2GCOB

Crystal structure of the human rhoc-gppnhp complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
192
structure length
182
Chain Sequence
HHSSGLVPIRKKLVIVGDGACGKTCLLIVFSKDQFPVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystal Structures Reveal Two Activated States for RhoC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Rho-related GTP-binding protein RhoC
total genus 63
structure length 182
sequence length 192
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gcoB01
2J46A 1QHGA 3GQBA 3SOPA 1W1WA 2YWHA 3MMPA 4KCGA 4BFUA 5FH9A 4JJKA 2X2EA 4CEHA 2VH5R 4JLMA 5BN4A 1II0A 2DBYA 3HDTA 4P4SB 2ZUDA 5JWHA 2WOOA 3K0CA 3EIHA 1H8EA 1C1YA 1ZVQA 4ESHA 2ZRIA 4FXPA 3ASYA 3BORA 4EPTA 3WP0A 1W5TA 2YNMA 3IQWA 3ZVLA 2QPTA 4Q7KA 2NO9A 2WKRA 4E5UA 2F3TA 2RHMA 4JBXA 1CF4A 1FP6A 2BJVA 3OIUA 4QNMA 3WYAA 2BWJA 4P32A 1EFRA 2P65A 2QPOA 3W90A 3LQQA 4DVGA 5BYJA 5KDOA 3CF0A 3O8BA 4B74A 5H8WA 4HATA 2C77A 1UBGA 4LHZA 2IC5A 3V00A 3THOA 1A4RA 5J4YA 1YU9A 2VSFA 4CT5A 4NZYA 3SC3A 1QF9A 1E1QD 1UEJA 2I1QA 2NGRA 4FN5A 2MSCB 4KYUA 3VFDA 4A8JA 3LW8A 2O8CA 1N6IA 3ZZUA 3Q3JB 3WBKA 1TX4B 4ZCLA 1P2TA 1F5NA 2H18A 4WXPA 1TQDA 2GEDA 4B44A 3L43A 4JL5A 3MWJA 5FL3A 1GAJA 2VF7A 1WE2A 4ITRC 2JDIA 3CH5A 1RRFA 2C9YA 4QXAA 1U0JA 3UPUA 2GEVA 1KI6B 2TMKA 2RB4A 4LBZA 4XVUA 3EG5A 3SI7A 1XEFA 2VYFA 1BOFA 1XTQA 2BIFA 1AGRA 3R7WB 2K5UA 5DI9A 4MKIA 2EWVA 2IYTA 1Z6YA 4UKDA 1LF0A 4IFBA 3NVAA 4HLUA 5DLQC 3EXAA 3EIQA 3FHTA 4M1TA 2IF0A 1HV8A 3DHWC 5JHHB 4M21A 1GILA 2OCYC 4PQYA 1GNQA 4QFMA 1T9HA 5DYIA 2W58A 3B85A 3FFBA 4TYQA 1SVKA 2QMOA 2G1KA 1WCV1 2RGEA 5TY0A 2QM7A 3C15C 2QEQA 4G5GA 4JLPA 3K9HA 4BPBA 4V02A 2WJJA 4XH9B 1P2SA 1YJ5A 1U8YA 2A5YB 5HTKA 4Q4AB 4KVAA 1OT3A 4PSKA 4O0MA 1GTVA 4PO8A 1RJ9A 1ODFA 4KBFA 3KQNA 5LB2A 2QBYB 1ZM4A 5GVRA 3KXKA 1XPRA 4Q21A 1BMFD 1UM8A 2REOA 5EXTA 2FSIA 2OLJA 2YYZA 3LLUA 2GESA 4LYFA 2I1VB 2QAGB 5ANRB 2PLRA 3MD0A 3AKDA 1NI3A 2ZI7A 1NG1A 3DKPA 3VX3A 2BMFA 2JLZA 1LVGA 1JPJA 1XU4A 4MQBA 3THXA 1XP8A 5B64A 2W6JD 4M22A 4OJKA 4LC1A 3V4RA 1FQKA 4MDEA 2ZI9A 5JMTA 2QG6A 2WKQA 3A1UA 3QG1A 5JEDA 1N3BA 3ASZA 4OK5A 4V0MA 3M6AA 5E4FA 5JJLA 1BMFA 4AURA 1FW6A 4BLSA 4M53A 2P3SA 5L3RA 4PX9A 2CNWA 2DCUA 4QOSA 2QQ0A 4RZ2A 3RVBA 2FX3A 4GPTA 4NCHA 1AGPA 4TMZA 1NL3A 4NONA 4DIEA 2ZS9A 4MGZR 1TEXA 4XD7D 1T0JB 4QJ3A 2OHFA 1P61B 1D8TA 2DY1A 5CIWA 3WMFA 1ZINA 2OZEA 1DADA 2KJQA 5SZJA 5KOYA 1X86B 1FX0A 3QF7A 4A6PA 3A4LA 3TMKA 3ZZTA 4IW3B 2JIZA 2H5EA 4IDPA 1GKUB 5FOVA 1R8SA 4ZKDA 2SHKA 2OSBA 2OILA 2E9SA 4K8OA 3NH9A 5C46F 3D6TB 2AHOA 3RC8A 1TU4A 4B43A 5JEEA 2EW1A 2NOAA 2R44A 3BD9A 2QE7D 3R8FA 4Q00A 3GLGA 4BFVA 3UK6A 3BJIC 1K5DA 1XJQA 2ODBA 4RKFA 1DE0A 3M1IA 5E95A 4OI1A 1LY1A 5A5GA 3G0HA 2ZYTX 3OIWA 3P4YA 1ZUIA 2ZM5A 1M34E 4B3BA 5KPJA 1P9WA 2C03A 2QGZA 3QBVA 4UNRA 3CR7A 2NTYC 1U9IC 3K0AA 3Q7PA 4RD4A 3GLIA 5A4JA 1MO5A 2VHJA 4OHXA 4AKEA 4V03A 2PT5A 1TADA 3H1TA 3JZMA 1CP2A 1BYIA 3WXMA 2JLRA 2GJAA 3CF2A 3ZD6A 4D0GA 3X1ZA 2R6AA 4KSBA 4PAOA 3J81k 3UANA 3U5ZB 2EFGA 2V54A 2ANBA 1OIWA 3KQLA 1E3MA 3KUDA 2WICA 1CJKC 1G4AE 2VHUA 4QBFA 4YLGA 4BZXA 1I2DA 1KI1A 1F48A 3QKTA 4US2R 4ARZB 4JLDA 2JLXA 1PV4A 4HDOB 3HWSA 2WBLC 2WWHA 1OXUA 3CF6R 3K0FA 1Z3IX 3C5HA 5JJKA 2ZRBA 3LFUA 3F3YA 3GCGA 1JAHA 3FYHA 1SVSA 4HUQB 1LFDB 1YRAA 1G7TA 2PMKA 3CLVA 3CPEA 1E4YA 3P26A 3I4LA 2Z4SA 3UG7A 1DVRA 3QPVA 5F2EA 2A5GA 2H57A 3GLGE 2IF2A 1G8YA 2IHYA 3EA0A 1P72A 3NEYA 2CMKA 1E2HA 3M0EA 4KLNA 1QHYA 1MH1A 3OAAA 4DDTA 3QI2A 2OEPA 4LDJA 2B8WA 821PA 2IXEA 1N5JA 1TTTA 1XPUA 4EFLA 3PCRB 1XF9A 1WBBA 4BECA 3HP1A 1D9XA 3L0SA 1VCIA 1OF1A 2ERXA 1R0YA 2V55B 4RKEA 2OBMA 1YR6A 3MLEA 1UJ2A 2DHRA 2XTMA 1AZTA 1LF5A 4MRSA 3RAPR 2FV8A 3OHMA 3AKEA 3AKCA 4KJZA 4Q1EA 1A5TA 2ERYA 4TWZA 1GUAA 1SXJE 4BRUA 4WOPA 4AYWA 4EQ6B 4Q03A 4GNKA 1JBKA 1AZSC 1OXSC 2KE5A 1AA9A 2EFEB 2FJUA 3LWNA 3WY9A 5FOUA 4C4PA 1BH2A 1KAGA 1K6MA 1NLYA 3RLFA 2HYDA 1P3JA 3TAHA 5CYOA 1KTVA 3AVXA 2ZYWX 2XZOA 2RAPA 1OXVA 4RY2A 4V0ME 3C5CA 4CZ2A 2CVHA 2Q0HA 3TW8B 2IYSA 3X1WA 1AN0A 2WVJA 2GILA 3FHOA 1G21E 3KUCA 1S1CA 3TJZA 2HDNB 1NVVQ 3EC1A 1NIJA 5K8IA 3I72A 4I1VA 4A0RA 3VNUA 2ZI4A 2QROA 2VHTA 4Q1AA 5FOXA 1N6NA 1NMYA 3C8UA 3GFTA 1E2FA 4PZLA 4BE7B 2C9OA 2VP0A 2ZRJA 3AF1A 2Q9BA 4DLSA 5BN5A 2AK2A 2JAQA 1IHUA 1Y63A 2IS6A 2WPDD 3HU1A 2ZETA 1MKYA 4Q1CA 4DB4A 4GFDA 4EPRA 5JI3E 4P4TA 1E79D 4MDFA 3IGFA 3U7EB 1XWIA 1XTKA 2ZE8A 4NE2A 5EP3A 4LI0A 1KK3A 2GEUA 4EUNA 4P4UA 2IA5A 2RGXA 1UBCA 4XSGA 5JSZB 1DAMA 1D9ZA 2WWGA 1SKYE 3DPUA 4TQ9A 2WJGA 1KO4A 1XRJA 1E4VA 2GCOB 4A0GA 4JS0A 2FOLA 4D81A 4ZIRA 1KK2A 3ADCA 3X1DA 4TL6A 2YC2C 1V43A 3LY5A 4DSUA 4GSYA 1KK0A 3FKSA 3H86A 1AJEA 1KY2A 3LX8A 5K8LA 1RZ3A 2BM0A 4P4SA 5F98A 4KV9A 2D62A 3FDIA 4OQXA 2VHCA 2ZRDA 2ZE7A 1T5IA 2EFCB 1Y3AA 4RD2A 2DR3A 1DAFA 1P75A 2Q6TA 3PEYA 4OHYA 4RCZA 4KYIB 3GFPA 4CYMA 1W4RA 1EK0A 1QHHA 3HR7A 2F1IA 2ZSFA 2YOHA 4URVR 3IBGA 2IS2A 2B7CA 5A0FA 5EXXA 1W5SA 4B2IA 2HLDD 3C41J 1CS4C 1S2MA 3QVUA 5FUWA 3TVTA 3TSOA 1PJRA 1G7SA 3ZLJA 5C2JB 4Q02A 4Q18A 5CITA 1XDBA 2CE2X 2ZI5A 2XXAB 1P6XA 1RFLA 2EFDB 3T12A 2Y8EA 3BERA 5KSZA 4BFTA 3EASA 