2A1UB

Crystal structure of the human etf e165betaa mutant
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
252
structure length
252
Chain Sequence
LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVERAIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTEDLVAKLKEIGRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Electron transfer flavoprotein alpha-subunit, mitochondrial
publication title Stabilization of Non-productive Conformations Underpins Rapid Electron Transfer to Electron-transferring Flavoprotein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 75
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2005-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2a1uB00
1U7DA 5EKDA 3SZ3A 2HMAA 1PG0A 1LW7A 1XNJA 1U3DA 4HJRA 1IHOA 2PZ8A 1KQOA 1ZH0A 1O0CA 4OJMX 1NUTA 5KWVA 2IELA 1BS2A 1TYBE 1ZH6A 4MUJA 3H9CA 5IHXA 1F7VA 3ISJA 1K4MA 4ZCPA 1QU3A 4E1AA 3ZXIA 2A1TS 4ARIA 3JXEA 3GMIA 3N8HA 1KAQA 2QTMA 3IMEA 5J59A 1JIJA 3N05A 1R6UA 5JBNA 1JEDA 1K92A 1M8JA 3MMXA 1ZJWA 1IQRA 3ZJUA 3K9WA 4CDNA 1H3FA 4DJAA 3HGMA 1WY5A 1IQ0A 3FDXA 3Q10A 3A04A 3ZXSA 3AKZA 4YBRA 1COZA 4MW4A 2EL7A 4JXZA 2H2AA 3IUBA 3H9BA 4KPUA 2CV1A 4L2IB 5H7XA 4UZFA 2AZXA 3TQIA 4MWCA 4Q16A 3UC5A 2XRZA 4I6EA 1N2OA 4OUDB 2O5RA 4P2BA 4QRDA 5LM3A 1YULA 1NSYA 4KR9A 4G5YA 3RHSA 1XNGA 2DUMA 1EXDA 1VBKA 2PFSA 1Q19A 4ZCTA 4ZT3A 1KR2A 3COVA 4EG8A 2V0GA 1MC1A 2D5BA 5BNZA 4GU5A 3RK0A 2QUIA 3PNVA 1NURA 3GUZA 4DLPA 3CLUC 2JAXA 1MBZA 1QRTA 5F23A 4NZPA 1UFVA 1IFXA 1YIDA 3D6VA 1O96B 3L93A 1LI5A 1KAMA 2HGZA 2J07A 1MAUA 4MW9A 1T6ZA 4MVYA 1OBCA 1OBHA 1EFVB 4DE5A 3FY4A 5FO0A 2A7XA 2QUKA 3COZA 4MW0A 1NP7A 3CVXA 4XFDA 1OWMA 4MWEA 1N77A 3ND7A 2QJTA 3IH5A 2JA2A 5FO1A 3PXUA 2E18A 3RBAA 3FIUA 1JILA 3SEQA 3KFLA 4DDMA 2DEUA 2DPLA 3IVGA 2VXOA 4KKVA 1N3LA 3IMGA 1MB2A 2BTEA 3IOCA 1MOPA 1O0BA 1XNHA 4PBRA 4EG3A 4MW1A 3OTWA 3A4IA 3UOWA 1MRZA 4FZJA 4RPIA 1O95D 4KR7A 3U1VA 1I6LA 2C5SA 3LE8A 3Q4GA 3UK2A 4CDMA 1JZSA 1EE1A 3TS1A 2AG6A 2WB2A 4NAUA 1RQGA 5FNZA 1ILEA 5KCMA 3OP1A 1H3NA 3N2YA 1N78A 2PIDA 4R2MA 1YUNA 1Q77A 2E89A 4ZT6A 3RJZA 1I6KA 1Q15A 2QJOA 1QU2A 1VL2A 1OWNA 4AS1A 3C8ZA 5TEWA 2NSYA 3SEZA 1TYAE 2PXHA 4CQNA 2J08A 3L92A 2DETA 3ND6A 1TYCA 3G59A 1CT9A 4MW7A 1TEZA 3ND5A 1M8KA 1QRUA 1PFWA 1WXIA 2CV2A 4F4HA 4MUFA 1JIKA 2ZUEA 1JIIA 2H29A 4PY2A 3HZRA 1ZUNA 2YWBA 1QRSA 4U7JA 5H16A 4MUNA 2CYCA 2Z09A 3D6UA 4K0RA 1YUMA 1O6BA 2CUZA 2QUJA 3P52A 1S4MA 1EUQA 1PFYA 3P0JA 4YP5A 2EJCA 4G6ZA 2X3FA 2X0KA 3I05A 3CLSC 4U63A 1IQUA 4MULA 1NI5A 4YP6A 4PBSA 1J21A 2B7LA 1M8PA 4NATA 1OD6A 4ND6A 1Q11A 3AIIA 1JEEA 2I1LA 2DR2A 2A1UA 2PZBA 2CYAA 4MW6A 3HFJA 2CV0A 2RD2A 4DDHA 2E0IA 1O5TA 4UZEA 3BL5A 4R0NA 5HG0A 1N75A 1PG2A 3DPIA 4EFKA 1GTRA 4PBTA 3DLAA 1QNFA 1O95C 3CLRD 4DDKA 2A88A 2QJFA 1M8GA 5KHAA 4EG6A 5K0TA 3CA8A 3G5AA 2J09A 2OQ2A 4AQ7A 3IMCA 3SYTA 1T6YA 1JHDA 1KH1A 3A05A 1T9GS 4MAFA 4ZT5A 4XSVA 1H1TA 1WXFA 1O96A 1NUUA 1O94C 2ZUFA 2CT8A 1GTSA 3KT8A 4CT0A 3NV7A 1WKBA 3TNJA 2A84A 2WQ6A 2DXIA 4ZT4A 2GKSA 1V47A 3VU8A 3MXTA 1FFYA 1JMVA 3NBAA 1PFUA 4MW5A 3CVUA 1R6XA 1M8FA 3KT0A 3MLAA 4KPUB 4QREA 1N2GA 3IOBA 3CVVA 1IVSA 1O97D 1N2HA 1QJCA 1YIAA 4MVCA 2IJGX 4JYZA 4R2LA 3X1MA 3X1JA 1PFVA 2CSXA 4ZT2A 5J5AA 2IP1A 1NUQA 3PNBA 1A8HA 3TQOA 1M1ZA 3IVCA 4GRIA 1ULHA 1KQNA 1F9AA 1KQPA 3RFFA 1I2DA 1J1UA 3IOEA 3CR8A 4BWVA 4MVXA 3KT6A 3F3MA 3CLSD 1U3CA 1VBNA 1M83A 3FOCA 5HUHA 4ND7A 3HV0A 5DEOA 4EG5A 2VTBA 1EFPA 2O8VA 2G36A 5DASA 3ZJVA 3HMQA 1N2EA 3FNRA 4HJXA 1IRXA 2PG3A 3HL4A 1WZ2A 3X1KA 3IDFA 3CLRC 1KORA 3FI0A 1WXHA 2CYBA 4MWDA 5DK4A 1F7UA 3AL0C 1JECA 1JGTA 1K4KA 4MQ6A 1O94D 3H97A 1HYBA 1NUPA 1QQTA 3FWKA 3Q12A 2E21A 2DERA 3TZLA 4JXXA 4I6GA 4HK4A 4MLPA 1TYDE 3FHJA 3AG5A 3ZGZA 3SZGA 3TZEA 3DO8A 1J20A 1G59A 2OV4A 4WNYA 3FG9A 3VRHA 1O97C 1K97A 3PNYA 4HPWA 2DLCX 3PRHA 5TEVA 1JZQA 3MLBA 3ZUGA 1T6XA 1N2JA 1KH3A 2YY5A 4X0EA 4EG7A 4ARCA 3CVWA 1QTQA 1WOYA 4NX2A 4MWBA 4KR6A 1EJ2A 4XFJA 5DB4A 4MW2A 5J58A 3NBKA 3FETA 1H3EA 4L2IA 1WQ3A 2A4MA 3LOQA 3MUEA 1TFUA 4JFAA 3RK1A 1G8FA 3COYA 4OUDA 2CFOA 3A2KA 3CLTC 3S3TA 1MB9A 3IVXA 2D54A 2V0CA 4S1OA 2PZAA 5K0SA 3ELBA 2RE8A 3AG6A 4EF6A 5HUJA 4NAHA 1OWLA 1KKUA 4MUGA 2X1LA 1OWPA 3VGJA 3N9IA 2BYTA 1U7XA 3QE4A 1WQ4A 2Z3VA 3KT3A 4U8HA 4DNXA 1GAXA 3INNA 1D2RA 3GLVA 1XJQA 1I6MA 1GN8A 5LFAA 1TQ8A 3IUEA 4EGAA 1MAWA 4Q93A 1EFVA 1GZUA 3M5WA 1GPMA 2A1UB 1N2BA 3P0IA 4EG1A 1R6TA 1Y42X 2HZ7A 1N2IA 3K32A 2R5WA 2J5BA 2A86A 2ZP1A 2AKEA 4J76A 3ZJTA 2GOYA 4MUIA 4ZCQA 3SP1A 4JZYA 1IH8A 2D13A 3UY4A 1NZJA 4ZCSA 3ZIUA 3LCJA 1OWOA 3CVYA 1WXGA 2NZ2A 3FH0A 3AFHA 1N1DA 2YXNA 4H3SA 4J75A 1KH2A 2TS1A 2GM3A 1X8XA 4MVWA 1WXEA 2Z08A 4MUEA 2WQ7A 2A1TR 3CLTD 3DV2A 2JANA 5TS2A 3QTBA 5TGTA 1F4LA 4RUKA 1G8HA 2J4DA 3IODA 1EUYA 1P7PA 1NYLA 5IJXA 1FYDA 4ZT7A 1KP2A 4QBTA 1WJGA 3H99A 1X6VA 4K03A 5AHWA 1U0BB 1J09A 4A91A 3G6KA 3UMVA 2QTNA 2QTRA 5LLTA 1V8FA 3COWA 4MUKA 4F3RA 1J70A 1B6TA 2QUHA 1SURA 4EG4A 4NDAA 1MJHA 4YP7A 1J1ZA 1YI8A 2VTBB 4TS1A 1DNPA 4WSOA 4I6JA 3P0HA 1EFPB 3E27A 1LI7A 1G8GA 2YWCA 1KP3A 1VLHA 4ZCRA 3QTTA 4G5FA 2XRYA 3SDBA 1VBMA 2WSIA 1T9GR 3ILVA 2X1MA 1NUSA 1GLNA 3H05A 4YMIA 4MUHA 3CLUD
