1FFWA 1LDMA 1Y6QA 4NYMR 5E6UA 3WMRA 3ZXSA 4JVMA 4Q93A 4CMKA 2Y2VA 2ISSD 4HD8A 4P5DA 1Y8RB 1Z6QA 4OOEA 5T3UA 1MF7A 3RR2A 4FQ8A 4YRSA 3O4VA 2HXGA 5BMOA 4MYUA 3WLQA 2EDCA 1VZ3A 3VNBA 1RM4A 3PIIA 3D0RA 5TQ0A 3WJAA 1U0EA 1XDWA 3N05A 4XLZA 2XDQB 5ADUS 2PJDA 3WK4A 4AX8A 2QVLA 1CJVC 3G5AA 3JRNA 4K03A 2JRCA 3LG2A 2PSSA 3B6MA 2VA9A 3C6XA 1U2GA 3CNQS 3O8RA 2RB4A 1ZUHA 4GLJA 4QDZA 2IHNA 3OZUA 4QTZA 4EF6A 2BM1A 3ED5A 5FUYA 4DPMA 2XRFA 1PGNA 2EARA 2Q5LA 3TIGA 2EHDA 4HCJA 2CK3D 3X1DA 4KTTE 4QA9A 2D2FA 1PI3A 3NASA 2XMQA 1ZAKA 5HE9A 4EFNA 1WETA 2G9NA 2OK7A 2FN9A 2MMGA 3RVNA 1KWKA 3QX8A 4JYAB 3HYCA 4BNGA 1GEGA 4URZR 1VJGA 2WD8A 5E7JA 4UAJA 2DX7A 3L7CA 1WMDA 3KJNA 4IWXA 4QYTA 5DIZA 1KAEA 1VTKA 5DNVA 1CTQA 2NUTB 4KZKA 1BMTA 3CURA 4URXR 3WA7A 1RCTE 4RF3A 1IBLB 1JLSA 1KZ6A 5CGZA 2ODWA 2E55A 2DU8A 5IT9A 2I6TA 3PHIA 3O8OA 4CODB 4P84A 1LLFA 4Q9DA 2RK3A 2RE8A 2NZUG 1B6TA 4MV0A 5EHQA 5CLIA 1N5RA 1Y98A 1L5ZA 2UYYA 2XHEA 1ZM4A 1UK6A 1NF2A 2IPAB 3F4KA 3LOPA 4HRYA 1E3WA 4J0IA 2HHAA 4P83A 1I13A 1N2HA 2SCUA 5EE3A 4DSUA 1JDVA 1WBBA 3AI2A 1Y3AA 1A7JA 2XRZA 2A4KA 2CXTA 2VAPA 4R7GA 3DZJA 1IEWA 1SXJA 3AVPA 3EBOA 5ALNA 1LDGA 5FL3A 4NABA 4DB2A 1U8CB 3B8EA 4G8CA 3E9DA 4UVDA 3RLFA 2I9PA 1TD1A 4BTEA 3S28A 3EG9A 4XW2A 2EYUA 4HUTA 2PKXA 1KYQA 2AFVA 2OXRA 4II7A 2F2TA 5COBA 1U9ZA 3SQOA 1J1ZA 2PS0A 3GUCA 2JIQA 4EW3A 5JC8A 3KZKA 3GC6A 1RJGA 1WHTB 1CQPA 2HKIA 1YZQA 3MIIA 4TTVA 5CCEA 4I1SA 4UNPA 1VI5A 5JY1A 1YRHA 2PKCA 1KE1A 3V1LA 3HA2A 3G2NA 5GOZA 2QQ0A 1WTCA 1CZRA 2HV8A 2ZDHA 4TLBA 4A2CA 3HKDA 3D6MA 1DXHA 3GDHA 3AM1A 3D4BA 3RE1A 3H19A 4YXWD 2MSEB 4U7WA 3RWMB 1I4OA 2DB3A 2CVFA 3OQBA 4Y2PA 2FUEA 1O9GA 2G1AA 3WADA 4B6JA 2P4EA 3F78A 3MS2A 4K9SA 4K81B 4HZUB 4LNUA 4M60A 3JPWA 2J3KA 4ZCSA 4HLNA 4EHNA 4Q3AA 1MOSA 2ODNA 1QHSA 4B3SB 1IZYA 1U90A 2QU8A 2PWPA 2C5AA 2QX9A 4JLSA 1H3EA 1NNI1 2APJA 5AI4A 4F4UA 3LPMA 5LU9A 4FYYA 4EG6A 4O25A 4KMSA 4Y9RA 3DC7A 2PD3A 1BKSB 2HY7A 3LJKA 1JHZA 4KIJA 4YQYA 1NXQA 2WTEA 4ZVNA 5AT1A 3ZGLA 1QK5A 4MKZA 3K35A 4BC1A 1C30A 4DCNA 5BWOA 2DXIA 1G5TA 3GRUA 3MRTA 1G38A 1NZDA 3FTDA 2V4ZA 3PR3A 2JI7A 5JS8A 1E2GA 1YMVA 3LA6A 3OPYA 4LHEA 3CO5A 2OMKA 5L4SA 4K6HA 3MYYA 1AQNA 1CD5A 2W6QA 1EAMA 1NVUQ 1UC5B 1YA4A 1BRMA 2L2QA 5GAJA 5CEEA 4HBGA 1ESCA 4WK6A 4EG4A 1JDSA 3K8OE 3QWIA 4RNDB 4U39A 5CA1B 3ZU3A 3F1LA 1C7ZA 2HGZA 1O9HA 4C1NA 4N6GA 1C80A 1UBNA 4AZ3B 1C3LA 3CLTD 3WLFA 4Q00A 2CV1A 4LBYA 1TE2A 3RSOA 1GDHA 1GL3A 4NU6A 2PT5A 3HCWA 4N0DA 4AP5A 3OAAA 3NNDA 3I58A 4GR4A 2Q3BA 1WBDA 4K9MA 2D1SA 3GCXA 3WTCA 3PUVA 2ZT8A 4ZT4A 1ZCZA 4K1XA 1L8LA 3TLXA 4FM9A 2GM4A 2O5CA 5KQRA 3KOZA 2WNHA 1TK3A 4B9EA 4MIKA 1I4DD 4RKEA 3PE6A 4KI7A 1JH8A 3KD2A 3G9QA 2RC5A 4P3YA 3RF6A 4Z7OB 1F2TA 4XCXA 1PZFA 1N1EA 5KKNB 3L92A 1NURA 3MTJA 1HDIA 4OXXA 3NFRA 3U7GA 2AFRA 2Q2QA 1G19A 4YAGA 3WOVA 4B3TB 3CUKA 4U9UA 3JSXA 4X3OA 1GLGA 3PQ8A 1FJHA 1SKAA 5BNWA 3ZW7A 1DUVG 1E0DA 3ZHSA 4BQPA 5DGHA 1P9WA 3KVOA 5C8ZA 1KMIY 4AG6A 5A5GA 1UXJA 3FYHA 4Z9FA 5JSQA 1QCDA 1R5JA 1FZTA 1OAOA 2GK4A 4X20B 4EELA 3TGPA 1JQEA 3FDXA 5A7FA 1KO1A 1SKBA 2VDWA 1AQUA 3CB4A 2BFAA 5KWIA 1DEOA 2MINB 1T2UA 3KKOA 1DBWA 3W79A 2PUCA 5AVSA 4DAEA 4EMUA 5KX5A 1AV7A 1XQYA 