1ZU5A 1G9XA 2GZHA 2W6ID 5L3SA 1FFHA 4BFSA 1II8A 2R6CA 3B78A 2HCBA 2R9VA 2FFAA 2XGJA 3RSOA 4RD1A 4DLRA 4HB4A 1RW4A 4M2LA 3TSWA 1P9NA 4QHYA 4A8JB 4XWKA 5TB5A 4PSVA 2VSOA 5FPHA 1G7RA 1JR3A 1XTJA 1QBKC 3AP1A 2VIIA 3KJEA 2OXRA 2GXAA 5F9HA 5BXQC 1QG2A 2YOGA 2AD5A 4NCNA 1KI8A 3TK1A 3ZGXA 3C4JA 4M9QA 1WDTA 1SKYB 4HB0A 1Z83A 5E7MA 2DFKB 2GK7A 3SYLA 1LW7A 1KMHB 3AVYA 1KKLA 2QT0A 1TQ4A 4RZUA 3TAUA 5EXSA 4YMVA 3L0OA 1E9CA 4W5HA 3PFIA 1E2MA 3BC1A 4F7WA 4I1OA 2BCJQ 5C4GB 4QGHA 1OSNA 4V0KA 1G4UR 3A36A 1VYTA 1MABB 2AD1A 4LV5B 1US8A 4URUR 4HDCA 2MMGA 2FG5A 3EAQA 2A9KA 1HH4A 3N2IA 1CJVC 3A1SA 3T06B 1GZSA 3AUXA 3QENA 3ZIAA 2ZRHA 2ASEA 2HT6A 4U00A 4WW0A 1YQTA 1OKKD 4E09A 1SXJD 1OHHA 1U94A 2A5DA 4TTQA 3W5IA 4I1UA 1N0WA 4HYYA 1JJVA 2A3RA 1HE8B 1OXXK 1U9IA 2WSSD 2GF9A 3K53A 4HLDA 2OAP1 2OT3B 4OHVA 4B2PA 2VP5A 4FMDB 1SZPA 3SHFA 3FB4A 1IBRA 5TMPA 4NYJR 1Z28A 3BBPA 4JT4A 5HCNA 4Z51A 1H8ED 4N3NA 2QNRA 4TYNA 2OE2A 4B73A 3THXB 3RDPA 3ZVRA 4DLZA 4OK3A 2VP6A 3DVLA 1SXJB 2QI9C 3NBXX 2CEAA 1KO7A 3QBTA 3TR0A 1M7HA 2PCLA 4DLYA 2C8VA 2LKDA 3NWJA 5AJWA 4C0JA 1DBSA 3A58B 4Y0VA 3W34A 2IS1A 3QJYA 3MJHA 1V5WA 4LYHA 1XEWY 1IN7A 3PEWA 3EW9A 1W47A 4IOMA 4LHWA 3REGA 2VP9A 1G1MA 5DHAA 1VG9B 4MGKR 4Q66C 3IHLA 3DEFA 4QHTA 1N6KA 2JLYA 2JATA 1L8QA 3ND9A 4CGZA 5CDFA 5FR2A 1EFHA 4DLTA 4X8HA 3IO3A 1G8PA 2FFQA 3IBYA 2PCJA 2KBFA 1IN5A 4KHZA 3VR5A 1D2MA 2G83A 2RGNC 4TYWA 5AUNB 2VSXA 1GP2A 2WHXA 4XOIA 4AYTA 3B9PA 3AF2A 1DAIA 1NLZA 1J7KA 1DTSA 5SZHB 4MYTA 1XTSA 4EPWA 1OFHA 3CBQA 2QZ4A 3FE2A 1JI0A 1GFIA 1UKVY 1RYFA 1U2RA 3B6EA 3RS5A 2OFXA 3VKWA 4CEHB 4O3MA 2Q3HA 2YJTD 1ZD8A 1J8MF 2O8FA 1S9DA 1H65A 1YZNA 4ZI2A 4IDNA 4LX0A 3FHCB 3KKOA 1TF2A 2G0NA 1ZBDA 3U3MA 1VG8A 4YC7A 3EPKA 1Q12A 3SBDA 2ORIA 5FOTA 3KB1A 4NKRA 5HE8A 4JT2A 2HJGA 3ZJYA 3DOFA 4M8NE 1CR0A 3KB2A 2KI5A 4LCBA 2GAAA 5IT5A 3NIBA 5FTMA 4JSYA 3KJIA 4LJYA 2QA5A 4A82A 1RE0A 2ZAOA 1BKDR 2NZJA 4K46A 3ZQ6A 5CB6A 3NDBB 1D2NA 2J7PA 3U6BA 3PUYA 2P5SA 2A2ZA 2C2HA 4UJ5A 1KO1A 1NG9A 2OBLA 1KIMA 4B34A 1KSHA 3CR8A 4YMWA 1VCMA 1XJCA 4B33A 2L0XA 4Q4HB 4YDHB 1X1RA 2R65A 1FUUA 3QVVA 4Z8YA 4A4DA 1WMSA 2F7SA 4A2QA 2HUPA 1XMVA 3CRQA 1QHXA 2E87A 2J7PD 3LAWA 2QUZA 3GJ3A 1Q22A 1E9RA 5FUYA 4R7ZA 1A7JA 1G16A 1KJWA 2GJKA 4HSEA 2ODWA 1A1VA 1Z6XA 1N2CE 1KI6A 4LY6A 4Q48A 3VHXA 4G3XA 4M1OA 5ELXA 3ETLA 2ZRFA 1NBME 2NPIA 4XVRA 2V7QD 1GNPA 2CL7X 4HB3A 1R0ZA 4QGAA 1TL7C 1ZM7A 3SQWA 2R6DA 2GZDA 1MRNA 3G5UA 4W5JA 4IXNA 3L2OB 3VR1A 1E9AA 1NRJB 5TXGA 2A30A 3GLHE 1ZCBA 2EU8A 1NBMD 4Q9JA 4IJMA 5G3YA 2QGNA 1F60A 5DO9A 3EPHA 2CJWA 1MOZA 1OH6A 2F6RA 2ZE6A 3AB3A 3NTUA 3KXLA 3ICEA 1JQLB 1YR9A 1W46A 2GA8A 4EQ6A 1OFIA 3WNCA 4QGGA 3I8SA 4ZO4A 2KBEA 2LWIA 4R9UC 4MH0R 4IOLA 2GJSA 2D2EA 3H4MA 3EPJA 3M4YA 5J5CA 4M4SA 1YZUA 3HU2A 2KWIA 5DI3A 5AUQA 3TLXA 2H16A 4D4JA 1SGWA 1ZM2A 2OXCA 1LS1A 5H68A 1TQ2A 3TUJC 2QBYA 2EVWX 2D74A 1IY1A 2XNSA 2YWGA 1CJMA 2IYZA 3F0TA 3K9LA 1RRGA 3P32A 3N2EA 2X19A 4Z1MA 1PLLA 5J4VA 2QAGA 2WJYA 2CNWD 4XSHA 3I61A 2J0SA 1N5LA 1B0UA 4IOJA 5IHPA 4F4CA 4PHGA 3QPWA 5CK5A 4XD7A 3S1AA 4YXWA 5FTKA 4HUTA 2BMEA 5DH9A 1HT2E 5F3WB 1DG3A 1Z0JA 1P9RA 2BVNA 4MKHA 4Q4JA 3C7KA 2RGCA 1E69A 1NJFA 2FEOA 3MWYW 3P20A 2C04A 3TW4A 4BGDA 4F91B 1FPMA 3BIFA 2QAGC 3DKVA 1DG1G 2NG1A 1GRNA 2ODNA 3AVOA 1XBTA 2IYRA 2QORA 3D31A 2ZJOA 5JSZA 4F4JA 4PQFA 1G19A 2OV2A 2Z4RA 4LBWA 3W6PA 3VX4A 1VHLA 4DLVA 4KFTA 1QHNA 4V0LA 2QE7A 5CJ2A 3CX8A 4ZIRB 2PZEA 3HPQA 1F2TA 5TDHA 1KSFX 4QBHA 1WB9A 3BGWA 4TMWA 4EIWA 4MUBA 3RANA 4GMDA 3KQUA 2ZR7A 1KI4A 1OFTA 2IXFA 1SULA 2ZS8A 3LBNA 3A1WA 4NCJA 4XTCS 4XIGS 1Q3HA 3MRSA 2H1LA 3OAAD 2ZJZA 4CEJB 1G6HA 3ND8A 4UNPA 2G0TA 3PG5A 2OAQ1 1YZKA 4F92B 1SXJC 1QHHB 4ZCIA 3IQXA 5JLJA 2QN6A 2XTZA 1EESA 1QHSA 4JVNA 3ZQJA 2ZREA 1KK1A 5DGXA 5CK4A 2XOKD 4TLEA 1R8QA 2AWNA 3OEHD 4PC6A 2J0VA 1BO6A 1W0JA 1Z07A 1G17A 4AG5A 3K0AB 1UFQA 1UKYA 5G40A 1Z8FA 2DFTA 3TSZA 1W0KA 5KPDA 4AC9A 1KI2A 4OI0A 1IM2A 1PUIA 2FMXA 4Q47A 1Q1QA 1U8ZA 2YHSA 2DB3A 4J0QA 5M04A 4EFMA 2R6GA 3T34A 2IUUA 1KOFA 1NNEA 1E1RD 3AF4A 3DDCA 1W48A 3OEHA 3TRFA 3VU9A 2EQBA 3QXCA 2IBMA 3AKYA 5KTYA 4H1VA 3B60A 4FINA 2BEKA 3H0KA 4XTRA 2ZPTX 1ZUNB 2QU8A 4BFZA 1DARA 4Q1FA 5GJVC 1PUJA 3VR3A 4EAQA 3MJRA 3VR6A 3T1QA 1VHTA 2G6BA 1ETUA 4LK2A 2VF8A 1W36B 3W3ZB 1G18A 4DCNA 3THYA 1E2LA 4B47A 1KDOA 2D7CA 4P0TA 2C96A 3BFVA 3MWKA 3GJ8A 2YWEA 4PPNA 2RKOA 3ADDA 4WAUA 3RS7A 4IDHA 2P5TB 3GEHA 3AGQA 3UKDA 3UMSA 4MYCA 3ECCA 1ZNXA 1Q0UA 3BH0A 2A5JA 4GMXA 4C0AC 3AF0A 3QUSA 1ZD1A 2MMCA 3Q8XB 2G3YA 2QQEA 1AS3A 1U0LA 3SYKA 1PVOA 1Q1ZA 1R5BA 3V9PA 1EGAA 3EX7C 1X8LA 4FMCF 3ZD7A 3A4NA 1XFAA 2GZAA 2WJVA 4MKFA 4E03A 4A92A 3FPAA 3IUYA 4GL2A 4NPHA 2AKYA 1RKBA 1G8HA 4BFWA 4RD3A 1EFCA 5B57C 3SQXA 2XEXA 5HZKA 4US1R 3LX5A 1SKQA 1J8YF 4MUAA 3RWMB 3FKSD 3AM1A 1PZNA 4AKIA 1Z08A 4BLQA 4KFUA 3CNOA 4L16A 1R5NA 3BH6A 3TQCA 1A2BA 3VMFA 3KKQA 2WPDA 3NC1C 4GDFA 4TMVA 5HZHA 2Q3FA 2YZ2A 4LRWA 3W8NA 4DWJA 3T35A 2R8RA 1X3SA 3W6OA 3A1TA 4ZV4A 4QJ4A 4G01B 3BE4A 1FMJA 2G77B 4B76A 2OG2A 2IYQA 2O8DB 5JBQA 4Y0AA 2J3EA 2RH5A 4BLTA 3NC0C 2IEYA 1ZRHA 221PA 4FMCB 3Q85A 4LPKA 4EJSB 