3LUPA

Crystal structure of fatty acid binding degv family protein sag1342 from streptococcus agalactiae
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
283
structure length
283
Chain Sequence
AMKLALITDTSAYLPEAIENHEDVYVLDIPIIIDGKTYIEGQNLTLDQYYDKLAASKELPKTSQPSLAELDDLLCQLEKEGYTHVLGLFIAAGISGFWQNIQFLIEEHPNLTIAFPDTKITSAPQGNLVRNALMCSREGMDFDVIVNKIQSQIEKIEGFIVVNDLNHLVKGGRLSNGSAIIGNLLSIKPVLHFNEEGKIVVYEKVRTEKKALKRLAEIVKEMTADGEYDIAIIHSRAQDKAEQLYNLLAKAGLKDDLEIVSFGGVIATHLGEGAVAFGITPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DegV family protein
publication title Crystal structure of fatty acid binding DegV family protein SAG1342 from Streptococcus agalactiae
rcsb
source organism Streptococcus agalactiae
molecule tags Structure genomics, unknown function
total genus 86
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02645 DegV Uncharacterised protein, DegV family COG1307
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1180.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein Tm841; Chain: A;domain 3 Hypothetical Protein Tm841; Chain: A;domain 3 3lupA02
3.40.50.10170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lupA01
1MGPA 2G7ZA 3FDJA 3PL5A 4X9XA 3LUPA 1PZXA 3NYIA 3JR7A 2DT8A 3FYSA 1VPVA
chains in the Genus database with same CATH superfamily
1DE0A 2BDEA 3CZQA 3D1VA 4O2RA 4QYXA 1PTKA 5B7PA 1HDYA 1PG5A 5K2OA 2A3RA 4MRVA 2H2WA 3LHDA 2ZPTX 5AT1A 1IY0A 1JZQA 2ZSBA 3N0XA 1Q92A 3O8QA 4KX5A 2OHGA 3GUYA 1ORDA 3LCVB 2WM8A 3AC0A 4BKUA 4Y30A 1Z6GA 3FCOA 4YO7A 3W5HA 2E2WA 4BNLA 3SLRA 2QMEA 4JBGA 5BWNA 2WG0A 2WWGA 4EELA 4LUCA 4OYLA 5ILOA 1PWEA 3GARA 1ZM7A 1UPBA 4WPGA 1G59A 2F1HA 1XKTA 4JC0A 2AYYA 5JJCA 1HDZA 4MUBA 2OXIA 3ROTA 3QLUC 5BRNA 3FLBA 3P9RA 3DMYA 4EMSA 5K4GA 3I9JA 3PYLA 3E7DA 3TINA 1O58A 2XH8A 3D6VA 3WK4A 3WOHA 1EFPA 1MX5A 1MNQA 2I3GA 2VVTA 3A1NA 3FKJA 3GGJA 1UOEA 5EINA 1XX6A 5BW6B 3WB9A 3WIUA 5BWOA 2FFAA 2J41A 4RZQA 5BY2A 2WHPB 2CSXA 3A4MA 3EZ6A 3LCRA 1ZCJA 2BGTA 2OK8A 4UUAA 4IO0A 1XLUA 4QDUA 2AIRA 4BVEA 1LPSA 2FK7A 1LLCA 4IDQA 2OV4A 4NDZA 3AM1A 1LNQA 5A5FA 2FFBA 5GQSA 5A1JA 1M7HA 5IJZA 5DHTA 4MQ6A 3CVYA 5AVOA 1J8QA 1P39A 1P1IA 4D1YA 3B6ZA 4TL7A 2AOVA 3BXPA 3TD6A 1J0EA 3RKRA 1ZKMA 3G5AA 1S3SA 1EJ0A 4QXQA 2F17A 3FM9A 2XQGA 1PLLA 4DR7B 4ABYA 3WICA 3Q15C 1U80A 1DLIA 3GHYA 3I6IA 1BSVA 3BZWA 2IPOA 2H1WA 2WP0A 2OXFA 3RSCA 5IMSA 1I6KA 1RWPA 2QP3A 2VATA 4BLSA 5ESWA 3WLOA 2VNKA 4R2LA 1KO7A 2AJCA 4G4JA 4BY9E 3OT1A 4K6MA 3T3HA 4CKXA 4UBMA 2D2XA 4WLOA 4C3ZA 4GNKA 2DOKA 4RK1A 5KNCA 2P9EA 4J49A 4LTMA 5ELXA 1QIJA 4AKIA 2FPKA 1GNPA 3ZKWB 5I7WA 1ONPA 4UKDA 1F2TB 4F72A 4BU0A 2XNHA 1YQUA 2NTEA 1JA1A 4OXXA 1BWQA 1ZEJA 2PAFA 1VMDA 1UKYA 3WWZA 4GC9A 2PFKA 2XGGA 4ZZ2A 1XVUA 4LYGA 1GYRA 1OYYA 1SZDA 1SBIA 3LH5A 4KREA 3N0VA 3ITKA 3A9WA 1GQ2A 1FSSA 1NPYA 2JLCA 4FYXA 4KPYA 4LHVA 4W7SA 3D3JA 4YAWA 5KTSA 1U7UA 4CQMB 1E9VA 1PR6A 3CZ4A 3K96A 4AMGA 4ES6A 3GLIE 3PZBA 2GXAA 1R88A 5IRCD 1P31A 3QIVA 1QG4A 2QRLA 3GHHA 3GPBA 3NHYA 4WLEA 3THWA 1M6EX 4DCNA 4ZJYA 1PV2A 1ELOA 3KPWA 2OHJA 1BN6A 4DCMA 5CM2Z 1KPIA 2BHNA 4Z2YA 4CFSA 2C9BA 3AFOA 2Q0SA 3RS7A 4D0SA 4RTPA 2FWAA 4KIFA 2VP3A 5DEOA 3ZOKA 3SIPA 4WBNA 3ZV4A 1TVKB 3PFHA 4ZPXA 2JHAA 3ZLTA 4IFIA 4E5NA 4KLNA 2B6HA 5CA0F 1GQQA 2XZOA 1OH7A 2VK1A 3O91A 4FJ1A 4XCQA 1TM5E 4UE6A 4HVCA 3QLVC 1OH5A 3SLGA 2JCBA 1Y98A 4OHFA 4QTYA 2PO7A 3DEAA 2P40A 2Q1SA 2QW1A 4D79A 1TM3E 3R0QA 2NUTA 4Y7CA 3A05A 3MEQA 1BEEA 2AFRA 4F9TA 1Q74A 2YXPX 3LXRA 3I23A 4RVSA 4XR4A 5LMZA 1IBLB 2B7LA 4PR3A 1ULUA 4R1LA 1C0IA 3S8MA 1CIPA 1GU7A 2CLEB 3HB5X 2XT0A 5TQVA 5D3MA 4I3GA 4E31A 3ZQ6A 1GD1O 3OZXA 3E3OA 2GPTA 3Q5EA 4R2XA 1DBPA 2VL7A 3M4NA 3W6PA 3BH0A 4AS3A 2CHVA 3E2MA 3MWDB 1JAIA 1VHLA 1W9MA 5K8TA 1Y5RA 3LWDA 3MJEA 2D1RA 1G16A 2HT6A 2C7QA 1FVOA 2A1IA 4TS9A 2GZDA 1N0WA 3AFMA 3NEYA 4UCXA 5H4HA 1A50B 1JU4A 2JI8A 1TA4A 2X2PA 5IVDA 4FIZA 1OWLA 3ZPXA 1J4AA 4CW7A 1D04A 1ZH6A 1NWCA 2VYVA 5I45A 4F3TA 2WSSD 5DNCA 2BD0A 1NVAA 2ADMA 2ZT8A 3V7FA 3TNYA 2HQSA 5BNTA 1UKBA 3I01M 3NATA 1JQEA 1M7GA 1Z0AA 2OCBA 3MIZA 5ALGA 4DJJA 1V2GA 3ELDA 1Z2PX 1H2EA 4BO2A 4EW1A 1Z2EA 2OORC 1ZDMA 2M1XA 4JB8A 3W04A 1Z83A 4ZCIA 2N47A 5F9FA 3DOFA 2JFVA 4B46A 3SXUA 1XPJA 2J85A 2ZETA 3IVGA 4NESA 2HSZA 2EATA 4AJ4A 4BQQA 3E35A 3OMLA 2WWXA 1YR7A 4EFNA 1C0EA 1E4VA 3E18A 4PLCA 4RA6B 4J16C 2YN4A 4R40A 1YS7A 4GZLA 3KKNA 4WDQA 5LZ8A 5JFGA 2JJ1D 3ZD7A 1N32B 3M9LA 5J2TF 4G5SA 4R5MA 1P75A 2X58A 2YMLA 3I04M 3WAKA 1KMHB 2OB2A 4NCJA 3KOZA 3O21A 1A4XA 2NTJA 1S02A 1VJ5A 4Q12A 4REOA 1YK1A 1C9MA 5PNTA 1ZD3A 3SI7A 4DLVA 3KCNA 1JKJA 2P4HX 1N34B 1XU4A 3B38A 1GU0A 3F7OA 2Y1LA 3I2YX 4FIDA 2SECE 3EEOA 4JLKA 2H4WA 1R00A 2OPBA 4F21A 5SY6A 2ZJFA 3AHJA 1DVRA 2XYGA 3NEPX 3M7IA 5DHFA 3L7YA 1UBMS 2ISQA 3ILSA 1RVV1 1XN4A 2VDPB 3JZMA 3O75A 4J6FA 5EPEA 4FQ5A 1T8TA 3VPAA 3KP1A 3P45A 4C7JA 2PD6A 2YNMA 5JZ9A 4MI1A 1MHPA 5KSYA 2XCRB 3GLFE 2JJMA 4FMDF 5IANA 3TW8A 2EJCA 2X1VA 3Q3JB 3JAWA 4RQBA 4L57A 1F3LA 4EF4A 3FOCA 3KOOA 3LC1O 2WP8J 4HDCA 1SUFA 1VA5A 2V1XA 3BZBA 3V9PA 2OM6A 5IHPA 4S35A 4R83A 3U6KA 4BMDA 2WU8A 1SRQA 3IBSA 3TFQA 4P3YA 4PSCA 3HA3A 4K9KA 4BGUA 3KQLA 1FL9A 2I7VA 3A32A 4PGAA 3VDRA 