chains in the Genus database with same CATH superfamily
4ZRMA 1F0PA 4OY3A 2BM0A 4RGVA 3EVNA 5KYXB 1R18A 4F5DA 1JQDA 1RW4A 3OHPA 2PD4A 3OAAD 5EYPB 1AN0A 3UANA 5AUOB 3IP5A 2P77A 5K3EA 4MYCA 2HFKA 4E5MA 5BNIA 2XQFA 4JEMA 1VB3A 3UGTA 2V7GA 2YQ4A 4D9BA 1X7YB 2VPIA 4JI2B 1NUTA 4BYGA 2G4LA 1HYGA 4GBGA 2ANBA 4M2LA 3U09A 1K4MA 3BMCB 5B3JA 3GLTA 2PJUA 4NP6A 3I5AA 4J0DA 1O94A 4YN3A 1D0VA 4LWOA 2QZZA 3BQNB 2WYWA 3MAJA 3Q3CA 4FFVA 5WRFA 2IXGA 3SFZA 1ZQ1A 4LHYA 3WNZA 1M6YA 3NP9A 2FRDA 5KU7A 2QLMA 1GTMA 2GARA 4TXJA 4EO7A 2HLNA 2IHUA 3IP6A 1NVVR 3TZCA 2H5EA 1ATIA 1PJLA 5BSVA 1DDGA 1IZZA 1OLXB 1UBGA 4E4TA 4O3FA 1Z47A 3OZFA 1D2AA 2CHQA 1DKUA 1C3OA 2IDJA 2PT9A 2VJBA 2YV2A 3E1SA 4FMCF 2OXCA 4RQBA 5BO5A 4EGCB 4PG6A 3D6JA 4G37A 3OMXA 5JATA 3C39A 4GR4A 4R9VA 1XG5A 4MP3A 5CEJA 4WK6A 5AVXA 5F5NA 1A5TA 2AEMA 3AUXA 1WCIA 4OUKX 4PHHA 2ZSKA 1NF3A 1YI1A 4N7MA 4QVKA 3EF3A 1JJAA 1QVZA 2WIJA 1Y5LA 4G5YA 4L3WA 4HDCA 2NZUG 1DG1G 1T0JB 1T5IA 2VEDA 3DWFA 3ZV4A 1I4EB 4YT4A 2D5BA 2VDPB 1LLDA 1YJ8A 3EOZA 4H3VA 5DPMA 5LA6F 3AEYA 2AQKA 9LDTA 1BDIA 4IXTA 4BECA 2G28A 3MTDA 4ERXA 2P5TB 3BRWD 3HKDA 4IJ6A 1U0SY 2EFYA 1CZKA 2HM7A 2QNRA 5FF9A 1NX6A 3RW9A 4DLPA 3X2EA 3FOZA 2NW6A 1VHJA 4O4LF 2ZB3A 4OX9B 3LYHA 3T5TA 1K8XB 1M1YA 1J8VA 2Z30A 3L0ZA 4YUVA 3BPSA 4IIYA 1YIDA 1JHPA 1J2YA 4C2UA 4IDDA 3F3YA 1CFZA 3GQBB 3CISA 1B6GA 2YQ5A 1UXIA 3AR3A 2RGYA 3A9SA 4H6PA 3IQZA 4OIMA 3KJEA 3T3HA 3ZU4A 2COEA 1A2KC 1XR3A 2GZSA 1FDUA 5IFLA 4PYIA 3GGSA 4Q1VA 4URZR 1ARZA 1W2GA 2HEIA 3L7BA 3GV0A 4FHDA 2PUVA 3TQTA 2OV2A 4O4JB 5TXGA 2W2KB 4UVEA 1UF9A 5HA5A 1M7GA 4POOA 1EZZA 1BHSA 2WJVA 3IH5A 5DMHA 5FOWA 5JQGA 2XDWA 5KDLA 1N6HA 3C3YA 2R8OA 2G9VA 4BLUA 4D1YA 2P11A 3SEQA 3GY0A 3WDSA 4HLNA 1E62A 5TQ2B 5K8CA 4YFVA 5CB4F 4XQCA 4CVNA 3CLHA 3W6OA 3IPLA 4KKVA 4F3NA 3MJ4A 4YUAA 4LF4B 1F2TA 1F4PA 2XWQA 2ZJ7A 4O5OA 2NVWA 4X71A 3QEKA 3RFVA 1QLWA 1RADA 1YCGA 1R8XA 2ZW9A 3BGWA 4RA6B 5C4IA 4I2VA 1AXRA 2I8AA 1BIFA 3ZDCA 3AVOA 1MG0A 2AOVA 3F7OA 3QYAA 4MW1A 3QUQA 4UBJA 1XLUA 1LW6E 5EOVA 4I3FA 4RPIA 3LKDA 3REOA 1YOBA 5L8VA 1H2YA 5HBGA 1A95A 3DFUA 3U1VA 2HPVA 2GBPA 2Q1SA 2RFLA 2ZROA 1NQAO 4BO1A 3ZXYA 3UH1A 1P9WA 3P2YA 2PL5A 3KPJA 3MJDA 1CE8B 1SOUA 4F5ZA 5TV2A 3QENA 4FI3F 2ORED 3G2PA 3E8SA 1AO0A 4J7AA 4EKNB 1JFSA 4QUBA 5EIOA 4Y3UA 2OVBA 3JD4A 1ZJ6A 1I0LA 3PC2A 4INPA 1RPZA 3JARB 2UYCA 1C1DA 3OJWA 5I6DA 1VL2A 2NSYA 2GZDA 2FZVA 3I2JA 2EKLA 3K9QO 3L92A 4U2CA 5EIWA 2EW2A 2GTHA 4G97A 3BMCA 2WYUA 4G8BA 3CCFA 1MKYA 1JALA 3QVUA 2C1XA 4ARZB 5K4GA 1Z7GA 2CB0A 1W19A 4IQ8A 1ADBA 1JX6A 1JTVA 3LQFA 5JC8A 4K7JA 4INAA 3F8WA 1U8AA 4MUNA 2Y67A 3HKBA 1EXNA 4DLLA 4D46A 4K0RA 2QUJA 1RQNA 2VQ6A 2ISCA 3IJRA 2VOJA 3T0IA 4G67A 3AF2A 1SXJA 4X93A 4PHGA 1EFAA 2G67A 1Q92A 2IKQA 3TCNA 1K3FA 4G1BA 1IY2A 1CUVA 3S28A 3L49A 3Q1LA 2FDCA 3JWPA 1AKVA 2ZTMA 4AO8A 2FG6C 2R1TA 3GRFA 5DM70 4YJ2A 3CU5A 1QE3A 3NRCA 1D2MA 4RZSA 3TGWA 4R2XA 1OT3A 2QSJA 2Y1XA 3F8SA 4UHCA 1GG2A 1MJGA 1GUYA 2WSLA 2BKEA 4KGZA 3U3DA 4KQFA 3ZW7A 4U6SA 1K6MA 2VHVA 3LK7A 4EUNA 3TUZC 1US8A 3T9EA 2EKZA 5IUNC 4DF3A 2A78A 2H9AA 1V5WA 4U2BA 1H9CA 1NR1A 4G41A 3F71A 3PEFA 1DIGA 3LXUX 1Z25A 3KAQA 3UW1A 1J2JA 4IYRA 1FSZA 4R0VA 4EY5A 5I7EA 1Y3HA 1Y4UA 1X86B 4HEQA 3PF9A 4TKMA 1B1AA 4BVEA 3TTYA 5KMGB 4RVNA 4EF5A 4EMTA 4OOEA 4OQEA 3OY2A 3V7NA 4J3JA 1VFNA 4TMWA 5B6PA 2J46A 1YU6A 1KHHA 1NJFA 4U8GA 1TCVA 2LKDA 4YV2A 1E1LA 1QGDA 4TTJA 5JAPA 4DSOA 4QHSA 5HKBA 1F06A 2A84A 4O29A 4WFJA 3HJBA 1CZUA 1I80A 1LFAA 1SJ9A 2EBFX 3STHA 4XD2A 2IH5A 5FUWA 3QLUC 4P08A 1N1EA 1SVKA 5DDIP 4O4JA 4F6RB 2HK9A 2WWHA 4RIIA 3F6YA 3TVTA 1UZUA 1VI2A 1Y6RA 3H65A 4R2LA 3X1JA 1NATA 1IY9A 4A0HA 3LUBA 3IEKA 4HNRA 3HR7A 4L75A 4PYQA 1JKXA 1F2DA 3EHDA 3HNOA 4OQ4A 3RC1A 2JD1A 3D02A 1OYVA 2GEBA 3N2KB 3STUA 5L7YA 2H18A 2AK3A 1SXHA 3CFYA 4HC4A 4C14A 1IK6A 4JIGA 1UPXA 2VEOA 2HCBA 1PSWA 4BVGA 2BIFA 1W581 2Z2JA 2COKA 4FYXA 1E63A 1U3CA 5KJFA 3ETCA 3R0ZA 4MEJA 5BNFA 3AF0A 3GZJA 4IDEA 4HWKA 3ZX4A 3ZW8A 1OX6A 5FX2A 1PUJA 2J3DA 4JLDA 3VR3A 4B6PA 4TZ0A 4RORA 3CWQA 5HKAA 4CKBA 1U94A 4EG5A 1YC2A 1PEYA 1WHTB 3ESZA 1UWLA 5JXHA 1YDWA 3KETA 4ZVNA 4L3OA 4LN1A 5IMBA 4IKOA 4OF4A 3WS7A 3NWEA 2YYAA 1N0HA 1WP4A 1KETA 1QGZA 4MGHA 1GSAA 2ZQ5A 3OOWA 3I32A 2C9DA 3EE6A 3OCVA 3VZBA 3EEOA 1EP9A 3V8VA 2RHJA 4MB6A 3NGLA 2AWNA 3GF4A 5C2JB 4FFBA 2I71A 4R7ZA 2O1WA 5LB2A 1SAYA 1R8SA 3DDUA 3IQGX 3SBXA 3FI0A 1H05A 2B1RA 1L5KA 3TQHA 4XVUA 1JA9A 3WBKA 3LVBA 5AKHA 5LP1A 3TMAA 1MC8A 1D9XA 2OHHA 1GNTA 1R0KA 4KI0A 1B0UA 5FWXA 2E21A 3JVUA 5JI2E 1PWEA 3CEAA 4YEDA 2DU8A 2JH8A 4C78A 2DERA 3R9XB 3EPRA 1GV1A 1PK8A 1S6YA 4GL2A 1VXOA 1BJTA 1BGVA 3AG5A 3FHTA 3J80A 5J2UA 2OBMA 2G9NA 3ETNA 2GYYA 2OV4A 2FTKE 2I7XA 4R1PA 2CJYA 1DUSA 4JC5A 1SOAA 2AX3A 2JB9A 4YQEA 3DEAA 1T1EA 4XLTA 4Z1MA 5HPYB 1B43A 1V2HE 1U7HA 3FCSB 1A4XA 4QDUA 2DLCX 5MN6A 1ZK4A 3RRZA 1XMSA 4ASUD 3K0EA 3ZHOA 1T6XA 2I6SA 1UBKS 4WFKA 1MDBA 1VP9A 3QEBZ 3PPXA 3EFBA 4X3CA 3UCXA 4CG1A 2PH3A 1SC9A 2AW5A 4PGAA 4DSTA 3QXXA 621PA 4U2GA 1RWBA 1G42A 4KR6A 4O8CA 2GCGA 1BCRB 3ET5A 5DB4A 1M3SA 1RLOA 3FGPA 2C3MA 3NBKA 2CK3D 3BXOA 2ZGVA 5IVPA 