2XXBA 2FPKA 3LC7O 4IX9A 4WY8A 1SURA 1GRNA 4ZAYA 2QTAA 4YAKA 5KYXA 1JRLA 5I7FA 3IDFA 3KKEA 2FEMA 5BR1A 3ZTTA 3IBYA 3AFIA 1G8YA 3JASB 3JYQA 1UC4B 5AW3A 4DTCA 5KMGB 4UULA 5FJJA 1QUEA 4YT4A 5JNRA 1E3EA 3VR2A 1FE8A 3MPOA 2OT3B 3LBHA 4BBJA 3PWZA 3EHEA 3EIHA 3C1TA 2EX4A 4P5EA 4QVKA 2RGBA 4IWNA 5HXAA 2XF8A 3PB3A 1XHLA 2CLDX 3TRKA 4WBNA 1K68A 3NHRA 1OXUA 4K40A 1PWXA 1U8UA 2V97A 3ZPXA 2ZRIA 1A04A 1N1MA 1X39A 1AS2A 4LZLA 3UJ6A 3OLVA 1USKA 3G0OA 5BT9A 3TNDA 2DR2A 4IICA 4MB6A 1CF4A 4IINA 4QO8A 1MAWA 3JVEA 4FFMA 5JJBA 4UE3S 1DIHA 1M6HA 3ORHA 3O83A 1CUDA 3FMVA 5FUQA 3N8KA 3V7FA 5EIWA 3AHCA 5EFOA 1ONSA 2C7QA 1XTBA 2BCEA 3BSWA 4L8YA 5MFPA 1GCAA 1NUQA 1TVCA 4HRXA 4OX9B 2OQ2A 3H4VA 1WWKA 1ZOSA 4UKDA 4UASA 3ZKWA 5CYPA 4HAYA 1Z38A 3R3VA 2GESA 4F0JA 1JIVA 1LF0A 3QUSA 2WWTA 1KEKA 2V9PA 2QJTA 5DXAA 1MB0A 2GN4A 3V80A 5CDTA 3BGIA 3FRHA 1P80A 2C2HA 1NY6A 1MQSA 1W75A 4C14A 3WRVA 3VR4D 3M33A 3TG8A 2CCJA 4Y2HA 1KZGB 1QOPB 3OTIA 3RC7A 4TVSA 2LDBA 1TU0A 1M2HA 2ID7A 2WPNA 3LGAA 2B6HA 5LXTA 3AY3A 2H2HA 4GRAA 4X3CA 5DWDA 1Z7GA 4W7HA 1W47A 1CS0B 2VBCA 4KEAA 1S7GA 2CD7A 4DDKA 4EA6A 4R8RA 1V45E 3GI1A 4QEZA 2LVBA 2XEDA 3EK2A 1NDUA 4CWAA 2CD9A 4PIVA 4M7PA 3MJRA 3MJEA 4GEKA 1A9TA 2IW3A 2CVPA 1T8YA 3CG0A 1YWGO 2NTYC 2JI6A 1H6AA 1WIWA 3I2IA 1TA9A 1NBWB 4QLOA 4JNKA 2VFAA 2XYGA 4TZ0A 2HTFA 3DOCA 1F0YA 3SICE 2GXAA 3IEUA 1VLVA 3MUNA 3BTUA 6LDHA 2PYDA 4BZPA 5HZGA 1E3TA 4W5OA 2D5BA 2QYSA 3STVA 5BN3B 4XB6B 4DLNA 4ZQGA 1G5RA 2ZITA 1RADA 5DZSA 3LUCA 4IX1A 2NU9B 2NYAA 5BV7A 1IU9A 1OH6A 5KC9A 4BVLA 3FMPB 1VRWA 2AI3A 2WZDA 3HLKA 3IESA 3L8DA 1F0KA 1TU3A 1OX4B 2WK1A 3GLGE 1NN3A 4RQAA 1BXGB 1P1KA 3HCAA 2JHGA 2XECA 2Q99A 4TMFA 1TMGE 3PG5A 3LA8A 3S0JA 1ECLA 2R7MA 1ENYA 3LUFA 1L5MA 4JUAA 5ARBA 1L1QA 1HMPA 2DQZA 1N2CE 3IKLA 3ND6A 3ANLA 4D81A 2XXAB 4WGGA 5I4CA 5KWJA 2WG1A 4BJHB 4KAAA 5EJGA 1T2FA 1T1SA 3QEMA 5TS3A 2VEDA 2E3JA 3DLBA 4WOKA 1DV1A 1GHTA 2Q9UA 1SCNE 1ZGZA 4Q1AA 3ETNA 4A8JC 3M6UA 2RHLA 2GA9A 3JAKA 3IHLA 3E2IA 2CL6X 1Y63A 4TM7A 5B6IA 2BE7A 2W6IA 4XGNA 3X2SA 4I55F 4YPVA 4WEOA 1B8OA 2V7UA 4RZXA 1C9DB 5U9CA 2IGBA 3DTVB 4FKMA 1L5HA 1TXGA 1K4KA 2PYZA 1XUOA 3NW9A 3ZKAA 4LNHA 3SDZA 2A0YA 2IUFA 4IOLA 3LP6A 2WRZA 1C3JA 3FBWA 5J47A 2H5EA 2R3SA 4UFOA 1TJ4A 2FDXA 2WUDA 2B8WA 3P2OA 3C7KA 5KDLA 3NM6B 3SJAA 4QG7A 3ACBA 1PDWA 1RHQA 1XT6A 4MR8B 2YHBA 3HN2A 3N28A 1ZO8A 3G2LA 3HXTA 4HAIA 1FDIA 1W5FA 5AKEA 5J59A 4DY4A 4ZIRA 1DKNA 4ZN6A 1GPUA 3IAXA 1V0JA 3AVOA 5K45A 1Q14A 2ZRFA 3PHGA 3Q9SA 4LE0A 4M6WB 3KXDA 4M38A 4ETWA 2IVZA 4BMZA 1L3BA 3BORA 1ABEA 3NYIA 2QKYA 1PRYA 1S9DA 2IBSA 1KAMA 1S8FA 5A0VA 2AVDA 4YRRA 2Z9CA 2VRNA 3DC2A 2H0RA 2GVNA 2QYTA 3AIIA 4FZVA 4YBRA 1RXUA 2I0FA 1SOAA 2BFDB 3IQHX 3JD3A 1QHGA 4PHHA 1MOZA 4A1FA 1VGVA 4N0QA 2ZK7A 5HG0A 121PA 3FBTA 3UTDA 5EPEA 2JAHA 3E53A 4Q7MB 2JLSA 4OQEA 4R2KA 3T1TA 2DKOA 1PJBA 1ZIXA 1FDUA 1MQ9A 2QU7A 3B5IA 1FDVA 2O57A 1Z5OA 4URUR 3AEKB 1E6EA 3ICCA 4WZZA 5FKJA 7AT1A 1MFPA 4GUAA 4MV3A 5C7YA 3ZIAD 3QU5A 1DVRA 1SA0B 2O2JA 3SX2A 2XNDA 4JX8A 2C9CA 1CRWG 3AF4A 1G7SA 2BJHA 1PJLA 3R3ZA 3ZBTA 2GCGA 2VOJA 2ZIGA 3CLSD 1C7IA 2FN8A 1ISFA 1OMOA 4QNRA 3P4UA 4HG2A 1KRHA 4LI3X 1I9GA 4C04A 1X7HA 3JWPA 1U4SA 