3E81A 4QJBA 1ID8A 1Y1TA 4RVCA 3UATA 2I34A 2A5YB 2YRFA 1F17A 3IMGA 4TTJA 2V4UA 2X86A 4DV1B 1C4XA 3NP7A 3F7TA 1X9GA 1E59A 2R5WA 1BX3A 2YMQA 2WHYA 4HN4B 4DG9A 4ATNA 2C2BA 4E33A 3EXFB 4PGHA 5TRTA 4PLVA 2ZJ6A 1TLTA 3LX4A 1MENA 2X0FA 1EFRD 5FPYA 2IYLD 3LZDA 2W6JA 1UODA 4G0ZA 4E5VA 1J7KA 1XD9A 2Z9CA 3JQGA 5FWDA 1Y81A 2CDNA 5JS6A 4ZOLB 2UV8A 4OLJA 1YZHA 2VDKB 4YRMA 2FNAA 3RUEA 1RQNA 2KHZA 3KKZA 2QA5A 3RVOA 2DCMA 1PIWA 1FUKA 4FZ5A 2J9YB 2IPLA 3JXEA 3RFVA 1K92A 3SZGA 2HK8A 2H18A 3EWIA 2AXEA 4KQKA 5DE3A 1A9XA 2AB0A 1F38A 1YC5A 4A7PA 4ZFNA 4EY8A 2I6UA 4HTFB 3IODA 1N6PA 3H4VA 1XJCA 2FN4A 4XFDA 3S99A 4CMCA 1PR1A 1V11B 2Q5EA 4QFDA 4JENA 3IAS6 1X38A 1MKYA 1KMCA 3CTMA 2WTXA 3F49S 2EGGA 1E0JA 1XMIA 2A9JA 2G1UA 2WJIA 1HF3A 2WD7B 2X9VA 3I2KA 1H65A 3T99A 4F2WA 5KNCH 2JCGA 2EJVA 2WM2A 2AVDA 4ARUA 1PYDA 3CINA 1G8SA 4KRYA 4XVCA 1XZKA 2PT6A 4K3UA 4UTVA 1MHTA 1UMDA 2IDKA 1UWLA 1PUXA 1IONA 2DC1A 3O74A 4FMPA 4RKQA 5FBQB 3RUDA 5BV2P 3SVTA 3T8YA 4QXOA 1N2JA 4CMEC 3BCUA 4BFLA 5BQFA 2VXYA 4FYHA 1D2RA 4Q3OA 1NJ5A 1P1FA 5CGZA 3TVYA 4DREA 2BRUC 2P4QA 1QS0A 4K05A 4ZAFA 1ND5A 2BP7B 2B98A 3BGIA 3RREA 4BQNA 3FTNA 2R00C 1R7RA 4IHJA 1L7MA 1Q1ZA 4BVFA 5H68A 1W8DA 1L1EA 1DRUA 1H2YA 3QXGA 4DCPA 5SICE 3L77A 4RZHA 5BN3A 3LHFA 1ZN9A 1IIRA 5ALNA 3PPIA 2ZFUA 5SZJA 3C7CB 4B34A 1T3SA 2MSCB 1R0CA 1ZLXA 2OBMA 3QVGA 4F9EA 4RESA 1X7ZB 2XB2A 4Y6PA 1I5OA 3RFCA 2PX5A 1KJJA 1NLFA 1UKCA 4KQ2A 4BNJA 2ZYGA 2X4LA 5HRAA 2DP4E 2O1EA 4IIJA 2VCHA 621PA 5KYUB 3DOCA 1I14A 3FNGA 1P6QA 1RE0A 3PUZA 5THKA 4MV8A 1RXUA 3T4EA 4PNZA 4DCGA 2C7PA 2BGGA 2Y2VA 3BH6A 4R1SA 1Y3AA 1JJVA 1TQ6A 5AKJA 2JAWA 4S1TA 4QRDA 1NF3A 2F55A 1ZM3A 3B9QA 3PDIA 5DISB 3ONNA 4W5WA 2B5VA 2ATEA 2OV1A 2IDJA 4TWRA 4ND2A 4XIFA 4LECA 2PFGA 2W6MA 2XR1A 3ESYA 2PR2A 4LJ7A 2RKWA 4LX8A 2I1LA 5JXJA 5FV7A 1B76A 4CTMA 3HVKA 1ZSVA 4LVNA 3RS4A 3KZXA 5B64A 5JNUA 5T41A 3QU5A 5G4KB 5ARBA 2Q5JA 3T35A 2II6A 3SLKA 3GGPA 2ACWA 3I73A 3KAJA 4FEAA 1F14A 1XOIA 2R7MA 1L7EA 3OZEA 3R76A 1XZEA 2G63A 3IUPA 3LCCA 1CUJA 2P7IA 3Q3HA 2CL6X 4PTZA 4BLWA 2PXXA 5JC1A 4ESVA 3IXLA 2VNHA 3MHPA 2OAGA 4JYCA 3CNHA 3ZCPA 2O5RA 4GOND 1P5HA 3CLRD 4A9AA 1QPGA 3LL4A 4D41A 4RTOA 1C4KA 3DB1A 3VR3A 1V45E 5A4JA 5C5IA 2FSFA 1PTJA 1IH8A 3SCZA 1Q12A 1TECE 3WJ7A 2EDAA 1QFXA 1W5AA 2H4HA 3C3EA 1IUKA 2E4WA 2R4UA 3HYTA 3OE1A 2H65A 4JXJA 4TWZA 4WNYA 4DRZA 1AN9A 1OA0A 2WFZA 5I5EA 2AFHB 5FR1A 4ZO4A 1U28A 2ZUFA 4Q4AA 3WX0A 3EY9A 5K0CA 4BO4A 4CEJB 4QXAA 1JEQB 3QOXA 1A5SB 1UEIA 3A8TA 3EIWA 4WSOA 2QAJA 4MRRA 1D4AA 4Q01A 3UQYS 3B53X 1CUCA 1HE8B 2PSFA 3HR7A 5I4IA 4R71A 4EKYA 5TPZD 4BVJA 1XKQA 4OFZA 1Y89A 5G40A 3JARA 3JV7A 4R5HA 1Q5PA 2NU7A 1JG1A 1H6DA 3P2MA 1WVIA 2GJ9A 3MWLA 4G1CA 4LJKA 5DBHX 3MBOA 5EJ8A 1QFZA 2IZ0A 4H7JA 4BKOA 1EB8A 3DOOA 4M54A 2CUZA 2QORA 3HCPA 1KBQA 3MS4A 3IRVA 2KS6A 4NONA 5I9LA 4QLAA 4UJ3A 5JCJD 1URPA 4EOGA 1C3VA 2H0RA 3F90A 3F2VA 4ZT3A 2Q7DA 4BASA 3TK1A 1ZI6A 1P1RA 4GO1A 2HW8A 4GP9A 3HKBA 3C3BA 3W5SA 1ZIPA 1COWA 4MVYA 4Q66C 4HPWA 3D59A 3OC6A 1GZUA 2V55B 1O8CA 1WMFA 2HHAA 3KUXA 2AHRA 1D0SA 4QIHA 1D1PA 3TSAA 2YYAA 5C5DA 1BU5A 2B20A 4FKZA 1J20A 1GTJ1 1P2GA 1EM8B 5CNMA 3OX3A 2UYOA 5K0LA 3F4LA 2IL1A 2NXWA 3LWNA 3UYKA 3TM5A 1N5IA 4OP2A 3CVOA 3LA6A 4WE3A 1AGXA 4UCFA 2UKDA 3TYXA 5AUPB 2DH5A 3QLTA 5BSTA 4XAQA 1BOOA 1K9VF 2CYAA 1E6UA 2K7ZA 2CLMB 4DNFA 4AI6A 3A1VA 3U56A 4UBOA 4TZ6A 1NUQA 3IS3A 4P80A 2JLVA 1IB6A 4YCLA 1RP1A 3BMCB 4KQXA 2GRUA 5CM9C 3N9IA 4XQ0A 2R96A 1DWOA 1K5GA 1E7MA 1O6BA 1ZRMA 1K7XB 2XITA 2Y0EA 3M1IA 3MK31 4L4YA 2ZCUA 1XMXA 4R3UC 1GLVA 1Z0IA 1RWVA 4KPUA 5AVYA 4M7OA 4M55A 1D1QA 1DJNA 2FOLA 2FJ0A 2RH8A 3LNTA 2QX9A 1L7DA 1OWPA 2FX3A 1ZCBA 4MGZR 2VYND 4U1RA 3WK8A 5IKMA 5KU1A 1JXQA 1B3BA 3PTAA 4AXBA 1RJ9B 4BRWA 3BMOB 2FLWA 3N8HA 1UQRA 1X3LA 4EUHA 3HZRA 1VPWA 3FDFA 1RXSA 1JQ3A 3M6XA 4DIBA 4YCJA 1FDOA 3KZCA 3E2PA 2PUVA 1WTCA 2VSOA 3FBTA 4JMLA 3UA4A 2JLSA 3IEUA 3GZTB 4HC4A 4MQFB 3LCMA 2XECA 4RPIA 1Q19A 5P8WA 1ACMA 2GXSA 3FGOA 4W6ZA 5KYWA 4F4CA 1Y6GA 1IY1A 1N9GA 3UAYA 3W6ZA 4US2R 3PRYA 1VM6A 4MLCA 4U4AA 1V6AA 1DDIA 2GS9A 1L5RA 1N0HA 3O6VA 4ZDJA 3QKWA 1U7XA 3NT2A 4MWZA 1E1KA 4LGCA 5AKXA 4EB6A 2H5JA 3FD8A 3K4HA 3PK0A 3T0FA 3WG9A 5HOEA 5HXAA 1BVRA 2H1IA 3OM9A 2Q3CA 4AULA 4K9LA 1GZ6A 1EFTA 4IG4A 4KE7A 3VPGA 4OHVA 3W5JA 4DARA 4LDNA 5HMLA 1X2EA 4M9UA 4PX2A 3J7AC 1K7CA 1JEEA 1F20A 3EA4A 5EE3A 5BW8A 1BVUA 1JDPA 4GAEA 2F67A 3TNFA 3CNNA 3KRTA 3Q8XB 3VSBA 3GJ8A 1C29B 4CLEA 2OFXA 3T1HB 1DAHA 4L27A 4QHYA 3L02A 1U7DA 3N2IA 5SZHB 1KI6A 2PWAA 3VXKA 3N0TA 4J2OA 2DUWA 2C5HA 2ANCA 2NZXA 3GPCA 4JX9A 5ARDA 1QMGA 3W7VA 1QLJA 1FP6A 5IJ0A 4NCKA 1RXCA 1X80B 2W2XA 1DOHA 3FPHA 5K3FA 1UBUS 4QUIA 3TH5A 4R1NA 1W48A 2Q1YA 1BS9A 3KVOA 4S1PA 4KQEA 7REQA 3TZEA 3Q98A 4X85A 2GEUA 3KU1A 2P6MA 3OG9A 3KNZA 4M0DA 5BXQC 3ORQA 2OD2A 5CIQA 2OXTA 5A4KA 3C6XA 1QM5A 1CYEA 1IBMB 2I29A 1GCOA 3WA7A 4L22A 4QPDA 3ZWMA 4MRSA 1NIPA 4P3KA 4MUYA 1DO2A 2ZB4A 2P9BA 4UXIA 3U7QA 1JECA 1ZRNA 5EZ6B 5ER6A 4DKXA 2WOJA 3L7MA 4RABA 4URWR 1Q2UA 2DWUA 4G1MB 5AW6A 2M98A 2XHEA 3NDBB 3A11A 3R5XA 3GEPA 5BSVA 4QE3A 2XMBA 3FPLA 3ABIA 1QIMA 2BZ0A 1W1UA 3JALA 1FP2A 3KZNA 4Q9JA 3TPFA 1C41A 3M6LA 3W1WA 4HGZA 1N57A 1T5DX 1TJ4A 3AR3A 