2GCOB

Crystal structure of the human rhoc-gppnhp complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
192
structure length
182
Chain Sequence
HHSSGLVPIRKKLVIVGDGACGKTCLLIVFSKDQFPVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystal Structures Reveal Two Activated States for RhoC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Rho-related GTP-binding protein RhoC
total genus 63
structure length 182
sequence length 192
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gcoB01
1G16A 1ZNWA 2MMGA 2N42A 1JJVA 1AZSC 4TQAA 1NLZA 3KJGA 4PQYA 4M1TA 3LVQE 4XVUA 1ZM7A 1EESA 2JLZA 3GLFB 5EXTA 1X86B 1NMYA 1VMAA 2KJQA 3CB4A 2GZHA 1R5OA 2F1JA 2HEIA 1E2PA 2RCNA 4LGMA 2OLJA 4W9MC 1XPUA 3RANA 3WHLA 4Q9KA 1SHKA 4MRPA 3DVLA 1Z08A 1JPNA 2VP2A 4UXHA 1Z83A 4JLJA 1HT2E 1WA5A 1YRAA 4N0EA 4EQ6B 5KYKA 2GXQA 1DVRA 4TL9A 1MH1A 4JLDA 3KXIA 3NHAA 4OHXA 2RGGA 1QVAA 1Y3AA 2W00A 1NVVQ 4ASUD 2IHYA 1ZNZA 4MDFA 1JI0A 4BGDA 4HUQB 1T4GA 4A8JC 2RAPA 2NZJA 3BK7A 4DRZA 3ADKA 5A4JA 3GLGE 2AWOA 3N70A 2B8WA 2GESA 4HDQB 3R9XA 1K5GA 2EFDB 1QHSA 3IPXA 2PCJA 3H2YA 3O8BA 2CHQA 3VR3A 2ZS9A 5FBQB 3CBQA 5J4VA 1G4UR 2GETA 1MR3F 4ILEA 4JLOA 4G5QA 5G3ZA 1YZQA 1CRQA 4Q4JA 1HYQA 521PA 1E2KA 4DCTA 1W4CA 3SDZA 2IYRA 4DDWA 1RYFA 1GTVA 2ZTSA 1N2CE 4TSFA 3VR5A 1XCGB 2ODBA 1QRAA 4A15A 2OHFA 3D7MA 1P61B 4RKEA 3U7EB 2BMEA 4BFUA 3AF4A 1R0ZA 3L0OA 5FOSA 2AHOA 5CIQA 2PL3A 3L43A 4RD1A 4D0NA 4FXPA 4IDOA 2WSMA 3IEUA 1OYYA 2W58A 1GG2A 1GNQA 4EFNA 5J4LA 3GP8A 4AKHA 3DZ8A 4MYCA 4A2WA 1JBKA 3TW4A 3LH5A 3C15C 3SNHA 1IN5A 1NY5A 4YONB 1G1MA 3EARA 4C7OB 5G3YA 3DHWC 4II7A 1EFHA 2L0XA 2O8EA 2Q21A 1P60A 3K9NA 2A5GA 4CT5A 4WA7A 1OH7A 1UEIA 3GJ6A 1QHHB 3MJRA 3NDBB 4C3ZA 3WHKA 4GNKA 4WXPA 1LFDB 1AZTA 3CF6R 3HYTA 3V4RA 2IYWA 4HB3A 1GIAA 1QHHA 2JLWA 1UPTA 4JKIA 1KSHA 2GCPA 2NQ2C 3WXMA 821PA 1IONA 2IT1A 2OBLA 2XNDD 4HAZA 3RLFA 1ESNA 5CLQA 1SULA 2GK7A 1OYWA 5JI2E 1AS2A 1T6NA 4KU4A 3A58B 2W83A 2OFXA 3TR0A 2HXYA 3DO6A 2R9VA 3E2IA 4KFSA 1U90A 3PXGA 1XMSA 4M2LA 4Z51A 2PZFA 1VDZA 5IK2A 4LC1A 4QJ4A 5LD2C 2VP9A 4LHZA 1JEEA 5FOWA 2J46A 4B35A 1ZM3A 1E9CA 4AD8A 1L2TA 2YHSA 1Q57A 4Q9HA 1E2LA 3PEUA 2IYYA 2IF0A 4YMSA 3K0EA 1Q22A 3TQFA 4NYIR 3ZGXA 4JBXA 1OB5A 2IUUA 1K5DA 3W6OA 1ZAKA 5KDOA 3K09A 4B44A 4LSGA 3K9GA 4BLSA 1LS1A 1SXJB 4PAOA 1CJKC 4LI0A 1FNNA 1SZPA 1G17A 2WWIA 4PANA 1ZM2A 3HU1A 5AUNB 1G8FA 1Z22A 4KFTA 4JVMA 3QI2A 2BDTA 4R2IA 2ANBA 3THXA 2FEMA 4NMMA 1W48A 2ZRKA 5KO2A 1RIFA 4JVNA 3U44B 3CRW1 1CU1A 3NBZC 2QTVB 1Z6GA 1Q1QA 2D62A 2F1IA 1CIPA 3K0SA 1JB1A 3Q7PA 1A4RA 2IUTA 1XDBA 5L3VA 2GZDA 1W47A 2XGJA 4KAXA 3WP1B 1SVOA 4YXWD 1CR0A 1JR3E 3T15A 3B7GA 4Q1BA 5CIWA 3BWDD 3I3SR 4JIMA 4PXAA 1MT0A 4DLVA 1MO3A 1T3HA 1R6BX 3DEFA 2AFIE 2P67A 5AUPB 5JMTA 4AY2A 5B64A 1FZQA 3SE0A 4DZZA 2ZE6A 3KKNA 1E79D 2JA1A 5E3HA 2WPDD 1BMFD 5FOUA 1U9IA 2ZROA 2ZJBA 1XF9A 2JLRA 1HEIA 2X2FA 1Z0FA 2OZEA 4MH0R 1F60A 4NH0A 1OPXA 4WBSA 5IF9A 4LYJA 1G20E 5CK4A 3VR2A 1EX7A 1KI6A 3W3AA 1AS3A 1NKTA 2PX0A 4PZLA 2NZ8A 2IYTA 4Q7MB 2GXSA 1NVWQ 5HCIA 4D81A 3K53A 3P32A 4LBVA 1YR8A 3TR5A 2I1VB 1SHZA 3MFYA 3ZIAA 2WWYA 1E2MA 2CNWD 2C9OA 2P6RA 1NVVR 221PA 4URVR 4B2PA 2IYXA 2O8DA 2O0HA 1UDWA 2AXNA 2IEYA 4L16A 3ZZUA 4ITRC 2A9KA 1OKKD 3PENA 4LHWA 1AGRA 3WBJA 2O52A 4DDVA 2VA8A 3Q5DA 1KSJA 2QA5A 5FUYA 1A1VA 3GCGA 2ZSEA 2BJVA 2ERYA 4TL6A 3QUSA 2OUKA 3TKLA 3C5CA 5EP4A 3WYFA 4DDUA 4IRUB 4DBLC 4TYNA 4MKHA 4DB4A 1FTNA 3IHLA 2EU8A 3WRYC 4ARZB 3CX7A 1FL9A 3M6AA 4M1YA 5DHFA 3RWMB 3PEYA 4RD3A 5B2ZA 3JZMA 4TN1A 2GXUA 1Z6TA 2C98A 2NO9A 4FMCB 1Z29A 4P4TA 3FE2A 5D3MA 3DM5A 4QNMA 4TMTA 4U5XA 1XEXB 2KSQA 2ATXA 1ETUA 1YJ5A 4LJ6A 2IC5A 2ZRBA 5EP3A 4CT4B 4ZDJA 3FPAA 1KI7A 4LJ4A 2FV8A 2WTUA 4FI3C 1Q20A 1G19A 5KHOC 1P2TA 3M1IA 2XITA 2VP0A 1OIVA 1KJZA 5LDDC 1R2QA 2VH5R 3H4MA 2DWOA 2Q9CA 2ZE5A 1US8A 1OFHA 1YU9A 2F3TA 4MGIR 1I4LD 2GNOA 5TARA 2K5UA 2ZSAA 1EFRD 4F4JA 2MSDB 3QBVA 2H16A 4NHOA 5TVKA 3LNCA 3M0EA 4IKEA 3K0FA 3OIVA 1A2KC 4LBZA 3B1ZA 3AKEA 1N3BA 1OSNA 2REXB 2B7BA 4JS0A 4H9GA 4QNRA 5JRZA 1UBGA 3IGFA 4D4KA 3GLGA 3WMGA 4LV5B 1N5KA 2KB0A 3P26A 4PFSA 3ADDA 3U5ZB 2WPDA 3CO5A 1CTQA 2FNAA 2UKDA 2VSFA 3PUYA 1KDPA 4E09A 5K8IA 3B1YA 1Z0KA 3KQLA 3QF4A 4V0NA 5IK2D 2I4IA 3NXSA 2GCOA 1SKYE 3AVOA 1LVGA 1VPLA 4DCSA 3KQHA 3OE7D 3V9PA 4RFSB 4RCZA 5UKDA 2WOOA 2IA5A 1XXHB 5A0FA 2F7SA 1F2UB 2VP5A 1RYHA 4DEXA 4FMDB 4PSVA 4C0LA 4US0R 1MO5A 4LYFA 2O8DB 3EPKA 1U0LA 3A1VA 4EIWA 2PMDA 4LBYA 3SU8A 4OL0A 5EE0A 3LD9A 4PPGA 2WMNB 3EXAA 5FL7A 1K6MA 5CITA 1P2UA 3QXJA 1GRQA 3EAQA 4HLUC 4M9SA 2QEQA 2DY1A 1XZPA 4Q7JB 2VHQA 1RPZA 3AVXA 2KWIA 1E4VA 4EDHA 3SJBA 3DL0A 1NIPA 2H7VA 4XIGS 2BBSA 3KDSE 4EUNA 3U4QA 2ODEA 3ND9A 1ZNYA 2ASEA 1EWQA 3QVUA 4YMUA 1N5LA 4KSCA 4WZ6A 2ZRDA 3GQBA 2JLVA 3W90A 2JJ2D 3P4YA 1R7RA 2CHVA 4PSKA 3WP0A 1AKYA 1W0KA 1OFUX 1OH8A 3R9IA 5E7JA 3I8SA 3EX7C 1XD2B 4JT2A 1UF9A 4Q48A 3A4NA 4B3BA 4FIDA 1VG1A 2Q9BA 4ZIRA 4Q1CA 4B43A 1YR6A 5FBRB 4U02A 4HAYA 2AX4A 4W5HA 1TQ2A 3W8NA 4NCKA 4KFRA 3VR1A 1DAFA 1P9RA 4PC2A 4CZ2A 2QAJA 4Q7LA 1E79A 3GLIE 2OO7A 2QTHA 3U44A 1QHGA 1XP8A 1I2MA 2SHKA 1GKUB 2BBWA 2ZI3A 