1ELOA 1DG3A 1WQ3A 1XOIA 3WOVA 4XWAA 4EPWA 3ZI0A 3KB8A 1KERA 2PAFA 4IEIA 3RVOA 2E5FA 2E4VA 3K71B 4UVIA 2Q5OA 2CF5A 2ZYUX 3FB1A 5LWQA 1PZEA 1H8HA 3CV3A 2WE8A 2R48A 4OP3A 1CERA 2V4ZA 3ZE2B 5HS4A 3K6SB 4QGHA 3C8HA 3JR7A 2Y6UA 1RQLA 3ELBA 2IZ1A 3D8TA 3R3HA 4F3TA 3TIIA 4DGQA 4E22A 4EFMA 4KFSA 1KWKA 1FDOA 4FDTA 5JWHA 1T8TA 1A77A 1Z33A 1GG5A 4E4YA 1IN4A 4MQBA 1F12A 1L5GB 1P8JA 3U6BA 2JK0A 1XRJA 3DEIA 2P3QA 4Y6GB 4DMKA 3UQZA 4Y6LA 5F5XA 3EX7C 2P6PA 4QT0A 4HGRA 4UXJA 2P9TA 1NM5C 4L57A 5EUQB 5EERA 1X7XA 3GG9A 4HAOA 4JOCA 4NESA 3KEMA 2VJCA 3U4DA 3WJ7A 1SVOA 3H5VA 3EZ6A 2EP8A 3TUJC 1OMOA 5B6JA 4L8WB 4GP6A 3WL3A 1HUQA 1PZFA 1UQUA 3N7AA 4GE0A 3HA5A 4ER7A 5LFAA 5LOVA 1SD2A 1E32A 4TKVA 3U26A 5FPQA 3GGOA 1HFKA 5BXQC 3TL2A 3BWDD 2HUPA 4QG7A 2HAEA 3P0IA 1R6TA 1WCXA 2HZ7A 3BREA 3G49A 3C74A 3TQQA 5CNMA 5CA0F 4HAVA 1UL1X 5BV2P 1UXHA 3EXFA 5B6IA 3GRYA 4IFBA 2OA0A 3BZBA 4IINA 2OBFA 5D3ZA 1QG6A 1WZUA 3GR6A 1IXKA 1H6AA 4AUNA 5FUQA 2B82A 1G0NA 4U7GA 1TXGA 4DY6A 4D9FA 2WAMA 1BVUA 3RIMA 4MVJE 1C30B 1RLIA 2VRCD 5TT1A 1L5YA 3RC7A 1KQFA 4QU5A 3DF9A 1ZJ4A 3GRKA 3JATA 1ZX1A 2ZRDA 4HTFA 4TV8A 1AA6A 1DIHA 3FH0A 1IXZA 1SUBA 4AKSA 4G4GA 2GCPA 3GNQA 4JR2A 1GRNA 2Q5IA 3HWRA 3IFSA 5AO9A 2NSLA 4DNFA 1JG4A 2P5SA 2YOHA 3O26A 5FAKA 5I47A 4ZU3A 1X8XA 3EEYA 4BIMA 5C5CA 4KN5A 4AN0A 1HQDA 1SVWA 4V2IA 2NX2A 4Q15A 3L2OB 4UXIA 4MUEA 3V46A 3DV2A 2CNWA 1FSPA 3G5TA 3F96A 4Z2AA 5HOQA 2O14A 2GWHA 1U11A 1Z5GA 5A03A 2PBRA 2AJBA 3GJTA 1HZJA 1XZ8A 1MGPA 3ADKA 5DSZA 3LT0A 3LRXA 3PD7A 5FWYB 3UXYA 1U2EA 4C4ZA 4JU9A 4CQMA 1MTZA 5G0TA 3WK4A 2GN0A 1GV0A 3JRNA 4JI7B 1R0BA 1M0TA 3UTDA 4B3JA 2BGRA 4FMBB 3N7TA 4S1NA 2ZYIA 4ZO8A 5EWMB 4YREA 1JW9B 4LYFA 4BO6A 2EKBA 2OWDA 2QN6A 4X00A 1JHOA 1UFRA 1VECA 3GJ4A 4JITA 4YRJA 3H9JA 5LCXA 3W9BA 3LC0A 1XALA 4B76A 4B3CA 3ROMA 2Z56A 1ZN8A 2X5OA 1QZTA 2C3UA 4D25A 3JVEA 1SB9A 2WJIA 4G89A 4XGNA 1Y80A 1MEOA 3PENA 3DOHA 1BHQ1 5DNEA 1Z15A 2AN1A 2DHQA 1W96A 2SICE 2IEAA 3EF1A 4EG4A 1ICEA 1C41A 3K94A 5KYWA 2G06A 1Q3KA 2NTYC 3IC5A 4G5XA 2CLCX 4NR0A 2H4JA 2R6CA 4UBIA 4E6PA 3E27A 4GWGA 4M8IA 4ZZIA 4HDSB 3IP1A 2ONJA 3M9LA 3ZNOA 5EWJA 1BW9B 2GTIA 2VNSA 2CHUA 4EB6B 2Y1DA 3DD1A 3PI7A 2GFHA 5B1EA 1XMIA 4JLOA 4HUJA 1T9GR 3V9PA 3L4BA 1V1RA 2UDPA 3ONVA 4RZ3A 2QBYA 2QN1A 1U9YA 4WLOA 1GUZA 4DMFA 1DQPA 5CLLA 1MRNA 2ZREA 4LF6B 4NENA 5EZYA 4QHTA 5K2MA 3MS2A 5LDGA 1GUBA 3W3AH 1PG0A 5K8IA 5BT8A 4X65B 2GBGA 1JQBA 1JHUA 1WXQA 3NNNA 3T54A 4HJRA 2IXBA 1VIDA 4J1TC 4BJ5A 2PZ8A 5FEMA 2ZZMA 4RSRA 3QVJA 1E3LA 5AM1A 4F38A 1SUAA 1I13A 2DQKA 1D7AA 5L7TA 4XQEA 5FR1A 3WYCA 5I9NA 1FJHA 4Z0PA 2JJ1D 2PX8A 3E4CA 1JEOA 4DPKA 1KL7A 1W4AA 3GG2A 3LJKA 3QELB 3N28A 3QF4B 1J06A 4MYDA 3M6XA 3PIRA 4JBLA 3CKLA 3RS5A 1E3QA 3IMEA 2A4KA 1DC5A 1H2ZA 2JBWA 2OZVA 4YHBA 1Z2AA 2A59A 2WPNA 3QZUA 1UJ4A 5AOCA 1QGAA 4AXBA 2VSOA 1FTNA 1ENPA 2ZWVA 3JZDA 3FYUC 2AJ8A 3CCCA 4YLGA 1WMFA 1G21B 1YZKA 1ZJWA 2PUFA 3DLTA 5K6RA 3WIEA 2EHDA 5L4NA 3NTRA 3QLUA 4N3GA 5HILA 2WWWA 3M4JA 3KX2A 1UT5A 4QATA 1OA0A 3ZLTA 4YV0A 3AKZA 1FNCA 1C7IA 1IWOA 1T6NA 4FWBA 4F72A 5F77A 4WA7A 3W5SA 2VDJA 1KI4A 4KPUA 4OBBA 3LHSA 3TZHA 4G4SO 1C8BA 1DFGA 2KX7A 4IUYA 5FUBA 1WCYA 4LX0A 4XWKA 5KJ6A 1F9EA 3E70C 1TDJA 5J5CA 5B7PA 3IULA 4TTVA 2DAPA 3PQFA 2IQIA 3S40A 4N5MA 3SZMA 2NNWB 4E1VA 1QHYA 4EEXA 2J4FA 1DLIA 4REQA 2EIHA 3IP7A 1N33B 4NEGA 5CG1A 2O0MA 1TKBA 1C30A 1KR2A 1ZY2A 4Y2SA 7ADHA 2QIOA 3UB3A 5CB4B 1YS6A 3OMWA 1DCMA 1S9DA 2WIBA 1GT91 3PQEA 4XD7A 4CM8B 5BMOA 5JXWA 2VDOB 1T8RA 5IBPA 5A0FA 4DYVA 4MKGA 1J9GA 1OZGA 2MOKA 2VOEA 4TWRA 4FZ5A 1K5GA 5K3SA 1U1IA 3KSMA 4KRFA 3R20A 2CFRA 1QRTA 1PF7E 4MCHA 1CYEA 1E9EA 4IHQA 3Q7IA 2X1HA 2QWXA 1TM2A 2AG1A 4AKIA 1YKSA 1A96A 3HBAA 4RK0A 3FFTA 4MX8A 3DAOA 4B6JA 5FWYA 4LF9B 3VYSB 4GOND 3EVBA 2R25B 1MIOA 4WJLA 3SEAA 1OI3A 5HYVA 2XDYA 3V4RA 3T9AA 1IN5A 1JDPA 4DE5A 1C8LA 4DLRA 2HHAA 3I61A 3O4JA 2PX5A 3ROZA 5FO0A 3SYNA 1QYVA 1N5DA 3EWIA 4DR4B 2A94A 4AK9A 3GW8A 3PPIA 4M6WB 1ZSYA 4B2YA 4ES6A 3FGZA 1OWMA 4BLPA 5LSAA 4W5QA 2MR5A 1R8JA 3RAPR 3L0IB 3ZCUA 1ZXLA 4I8IA 3ZXXA 2Y68A 4BAGA 5AW6A 4MYSA 3B9PA 5MN5A 2ZBPA 3N39C 5LBIA 2VLBA 3K0KA 5IN5A 5FA5A 1N9GA 3BZWA 2VRNA 1QTNA 1ZN7A 2C8JA 3E22A 3GFGA 3N8NA 5SZIA 2PGAA 2VHWA 3STVA 3HHEA 3H0KA 1JFRA 2P4HX 1R7RA 1QAQA 1IVSA 3QVKA 1NMZA 2V7UA 4OXRA 4D97A 3ZV6A 5JQGF 1G4AE 2QVCA 5JAMA 2C0QA 4RPCA 5AKIA 1YNOA 2VJQA 3GP5A 4CEIB 1E1NA 3ICOA 3NTUA 4IO1A 3LOPA 5CDUA 1T3SA 1XNQB 4LDJA 4BGIA 4I9UA 4GXNA 4FT2A 4QYWA 4Z3OA 1QC5B 4Q9KA 1GGHA 3N7UA 4KXMA 2PXCA 4LVUA 4QELA 4P86A 3R7BA 3ULKA 3W9YA 5JC1A 2V3VA 3PB3A 3DZJA 3IV7A 2CNNA 4CE6A 5FOXA 3Q4GA 1KI2A 1WCWA 2EBHX 2IVZA 1TZJA 4HI0E 3VR2A 1C2TA 2I2XB 4H1UA 3EFOB 1RQGA 3D2AA 4D02A 4DCGA 2DCMA 4UQPA 4AVYA 1H3NA 1V48A 2VFAA 3NNSA 4F4IA 1TVKA 1YJQA 4PHCA 4CT4B 1C1XB 2VJMA 5EP1A 1Z5UA 1Y7PA 1ZSNA 3JQ7B 2WTXA 2NYAA 5GV8A 2GM4A 3HY3A 3FNEA 2QG4A 4BLSA 5FPPA 1OWNA 2JD2A 5TEWA 3PHJA 1NLZA 2VJNA 5K2OA 4OK3A 1GTG1 5K45A 2ZBGA 2EFEB 5MFZA 1F6BA 1TYCA 3PC7A 1YR9A 2NU6B 3P96A 1ZRHA 1AB6A 1RHUA 5MGBA 2Y1WA 3GZTB 4Q1FA 5ED0A 3AX6A 4BNFA 4CM6A 1KRWA 5COAA 1GUAA 1K9SA 4I55B 3U9SA 4D44A 5KQGA 3VNUA 1AGNA 