2GCOB

Crystal structure of the human rhoc-gppnhp complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
192
structure length
182
Chain Sequence
HHSSGLVPIRKKLVIVGDGACGKTCLLIVFSKDQFPVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-related GTP-binding protein RhoC
publication title X-ray Crystal Structures Reveal Two Activated States for RhoC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 63
structure length 182
sequence length 192
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gcoB01
1ZUNB 3K0EA 4Q9LA 4CDGA 1COWA 1ZCBA 2BKUA 3ND9A 4L5BA 4FD2A 4MGYR 4F4IA 1J7KA 1JQJC 1CR1A 3JVUA 1Z0JA 2VHJA 4HATA 2QAJA 1GL6A 4DEXA 5KNBA 2IK8A 3AUYA 3I61A 4TN1A 1AQUA 4H9GA 4A8JA 1GG2A 5M04A 1G3RA 2WAYA 4CEHA 2O8CB 1R2QA 3KJHA 1U98A 1G3UA 3KXIA 4NHOA 4LPKA 2ZI3A 1VKJA 5G3YA 1NG1A 2QA5A 4P0TA 2FGJA 3CX7A 4IDOA 4Z8YA 3T06B 4F93B 5TV2A 2YWEA 1M6NA 1W0KD 1P61B 3LQRA 1E79D 4OK3A 4RKFA 1RPZA 3Q9LA 1T91A 4DIEA 3U7HB 2FU5C 2YJTD 3QKSA 3TQFA 2ZYUX 3ZQ6A 2CHVA 3F5FA 4GZMA 1T3HA 4ON9A 1YJ5A 1EX6A 3GFOA 4PHFA 721PA 1LW7A 2CLCX 2GNOA 1UDXA 4NYJQ 4WVFA 5L3SB 2OFXA 2C9CA 1QHGA 1KI4A 4OJQA 2IHBA 2IF2A 1OHHA 2LWIA 4II7A 2G9NA 1OIWA 2FV8A 3ZH9B 3ZIAD 1EXMA 2BKEA 1E2IA 2EYQA 5FOTA 2C8VA 3MAAC 3EPLA 3EPKA 2FFBA 2JAQA 3I4LA 4L8GA 4ILEA 3WMEA 3U2QA 5JS8A 3GLFB 5ANRB 1OXXK 4HB3A 4Q47A 2QBYA 4UNQA 3OIVA 3THXA 3GEIA 4O25A 3QXJA 2O0JA 3GCGA 5EXSA 1E1QD 5TMPA 2R6DA 1QVAA 3FYHA 5KSZA 3OEHD 5D3MB 2FPLA 2GBLC 1NMZA 4GOXA 4E22A 4C7OA 3W5IA 3L0SA 2V6JA 4O2LA 1T9HA 2ZR0A 4FWIB 3RS4A 1ZC3A 1P9WA 3B1VA 1HT1E 4D81A 5IF9A 1KAGA 1NN5A 2WSMA 3LVQE 2L0XA 4PZLA 5E4FA 1GKYA 2WJYA 4DB2A 4XH9B 3IQXA 4N0EA 1RRFA 1JEDA 1SVSA 5BN4A 1N5KA 1G4UR 3CX6A 2ZRIA 1JNYA 3O8CA 2RGEA 1F48A 4LHVA 3K0CA 3REGA 4B6EA 3A1VA 1T8TA 3CRW1 2JJ1D 2CL7X 1T6NA 1YZGA 1I4LD 1PLLA 5FUWA 2A3RA 2XX3A 2NO1A 3RC3A 3X1WA 1KGDA 1E9CA 1KIMA 2RKOA 1AS3A 2ZRDA 4UXHA 5LPNA 2BJWA 2H8KA 3IO3A 1KY2A 2D74A 2DFNA 3SYKA 2R62A 1R8QA 4NL4H 1IN7A 3CZPA 2P2LA 2FJUA 4LV6A 2IEYA 3RABA 1W0KA 2WAXA 1E79A 1FMJA 3MRSA 1TF7A 4CF7A 1VHLA 1F5NA 2QY9A 4UQOA 1HV8A 3R9WA 3TVDA 4F91B 1XU4A 4ESHA 5JSZB 1D2NA 5FOWA 4A0RA 3SOPA 4K46A 3BE4A 4EJSB 1KMQA 1XEWY 1S9DA 3MWJA 2JJ2A 4JVLA 2VSXA 1I2MA 3T1TA 4RVCA 1TADA 1TL7C 3EC1A 4IVQA 3ZIAA 2F7SA 2CJWB 3A1TA 1TU3A 3MMPA 4R71A 4M53A 3C8UA 1E2JA 4KBFA 2C9OA 2EFGA 2A5FA 2ASEA 2ZE6A 3UXMA 4F7WA 4XVUA 3TKLA 4MQBA 4FMCF 4DLYA 2ZRKA 5KDLA 4D26A 5FTKA 3P27A 1A2KC 3EIQA 4LJ4A 5GJBA 4W7SA 1BS1A 1PJRA 4RJLA 3VAAA 3PJRA 2ZUCA 3FHTA 1L4YA 3EWSA 3EZFA 3AVOA 4HI0E 2KSQA 2ZRMA 4MRNA 2ZU6A 4AURA 1N6KA 2BHRA 4LRWA 4DLUA 3AKEA 4GSYA 4MUBA 1P62B 2ZRAA 5F98A 4Y0VA 5HCNA 3W6OA 4CEIA 3SYLA 3KJIA 4KLZA 4JSTA 4ABYA 2VSFA 1R5NA 1G18A 3CNLA 3RS0A 2R2AA 2IL1A 3ZJYA 1XCMA 1GOTA 2GEVA 3FKQA 4B34A 1GZSA 1OFTA 3H84A 3DOFA 2PEYA 1FFHA 2XTZA 5C1BA 4BGDA 4YDHB 4DDUA 2CHGA 2XJ9A 4BUJA 3LX8A 1ZP6A 5DN6D 4HAWA 3OIUA 4ZI3A 2JLQA 2GVZC 2XEXA 3KQNA 4M8NE 2V3CC 4M2LA 3AVWA 2VF7A 2DB3A 3DM5A 2J7KA 1G3IA 2QE7A 5AJWA 3B60A 4LC0A 4LHXA 3K0AA 1NNEA 4QGGA 421PA 2YC4C 2DPXA 4DC9A 4JMPA 2JJ1A 4E03A 2V54A 1QHIA 2HXSA 1AQYA 4ITRC 4Q7KA 4GI7A 3KX2A 1ODFA 1FX0A 1YHNA 4OQMA 5AR1A 4TQ9A 3LBIA 2H16A 4CRWB 4FMDB 2QENA 4YMVA 2WMOB 2CXXA 2PMDA 4G5OA 2ONKA 1G291 3RSOA 3H1TA 1Q1ZA 4H1VA 2BCGY 1XMVA 3R9IA 4KVGA 2C04A 4RCYA 4Z1MD 2JLZA 1MO3A 4JKIA 4BFXA 4BLSA 3GJ3A 5JHGB 2RCNA 2PH1A 4XSGA 2HCJB 3VNUA 1WE2A 2QNRA 5TY0A 3C16C 2WPDA 3LWNA 3GLIE 4EFLA 5KPJA 2WJIA 3B1YA 1E2PA 2ZI6A 4AKIA 1QHHA 4JKYA 3SJCA 3RVBA 4KO8A 5AUOB 3KUDA 1K5DA 3KKOA 3EWAA 3QI2A 5DIFA 5GJWC 1KNXA 4P4TA 4QRHA 4PC3A 4MRPA 2ZXUA 2GF9A 3NKVA 1ZRHA 1OV4A 1G1MA 1HY3A 4RKEA 1HTWA 3SJBA 4Q4LA 3MWKA 2RMKA 5EE1A 1M74A 4PPFA 4DCNA 2F43B 5JRJA 1G9XA 1RJ9A 2ZS8A 3MSXA 1SQ5A 4LK2A 2QU8A 1WCV1 2J87A 3AKCA 4B48A 2ZTSA 4PQYA 3K9NA 1Z3IX 2DFTA 5HKKA 1T3SA 1L8QA 2FMXA 4B43A 4BZXA 3Q7PA 1N0VC 4W5JA 2FWRA 1EG7A 2PZFA 4MYTA 1CP2A 1VECA 1ZW6A 2YOGA 1Q1QA 4EPRA 2BVNA 3TIFA 1NMXA 2C99A 5HCIA 2XOKD 2CL6X 4C0SA 3B7GA 3HR7A 1HE1C 4ZO4A 1LVGA 2P3SA 4B33A 1GKIA 1E94E 4ZCIA 3IKJA 1X86B 2DY1A 3NVAA 2D06A 1X1SA 5C2JB 4EPTA 3HU1A 2ZM5A 5DN6A 1SGWA 2JGNA 4QJ5A 3FDIA 1UBGA 2IYUA 2GWHA 3TH5A 1KSFX 4LBYA 2GCPA 2HDNB 1G21E 1QHYA 2O8FA 2G77B 3PEYA 1A5TA 2Q3FA 4C0JA 3THYA 4FMBB 3GLHA 3T1OA 1OB2A 3EA0A 4ZKDA 5JI2E 1UBCA 5JCPA 3A8TA 2FZ4A 1SXJC 4RFSA 4WBSA 3SHFA 4TL7A 5HE8A 4ZCLA 3EZ9A 2JATA 2YOFA 2VP0A 2YNMA 4PC6A 2FFQA 3T35A 2A78A 3K0FB 3I5YA 2ZRGA 3CBQA 4BWYA 4CYMA 4LBZA 4D0GA 3W9YA 4TLCA 4IOLA 5FI1B 1JXMA 1N6PA 2AWOA 2PCJA 2RAPA 2IEZA 2FE4A 1IXZA 2WMNB 1XMJA 4Z1MA 3A1SA 3OZXA 4C0LA 1Y63A 3C4JA 4AK9A 1N5JA 3UANA 4KITB 1XD2B 5HE9A 3VR5A 4B6FA 1OT3A 1BYIA 2QG6A 1Z28A 2OCBA 3CKLA 2HLDA 3VX4A 1IOZA 3ADBA 3ZLJA 3CRRA 5HZKA 2OUKA 2WM9B 1Z29A 5J40A 3CWZA 4F38A 3NBZC 5KYKA 4AC9A 4F4JA 3K0SA 3LBNA 3AVXA 2HJGA 2FFHA 3GLGE 1G7CA 2GZAA 2J45A 3L0IB 3CM0A 2JASA 1XWIA 4MKHA 3C5CA 1ZUHA 3KXKA 4Q4HB 4TYYA 3T12A 1FUKA 2F9LA 3EW9A 4EPYA 1EWRA 4IRUB 1E2QA 2IWHA 3CH5A 1Z22A 4M22A 5K8IA 4OKSA 1HURA 3EASA 3T61A 1T0HB 4URUR 1E2HA 1DARA 1VG8A 4LZZA 