4YTEA 2HRDA 2I66A 2PSEA 3KYDB 2FP4B 3JQ8A 3N74A 3U17A 1LZKA 4R40A 4Z0HO 4L4RA 3VU9A 2WJPA 5JADA 2TRSB 3P9XA 1PEKE 4UTNA 1IHDA 4AO6A 1LDNA 4B2IA 1O0CA 1YTUA 5HRCA 2CMKA 1NQOA 4E6PA 4F3YA 2XYHA 4HWRA 2ZB3A 3FPJA 4KSYA 5FOUA 1XD2A 4F8YA 3QQ5A 1QWSA 2GZAA 4GVPA 1R88A 3IE2A 1YKGA 3DQPA 2QF7A 2W6MA 1TU4A 4FMCB 4O4LF 1S2LA 4G9BA 4LVCA 5EZSA 4OHZA 4OA5A 3WRXA 4MQLA 1DRKA 1TCCA 1HETA 4V39A 3URKA 1B8UA 5IFLA 2IVFA 1ULAA 4KLZA 4W5WA 1YDGA 5G40A 2NUAB 1P2FA 5KKCA 1E60A 2C2GA 4MS4A 1JI0A 3I4FA 1XV5A 1FVFA 2EL9A 1NVGA 4IZHA 3WGKA 1PDVA 1UT6A 1ZZEA 5JXHA 4GMGA 1ESZA 2EX0A 1Z28A 2Y67A 2RHJA 4TL7A 4O8ZA 3FZGA 4GI5A 2QP3A 2X2OA 2VYQA 3WLKX 3LL7A 1US8B 1BGXT 4DYDA 3TTYA 4MWZA 1TD9A 1NFRA 2A9RA 1B15A 1TM2A 2C5HA 2YYSA 4RVSA 4PC2A 4FKZA 1GXSB 1FSFA 4BNVA 1TRHA 1N32B 2EFYA 1XPRA 3OEHA 4N1AA 2IYUA 2WT4A 4L73A 2NVWA 4RV4A 5FYQA 1BHJA 3AKEA 1RKXA 3FPBA 4BQIA 5SICE 1A8IA 1ELOA 3I32A 4LJSA 3IVGA 5JY6A 2I29A 4B3GA 1ZD1A 1IZZA 3QG1A 2C97A 2PSJA 3EA4A 1NOKA 4G5HA 3WLTA 3IT0A 1A8UA 4RU1A 3DZ8A 2GZSA 3IDSA 3PUZA 4ZV9A 2J1LA 1LJLA 1QRRA 4AZVA 2WMOB 1UMDA 3QX7A 4HWSA 4Y6SA 3BQMB 1ZXXA 3GZ4A 1M1XB 3MUFA 4GGPA 4LAFA 2CXRA 4N5DA 1ZK4A 2CE7A 2B82A 5JVDA 3FZNA 1V16A 3F97A 3A4YA 3CRVA 1VRCA 3WLEA 3ZIDA 1QXSA 2EX1A 5BSUA 5EKTA 1SOUA 3DLPX 3M2PA 3ZNQA 2J9FB 4RC9A 5CB4B 5AIBA 1V5IA 3PFFA 1JDPA 4CQNA 3KJXA 5IWCA 1AU9A 3KOOA 3UAOA 2NU7A 4S0XA 2PL3A 2VAWA 3VDNB 3A28A 2OV8A 3HU2A 1Q44A 2QE7D 3A9WA 4QYXA 3OEEA 2BR5A 2VTVA 2V6FA 3H9GA 2F4VB 3WLLA 2B0CA 1HH4A 4K8RB 4M8IA 4AURA 4BZQA 5IWAB 3T8YA 4Y6LA 1OGJA 3AVWA 1HTWA 1U3UA 1EP3B 4OHBA 4YO8A 1JZQA 3DLCA 1TQ2A 4NARA 1JXMA 4TKVA 3QH4A 4G89A 5CNJA 3PQEA 3ZVRA 2ZLBA 2MSDB 2Y1KA 1W8IA 3WLNA 1PL6A 1FFXB 3KQWA 1IBMB 2K6GA 4WGFA 2IHBA 1JEEA 3GB9A 2GO7A 2UV8A 3OU7A 1FQKA 4EO9A 4D6PA 2WB4A 3PNMA 2A9JA 3S40A 3VZDA 2Z2JA 4D74A 5BWMA 3B1ZA 3U4HA 1NP6A 5ECYA 2BMVA 1GRQA 2GX6A 4ZO6A 4RDXA 4RLSA 5KOYA 1PEDA 1UOEA 1WD5A 2I7DA 2IPLA 2VPWA 1W9HA 3W06A 4F93B 2VQFB 3MWJA 4GYKA 4OMUA 1HT2E 4XOUA 4MMXB 3DV9A 5K4GA 1JLRA 2FPXA 1IK6A 1UXOA 1V4NA 3QE3A 2ZB4A 4EKGA 4F46A 5JQGA 4QFMA 2FSFA 3G02A 1BH2A 4O4JF 4OPMA 5IT0A 4JI5B 4QPCA 2M6SA 1W49A 1FJXA 4C87A 5KNCH 2J6HA 5FNVF 1KBOA 2NO5A 5K0BA 2XMDA 5CLQA 2JGRA 1P3DA 1SULA 1XZKA 5HFJA 2BDUA 4RQBA 5IAEA 4KBGA 5KKAA 3VI3B 4TVKA 3DFFA 3UWSA 1JHXA 1TZJA 2WEKA 3DO5A 1AJEA 3E9MA 2WJHA 4G26A 4D9GA 2I2BA 3KTDA 3QF7A 1NPTO 3FUUA 1MZVA 1MXHA 4G4SP 2PL5A 1O94D 3M5CA 3NVMB 4FDMA 2BR4A 4JIGA 1J8VA 4JC8A 1LLQA 5EQJB 1O8CA 2V7QD 2ENWA 4RESA 1WZ2A 4MI1A 4WTOA 1W46A 4QULA 3PHJA 4LMAA 3A4VA 3BB1A 4KLCA 3CH5A 5CJ2A 4UATA 3ZUPA 3N6VA 3Q72A 2IBTA 1OBFO 1GTG1 2DUWA 5EIFA 4BMNA 4YCCA 5H1YA 4BBAA 3KLBA 4TKLA 4RTJA 2XKKA 2C9ZA 4IHKA 1W0CA 4NBWA 1MT3A 1QVVA 1ZS9A 2AOTB 3ZWDA 3A2KA 3QPCA 5EJMA 2CWWA 1KU6A 3P2JA 3TRIA 4GXQA 1G0NA 1E2UA 1ECCA 1E7YA 1M1YA 2HCFA 3EXFA 4L5IA 1RPNA 3U26A 5BN1A 4ZEOA 1USIA 5EC8A 2CDAA 9ABPA 3TVDA 2CJPA 1MTOA 1P7VA 1SQSA 1C8BA 1P31A 3JZIA 3UKJA 4IDBA 5H68A 4DDTA 3BICA 1EB9A 4FC6A 3TECE 3W3AH 1OTYA 2EFCB 3Q40A 4WT7A 3V33A 3IUQA 2ZSIA 4K1LA 4KRFA 1CNEA 2UAGA 3UGTA 4BP1A 4RJLA 5LZ2A 5K3EA 3RSFA 2RHDA 5JBNA 2OFXA 2VF5X 3SE0A 3ZWWA 4E5YA 