3EQ2A 1ZUNA 4MRMA 4PTYA 1NM5A 2JLSA 3LVQE 4QUDA 2YWXA 2J9YB 2AFVA 2KWIA 1Z35A 3F7MA 5HM8A 1YUMA 3PL5A 1AUOA 4D3YA 5BQOA 2VXCA 3VNQA 1AMUA 4E5SA 1DHRA 4HWGA 1PJTA 2PUTA 1UPFA 3CURA 3WO0A 4ACBA 3AVQA 3VO9A 1VL0A 5DNCA 2AG8A 3RS3A 3RYIA 4P4SB 1NVUQ 1CQIA 5BYJA 4D9NA 5KVVA 1CW2B 3JAWA 4QXAA 2ZUTA 1Z6AA 2E37A 3NHYA 1W5AA 3WJ1A 2NZYA 3VSBA 3VYVA 1NAHA 2H6EA 4PBSA 1MH9A 4YP6A 1U4NA 2P9EA 2Q2QA 1T35A 4PLFA 3SHWA 5JH7A 1FX0B 4BN4A 3LYLA 5C8XA 2HRQA 3ETGA 3ZS9A 4C07A 4XWGA 1N2XA 2CV0A 1K63A 3I9MA 4LJSA 2FQXA 4HAWA 1KSGA 3MD9A 4HQFA 2B99A 1E7SA 2Q7DA 4HNGA 3W2TA 2ACWA 3ZTYA 2ZS8A 1JXAA 3OZEA 4CBVA 4U7DA 1PR5A 1RWXA 3ZLBA 3K70B 1KI6A 1Z6GA 3TJMA 3ZK7A 2R00A 3FDZB 3HVJA 2JGIA 1PGPA 4GPAA 2H06A 3B9BA 2WLSA 4UU0A 1OR8A 3CA8A 1EJBA 2EP5A 1KYVA 3OJFA 4WLNA 4YT5A 4R8SA 4WKGA 5DI3B 5SY9A 1TAGA 1KVSA 2YY7A 4EYEA 3GU3A 1SA0B 1TZMA 2A9RA 3RFTA 2HD4A 1USIA 3GHHA 5DBOA 2ZUFA 1M2NA 2PUDA 3JSXA 3F9RA 3MTJA 2RH5A 3NV7A 3U16A 2FUNB 1WKBA 2KSQA 1IJEA 3RQSA 1G8SA 2RGGA 4AJ2A 4HHEA 1CR2A 5CH3A 1QG2A 3ANYB 1VPEA 3CG0A 1X1DA 4FEAA 3BFPA 4K6OA 4XQ9A 5K5EA 4QPCA 4FBLA 4IUBS 3CVUA 2HWUA 1MFZA 4NPAA 4N4AA 4J0IA 4CTJA 4YMTA 2XNCA 1PFVA 1TQ4A 4MDEA 2EG5A 2R6JA 4RJIA 2BGKA 4R1UA 3H1AA 3V5NA 3VC2A 1IUPA 1YR7A 2F3QA 3BKXA 2AJTA 4OHUA 4XIJA 3RVJA 4IPTA 3ZZ0A 3MJVA 1U1GA 3P94A 1R74A 4BTVA 2FX5A 4D7AA 4Z4QA 4HY3A 4BCCA 3BDAA 4ZI3A 1DJOA 2RGCA 4MVXA 4EW6A 3UCEA 4XDGA 1OHHA 2VNIA 1M34B 3NORA 4HO1X 4TTRA 4TXNA 3D4BA 4RIEA 2EWMA 3W0LB 5B12A 3DLHA 1JPNA 3B78A 2BM1A 3ZXUB 4GVXA 3UWDA 1IG3A 3LDFA 3NHZA 4WLFA 4CIWA 4L0CA 4I4NA 2C9BA 2WJ3A 1LX7A 2XTMA 3HCAA 4PNPA 2IHYA 2OKCA 1EIZA 1Q16A 3HN7A 4N9QA 1CF4A 4NBVA 2RHDA 3ZLUA 1DBWA 4GS5A 2PMEA 1EWVA 2G36A 4DIOA 2O7QA 4OA5A 2VP9A 3SU8A 5AI0A 2PG3A 3T0FA 3WNCA 1KOLA 5LMZA 5IM4F 1IHXA 4YAEA 2XMZA 3DHYA 4JI5B 4IHJA 1UJMA 2EQ5A 4K6CA 3TINA 4ITVA 4YRMA 3BRCA 4GLJA 16PKA 5IVDA 5IBQA 2QZ4A 1WZIA 2WFZA 4X62B 3T9FA 4LRTB 4J29A 3X2SA 4H6VA 2FWPA 1EUDB 1LRKA 2D3TA 1CY7A 2BUCA 1EVKA 4TWJA 5G0UA 4P58A 4OVKA 1PCXA 5F52A 4TVOA 1R66A 3SZGA 4LJ6A 4LJRA 3TAXA 4A27A 4W6QA 1G59A 1VCHA 2VJAA 4I1VA 2HLDD 5IW8A 3WKEA 3KOWA 1TGYA 2I8LA 4MQFA 5DM60 1JAIA 4OIFA 1VYVA 2PUJA 1KAOA 3K0CC 4O8ZA 4RPLA 5B1IA 2NXWA 3SXUB 4MP8A 3KQHA 4AWXA 2YR0A 4AO6A 4EL5A 2QI9C 2N46A 1O6ZA 5J2UF 1TRHA 2HF2A 2VRBA 1TF5A 2HQOA 3PRHA 1MVNA 4AJKA 3W6ZA 1X1SA 5AHRA 2F4NA 2K2QB 3AEKA 3LX4A 5FTNA 4V1CB 2NP6A 1C14A 3IQWA 1N6RA 1UZNA 1K9VF 3MCWA 4S2EA 5KOYA 1NJSA 5B58C 1FX0A 2C9ZA 1IBKB 4ADSG 1TKAA 2G4CA 4BPRA 2DR0A 4C2AA 1PNVA 3D3WB 3TF5A 3KJZA 1O95A 1SZDA 5F1OA 3F5FA 2UXCB 2ZRNA 4FIDA 1CPYA 2V7XA 2UZ0A 1YQGA 3QWAA 2V98A 3KEFA 3RC2A 1TFUA 1NVTA 4HR7A 4ZV7A 2VF4X 2VBIA 1AIPA 1N7IA 5JW6A 4HDRA 2AMFA 3EMDA 1E1CA 1FSSA 5KDDA 4DJDC 3M81A 4HDQB 5K51A 4AYTA 2GASA 1SHLA 5FPHA 1R5NA 3RRBA 5EXTA 2ACKA 1EHYA 1YZLA 1ADCA 1IHDA 1M6HA 1UBUS 2NN3C 3D0OA 1U7XA 2KM1A 3N9IA 4UMDA 4BZWA 4DMGA 3GT0A 2P9JA 3B8EA 5DHPA 5FUYA 1YVUA 4KQXA 4M7RA 2Q8PA 3NBXX 3OLXA 2BW0A 4XB6B 4RHTA 4EM6A 1XJCA 1YDHA 4JUIA 1JJFA 4D8YA 5BQ5A 4CM3A 2IYPA 2PBLA 1OKKA 4QFDA 2ZKLA 1P2GA 4JI3B 4P7GA 2C4TA 2ID7A 5T4BA 4FWTA 2H0QA 2FZEA 3GZNB 4JHLA 3AFIA 3RYCB 1BRTA 2K5UA 3D5EA 3FJ1A 3A9CA 2JAUA 3OBBA 3IUEA 4W9MC 1TMOA 3TAUA 3THWB 4F6CA 2QTFA 4MP6A 1UDAA 3FD8A 1BCSA 2FETA 4IAOA 5KWIA 3A1VA 3BMOA 3HPRA 3O8OB 3PDIA 2IDZA 2HZBA 3FPAA 3U5TA 3KVRA 3SNHA 5CBKA 2V3CC 4C1NA 4FHFA 4HXGA 4OK6A 1C4WA 5CJ2A 1M34A 2RHBA 2QPLA 3INTA 4RV4A 2ETVA 3DHNA 4TYWA 5FRDA 1OAAA 1U6JA 4HVLA 3QOYA 1T5LA 3HKEB 4ND1A 3N8KA 4QOGA 2ATEA 4XVRA 3VNAA 3LCJA 1TM3E 3HLYA 2Y1CA 5ISMA 2PTHA 4IIEA 1VCIA 1WZEA 1F2UA 4FBMA 3RFXA 1YH3A 4L0MA 3TH5A 4BKUA 3L1HA 4UOZA 1V8DA 3T35A 1L7RA 4I9NA 4ML3A 2C7BA 3WZ2A 5HTKA 4B8WA 4RENA 5AXAA 5EZQA 1F8UA 1SQ6A 5C51B 3L4KA 3G8BA 2GD6A 1FPMA 3FHLA 3QVGB 4TV8F 1JI3A 5DW0A 5BW4A 2YOGA 2Q3MA 1DCFA 3KQQA 1KKLA 1TIPA 4PR3A 2XLCA 4EX6A 1DU4A 2FG5A 5I7HA 2W4IA 4L6IA 5JFOA 2GPWA 2VT6A 2NSJA 1GA6A 1P29A 2AXQA 3QJGA 4H35A 1ESCA 2E1RA 2OBXA 5F4BA 1JZTA 3NI2A 4DABA 1EUYA 4EECA 1IBCA 1E8NA 1SEPA 3H2JA 5HFJA 4KPYA 1YFZA 3NANA 1MZPA 4LSGA 2CMDA 3D8NA 1N2CE 3TIGA 2C78A 4II2A 4R1OA 1WJGA 4URVR 1NDUA 4DLNA 4JLJA 3WWEA 1PE0A 2YWJA 1SR8A 5DP2A 3B6JA 4AG3A 3BAFA 2GRUA 1EK1A 1MHPA 2HKIA 2Q41A 1X0XA 3QMWA 1PFGA 4E7PA 3VR4H 4F9FA 4IVNA 4UTPA 2JLWA 4EKIA 1KMQA 3QLJA 3OZWA 3UT0A 2QQEA 1YI8A 4DBZA 4OQDA 2IUTA 2TRSB 2W4MA 4RS3A 1A8IA 3GOHA 5BMVB 5AHKA 1HL3A 1JHZA 2RKBA 2WHPB 2JIOA 2C61A 1RAAA 3ZYCA 4Z4EA 5IDXA 2GK7A 1SUWA 5C52B 4GYYA 2X1MA 3ZKWB 5BSUA 2W2MA 3K92A 4L27A 5C5DA 5CG2A 4I1OA 3Q3HA 2VPWA 2M1ZA 1NLFA 4G23A 7GPBA 1HDXA 1XA4A 1HDCA 1XQWA 3R77A 4LV6A 4PO3X 3I1IA 3OLWA 3LGXA 3QEAZ 4MARA 2O06A 3GFRA 3QWIA 4QLOA 4UUQA 4PEVA 4PX5A 5CDFE 5DISB 4EI9A 4YRRA 3W5CA 3ROKA 4HN4B 4DIUA 1OFUA 4OAPA 4AQDA 3Q2KA 1NC3A 3NHRA 4N01A 2GWRA 5EHZA 1V11A 3LLSA 4XVHA 1GRRA 3TCKA 5GTDA 3VC1A 2WUDA 2HIAA 3DUFB 1H9AA 3BUSA 3IBGA 4W8HA 1D8TA 5DVZA 4ZCPA 3K15A 3SR4A 1JR3D 2QX6A 2X8AA 2VJOA 1L7AA 3IR5A 5TMBA 4C3VA 2ORVA 4JASB 4G0ZA 4WJZA 5AKJA 2ONZA 3DHEA 1KAQA 2QTMA 2B4RO 5J59A 2WSYB 3UUWA 3WKCA 1RRCA 1SIOA 1XTQA 