5FI0B 3KHUA 5GM1A 5TGTA 1WDMA 5BWBA 1AQ6A 1EVIA 4URYR 2A7XA 2FSUA 2H7CA 2P35A 3DDHA 2BJHA 3PPXA 2QL9A 4PPQA 3ESXA 1K6JA 1M0TA 1GPMA 3C15C 3G5LA 4LISA 2PKQO 3DWGA 3R44A 2J8ZA 1K5PA 3H1EA 5U1PA 2ZM6B 2FF5A 2HLNA 3PNPA 1XZCA 3PGXA 3FYHA 4KXVA 1TD9A 3FNRA 2WUEA 3I4CA 3L84A 4IJMA 3A6HA 2ZB2A 3IAM1 4XUGB 4AZVA 2IIQA 1LI4A 2W42A 1KARA 2I4TA 1WX1A 2PKCA 4GZMA 2R60A 3R3ZA 4OV6B 2V0CA 4EI9A 1KF0A 4RVHA 2XUIA 5DCLA 4N0MA 2R751 1JI3A 2W48A 1YDWA 2JEZA 2E85A 3NIWA 3WYDA 4G67A 3OEEA 4P7BA 4DBLC 3BDIA 1KI1A 1MB0A 4AZ3A 4GI1A 1UJCA 3VPSA 5KX5F 1SUDA 4KIJA 4YPVA 2WFLB 1UDBA 4JU9A 1VDMA 2P6RA 2JHFA 3I3SR 1P7PA 3R6DA 4KQJA 3OZWA 4IW3B 1U31A 3H97A 2ISSD 3HY6A 2ZI6A 3MWFA 3PIRA 1W1WA 3U1VA 3HDHA 1NQ5A 4CG1A 4PIPA 3TS1A 1Q14A 2ZUUA 3RIGA 3MCWA 2NYAA 3GI1A 4YAOA 2X42A 4PM4A 3O0DA 3N6RA 3OJLA 1ODLA 4IDPA 2GZSA 4CFYA 2R62A 3CRW1 2ROQA 3U3MA 2HFJA 1P0CA 3P9XA 1ZVMA 2Q1XA 4GOKA 4PPGA 2C61A 4OPMA 3A25A 3HM2A 2DKNA 4UU1A 2OLKA 4ID9A 3OQIB 3DVAA 4GOOD 1ZSYA 1CF2O 2FEMA 4MGIR 4Q1DA 4A8JA 4L85A 4EGJA 1CUUA 4EPVA 5CD1A 1RKBA 2HX1A 1VBKA 1XTQA 4Y0VA 1C0PA 2A9FA 2GAFA 1PT7A 5KREA 4V0OA 4KI0A 5AHOA 3ZDXB 3DBLA 4INOA 1WMBA 2P0AA 4P84A 3T3PB 4AJEA 4RLSA 3R3HA 4G5GA 4J0DA 2QN3A 2CMDA 2EL9A 4YRTA 4F3CA 4FW9A 4JMPA 5KPDA 1LB1B 1Y3CE 5BV7A 1JL3A 1XE3A 4NOLA 1BDJA 2VHWA 1WJGA 4ZWNA 1XJ5A 2B0JA 3NEAA 4QPZA 4RANA 3N39C 4U7FA 1YS4A 2RB5A 4KIWA 1EA7A 3TMYA 2F3UA 2W6QA 3ZDBA 2V8BA 4FFPA 4QSHA 1M5TA 1NDUA 2DQZA 5BMOA 1JZTA 1L3IA 4PC6A 3D2LA 3UWKA 3E58A 1J90A 1L2TA 1NBME 2QBYA 1Y1KE 4AO7A 3RYCA 3AR9A 2VT6A 2RAVA 3EFOB 1BXRB 5TY0A 1MB4A 3GXOA 1NY5A 2G80A 1VKZA 3AEQA 4DIDA 1DIHA 4IIDA 5KHOC 3C8UA 5HG0A 5I6DA 1WOYA 2GERA 2UZ1A 3ERCA 3ZWDA 1REQB 5IC6A 1RRPA 3OKAA 1RT9A 2YWHA 3DMRA 3V32A 1MC5A 2V6IA 4Z4HA 4RK6A 1MX1A 5K05A 3U7FB 3H6HA 3NV7A 4QUHA 4CT5A 1ND6A 1OX6A 1CR1A 1UJ2A 4LJ6A 1T6BY 3T94A 1E3WA 3E6AA 4QGBA 5K0BA 3UV7A 3HDYA 4OJYA 3AG5A 1WNTA 1WU8A 4X54A 3BB3A 4DMUB 3SS7X 1THMA 1PHRA 5BWCA 2O8BA 4DW8A 3V4ZA 2A9OA 2XYRA 1W0CA 3SR3A 2QU7A 3D4IA 1K9SA 1GQOA 2PBZA 2EBWA 3PSHA 3PS9A 1DAFA 3IAUA 2IEGA 4FSDA 4C4RA 4RKWA 4N01A 4DBLE 1TU3A 3WMFA 1OWOA 3TZ6A 3AVPA 4CM7A 3B9RA 1QJ4A 1HG0A 3SM3A 5B6JA 2F3RA 3MFQA 2C3OA 1P1BA 4D4GA 1KEWA 2GHTA 3GK3A 5ERXA 5M04A 1A9ZA 1JR3D 4KTTE 4LW8A 1C80A 2XVYA 3L8MA 1N9KA 2VWHA 3OJ0A 1ZI8A 4KWTA 1N2CE 2OHOA 4BYMA 4ESEA 5FAKA 2DERA 4K2HA 3RV3A 1Z8NA 2LXNA 4CQJA 5B3JA 4JI7B 3SZOA 4KXYA 4KSCA 1O94C 1J00A 2FDCA 4N76A 5C3UA 1D9XA 4BYGA 3CW8X 1V8OA 4CM8B 5EOVA 4J2HA 1RPZA 1A71A 3R3JA 1ZGCA 3D6AA 3PXCX 4IMIB 1W4ZA 2XA2A 1GARA 2CDCA 3ILHA 3A6PC 1WDLA 3VAAA 1Z4MA 4PLHA 4BGEA 1R4MA 2BR3A 3H1GA 1V8DA 1W6RA 2CD9A 4EX7A 4OQEA 4AQYB 1QGAA 4CQMA 3IB3A 4DRXA 4C5BA 1L5ZA 5EGNA 1A96A 4FLFA 3NNNA 4GVXA 2O5EA 4EFKA 4LG1A 2XRZA 1OMOA 1C1XB 2G76A 1Z2NX 4FINA 1IK6A 2IODA 5ICSA 1G2OA 2Y1WA 3HO1A 1B6TA 3HJRA 3AESB 2OLJA 1BX1A 2IW1A 1XTVA 4POAA 2GOYA 3TQIA 3VU0A 4QOFA 1WTAA 2QP4A 3RC3A 3RS3A 1E2UA 3EGVA 2E18A 4J4HA 4Y7DA 4DCCA 1UP7A 2W2PA 5A7GA 4X62B 2J3IA 5HK9A 1XL1A 1NFQA 1CHDA 3QRWA 4FGZA 4UBJA 4DPMA 5J23A 1ZHFA 1KI3A 1DARA 1L7AA 1TCAA 3SR4A 1GNRA 2QD2A 1IOZA 1P77A 5DI3A 3EOZA 2H6EA 2NT3A 2VPXA 1ADJA 5JAMA 3LGAA 1IPHA 3FCSB 4YQZA 2X5OA 1ST3A 4W7IA 1NN0A 1TKAA 3HB1A 3FYDA 2DT8A 1FYFA 4X1YA 1UZLA 4I1VA 1L5NA 5GV8A 1TE2A 1W6UA 1VL1A 4D96A 4DWVA 4KO3S 2A0KA 3V7NA 4EMBA 3KE9A 2G08A 3NHUA 4V2UA 3NWEA 4BXOB 1TFRA 4AZ0A 1ZVQA 1DXHA 3FZQA 3IVAA 4KQFA 4OB6A 3K0CC 1LV8A 1WUTA 1QAOA 2YV5A 3IR7A 3DMHA 4BOYA 5B7QA 5ICMA 1E0DA 1W0JD 2EX0A 4J0EA 4G5HA 4MPTA 5HBGA 4HV4A 5HZHA 4ZT5A 4RJ2A 2I03A 3BKXA 1WEHA 1L4NA 4GBMA 4F04A 1E9BA 1OFTA 1JJAA 2W6ZA 4BNMA 3QOWA 4INPA 1A98A 2Y1XA 2B69A 3C5EA 1SXPA 4WK2B 4BRUA 5CK4A 5AJTA 3M5WA 4RYDA 2WC1A 1BYIA 2EWVA 4L9SA 4OOFA 4Q48A 1RMQA 1ZOOA 5KVSA 2CDRA 2BGUA 1QTNA 3GNLA 3RB8A 3DMTA 2XTJA 3UXHA 3R9XB 2QRMA 1GHTA 1TU4A 4B6OA 1DC8A 3BWVA 2FA9A 2PUWA 3CJRA 5K01A 4CGZA 3DMGA 3U7EB 2O50A 1S3IA 2PEZA 1UBEA 2SCUA 4FLMA 3JSXA 4RVOA 2X40A 4AUNA 3QQ5A 3AXTA 4ILKA 4D74A 4RV9A 1EAMA 3TUZC 2JLXA 4WOBA 3WGVA 4LRSB 4DGQA 4EQ6A 1BQ3A 2MYNA 3M6VA 4N7RA 4BO1A 3FR8A 2D0OB 3KYIB 4N3BA 2XWJI 4PZPA 4TVOA 4US0R 3GUZA 2NO1A 4CNQA 4X6YA 5JH7A 4P98A 3ROZA 3E9DA 4IWYA 2I2BA 5HCIA 2FPPA 5MF6A 2JFQA 5JCOC 1P61B 2C98A 1N4DA 1GXSA 2XEDA 3A4YA 3W2IA 2AMFA 4O4IB 2ZVQX 2Y6VA 4LDZA 4FFRA 4WCVA 4ZHSA 1DBSA 2G17A 2HJWA 2XVZA 2FZCA 2Z4TA 3PL5A 4L5JA 4MARA 5CT5A 4R8MA 4A8TA 1EJ6A 3IOMA 5A1TA 1GDTA 2OCDA 4X1OA 4ZGBA 2PD4A 4O5AA 1CEXA 2C3PA 4CL3A 3ESCA 2JAPA 3PPVA 3NKLA 4H1HA 4KODA 4BWGA 2PU7A 4HS9A 4OQLA 1YGPA 5C7LO 1K3FA 4BBAA 1YHYA 3JYHA 1R6TA 3CT4A 1R5BA 3L1VA 4ODIA 3ZIUA 3B1KA 4YRPA 1QVAA 5H0IA 3DMNA 3L1UA 3UGKA 3A2MA 2GCPA 1T9CA 2H9IA 2ZBQA 3F71A 2VWPA 2OYSA 3JQAD 2FZVA 3OX1A 4TT3A 5GZ3A 2GA8A 3L1JA 1GSIA 1WW3A 5BVHA 4DTIA 1L4YA 3R5HA 5IHXA 1DWUA 1WXFA 2IEIA 2EZ4A 3T9CA 3GO4A 1FBTA 2OR3A 3ABRB 1C81A 3FIJA 1NRWA 1QDUA 3AL2A 4PFJA 1QK5A 1AS2A 2ZJBA 3M1LA 5DNYB 3BQMB 2PH5A 1UZNA 4AL4A 1RJEA 4C88A 3K1YA 1G21E 2ZUVA 1O6FA 3E82A 3IJPA 1BGVA 1P33A 2ERXA 2KB0A 3AM4A 1C7RA 2OL4A 1YBAA 3G2NA 3HNRA 3NHLA 3P71T 4V24A 1V95A 2FSHA 5DZSA 2IZOA 5AM3A 2R6R1 3CSDA 4XJSA 2ZIXA 3K6KA 