2GCOB

Crystal structure of the human rhoc-gppnhp complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
192
structure length
182
Chain Sequence
HHSSGLVPIRKKLVIVGDGACGKTCLLIVFSKDQFPVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Rho-related GTP-binding protein RhoC
publication title X-ray Crystal Structures Reveal Two Activated States for RhoC.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 182
sequence length 192
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gcoB01
2JLVA 3DVLA 4DCVA 2WIAA 221PA 3LWNA 3U3OA 5KNBA 4KHZA 1P75A 2ORVA 1EFHA 1IXSB 3E1SA 4WBSA 1W0JD 2F1JA 3MJHA 2OSBA 1KO7A 3ZQJA 1Q12A 2XX3A 3I8XA 2B8TA 1ZM3A 2C9OA 2WWIA 2J45A 3PUXA 4D4LA 3N2EA 4B33A 3D31A 1UDXA 1AIPA 1DO0A 2VYFA 4DRZA 3SS8A 3UPUA 3KXKA 1OSNA 1XEWY 1OW3B 3C41J 1NG1A 1E2PA 2H8KA 3SYNA 4G01B 2IUTA 1QG2A 2OESA 2OT3B 3TNFA 1GAJA 4BRUA 4DLWA 2A5FA 3PCRB 4HAXA 1OB2A 2W0SA 2AKYA 2JLZA 2IEYA 3QEOA 4UNSA 2XB2A 5TVKA 4DLSA 4E09A 4ZV4A 3MLEA 1T8UA 3LH5A 4Z8YA 2EWVA 4Q66C 1YR6A 2A7QA 1WMSA 2CK3A 1T4GA 2UZIR 3KQNA 4Q03A 1T6NA 2EFGA 3BB1A 4D80A 2YC2C 2ECKA 1YKSA 5BWMA 4IFEA 1UEIA 5HZKA 3UWKA 4L4UA 2G3YA 3TR0A 4KFUA 4BRWA 4DIDA 3U7GA 1NKTA 2QSZA 2OHFA 3SFVA 3BERA 3B85A 4GP6A 4DWJA 1I4LD 4XTRA 4B34A 1W0KD 3DZDA 1EK0A 4L15A 4ZIRA 4IFBA 1A7JA 4XD7D 1PZNA 2OV2A 4I1VA 3SJZA 5HPYB 4QNRA 4HLUA 2J0SA 2IYVA 5JJLA 1E3MA 2HF8A 1ZD1A 2WPDD 1N6PA 2P6UA 3A1UA 1KGDA 1WP9A 3CH4B 1YZLA 3FHCB 3PIRA 4QNMA 1GWNA 2OFWA 2ZI4A 2ZTSA 4B2PA 5FBVB 4RZ3A 1D9XA 2ERXA 1BIFA 2ZJZA 1H8ED 1N5JA 4OL0A 2V6JA 3U3RA 3VHLB 3OZXA 4KI0A 4EPVA 1CR2A 3QG5A 3IIMA 3CX7A 1QG4A 2FZLA 5FOWA 4NPHA 2Z6VA 4A0FA 4CVNA 1RFLA 1R0YA 3DOEA 1W36D 4LPSA 4TMVA 4X8HA 1EFRD 4OHXA 1B0UA 1G4AE 4D0NA 4B3XA 4DVGA 2VP2A 2PZEA 2WJJA 1YZQA 3Q9LA 4BFUA 1PV4A 5G53C 1R7RA 1L2TA 1M34E 1JR3A 2KB0A 4Q9HA 4PHTA 1J90A 3QXSA 4TL6A 1II0A 3L0IB 3LBNA 1HQCA 3NG1A 4KAXA 1VG9B 1G16A 2HYDA 3LLMA 3H2YA 1MOZA 1D9ZA 2CCGA 3P27A 4LHYA 1RZ3A 2R44A 3TR5A 4C0AC 1ZIPA 1E69A 2A5DA 3CM0A 4S35A 3SBDA 2O8FB 3R7WB 2VP9A 3DM5A 2C9CA 2PJZA 4GOXA 2NPIA 5FOXA 4Q4JA 2GJAA 4IDHA 4TLDA 2FJUA 1RKBA 4NBSA 4F91B 2QA5A 2NO9A 3QF7A 1LNZA 3OEEA 5H70A 3CO5A 3LY5A 2DFTA 3K70C 3OIVA 2CEAA 2CL7X 4JYCA 3F0TA 4TL7A 4MKIA 2AK3A 2GAOA 2WMNB 3RANA 1X8LA 3VNUA 1T3LA 1IN6A 1Z29A 2AWOA 2IYXA 2F9MA 2LKCA 4TLCA 1DELA 3MAAC 1JQLB 2GTPA 3AKEA 2WWGA 3EC2A 4QGGA 5L3SA 5JS7A 4P33A 4I4LA 2ONJA 4AG5A 3CR7A 5E7IA 1CR1A 2YHSA 4CEJA 4IOKA 1Z8FA 1KMQA 4EDHA 1NIJA 3MMPA 5GVSA 4Q1EA 2ZSFA 3VU9B 3EX7C 1II8B 3CNLA 3AH8A 5D3MA 3U44B 4BPBA 2LCFA 2ZRNA 5AR1A 2BV3A 2BHRA 5CITA 2AR7A 3LNCA 3ASYA 1G64A 3IIJA 1QDEA 4TMTA 3SJCA 4YXWA 1ZVQA 4RD4A 4C30A 1KK1A 3EIHA 3UXMA 1Z6GA 1VTKA 5C1BA 5JHHB 1DG3A 3W6PA 1LVGA 3NC0C 2BCJQ 5JI3E 4CRWB 4OQFA 3TQFA 5FL7A 1E2HA 1D8TA 1RRCA 1CKEA 1UBGA 1OH8A 1GRRA 1NBMD 1NBME 4RD0A 3GJ0A 5CYOA 2BJVA 3TW4A 2Q3MA 2GXUA 4IVQA 2VIIA 2QP3A 1VIYA 2ZU0C 1W4AA 3ZS9A 4BEJA 1DADA 4BZPA 3BE4A 2YOFA 3N5CA 5EE1A 1CJKC 3CRRA 3FMOB 3QY0A 3BFXA 4F4CA 1Z08A 4TZ0A 2QGZA 2ZSEA 3F3YA 5EQTA 3QKRA 1B23P 1S3GA 3KJIA 5TARA 4CDGA 4DEXA 3KQKA 4OQNA 1KKLA 2VTKA 3ND8A 2OBLA 3A1VA 3FFBA 2FA9A 2QE7D 2J1LA 2RGBA 4FIDA 4NYMQ 3S1AA 4QHTA 5K8UA 1W2HA 4I1SA 2H5EA 2G83A 2LWIA 4LYJA 1JR3E 3KTAB 1GG2A 1MABB 4BE7B 3KXIA 2RH5A 1G8YA 2IA5A 3LA6A 4JT4A 4NCJA 4YMSA 1J2JA 2RGXA 4JKYA 4JZKA 4OI4A 4TMXA 4C7OA 4QGAA 4A2WA 3T61A 3V9PA 1MV5A 1NLFA 1XXHB 2FWRA 3VR2A 1TUIA 2GDJA 4TLAA 3SEAA 3U61B 2JATA 2W2TA 5JFGA 3RAPR 1FOEB 3P4YA 1OIWA 1W49A 3NBZC 4RFSB 5EE3A 2R62A 5SZKB 2IHYA 2XXAB 4YQFA 4Q19A 4DSNA 3QXJA 3CONA 1JXMA 2WJVA 5EXPA 1D2MA 1NY5A 1HT2E 4DT1A 2VP5A 4M8NE 1VPLA 2JJ1A 4ZPXA 1N2CE 2FSIA 4KU4A 1TF2A 2NO0A 4PZLA 3I72A 1N5IA 3MCAA 2YINC 3NH9A 3WNBA 4M1YA 4URVR 3NWJA 1G7TA 1LB1B 5EXTA 1GFIA 4G5QA 2QPAA 1ZJ6A 4N0DA 4HZUB 1XTKA 1E96A 2RMKA 2BBSA 4TTRA 3PITA 4PAOA 2C98A 3AF4A 4Q7LA 4KV9A 4PPFA 3NTUA 4M1TA 4F93B 1E79D 1KZ7B 2IS6A 2OAP1 2WJIA 2P6RA 5AK0A 4DB4A 1EGAA 4C2UA 4Q1AA 2KWIA 1GNRA 4ASUD 2GBLC 1IN5A 2FH5B 1QZXA 5KYKA 3LLUA 4JLVA 4MGZR 2G0TA 2VF8A 4LC1A 2JJ2A 1KK2A 1G3IA 2I1QA 5J4LA 1SVMA 4DCUA 2WJHA 1VHTA 4Q4AA 2VO1A 4Q02A 1P2VA 2VF7A 2A5JA 4AC9A 3GJ8A 2ZSDA 3NBYC 2PEZA 3DHWC 1IJEA 5E4FA 2BBOA 5BN4A 3A4NA 3K0FB 4B3GA 2ZAMA 2JJ8A 2AWNA 4PQFA 2IK8A 1Q57A 3MJRA 3TGPA 2RCNA 5EP1A 5JMTA 1I2DA 2FFHA 3NIBA 4L5BA 1HUQA 3VR5A 2D7CA 1O87A 4KXFB 2YWGA 3QPWA 1KI3A 2WV9A 4HUTA 4LBZA 1Z0DA 2QNRA 2CDNA 4M1OA 3ADBA 1E98A 3RRZA 3RS3A 1AKYA 4B6EA 1R6BX 2QMUA 1QVAA 4A8JB 3RC8A 2PT5A 5TMPA 1GL7A 1J70A 2OXCA 1IXZA 3NH6A 4OBEA 2QAJA 2O8DB 1AQYA 3C16C 2V4ZA 5FOTA 4DDTA 4O3MA 1K8RA 4H1UA 3PUVA 4HZIA 3ZH9B 5CM8B 3FKSD 4XTCS 2GJ8A 1SVWA 3AVWA 1UKEA 4XOIA 3HYTA 3W6OA 4EFLA 3SYKA 4OI1A 2W0MA 1VG1A 2H7VA 4LSGA 1H8HD 3GLHB 1E0SA 1XMIA 4FWTA 1PUJA 3HR7A 4CYMA 1KY3A 4GFDA 1JR6A 2H57A 4ESVA 3AQ4A 4CEIA 2FSFA 2ODEA 1C9KA 2X1VA 2IUSA 3GLGE 1DS6A 2J0UB 3ND9A 3MD0A 2F3TA 3JVVA 2EFHB 3WY9A 3L0PA 4WOPA 4M2LA 3AUXA 3LW8A 4AYXA 1G7SA 2FDCA 1CXZA 1NL3A 4IDOA 1JNYA 3ADKA 4F4IA 2ASEA 4PQRA 821PA 1NJGA 1FMJA 3N70A 1P3JA 3OESA 2OBNA 5KDLA 