1XRMA 1R6UA 3S2EA 4E12A 1II0A 2IYWA 2ZSEA 1NBMA 3GXOA 3WNQA 1AKUA 2FWBA 5JCOA 3R74A 5EFOA 1PL7A 1JAZA 4P3YA 1X15A 1EVZA 2YJ5A 3B3AA 4NE2A 3STWA 1QCZA 1EXWA 2PKQO 1UP4A 3HKCA 1U2DA 2AMYA 4LTDA 1ZVMA 2ECQA 2H92A 3OFNA 2NU8B 1PQYA 1YJBA 2P1RA 4K87A 5JDIA 3O8OA 2C4MA 2OENG 1EPUA 4L2IB 4TM8A 1AQJA 1J5EB 3L4SO 1AGXA 3VYWA 4EHFA 1N2OA 4L15A 3EMKA 2DFPA 2E4AA 5P8WA 1JJ7A 1YQXA 2QE7A 1MG5A 2QMHA 3E2IA 3HA7A 1XA3A 4GW3A 4OI1A 3U37A 3T3OA 1TYEB 2XRMA 3JQCA 3R5KA 3HXOA 3GO4A 1VB5A 4UJ5A 3WGKA 2EZTA 3IILA 4LXIA 2PNJA 2HT6A 3PNQA 3L06A 1QOZA 4U7TB 3TQSA 2JCGA 3EYWA 3O9ZA 1Z2OX 1RM5A 3EGEA 5J4YA 3A6EA 5AW3A 2EARA 1TTQB 3QE9Y 3CH6A 1BKYA 3ZTWA 3F4LA 2OZLB 1MH1A 2OY0A 3HR8A 4WXHA 3O03A 5CT9A 3ACBA 1KA9H 3CT4A 3IUSA 4Q4HB 1Q50A 1N0WA 4H16A 2GCNA 3OZVA 1KEEB 2QGFA 3L93A 3VDMA 3PHHA 4QOFA 1NI4B 3GUCA 3GOQA 4ENRA 4GM0A 3UJ3X 3UXEA 2I78A 3WL8A 4UNPA 3TMYA 1FS6A 2I7DA 1QSGA 3MELA 2OEPA 3JYHA 5A5FA 5KKNB 4C7OB 2VZ0A 3DVAB 2VZLA 3HVKA 1CEEA 2F9LA 1LH0A 3OT1A 3SXJA 1M6VA 3FVVA 3OZ7A 3E81A 2GFIA 4L4UA 4J2HA 4QBIA 1Z0JA 3RLFA 1WA5A 4Y1FA 5A62A 1L7OA 3F97A 3K4QA 1R37A 3R23A 3KDAA 2RIPA 3CMMA 1RWMA 2VNJA 3LC2O 3RBAA 4BNYA 1QKIA 4UTZA 3SKVA 1FTWA 1MDFA 1TEXA 3P9YA 1YDMA 3CJRA 3M1LA 2Y3IA 4HAXA 1WB4A 3IVGA 4C6TB 4DW8A 3GJ5A 2O2EA 2O3RA 3HUTA 3D3EA 4M99A 3VMMA 5G1PA 1ZNWA 4HZUA 3SSMA 2LCIA 3ZJ4A 1H2RS 3NO4A 1EIWA 1ABEA 2F3PA 4RTRA 5AW5A 4D9IA 4H1HA 1NXOA 3JWHA 4Y8VA 3H1EA 1QGUB 4NQRA 5AM4A 4BJ1A 1HXHA 4FDLA 5TR9A 4W5RA 1JDJA 2AN5A 1NFFA 2XJ4A 3A26A 3M82A 4KIWA 5BOSB 3BL6A 5DK6A 2XUHA 2Y2VA 1QYCA 5JR3A 2H2HA 4PWYA 2P2ZA 3JU3A 2YRFA 1QHFA 3KZXA 2IZZA 1IEXA 1FUKA 3FRHA 2GXQA 3DEFA 4A82A 1JKMA 3BGIA 1J2UA 2RGDA 3FHOA 1I32A 1DX6A 3FPLA 3KTFA 1ZIOA 3EUAA 4B3IA 1P74A 2C2WA 1YONA 1U2TA 4NCNA 4LJ9A 1Q77A 2X7HA 3FUWA 3ZIDA 1N0IA 2NZXA 1UM9B 3OOHA 1HDRA 1UMKA 4P81A 4A3SA 2OAQ1 5P21A 1CDEA 1NNSA 1VLLA 2QJOA 3E2MA 5EAIA 4ZAXA 4DA8A 1XYVA 1UMDB 3KLNA 1YQWA 3PKIA 2PXHA 3PJRA 4V2UA 4KK3A 3AM4A 3W3ZB 5C5IA 5CFNA 1X2EA 4O2AB 4HFJA 4TVKA 3D6TB 4DXHA 4E21A 4OXNA 5C5EA 4C0JA 4EA9A 4HMQA 2MSNA 3VKGA 2JASA 1SCAA 3PPWA 1GKLA 2AE2A 2ZUEA 1RYYA 1XN1A 4HLDA 3K9CA 2P3OA 1Z6XA 4FZVA 4IWYA 3KP1A 4PXYA 4G8DA 1JB9A 2I87A 1JIUA 2C0PA 3EZ2A 1RXEA 3AI3A 2H1OA 3I23A 4Q3BA 1USVA 3AINA 4PN3A 1XTKA 4EJ2A 1XCOA 2R8XA 4RK1A 4OSEA 2Z5LA 2JLCA 3KRTA 3KUUA 3SDZA 2NQ8A 5A4MS 2O0KA 3VHRA 3KFXA 3MILA 4L4ZA 1T2FA 7YASA 4LDQA 1U6IA 3HXPA 5CB8A 5IANA 4TVBA 3MWYW 2VDRB 1U5AA 2AN4A 4DR3B 3GNSA 4CCWA 1P18A 3GRAA 2Z9CA 3A1EA 4ZYWA 1QZ3A 3RUCA 1SVMA 3TPFA 1T5SA 2OZKA 3O1IC 1JEEA 4JP8A 3KZOA 3G0GA 4L16A 2FPPB 2VDWB 3AI1A 3QITA 4MW6A 3RQIA 2XECA 5ALYA 1M2HA 1NASA 4TZKA 4C5AA 1SKYE 2C2OA 5AM3A 5JH7F 2A8YA 4IJUA 3S2IA 1UKZA 1NQWA 1CTQA 3HJNA 5AKLA 1G66A 1QLJA 2MYUA 3VAAA 4EFKA 4XVCA 1KI8A 2QPTA 5E7JA 3V97A 5I45A 5KTMA 2C7QA 2DBRA 2FRVA 3VDRA 1U90A 2AK2A 1GU0A 1KVUA 3K0FA 4R5MA 3UAOA 5JUWA 1Q44A 2J32A 4MO9A 1T9CA 2J09A 4YQZA 4B79A 2BCGY 4BFVA 1Z68A 2D6FA 4LFBB 2WYIA 1C4OA 2ASVA 5AVRA 2W90A 3A05A 3EK2A 3P0FA 4BP9A 5JZMA 3HZHA 5LPNA 1VMDA 2V7TA 5DGXA 4AYXA 2Q4OA 2WY2D 3OE5A 4YHHB 2ZZKA 3GARA 1FP6A 3PWKA 4EQ6A 2OD7A 2HPZA 2C57A 1CBUA 4NEHB 4YQYA 1MOQA 1O4VA 2GKSA 2OCGA 1RCUA 2QL6A 2YUIA 5CFQA 2HMTA 4DSAA 2BR5A 1WVIA 2WWTA 3HJAA 3IUPA 3K2QA 1HO3A 4IDHA 3UJCA 3NIGB 2ZT5A 4DR7B 4A6EA 3PC8C 1QRRA 2J5XA 1XYGA 2WD9A 4RKFA 5FXMA 3OO0A 1J39A 2G9UA 2Q4BA 3ECCA 3AHGA 1YCDA 3CR7A 2FGJA 1OB2A 3DTVB 3TQOA 2H85A 4P93A 3V4PB 1V2GA 4FYHA 3U1BA 1ULHA 1KQNA 4DLZA 5CITA 2WJAA 4M22A 2YJNA 4XPZA 2AJLI 3DC7A 3QK7A 5KOJB 2BONA 2H7VA 1ZVVA 4DLWA 1KK1A 3ONWA 4IHAA 1PW7A 3F3MA 3ZC3A 1YHYA 3CF6R 2UVQA 1AO3A 2FUEA 3OZCA 4OHWA 4A4DA 1GDHA 2XZOA 5JSHA 1A5SB 4ALLA 5KSZA 1KFEB 4ZI7A 1YUBA 4A2QA 1SPXA 4I9GA 3U3ZA 4YGYA 5JG7A 4U3JB 4BFUA 4XYMA 3RV4A 3O91A 5CMLA 1QF6A 3MCTA 2HEGA 4ZI5A 2IHNA 2OMKA 4EW3A 4NV1A 3ES9A 5IVKA 1N2EA 3U9LA 1EWTA 3N0TA 3I01M 5LZ8A 4PZCA 4RMNA 4BE9A 5DHRA 1Y7TA 3O3CA 3PZRA 2EGUA 4LRXA 1ORWA 1XB2A 2P40A 3IDFA 1LTKA 2VAXA 4U9UA 1U28A 1WXHA 2Z04A 2P9CA 1T5DX 3EXAA 3LIIA 2BE9A 4LJAA 4QEKA 5F2NA 3CZ9A 4A15A 2NVOA 1JECA 13PKA 1F38A 1RAHA 3REQB 1NUPA 3KM0A 2IOYA 4IHJF 4TL6A 1KZHA 3UFXB 5ALPA 1IZ7A 1YDGA 3ZNPA 3CY6A 4A7PA 3PHCA 1KF0A 3A1CA 3T3MB 2X0IA 1PO7A 1TYDE 4ZOCA 3UHPA 3D6MA 3K16A 5AVVA 1O03A 3T1YB 2X2EA 3JQRA 3PQDA 2Q62A 4R9UC 4N5LA 3GI1A 1Z5WA 1IL0A 3U49A 2I34A 3CQ9A 4R2JA 3BTVA 3U44B 4EHKA 2LCFA 2B6NA 1ONBA 1Q0PA 1YKGA 3IRVA 4HYTA 4QOJA 2Q4RA 3PNYA 3OZBA 5CDYA 2FF5A 1E79D 2AW3A 4GGMX 5FTKA 3KQLA 1UDWA 2GJSA 3ESRA 4NYJR 4R0MA 3RF6A 1Y8ZA 2JFQA 3B1YA 2PGLA 3WIOA 4JEHA 1KDPA 4BMDA 4ZO7A 4DG5A 1KH3A 2XOKA 3TWOA 4F0JA 5ALMA 2OTCA 1Q3TA 2AWOA 2IL1A 3BHJA 5F51A 4EMSA 4F5WA 3H4VA 3EXHC 3OQIA 4IILA 5AD1A 2CXQA 3KQVA 5A7FA 1N5MA 1RKVA 5AI5A 5BW8A 2O1EA 1F2VA 4A2PA 1UDBA 1CJVC 5U1PA 2QPOA 3PDHA 1M2FA 3B3FA 4YONB 1OAKA 3B6MA 3EFEA 3IQDB 4LHXA 1SCBA 2B9EA 2HJHA 1L9KA 3OTHA 4CEJB 4KUEA 4C22A 3M3HA 3D0KA 2R1VA 3EIWA 2GLXA 1DEXA 3VR1A 2GBLC 2I4MA 3EH1A 1Y9DA 3EGDB 2IIBA 2D54A 2QP3A 3I9V1 3A4MA 4KQCA 2AR7A 2VZEA 5SY4A 3VR5D 1XZIA 5HUJA 4F21A 4JLAA 3WGNA 4D3DA 1QHHB 2DGDA 