3X2SA 1G8GA 3EAQA 2ZRFA 4LJ7A 2WOJA 3FKSA 2V55B 2N46A 1VIAA 3AVPA 3RS2A 1CBUA 3O8DA 4LV5B 3K09A 1JAHA 1LFDB 3RLFA 4C0HA 3B9QA 5HPYB 2VP2A 3I5XA 2HEIA 1QHSA 1H8EA 2BEJA 2ZIAA 4UJ5A 4X8LA 5EP4A 3GD7A 3AGQA 2GK6A 2OBLA 2OCAA 4IJMA 4Q48A 2JA1A 1T0JB 5IDVA 3T5DA 4DBLC 4DJTA 1E2DA 1O3YA 2QP4A 3KTAA 4HUQA 1U90A 1QF9A 4HB2A 1J8MF 4TMZA 1YE8A 3U5ZB 2WVJA 1KI6A 3FHCB 2NZJA 2ZVQX 1SXJD 3CF6R 2GDJA 3IIKA 2DCUA 4TYQA 4G5RA 4HDQB 2VHTA 1TMKA 3OE7D 1F2TA 4M21A 2YVUA 4GOKA 1G19A 3WXMA 1DAEA 1ESNA 3B85A 1WP9A 2WWHA 4M1MA 1UKZA 1AGRA 4NCNA 1NIJA 3EC2A 1WMSA 2IUTA 1UPTA 3FMOB 2YYZA 4TLEA 2GETA 1NVXQ 4CIDA 1JI0A 2BCJQ 3VR2A 2GJ9A 1NJGA 3KKMA 3Q5EA 5P21A 2REBA 2RGCA 3DOEA 4D4LA 1PVOA 5CDFA 3KFVA 4US0R 3CZQA 3U3OA 4TZ6A 2C95A 3FPAA 4JLBA 2ZJOA 4JVMA 2K5UA 1CJMA 4Q02A 4QJ4A 1SKQA 4AG5A 2G88A 1NRJB 4KI0A 4UKDA 2XAUA 4IOKA 1ZNXA 1DS6A 2XNSA 3IHWA 4LOAA 2EW1A 1AA9A 1US8B 2G0NA 4HLCA 2IS4A 4XVQA 2YWGA 4Q1EA 2QEQA 3A36A 5H1YA 2O8BA 2E1RA 2R6FA 5FTNA 5BYJA 1UBFA 1XJQA 3M1IA 3H0KA 2IYWA 3CUEF 4CT5A 3ZVLA 4OQNA 4Q19A 4CEJA 5LD2B 4IW3B 1KDRA 4CZ2A 2PT7A 2QGNA 4PTLA 1NBME 1T3LA 4WA7A 5FR1A 2J9RA 2XITA 1KAOA 1DG1G 3ETLA 3FHOA 2ZVPX 1OXVA 3X1DA 1OH5A 4OI1A 2RGNC 2B8TA 3A4MA 3UPUA 4Q9IA 1XMIA 5JECA 4IXNA 5BXQC 4A0FA 4ZIRA 3U3MA 2E87A 1II8B 1IN8A 2FNAA 4HLUC 4K81B 1Y3AA 3I73A 5EQTA 3GLGA 3WNCA 5DSZA 3MCAA 4A8JB 1UDWA 2DBYA 4GZLA 4NCHA 1P7CA 2JLUA 1G7SA 2ZUBA 1E4VA 1FUUA 1FW6A 4FN5A 3DZDA 1HEIA 1ZD8A 3PUWA 4BFSA 5EP2A 1KJYA 2VRWA 1E2LA 3AV0B 2JJ8A 1SXJA 4MH0R 2AFIE 1P6XA 1N2CE 5K8LA 3GJ7A 1QHNA 2AWNA 1E3MA 1YR9A 1W4CA 2OEPA 1AM4D 3UG6A 1KO7A 4AWXA 3KQHA 3E70C 2ZAMA 3W6NA 3TUZC 4A6PA 1Z08A 3I62A 1HA3A 2PCLA 1AKEA 4Q7LA 1GSIA 1JJVA 3QKSB 1D6JA 3E1SA 4HEJA 4RD4A 2V6IA 1EFRD 2OLKA 1E0JA 3TSOA 4ZCMA 1Z47A 1OFIA 1JPJA 1MKYA 2BDTA 3IPYA 1R0YA 4NDZA 1XMSA 5CK4A 3PEWA 1W2GA 1CS4C 3CPJB 3DHWC 3A37A 4PAMA 4A92A 1XPOA 2WKPA 3K0CC 1ZM9A 2AL7A 4PZYA 1U0HC 1I4DD 2EQBA 3X1ZA 1MO4A 4AYXA 4DT1B 2RGBA 2AK3A 3DKVA 4B2IA 2QPAA 1DAFA 1NY5A 1W1WA 3QXCA 3HWSA 4QBFA 2VHCA 4C0KA 1R0XA 4QHSA 3HU3A 3LXRA 1JR3E 3KFXA 3LY5A 2B6HA 3BB1A 1HQYE 1DVRA 1B0UA 1NVWQ 3SFZA 2QBYB 4KU4A 2AKAB 2BMEA 2QROA 3CIOA 4BEBA 4CGZA 1VCOA 1UF9A 1Z63A 2AXNA 1FOEB 4IEEA 3VQTA 1KKMA 2VLIA 3L0PA 2BMFA 5FFMA 5TARA 1KNQA 2C9YA 4DCTA 4L9WA 3EZ6A 1MR3F 1LB1B 1Z07A 1R10A 3M4YA 2WZQA 4DLZA 4PZZA 2D7DA 2ONJA 2HV8A 2QGZA 3FWYA 2Y8EA 2OO7A 3AH8A 2AKYA 1EX7A 4RD3A 2IYLD 1ZVQA 4IDHA 4QGFA 1SVMA 5B58C 5GJCA 4XIGS 3P32A 2IYQA 1J90A 5GVSA 5CIWA 2PJZA 4XWAA 4J0QA 3DKPA 2J0SA 2REXB 1RYFA 2R6AA 3NTUA 2IF0A 1XJCA 2FDCA 4PO1A 2G83A 1DAIA 2VL7A 4LGMA 3VR3A 1AK2A 4B73A 5FI0B 3QXSA 2ZUDA 3R7WA 2V1UA 3KJEA 3QPUA 5FBWB 1RVDA 4PXAA 3VU9A 1KDOA 3ZS9A 4EQ6B 1WA5A 1PZNA 2QN6A 2FSFA 3AKDA 5JCZA 4I99A 1CJTC 4B3XA 3JVVA 2ODNA 5EXXA 3NDPA 5JS7A 4IEIA 1EFCA 1EESA 2N1BA 3O47A 4FXPA 3NXSA 2FF7A 2FH5B 4S35A 4ACAA 1XZPA 4JS0A 1ZUIA 5FBLB 3NIBA 5DI3A 1U81A 1BO6A 4IDQA 1F2UA 4QBIA 1GL9B 1KJWA 2WWIA 3AP2A 4OK5A 2W83A 1EFRA 1CULC 1Z8FA 5E3HA 5KSPA 1ESMA 2ODWA 3B13B 1AGPA 2QP3A 4KSBA 4KBGA 1NVVR 3ICQB 3GEHA 1X8LA 3OEED 4RFVA 2ZJ5A 5FOUA 1G5PA 3SR0A 4A2PA 1ZM7A 2KWIA 4US1R 1N6HA 2ZEJA 4L9SA 2ZSFA 4B3FX 3ICEA 1ZINA 2IXFA 5EE9A 4EIWA 3I72A 1ONBA 1SKYB 1KMHA 4B71A 1XCPA 2XJ4A 4V0ME 5G41A 2ATVA 1E69A 1DADA 3U61B 2ZJ2A 4OYHA 4EPVA 2G3YA 3AQ4A 2O8EA 2PT5A 3B1ZA 4QNRA 3WMFA 4G01B 4BFTA 4JLNA 3IDQA 3EIEA 4M1WA 2BC9A 3N2EA 4POAA 4ZDWA 4BLQA 1UKVY 3WBKA 5J4KA 3BH6A 3GMTA 3ASZA 1SKYE 2PLRA 2XXAA 2JJ2D 2ZJZA 3IIJA 3IIMA 2RGDA 4N3NA 2RGNA 1FTNA 3V4FA 2PZEA 2OFWA 1Z0FA 2XNDD 2Z43A 3GJXC 4CEIB 3CPHA 1XD9A 3CR7A 2HYIC 3IUYA 3I3SR 1GFIA 4LYFA 5FTJA 3WNBA 2OSBA 4D6PA 1IONA 4JLDA 4BLTA 4HLUA 4DSUA 2OM2A 4L15A 3PR1A 5C46F 1D2EA 2J0QA 1IAQA 1MRNA 1HH4A 5E7IA 4QJ3A 4M9XA 4XVRA 1PLKA 3RC8A 4HAYA 2ZRLA 3THWA 2I3BA 2IW3A 2QI9C 2ORWA 2YWFA 2VP6A 5FR2A 2VHQA 1XEXB 4MGZR 2ANCA 3MLEA 2WWXA 1J2JA 2GVDC 1RC8A 3QKUA 3BWDD 3K0AB 3AVVA 1IHUA 1L7VC 5DHFA 2Z0MA 3GLFE 3IHLA 1ZYUA 2GJ8A 1ZD1A 1BH2A 1W4BA 2X2FA 5BN3A 4PC2A 1G16A 1CU1A 4PO9A 1G64A 3H86A 3U4QB 2QT0A 1R4AA 2WV9A 3GJ8A 4EUNA 4BFVA 3EZ7A 2CCKA 2GZHA 4YMSA 1CJUC 1CRPA 5EXTA 3BIFA 1YU9A 4U7DA 3SE0A 4OHXA 2YWHA 4NZYA 4XSHA 4I1SA 5FPYA 1XB2A 2KBFA 2O0KA 2E9SA 1ZNWA 2CCJA 2QE7D 2XTMA 4WOPA 4X8OA 5J4LA 1KI8A 1VG0B 3F3YA 1JXOA 1Q3TA 1YZUA 3BORA 3I1FA 2H17A 1S3SA 1AJEA 2VEDA 2XB2A 2CLSA 2OLJA 4Q00A 1XTQA 4I81A 1QG4A 2H92A 3TUJC 5A4JA 3KZ1E 1QHHB 1UJ2A 2BBTA 3WP1B 2GILA 2HXYA 2B8WA 3OEEA 2CK3A 3QKRB 4Q4JA 4TMXA 4TSFA 4URZR 4DKXA 3QG5A 4JSYA 1ZD9A 3CNNA 5JHHB 4WXPA 3A4NA 5EP3A 5JWOA 4DHEA 1E96A 2UKDA 1YZTA 1H8HD 2O5VA 2GHIA 2PX0A 3T5GA 4F4CA 1XTIA 1W36C 2R44A 4AYTA 2NPIA 3W90A 1YR7A 3DDCA 3A58B 3ZZTA 4NYIR 1RRGA 3B2EA 1KK3A 2WPDD 1ZIPA 1EWQA 1KI7A 2FPMA 2ODBA 1C4OA 1XEWX 4KXFB 5DO9A 1E32A 1KI2A 3SYNA 1UADA 1I4TD 4LJYA 1G8FA 1IBRA 1QHXA 5H8WA 2X19A 1AZTA 2XNDA 3ND8A 5CB6A 4RD2A 1XDBA 2QMEA 1CJVC 3NHAA 4MDEA 3SDZA 5EP1A 2WJJA 5BQ5A 4FMCB 2A5YB 5G53C 3SFVA 4M4SA 2ZSDA 4DVGA 2D4HA 5EJEA 4MGKR 2QRZA 2NMVA 4NBSA 2WJVA 3QQ5A 4MUAA 4Q66C 3UWKA 1LF0A 