3W90A 4IVPA 3PUYA 1E1QD 2J9RA 1FMLA 3ZVRA 3H84A 3L0OA 4ZDJA 1NVUQ 1AK2A 3SZRA 2GHIA 3B9PA 3TK1A 3VR3A 4TYWA 2NZJA 4TL8A 2AFHE 3PFIA 1N6RA 4MGKR 2OCYC 1UEJA 4UQOA 3LFUA 2VHQA 4G5OA 4JLDA 1H65A 1DPFA 5SZJA 4V0MA 3I62A 1T3HA 4KITB 3EPJA 5JI2E 1GRNA 1ZU4A 1X1SA 2KI5A 3O8RA 4Q1DA 1TTTA 1YZUA 2IC5A 2YWHA 2F1HA 5FUVA 5B2ZA 4G5RA 3KX2A 4TTQA 4QKQA 1SVIA 3G5UA 4MUBA 2DB3A 4G3XA 1DTSA 2OXRA 3GJ6A 3HWSA 3QPUA 3FKQA 4BASA 1ETUA 2GBLA 3KFVA 4RCYA 5KNDA 1P61B 4D26A 4TLBA 1IXRC 1XMSA 2Q9CA 3W34A 2QQEA 2D06A 5BYKA 3E5HA 2I1VB 2AX4A 4RD6A 2ZRGA 4JBXA 3D3QA 4HUQB 4NL4H 4K46A 2WJGA 3GJXC 1E9RA 2HLDD 3QKTA 4PO8A 4ARZB 2ZJ2A 1E9BA 4HAVA 5AJZA 3SHWA 4B74A 3JZAA 1M74A 1ZNZA 4B71A 5JWRA 3NVAA 1CBUA 5KPDA 3FWYA 1XMJA 2BBTA 1XCGB 4X8OA 3UATA 5F9FA 3THOA 1CU1A 1HE1C 3IEUA 4TSFA 4JL8A 3CRMA 3BH0A 3WNCA 1N0WA 1PVOA 5EZ5A 3AVQA 5F3WB 5JCPA 1AJEA 4C0QC 5CIWA 1Q3TA 4I81A 3THYB 3SE0A 2AXPA 1GNQA 4QGHA 1CF4A 2WZQA 4XH9B 4BFZA 1XEXA 2IS4A 2CNWD 1FW6A 3T5DA 3GFOA 3UKDA 1EX6A 3PEVA 2P67A 1ZM2A 1NSFA 3DMNA 2V7QA 4LV8B 4PC2A 3AKYA 1R4AA 4JBYA 5CK4A 4GMDA 1I4TD 2VBCA 2PMDA 4YC7A 1F48A 3CF0A 3QXHA 3UMRA 3GLFA 3HU3A 4K81B 4HAYA 2ZJBA 4FMCF 1E2JA 2YNMA 4TT3D 4RJLA 3LVRE 1GVNB 5L3RA 2IYZA 1OFHA 4AYTA 4MKFA 1KNXA 1FTSA 3HP1A 1CJTC 4A6PA 2VSXA 3GFTA 3UANA 4QC2A 1MT0A 4YMTA 5KUTA 2C77A 2L0XA 3TBKA 2EWWA 2IYLD 1R0WA 4MH0R 1NRJB 2H17A 2OE2A 3C14C 4NH0A 4QBFA 2GJ9A 4EJSB 3LVQE 2FN4A 2NIPA 2ZYVX 2GF0A 1TQ6A 1XU4A 5TDHA 5FI1B 2JDID 4M9SA 1N0VC 4LDJA 2NG1A 2W00A 1YR7A 3BH7A 3CF2A 4KO8A 1COWA 5IK2D 1Q3HA 2I4IA 4DLZA 4I99A 2P6NA 3KUDA 3GFPA 1T0HB 1YRAA 1MR3F 2ZAOA 4ZCLA 5EJEA 2ZR7A 1SKYE 5ANRB 2ZJYA 4UXJA 3CRW1 1SULA 3BB3A 2QMEA 3THWA 1W36C 3QENA 1ESMA 2GCOB 1RJ9B 4FMCB 2LKDA 1G6OA 1G20E 2QL6A 5DIFA 3ZGXA 4BLOA 2J5XA 1E99A 1YU9A 3AB3A 1IY1A 4M9XA 4BWYA 5KSPA 4GRAA 2O0KA 1OF1A 2YWEA 2HCBA 2ZUBA 1WB9A 2CHQA 1DO2A 4ITRC 1BO6A 1S4QA 2PCLA 4LYFA 1X8JA 2VHCA 3GJ5A 3SN6A 5KNCA 5JWHA 1ZP6A 3R9IA 3P1JA 3SQWA 3K9NA 4KYUA 2XSZD 1J99A 2W2XA 2REOA 1ZD8A 3Q8XB 5FPYA 4FCWA 1XBTA 2G77B 2UZ3A 2ZS9A 4Q00A 3TE6A 5AUOB 4IXNA 2G9NA 4M1MA 2A3RA 3UG6A 5A5GA 2C95A 4PZYA 4LJ5A 1ZUIA 2HXYA 3TVTA 2HYIC 1JBKA 2IF2A 4Q47A 4V0OA 4AD8A 1R0XA 2IL1A 4DUGA 1IN7A 5DSZA 2CVFA 2ZEJA 1U0JA 4WAUA 4XJXA 1PLKA 3LXXA 3AVVA 2CLCX 4Q7JB 3AF3A 4B43A 1G8GA 3I92A 3WMEA 3FVQA 1P6XA 4Q1CA 1OHHA 1RVDA 1TNDA 4Q5IA 5E7JA 3ZZ0A 1KK3A 3GLFE 4GBMA 5JJIA 2X19A 1NIPA 4EQ6A 1QHSA 2JIZD 1DG1G 4TYYA 4RY2A 3U3MA 4URXR 4KFTA 1SXJA 5KO2A 5JSZB 2C96A 4A9AA 5LPNA 2W6IA 4D82A 4Q7KA 1LF5A 5EE5B 3RWOA 2RHDA 1AS0A 2Z0MA 2EFEB 1ZUNB 1VECA 5GJVC 1OIVA 5E95A 4UJ5A 2XB4A 1E0AA 4KCGA 4B3CA 5JBQA 421PA 4HDOB 1EXMA 2EYUA 1LF0A 2C2HA 4Z1MD 4R7ZA 5C4MA 3B6EA 1ZNXA 5CJPA 3I5YA 5G41A 4NU0A 2IX3A 5UKDA 3NDBB 1UBCA 2J59A 2QORA 2QTHA 3LX8A 3VR1A 4TLEA 3IO3A 4YMVA 4PR0A 5FUWA 3OAAD 2ZVPX 4GNKA 5C4GB 4OHZA 2IS2A 4LJ4A 1A2KC 2JLSA 3RWMB 1GUAA 1XD8A 4BLSA 4WXPA 2OZEA 2G0NA 4E07A 4D4KA 2QGNA 1M8PA 3MWLA 3RC3A 3WRYC 1Z0KA 4PC3A 4BUJA 1T5IA 3U4QB 3CH5A 4W5JA 4LCBA 5HCNA 3BIFA 3R8FA 4EPXA 4V0NA 1TEXA 1P73A 5JS8A 4Q4HB 1ZM7A 2ZROA 4G5GA 4R2IA 4DSTA 1VHLA 1UM8A 4LV5B 3ZIAA 1L8QA 4GI7A 1P2UA 3EA0A 2Q9BA 3CIOA 4TMWA 3QXCA 3BORA 1T3SA 1KAGA 1P60A 1MRSA 3KB2A 1JI0A 4TQAA 2ANCA 4EFNA 1WQ1R 3HU2A 1G41A 4RD3A 2QAGB 1E2KA 4QJ5A 3W8NA 2H16A 3EPLA 2J7PA 1YHNA 1GTVA 1E2EA 2R6DA 3Q85A 4IHQA 3U7FB 2O8EB 1BS1A 4PXAA 1N3BA 3GD7A 3AP2A 1J8YF 1TQDA 4B3DA 1R5NA 1P2SA 4QJ4A 1BYIA 2F43A 2CE2X 2ZS8A 3C4JA 1VCOA 3NKVA 2V3CC 3NEYA 4TQUS 3AVYA 5FOVA 2WIBA 2PH1A 3QSYA 2R2AA 5FTNA 5IRCD 4HYYA 3I8SA 2V55B 1DE0A 1AM4D 4BQSA 1D2EA 4EPTA 1XRJA 5B30A 1SXJE 2DR3A 5BXQC 2D7DA 2OCBA 4LHWA 1ZNYA 3KJGA 4C0JA 1U8YA 5EXXA 3BRWD 1NLYA 2IHBA 1IY2A 1KSHA 1YZKA 5CYPA 2WWXA 4PO1A 4RZUA 1V43A 3TSWA 1M1YE 3PENA 1KO8A 4V0LA 1TU3A 1GIAA 1NVXQ 1VYTA 1WXQA 2QPTA 2YV5A 2HT1A 1I4DD 3WXMA 1R5OA 5JZVA 4Q9JA 2J41A 3R9WA 2GJKA 5JEEA 1OIXA 4O2RA 3ZZUA 4AURA 2NPFA 4GL2A 1US8B 3PJRA 5DGXA 2BBWA 3U2QA 1VCNA 2XEXA 5A4JA 3DKPA 2CMKA 3CB4A 3B78A 2GXSA 4IXMA 4EUNA 2OILA 3C5CA 1WBDA 3FE2A 1VG0B 2C5LA 3AF0A 2RB4A 2W6JA 4LY6A 1F2UA 1OPXA 4H9GA 5HR5A 4MGIR 4ZI3A 3CWQA 4RCZA 1IY0A 2KJQA 2A2ZA 4Q9KA 2BIFA 2CLDX 2ZVQX 4Y0AA 2XAUA 2VP4A 4UXHA 1UJ2A 3FHTA 3RS2A 5EP3A 121PA 3CLVA 4B2LA 2OEPA 5FBQB 4FXPA 1JJ7A 3W6NA 2Q6TA 1Q1EA 4ZI2A 1E94E 2ONKA 3TLXA 2P2LA 4CT4B 1Y3AA 3ZZTA 1NLZA 1G9XA 4B73A 3K0SA 2IYRA 3FMIA 2IT1A 3DZ8A 1T5LA 2ZE7A 2J7KA 2VSOA 4P4SA 4HB0A 1NI3A 5P21A 4F7WA 5L3QB 3KFXA 4RKEA 4PQYA 2EQBA 2JAQA 3U3KA 4NKRA 1F2TB 3IILA 1OFTA 2JGNA 2Q3HA 3FMPB 4KJZA 4LHZA 2CK3D 4BGDA 1G7CA 2FE4A 2RGDA 4BFTA 3NBXX 3BXZA 3GEHA 2WKQA 1MO3A 3KUCA 5AUNB 1Z5ZA 1G8HA 1Q1ZA 3TVDA 3QKRB 1P2TA 4AKHA 1KDPA 5AWFC 4IOJA 3U6KA 2V54A 5DN6A 2ZSBA 3B1ZA 3VMFA 4MDFA 3LXRA 4M1SA 3B9QA 5K8LA 4Q1FA 3WMGA 4Z8XA 1N5KA 1VYVA 1XF9A 4FI3C 3LO5A 4OHVA 3IGFA 1IN8A 4MRPA 3WBJA 2YZ2A 1E1RA 2IXFA 4C7OB 3PUZA 3GQBA 3KDSE 1UBFA 3B8HA 3QKSA 1BMFA 1M7BA 2JEOA 5E7MA 1XZPA 1G5PA 3T15A 1E2DA 2EU8A 1XPRA 4BZQA 4BFYA 4NP6A 4TYNA 1TF5A 2GZDA 4IDNA 3RYTC 2ZANA 3TQCA 1P7CA 1E2MA 1MKYA 