5KYXA 2J5KA 3CUKA 3EDOA 3KQUA 1H9CA 1P8AA 3PQEA 1T9GS 2B9EA 3BFVA 3S29A 3TCNA 2PWPA 3QFRA 4KB5A 2HF2A 3GJ4A 2RK3A 1O96B 1U2TA 4R8KA 3WHPA 3UHAA 1J8DA 5B2EA 2I6FA 1XA0A 4A03A 3OO0A 2V9CA 3GW8A 1R9GA 3QUCA 3UXEA 1P2BA 4D9IA 4F96A 3QWIA 5L6MB 4L6CA 2YH2A 1Z5PA 4W1QA 3L4EA 3RYIA 2C9MA 4ZI7A 4K6HA 1ZPDA 1ZXXA 5C37A 3IDOA 4AMUA 1TKBA 3BVPA 3L79A 3QPCA 4HQFA 4RK4A 3AL3A 3K0SA 1DAIA 3ZCQA 1UFVA 4C6HA 2B4TO 2ZE7A 4OFWA 3OPVA 4K5QA 1KP9A 4UVHA 3VUFA 4GGPA 2DHDA 1C9KA 3O8CA 3DLCA 4D9EA 3OE7D 1HNZB 4GWGA 4HS4A 3NWJA 5JALA 4RSHA 2PNJA 4F8YA 1MPTA 5AXCA 4LY3A 5CB4B 2OILA 3TQHA 3GEGA 3ZZMA 1U0GA 1DT5A 4B47A 4BQOA 1SBYA 1JH8A 2WNHA 3GUVA 5SYAA 1UJBA 2C58A 2Q4EA 4WZBA 2A3NA 1MAWA 4ZHQB 3D8BA 1ISIA 1FFEA 2KWIA 3A1CA 3GFQA 4MA0A 4YBZA 3EQ2A 3OLCX 3OQBA 3PLNA 2QG9A 3RS5A 4MUHA 5B4TA 3WLKX 4GS5A 5AHXA 4I4TF 1TL7C 2WWRA 2WE8A 3P4XA 3QXJA 3K73O 1I10A 3ZYZA 4BJ3A 4OHZA 1AXRA 2J5RA 1OT5A 2CNWA 3EUWA 4UZFA 4HOYA 2V96A 2NADA 3KBBA 3QVUA 2PPLA 4FKBA 1OVMA 5DU2A 4AK9A 3AB8A 1O3YA 3GUCA 4AX4A 1DTSA 2D5AA 1ZHHA 5IM4A 2FW1A 3GVPA 4GF5A 1EDDA 2VH5R 5G4LA 1UMBA 4CT0A 1GCGA 3X43A 4B74A 2IXGA 3D8UA 3ZJ4A 1QBKC 4ECEA 3EXHA 4H7DA 5AVXA 5EERA 1L9KA 1VKOA 4ENQA 3UPTA 3G2MA 4XQ9A 2PYZA 3ND6A 4LWPA 5JSFA 1S8AA 4LRXA 4IJWA 3NUZA 4AJOA 1RXVA 3T5CA 3L7NA 4LWQA 4CWAA 5ES3A 3BD9A 4KQGA 1JFTA 4FBMA 4ZVRA 5BSMA 3BRWA 1J1UA 1VMKA 4QASA 5GIOE 1KAGA 2BKVA 1U2EA 3FOAA 3QNUA 1JPNA 4BWFB 3VOSA 5BO5A 3QNMA 4BBZA 3AVQA 3HCAA 4H4CA 1SC1A 4MUMA 4J1SA 2WZCA 4ZTBA 5L6LB 1P18A 4MIYA 3UJ7A 1SB9A 1TZMA 1YB2A 1T34A 3T3IA 1NQVA 4TVKA 1K5HA 1MC8A 4GNRA 4MR9A 2PQ2A 2YV2A 3L6BA 4O2BB 2HA5A 4MVJG 4XVHA 5CDFE 3BZUA 4FWBA 3DJFA 4BP9A 1EFHA 2DCUA 5GGYA 1ODIA 3D2BA 2B35A 2G9ZA 3KXKA 4GM4A 1Q1BA 2W2NA 4I0WB 4CLRA 4GKBA 2C42A 1CNMA 5EXXA 5NLLA 3F3MA 1JHVA 4P34A 1YIOA 4DDHA 3UT5A 1Y63A 3C45A 3IQFA 5E8JA 5AKLA 1CY6A 3HJBA 4L1KA 4X8MA 3ZVMA 4HO1X 2ZYUX 1JHXA 1I3CA 2XCIA 4B33A 2ZS8A 2BELA 2HCRA 4I5GA 4RSGA 4GPAA 4WUTA 1T6ZA 1NXXA 5AK3A 4H1UA 3ZCTA 1U2RA 2QW8A 3R3SA 1DXYA 1Z34A 1CULC 3IAXA 2HA4A 2CEKA 1SCJA 2EWMA 3H5NA 2FPIB 3LBHA 4G5FA 4MIKA 4XGIA 5J4VA 3FOFC 1VG1A 2DTDA 2G3YA 2ZWPA 3BEDA 1JDSA 3RVMA 4DQLA 1YFZA 1G8GA 3BFXA 3QBDA 2VQ6A 3FFTA 2YC2C 2HMSA 5CXXA 4YAFA 4OQMA 2C97A 2D7CA 2PKYX 3K4PA 1ZINA 2IYVA 3VAYA 4FYVA 5HP4A 4MR7B 1FTGA 1SHTX 2FWBA 4MVJE 3RBXA 1DTWA 1V35A 2NACA 4DDKA 1QG6A 3CKLA 4O2LA 4B73A 3ZHCA 1P4HA 4KGDA 3MWYW 5THQA 3DOHA 3PLAE 2ZYSA 4WCFB 4LFCB 3AKZA 1QIIA 3KLPX 1E5XA 1E2FA 2HWKA 1PWZA 3LQKA 2IHZA 3HCOA 5EZQA 1NPTO 2ZZNA 4QVKA 4MVJF 1FF9A 2CSUA 4PFQA 1OIXA 3VC1A 4TKLA 2X5XA 1KQ3A 3DULA 3EEBA 4FBLA 1AHNA 4IOKA 1HC7A 2AZMA 3JQ7A 4MV1A 3LVBA 4KYVA 4QGGA 2VS1A 2OFPA 2REQA 3L7KA 4NFHA 5K3CA 2DJ5A 5EWLA 5LYJF 3EPJA 2CFTA 2VNJA 2XVMA 4U7TB 1ATIA 4YCBA 5B1YA 3B6IA 1QYCA 1FFWA 1YMQA 2JFNA 2ZTUA 2ZITA 3CYFA 3LQYA 4N65A 3EARA 4YRDA 5A9TA 3ZUPA 4BKQA 4URVR 5A2GA 4FN4A 4F60A 5TQ2A 3R23A 2B1QA 2I65A 5EJEA 3GVHA 4HZUA 3SHFA 3OZGA 4KJXA 3NCTA 4DMCA 4R2WA 2ZQZA 3GGOA 5LBIA 3HZOA 1ILEA 4D6YA 4KFTA 4KNYA 2H7YA 4H0CA 1W73A 3VI3B 2GAOA 3WOVA 2ZKLA 5L4LA 1P7WA 2RGXA 3AT1A 1E4EB 3JATA 4RQUA 2OGTA 1IZ0A 4I6JA 3U1TA 4A5SA 4ENWA 3GXBA 1T3LA 1Q22A 1UK8A 4D9GA 2VDLB 3PWTA 2HB6A 5G41A 4NL4H 5TMPA 1T0HB 3TNDA 5C3MA 1AKEA 1I13A 5CLLA 4DLSA 5I8ZA 3C3AA 4FC6A 1BE6A 5BW4A 2EFCB 3KR2A 2IU3A 1GDHA 3M34A 3HEAA 4LWZA 3QEMA 3ZHRA 4Y2YA 3FPFA 5HVNA 1XDBA 2I6TA 1N6OA 1QONA 3WV5A 1XEXA 1XCJA 3DGEC 1U2PA 1BU8A 1HORA 3WK7A 3W9YA 2BBOA 3BGVA 3DFFA 3H5TA 4GEGA 3M9WA 1EFDN 3TQOA 5JARA 1XK6A 1ZJYA 3PJEA 1VI2A 4JBWA 3T1VA 2GZMA 1EX1A 2EXXA 2E4AA 3OECA 4NCAA 1QHFA 5JY6A 1EFUA 1U3UA 4LI3X 4RHFA 5FBZA 4IG9A 1I6LA 4BDSA 4WACA 1E2DA 2KYRA 3LQ2A 5C18A 1FDVA 4HNAB 3ZI0A 3OICA 2EV9A 5HILA 2ZM5A 5BSEA 5BPHA 2VHYA 5TQ0A 4BC0A 2GVZC 1SCDA 1A5AB 2QUIA 1GDDA 1V1JA 1F2VA 2C4NA 1ZA2A 1UXIA 3NBFA 4JWTA 4LFBB 4QYWA 2F8LA 4XEUA 4QHSA 4PBSA 4JLNA 5BQPA 3UK0A 3D3WA 3TECE 3CRNA 3TVDA 3OIYA 3HP4A 3U7IA 1AKVA 5CFQA 2ERYA 5HRCA 5IKPA 1DBRA 3HRHA 3DCIA 4RF4A 4TMTA 1E1MA 1SG6A 4DLZA 1NBAA 1FQWA 1PT5A 4MP6A 3L6EA 1HYHA 3OT5A 2F4NA 2OGZA 2VF4X 1M9NA 4KLRA 5F2OA 4IY1A 1P5RA 3GJ7A 4RD4A 2NX2A 2AT1A 2W9XA 3S2ZA 1AH2A 1X77A 5F33A 4QDXA 3E84A 3HS3A 4IXMA 4ZP1A 2V7QA 3AETA 2LRHA 1PKEA 3BPSA 2WINI 1I7SB 1SB8A 4JNKA 1SA0B 3HJFA 5F5XA 2GF0A 4C4ZA 1LK5A 3TTTA 5E9AA 5AFSA 2EKQA 4OY3A 1M8PA 3IA2A 4IYRA 2CXNA 4H7FA 4AURA 1RM5A 4S1NA 1J21A 2OGWA 2PX6A 1BRTA 2QJRA 2GETA 1PYGA 3I9MA 4R2JA 5EIHA 2OK7A 1LQTA 2NAPA 2FXIA 1ZS9A 1U11A 2Q3DA 4G4GA 3VRHA 4DLTA 3C70A 2QLNA 3KYBA 2CMKA 3E1GA 3RGGA 3QVXA 4RPLA 5F73A 4HVLA 5JE8A 3W8EA 4HDQB 2COKA 2EJBA 4LZAA 5KTKA 2NAFA 3F96A 4DZTA 1ZUNB 2E89A 3L6UA 2P5YA 1DXQA 2FCRA 1XPRA 1Z38A 1VJTA 1F7VA 2CVQA 2VF7A 1JT9A 1ULBA 4FDAA 5E2BA 3SHQA 1AZWA 3TUIC 1AUOA 1L4MA 1OWNA 4LV6A 4N03A 4J0KA 1YKSA 2AE1A 4G84A 3DT9A 3FRIA 2E87A 2IIBA 3LJKA 3MGBA 4HQ0A 3DVRX 2EQBA 3VTAA 3W6OA 1OBHA 2W8BA 2XWSA 5C31A 4C4OA 4DSAA 3WWPA 2P5TB 3N2YA 1HOTA 3AB3A 4GD3Q 4N6GA 2AOTB 1YB6A 1N7IA 1Q1NA 3ABZA 4IYJA 2OAQ1 4YMTA 4JQYA 3EMKA 5CVVA 2GN2A 3B36A 2DLDA 2EBFX 1MEOA 5H80A 4W1PA 8OHMA 2WQ7A 2OMKA 4DQXA 4H7KA 4DJFC 3Q5GA 3EIFA 3I6YA 3REGA 4AWAA 3G23A 