1KK0A 3NEJA 1DOAA 4V0MA 4EPWA 2HT1A 1VDZA 4EKDA 3PXGA 1RKBA 3AEZA 4B32A 5HKKD 1G3QA 2Q9CA 1VPLA 2IYRA 2DFLA 3OF5A 5H70A 5AJZA 2WKQA 3AUXA 2O8FB 4Y0AA 3TSWA 2GXAA 1E6CA 4M9ZA 3GLHB 2O52A 1VG1A 3SHWA 2BM1A 2GJKA 2OXRA 5DE3A 3KKNA 4BLOA 3RS5A 1XPUA 5KHOC 4NYMQ 2GAAA 4KV9A 2TMKA 3Q8XB 1CR2A 2CDNA 1Z0AA 3RRZA 3K53A 1HT2E 3P4XA 1G17A 3K09C 1Q1EA 1E98A 2FSHA 5H68A 4CT4B 5L3SA 2IYZA 2AFHE 2I1QA 2ZI7A 2Q0HA 3IEUA 1QVRA 2F1RA 4MDFA 4EFNA 4MRRA 2A5JA 2NO6A 3LFUA 3TMKA 2WWYA 3UMSA 4JLKA 1TQDA 5J4HA 3HDTA 4U5XA 5EUMA 4A36A 3FB4A 5JJIA 1WBBA 1P2VA 2NOAA 4UNPA 1YQTA 1E2GA 1KDTA 3GJ5A 3A4LA 3MWYW 2J1LA 4G1UC 4DSOA 1E2EA 1MT0A 4NU0A 1W36D 2BBSA 2MSEB 2JLSA 4FW9A 3IO5A 2P65A 1Z2CA 2VP5A 2JLYA 4Q18A 3DPUA 5FBQB 1H8HA 1P9RA 1G8HA 2OT3B 3ZZUA 2BMJA 4URVR 1FP6A 3W34A 1OF1A 1EGAA 5EUQB 2XZPA 1XX6A 121PA 1U8AA 3VFDA 5KNDA 1E2MA 1G5RA 5L3QA 4NCKA 4QGHA 2H18A 3UIEA 5CJPA 2HLDD 4BECA 4D25A 4JZKA 3N70A 3O8RA 2WHXA 2QM7A 3IBGA 2LCFA 1EFUA 1W46A 1K5GA 2ZS9A 2J5XA 2ERXA 4IHQA 4MKFA 2BOVA 1A82A 4MYHA 3VHLB 5JI3E 3HYTA 3LAWA 2B21A 3HP1A 1QG2A 4G0NA 2RHDA 4EDHA 1N6LA 2IXEA 4KODA 5G40A 3WNDA 2P5TB 1N25A 2ZPTX 1BMFA 3N2IA 3W3AA 1FZQA 4TYPA 2J0VA 3B82A 3BJIC 4DLXA 3A1WA 3RAPR 5K8TA 4V0NA 3D8BA 2QSYA 4RZ2A 3KTAB 2XSZD 4P4SB 2ZU0C 4MRSA 3CNOA 2VSOA 1SVLA 1KI6B 3AVYA 2HCBA 1BYUA 3SBDA 4YMWA 2AD5A 4JLOA 5KNCA 3FKSD 1SVOA 3K1JA 1F2TB 1SVWA 2MMGA 1F6BA 1ANKA 1KZ7B 5KSOA 5B2ZA 4R2HA 4URXR 4OI2A 1H8ED 2VIIA 1XP8A 2F55A 1DO2A 4PAOA 4L16A 1M34E 3SZRA 3AF4A 2WTUA 3VKHA 1TF2A 1KO1A 4MGIR 1OXTA 1K8RA 4LC1A 3E5HA 5JSZA 2ZSAA 2RB4A 1DO0A 1OKKD 2G0TA 3PFIA 2BBWA 2OG2A 3JZMA 4Z54A 1IY0A 4M1YA 2QT1A 2OESA 4A6XA 4F92B 4A4DA 1R8SA 2FG5A 1XFAA 3LW8A 3WMGA 4BFZA 3QPWA 3AM1A 2DWOA 4NONA 3RSLA 2GA8A 1IY1A 1D9ZA 1E9FA 5AJVB 5DYIA 4DLWA 2KE5A 5JMTA 1NN0A 1H65A 3KDSE 2O8BB 3ONWA 4A15A 2JDID 4DZZA 1Q22A 3KXLA 1OPXA 2OE2A 1YZNA 4OK6A 1OYWA 3IILA 2F9MA 1YZKA 2WBLC 4NPHA 2ZETA 3SJZA 4WAUA 2D7CA 4NYJR 4CEJB 2ZRBA 5DI9A 4OHZA 3OAAA 2WWWA 3GFPA 4LSGA 2CHQA 4DCVA 2JLXA 4HZUB 1IXSB 4BE7B 1GITA 1U0LA 4KYIB 3GPLA 1HYQA 2J7PD 4MA4A 2QZ4A 2ZSEA 1DG3A 1X8KA 5FOSA 3UK6A 3AGPA 3EG5A 4WW0A 1SHKA 2C2HA 2X1VA 2JEOA 2QQEA 3BERA 1M7HA 1D8TA 2BBOA 3QNUA 4H1UA 4ZIRB 1FL9A 2OILA 5SZKB 3GP8A 4OHWA 4ZDIA 2EFDB 2EU8A 3K70C 3QBTA 3PUYA 3UMRA 4BQSA 1T4GA 1E0AA 2NO9A 3ZQJA 4P33A 4M0LA 2XSZA 4PHGA 1HUQA 4Q7JB 3BS4A 1OJLA 4OHVA 5JBQA 1TEVA 1V43A 1U0JA 2OCYC 3T34A 4UXIA 2W00A 1XXHB 2HT6A 5CYPA 3DL0A 1SXJB 3NC0C 4KVAA 3SI7A 3Q7QA 1M1YE 3B9PA 1OXSC 4TL9A 4BFYA 4JYBA 5IRCD 1MABA 3C7KA 3LNCA 2ZRPA 4PANA 1GIAA 1P72A 2Z83A 1OW3B 3GLIA 3ADDA 3WYAA 3MWLA 3R8CA 1GTVA 1PLJA 1DAMA 1KZGB 4PX9A 2F3RA 2IHYA 4PSKA 3B5JA 4M1SA 2XZOA 4OQXA 4YLGA 4US2R 1IXRC 1BKDR 4ARZA 3ZD7A 5TXGA 4DWJA 3DEFA 3DMNA 4PHHA 2C77A 3TSZA 4ASUA 1FPMA 4M1OA 1W0JD 3LBHA 8OHMA 1OKKA 2EVWX 5JJKA 2QMOA 1DAKA 1S2MA 4LHWA 3EIHA 2EYUA 1U9IA 1AS0A 1KO4A 1GDDA 5AJXA 3SS8A 3ZGXA 3D6TB 4HLDA 4LJ6A 1U8ZA 1CIPA 1OH6A 1UKYA 2V1XA 3B1WA 1T5LA 4LJAA 4DUGA 4FWTA 4HAZA 2ZYTX 4Q5IA 3QOFA 4I4LA 2W6JD 2JDIA 1KSHA 1CR0A 3TVTA 1DAHA 2A5GA 2PJRA 1TUEA 2OV2A 4UNRA 2FGKA 4JYCA 4Q4AA 5FPTA 1UKEA 3U6BA 1PUIA 3V4RA 2J59A 1QRAA 1XJ0A 1KOFA 3CLVA 3EARA 1TNDA 1U94A 3HYRA 1XTJA 2QTFA 3MJRA 1U8YA 1IJEA 4XTRA 4XWOA 3AB3A 3W6PA 5KPDA 2VO1A 3QVUA 4LCBA 5E7JA 1NKTA 2J7PA 3EX7C 5AUPB 2A9KA 4N0DA 3RYTC 1IM2A 3K70D 3ZVMA 2J0UA 1QBKC 3U44A 1R0ZA 1VYTA 4JJZA 1D5CA 2ZAOA 2V4ZA 3I8XA 3QE0A 3SQXA 2CBZA 2AHOA 2FN4A 2ATXA 4DLSA 2ODEA 1N0UA 1DTSA 4JBYA 5AUNB 1KDPA 2CLDX 4YMUA 2WIBA 3MD0A 5JEDA 5J47A 1DPFA 5L8VA 1RRCA 4Q9JA 2IYSA 1X3SA 1GNRA 5FUXA 1XTKA 2EFCB 1ZNYA 2NTYC 2QL6A 1AIPA 1XF9A 4KJZA 1Q21A 4NYMR 4R9UC 2IWRA 2V9PA 2JLWA 3RNLA 1DE0A 2PZGA 2ZQ5A 3K0FA 3HJNA 3OIYA 3GJ4A 3RWMB 4Q7MB 4XOIA 1KHTA 4C3ZA 5FPKA 1Q57A 4BPBA 1BOFA 1J8YF 4LYAA 4LYJA 1G6OA 4LY6A 1WXQA 1T5IA 4A0HA 1F2UB 2X2EA 1N5LA 2GCOA 1NN1A 2GJSA 1LNZA 1OIXA 1ZNZA 3QKTA 1F3OA 5KTYA 2V8OA 2CE2X 3IGFA 3WY9A 2C78A 4CEHB 2CL0X 1W0JA 3PQCA 1NBMD 3T15A 2OHFA 4V0KA 1Z0DA 4WIAA 2PBRA 3CRMA 1E9RA 2OAP1 2QTVB 1KMHB 2P67A 1G4AE 4O2RA 4Q4HA 4TMKA 3PG5A 2O8EB 3H2YA 2R6CA 4GT1A 4QG7A 1Q20A 3B6EA 4OQLA 5FTLA 1W5TA 5CJ2A 3NDBB 2W6JA 2IA5A 4B35A 3NBFA 5EXPA 1Z6TA 3W5JA 3C15C 2ZRNA 3VR4A 3ADCA 1IN4A 5FUVA 2VHUA 4LX0A 4UNSA 1WDTA 4WZ6A 1W4AA 4E09A 4DDVA 4RZUA 2ZR9A 1W7AA 3GEEA 3L0OA 3TBKA 5JRZA 4XD7A 1S96A 2GRJA 3CRVA 2QAGC 1G6HA 1OSNA 2WICA 1CLUA 1Q0UA 2R6GA 4KSCA 4UJ3A 5CB8A 4HYYA 2IYYA 4P32A 3C5HA 5LB4A 4O0MA 2SHKA 5TB5A 3THWB 2ZJ8A 4V03A 5CYOA 3W3ZB 621PA 3THXB 2F1HA 5DHAA 2WIAA 1MV5A 1GP2A 2W0MA 1Q44A 3AF2A 2FOLA 3UWOA 5C4MA 4MKIA 3VKWA 3X1YA 1GNQA 4C7OB 4NMMA 5B30A 2YV5A 4GDFA 1AN0A 4GMDA 1VCNA 1S9HA 4JBXA 3SEAA 3T1QA 3CO5A 4U00A 2P6UA 2ZJAA 4DLTA 4QBHA 3LD9A 1ZCAA 1ZU5A 3QBVA 4HLQB 4PFSA 3CF2A 3TJZA 4DRZA 1S8FA 3FE2A 1P9NA 3KL4A 4Q9KA 5FBRB 1JR3D 1E2FA 1GVNB 3BB4A 4GFDA 1NG9A 2IUSA 2C5LA 4B75A 4C0BA 4Q1FA 3TAHA 1JPNA 4BEJA 2CVHA 3HR8A 5B57C 4RSGA 2NG1A 1Q3HA 1XRJA 2H57A 1M2OB 4AD8A 4TZ0A 4MRVA 1M7BA 3IQWA 1NKSA 4Q4JB 5EE0A 4B2LA 3EPHA 1NBMA 1YZQA 2H5EA 1NLZA 