2GCOB

Crystal structure of the human rhoc-gppnhp complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
192
structure length
182
Chain Sequence
b'HHSSGLVPIRKKLVIVGDGACGKTCLLIVFSKDQFPVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-related GTP-binding protein RhoC
molecule tags Signaling protein
source organism Homo sapiens
publication title X-ray Crystal Structures Reveal Two Activated States for RhoC.
pubmed doi rcsb
total genus 63
structure length 182
sequence length 192
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gcoB01
2ONKA 5FOXA 3MMPA 1Z0FA 3LA6A 1VG9B 4RKEA 4TMZA 1N6KA 3GMTA 2NO9A 4R7ZA 4V03A 1GTVA 5JWHA 5SZKB 2X2FA 5BW8A 3SQWA 4BRWA 3F3YA 1AZTA 4QFMA 1G3UA 2F43B 4F93B 1C1YA 1NVWQ 2RGNA 4TLCA 3CRRA 1W4AA 3SHFA 2Q9CA 3GJ8A 3TE6A 2PT7A 3B8HA 1DAKA 1ZP6A 2R2AA 4AYXA 3QF4A 1JJ7A 3B6EA 1II9A 1QVRA 3RRNA 3RYTC 3UK6A 1J8MF 3W3AA 4PSKA 2XNDD 1GNQA 1U81A 4TTRA 2OXCA 1GRNA 3THWA 1O3YA 1J90A 1ZC4A 3LQQA 4W5JA 2GBLC 2KBEA 3TBKA 1E2NA 3QG1A 3H4MA 2AWOA 2J3EA 3LFUA 4DDVA 1YHNA 3AVQA 5FTKA 1N0WA 1VYUA 4B6EA 1RFLA 2WJJA 1OE0A 2FV8A 2IEYA 4M0LA 3U61B 1JQJC 2YKGA 5F98A 4JZKA 4R9UC 4BFSA 4DLUA 2ZS9A 4MGIR 1RRCA 5E95A 1R0YA 5JMTA 2V6JA 1SKYB 3A4MA 5C2JB 2ZEJA 4LSGA 5L3QA 4YQFA 1G18A 4WW0A 4BFUA 4FWIB 5FTJA 2ZU0C 1HV8A 4DCNA 1CBUA 1Z0IA 1D2NA 4NHOA 3IIMA 1SKQA 2YOHA 3IGFA 5KTYA 3EARA 3TNFA 3EX7C 3BOSA 1YZQA 5KHOC 3P26A 1JXOA 5HPYB 5F3WB 5EP3A 2QN6A 3PEYA 2WPDA 1NSTA 2ZYWX 4M53A 1D9ZA 3QVVA 3X1ZA 4M2LA 3CRQA 2ZRMA 1DAHA 4R2HA 4TLAA 2WAYA 4D0NA 3F8TA 3AVUA 4GRAA 1VHTA 4TMTA 5BYKA 1XD9A 3FVQA 4AK9A 2QG6A 4KV9A 2D7CA 4Q4JB 1KO1A 3NVAA 3ZZ0A 1F2UA 2RAPA 4N0DA 1OH5A 4QGFA 4KBFA 3KJEA 1GDDA 2A9KA 5EXXA 3B9QA 3T1VA 1QHHB 3U6BA 3SFVA 1YU9A 1G3MA 5JHHB 3ZS9A 3L2OB 3ZD6A 4BRUA 4PSVA 1KIMA 4TLBA 2CNWA 5EXSA 1KK3A 2KE5A 4GT1A 1GKYA 1MO3A 4TMVA 2I1QA 3QXCA 3CZPA 4IDOA 1E0KA 5FOSA 3TR5A 4WZ6A 4N0EA 2XTNA 3CUEF 2IW3A 2I1VB 5HZHA 2QL6A 1YZTA 4ACAA 3UPUA 4GZLA 1KMQA 1SXJB 2REXB 5TB5A 5KNCA 4H1UA 1Q44A 1UBCA 4PC7A 4TTPA 3OEEA 1A1VA 4XTRA 4AURA 5FTLA 5JLJA 3KFXA 4OI2A 2W6JD 4NCIA 4A8JA 4HI0E 1CJMA 3DOEA 521PA 2HUPA 1HE1C 2ZRJA 4C30A 3R9IA 5FPTA 2C95A 1P72A 4DLWA 4G3XA 2QTFA 4Q9IA 1N6LA 2NGRA 4Q01A 5E4FA 3GEHA 1W4CA 3BBPA 4AYWA 5JBQA 5FBLB 2KSQA 1IY1A 2PMKA 4U00A 2ZR7A 3SC3A 4PPNA 3U7GA 2QE7D 2CHVA 1SQ5A 3SHWA 4GI7A 3AM1A 5DN6D 2W58A 3K1JA 1J7KA 4AIIA 2BBSA 2RGXA 2GWHA 2OCPA 4HSEA 5E7JA 3TW8B 2IS4A 4US0R 3SJCA 4KFRA 2A3RA 4M9SA 3GFTA 1DO2A 3K9HA 4AKHA 2BMJA 3UMSA 4IDPA 4A6XA 3B1YA 3PITA 2IWRA 3V4FA 3QPWA 1XU4A 4C7OB 3BWDD 1VKJA 3KKOA 3GJ6A 1HT2E 4OHXA 5KSZA 2DFNA 2VL7A 1ZIPA 4D2IA 4Q03A 2VTKA 1U94A 1KKLA 4AKGA 2DBYA 4ZO4A 2FPKA 5CYPA 3GJXC 2O8BB 221PA 1E9DA 4EJSA 1SZPA 1XTKA 2BDTA 2XJ4A 3L0PA 2JLVA 3SBEA 1E9BA 3GJ5A 2JLZA 3L0IB 3AVPA 5H1YA 2WMOB 4AG6A 1OJLA 3G82C 1E98A 3FFAA 4S2EA 4PO8A 1R5OA 4BLRA 4BFWA 4DLXA 5JCZA 1XEXB 4V0KA 1U90A 2Y8EA 4A4DA 4M1SA 3QEJA 3HPRA 1FP6A 4KYUA 3N70A 2NO0A 5K8UA 2C03A 1NMXA 4MKHA 3QIAA 2CK3D 1KHTA 1QZXA 3C14C 1WMSA 2AL7A 2ZTSA 4CDGA 2CE7A 2IS1A 1I4TD 1ZM3A 3RS7A 3AVTA 1W46A 2MMGA 1A82A 1SHKA 2MMCA 4LWZA 4BFTA 1E2QA 3TSZA 4CGZA 4J0QA 2WOOA 2GCNA 2DY1A 4HAUA 4NYJQ 5FR1A 1V5WA 2IXEA 5EUMA 4GL2A 4C0KA 1E2GA 4ZCIA 4EUNA 1EFUA 4XOIA 4A0HA 2NO6A 1GITA 3KL4A 3MG9A 3UMRA 3BAFA 4DIEA 3NEJA 2AXNA 3PG5A 5CIQA 5FL7D 3KQKA 5M04A 3V9PA 2F55A 4HUQB 4MUBA 4MGKR 3U44B 1QHIA 5B64A 3N5CA 2FG5A 1YVDA 4EJSB 1NLYA 2YWHA 3ZS8A 2Q9BA 1WXQA 1XMJA 5TXGA 1S0UA 2BM0A 2FFQA 4L5BA 1RRPA 2EYQA 2GEVA 4W7SA 1OXXK 3S1AB 3FMIA 1KI6A 4JLKA 4NMMA 1LW7A 4A92A 1RJ9B 5KDOA 4X8MA 1P60A 3RRZA 4Q66C 3LV8A 2YC2C 3FMOB 3RABA 4LRWA 2DCUA 4Z1MA 2FEOA 2NTYC 2VIIA 2W2VA 3OE7A 5JSZB 5DYIA 3W3ZB 2A5GA 2P2LA 4C0SA 2V6IA 5L3QB 4G5QA 5HE9A 3BS4A 2XOKD 5FUXA 5SZHB 3ND9A 5CDFE 4XVRA 1VCOA 3TVDA 3WHLA 1W36B 3LVQE 4IDQA 4O25A 5CB6A 4A15A 1JXMA 2V1UA 2QQEA 2VP6A 2IF0A 1X1SA 5EXTA 1IXSB 2ZRFA 5LBIA 1EX6A 1MKYA 1G7TA 2J46A 1IN5A 1KI2A 2WWGA 5BN3A 1G4AE 2FGKA 3B1WA 1KGDA 1YZUA 2ZRPA 3JZAA 4JIMA 5JEEA 4KCGA 1W4BA 4Q7MB 2VH5R 4ARZB 3SYKA 5FTNA 1GZSA 2QMEA 2J1LA 3K53A 3RDPA 1P62B 2VBCA 3M0EA 3IQWA 3A36A 4KXFB 4PAQA 5GVSA 3A4NA 5JI2E 3O8DA 4CW7A 1EFRD 2VHJA 2ZRKA 4Q7LA 4Q7JB 4M21A 2B7CA 1D2MA 3HDTA 2PMDA 4OQMA 3QF4B 121PA 1KO4A 1XPOA 2DR3A 3EZ7A 5D3QA 3K0AA 2G1JA 2GESA 3OIUA 3LLUA 4OJKA 2BJWA 4WXRA 2NPFA 3O8CA 4Q18A 3U3RA 1LB1B 2PBRA 4YMVA 1U0HC 5TY0A 1KDTA 2ZSBA 2ZRIA 4PC3A 1DG1G 2HJVA 2ZSDA 5FBRB 3ADCA 4TT3A 1D9XA 4F91B 1AS0A 2W83A 2IUSA 4KLZA 1VYVA 4IW3B 1RW4A 2NPIA 3B7GA 3QKSA 2WJYA 2R44A 4JS0A 4E22A 4DB2A 3EIHA 2FWRA 2WWFA 5KNBA 1P2UA 4KFTA 5GJVC 2GF0A 2WJGA 3AF0A 4MYTA 4Q02A 4NCKA 3K9NA 4DCSA 3LW8A 1LNZA 4LOAA 1W36C 4EFLA 1Z3IX 2IT1A 2QU8A 4GBMA 1YR6A 1YE8A 4HZIA 2IWHA 1M74A 4MUAA 4C9BA 2A5YB 3SJZA 4CRWB 1Q1QA 4Y0VA 4F4JA 2WHXA 2ZRAA 3IO5A 1N0VC 1ZINA 4PHHA 2EFCB 3QKSB 3VR2A 1G6HA 1KTVA 2CHGA 2WSSA 1TU4A 5G41A 2Q3MA 4GP7A 4K8OA 2O8FB 2OAQ1 4PR0A 1W2GA 4CYMA 1A2KC 1G8GA 3K9LA 3CLVA 5DYGA 3CIOA 1US8B 2VYFA 1NN5A 2XB4A 3U60B 5LD2B 3GLIA 4B35A 3WY9A 4URXR 4LHZA 3U7HB 2F9MA 1U2RA 