4ZQIA 4RZUA 4OEHA 6CHYA 1H2XA 1VHWA 3I42A 3MMNA 4F6CA 3V8RA 3COYA 2HLDD 2TRSB 4Q0MA 4C0SA 5A0VA 1JW9B 1GGVA 1HZZA 1FU8A 3X1WA 3HG7A 3AKEA 3A3OA 4ZREA 4JLAA 1UL1X 4H1WA 3IELA 3O1IC 5K9ZA 2IP2A 4PZYA 1PDVA 1ESNA 3JQAB 2CHFA 2FWIA 2J3JA 2C7BA 4HH0A 3CR8A 2P9JA 1HDCA 1PYOA 3UTCA 1RWXA 3DLAA 3G8CA 3ORSA 4HEQA 4MV3A 4BZXA 4ZIRA 5TF0A 2HA2A 3KAKA 3DAGA 4QBGB 2J32A 3OJXA 3AHDA 4E88A 4ENPA 1CEYA 2BFOA 2LTAA 1IEXA 3R40A 1U9IA 1KJZA 1K7EB 2JRLA 3OQHA 3FAZA 5AP9A 3K0HA 4GH5A 4FOTA 1OXXK 2ZJ0A 4M1WA 1XTUA 1HQDA 4PNEA 5LBTA 3DKPA 2WAAA 2CDAA 1WVMA 4XZ3A 5B53A 3TTWA 3WGNA 3B51X 1A5TA 2V3WA 3KSMA 1OTHA 3G2IA 5DRTA 1PZMA 2ZSJA 1QYIA 1LNZA 1XCOA 2PNFA 3BMQA 4N1AA 3EQ7A 2FN3A 2NZ8A 3DO5A 1PHPA 3O3NB 1TTHA 2VAMA 3ZV7A 2AGVA 2Z4RA 5TIIA 1E1CA 3EXEB 1AM4D 5EUCA 1RRMA 2PKRA 2W2LA 4OQZA 3RRZA 4B3TB 5T4HA 6REQB 3LPMA 2GO1A 2E21A 1B6RA 1WB6A 4Q4CA 3NAGA 4ZEVA 1ECBA 3K0AA 2VXCA 4XGNA 3P0RA 3M3DA 1YUMA 2Q4TA 3ZKAA 4LV5B 4O8CA 5J2UA 1UBTS 4ESOA 1R4NA 1FCJA 3B9BA 1U8YA 2K2WA 4FXOA 1SVMA 4JOSA 5ELMA 5GVRA 4JHXA 2N3ZA 1YCGA 3UICA 2VRCD 3H11B 1CDDA 3MWEA 5AMXA 5FYDA 2Z09A 3EC7A 1FNBA 3ND9A 4HZGA 4IX9A 3WK9A 3ZX5A 3CVVA 3RADC 2HCFA 1TLFA 1EEHA 2AN3A 3MPOA 4GBGA 4M3NA 3AJ9A 1IXRC 4FFSA 3DDNA 2PGJA 3KXLA 1HFWA 2BM1A 2JVIA 3H3JA 3O4RA 4GYJA 3IEMA 1ISPA 2GYYA 3HI6A 2JI9A 5U4XA 1KERA 2YVKA 1DOZA 2C0PA 5HKBA 4XUEA 4ITVA 4Z9XA 3UB2A 4UEOA 3LXXA 2Q7XA 3DOJA 1A8PA 2VOEA 3MQ4A 2ON6A 2YZMA 3DL2A 2NWQA 2XKBA 3WNVA 4DDUA 1E9RA 1ZWLA 1RI2A 4E6EA 1SULA 2AK2A 3C43A 3K9CA 4FZJA 4DLRA 3PCTA 1M34A 3IBCA 3OEHA 4D3XA 1V5WA 2DY0A 3S40A 5EP3A 1LI7A 3UMRA 5I9IA 4ZQBA 3Q3VA 5BQ5A 2NO4A 4F0JA 4M9XA 3PWKA 4ZAVA 1DQZA 1YI0A 3FAKA 1I51A 2DBVO 4JOBA 3GOHA 5E6UB 3B13B 2FPMA 4HUTA 3U09A 1MJFA 1BE0A 1VG0B 4PC7A 3MW8A 4HLQB 4M9RA 1UDWA 5IT5A 1M5UA 4FS8A 4WD3A 4HDNB 1FDUA 5F4ZA 3RC1A 1RAHA 1DUSA 4HDMA 2WTAA 3OFKA 3T1OA 4NXMB 4YX9A 1QH8B 4JEMA 3TLAA 1JFFB 2AC4A 3UYLA 4C6TA 2XKKA 3C3CA 2PJDA 1PW7A 1KZHA 1J49A 2BWJA 4D46A 2VRWA 2X3UA 4CQLA 1N25A 5B5SA 4ZC1A 4REQB 1NZJA 3IOYA 3OJFA 2WF5A 4LCBA 4LJ9A 4F84A 5CFNA 3B20A 4UHHA 5T4FA 5EC8A 5EZYB 3E22A 3IP6A 1MEJA 1JRLA 4WZAB 2I8AA 1J2YA 4G63A 1O95D 2HN9A 3JWEA 2HMYB 2WW8A 3LXMA 5AW4A 2QWXA 3H2GA 2KE5A 2KLBA 4LVUA 1F0YA 1V1RA 2GCOA 4M9SA 3QBEA 3TCXB 1J6UA 4F9FA 3AV0B 1MGPA 1KI8A 2XA1A 2QMZA 4YO8A 5F1YA 5I5GA 3LT1A 3FJOA 3ONFA 4MCHA 1R6XA 2FQWA 3G49A 1H8HA 1RBYA 1HLDA 3MOIA 4AKSA 3GRPA 1V16B 1VLVA 3OFVA 3IERA 1QR6A 1SD5A 3TZQA 3ZK9A 2Q8PA 3F78A 3OZDA 1D0IA 2QN6A 3NDRA 4FX2A 4GW3A 4LTNA 5DOZA 3E9QA 3TBFA 3BWEA 4DCJA 3K1JA 1P2UA 1QIEA 3ISVA 2OYCA 1V3VA 2DUJA 3I53A 5P21A 1Y82A 4R2HA 4B75A 4AJ1A 4ND1A 1RFLA 2HA6A 3EPKA 1W46A 3FGPA 2PUDA 2RMKA 1GT6A 1JDTA 2WJAA 2JGIA 1YBMA 1P7YA 2JD0A 1N6NA 2N1MA 4MVJP 1S01A 5CBPB 2RH4A 2XNDD 2GCGA 1XXHB 1SG9A 5CJ2A 4P7GA 4YP7A 1AIPA 5GJWC 4DNPA 1HTBA 1Y8RA 3W05A 5BSRA 5HOQA 5KOHA 4L5BA 4PZ0A 3EQ8A 1OLUB 1KMIY 3AKCA 3WL5A 3QUAA 1U7OA 2VJMA 5GONA 2QW0X 1AOXA 3R7DA 4W9RA 5HIKA 1PQPA 2VCEA 1P2FA 1U2SA 3WLPA 3WYGA 4GKAA 4TS3A 1TUIA 1JPJA 1G5RA 3CT6A 3DUFA 3NBAA 5I48A 5JAPA 2GARA 3ADKA 2F64A 2I67A 2JBHA 2F3PA 4GR4A 4S1VA 2HPHA 2BGWA 4P31A 1LWOA 1T0JB 3CUSA 3RBZA 1L0BA 3X44A 1UDCA 2NV2B 4NQZA 3NVKI 5FPHA 2PYIA 3R6WA 1W47A 4DPKA 4BNGA 4K9MA 3QE2A 3X1ZA 5AVQA 1EVQA 4RWEA 5JCPA 1O6ZA 4YMVA 4MI6A 4BNDA 1KH1A 1C3XA 2JF0A 3RCBA 4YRRA 2PA0A 3W5IA 4C7KA 5EHZA 3IE1A 1C9EA 4ZGWA 1EZZA 3G5UA 4FOSA 4Q3NA 2OHIA 3UXMA 4I14A 5KSWB 4IM7A 1QVWA 3GZ4A 4ZRDA 4P7KA 3B7PA 3BFKA 2ECFA 3I1YA 3L5KA 3I9FA 3A26A 2G9RA 1W85A 2Q4DA 4AFNA 4FB5A 5B55A 1LJLA 2H3HA 3LKZA 1KFCB 1Z6TA 5G53C 4KVZA 3V6LA 3T12A 3VNUA 4DJEC 4E4RA 9MHTA 3N2GB 2BR4A 2ODEA 4NHOA 2HJ9A 1S7GA 3QU4A 4GP6A 4RE5A 2VJCA 3JQFA 2FLKA 2PZMA 1R5NA 3CPSA 1JHOA 2H0AA 2X4GA 2XXAB 1YQDA 1UC5B 1O57A 3LQ4A 1T4CA 3HCBA 2V5AA 3FPAA 5JXWA 1D9ZA 3ZGZA 1DSSG 2WWFA 1QIFA 3PYXA 3RWMB 4MGKR 4URHA 1P1CA 4LXGA 1KC1A 3U3DA 3DBIA 4C4YA 4L0QA 4QBHA 4IFTA 1DBQA 5AKEA 3U3ZA 3FX2A 4QOJA 3U7JA 3KB8A 3R24A 3BTSA 1UOOA 2I1QA 3BHJA 3BSSA 1YFKA 2ONCA 3GNQA 3L18A 3UOWA 1X1SA 2CWDA 3ABQB 2ZWVA 1OV4A 3C16C 3CLRC 2QG4A 4MQUA 4WLUA 3UO8B 3VR4A 4PG8A 3IAEA 3NEJA 5DSXA 1V5EA 2BTQB 1NR5A 3H7AA 2ECOA 1LF5A 3K4QA 1WZCA 2BMAA 2DFPA 3TGPA 3GZNB 3DAYA 3OIDA 4ARIA 4B4VA 2MR6A 2B78A 3OTWA 5BN5B 4PC2A 2JLUA 2EZTA 3AI7A 4J75A 1X7XB 5FQOA 2WG1A 1A4IA 1YJCA 2QM3A 3DZKA 2DX7A 3A0UA 1USWA 1Z4PX 3PHJA 4TMVA 1X86B 3ZU2A 2WWYA 1ONNA 4YA6A 3X2EA 5TGDA 1SCBA 1B1AA 2DH6A 5IC5A 5A7HA 3C3KA 3C6MA 4Y2QA 3KK0A 4C4SA 2J87A 2DTXA 4F4HA 3LLVA 4BKMA 3EBPA 3BYZA 2O05A 3PNVA 5FDFA 2BPOA 3AM3A 1W96A 4FGUA 3AQIA 3WL4A 3FUUA 5GINE 2PL9A 1OI4A 4CHGA 1AQYA 4LZPA 4ZVPA 2WHPA 4JT9A 4DUGA 1NUAA 1T9HA 4YDRA 1E1RD 3AW9A 4MQ4A 4P81A 4KW7A 5AICA 2CJFA 2Q3BA 4X90A 4KQ6A 3ZX4A 3DB2A 1T3ZA 4O4LB 3VHLB 3FPKA 3ZGLA 2E55A 5MFZA 1IYZA 1PBTA 1I30A 2C2OA 3Q8LA 4D9HA 5H9WA 3JWGA 4JBHA 1FDSA 1T9KA 1U6IA 1SCUB 3ID6C 3IV7A 4NZPA 2JGEA 5AHWA 2VA8A 4QJ3A 3K0CA 4LXTA 4I4LA 2GFHA 2GBIA 2B83A 4RPGA 2BEWB 4D2IA 3ETCA 3PFBA 4C2BA 5JQGF 1QGUA 3SQLA 2Z95A 1E9FA 4M0UA 1MJGA 5I9BA 4EMUA 1YVRA 5I9NA 1DAMA 3M2PA 3D7KA 2WHRA 4Y2PA 2QSUA 2O0HA 1WKBA 2VF5X 3C1UA 2DQ4A 3CZCA 3SFTA 