3I5XA 4X8MA 3W5IA 1R8QA 3QBVA 4C3ZA 2DFLA 3PR1A 4N1AA 4JLPA 1MO6A 3G82C 1TPZA 4DJTA 5FH9A 2FNAA 3K09C 4P3YA 3KQUA 3GLGB 1SVKA 5CDFA 2BEJA 5D3QA 3SQXA 1DAKA 4W5HA 4LZZA 1VG8A 3A8TA 3OEHA 2GVZC 2XNDA 1KSJA 4LUCA 2DYKA 2PT7A 1ZAKA 3M6AA 1HY3A 3ECCA 5FPTA 5CM9C 5GADl 4PAQA 2IXGA 4KYIB 1QHYA 1JR3D 1EG7A 1NMXA 3QPVA 1KI8A 4N3NA 1SVSA 1NN5A 3V4FA 2ODBA 3DM9B 2NMVA 4AYWA 3MFYA 2PL3A 2HF9A 4ZCIA 5DHAA 4K8OA 1KO1A 2F1RA 1G8PA 2J0VA 5HKKA 2OO7A 4U00A 5GVRA 2ODNA 4C0SA 5JRZA 2NO7A 2ZI3A 3VKHA 3TAHA 3Q7QA 4F92B 1G17A 2RGCA 2W83A 2CJWA 1YZTA 3IPXA 3R20A 4URWR 1AN0A 1KI6B 4A4DA 2VL7A 1XEWX 3AUYA 4QHSA 2OFXA 1CRQA 1PJRA 3C5HA 4NCNA 3C7KA 2XITA 4WVFA 5LB4A 4E5UA 3OEED 2CCKA 1ZCBA 1M2OB 4L8GA 3T35A 4M0LA 2ZU6A 1XFAA 1EFCA 3EASA 1S2MA 4IRUB 3MUFA 1GKUB 2X2FA 4M53A 2J3EA 3K8YA 3T1QA 1XDBA 1W5TA 2N1BA 4DDUA 5ELXA 3EG5A 3DPUA 3QBTA 3P26A 2QMOA 1X1RA 1J8MF 2O8DA 4DIEA 4J0QA 4P0TA 3GEEA 4JSYA 1GL9B 3REFA 4XVRA 1TADA 5B64A 3SHFA 1BYUA 3B7GA 1TL7C 3M0EA 5EE9A 3BH6A 4R71A 1Z0IA 4Q01A 2A9KA 2X8AA 3VFDA 4A8JC 4KFRA 4YXWD 1AKEA 3ZQ6A 4N0EA 1E4YA 3V00A 2O8BA 3FFAA 1Q21A 4NONA 5KPJA 2G1JA 3THXA 3MWKA 3M1IA 4MKHA 3T34A 4A2QA 4US0R 5FL7D 2R9VA 2ZREA 3QOFA 1QHHB 4JIMA 2WJYA 4PHGA 3VX4A 4FN5A 4QOSA 2ZYUX 5FBWB 4KSCA 4B6FA 4HEJA 4CEIB 4MRVA 1KDTA 3QG1A 1AGPA 1TQ4A 3GJ3A 3QJYA 2Q9AA 1G1MA 5CDFE 3ICQB 3QIAA 3CBQA 4R9UC 3Q7PA 4GSYA 2GZAA 4JLBA 3RNLA 1KAOA 2ZETA 2W58A 3ONWA 2QM8A 2XXAA 4M22A 2QROA 5EP2A 1GM5A 2GZHA 4AIIA 3ZLJA 4C4PA 4GMXA 1AS2A 5FPKA 3T1TA 3SC3A 3K09A 3I3SR 2QN6A 1A2BA 2R6CA 4FD2A 1U2RA 2GK6A 1F60A 3SNHA 4BLTA 3LW7A 4IJMA 1GNPA 1RRFA 3RDPA 1YJ5A 3SR0A 2VH5R 4TZ6A 5FI0B 4PSKA 5JLJA 4W7SA 3IBGA 4HLDA 5BN3A 2OLJA 1JECA 1G3RA 1ZC4A 2FU5C 2RAPA 2R8RA 1LTQA 1F6BA 3HR8A 3UWOA 2WWFA 2PLFA 3W5JA 5IF9A 4NDZA 1WDTA 1NP6A 1VMAA 5J4HA 1Q20A 3NXSA 1N6NA 1ZUHA 1KMHA 1FNMA 1RW4A 2ZQ5A 3QVVA 1WCV1 3OIYA 4BFXA 2NZ8A 3AGPA 2JJ1D 1OLOA 4URYR 3JZMA 3W9YA 5DHFA 5HE8A 4URUR 1GKYA 1W4CA 5AJXA 2OCAA 1SKYB 2QTVB 2VP0A 1KHTA 5FL3A 2BJWA 4US1R 1CJUC 2ZE8A 3CNOA 2QBYA 4LRWA 4HB3A 3K70D 5L3SB 3EA5A 3ADCA 5LD2B 1UPTA 5KDOA 1KO4A 4QJ3A 3BOSA 1U0HC 2BOVA 2NOAA 5FTKA 1IONA 1DAFA 2OCPA 3FTQA 4LBYA 1X86B 5AJVB 3QI2A 1G5TA 1QHGA 4OQXA 1X8KA 2QENA 3GPLA 3EZ6A 2PX0A 2RGNC 2V8OA 5DO9A 3EW9A 4HSEA 1DAGA 3EWAA 4HLQB 4F38A 5C2JB 3JVUA 1TX4B 1NVWQ 2ZXUA 3RHFA 3P4XA 1JEDA 2JJ2D 4EPRA 1Z28A 3DDCA 1Z3IX 4PANA 2V1XA 4UJ3A 2CLSA 3A1SA 4KSBA 4A8JA 1T9HA 4II7A 1XTSA 3L43A 2GETA 2HCJB 5B57C 4WA7A 2HT6A 2WVJA 2F1IA 2ZITA 1OKKA 5E3HA 2O0JA 3OIWA 1L7VC 4JVNA 3VKGA 4WZ6A 2GESA 2WOOA 4JJKA 3GLFB 1E2LA 1UKVY 1S8FA 2IBMA 2ZRAA 3GLHA 2JLWA 5AUPB 2AHOA 2RGEA 4TL9A 4AG6A 2IW3A 1E9DA 1FX0A 2B8WA 3RSOA 1KI1A 2GRJA 1VCMA 2ZI7A 4EKDA 3KXLA 2RKOA 4I1OA 2ZJOA 4DB2A 5JECA 1KDOA 4PTLA 4MRNA 2XOKA 1KI7A 3BWDD 3QVUA 4US2R 1NN0A 5H8WA 1JAHA 3TJZA 3OE7A 1Q1QA 5TB5A 3UMSA 1OXVA 1CR0A 4MYHA 4OHWA 3CR8A 1GDDA 2D4HA 2P65A 2WSSA 1HURA 4D6PA 2QY9A 2CBZA 4Q18A 4JVMA 4EJSC 1HH4A 1ODFA 1W44A 1DBSA 4AKIA 4KLNA 3WHKA 4CW7A 2R6AA 1JPNA 4QBHA 4NYJQ 4Q1BA 4DKXA 2EYQA 1U0LA 1OXTA 2AKAB 2BM0A 1E9AA 1G4UR 5EXSA 1G291 1IBRA 1KDRA 2PMKA 1FUKA 5LBIA 1I2MA 1Q0UA 1W46A 1XJ0A 2GK7A 2GEDA 3X1ZA 4LJ9A 4MYCA 1CJVC 2Q0HA 3K0CC 4JT2A 1E32A 3U3JA 3THWB 3CKLA 3QKUA 1G3UA 1XD2A 1PLJA 4JLKA 3VQTA 4FINA 1U90A 2CE7A 3P20A 2KBEA 5CJ2A 4B44A 3GJ4A 1G18A 1HTWA 3DMDA 4B3FX 1E2IA 3VR4A 1QHXA 4KVAA 3U6BA 4TWZA 2CXXA 4HUQA 4V0ME 4DSUA 2JLQA 1OH7A 3BB4A 1XJCA 4JLNA 3AVXA 4ARZA 3O8BA 1R2QA 4FCTA 2ORWA 1NJFA 3LBHA 3KKNA 1RYFA 1LFDB 3ZD6A 2GEVA 2ZRJA 4UNPA 1Z07A 2C99A 2HDNB 1T0JB 1R10A 3I61A 1Z06A 1A5TA 4D81A 3BD9A 5DISB 1WE2A 1YZGA 2GKSA 2REXB 1N6IA 1U8ZA 2IF0A 4MRSA 3GLIA 1DAIA 4ERNA 2ZJ5A 2BKUA 2IYTA 4M9ZA 4NYJR 5A0FA 2FFQA 5CLQA 1XTQA 3FYHA 5HZHA 1XPUA 3OFNA 2WMOB 4EQ6B 2OFOA 1KYIA 1SXJB 2XNSA 3CZPA 2TMKA 1N6LA 3VKWA 2AD5A 4G0NA 4QM6A 4TSFD 2QPOA 2ERYA 3TMKA 1YVDA 4FWIB 3FPAA 4GOJA 4YLGA 2ZRKA 2J0QA 3IBYA 3BBPA 4M1WA 1KO5A 3BAFA 4HLCA 4ACAA 1W0JA 1W4BA 1W7AA 2VSFA 1G3MA 1AQUA 1HE8B 2G1KA 1W48A 3F8TA 4QXAA 2YKGA 1YR8A 1ZC3A 4MGYR 4OI2A 4LJ6A 4OQLA 4F4JA 3QF4B 4QHYA 4FMDF 2IEZA 4YMWA 1NN1A 2YJTD 3O8DA 1C4OA 1FQJA 2BMFA 4POAA 4Z51A 2YVUA 3A36A 2JLYA 4JS0A 3B2EA 4B48A 4GP7A 2GXAA 1AZTA 4OQMA 2V7QD 4QM7A 5CIQA 1AA9A 1E2GA 2DBYA 4PC1A 1RRGA 2ZJ8A 4EJSA 2EFDB 4GZLA 5DNYB 1D5CA 6Q21A 2F7SA 4LHXA 1CP2A 3WRXC 3IHWA 2GNOA 3DL0A 1HEIA 2YC4C 4V0KA 3ASZA 4YONB 3B5JA 5EE0A 4ON9A 5B58C 4CIDA 2J46A 1OXXK 4HB2A 1N6HA 3ZVNA 1GZSA 1YQTA 1CEEA 3KKPA 4UXIA 2FMXA 1AZSC 4Q9IA 3U5ZB 5FUYA 5H68A 5JWOA 4CEHA 2ZR9A 4B32A 2ANBA 1GP2A 1MH1A 2QRZA 4PPNA 2GCOA 5J40A 1RJ9A 4OKSA 4BLPA 2QU8A 2IYYA 5TXGA 1TU4A 1Z6XA 1AGRA 2QTFA 4LBWA 3Q72A 1U9IC 2N46A 3AP3A 4C0KA 1W0KA 4FMDB 2XZLA 1XTRA 2F6RA 5GJBA 1COWD 1CLUA 2FZ4A 1TF7A 4XD7A 3EZ2A 5TV2A 2QAGC 1G8FA 3AP1A 1RPZA 4XIGS 4A0GA 2WPDA 3FMFA 1PLLA 1SVLA 2F43B 1DAMA 3GLIE 1G19A 1W4RA 3SJAA 3X1DA 4C9BA 3TUZC 2AD1A 5DH9A 3MG9A 4KODA 4TTPA 1W47A 1ZW6A 1H8EA 4LHVA 2BC9A 4BFVA 1G7RA 3I1FA 2ORIA 1CS4C 4AKEA 4I1UA 1RC8A 2FFBA 1UAAA 2A5GA 1QVRA 2DFNA 3DOFA 3VAAA 