2H1LA 3ONWA 1Q1ZA 2C9YA 3I92A 1MRSA 3TUJC 3RRMA 3RWOA 5JS7A 5KPDA 2WWHA 4DIDA 1XNJA 2ZQ5A 4IXMA 1SVIA 1MOZA 4F38A 2ZRGA 3CBQA 3A58B 4OHWA 1FMJA 3FHOA 1W4RA 3KX2A 3MWYW 4TMXA 4A0FA 2W2TA 4ZCMA 1AK2A 5IT5A 1YKSA 3KB2A 2CL7X 1TU3A 5GJCA 1KI3A 4Q1BA 1C9KA 3IUYA 1OH8A 1OB5A 4ZDIA 1QVAA 5JJKA 4ZPXA 1M8PA 2JJ1A 4B44A 3K0SA 2XGJA 4RD1A 2ASEA 3T5GA 3FMPB 3W8RA 3VTKA 5C4MA 5J4VA 1JALA 3HPQA 4LYAA 4I1OA 4M4SA 2ERYA 1RYFA 1DELA 4RFSA 3WNCA 3PR1A 4AYTA 4JLJA 2DWQA 4NYJR 1PUJA 2ODBA 1AQUA 3QE0A 4DSTA 4BE7B 2FFHA 3TLXA 1HA3A 3QOFA 1OV4A 4ZIRB 5JRZA 2GXAA 2JDID 3EPHA 1T9HA 4F4IA 3VR4A 2GDJA 2KBFA 2HYDA 1CRPA 3D31A 2ZJ2A 3DZ8A 3ADDA 4HUQA 1XJCA 2CL0X 1ZNXA 3PFIA 3N2EA 4URZR 1OLOA 4YXWA 3K0CA 3EXAA 4EPTA 2G0TA 4PO9A 3ICEA 3LXRA 2P3SA 4M9ZA 5GJBA 2FFBA 3M1IA 2CLDX 2JCSA 2YOFA 4IVQA 3K70C 2DB3A 4B32A 3L0SA 1PZNA 2R6GA 5BWMA 1KZ7B 2B7BA 2EWWA 4PHFA 1E2DA 4OI0A 2ZRNA 2C9CA 3JVVA 5EE5B 1M7HA 1QG2A 3IDQA 4B3BA 5TV2A 3QXJA 2GZDA 1KAGA 4OQLA 3RAPR 2ERXA 5KNDA 2GEUA 1G3QA 2NZ8A 4N1AA 2WSMA 1XTQA 3LNCA 3F5FA 1DVRA 2P6UA 3REGA 3E1SA 2DHRA 3GLIB 3EPKA 3VNUA 2VSXA 3P4XA 3MWKA 2AR7A 4LCBA 3THWB 1CKEA 2B92A 2VP2A 3F0TA 3PUYA 3GLGE 2BEKA 4POAA 4KAXA 4HLDA 3WYGA 1TF5A 2GBLA 3EA5A 5J4HA 4QL3A 3OIVA 5SZJA 5IRCD 1FQJA 4QBGB 1EFRA 3ASYA 4P31A 3TAUA 1AJEA 1AKYA 4P32A 5A4JA 1TEVA 4FMBB 3GLFA 4QHSA 4XWAA 1EXMA 5FTMA 4RCZA 4TMWA 3GPLA 4FWTA 3W6NA 5L3SA 1E2KA 4Z8XA 1CR0A 3W9YA 3LD9A 3B60A 4JLNA 3AKYA 1BIFA 1OF1A 4TQ9A 3DKVA 4B71A 3B5JA 2G0NA 2CDNA 2YJTD 3K70D 3AF3A 5JHGB 1E69A 4Z54A 1IM2A 1G19A 2OCBA 2H8KA 1VG1A 4JLMA 4XVQA 1SXJC 3EPJA 5FPSA 4PPFA 2GVZC 2QPAA 2E87A 2FN4A 3MUFA 4TN1A 1H8HD 4X8HA 2D74A 4NYMQ 3OIWA 5H70A 2JLUA 3GJ4A 2XZOA 2UKDA 3GJ3A 1NRJB 1G8PA 5P21A 2FGJA 1Z5ZA 3C8UA 4G5GA 1KJYA 3KKPA 1CU1A 1XF9A 1XEWX 5BXQC 2ZRBA 5AJVB 5HCIA 3U3KA 2NOAA 3RSOA 1Y3AA 4XWOA 4B48A 3DDCA 2WVJA 3U4QB 3KTAB 3LBIA 2ZSEA 4WIAA 1DOAA 2CK3A 1P2VA 2ZRHA 5A0FA 3KUCA 5A5GA 4N3NA 3RS3A 1S1CA 1W47A 3W5IA 1Z07A 1XD8A 3BFXA 1GIAA 1XWIA 4EKDA 1G5PA 3I4LA 3IEUA 1G7CA 1KI9A 4OBEA 2K5UA 1SVLA 4DEXA 4A2QA 1WE2A 2OCYC 4URUR 3NDPA 3IKJA 1IXZA 1IAQA 3KXLA 3B1VA 1GL6A 4M1WA 2IYRA 4C0QC 2CBZA 1GM5A 2BV3A 1IY2A 1YQTA 5EP2A 4LJ6A 1NG1A 3RS0A 3BC1A 1HT1E 2WBLC 3CRVA 4MRRA 4TYPA 4GMXA 5C1BA 2W6IA 2C9OA 1P9WA 2GVDC 2GA8A 2J0UB 1OXSC 1GUAA 2IYVA 2P65A 5EUQB 2O8DA 1G64A 1ESNA 4PQYA 1BYUA 4LV5B 4LYFA 1G8FA 3A1UA 1DG3A 4QC2A 1X8KA 1ZD8A 5J4YA 2WAXA 1WDTA 4ZDJA 1ESMA 2CLSA 2V55B 2BCGY 1GP2A 4JBWA 5KSOA 1DAFA 4LJ7A 4H1VA 4R71A 1KDOA 1CTQA 2JIZD 2IX3A 4MH0R 1BH2A 4DC9A 4DDUA 1KAOA 4JJZA 4OYHA 1I2MA 3NXSA 5JCPA 1LTQA 1UBGA 5DH9A 4JL6A 1OHHA 1OKKA 1PLLA 1W0KA 3EWAA 4FMDF 4S35A 2A78A 4YDSA 1X1RA 3GLFE 1XPRA 5CLLA 4CEIB 2O0KA 4QG7A 5EZ6B 3CPJB 1IJFA 3D6TB 5AJWA 4B76A 3SR0A 5AJYA 1AKEA 3FWYA 4A82A 2X2EA 4BLPA 1TUIA 1EFHA 2EFGA 2HDNB 5DI3A 2LCFA 2V7QD 4FMCF 1EFTA 2GCPA 5J4LA 3DZDA 2R62A 4MYHA 1Z63A 3Q9LA 4GPTA 4D80A 5ANRB 1BO6A 3IILA 2JLWA 2QMOA 3DPUA 4K46A 1JAHA 2JIZA 3JZMA 1ZUNB 2R8RA 3NH6A 1BS1A 2IYXA 3CR7A 2GILA 2YYZA 3BH6A 3AVWA 4LC0A 3KFVA 3LO5A 1KSGA 5DHAA 3TQFA 1S2MA 1U8YA 5TDHA 4D4KA 3BXZA 4WA7A 3VNVA 3R8FA 1G4UR 3KXKA 3OFNA 3BB1A 3MJRA 2C04A 4YMSA 4DZZA 1PV4A 2D06A 1NBME 1XEWY 1W0KD 3O47A 4M1KA 4QBFA 1F5NA 2FDCA 1OFIA 1P4SA 2O8EA 1BKDR 1VDZA 1CF4A 1P2TA 1E2HA 2IXFA 2OBLA 1E79D 1H8EA 3QI2A 3U2QA 3VFDA 4HB2A 1COWA 3QBTA 1FPMA 2HXYA 2OSBA 4LBZA 3PEUA 3T1OA 2VP5A 1OH7A 1UAAA 1OXTA 1PLKA 4HATA 3DL0A 4L9SA 4YONB 2RMKA 4OKSA 4D81A 3B9PA 1BYIA 2QSYA 5AUNB 1NVXQ 3GQBA 4DXAA 3A6PC 4NCHA 3NTUA 3SFZA 5BN5A 1UFQA 1ZM2A 1VYTA 4K81B 4BQSA 3IHLA 3CX6A 1QHSA 1R8QA 4FCTA 1GFIA 3QKUA 2QAGA 2ONJA 1GAJA 3LLMA 1KNQA 1MABA 1S9DA 3ZZUA 2WWXA 2O5VA 4IFEA 4JMPA 1ONBA 3DVLA 3ZGXA 2F43A 4KFUA 2G77B 5F9FA 2EFDB 3AGQA 3LDAA 1KNXA 1JAIA 2EWVA 1UDXA 1ZUHA 4A8JB 5JWRA 5KUTA 5GJWC 1E2MA 2JLSA 4JL8A 2HV8A 3A1TA 4OK6A 2AD1A 1VCMA 1R4AA 2PZGA 4HZUB 4P4SB 2BHRA 1NMYA 3TQCA 5HKKA 5JJIA 1LVGA 2Q21A 1FL9A 3L0OA 1FFHA 1ETUA 3GLHE 2F1IA 2WMNB 2ZR0A 3K0CC 3M4YA 4G0NA 1DAEA 1BOFA 2FSFA 2PEZA 4V0LA 1Q20A 2GNOA 2WJIA 4DRZA 2IS6A 3CZQA 3T1QA 2ODEA 1KY3A 4NYIQ 2YC4C 1VPLA 2ZRLA 3SBDA 1WBBA 1JEEA 1CJKC 1LV7A 3C4JA 4QGHA 3MWLA 2GJ9A 3QXHA 4AKIA 4CZ2A 1SVKA 2ECKA 2V3CC 2VSOA 1SXJD 1K5GA 4Y0AA 5BYJA 5FPYA 1T5IA 3T06B 1KO5A 4G5RA 1MV5A 3CWQA 1R5NA 3DEFA 1OT3A 2GCOA 2FOLA 4PQFA 3OAAD 1N25A 2ANCA 4JSTA 2ORIA 3VHLB 2OLJA 2RGNC 2ZE6A 2GJSA 3CH4B 2ZETA 1OB2A 1TNDA 4OQFA 1OFTA 2DPXA 1QBKC 1OIWA 2YWGA 2QY9A 3TSWA 2GRJA 1NI3A 1YR7A 3EZFA 3LQRA 3H1TA 1L2TA 4B2LA 4EFMA 3T34A 3WYFA 1AGRA 3PEWA 4D26A 3BERA 1P9RA 3EIEA 3SI7A 3ZQ6A 1LS1A 1XTIA 2OEPA 3ZZTA 3Q72A 2O52A 3TUIC 4DSUA 5B30A 1K5DA 3DKPA 5FOVA 4D25A 1G3RA 3LVRE 2BBWA 3BE4A 5GVRA 1SXJA 4TSFD 2IUTA 5DE3A 1NN1A 4V0MA 1MT0A 5JSZA 5E7IA 3FKSD 4AI6A 2GJ8A 4US1R 2PLRA 4A2PA 1CP2A 1R0WA 3QBVA 1XXHA 3THXB 5FH9A 2NO7A 2ZUDA 1N2CE 2ZREA 3N2IA 3KKMA 4LPSA 4URVR 3VKWA 1YJ5A 3EZ2A 1GWNA 1G17A 1PUIA 1UJ2A 2OXRA 3MWJA 4IEEA 2G3YA 3BGWA 4LV6A 3I73A 1II8B 1XTSA 1F3OA 1U9IA 4RFVA 3TRFA 4EQ6B 2ZIAA 1AS2A 4MGYR 5F9HA 3MFYA 4P33A 4FIDA 