5JWOA 2QGFA 3N8KA 5E4JA 2ZLBA 1J0AA 3LX5A 3EWNA 5G1PA 5LOVF 2VI5A 4I3FA 5CVJA 2GN0A 4FR5A 4QDKA 3UB3A 5KSOA 3CY6A 1XV5A 1F2TA 3JQ9C 3K94A 1X14A 4P4TA 2IKSA 2NV6A 1KI7A 2I6SA 2RKOA 3QVJA 5LBUA 5HR5A 2XUJA 1J42A 3WL8A 4DJAA 4DHEA 1D6NA 3A1FA 4YN3A 5FUMA 4FEGA 2VP6A 3RS0A 1A9QA 1S3GA 4BO6A 2XB9A 4F92B 3F9IA 4RH0A 2GRAA 1RS0A 3BOSA 1GRNA 2Z2XA 1AKWA 1F8GA 1KU6A 4HGYA 1SHJA 4M87A 2J5QA 2XWBF 3BM5A 1T5LA 3HBMA 4LMPA 4QGHA 3L7OA 3OEWA 3T38A 1MUUA 3H1FA 3UK1A 4DXAA 3HXMA 2QTHA 3CF4G 4D9KA 2VJQA 4A2PA 1VE1A 4A73A 1G41A 3RT7A 5TVGA 4O0MA 1FVHA 4I5EA 1P6UA 2G04A 4NEQA 5BNIA 4JLWA 2Z6UA 1XFAA 3H87A 1U1DA 4GGMX 3LVRE 3EZGA 2VWGA 1T35A 5TPWB 2KX7A 2XX3A 1CNEA 2R7LA 4WL0A 1RXYA 3D6HA 2EX4A 1X1DA 5LFAA 5KIAA 2NZYA 3HH8A 4M1EA 4YC7A 3TXAA 1ZONA 3QHPA 3FMOB 2FZLA 2DE0X 2O7NA 1NVVQ 3KQMA 3Q6MA 4YJ2B 3ULKA 1L4GA 1X9IA 3P9KA 4ASUA 3DZBA 1BS1A 2P11A 2WIGA 4HLUA 3F5FA 4BC1A 3ZZUA 1ADGA 5DGIA 2NVUA 3TDKA 5JECA 3AF2A 4WQMA 3EDCA 1ZMBA 4LXYA 1UAGA 1E1LA 2C20A 3SBOA 1TO6A 4M1SA 2YHAA 4PCVA 4WXYB 4QOSA 4Z86A 3RVRA 1ZOSA 2R8XA 3MWDA 3IMCA 4ZV7A 3SP1A 5K6TA 1WXGA 2MTBA 4DV4B 1BMFD 1FUIA 2ZUTA 2VZLA 5K3OA 2JFHA 3DZCA 4CM9A 4M22A 4NICA 3VR5A 3GOQA 4QBKA 4KFCA 4Z3KA 1J22A 3UENA 5ADUS 1EKXA 4N4AA 2RGAA 4PZAA 4IRXA 3NHBA 3F7MA 2VBGA 1XROA 4Z7OB 4TX1A 4DSTA 1JPUA 1CK4A 4NU0A 4JA2A 1TB4A 4MW6A 2AZTA 4L4SA 2RGDA 1JHQA 1E58A 5AVTA 5GJVC 1CCWA 2QSZA 3W34A 4D4IA 4B3CA 1PX2A 3ROMA 2ZIAA 2VQFB 3Q4GA 4N0QA 1BMQA 1TGVA 3RRFA 2RGNA 4PZ9A 5C4MA 1NLYA 5KWJA 3G7UA 1HE3A 2OO5A 1U9ZA 1U9CA 5KNDD 1Z6ZA 1K8YB 4YAKA 2OOSA 2I3ZA 4UUMA 3VPHA 3MSXA 1P3JA 4N12A 2IBMA 3EB9A 3UAXA 1KDPA 1UKEA 1ZD5A 2ECQA 3M0EA 1SJ9A 3NHZA 4RA6A 3SDBA 5K0ZA 2X1LA 1U2GA 5EUQB 4IJKA 3VZSA 4P5PA 3FYUB 4CIWA 1D8TA 3CUUA 2OOKA 3NHAA 4GX2A 2Q50A 2QV0A 1HKUA 4EL5A 1IJEA 4DDVA 1E4YA 1KMHA 4WW0A 2GM3A 2R25B 3GQBB 3ZHYA 2FW9A 1IN1A 1OU4A 5IAGA 2PKQP 4GT1A 4WA8A 1N8TA 2CNKA 2PS1A 3DHNA 4DV7B 1Z8DA 2XUOA 2PGAA 3W4JA 1OX4B 4IJUA 5EHGA 4Y6OA 4NLLA 2OPHA 2VBIA 1OBVA 2SHKA 3M3PA 3N70A 3NC1C 4QXMA 3WMGA 2DLNA 2P3QA 3B1XA 1MEEA 5ALKA 3R3WA 1GLNA 3O83A 2IPMA 1T1SA 2WIFA 5IFLA 5AYVA 3KCQA 2ORIA 1WIWA 1LZKA 4PXYA 2G40A 5JVDB 2ZRDA 3RTBA 1YI1A 1N6RA 5TQJA 3IMFA 3O2SB 3OHPA 4IIHA 3MJFA 3UGTA 1EP3B 1K63A 1OXBB 2NXEA 2PX2A 3BE4A 3GCGA 3N3BC 2N1BA 4JLMA 2EGHA 2HYIC 3TOZA 5EIAA 3TEJA 5C1BA 3UMCA 1M2WA 1Z5GA 4RH1A 2IV3A 5A5DA 5TVKA 1SVKA 1TRHA 3FWZA 5LP6C 2OQ2A 1L7PA 2BHTA 3ISTA 4NBKA 3UUGA 3AEZA 2H52A 3FTQA 1U8XX 3I12A 5F2EA 3VR2D 4CCYB 1PQUA 1YRHA 1XLWA 2NTYC 1NULA 1EVYA 1K88A 3KM0A 3OU6A 1VHDA 1SZJG 5GVSA 1QP7A 4DZZA 4I36A 4F91B 2CVPA 4G25A 5HFNA 5IUNC 4YMHA 2ANBA 2RHWA 4QRIA 3V2IA 3HA2A 1R4ZA 2RONA 3F3SA 3C3JA 5E7JA 5HDQA 3U19A 2G9NA 4NULA 4ZOLA 1E1YA 1U7WA 2BGJA 3P9SA 1T29A 3P4UA 1U1IA 3QVLA 3PKIA 3QW4B 1W29A 1HYEA 2H8GA 3HRIA 4NX2A 5IAEA 3WWYA 1JA0A 1VGQA 4PYOA 3WGKA 4TXLA 1QQ7A 3ZWVA 1G0OA 1TKCA 1SCAA 1WZEA 4LSZA 3QWFA 1WMEA 3CNOA 1KO5A 4OH7A 4BAUA 2FMKA 3VR6A 5BR7A 2FK8A 3FCEA 1ECCA 2AQ8A 1RI1A 1TKRA 1S8NA 4PYLA 5T5QA 5IVKA 2ACVA 2ZSHA 5D86A 5EJAA 3NP9A 4IEEA 4IV5A 2OP0A 3E27A 5H3LA 2ZP1A 1XB2A 1XZ8A 2NSDA 3FXAA 4QDZA 3R7NA 1ZC3A 3AR7A 4FWTA 2ZQYA 1JR2A 3CWQA 2VJKA 2R5NA 1JLKA 3V4OA 1II8B 4R1PA 5C7IO 1YE5A 5A62A 4MCIA 4ZT6A 2O2DA 5JTUA 1H1TA 4WNCA 4Z4CA 5CDGA 4CETA 1PJ4A 4DQ0A 3ADPA 5CVEA 4TS1A 3JQ6A 3ZTWA 4BP1A 1EXMA 1YRAA 2CVOA 4C6SA 1K8RA 3DBHB 5KS2A 4MDEA 3OCCA 2O8FB 3L8HA 3QXSA 1TIKA 5CVCA 2Z5GA 3W2EA 5EJMA 2XEXA 1J9ZA 3I9V6 2R7KA 1PO7A 1I3NA 2BP7A 4BWVA 1E63A 2R1VB 3TZCA 4P3NA 4BZQA 3FDXA 1JS1X 5BMVB 5EJ4A 1GQRA 3EW9A 3O1LA 3P8ZA 1V9CA 4D9NA 3OZIA 3KHKA 4JJ7A 3WRYC 3F4BA 2DFNA 3GPLA 3V48A 4PAOA 3K70B 1Y4UA 3NLLA 5CK5A 5FNVB 1GKLA 4XWYA 1GPAA 3EISA 4BGDA 2BE9A 1OFIA 1BDHA 2GXQA 3N7TA 1IZ8A 1WB5A 1KJ8A 1V1MB 1TJ3A 3FUTA 3LGSA 3I01A 5HDBB 4UVDA 4JDPA 3DT6A 3GPIA 3QVMA 1Z2AA 2ZYVX 4JJZA 5KYUA 4ZVNA 3BA6A 1I80A 5J63A 3TE7A 1KZ4A 4AKTA 4BO3A 1OROA 3DD5A 2ONYA 2J9ZB 2HIHA 3DXXA 1VIAA 3ZIAA 1KR5A 1Y6JA 2NYRA 1EK6A 1GADO 4FGKA 2GMWA 2WB2A 2CGEA 2ZUCA 2UYCA 1NVXQ 2IX3A 3M6AA 2CZCA 1S96A 1CB0A 2KM1A 3JQBA 2WJVA 2PCJA 2OLEA 3E3MA 4TUYF 1K27A 4R9RA 2LR0A 2ZWIA 3EDYA 4IL5A 1QX4A 2TYSB 3TQTA 1TCVA 2D4AA 5IF9A 2QF7A 4TYYA 1RQXA 3MUFA 4OHBA 3LUCA 3PP8A 4IOLA 1BW9B 3I04A 1Q20A 1QPBA 5G4KA 5AW5A 4HAOA 4YRIA 5LP6F 1TQHA 1UM9B 4IQGA 3ZJ5A 2J31A 3I9NA 5TX7A 4YXWA 4P5EA 1JDBB 2RI6A 5JSKA 4MCJA 1R16A 2CK3A 1N6KA 1VCIA 4Y9TA 4A82A 4OOEA 1RHMA 3VR5H 3IQDB 4WJKB 4BNTA 4B3IA 4FILA 1EU1A 3B3GA 2QRKA 3I58A 3RTDA 1JLLB 3TLJA 3KQHA 1CSEE 4TQ9A 2BV3A 3FUXA 1QJCA 3P2JA 4INZA 4E0BA 3I62A 1BCSB 4AIIA 2Y1KA 5K0GA 4X20B 1AA9A 4KEAA 3N8IA 3IP7A 4NAVA 3L2OB 4RV5A 5IDQA 1CC1S 1LFAA 2WUDA 3C5WP 4D97A 4XWTA 1P3DA 4LJYA 1PL7A 4YT8A 4FLEA 3ZDFA 4UBIA 1VPVA 1R1DA 2NT4A 4V0MA 1CBUA 3CE6A 3TQSA 2AFHA 4ZYWA 2UUOA 4CEJA 3M6FA 5DGHA 1JEQA 2C8LA 1GRQA 3PNYA 3RROA 4A92A 3GB9A 1T6XA 3I5MA 3TO5A 3KSZO 3Q3CA 1AJEA 3GPDG 1VLZA 1RPJA 3U4CA 2G70A 2NUPB 3WAGA 2IYPA 3JQQA 4J7UA 4OA5A 3OH8A 1G291 1Z6PA 3TQCA 1OZFA 3HJUA 1RZRD 2O8CB 4Y6LA 4BJHB 3AWIA 1I5RA 2WVAA 4GSYA 2VPPA 3CRMA 1U5BA 2A4KA 4WDRA 3QWAA 3W06A 2Y67A 3CTPA 4U2GA 4YLYA 1P9LA 4FDVA 3DUWA 1D4ZA 