2AWOA 2XNDA 1WRBA 4QG7A 1U81A 2YKGA 1E9FA 2QTVB 4BLOA 4EPYA 1N5IA 3ZVNA 1XZQA 4MYUA 3AUYA 3THWB 2QSYA 4HAVA 2LKCA 3W6NA 2Z83A 4M1SA 3D3QA 1KO5A 3TE6A 1SVWA 5DN6D 3KZ1E 3LXXA 5B30A 3CONA 4URXR 2F1RA 3UIEA 3UG6A 1VMAA 1XD2A 5DISB 4A0FA 2UVQA 2ZS7A 3IPXA 4WBSA 3LVRE 2QMHA 3AP3A 1XCMA 5EJEA 4HAXA 2ZJ5A 1JXMA 1JR3D 4BWYA 1E0JA 4K81B 2YC4C 4B3XA 4ZDKA 3PEVA 2V1XA 4OQMA 1JALA 1OIXA 2BMJA 2OLKA 2WJHA 3GLFB 1W44A 4HLUC 2PEZA 4F93B 1ANKA 2CLDX 2X8AA 4MGYR 3BAFA 2FFBA 1G41A 1OFUX 3D7MA 3SR0A 1CR1A 3HR8A 3K1JA 2F43A 4DC9A 5AUPB 4C3ZA 5B58C 2ZJYA 3VNVA 2CLSA 3NHAA 2YWFA 2WWWA 4MKGA 1AIPA 2XAUA 3EA5A 3RWOA 5FFMA 4B75A 5FPKA 5GVSA 4U02A 2B6HA 2AFHE 1OYWA 1YHNA 1DPFA 1XNJA 1P73A 3K8YA 1E2IA 4TTPA 4CT4B 3FMPB 1E94E 4A8JC 3VQTA 1XEWX 4L8GA 3VR4A 2ZU6A 4WIAA 5HE9A 3CRRA 3EC2A 3SFZA 2ECKA 2XXAA 2JA1A 3ICQB 1S3GA 2RCNA 4D2IA 1JB1A 5FL7D 2HXSA 5AJXA 2N46A 2RGDA 2W2VA 4DIDA 1II8B 2CHGA 3SU8A 4GP6A 3MFYA 4URZR 1OIVA 2AK3A 5CDFE 3TBKA 4TT3D 4XWOA 5C4MA 2F3RA 3CNNA 5SZKB 4LC0A 4DBLC 2C95A 4YMTA 5JCZA 1J70A 1G8FA 1RRCA 2HXYA 1COWD 2V8OA 1XTIA 3GEIA 1OV4A 2AN9A 5LD2B 4QL3A 4G5SA 5EP2A 5FL7A 5CM9C 4TZ0A 4G0NA 2D06A 4HDQB 2GDJA 2QP3A 4RZXA 4C2TA 1E0KA 3GLIE 1D5CA 1M7BA 3B9QA 1ZM9A 2ORWA 4DLUA 4DSOA 2VA8A 3K0CC 5EE0A 4GI7A 5KSOA 5EQTA 1HURA 4IVPA 4KLZA 3FGNA 3SBEA 2XX3A 1FTNA 3IDQA 4OHWA 4KAXA 4PPGA 3DOEA 4Q7JB 1Z0KA 2XZPA 5IF9A 2GNOA 4WA7A 2ZI6A 2CJWB 1W2HA 1HQCA 2PX0A 1KSGA 3L82B 3VR2A 1JEEA 2WSSA 4JZKA 3ZYCA 1KJZA 5GADl 3BWDD 4M1MA 3RS2A 5AK0A 4EDHA 3W5JA 1I4LD 1UF9A 2J5XA 2MSDB 3I32A 3JZAA 5EE1A 1EFRD 2CHQA 3FKQA 3MGCA 3OFNA 4B3FX 1HEIA 2H17A 1SVOA 1J2JA 2FZLA 1E6CA 3GFOA 3QXSA 1UKZA 5DI3B 1UADA 4C7OB 5E7JA 5JCPA 2BKEA 1F2UA 3TH5A 3U61B 2BV3A 4Q9HA 1NMZA 2GF0A 4B2LA 2QTFA 3LXRA 3SEAA 2IL1A 4PHFA 3CKLA 4OBEA 4KU4A 2GETA 4GRAA 2XZLA 2UZ3A 3OFND 3OE7D 3SJZA 1E32A 2JJ8A 1U90A 1OE0A 2X2FA 3NBYC 4DT1A 5KHOC 2XJ9A 3RS4A 1F3OA 4PFSA 1IJEA 1P62B 1KDPA 2ZYUX 5LDDC 2OFWA 3PXGA 3PV0A 1JAIA 2JDID 2X77A 2IYXA 1Z22A 5EUMA 1YVDA 2WIAA 4LSGA 4IEIA 1E2KA 1ZIPA 3B5JA 4Q4JB 5CJPA 1ZAKA 4KFSA 2CVFA 1R0XA 1UBEA 3MCAA 4PSAA 5LBIA 4RFSA 5J4LA 3TNFA 3X1YA 3IIMA 3HYRA 5GJWC 3CZPA 5TVKA 3T15A 4Q9LA 4ZDIA 3Q5DA 4BZQA 5EZ5A 1Z63A 2QENA 2FNAA 5BWMA 3ADBA 5LPNA 4PZZA 2VL7A 2F1JA 3BRWD 3QF4B 2RGNA 4ACAA 3GPLA 1F2TB 2OUKA 3AQ4A 3GJ0A 1G3RA 1YKSA 1A2KC 4AK9A 4BFXA 4D0NA 1H8HD 4MRNA 4NBSA 2ZR9A 4AKHA 2ZJ2A 4PC7A 1X1SA 4AG6A 5F9FA 3KFXA 4YMSA 3PJRA 3U3RA 1L4UA 3RRMA 2CK3D 4B3GA 1T3LA 1MT0A 5AJZA 4CEIA 2QRNA 4UXHA 4DB2A 3HJNA 2RGAA 4JLVA 3R9IA 5D3MA 4OI2A 3UATA 3O47A 2VPPA 1GITA 1VG1A 4II7A 1JR6A 4TSFD 2HJVA 4Q19A 1IXSB 2J7KA 1Z5ZA 1R6BX 2WAXA 3LVQE 5JS7A 1ZYUA 3HU3A 2O8FB 4OK6A 4PPFA 1RPZA 3B82A 3KTAA 3N5CA 1ZP6A 3B2EA 2AFIE 4Q4LA 3LO5A 1YZLA 3I62A 4JBWA 2QMUA 2JCSA 2JLSA 4PQRA 2GWHA 3E5HA 3NDPA 2FN4A 4HB2A 2W2XA 1W36C 4TSFA 2CCJA 4QBGB 1UAAA 5FBQB 4TMKA 3RC3A 1S96A 1U98A 2NZ8A 2P67A 4JIMA 4LBVA 4EKDA 2BMDA 4DLXA 2IX3A 4P33A 4A6XA 1FL9A 2ZR0A 1W4AA 5CYPA 5H70A 5FPTA 4JMPA 3VU9B 2CLCX 5H1YA 2ZUCA 3NH6A 4W7SA 4BFYA 4IVQA 3A1VA 1G5RA 1E2JA 2J87A 2ZRNA 4Q4HA 4Z1MD 2O52A 2IUSA 4ASUD 1TF7A 3AVUA 1ZM3A 1LS6A 3QQ5A 2Z0MA 3EZFA 3Q72A 3U7HB 3LA6A 2DWOA 1RVDA 2JIZD 2W6JA 1C4OA 4JLKA 3T61A 2A78A 2WWFA 4CDGA 1P4SA 2C78A 5FTJA 2NMVA 1G3MA 1M2OB 1KKMA 1P60A 4TLAA 1GRRA 2CBZA 2FH5B 5JWOA 1GRQA 4UXJA 1FTSA 4PHTA 2OBNA 3A8TA 1OXTA 2PT7A 3L8YA 1D6JA 3PITA 5FI0B 4A2PA 4D80A 3RRYA 2ATVA 1ONBA 2HEIA 1E2PA 2FSGA 3HYTA 3I5XA 5KDDA 2ANCA 3LQRA 4IVRA 1QG4A 2GBLC 2C98A 3DMDA 4QNRA 4JLAA 2QM8A 4NMMA 3U4QB 1LB1B 2HT1A 1HE1C 1XEXB 4DCSA 4IXMA 3CH4B 1CLUA 1ZNZA 3EZ7A 4JLJA 1NVXQ 2CCGA 1KY3A 1SVIA 1VKJA 1M7GA 3RS0A 2OESA 3NXSA 1YZTA 2QAJA 4L4UA 1OPXA 4IDOA 3MWLA 1KMQA 2GJ9A 2X1VA 4RD6A 3BK7A 4H1UA 3QIAA 4S2EA 4E07A 2PJRA 4Q1BA 1XD9A 4R71A 2EYQA 2FPKA 3PENA 5KSPA 3GJ7A 5AJYA 3H84A 5L3VA 4NYIR 4DSTA 1VECA 3AV0B 4ZDJA 2O8BA 4LJ5A 1VG0B 2P2LA 4NYMQ 4LYAA 4CIDA 4LJ4A 4GZLA 2O8DA 3WP1B 1XCPA 5DHFA 5C18A 1ELOA 3K09A 2HYIC 1SVLA 3LNCA 1W0JD 1HUQA 3QXHA 3S1AB 1GL7A 4JL8A 1OLOA 4TMXA 1K5GA 1R4AA 5E7IA 1G5TA 2AXNA 2W0SA 2VO1A 4GBMA 3THWA 4JLBA 3E1SA 1VPLA 3GLHB 3BXZA 3QE0A 3WYFA 1G3IA 1O3YA 4WXRA 4DDVA 2IEZA 3LD9A 3DM5A 2RHDA 2XSZD 3LV8A 1JR3E 4TLBA 1W2GA 1XD8A 3VKGA 4UXIA 4WZAE 4O2LA 3CRW1 4LV6A 1Z0AA 5FOWA 1QRAA 2V6IA 1VYUA 2PL3A 4FWIB 4X8MA 3A6PC 3DZ8A 3QY0A 3QXJA 4LJ8A 3QXXA 4DDUA 1U0HC 2W2TA 4TLDA 3GJ4A 5FPSA 1FOEB 4EJSC 2ZYVX 1XXHB 2XOKA 2BDTA 3REFA 4DEXA 1I4TD 1YZQA 3T1VA 1W4CA 1S9HA 2F43B 2JJ1D 4LJ7A 2RMKA 4BLRA 4WZ6A 4DEYA 1O87A 3CIOA 4CEJA 2QPAA 2RGGA 4YQFA 1N0UA 2J0UB 3IHWA 4JJZA 3RABA 1X8JA 4ON9A 621PA 1GKIA 1ZW6A 1LTQA 1E9EA 2ZE5A 3ADKA 2WMNB 1U8AA 4D26A 2VP4A 2WJIA 1IY0A 4AIIA 1EG7A 1NN3A 1HTWA 1Q3TA 2Z5FA 4OI4A 5AJVB 3U7FB 1KI7A 4KBGA 2PBRA 3NBFA 1X6VA 2JJ1A 3CRMA 4H9GA 1DO0A 4US0R 1VYVA 1T3SA 3FMFA 1WA5A 3OESA 3LRPA 2N42A 2ZRGA 1E2GA 4LOAA 2ZXUA 1YRBA 1RC8A 4B35A 2H92A 2IHBA 4HZUA 3QSYA 1G5PA 2GTPA 5IRCD 2H8KA 1MO3A 3BB4A 4NTZA 3PR1A 3K70C 1G3QA 4Q7MB 3SNHA 2GK6A 3NKVA 2QTHA 4X8LA 1U99A 1Z0IA 3QEOA 1IONA 2XB2A 4D4LA 