3VU9A 1E0AA 1JB1A 1L7VC 1UF9A 2HXSA 2ZJOA 3GFOA 3VR6A 1IBRA 2OE2A 5EZ5A 2QENA 2H16A 2RHDA 1U0LA 4JYCA 4OK5A 3ZIAD 3PQCA 3QF7A 2QSZA 4MDEA 1NBMA 1II0A 5HE8A 4E03A 2ZXUA 1WB9A 3IIKA 3VR3A 1ZNYA 3MSXA 4AG5A 2Q6TA 4BFVA 3HWSA 1WCV1 5CJPA 4DLSA 2AKAB 2JLQA 4M22A 4U7DA 2OFOA 1AS3A 2QGNA 1G1MA 2OHFA 2UVQA 3PVSA 1G41A 2FPLA 2VQSA 1L8QA 1IOZA 1XDBA 2HF8A 4LJ4A 1KY2A 2X19A 2GEDA 1G3IA 2WSSD 2PZFA 4DLTA 3GJ7A 1S3SA 1N5IA 2DWPA 1LY1A 3LBHA 1RE0A 4Q7KA 1CIPA 5GADl 1DAGA 3SS8A 4GOKA 2WWIA 4LGMA 3DMNA 4W5WA 1R6BX 4IJMA 1MO6A 5JJLA 5KPJA 4M1OA 1DBSA 3NKVA 2XSZD 2VRWA 4JLOA 4DDTA 3OESA 3OZXA 1VCIA 2REBA 2PJZA 1E2IA 1NBMD 2R9VA 4URWR 1DADA 3A4LA 2WJVA 3QPVA 1GRRA 4MRSA 3TVTA 4V02A 3ZIAA 1CRQA 3HU1A 2O8BA 4JKYA 4NKRA 2AK3A 2ZSFA 4KBGA 5LB4A 4C0HA 4Q9KA 2WIAA 4YLGA 4F92B 2JATA 4Q1DA 2DFTA 4IFBA 4KSCA 4AY2A 1BMFD 4L8GA 4PHGA 4A36A 3LY5A 3I1FA 1YZLA 1N0UA 2FF7A 4IDNA 3U3JA 3WHKA 3VMFA 2YVUA 2IF2A 2RGCA 1R0XA 3PV0A 1XTJA 4OK3A 2V7QA 2ZE5A 2ZYVX 1X6VA 3QQ5A 4NCJA 3EW9A 3HU3A 3KJHA 2ZR9A 3ZVNA 2RGDA 1W36D 5G40A 4Q48A 3BFKA 1ZNZA 1Z29A 4YDHB 2GJKA 2CVHA 1JNYA 2XXAB 4HLUA 2QBYA 2JDIA 2BMDA 3UWKA 1GG2A 1KI1A 2VA8A 2XSZA 1XRJA 2ZITA 4QXAA 5J47A 1EESA 1V43A 1XB2A 1VIAA 5D3MA 2QA5A 2IS2A 3RLFA 1PLJA 2ZM5A 1VG8A 3CNLA 4MRNA 1CR1A 1R7RA 1A2BA 3AVYA 4RKFA 3QY0A 4YXWD 2QT1A 4LZZA 1Z0JA 4HAZA 1YR8A 2O0HA 1XJQA 2QI9C 4HDQB 3NG1A 4HAXA 1L4UA 2QEQA 3B1ZA 5IF9A 1IY0A 1CR2A 2J9RA 4LK2A 2ZAOA 1W44A 3P20A 5B57C 1TQDA 5DGXA 4MDFA 4EPYA 1H65A 1E1RA 4NCNA 2XAUA 4TT3D 2REOA 2YV5A 3GCGA 1N6NA 4PSAA 1O87A 1NJFA 5TARA 4DBLC 4GOJA 4JL5A 1TL7C 4D4MA 1TTTA 2QP3A 3AVXA 4DCVA 1GKUB 1IJEA 3RS4A 3WNBA 4Q4AB 1I2DA 3RS2A 3LBNA 1E9CA 3TKLA 2NO1A 3C5HA 1RRFA 3QXSA 4TL9A 3WMFA 2ZJ8A 1NP6A 1FX0B 4BUJA 3RSLA 4Z8YA 2IK8A 4XD7A 1TADA 2QAGC 4ARZA 5FR2A 5LPNA 3ZVRA 1JPNA 5CDFA 3W34A 1XMVA 5J40A 3ADBA 1Z0DA 1A7JA 4PAOA 1KK2A 1NVUQ 3DM9B 3DO6A 2YNMA 3T5DA 1P6XA 3HU2A 2R6FA 3TIFA 1G9XA 2IYYA 3SNHA 3BRWD 2A2ZA 2O8CB 1UADA 2RKOA 1OKKD 4TWZA 1K8RA 2XZPA 1DEKA 1A5TA 1E4YA 3RHFA 4WOPA 4B3XA 2QP9X 4EIWA 1MO4A 4B3FX 4HB4A 1UDWA 2ZVQX 4Q4JA 3TSOA 4DVGA 4NH0A 3P4YA 2IC5A 3QJYA 3L82B 4DLRA 1Z28A 1E6CA 2VHCA 3QUSA 4D6PA 1ZM7A 5CB8A 4IOMA 1SVWA 2A5FA 4LV8B 5DSZA 2EU8A 2ZPTX 1P5ZB 1QG4A 4TL8A 5CK5A 2NIPA 1E96A 1FQKA 2GXUA 4Q4AA 1ANKA 1GVNB 3H2YA 4PC1A 1S8FA 2FNAA 3U6KA 4AWXA 3CW2A 3QEOA 5KSYA 3VHXA 4QM7A 1XMIA 3NHBA 5L3RA 2CVFA 2PT5A 4RZ2A 4I1SA 5TMPA 2OT3B 1VECA 4CEHB 3KQHA 3LH5A 4G5SA 4NE2A 4FCVA 4B33A 3BB4A 821PA 3NC1C 4X8OA 4EPVA 2XJ9A 3E2IA 3BH0A 4RVCA 4ON9A 3U5ZB 3GFPA 3ZVMA 421PA 1WA5A 2RCNA 4E07A 1E94E 4OJQA 1N3BA 1Q1EA 2QPOA 2FA9A 3TK1A 2NQ2C 4MKIA 2CEAA 4B2PA 1WQ1R 4IHQA 3CX8A 3I3SR 5K8LA 3I32A 1CULC 1NKTA 3VR1A 3GLIE 2ANBA 3CPHA 4UXHA 1GKIA 1JR3E 5J4KA 1TMKA 4HLQB 4US2R 4C3ZA 4EPWA 2PCLA 1E9AA 4OHVA 3WP1B 2BM1A 4QBHA 5AR1A 4CVNA 4IVPA 1AA9A 2VF7A 2QE7A 2V8OA 1FX0A 2QZ4A 2DYKA 2QRZA 2NZJA 2FZLA 2JA1A 3UG6A 3AVVA 2JLRA 3DHWC 1M6NA 1E1QD 1PVOA 2OCAA 3J81k 4TQAA 5HTKA 4KITB 3EAQA 2WWWA 2ZRCA 3HJNA 1EGAA 4LYJA 1EWRA 4PO1A 3FHTA 4B3CA 2P0EA 2Z0MA 1X8JA 2ODWA 4HAVA 2HT1A 4Q5IA 2I3BA 1BMFA 1HY3A 2H5EA 2PLFA 2IYUA 1XD2B 1ZD9A 2OZEA 5EE1A 4V0ME 4HDCA 1KI7A 3EWSA 1FTSA 4DLYA 2BVNA 2W2XA 1Z6AA 4HB0A 4XSHA 3TAHA 2C77A 4JLAA 3WRXC 4BFYA 1ZBDA 2JGNA 4PXAA 4LJYA 5AJZA 1CR4A 2FZ4A 3CM0A 5H8WA 1KJZA 3SE0A 1FW6A 2J0VA 2CNWD 4PPGA 1LF5A 2GCOB 1IN4A 3CB4A 3CWZA 4OI4A 2ORWA 3EC2A 3ZYCA 4GDFA 3GLFB 1NKSA 4O0MA 3V4RA 1FOEB 2GETA 3OEHA 4HAWA 2J45A 4LBYA 4QJ5A 3MCAA 3QXXA 1LS6A 2PEYA 2WKRA 3AP1A 4B75A 2F1HA 4OL0A 2GF9A 4FMDB 4QBIA 2HCJB 1JI0A 2QBYB 2R65A 1P61B 2J7PA 1DS6A 4V0OA 5G3YA 1OW3B 1Q0UA 5B58C 1XMSA 4TLDA 5KDLA 4B47A 2BKEA 2LKDA 3A37A 1NIPA 3OFND 3A1WA 2CMKA 1ZIOA 5JEDA 1DAMA 2GXQA 4D82A 4IKEA 1TQ4A 3I62A 4BFXA 1WBDA 3LRPA 3NIBA 5AK0A 1ZMXA 2CCJA 1HTWA 2ZE8A 3GD7A 1T3HA 2RGEA 1D5CA 2FMXA 4GMDA 3TH5A 1HQCA 1F6BA 2ZYTX 2XTMA 4D0LB 4NP6A 5FFMA 1KOFA 3BK7A 2N46A 2QQ0A 3D8BA 2AD5A 4B2IA 1RYHA 2JAQA 4MYCA 2QP4A 3AF2A 3FPAA 4G5OA 2FJUA 4ITRC 1G7RA 2E1RA 3VKHA 1F2TA 3LXXA 3QVUA 4G01B 3OEHD 5FUVA 4QGAA 2D4HA 4ABYA 4LJ8A 3V00A 3PXGA 3QSYA 1XTRA 1E4VA 4II7A 1SGWA 4DUGD 3H84A 1NG9A 4U02A 4QNRA 4AC9A 5JS8A 4BZQA 1W48A 1ZJ6A 1E2PA 4UNPA 4NPHA 3SU8A 5F2EA 2YWEA 3FGNA 2OM2A 5DISB 1W5SA 4MKGA 1T5LA 3HR8A 2QM8A 1G16A 4ZKEA 3ICQB 2XB2A 4TSFA 2PL3A 3UATA 4DLZA 3Q7QA 5DI9A 1S4QA 1OHHD 3HP1A 1OSNA 1ZC3A 2QRNA 2ZE7A 4Q1FA 1Q12A 3B1XA 2F9LA 3GP8A 3EA0A 1WF3A 2NG1A 2QPTA 4KFSA 4BLQA 2AHOA 5KOYA 2RGGA 2XZLA 3S1AA 1T0JB 4V0NA 3KJGA 5IK2A 3THYB 3MD0A 2B6HA 4A1FA 1FUKA 2IHYA 4WBSA 1XCPA 3WMEA 4TYQA 3KQNA 1KSHA 4PC2A 3NEYA 1KK1A 1M34E 1WRBA 1GRQA 3Q5DA 3Q5EA 1JPJA 2G88A 2P6NA 3VAAA 4MITA 3QG5A 1M1YE 1QF9A 2CLCX 3AUXA 3A8TA 4NZYA 3AV0B 3NHAA 4RD6A 4ASUA 3I8SA 1HURA 3T35A 5LDDC 1RC8A 2H57A 3UXMA 4LHXA 3CF0A 1JR6A 1GNPA 4IOLA 2O8FA 1AZSC 1HEIA 1AM4D 4JVMA 1UM8A 3THXA 3UANA 3X2SA 4M8NE 5BQ5A 5TVKA 1ZRHA 5CM8B 3GEEA 3X1WA 4CEHA 4XTCS 4Q1CA 1TQ2A 4RY2A 1HYQA 5K8TA 4TYYA 1H8HA 4M9QA 3W5JA 4I1UA 2J59A 1XJ0A 1OIVA 4RZUA 4BPBA 2VP4A 4IDHA 1T8TA 2IEZA 3FB4A 2VHUA 