2JLRA 2W6ID 221PA 1ZU4A 4LBVA 4LI0A 2HJVA 2ZRCA 3RS7A 1GL7A 2QMUA 3RS3A 4AKEA 4B2PA 3N5CA 2DWQA 4QHYA 4ZPXA 3KB1A 4KFTA 5GJVC 3G82C 4FCTA 1TQ4A 5AJYA 3DMDA 3S1AA 3J81k 4JLAA 2NQ2C 2D62A 2IC5A 3CB4A 1W2HA 2W2XA 5CM9C 2OZEA 5FOXA 2IYXA 3BOSA 4GP7A 4QHTA 4FI3C 1JR6A 2FPKA 2V7QA 3IBYA 4I1OA 4EQ6A 3L43A 1A2BA 2CK3D 4TSFD 4TLBA 2OCPA 1HE8B 2NZ8A 4KAXA 3VR1A 1II8A 3AVQA 1W4RA 1CKEA 1LS1A 3AKYA 5CIQA 4ZDJA 5JLJA 3PCRB 2IUUA 4TMVA 4EFMA 3FMIA 3CF0A 3O8BA 1X1RA 2Q9BA 4AYWA 1DAGA 2VYFA 1XBTA 4GP6A 4LJ8A 5EZ5A 4BASA 4TL8A 2YOHA 3PV0A 4JT4A 4RZ3A 2Z6VA 1Z6YA 3TGPA 1LTQA 1M7GA 1E9DA 3QY0A 4M9QA 1N6RA 4TTPA 1TPZA 1WBDA 1UFQA 2OXCA 3KQUA 1JJ7A 6Q21A 4AKHA 3BXZA 1L2TA 1Q12A 4JL8A 1R7RA 2QPTA 4PC7A 5FBVB 1UBEA 1AKYA 2Q3HA 3EXAA 1YRBA 2KBEA 4DB4A 3VNVA 1S1MA 4DDTA 1JR3A 1KO5A 4NTZA 3SJAA 4QC2A 5IT5A 1WF3A 3D31A 4JT2A 2ZROA 5CLQA 4NP6A 3BAFA 4ZI2A 5A5GA 5HTKA 1KI1A 2FSIA 4R2IA 5FTMA 1MO6A 4DT1A 1C9KA 3OFNA 4YC7A 4C2TA 3EPJA 1I2DA 5L3RA 4JVSB 2KB0A 3PUVA 1GRQA 4TLDA 1RFLA 5D3QA 3A6PC 4HAVA 4IKEA 3QF4A 1FX0B 3TUIC 3QEOA 4FCWA 3QIAA 4DSTA 1D2MA 4DCSA 2W6IA 5FL3A 1W47A 4O3MA 4Q9HA 1IQPA 1IY2A 1S3GA 4QBGB 3ZDQA 4Z51A 2FZLA 3QEJA 2EFEB 4A0GA 1Z0KA 4G3XA 1KTVA 4KCGA 3B8HA 4IFEA 1LY1A 1ZMXA 4YONB 4YXWA 3RRYA 2NPFA 4LHZA 5KDOA 2IS2A 1E9EA 3WHKA 2KI5A 5DISB 3TE6A 5L3QB 4BFWA 1KI9A 3BFXA 4EJSC 2D3WA 2QSZA 2VPPA 3KJGA 4LYHA 5UKDA 3G0HA 4HSEA 2QAGA 3LXXA 3M6AA 3CWQA 1MH1A 4NE2A 521PA 1YZLA 3KKQA 4YDSA 1U99A 1A1VA 4HB0A 1SVKA 2GEUA 5HZHA 3NEYA 1GRNA 4N1AA 5JFGA 1TQ6A 2BMDA 4HDCA 5KDDA 1S4QA 4FCVA 4NCJA 3AF1A 5CITA 5KOYA 4JLMA 4QNMA 4Q21A 3K9HA 3P1JA 4IOMA 2RGXA 1N6IA 5FPSA 5KSYA 1CF4A 1WQ1R 3VTKA 1AS2A 1KKLA 1NY6A 1ETUA 3BGWA 4D4JA 1EFTA 3L8ZA 3SBEA 1RJ9B 3C41J 3D3QA 1C1YA 1YR8A 4R7ZA 1CRQA 3OESA 5HR5A 2CVFA 3ZZ0A 2PLFA 1RZ3A 4IVPA 2O8DA 3F8TA 3FVQA 3I32A 5C18A 2R65A 2FEMA 4AI6A 1XD8A 2ERYA 3U3JA 4P3YA 2I4IA 1KSJA 1RW4A 2NGRA 2YC2C 1SVIA 1G8PA 4LDJA 1BMFD 4NKRA 3SN6A 1E0SA 1OXUA 2ECKA 3PITA 3WYGA 3W8NA 3U3KA 3QXXA 4HB4A 2J41A 4TT3D 4RCZA 2O8CA 3L8YA 2MMCA 1OYYA 5C4GB 5GVRA 1VCMA 4LHYA 1JAIA 3TNFA 1UEIA 2GCNA 2P5SA 1KSGA 1E99A 3G5UA 1DBSA 2A5DA 3K8YA 2JCSA 2ZI4A 3CRQA 3QENA 1CTQA 4Q03A 4TQAA 3WHLA 3NH9A 3QSYA 5KU1A 3THYB 4LJ5A 1IN5A 1G5TA 1QZXA 4TTRA 5SZHB 1RE0A 1KJZA 4RFSB 4ZKEA 1P2UA 2BM0A 2WJHA 2I1VB 2ZITA 2IYTA 1W36B 3RANA 1ZM2A 3FFAA 3DO6A 1DEKA 4OJKA 2ZE7A 2ZSBA 4ZDKA 3GLHE 1OH7A 1NP6A 3L82B 4L4UA 3AVUA 1E1QA 4XWKA 1VG9B 1IJFA 3KB2A 1NSTA 1P5ZB 3OEHA 1GKUB 1FNNA 2NO7A 4AG6A 4IDNA 1TQ2A 4PPGA 1N6NA 5IHPA 5F9HA 2Q21A 1P73A 1W48A 2FSGA 3QJYA 4KHZA 4E07A 2KJQA 1TF5A 4HZIA 3GLFA 4JLPA 1E9AA 2LKCA 2ZE8A 3ECCA 5J5CA 4BRWA 3OHMA 1U9IC 1MO5A 2QUZA 3Q72A 1NJFA 3LX5A 1PV4A 2HUPA 3ZVRA 1SHZA 2QM8A 4QGAA 2Q3MA 1YR6A 5DH9A 4M1TA 1NI3A 2W58A 1XEXA 1L4UA 2ZJYA 5GADl 4IFBA 1YKSA 1JQLB 3PEUA 2J46A 3VKGA 2Z4SA 3SNHA 2FEOA 2AD1A 3OAAD 5SZJA 4D4KA 2OBNA 3WYFA 5D3MA 5FUYA 1R0WA 4IDPA 1KYIA 4RD6A 2BEKA 4B74A 3IPXA 3U60B 4A9AA 2D2EA 4IOJA 5B64A 3U4QA 1TAGA 1E0KA 1EK0A 2XB4A 1X8JA 2Q6TA 1MABB 3D7MA 5AUQA 4D82A 1ZJ6A 3L2OB 5LB2A 2P0EA 3GLIB 1RYHA 5CLLA 1XEFA 4JL5A 1G7RA 4FMDF 4Q1DA 2DFKB 3DVLA 3NBYC 3P20A 3U7EB 2P6RA 2GEDA 3LVRE 5LDDC 4OQFA 3V00A 1FTSA 4HDOB 2QP9X 1IN6A 2QMHA 2B92A 4I1VA 4QL3A 4ARZB 4LJ9A 4V02A 4OBEA 4HUQB 1KK1A 3BD9A 4C2UA 3FOZA 4LBWA 2OBMA 4NH0A 3MGCA 2FX3A 4TT3A 1B23P 1ZIOA 4G5SA 2G1KA 4XJXA 1E2NA 3QKRA 2ZRHA 4DLRA 3P26A 2Q9AA 3CH4B 4RY2A 3R8FA 2PMKA 4Q1BA 3GJ0A 1TX4B 4P31A 4GMXA 4HUTA 1VCIA 1YVDA 3NC1C 1E1RD 1FQJA 2UVQA 2BV3A 4OL0A 1XNJA 2CNWD 2REOA 3MFYA 5IK2D 5KO2A 3ZD6A 2Z4RA 1S1CA 2C03A 1JALA 2WOOA 2N42A 3M0EA 1R5OA 4B3GA 2ZYWX 1N0WA 1K6MA 2GBLA 2RGAA 3QPVA 1P3JA 4ERNA 1LF5A 1P2TA 5TVKA 2MSCB 4Q4AB 4ASUD 4EJSA 5EZ6B 3V9PA 3BK7A 2UZIR 4DSNA 3TRFA 3NH6A 5JJLA 4ESVA 4W9MC 3VR6A 1GM5A 1Z0IA 4S2EA 3PIRA 3TW8B 1CXZA 3TK1A 3ADKA 2G6BA 1OB5A 2YINC 4FINA 2CJWA 4URYR 3EA5A 1MRSA 2J0UB 5A0FA 3U44B 1XCGB 1U2RA 1Q1BA 4DUGD 5CDFE 1GRRA 3MJHA 2GAOA 2C96A 4OI0A 5EE5B 2ANBA 5FL7D 4BFUA 1X6VA 3I8SA 1KK2A 2RH5A 4PR0A 4KFRA 3RRNA 3RHFA 2F3TA 1MOZA 3BC1A 4Q1CA 3U7GA 3Q3JB 5DGXA 5TDHA 3F0TA 4IXMA 3BH7A 3BFVA 4IVRA 4TTQA 4KFUA 3QVVA 3LH5A 3B1XA 1R5BA 3LRPA 2IYVA 3LV8A 2C98A 3QXHA 1J70A 4BRUA 4D0NA 3ASYA 1GAJA 4URWR 2GXUA 1VYVA 3LLUA 2QTHA 3OIWA 5JWHA 2YKGA 5FH9A 1KI3A 2W2VA 4LUCA 4W5HA 4TWZA 3GLGB 3UKDA 4PPNA 4GOJA 2GXSA 2ZE5A 2GCOB 3MG9A 3LO5A 1NSFA 1FQKA 1XTSA 1FNMA 1AZSC 3SU8A 2CCGA 4ZV4A 5DNYB 5L3VA 4BZQA 1NVVQ 1NL3A 4RZXA 2GXQA 2JIZD 2RGGA 4LV8B 4XTCS 3KQLA 2R9VA 4B47A 3RWOA 2GESA 4UNNA 3U6KA 3NG1A 1TUIA 5CK5A 2H1LA 2O0HA 4DIDA 2JLVA 1E1RA 5IK2A 2CNWA 4LPSA 1P60A 3CX8A 4GRAA 3DM9B 1NVUQ 3A1UA 821PA 4RD0A 5F3WB 1XXHE 4QM7A 1M8PA 1ELOA 1SXJE 4R98A 1G41A 1N6OA 1Z5ZA 4YQFA 4PAQA 4TQUS 2GZDA 3VHXA 3NHBA 2GJAA 4QM6A 2QPOA 1OIVA 1CEEA 5JWRA 2IXGA 4NCIA 3RDPA 1VYUA 3WP0A 1CR4A 5J4VA 1RRPA 2ZI5A 4PQFA 2IS1A 4PSAA 1CJKC 2XZLA 4PPQA 4C4PA 1UM8A 1KO8A 1A4RA 2IT1A 4CW7A 2J3EA 2XOKA 4MYCA 1W49A 1E9BA 5JEEA 2B7CA 1LV7A 1NLFA 1OFUX 2DWPA 2GKSA 3C14C 4DDWA 3K70B 5AK0A 2IBMA 4KLNA 2X77A 1NMYA 