3QJGA 1UP6A 2KBEA 2H1FA 1X7XB 1X70A 2X5KO 2ZVPX 3K31A 2YBEA 1GN9A 1AVTA 3IYLW 2ARKA 4MWGA 1M8FA 2ZBVA 4KV7A 3WHPA 1Y1SA 4DB4A 4KFSA 1FQWA 4L1KA 5EJ7A 1HSOA 2H1LA 3ZH9B 3P26A 1ZITA 3OM0A 1C3OA 2VWPA 4LJAA 5JWOA 1BS2A 1KMNA 2OAGA 3IEXA 5LQKA 1W9MA 3BERA 2E37A 3FTCA 1T3LA 4WEQA 4KQEA 4UQLA 4HDMA 4ZCIA 3PC7A 1RKUA 2HQRA 2Z5VA 3VU3A 4CLDA 2DCUA 1ZRNA 2XH8A 4J07A 1N6LA 3QK7A 4PBTA 4I55B 1CWUA 1H65A 3KG2A 2PMFA 4KYTA 4CR6A 1UBSB 1H22A 1IBCA 2C4UA 2EFGA 1F38A 1VYVA 3J7TA 4FI3F 4EPRA 2QY9A 4TWRA 2PGXA 4H0FA 1EP9A 2WAXA 2DOKA 4TL9A 3VYWA 1BZYA 2PT6A 2V7WA 4GMHA 4JK3A 1U98A 4Q6BA 4N5MA 2J87A 4NZZA 4LQCA 4DJDC 2N1BA 4I8IA 4QGGA 5C8YA 2PWBA 2AL7A 4KLNA 3VDXA 1EUCB 1GRCA 3DO8A 4FFSA 4O2AF 4B5KA 1ZKMA 3KFVA 1T4CA 3A4NA 4A15A 1E62A 1KBQA 1LX6A 3NHWA 4NBLA 4RF2A 1XCBA 2J0SA 4LF8B 3FLEA 3PD1A 4CLOA 4PU0A 4LK2A 2FZKA 3FIUA 3PX2A 5KVCA 4L4SA 4M0CA 3PPVA 4KREA 2XNHA 4RH1A 3RH0A 1KMHB 3SQDA 4F2WA 4FMBB 1D1TA 4EP1A 4ZDJA 3NHJA 1DKQA 2ZR0A 3A9TA 4NAHA 4WFIA 2GUGA 2OD2A 2EIHA 1GFWA 4M0LA 1Z35A 4FGWA 4HPXB 4DRXA 4PX9A 3WIBA 1CXZA 1JDBC 4RFSB 5DRTA 3CUEF 4BV9A 1MXFA 3KUXA 2F8LA 3NOXA 4LSZA 4DCCA 2FR8A 2BFMA 1RC0A 5AVKA 4XE5A 4YRAA 3PRJA 4EO7A 4GP6A 1Z75A 5ALVA 3W6UA 1S02A 1IUPA 1OVMA 1TZKA 4G09A 4A8JB 2VCYA 1Y8QA 3QPWA 5IUNC 1OXXK 2XUQA 3IV6A 2RGGA 2RJ3A 3K3PA 5TE9A 4KPGA 4OLHA 4JCCA 1ISSA 4EFKA 3KOMA 4PSCA 1LQUA 4U2KA 5EHIA 2CLMB 2A92A 3HL0A 3ZHBA 5AHXA 1QHHB 1U4NA 4N47A 1QWOA 1V96A 1DJPA 3PPXA 3KSRA 2ASVA 5FWYA 2AW3A 4A2PA 3T35A 2ZQYA 4NOLA 4NBRA 1LI7A 5DHSA 1ZGGA 2EWMA 3WI7A 1H2YA 2H65A 1YU6A 3Q3JB 1RDFA 3HN6A 2AR9A 2YWRA 3DQQA 1UJNA 5A5FA 5E4YA 4PZAA 3HXMA 2QW1A 1TJYA 2WZBA 2Q5CA 1ZA2A 2GPAA 3HFJA 4OYRA 3TLCA 2R8EA 2EFHB 2YV1A 2ZW9A 3ONDA 1U8XX 2HWXA 1NGSA 1T1IA 4TMWA 1JKJA 3C70A 4BLVA 4ESOA 2WT9A 5IDXA 2G1PA 1SWVA 4TRRA 2KB0A 2WAOA 1SD2A 3A4TA 3TL6A 3AH8A 1LFDB 1KA9H 1U0RA 1Z2PX 1RZ3A 2J3MA 3NPMA 3EPLA 1WB9A 4F60A 1PR9A 5IXSA 1RI3A 2IHTA 2XB9A 4GL2A 3PQ6A 4YRGA 4QIHA 4U7TB 4JI6B 2W11A 3CSSA 4P4SB 1JYFA 1JPNA 4IWYA 4OKNA 3W4IA 2AFIB 4XIYA 4J94A 5SZHB 1MJGM 3WJ1A 3FOZA 3SEQA 1CJUC 1QAQA 2VT6A 2YXPX 4MR7B 4P4GA 2CFTA 2GJKA 1XXLA 3ZDZB 4FHGA 1Q5PA 4R1QA 1C7JA 5C5CA 1KQPA 3OZEA 1EG7A 5LOVF 1HNNA 2J3QA 3IJEB 2NV6A 1E2BA 2FZGA 1OF1A 5A3JA 2C4WA 2Q3EA 2JAOA 1C0EA 1QGDA 1J1UA 3D3QA 3LBNA 4BLSA 2P78A 2RFLA 3DDSA 3F8TA 4YRIA 1H6BA 1VJCA 4S1PA 4TMKA 3CBQA 4R2HA 1VP9A 4JU9A 4LDQA 4LDPA 2ZSJA 2XDAA 5E3HA 2BMEA 3CPEA 3V1UA 2W2MA 2P8SA 2W4IA 2H29A 5JSZB 3M4YA 3NUGA 1LV8A 3QP9A 4MIOA 4OQXA 2ECFA 3INYA 4WKGA 1N1GA 1LS1A 1RYMA 3BX1A 3NJ8A 3TW8B 2GKGA 1ZCAA 1FFSA 3NH9A 5JD5A 3UK1A 2H6EA 1FEZA 2RHHA 4W8OA 1Z8FA 3OTGA 3CNHA 1KOFA 2XW6A 4HMOA 3L1JA 4N49A 3L0YA 2GVZC 1HI9A 2P4QA 4Q1FA 4DNQA 3MB8A 2A5JA 3E1SA 1XAHA 4MS1A 2C0QA 1YBHA 4GVXA 2Y05A 4N03A 4L4UA 4W1RA 4JOSA 3E5NA 2I3BA 1IAVA 1IJKA 1W0KD 1YMUA 3F47A 4P3PA 1UBTS 1SHZA 2ADMA 3OM1A 2FN3A 4UXHA 5DOZA 5ENDA 1L4LA 4LGCA 3DM9B 4KPYA 3UGKA 3M9LA 3X43A 5K01A 4O0MA 1EJ6A 1TJNA 4NCBA 3E22A 3NQ41 3K2IA 3UHOA 3LLCA 3SS9X 5JYDA 4BO9A 2E2WA 2WF7A 3AF6A 2PE5A 4PWZA 1G55A 4RCVA 3H3FA 5IC5A 4B9AA 2Z98A 3QI7A 3IA7A 4HR7A 3F98A 3OUTA 1EUQA 1MV5A 4FS8A 1P73A 2F6RA 