2W0SA 3CPEA 3TGPA 3SYLA 3IHWA 3VX3A 3P32A 3RVBA 3L8ZA 2BBOA 4DWJA 3RRYA 1IN6A 1R2QA 3MGCA 1MO5A 1VCNA 4DB4A 1FMLA 3I5XA 2GHIA 2W6ID 1P2SA 1NSFA 2EW1A 4UQOA 5J5CA 1HE8B 3ZJYA 1PJRA 3BH7A 3AF4A 2ZI5A 4KVAA 3FMFA 4M1YA 4PZYA 1J8YF 3WMGA 1DARA 2XX3A 5FOUA 1P73A 3CRW1 4I1VA 4QKQA 1SHZA 1Z6YA 4B3GA 4TQUS 1N6IA 5EE9A 1HUQA 4O2RA 2VPPA 2IBMA 4KHZA 1GL9B 1R10A 3Q8XB 4I99A 3FKSA 4Q1EA 4JLVA 2Q0HA 1AN0A 1DE0A 4BFZA 5KO2A 3U7FB 3L43A 3MAAC 2PZEA 5C4GB 4DSNA 3OIYA 4IEIA 1W49A 3BORA 1MABB 2IYTA 1NY5A 1RVDA 2ZJZA 3H86A 4FXPA 4BZPA 4CF7A 1E2FA 4Q19A 3TW4A 3K0AB 4D4JA 3BD9A 4LX0A 2ZJBA 1JR3D 1XEXA 2J87A 5G53C 5HKKD 3I5YA 4W9MC 1L4YA 2HLDD 3M6AA 3BIFA 1N6HA 3HYRA 1FTNA 3MJHA 5HZKA 2ZSAA 4XIGS 2A30A 1NN3A 2G83A 1OXUA 3KKNA 4G1UC 4I81A 5JRJA 5KDDA 1GL7A 2G1KA 1ZCAA 2IHBA 2WKQA 4KJZA 1HH4A 4RSGA 2I4IA 3KB1A 2E9SA 3K09C 2AXPA 3QKRB 3R9WA 3ADKA 1E1QA 2O0JA 1NVVR 1ZM4A 2OLKA 2BIFA 4UXIA 3NBYC 4PPQA 4HYYA 3FDIA 5DIFA 5FOWA 1W1WA 2PX0A 3KJIA 1N5JA 3K70B 2D3WA 2NMVA 2ZI6A 2BC9A 2JJ2D 1KMHB 4FINA 2CCKA 3FHCB 4GNKA 1R5BA 1P7CA 4LJ5A 3RWMB 5EQTA 4EDHA 4DT1A 1QHHA 4PHTA 4RZ3A 1NIJA 1GSIA 3TUZC 2AFIE 2RH5A 5FI0B 2AFHE 4B74A 3ZD7A 4FW9A 1OH6A 4DEYA 2BWJA 4BZXA 2HLDA 3REFA 1X8LA 2XNSA 1Q3HA 4QHYA 4F4CA 4JVSB 4B34A 1JR3A 2AN9A 4BWYA 1LFDB 2GXSA 2H17A 4TMKA 2ZI9A 4EJSC 2KB0A 3GLGB 3ZDQA 5EE0A 2GKSA 2JJ8A 5L3SB 2ZVPX 1GNRA 3NBZC 3C41J 2GZHA 2Z4SA 3KZ1E 3THOA 1UKEA 2KJQA 4ZV4A 4ESHA 2IL1A 1UKYA 5IHPA 2F3RA 1CEEA 1ZUIA 2QROA 1RZ3A 2BEJA 3AB3A 1UBFA 2W0MA 2RGAA 5LB2A 1OXVA 1U98A 3HYTA 2C2HA 2IUUA 4M9XA 4MRVA 4ZIRA 5DO9A 4OI1A 1LF0A 4JT4A 3Q85A 4LC1A 1JECA 1UBEA 2WTUA 4A0RA 2TMKA 3R20A 1Z0AA 2HJGA 2QGZA 3EZ6A 4EFNA 4TLEA 4D4LA 2Z5FA 5CIWA 1RKBA 1EWQA 1D6JA 4R98A 3ZQJA 4Q9LA 3WNDA 1IQPA 4MA4A 5CK4A 1EX7A 3LX5A 5L3VA 1TAGA 2ATXA 3SN6A 5HR5A 1G21E 4MYUA 1E9EA 4TL6A 2LWIA 3VR5A 3WXMA 1ZD1A 5JI3E 4HDOB 4TYNA 2EFHB 2ZUBA 5E7MA 4KI0A 2CJWA 3C16C 2ZJ5A 3GLGA 3NDBB 3QNUA 1SKYE 5EE3A 1QDEA 1R8SA 3KUDA 3IPYA 1NVVQ 2FSHA 1E9SA 3BJIC 3OE7D 3PENA 2G6BA 4YMUA 1KO7A 4HEJA 4DLVA 4L16A 5AUQA 4JLPA 3NH9A 3AVOA 3K0FB 1SXJE 2O8EB 2CJWB 4HAYA 1E0JA 2P67A 1IN7A 3DMDA 4XJXA 3IPXA 2F6RA 2J7KA 4P4UA 2P5SA 4QJ4A 4CIDA 1ZYUA 2FFAA 1S9HA 2QUZA 4LDJA 4QM6A 1IXRC 1E1RD 1G6OA 1G5TA 4X8LA 2QT0A 1ZW6A 2C99A 1U8ZA 2DWOA 4RCYA 4TYWA 2KWIA 5IK2D 4RJLA 1K6MA 3GEIA 2R6DA 3AP3A 5H68A 3WBJA 2BMEA 1OIXA 3P27A 2XTZA 3E70C 1TEXA 2VEDA 1KDPA 4NYIR 2J0QA 2O8CA 2ZJAA 1AQYA 3CX7A 3PIRA 4RZXA 4UNQA 1QHGA 1E2LA 2GTPA 1G20E 2Q3HA 4EPXA 1QHNA 2C78A 1WP9A 1D8TA 4FN5A 5FUYA 4ACBA 2HF9A 4LJAA 5FPHA 4L4UA 3IEVA 3B13B 1KO8A 1ZNWA 3MRSA 4KVGA 4PX9A 3T15A 4Q1AA 4DSOA 3ZVLA 3FE2A 4XSGA 3CO5A 4HZUA 1ZVQA 3B78A 4P4SA 3DOFA 5FL7A 2ZYUX 3R9XA 1F60A 1I4LD 5BN4A 1U0JA 4LBWA 1Q57A 2CHQA 4BLSA 2Z43A 4BEBA 5AJXA 5FPKA 2D62A 5UKDA 1F48A 4LI0A 1Z2CA 3G5UA 1W5TA 4ZCLA 3GLHA 3KDSE 4C0JA 3AUYA 4WZBE 4O3MA 3Q3JB 3GJ0A 4DKXA 4R2IA 5SZIA 4C4PA 2MSDB 1XEFA 2ZS8A 2RHMA 4AD8A 4DJTA 721PA 1Z08A 1RIFA 2BOVA 2N42A 3PUVA 2Q9AA 2ZU6A 1KMHA 1SVMA 2C8VA 2Z4RA 1RRGA 5FL3A 1KI8A 4GZMA 2BCJQ 1B0UA 1AIPA 1AGPA 3KXIA 3D7MA 3K0FA 3W8NA 4PZLA 3QKRA 4ZDWA 4OQNA 4OQXA 5KYKA 1FUUA 1TF7A 2H7VA 3O8RA 4MKFA 3SZRA 4A0GA 4WXPA 1QRAA 3FYHA 5AUOB 2VHTA 3VU9B 1G291 3ETLA 2FSIA 4IOJA 3WYAA 5CM9C 2XXAA 4NBSA 3W6OA 3VKGA 4C2TA 3RANA 4RD4A 3OHMA 4CEJA 1JQLB 1JBKA 2WM9B 2UZ3A 2B8TA 3EZ9A 3ECCA 4DHEA 2V4ZA 4JKIA 4Q21A 2J5XA 1VHLA 2VP9A 5FOTA 3W90A 2H18A 1CXZA 3ND8A 3RS5A 3CNNA 1T6NA 2F1JA 1Z47A 1Z6XA 2IA5A 1G7SA 4UNNA 1X86B 3B2EA 1KI4A 1YZKA 3HR7A 1TF2A 3QPUA 5C18A 3JVUA 3TMKA 2FSGA 2ZI7A 4C0LA 5EP4A 2WICA 1T8UA 1XXHE 5KU1A 2ZI4A 3RC8A 2WIBA 2C96A 1S1MA 3ZH9B 4GP6A 3W6PA 621PA 3EIQA 3KKQA 3LX8A 2JJ1D 1HQYE 3CONA 2W6JA 3BB3A 2RGBA 5DI3B 3NBFA 2JJ2A 3SQXA 1Q22A 1NL3A 3NBXX 3SJAA 2CE2X 4A6PA 1KDRA 4QOSA 1ELOA 4KODA 1XCMA 2F7SA 4BLOA 1U9IC 3FFBA 4UNSA 2IXGA 2B21A 3C5CA 4A8JC 4C0BA 2D2FA 3LAWA 2AWNA 3ZLJA 2YHSA 3AKCA 1Q21A 1FZQA 2X77A 5IDVA 1M7BA 1DPFA 3MLEA 3FKQA 4PAMA 4RFSB 4F7WA 2YOGA 2D2EA 4B43A 3LWNA 4Z51A 1Z6GA 3AQ4A 2Z83A 2J41A 3TR0A 2IYZA 2J7PD 3X1DA 1OYWA 3A1SA 3D3QA 2OILA 2UZIR 2ORVA 2N1BA 3RC3A 2BJVA 4DCTA 1QHXA 3T12A 1Z22A 3SYNA 5FUWA 1D2EA 3UIEA 4H9GA 4IVRA 4DCUA 2SHKA 2ZJYA 4Z1MD 4CT5A 3VX4A 1P75A 1MRNA 3I72A 4B6FA 1N6PA 5K8IA 4FMCB 1MH1A 4I4LA 3H0KA 3PCRB 4LHYA 1N6RA 2GZAA 4UNRA 2CCGA 2V54A 3X1YA 1YRBA 1E2EA 4OHYA 4A9AA 1E3MA 2ZI3A 3AGPA 4JLDA 1EG7A 2FPMA 2EYUA 4YMTA 4ZI2A 4CEIA 4QNMA 1XBTA 4EQ6A 1EK0A 4WZAE 3NC0C 4EPRA 1ZM9A 4MRPA 2OUKA 2WKPA 5E3HA 4E5UA 3DM5A 3I8XA 4TZ0A 3VQTA 1XXHB 1M2OB 1E0SA 4A2WA 4JJKA 3U3OA 4XVUA 4URYR 5EP1A 4ZKDA 4DDWA 2CL6X 4BEJA 5JFGA 4LY6A 5B2ZA 3SOPA 5JWOA 3T1TA 1DO0A 2VF8A 1TQ6A 2AX4A 3U7EB 2AKYA 3SEAA 1IONA 4L9WA 4PC6A 4OHZA 1G8HA 1ODFA 1Z0KA 4Q4HA 2GAAA 3IQXA 3CRMA 4XWKA 1T0HB 4XH9B 5CLQA 2WOJA 1NJGA 5DHFA 5JZVA 3WP0A 2GK6A 2XEXA 1UPTA 1W0JD 1S3GA 2C98A 3CKLA 1F2TB 1R0ZA 1Z6TA 4LUCA 1ZU4A 1OFHA 4RD2A 2P6RA 4NL4H 1KYIA 1U99A 2PH1A 2WV9A 2ZRDA 3CF6R 3Q7PA 4HLUC 5L8VA 1NY6A 1QHYA 3CH5A 1U8AA 1T4GA 4DT1B 4Q4HB 2A5DA 4PQRA 2JLYA 1W2HA 4RD3A 