1OH5A 3KDSE 1NY6A 3DM9B 2ZSAA 1YR7A 1OB5A 4D6PA 3TUZC 1TQ6A 2V9PA 4OQNA 3SHWA 5KNBA 5KO2A 1AS2A 4RZ3A 5BQ5A 2F9MA 1XX6A 1KJYA 4OJQA 5JZVA 3THYB 3V4FA 2BKUA 1DOAA 2WV9A 1LV7A 4TYYA 4RCYA 5EE3A 3P4XA 4DSNA 4ILEA 2AL7A 2IS4A 2ZSDA 3A37A 2WM9B 1AM4D 2J1LA 3AF3A 3JVVA 4RD0A 1ZC4A 2O0JA 3G82C 1XB2A 4HAWA 3EPLA 1UDXA 3IO5A 4FCWA 3GEEA 5L3QA 5DSZA 3MAAC 1OW3B 2BJWA 2W83A 1FZQA 4GOXA 4EPVA 1NN1A 2YINC 3K9GA 3TIFA 4CF7A 2NPFA 4Q9IA 3QOFA 1N25A 1Z0FA 4TQUS 2HLDA 6Q21A 1OB2A 3L8ZA 1JQJC 4N0DA 1KDTA 3I1FA 3FFAA 4JVLA 4F4IA 3TGPA 2C99A 3K0SA 1G64A 1Q1EA 1XXHE 3IKJA 2JJ2D 1ESNA 2ZIAA 4NYMR 5FBRB 4RJLA 4XWAA 4AD8A 1FUKA 3TVDA 1B23P 2FE4A 4P3YA 1JPNA 1CJUC 1Z6TA 4ESVA 4UQOA 3T5DA 1ZUHA 4L5BA 1FP7A 3R9XA 2GRJA 1MV5A 4HI0E 3LBIA 2IWRA 3B13B 5JJIA 5KUTA 4DT1B 2XNDD 3KJGA 2JJ2A 1NN0A 4A1FA 2GCNA 1F6BA 4JYCA 3SFVA 4URWR 1A82A 1HY3A 3PEUA 1NSFA 3U7GA 5TV2A 2ODEA 3U60B 1BYUA 1CKEA 2BBSA 1QHIA 2ZAMA 4N0EA 2VTKA 3PUZA 2O8EB 2ZJBA 4TMTA 4D25A 1Z06A 4HEJA 3U2QA 2FDCA 2FF7A 4EJSA 4BLPA 1GSIA 3E2IA 2I3BA 4O2RA 4A36A 1Z29A 1LNZA 1FQJA 4UNQA 1Z2CA 4A9AA 3EWSA 4N1AA 2J0QA 3FTQA 3PUWA 4RVCA 2JASA 4PXAA 3QKRA 5FBVB 5EE9A 3QF4A 1KI3A 5GJBA 4G5OA 1XD2B 4JLOA 2ZI3A 2LCFA 4Q9KA 1G6OA 2PZFA 2UKDA 3ZIAD 5D3QA 1COWA 1UKEA 4L15A 2GXQA 4MRRA 2J59A 4PAMA 5CLLA 2DYKA 2ZRAA 2D3WA 1EX6A 4OL0A 4DCUA 4HAUA 2O0HA 1C9KA 1GWNA 1QVAA 4JKIA 5D3MB 3GLFA 2FGJA 1J90A 1ZIOA 3RS3A 3UMFA 4A2WA 2ZRLA 1M1YE 3X1XA 2OO7A 3K09C 4MA4A 1G8GA 3WRXC 3ZS9A 3RSLA 1IN8A 2EYUA 5UKDA 3B8HA 4DXAA 5KNCA 3KTAB 1E2DA 3TUIC 2C5LA 3I92A 4UNNA 2GHIA 1VTKA 4PR0A 1L7VC 4JVSB 4PC3A 5HKKA 1E96A 3PUXA 5LB4A 4AY2A 4B32A 2VLIA 1CJTC 5FPYA 5LD2C 4FMBB 1KNXA 2ZVPX 3EARA 2ZU0C 1HA3A 2AXPA 1CXZA 2IYLD 4NDZA 3AVTA 1CEEA 2J41A 3Q7QA 1KHTA 3SJBA 5FUXA 3CM0A 1GL9B 1UEIA 1GG2A 4JKYA 3O8RA 1DELA 1KNQA 3BH7A 5FR1A 3VAAA 3B1WA 1N0VC 1RIFA 5DE3A 1OKKA 3GP8A 4NYJQ 5IDVA 5HCIA 3D8BA 1FNNA 1GL6A 2Q9CA 4LUCA 3BOSA 2OM2A 5JRZA 2ZEJA 2GVZC 2JLVA 1AQYA 4ZKEA 5KYKA 3AVVA 3VKHA 3B1YA 1T3HA 4M9ZA 1GVNB 1Q1BA 2KSQA 3CWQA 3OEEA 3SE0A 1XPOA 4QHSA 3CWZA 4BEJA 5DNYB 2BHRA 2O8CB 4PANA 2V3CC 4TN1A 1NKSA 2WWXA 4QKQA 3GJ6A 8OHMA 2P6RA 2D7DA 4NL4H 3W3AA 3RRNA 5BN3A 4NHOA 2DFLA 1MRSA 3WRYC 3QNUA 4ZDWA 2IYVA 3P27A 3CNLA 3UMRA 3B1VA 2IK8A 5G41A 1CTQA 3OEED 2WIBA 421PA 5K8TA 3DMNA 5SZIA 3R7WA 1E1QA 4IOKA 3JVUA 2D4HA 3PIRA 4KO8A 3BB3A 1PLKA 1N6LA 1KSJA 2OCBA 4OKSA 4TL8A 3K9NA 1GDDA 4W5WA 2AKAB 4TYPA 2ZQ5A 3WHKA 4LJAA 1XMSA 4POAA 2B8TA 1EFTA 2F9LA 4BZPA 4JL6A 5FOSA 4FI3C 3DO6A 4L9SA 3WNDA 1IOZA 5JECA 4DCTA 3CPJB 2O5VA 3U3OA 1EWRA 1Q57A 2ZJAA 3X2SA 2DWPA 1XEXA 2FFHA 2IYYA 3BFKA 3UWOA 121PA 3LLMA 1WP9A 3OE7A 4HLCA 1NF3A 5CM8B 5B2ZA 3TQFA 2WTUA 4Q4AA 2AX4A 1NN5A 3QEJA 4C7OA 3KKMA 3VTKA 4LYJA 1F2UB 3OF5A 2BEJA 2J9RA 2QL6A 4HAYA 4WVFA 3WMGA 1CRQA 5CIQA 1E99A 1OJLA 2REBA 4GOKA 1CRPA 3B7GA 2YVUA 4FCVA 1SQ5A 1WQ1R 3U44B 1KO8A 3PVSA 1ESMA 2IXGA 4PHHA 2HF9A 3R8CA 4D0LB 1YR8A 1JECA 3L0PA 1MO4A 4KFRA 4U5XA 2BC9A 2H7VA 4B48A 4Z54A 4YDSA 1DO2A 1N5KA 3Q9LA 4LJ9A 3GD7A 4KSCA 1N6RA 4R98A 4OYHA 1K8RA 1IAQA 2CXXA 4I81A 2IYWA 5AR1A 3C14C 4LHXA 1S3SA 1GKYA 4NCIA 1JJ7A 2JLQA 3CO5A 1ZU4A 2XB4A 4XJXA 1T5LA 2FSFA 2F1HA 2QT1A 2VEDA 4JVMA 2WMOB 4RFSB 3RNLA 3R9WA 2VHQA 1E9SA 1H8HA 1SVMA 1JXOA 4AKGA 4L9WA 1Q20A 1ZNWA 4FW9A 2ZSEA 1NBMA 1JEDA 1Q44A 2CK3A 1MR3F 1HT1E 1TEVA 1WF3A 5C1BA 1G291 2WKPA 4D82A 5DIFA 1YE8A 4PC2A 1AKEA 2REXB 1X8KA 4HZIA 3K70B 4ASUA 1TNDA 3F8TA 1HQYE 1VCNA 4PO9A 3KQHA 1VCOA 2CCKA 1Z0DA 5J4KA 1P7CA 2WOJA 4M0LA 2GXUA 3QKSA 3DL0A 1P5ZB 4MRVA 1R0WA 3EZ2A 1XMIA 4CVNA 4U7DA 4JYBA 1CIPA 2E1RA 2NO6A 4RSGA 3FMOB 4CEIB 3U6KA 4DCVA 3AGPA 3AP2A 2O0KA 1NVUQ 3CB4A 1CULC 3ZS8A 4AI6A 2ZRMA 3GLGB 2V7QA 3EZ6A 3FOZA 3CX6A 3SYNA 2IWHA 4MGIR 3LW7A 4O25A 4NP6A 3I3SR 1KI9A 2IT1A 2PZGA 1T4GA 2R2AA 4Q5IA 3SJCA 5JWRA 5EZ6B 5EXPA 4ZPXA 3I5YA 4G5QA 2FWRA 2QY9A 2CE7A 4M1KA 3WHLA 2ONKA 3GLIB 2B21A 4E22A 4Q7LA 1IY2A 3AEZA 721PA 3T5GA 3QKUA 4IHQA 4X8OA 1G7CA 1EWQA 4HZUB 2NO7A 2ZUBA 1M74A 2GJ8A 1Q21A 2FA9A 2CL0X 3PQCA 4UJ3A 5G53C 1UBFA 1II9A 1G3UA 4B6FA 3KFVA 3I8XA 4OQFA 4ARZA 4R2HA 4YMUA 3K0FB 1EFUA 2PLFA 4MRPA 3UXMA 3KQKA 1FMLA 1Z6AA 3OIYA 1E2NA 4FCTA 5IK2D 4HUQA 2NIPA 1R5OA 1NP6A 2Q21A 1I4DD 2EFHB 4B6EA 1S0UA 3T1OA 1Z2AA 1KAOA 1WBDA 2NQ2C 1KDRA 2P6NA 5FBWB 2QRZA 1ZC3A 1CU1A 1L2TA 4C0QC 2XITA 4TTRA 4YXWD 5CB8A 3IEVA 2J45A 1AK2A 1ZNYA 4TL9A 4IEEA 4KXFB 2VBCA 2GKSA 2ZSBA 2P6UA 5IK2A 4C30A 4CRWB 3BB1A 1NKTA 4NU0A 1AKYA 3QPUA 4C0KA 3UWKA 4TLCA 4YONB 1R10A 2OFOA 4B71A 4DLWA 4W9MC 1TMKA 1W36D 2XSZA 2ONJA 3IILA 1E0SA 3K0EA 2RGBA 2F55A 1WXQA 521PA 4IDQA 1ZMXA 2G88A 4PO1A 4XVQA 1OH8A 2PX3A 4HAZA 3ZDQA 2VP2A 1KZ7B 5L8VA 3GLFE 2IYUA 3DZDA 4LV8B 1S1MA 3C16C 4RFVA 3U4QA 1W0KD 5G3ZA 4C9BA 1NSTA 2VRWA 4B3CA 4C0BA 4DZZA 3AH8A 2OCAA 3W8RA 1NVVR 2ZVQX 2HCJB 3OZXA 4IKEA 3KKPA 1TU3A 4Q1DA 4A0HA 5BYKA 4P31A 3IEUA 1TUIA 2ATXA 3U3KA 1CR4A 1RJ9B 2FZ4A 1RRPA 5FUVA 1UPTA 1CR2A 3T1TA 1XCGB 4D4KA 3ONWA 1DAGA 4HLQB 3BFXA 2B92A 3N70A 1L4YA 1KGDA 2O8BB 4V0NA 5KDLA 1S8FA 4AYXA 3ZVMA 3LDAA 1DAHA 2O8EA 5EP4A 4V0OA 1R7RA 