2JGNA 1LXCA 1EDZA 4MMYB 1SG6A 1WXXA 3UWKA 4GNRA 2G09A 1GY8A 1XF1A 3O8DA 3QVLA 2XTZA 1ZI6A 3B3JA 3URMA 5HK8A 3TVDA 2R7KA 2FSGA 3A9TA 3A0RB 5ILGA 4JYAB 3ESYA 4JZKA 3HHPA 2XBLA 6GPBA 1JQAA 3PR3A 1PYGA 4YBZA 2WJYA 2J7PD 3CUYA 3S5JA 4XM0A 2XSZA 2ZEJA 2VDQB 4IFTA 2D06A 4YXWD 3N76A 2H54A 2HTFA 5EP3A 1GUFA 3JTEA 1IULA 3GCGA 4KQKA 5FL7A 3T7KA 1H85A 4LWQA 4NFHA 2WJWA 4HQKA 2UYYA 3LUDA 1Y3IA 2O8DA 4LG1A 1NX9A 3UW3A 4B40A 4EG1A 1G20E 2YBDA 3CB4A 4BNZA 3WNVA 3SM3A 5CD9A 1TTTA 4JLVA 3R3ZA 5DLEA 3NTQA 5D3KA 3D4IA 2GK6A 3P2MA 5FV7A 4K46A 3QHPA 1JUDA 4PC1A 1E0SA 4MUIA 3OPYA 4EKGA 2BHNA 2GERA 2H51A 3EJWA 3GBPA 1GL9B 4YFYA 5CM9C 5F9MA 4AMYA 2ZI4A 3SE7A 5J43A 1A69A 2QTGA 4HMPA 1E3EA 4R71A 1E1RD 5ALSA 3PWTA 2V65A 4JOSA 1Z12A 1ZDMA 5JAOA 1KRHA 3VNBA 3HZOA 4W9RA 3AONB 4NK4A 2VPPA 1JEQA 1VOTA 3HCFA 5DRYA 1WCV1 4S04A 2YXNA 5H4HA 1PDWA 2G4VA 2SCUB 2YNMA 4FNOA 4U3JA 3ZS8A 4LNHA 2YZ2A 1XELA 3S2GA 2X8LA 3KZ1E 2HIMA 2QUAA 2J3IA 1YKFA 2JCXA 3GUVA 3KOOA 1DV2A 5ELMA 1DZIA 2PVCA 4RIFA 4YAJA 1TUBB 2X9VA 1Z7EA 2JHFA 4WW0A 2JK1A 5KTSA 1VE1A 3MLEA 2FU5C 5JD6A 2P78A 2ZT6A 2QVYX 1XTIA 3KVVA 4Q1DA 3UJ7A 3CNHA 4CKEA 3PSAA 2F1IA 5KIAA 2PJRA 1N4DA 2FEPA 1LB1B 4F04A 3D1LA 1MFPA 5LWHA 1GPYA 3T5BA 2YZMA 4LWZA 4JJZA 4RXMA 1EWRA 2NQ2C 1C7FA 4GL4A 4ZAWA 4Y9UA 1VP3A 2V8OA 5T41A 1ZA1A 2JC3A 2W00A 1QS0A 3AP2A 4RC9A 3RUPA 5A02A 2FYTA 1FX1A 1OXUA 4AXXA 1J2EA 3A25A 1HLDA 4U9HS 2CJWB 2RMKA 3PDWA 3U19A 4YJHB 1UJ2A 1BOOA 3T3IA 3CMCO 2HO4A 2VP4A 1JT2A 2H8KA 4DIFA 5LQRA 8GPBA 1K3UB 2EQBA 1YZUA 3BXHA 3D8BA 1JG7A 4CMIB 1A9SA 1QV6A 4KLZA 1B2RA 5IT4A 1Q0UA 2FZLA 1SURA 3PX2A 2ZIVB 2XQKA 3OTIA 5ED4A 1L5RA 4YP7A 1YQDA 2WFLB 2VTBB 1I7SB 1BNCA 3A3NA 4M21A 2QDXA 3C98A 3D0QA 5JADA 5CCXA 3OKFA 3PZBA 5LNK6 1SUCA 2XOEA 3KWFA 5EIAA 3T8YA 4P0PB 2B3DA 1IZ9A 3HLKA 3M6AA 5KSWB 5EC8A 2OFFA 1PR3A 1MO4A 3EUFA 4P4NA 1P1IA 1A0OA 2NU9B 4EY6A 3SVZA 1KBOA 2R8ZA 4L6CA 1GLNA 4AIRA 8AT1A 3PUKA 5JCJD 2X4IA 3AF3A 1OAOC 2B4KA 1QIEA 1NKTA 2W6IA 1XZMA 3L7JA 4MUHA 2XMSA 4OMUA 1J97A 4QNRA 4ZP1A 5I5EA 1HT2E 4L7VA 3EAFA 1NRIA 4GWKA 4Q3KA 1E9BA 2YXLA 4DJJA 3QE0A 1UH5A 2ZJ6A 2FKAA 4DJEC 1JDNA 5INTA 2ZQYA 2OP0A 2B1JA 2Z2KA 2B6HA 3GEHA 4L76A 2P35A 1IHOA 1UJ6A 3ILYA 4PYKA 2PYZA 3GQVA 3UMMA 1KQOA 3I9LA 3I1FA 4UD6A 2QLFA 5TMEA 5D2CA 4HGYA 1AXEA 2CLKB 1CSEE 3ELUA 4HX9A 5K3OA 3H8SA 1S3FA 4QYIA 4EH1A 1SUFA 3UJHA 2GH1A 2OB2A 2ODPA 1FZTA 1A5ZA 1U2RA 2IYZA 1QHHA 2YDYA 1TMKA 4DEYA 5IF9A 1QU3A 3DQPA 1OXBB 2WIKA 4BNUA 4YGXB 1DKQA 3CC8A 4WH0A 2FZ5A 4PO9A 1N0VC 5LXTB 1JQKA 3LP8A 3O94A 1YGYA 1EG2A 4NYMQ 4OL9A 1TF2A 5CGZA 2C1ZA 2XAUA 5DZSA 1YRLA 4U2KA 5LKAA 3PK0A 1X80B 1MB4A 1XYYA 4DA0A 1ODIA 4BMPB 4L22A 4E03A 3MQ2A 3A11A 2QOEA 1ZGZA 2VPQA 4R3UC 5IYZB 2ISSD 2XZLA 3FDIA 1LX6A 4KPFC 1B74A 2WHYA 3PC8A 4DJAA 4ZAZA 1SKBA 4C5BA 1KOGA 1OCEA 4XOUA 4JT4A 4BUCA 4DHWA 5AVYA 4JWKA 4AZ0A 2OFPA 3NIFB 4AG5A 3WXBA 2QM7A 1W88B 2EVWX 3O1HB 4YRLA 4GMHA 4PLCA 5KOHA 4P82A 1X7ZA 4TQAA 4G36A 4FGKA 3RT9A 1AN9A 1BGWA 2V7QD 4KG7A 2BEWA 2CNOA 4C4XA 2HK8A 1N5JA 1FJXA 1H5QA 2ZTLA 1K06A 3RSQA 2X13A 1VZ2A 3QP9A 4FGUA 4Y30A 3C8DA 2QW1A 3IIIA 3NWPA 1VBKA 4TZTA 4X64B 3COVA 1W6RA 3Q9LA 4L8LA 3ADCA 1Z7YA 1Q1AA 1TEVA 5DEIA 3J81A 2IS1A 1UR5A 1DDOA 4IV5A 4CUKA 2EX4A 3U40A 2GS9A 3F46A 3F6SA 3RYTC 2ZUCA 2X86A 3OU2A 2C9OA 2B94A 2H2FA 5K3CA 2ZVJA 4BQNA 3FCUB 1QTIA 2EKDA 2JCVA 4REOA 1ADYA 1NXSA 2BTQA 2C8KA 5TQ0A 5CFPA 4F56A 2AOUB 4EIWA 1VSUA 5CFZA 3WRVA 3CZQA 2OHJA 3DJYA 1W5TA 5AK3A 4JVLA 3DFZA 3HXQA 1I5RA 3KPWA 1Z83A 1UFOA 3I28A 1EFVB 1XQVA 1NONA 1J24A 1A7JA 1P2VA 3DEHA 4ND8A 4EO4A 1E6EA 1TO2E 4ZHQA 1DAGA 1S96A 4HH0A 1V6SA 3WWDA 2EKQA 1F6DA 2QTBA 1JHVA 2OC9A 1SC6A 2Q3CA 3F3SA 2WUEA 4WMLA 4EHLA 3RUAA 2EX1A 3QY9A 1DTEA 1NE2A 4RZ2A 1AQ6A 1N77A 2ADMA 2VT2A 4WAUA 2F1OA 4F9TA 1XLVA 2E55A 5FPKA 2C2XA 221PA 1NLYA 4BWFB 2PLAA 2PS3A 2MSWA 1QE0A 1HRDA 2H4WA 2KW5A 3FIUA 1I0ZA 2JGLA 3L0DA 1ADFA 2BFOA 2FPIB 5I51A 3EVAA 4LRWA 5ABPA 1X77A 3MA0A 2VI5A 1F3LA 2O2JA 2UUOA 3C6YA 3D4LA 3IE1A 3AVYA 2WVJA 1U6KA 3PTAA 3IMGA 2HI0A 2J3QA 2OB1A 2PL9A 1P19A 5AJXA 4DV1B 2QMQA 4Y9DA 5L3RA 1XNHA 5GZ3A 1ZU5A 3U7GA 3HRKA 3BFVA 1T24A 1IG0A 3AW8A 3C1UA 4B7UA 2QI9F 2ZAMA 4ER0A 2XQVA 4FSDA 2ZE5A 1XCLA 3EXHA 2AN3A 1JPJA 5CXXA 2QS9A 1NKSA 1I6LA 3DBOB 1GZ7A 3M2TA 4KZPA 5EPOA 1ZN9A 5KQPA 1E89A 4BP3A 4CTMA 4DRYA 3L8FA 2FEKA 2H1VA 2VF7A 2PT6A 1ZMXA 3FSGD 3L6UA 5FT9A 4F2WA 3AM3A 1XPUA 2NP7A 4BBAA 1RHQA 1NW3A 1JSXA 1T15A 2RBKA 1Y3AA 2FP4B 4J0CA 4CI9A 3QEMB 2VHYA 4I4TA 3W5IA 2GBLA 2QTAA 4UEJA 4TYMA 1NBMD 4Z86A 1SHJA 4X66B 3FBWA 4ZODA 4P3KA 1H0KA 3BJEA 3DMTC 2AMJA 1FB5A 4QTYA 4M1WA 1FFXB 1KY5A 3I5XA 1OPXA 1YL5A 1XE3A 3BE6A 4PC7A 4QRIA 1HZZC 5CLJA 3HPQA 1EHCA 2AVNA 3B36A 1WUTA 4TTPA 1XZAA 2C2HA 3HJUA 4HAZA 3TNLA 4AAYA 3HZRA 4OGKA 1OZ0A 2VSYA 3MXOA 1U4SA 4OMDA 2H2WA 3W2FA 4KO4S 1YU9A 3EIOA 3O82A 1H5UA 1PFYA 1SCKA 1E3SA 4HDMB 4YVFA 4PAMA 4XIGS 1Y89A 1JSRA 2WB4A 1KJ9A 4OGGA 1DFHA 2VXYA 1J0DA 1TAHA 3DP7A 1AUQA 3CUWA 3KAJA 3NHWA 3NV9A 3WRYC 4QO7A 1DB3A 1TA4A 3AY7A 1NI5A 3BSWA 4CF5A 2IQ5A 3DCYA 3NHLA 5F5LA 3FTPA 2J0UA 4PSUA 1LJLA 2DOKA 1LVHA 3D8UA 3GLHA 5LLSA 2QYHA 