1Z2AA 3X1XA 5DN6A 3R7WB 2MSCB 3U3MA 2OV2A 2FH5B 2O8DB 4FI3C 2R6AA 3AKEA 2WZQA 4LPKA 3B82A 4AKEA 3EG5A 2EVWX 3GLHB 4KLNA 4CT4B 2BKUA 2ZROA 2J0SA 2PCJA 1NF3A 1KKMA 2QMUA 3OEED 1XX6A 2EQBA 4ILEA 4JLBA 1XZPA 5DLQC 2FE4A 2V9PA 2L0XA 4YMWA 4ASUD 2F1RA 5ELXA 1XFAA 2ZAMA 1N5KA 5G3ZA 3G0HA 2QNRA 2V1XA 1W0JA 3FOZA 4Q4LA 3TJZA 2CXXA 2ZS7A 2A5JA 4HUTA 4IXNA 5EXPA 2A7QA 4NONA 4PZZA 1KK0A 4B3DA 4IOKA 3KQUA 4FCWA 1T91A 3PJRA 2VLIA 1E32A 5CITA 1NN0A 1Q3TA 1GILA 2PJRA 3AKDA 4NYMR 1KI6B 3BFVA 1SVOA 2IYQA 2WWYA 2JEOA 2HT6A 1Z8FA 4TTQA 2JASA 2QTVB 5DNYB 4HB3A 2ATVA 3THYA 3T61A 2GK7A 3IBGA 3UMFA 1NLZA 2QAJA 2OBNA 1E9FA 2FEMA 1CS4C 2PX3A 1XCGB 4QGGA 4XD7D 3KQLA 2ZANA 1EFCA 2XNDA 4JT2A 3IBYA 3K0EA 4UJ3A 3CNOA 1TX4B 1I4DD 2QAGB 1FP7A 3B85A 1T3LA 5FBVB 4TZ6A 4JSYA 6Q21A 3CR8A 3PUWA 4B73A 5LD2C 1RJ9A 4C2UA 4U5XA 4JVLA 2HCBA 1JJVA 1II8A 5JECA 4P4TA 4Q00A 4M1MA 4KO8A 2HYIC 3EC1A 2OG2A 4L15A 3CF2A 2G9NA 4WAUA 2DFKB 1DAIA 2VHQA 5CYOA 3RNLA 3IO3A 3OAAA 2GAOA 3ASZA 4D0GA 5AUPB 3U44A 1YR9A 3FTQA 2IYWA 3UWOA 2BBTA 3K09A 3L8YA 4ZDKA 1NNEA 1YZGA 3K8YA 1A4RA 1VMAA 3EPLA 4NDZA 1S96A 1SVSA 2VO1A 4LHWA 1NMZA 4P3YA 5C46F 1G5RA 1SULA 1XZQA 2GJAA 2YZ2A 4UJ5A 3C15C 4RD0A 4P0TA 4KU4A 2F3TA 4LJ9A 1W7AA 3AF1A 4BECA 1KSJA 1TUEA 2VP0A 1KJWA 4KSBA 1E9RA 2B8WA 1OYYA 2WPDD 4WVFA 4Q9JA 4QHTA 4E09A 5FBWB 3UKDA 3U4QA 3OF5A 4PFSA 2OFWA 4QRHA 4UXJA 3R8CA 2D7DA 3A1VA 5AWFC 1FNMA 1VG0B 3PUZA 4M1TA 3SDZA 4FD2A 1IHUA 1Z06A 5FBQB 4CEJB 2HEIA 1UKZA 1ZU5A 2YWFA 4HLCA 2H92A 2R6CA 2WJHA 4C7OA 4JBYA 2OBMA 2J0UA 3E5HA 1UKVY 4LHVA 1Z83A 4LBVA 2X8AA 1COWD 4W5HA 1ZCBA 2DFLA 1VTKA 1P3JA 4NU0A 2LKCA 1UEJA 2ZUCA 1T3SA 2RB4A 4BGDA 4IRUB 4BASA 4C0AC 2AK2A 5D3MB 3O8BA 3IIJA 2IYSA 1VIYA 1JEDA 2VSFA 1YRAA 1FNNA 1E2JA 1TPZA 1UEIA 4LYHA 2OO7A 2OAP1 5KSPA 2QMHA 1KZGB 4GOXA 1CJTC 4TL7A 3I61A 1GOTA 1B23P 4Q47A 1IN8A 2KI5A 1E99A 3P1JA 4MQBA 1YZNA 3SJBA 2XITA 1M7GA 1OFUX 1C4OA 2JLXA 3PEVA 1CJVC 2BMFA 1RPZA 2QM7A 2XOKA 3QKTA 1KSFX 1US8A 2X1VA 3C7KA 4GSYA 4EAQA 2C5LA 1N6OA 1DTSA 2OFXA 1CJUC 5FI1B 3EASA 4QJ3A 1N5LA 5EJEA 5HCNA 2EFEB 1X3SA 4NTZA 4ESVA 1E79A 1J70A 1H8ED 3NWJA 4JYBA 4BLTA 2IYLD 3AH8A 3AEZA 2W00A 2QORA 1G8YA 2FU5C 3KTAA 8OHMA 1NLFA 4JBXA 4MGZR 4Q9HA 4DUGA 4O2LA 1ZAKA 4UKDA 3UG7A 4YC7A 1Y63A 3AP2A 3PUXA 4ERNA 5CJ2A 3R7WA 1XPUA 1J2JA 2ODNA 2Z6VA 1J99A 3QENA 3K9GA 1P9NA 4KYIB 4PANA 1OPXA 2P5TB 4JVNA 2FX3A 4GFDA 3WBKA 4PTLA 3LW7A 2MSEB 1XD2A 1CLUA 1F2UB 2YINC 1MR3F 2Q3FA 2OESA 1Q1BA 4ZI3A 3WRYC 1XP8A 2QTHA
chains in the Genus database with same CATH superfamily
4EK9A 1IUKA 1U5BB 3KDPA 3OUUA 1C3JA 1ZJ5A 1VG9B 4RW0A 4TMZA 4NOKA 5SICE 4AUNA 4R7ZA 2IKSA 3P9PA 4XM1A 4D41A 5H59A 2XUHA 2ZUVA 4J76A 1NU6A 5JWHA 1YH3A 2LGJA 4G8JA 4RACA 3ICOA 5BQFA 4BO4A 4BRWA 5GIPE 1AZTA 4GQIA 4QFMA 2F43B 2JHFA 4JENA 1ZG3A 1C1YA 3CRRA 1W4AA 4KEAA 2A58A 1OXMA 2H5IA 2XMGA 1L5LA 1KQGA 3G8DA 3QPAA 4QUEA 1M75A 3EEIA 2R2AA 1U4NA 3EXIB 4N3CA 4AYXA 5BMVB 3JAWA 3VHRA 1NJ8A 1O97D 2VF5X 3EIXA 3EGVA 3PPVA 5A5FA 4W9NA 5KNCH 5LU8A 5IVHA 1YFZA 3W3AA 4XIIA 2XNDD 1JAXA 4RVOA 1ZHFA 4TTRA 2XMRA 4RTKA 3NT4A 1J90A 3N7TA 4BJ3A 1ZC4A 2BE7A 2W5UA 4E2YA 2C2XA 2GBLC 1QCCA 4FOSA 4B82A 3TBKA 4DV0B 3DZGA 3TS1A 5LXTB 2P3OA 3V33A 1F9EA 4ZAFA 1XRMA 4KSYA 4PYLA 4BVJA 1C30A 4WN9B 1FXUA 1XPJA 4P3XA 4GKAA 5TMDA 1V4BA 3E8MA 1N36B 1G5IA 3ICVA 2HJWA 5FWYB 1XQVA 2XT6A 3WWEA 3O8NA 1DOZA 4GG1A 2IEYA 3U61B 2XUAA 2W98A 1VE7A 2YKGA 1U7HA 4JZKA 4FHFA 1EX9A 2GO7A 3F4LA 3L8GA 2ZS9A 2YFYA 1RKUA 1W85B 2BGIA 3OCUA 4TS3A 5E95A 3ZCPA 1WKBA 4ECAA 5JMTA 2AGVA 2YDXA 4RV5A 4FS8A 5C7LO 5L3QA 1G18A 1X0VA 2NAPA 4WW0A 1T3TA 1TKCA 3I2FA 4U6QA 2FPIA 5FTJA 3TMYA 4DCNA 1Y9ZA 1Z0IA 1Y1SA 1JJBA 3DNMA 1IJKA 1D2NA 1IEXA 1PDOA 3NKLA 2X22A 1WVMA 2EBFX 1WXWA 1JJAA 3HRIA 3IGFA 2AB0A 3ILHA 3GVPA 3P0EA 4Y6LA 1KQPA 4AS3A 4F3CA 1DQYA 3HNRA 3PC8A 5K6RA 3BOSA 1JH9A 3JTEA 4FKMA 5ECYA 1AV6A 2RHHA 5HPYB 1O96A 3EA4A 3M82A 3EOAI 5BURA 3NRCA 3H42B 4J0CA 1NSTA 1TUBB 4ZVPA 3HK2A 3PEYA 1JZTA 4H0CA 2JHCA 4M2LA 5IZCA 4W82A 1DAHA 2WAYA 1GPAA 5EKUA 4JOCA 1TM2A 2HJ9A 4HXEB 4TMTA 3ETDA 1XD9A 1CZLA 1GAQA 4QXPA 5JTUA 3NOXA 4JN6B 2AMLA 2J32A 2D7CA 4MVJP 4Y9RA 3UJ9A 3WQSB 1O6GA 1UC5B 5AVYA 5H9WA 3ZZ0A 1QYRA 3N5KA 2RAPA 3PQ7A 3JW8A 4E5DA 5EXXA 1SUSA 2B6NA 4TV8A 3JARA 3T1VA 3WMXA 3UMMA 2R85A 1G3MA 3HJTA 3O8LA 3L2OB 1H5NA 2GEBA 3DBIA 1VIDA 1C3XA 1KIMA 3OZRA 3ZI4A 2DZDA 4BQQA 1Z17A 2CNWA 4ZCRA 1ZDMA 1Y7LA 2KE5A 3NANA 5C7OO 3F1LA 4BYGA 4QOIA 3VUFA 1TTPB 4LMBA 4IDOA 1OX5A 4QAJA 5FOSA 3TR5A 3GK3A 1X38A 2HF2A 4FEAA 4U1RA 3U1BA 5LBTA 2C7RA 3E5NA 3UPUA 4UC0A 1L1QA 1CY6A 1A50B 4Q05A 5IAOA 3OKPA 4H1UA 5BSKA 4PC7A 4OA8A 4TTPA 5TVGA 3ICPA 1L7NA 3HB9A 3I9NA 4HWPA 4AURA 1FLNA 5JLJA 4TV9F 5BSMA 2XF2A 2QRLA 4A8JA 4R68A 5JD6A 1TJ3A 3NM5A 3BHNA 3EZLA 3K1YA 5J63A 3L6OO 4UVDA 5EFZA 2F4NA 2ORYA 4W99A 4EG5A 5COBA 1QANA 4OQYA 1Y1TA 2QTFA 1N6LA 4Q9IA 5F12A 2C7QA 3RPEA 1RAIA 4M3NA 4IJQA 2IU3A 3EJ6A 4AYWA 5JBQA 1YC5A 3H2IA 3PIDA 3J81A 1YFJA 1IY1A 2ZR7A 3I52A 4R4JA 3U7GA 4TOIA 3AHIA 4HH3C 5IJWA 4B40A 1SQ5A 3SHWA 3AM1A 1YJAA 1ZD2P 2IHTA 4Y9UA 5L3ZA 2Y27A 2GBFA 