4ZIRB 3CX6A 5FFMA 1Z6YA 5IT5A 2AN9A 3A58B 4XWOA 5KSYA 1OH6A 3K0AA 2FGKA 3RS5A 3CW2A 3HU1A 3K0EA 1QHIA 1VDZA 1EFRA 1XPOA 4LV6A 4GZMA 3TRFA 1ESNA 4B75A 1E6CA 1R5BA 1P9RA 4YDSA 2FF7A 4IEIA 1PUIA 2FPKA 2QM7A 3PVSA 5EZ6B 3K53A 2GCPA 1YR9A 4DDVA 1Z0FA 2WTUA 3UG7A 5C46F 1UFQA 5K8IA 1NG9A 5JSZA 1VIAA 1SHZA 1XMVA 3H86A 4W5WA 5CLLA 1FL9A 3Q3JB 3GJ7A 3VTKA 4MRRA 4DBLC 2AL7A 1LV7A 5FBRB 4DUGD 4PAMA 3IQXA 2EW1A 4RFVA 3TUJC 4XVQA 3T1VA 4OHYA 2DPXA 3C8UA 4UNNA 3LDAA 1S1CA 3BFKA 5DI3A 3ZVLA 4CF7A 1OHHD 4TMZA 1VYUA 3W3ZB 2DFKB 1UF9A 4QL3A 2WICA 4S2EA 4O0MA 1F2UB 4NCHA 4NE2A 1SXJD 2O8CA 1KZGB 1KOFA 1MRNA 3SBEA 3KQLA 5FOUA 2W6ID 4Q48A 2FSGA 1KSFX 3ZYCA 4DCTA 2IS1A 5SZIA 4PFSA 1RIFA 4LYHA 2DWPA 4A15A 3IO5A 3UMFA 2ZRDA 2DWOA 3KKMA 4JL6A 5GJWC 5G3YA 4B76A 1XD9A 2REBA 1S1MA 1IOZA 1UDWA 3I73A 1F3OA 3VR6A 3CPEA 4EAQA 2D74A 3P32A 4Q4JB 2FEOA 1Y63A 2IXEA 1Z2AA 2C78A 1E2NA 3AGQA 4JL5A 4LJ7A 2CVHA 2D2EA 4P4SB 3U4QA 5HCIA 2X2EA 4U7DA 2XZOA 4MITA 2NGRA 2N42A 3H0KA 4Q4HA 4NYIQ 1IN4A 3U60B 8OHMA 4A0RA 4U5XA 1R8SA 1YE8A 1OE0A 1JB1A 4M9QA 4B2IA 2FOLA 2VA8A 3GMTA 4M4SA 3VNVA 1U9IA 4LGMA 1ZRHA 4D0LB 4W9MC 4CEJB 2IYSA 5EP4A 1NBMA 4D2IA 1TEVA 3CF6R 2WSMA 3L8ZA 2DWQA 1LW7A 5D3MB 1A82A 3EZFA 4DHEA 4DZZA 3ETLA 2P3SA 2QAGA 4E22A 1W2GA 2FGJA 1E9CA 2PJRA 2O8EA 4OJQA 4DXAA 4CGZA 1NKSA 3B13B 1XX6A 1V5WA 2O52A 4A2PA 4OI0A 2E87A 3ZIAD 4NHOA 1E0JA 4LOAA 3LAWA 3E70C 3QKSB 2VEDA 1G6HA 1KJWA 3IPYA 3NHAA 2QE7A 4Q4LA 2GCNA 4D4MA 2D62A 4JJZA 1Z0JA 1E2QA 3TW8B 2ZRCA 5CB6A 1TUEA 2DCUA 4PPQA 4LJAA 2XZPA 2ZUCA 1U81A 2JLRA 5FR2A 4JBWA 2P0EA 3UIEA 1U98A 2P5TB 2J7PD 2BMEA 4URZR 4V02A 3EARA 1HQYE 5KSOA 1UKYA 2E1RA 3IIKA 5AUQA 1KSGA 1W5SA 2CHGA 4KFSA 2E9SA 4LWZA 1A4RA 1II9A 3FDIA 2OM2A 2QZ4A 1ANKA 1K6MA 3TKLA 3ZD7A 2MMGA 1X6VA 4DLTA 4EPWA 1JJVA 3WYAA 3H4MA 3S1AB 4XSGA 4NYIR 1F5NA 4HAZA 1US8A 5F9HA 1OFIA 3BK7A 3TSZA 4C2TA 4Y0VA 4O25A 3X1YA 2GEUA 1E0KA 1P9WA 1U8AA 4MYTA 4Q7MB 3RVBA 4XWKA 1N5LA 2VHUA 1P72A 2UVQA 1ZINA 3Q5EA 4Z54A 4LBVA 4FW9A 4AWXA 4FCVA 1X3SA 1L4YA 3D8BA 2CJWB 4JLAA 4KBFA 3RRNA 1LS1A 4PPGA 5DLQC 3QQ5A 2EVWX 1Q22A 1YRBA 1E79A 3NC1C 3RLFA 1E2FA 3K9GA 3DKVA 3PQCA 3CX8A 4DT1B 4P32A 2PX3A 4O2LA 3L82B 4P4UA 5BW8A 1WF3A 1EX7A 4ASUA 3X1XA 1GKIA 2GVDC 3EAQA 4R98A 2ZR0A 3MWYW 4L9WA 1C1YA 4UKDA 3R7WA 3VX3A 3WHLA 2O8FA 2HJVA 5CB8A 1DAHA 2OBMA 1EFTA 2YOHA 4WZBE 4QRHA 1N6OA 4GT1A 1Z0AA 2P5SA 2W6JD 3B1WA 5FTMA 3K70B 5L3QA 5FPSA 1XTIA 3T1OA 2B7CA 2C8VA 1K5DA 1RRPA 3WBKA 1F2TA 3CNNA 2D3WA 3PEUA 5EUMA 2IWHA 1SHKA 4JLJA 4B3BA 3W8RA 1XCMA 2GWHA 1ZIOA 3RSLA 4ESHA 1U94A 3FGNA 2NO1A 2XJ4A 2Z4SA 4IVRA 5G40A 3RS4A 4YMUA 5KTYA 1FFHA 2C9YA 3X1WA 2ZI9A 4DEYA 4XSHA 4DC9A 2O8BB 1HT1E 2BMJA 2F3RA 3THXB 3ZJYA 5J5CA 4RD2A 3W3AA 3EC1A 4BECA 521PA 5K8TA 3KKOA 3QUSA 3VU9A 4A36A 1II8A 3U44A 2CL0X 5KOYA 1BKDR 1P4SA 2V9PA 4OJKA 4ABYA 2PZGA 4Q9LA 4Q4AB 1JEEA 5J4KA 4TYQA 2GXQA 3PV0A 4P31A 1ZU5A 2GAAA 2BKEA 1E9EA 5FUXA 5L3VA 3C15C 2QEQA 2A5YB 3CRQA 3U7HB 2FEMA 4R2HA 3FKSA 2GILA 2HXSA 2Y8EA 4IOMA 3T5GA 1ONBA 5KHOC 1SKQA 4ZDIA 1SQ5A 4L16A 1DAEA 2NTYC 3MRSA 4LYAA 1H8HA 4C0BA 5DN6D 4TYPA 1UADA 3NDPA 1KKMA 2B6HA 3SFZA 4MUAA 1FNNA 3WMFA 1GL6A 4GOKA 5IHPA 3I4LA 1OH5A 4NTZA 3LBIA 3SOPA 2GA8A 3CRVA 3GLGA 2BEKA 2PEYA 1E1RD 1Q1BA 2C04A 2OUKA 1P5ZB 2YOGA 3R9XA 4D0GA 2B21A 4CT5A 3A6PC 1BMFD 4BFWA 1HV8A 2MSEB 2FX3A 4HDCA 1CRPA 3A4MA 3PG5A 2KBFA 3BS4A 3WYGA 1E1QA 2OLKA 1Q44A 2H92A 1KMHB 2PLRA 2ZPTX 3KTAA 1MABA 2VRWA 4LX0A 4C0LA 3AKCA 2WM9B 5FPHA 1BOFA 2ATVA 3QEJA 1OYYA 3WP0A 1NSTA 4PC7A 4NYMR 1XXHA 2KSQA 3A1WA 3OEHD 2WBLC 2WAXA 2XNDD 4RFSA 2AXNA 2FPLA 4U02A 1KI6A 2VPPA 1XEFA 3B82A 2ZE5A 4BZXA 2QBYB 2VLIA 1MO4A 1IQPA 1DVRA 1L4UA 5KSZA 4OYHA 5SZHB 5HE9A 3LQRA 4OK3A 5LD2C 1DEKA 2FG5A 4PC6A 1UBEA 2GF9A 2WHXA 3T06B 1CIPA 1E4VA 2CHVA 2F55A 2QSYA 4QG7A 5KDDA 5HKKD 2ZJAA 3CPHA 2BDTA 1P9NA 1BH2A 5JEDA 3IEVA 4UNRA 4L9SA 4HZUA 3BFVA 4IDQA 3U7EB 2XJ9A 3NEJA 2HLDA 2PBRA 4DLRA 3TIFA 1NMZA 2ZSAA 4WW0A 1Z47A 2ODWA 3MGCA 5CK5A 4B35A 4M1KA 1LS6A 2KE5A 3D7MA 5F98A 4NMMA 3N2IA 2B92A 1NN3A 4HDQB 2V6IA 2Z83A 1CTQA 1UKZA 1S9HA 2CCJA 5DYIA 3J81k 3CPJB 1Z6TA 4JLOA 3GP8A 2RHMA 5TY0A 2ZE6A 1RE0A 2QRNA 4IKEA 4ZDKA 1FTNA 4DCSA 3AVUA 1QHHA 3KZ1E 2GJSA 2CNWA 5AJYA 1J7KA 1DARA 2ZRHA 1FX0B 5JRJA 3LRPA 1FQKA 3B1VA 4ACBA 4D4JA 1CULC 4UNQA 1JXOA 4PHFA 1JALA 4LI0A 3K0FA 3G0HA 2QQ0A 3V4RA 2K5UA 5FBLB 4DLXA 2ATXA 3IKJA 5H1YA 2R6GA 4DCNA 1KI9A 1QHNA 1NY6A 3B1YA 3WYFA 2BWJA 4IW3B 5GJCA 3EZ9A 4HAUA 1SZPA 3B60A 1TAGA 3K9HA 1Z83A 2IYQA 2O5VA 1ELOA 1YZNA 2ZI5A 4TT3A 4X8LA 2IWRA 2HV8A 3BGWA 1EWQA 3H1TA 1KJYA 1XEXB 3SU8A 4BLRA 4NCKA 3WP1B 4D25A 1OXSC 1JQJC 2C03A 2WAYA 3KB1A 3BC1A 1NVVQ 2ZIAA 4MKGA 3IQWA 4P4TA 2ZYTX 2OG2A 4DDWA 1HYQA 4YDHB 4G5SA 4ZCMA 2AFIE 5FTJA 4QBIA 1OYWA 1XXHE 5FTLA 4JSTA 4PO9A 5J4VA 1GITA 3RS0A 2SHKA 1QRAA 2JDIA 1IHUA 2R6FA 4A0HA 3KQHA 2IYWA 1XD2B 3AKDA 1N0UA 1SVOA 3MWJA 2JLUA 5DI9A 3SDZA 4LPKA 3EWSA 5IK2A 3DEFA 2XGJA 4FMBB 3SI7A 1D2NA 3ZS8A 4KBGA 4JYBA 1GRQA 3MSXA 2ZRLA 3LQQA 4BLQA 5KU1A 1IAQA 2J0UA 1KK0A 2A78A 3EZ7A 2NO6A 3Q5DA 5BQ5A 4PSAA 1P62B 4MQBA 