3OIUA 2RG7A 4ZHSA 2I22A 2CVHA 3PLRA 4QODA 1UXKA 4UBMA 4ZREA 5AW0A 3I2HA 2RD2A 4DRZA 1O5TA 2D1YA 3L7NA 3BCUA 3QPDA 4Y2RA 5DH9A 4LOHA 1WMSA 2YWDA 1HT3A 3KYBA 4PHFA 4JOBA 521PA 1U0OC 2FZ4A 3JAMA 1R9JA 3TDNA 2L82A 2AXNA 3GVCA 2XB4A 4QEZA 3HY4A 3PHBE 2JI6A 4GYKA 3W06A 4FQ8A 4XFKA 1OJLA 5E3IA 2MCFA 3B38A 4BMSA 2BDTA 5LMCA 2QUBA 2XKAA 5DRTA 4AQ7A 1E7YA 4LKRA 4ZOAA 3V8PA 4LS3A 4YLEA 3T94A 2Z2ZA 4N54A 3ETJA 3BHMA 4NULA 3DBIA 2CMFA 1ISJA 1HR0B 2REXB 4OJQA 1Q0HA 2BN4A 1W4CA 3IIKA 2ISQA 3AUAA 5JD3A 4EPYA 4HEHA 3AVVA 4E31A 1O6FA 4RGQA 1HA3A 4EUSA 2GCIA 4NDNE 3OIVA 3U7EB 4CYMA 4KQWA 2CVOA 2QQGA 3IQHX 4PRYA 5TQJA 4BNVA 4Q3LA 1P5RA 4CEHA 1P7VA 3E1KA 1R6XA 1M8FA 2Q3HA 1NW6A 3KT0A 3IOBA 2OK8A 4JVMA 1N2HA 2BDEA 2FR8C 2W5UA 4EKEA 3LHDA 4J6EA 1NXQA 1R9MA 1IM2A 4GI3A 3H8WA 4ZT2A 3VOBA 3ZBPA 1CJUC 5BOVA 4DUGD 1P2SA 4F1WA 4H2DA 1QHNA 1WQ1R 1GD1O 3HFGA 3JSAA 4U6NA 2I9KA 2LNDA 3V80A 1VYHA 2OPHA 1T29A 2OV8A 2QRUA 1G2OA 2UZ3A 2YFHA 2ZRJA 2R96A 3JWEA 3RFFA 4H7DA 3RRNA 4RTPA 1J1UA 2AUMA 4L4RA 2ZRKA 4I81A 2B4YA 2C5BA 5I4CA 1SRQA 4ETIA 2SKCA 1WBBA 2GJ4A 3HA3A 3TTVA 4Y2HA 4EBBA 3FOCA 4X5OA 5T7BA 4E2ZA 2V9PA 3TFWA 3THXB 4F86A 4X94A 3QQ5A 1ORTA 5IDVA 1PJ3A 3EXEA 2A3RA 2CC2A 5MN4A 1G5RA 1EZ4A 2L69A 3B1JA 1BA3A 1QVVA 3VX3A 3QE3A 3F9IA 9LDBA 1SWWA 1IVYA 2DG2A 1PR6A 4GLOA 2IDMA 4TKLA 2G80A 1QKKA 3HBLA 4LCEA 5AP9A 3LXXA 3TB4A 4TTIA 3AK4A 5JAQA 2CXOA 3UJBA 4F60A 2YHIA 2XB2A 5J23A 2J3EA 4MGEA 2BF7A 4R81A 3I04A 3QYJA 1E2HA 3NLLA 2C7GA 1CDDA 2B7CA 5T5QA 1JH9A 1JQ5A 1QIJA 1PLKA 1SBQA 3EUEA 3IKVA 3NRJA 5PNTA 2J9XB 3G17A 3SAJA 4CPDA 4H3HB 2QENA 2QM3A 1XWIA 4E51A 5KOIA 5GPBA 2CYBA 2F90A 1FVXA 2FV8A 2XEDA 3LSYA 4JODA 4X3OA 5JO0A 3EQ6A 1G291 5EKTA 2LIVA 2VHQA 4HDAA 1S0UA 1L4NA 4UTOA 3TTXA 1T9BA 1TPYA 2GHQA 3OWHA 1E9CA 3TZLA 1YFJA 5JS1A 3K9LA 3QSGA 4C3OB 2HFJA 4RNDB 5KNBA 1JG3A 2NYVA 3TXAA 3PGMA 4MQEA 2VQ3A 3LFUA 4YMWA 3M0EA 3DOFA 3LBYA 2GZAA 3R5XA 1J20A 2NXEA 4MUMA 1HE4A 1YHZA 1Q3HA 1YL7A 1CZHA 3AIMA 3ZD9A 4H7IA 1G5TA 4Q4AA 9ABPA 2E49A 4G26A 4WNYA 3HM2A 4B8YA 4CM5A 2CKMA 1QP8A 5FOUA 1JIQA 4UEKA 1AF4A 5ALJA 2CUKA 4OAQA 4UDOA 5TEVA 3HCNA 3MLBA 4FX5A 3TLBA 1B7GO 3VYUB 1NIPA 3ERCA 5JNVA 3DAPA 2GCOB 3GH1A 1TT5B 3AEXA 4XJVA 1IBRA 1OJ7A 4CIXA 3ODPA 1WDWB 5JVDB 1JHMA 4EOGA 1PV4A 4ZV4A 2MINA 2Z8ZA 4GPIB 2WDZA 3PFGA 5EMNA 4Z99A 3BJRA 2O23A 1N2CB 1VFPA 3MF4A 5GGYA 3CRNA 2Q3BA 1Z73A 1ZJJA 1W52X 3D3QA 1MX1A 1E4YA 4MR7A 5EVCA 3UJ9A 2P2DA 3LBAA 3LL7A 3AOGA 4O59O 1A76A 4QSMA 2P9HA 1G8FA 1T26A 1YS1X 1FFDA 4O2BF 5EHXA 1Z6TA 1BWSA 2BM8A 2NV6A 2ONKA 3MWLA 5F35A 2Z5VA 1CS0B 1OXXK 2BBTA 3CRRA 1GKYA 1F0YA 3GCWA 4H9GA 3GAZA 2OO7A 4MTCA 4D2IA 2WTUA 3LX8A 1I3LA 3R0XA 3TBKA 2YMQA 3LUHA 2X1LA 4NOMA 1WMDA 4ZIRA 5DT2A 3VGJA 2XUAA 4QBGB 4L7QA 5EJ7A 4Y2PA 1EH5A 1P1FA 1W8IA 3F5SA 4J1QA 5EJAA 2IYEA 2NUPB 3TOZA 4Q4JB 4BO2A 4AJJA 5B7QA 4BGDA 1WU7A 1MAVA 2Z5GA 3EXG1 4HTAA 3RC9A 3BMQA 1WE2A 4FGLA 2PWAA 3TTSA 2INGX 1N6NA 2P1ZA 1OLUB 1XJ5A 3DVSX 4LY0A 4MUBA 4KB5A 4DREA 3IKTA 5KX5B 2WG0A 2QRGA 3FA2A 4PFJA 3B1ZA 2CW5A 4QD3A 4V1CI 2O0LA 2XYPA 1RMQA 4W7HA 4UCFA 5BN4A 2C5GA 1X1TA 2Q7XA 5FB3A 3G23A 4OPMA 4R51A 1NZDA 4IS2A 4MS4A 1F60A 2VZ9A 3GJZA 3C87A 5AJHA 4CDRA 4ZANA 4BNNA 4XVQA 3CO0S 1QDUA 2IX3A 4RJLA 2BFBB 3JQGA 4UUOA 1EGMB 4E3ZA 4D3FA 4HNAA 3K1AB 4YASA 1W0JA 1KWGA 5CT6A 3VH1A 1EJ0A 4Z7OB 1UPCA 2GOYA 1AQUA 4GVPA 3CKMA 1DVRA 4FHZA 3VDXA 3S1SA 4FFDA 4B0OA 2PRSA 1GUDA 4PGMA 5KU1A 3A1UA 1H69A 1I33A 3BGSA 3KPUA 1XRQA 1IN7A 2JA1A 1ZVKA 2JRLA 3ZDAA 3ER8A 3EZ9A 2PKRA 3G0OA 4TL8A 1M1XB 5DHSA 5DTRA 2WU8A 4ZYVA 5AESA 5HIKA 1YB4A 2RHHA 3OQNA 3S29A 4J75A 3V48A 3NTOA 3QPUA 4QHYA 3ZU2A 2ZAOA 3R7NA 1GKUB 2VQSA 1J4AA 1F4VA 3UPUA 2AZMA 1AS2A 2M9MA 2Z08A 3S4YA 2WQ7A 4Y18A 5AJZA 2GK3A 3OZDA 1XPRA 2WIAA 1CUWA 1G9SA 4WNAB 4XX0B 4L4SA 5TS2A 1O4WA 2WD7A 1VPLA 3P7MA 4RD0A 4ZOLB 2LIPA 3GFVA 3PR2B 4FBGA 1XWFA 4PPGA 1ZGGA 2B83A 1HRKA 3X1YA 3EC2A 4EFNA 2VK4A 3EBPA 3UHFA 4DDWA 2DH5A 2CFIA 4RMGA 1USWA 3VPGA 1NVWQ 1H2WA 1IOVA 5G3ZA 2J9FA 1HDGO 3EVEA 2FJPA 4Y7DA 3VFDA 1P7PA 2Q2OA 3DMTA 4C1BA 2AMLA 3DR5A 1P5JA 2P9YA 2NPOA 3HU1A 3LY5A 4C0HA 5HQ3A 1GO2A 4U7FA 5KUTA 1IU9A 1X6VA 2A35A 2NLOA 2FQ1A 2I2BA 3P32A 4IWXA 3RABA 1P31A 4D79A 3JQ8A 1ONOA 1MLDA 5CVVA 4UD2A 3AETA 4H15A 4PLGA 3UMVA 3YASA 4DBVO 1CJMA 1I4WA 3PXCX 4PO8A 2IUYA 3T5MA 1TMGE 4MUKA 4YT8A 4TUYA 1FIUA 3C41J 5IAOA 3BXEA 2GXSA 5A5VA 4P3OA 1PQWA 2CE7A 1G1AA 4LK3A 4RESA 4Z1OA 5BWBA 4AWAA 4ETMA 4D8VA 1GSOA 1EFPB 5UKDA 3LT5A 1NBIA 1VLHA 2ZJ8A 4LK2A 5HS6A 2QRPA 3GJ8A 3W3AD 3ZGOA 4DLTA 1JEJA 1SKAA 4EA6A 2ZWAA 4QGFA 2P79A 2C58A 2XRYA 2RH9B 4IIUA 6NULA 3C7TA 1TT5A 2PWYA 1TW3A 2JIDA 4L07A 2WSIA 5HFAA 5JVDA 3A3YA 3MT7A 2ZCJA 1JT9A 5M2QA 3NNDA 3KXPA 5HOEA 4KREA 3WZLA 2ADOA 1E9AA 1K2WA 4FEEA 3SI7A 1D4ZA 1T25A 3T3GA 4O1MA 5J2TB 4KXNA 2GM9A 4WXRA 2WHQA 4P5EA 2RK6A 3E1GA 1KJJA 1N6PA 1M1UA 3CZAA 1L8XA 2H5JA 3ST7A 3S8YA 3TZBA 4MA0A 2LWIA 3FKSD 4GFDA 4XR9A 4GXTA 4WTOA 1G4HA 3FM9A 3DTNA 2J3MA 1KJNA 4MA5A 4YJFB 4UPVA 5C8YB 1MNAA 2ZYHA 3G3EA 4KYVA 4CMHA 5H81A 1E5TA 2DZDA 3DTYA 3I42A 4F6LA 2ZJ3A 1DAHA 2I4TA 4WXPA 1T36B 2QL9A 3SQDA 1P3JA 