2Y1DA 1HDRA 4MQEB 4E51A 3SCZA 2Y4OA 1M2GA 1H4QA 1UBHS 1ZK0A 2DFVA 2DQKA 1FP4A 1LB1B 1VSBA 2P9FA 3B60A 1CY7A 1E94E 1FTGA 1NJ5A 2FPGB 2WUGA 3I2FA 4H6PA 4HZGA 4Y0AA 3L06A 1EAYA 1F5NA 1OXVA 2EATA 2ZBQA 4NCIA 4YP9A 4HAXA 4EF5A 2Q4BA 4DCGA 3IDOA 4MKGA 2R6AA 5I7SA 4IO0A 3QY0A 1G4AE 3DVRX 1XDBA 5F1PA 2AEEA 4JYBA 1KR5A 2VI5A 4H1TA 1BWSA 1C9MA 3R6LA 4WK4B 1SUDA 3KTFA 3VR5H 4AS2A 1XD9A 2ET6A 4OCZA 4DV0B 5EPOA 4G1VA 4GI2A 3ZE0B 1GDDA 3ISTA 3Q87B 3P9SA 5AI6A 5D6NA 1FK8A 1QIEA 1LPSA 5AM5A 5HMMA 3VDRA 2Y1OA 3COWA 3EQZA 4O4JB 1G4HA 1X7YA 1DEXA 3A1TA 1Z4JA 2ZIVB 3AB8A 1AXEA 3ET5A 4OTZA 3STTA 1R12A 2VDOB 1E2QA 4PQGA 2H4ZA 4A92A 2F62A 3FD8A 4AD8A 1PUJA 3QFHA 1L5KA 3BMNA 3RVBA 1DIBA 1NP7A 1OSNA 2ZYIA 4GF5A 2JFGA 1Y5LA 4JBYA 2XNSA 4ALMA 3HDQA 5J58A 2VK2A 2YXNA 1O08A 4QBIA 4W5JA 2V5VA 3I5MA 2RMKA 1CB7A 3HNPA 4RKYA 3N2NA 3OA0A 4EJSA 1OILA 3F6YA 3M4NA 3K5HA 3NTRA 1O95D 2MYPA 1TYBE 2JAXA 4FHZA 2DWCA 3I8SA 1J4AA 3EX7C 3D8NA 5GV7A 1RBYA 3QWHA 4LZWA 3S44A 5B57C 1OOEA 5HSGA 5JH7B 1K75A 5KTNA 1XRQA 2VHTA 1AGNA 1KETA 3EEQA 4QSHA 5FTJA 1SG6A 2LPMA 4OI2A 5G0VA 4GLFA 4HLQB 3VR6D 3A9UA 1EE1A 1EWTA 2NPOA 1JQAA 1W88A 1KH2A 1XDGA 4DJFC 2EQAA 3X2FA 3WHLA 3MUOA 1YUBA 4Z86A 4A23A 3QBTA 3FKSA 5CM2Z 4UUPA 2YC4C 1LQ2A 1A1SA 4FYXA 4MVJH 2DY1A 2W2VA 4TWZA 4JV5B 2EGGA 4EB0A 3VPGA 3JQEA 3RFVA 1U1EA 4J91A 3L4BC 3TZQA 3PPIA 2I1LA 2HJWA 1QG2A 2AZMA 2JFBA 1JSRA 3HDHA 1XDDA 1ZLXA 2J7KA 1I0IA 3PD0A 2IV7A 2DE0X 5C52B 3HJAA 2GB4A 3Q7EA 3IXQA 3UT5B 1J7JA 1OLXB 4IMJB 2BUCA 4Y1FA 1JW9B 2PANA 1RYDA 3Q7RA 4MAFA 3DMPA 4RY8A 5CLGA 4LYAA 1LC3A 1M34A 3IOYA 4GOMD 1A7KA 1M1ZA 3UJ8A 4MK4A 4FFVA 5KREA 4YUWA 1UF9A 1Y3BE 2YCBA 4J0CA 4Z9AA 4D0SA 4CG2A 4NEQA 1L5LA 4KR7A 2ECPA 1VLJA 1WHSB 2UYQA 2A1UA 2BMJA 2JIOA 4MWCA 4OHXA 5JRZA 5AQ1A 3VC7A 4JMPA 4A0QA 1IBSA 2X3UA 2DFKB 5F35A 2R66A 4HYTA 2I78A 1N0IA 3UJ7A 4PPGA 1PYOA 5CR9A 1PZGA 1Z36A 4HEJA 4Z3KA 2FF5A 4JB0A 1U6IA 1DHTA 1J90A 3I0NA 3NU1A 2IYPA 4XDYA 3WXBA 1HLGA 4FC7A 4FN4A 4J7UA 4FOTA 1HNWB 2BZSA 3HWRA 1SD1A 2R60A 3IIKA 1R27A 3CZQA 4V2UA 2PIAA 2WM3A 5EP1A 4AP6A 7YASA 1JNXX 1CBUA 3BMOA 4B17A 2AJTA 2C88A 3U7IA 4JIMA 5DYNA 2GPTA 3R40A 4FE4A 1QIMA 5LB4A 3MJTA 1G2PA 3ZQ4A 4BCBA 3RAFC 2VYCA 3CSDA 5EJIA 3WHKA 4EZIA 3UW3A 3CLRD 4KWTA 3ESQA 1WY7A 2XQFA 3O95A 1EA5A 5IXYA 5DN6A 1XFAA 3WWCA 1U9JA 4GVLA 3N6XA 3G9XA 1NVKA 4G1UC 1UM9A 4JT2A 2HNAA 4LYHA 3VHXB 2ZIZA 2PR2A 3AVQA 4W9MC 3U61B 5EMLA 2QTCA 3C6BA 1I2AA 4KI0A 4IV0A 3A14A 3KDSE 4PZDA 4GOXA 1N92A 1Q92A 1U7WA 3MS7A 2QD4A 4L3WA 4PLTA 5EMNA 3AHHA 1PN3A 1YVEI 3ZHVA 2FUNB 3ENNA 2QRJA 4TVBA 2W6NA 4BIMA 4E13A 3DDWA 3JQFC 3N2KA 3OJEA 4HKTA 4N9WA 4R8MA 5BURA 3FZEA 3KB8A 1KZ9A 1UQUA 1ZJZA 1AY0A 4QPNA 1YFJA 1BOOA 1U7UA 4FNOA 3LVQE 1P3Y1 3NUQA 1MB3A 2YHIA 3FUTA 2R00A 1TFRA 5FPKA 1BCRB 1YZKA 3A1EA 4RMHA 1O89A 1QF6A 2Q5IA 1C14A 3PJDA 4Q18A 1W8DA 4I5EA 3CH4B 4XSHA 3ZVKA 3VNRA 1XZDA 3FVWA 3IAUA 5AI8A 4O4IA 1FUEA 5CUQA 3DBRB 3IP8A 2PBLA 4MYHA 3UPTA 3OF3A 2QX6A 1FNBA 2BRUC 2EFEB 2OUIA 2W2LD 3TZ6A 5KNDA 2QX4A 1V8ZA 4NECA 5KI6A 4D3SA 4EM6A 2B99A 2C5EA 4GPTA 2RD2A 3ESBA 4MLDA 4IQFA 3QXJA 3MRXA 1WX1A 2XE4A 1M2EA 4JBGA 2WTMA 4HDSA 3RAGA 1JXQA 2O2ZA 2Z08A 