2DH6A 3K1JA 3OHPA 2RGXA 1OAOA 1EHYA 4ML3A 2AW3A 3RYIA 3SJCA 4BVLA 3DEJA 4DV5B 4ND1A 8MHTA 2A3RA 2WM8A 4G8CA 2WTXA 3AM5A 2XUJA 4C08A 4IPTA 1QFYA 1UDCA 3F46A 3IQZA 5DT9A 1DO2A 3K9HA 1P33A 3USES 4AKHA 1MCZA 3QELB 2P62A 2Q5EA 2ZJFA 2PWYA 4PVCA 2BMJA 2JG3A 4IDPA 4A6XA 4CQMA 4OIMA 1AE1A 1CC1S 1YS1X 4F2GA 5I7RA 2X8BA 3Q8KA 3MUNA 4E2XA 1JILA 1XU4A 1FU7A 4CG3A 2IQ5A 2JEYA 2PGLA 4U8HA 2NZXA 3G23A 3GJ6A 4ARUA 2O19A 1HDYA 4D9HA 4OFXA 2GS9A 1M6WA 4WX2B 2VTKA 1XEAA 5AK6A 3H05A 1WMDA 3IXLA 2FPKA 5CYPA 4L6CA 4YR7A 1Q0QA 2ZIVB 3FN4A 3GJXC 5DCUA 3K5WA 5I8PA 3EG9A 3RUIA 4DQ0A 1Q0TA 4EJSA 4KX5A 3WYEA 4LGYA 4KHPB 3A28A 1GTSA 1Z35A 1A7UA 3L0PA 3OETA 2JLVA 4PXSA 1CUCA 3P2OA 2A9RA 3L0IB 4D42A 1KBOA 4KFCA 4MS3B 3PFGA 2EP5A 4DLKA 2WUDA 1UAYA 1Z25A 3G82C 4DNFA 4F2PA 5ED4A 3PFNA 4X84A 1A7KA 1AKMA 1HORA 2QD2A 1C80A 4JNCA 4BLRA 5DHRA 4BP8A 5JCZA 1UFKA 3DAPA 1AHPA 2ZUSA 4R8LA 4U63A 1QIMA 3DEZA 4EHLA 4M1SA 4GF5A 1XT6A 3BXXA 4ROSA 5K8UA 2C03A 5DXFA 1NMXA 3FI9A 3KE8A 4MKHA 3VR3D 3SWWA 2GN1A 4UUPA 2INGX 4ZJPA 1JA9A 1QZXA 2WHEA 3C14C 4R3WA 2ZB2A 2CL5A 4FYHA 2F3UA 3C3KA 1L5ZA 2HHJA 1QO0D 2GFIA 3GH1A 2PMWB 3K96A 4V1CA 3AVTA 5A3RA 4NJEB 3KM0A 2IZ7A 3UYKA 2BR4A 4J0QA 2GCNA 1UC9A 3G2KA 1GXSB 4OV6B 1Z33A 1E2GA 4HD8A 4B73A 4C0KA 1O0CA 1EFUA 5JW6A 4G1BA 3MG9A 1P45A 4BJHB 4L9AA 4D8UA 1DAPA 1ZK0A 3SZGA 3E7FA 1O54A 3RG8A 1XLTC 2BHSA 1QHIA 4NNJA 4PX5A 4EJSB 3DZFA 3MRTA 5CA1F 1PZEA 5C81A 5AVRA 4YPOA 3PC3A 1YS4A 1OBOA 1XO1A 5JZOA 3ZY2A 1ULZA 3B70A 4INPA 3FD8A 2BM0A 3OZGA 2FFQA 4E7PA 1BDJA 1Q92A 3KALA 4XWWA 4RUKA 4LMAA 4DIFA 2GEVA 2PUEA 3E58A 1E3WB 1T0BA 3PNLA 4KPUA 5AVOA 4BHTA 2ZUEA 1OOEA 2E4UA 4RF4A 4GPBA 1ZL2A 4XRGA 5KDOA 3NALA 3L1IA 2XMZA 1PN3A 3FTCA 4XYBA 2WT9A 4Q66C 1P29A 3LV8A 3VUEA 5B4TA 3BL5A 2DCUA 4LRWA 4OMFG 3OE7A 3H2GA 2W2VA 4Z1MA 2RKWA 5HMMA 3IA7A 2OHJA 2WJZB 4JYMA 1C9JA 4ID3A 2P2LA 4IKPA 5L3QB 4G5QA 3BS4A 5DZSA 2BUCA 5K0FA 2SCUB 3FDJA 1W9MA 2PBLA 4AICA 3REOA 3B6KA 3B8EA 4X1OA 4X20B 4XVRA 4AP6A 3IOCA 1ZITA 1W36B 4IDQA 4NWIA 4BGEA 1JXMA 3VR0A 2V1UA 1Y37A 3L40A 4YAIA 2VJPA 1GCIA 4FS3A 5LBIA 1E1DA 3DL2A 5A4KA 1T5HX 2WWGA 5ELXA 1AF4A 2FGKA 3B1WA 2ZRPA 1R8YA 3EVBA 3GVIA 5HDBB 5ADWA 1E6LA 4YP1A 1L4KA 2VH5R 2SICE 3MGAA 3RV4A 4Q4DA 4A7PA 5IJAA 3REQB 4L6IA 4BIIA 2Z5LA 3A36A 1E64A 1IHYA 2CFOA 3A4NA 2I71A 1EFRD 2VHJA 2ZRKA 2JKYA 1LBTA 2B7CA 2BMAA 3HDTA 3N6XA 4P4NA 2PMDA 2RD2A 2MR6A 1KAEA 3AMVA 3V8QA 1UDBA 3AY3A 2P9HA 1KJQA 1YR1A 2DR3A 2QW1A 3BCSA 3SXUB 1XPOA 2G1JA 2GESA 4MJLA 3MTJA 3NBMA 2BJWA 2JCVA 1R9NA 4MNTA 1GQQA 5CB0A 3T7IA 4IGIA 2PBRA 3DLHA 3WSVA 3WLNA 1X9HA 4AJPA 2R2GA 3WK4A 4JJ8A 4PLZA 2ZSDA 2FZVA 4IRMA 2QMZA 4EMUA 4NZMA 1WHSB 1RRMA 1FMTA 5E6RB 2IUSA 4BIMA 4O4IB 2VWGA 2MSWA 4R2MA 1MC4A 4MX8A 2X8JB 2UUPA 2H29A 3QKSA 3NM4A 4TWBA 4FDUA 2R6JA 4ZO7A 4IG9A 1GYQA 3KBBA 4INZA 1AUPA 2FWRA 4N03A 5C8ZA 5KNBA 4H6PA 1P2UA 1W19A 4YECA 2GF0A 5K0LA 5K8VA 4MYTA 4GP9A 4X63A 4K9DA 2WYHA 1VGQA 4CKXA 1EFKA 1HKUA 1QR2A 2AX3A 2QHXA 3CISA 2GZ2A 3LW8A 4QNNA 4UBKA 1TM4E 1ULHA 2EKLA 4EFLA 1W36C 4EX6A 4IFTA 1Y7TA 1C7JA 1YE8A 5BPHA 3VR4H 3OO1A 1I6WA 3ZX5A 2BY4A 1PJSA 2A5YB 3ABOB 4FB4A 4F6LA 4O02B 2PU5A 3R8XA 1VXRA 2ZRAA 3DLCA 3QFSA 1DBIA 2FHSA 2NXNA 2ZWIA 3A3YA 3ELUA 3ILYA 3K0HA 3O2QB 1PR3A 4UOQA 5DNDA 5JVDB 3QKSB 3SJUA 3HFJA 1G6HA 1KTVA 2CHGA 1IQUA 2WSSA 1TU4A 4L9RA 5LQKA 3JPYA 4GP7A 3F3MA 4PR0A 1JQEA 4CYMA 2Y6VA 2R0QC 1A2KC 1QORA 2P3QA 3BJZA 3ZCTA 4BNLA 1US8B 3C6MA 4ZTUB 4S1VA 1RYYA 2VYFA 1NN5A 3UAWA 3ZCQA 2TECE 5LD2B 3F2VA 4WDRA 4UM9B 4B35A 3WY9A 3DMFA 3ZJTA 1U2RA 2H1LA 3ZUPA 4EJFA 2C9YA 2DHDA 3I92A 1MRSA 3RWOA 2P35A 4WJZA 2R8PA 2J33A 3QSGA 4IXMA 1MOZA 2BFOA 2W2KA 3CMMA 2OO5C 4KN6A 3N6VA 2GN9A 3DOUA 4MPDA 2FDXA 1ODCA 3A58B 4OHWA 4H2DA 3ZE2B 3FHOA 1RXUA 4AXXA 3WLSA 1JIUA 1FFWA 1XA3A 4N8SA 4TMXA 2W2TA 2XVXA 1AK2A 1NYTA 2GPNA 2CL7X 3G5LA 1P7YA 1TU3A 4LY9A 1H2FA 2ON6A 2C54A 1KI3A 1MEJA 3IUYA 4F4DA 4LAFA 2X6TA 2FVYA 4HY3A 5I5EA 1QVAA 3REQA 2B2CA 3JATA 1HDGO 2H1WA 3AJ8A 3MM4A 4K6OA 2O59A 1M8PA 1R0CA 2QN1A 2YVQA 4DZTA 2OXIA 4LXYA 5BMOA 2VZLA 3NHWA 3T5GA 3ZTTA 4Y2XA 2V7EA 3KVVA 3MWEB 4DXHA 4CIWA 4CL2A 5J4VA 1VL1A 3HPQA 3SF0A 2OPHA 4I1OA 3KK0A 4ZU1X 1V47A 3II6X 5KYNA 5BWBA 4HDNA 4NYJR 1ST2A 5HKLA 5J2UB 2BHLA 4E2WA 3TM5A 4BE7B 4EMBA 5LQDA 1V5IA 1OYOA 1X7DA 2H2GA 3GRYA 1XTZA 2WB2A 1ZVMA 5AD1A 1ZR4A 1XZEA 2C4MA 2O23A 2XIQA 1KEEA 2GXAA 3IOYA 3EPHA 3F98A 5U4XA 1P6UA 2IFTA 3VR4A 5K8CA 4KQWA 2GDJA 1K6EA 4HG2A 3D31A 5E1DA 2ZJ2A 1WV0A 1N57A 3T0IA 3ADDA 4HUQA 1MVNA 3ENWA 3N2EA 2YVLA 1MEOA 1GN9A 1XHLA 1ADJA 2AQHA 1K88A 2G8NA 2JPDA 1JHYA 3EXAA 2HWYA 4H16A 1IB6A 4PO9A 5CBKA 2P1RA 1M6YA 1Y8RB 4E31A 1F3LA 1HR0B 1ZIXA 4ZYWA 2EGHA 3FNEA 4FE3A 4RSRA 2V0GA 1HGXA 2KLBA 2JFWA 4IVQA 4B32A 2DB3A 3UAGA 4EI2A 1N32B 1PZNA 5BSFA 3RFXA 3UKOA 3M6FA 3OCXA 3WJAA 5HS4A 1YQEA 3F6SA 2GKGA 1DDGA 3OY7A 4EZIA 2C7GA 1CRZA 2DM6A 4B3BA 5A3QA 4JOBA 2GZDA 4LZPA 2X0DA 2JI4A 3EQ7A 4YH1A 2WIFA 2J9FB 3PCTA 4TPKA 3K5PA 2WSMA 1XTQA 1FMCA 3LECA 5ALHA 3ZDDA 2YJ5A 3O92A 2ZIFA 3EXHC 4OOEA 4BO8A 3O3OB 4NBTA 2C94A 3DFFA 4R8VA 3THWB 4FHCA 2JIMA 3F0TA 3QUCA 1TM1E 