2R6FA 4BRWA 4DRZA 4GP7A 1EXMA 2FPLA 4S35A 3GJXC 3KXIA 2YOFA 2PJZA 1IXRC 2Q9AA 4OQLA 3B1ZA 5JI2E 1XTRA 3A4MA 3MSXA 4OHZA 3GLHA 1GNRA 2ZRPA 3KKNA 4M1YA 1NIPA 5CLQA 3FWYA 3LH5A 3AVWA 1S4QA 2UZIR 3QKRB 4DJTA 5FBLB 2V6JA 3SZRA 1TUEA 2ORVA 1E1RA 3AVPA 5EUQB 4WZBE 1R2QA 4MITA 2QP4A 2ZITA 3BS4A 3IPYA 2V4ZA 1SHKA 4FIDA 2FGKA 4FWTA 1G20E 4NCKA 5JHGB 2GCOA 4I99A 1MO6A 4LWZA 3OIVA 2XTNA 4PAQA 3RHFA 1FX0B 4PC1A 4DUGD 4TZ6A 1AQUA 3EIEA 2PEYA 5FTLA 1XXHA 5AWFC 3E70C 2EWWA 2WWIA 2QP9X 2NO1A 4LZZA 3L0IB 5EE5B 3W9YA 4EPXA 1OYYA 2G9NA 2JEOA 3WBJA 5TARA 1TF5A 5FI1B 1T6NA 4LHVA 3CW2A 2WWYA 2J0UA 1E2EA 5HR5A 2ZROA 2IW3A 3F5FA 2ZRKA 4IRUB 1NJGA 4AWXA 3CPHA 4DUGA 5E3HA 1W7AA 4KODA 3GJ5A 5K8UA 5KNDA 2JLWA 2JLUA 3R20A 1IJFA 2YV5A 1T8UA 1NVWQ 2R62A 3SS8A 4GZMA 2MSEB 4QGFA 1NLFA 2FU5C 2Q3MA 4MYHA 2G1JA 5J40A 4DKXA 2BCGY 1DAKA 3ZZ0A 3AVQA 2PH1A 2FPMA 2GXSA 1ZD9A 4BASA 1IXZA 1E79A 2N1BA 2C9CA 1E2QA 2VQSA 4G1UC 5KSYA 4BQSA 5L3SB 4C2UA 1T8TA 3TR5A 3RRZA 1ZJ6A 1P2UA 4JSTA 4TL7A 5J4HA 4GT1A 3NEJA 3VHLB 4C0HA 4QBIA 1XZPA 3O8DA 4NH0A 1D2EA 2QMEA 1QVRA 3NG1A 1DAEA 2IUTA 4KVGA 1E9BA 5GJCA 2GBLA 1PLJA 1Z6GA 2Z43A 1W4BA 2W6IA 1BS1A 1E98A 3U3JA 4KITB 3CX7A 2FEMA 3CZQA 1KMHA 4G5RA 2NO0A 3H2YA 4QC2A 1N6OA 5JFGA 1GOTA 2V1UA 1AS0A 3HPRA 2W0MA 4F38A 3WNBA 1FNMA 3TKLA 1NMXA 1EX7A 2ZTSA 4LGMA 3B1XA 2BM1A 1DEKA 1SHZA 3FVQA 3NHBA 5EP1A 1XJ0A 4ERNA 1CBUA 2ZRCA 4ABYA 2GVDC 2AR7A 2QSZA 1OH7A 4JLNA 4QM7A 5L3QB 1J99A 3MUFA 1MABA 5DN6A 5DYGA 1US8B 2HF8A 4A15A 4BEBA 1BIFA 5FTNA 1M8PA 1UDWA 3IIJA 4LPSA 4R2IA 3IIKA 3FMIA 2BBTA 2OCPA 4D4MA 3P1JA 5AUOB 1IN4A 5BW8A 2GCPA 3EZ9A 1NY5A 1KYIA 1GM5A 1IN6A 4QJ5A 5JRJA 4PPQA 4M9XA 3O8CA 4GOJA 3CRVA 4B3DA 1VDZA 2WSMA 1HYQA 3NBZC 3SJAA 5JS8A 4KI0A 1RYHA 4C0LA 3I73A 4LHYA 1XMJA 3KJHA 2GAOA 4PZYA 5HPYB 3U44A 1N6PA 4ZI3A 4PTLA 2DFNA 4UNSA 3KL4A 1VIYA 2DWQA 5KU1A 1KZGB 2BOVA 4M9SA 3GMTA 3SN6A 3WMEA 3LBHA 5P21A 1P2VA 5HKKD 3ZH9B 5J47A 1SXJA 1OHHD 4URYR 1QZXA 2KB0A 1GIAA 1I2MA 2CL6X 3Q5EA 1TAGA 2A7QA 2B7BA 4QRHA 1IQPA 4ZCMA 3K70D 4JBYA 2WAYA 3EWAA 2BBOA 1QDEA 1W49A 1E0AA 1E9DA 4I4LA 4I1SA 4NYIQ 2ZJ8A 3SDZA 4FD2A 4DHEA 2PMDA 4LJ6A 2WZQA 4C0SA 2P0EA 4TQAA 1N6HA 1JNYA 1Z47A 4CW7A 2JGNA 3PUVA 3CUEF 2BBWA 1M6NA 4DDWA 2FSHA 2I4IA 2DPXA 2ZANA 2HV8A 4BUJA 4EFNA 4QM6A 2W00A 1DS6A 4LBYA 4Q01A 1T91A 3QG5A 4FMDF 2D2FA 1VIAA 2CHVA 4TT3A 2A5FA 4IFEA 3KX2A 4M1WA 2Z6VA 1YZGA 2CDNA 3RYTC 1ZCAA 3QKSB 1TPZA 4Z8XA 3MG9A 1T0HB 4ACBA 2XJ4A 3WYGA
chains in the Genus database with same CATH superfamily
3IR6A 1U28C 4QRIA 3GQBA 4K7JA 1W1WA 3EQZA 3II6X 3MMPA 1NI4B 1CZUA 2QZZA 3KEMA 4JJKA 3KTFA 3PP8A 4BFUA 1G5HA 2VH5R 4CLHA 4BXOA 1XWWA 2ZUDA 4YBZA 3ROPA 1JV2B 4NCXA 5LXTB 3K8ZA 3BXHA 3FUWA 4DBLE 3B53X 1ZJ5A 3COZA 2YJ4A 3S99A 4G81A 4MVJG 3MT7A 4LZLA 3BORA 3TEJA 1EK6A 3E3AA 5CEEA 1V39A 3FNGA 3ZVLA 1IOWA 4A23A 1ISGA 2MINA 2QPTA 4D9KA 5JNWA 3VO8A 2JEZA 3WG9A 1N2BA 3CSUA 3DFKA 2BJVA 3OIUA 1QZUA 3A25A 5JSUA 4WK6A 3WYAA 1CG6A 4BQPA 2R5NA 4S1WA 3WKAA 3GZJA 3LQQA 3VYWA 4LYDA 4DVGA 3OOWA 4F12A 1C9YA 1HDYA 2WKSA 2O8EB 2JEYA 4LGCA 5H5JA 1SR8A 3LGSA 3D7KA 5KDOA 1U1IA 3H2IA 2BGRA 4EZIA 3A9UA 5IBPA 1SURA 3P2IA 4LHZA 2IC5A 2PL5A 1A5AB 1SCKA 3E3OA 3GZ4A 3DHNA 3THOA 1A4RA 2NSHA 5J4YA 4DREA 1YU9A 3TLGA 4UAJA 3RYFB 2UV8A 1M6VB 2RKWA 1BFDA 4YRZA 4CT5A 2C5SA 3O94A 3HCNA 3SC3A 4L75A 1PCXA 1QF9A 1UEJA 2NGRA 2WSBA 3IUBA 2HMSA 4A8JA 4DR4B 2O8CA 3LW8A 1W4ZA 3ISVA 1V96A 5ADWA 3V4OA 2H18A 5AW7A 1YSCA 2GEDA 4PWYA 1GAJA 2Q1WA 3DL7A 3TGLA 1PSZA 1WCXA 2JDIA 3CH5A 1RRFA 2GR9A 2C9YA 3GUHA 3H6GA 4H60A 3VTFA 3MIIA 1J6UA 1IIBA 1KI6B 1Y89A 2RB4A 2TMKA 3OWXA 1HXHA 4PYRA 3SLKA 3N58A 1H23A 3WK5A 5HZMA 3AM3A 3TLYA 2BIFA 2X5OA 1B8OA 1ESCA 4WFQA 5H02A 4G67A 2H11A 1KFKB 1MJFA 4BNMA 2EWVA 4PVDA 2WRZA 3KG2A 1Z6YA 3MSCA 4QASA 1LF0A 4IFBA 1TUBB 4HLUA 2BFAA 3ZNPA 5JHHB 4M21A 1EGMB 5KBYA 4YJ2B 4DLKA 1B41A 3RUFA 5DYIA 4YROA 3UWPA 3MTBA 3AZQA 5AH0A 4A7PA 1ZMOA 2W48A 2O5RA 5FAKA 2GGSA 1N1MA 2QM7A 1Y3HA 3GYGA 4JLPA 4BPBA 4X94A 3UCFA 5DZSA 1THMA 4P35A 5HYVA 2X4IA 4QEDA 1JXAA 2AG0A 3NJ4A 3E05A 5HTKA 2A5YB 2CUNA 2DHDA 2YQZA 4RHCA 1G6KA 1YGYA 1HFJA 1VIVA 2P2NA 1OT3A 2W2NA 3DZGA 3V6MA 5CBKA 1O8BA 4PO8A 1RJ9A 3ZV6A 1ODFA 4DQVA 4GI2A 4JP1A 4RM2A 3CH7A 5KKCA 4C78A 3AY3A 4NAVA 4MWBA 1WVMA 2XMGA 2ZATA 3GY0A 1HDXA 5AOCA 5H7XA 3JRXA 1Q0LA 2FSIA 2OLJA 3UF0A 3LT0A 2N1MA 2H7YA 3IEXA 3OQVA 4KQ6A 3T3PB 1RJWA 4M6WB 1R4ZA 4S2UA 3ZJVA 5ANRB 2ZYAA 2WF8A 1RKVA 3NBAA 5C7IO 4GYJA 3DKPA 2IZ0A 5CG2A 4F1JA 4BLUA 3THXA 3QYAA 3ORRA 2XEDA 4OJKA 1N9GA 1ZGHA 2D5LA 3DBVO 4LC1A 2ZI9A 2FZ5A 5AIAA 1D09A 2BEVB 3BGIA 2FZGA 3QU5A 3RKSA 3QG1A 2QTWB 3V4SA 5BSHA 2P27A 4OK5A 4PGFA 1L1FA 2IU3A 5E4FA 5JJLA 5BSEA 4AURA 5ESRA 2XZDA 1S6YA 1MF7A 1J97A 7AT1A 1NTRA 4ZICA 2ZZMA 4HWGA 4RGVA 2H52A 4M87A 3D4OA 3GB9A 1W35A 2PJDA 3BZWA 4NCHA 1T8YA 4DUPA 5EKTA 4DIEA 3HEBA 2X4GA 2GEFA 4PICA 5IKXA 1T0JB 3IXLA 2C8LA 2BZ1A 2X5XA 4KR2A 2HZBA 2AJCA 1LK5A 4M0UA 3WMFA 2IHVA 1KPHA 4N8DA 1G1AA 1YVUA 1ZINA 4KPFC 2V4MA 1DADA 4KWIA 3DS8A 5A4DA 1NC1A 1FEZA 1FX0A 1WCIB 3A4LA 4A6PA 1Z5VA 1B76A 2IPMA 3BSYA 