3AVTA 1XCPA 3CUEF 2VP6A 3O47A 1EFUA 2WWHA 3OIUA 3QE0A 2IUUA 4DLYA 3PEWA 1GILA 4B47A 5F2EA 3A4LA 4RZ2A 4NCIA 4C0HA 2BM1A 4MDEA 1ZYUA 2MSCB 4TQ9A 5AJWA 3L2OB 1Z63A 1ZNWA 4QBGB 3ADDA 3AF1A 2PCJA 3KKQA 2Z43A 3D6TB 1ZM9A 2XSZA 4ILEA 1OT3A 5JCZA 1S0UA 3GLIB 1A1VA 4IEEA 4DLVA 5HTKA 1S9DA 4G1UC 1LY1A 1EESA 5DYGA 1XJQA 2PZFA 2XTZA 4RD1A 3DO6A 1NVVR 1FUUA 2AK2A 2G88A 3LD9A 2FSHA 5FOSA 1R0ZA 4HI0E 1TMKA 3TAUA 1SXJC 4ZKDA 4NZYA 1FP6A 3WNDA 1MO5A 2ZRIA 3AEZA 1N6KA 1S96A 1GSIA 3EPHA 3RRMA 1W1WA 4A6XA 2JLXA 1SGWA 4AKGA 5JJKA 3EIEA 3HPQA 4MA4A 2QT0A 3ICEA 3O8CA 1TQ2A 2X77A 1ZMXA 3KJEA 3OHMA 1NNEA 3M4YA 1M7GA 2JIZA 3OF5A 5IDVA 1NMYA 1KI4A 1Z6AA 3LX5A 3SYLA 2QI9C 2ZUDA 2Z5FA 1RYHA 3CWZA 1XWIA 3LV8A 1E9SA 4JVLA 4LJ8A 4PX9A 1KY2A 1WRBA 1Z22A 4A92A 1VKJA 2BMDA 2QUZA 2RGNA 2UKDA 2WKPA 4GPTA 4WZAE 5DE3A 2A30A 1OKKD 3BJIC 2MMCA 1IM2A 2YWFA 2DY1A 2R65A 3I32A 2H18A 3PXGA 1M7HA 4AY2A 2HUPA 3GEIA 5BN5A 2ZRFA 3THYA 2EFCB 1OV4A 1KIMA 3AM1A 4Z1MA 4AI6A 2J87A 4E03A 4EFMA 1KJZA 3GLHE 2Z4RA 1O3YA 1T8TA 3X2SA 1G5RA 3IDQA 4BFSA 4A82A 3EXAA 5J47A 4RKFA 4RVCA 1T91A 5LB2A 2ZRBA 4AK9A 5C18A 3NHBA 2V1UA 1ZBDA 2Q3FA 1QF9A 3CZQA 1S3SA 4MYUA 4HB4A 2JASA 2XOKD 1DOAA 1N25A 3REGA 4CEHB 1FP7A 2IYUA 1JAIA 2D2FA 3OE7D 3OAAA 1IJFA 2I3BA 2FV8A 621PA 4WXRA 3AV0B 1XZQA 4GDFA 3L0SA 3QXXA 4LC0A 2HJGA 4ZDWA 1KI2A 1NF3A 3KL4A 2WSSD 4LK2A 1OJLA 3HYRA 3EPKA 3A37A 4DLUA 4XWAA 2VHJA 2YYZA 1EWRA 3TUIC 2WKRA 2WWYA 1QBKC 3K1JA 3QNUA 1GOTA 2O0HA 3IUYA 2ZRPA 2BVNA 2W2VA 2VQSA 5L8VA 2H1LA 1WBBA 5FR1A 3FHOA 1AS3A 3HPRA 4JMPA 1XP8A 2RGAA 4Q21A 721PA 4TMKA 1M6NA 2OAQ1 3VHXA 2CL6X 3F5FA 2VHTA 1XNJA 2MSDB 2ZS7A 4ZKEA 5M04A 2G6BA 3KJHA 3SJBA 2XTMA 2HEIA 2WWWA 3ZDQA 1HA3A 4BEBA 2QP4A 3E2IA 1Z2CA 4PZZA 3EIQA 5EUQB 4A1FA 1XB2A 4JVSB 4CZ2A 4WIAA 1CJMA 1ZM4A 4JLMA 3K0AB 3AF2A 3K0CA 1KTVA 3B1XA 4IDPA 4QFMA 3R8CA 1WA5A 3T12A 2ZM5A 1W36B 4QGFA 1G3QA 3K9LA 2Q21A 3PEYA 4HLUC 4V03A 1G21E 2F9LA 4PHHA 1JPJA 2QG6A 4RZXA 4OK5A 1D6JA 2DHRA 4KVGA 2XTNA 4DSOA 3HJNA 2JCSA 2ZI6A 3RABA 3A1TA 2WOJA 2JA1A 2ZRMA 2RGGA 1OXUA 3PUWA 3IHLA 4XVUA 2FFAA 1OFUX 2QT1A 3AVPA 4M21A 4KLZA 3TH5A 3ZVMA 4OK6A 1K5GA 1FPMA 1VCIA 1OB5A 5J4YA 2ZYWX 4ZO4A 4IOLA 2NQ2C 2B7BA 1ZCAA 3AVOA 4JKIA 4TN1A 1KNQA 4H1VA 1FZQA 3L8YA 3HDTA 4HAWA 2BCGY 4EPYA 4PSVA 5DI3B 5LDDC 4HATA 1ZD9A 4LJYA 4EIWA 1U99A 3NBFA 3GCGA 3QF4A 3FOZA 3TSOA 3RRYA 1E9FA 1XTJA 2QMHA 3OFND 5BYJA 3UK6A 1CR4A 5G3ZA 2FPMA 2QP9X 2O8CB 3RS7A 4RSGA 5JHGB 3FB4A
chains in the Genus database with same CATH superfamily
2HI0A 4GX2A 4UEQA 2JLVA 1V95A 3BPSA 2ZTVA 2FZVA 4DCVA 1D09A 3DLAA 4HWPA 4AJ9A 3I6IA 2WU3A 1FA9A 3LWNA 3U3OA 5KNBA 3IVCA 4IZHA 2ZYSA 4IWNA 1FVFA 3BRQA 4WBSA 1U63A 1FSZA 3SQNA 2F1JA 3MJHA 2OSBA 3IR5A 1OBOA 1RABA 4CV0A 1PFUA 3MCTA 3ESAA 2B8TA 3S28A 4LF5B 2WWIA 5E9AA 1D1SA 4ITUA 5HF5A 1RD4A 3D31A 4Z99A 3RU7A 4QU8A 1Z13A 4Q3EA 2Q0SA 2PUCA 5SV2A 2C3YA 1FDVA 3KXKA 3HNOA 1DEAA 1Z2OX 4KQ9A 4XXHA 1XEWY 1OW3B 1YIDA 1CUHA 3BYZA 1H1LB 3SZ3A 1SMKA 1I3NA 2H8KA 5C5EA 1NURA 3UTDA 4G01B 2OT3B 4QVKA 3JYOA 3LWDA 3PCRB 4HAXA 1OB2A 4IQFA 4LXUA 4BO6A 5IFKA 2JLZA 1N2HA 4B74A 4I0WB 2CFSA 3HC7A 2TMDA 2OOSA 2XB2A 2NPOA 4DLSA 4E09A 3G89A 2AOVA 3KT3A 1OGIA 1GGNA 2EKBA 4MCHA 5DCYA 4D6XA 2EWVA 1XHLA 4Q66C 4DV4B 1SQGA 2OORC 4O1IA 3B48A 2UZIR 4HPWA 4U2KA 1A5BB 1TJYA 3LUJA 1T6NA 2BGTA 3L0YA 4OJNA 2PZAA 1SRRA 3RODA 3U39A 5LMNB 4IIEA 3PNSA 4D80A 1BAPA 1VBNA 2GTHA 2GPAA 3ZHQA 4P86A 3DFMA 1OV6A 4MS4B 5BWMA 2AI2A 4ZRNA 2DLNA 3BN3A 3TQOA 1U2GC 2HUNA 5DNEA 4PN3A 8ADHA 5ALDA 2ZQZA 4DIDA 3P2YA 3RI3A 2FPPA 2MSWA 1NKTA 3DZIA 1SURA 2PVCA 3G8AA 3NM5A 1RKXA 1XZ8A 4AXBA 1B3RA 3L4KA 4W6QA 1I4LD 3NM6B 4X1YB 4XB1A 3HKBA 3LKBA 4H3HB 4E51A 2VRNA 2FMIA 3HZZA 4QXMA 2IXDA 3SXPA 1EK0A 3DTVA 4CLOB 4BB5A 1BFKA 2R6HA 3LBYA 5IZCA 1SD5A 4PX3A 1EVIA 1W73A 4FJ0A 4XD7D 1PZNA 2OV2A 4I1VA 4BMDA 1K7XB 4RPGA 4MZDA 2IYVA 3CA8A 1W29A 3FCEA 2VJLA 2HF8A 1ORIA 1ZD1A 4ARCA 2P6UA 1OXBB 1GT6A 4E2WA 1KGDA 1QG0A 1WP9A 1YZLA 1J06A 2ODTX 3EDOA 3PIRA 4JENA 3HRIA 4LDNA 1FRVA 1MEOA 2C5GA 3VKVA 4B2PA 5CYGA 3UH1A 1NNSA 2EARA 2ZJZA 1H8ED 1N5JA 2Q1XA 1N1EA 2V6JA 1H2FA 4FZ3A 1EK5A 4MOWA 4ZOEA 2A5LA 2DHDA 2XQIA 3ON5A 1XA0A 4X20B 4OQZA 1QG4A 5FOWA 1YONA 2PNFA 3E3OA 4BS9A 2HFKA 5J9FA 4NPHA 1Y1PA 1C8BA 4IY1A 2XYRA 4I6EA 3K0KA 2HBYA 1TA4A 2PMWB 4P34A 2AOTA 4OYLA 1B0UA 4S0ZA 3OC6A 4TSKA 5C34B 1CFZA 4NXMB 4XQ0A 2J6IA 3DW3X 3VDNB 2VP2A 1CVIA 1EE1A 1YZQA 3KALA 3Q9LA 3JQ9C 5TMEA 4BFUA 3NBAA 2CV1A 4X54A 1I10A 1E6UA 2G67A 3AFMA 3DQPA 5ALQA 5FNZA 1L2TA 4BGVA 4DMFA 4RORA 3F2IA 1A2QA 1P4GA 4HDNB 1JG7A 4TL6A 1N8SA 3NG1A 4KAXA 4Y18A 2FCRA 4L5AA 1R50A 3RTDA 4C0AC 5T5QA 3DPIA 3TR5A 4JQOA 3OJOA 3CTMA 1E69A 1IY8A 2A5DA 1NLMA 1RBMA 2BCEA 2O8FB 3R7WB 5ER9A 2VP9A 1O94D 2VJQA 2VJCA 3E9NA 4LOKA 5C7LO 5F9MA 3LQYA 4GOXA 3OZTA 2QG4A 1RM5A 4XIIA 4DRXB 2CFTA 2G63A 4ZD6A 5LQSA 1Z45A 2PM8A 3GGSA 1SC6A 3INNA 1M6WA 3O91A 4OO3A 3WK8A 4RULA 5DNVA 1RXWA 2NO9A 1FQWA 3NWBA 1Y7TA 1KFEB 2CB0A 3OEEA 5H70A 3NMUF 3HABA 1QQ6A 3OIVA 1TFRA 2O0MA 2Z5LA 1TM1E 3EQ6A 3PDHA 4JYCA 4GI5A 1ZGJA 3E5MA 2QTMA 3RANA 1T3LA 