1M7HA 1M34E 3AV0B 3JZAA 4JLAA 4ZPXA 4D80A 4PO9A 4B3DA 1UADA 4D4LA 1WBBA 2ZQ5A 1YQTA 4P3YA 1CKEA 2DWQA 3BH7A 1GRNA 3KXKA 5B30A 1PVOA 1XJQA 2F1HA 4XWOA 4GP6A 1OHHD 2OE2A 4B3FX 4F93B 2HXSA 3T5DA 1LV7A 4D26A 4US1R 3BC1A 1S2MA 3QE0A 2AD5A 1XEWY 4PPQA 4BWYA 3SYKA 3OHMA 3U3RA 1R5BA 2ATVA 4OHZA 1GUAA 2JDIA 4QC2A 4C0SA 2J45A 3FB4A 2C04A 1ODFA 4P0TA 1GNPA 2JIZA 4NDZA 2YC2C 2F1RA 1X8LA 3SBEA 3AF1A 5HCNA 1Z6XA 4HATA 3K8YA 4KV9A 3A1SA 2CLSA 2RHMA 3W34A 1AK2A 4CYMA 4D0LB 4BLRA 3U6KA 2AK2A 1AA9A 2GVZC 5AJZA 4QGFA 1JXOA 1NVUQ 3RDPA 4ZI2A 2FPLA 1G6OA 5EJEA 1GOTA 1Q1BA 5H70A 3SEAA 2N1BA 1NKSA 2JJ1D 1KI9A 4Q1FA 3DZDA 1Z06A 2R6FA 4A6PA 4HB2A 1O87A 3O47A 5JBQA 1OE0A 1MABA 1JJ7A 1PUJA 1ONBA 4A0HA 4E07A 1DADA 2PJZA 1OFIA 5EXPA 1KY2A 1NBMD 2QMHA 3A36A 4AWXA 2H92A 3H0KA 2FFAA 1W36B 1YZKA 4BFWA 4NKRA 2WAYA 1ZNXA 2E87A 4HLQB 4NYMQ 2IXGA 1DAIA 1JR3A 3A37A 3T12A 3QKRA 1KSGA 2BC9A 3FGNA 3MUFA 4M1WA 2W2XA 2CVHA 2CE7A 2V8OA 1EFTA 5KNBA 2E1RA 4MDEA 5DH9A 3EPHA 3RRNA 2J5XA 4CEIA 1FOEB 3KQUA 2QORA 3ADBA 4PO8A 4GDFA 4BLOA 2HDNB 2QL6A 4OHYA 3VR6A 5AR1A 3W5IA 5BYKA 4V02A 2ZRAA 3C4JA 5EUMA 3THOA 4B76A 1BH2A 2QZ4A 3FTQA 2W2VA 2G6BA 4UJ3A 2YNMA 3RHFA 2REOA 2YKGA 1LNZA 4RZXA 3D31A 2WIBA 1Q12A 1KI2A 3FHCB 1FMLA 2ZPTX 2BIFA 1US8B 4QBFA 4A2PA 2G0TA 4TLCA 1CP2A 2OCAA 4E5UA 4DVGA 4A0GA 4IXNA 5CK5A 1W0JA 1MV5A 3B1WA 2J7KA 4PHGA 5EP1A 1XJ0A 3M4YA 4O0MA 4UNQA 2WAXA 2IL1A 2VP4A 1OKKA 2UZ3A 4Q4HA 1EG7A 4HYYA 4TSFD 1KNQA 2QT1A 2QBYB 4RY2A 3A1WA 1SQ5A 1ZD9A 2A5FA 3VX4A 1XTKA 2J87A 2VF7A 4A2QA 5AJYA 1E9RA 5F9HA 1G7RA 4Q4AB 2V1UA 1XMIA 3FDIA 4P31A 1NJGA 1Z2CA 3IUYA 4NP6A 1J99A 1E69A 4DCNA 4ACBA 1HV8A 5GADl 4GRAA 4C0QC 3SQXA 4DJTA 4HSEA 3AGPA 1O3YA 2CMKA 3L8YA 1QHYA 2F43B 3CR8A 3NBYC 3EWAA 4LHYA 3KB2A 2ZUCA 3S1AB 5FR1A 1G5PA 3EIHA 4DSTA 4GL2A 4TTPA 3AVUA 1W4RA 3KFXA 4GOKA 1CULC 1E9FA 1ZU4A 1E2EA 1MABB 1E1RA 1KHTA 3BB3A 1F48A 2A78A 2BV3A 3AVVA 1MKYA 3MG9A 2GF9A 1ZW6A 2WJHA 4UXJA 2B8TA 3B9QA 1VYUA 4I99A 4KYUA 1KMHA 2XSZD 3PUXA 5AWFC 1WRBA 3U7GA 1ZUHA 4A4DA 1E2IA 3N5CA 4UNSA 3HPRA 4QRHA 1TQ4A 2BBTA 4IOMA 4HLCA 1D9XA 1G3RA 2FZLA 3KTAB 4HB4A 2C9YA 1X1RA 2DBYA 5G40A 3X1YA 2BCJQ 1TQ6A 5FUXA 3ND8A 2BM1A 2FGKA 1TU3A 1P2SA 1E9BA 2R44A 2ZRHA 4FW9A 1E2DA 2JGNA 2YOGA 1KJYA 2ZEJA 4F4CA 1NSFA 3R9WA 4IDHA 1R5NA 1QVRA 3O8CA 5LD2B 4ZI3A 3I62A 1WMSA 3I32A 2AD1A 4KYIB 3KZ1E 4XTCS 3B82A 4Q4JB 4GFDA 2QPOA 1H8ED 4JZKA 5FPHA 3ZZTA 1IQPA 1SVMA 5FPSA 5HZHA 1M7BA 3LW7A 4FCVA 3PUWA 1G5TA 1OFTA 1E9EA 1W0KD 1X8KA 2ZR7A 4JL8A 4Q9JA 3UMFA 2PEYA 4NCHA 3BH0A 3T1VA 5FUVA 3W3ZB 1G7SA 2IW3A 1KNXA 3ZVNA 2QSYA 4LBWA 2JLUA 5BN5A 4Z8YA 3QSYA 2XEXA 4C7OA 3SS8A 1IAQA 2I3BA 4JLVA 3UANA 2HF8A 4IFEA 3NH6A 4PSAA 2OCYC 5LBIA 2NO1A 4IEIA 3C7KA 1FX0A 1QDEA 1TADA 1ZD8A 3SC3A 4C4PA 4DLZA 4NCNA 3LBHA 3EW9A 5FBLB 1N5JA 3A8TA 5TXGA 2QMOA 3LV8A 4FWTA 2LKDA 2GJ8A 2P6NA 2IX3A 3FHTA 4YQFA 1KK3A 2R62A 1DAHA 1P73A 5GVRA 1J8MF 1Z47A 3QKSB 1ZU5A 4RJLA 1SVLA 4BFYA 4OQLA 4KSBA 1MOZA 1TF7A 2D74A 1BOFA 4B3GA 2MSEB 4TYWA 4Q1EA 1G8HA 4A0RA 4P4UA 1DO0A 4YC7A 3QXCA 4EFLA 3KJIA 3UKDA 2HV8A 2X2EA 2RGBA 4Q19A 4QG7A 3T34A 3OEHA 2YZ2A 2P65A 2CL7X 3T61A 3MAAC 3E5HA 1I4DD 4B48A 1G21E 4C2TA 3EC1A 3NIBA 2GAAA 2VF8A 4URWR 3MRSA 3BJIC 4LJ8A 1G3MA 4MRRA 2ECKA 2QGNA 3KKQA 3BFVA 4JJZA 4Z8XA 2PLRA 3F5FA 4R98A 1LB1B 4YXWA 3BOSA 5HE8A 2VEDA 4OJQA 3KKPA 5JWOA 1KKMA 1H8EA 4B33A 2R6CA 1XU4A 2J3EA 2QN6A 5HR5A 1YZGA 2EFHB 3AP1A 4EJSB 3B6EA 4PAQA 2CBZA 3B78A 4NYJQ 5CJ2A 2R6AA 2A3RA 2YOHA 2AKAB 4QGAA 3VHLB 4LX0A 4S35A 1T0HB 2ZSDA 1TU4A 1FQKA 3PIRA 5E95A 1T91A 4AI6A 5DNYB 3SI7A 1HE8B 4TTQA 5CB8A 4HLUA 5M04A 4GSYA 4EAQA 2XZLA 2HYIC 4PHTA 2V6JA 1E94E 2PT7A 1G7TA 1WE2A 2EYQA 1KOFA 1P72A 1T0JB 1H65A 4UKDA 3R20A 1SGWA 3QPWA 4I1VA 1QG4A 2JATA 2V3CC 2G88A 2J9RA 2GA8A 4PC1A 2PLFA 4QM6A 3KXLA 3QEOA 3I61A 1WDTA 1S3GA 3SBDA 1N6RA 1NLYA 3MWJA 5FL7D 4B32A 4Z1MD 3BORA 1HH4A 2DFKB 4JYCA 1W1WA 4QGHA 3C16C 4KXFB 3HDTA 5JFGA 1GWNA 1FFHA 4O25A 3A4LA 2JJ8A 2CK3A 3IILA 3NC1C 4IOLA 4TLBA 1S4QA 1UJ2A 4MKFA 1EXMA 3AF0A 1N5IA 3ICEA 4TLDA 3ZQ6A 4N0DA 3I5XA 3GJ4A 3BFXA 2PX3A 3L8ZA 4B47A 2JJ2A 3QKSA 1OIWA 5FFMA 3TVTA 1XEWX 5JSZB 1KI3A 2NPFA 2ODNA 4OI2A 3REFA 3G0HA 2OSBA 2RHDA 5DGXA 4B2LA 2QNRA 4LWZA 5FTMA 5FTJA 4D4JA 3U4QB 1RRCA 2CCKA 4AYWA 2PZGA 3Q9LA 4N3NA 2CL6X 2J7PD 5HTKA 5IT5A 5JJKA 3BD9A 3GJXC 1BKDR 4JL6A 4M0LA 2AXPA 4XD7D 1JXMA 3GLHA 2VYFA 2ZVQX 2D2EA 3MWYW 5FUWA 4QHTA 1VG8A 3A1UA 2H8KA 5K8LA 3HU3A 4PC3A 2OBNA 2QPTA 3IIJA 4LV6A 3AF3A 3BERA 3VU9A 1N0VC 4RVCA 5BXQC 1CXZA 2O8BA 1Z2AA 2QU8A 2OCBA 2QE7A 3RVBA 2CLDX 4IDQA 3TH5A 4ZCMA 4C0BA 2EVWX 5FR2A 2NPIA 5JEDA 2IYSA 4D25A 1YVDA 3RABA 4HAWA 3TW8B 2OESA 4RFVA 4LHVA 3CM0A 2OFWA 2GZAA 4RKFA 3SJZA 4MYTA 5FTKA 4IOKA 3LWNA 2WKQA 5LPNA 3BB4A 1ELOA 2DPXA 1XMVA 2JLXA 1ZM4A 4FCWA 1A82A 1WCV1 3QBTA 2GJSA 2A30A 1CR1A 3AVTA 4CEIB 2ZS7A 4MRNA 1Q3HA 1ZINA 3WYGA 3I5YA 1XCMA 3RS2A 3X2SA 2RGCA 4HAXA 4PR0A 5EZ5A 2CLCX 4LDJA 3CRQA 3PVSA 5IHPA 2J1LA 4Z54A 2DFLA 2FPMA 2WBLC 2YINC 3TSWA 1M8PA 1N6IA 5HKKA 5EQTA 4E03A 3TE6A 1FTSA 3ZVMA 2ZU6A 1M7GA 2O8FB 2GXAA 4YMVA 2RB4A 