3ETHA 3K72B 2NLOA 3TMKA 4J9VA 4CKEA 4NCBA 1WMBA 5BOSB 3HUDA 4JWKA 4NPCA 1YNOA 3GRPA 1NVBA 1HSZA 4AN0A 2SHKA 1SY7A 4EHNA 3DGFC 4K8OA 2WJAA 3NH9A 3F1KA 2AHOA 3O7WA 4ZAZA 4MLCA 1KVRA 2HIGA 3V34A 2EW1A 3T5PA 1U11A 3UMBA 3R8FA 1GZ5A 2BFDA 3FI9A 3I9LA 2XYPA 3IR5A 5E6UA 3ND5A 1XJQA 4MI6A 5F3RA 5ED4A 2BYTA 1QWOA 1HDGO 4C08A 4KOEC 3GRCA 3VJLA 5A5GA 2ZYTX 3DULA 1BXZA 4KIJA 2FKNA 3OM0A 3P4YA 4R9SA 3MLBA 1ZUIA 1BW9A 4CMGA 1M34E 5KPJA 1P9WA 2H7CA 2XVAA 3FYUB 3K73O 2OGTA 4UNRA 1U9IC 5BMVA 1ZOOA 1DLJA 1MO5A 4PYOA 3ZWXA 4EMTA 3OICA 4AKEA 2V3WA 4AZ0A 2OV4A 1TYAE 1TADA 3H1TA 4V1CB 1PZGA 4CF5A 1CP2A 2PPLA 5LMNB 4O4LA 6CHYA 1N2HA 3ZD6A 2GYUA 2XUZA 2YY6A 4KSBA 1ZY2A 5BSTA 2GH1A 3ZOKA 2C5EA 3KQLA 3PNQA 4R6WA 2OBBA 1LBHA 4BZXA 4YLGA 4G9EA 1I2DA 2NV2B 1KI1A 1F48A 3DZJA 4PN3A 1JIXA 2VDWB 4PINA 4ARZB 3AR6A 2QRVA 2WBLC 4HDOB 3C6KA 4S1VA 1G66A 3C5HA 5E0OA 4I8IA 5DSXA 4KN6A 2NU7A 3GCDA 3GCGA 4WPGA 1JAHA 1JG6A 4EI2A 5B37A 5JR3A 3H0EA 3WSTA 3WTBA 4BL5A 2N47A 3P26A 2FSVC 5FORA 3UFXA 1FYXA 4BQFA 3COVA 4Z7JA 4HMQA 3QW4B 5C1DA 2ZBVA 1ZL2A 1QHEA 2XLCA 3FTFA 1P72A 3FAZA 1A1SA 1AO3A 2R86A 3LK7A 5BSWA 4ZQGA 5CB4B 3GAAA 1QHYA 1JF8A 1XZHA 3QI2A 4TKUB 1U8UA 4LDJA 3LFHA 1JVSA 3PNMA 2QG4A 5TPZA 3VVMA 1FXSA 2VYCA 3BWCA 2ZCJA 2CJPA 4EFLA 3FA2A 3PCRB 4HRVA 1XF9A 4MV1A 3D8TA 3PC4A 4UQPA 2JFPA 4FCCA 4KO1S 4HVAA 4U7WA 1AVTA 5LLSA 3WAGA 3LT5A 3CY6A 2V55B 5D3KA 1UPUA 1M0WA 3V8PA 1YR6A 4WBNA 4QARA 1ZZGA 4MRSA 1LF5A 5JAZA 5A71A 2XA1A 3AKEA 4D96A 4Q1EA 4TWZA 1P6UA 2ONZA 3AUKA 2VHWA 3PGLA 4WOPA 4Q03A 2Q5HA 5KYVA 1AZSC 1G8SA 2B78A 4ZQHA 1JMKC 2FJUA 3WY9A 3PFNA 1ZEJA 3R7FA 1K6MA 1NLYA 2JAUA 3KQMA 4N5IX 1O03A 1XZ8A 4R1OA 5T3YA 2HYDA 2J3HA 3OF2A 1AXRA 4K9PA 5CLFA 5JY1A 3G0GA 5J5VA 1BEEA 3GLUA 1OWLA 4JH0A 2ZYWX 1NUQA 3FF4A 3M3PA 1JLLB 4OQZA 4V38A 2XZOA 3CG0A 3JQAA 4V0ME 4RY2A 3MJ4A 5K2MA 3C5CA 1GGHA 1P8AA 1YKGA 4H16A 3EGVA 4CZ2A 1Q7RA 4YRGA 3TW8B 2NVOA 2WVJA 3ZDXB 1JTEA 4OHCA 2F3QA 2Z1DA 2HO4A 4QJIA 3FHOA 3VSCA 1D1QA 4OAOA 4D5EA 5KVVA 2RH9B 3T4PA 3VSDA 5MFPA 3I72A 4I1VA 4J0DA 4KQXA 4B82A 2Q1UA 2VHTA 1O8CA 5EEGA 1N6NA 3EJ6A 1NMYA 3C8UA 4UVEA 5FX2A 3FTCA 1FS6A 3AF1A 4DLSA 2J67A 2MWMA 5BN5A 4ME6A 3I3OA 1YH3A 4KQKA 4ZMBA 1IHUA 1Y63A 1HG0A 2EF1A 3K35A 3OIDA 2WPDD 1HDOA 4HF7A 1NUPA 2C0CA 2OL4A 2YV2A 3OY2A 3ZY5A 3HU1A 4IMJB 2ZETA 4QTYA 2WFLB 1MKYA 5KYYA 3AR3A 2I9KA 3MHTA 3AETB 4Z4IA 2WJ4A 2JFZA 1P4RA 2NTEA 3GHHA 4L3WA 4MNTA 4YCLA 1Q7EA 2DR0A 3K96A 4E5PA 1E79D 2DM6A 1XWIA 3HVKA 2R8ZA 1XTKA 4X60A 4AKTA 1KK3A 3WX0A 3G6WA 5K5EA 2VKQA 1UBCA 5JSZB 5T64A 3MCWA 3VH2A 4BVHA 5T6MA 4A8TA 1SKYE 1K0FA 1MGPA 2QDXA 1UFKA 4DR7B 2A14A 2WJGA 4P5PA 3RNOA 4B6QA 1KH1A 1XRJA 2GCOB 2C7VA 2V45A 1YI8A 3FSJX 1CEQA 4FSDA 4KXVA 2WF7A 5JO9A 3ZE9A 4O4LF 4A0GA 4B31A 3R1IA 3W8FA 2Q1TA 1OU4A 2Z2KA 3HB0A 2OR3A 1I30A 1U7DA 4XOUA 1C8BA 4TL6A 3IP9A 2XUAA 1XYYA 3D02A 4DSUA 4GR5A 3NVKI 3EGCA 3H86A 5KOJB 3LX8A 5K8LA 4G0OA 4MVJA 1RR6A 1TVKA 2IP4A 1E7RA 4H08A 3QLTA 2DUWA 4JUIA 4KV9A 4X54A 3FDIA 1JRLA 1V11B 1X39A 4EL5A 1C0LA 2PUCA 3R0QA 4LDAA 2EFCB 1Y3AA 3MJTA 2DR3A 5EG5A 4Z4QA 3L1HA 2PA0A 2HQRA 3AR9A 3IPRA 4HNAB 4OHYA 4DCPA 4UMFA 3E4DA 1C30B 3GFPA 1GNVA 3IELA 1FU7A 3NP9A 5F1PA 1HT3A 3FVRA 4WINA 4DN6A 2PUAA 4DDMA 2ECOA 1JEJA 2YOHA 3ZU4A 2DXIA 2D5CA 3DONA 5F35A 1XWFA 1PJ4A 3IT2A 2IS2A 4IDGA 1OTXA 3A6EA 4D8WA 1P4GA 2PSJA 2DTXA 1W5SA 2BI7A 2PLAA 3KZMA 3OY7A 5JRDS 2E4XA 1RHQA 5FUWA 3T5TA 2JI8A 5KNDH 1PJRA 1C3VA 3A6JA 3CLTD 1IG3A 1JYFA 3KYCA 5ALIA 3TZCA 4DNOA 2ZJ4A 5CITA 1JDPA 1JIQA 1W85B 1XDBA 1P6XA 1DFHA 4KX3A 3WB2A 1IBCA 5ALSA 3EK2A 4HVCA 4LF5B 4LY3A 1VE3A 4BFSA 1II8A 2P4QA 4EI9A 1EINA 2HPZA 4CKCA 4KTVE 3EVCA 1M6VA 1YUBA 3RSOA 1R9JA 2I7CA 2J07A 3LCCA 5KWIA 2E5LB 1XCLA 4OXRA 4Q7EA 4YCJA 1JFSA 4CE6A 1TA4A 2FMFA 2H2FA 3RHSA 3UY4A 4H1HA 1LBQA 2JS7A 2GD1O 3DEHA 2VIIA 3BXEA 3S27A 5BMVF 7YASA 1YCFA 3H4VA 3V3TA 4EKEA 1YAHA 1QCDA 5F9HA 1KYXA 3DTVA 4K88A 4NCNA 1KI8A 1X92A 3TK1A 4XYGA 5K01A 3LTNC 4OKNA 3KU4A 1A50B 1VLZA 4GI5A 5KVSA 4UCQA 3TXAA 2SECE 2XGSA 3MJEA 1P9OA 2DFKB 3S2UA 1EWVA 3SYLA 3TDNA 1DAPA 2HK6A 3F49S 4AWBA 3P9XA 2B2NA 4YP7A 3IAFA 1KKLA 1X3LA 2FXVA 1TQ4A 1VGQA 2QT0A 1X42A 1X0XA 1CQPA 5KTSA 1E9CA 1GEGA 3QP9A 3T3NA 1LPOA 1PE0A 1U3WA 2V7UA 2D2VA 2IY8A 1C0IA 1P81A 2ZUTA 3VU8A 3IDOA 4YJ2A 2WEKA 3SYMA 2GDZA 3OZGA 2HK8A 4KQJA 1PIWA 4EAAA 1EDDA 3Q87B 3A36A 4RBNA 4RTOA 1L5ZA 4LJRA 3FUXA 3GPDG 1GXSA 1XKTA 3EQ7A 2W90A 4HDCA 2VK2A 4QYMA 2MMGA 4ZEVA 5DTJA 1BU8A 5IJWA 2WT8A 3JQRA 1A7KA 1CJVC 3H1BA 5IAKA 5AVXA 4NRDA 1V8OA 1LLUA 1W9HA 2Y0BA 2ZRHA 4KXWA 2PRYA 4ZQFA 4XWOA 1Q7BA 3HXQA 1SXJD 3NFYA 1NAHA 1B7GO 4JXXA 2QVBA 1RHRA 1YBMA 1MB3A 3W5IA 3AFMA 4HYYA 5DULA 1LLDA 2A3RA 4M0DA 5CBPA 2H9YA 2Y66A 4HLDA 2WSSD 3K53A 1RHMA 4R9NA 2ZWMA 1GUZA 4CDRA 4RXMA 2VP5A 1KVSA 2D5BA 4P82A 3FB4A 1IBRA 4AJPA 3URMA 1SRRA 3CW9A 3IMFA 3IYLW 4IIJF 4JT4A 2FRDC 3WLSA 4EZEA 1RACA 2X6QA 3IJ5A 2JB9A 3AERB 4B73A 4KE7A 1WB4A 3HZZA 4GUDA 3S5JA 4DHWA 4TYNA 1N9GB 2GBGA 3DVLA 1P8JA 3HS3A 3QBTA 2C59A 1Q2UA 2OQRA 4QX6A 3TSCA 5AJWA 3LUKA 1DU4A 4RVOA 4BQOA 4BEWA 3CVUA 1DBSA 3A58B 2IS1A 3ESDA 