1Q91A 1IN6A 3LVBA 2IYXA 2ID9A 4JXKA 2GX6A 1B43A 4DMUB 2XCSB 2CHUA 3MAAC 2DE0X 4PX2A 2QLLA 4C4RA 2WWGA 2Q3JA 3EDMA 5JS7A 1CYEA 1CVLA 3ILVA 3VPXA 5JROA 3NTRA 1RT9A 4IOKA 5JDCA 2WWTA 5HJ2A 2HSWA 3FI0A 3MMPA 4ZAGA 4QQKA 3EX7C 1YS2X 3U44B 3LP5A 1OZ0A 2DR0A 4AJ4A 3VYSB 4EA6A 3MYRA 3NTQA 3UB4A 1GYRA 1FF9A 2ZP1A 4KG7A 1TYEB 3SZOA 5JFTA 3E53A 4II2A 3E7PA 3HJAA 2PS3A 4QEZA 1NP3A 3S55A 3UWPA 2GNPA 3ASYA 1G64A 1OZAA 2BFEA 4YUVA 3SJCA 1C9YA 3RYFB 4RD4A 1JTVA 3EIHA 4BMVA 1F3LA 5C1BA 2PUFA 1DG3A 2B4QA 3HY4A 3ZIDA 1LVGA 3MHTA 1U2QA 2CD7A 4F9GA 2OLEA 3V34A 3K1ZA 1UBSB 1FCJA 3RS9A 5TVGA 1QU2A 3TW8A 5A4MS 1NBME 2IYEA 2VCEA 4IJUA 3GJ0A 1E66A 5CYOA 5ELMA 5JD3A 4C4OA 5CT9A 3FBGA 3NKLA 2C57A 3TMYA 2IOFK 2QP3A 1PR4A 3A11A 1TYDE 3BK2A 1W4AA 1JNXX 3QX8A 5AMXA 3SQLA 2BKXA 1STOA 4BZPA 1Y5MA 1KBOA 3L7LA 4RHTA 3BE4A 3BXGA 4AXXA 5KTNA 2RHLA 3ENQA 3FMOB 4MR9A 3I28A 3UK1A 2WM2A 1FY2A 1USWA 4NV3A 1B16A 1Q6ZA 2HO4A 2P3OA 1Z08A 4TZ0A 1S2GA 1H22A 3ICOA 2QGZA 1R9JA 3JU3A 4IUDS 1DCKA 1B23P 3KJIA 2Q8NA 5LXTB 3KQKA 3G0CA 5JO0A 3VYWA 4DV1B 1I1NA 3E9MA 2J9XB 2OV1A 1B00A 2L18A 3NZEA 3S1AA 3ZHBA 2HA4A 3NPMA 5IM4A 4I1SA 3T1YB 2G83A 2LWIA 2NZVG 1X7YB 3EAGA 3QUQA 1PNOA 1JR3E 2IODA 1GG2A 2O57A 2P1DA 3KTAB 4H7EA 2CBXA 2YHIB 3Q12A 4HQKA 4OG2A 3IAXA 4ZJZA 1J2JA 1HYHA 3Q40A 4C7OA 2QTWB 4XGRA 1KFBB 1EIZA 2A0FA 4A2WA 1K0UA 1U28C 2R1ZA 3H97A 2IBSA 5IN5A 1XXHB 3RUPA 1Z7WA 2FWRA 2R60A 5T4HA 5CBPA 5GIPE 5JFGA 4DUYB 4LF6B 2R47A 1OIWA 3NBZC 2WKWA 3FZQA 5GV8A 4YRMA 3H7AA 4CTMA 2XXAB 2PQ0A 2G9QA 3QXJA 3CONA 3QIVA 5E6RB 3ENNA 1P77A 1FYWA 2E0IA 3ZHOA 1JT2A 4JZYA 4P83A 2NTNA 2ROQA 1YMQA 4J0DA 3VJRA 1TM4E 2XF8A 3MCAA 3OIFA 5AKJA 2JGKA 1G7TA 1B0PA 2QPAA 3OHSX 3OO1A 4N0DA 2YZMA 3HJRA 4FUQA 5KTRA 3S2SA 1E96A 1MT3A 4D6YA 5HGJA 4K6HA 3PITA 3TRIA 2C98A 4RLHA 5LQJA 4KV9A 2AW3A 5LLSA 4PLHA 2BM8A 3MIZA 1RWBA 1E79D 4HDMB 4F93B 3LDUA 3RYIB 3KHSA 3WYEA 3ZVKA 2EWMA 2ST1A 4FGLA 1PZFA 1KY5A 4L0DA 1CS0A 3SLRA 4MP8A 3T7CA 4P3OA 5JCOC 2KWIA 2EX4A 3LPNA 2ZUWA 2P8SA 1CZOA 1QZXA 2ONCA 1AXGA 1Z75A 2I66A 1E3DA 4KXNA 4FGKA 4P84A 1CX9B 3QYJA 1TA0A 1KK2A 2I1QA 1OLXB 3PFWO 1YOVB 1AZWA 2C84A 2GAJA 3EIOA 1IBMB 2VO1A 3R7LA 2VF7A 3PNQA 3GJ8A 4M1QA 2ZSDA 4HDSA 2HX1A 1J2YA 1WTAA 3NBYC 3TXYA 2PEZA 3DHWC 1IJEA 4FX5A 2UYCA 3BGSA 2XWJI 3ELDA 1JAZA 4TKVA 2B4RO 4UHEA 2AMJA 2AWNA 4UM9D 4PQFA 4N5IX 1B73A 1IUOA 2RJOA 3NKFA 3PX2A 4PBTA 3TGPA 1P18A 3IESA 5KQRA 3QYFA 1VDMA 5E1DA 2UZ1B 4QUJA 4GWKA 4CG3A 1Y1QA 2H0AA 3GU3A 1ZD4A 4BRZA 1ZN2A 2Z2JA 3Q0IA 4F85A 4HUTA 1BJTA 3IUPA 2OAEA 1Z0DA 4QECA 2HPVA 5I7WA 2JG3A 4M1OA 5EFOA 5IKMA 2B98A 4RIIA 3RSHA 4NAHA 4CJXA 1Y3DE 2EW8A 1R6BX 2QMUA 1NW3A 1IXYA 1QVAA 2ZUTA 5CMLA 2PT5A 3OD1A 4C7MA 1GL7A 5DX8A 2YHUA 2QAJA 4RK5A 1RAEA 1GUDA 5FOTA 1JVSA 1CUSA 1SQ0A 2DLDA 2Z2ZA 3HKDB 2ISCA 5C8VA 3ZH9B 1GTZA 3ESQA 3WI7A 5CM8B 1T8SA 4F97A 3MGKA 2UYYA 1NC1A 3EEIA 3ZGVA 1H2RS 4YFYA 4OI1A 2VDWA 4LZOA 3SYKA 1GDTA 2I2WA 4Z2YA 4N8EA 4LSGA 3GLHB 4JJ6A 5M3BA 4KXWA 1ZEJA 4OQPA 4FWTA 3HR7A 3M7IA 4R1LA 2HF2A 2WUFA 2Y3IA 4LZLA 2OB2A 1OBVA 1KY3A 4YALA 2Q6IA 2I8CA 3HJBA 4R9SA 5LIRA 2CV0A 5DTRA 3P5SA 1ORDA 2BP7B 1UOPA 2IUSA 1Z17A 2ODQA 4WECA 4DY6A 1HF3A 5ADHA 3GLGE 5HKBA 2ID7A 4RVNA 5AXDA 1NUSA 2F3TA 3JVVA 2I4OA 2G1UA 1KY4A 1KFCB 4ND8B 3BT7A 1E5LA 3AUXA 4L9AA 1NL3A 2C58A 1QCYA 3QPBA 5JJCA 3KB6A 4OL9A 3AFIA 1NJGA 2W6CX 1FMJA 1K8XB 1P3JA 1JS1X 1QIEA 1M2VA 4YUZA 4DJJA 4IVPA 5AI5A 1DC7A 1E1QD 2AA3A 3TLMA 1NQWA 1PJBA 3MQFA 2AG6A 3ACBA 2J07A 3ZVRA 3AHJA 1AK2A 1XIVA 2RJ3A 4A2PA 3GUVA 4BX0A 3B9PA 4Q16A 1H0RA 3VR3A 4CQNA 3OLXA 2B0JA 2AFHE 5DWVA 1FFYA 1ABEA 1UZLA 1OC2A 3PCXA 3PEFA 2FOXA 3DAOA 3VZDA 1M6YA 5ICEA 3F47A 1DOZA 5ALGA 1GSHA 4JJ7A 4V0MA 2C5BA 1T3HA 4CNQA 1PDOA 2EBHX 3E2MA 1GRNA 2NYAA 3Q9UA 4WV3A 3LHSA 2DPYA 2ZWPA 3GAMA 1SBZA 2C5FA 2YWHA 1SCNE 3R41A 3RKSA 3UMBA 1TC2A 1XKXA 4XB6B 2JZCA 2AC4A 4M49A 1KYVA 1YUMA 3SEZA 3P94A 3ILYA 5K0LA 2JLCA 3GJ6A 3VOSA 1JF8A 1OFUA 4D3YA 2IH5A 1G66A 3COJA 3H11B 2BGLA 4XGIA 3KFVA 4NAVA 4PLTA 4ZVVA 3C6BA 1P61B 4RY0A 5AM4A 4D9EA 3IIIA 1BN6A 1XMSA 2Q9CA 3W34A 3CKMA 1TMOA 1SKBA 3E5HA 4JJGA 5CD1A 2HZBA 2I1VB 3HI6A 4IRXA 4G0ZA 4DMKA 4EY5A 3D3QA 1G21B 2DKOA 4ZYVA 1K8ZB 4LF8B 4I9NA 3NQ41 5ALJA 1M2HA 4QGBA 1A88A 4ARZB 3H2KA 2E4AA 5EUCA 4OXQA 4S0XA 4FHGA 2NT3A 4QDXA 3WJ7A 1W5AA 1P1IA 1QIJA 2MSKA 4BB0A 5I7RA 5KTMA 2HHCA 2AQIA 4ZVLA 5HFAA 4Y2YA 4X8OA 2DKFA 2RI0A 1VB3A 3GAFA 3U13A 2OBFA 3IEUA 4TSFA 4PG6A 3C98A 3HDQA 3W9UA 5LLTA 3WNCA 1EXNA 1IFXA 4YO8A 1B6GA 1N0WA 3GH3A 1OQAA 3HJCA 2VQDA 5F3WB 2R5FA 1UPFA 1AJEA 3CUUA 3G7NA 3IELA 4GYJA 5SYNA 2GLTA 2ZPUA 1IRIA 1DXHA 1Q3TA 1T1GA 1ZQ1A 4C0QC 1F12A 3ROPA 1CW2B 3THYB 3S70A 1U3CA 2WJZB 1R3DA 3B3GA 3R7FA 1RZRA 4ZAZA 1EUDA 2DULA 1Z4JA 1ZN8A 4XH9B 1F1JA 1V8FA 1CNEA 1XEXA 2DT8A 1JBEA 2RHHA 1G2OA 4M0CA 5EWJB 4YWHA 1R4MA 2QG9A 3NHPA 5HF6A 4NZNA 5BV1A 1YVPA 1L3IA 1NBHA 3D5TA 3EIXA 3PEVA 5KI6A 2H5LA 2QN9A 4WOCA 1U1EA 3A6HA 3BWXA 2WA1A 1VP3A 3LLSA 4HG2A 4KFCA 5IMSA 4UU1A 4QA9A 2RGRA 2C4NA 4JBYA 4JT9A 5CK4A 3BMQB 3RSZA 2I33A 1I4TD 2VBCA 4EHAA 1F48A 2FK7A 1TM3E 3PGVA 3QXHA 2GBCA 