3TK1A 4EJSA 1AM4D 2OM2A 4GBMA 4JSTA 3UMRA 2R6DA 4BFSA 3LXRA 3DOFA 3E70C 3PV0A 4LCBA 1G18A 4Q4HB 3W9YA 1JECA 4XSHA 2BVNA 1U2RA 5DI3B 2ZITA 2Q9AA 3RYTC 3ZH9B 5DN6D 5L8VA 5E7IA 4B3CA 1KO8A 2R6GA 3KFVA 1U98A 4M22A 1TX4B 4G5OA 4LJ9A 1EX6A 1KI4A 4D6PA 1DBSA 2CCJA 2TMKA 4Q1DA 4B71A 1MRSA 1XRJA 3CH5A 1EFRA 1T5IA 1F6BA 4KCGA 3TRFA 3ZLJA 1Z8FA 2G77B 1I2DA 2QG6A 421PA 5KSZA 4X8HA 2NMVA 2W0SA 2ANCA 1P75A 2XX3A 3LA6A 5JSZA 3QIAA 1GFIA 3ZZ0A 2ZRJA 1Q3TA 3BS4A 4OI1A 2PCLA 1J7KA 2IXEA 4HUQA 1IN7A 2OAP1 1E99A 3DOEA 5C18A 3SJCA 4AG6A 1X8JA 2FGJA 4DCUA 4U7DA 3DMNA 2QPAA 1XPOA 1HT1E 4URYR 1P62B 3EIEA 5KDLA 4BQSA 1FMJA 1YE8A 2CDNA 1RRPA 3H86A 2B7CA 1E2GA 4KITB 2KBEA 1GRRA 1IY1A 4KLNA 4X8LA 1QZXA 4QL3A 4R7ZA 4ASUA 4DHEA 3FMIA 4L15A 1T5LA 2CCGA 3U60B 1DG3A 4M1OA 2FWRA 3RAPR 1OB2A 4DLSA 1JAIA 4F92B 4CF7A 1WBDA 3GLFE 4RD0A 5BWMA 2XXAA 2ZVPX 3G5UA 5FTLA 3RS0A 4RFSA 1D6JA 1JR6A 5KOYA 1V5WA 4JVSB 4LJ7A 2DFNA 1U0HC 4MGKR 1LY1A 1SVSA 2WWXA 3TQCA 3K70D 1XJCA 4AK9A 4PC6A 3OF5A 1NY6A 1Q21A 3VKWA 1E6CA 1N6NA 2IF2A 3CNNA 2IEZA 3WNBA 4D82A 2FX3A 1CJMA 5HE9A 2B92A 1ZD1A 1G8YA 1T8UA 3AVQA 1BMFA 5H68A 4GMXA 1OXUA 4XH9B 2HUPA 2ZJZA 4M9XA 1XTSA 2VSOA 3BAFA 2XSZA 1CJUC 2O8FA 4IHQA 4M4SA 3GLHE 3LRPA 1DPFA 3KKOA 4OQNA 2QAGC 4B73A 3R7WB 1RRFA 3K0FB 2XZOA 5CYOA 4UNPA 2X77A 4PZYA 4I4LA 4WW0A 1FX0B 5EE9A 2ORIA 2C95A 3NTUA 4YDSA 1HQYE 4Q00A 1P9NA 3OEEA 4TT3A 4O2RA 2O8BB 2WVJA 5GJVC 1P3JA 1U8AA 2O5VA 4Y0AA 1AQYA 2YVUA 2ZRPA 5DSZA 1VG0B 2BMJA 5AJWA 4JJKA 3X1WA 2IYUA 2G3YA 2J0QA 1KSFX 1R10A 4TLEA 4LYHA 2BMDA 1U81A 4LY6A 5JRJA 2ZAMA 2ZJYA 5FL3A 4NPHA 2ZYWX 4A9AA 2HCJB 4XWAA 2O8CA 3OESA 4PQRA 4BLPA 1OJLA 2NTYC 4IXMA 3OFNA 1IBRA 4DEYA 2VHUA 2O8CB 1XTRA 2NO7A 3EASA 1G3QA 2RGNC 2IWHA 5A5GA 3TNFA 1DOAA 5JCPA 1NN5A 2FE4A 3CNOA 1T8TA 3D8BA 3CWQA 2WSSD 721PA 1DEKA 2D7CA 3U3KA 1IJFA 4ACAA 5KNCA 4Q02A 4JSYA 1PLKA 4NTZA 5C1BA 1VCOA 3CX6A 5J47A 1KO7A 2ONKA 1D5CA 1U8ZA 2JEOA 4F4IA 4TZ6A 1C4OA 1E2QA 2CNWA 2R65A 2MMCA 3UWOA 4OQXA 4OHWA 1KTVA 3I92A 1GL9B 1OV4A 4ARZA 3R8CA 4FMCF 1XXHE 4XJXA 3QG5A 2GJKA 2V7QD 2PEZA 1TMKA 3C8UA 4MYHA 1IY2A 1UEJA 2Z4SA 4ZKDA 3WRXC 4EPYA 3QXHA 3QXSA 1XEXA 2FSFA 2VP6A 3GPLA 4DSUA 3CZQA 3IIMA 1YHNA 2QGZA 2X8AA 4FCTA 3K0CC 2FFQA 2Q3FA 2P0EA 1C9KA 4F38A 1COWA 4UNRA 4DT1B 5H8WA 4DLRA 4IFBA 3BRWD 4C9BA 5FPTA 1CS4C 2BKUA 5CM9C 2Q6TA 4HZIA 5JJLA 1KIMA 1GKYA 3VHXA 5JLJA 4KHZA 4C0HA 3FOZA 4KJZA 1E2FA 3O8RA 3PJRA 2DB3A 4QGGA 3R7WA 4QBGB 1FNMA 3TBKA 3GLHB 4B75A 1D9ZA 3Q72A 4Q7KA 4DXAA 3VTKA 1WB9A 3BH6A 2ZJ2A 3VMFA 4ZKEA 2ZRCA 4NYJR 1VHLA 2AFHE 2VQSA 4JKYA 4ZO4A 2H17A 2P6UA 4URZR 1YZNA 2HCBA 4E22A 2FZ4A 2NO6A 1OLOA 4CVNA 1ZRHA 3FFBA 4P32A 2WIAA 4XD7A 4ON9A 3GLIA 4PPFA 4NYMR 8OHMA 4BZPA 1QHNA 3U3OA 1W2HA 2BMFA 2QRNA 1EFCA 1P5ZB 3Q85A 5FOXA 3N2EA 4ABYA 5ANRB 3Q8XB 1HTWA 2IYQA 3AB3A 3B1XA 4G5GA 1Z28A 3OEED 1D2NA 3DMDA 2BJWA 4TT3D 4ZCLA 2LWIA 4MRSA 3X1ZA 4AYTA 1LW7A 1IHUA 3THYA 3THWA 4HB0A 4EPTA 5CDFA 5D3QA 3OIWA 3Q5EA 1ZBDA 3PITA 4C0KA 1KK1A 2A2ZA 1U99A 4I1SA 4PC7A 4RD4A 5TV2A 2H5EA 3EIQA 5SZHB 3NG1A 3AF2A 1GILA 3QPVA 4IVRA 1XTQA 3KL4A 3Q3JB 3RS3A 2FJUA 1DARA 3QPUA 4QM7A 2AWNA 1S1MA 1NLFA 1ESMA 3MSXA 5CLLA 2PZEA 5JHGB 2JAQA 3CRRA 2VPPA 2RGEA 3K70C 4W7SA 1KGDA 1OH5A 3TSOA 3A4MA 4AIIA 2EYUA 5HKKD 5JS7A 2BKEA 4X8MA 4G5RA 2CK3D 2YC4C 3HWSA 3FKQA 2GEDA 3IBGA 4G3XA 2R8RA 4PO1A 2EFCB 1DG1G 2C2HA 4RZ2A 4NU0A 1GVNB 1PJRA 3PUVA 5J4YA 4B3XA 5EXXA 4POAA 2AR7A 4EJSC 4HUTA 2HLDD 3I8XA 2CEAA 1S3SA 1TF5A 5FH9A 4KLZA 1NN0A 2WV9A 3ASZA 1W2GA 2FF7A 4KBFA 5EZ6B 1NG1A 1N25A 2QSZA 2WWHA 3IDQA 2IYVA 5E7MA 3HP1A 5KPDA 3QQ5A 3TUIC 4RCYA 1MO6A 1Q0UA 2YWHA 3SN6A 5DO9A 1KO4A 1P7CA 3G82C 4GZMA 1KKLA 1BYUA 3RNLA 2GJAA 1QF9A 1Z6AA 1UM8A 2EFGA 2CJWB 3CNLA 4AKEA 2HT6A 4K8OA 4Q01A 4MGZR 3ZDQA 1TL7C 4BRWA 4QHYA 1U0JA 2RGDA 1XWIA 4KI0A 2FH5B 4FWIB 2REBA 2GBLC 1UKYA 2Z5FA 1W5TA 1TQDA 3UK6A 2WJGA 3IO5A 1F2UA 6Q21A 1TEXA 3RS7A 1XXHA 2GDJA 5JHHB 4PPNA 3R8FA 4D0GA 2P2LA 3I72A 1HURA 3K0AB 3EPJA 3EZ6A 3U61B 5JS8A 4OI4A 1N6HA 2WKRA 4AG5A 1TPZA 3V4FA 1KYIA 5AJXA 4OYHA 5FBWB 4AKIA 2GKSA 2VLIA 2H18A 4GPTA 5K8UA 1G291 1YRBA 3DKPA 1NJFA 2VSXA 4XTRA 5JWHA 2XXAB 4JBWA 3KTAA 4B2IA 3B60A 4JBYA 3EPLA 2OT3B 3OZXA 2XJ4A 3W6PA 2C03A 2HJVA 2Q0HA 2DHRA 5J4HA 5DE3A 4D2IA 4QFMA 5B58C 4FMBB 2ZRGA 1SVKA 3BFKA 4TL7A 4Z1MA 2WZQA 4M53A 1JEDA 3B1VA 2O0JA 1W44A 2FSIA 3LBNA 3K0CA 4XVQA 3TAHA 2FDCA 1S1CA 1IN4A 1JR3D 4NYIQ 2F55A 1KI8A 3K9HA 4US2R 1QHIA 1W7AA 1E4YA 4P33A 3KQKA 5LB4A 2A5DA 3P20A 2H1LA 3LW8A 3ZVRA 1NRJB 4BUJA 4L8GA 3GFPA 3T1QA 3T06B 1COWD 1GAJA 3QJYA 4LPSA 1IY0A 1AS0A 3CKLA 1F5NA 3P27A 1VCIA 3C41J 2QAGA 4OK5A 1II9A 4I1OA 1G3UA 2V55B 5DN6A 3PEWA 1OXXK 3KJEA 3UATA 2GEVA 1Z63A 4Q4LA 1PLJA 4OBEA 2IS1A 3VNUA 1FUKA 1M6NA 3GMTA 4A6XA 3CONA 3DPUA 1YR9A 3ZS8A 1RFLA 3ZIAD 3BIFA 2KE5A 1IN6A 3GJ7A 3UG6A 4KFUA 4GOXA 2BCGY 2J0UA 4ZIRB 1E0SA 1L4YA 1Z0JA 2W6JD 3LQQA 4RZ3A 3RS5A 4JLKA 1ZCAA 4DC9A 1NNEA 4Q18A 1Q1ZA 1KZ7B 2JCSA 1KI6B 1ZC3A 3RSLA 3KB1A 1GP2A 3SYLA 2BBOA 1S0UA 5G41A 4OI0A 3A6PC 1L7VC 2NGRA 5JWRA 2ZRLA 4QBHA 5EUQB 1SVWA 1UFQA 4TTRA 1DTSA 2CJWA 