5FYDA 3W34A 2ZVJA 1V5WA 4YRLA 1XEWY 3REGA 2BTQA 1G1MA 1WAMA 4NBWA 4MGKR 2IGBA 2A0UA 3NM6B 3IHLA 3BK1A 3K32A 1ESEA 3AB8A 4GLLA 2RJOA 1FBTA 3RG2A 5AJUA 4R3UC 1M2HA 1GFSA 1BX1A 2GM3A 5CDTA 7MDHA 5K8JB 3O2SB 3UBTA 2H1RA 4DLTA 5B7QA 5ADUS 2ILVA 2P9FA 1QZZA 3FFWA 3RK4A 2KBFA 2PY6A 1PT6A 4HGNA 1IN5A 3OD1A 1GKLA 5IT4A 1XCOA 3ISTA 3ST7A 2RGNC 1G60A 3FZNA 3RV4A 5HQ3B 1UWCA 1ZSVA 4QDTA 2VSXA 1LI5A 4NLLA 1UBSB 3HBMA 1JSRA 1JIJA 2BGLA 3S2FA 4UHFA 1DAIA 5L95A 2ZCVA 3FRIA 3GV0A 3IOEA 3L4BC 5CVVA 4DWVA 5SZHB 1I3OA 2IVFA 3BXXA 4GQBA 4JGBA 4LHEA 4YJKA 1UXOA 1Y9AA 2XQVA 1UKVY 1U2RA 1N4AA 2OCKA 3RS5A 4QODA 2YJTD 3IPLA 3JAKA 1FA9A 2F4NA 4O2BA 1S9DA 4UBJA 1Q77A 1GPWB 1NRXA 3FHCB 4LX0A 4AT1A 3LA8A 1ZBDA 3U3MA 3UJ3X 3ORQA 1IEWA 1Q12A 5DVZA 2ORIA 2Q3DA 4NKRA 5TT1A 3RASA 4HGOA 5DEOA 5HFAA 3G2HA 3PICA 4EJ6A 2QRJA 3KB2A 2KI5A 4JI3B 4NFSA 2WILA 5BR4A 1XOIA 2BI8A 3KJIA 4TTAA 2PGDA 1RE0A 3CN7A 3LYUA 1BKDR 4G85A 4G86A 4EWLA 1S2GA 3M1AA 1KH2A 3LUFA 3ZQ6A 1SQFA 5I4KA 4DARA 4YHHB 2YX1A 3R6GA 3ZWVA 2YZKA 3K0KA 4JQOA 2A2ZA 4LI3X 3TN7A 3HEAA 4UJ5A 4B5LA 2FW9A 2WUEA 5I7HA 4N3GA 1JL3A 3GJSA 1ECFA 1E64A 4NOMA 2OM6A 3CR8A 4INPA 2AQ8A 1NASA 4MI3A 2JGMA 5JSFA 1RXUA 3G13A 4QO8A 1X1RA 2R65A 1FUUA 3NI2A 3QVVA 1ZGCA 2JHGA 3BULA 3LC1O 3MWEB 4K9LA 2QYSA 4B85A 2WJPA 2BLNA 1WL8A 1QHXA 3M9XA 2AN1A 3K8QA 4JSRA 3HCRA 1Q22A 1WULS 2BKXA 4P9NA 3SOZA 2GJKA 2BR5A 4JI2B 1M8KA 1Z6XA 4ZOAA 2LCIA 3VHXA 4HNSA 3FBGA 1XZCA 2D0IA 2Y2VA 4M1OA 4M3NA 1IQRA 4UPEA 1CY0A 4RQTA 2C2GA 2V7QD 4QQRA 3IRUA 5INTA 1ZM7A 3SQWA 3G5UA 3ZDEA 4KPEC 1JEOA 4RJTA 4IXNA 3ORFA 5HSGA 4N8EA 2QTNA 1QDLB 2GI4A 3GLHE 4IXDA 3ZV4A 2Z95A 1ZCBA 2EU8A 3LKZA 3WK6A 1NBMD 5L7TA 2HJ9A 2JFNA 4XM2A 2SNIE 1JFVA 2YFHA 1UBKS 3IESA 4RXTA 4WXEA 5G3YA 5HFNA 1GVHA 4E21A 2CJWA 1OH6A 3WQRA 3DVQX 3NTUA 3QPCA 1O0BA 3EOAI 5IAGA 8AT1A 4WZBA 1W46A 2GA8A 3I8SA 2R7LA 1PF7E 4RWZA 4XASA 4ZO4A 4C06A 4R9UC 5IZCA 4IAOA 1TXGA 2B4QA 1IDN1 5LP6A 1V45E 4UHDA 3BMQB 1CFJA 1UMCA 1LNQA 5FA6A 1H0SA 5DGCA 1EX9A 5A7FA 3NBQA 1FLNA 1JLLA 4C1BA 5TQJA 1ZM2A 2FX5A 3OO0A 2QBYA 2EL9A 4N65A 4XAQA 1DUIA 1N2IA 2E18A 3JW8A 3KYBA 3ZHVA 2DULA 2O6HA 1RRGA 3MRVA 3OHPA 3L0CA 3P32A 4K3VA 2FETA 2RD2A 3HMKA 1EM8A 3QFTA 1S02A 5TS2A 3VU3A 1SBNE 1GT91 2JK1A 4OP2A 1L7MA 2J0SA 1N5LA 1B0UA 4KREA 3OP1A 1IHOA 1YU6A 4OSPA 4BKPA 5BPHA 2Q45A 2VBFA 3WB1A 2JFWA 2D0OB 4H77A 2XCSB 2DKNA 4OHPA 1PYOA 1A8SA 5EIAA 4PVCA 5LQRA 3UMCA 4DLNA 3IUMA 1HT2E 3H9UA 4IIEA 4FBGA 3UJ9A 2ZYGA 2PAAA 3KR2A 4KL8S 4MEBA 1Z39A 4F3NA 5KYYB 2BVNA 2HZ7A 1SQ6A 3P20A 1WZIA 1FUIA 3I01A 2PK3A 5L4LA 3E6AA 1Z33A 4F91B 3BIFA 1EA7A 1JT9A 1DG1G 2X8BA 2JFYA 9LDBA 4GGPA 5JALA 2IYRA 3D31A 5EHQA 3A1NA 5DRTA 4JK3A 3GR6A 4PQFA 4ZEOA 1G19A 5ICMA 3JQ8B 5DK4A 4RELA 1U3CA 1Q0HA 2RH4A 3QYPA 4MLDA 4V0SA 4BNKA 1ZR2A 2B83A 3A6GA 2I7XA 3E82A 5DYTA 1ZJZA 2R00A 2VI5A 3UEOA 4C2BA 1WCWA 1F5SA 3B1JA 5CJ2A 1N34B 2QUBA 4OMCA 3HPQA 1F2TA 1X74A 2VCEA 1VYHA 2I4MA 2VJMB 4BNVA 1JG4A 4QVGA 1WOYA 2C2ZA 1HLPA 2NM0A 3U31A 3KD2A 2WQ6A 4MUBA 1FFYA 1EXNA 1J00A 1A88A 3VZCA 4EG5A 3SIPA 1OFTA 2IXFA 1Y9EA 2QX7A 1L7PA 5JQWA 1NV9A 3M5PA 4FQ7A 3HBFA 2AFRA 3QTLA 4LWOA 2PS9A 1Q3HA 4LRQA 5I4BA 2H1LA 2ZB7A 3GBSA 3OAAD 4KK3A 1PG5A 4GZ6A 4Z99A 3OZUA 3PG5A 1KEVA 2HUNA 3LDHA 4XVHA 4F92B 4Y9SA 3WL8A 1X9HA 5FWAA 2GTIA 3EVGA 4DMGA 4ZCPA 5BR1A 5C1OA 3UPTA 1F7UA 3WMWA 2QN6A 2XTZA 5BQ3A 1THZA 1KOLA 3NYIA 4OL9A 4TLEA 3ZU2A 2V65A 4W7HA 2WWVD 1JSLA 4CQLA 2ROQA 1L5QA 3AR7A 4I55A 1W0JA 4Q3DA 4D57A 1G17A 5ILOA 1YL6A 4HGQA 4AG5A 1RQPA 2W2OA 3K9BA 3IAXA 3VDMA 3KVOA 1UKYA 2VVTA 1SC1A 1Z8FA 3DDNA 2DFTA 3OMXA 2PFSA 1P3Y1 3WIOA 4Z4CA 3L6BA 1I7NA 3GCWA 3TIIA 4I4TB 4D4IA 1PUIA 2ECQA 3CZ9A 5IYZA 1Q1QA 3N39C 5KQPA 3DKKA 3A27A 1QQ5A 1VJDA 1HYEA 1IIRA 1YCGA 4LSMA 4DW8A 4EFMA 1ZVMA 3LC0A 1J8QA 1NNEA 3FPHA 4ENQA 3TRFA 3OEHA 5FWYA 3LVBA 4EF6A 5IT9A 1KAMA 1N32B 5GONA 2AQIA 4O6VA 2ZPAA 3OQPA 4RLSA 5HGJA 3AKYA 3RUDA 1WNFA 1N3LA 4E2XA 4MP6A 5D6OA 1V95A 2AFIB 3H0KA 1YIOA 2GCEA 4HN9A 4JJ8A 4MZXA 4B3IA 3KIPA 1ZJ4A 2QU8A 5TPZD 1E20A 4YJ3A 2YIDA 1A3CA 1XC7A 4G36A 4K6HA 4BFZA 5TX7A 4K2HA 1U1EA 2XE8A 5AM2A 2QT9A 1R4MB 5KC9A 1FMCA 5CW2A 3OPXA 3I0NA 5TF4A 2I66A 1G18A 1FRNA 3M6LA 1R8YA 4G0WA 3TW6A 1YQGA 3I05A 1RCUA 4N3BA 1P7PA 1FPQA 2I6UA 2YWEA 3GJ8A 2RKOA 3ICPA 4GE3A 4MWZA 4CIAA 4WAUA 1L5KA 1C14A 1U1FA 2VUHB 3GEHA 4C21A 5LMUB 1FMTA 1BROA 3AGQA 5A9SB 3UMSA 5KZMB 3VV2A 2IHZA 1ISSA 5JC8A 2HM7A 1J8FA 2G3YA 4E6PA 4EUKA 4RHXA 1U0LA 1R5BA 5DM1A 1X8LA 3ADPA 1P2BA 1T4DA 2JAPA 1ZH2A 4U0JA 2WJVA 2FN9A 4PLGA 5CA1A 3D43A 3OFVA 3ZWPA 4AJLA 1IDOA 1N3YA 1N9ZA 4A92A 3OX2A 4DJJA 4NPHA 1L8LA 4NE7A 1GZVA 1JLSA 3MC1A 1L4KA 1UXJA 3BXOA 3ITNA 1G8HA 4A5OA 1EFCA 5KHAA 4DJDC 4F2HA 1DQRA 1TTQB 2XWQA 1F4PA 1GG9A 3QBJA 4MUAA 4WERA 3FKSD 3C3JA 1PZNA 3CV3A 1WMEA 3FVWA 3KT8A 1YS1X 1K7XB 4G9GA 4IGEA 1XO1A 4L0MA 3DXZA 4OHKA 5AT1A 3CNOA 4H7FA 4TV8A 4L16A 1NP7A 4RA9B 2BN4A 1A2BA 3RR2A 4MR8B 1LSOA 1EK2A 3RU7A 2WPDA 1NULA 1WB5A 2QJRA 3EAFA 4HYQA 3ZK7A 1NXOA 1EXDA 1I3NA 5CFNA 4GQAA 3W8NA 2BGNA 4HYTA 1F8UA 4NWIA 1QQBA 1X3SA 1PJCA 3X2FA 3A1TA 5D3ZA 3JWPA 2WD8A 