1MB2A 4PIPA 2DUUA 1YL5A 1CR0A 4JQSA 3VTKA 2C3PA 2PT9A 5CDSA 3ZHOA 3EH1A 3TAHA 4DNXA 3OEYA 1MUUA 3VBEA 1WU8A 2FW1A 1ISGA 3M81A 4NAVA 1L5YA 2BKXA 4JI7B 2O8FA 3FJOA 2HF7A 3T5DA 4MVXA 3O7MA 1MJHA 2XWQA 3MNFA 1L4MA 3D54D 1JDBB 5LIRA 1ZMBA 4LI0A 4LMRA 5FR1A 3IL2A 3KSMA 1DCTA 3HE3A 1SNYA 3WHIA 4E46A 4I1UA 3WSTA 3RFTA 3OFKA 4U0KA 5T64A 5C7LO 3TCKA 2JFZA 1E5LA 3MINA 4ACAA 1T6NA 2NTEA 1CW2B 5DBFA 2J5XA 2VJYA 2IY8A 3KVNA 1JTVA 4K46A 2IYWA 1OJLA 5CDGA 1QF7A 5GIPE 2WJAA 5AKIA 4Q3KA 2AK2A 3EZ6A 1N9ZA 1NUUA 1OFGA 3AEUA 2XCSB 1RPTA 2IXFA 3IULA 2YY7A 2E4XA 3G88A 3Q3CA 3G9TA 2OPBA 1T9HA 4KG7A 2L69A 3V1NA 2I5PO 3WMGA 3FOFC 3BD9A 3S2EA 3TKYA 1YHNA 4G8JA 4KN8A 1GSIA 3L0IB 4NMXB 4YA6A 5AOVA 4ZVPA 1T29A 5I7RA 4ZCPA 2HUNA 3NBFA 2GWRA 3FPCA 3A70A 4C4ZA 4Z4FA 3KAPA 2FSVC 2HAEA 3N2LA 3M6IA 3FWHA 3AI7A 3B70A 1G20E 3OIUA 3LBAA 4F71A 5JS2A 4DDUA 1KQ3A 3BILA 3E61A 5AVOA 3RVRA 3TZHA 1QBGA 1FFHA 2UYOA 2FPGA 4PZZA 1H85A 1SZDA 3KYJB 4JT4A 1NUPA 4RZSA 1MDFA 3U7QB 4RA9A 3JQAA 4R1UA 2NSHA 5I5GA 1SVIA 1F6WA 1IY9A 3O1JC 2IJGX 3LZCA 3PC8A 1AHPA 1KR2A 1IHXA 1QMPA 2K7ZA 3HO6A 1N57A 2CBZA 2ZUCA 3FFAA 2L17A 2QV7A 3PFHA 5D5PA 3SYKA 4R1PA 3EQ9A 3SSNA 3ZY5A 5J2TF 1KTIA 2V3CC 1R4NB 3PFBA 1S3SA 2BFFA 3MS4A 1JT9A 2H7VA 4D0NA 4G1EB 4BLTA 1UWKA 3H1BA 1ZJ6A 1MAUA 5FOQA 5IZCC 4AKGA 1AXGA 1YASA 2HM7A 2H85A 1N9GA 4P82A 4ND8A 3OOYA 2BL4A 2J0UB 4RK0A 2IU0A 1DO2A 1CYDA 1MC8A 2FCRA 1RYZA 2IELA 3EFHA 5CH3A 4F45A 3QE0A 4ZI7A 1XPUA 4MQBA 4RMGA 4S2EA 4MROA 1L7NA 2ZPUA 1GCGA 4CM3A 5KUTA 3B38A 5D7BA 3UQYS 3NRJA 1ZVMA 2JJ1D 2JNWA 4GSLA 1YK0A 2R4TA 3LRTA 4LTNA 5TPWB 3MWDA 4P2GA 5DULA 4KXMA 4KGVA 2J4DA 1GL6A 4QQ8A 1JLLB 1XK7A 1YJAA 3M83A 2ZM5A 5BUSA 3FTEA 4N3BA 5EE0A 3KEOA 4L76A 2FG5A 2RBGA 1IQRA 3L8GA 4LY6A 4PTLA 2RHCA 4BV8A 3PITA 1N7GA 1R16A 3OZVA 4QXMA 3FF1A 1SU8A 2JC3A 4ZPJA 4MI9A 2UZ1B 3PHBE 4RTSA 1TAUA 4JFAA 1EFDN 2IU6A 2RCNA 3DOFA 1L7VC 1RQRA 1IMJA 1EVLA 1ZSYA 4AYXA 4BTVA 1O57A 5KOIA 2IS2A 3PJGA 4JBIA 5JFOA 1Z9BA 3D6JA 4ISCA 5A02A 4LZJA 1ESMA 2BEVA 3K30A 4Y2JA 3LX5A 3OPVA 3BIJA 4J16A 4R68A 3DEHA 2WKSA 1QVRA 4K05A 4DR5B 3SVLA 2RHMA 3KSAC 1M5RA 2X0NA 1BXKA 2YXEA 3VXKA 4EY6A 2VZ9A 2HU8A 4QX6A 2B98A 3H4TA 3SC6A 5JDCC 1SU7A 4J0JA 2P9TA 4X3PA 3CZCA 3U1VA 5LMNB 1EIZA 1FP6A 2JARA 3GIWA 1K86A 2MCFA 4AMBA 4BATA 2I1WA 1TRKA 3U62A 2BC9A 4OQZA 3OCCA 3SR0A 2DBYA 3I73A 2FG6C 3EFEA 4GZ6A 4O5OA 3T95A 4D9BA 1QP4A 2YASA 4LYYA 2Q5EA 1QVZA 4LYFA 3R74A 4BVBA 1E9BA 4KITB 2WA1A 1NYTA 1WBJB 2RGNC 1VGQA 2H4XA 1WXDA 2HADA 2KX7A 1U65A 4GUDA 5D5HA 4US2R 5J4HA 5LDHA 1NVAA 5C51B 1F7UA 13PKA 1OWNA 2Z6QA 5EYPA 4WFKA 4EF4A 4ENRA 5I9MA 4I7EA 1TQ6A 4CTKA 5JAZA 3GCZA 4LHWA 3S8EA 4IRUB 3HCNA 1P4SA 3HACA 1QTNA 1QHEA 2ZQZA 4LC9A 4LZZA 4UU0A 1SIWA 1WMEA 3H05A 2P90A 1FRQA 2EC5A 2X23A 1GAQA 3EXHA 3UKOA 1ZGHA 2O2EA 3EQ2A 2VKQA 4G1MB 3C1UA 2R6FA 2MOKA 3LDFA 3OTWA 4TL6A 1TL7C 3P9IA 4V0SA 3IOMA 2QG4A 1ETUA 4Z4HA 4R1SA 1JAZA 1WRBA 1NVTA 2I54A 1YZGA 3DAOA 2RG1A 2PZJA 4PF1A 4RKWA 5FA5A 1RI5A 4UEOA 3PXXA 5JYEA 5JTUA 3ZTWA 1IIRA 4KGXA 1AS3A 4ENVA 5KYUB 1JFFA 3EBLA 5BR7A 1NQXA 3BJIC 2VPIA 3I6MA 2QN1A 3THRA 2FEXA 5FPTA 3UEOA 5K8VA 1NVXQ 4GQAA 3DUFA 1N1DA 1V26A 3FNHA 4IY1A 