1YBFA 2QTVA 5DX8A 5B1DA 1W1UA 4E1AA 4RZIA 4OQPA 5JD5A 3RI3A 4UEWA 2R66A 2NPFA 4BNHA 2FUG1 4IGFA 1XEFA 3RAEC 4M8SA 3V1NA 3Q7SA 3WGTA 4ENTA 1X7WB 3BD9A 4FX2A 3G8DA 5EZ6B 4YV1A 2D1TA 1CZOA 1LBHA 1OFTA 5A4DA 2PUGA 4F7WA 1I01A 4GBED 1E5VA 4TSRA 1A27A 1CVRA 3RSOA 4WZAA 2PLFA 1U63A 4AJEA 4GPEA 3HXTA 4KHPB 3Q10A 2FR8A 1E3WB 3O0DA 1LDNA 4EITA 1T4CB 1WS6A 4PZEA 3CNEA 1C50A 5GJCA 1P61B 3L1VA 4ZCRA 1R00A 5CDHA 3UT5A 4BMYA 3EZNA 2NU7A 3TNDA 4HVCA 1RJGA 1U0RA 4K88A 4R3NA 4Z54A 4UZSA 4UZFA 1VSVA 4FW9A 2GVZC 1E1QA 5DCYA 1S1MA 4XUGB 3UMFA 2XRZA 3BJZA 3C16C 1FY2A 3S2YA 5LZ2A 2GPNA 4YRCA 4QVIA 1U7TA 1JBKA 4NMWA 3NHJA 1VCOA 2O5RA 4S0ZA 3TW8B 3PGJA 2J4CA 3CEMA 3JQ9A 4J9UE 1S8AA 3U56A 1IJFA 1N5IA 4FW8A 4ZQGA 1BRMA 2WMOB 4XJXA 3DF7A 1JDZA 5FYQA 2PFSA 1GVHA 3IUNA 4DXAA 2V0GA 2I4RA 3DEYX 3WYEA 4WY2A 3ZTTA 5BNZA 1Z75A 2A67A 4GU5A 3ICWA 2W8BB 1Q1BA 3ENWA 3PC6A 3VX4A 3VU3A 4ZYTA 3L0CA 3LUJA 3DHVA 3KZKA 3VDQA 1IBLB 1B8VA 2FMHA 2FMUA 3A3KA 2CN1A 3PPVA 2JAXA 1HDZA 3KYDB 4M1EA 5L3VA 1WTAA 5JAIA 3HU5A 2C77A 3M8KA 5BRJA 5F23A 5IKXA 1KK2A 3PDJA 3SJCA 1E92A 1I3OA 2YXBA 1G7TA 3ECAA 2I3BA 3Q6NA 4QXOA 1MX3A 3G2MA 2AVDA 3RVSA 5CVJA 4PSVA 1KJ8A 2DF8A 3EPLA 1ZIPA 2BZ0A 2BJVA 3RUHA 4NYIR 2PK3A 1OBCA 3HR4A 1ST3A 4UBOA 3JQAB 1CRWG 1RR6A 1J8FA 1PHPA 1HLFA 1ZD1A 2AFIE 2FW8A 1FRNA 2Y0PA 3FY4A 3IELA 3WLTA 4D9EA 1N3IA 2A7XA 2Q5CA 3FCAA 5G1NA 1SKYB 4MW0A 5I8ZA 5HM6A 3H04A 3LT4A 3BXXA 3GJ0A 4OJYA 4XFDA 1PUIA 5BYBA 5E6RA 1JDVA 2QLTA 2WMDA 2Q4TA 4OD0A 3CSDA 3K0BA 2BGUA 5IULC 1RWKA 2JA2A 3GXBA 2QM8A 1XCPA 1IRIA 4QLAA 4DNQA 2NQTA 1NQTA 3D4NA 3HBMA 3LUGA 3QX3A 3Q0EA 5EESA 4R1NA 3EW9A 4UQOA 4QPZA 4MCIA 121PA 3GNLA 3LY9A 1ZOLA 4CCYA 3H2ZA 4Q9IA 2XGMA 1OY1A 4DA9A 4P38A 3T15A 5B5SA 4OLAA 1HL7A 4I4CA 3AL2A 2UYQA 4IF6A 2HBZA 1MQ9A 1GFWA 3H5LA 3HY6A 4IR7A 1M2VB 2YVLA 1LF0A 3ODGA 4GPD1 2JEZA 4KDFA 1IY1A 5TX7A 4AECA 1X92A 3ROEA 3UK2A 3IEVA 3OQOA 3PNSA 4BMXA 3UYLA 2AG6A 3BAZA 4HRVA 3E0XA 4XYBA 4KAXA 3DVRX 4MDFA 5HUQA 4HB0A 5FNZA 1DMSA 4GGOA 3OP1A 4HWTA 3SGLA 3WSVA 1X1BA 1QVRA 2IU0A 3L8YA 4IDNA 4IOJA 4M36A 4TOIA 1YBVA 4NV0A 3MCZA 5CT4A 3OFVA 4AF8A 2R4UA 2UVPB 2XCOA 4P4TA 3ZJ5A 5I3CA 3KOMA 2A0XA 1DJPA 1IHUA 3WAJA 3B9RA 3IAM1 1X38A 2IOFK 2ZDGA 3JD2A 3RVDA 2QNIA 1VSBA 2EKPA 2X4GA 3BULA 3DCIA 3KLPX 3GVXA 1JMYA 2YY6A 2VPZA 1ACJA 2GO7A 2R5NA 3OE7A 4R01A 1V16B 2PQ0A 4F4HA 1EGHA 4ZYZA 5AW1A 4OGFA 5G4KB 4FS3A 3BGOS 4WZBA 4U7JA 4Y1GA 4GX5A 3NG1A 3QWHA 4Z3KA 4E15A 1N8TA 1QWSA 1FXWA 4IDGA 1VIVA 3HA2A 1J90A 3SLRA 3CPEA 1KY4A 1PNOA 1JVNA 3R4VA 1N5OX 4JHXA 4K6MA 4N5NA 1EINA 1HY3A 4UVDA 4ZGWA 4CKWA 4CGYA 1K2VN 3S68A 4ZQCB 1L5VA 2P4UA 2DHEA 4BVLA 4D74A 2VWGA 1PFQA 2O48X 1NPDA 1QR6A 2REQA 3AERB 2DRIA 3MRVA 3Q0IA 4IGKA 2IV3A 4BVAA 2B7LA 2F1JA 3RIXA 3VNRA 2F17A 2ZIAA 4V0KA 2VWPA 5JNWA 1RVDA 2I5PO 1X9GA 3G82C 1CNMA 3KAKA 3GLIA 4LHSA 4C43A 4W8GA 4F3CA 2IP4A 4GDFA 4JV5B 1QBGA 2GPSA 4YP0A 3I76A 4PZPA 1RYMA 3U48A 4EVRA 5HG0A 1PG2A 1P7WA 4ZC8A 3CBQA 1TC1A 3DLAA 4M9ZA 1XF9A 3SR0A 3ZHZA 2XI4A 1OFGA 1SVIA 2ECKA 4B75A 2UU9B 1W1IA 5IEBA 4OJKA 1OASA 3WQQA 3DL4A 3SCZA 2OQ2A 4K1LA 3BD7A 1G3UA 5DT9A 2P6UA 4NE7A 4BV3A 3HBFA 1QIFA 3QA3E 1JHDA 1YS4A 4LJ8A 2JFVA 2F43A 3WSWA 1BO6A 2EXXA 3W8NA 2EFJA 3KT8A 4JDPA 4NXMB 4D9HA 4CLXA 3FTEA 2V59A 2JDID 4U02A 3QNWA 5FFNA 3D6AA 1KSHA 4JLPA 2CDBA 5CLIA 3NBAA 1XIVA 2ERXA 3O2SB 1BQ4A 1FXSA 2NO1A 2V4UA 2VF2A 3BBPA 3KQWA 4J4HA 4DIEA 1PT6A 4JYZA 4CM4A 1K3TA 3G88A 4YJGB 4PYLA 4AU1A 3DD5A 2R7AA 4ECAA 5ALUA 3HI4A 4M54A 5JFTA 2A9OA 1OV6A 1I2AA 3FVQA 821PA 5REQB 2D1QA 3PE4A 4UCQA 3UJPA 1NN0A 2CD9A 3D1VA 2XA9A 3FWNA 4GGPA 1S2MA 4K6GA 4WN9B 4ZU1X 1V7ZA 5AHXA 3CLSD 3U7RA 4C7BA 2B8TA 1A3CA 2BRUA 1XQYA 5CX1A 4F71A 4ZGGA 3OLQA 4ZJYA 5HUHA 1PRYA 2X1VA 1XDWA 3AFNA 1P4GA 1YJ5A 3VVMA 3DMPA 4ENVA 4XR4A 1W35A 4R2IA 2J67A 3FFWA 5A3VA 4N18A 1HE3A 1D4OA 3L46A 4J0GA 5ECDA 3A37A 2ALJA 3H9QA 1P0CA 3R3VA 4OBXA 4XAQA 2IP2A 3N58A 5DM2A 1EVJA 3ROTA 1D2CA 4WNIA 5IRCD 4TRRA 2K7ZA 3DFIA 4YS6A 4X6UA 4LXUA 5LDHA 1IRXA 1TCCA 1XD2A 4IUDS 1G20B 4LDNA 5JE8A 1L8QA 4TZ6A 4OV6B 3X1KA 3EIHA 1VYTA 1RHRA 3VKWA 4D4MA 4IY1A 2PT5A 1KORA 2UVPA 3AHEA 2WG1A 2FEXA 3GJ6A 1GNQA 4MWDA 3FZGA 4QICA 3K4PA 2A5YB 4KV7A 3S1AA 1G3QA 1I3KA 3ONNA 1PGQA 1PR1A 2O3UA 4BIIA 1S2NA 1CP2A 1WDLA 5B4UA 3CKYA 4BB6A 3KD2A 3NC4A 4RE6A 1H5NA 5A0VA 1XUOA 5NLLA 1YE3A 2V6GA 2Z43A 1KJQA 2YIDA 5KS2A 4G3XA 3TLZA 2H7XA 3RHTA 4R8VA 3HCRA 1VHWA 4DWWA 3FJYA 1BEUB 3DW1X 4NRDA 1YB1A 2PLRA 1SULA 1ZS9A 3OPYI 4RDCA 3RTAA 4GAEA 5I7AA 4ZJZA 1BJKA 5KQMA 5F3DA 5DNYB 1I6WA 4XDZA 5A4IS 4J49A 5E6SA 1APBA 3IAS1 1JJBA 1JFLA 3USCS 1A88A 2VJPA 4URYR 5AM0A 3QGMA 1V1JA 3SYRA 1GM5A 3CUTA 3GP3A 4G2TA 1YZVA 4W5JA 1WEHA 3EXIA 4O4IB 3KTOA 2WSMA 3PFCA 4FMDB 5FPSA 1FQKA 5FLEX 1G9TA 3H11A 5FFMA 3WBBA 5EGSA 3X1XA 4DC9A 5CVTA 1UBRS 3QXGA 1O9BA 4G85A 4MV4A 2J8ZA 1WPGA 2XE4A 4AJ1A 1NBHA 4TSKA 4DLVA 4QU8A 4IW3B 4JYBA 3U3XA 2FF7A 5A1JA 2RGAA 3O9VA 3ZHYA 4IMJB 1T3GA 1J07A 4ZCIA 1FBNA 1JXOA 2G6BA 5AKKA 2OR3A 1ECGA 4XCVA 1W48A 2CVQA 1D4FA 4BAUA 4PF1A 3RSGA 2FSVC 4GG1A 1KIAA 4Q9LA 2BAGA 2FQQA 2QRZA 4AMVA 1A2OA 1PJCA 3FF4A 2RK4A 1C3XA 3I1YA