1AKEA 4DUGA 5KSYA 2GILA 3VKHA 1BO6A 2QP9X 1EK0A 1A2BA 1CR4A 2QMEA 4L4UA 2IS4A 3EA0A 5FOVA 3GLFA 3QVVA 4MA4A 1NN3A 4EPVA 3RSOA 4IDNA 5GVSA 2NG1A 4OQFA 5E4FA 3TIFA 3SZRA 1NIJA 4AURA 3AH8A 3FMFA 4K81B 3WNDA 4RD6A 1P9WA 2YYZA 3VX3A 2NOAA 3KUCA 5L3SB 1TNDA 2HJGA 4L5BA 4YLGA 4QKQA 4R71A 1GITA 4NZYA 4TLAA 1SKQA 3REGA 5FI0B 2W0MA 2ZI7A 4MGYR 1FP7A 1FUUA 2ZU0C 2FSHA 1H8HA 1QBKC 2DFTA 3QENA 3B13B 1NVXQ 4M9ZA 2XAUA 1W4BA 3WMFA 1VCNA 1UKVY 5TDHA 2DCUA 4ESHA 2QM7A 3NVAA 2DWPA 2D4HA 4PHHA 5EE5B 3QKUA 4BFVA 1MRNA 5TB5A 4H1UA 3EG5A 5JZVA 4N1AA 3AKYA 3S1AA 2FMXA 3SFVA 5B57C 3D6TB 3DM9B 4BRUA 2X1VA 3GJ5A 3HR8A 4M1KA 2DYKA 3FMPB 3K09C 4WVFA 4PQFA 3GFOA 2ZM5A 5KNDA 1M2OB 3PEVA 5AUQA 2O8EB 4A1FA 1W36D 2EFEB 2ZR0A 3NWJA 3QG1A 5DYIA 4Q9LA 4HAVA 3K9LA 4TMZA 4G01B 4CEJB 1G6HA 3L2OB 4PZZA 4H1VA 4TQUS 3LDAA 2WJIA 1G9XA 2QAGB 1N6LA 2LKCA 1XEFA 1KZGB 2AK3A 1S96A 2A7QA 3KQNA 4CEJA 1DAKA 2EWVA 2HYDA 5CB6A 1KDTA 4GZLA 4M9QA 4I81A 1AJEA 1PUIA 4LJYA 2RH5A 3P1JA 4NL4H 1F2TA 2Z6VA 2ZS8A 4GMDA 4QOSA 3UG7A 1IJEA 1KI1A 1Z5ZA 3SHFA 3K70B 4Q03A 1FQJA 2FPKA 5BN4A 3MWKA 4B6FA 4WZBE 4ERNA 4DIEA 4DWJA 1VYTA 4YMWA 1II8A 1N6KA 2XOKD 2ZR9A 5F2EA 4ZCIA 2ONJA 4EKDA 5FI1B 5DHAA 3KUDA 1DAMA 4CGZA 1E0JA 2MSCB 2ZJ5A 4X8OA 1UKZA 1SVIA 4LJAA 4Q66C 1JPJA 4MKGA 3U7HB 4EFMA 1VECA 3TUJC 2WOJA 1TF2A 1ZIOA 4AKGA 4URXR 2V54A 1G64A 1CBUA 4J0QA 3F8TA 1E0AA 5SZKB 1VIAA 2WWWA 3NEJA 1GSIA 2FFHA 1LTQA 2ZE8A 5KSOA 5F3WB 3FMOB 1RC8A 2PMKA 1WP9A 1KAGA 2EQBA 2CL0X 1PV4A 2O0KA 2GK6A 2KI5A 4XVRA 2RKOA 1E32A 2WHXA 2GAOA 2NO0A 4BZXA 4JMPA 2WSSA 1KMHB 2G9NA 3MWLA 3FFAA 4C30A 4BLQA 4KVAA 1HE1C 1XD8A 1E9SA 1YZLA 2J0SA 3UMSA 3U3JA 2RGXA 2QROA 2OXRA 3CF2A 2YOFA 3PR1A 1P4SA 3I73A 3LFUA 1KY3A 3QXXA 5GJWC 3ECCA 1Z3IX 4CDGA 1EWRA 2A5JA 2C96A 3DKVA 3A1TA 4LK2A 3AM1A 3U6BA 3EA5A 1XFAA 4FN5A 5GJBA 2WKPA 4CEHA 621PA 4M8NE 1XTJA 2PJRA 1WQ1R 2XTNA 2D06A 2GJ9A 4LPKA 1J2JA 3CF0A 4WXRA 5K8TA 1E0KA 1BS1A 2ZANA 1R0YA 5JCZA 2OLKA 2OFOA 1ZCBA 2CE2X 5C4GB 2QRZA 4EPWA 5FOTA 4Q21A 4DT1A 1NL3A 2YWEA 3B85A 4LYAA 1Z0DA 1M74A 1JNYA 3QEJA 2UZIR 1XCPA 3MCAA 1Z0IA 5BN3A 2F3RA 4KODA 1GL7A 4DSOA 3HYRA 4BEJA 2IS6A 2QQ0A 5CDFE 5CM8B 4Q47A 4RD2A 1Y63A 3LBIA 4HEJA 3C14C 2FEOA 3HR7A 2IS2A 4OHVA 1KDRA 1TEVA 1D8TA 2FFBA 1EFUA 3B5JA 2ZRFA 1P6XA 4FMDF 4MUAA 3T1OA 3ICQB 3U7FB 2RGAA 2IBMA 3JVVA 2J0VA 2V7QA 2ZYTX 4JVLA 4Q4AA 1L8QA 4U00A 1KMQA 2BWJA 1IXZA 2C8VA 2YV5A 4A82A 1ZUNB 2D7DA 4BPBA 2W6ID 4TMVA 2HT1A 1E2HA 3LAWA 2N46A 2CXXA 2QBYA 4TYYA 3L0PA 3EZ9A 5KDDA 1NG9A 4DUGD 5HZKA 1PLLA 1KJWA 1E9DA 3TLXA 2ZYVX 3GJ8A 2C78A 2ORWA 3OFND 4V0MA 2Z83A 1OIXA 1KAOA 1TUEA 2UVQA 3D3QA 1E2JA 5F98A 1UBCA 1ZC4A 2GEUA 2Q3HA 1OT3A 1KK0A 5SZIA 1NBME 3CIOA 2QTFA 4JLPA 5KPJA 4HI0E 5JJIA 2IK8A 1XNJA 2C99A 1DO2A 3LX5A 5AJVB 1W46A 3NBXX 4TZ0A 1XMJA 1YR7A 3T5GA 1HQCA 2XTMA 2IUSA 4BASA 5L3QB 3I1FA 4QXAA 2IYLD 3C5HA 3H1TA 1SXJE 1T9HA 3GLIB 3E1SA 3W6NA 5L3QA 1E1QA 3FKSA 2YWFA 2F6RA 1CEEA 1VHTA 2D3WA 2W2TA 2AL7A 2PT5A 4DLUA 3AP2A 3WBKA 3I4LA 2ZI9A 4W5WA 3GEHA 4LV8B 3UXMA 1IXRC 3FVQA 4G0NA 4RSGA 1FW6A 1VG9B 1NF3A 2JIZD 1IXSB 3ZS9A 4CW7A 4TYQA 4TYPA 3RRZA 1E9AA 2QE7D 4TWZA 2C5LA 2GVDC 2ZETA 3NBFA 4P4SB 2JDID 4BZQA 4CIDA 4DB2A 4TMWA 3EWSA 2RGNA 3CPEA 3LXXA 2ZJAA 4NCIA 2P5SA 1X6VA 4JL5A 5F9FA 3ONWA 2NIPA 4P4SA 1R8SA 1RJ9B 1X1SA 2ZRMA 5BYJA 4D4MA 1LS6A 5BW8A 4V03A 4IEEA 4IDPA 3AKCA 2XB4A 3GLGB 3B9PA 3ZD7A 3SOPA 1ZIPA 1CR2A 3AUYA 1II8B 1IN8A 2WWGA 5LB2A 1ZYUA 1JALA 2AN9A 2Y8EA 5GJCA 4BFXA 1OXSC 3CRMA 1W4AA 1K8RA 4V0LA 5AUOB 4JYBA 3IQXA 1E98A 4NBSA 4UXIA 2ZUDA 3QY0A 5J5CA 3CRVA 4ZDIA 1UBFA 3QF7A 5SZJA 4R2HA 3RWOA 4A8JB 1F3OA 1T3LA 3FHOA 4MQBA 1QG2A 4QBIA 4NONA 1BYIA 2QENA 3HJNA 1F2TB 1SXJC 2WMOB 2ZJ8A 3NH9A 3VAAA 4L9WA 3VR4A 2AKYA 3NDPA 3UWKA 3GEEA 2V6IA 2GHIA 2JLYA 1UKEA 4OKSA 1NI3A 4B34A 3ADCA 3LLMA 4GOJA 4CRWB 4DLTA 1B23P 4WOPA 2BOVA 3RC3A 3F3YA 4NCJA 5C46F 3BBPA 4KVGA 3ZYCA 4JLNA 3NC0C 1U8YA 1AIPA 2OXCA 4IOJA 4DLYA 1Q44A 4WZAE 4LHXA 1NSTA 1RE0A 2IXFA 3LX8A 3THWB 3BE4A 3WY9A 1JAHA 5TMPA 1MO4A 2LCFA 1G3IA 5C2JB 4DLWA 1E1RD 4LUCA 2ZIAA 4MUBA 1XB2A 3AVYA 5ELXA 2C77A 3X1XA 4G5SA 2WJJA 3KKMA 3P4XA 1J90A 3EZ7A 1RZ3A 4XOIA 4KO8A 3ZVLA 2ZSFA 4TMKA 5L3SA 2A5YB 2P3SA 1G4AE 1S8FA 1LF5A 2FSGA 2GRJA 2PBRA 1Z07A 4M21A 2Q3MA 3GD7A 3Q7QA 4TQ9A 1FP6A 1DAGA 3IEVA 1GL6A 3K1JA 2ZSBA 3V00A 2Z0MA 3SHWA 4L9SA 4ESVA 1CJTC 1V43A 3QNUA 3TVDA 3RC8A 1I4TD 2WM9B 3H84A 3GJ3A 1G8PA 1GZSA 1NMZA 3HPQA 1G5RA 1D2EA 1SXJD 2QMUA 1J8YF 2WICA 1OHHA 2OAQ1 5KU1A 4ZDWA 1C1YA 1NN1A 1VYVA 2DR3A 4B74A 3B8HA 4KBGA 5KSPA 1LF0A 2ZRIA 1UBEA 3LQRA 2HF9A 3KX2A 4BLTA 1KDOA 1N0WA 2IHBA 3OIUA 4WAUA 1XX6A 121PA 4URUR 1S9DA 1VCMA 4MYUA 4QJ3A 2ODWA 2VO1A 1W5SA 3VKGA 3FYHA 3B2EA 4Q1AA 1RJ9A 4NE2A 3CLVA 2OG2A 4DCVA 4GP7A 5EE1A 1N6OA 3VQTA 2C9CA 1YKSA 3AP3A 4IJMA 5EXSA 2W6IA 4A92A 2D2FA 1J70A 1OXTA 1DAEA 2E9SA 3MGCA 2ZJOA 2EWWA 4UQOA 2J41A 5AK0A 1XBTA 3NHBA 1QHXA 2RMKA 1SKYB 3TMKA 5C4MA 2VHTA 2ZAOA 1KO5A 5TY0A 4HLDA 2CHGA 3RRMA 2OBMA 1UAAA 3LO5A 4V0KA 4C0JA 3BB1A 2XJ9A 4HDCA 3IKJA 1CF4A 1OXVA 3AQ4A 4O2LA 4A8JA 5JI3E 5DIFA 4EPXA 1ZP6A 