1UT8A 2H7CA 3E5RA 3R7DA 1MB0A 5I7UA 4UVEA 4HLDA 3SCZA 3U4GA 4IO1A 3IAS6 4DIUA 3KSBC 4K1XA 4OB7A 3Q3HA 4F4HA 5IRCD 5KTSA 4QBGB 1JNXX 4WOKA 4ZRDA 2O1SA 2C5BA 1YFLA 3QYJA 4ZO6A 1VMKA 1USIA 3I04A 5A4JA 2AOUA 4QHSA 4XWAA 1Q77A 1EXMA 3GH3A 4HQLA 4M9UA 5FTMA 4RCZA 2R7MA 2GA9A 2J31A 2JBWA 3NP7A 4KIJA 4Q82A 5F1KA 3N3AC 1XMPA 4JLNA 1SRQA 1TJYA 5GAJA 4LFAB 1R8JA 3B5JA 1RXVA 2OENG 1DIRA 3ZV6A 5ECGC 3H83A 1E69A 4Z54A 1IM2A 5LNK6 4UNIA 2GYYA 1SXJC 3LHKA 4CUZA 1JTEA 1PU2A 5FPSA 3VM6A 5CDHA 3BIJA 1KQNA 1TECE 3MUFA 3QHAA 1HDZA 3OQBA 1H8HD 2VDVE 4TN1A 1EU1A 1T8WA 4KQCA 5FP0A 1U0SY 3PC8C 3PLRA 2VDPB 4FGLA 2XZOA 1W94A 3FNHA 4FOTA 2VYQA 5ALIA 3DXZA 5P21A 3KSZO 3R77A 4CR7A 1C4XA 1KJYA 3KKPA 1CU1A 4HXYA 4D6YA 5BXQC 1GPJA 1JDVA 1CDZA 1IVYA 2WLSA 3P0IA 4BX0A 2FY8A 3M6IA 4XWOA 3RCBA 3RT9A 1K89A 2XZTA 2IHJA 3GP3A 1NPDA 2WVJA 5CVUA 2I65A 4RPIA 2DBQA 2R5WA 4NOJA 3P9YA 4R1LA 4DJJA 1ZBQA 3AEQB 3KKZA 1P2VA 1NMQA 2FZCA 2RBKA 2ZRHA 4G2TA 2G40A 4X0EA 3SE7A 1W47A 2HI0A 3FJ1A 2EWMA 4DMLA 5TLSA 3W5IA 3ZWOA 1A5BB 4IZOA 4QULA 4U7GA 5ER6A 2GF2A 3I4LA 3LUGA 2JFNA 3FWHA 5JDCC 1G7CA 1KI9A 4OBEA 5C5CA 4DEXA 2OCYC 3MN1A 4G09A 1T2DA 5KREA 1JH8A 3IKJA 3B1VA 2JI8A 2P9CA 4C0QC 2CBZA 3VYSB 2BV3A 1IY2A 1JIVA 2DBZA 3FPJA 5DLEA 1PFKA 5AW7A 1LK0A 1Y9AA 3UXEA 4QQKA 1CUGA 3STWA 1HSZA 1KEWA 1K66A 4PRZA 5DGHA 5TT1A 1Y3HA 3MA0A 1KRHA 4LJLA 1P9WA 3TQQA 3B1JA 1MAHA 1GUAA 2IYVA 5EUQB 1J09A 1ESNA 1NTOA 4PQYA 4F4UA 2ZUTA 3FCUB 1PAUA 3A1UA 3KAKA 4TZTA 3K1AB 3TJMA 4IGFA 3HKEB 2HK6A 5B6JA 3CVWA 5EJMA 5IX8A 5J4YA 2O3TA 5L4NA 2HU2A 1AMUA 3TD2A 1XXLA 2I2CA 2CLSA 1IEWA 2V55B 4EZEA 4ZDJA 2PE5A 2BCGY 2DX7A 4MV3A 1GP2A 2HQBA 4JBWA 4YO8A 5KSOA 1XNRB 2OORC 2HBZA 3KKLA 4FSDA 5CFPA 1NVBA 3CJQA 4KBYA 4O1IA 4R71A 3NBKA 4P53A 4RABA 1IOWA 1YZHA 3HA7A 5E0KB 3H9GA 4DC9A 5FEUA 1KAOA 1PYOA 2B37A 1TA4A 1I2MA 1AGYA 2P7HA 3IV7A 4RTJA 4K05A 4ER0A 4BL5A 3KQMA 3U48A 2VJQA 2WTMA 2GEFA 4L5CA 4XUDA 1A8PA 2ZBVA 1QR6A 2FUEA 2ZK7A 1I10A 4S35A 1XVIA 3H4VA 1ZA2A 3C8HA 5HG0A 5HGJA 2AR9A 2R4TA 1XPRA 1CZRA 1AKRA 1SD1A 2O0KA 4PGHA 2FQWA 1T2EA 4PYJA 3RAEC 1E7SA 1IJFA 3HB4X 1X7XA 4R1PA 1QRUA 1OAOC 1Y5NA 3ITKA 4JZYA 5HXAA 2PRIA 2PU7A 3GZTB 2DHCA 3WIBA 3U39A 2IEBA 3LHSA 4A82A 3LGXA 2AI2A 2X8LA 4KKVA 2EFGA 1TW3A 2HDNB 5JXGA 4DY4A 5ECDA 3KPYA 4FMCF 4DWVA 2GCPA 2X5OA 2X1LA 5JS2A 4ENUA 5K3OA 1XTUA 4L95C 3IURA 2OMEA 3DO5A 4TS9A 3D4BA 4FFLA 4KN5A 2Q4RA 3VNRA 1GGHA 4BZWA 1ZUNB 5JC8A 1LLQA 1QAMA 3NH6A 2GBCA 4YK7A 3NW9A 2AS0A 4X3OA 3OY2A 2Y77A 3WC4A 3VSAA 1RXYA 3FFXA 5L51A 1K63A 2FRDA 3N2KA 3H1AA 3KFVA 1NW8A 3LO5A 5I47A 2H3HA 3AT1A 1IZZA 1NHWA 3TQFA 4F71A 4QFDA 5TDHA 3U1VA 1M2VA 4AJ9A 4ZOLF 3URKA 1BJTA 4FXOA 3KXKA 4JQZA 1B6TA 3DMTA 5A4MS 3N2GA 2GRAA 2D06A 1ZRNA 2VPXA 5B3JA 3AU9A 4UTXA 4F6RA 2UYCA 4QBFA 4JB3A 3L01A 2X6QA 4RS3A 4HL6A 4GVPA 1BKDR 3DE1X 3BWXA 4FTWA 3U2QA 1E2HA 3VFDA 1H8EA 2C4VA 4CKBA 3ZHYA 3LUFA 1BXGB 1DUSA 1KMIY 1YUNA 3DMTC 4F9GA 3FVRA 2YYSA 5CMLA 4QOJA 1VMIA 3D3NA 1F2VA 1YRQA 2P1ZA 3IPLA 1FPMA 3OFVA 1PO7A 2OSBA 5I51A 4J3FA 2RE8A 3BMNA 3CLTC 1OXTA 2BSAA 3DL0A 3SF8A 4W5QA 1LDNA 2VRBA 4ZRNA 3V8BA 1BYIA 3ZU3A 1RI2A 4BE9A 3E7PA 1VZ2A 5JNVA 4HH0A 4S2UA 1JEOA 3SFZA 3URMA 1THTA 5DTRA 3W7AA 5LIPA 2HBQA 2WAAA 1TIBA 1QQ6A 3F5DA 4BQSA 4C6TA 5EFOA 1G0NA 1EIZA 1R8QA 1T2AA 3JAWB 1GFIA 4FCTA 5EIBD 3QKUA 3DS8A 2O7NA 5DU2A 2JGRA 2ONJA 1MABA 1TO1E 1UC8A 1T9BA 2AQIA 1K7CA 2C7VA 3R3XA 4IFEA 4JMPA 4P6VF 1ONBA 4RK1A 4AZWA 3ZGXA 5CNIA 5JQWA 2F43A 2G77B 3AGQA 4HWTA 1GQ2A 3LDGA 1JAIA 2EWVA 1P7WA 4TRRA 4PGGA 4CM8B 4PN3A 1ZUHA 1LI5A 1JR4A 5JWRA 4RIGA 5HOEA 2IHKA 4B17A 3R24A 2G4LA 2PZMA 3CKMA 1IZ7A 1GV0A 4FFWA 1VCMA 1J97A 1R4AA 3C3EA 3LC7O 3ODGA 4P4SB 5TQ0A 3I1JA 1NMYA 4MKZA 5JJIA 2G72A 3Q1KA 5HFNA 5DNUA 3L0OA 1SQ0A 5FPQA 2NVBA 3NVMB 5C1OA 4P5PA 2Z98A 5AIAA 1PWXA 1MOSA 4PE5B 3QJ5A 5EJ4A 1BOFA 3LRXA 3TZKA 3C1AA 2Z4TA 5T4FA 4DRZA 3DHVA 2IS6A 3T1QA 2AFIA 5F23A 3B12A 4BQEA 5HS6A 4KWEA 4DUZB 1WBBA 2FXVA 5FWXB 1L1EA 2B98A 1LV7A 2P90A 4RLFA 5G4LA 2HHHB 5A03A 1BWQA 3GXBA 5ALKA 2AZ4A 1PR0A 4HNGA 3GJSA 1B7GO 1NQUA 1GQRA 3GJTA 4OB8A 5EIFA 4ERXA 2VF4X 1SURA 1KO5A 1P77A 3W9SA 4ZYTA 1ZH4A 2PSEA 1NXVA 1XIVA 5HUQA 3MRVA 1OT3A 1UPBA 2GCOA 2PUTA 1SUFA 3SMVA 3I8OA 1FP4A 2OB1A 1QNLA 3H2BA 2RHCA 4KC0A 3KLBA 4JSTA 5FWXA 3UWSA 3VHLB 1S3FA 4MVJH 1JL3A 1UXGA 2OHOA 3DT9A 3P5BA 1BX0A 1M34A 1QBKC 1OT5A 2E49A 4QTYA 2YWGA 4TS4A 2ZBQA 3WIEA 3AB8A 4IWYA 4WDQA 1SBCA 1WPQA 2QUAA 1P31A 3EZFA 2HQRA 4LRXA 2I2BA 2OV8A 4R9NA 3DQZA 2PNFA 4F1KA 4H1HA 4YRAA 1S6YA 1AGRA 1UJNA 1AHIA 2X2OA 3G9TA 4D26A 3HJUA 5AHOA 4C6SA 1WCYA 2AF4C 2OCXA 3LU1A 3PZBA 1NUHA 3OOWA 2E6KA 4CMEA 3LUAA 1GGFA 4JJ4A 3QXGA 1RPJA 5IKXA 2FSVC 1SUWA 3TUIC 4DSUA 3K8OE 3KPJA 4TWRA 4RETA 5FOVA 3UFXB 1RT9A 1XP5A 2CNDA 1Y7IA 3KYIB 4PTZA 1ZMRA 1QO0A 3BE4A 4XYMA 5GVRA 1OROA 4TSFD 3QWIA 1ZA1A 4UMDA 7REQB 3CSUA 1M8KA 1WO8A 2OP1A 4ZOCA 5DE3A 2NU6B 3NTOA 5JSZA 1MT0A 3CN7A 3ZW9A 4NH4A 4JH0A 1J20A 1QC5B 1X94A 4E1BA 1YOBA 3OM9A 1S2NA 1XXHA 2GT1A 2ZUDA 5GZ1A 1EFAA 4URVR 4E5SA 1F38A 2E7ZA 3B6MA 1YJ5A 4EW2A 2D5IA 4RJIA 2OXRA 1U4SA 2C20A 3OC6A 1DBQA 