4JU8A 1GT91 4YX9A 4LGYA 2CLEB 2ONCA 4BFCA 3T99A 3DE5X 1UEIA 1PQWA 3AZOA 1SUIA 4MPJA 5K2MA 1JIUA 1DZ3A 2X5XA 2CNLA 1EWKA 2WJYA 4LZOA 4U5XA 1DIAA 1EE2A 3UMMA 3DNFA 2FNAA 1SU4A 2UDPA 3DZHA 3UMBA 1B2LA 1W85A 1PX2A 1J21A 3TINA 1L7AA 4OBBA 4OSPA 1BMDA 1EK5A 1R0ZA 1KDTA 4ZGWA 2XUFA 4YI3A 4C0HA 2RI1A 2AEJA 4GWKA 4BXOA 1JXOA 2ZI9A 1G6KA 2OOSA 4W1SA 4F38A 4S24A 3RTGA 2Z95A 4QDUA 5E6RB 1V1RA 5C32A 3GLGB 3KT6A 5H4GA 5LZ5A 2XMRA 5JOQA 1NOJA 4QQRA 5KYWB 3OOWA 2Y0PA 1I1NA 2QQFA 2YV5A 3W1VA 1X13A 2JI9A 1FDOA 4YJHB 4UTVA 3D5QA 3ZC3A 1ZBDA 4RABA 1NUTA 1N2CB 2HDHA 5E1DA 1EP1B 3RRFA 4B5LA 2RKWA 5F2OA 1BHSA 1K2VN 1LV7A 1Y5RA 9LDTA 4FONA 3ER6A 5CB0A 4A6PA 3L18A 4INPA 5LUBA 1SHKA 4P54A 3A9SA 4JD5A 4BB6A 4B84A 5A0TA 1QBKC 5AW2A 1RAGA 4I9FA 3PFGA 5HF8A 3ICEA 4DA4A 4RTOA 3AL3A 1UPAA 3L7AA 3IBTA 3V00A 3NEJA 2J59A 1HDEA 2A33A 4H77A 3HB0A 4PZ0A 4XTCS 3PNLA 4XX0B 1NN0A 3N8NA 1XMVA 1EBUA 3MT9A 2Z56A 5AVVA 1WL8A 3QNMA 2ZRHA 2ZXFA 3RSQA 4BNNA 5G0SA 4LF5B 4ALLA 2CE2X 1THZA 3VR2D 2F7SA 4MP6A 2OZPA 5FBHA 1V11A 2GH1A 3JWIA 1J39A 1OA1A 1YSCA 2YDXA 4CM5A 2QNBA 5HZMA 4P6VF 2QENA 4ZAZA 1MZPA 3IUYA 5DNCA 1UINA 2VYVA 5D86A 4QXRA 2HK9A 2A5LA 3X1KA 4IIJF 1U3WA 1TO1E 1E64A 2JAPA 3WDLA 1R1DA 4D4GA 2FN7A 2JF0A 5THXA 5IF9A 1GV1A 5HS4A 4QEDA 3G0DA 3QF4B 1FDWA 5B64A 2W8BB 2CNKA 1GTMA 2N75A 3M0EA 2VR1A 3Q7QA 4HDQB 4KR9A 1RBQA 3ZGXA 1CUUA 1E2KA 4HEA6 4F96A 1I14A 2HW8A 1OFHA 1P0QA 2VDKB 3BTVA 1C7RA 4EB6B 3UPUA 1XVVA 1Y5MA 1E69A 1E6WA 1Z22A 3OQHA 1VJRA 1ZJJA 2RGWA 4KQWA 1T34A 3AR6A 1V5FA 2C2BA 2FPIB 2GK3A 5DLPA 4NENB 6GPBA 4MQMA 5JASA 1ZOIA 1BN7A 1KRXA 1FXSA 3EIOA 3AV3A 2JFFA 2ZBFA 1XR3A 3RHFA 2G04A 1UBRS 2EG9A 4NPAA 1O96B 3D43A 5EE9A 2B9VA 4M54A 4R7TA 3CLUD 1Z07A 1U3DA 1Z5GA 3RKUA 3VRHA 1XTKA 3FCAA 4ND1A 3U6BA 1J0BA 3PC2A 4FKBA 1BMFA 1TX4B 5JJIA 1EVEA 2COEA 2IGTA 4Q3CA 4QUIA 1DT3A 1T0PA 4RY9A 4C03A 5EQTA 5CLLA 3BYZA 2JA1A 3WO0A 4DKJA 2BYTA 4GZLA 3F6SA 3I39X 3SVTA 1Y1QA 1E3LA 3ENWA 2PMWB 3T9CA 4XM2A 4NBVA 5EG5A 2O1WA 4TN1A 3R7SA 2O8BB 1UBCA 2WPDD 4YC7A 3VZBA 5AKYA 2CJXA 2DWOA 3BHNA 2Z1MA 4UCXA 5L6LB 2CUZA 3MCTA 4I3GA 4RVHA 4MVJE 3EZ7A 4D8XA 1NWHA 4JR0A 3KAKA 4ROTA 5T4HA 2WHXA 3PGA1 4HGYA 3ZDCA 4ETNA 1U94A 4P1ZA 1DI0A 2PUVA 3RQSA 3R8FA 3NDPA 1ZHHA 1AQYA 4N6NA 2GLXA 4PTZA 1F2UB 1JQ3A 1E2LA 2PV0A 1F14A 2QLMA 2OENG 1NMSA 1SM4A 3GFSA 1DV2A 1R6XA 2AKYA 1ZOLA 2NPIA 3NRCA 4HEHA 3U3MA 3U49A 4DCTA 1N34B 4A73A 3LUPA 2GJAA 1T91A 4DREA 1JLLA 1T8SA 4U2EA 4AG3A 3MN1A 4PRZA 1VB5A 3HU5A 1NF8A 4DKXA 1GM5A 1QB7A 2ZGVA 1PS0A 2ZTUA 4NXMB 2W98A 4WN3A 5J5AA 2VXYA 5KSPA 1VA5A 1YT5A 4EUNA 1RFGE 4OMCA 4UVIA 3TM5A 1II9A 2A3NA 4OKIA 1MVLA 1SRQA 5JPIA 4H7FA 2PEYA 2IKSA 1U2DA 3AU8A 5F3RA 2IX9A 4ZHQA 1GA6A 1HFJA 1WXXA 2ZIXA 4N40A 5GJWC 1BA2A 1G16A 2PZGA 1KEEB 1PGPA 4KWEA 3R7LA 4MZDA 2VWHA 4LJ6A 4A4DA 3DLHA 3IXMA 1AK9A 3B1KA 3P97A 1ANKA 3CW9A 2Q1XA 3A25A 3EPHA 4JVNA 1IHOA 1R37A 3AR5A 4N0PA 5CEFA 2NQ2C 4JA0A 4Y6PA 2MU1A 4RPJA 4RVCA 1C8KA 2Y1LA 3CH6A 2CB9A 2L82A 5H59A 5EWJA 3RS0A 1OU4A 3NJRA 1EFLA 4NDAA 3SYMA 1MD9A 1MIOB 1Y42X 4EQZA 3VHQA 4EG0A 5JYCA 3ZLJA 3OE7D 1A9YA 1FRZA 1RVDA 2BP7B 2ZIAA 5H16A 3UANA 1H1LA 3AUFA 4JS0A 2RBEA 1LA2A 4YCLA 