2Z4RA 2OV2A 1YZTA 2ZI6A 4HDOB 4M1SA 2B21A 4GI7A 1OF1A 1EGAA 3MD0A 3PFIA 4UNNA 1AGPA 3TSZA 1CJVC 4O3MA 1RW4A 4M1MA 2CVFA 3W8RA 2GBLA 2F9MA 3ZJYA 5FTNA 1CRPA 5DYGA 1A7JA 1TUIA 1W0JD 1XTIA 3AUXA 4C2UA 2JLQA 2VHJA 2FA9A 3BXZA 1S9HA 4OQMA 3U3MA 2G83A 4BE7B 4EPRA 1ZVQA 3CW2A 4TL8A 5D3MB 2V4ZA 3NKVA 3OE7A 1E3MA 3THXB 5H1YA 3L0IB 4PX9A 3SQWA 1XD9A 3T35A 3SFZA 2KBFA 3CH4B 1ZJ6A 1U9IC 1KO1A 4F7WA 5J40A 1VTKA 1RKBA 2GCNA 3RRYA 3SJAA 5CYPA 3CZPA 2XNDA 1M1YE 2ORVA 3AKDA 1HUQA 2OCPA 3LY5A 3OAAD 3QKTA 2EW1A 1VIYA 2QP4A 3CX8A 3QKRB 3OIYA 2BEKA 1HY3A 2ZE7A 4UJ5A 3MLEA 3WMEA 2XZPA 1NMXA 1BIFA 2BM0A 3CR7A 3IIKA 3VFDA 2ZI5A 3AVWA 1JQLB 4JT4A 4PHFA 3T1TA 1GNRA 2VRWA 2W6JA 4TMXA 2IWRA 2VL7A 1R0XA 3U2QA 4DLXA 5FPKA 1OH6A 4K46A 1GKIA 2FG5A 4HZUA 3FWYA 1D2MA 2J59A 3PUZA 1T3SA 4IW3B 2PH1A 3W5JA 4XSGA 3ZQJA 5DLQC 4B6EA 4HZUB 1CLUA 5EP2A 3MMPA 5BQ5A 4W5JA 1KK2A 2ZYUX 2QI9C 3QOFA 4ZV4A 4V0ME 2F9LA 2BEJA 3CUEF 2JASA 4MRVA 3DDCA 1G7CA 4OJKA 4YMTA 4YDHB 2OILA 5IRCD 1DE0A 2FOLA 2JJ1A 2VHCA 2GCOB 3SYNA 2F43A 5KUTA 3CWZA 2VIIA 1TTTA 3WYAA 5FPYA 3TAUA 3JVUA 3EC2A 1L4UA 4PTLA 3RS4A 4Y0VA 4A0FA 2OEPA 3L82B 4ZDKA 1IM2A 1B0UA 4G1UC 4AC9A 1WF3A 2HLDA 2GWHA 3IQWA 4LC0A 3L0SA 1N6PA 3VU9B 3IO3A 1H8HD 2J7PA 4JLMA 5IDVA 2ZXUA 3PQCA 3CPJB 2IYZA 5DISB 1ANKA 5L3RA 1GM5A 4AYXA 3N2IA 4Q9IA 1WXQA 4DDTA 4BFTA 4LRWA 3ZD6A 3KJHA 1PZNA 1X3SA 1ZMXA 3AGQA 2BHRA 5HPYB 1P2VA 4LOAA 4DKXA 4BFZA 2G1KA 1NBMA 1Z0AA 1R4AA 2YWGA 1N0UA 3OEHD 2G1JA 4QJ5A 5JECA 5JEEA 4GT1A 2XOKA 1HA3A 2WJVA 3IPYA 2Z43A 1Q1EA 1A5TA 3EZ2A 2ERXA 1AN0A 1Z6YA 2XNSA 4FD2A 2FN4A 4Q5IA 1SXJA 2WJYA 3MJHA 4IVPA 4C0AC 5FBVB 3LVRE 1IOZA 4MKIA 3TGPA 1YZUA 5DI9A 5G53C 4V0OA 4RZUA 4CEHB 2XB2A 2ZRNA 3K0AA 1E96A 1ZM9A 3OAAA 1UDXA 2I1QA 1G8GA 4IVQA 3PCRB 4FINA 3UIEA 1R8QA 3ASYA 2QUZA 5J4KA 3IHWA 2YJTD 3AEZA 1VKJA 4DSNA 2GTPA 3HU2A 4OK6A 4DIDA 3VNVA 1DS6A 4XWKA 3GFTA 4QHSA 4BEBA 3LLUA 4A36A 1G41A 2FU5C 1ZUIA 3F0TA 2XTZA 3CPHA 4MITA 3THYB 1GDDA 1OW3B 2QM8A 3PG5A 2P5TB 2VBCA 2ZI4A 1XD2A 1XZQA 4I1UA 4EQ6A 1JQJC 5EE3A 2B6HA 1E2NA 4LZZA 2JLSA 2ZUBA 5KTYA 5CJPA 4LJ5A 2ZREA 2G0NA 4OK3A 5DI3A 3EZFA 1XPRA 2R2AA 1AQUA 1R0WA 1II0A 2QQEA 4HAUA 5P21A 2V9PA 3IBYA 3WNCA 3X1DA 3TJZA 1DELA 3SR0A 3GEIA 1TAGA 1W36C 1RRGA 2J0UB 2QP3A 1NP6A 2X19A 3AVPA 4JLBA 3J81k 1E1QD 2WWFA 3FKSD 3NEYA 4S2EA 1FPMA 3ETLA 2QT0A 3TUZC 2GF0A 3GJ0A 1W49A 4PAMA 4WIAA 2VTKA 4F91B 3QF4B 3BGWA 3O8DA 4R9UC 1U94A 4BECA 1RVDA 3UPUA 2H57A 2QY9A 2V1XA
chains in the Genus database with same CATH superfamily
1ZNWA 1N8TA 1PEAA 1R12A 3LNTA 3OTQA 1W1UA 2OK8A 4MUKA 4WGFA 3KJGA 4PQYA 1A7KA 4INAA 3CLSD 3LVQE 4GBED 4MJ3A 3UTCA 4QU9A 1CFJA 1UOEA 2JLZA 1ZPDA 1X86B 2FP4B 3K0BA 4ZAZA 5TQ0A 2M9MA 4KIWA 1YS9A 2F1JA 1E2PA 2IEGA 2RCNA 4H6XA 4WNIA 2PL1A 4W9MC 1A4IA 1ZNQO 5FIUA 3WHLA 3MERA 4R69A 3ZI7A 4EGQA 2BKVA 2PUWA 3L7NA 1TEZA 1MHTA 4HNAB 4KWEA 1JVSA 4CQNA 1WA5A 4LNHA 4ALLA 3WAJA 1LK0A 1BNCA 4NMWA 2XZDA 1DVRA 4YJGB 1PK9A 4UUPA 4ZV7A 4K05A 4AJNA 5BUZA 2I3DA 5LYJA 1ULTA 2Y1XA 1I0LA 5DHPA 1XROA 2IHYA 1ZNZA 4CI9A 4MDFA 2CKMA 3CE6A 3B52X 2Q99A 2RAPA 3HJTA 2G1AA 4NAUA 1CUSA 4OJTA 4RPKA 3I4FA 4JJ8A 2JGDA 1K5GA 3IPXA 3KYIB 3MK31 4CF5A 3O8BA 1Q17A 1ZESA 1ICIA 4RE6A 2CHQA 2QDKA 3E9DA 4FT2A 4WH0A 1SU7A 1TZCA 3C6ZA 3ZWQA 3U19A 1IIBA 5FBQB 2YJ5A 2ZSUA 4MCIA 4ILEA 4F3RA 5ICGA 1BWPA 4FFRA 3F71A 4Q4JA 1HYQA 2H1RA 3PPWA 4DCTA 2XR1A 4DDWA 4PXYA 3A4TA 1ECPA 2ZTSA 2HA5A 2UU9B 1N2CE 3M5PA 4A15A 3ABZA 3KLMX 4KMSA 4YJFB 2EKLA 2OHFA 4X45A 4UMDA 3ZCSA 2DETA 4M9RA 4REQA 2OLEA 3FTFA 2BUBA 4D8UA 1R0ZA 5EIXA 3D4OA 3VH3A 3NTOA 1GPKA 4O5AA 4XFKA 4PGAA 4X90A 4GQAA 2PL3A 4D0NA 2WQ6A 3KOMA 3WWYA 2WSMA 4ICIA 4K3UA 2W58A 4XDYA 3DZHA 3K6JA 4XCVA 3FDFA 3DZ8A 4ZO6A 4A2WA 2BYTA 1QPZA 4ZZ0A 4D41A 4CM7A 5LQSA 3S2FA 1IN5A 3B1KA 1NY5A 5C8ZA 3EARA 3IKLA 4MVJD 1CNFA 5I7HA 2VTVA 4C7OB 1Q7BA 2G80A 3DHWC 1SHTX 3U40A 4Y2PA 4TSKA 5BRAA 1A2QA 3N6XA 4LWPA 5EZSA 1EGMB 1P60A 3FWPA 4YXFA 4WA7A 4GRDA 4MPRA 4KO3S 4N49A 1EQUA 3G0DA 3C74A 1UFOA 2NXWA 3KQYA 4QUJA 1QHHB 4ABTA 3G2KA 3MJRA 3A2MA 4MS3A 4MX8A 3WHKA 1LFDB 1AZTA 3HYTA 2X3YA 4HB3A 3TPZA 4KBYA 1N8SA 3DQPA 1USIA 2AZ4A 3A31A 1SY7A 3TCNA 3ZCXA 2NNWB 2P27A 2C5HA 4UCWA 821PA 3D3NA 1YFJA 4L5JA 5C3MA 3K7EA 2CYCA 1MB3A 1ESNA 2AN4A 4LCJA 5CLQA 2ZAGA 2GK7A 4ZO7A 2RHHA 4X63A 4AJHA 1UFVA 3N2KB 4I4NA 3RASA 3W4KA 2VJDA 2B3TA 4CF4A 1VBNA 3I6MA 2Q45A 4FYIA 4OBWA 1TJ3A 1M2FA 4KFSA 4BWGA 1R15A 4UBNA 2XKJE 2OHVA 2PZFA 1VDZA 1H93A 5KTTA 3EGIA 2UZAA 5JH7A 3ZWKA 2Q2WA 2CUZA 2VP9A 1UBHS 5FOWA 2GZ2A 2VJMB 5C4IA 1MZVA 3TLBA 3CSDA 4JASB 3QU2A 4WPGA 4KAJA 3L6DA 2YNMC 1L2TA 4FFDA 4S0ZA 2B4YA 4KGXA 3WK6A 1Q19A 3OJOA 1E2LA 1Y33E 3EG9A 4I8XA 2GN4A 1F51E 1MAUA 3RYHB 4GVPA 3TQFA 3JQCA 2HIGA 4ECEA 1OB5A 2HJ9A 5M29A 2OPHA 3UAXA 2EKBA 1K5DA 5DVZA 2NZVG 4QDJA 3V42A 3VPDA 4KGZA 1SKAA 4LSGA 3W6OA 4B44A 3VPGA 2DPMA 4G2TA 1JQBA 1K86A 3UV6A 1CUBA 1LS1A 1DCTA 1V9LA 1WZUA 4PAOA 4LI0A 1FNNA 1SZPA 1JKJA 1XHEA 2WWIA 2IXAA 4MDHA 4ZARA 5IFLA 5CT6A 3Q0EA 1KOJA 3NATA 3OQHA 4IL5A 4OP1A 4UZFA 1Z22A 3K5WA 1EP9A 1XJ5A 3PR3A 4KFTA 4IHJF 4P1ZA 1Q1GA 