1X8XA 1RQGA 3BE4A 1FMJA 3FYDA 2W37A 2IYQA 4LEIA 1MC1A 5GM2A 1E2UA 2ZOSA 2WB2A 3JVDA 2HRQA 3OLZA 2RARA 3JD4A 4L27A 5CDUA 4L02A 1J20A 1NLUA 2V96A 4EJSB 5K99A 4I6JA 3UMJA 5F9MA 3ANTA 1UXKA 1Z17A 4BLOA 4ZQEA 1QOPB 1UDBA 2CDAA 1N5IA 3BXFA 1XZQA 2G36A 2WG1A 3H16A 5JNUA 3AUYA 3ZVNA 3THWB 3HKBB 1D8AA 1GTZA 1OLXA 4X7BA 4NXMB 2DE0X 2D6FA 3BA1A 1SIUA 4U5QA 1KO5A 4HADA 4EX6A 3H5RA 3OUUA 1AO0A 3DD1A 5KYXA 1DC4A 1QTIA 2Q4TA 2CXRA 3TQHA 3EULA 4Y2UA 2HRDA 4URXR 4S04A 1ZK3A 3ESAA 1VMAA 1XD2A 2AMJA 2GHTA 5EWJA 3OTHA 3D2BA 2X1LA 4BO9A 3L8EA 7ADHA 3IPXA 4I1PA 4KQ2A 4R1QA 3WLPA 3ESBA 4HAXA 3FTPA 4X7RA 1D2AA 1TC2A 1C4KA 4ND3A 4K2AA 4UDXX 2V1UA 1NATA 3TF5A 1T9ZA 2F3PA 3F6EX 1TO2E 4ZDKA 1MX1A 1K0UA 2ZYDA 3GWZA 2J3DA 3IT0A 2B1JA 4DQKA 4EB6B 4OQMA 1NMQA 2H00A 1Q0RA 4IDDA 2RHOA 2C2WA 4M8SA 1ST3A 2BMJA 1KYYA 2EZUA 2OLKA 2WJHA 2FP3A 3V1TC 2C9ZA 2JFOA 2ZAIA 3FPBA 4M37A 4NX2A 5ITZA 3IL2A 1O08A 5CH8A 4H0CA 1SCJA 4X97A 5LL6P 1GTL1 2J6IA 1PJQA 1OX5A 4DC9A 3F3KA 3QEAZ 5HX7A 5IASA 4WACA 1GUDA 2DJ5A 2WP8J 4AQDA 1KARA 4RTKA 5HUJA 1T0BA 3RAFC 3O8NA 3NNNA 4C01A 4CGYA 4EZBA 5CD9A 2JJYA 3GAZA 3RWOA 5FFMA 3UOAB 5FPKA 1S89A 2R7AA 3PNOA 4O8CA 4D6XA 5AHRA 1OYWA 2DQSA 1L7QA 2H7XA 5KWJA 1XA4A 1P73A 3GFFA 1E2IA 1EQUA 1I0ZA 1RKQA 1E3IA 3FMPB 4ER0A 4JCOA 1TMGE 4G07A 4A8JC 2L42A 3MWGA 1R64A 3V2UA 4FBLA 3ZGVA 5IABA 2XRZA 5B2EA 2EBHX 1FFBA 2HNBA 2ZU6A 2E3JA 1S3FA 3O38A 4ZEWA 3SFZA 3DE1X 3G3EA 2XXAA 4EJ2A 3I5MA 1CUGA 2RCNA 4UVIA 4D2IA 4UFOA 3S7TA 2O2IA 3HKEA 4BB9A 5ENZA 2G1AA 1A8HA 4DMHA 1GPMA 5GZ1A 5DYNA 4U9IS 2B1RA 2CHGA 4R2JA 1TM4E 3WGHA 4X92A 4ANFA 4D9NA 3OC0A 4MV5A 2AK3A 2WU0A 5F5NA 4DLBA 5I01A 3ORSA 4GMHA 1GQQA 2P69A 4IHAA 3CZ4A 4TT3D 1PR4A 1WXEA 1XQ6A 4AS2A 5SZKB 4B4WA 5C4MA 4LC0A 4DBLC 1RZRA 1IN1A 2AJLI 1RAFA 4Y6OA 2HXYA 5TNXA 1PL6A 3FJOA 1XTIA 1FDUA 1U9CA 3AHEA 1USWA 1E7SA 1ZOPA 1D4AA 3GDWA 4MYDA 4WXHA 5T57A 4EG7A 2AN9A 2O4UX 3H3JA 3RRFA 4G5SA 5LD2B 5AYVA 1WHTA 4HDQB 3VHXB 4FX2A 4MAAA 4C2TA 2P4SA 2DKOA 3D1LA 5BN1A 3WL4A 2DT5A 1M7BA 3IMCA 3PZRA 4II2A 5GWXA 4DLUA 3T5CA 5ES3A 1XK6A 1ZUD1 2JFBA 5TEVA 3OM1A 5KSOA 5TJ9A 4KLZA 3RFXA 3N5KA 4JYAB 5B7PA 2QLBA 4AXBA 3FVTA 2R97A 4KAXA 4F5EA 1P4HA 3HNOA 1AQJA 1Z0KA 2XVMA 2XZPA 5IF9A 1AUQA 4WA7A 2ZI6A 1XROA 2CJWB 3AI3A 3FDFA 2H4YA 3PNSA 1WPGA 3C98A 2P2GA 4HWTA 2YY5A 2AQKA 4KPGA 2WSSA 4PGHA 3ZYCA 4AF6A 5GADl 3BWDD 4AMZA 1PFQA 1ILWA 4M1MA 5AK0A 4ZAGA 3JQPA 2OP0A 3NATA 4FYHA 5DWDA 1JA9A 5AP9A 3KQWA 1YDGA 1XQ9A 2IYFA 3JZAA 4QRDA 5K0BA 4W1QA 3P0HA 2CHQA 3OFNA 1S8OA 3HDYA 3MGCA 3VNQA 4B3FX 1HEIA 2X22A 1MDBA 2ZDQA 1SUBA 2BE9A 1J2JA 1UMCB 4K40A 1JQKA 3DMGA 3F5MA 3LPNA 2Y27A 5H9WA 4LF7B 1BCSB 4L28A 4MWDA 3E0XA 5AW6A 2ZJ7A 2BKEA 4WKGA 3RAPR 1DNPA 1H3NA 1IXKA 1PS8A 1K7EB 3DO8A 1NX9A 4Q9HA 5JG7A 3CEAA 3TD2A 2IL1A 5AM4A 4IQFA 2ZJ0A 3CKLA 4M1QA 4D3YA 1IBMB 4J0FA 4KU4A 1ABBA 1AH2A 2FWIA 2UZ3A 2XKAA 3OE7D 1GTJ1 1E32A 1T4CB 4FHFA 2CBGA 2P2YA 4TWBA 3TL6A 5JJBA 2JHCA 4UMDA 1C8LA 1SA0A 2BGKA 1X80A 2R6R1 1N7GA 1YVDA 1XU7A 1C9MA 1OY1A 1WEKA 4IEIA 1JP7A 1WD7A 1GJRA 1ZIPA 4YAOA 1LVHA 5BWCA 4PYJA 4KFSA 3EF0A 1BN7A 1AX9A 1QO7A 2CVFA 1NYTA 3HXLA 1H42A 1UBEA 1NUTA 1YIAA 3G85A 3JYQA 4GVPA 5LQKA 1OD6A 1EJ6A 4TS9A 2ARKA 3WRWA 4JX8A 3HYRA 3IQGX 3HKCB 1R3UA 3PXCX 3FNEA 1JDSA 4TVSA 1RS0A 3CE9A 3F71A 4YV7A 5K3EA 3BMNA 1KP3A 3Q5DA 4A6EA 3WZLA 2ACKA 1Y8RB 4LJSA 1RNLA 4FNMA 3RIMA 2D2IA 1RHJA 2FNAA 5KVQA 1A8UA 1VPEA 3RUEA 4DM4A 4EJFA 2O7QA 5LPNA 3TNJA 2QR3A 4UAUA 4IF6A 5HF8A 2X15A 3U19A 4P3OA 3HB7A 5E3IA 3RHZA 1YKSA 3R6LA 3BWXA 4DNPA 4D0NA 4BFXA 4RTQA 1H8HD 1T5HX 5AFSA 1VJTA 4AKHA 3TOXA 2FLVA 4PC7A 1X1SA 3E7WA 4AG6A 4CI0B 3KFXA 4JUDX 10MHA 3PJRA 2HCFA 2PVCA 3DOOA 4HWSA 3AESB 1T3LA 2BM9A 4J8PA 4IMRA 3NO4A 4CEIA 1O6FA 2FP4A 3S0JA 1HPLA 2OD7A 1T29A 5THQA 3EPPA 5HIJA 5EIBC 1VG1A 5EJ2A 2DWUA 5ICFA 3ZDBA 2XUOA 1Z5ZA 3DL2A 5CLHA 4DIOA 3HU3A 4M99A 3DAPA 5ALVA 4PPFA 1RPZA 1RE1A 1FK8A 2R751 3HJBA 3N5CA 4HDRB 4NU5A 1ZEMA 1ZP6A 3B2EA 4XDGA 3RTGA 4DYHA 3AV3A 2G0AA 2W98A 1YZLA 2SKCA 5ALHA 2JIDA 1Z45A 4JBWA 3I62A 1YS6A 3E84A 4WOCA 5BT8A 1JJFA 3BGSA 5AM1A 1KZ1A 2ZAGA 4ZAWA 3KUUA 4FOSA 2TYSB 3W9BA 2FN3A 4AU1A 4ZCTA 2H07A 4I7EA 1MQAA 4HB2A 4LTMA 1C5KA 2ZIWB 1QH0A 2FMUA 2FWPA 3KTOA 4DLPA 1FXWA 5FBQB 3T9CA 1E1MA 1UAAA 2PSEA 3RC3A 2P67A 4L5AA 3BBLA 2W6MA 1GTG1 4A6XA 1FL9A 5F78A 2QHXA 4MQMA 4I1IA 5FWYB 3IVRA 1PJ3A 5H70A 4JMPA 4PHCA 4PPYA 1IPHA 2BGUA 4BX0A 1BFUA 2CLCX 2HBRA 3FB1A 4FEAA 1YMUA 2C7PA 3BMCA 2RHCA 1IUNA 2AFIA 4AFNA 5BNWA 2PDAA 1G5RA 3M89A 3H8SA 2CXHA 4PS0A 4UTNA 3ZDDA 1ZUNA 2IDJA 3GVCA 4YJ3B 2GD0A 4D9FA 1XU9A 1QQ6A 2V0GA 4KV7A 3RODA 5KMGA 3C3YA 4BKQA 1R4MA 2Z0MA 3CZRA 3M4XA 1P19A 2HR1A 2GBFA 5IJ0A 2FW7A 2JIZD 1LUAA 4JLKA 1U7OA 3T61A 2KHZA 4QYTA 2BR4A 2A78A 3ZCVA 3GLKA 2J3JA 4CDGA 1FYFA 1E3QA 2Z4TA 3TFOA 5FTJA 3N7AA 1G3MA 4CQNA 1M2OB 1I10A 5C4IA 5KIAA 1T10A 1GRRA 1TFUA 4XCXA 3IEMA 3JQGA 1O6BA 4PHTA 3A8TA 3NORA 3PITA 5FI0B 1D6JA 4KKXB 2AOWA 2ZT6A 2HADA 5KINB 4FK8A 2QWXA 1ONBA 2PGIA 2UYOA 3QX7A 3HYTA 5J2UF 4GWGA 4FOPA 5EZYB 2OUIA 4KQIA 4F0JA 1BE8A 5EQDA 1SVNA 3MTGA 1OZAA 4TS1A 4ZO8A</