4AL4A 3AEQA 1EDOA 5EZYF 2ZJBA 4FMCF 4UHJA 2ISSD 3O1HB 1E2JA 5JBNA 4FEGA 3Q8KA 5F64A 2YNMA 2Z6UA 1ZGBA 4CQMD 4DILA 3WO0A 4P3KA 2NADA 5LQNA 1CJTC 3GHYA 2QIOA 3ABOB 3GFTA 3NAQA 3DB2A 4NFSA 3EAFA 4QC2A 3UANA 4AJIA 1YB7A 2KM1A 1VJ0A 4F21A 4RDIA 3U1VA 3LF1A 4YMTA 1NQTA 4RO0A 1L4NA 4B40A 2EWWA 1R0WA 1TLTA 3AYZB 5EVJA 5BRAA 4CUKA 3IH5A 2H17A 2F90A 2VT2A 3AOEA 3C14C 3O4IA 2MINA 2GJ9A 4G0YA 4QBFA 3VHXB 2O2XA 5E38A 4D79A 1ID8A 1ZH6A 2ZYVX 3SQMA 2Q3EA 3JARA 3ANSA 3HK2A 1U7XA 1T2DA 1IB0A 3JWPA 3WLHA 4BNZA 4NMWA 3HSKA 4E7PA 1OZHA 1V7CA 5HQ3B 2C5HA 2NG1A 3EVTA 1KMNA 1YR7A 5T6MA 3W77A 5K8VA 2NZYA 3E5RA 4F9EA 2A0XA 4HZGA 4V0RA 1AK1A 1DLIA 4R84A 1ECCA 1GLVA 4QTYA 3IT1A 5JCJD 3IC5A 4ALLA 3UT5A 2E37A 4BY9E 4WTOA 1KKUA 5T6BA 3TI9A 4F4DA 3ZKWA 2ZR7A 4KRYA 4MW0A 5ANRB 3MERA 3JRXA 3L6DA 4EZBA 1C1XB 2FAXA 3DD1A 4EZIA 3Q7RA 4MARA 4UAJA 1W36C 3QENA 3KLOA 1RJ9B 4PX5A 2LKDA 2IQ5A 2Z09A 3RJZA 1YU9A 3AB3A 1IY1A 3WWPA 4B9AA 1BXGB 3ZG6A 4BWYA 1MW8X 3EZGA 3M5CA 5EHQA 2V9ZA 2OGWA 2I2BA 4OLFA 3D64A 5KQPA 3S2UA 2ZW9A 3F5QA 1ENYA 1UFVA 4OFXA 2CHQA 1I01A 2VNKA 2VK4A 5DK6A 1ZBQA 2H4HA 3GRKA 4LYFA 3DUFA 4XW2A 4CG2A 1Y6RA 5KNCA 1M6VA 4WI1A 2A86A 2H07A 2R96A 3MPUA 2HREA 2W2XA 3Q8XB 4IRMA 3SDBA 1QCZA 2PFSA 4FDUA 3K96A 1X7ZB 3I8OA 4B80A 5ED4A 1OXKB 3LUDA 4YT2A 3WGLA 4CUJA 2G9NA 4QLBA 5IDWA 1N2ZA 5KYXB 3ESZA 4PZYA 2NXWA 2OZLB 5D2CA 1ZUIA 3TVTA 4L5JA 1JBKA 3BDIA 5HIJA 3IJEB 3LUFA 4AD8A 3VU8A 4XDYA 2PUHA 4R2WA 1YGYA 2JGIA 4F9FA 3LIPA 1NZJA 1PLKA 1J9ZA 3QPAA 4JBNA 2X5XA 5FX2A 3AVVA 1HR0B 1E1DA 1OWOA 2Q3DA 2XI4A 3NOQA 3GCWA 3KPWA 4GXQA 1P6XA 1OHHA 1RVDA 1GQRA 1TNDA 1WSWA 2P9GA 3DJFA 4XKJA 1KK3A 4TWAA 5AKZA 3V1KA 3GLFE 4M7OA 2EBUA 5FA6A 3N7UA 3TLJA 2QX9A 4NENB 4WOKA 3MIIA 1NSYA 2C8JA 1JFFB 1ATZA 1B14A 4O08A 4KFTA 1TJ3A 4KRFA 5EWLA 1H3NA 5ALOA 4G89A 4P36A 4LHSA 3O90A 3FR7A 2PKEA 4Q7KA 3VDMA 4Y7DA 2Q4TA 2IHKA 4RXMA 2RHDA 1AS0A 4FC7A 4DR3B 2EFEB 4LY0A 7MHTA 5E95A 1M76A 4OBBA 4OSEA 2FPOA 4OM7A 2X4DA 4B3CA 2PX2A 3SKYA 5J58A 3K94A 1LA2A 421PA 4TV9A 5EN4A 1QX3A 4BGIA 1UEXC 1NW8A 2ZATA 3L7NA 1GU0A 3JWJA 1SR8A 4MVJI 3M5DA 4GQAA 4Z7OB 4HRXA 1AX9A 1MV8A 2J6HA 3OQPA 1EFKA 4J7XA 4GL4A 1U5BA 3I5YA 1VSTA 3V48A 3K4QA 4XFJA 1A9XA 4RTNA 5G41A 3E4DA 2QLJA 3KWFA 4J2HA 3EBOA 3L7AA 3QJ5A 3EEFA 5B1YA 1H2EA 4Y1RB 4R05A 1FP4B 2QTHA 3LX8A 4IF4A 4MHSA 3MWEB 4Y6GB 5KX5A 3B70A 3EJWA 2PMEA 3HL0A 1LKZA 4WK6A 2O2ZA 1BFUA 1QYIA 2QX8A 3M34A 3FMGA 5C4GB 4D5EA 5BSUA 2IS2A 1YTLA 2B82A 1XL0A 2V8BA 2LP4Y 3J81A 1QP4A 4BLSA 1XMXA 2R1UA 2Z1DA 4Z0PA 3ZPXA 3GPIA 1V37A 3T0IA 4E07A 1U7UA 1M8PA 3G9XA 4F86A 3WRYC 3G23A 1Z0KA 4QREA 5CA1F 1T5IA 2GPWA 4EF5A 4ES6A 4P2BA 2P4QA 2P2YA 4W5JA 4MR7A 3W1VA 4QJIA 5TQ0B 3R8FA 4EPXA 3TRDA 2CKMA 5JS8A 4H3KB 2GHQA 3BKWA 1FXWF 3NV9A 3VO1A 1ZM7A 3RO7A 2ZROA 4RHEA 4DSTA 3DBRA 1CEQA 3MCWA 1MDFA 1UAYA 2E48A 4GI7A 4WXEA 3ZWYA 2Q9BA 4Z7QB 4DXDA 4JT8A 3MT0A 1XVIA 3KFLA 4TMWA 1T3SA 1JZQA 1VRVA 1PQ4A 2AEMA 3D0QA 4NR0A 5AJHA 5BSKA 1U1CA 2AW5A 3GJZA 3OU6A 1KEZA 4A03A 1DC3A 1YGPA 4BKPA 1TAQA 1Z5VA 1V8OA 1H5UA 2C7QA 4ABTA 4UDYX 5DDIP 1LBTA 5FBKA 4QIHA 4ZZ1A 2IIQA 3EPLA 2J7PA 2PRIA 3H8WA 1E2EA 2R6DA 5IMBA 1J1IA 5JR3A 3ITKA 1UBRS 3LZ6A 4HEHA 1DBWA 2DQYA 1J8YF 1TQDA 4UEJA 4IKPA 3MOGA 4ZAFA 3V8MA 4B3DA 4QJ4A 1X13A 2F43A 3CUWA 2CE2X 3LHKA 3NKVA 4MLDA 2V3CC 1J42A 3ML1A 4YV2A 4CIAA 1TJPB 4IDGA 1UPBA 3NTXA 5FOVA 2YFYA 4B3RB 1ESEA 4QUDA 2G09A 4I19A 4YI3A 4D96A 4O2AF 3B6MA 3TZEA 1YFJA 1QMGA 2V55B 1DE0A 1AM4D 1NQVA 1D2EA 4HN4B 5ENZA 4PZCA 2D7DA 3HJTA 5DJ5A 2H00A 1TJ5A 1R64A 1ZNYA 1J8FA 2X8LA 3F96A 3GGJA 1KARA 2JI8A 3AIMA 4KKVA 5F77A 4IJKA 4DAOA 2GFHA 2VJYA 2YW9A 3TSWA 3PENA 1KO8A 3STVA 3FI9A 1VYTA 1FNCA 2IOHA 3H5WA 3KEMA 4CM1A 1ENOA 1I4DD 3VR6H 1JHPA 1R6UA 1R8YA 5JZVA 4RQAA 4INJA 4ZO9A 3HXOA 5I4KA 1QYCA 2NU9B 5HBRA 4YUWA 5JAZA 5AH0A 4N0PA 5DT2A 4GL2A 1J9EA 4LJKA 4EGQA 4KYTA 1N2CB 4O59O 2BBWA 2Y66A 3U2QA 1L5ZA 1O5IA 2HRRA 4MUJA 3INTA 3YASA 3IQHX 1ZK1A 1KC1A 2GXSA 2ESRA 4YAJA 4JC5A 4LKOA 4WZBA 2X4LA 1VG0B 2PUAA 4ME6A 2RHWA 3AF0A 5M5BA 1F2UA 3MELA 3AB8A 3T99A 1XZKA 1VE7A 1UM9A 4OD0A 4RCZA 2BR4A 5F78A 4Q9KA 4AO7A 3DFKA 3W6OA 4A6EA 2V4UA 2R87A 2Z8XA 4WGFA 2WJAA 4Z9XA 3FHTA 3RS2A 3ZCRA 5EJ4A 2I76A 3ZY5A 121PA 2AG8A 4KR0A 4B2LA 3E2PA 5EUBA 5FBQB 4UPDA 4FXPA 1JJ7A 3PDUA 2QZSA 2Q6TA 1XQ1A 1EJBA 2YXBA 2P2LA 5EHZA 3K6RA 3LY8A 2W90A 3MK31 3NIGB 2VHVA 2IOYA 3NVDA 3OM8A 4JGGA 4MUNA 4O4HB 2DH5A 3FMIA 4JUAA 3NGLA 3WHIA 6REQA 4BQQA 4G1VA 2V6FA 2ZE7A 2ZXEA 4YAKA 4HB0A 1JWBB 1YDEA 3DEHA 2EQBA 1N7GA 2JAQA 2XE6A 3Q7IA 1SUAA 1OFTA 3ZHTA 3G2MA 5U4QA 4LHZA 3B3FA 2R86A 2VDMB 4BX2A 4UM9B 5HKAA 3OQIA 4ZRDA 3EK2A 4MR9B 2RGDA 3SLKA 3BXZA 4I2NA 3ET4A 1LGYA 1MO3A 1RQGA 3HE3A 2WU8A 3QA9A 1Z5ZA 2D4AA 5AUNB 4X62B 1G8HA 1L9KA 1MAUA 3X1JA 4AKHA 3C3KA 1AB5A 3VSAA 1YZVA 5AWFC 4BBPA 3A6FA 4ZICA 3U6KA 2Q4RA 3B1ZA 2QF7A 4J9VA 3AI1A 4N03A 5COBA 3VMFA 4R40A 2DVMA 2DG2A 4NMXB 1JA1A 2FMTA 2HXGA 2OORA 2YV2A 5FA8A 3RUEA 1AOXA 1M6HA 2QYHA 3PFNA 4F12A 2C7RA 1JW9B 3I4FA 4ZYXA 2HL6A 2NZXA 4Q1FA 1EUQA 3WMGA 2PZBA 2GWRA 1JYEA 1F8FA 1IHOA 5JSFA 2VYQA 4RA6B 3UMJA 2R8YA 