4JJKA 2A7QA 1NN3A 2FA9A 2X8AA 4LWZA 4P4SA 3I92A 2R8RA 2NIPA 4JVNA 2WWFA 2F43A 4C30A 1GILA 3FGNA 4WXRA 5FL7A 4HAXA 5SZIA 1II0A 2Z5FA 3W8RA 5LD2C 4K8OA 2W0SA 2PL3A 4BLRA 3DZ8A 5DYGA 3QUSA 3PENA 1VTKA 1WRBA 2QQ0A 1N5IA 2ZS7A 4AY2A 4XD7D 2ZYVX 5K8UA 4FIDA 4JLVA 1JBKA 4AKGA 1OH8A 3PVSA 2LKDA 2VF8A 3NBXX 2WSSD 1GUAA 4HAUA 2AR7A 4D80A 2F1IA 1YRAA 3GQBA 3B78A 4C0QC 2WWGA 3K9LA 3REFA 1JECA 3U7FB 4D0LB 2YHSA 1XZQA 4C0AC 1W5SA 5J4YA 4A8JC 1ZBDA 2VH5R 2QRNA 4PO8A 4DEYA 2B7BA 1DELA 2AK2A 2DR3A 1WB9A 5E95A 3R7WB 1TU4A 4QKQA 5F9FA 4M1KA 1KY3A 4I1UA 3VU9B 2OAQ1 2GK7A 3BFKA 1BIFA 2JIZA 2XTNA 4B44A 2XGJA 4YMTA 1VIYA 4QXAA 3EZ2A 2WKRA 3NWJA 5G3ZA 1GWNA 5BYKA 1Z6AA 4PSVA 1Z2AA 1FP7A 1NF3A 3UMFA 4P4UA 4Q01A 2WJGA 4MITA 3BB3A 1GNPA 1R6BX 5DI3B 3S1AB 3SC3A 4TL6A 4KFSA 4G5QA 4OHYA 4HZUA 3LA6A 3P4YA 1XD2A 2VP4A 4NYIQ 4B3DA 4E5UA 2AN9A 2VP9A 4EPXA 1V5WA 2F1JA 3HPRA 1SULA 4B76A 4M9SA 1NIPA 4B3CA 4QOSA 3FFBA 1G3MA 1NLYA 2BJVA 2PX3A 3CONA 5FOVA 2GF0A 3R20A 3PUXA 1Z06A 3WBJA 2ZR7A 1JB1A 4RD1A 2GTPA 4GBMA 4W5WA 4MKGA 4ACBA 4A82A 5BWMA 2IS6A 1T8UA 3FMFA 1TTTA 3TR0A 1Z83A 1EFHA 2ZRJA 1XPRA 1D9XA 3BH0A 4MYUA 4AIIA 5CM8B 3GJ6A 3AP1A 1P4SA 5EE3A 1ZAKA 1E9SA 1XXHA 2D2FA 2XXAB 3THOA 1VHTA 3LDAA 2V7QD 4PQRA 5F2EA 1II9A 2AXPA 4X8MA 1RIFA 3OE7A 1JEEA 4U02A 3ZVNA 1W44A 4V0LA 1COWD 2EFHB 3LW7A 3WRYC 3QG1A 1UAAA 5LBIA 5JZVA 3FTQA 1PUJA 3UATA 2ORIA 4JLJA 1S0UA 3TR5A 4PC1A 4DCUA 2WSSA 2ZI9A 3HU2A 1OFHA 2RHMA 4GL2A 1A7JA 2A2ZA 3AF3A 1SZPA 2DYKA 4DLVA 1Z6GA 4OI4A 4JIMA 1G20E 1G7TA 4C9BA 4V0OA 2AX4A 1N3BA 3BRWD 3IEVA 2ZREA 1TEXA 3QF7A 4GPTA 3K9GA 3X1XA 4D2IA 1VMAA 3LLMA 1HQCA 1P2SA 4TMWA 3GFTA 3HPQA 2IX3A 3Q85A 2G1JA 4TLAA 3CPEA 3QF4B 2CMKA 3BBPA 2NO0A 3AP3A 5BN5A 1UEJA 4Z8XA 2HF9A 3AVTA 2CE7A 4TYNA 2VQSA 3Q5DA 3T1VA 2YZ2A 4EAQA 2F6RA 1ZC4A 1G8YA 2OFOA 5FPHA 4DXAA 2HF8A 1OHHD 2FFAA 2ZANA 3MUFA 3VMFA 5DLQC 3TAUA 2H7VA 4BLPA 1E2KA 3ZS8A 3OFND 1OLOA 1Z6XA 3LQQA 3E2IA 5BW8A 5ELXA 3JZAA 3KUCA 1ZM4A 2EWVA 2MSDB 2QAGB 5E7MA 2ZJBA 3RRMA 4G5GA 3WRXC 3ZYCA 4A1FA 3KQKA 4WZAE 1US8A 2VTKA 2A30A 1E4YA 4Q1AA 4X8HA 2VA8A 3VX3A 3AF0A 2W2TA 4WZBE 2QORA 3TQCA 4TMTA 3H4MA 2P6NA 3R9XA 1J99A 2DHRA 4B3BA 2BWJA 3PUZA 2EWWA 4JL6A 5KUTA 1FMLA 3CR8A 1LS6A 4A2QA 3TLXA 3CW2A 4QFMA 2PEZA 3KKPA 4D4MA 4YXWD 3UG7A 4PHTA 3U3RA 4UXJA 4BZPA 2VBCA 1QDEA 2HYDA 1O87A 3TW4A 1OE0A 4CVNA 4TYWA 4KYUA 5AWFC 1ZM3A 1P75A 3PEVA 4A2WA 2ORVA 2CEAA 3FMPB 2O8DB 4JBWA 2BIFA 4GNKA 3SQWA 1F60A 2UZ3A 1XTRA
chains in the Genus database with same CATH superfamily
3CJTA 1RYEA 1UXGA 1JEJA 2C2BA 2OO3A 2ZIUB 2DULA 3G8YA 2E21A 4HRYA 4L5BA 4MGYR 4QUEA 1B8PA 3ANLA 2PYIA 2HBRA 3NKLA 4EMBA 4OPMA 3IDOA 2G04A 3Q7TA 1CRWG 5TQJA 3AUYA 4MVWA 4DEXA 3QBJA 5U9CA 2IP4A 2Z9DA 3I61A 1AQUA 5IXYA 1LI7A 2BE7A 4A8JA 3RHZA 3NHUA 3OC6A 4IDEA 1WSDA 2WAYA 2FB9A 3N74A 4CEHA 1PKXA 3PDIB 1KR5A 3OQJA 3R5XA 3WHIA 3RIGA 3DB2A 3E9RA 4LPKA 1UH5A 2BKAA 2Q7DA 3CZRA 2ZI3A 2ZR8A 2C8LA 2QA5A 3KFLA 4DV7B 5L9AA 3IEMA 1R6VA 1U7TA 2NV2B 5JARA 1EFLA 3RHSA 4RMIA 4MAAA 4DSZA 3ANMA 2AZTA 1D7AA 4KHPB 3WRYC 1KVTA 4H7IA 3PT5A 3AEQA 3MXOA 1RPZA 1ODTC 3Q9LA 3G8DA 1T91A 5K0SA 3OE4A 3FFTA 3RTBA 2D8MA 2WM8A 3GHYA 3GV0A 2EHDA 3L1IA 3IVRA 4LDPA 4LMRA 3G8BA 4RZHA 5ECWA 1QIKA 3GK3A 4L1KA 4RK0A 2CHVA 3AC0A 3MTEA 4C03A 4ZYVA 3EMDA 3N07A 3OWXA 4RPGA 1GLVA 5ICMA 2GNOA 5E9QA 4YRKA 1GG8A 4X6UA 4Q7QA 2C9CA 3R4CA 1KI4A 1N5OX 3C3JA 2IHBA 3KAJA 1OHHA 4II7A 1EP3B 4MI6A 2FV8A 3P5SA 1L6RA 3M5PA 1J0CA 4FKMA 3ZIAD 1ZIXA 2Q0SA 1QTRA 3IP6A 4AROA 1KH2A 1XELA 1E2IA 1ISSA 1L7EA 2WUGA 3HNRA 1Y33E 1AKNA 2ZUVA 3MAAC 3O8LA 2ZWPA 3E7FA 3G17A 2JAQA 3I4LA 4L8GA 4BVGA 2XUOA 2B8NA 3INYA 2XMRA 3PXAA 3KDPA 3DTVD 4GR5A 4P3NA 1NX6A 2FDXA 3SLKA 5I45A 4BATA 1JSZA 1CF2O 5SYAA 2V98A 2PGLA 4TWBA 3QFHA 1B00A 3CF4A 3NCHA 2PIDA 3DE1X 3QPBA 4YUZA 1Q19A 2O0JA 2PLNA 4WKBA 2C5FA 5EXSA 4D9GA 4MVCA 4JLSA 4QGSA 3B20A 4BQPA 5TMPA 1AMNA 5D6OA 2YHIB 1DKQA 5KSZA 3X0DA 5BVHA 2GBLC 1ORTA 4ZJZA 2EG9A 3L0SA 4M54A 4UHDA 1IHOA 4JI4B 1SQ6A 1CUZA 2G09A 1XKTA 1ZC3A 2ZR0A 5H16A 3R5SA 3B1VA 2DTDA 2QX4A 3HCBA 4RF5A 2VXYA 2J3JA 4CCYA 2PD4A 4REOA 4UEJA 3WGHA 2L0XA 3ABRB 4PZLA 5E4FA 5ENVA 1IQUA 1GKYA 4DB2A 3Q3CA 2PDAA 4EGJA 3R3JA 3STYA 3TLKA 3DE7X 3IQXA 1LCIA 1W5EA 1FP1D 3MILA 1JHDA 4YMIA 2WF8A 2VA9A 1U0BB 3I2HA 2GCGA 4DWOA 3L0YA 4KBYA 4NH4A 3O8CA 4P53A 1P19A 3P2EA 4B6QA 1A0OA 1XZNA 4UVIA 3TCKA 3REGA 1OZFA 1HETA 1SA0B 3A3PA 3DUFA 3K4QA 4B6EA 3OQNA 1T8TA 2I4OA 2OWEA 3KPJA 4C7BA 2XDQA 3DR5A 3MQ2A 2JJ1D 4Q82A 1T6NA 2A3RA 4FQ8A 1J1IA 2NO1A 1THGA 1KGDA 1E9CA 3X1WA 3ZGZA 3PD0A 3T7AA 2BJWA 2H8KA 2DFNA 4BJ5A 1R8QA 2IYOA 1IATA 1T0UA 1ADFA 1IN7A 3MTBA 2P2LA 4BV9A 4N5MA 3TZ6A 4LV6A 4BIMA 2IEYA 4K9DA 3AUAA 2WAXA 5K05A 4DR1B 4PXYA 1Y7HA 1P1BA 3OJOA 3BVPA 1H94A 4EEZA 4CF7A 2A3NA 1VHLA 3IHKA 3R6GA 4GL4A 1NRXA 1DRUA 2EBHX 3CKKA 2YNMC 4S12A 5AOAA 2I2CA 2IHNA 1I3KA 4FGZA 2NNWB 3DOIA 3TVDA 4ESHA 3EEYA 3BGOS 2WB2A 1P7YA 2FPSA 4WEQA 3SOPA 4EJSB 1XEWY 1S9DA 1FVHA 4MW6A 2ODQA 4GI3A 3ZWXA 3W7BA 2VSXA 4GMGA 4KPUB 3EF3A 3WRXA 3WQHA 1MJGM 2FWBA 4NDAA 5TE9A 4M0DA 1O6GA 2LXNA 2Q1WA 