3SM9A 2ANBA 4NMMA 4NF2A 5JDCC 3KYCB 3UJHA 3JCZA 2PKEA 4HGOA 4C3VA 4ZAWA 5KO2A 3RADC 4D98A 3ESQA 3KYJB 4KEAA 1M5TA 3CRW1 4GD3Q 4LDPA 1CU1A 5FTWA 5TMBA 3DBRB 5EYPA 3L7CA 1JB1A 1TMYA 3H5VA 3MB8A 5U4XA 4CKBA 4QIHA 2WIFA 4IDCA 4UMVA 3CFYA 3SGLA 1M2JA 2IPAB 1NUAA 1OBHA 3PQDA 3W5VA 5EWLA 1AGXA 3KEFA 4PLHA 3QVXA 4KAXA 3AL0C 3OEWA 4MRMB 4U8GA 4PFKA 4K3VA 1JR3E 2C20A 2I8CA 2IUYA 3QJGA 4Q1BA 3S2UA 2BKLA 1FJXA 2RGYA 1CQZA 4DLVA 1T3HA 1SWWA 4DMRA 4JELA 4PGGA 2FN8A 4AY2A 1JR6A 5JSQA 1FZQA 5K3FB 2ATCA 2FDRA 3PCTA 4OHOA 4DQLA 3KKNA 2YMLA 2JA1A 3G2QA 3DVAB 4Z4CA 1QC5B 3U1VA 5KOHA 3TRDA 4BUCA 1MFPA 1HTTA 1YACA 4RY9A 2QLLA 5AW0A 3OTGA 3CA8A 1F60A 1FE8A 1RABA 2FFRA 4JX8A 3CVVA 3ROEA 4NH0A 4WBSA 2YS7A 4DQUA 2NT4A 4J3NA 5CK4A 2I66A 4PEVA 1KI6A 4UULA 2DEUA 3W3AA 5H83A 3ZY4A 4WESA 1RQPA 3BQNB 3K4HA 1YD7A 2YMMA 4D9IA 3C7DB 3ENZA 5HCIA 4H31A 3UN1A 1OILA 2QN1A 3TR5A 4K86A 5B58T 3DTVB 3DF9A 4N7JA 1DFIA 2IY9A 2EBFX 2WWYA 3F9CA 4R8SA 1B41A 3GLVA 2C9OA 3QUTA 5FA5A 3FPGA 1NVVR 1PNQA 221PA 4J0CA 1X7ZB 1E1KA 2ZBRA 3ZN2A 2O8DA 3VPXA 5AFSA 1UDWA 2N47A 2R8EA 1B00A 3G2MA 2AXNA 4BMYA 1NYTA 4L16A 2WFZA 3HKBB 4G0PA 3ZZUA 1NBWB 2CSUA 1E3DA 4AJIA 5ALWA 4HFNA 2O52A 4KACA 4NEQA 3ADPA 1KSJA 1HYEA 1T6YA 2B8NA 5JD5A 2ZSEA 3BMCB 1YFLA 1QGOA 3HKDA 3L6BA 4TL6A 5JV5A 3NS7A 1PRYA 5JD6A 4MQLA 4DB4A 4O2AB 3IHLA 1VB5A 4KAFA 4ZP1A 3DDOA 2C3YA 3DXXA 4G5HA 4AZ3B 4J75A 2D1YA 3I23A 3MXTA 3G5MA 3EQZA 3UQZA 3LOPA 4TXNA 1QAQA 3D4PA 3HZHA 5I3CA 1GAQA 4S1NA 4HFRA 2SBTA 2O8EA 4EYOA 2L18A 5F52A 1NYQA 3AEQA 3H2IA 2WAOA 1SC6A 4KN9S 3WS7A 1XEXB 5GV7A 3WYDA 1X15A 3FR7A 4LISA 5F78A 1E3JA 4LXHA 2IC5A 1QQ5A 4ZALA 4CT4B 2JJYA 3HDJA 1EVQA 1Z2EA 3CMMA 3FNBA 3FPAA 1HETA 4LJ4A 2FV8A 1Z7YA 2WTUA 4FI3C 4IKOA 1G19A 2H59A 3JRXA 3A9UA 1YRQA 1JIJA 1W8IA 1MJNA 1OIVA 4CTNA 1N1GA 3DW1X 1Y5NA 1GZVA 3D1VA 2ZE5A 5GMOA 2RAFA 4BGUA 4B3HA 2NT3A 3UPTA 2AOVA 1OFHA 3T0FA 3LCVB 1DNPA 1U2SA 2VG8A 1C2YA 4MGIR 1I4LD 1UBJS 4Q3DA 2K5UA 4EVSA 4F4JA 2CJPA 3QBVA 4FX2A 4KOAA 2QM0A 3OEYA 4U0JA 3T8YA 3TSYA 1FQOA 3B70A 3M0EA 1P5JA 3TTWA 5ICCA 5B2EA 2NXNA 4IGFA 3K0FA 4PAWA 3TM5A 5T7BA 1OLXA 4ECAA 1MX5A 4EX6A 2OZLB 6REQB 4JS0A 3BMNA 4QNRA 2D5BA 1HX7A 4L5YA 1OI2A 3PQ3A 3GFVA 4W1SA 3GLGA 1YB2A 2KB0A 3HMKA 3TF5A 1AC5A 4PFSA 3PFNA 4OB8A 3WTBA 1E3SA 5B4UA 2WPDA 3DL2A 5F7XA 3DVSX 4XZ3A 1Y3FE 1VP3A 3GLQA 2UKDA 3PUHA 2VSFA 4UHDA 4F1KA 2B1RA 1Z0UA 3M6MD 4E09A 5K8IA 2UUAB 3OUUA 1I13A 3N3AC 4FJ2A 1WSBA 1YL5A 1Z5OA 4MSUA 2R00A 3NXSA 2GCOA 5EZQA 4G5XA 1VPLA 4HWOA 2XA9A 4RFSB 1DBPA 4JLUA 3EYAA 1JKFA 2WOOA 2WZDA 1GA4A 5DHSA 3CLUC 1XXHB 4MR8A 1CY8A 5ITWA 2H65A 2XWQA 1T1RA 3GVCA 4DEXA 9GPBA 5HQ3B 3OPYI 5EMHA 2C0PA 4ARVA 1MO5A 4IGEA 4WY2A 3CUKA 3TTVA 2QTWB 4B4OA 3A1VA 4GBJA 2HUNA 3SU8A 2QQFA 1LXCA 1Z7GA 2AG6A 5ARCA 2RJNA 4PPGA 3UK2A 5ALJA 3WYBA 4F85A 4DRYA 3CISA 4OY3A 2VN8A 1UZNA 4M9SA 5CA1A 1W5AA 1ECBA 1XZPA 3FUCA 1FFWA 1JBEA 2QX4A 1RPZA 3CLRD 4X1KA 4JY7A 2TRSB 3LKVA 3P9YA 4F97A 3OKAA 3C39A 4XB6B 5HA5A 3TZCA 2H7VA 1PR4A 2ODEA 2WF7A 3ND9A 3CKMA 7ABPA 2ASEA 3AZPA 3LQ4A 2H54A 2X6TA 1EWQA 1FTYA 4YMUA 4D4IA 2Y1CA 1PQ4A 2GO1A 2CHVA 4DOMA 4GHWA 4D4HA 3I9KA 3EY9A 3NO4A 1AKYA 1W0KA 3WP0A 1OH8A 3HO1A 1MVOA 4E70A 1QV9A 1CV2A 5FNZA 3EX7C 3H1FA 2YICA 3H75A 3SC2A 1WIWA 4D9BA 1UJ6A 3PEEA 1FXSA 1MQAA 4BY9E 2E5WA 4KQ2A 3A1DA 1FFYA 1VG1A 2EGUA 4U6NA 4F5WA 4LQCA 2DTEA 1H6DA 4L3WA 3IALA 4B0OA 2GF2A 3CZMA 3NGLA 4EI2A 2P75A 3GJRA 4GXRA 2B25A 3FX2A 4U02A 3MB5A 4HAYA 3TXAA 5H3LA 3M82A 2XE4A 1K4YA 3BIJA 3KJZA 5H81A 1YQUA 2E5FA 2F3SA 1P9RA 4KFRA 4BTVA 2QAJA 3QPDA 4WNCA 1E79A 3DLPX 4Y2SA 3UF0A 4MMZB 4D9JA 4DQXA 4YT4A 1RFGE 2L82A 5F1YA 3SHOA 2SHKA 4JYZA 3BSWA 1KP3A 3S7ZA 2BBWA 3NAZA 1X2EA 3LUDA 3TZQA 4EG4A 4JHXA 3GJSA 3AV0B 2QR3A 3JZAA 5ALKA 1L4GA 4Z99A 5AI8A 3ZY6A 4B3DA 5DGCA 2PUGA 1L7PA 4Z0PA 1PVOA 2IPOA 3BH7A 1GRNA 5B30A 2ZZNA 4AJ4A 3D4IA 4GP6A 4XM2A 3SE7A 1WHTB 1VLQA 3FNHA 1LV7A 1DRVA 1GZ4A 2MSKA 3DGEC 3ETGA 4L85A 2O1WA 1JXQA 1NHGA 1S2MA 4LZOA 3TW6A 1JDTA 1MTZA 3SYKA 3CX3A 4MHSA 1BA2A 4OHZA 4C0SA 4MMXB 1R4MA 3AU8A 4RMJA 4P0TA 1WS6A 1IQRA 5HFNA 1MFZA 2JIZA 3MAGA 2YC2C 1VOTA 3P2OA 2XRZA 3WIOA 4HATA 4G37A 3AT1A 4KKVA 3A1SA 3WLSA 5CFLA 1RNLA 2XKAA 1P29A 2R8PA 2BEWA 3I6IA 4LI3X 4C0XA 4IDAA 3V97A 2HDHA 4CYMA 1EJ6A 4B3TB 4K6GA 1JA0A 2IZOA 1HKHA 3NZEA 5TVGA 3WGQA 4BC1A 4I0WB 1NVTA 1ZGGA 3GX1A 1JXOA 1NVUQ 1AD2A 5F35A 1GDHA 2FPLA 4KPGA 1YRYE 3VH4A 4MLZA 4MINA 5CUQA 3HFGA 3HLKA 1GOTA 3OICA 3D6MA 3SEAA 3O83A 3ZTTA 1SHJA 1ZEJA 2ST1A 3LQ2A 4G56A 2FI1A 4YA6A 1G9SA 2JJ1D 4GR4A 3ETHA 1NLUA 4H08A 3T41A 3KETA 3T95A 1C9NA 5CX1A 2D6FA 2YV4A 4KIGA 4EGSA 1KVTA 5JBQA 5CD9A 1NGSA 4A0HA 1PIWA 2I0FA 2OAGA 2PJZA 4U2DA 1OFIA 5EXPA 1U8EA 4AWXA 2BH9A 3GT4A 3TZLA 1BVYF 5E9JA 4YRJA 2BHNA 3PQEA 4P7FA 1JVBA 1XCOA 2C2OA 4MUXA 4KQJA 4NU8X 3V4VB 2E87A 2GPJA 2M1XA 4HLQB 1DAIA 1YJCA 1R9GA 2EJVA 3A37A 2BC9A 5CAEA 1EUQA 3MUFA 5L7YA 5MHTA 1CY1A 3MRTA 4IY1A 1F4VA 1FU4A 4KIUA 4AO8A 2FZWA 1XMPA 2TMYA 3PSHA 3QX9A 3DVAA 4BLUA 4QBTA 4OSOA 1JLSA 5K6RA 1P1IA 4M0MA 3KQUA 1FTQA 2Q1YA 1KERA 1E2BA 3L40A 4CLOA 4PO8A 3V48A 1MX9A 3T5TA 