3HCRA 4GLLA 2O2CA 1K6IA 3SFVA 2XOEA 1BKSB 4MQEB 5G02A 3W5BA 1EH5A 1QLHA 2VYQA 1L9XA 1G8YA 2YICA 3A6FA 2FUG1 1AC5A 3FYSA 1Z0ZA 2XAAA 1QMPA 1YZTA 3HJTA 1BGXT 5ITZB 1GJRA 3G0OA 4DA8A 1O03A 2PK3A 3OURA 4DKJA 2HIAA 1ZUIA 5LVAA 1T24A 1N2BA 1IUOA 2OSBA 4X8HA 4S05A 2VBFA 3GLTA 2HADA 4RSMA 1L6RA 1P0FA 2FUEA 3O31A 1TJNA 3DJYA 1W94A 4H16A 5JUWA 3KQNA 3AUXA 2J3EA 2QTAA 3ND7A 1I3KA 4WERA 4Q15A 5GV7A 3D02A 2YJNA 5EIBD 4FTWA 4G5OA 4RXUA 4EJ0A 4DYHA 3IP5A 4MJ3A 5JXGA 4BS9A 3QF4A 2FSGA 3ISJA 3VKGA 3WL7A 3D4NA 4HB4A 4JI5B 3BMCA 1ZJ5A 4TKUB 9LDBA 4N3NA 2DPXA 1ZGAA 4G65A 2XUAA 3SE0A 4B48A 4A23A 1SO8A 1USVA 3FCXA 1NQWA 2BMVA 1DHRA 2P9GA 4L7VA 1M6HA 1T0IA 3QU7A 4XX0B 3G68A 4XRRA 4E15A 2IYEA 2ZRIA 3BF7A 3PENA 3KJFA 4L5CA 2PUJA 4Y2UA 1V7PC 5D51S 3AF0A 3AR8A 5INTA 4E7OA 1GZHB 5AI6A 1IN6A 1OZHA 4XM1A 1X7DA 4UAJA 1L7VC 3BMOA 1LJUA 2GJ8A 4Q82A 1YBVA 3QKSB 3TOVA 4CGYA 3UAOA 5AVWA 3T61A 4ZYLA 3WGTA 1QV6A 1UXKA 1X1TA 4L9WA 4RKEA 4ARZB 2HWXA 1L8OA 3O38A 2M32A 3H2SA 4MQFA 4MULA 4TT8A 3VR6H 3V97A 2A5JA 2J6HA 2WYUA 3KD2A 4ZV4A 2IVFA 4HUJA 1XNGA 3OHSX 3K9LA 1B74A 1BMTA 1Y9ZA 3O84A 2FG5A 4OLFA 3SR0A 3PQ6A 3W79A 3WKAA 2GN8A 4XIIA 1P2TA 4KRFA 4JI2B 2OSVA 1POXA 1DIRA 4HEA1 1SKYB 2HO4A 1RPTA 4QFCA 3U3OA 1QG2A 4FU0A 1NVKA 1NW8A 1YCFA 3QVWA 4HFMA 3HYRA 3QFCA 3D81A 4NEGA 4MJ7A 5K8VA 5YASA 2JC3A 3B2NA 4NMLA 1PJCA 2VZEA 1OB2A 4OGLA 4LX0A 1Z0UA 2R7AA 4ZI2A 4NYIQ 3W9UA 2HA0A 3BFPA 2XBMA 1N1EA 3DNFA 3RV4A 5HS6A 4OGKA 3H3XA 1X80A 4W9NA 1MD9A 3WISA 1IBRA 2WSSA 3KELA 4QELA 5TNXA 4BMOB 1VXOA 3HZHA 4FNMA 4NPCA 2Y0CA 1LX7A 3PDWA 1A3CA 4NDNE 4C78A 1G3UA 1WHSA 3WNQA 3PCRB 4GX1A 5JS2A 4EO4A 4POOA 5KOYA 3AEYA 2V5VA 3MG9A 4YJ3F 1EE9A 1CQWA 4Y6SA 1ISFA 3AGQA 5KB3A 2R6DA 4N48A 4IDGA 1HM5A 1Z88A 2OMEA 2WUGA 2R3SA 4YR7A 3TNLA 3TR5A 4DR2B 1XF1A 2Q99A 2P8SA 3DO8A 2WYWA 4YWHA 4UFPA 1SU6A 4JSRA 3R77A 4HDKB 1JE0A 3QVSA 4UHBA 5DBFA 4J0HA 1GUFA 2C5GA 2GCNA 4IOJA 1JWAB 2JFWA 1WU7A 3AOEA 4J1NA 4N39A 3S2UA 3ZVRA 4DB4A 1DAEA 4DB2A 1IPEA 1UQTA 1Y48E 1SU7A 3I45A 3L06A 3OSZA 1DEOA 1NM5C 4L0DA 4Y9RA 1E66A 1ZH4A 3E9YA 1TDJA 3ND8A 1Y9EA 4KQIA 4IBOA 3U3XA 1NT4A 2IEDA 1KSHA 1DQPA 5GZ6A 4YRBA 5HQ3B 2FE4A 3VPCA 3IT2A 4TVSA 2JFFA 4D6XA 3B3QA 4O4JF 3LXUX 3RSGA 4C08A 5AJZA 3DF9A 1DS6A 2IZ5A 1JSZA 3QMMA 4KH0A 4LZOA 5EP4A 3RG8A 2DQKA 4OAQA 3W90A 2BMWA 2JZCA 5A9SA 1GV0A 4NAHA 2BLNA 4MOWA 2FI1A 3LBNA 1CUSA 1XVVA 4FE4A 4PLYA 5LUAA 2ZIUB 4IQFA 5DX0A 4D9MA 4ZOQI 1XU7A 1DKOA 1S2IA 3JVUA 3VYTB 5LQNA 4E03A 1KDOA 3WYNA 3T3OA 3HVJA 1PSWA 1OHHD 2E4VA 4OI2A 1BRMA 1XJQA 4IHAA 5FI3A 4OK5A 5D1HA 2NTNA 4Z6KA 4OGFA 3CSUA 3PXAA 5IYZF 4LVCA 3R7SA 1H6CA 1B2LA 4H18A 5B12A 1OZ0A 3LT0A 2WAXA 3FZYA 3SJ7A 2DULA 2WFLA 5IWCA 5TLSA 4QRHA 2J07A 1OE0A 2D0IA 3OY2A 4MKIA 3G0IA 3N2ZB 2IYXA 4UNSA 1L4KA 4UMEA 4AMZA 3L0SA 3LQQA 4JXXA 1EFRA 2WVJA 2QPTA 3LLUA 4TS4A 1MBZA 5AOAA 4UQPA 4CEHB 1MOQA 4MPJA 1FSZA 4OI1A 1XAIA 1FUYB 2H2DA 2NXNA 4XLLA 3Q8WA 3ICQB 3IHTA 5THXA 1ST2A 4JLVA 1N6HA 2Q2OA 2QM8A 2RG1A 1MLDA 3C6KA 3EHDA 3ZHTA 4HADA 3EZNA 2WUVA 2HK9A 3AERB 3C6BA 3PT5A 8ADHA 4ZOBA 2FW7A 4B9EA 3OQIA 3GLFB 4DR4B 4JUBA 1M72A 4XUCA 1E9SA 2J6BA 3FWNA 4JJAA 4YIHA 3CN7A 4M0KA 5C35A 1KA9H 4LDPA 1M74A 1PK9A 1YS6A 1QH9A 2W6OA 5HJ2A 4LNHA 5HPYB 1X8LA 5LWHA 1G4HA 2EBUA 4GLFA 3CMMA 3BWDD 3CW2A 1FRFS 1Z28A 1Q3HA 1QGYA 1CVIA 2JBAB 5C5EA 4I9FA 1ZMOA 5JFOA 2XF2A 3TKLA 3QE9Y 1YTUA 1ZCZA 4TRNA 2C83A 2WPNA 2OB1A 3OX2A 1LTQA 3V9AA 1GUYA 1KFKB 4IVPA 2WKQA 2GYWA 1A04A 1UKZA 3SKYA 1DX4A 1XCLA 1QOPB 2PT7A 2CL0X 1PWYE 16PKA 1XMVA 3CH5A 2PQ0A 3X1KA 4HL6A 3T1QA 3ZR4B 4AJLA 1QGZA 3KLBA 4AX8A 5EIFA 5FB3A 4PYMA 4GPIB 4RVFA 3EFOA 1BXRA 3HB0A 2W4QA 3NOXA 5LZ2A 2XSZD 3GJYA 1USGA 3INRA 3ROKA 1F1JA 3IVXA 5CB8A 3A9UA 2O0KA 1SIOA 3VNRA 1REQA 2OCYC 3GFPA 3FLEA 3TD2A 4B4OA 3BXGA 2YBDA 4LNUB 3A9TA 2ZWOA 1KY3A 3E8SA 4OB8A 4JFAA 4RW0A 4KOAA 3VKVA 2EKBA 3C3XA 4IUCS 4CV3A 1WP4A 4DLBA 3ZJVA 2AVNA 4CJXA 4M86A 2MT9A 4QEKA 3QUQA 5DBEX 5H9VA 1B41A 4EJSC 3NHRA 1Q11A 4HDSB 4ZCQA 2ZBDA 5DYYA 4V02A 4R7TA 1A7KA 5EIOA 3VMFA 3VNVA 1HT3A 3L0ZA 4I55B 1W5BA 2FEAA 3ZDEA 4B87A 5FUVA 1L5QA 1QYWA 1U2ZA 3J80A 4MIEA 4RY8A 2BF7A 3D8HA 4IILA 4QBIA 4WEQA 4ZZ3A 3GEBA 5E9QA 3DM9B 2HMWA 1OLOA 4HGPA 4OMUA 1FJGB 4I5FA 6LDHA 1ANKA 2IYTA 4QHTA 3T1NA 2X6RA 3D6FA 1XCMA 1Z35A 2R6AA 2JAOA 1TMOA 1NF2A 1U3GA 2QE7D 4K9PA 4IS3A 1V5GA 2AX4A 3PPWA 1L7RA 3CKMA 4UOEA 5IJXA 4IUYA 4BFXA 1NMYA 1OYVA 1YK0A 5ALSA 1N0UA 2JRCA 2DR0A 3V1KA 3PUJA 1KIFA 3Q6IA 1GL3A 1K6EA 2LZ0A 1AD2A 1ZH0A 4M37A 1B6SA 1IJKA 5CPFA 4JYZA 3LYHA 1IJFA 1IMJA 2W6IA 1HH4A 4ND6A 4BV9A 4CM8A 5EN4A 3ZNPA 3ZY3A 1Z9BA 3PFKA 3C1TA 1QFMA 1YKFA 1V6SA 5KC9A 4M7RA 3UK7A 1TK3A 4CI0B 2YINC 3PDUA 3NFYA 2FKNA 3KQVA 3REFA 1XZBA 4XYBA 5A3VA 2WB4A 3DEYX 2DUUA 4CUJA 5KWVA 1JIXA 4LF4B 1Y7HA 1BCRA 2X14A 4ZKDA 2IUSA 2Q5IA 3SX2A 4UE3S 3B12A 3FF4A 2A7QA 4EFMA 2WIDA 4P6VF 1C1XA 3EDRA 3IQGX 3B85A 3FZGA 3P9IA 4C20A 1AUQA 3U49A 1QP0A 1JQ5A 1KKLA 1EB9A 1EWVA 2GO7A 1E2NA 3AESA 2G5PA 5A03A 3LHIA 4LYHA 3FVQA 4DXHA 1VHTA 2RB4A 4FI3C 4PW0A 2PKXA 3Q3EA 3EXIB 5CCEA 5FJJA 2R6FA 5CTJA 1F6DA 4ZU1X 4A0HA 1ARZA 3H2IA 1EP2B 4J90A 5TPZA 1C8VB 5CEEA 5C52B 2GBLA 3HXQA 3C5HA 4ZJUA 2ZU0C 1TIBA 4LIPD 