3P19A 4RA9A 1E1RA 1QV9A 4X97A 3VC3A 1YSCA 2FDXA 3ZTTA 4C7OB 2QNBA 4EVRA 3DKRA 2OMEA 3GQBA 3IEXA 3UMCA 2I62A 5KYUA 1PKEA 3QKSA 1R9NA 3CGGA 3R3SA 4BJHB 4ARUA 3LY7A 4L9RA 2WG0A 3H2SA 4HX5A 3HXQA 4CMEC 5J2TB 4TYNA 4JI0B 3RYTC 3IJPA 4NZOA 4F2WA 1E2MA 1MKYA 4Q82A 2Q7DA 4CI0B 5T4EA 3S2EA 3BSWA 1FVXA 4DLBA 1JFRA 1LH0A 3G82C 4MV5A 4DJTA 2BTOA 3NWEA 4JJEA 5A04A 2IITA 5JALA 5C0OE 3OE4A 3KQUA 1SVKA 2AEEA 5CDFA 1O95D 4NIMA 5CP8A 1DAKA 2BELA 3S1SA 4LZZA 3PGKA 1I7SB 3AK4A 3HO1A 1T5OA 3C4VA 2ZR8A 3HUFA 4WKBA 1QIDA 3L0DA 3D3JA 5JOQA 3LK6A 4D8WA 5DW3A 1I5EA 5CM9C 3ZK9A 3Q8LA 2VTBA 1PWXA 1Z7GA 2ORYA 4K6CA 2VDNB 4HVLA 4CIBA 4XQ9A 4IH4A 1EJ2A 2J5RA 4L0CA 2P27A 3RVKA 4PNPA 2AN4A 3WGQA 1JR3D 3OZRA 1XQ6A 2BGJA 1CRLA 4ZMSA 4O4IB 2VR1A 3C1AA 4PYOA 5REQB 3V4FA 4C6HA 3L4JA 2NMVA 3MFYA 4ZCIA 1OX4A 5DHAA 5K3CA 4M46A 2F1RA 4DSZA 5K09A 4LX8A 5HKKA 2WAOA 2BFFB 5GVRA 2ODNA 4NEQA 2DCMA 3FF1A 3KK0A 5JRZA 5C1IA 3EMBA 1PV1A 2ZI3A 4FZRA 1J0XO 2RDMA 3JQ9A 3PI6A 2W83A 3TAHA 3U37A 1B8UA 3GGPA 3W3AH 2QK4A 3RG2A 1RADA 4M0KA 1AN0A 4GWGA 4URWR 4FFSA 1MCZA 4QHSA 5K4HA 1F0PA 3UPTA 3TM5A 3C5HA 3DAHA 4YJHA 3B5IA 4Z4GA 3RT7A 2W2LA 1DKMA 1X1DA 1YKFA 2VDLB 3I1JA 3KUUA 4JR0A 4LXXA 3TTVA 3W5BA 4Y6OA 1M2OB 2ZOSA 4KE9A 2ZU6A 5EXDA 4YX9A 3CVXA 1DQYA 1FNBA 2XCRB 4HWSA 4INAA 2J3EA 4MLZA 2PL5A 3T1QA 1L4KA 1NPDA 4S24A 1W5TA 3ZE8A 4FDLA 3PHGA 1IK4A 1L9XA 4ZXPA 5LOVF 4JXJA 1BU5A 7YASA 3B2QA 3FETA 4YCJA 4H16A 2YL2A 3CLHA 3JRNA 4J0QA 4P0TA 4JSYA 5AVVA 4FBMA 4Q9NA 3DE0X 3REFA 2HADA 4D9MA 3CN7A 4DZTA 3S81A 4OREX 3M9XA 3DAFA 4KGDA 5F52A 3ZX4A 3KOMA 3B7GA 2AOWA 1SY7A 3Q3IA 2XA1A 3M0EA 2N0SA 3R23A 2J3JA 3PNYA 1JKXA 4H15A 4LGVA 3ZGLA 4OX9Y 3EZYA 3DOOA 1EAMA 4IIXA 4FGWA 4KFRA 2XT0A 4P4LA 3H5RA 4ZVTA 3ZQ6A 2CDAA 4TXLA 4LOLA 5DHRA 1P0MA 5D6OA 1R9GA 4JB0A 1KF0A 3LIIA 3REOA 3TQIA 1Q7BA 4RWZA 2O8BA 4H0FA 1H93A 2W93A 3DBLA 3KJQA 1PNRA 1MTZA 3EFEA 2NVUB 3AR3A 1C7IA 3IERA 1JDBB 3A14A 4IDFA 4PAGA 3FG9A 4JIMA 5TQJA 1KE1A 1W2WB 2UAGA 4PHGA 4PZ9A 4WUVA 3VX4A 3O4JA 3H5AA 2I6QA 3FNFA 1GQYA 1ZXXA 2N9UA 3R77A 4GU5A 3SY8A 3U3ZA 4HEJA 4DJDC 1K63A 3H2GA 4Q4CA 1ZRNA 1QKJA 1Z56C 4CCAA 4RHXA 1AGPA 4UATA 1PT7A 1M0SA 3ED5A 2EL9A 3FCXA 2G82A 3BRCA 3GJ3A 4MI9A 5DCUA 3UY4A 1MC8A 3SC2B 3HXPA 4Y2TA 5LUBA 4R7GA 1T2EA 1WMAA 2JW5A 4GSYA 4P92A 4JLBA 4XQEA 3RNLA 2ZETA 2YJ5A 1TZMA 2P5YA 3QJGA 4AJJA 3ONWA 4D43A 2ZG6A 2D5LA 1M2VB 2H59A 2Y1FA 2B34A 3EXEA 3FJOA 2SKDA 2Z5VA 4GMXA 1PGPA 3FOBA 3SC3A 2W98A 3HI4A 4RVSA 3TPFA 2RHTA 1U2RA 1W88A 4J7UA 1MPXA 2INGX 2ZWVA 1N9ZA 3UCFA 5F7ZA 3D1LA 1TM2A 1NUUA 1TE2A 3SR0A 4PSKA 3VH3A 2HMAA 4FPXA 1IBSA 4X84A 2XCLA 4BFLA 2RH9B 3UJ6A 3QOYA 3ZHUA 4X6UA 3FDZA 2OLJA 5ETJA 2AI3A 2RAPA 1LTQA 4Q9AA 2WWFA 3ZUGA 1PX2A 4ZV7A 1QZUA 3TLCA 3WGHA 2PLNA 1ZUHA 3L1UA 1KMHA 3FIJA 3P2EA 1LXCA 4R8SA 3CNHA 3NHLA 2ZQ5A 1F9EA 1SH7A 3PTZA 4F5WA 1FDRA 1TTPB 1X0VA 1DLJA 3UV6A 1KWGA 1W59A 1B6SA 1U28A 2BISA 3A04A 4K26A 3UAWA 2YY6A 3CT6A 4PLGA 1X8XA 1L4MA 4HH1A 1DQRA 1JUDA 2C88A 3QY9A 2C7GA 3OCZA 2WG2A 1NUHA 3DV2A 1K8QA 3PPYA 1T8WA 3VPBA 4PZAA 3LKDA 1KEEA 3UBTA 3IEKA 1NDHA 3VXKA 3ZE7A 4G65A 1K27A 4US1R 1CJUC 3CJRA 4CGYA 3OJEA 1V0JA 1UJ4A 3UB2A 2OENG 4MS1A 3MSCA 5A5VA 2W2PA 3QX7A 3EA5A 5BRJA 1BDBA 2EBWA 3C8MA 3ZWPA 1HI9A 3OCCA 4BNTA 5JCXA 5LD2B 4NK5A 2H1VA 3HO6A 1NNUA 5CW2A 1QLJA 1IONA 2JIPA 2RHGB 3L1JA 1GPLA 2BDEA 1A77A 1X86B 5BQOA 4R0NA 5AJVB 1I6MA 1XTZA 4EGSA 3FB1A 4F9TA 2QENA 5IARA 4N7MA 2IP4A 3EZ6A 2ZB7A 2ON6A 2V8OA 2ZAIA 4KMOA 3GMDA 5DO9A 3MWGA 3ZH2A 1SXIA 1YZYA 3IUEA 3EWAA 4EOGA 4LJRA 4Y2XA 1TX4B 2PR2A 1GQSA 3NX4A 1NUTA 1PWHA 1Z4IA 4J4TA 1T2CA 3DDWA 3OM9A 4H1HA 3WQRA 5ICSA 3RVPA 3TRKA 5TGDA 3F5DA 1V5EA 1ORHA 1R4MB 2GZ3A 2JAXA 3AHEA 1DWQA 3EN0A 3JALB 3SIXA 4A8JA 2GFIA 5JCOA 1ZUWA 3HCOA 3KYDB 1N2EA 4EY3A 5CVEA 3OIWA 3L04A 2CLHB 2C2WA 1L7VC 2ZJ3A 3HVKA 2O2EA 3MUOA 5PNTA 3KQOA 4L5IA 5DXJA 1FS6A 4IICA 4FEEA 1YL6A 5A6SA 1M0WA 4XD2A 4WZ6A 2B1QA 4TX1A 5TF4A 3NNDA 3IBSA 2XKAA 3P97A 4JJKA 1E2LA 2H7CA 4OTZA 1S8FA 2IBMA 2YFQA 1UPUA 3MTEA 2JLWA 1DJQA 3N8NA 3QXGA 5AUPB 2AHOA 4IO0A 1A5AB 2IW3A 4JUCA 5H3HA 5TMDA 1VPDA 4DNQA 4WCVA 4BNJA 2ZI7A 4YH1A 5F23A 1C30A 2Q5FA 4I1OA 1WCIA 1Z5PA 2H8GA 3GY0A 4K9NA 5D5HA 1M1XB 3IAM1 1KDOA 2YWDA 1GPBA 1DBRA 4MRNA 4HK4A 5U1PA 1KI7A 2H51A 5KU7A 1JKJA 2VH1A 3GJQA 4HTFA 4MWOA 4LQDA 4TS1A 4WLNA 3OE7A 3ENZA 5GM1A 4WNAA 1H69A 3C6YA 1I7NA 4BVGA 3LK7A 3MA0A 2H5IA 3IOCA 2QYOA 2H4FA 2HF7A 1RMQA 2MINB 4MYHA 3SC4A 2O7SA 4ZO8A 1HURA 4D9GA 3OCVA 3JARB 3DS8A 4Q18A 4JVMA 2AB0A 3PJEA 3RG8A 1GPMA 1ODFA 3G8DA 2E18A 5IW8A 3V4ZA 3J81k 4AKIA 1XQYA 1BVRA 1P7PA 2R6AA 1JPNA 1TUGA 2WT9A 4KX3A 5IAOA 3F4BA 4BNNA 4QO7A 4TV8A 5EYPA 2ETVA 4GAEA 2AE2A 4Q1BA 5CRIA 1MQ9A 1U0LA 2IZ7A 1P0QA 5HM6A 5K7SA 1E9AA 1EGHA 1AKWA 3FNBA 3F1KA 4LKRA 2UUAB 1KDRA 5GV7A 3SBXA 4NE9A 1BGXT 3C3AA 1I7DA 3L3BA 1D07A 4MYCA 4WLUA 1X3LA 1CJVC 1Q50A 1Y4DE 4C6TA 4HAIA 3ROGA 1M9NA 1KXZA 2K7ZA 3CKLA 3IEMA 1XD2A 2P69A 4QU9A 3BMCA 3JPWA 1RRKA 1Q95A 4IFIA 4H6WA 3PHHA 3EIUA 5CJ2A 3TLBA 2DUUA 1U8EA 1WNFA 3RHTA 3CZRA 5GP1A 3RUAA 4FB5A 2QVLA 1OI7A 1RXYA 2GD2A 3AJAA 3QM1A