4GDFA 4N7MA 3E3OA 1M76A 1QTNA 4KO4S 1QNFA 3BGVA 4EY7A 1JU3A 4BNKA 4UTXA 4EL5A 1VPVA 2CHFA 2W6MA 1BH2A 2QZ4A 3E18A 4NZPA 5LUBA 4QU8A 3D8UA 3RHFA 3HVHA 3MGBA 2YKGA 3DOHA 2N3ZA 5DYWA 3OF3A 1JQ5A 3A26A 3P9QA 5BUCA 3CLTC 4QBKA 2CMHA 2QW1A 3P7MA 1O03A 1EU1A 1KI2A 3PNOA 3DFIA 1M73E 1RU3A 4QBFA 5P8WA 2G0TA 4A2PA 1QO7A 2OCAA 1NVAA 1YL6A 3HCBA 3PFBA 3REQA 1ZCFA 4C7MA 4CV1A 3TZEA 2Q6KA 5EIBC 2ZIFA 4S2UA 5CK5A 5K9ZA 2WPNA 4H27A 1C0LA 3QHAA 1DWPA 3KVNA 4PHGA 3M4YA 2VHVA 4JC0A 4O0MA 4WJZA 5HKLA 4PR3A 2VP4A 4RHCA 1BFKA 4Q4HA 1MAAA 2C4UA 1M72A 3PFCA 1DGQA 1KNQA 3WKEA 2Z8YM 3DAYA 1SBNE 3UPDA 4RY2A 3WLJA 3JQ7A 1P4JA 4EGJA 1ZD9A 4H35A 5IZCA 3EXFB 2EBWA 4A2QA 1JFSA 1WULS 2PA0A 4CUJA 5J59A 1E9RA 1AXRA 1RWKA 2QRMA 4JP3A 5C1DA 3MPOA 3T94A 4EJ0A 2B4TO 1NJGA 3DLBA 3IUYA 5JTTA 2ID9A 3GEBA 2OV3A 3BBLA 5E1MA 2PY6A 2Y67A 4D8WA 2KLBA 3TKYA 4Q12A 4DCNA 4IQ8A 4GRAA 4C0QC 1AQIA 1H6CA 3C85A 4HSEA 5G02A 4BNWA 4ZICA 3RUEA 4L95C 5DNVA 4B8WA 1TCBA 1ISRA 1LC0A 4M1QA 3DJFA 2CMKA 2JH8A 4HWKA 2I3GA 2ON6A 4EKIA 4BO5A 1QHYA 4D5EA 2F43B 2B6NA 5EMMA 1ODKA 3O7MA 3S1AB 1Z25A 2QLJA 2VAWA 3CEAA 2WD8A 4ONEA 2HHLA 5FR1A 3BJEA 4QQ8A 5KYUA 2O5RA 4GL2A 1E9FA 4V2UA 1ZU4A 1E2EA 5D5PA 3TINA 3VGJA 4J0HA 1E1RA 5E6SA 3BB3A 3A6HA 4Y1RB 1GG5A 3NR2A 4WQMA 2P79A 1G4HA 3OQJA 5CIYA 1YQ9A 4UXJA 2BR3A 4MV1A 3B9QA 3NM5A 1VYUA 1NURA 3SSOA 2XSZD 4UHKA 3F6EX 3HGQA 5AWFC 1HMPA 3U7GA 1NC3A 3BTUA 3UMCA 3GRFA 3HB9A 5BR7A 1U2ZA 1GEEA 1T1JA 1FFEA 4NJEB 4LFBB 2Y1KA 2I8LA 2OY0A 3HPRA 4DNFA 2XMSA 1V0JA 2NO5A 3EOZA 1E3LA 4J0FA 5BO5A 5DYNA 5JLAA 1Q7TA 1GCAA 1M5UA 1X1RA 2C9YA 1ORHA 3VZCA 4S04A 5FUXA 1C1XA 1ZLXA 3ZWMA 2BGTA 4FW9A 1RQXA 3FCYA 1U7WA 3NNDA 4LZWA 1KJYA 5AM3A 1XKXA 3OMXA 5FULA 3T5BA 4A1OA 3GGGA 3M89A 5ICEA 4BOYA 1R5NA 2NAPA 5ICMA 3DBHA 1WMSA 5AM5A 2XCRB 2AD1A 1E2UA 1Z18A 4XTCS 5D00A 3B82A 4PYKA 1T8SA 2FP3A 5AOBA 4FOOA 1RS0A 5DP1A 1I9CA 3ZHVA 4EG0A 3O4VA 4R1NA 5FPHA 3ZZTA 5A4DA 5IEJA 5CYGA 2VPWA 4OLBA 2PTHA 1WB4A 2NUPA 2WAAA 1KJNA 2Z9CA 2OTCA 1KQNA 1MNAA 3BQ9A 1OFTA 3I6BA 5AP9A 1GARA 4G5FA 1ZK4A 2ZR7A 3IBCA 5GONF 3LUCA 5DU2A 5ADWA 4ZGWA 4RKYA 1EMDA 3HUEA 5IM5A 3W3ZB 2W2NA 4TV9B 5FI3A 3QX7A 3ZU5A 2Q5FA 1FDWA 3UFXA 2CZGA 2QSYA 1IDN1 4IR7A 1CCWA 4LBWA 4MR9A 9LDBA 3ZVNA 2Q29A 1XL1A 4BFLA 1HLFA 2WDPA 1LTKA 1QH8B 2J8ZA 4II2A 3CC8A 5IW8A 5IXSA 3O4FA 5ILOA 5LBIA 3BK1A 4IEIA 1WWKA 1WDLA 3C7KA 1FX0A 3GAAA 3N74A 3SC3A 1ZD8A 1ZCJA 3TLZA 2PZMA 2Z4TA 3EW9A 1I6LA 1U3UA 3A8TA 4FWTA 3GYBA 4RIFA 1CDOA 4LCEA 2NVUB 1DAHA 3MS2A 4QASA 3BXFA 1Z47A 3O4IA 1HDOA 1O5IA 1SVLA 1ZWKA 3LCJA 1DT5A 2BDUA 2PDAA 4XUGB 1MOZA 1N7JA 2D74A 3U48A 3LT1A 4FNGA 3STUA 1B1CA 3AL3A 4V39A 3SKVA 3DHVA 4WOJA 1G59A 4YC7A 3A9WA 3LBFA 3KJIA 4NEGA 2HV8A 1QORA 1B0AA 3LL7A 3PDWA 2OGTA 4Q19A 2YL2A 1O54A 2P65A 5KOIA 4NARA 4YP9A 3MAAC 3E5HA 1I4DD 1KJIA 5DOZA 1JKJB 4AMGA 3EUFA 3I9LA 3EC1A 1F7VA 1NQ5A 5CCBA 4L51A 5CTAA 5I7SA 2G08A 4W5TA 1E89A 4H6VA 4EGFA 5BPFA 1G3MA 4NXNB 2ECKA 3HSSA 4DQ0A 3BFVA 4G0ZA 3B7WA 1RAIA 2GLTA 4Q37A 3DE5X 4YXWA 1C9DB 3A25A 4F5YA 1O0SA 4QEZA 3AXSA 4MA0A 1ZK0A 4ZEWA 3KQVA 3MN1A 1W4LA 1KZ4A 4OJQA 4WKPA 3W2FA 5L6MB 3ILHA 4BMZA 1X87A 3KKPA 5DBHX 1UBOS 3HUUA 3U4MA 1GRCA 2QN6A 5HR5A 4Z0HO 2B37A 4PAQA 4H6WA 1AQNA 3UWDA 1A95A 1FU8A 2ZBEA 2WNHA 1ZJJA 4AAYA 1JG6A 2LDXA 4S35A 4Y9RA 4B7AA 2VBGA 1O94D 1I2AA 1RI5A 2X3FA 3C3KA 3LY7A 3WL6A 3OOSA 4NCAA 1T91A 1HE8B 1EBBA 1HRDA 4N3AA 4TTQA 1GT91 2OGSA 1JG2A 3P5BA 3TO5A 4CMHA 3H5RA 4EAQA 5M04A 3N28A 1VA5A 3AC0A 3U81A 5I4BA 4PHTA 3JQ7B 2V6JA 3WE7A 2AGVA 2PT7A 3AUAA 1KOFA 2WU4A 3COVA 1THZA 2VZ9A 3ZW7A 3ZU3A 3L3BA 4I1VA 4BVFA 3ESAA 4BV9A 3IKVA 3MEQA 4BO3A 1JHXA 2H0AA 3CH7A 1IM8A 3L8DA 3DHEA 3FNRA 4UUMA 5HFAA 2PGXA 2C0QA 1WDTA 2WYHA 5ALLA 2M6KA 4CG1A 1YRWA 1YR1A 1QJ4A 2PWBA 3MWJA 4TMYA 5FL7D 3WO0A 4Z7NB 2HA2A 3D1LA 1U0SY 2X5NA 2AG1A 4XKJA 2DFKB 4FM9A 1PGNA 2H2GA 1W1WA 1J9GA 2OFPA 4QGHA 3GAZA 4DLPA 3QZUA 2LDBA 5JFGA 1Z26A 3FAKA 1U6KA 3VTZA 1QUEA 3T5MA 3QUQA 5ES3A 3M6XA 5EZYF 4IOLA 2GPWA 1UH5A 1S4QA 1D0VA 4YQYA 3MT8A 3O8NA 3ICEA 4TLDA 3ZQ6A 1K3TA 1JZQA 1Q15A 3QKSA 2D5CA 3TVTA 2D1QA 1V3TA 4BJ6A 3T9FA 1XEWX 3DQZA 5FJJA 3O7WA 3ZC3A 4YUVA 1ZK1A 5JSZB 2IUFA 1Z4IA 5GM2A 2R1ZA 3ZCQA 5JFOA 2BH2A 4W8OA 1B2RA 2QNRA 4I1RA 5FTMA 1B7GO 5A3VA 3F5MA 3KRTA 4D6XA 4D4JA 1VLMA 2CCKA 4ZA2A 5JR3A 4JUDX 2PZGA 5H80A 2QN2A 4UDNA 5T4BA 2ZSIA 3GJXC 1K8YB 1SXQA 2IHJA 3OLCX 1IATA 3LHKA 1I1QB 2D2EA 4XB1A 2ZAYA 1JE0A 1PVVA 2BL4A 1BA3A 2NNLD 1D1PA 2AG5A 1H42A 2Z1MA 3UHAA 3LLVA 5FFFA 4AROA 2GLUA 4PC3A 4P38A 1WPGA 1G55A 5WRFA 4JI4B 3L8FA 3HL4A 4AP6A 2QE7A 3GB9A 3NNNA 4IJ5A 1GZ6A 4KQ6A 2IP2A 2QX7A 4CCSA 5E9AA 5K2MA 4M37A 5EEGA 5FR2A 4NFSA 1FP2A 5KB3A 1GNTA 4MTLA 2IY7A 4N76A 4XYGA 4XQGA 2D0OB 4NVRA 1M2EA 4HAWA 2OESA 4RFVA 5B1IA 4ENUA 4L8WB 1Z8HA 4TGLA 1I51A 4NATA 4EFDA 4MYTA 3LWNA 2WKQA 5BNTA 4QPZA 1ELOA 1M2NA 4MAFA 4CR8A 1ZM4A 1PT8A 3WX0A 1VPWA 3IERA 2BHTA 3G88A 1M8FA 2GJSA 2C2XA 1K7FB 4KVFA 3JQ8B 5D3KA 3UAOA 1XHLA 3R7LA 1CR1A 1EWKA 1ODCA 5T6MA 1E3WA 2BSAA 2IYFA 3S68A 4CEIB 1A77A 2ZS7A 3CLTD 1OGJA 4MRNA 3WYGA 4W8HA 4E2XA 1XCMA 4ZREA 2W2KA 3H18A 