4BNUA 4N49A 4RVCA 4NZZA 3IMEA 3MFQA 2YUTA 2F7SA 3ZIAA 3H2GA 4LMBA 3MMPA 1TU3A 2HK8A 1Y6GA 3C8UA 2VZ0A 2PX4A 2PGIA 2EFGA 4BNDA 2XNJA 4XVUA 1RM4A 4OHRA 3TKLA 4W8GA 3AHGA 2GN9A 3DTVA 1MDFA 4OM7A 3OFJA 3P27A 1J42A 1O7JA 3G2MA 4FLMA 1XXLA 2GZ1A 3PNLA 4ZEMA 2AHRA 5REQA 2ZUCA 4INJA 2HOQA 3TKAA 4Y2TA 3NX4A 4U2CA 2ZRMA 3FW1A 2OGSA 3IDSA 2W98A 5KNDH 1JFVA 1P62B 4XJVA 4ZT4A 4UZFA 2IIVA 4N6NA 4XB2A 3SYLA 3ZJVA 3H87A 3RVQA 1XC7A 3HBFA 3GG2A 4ABYA 2VSFA 1KBQA 4A0SA 1R5NA 3PCXA 1Q91A 1B74A 1G18A 4HGQA 3TR6A 4YJGB 3ZJYA 1MGOA 2GEVA 3G6KA 4K6GA 3TKYA 5I8WA 2UUOA 4Z2YA 2PEYA 4N5LA 3TEJA 2CHGA 2HSEA 2VT2A 2EBFX 3RSZA 4HT3B 1FP4A 1T29A 1WTAA 2XEXA 2Q7OE 4TWIA 1Q7BA 2X41A 3TL2A 1QQTA 2FE1A 3CR3C 4C6SA 4E21A 3DM5A 2DB3A 1WKBA 4M0EA 5BMOA 3FPSA 1BMDA 2ZP1A 3FFWA 4HY3A 5FV7A 3HCCA 4FM9A 1N8SA 4LC0A 3K0AA 1EKXA 1HSZA 1IOLA 1NVFA 3DUWA 4M89A 2R11A 1NYQA 3OE1A 3BRSA 1KORA 2DPXA 4Y67A 3TGWA 1P2FA 1U7PA 1YRWA 2JJ1A 4E03A 2HM7A 2HXSA 2OKCA 2BP7B 4ITRC 4Q7KA 2QV7A 2Q7XA 1S2OA 3EH2A 2JI8A 3R5JA 2XWJI 1EGQA 5CA0A 4A5SA 4TRMA 3FYUA 4WEOA 4LF7B 1QXSA 4J1QA 2H16A 3DWGA 4JELA 1LZKA 5JSUA 4FMDB 4F85A 2I6XA 2BFFA 2WMOB 3WC4A 1BEUB 1C41A 2GSWA 5BW4A 4H1VA 2BCGY 1PWHA 3R9IA 2WF5A 1IB0A 4U3JB 2C3UA 3O94A 5G0VA 3A05A 4DM7A 1HLGA 2Z2KA 1EUDA 2Q4DA 1EHIA 1Y5MA 3OQVA 5ARDA 3VR6H 3VHXB 1T0BA 4P6VF 1WE2A 1XTPA 4O4LA 3ZHZA 2QNRA 4DC0A 1I3OA 2BR4A 2XYGA 4I1RA 4EFLA 1JEOA 2WJIA 2JS7A 1QWOA 2ZI6A 1KP9A 1LWNA 4AKIA 1LK7A 1QHHA 3NTRA 4JKYA 3K2EA 3SJCA 1V37A 4M9UA 4HZGA 3KKEA 4U8HA 4AX8A 1U2GA 3CTPA 3KUDA 3L18A 3CMCO 1K5DA 1KA9H 1XDSA 1E6UA 5KWVA 3CN9A 2OGZA 5FJJA 4CTJA 3LDUA 2OC4A 2Z2YA 2ZZNA 1OVGA 3PWZA 4MRPA 2ZXUA 1FE8A 3R1IA 4KRGA 1MEOA 1UC4B 1JLMA 1OBVA 3KVOA 4RSRA 1THTA 5EIAA 4JC4A 1L5LA 1F2DA 5BV0A 4EG5A 1PRYA 3WIEA 5BUCA 3PLNA 1APBA 3QA9A 2VK2A 2HBYA 4LK2A 2IVZA 4EG1A 1WCV1 2ZTSA 4PQYA 1Z3IX 3AFGA 3VNBA 1OPRA 1T3SA 2FMXA 5EZSA 2YQ5A 3QFSA 5G1PA 2FWRA 1L8OA 2GFIA 5C37A 2P2DA 4BFCA 5JXJA 1Z4MA 2YOGA 3MW8A 1LLDA 4X84A 3TIFA 2BHNA 2B8EA 2Q6KA 3AEYA 1CIVA 4EPRA 2G6TA 4PWYA 3LWDA 3F6YA 3KR9A 4DSAA 5KIAA 1BMQA 3OU2A 4C0SA 3CZ5A 3B7GA 1K75A 4IS2A 4EB8A 1WETA 4IGEA 4LZLA 4DR7B 1W35A 2BFNA 3IKJA 3NTXA 3V80A 5JSHA 3T41A 3IAFA 4II2A 3VU1A 1REQB 2C4UA 1ULZA 3TIIA 1YULA 4EPTA 5BY2A 5COQA 4GPAA 2FWNA 3NMUF 1SGWA 4XCXA 3GQBB 1IZ9A 3UGJA 1HLPA 4GPEA 3EN0A 4M0FA 1JKJB 1KSFX 5HA5A 3WWZA 3C7DB 3D02A 2ET6A 2Q2OA 1I3LA 3MMSA 1L7MA 2V0NA 2H2DA 2D5CA 1A5TA 3OCYA 3O1LA 4G8JA 5IAKA 1U9YA 2HY7A 4Q3NA 3FPJA 3GLHA 1N4AA 1L7NA 1NQ5A 4C21A 3GA5A 1UMCA 1LPSA 3H4TA 2X1MA 4IR7A 3V7YA 1AQ6A 3KYCB 2A0UA 2FZ4A 1SXJC 2QTWB 3EY9A 1RQ7A 2Q3JA 2IPOA 2UZ1A 3GD5A 3HRHA 3W5HA 1OAAA 4X54A 2VP0A 2XMCA 3T35A 3UFBA 1F51E 5JH7A 2DBQA 1AQIA 2B99A 3IEPA 3PJGA 4G0MA 4CYMA 3C1TA 4LBZA 1EI9A 4D97A 4HVLA 2FOIA 2XKKA 2AYZA 1JXMA 2AWOA 2NUBA 2TECE 1L7OA 3PPXA 4QREA 1Y6JA 1N32B 1IXZA 1NT4A 1UWLA 1CUXA 3X3HA 1C9NA 3DB1A 3B6KA 3A1SA 1N1EA 1R6DA 4C0LA 4J1TA 2JCVA 3IJEB 3JWIA 2PL5A 1CZOA 2BHLA 4FHFA 4M88A 1OT3A 1NDQA 2B4RO 3QE2A 1C9MA 3FB1A 2Z8XA 3BMOB 3T7DA 3VOTA 1Z28A 1NDUA 2C57A 1LEHA 2EKPA 3DD1A 3FLBA 4J9VA 5C7YA 1U2ZA 1IOZA 1M1ZA 3DMFA 4R1OA 4E14A 1K4YA 2OUKA 4X3OA 1V3QE 1Z29A 1JHRA 4F38A 5KYKA 4JP1A 3RARA 1QYIA 2HJGA 2JFOA 3N2KA 1SK9A 2J45A 4MW2A 4U7FA 3WQSB 1AQLA 4JUCA 2XMGA 4KAJA 4XPIA 5K20A 1T35A 3G2LA 3AJDA 3K1ZA 4MKHA 3KSZO 1OOEA 3ND5A 3D6FA 4J0KA 4JD5A 1FUKA 1M0WA 2F9LA 2OECA 4IRUB 4IJWA 3T12A 1F12A 3GH1A 2FWPA 3ICCA 3I9V1 3KPUA 5F9MA 3AEUB 1Z22A 3SVLA 5E6SA 4M22A 5K8IA 4CM4A 1ILEA 3RBZA 1CUWA 2QN1A 2UZAA 3GEGA 3AI3A 3D5TA 4URUR 5K3EA 1DARA 1VG8A 3KJFA 3O8NA 4FLEA 6LDHA 4PYOA 1XCOA 5EPUA 1TMOA 3DV2A 3N2YA 1NZJA 1NNUA 4UM5A 3RC7A 3WVNA 2CXHA 2YY6A 5JTUA 2ZRFA 2O5EA 2WOJA 3P2JA 2HRZA 3AVPA 4IQGA 1ST3A 4XIYA 5ALLA 2R1TB 4ZALA 5AW0A 4O1IA 5BPFA 1VIMA 4LV5B 1JAXA 1UP7A 4X93A 3WRWA 3B7WA 3B9QA 2PX6A 2DERA 3I5XA 4A23A 5KYWA 1H8EA 2BEJA 2ZIAA 4UMVA 3GJTA 3VTAA 2E85A 3DZKA 4UJ5A 1Q92A 5ALSA 2FFRA 3EZGA 5EP4A 3WA6A 1PTJC 2VLBA 1XKQA 1DEOA 3AR5A 3HL4A 1SQ0A 3PFFA 4QUHA 5AOCA 4V1CB 3QEAZ 2ZBRA 2C58A 2OCAA 4DJTA 2JA1A 1TAQA 4MVJM 1Q0LA 3UGKA 5A2QA 1J9EA 2A0KA 3KTAA 1WULS 1OI2A 4E13A 1QF9A 3STWA 2BZGA 1YE8A 4U7GA 3PIDA 1PJ4A 3BWXA 5MF6A 2HLHA 3FR7A 1A2QA 3FJOA 1PHPA 2GDJA 3IIKA 2MR5A 3DMGA 2DSTA 4PW0A 1PSZA 3DE4X 2V5VA 4XSVA 4ZI7B 1VGVA 2FN8A 3O8QB 3F5SA 4XUDA 1RQ2A 2AN5A 1D4AA 1Y6ZA 1ZJ4A 3PZRA 1WP9A 1Y7PA 2CW5A 3LPLA 1XIVA 2ZBFA 3HB4X 2EKBA 1WMSA 2IUTA 3FMOB 1WXDA 2YYZA 3DAOA 2I67A 3HJHA 1KAMA 3MRTA 1NVXQ 5BN5B 3UJAA 2HRDA 4B8WA 3HADA 5IT9A 2CFRA 1DNPA 5JAOA 2XWBF 3R5HA 1DWOA 2BZ1A 4LK3A 1JJFA 1JEYB 3FCXA 3D43A 1DKNA 2P6PA 1JLRA 1QTNA 3P8ZA 5P21A 3DOEA 1U8FO 2RGCA 4P4GA 3WMWA 4H0NA 5BSRA 4ZJUA 4B8YA 1VIDA 2JLBA 2ZCUA 3KFVA 3CZQA 3PGJA 4G0OA 2C00A 4HFRA 1YI8A 4QXPA 1R4MB 4R9VA 1NYRA 1K86A 3JQBA 1TLTA 2IFTA 2ATCA 4GZ5A 4PF1A 3RI3A 4AG5A 1NVKA 4B6PA 1N36B 3JTMA 4OO3A 1ULBA 2R1ZA 4U9HS 4LDQA 3E0QA 5BSGA 1BX0A 2P2SA 5KBYA 4LOAA 3R7NA 3AR3A 2HXGA 2I34A 2J6HA 1XU9A 4YT5A 3DVQX 2RBKA 3MPUA 5AKJA 4QD3A 4Q1EA 5KYXB 4N9WA 5H1YA 5K0NA 1ADJA 2O50A 