4RZ2A 2AOUB 4BLQA 2IU0A 1FFHA 3P9PA 2VJBA 2VN8A 4YMUA 1Q0TA 3ACBA 5LA6F 2AW3A 2BMEA 1XDGA 3UMMA 3DPIA 2F4VB 3S81A 5FBWB 5DHPA 3AR6A 2W83A 4ZZ1A 2FG7C 3CF4A 4PFKA 5IUKC 2YHIA 1N4AA 3TOXA 3OP4A 3RO7A 1MO2A 3DZ8A 3U9SA 3ITEA 3K15A 3CZ5A 2PL1A 4QA9A 2AXPA 2VC2B 2XZLA 4PN3A 4PNHA 4EBBA 4DUYB 2NIPA 3QNWA 1DIOB 9GPBA 5CDHA 4HWTA 4KFSA 4XD7A 2WUFA 4YWJA 2OY0A 4CR6A 4QTUB 1J5PA 3HBNA 4XJXA 4DM7A 2W8ZA 1XVLA 2D1FA 1C3LA 4MWOA 2C88A 3SEZA 3WLEA 4CVNA 2X13A 1Z3CA 2GN9A 2YHSA 2QL5A 4L73A 1C9NA 2GF9A 3K72B 1JTFA 3ZHQA 4OLBA 5LXTB 3DFUA 5KPJA 1EP9A 4BECA 4JZKA 4BLVA 1FRVA 2I99A 4G81A 4S2UA 4Q93A 4YYEA 2D1YA 1R0BA 1LDYA 1V96A 2HBZA 1WPXA 2ZYTX 3COWA 3DDZX 3T0IA 3WZMA 4E2YA 4DR5B 5JZVA 5AKGA 3W5UA 2W0SA 1SU8A 5BORA 3TG8A 4FVTA 1XTKA 1GPH1 3Q2OA 2FQ1A 3TLMA 4ZDWA 3PR3A 1NIJA 1GTZA 3R9XA 1ENZA 3HUTA 3IT0A 3NALA 3WYAA 1PQYA 4DFDA 2GPJA 1IWOA 2GM9A 2XQIA 4TRMA 3KOYA 4AVYA 3MJCA 1HRKA 2MJLA 2C3UA 3JQ9A 1NI4B 4ZARA 4EF5A 2B0CA 4DMRA 5ALUA 3OZCA 1UPUA 1AS0A 2PWYA 1IXYA 3L8DA 1VLHA 4A0FA 5CA1F 1ENOA 5L9AA 1K86A 3EZYA 3TL2A 1ZXLA 3KTAB 1IDOA 2RBGA 2XUHA 2O2HA 3IEXA 4TYPA 5EKUA 3RSLA 2G1AA 5KQLA 2W11A 3PVZA 3QM1A 4OF4A 3KWLA 3FHTA 4TV8B 3WNBA 5BQXA 1JG7A 3TBKA 5L7YA 4D0GA 2P1ZA 4B8ZA 4ALJA 4DADA 1SKQA 3G5MA 4XIGS 5F5LA 2Q6VA 4EEZA 2G06A 2RIRA 3HQ4O 3SC3A 1FLAA 4Q4DA 4Q3LA 3NU1A 1Y6FA 4O4IA 4PANA 1UP6A 3ZS8A 1GZVA 1GPUA 3MYYA 2PIDA 3KPYA 4ZT4A 1Y8CA 1V8PA 1HRDA 4HZIA 4BVLA 5JPDA 2EG5A 2VPTA 4KMMA 3SQWA 5K8LA 2P9YA 2FRDC 1YHZA 3AYZB 2HBRA 4YROA 4LNAA 1OH8A 5EA2A 5AOCA 2ACKA 3EA0A 4DXDA 2NSHA 3GDWA 3VYVA 2OBYA 3JS5A 4GRAA 1EFCA 4NH4A 5I7RA 1KI9A 2RG7A 1V5FA 1Q15A 5EMKA 2OP1A 3I83A 4WESB 4QT0A 4ZTZB 1RHKA 1GGFA 3TQQA 5CX1B 4D0LB 1JIVA 4HNRA 3FSGD 4R3NA 2GJKA 1IM8A 2P2SA 3LL7A 5DK6A 1FW6A 4R7GA 3RE1A 3G9XA 3U3RA 4TQAA 3G17A 4IS2A 1L4UA 4JV5B 1RYEA 3HY3A 1Y7PA 3MTGA 4Q1AA 1DJQA 1U7HA 2MMCA 2QOEA 2J33A 2ORED 3G9TA 1CF4A 5CFMA 2GNOA 2O8DB 2YWCA 3VKUA 5AUNB 1SUEA 3KXIA 2D1QA 4LOKA 1PR9A 3H5OA 4HDRB 4HXGA 2Z2KA 1PJTA 3HC7A 3IKMB 3L0PA 1JAYA 1JEJA 3PVSA 4L8YA 2F9FA 3EQ6A 4ZQEA 1ECGA 3RRJA 4XCXA 4F7DA 2J5XA 3U0BA 1AVTA 4MROA 3PSAA 1O96A 5B58C 3DOUA 1K0UA 2HNBA 5D87A 2R68A 3JD2A 2ZRNA 3LUPA 3WWOA 5CIYA 2ZW9A 2CFCA 3BSWA 5KTTA 1PNQA 2JATA 3DVQX 2AG8A 1PNTA 2H63A 4UU8A 4BVBA 4JLSA 4M0CA 5IU6A 4RXMA 5LU8A 4BPBA 2PU5A 2XTZA 4HGRA 4I1IA 1LRKA 4E2ZA 5IZCC 4JQOA 5KDLA 1M2EA 1ULHA 4BO8A 3KL4A 3CZAA 1YZLA 1JFRA 1MXFA 2B1GA 4FGJA 1TC1A 4MTCA 1AUPA 2QZZA 10MHA 3D0RA 3FYUC 2QT1A 4WXEA 1FY2A 5AH0A 5LD2B 2QD4A 3R0VA 2Z2ZA 1GGNA 5IK2D 2ZZKA 3DKRA 5JW6A 1J07A 3ENQA 1XZDA 3LUJA 5I51A 4N0DA 4PG7A 2JJYA 5IULC 4I08A 4KITB 5CYOA 3I0NA 5CB4A 3I3OA 1KK3A 4WKOA 2ZR9A 3GU3A 4UM9B 2VUSA 4C3VA 1A2KC 3FYTA 1MZPA 3NM6B 1H8ED 1N8SA 4L4UA 3KB1A 1FFXA 5EQTA 3PGVA 4ZHQA 1ECFA 4Q24A 4BO5A 1CJCA 1PD1A 1UJ4A 1UH5A 2QG6A 3H1PA 2F6RA 3IBFA 4URZR 4X3PA 1QNLA 1OBOA 1IZ9A 1CRWG 2Q5HA 4O4HF 4DHWA 4CG3A 5EVCA 1E3EA 2HHHB 1XXLA 4EG0A 5HK8A 4DEVA 3E48A 4S0XA 3WL6A 5JRZA 4WTOA 2V7EA 5IFKA 1Y8ZA 4DOMA 1MQAA 4ETMA 3WSVA 2CHGA 3KYDB 3MTEA 3UMFA 5FHQA 1LA2A 2N42A 3P4YA 1SM4A 2V7XA 4GPEA 3TG2A 2WG2A 2YUTA 4YLGA 1KVRA 4K6OA 3U4MA 3JZIA 2C2HA 1GLGA 2PX4A 3I34X 1EGHA 1ICEA 3AIIA 1NWHA 2B9VA 3GN2A 4KN6A 4Q1EA 3ZGYA 1YL6A 5DSTA 4CG2A 4DWWA 3USES 3GCDA 3RAPR 2O48X 2ZUWA 1USKA 2QLLA 3FNIA 1PZHA 3FPEA 3UFBA 1ABEA 1S2NA 4YJ2F 4YRZA 3E23A 5FPKA 1O95C 4WMLA 5ED0A 3HUFA 1EXVA 4ZMSA 5AWFC 1QIHA 3THOA 2BFFA 1RZVA 2Y2UA 1IATA 2WICA 1P4AA 2OUKA 4P3PA 4AMVA 2G09A 1FU7A 4LGVA 1CUZA 1W8IA 1PFWA 2AXNA 3KB2A 1H5QA 2I33A 3Q7EA 3AY6A 4EMTA 3GLIB 1VL0A 4D57A 5CA0B 1DFIA 4FMCF 1IB0A 5IS2A 8AT1A 1R12A 4GQAA 2EOAA 4FFDA 3O8NA 2C04A 2H8KA 3IT3A 3DWIA 4GU5A 4O2BA 3T95A 3S1LA 5EJ6A 1YASA 1AMUA 3OQMA 4JL8A 5SZIA 3WMXA 2BF4A 2NYVA 4QJ4A 5HKKD 2O06A 1NZDA 3I8OA 3WB0A 1YU9A 2Z5FA 2FZKA 3HL0A 4KGZA 4MHOA 2CL5A 4IKPA 5HM6A 2WVGA 1NNEA 4GM1A 5FTJA 3DHVA 1T2FA 4Y1RB 1DC7A 1ZESA 3G85A 4X7PA 4P3OA 1NG9A 3CGGA 1UMKA 1YRLA 4BV8A 4X66B 5AHKA 2DRIA 3DLPX 2V97A 2FPIA 4RUKA 1VB5A 3AHGA 3WLRA 3ZDDA 4DMMA 4G85A 3WNDA 4DILA 4FCTA 2HSDA 3JD1A 1XDZA 5T6BA 2IXDA 1KJNA 1WQ3A 3NRJA 2DUMA 3IAS1 1CS0B 1XNRB 2UUAB 4RY9A 3LOUA 5A05A 4DM3A 1XTZA 1Q1AA 2OC9A 2Q49A 4TSKA 4MR7A 5EGSA 1VL2A 4YP6A 4ZCLA 3WFJA 2F43B 4LPKA 3VUEA 2AC7A 4EKDA 4Z4GA 4RO0A 1EWTA 3MS2A 1VHJA 3R5SA 4XDYA 1JPVA 4DSNA 4PHTA 1SCKA 1Z47A 2A5GA 4CR7A 5KQPA 2W2TA 4WCFA 2NM0A 5G0WA 1MDFA 4R51A 3MF4A 3S55A 1Z68A 4C0HA 1DOAA 1A9TA 2P62A 5BQ3A 2H54A 4ZT2A 1V4BA 3FKSA 3U6BA 3LUKA 3FNEA 4UHEA 3ZOZA 4C0BA 1WF3A 3KDAA 1T25A 5JROA 3K70C 1R5OA 2BOVA 1XEFA 5LJLA 1EGVB 1XD2B 2WSBA 3ANTA 4G23A 1ESDA 1NZFA 2ZJ5A 5AKKA 5K5EA 1ORWA 2VWQA 4Q1CA 3S28A 3GJ5A 4BNUA 5JD6A 2FB9A 1F4PA 2RSLA 4E5MA 3FR7A 4WZZA 3TLBA 1QHIA 5H3HA 4COKA 5J2TB 1RAFA 1NMQA 1JR3A 1VJGA 4RTNA 2B1IA 4RD1A 2V7UA 4W5QA 1RM0A 2HGSA 2HRBA 5JD4A 2K7FA 1IHYA 1L5VA 3AK4A 3L5OA 4LHEA 4W63A 5IJ9B 4P8RA 3MRTA 5K6AA 4R69A 1T5BA 2BGMA 3F98A 2PXHA 1NN5A 3CLSD 4Q3DA 3O0TA 4TLAA 4YP1A 1TCUA 2N9UA 3T4XA 3C39A 2EJTA 1AO0A 1W1IA 4K86A 4KQ9A 4N9WA 4PYIA 1K5DA 4H7IA 1WXWA 1E4EA 3BIWA 3M5PA 1PQWA 4KR2A 3RJ5A 1PFUA 6YASA 3P96A 2PMDA 3D7NA 4W4TA 3MCAA 4KU4A