2YQ4A 4GWLA 5DM1A 2QL9A 4PR0A 3CR3C 3W5HA 1LQUA 5AQEA 1G0OA 2WC1A 3DAPA 3EEOA 4RK1A 2VA9A 1V1RA 4E1AA 4KR6A 1TCUA 1QVVA 2WVHA 4I1YA 4RIGA 4H7IA 1ZSVA 4IIDA 1QCYA 3BPSA 1F8GA 2VT6A 5AOAA 5EQTA 5EWLB 4ZTZB 2ZU6A 4IIJB 5CBPA 1BU8A 5DEOA 3N7UA 4QEKA 1SN7A 2QX8A 1G63A 3KIPA 2XUDA 4Y1EA 2VQEB 2P2SA 4I4IA 3UMRA 2NZ2A 2GDZA 2R6DA 4G81A 4YRIA 1B8OA 2XQJA 3RIHA 2JPDA 2JRCA 3E70C 4H0CA 5AVZA 5L95A 1QRDA 4Q4HB 1MVNA 5DI3B 1Y6RA 2A0KA 2C4KA 3IESA 3BWCA 1V8OA 3AI1A 4X97A 3ZH9B 2X5JO 1IZ0A 1RHMA 4I5EA 2W6ZA 4GOND 5CGZA 5DN6D 5L8VA 2VZ0A 3ANMA 1XWFA 4Y9UA 3EIOA 5TSDA 3RBAA 4OIMA 1EX6A 2PSHA 4URHA 1WUJS 2WQ7A 4O4IB 3W3AD 3OTIA 2CCJA 3G0OA 2TMKA 3JASA 3ITEA 4Q1DA 3SFTA 4D6PA 3I1IA 3CH5A 4OXYA 3U09A 4F2HA 5LP1A 3L1IA 5DCYA 3GUVA 5ECWA 3DJYA 4NAVA 2WVAA 4X65B 2OV8A 421PA 1A5BB 1FVHA 3D3JA 2CXRA 2DG2A 4X8HA 3SQOA 5KSZA 2PUVA 3OIDA 3LA6A 3QIAA 1QIJA 3ZZ0A 4KUHA 5AVVA 1QM5A 1RCUA 4Y9DA 5K4GA 1T25A 4J6FA 4F56A 1D1SA 3BS4A 4WK2B 2PCLA 1DKUA 1V8FA 1RLTA 2OAP1 1E99A 4BP8A 4AG6A 1X8JA 2RK4A 1Q7RA 2JCBA 5EWMB 5LZ8A 2E85A 1TFRA 2R5FA 1L7AA 2XGSA 2A6PA 4KRFA 1P62B 4HXGA 2QRVB 1IWBB 3OO0A 2CDNA 2OM6A 2ZT6A 1GTJ1 2B61A 2XUAA 3MBKA 2VYVD 4WN3A 1UM9B 5IABA 1QIHA 3QW4B 2HLHA 3L7JA 2IZ7A 3D7KA 2VDOB 4H3VA 1JQAA 3Q3EA 4R7ZA 3RREA 4ASUA 2O14A 3FMIA 4L15A 2X23A 2VC2B 3NRCA 4KX3A 5IN5A 1T5LA 1M6EX 4D3SA 2NUPB 1T3TA 4DAEA 1DG3A 4JUFA 4YCSA 3U60B 1EXNA 1HL7A 3FWHA 1JAIA 2AOUA 3LXUX 3P0RA 4ZVSA 4DLSA 4CF7A 5AVYA 1WBDA 4RD0A 2YV3A 3JWHA 2ZIGA 3D0OA 1TAQA 3D64A 3RS0A 1I36A 3H5NA 4RJJA 4JVSB 1HYBA 5I7AA 1QH1B 4LJ7A 3I5MA 3T9AA 4CLHA 5KOJA 3HN2A 2PNJA 1U0HC 1NF2A 2P6MA 2X41A 3BJRA 3CSUA 3UOWA 5KTKA 4TN5A 2PMEA 1JIQA 1K7YA 1VE7A 3C6XA 2GERA 4WERA 1E6CA 2V7XA 3U4AA 5T8KA 2FX3A 3DE6X 2XNHA 2FUG6 5HE9A 2B92A 4HDKB 4ZGGA 4YV7A 5AD1A 2VJYA 3PWTA 3N0WA 3AVQA 4MQUA 4HN4B 5KOHB 5JYDA 5H68A 3VI4B 4GMXA 4IILA 4MW0A 1XRMA 3DP9A 4XH9B 2HUPA 3RIGA 1BEEA 4ZVQA 3W4IA 4E4RA 1NBAA 4YRPA 4M1EA 2XSZA 1CJUC 4IJWA 5M3BA 3LRPA 4MWZA 5ALSA 3KU1A 4GO1A 5IPFA 4XAQA 2QAGC 3I04M 3R7WB 3K4QA 3AETB 4I5GA 5CXSA 4QDZA 1GGEA 3WNVA 2X77A 5E4JA 4K03A 4C21A 1RYBA 5IH7A 3TYXA 4PV7A 4WW0A 3F4BA 1FX0B 1PW7A 3IBFA 5EE9A 2IW1A 2C95A 1UKBA 4DIUA 1HQYE 3KTFA 1DIRA 4Q00A 4UHEA 2ZIWB 4DNPA 4YI5A 4RADA 1HL3A 4NC9A 5GJVC 4ZFNA 3H1GA 5J23A 2YVUA 5BOSA 2R6ZA 3AUUA 2ZRPA 4HDSB 4B9EA 4ED9A 5K0SA 1UJCA 2H00A 2QUAA 5AJWA 1NULA 3SZUA 5A7FA 5LIRA 2G3YA 1FFCA 1KSFX 1R10A 3FVVA 2BMDA 1U81A 2QOEA 3G6KA 3H9CA 4LYHA 2ZJYA 3FG9A 3R7DA 2JKZA 5CDUA 4RZHA 3FTPA 3OESA 5EQDA 4M46A 5D7NA 4B83A 4BLPA 2UYYA 3TNLA 4RPIA 1KY5A 2X40A 5B37A 5ALMA 2EFJA 4CI0B 2O8CB 5A5GA 3VM6A 3X2EA 3TNFA 1OY1A 2IEAA 1NN5A 4LRTB 5DW3A 3UB4A 2WSSD 1ZD3A 3MJEA 5KNCA 2RI6A 5B3JA 3UZUA 1N2CA 2DLDA 3OZSA 4JSYA 4ND8A 3ROXA 4NTZA 4AZWA 2I6TA 4W6QA 1CY7A 1WABA 1OAKA 1DJPA 4ZQGA 2ONKA 5HF5A 1D5CA 1U8ZA 5AH0A 4HMPA 3PDUA 5K6TA 4TZ6A 2IP1A 1C4OA 1SOAA 2C4VA 2CNWA 2NZXA 4IJUA 1C30B 4IRMA 4OQXA 3RUAA 1MMFB 1B1AA 1PU2A 2NACA 2P9QA 3FLEA 4GYYA 3DWEX 4MVJH 4BFCA 4EG5A 2ET6A 2O2ZA 4KQCA 3R8CA 1KAMA 2DE0X 2Y3IA 2E4WA 4XJXA 5T64A 4MYHA 3T3GA 4HNGA 1NW9B 2Z58A 3V1TC 5H3HA 1R0KA 4DLBA 3QXHA 5HP4A 1SD1A 5K1ZA 3CZQA 4R51A 2JFQA 1T6XA 3R5XA 3SZMA 5IUNC 3QEKA 1XFDA 1QX3A 1YUNA 4C4AA 4PLYA 2J9FA 1COWA 1XZCA 2V6GA 3RTBA 4F38A 2BLNA 2X6RA 2Q0QA 2GMWA 4IFBA 2C1XA 2BMWA 5EIOA 2G70A 1G2QA 4QO7A 2V3WA 4KXYA 2B2XA 5B4VA 2R7KA 1KIMA 3C3PA 5THXA 4AJLA 2XTJA 1GKYA 2AMYA 3R3HA 5JLJA 4C0HA 1DUIA 3U7JA 3KCQA 1K1EA 1MA3A 2H1OA 2DB3A 4F3KA 2VYND 1D9ZA 1XAJA 2MT9A 4DXAA 3UGKA 3VTKA 2WZCA 1V4NA 3BF8A 2IHTA 3BH6A 4HPJB 3VNQA 2HCTA 1VHLA 2AFHE 3U9SA 2H1HA 4ND5A 4S24A 1YZNA 2YY5A 3IURA 2G4LA 2NO6A 3PHJA 1APBA 3TDKA 1UOPA 4GBGA 2QVGA 3UT0A 2E55A 8OHMA 1PX0A 2BGNA 4PX5A 1KQFA 3EY4A 2BMFA 4KYTA 5FOXA 1EFCA 3VR4H 2CT8A 1PWYE 1R6VA 3N2EA 4ABYA 3Q8XB 3H8JA 2OO3A 2VJNA 1Z28A 3OEED 2VRBA 1QTIA 2BJWA 3Q6MA 4HX5A 3HM9A 2Q3DA 5I9MA 4MRSA 3F74A 3I2YX 4GPAA 1IHUA 2PKYX 3PNKA 3KB8A 4HB0A 1YR2A 3BTSA 5DNEA 2WM3A 4NESA 1JKMA 3HY4A 3Q5EA 1U2GC 2I5PO 2MSNA 4MAMA 1KK1A 1GYQA 4N3CA 4PC7A 5ADHA 2QUBA 5HW0A 1WSWA 1U80A 2WIGA 2QL7A 3QPVA 3Q3JB 4GE3A 4AVYA 5HTOA 2HIHA 1DARA 2W2OA 1CC1S 1N2IA 3TL6A 4BJ3A 3IEIA 3PFHA 5JROA 2Q0XA 3MTQA 3TN7A 3QVTA 4OO3A 3VI3B 3I05A 2Z57A 5CLLA 1CHNA 4WZZA 2E1PA 4ZCRA 3FUVA 2RGEA 4UPDA 2GN6A 1TKAA 3RFXA 4FDMA 3A4MA 3WL3A 3F3KA 1J97A 1QFSA 2EYUA 5HKKD 4M55A 5A9TA 1K5HA 2FDXA 2H63A 2P5UA 2IPLA 5DULA 3WGZA 1ZUD1 3FKQA 3L07A 1VE1A 2G5CA 2R8RA 3CU5A 1OLSA 4OQPA 3QU4A 2JK1A 1FNSA 3PUVA 4R81A 1KFCB 2YWRA 1XPJA 3QEMA 1I4WA 2HMAA 1SO8A 3FZQA 3GHYA 2IH4A 1TYBE 3NMUF 2PXXA 3FTDA 5J2UA 2ES4A 2X1HA 2HLDD 1JAXA 2O7SA 1PL0A 3IOBA 5C7LO 4H4DA 5ULLA 3UA3A 4N0PA 3FSGD 4JR0A 5D5HA 4KLZA 3P2YA 2EQAA 1I0ZA 1SM4A 2FF7A 2JGRA 3ASZA 1SC3A 4REOA 1EFVB 2AEFA 1F06A 2H4ZA 1LWNA 3H2HA 1A9YA 5JO9A 4UHFA 5KPDA 1A69A 2JD0A 3NQ41 2CUNA 1Z2PX 3TEFA 1N2BA 2YWHA 3LDGA 1DBRA 1VJDA 1LLFA 1YXMA 4RESA 3RSZA 3U7QA 1EVEA 1KO4A 1XEAA 1STOA 5E7QA 1CQIB 3G82C 1R6AA 1KKLA 4OH7A 3HZOA 2WFAA 4ALIA 1ZFNA 4IMJB 4P5DA 1XRRA 3ADOA 2GRUA 2P2NA 3HCRA</