5LQKA 1W9HA 3H0KA 3IRVA 1TQHA 3DFFA 4S2UA 3ZTTA 1F0NA 1GZHB 1OI4A 1OGJA 1RMQA 1NUSA 4OQNA 4K9PA 5AXAA 3ZX4A 4L4SA 5PGMA 4Z3OA 1NJSA 4KB5A 4EY6A 3VNQA 5LD2B 4CEJA 3EBOA 4EY8A 3FZEA 2J6CA 2HNKA 3CUKA 3LT5A 1CUYA 1DXOA 1NBME 2WHEA 4WA7A 4L5IA 1M33A 2ZBQA 1Z73A 2PRJA 1QM5A 2FPRA 4FK8A 4L75A 2B37A 3TNDA 5CDUA 3A4MA 3A2LA 4PG6A 4QRIA 3S2GA 4BKRA 3UPUA 1GTG1 2HJ9A 4ZODA 5CT9A 4AAYA 2YW2A 4Y2JA 5A5VA 4B31A 4K5QA 5EA2A 1YA6A 1YS2X 1HXHA 3IKLA 4RVGA 5ALUA 1II8B 1IN8A 1M8KA 1QX4A 4HLUC 2V03A 5CLJA 3H3FA 3GLGA 3WNCA 4G67A 5F2KA 4BVHA 3E23A 3INGA 4E32A 3D5EA 2YL2A 5DSZA 1Y3HA 1RXEA 4RPKA 4A8JB 1UDWA 2DBYA 3T4PA 2JLUA 3I9FA 1FUUA 4E5PA 5EJFA 3T7RA 1HKHA 1CFZA 1F0YA 1ZD8A 2DH6A 3R5TA 5E1OA 2I78A 1O94A 4FX5A 3C6MA 1RHRA 2JJ8A 5BV8A 3LUKA 2BTQA 1P6XA 3GT7A 3V7WA 3W9UA 2AWNA 1K3FA 3O2JA 4KDEA 1E3MA 1YR9A 5CXXA 4KREA 4FC7A 1IMOA 3COSA 4QYXA 1GR1A 1P0CA 1KO7A 1RRVA 1M67A 1RAGA 3BFPA 1AURA 3MWEA 3KQHA 3K6SA 3MPOA 3E70C 5LP6A 2I3ZA 2ZAMA 3I4FA 4ZYYA 3IPCA 1SMKA 1Z08A 3M81A 1HA3A 2PCLA 2B5VA 4U8GA 5KNBD 1JJVA 4MUIA 1D6JA 1FRVA 3TQSA 5DX1A 2A84A 1EFRD 1PG5A 3M70A 2OLKA 3ZXXA 5L7WA 4EJ0A 1E0JA 4DWVA 4H35A 1EJBA 1MKYA 2IW1A 2BDTA 3IPYA 3T7KA 4NDZA 1X15A 4C3OB 1W2GA 1CS4C 2Y05A 1WDLA 2GLUA 1U9ZA 2BY4A 3CPJB 3DHWC 2AG0A 4LOIA 2QRQA 4PAMA 1W4LA 2HO4A 2Q50A 2WKPA 3IOBA 2CYAA 3F5QA 4C6TA 1XPOA 2EQBA 2PBLA 4LRQA 1OREA 1T5DX 4P7KA 2RGBA 3U4GA 1CUFA 5IU6A 2AK3A 1ZWLA 2ZB3A 2IEGA 5AVOA 3DKVA 1QPZA 4HVCA 3IP3A 3I5MA 2BGGA 4PLWA 3FETA 3N0RA 5M2QA 3NGLA 1SC6A 2EJBA 3AONB 4F9EA 1CPYA 3LXRA 1UXIA 1JR3E 1Q1GA 3DBVO 4HPWA 3UGTA 2UVDA 2HAEA 3BB1A 1HQYE 3DXZA 1B0UA 3I0NA 3QFRA 2QLBA 1NVWQ 4WA8A 3SFZA 4UVDA 2WJ6A 3MGBA 4ZRNA 3W1VA 5JQGF 3UC5A 1J20A 1HX7A 1JG1A 5GQSA 5HQ3A 1Z63A 4D8XA 4I1PA 4MVJG 4EZEA 3VQTA 2IP1A 5KINB 1UZLA 2BMFA 1VJRA 2FK7A 3NM5A 4UDNA 4PYMA 4MKXA 1PYGA 5DGHA 5G0UA 1LNQA 1ZG3A 1NVMB 2FF5A 2QT9A 3QVTA 4O2BF 4P4NA 1JMVA 5J5VA 3UOGA 2BISA 2GRUA 2OGWA 4IIBA 3QYFA 2FR8A 2QGZA 3G9XA 5AQEA 4PGMA 2Y99A 3FWYA 4MV7A 2JK1A 4I66A 2OO7A 3V46A 1ZIYA 1E3IA 3UMVA 1IWBB 1HLDA 2WVAA 2WYWA 5DASA 2PMEA 3ZU6A 5JVDF 4RTMA 1ZVQA 5FI5A 4IDCA 4MW9A 4BJ6A 3B3QA 3CNEA 5GJCA 1UDAA 1J90A 1X1EA 1XQXA 4FFOA 4RMHA 4EGSA 1LA2A 1JA1A 2PJZA 2WG1A 3FPHA 1P0IA 4O6VA 3M6LA 4RGQA 2REXB 4G4GA 1UPBA 2MINB 3RUCA 3D4IA 3T1HB 4L22A 3IV7A 4OM8A 1FS5A 2E4UA 4FFBB 5DHPA 3WGJA 5KWIA 3DUFB 3HXMA 4LGMA 3K2IA 3VR3A 4AT1A 4B73A 4NR0A 2WUFA 4AF7A 3G9ZA 2XDQB 4OJNA 2B9VA 2WC1A 3R7WA 3WK5A 3J81A 3KJEA 3IP8A 3DDOA 5B3AA 3X1KA 2V1UA 5FBWB 3RHTA 1C0KA 4YN3A 1XDZA 1JH8A 2JD2A 4WINA 1KEVA 1WA5A 3ICWA 1E1CA 4HFNA 1T1SA 3NR2A 4WD3A 2FSFA 4EHJA 4QJIA 3U9SA 4OB8A 2R86A 3NDPA 3K7EA 1EESA 3LL4A 3PGXA 4FXPA 4X61A 4MEAA 5TF0A 3ZWNA 1ZUIA 4ND2A 4X60A 1J0DA 2OD2A 3H3XA 3MJCA 5DI3A 1IHPA 2ZT5A 2P8JA 3RT1A 5C35A 2P4SA 4QBIA 1KY4A 3KR0A 2WWIA 1UDBA 5JD4A 1EFRA 1XDDA 1Q0QA 3AHFA 4YRTA 4DR5B 3O9VA 5EJAA 1RNLA 2COUA 4J3JA 2CUTA 5K2MA 5KSPA 2QP3A 4E1VA 1ZRSA 3GRYA 1GTRA 4XWGA 4GYKA 1X8LA 3OEED 3J80A 1L5YA 5FOUA 1G5PA 2B1RA 3WKDA 1N6HA 2ZSFA 1IN1A 2HJSA 1Q0HA 2IXFA 3EJWA 3T94A 1BN7A 2QTVA 4RU1A 1EK1A 2X22A 1FTYA 1ZSNA 2XJ4A 2H2FA 5ECGC 4BNDB 2ATVA 4CIXA 4NZNA 1E69A 1DADA 5E4YA 4EWLA 2VKTA 1HYGA 2HK6A 1CUEA 1YWGO 1LGYA 3DTVB 4X94A 3UAVA 4RK1A 2BKVA 1TECE 3OJEA 3B1ZA 3S3TA 3O1JC 2ZTMA 3CURA 2RGRA 3N2EA 4POAA 4LOLA 1NQUA 3OVMA 4UAVA 3RK1A 5J4KA 1X74A 2JJ2D 2ZJZA 3SE7A 4E3WA 4N3NA 4CFYA 2PZEA 2R97A 4XFJA 2XNDD 4FOPA 2V7TA 3CR7A 1GFIA 4KLRA 3WNBA 2OSBA 4LTMA 1IONA 1WMFA 4I36A 4ZRDA 5EHZA 3IAM6 2F90A 4DSUA 3PR1A 3ZWVA 4HEA6 1MRNA 1VZ3A 3O4VA 1EGHA 3D6UA 2MDTA 3CKMA 4M9XA 1T3GA 3TM4A 4DHWA 2G1AA 4JYMA 3S2ZA 3RC8A 1FJXA 4HAYA 5KJEA 2WF6A 3JQ6A 2P9BA 2QI9C 2QN2A 4EF4A 1FP4B 2YWFA 2VP6A 4HNSA 4KX3A 2PQMA 1ULHA 1OI3A 5FR2A 3K35A 3G6WA 4MGZR 1XEXB 4RAOA 4YJ3A 4EB6A 1T36B 1Z4OA 1HTBA 2LPMA 4KGVA 2VQEB 3BWDD 3K0AB 3OZIA 4Y2SA 1E61A 1L7VC 5DHFA 3E9DA 3GLFE 3EGOA 5KZMB 1USUA 3N8IA 3ESXA 5A4MS 5EUBA 4BVLA 2B0JA 2I7CA 2X2FA 2WZBA 3SICE 4S05A 1UXKA 4PO9A 1G64A 2UYHA 3I9MA 3U4QB 1FP2A 4IXWA 4L6AA 1R6UA 1CT9A 3DSRA 1R4AA 3FYUB 4FFSA 4MTCA 3H1BA 3I9LA 1P5FA 3DEHA 1L4MA 1QO0D 3QU4A 2Q0XA 3QGMA 1V4BA 4U39A 5FJIA 1MAUA 4U7DA 3NHRA 2XVZA 1RXUA 4KWEA 4OAQA 1GAXA 4DIOA 4NZYA 2IQIA 1FNCA 3PQFA 4KQKA 4YP9A 4RQTA 2KBFA 2HMSA 2O0KA 4UVGA 2OV8A 4Y7DA 2XTMA 4WOPA 3MZ0A 1VG0B 1SU8A 3F3YA 1JXOA 1YZUA 3BORA 3WNQA 4I9NA 1EUDB 1GNVA 1RIIA 1R0LA 1U4OA 2H17A 1L5ZA 1E20A 5LKAA 1PQUA 2XB2A 1OX4A 4O4LB 2V8BA 4Q00A 3ORYA 1ZUWA 1Z34A 4KXYA 4MW4A 4KTVE 4AMYA 3TUJC 1QHHB 2BBTA 1N3IA 2NXNA 3N7UA 3WP1B 3OEEA 3QKRB 3MB8A 4TMXA 2CJPA 4URZR 1EU1A 3EULA 1QK4A 2OYCA 4ZQHA 2VF5X 3CNNA 4DHEA 3I8OA 4YQYA 2UKDA 2JFXA 4D4HA 4YWJA 4L0CA 4MIKA 3WFZA 1H8HD 4JBIA 4KQJA 4WK2B 3T0FA 2GHIA 1AKVA 2QI9F 4PFQA 1W36C 2R44A 1THZA 3KT8A 5E7QA 3UXHA 3ZZTA 4E70A 3FZGA 1WZCA 2DECA 3LG2A 3SSNA 4L5YA 5E1BA 1KDZA 2VKQA 2WPDD 3Q0IA 3IBFA 4AZ0A 2GARA 4M37A 1E32A 3GRZA 1BHO1 4NC9A 5H8WA 4KUHA 1C3OA 1FFBA 1WHSA 2PWYA 2XNDA 2VNAA 4RD2A 1H2EA 4AVYA 2G9ZA 3EISA 1XTBA 2J3QA 5EP1A 5BQ5A 4F1JA 3UHPA 2VHWA 1V7CA 