1F3OA 1JR2A 1OLSB 2AG6A 2CWWA 2HTFA 2ZIAA 3EVEA 1AS2A 1P0PA 4Q12A 2EW8A 4ALLA 4BZZA 5F9HA 2FWIA 5AI4A 1ESZA 1JQBA 1JB1A 1MAAA 2HXSA 4QRIA 4D8WA 2CFRA 2AFHA 3GFOA 3M9LA 3EEQA 4LE1A 2HPAA 2Q1WA 4C0WA 5BQXA 4FJ1A 2WG0A 2H16A 1XDGA 1D2HA 1Y8ZA 1JLKA 3VH2A 3RUPA 4KDEA 1E5QA 3T7DA 1U6KA 2B34A 5TX7A 4LOJA 4JXJA 2J4FA 2J4CA 1UZMA 3SC2B 1V16A 4EG4A 1ZNYA 5THQA 3F5MA 4HYQA 5CJPA 1A5ZA 2AKAB 4IGEA 4MVJA 4M22A 1QK5A 3GG9A 4LECA 2V58A 4K9RA 1D1PA 4U2EA 2W6NA 3C4VA 3DPIA 1G1MA 4EB0A 2IOQA 3H04A 3QTBA 3BGIA 4Z7JA 3EVFA 2FPLA 2G1UA 4X92A 1SUPA 1MJGA 2VQSA 3U7QA 1BEEA 2FG7C 2PYDA 1IOZA 1XDBA 2R1VA 1OMOA 3AFGA 2BFAA 1SUCA 1G3IA 1NLMA 2PZFA 3IDZA 4H0NA 3FKJA 3S6JA 2XLBA 2DWPA 1RE0A 1DAGA 1JUDA 3DVAA 4GOKA 1WB4A 1X1CA 5JJLA 1MO6A 2HWWA 3B9RA 3E5MA 4XA8A 1YS2X 3NKVA 1SHLA 3GGDA 3L7NA 3ML1A 4L72A 4QUGA 4PTYA 3OESA 1R6XA 2E2WA 3O2SB 2REBA 4LOHA 4P4GA 2NTJA 5D8DA 1DADA 3A4LA 2WJVA 1FTQA 5JXHA 4V02A 3ZIAA 3HU1A 2O8BA 3WLKX 4LMPA 3F96A 2V3VA 3DWGA 2NUAA 4I2VA 3NHYA 5A2QA 4CKWB 5DCWA 1CYDA 1X7ZA 4Q1DA 5EZQA 4I4TF 1HF3A 4KXVA 1BX3A 3LPDA 4Y2TA 2UUOA 3TNDA 3V8MA 2A57A 4HWGA 1Y3DE 2DMRA 2VRCD 4L8GA 4PHGA 4IIVA 5AVKA 3UF0A 4TT8A 2IYPA 4YT5A 1N0UA 3KVRA 2FF7A 2JFXA 5FEMA 1L5KA 5TPZA 2H2DA 3EXEB 1T1RA 2P0AA 3QX9A 3E9NA 3JD0A 3X0DA 4BMPB 1QU2A 1ENZA 5A04A 3DAGA 3CZ9A 4HDRB 2YY5A 5BOSA 3HN6A 1XTJA 3WK5A 1BWPA 1XZMA 2I3ZA 2GYWA 2V9ZA 4MP8A 4NCJA 3QQ5A 2NP7A 1WOYA 3HU3A 2ZR9A 4TKVA 2FKNA 2RGDA 3UV6A 1W36D 2Z2XA 4Q48A 1WY5A 5K05A 5KQMA 2CVHA 1JNYA 1J22A 3O0TA 3WQRA 4ENTA 4O3MA 4EMSA 3EGDB 2QBYA 2JDIA 3UHAA 3TD9A 4QUAA 1GG2A 2XSZA 2VA8A 2EEZA 2ZVDA 2ZITA 3KEMA 4BB5A 3ESQA 3P9NA 1NQ5A 4NBRA 3O6VA 1V43A 3GLSA 1U0RA 1V5GA 4F60A 1YI8A 3ORQA 5BV8A 2I5PO 1PL7A 1YJQA 4QU5A 4FR5A 2ZM5A 3CNLA 1CR1A 1JU3A 1W5AA 3D5TA 3QY0A 4X3CA 4JUBA 4YXWD 1CUYA 3JQ9C 4KR7A 2BELA 1YR8A 2O0HA 2QI9C 4XZ3A 3S2SA 4B85A 3H6GA 1UWLA 4HAXA 1N7IA 1VA5A 4UHHA 3FVVA 3L7OA 3EIUA 2ZAOA 3A0RB 5F1YA 5AW4A 1NW4A 3AY6A 4BP3A 3PNYA 1EGMB 4BLVA 2HJRA 2B0CA 1NMSA 1OGJA 2BKXA 2OQ2A 4NCNA 4ND8A 3PHJA 1VPTA 5CVVA 3W04A 4AO8A 3BK2A 4RMJA 1N6NA 4DLPA 1HDOA 3QVOA 4JY7A 1Z7YA 3HN7A 3Q8WA 1O87A 2NQTA 2DULA 4IX9A 4GOJA 2OHVA 3GD5A 3SG0A 5JH7A 4IMIB 1VJRA 4PAOA 3JALB 4JJEA 3RS4A 2C7OA 1MTOA 4CV3A 4IV5A 5T57A 4QYSA 3DDSA 1E9CA 3OPYI 2IPAB 1U0FA 3AY7A 3OPMA 1LC3A 4TL9A 3N8GA 4QAQA 3ZVKA 1CUEA 3LCRA 1EYZA 1VGVA 4IJ6A 4Z8YA 2IK8A 4LC9A 2QAGC 4G4IA 3DKIA 4EO4A 3EEFA 2R8YA 5FR2A 5LPNA 3HJGA 3ADBA 1F2DA 2PO7A 4QODA 3QMPA 3DW1X 4MPPA 2QRQA 3A14A 1XDWA 4N5IX 5I4BA 3SVTA 3CUWA 1CZOA 5KNBH 2AUNA 4B4DA 4GH5A 1P6XA 2EW2A 1ONSA 2Q5CA 5J58A 1N0HA 1G9XA 3H0EA 1EK2A 1RACA 2GM4A 2Z56A 3OZSA 2A2ZA 2B8EA 2QV7A 2NN3C 2Z1NA 2CXTA 2VUTA 3JQFA 3KV1A 2JIQA 3CY6A 4TWZA 3CLUC 1GCAA 1K8RA 2XZPA 5JCOA 2MCFA 1EBUA 1XLTA 3ZTYA 3QM1A 4DY6A 2YIMA 3LT2A 4D6XA 1M2HA 1ZKMA 5GINE 3UICA 2YUIA 4HB4A 2DQYA 1J7JA 5BRAA 2IC5A 2WFLB 3F9RA 3TGLA 3KPWA 2YHIA 1WUKS 1NVFA 1A97A 1GYPA 3QVMA 3OA0A 4PZ0A 5CB8A 3H1PA 4IOMA 2A5FA 4WLVA 1AOXA 1N9GB 2P3LA 2WNIA 4NV0A 1T5SA 1JVSA 1MJ5A 4UFPA 4J0FA 1WOMA 2E1PA 3OPQA 4Q4AA 4AWBA 5HIAA 2H63A 2FNAA 3IS3A 1I4OA 3LX6A 4HVAA 3DDZX 3UMVA 4LDPA 3WAKA 2WG2A 4P2BA 1XC7A 4XUEA 4DILA 1J23A 3P19A 2OT3B 1UOOA 3LH5A 4K6GA 3O1LA 4FCVA 1WSWA 4FGSA 4Y9DA 3ZIDA 2D0IA 4HMPA 3NC1C 4X8OA 2XJ9A 1P39A 4RVCA 3GFPA 1GXSA 1U7ZA 1EI9A 1PTJC 1W75A 3L84A 3PVZA 1N3BA 4OJQA 4PZCA 3WL7A 1CUUA 2IY8A 1MHTA 2QPOA 1XZLA 4GPEA 4CM7A 3P9SA 4MVWA 5KZMB 2NO4A 4GX2A 2Q0QA 3INRA 3T3DA 2IZ1A 2CEAA 3C8MA 1AXEA 4IHQA 2VQEB 2H0QA 4L85A 4NR0A 2DWUA 3I32A 4Y2HA 4XX0A 4BQPA 1CNMA 4HCJA 3NU1A 5BSWA 2ANBA 1SOUA 3CPHA 1GKIA 1JR3E 5J4KA 1N7HA 3FJYA 4Y8VA 1XRQA 4IXWA 4RU1A 4HLQB 5H80A 5F7XA 1PTJA 4K9KA 4US2R 2B82A 4KO1S 5GMOA 5CB4A 1E9AA 5AICA 3VR4D 3FNGA 3H87A 2BM1A 3Q3GE 3E18A 4IVPA 1IC6A 1W0CA 3SJ7A 1XTTA 3ZLUA 2DYKA 3QNWA 1L5VA 5CA0A 5A4DA 4MV7A 3AVVA 2XQGA 2AQ8A 5DW0A 1E1QD 1SNYA 4F6CA 2OCAA 3J81k 3U56A 3BWEA 5DM1A 1XZNA 3K9FC 5JYDA 3HKBA 3VNSA 2X0RA 2LD4A 2O3RA 4LYJA 4EHJA 3IXQA 1MC8A 5CPFA 1Y8QA 5ALVA 2FSUA 5AW0A 2FPGA 1XQWA 4XIFA 3RHSA 1GVHA 4NMHA 3AXSA 3HCNA 2HT1A 2R00C 2GM3A 4X54A 1TIKA 5E4JA 1WZIA 5EE1A 1EBFA 4WERA 4LXIA 3VPFA 4GPD1 3K0BA 4X93A 4JU9A 3EWSA 3O3NB 3TTYA 4DLYA 5LR6A 1MT3A 2I55A 2W2XA 2XY4A 4XSHA 3TYXA 1CY7A 5DRTA 4H18A 3WQBA 4FBLA 4JLAA 2OGWA 3ICCA 3CM0A 2OTCA 1KJZA 5J2TF 4EI7A 2F3SA 3GWZA 2GM5A 3PXBA 4PPGA 1BQ4A 3DKRA 4HUJA 3R5SA 1IN4A 3SX0A 2ORWA 3EC2A 5K8JB 1IL0A 1FOEB 2GETA 1E6MA 3GRFA 3OEHA 1ZXXA 2QD5A 4QJ5A 3ELYA 2PEYA 2EDCA 1JE1A 2CWDA 3I6IA 4D5EA 4HX9A 3W3AH 1VJDA 3S7ZA 1AA6A 4OL0A 1RKXA 2QR5A 3HM9A 4C4XA 4QBIA 2HCJB 3ETGA 1YQXA 4Q16A 5DBHX 3WWPA 5KYWB 4S1OA 3UJ7A 3UUEA 4C1NA 1VZ3A 4CCAA 2UXDB 3C3MA 3WJ1A 2V97A 2LDXA 2GMWA 1E1LA 2GN6A 3A37A 1NIPA 1FW8A 1GFZA 5BT9A 5JEDA 4BAZA 2B2NA 4IKEA 3F71A 2VLBA 5BN3B 1WBDA 3LRPA 2GTIA 2WWTA 5CP8A 1HTWA 1U8CB 1PFWA 4JBLA 3A31A 2YQ4A 4WWHA 4KNYA 5DTIA 2NQ8A 3L6BA 4NP6A 1PKEA 4RPKA 4XAQA 5A9SB 2N46A 2QQ0A 3AZOA 4F21A 1RYHA 4GPAA 4IDGA 1RC0A 3TQOA 4MYCA 4O2BB 1WXGA 2QP4A 3AF2A 1FDUA 1DQRA 2ID9A 2OO5A 1B6GA 3U4DA 2O1WA