2OR3A 1V2GA 1OKKD 4EENA 1HFWA 5FHQA 3AJ9A 1WPXA 3EUEA 1OU0A 4BNHA 2D1FA 1UEJA 1XK6A 5LMCA 1EXDA 4GKKB 1IUKA 5FQNA 2XSZA 4JUDX 1KHHA 5KCZA 3QJYA 4MARA 4QOEA 4AO8A 1NL3A 1WUTA 2IHKA 4I8XA 4IXDA 2F67A 4WCFA 1P7WA 3DYBA 3CN7A 3KJFA 1TQHA 4WMLA 3RS2A 4LDJA 4KE9A 4U2GA 4XPZA 3UCXA 3M34A 2MR5A 5HGJA 3B7PA 3AY7A 4IDHA 1H6DA 1CETA 2ZPAA 4HXGA 4RJKA 5EP3A 2GJ9A 3W9UA 2EXXA 3FDIA 3SK0A 3TKAA 1SG0A 3E23A 3C4VA 4YJ3A 5SY6A 3DHYA 4F2PA 1NSFA 1A97A 1Q3HA 1X94A 2CN1A 1UJ6A 1VPEA 1P9NA 2H8KA 2IEYA 3BFVA 2B7BA 3OBBA 2H7CA 3FTPA 3PLRA 4JELA 1QQ7A 4DV5B 2PAAA 1D5WA 1COWA 2F1OA 4LA4A 4KXYA 2PKRA 3HR8A 4MUNA 5IBQA 4B7XA 5BW5A 1CZKA 2R2AA 3UJPA 1J0AA 1XRLA 4BN4A 1KK1A 2SNIE 2GJSA 2YR0A 3MOSA 2DT8A 2Q62A 4QNMA 3BGDA 3JWEA 4E5NA 1AGRA 3OSZA 3W7VA 3MC1A 3WDSA 5LZ9A 2XCOA 3ILHA 1LRKA 2PZEA 4S12A 4PYLA 4UNIA 2HPVA 4HV4A 5H5JA 5BR4A 1DBIA 3BMCA 4TV8A 2R8ZA 3DAFA 1PO7A 3P9CA 2ZUFA 2ORYA 2YRWA 2WAYA 3AVXA 3Q8XB 1LPPA 3LY5A 1MG5A 1MU0A 3ESZA 4QDXA 1F17A 5B3JC 3THXB 4QYSA 4OUDB 2VTKA 3AY6A 1QC5B 1XZ8A 3E4CA 4WXEA 1EM8B 1ZHOA 2GBLC 2FA9A 4PGMA 1C29B 2VDLB 5TNXA 2DH6A 3O4JA 1A4RA 3LQQA 2F4NA 1GRVA 1GU1A 4R2XA 4B3DA 1DCMA 1H3FA 1B76A 1SH7A 5FV7A 1U7PA 1CX9B 3I53A 2IH4A 1TVKB 2J5KA 2GQ0A 1U0HC 3DCNA 3G2JA 3RYIB 4MUEA 4BAGA 3WFJA 4R51A 4AJEA 3I61A 1CY6A 1B16A 2ZBEA 2ZBDA 3ZWYA 2PUFA 5F5NA 1C1HA 3DAHA 4F3KA 4UEKA 3W2IA 2B4TO 5J63A 4BECA 3WBFA 3NGLA 3SHFA 4KBFA 2NNLD 4HQFA 3RVMA 4FCCA 5IW8A 3T1YB 2ANBA 3RPEA 1CUCA 2GCNA 1ZR2A 1D0VA 1VE9A 5JFGA 4CMJA 5TSDA 1WZIA 3H2HA 3PNBA 1UDBA 3VHLB 3W9SA 2Y9PB 2YZNA 3HGMA 4C7XA 5A1JA 5FI1B 1AKYA 1L6IA 1UBJS 2I4IA 1E1DA 4LQDA 4Y6GB 5K0LA 5JSUA 2FSHA 2JFVA 3BB3A 4KXFB 4YJFB 3OZWA 1UKBA 2RH8A 2YW9A 3CZ5A 4U0JA 3TQOA 3YASA 4KXUA 3DFUA 4NONA 1NYRA 1RRPA 3F6RA 10MHA 3OU6A 1I10A 4QU9A 3E6AA 5C4GB 4JJGA 1V1MA 3OEHD 3WLRA 4ARAA 5D00A 5LWQA 3FMGA 1Q7BA 1RWNA 3TOXA 3R5KA 5GIOE 2E4WA 4U63A 3TTUA 4KMMA 2EFJA 4KFUA 1L3IA 4QZVA 2Z58A 1DFGA 1TB4A 1I6LA 3TNYA 3SFVA 4MYDA 4YRTA 5FLEX 3OTOB 3A2MA 3AEQB 4EVSA 2C42A 5AM1A 3AKDA 1U7ZA 2EZUA 3MCAA 4FQ5A 3J81A 5E1BA 1S8AA 5DHRA 1E9AA 4D92A 1X7ZA 4HB4A 4FT2A 1DBRA 3EEOA 2LIVA 4WESB 4H6XA 2A0FA 1ZH6A 2HLPA 5AJUA 1NN5A 3ZJYA 1DARA 3RSZA 1C0IA 2XWBF 2XCQA 1SHLA 2ZJOA 1ZXLA 3MTGA 2P35A 4L6AA 2OD7A 1YDFA 1CB0A 4TZTA 1BNCA 2C07A 4PIMA 5L3QA 4H9GA 4DMKA 3V5NA 3OBIA 1D4FA 2YRFA 3VU0A 4R3NA 2JHCA 5EI5A 4WASA 1USUA 1D1QA 3NDRA 5DM2A 2NZXA 2BFPA 1AN9A 1JE0A 4IOKA 3ONEA 2HHJA 4E5KA 5IEBA 2Q29A 3AQIA 3S8YA 5AUNB 2WMYA 3OEED 2W58A 4CMEA 3ZXXA 2YX1A 3TBHA 1FF9A 3RBZA 1K7FB 4UREA 4G0XA 2VWQA 3ZD8A 5FAKA 3QEOA 4G5GA 4JZYA 1FYXA 2C5SA 1UMCB 2HB6A 3DFIA 3TMYA 4MRSA 4CLRB 1P5RA 1UOPA 3L8FA 5HCIA 1OREA 5LA6A 2UXBB 2D0DA 3L5OA 1F2VA 1SPBS 5EQFA 3WNCA 4TXMA 4UUQA 1X1SA 1B8VA 3HLYA 3H75A 3AU9A 3Q3HA 5F21A 2ID9A 2C4VA 3ZCVA 3HABA 1PWHA 4JR2A 3TLGA 3A32A 1Z0JA 4PHGA 3GQBB 2GAAA 5F52A 2PTGA 4HP8A 3MJCA 3SC2A 4CMIA 5CT8A 2FGKA 6CHYA 1V2HE 4LTMA 5IAKA 4X6XA 4WZAA 4PFJA 4D43A 4V03A 5D3ZA 4GI7A 5IVPA 4B34A 3JW8A 3HKEB 4EDHA 5KOJA 2E4YA 4ZAXA 2QM0A 5ALXA 5EKSA 3K6RA 4Q7QA 4L8WB 1HT3A 1P9OA 2MYTA 1B42A 1RW4A 1E1QA 5EJ4A 1SCJA 3BK7A 2VP3A 1S6YA 5BQ5A 3SBXA 3GNLA 2W93A