1T10A 1I2CA 4PGFA 1BG6A 2XEDA 2ZSDA 3VXKA 2D4HA 5EJEA 1B6TA 4LVNA 4MGKR 4NBSA 2PL1A 2A1TS 3KQTA 1UBLS 1RHJA 3K72B 4LZWA 2Y68A 3D3NA 1DC7A 2ONYA 4GLLA 5EWMA 2R79A 4V0MA 3ROPA 3TIGA 3ET4A 2WD8A 5K51A 1CS0B 1VDZA 5IFKA 2VOEA 5KU7A 2CHUA 1J22A 4B32A 2COKA 1G3QA 1TVMA 5LZ9A 1VPLA 5H70A 1RBZA 4BKPA 2AJ8A 4MCJA 1C29B 4IMIB 5EQDA 3GLHB 1H85A 1VG1A 4BNYA 2CVQA 4D6YA 4N82A 1T5BA 1P5JA 2UXCB 2GAAA 2UZ1B 4D6XA 1UJ4A 1YS6A 2VJAA 1C50A 5JAIA 3AZQA 3RG8A 1SOAA 4BX0A 5JLAA 3HMQA 2C9ZA 1RI1A 3C3MA 3VDMA 2F59A 3C87A 3IBTA 2PO7A 1LBIA 1FSZA 5LDHA 2J6IA 3DULA 2N75A 5L3SA 3RWBA 1QE0A 1XP5A 3T0GA 2A9OA 1U1FA 2ZI7A 2Q0HA 3NBQA 4O08A 4BGEA 2F1RA 2VWHA 4UEKA 4MDFA 1XAIA 1J21A 4ZAWA 1GQOA 3JAKB 1U5AA 3TMKA 2WWYA 2AJDA 4B6RA 4JLKA 1Q0RA 1TQDA 3DEJA 4NEHB 4X91A 2YWBA 3HDTA 2YJZA 3U7JA 4UE3S 3CFYA 1RBYA 3R3UA 3VOAA 2YASA 1P33A 4AB1A 3BXXA 2VNSA 1LC0A 4LFCB 4GX2A 3FH0A 1E2EA 3OPVA 3R09A 1MT0A 3EDOA 3N2KB 3ZIDA 3NHPA 4B4OA 4R9RA 1ZSYA 2D5BA 4XPIB 1KWGA 4XKJA 1PR5A 4QG3A 1I4EB 5KQLA 1VKNA 3IO5A 1FS6A 1OYVA 1RAIA 2QRVA 3LS2A 3QVKA 3NNNA 5FBQB 4ZT7A 2JFHA 4CTMA 3E9MA 1H8HA 1X38A 1EBBA 3PFGA 2EZ8A 4KQXA 2OT3B 2BMJA 2JHFA 1XYYA 3C98A 1YJAA 2J9GA 3DAPA 2IOQA 3M6UA 1F8XA 5E6SB 4CM4B 4I14A 1RPJA 1EDZA 4D8VA 1B3BA 1UP4A 2P30A 3HSYA 4H6VA 4NCKA 4P08A 4QGHA 3UIEA 5CJPA 4BIIA 4I3GA 4DM3A 1NVGA 3HO1A 3X2EA 3KZCA 3RVRA 4EKEA 1CX9B 1OU0A 1EFUA 4GLBA 4P5DA 2XB9A 1W46A 1K5GA 4MKFA 4IHQA 4AG3A 1A82A 5T4BA 3LAWA 3FTNA 1CQIA 2VUHB 1QG2A 4G0NA 2A1TR 2RHDA 4PLGA 4QVIA 1N6LA 3UBMA 5KYWB 2IXEA 3DGFC 2ZIWB 3WDSA 5KC9A 1N25A 1R74A 3FWNA 1BMFA 1O8BA 1OLSB 3C5EA 3Q3EA 2Q8PA 4TYPA 4UZEA 4RHEA 1M2VA 3GMDA 3QELB 5K4GA 1XR3A 3OX1A 3D8BA 3HY3A 1N78A 2ILVA 3N8KA 2CYCA 5HBRA 4RZ2A 3ZHBA 3KTAB 2XSZD 2QN3A 2ZTHA 4NFHA 2I7DA 2CLOB 3CNOA 3DBOB 2VSOA 1SVLA 1I13A 3MJVA 4NPCA 1B6GA 5F4ZA 1XRRA 5H3HA 4Z7JA 4Q3DA 3ZE0B 2I5PO 2PS3A 5EPOA 4FSXA 2FUKA 3K1JA 1KQGA 5FLYA 3A2NA 4YRGA 3R6TA 2YY7A 1IWPB 4ZO6A 2OQRA 1CUSA 1VPEA 5ALJA 3TSAA 3KD3A 4UM8B 5CB4F 1H0SA 2WIFA 4BYMA 1NVEA 4EW1A 5AK4A 4D79A 2F55A 2FQXA 1LSSA 2OAGA 3D5QA 4XE5A 4RE5A 4M83A 2WTUA 3RSHA 1OXTA 4C4XA 4LC1A 1QYDA 1GPKA 2D0OB 1Q7CA 1VBMA 3FSJX 4FDAA 2Z8YM 1MB2A 2YWRA 3A1DA 3UTCA 4KK3A 2PSJA 4AUKA 2RB4A 4ZXPA 1DT3A 2VDWA 3H9JA 2FMTA 2OG2A 4I3HA 1B7GO 4PX5A 4MW0A 4Z54A 4F92B 4QU0A 2XCUA 3RAEC 2HMUA 2GZ2A 1E1KA 1QLHA 3GGPA 4R8RA 2WLSA 1E5XA 3V1LA 4EHKA 2ZG6A 3LW8A 2JKVA 1ZK2A 4PG5A 2OO5C 5JBIA 3PKJA 2WQ7A 4AN4A 2Q4OA 4ED9A 3BZBA 1RP1A 2DWOA 4S1OA 1R9JA 2VNIA 2GA8A 1Z36A 2WE7A 2WE8A 1CVRA 2DSNA 4RADA 3RSLA 1YNSA 4EW6A 1NN0A 3AG5A 1H4SA 3LHKA 1BC5A 1SQSA 2GCIA 4GLJA 3X1MA 4DZZA 1ML4A 5BMVB 2B25A 5LQAA 4RZQA 4ER3A 5JOQA 1O57A 5BSEA 4FYIA 1OYWA 2EERA 1YZKA 4TS3A 4XIFA 3D54D 3TTVA 5ADHA 4CEJB 4M0MA 3QYJA 2QZPA 1L8LA 3D8HA 4OHZA 2JLXA 2H1SA 2ZB2A 2OGTA 1P81A 2JIMA 1RAAA 1GITA 1U0LA 2C2OA 2O6HA 3EEQA 3KP1A 8MHTA 1HZZC 4KLCA 4MYSA 3FRHA 3EA4A 4WKOA 1X8KA 2PKRA 3UK6A 2ZB4A 3JASB 4WW0A 2XI4A 1YO6A 1URPA 2C2HA 2W90A 2XWPA 3TSYA 5DHQA 2X1VA 2J32A 3Q7EA 3ZWCA 4AS2A 1L9KA 4J7AA 3I76A 1YIDA 2ZIZA 3ZYZA 4C6RA 1FEZA 3L1HA 5SZKB 4KRFA 3HGQA 3DVRX 1W76A 2O8DB 4IQ0A 3RAJA 4EFKA 3K70C 2Q1YA 3QBTA 5MHTA 3V34A 3IOEA 4PQEA 4E7OA 2HX1A 4H6XA 3S8YA 1H4TA 2ZOSA 3KEFA 1RC1A 1V6CA 4UCWA 5LZ8A 4Z3KA 1S3FA 3TG8A 3ZW8A 5IJAA 2XSZA 1Y9AA 3LM8A 1VLVA 2PVSA 1OJLA 2XUJA 1Z5VA 1N2XA 2HI0A 2L82A 1V43A 2ZBEA 3DZFA 4LY9A 4R4JA 2X7XA 5CYPA 3NVDA 3KEGA 3NC0C 3SI7A 4X0EA 4FONA 3B9PA 3UXEA 2W2OA 4BFYA 2ZBGA 4G25A 2VC2B 4LDZA 3GWGA 3WGVA 3O84A 5K4HA 4PANA 1N34B 4Y2RA 2H4ZA 1PJAA 3K0BA 2Z83A 3S28A 1PT5A 1DJLA 3AJAA 4WLVA 3MWEB 1DFIA 3GLRA 3KU1A 3MWLA 4X20A 2JRLA 3V4OA 4B9AA 1PLJA 1DAMA 4O29A 1KZGB 2BF4A 4PICA 2E4AA 4DCGA 4RTRA 1J97A 5C8YA 2NZYA 4I19A 3LLCA 5B6IA 4HAOA 5GV7A 4M1SA 2GUWA 4OQXA 2RJOA 3DDSA 3H5RA 4XA8A 3O3OB 1IXRC 1BKDR 4ARZA 5K8JB 3ZD7A 4DWJA 3ZHOA 4S1PA 2C77A 4R2LA 5LWHA 3MOIA 1ODSA 1MW9X 3WHPA 3U4DA 1W0JD 4LISA 2ROQA 3HN6A 5TPZD 2QMOA 4XFDA 4P54A 3LHSA 4J43A 3CUSA 3QUBA 4C1NA 2EYUA 1U9IA 4RKQA 3OZFA 4BE9A 1RU3A 4QYSA 2IRWA 5ULLA 2WP0A 5AI8A 2LP4Y 4LJ6A 1Q95A 4BO7A 1OH6A 3E18A 3IESA 1PG0A 3GO4A 3HDQA 3G2HA 2V96A 4LJAA 3PLRA 4Z9AA 4BJHB 5KYGA 2AEFA 1KP3A 2NT4A 4GEGA 4YCSA 3CVVA 2KW5A 1Q16A 2ABWA 4AO8A 4OX9Y 5TPWA 1CR0A 1UWCA 2QY6A 5IYZA 1TUEA 3IAHA 1J2RA 5E0KB 3O5AA 1G2QA 4QAJA 1JF8A 2BF7A 3V4RA 3DEKA 4E2YA 1RM3A 5GV8A 5HQ3B 3PPYA 2Q2QA 4U7WA 2Z4TA 4UM7A 1QIEA 4UDOA 3SYTA 2KHZA 4RENA 5T4HA 5I4BA 2QTFA 3FNEA 3MJRA 1QIMA 4XTRA 1A9TA 1JSLA 4DPKA 3W6PA 4XWOA 5HIIA 1BVUA 4ZI7F 1H2XA 3EX7C 4FGLA 3CQ9A 3UV7A 4FB4A 4N0DA 1LQTA 2X5NA 1FDSA 1VP3A 4TRRA 4L50A 3D2LA 5F23A 3L7LA 1D5CA 2ZWOA 3OZ7A 4Q9DA 3GGCA 3TDMA 3ET5A 3JALA 4BO8A 3U16A 3DTTA 2WUEA 2AHOA 2FN4A 2XUQA 2YZMA 1E1MA 1N0UA 2BYTA 3KYJB 4C01A 2R2GA 3TO5A 3N76A 4NHEA 4RTQA 3NFYA 2QYSA 1SKUA 3MD0A 2FMIA 3Q12A 3U3DA 3CLUC 5AOBA 5JEDA 5F12A 1KYYA 1DPFA 1N57A 3BCUA 1YBHA 2IYSA 1UT5A 3OPYI 5CX4A 2HMWA 4JXKA 1F06A 1O58A 4PFKA 1Z4JA 5FUXA 2CF6A 2XYQA 1NATA 3KV1A 2I8LA 4MIEA 1XVVA 2PAFA 1NOKA 5H4HA 1Q21A 1E1CB 4R9UC 3PSHA 2IWRA 1QGUA 5EHXA