3LUPA

Crystal structure of fatty acid binding degv family protein sag1342 from streptococcus agalactiae
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
283
structure length
283
Chain Sequence
AMKLALITDTSAYLPEAIENHEDVYVLDIPIIIDGKTYIEGQNLTLDQYYDKLAASKELPKTSQPSLAELDDLLCQLEKEGYTHVLGLFIAAGISGFWQNIQFLIEEHPNLTIAFPDTKITSAPQGNLVRNALMCSREGMDFDVIVNKIQSQIEKIEGFIVVNDLNHLVKGGRLSNGSAIIGNLLSIKPVLHFNEEGKIVVYEKVRTEKKALKRLAEIVKEMTADGEYDIAIIHSRAQDKAEQLYNLLAKAGLKDDLEIVSFGGVIATHLGEGAVAFGITPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of fatty acid binding DegV family protein SAG1342 from Streptococcus agalactiae
rcsb
source organism Streptococcus agalactiae
molecule tags Structure genomics, unknown function
molecule keywords DegV family protein
total genus 86
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02645 DegV Uncharacterised protein, DegV family COG1307
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1180.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein Tm841; Chain: A;domain 3 Hypothetical Protein Tm841; Chain: A;domain 3 3lupA02
3.40.50.10170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lupA01
1PZXA 2G7ZA 2DT8A 3JR7A 4X9XA 1VPVA 3FDJA 3FYSA 3LUPA 1MGPA 3NYIA 3PL5A
chains in the Genus database with same CATH superfamily
2QJOA 1FXSA 1D4FA 3HI4A 3MM4A 1E8NA 3OT4A 4KCGA 2FSGA 4URFA 4AG3A 4V1CB 1E4EB 3ZDCA 4WASA 1PJ8A 3QA9A 5FOQA 3S55A 3Q9UA 4YTEA 1CZKA 1ATIA 2R5FA 3HJGA 4MUHA 2H5EA 4R9SA 5EVCA 3LL7A 3EVCA 1XTPA 1C3LA 1FLNA 3G59A 3GRRA 1V8FA 2YJNA 3MWYW 4G5HA 4CEIA 2HB6A 3L4BA 4UEJA 4E4RA 3L1JA 5JS6A 2P77A 4Q1BA 5TGZA 1X0VA 4BGEA 5KKAA 2A14A 1F7UA 4M0CA 3FCYA 2GK4A 1IHYA 2V4UA 4KQMA 1W4ZA 3KPUA 4AX4A 2AXEA 1JALA 1QFSA 2BE9A 5B4VA 1FX0B 4RVNA 5FWDA 1UMBB 1M1ZA 2FQ1A 3ZVMA 2QX8A 3H05A 3V34A 3MSCA 3JTMA 2QTAA 2GBLC 3AM1A 3EZFA 4M0KA 1VZ3A 2LNDA 3UKJA 2POQX 3K8OE 4LGCA 5I7SA 2DUNA 1TM1E 2FDXA 3VOAA 3VPXA 3NHPA 1P73A 3UGKA 3UZUA 1LD3A 2J59A 5AJZA 4BKRA 1PK9A 3W6PA 1ENZA 1QYDA 4Q3OA 2YVKA 3HDYA 2GM5A 3WL3A 3ZE2B 1R8XA 3KQTA 1L1RA 2YXLA 5CNMA 2OQRA 5SZKB 1JL3A 4OI1A 1GN8A 4R8RA 1I8TA 5LL6P 1VE5A 2QNRA 1O95D 1YA4A 1E3EA 1P5RA 5BPHA 4LHSA 3BHIA 1U9IA 2ZFUA 1UJ2A 1E9CA 2ATEA 4FFPA 5HK8A 3VXKA 4D9GA 4X44A 1RWOA 4KN6A 1RRKA 1Z16A 5EJAA 1DTSA 1GGNA 1MCZA 3K2QA 1U2GA 5DHAA 3WRXA 4AB1A 2ZYDA 4HH1A 1OWMA 4IGIA 1UC4B 2XF8A 2GTHA 4HKTA 5BQPA 3MWEB 3SYKA 2IP2A 5KC9A 1VJRA 3TUZC 1F1BA 1NP7A 2ZCUA 3WKBA 2FG5A 3M49A 3IOBA 2DGDA 5C37A 4RZQA 5CDGA 2Y99A 4PZYA 5DX0A 5A9TA 1L4NA 4OB7A 3P9KA 1GZHB 3A1VA 3VX4A 5HDQA 3G49A 3KQKA 3IFSA 3NIWA 1A88A 1U5BB 4AO6A 3H13A 1U1IA 2DT8A 4TX1A 5BR8B 3HXOA 4XA8A 2Q6LA 3ODGA 3CEPB 5LMUB 3A1CA 4B1FA 3AVXA 1M7BA 3GH3A 1CRPA 4X91A 4Z5XA 3SF8B 1CY1A 4IDNA 3FTEA 3DLCA 4ZZ3A 3EIFA 4MZDA 2HHCA 2Z1DA 3KT6A 4RJIA 2C99A 3ON5A 4QAJA 2B1IA 2HDNB 1OTYA 2G28A 4L76A 2NO9A 4KRGA 4ZYYA 2ZM6B 4H7EA 4FFLA 3LXXA 3QYPA 1T4CA 3VUFA 4CDGA 3UB4A 4W4TA 1MOQA 3UO8B 2JLZA 1R88A 3BFJA 5HCUA 4DDWA 3IPXA 1YWGO 2VBGA 4Q3DA 4DEVA 5CX1B 1OWLA 3BZBA 3PEEA 5EAIA 1UADA 3AR9A 1RQRA 4HP8A 5L3ZA 5A4KA 5JSZA 1W1WA 4N3BA 3NT5A 3ZNNA 4JBYA 4YCDA 3KOUA 3QUAA 1WZCA 5HGXA 2BP7A 4RIFA 3KJNA 2H54A 4LOHA 2I67A 2XEDA 3K30A 1DELA 3ISJA 1HH4A 1B2RA 2B3DA 3LC7O 3LNTA 1Q12A 2XB8A 3U4GA 3AUKA 1VXRA 2JFWA 4HSGA 1G3QA 2X2PA 2IT1A 2NXNA 3UF0A 4B6OA 3BXEA 4LEIA 1EESA 4DSZA 1JHAA 4DABA 1S8AA 5EP4A 1FA9A 1ZHHA 1ZL2A 2JHAA 2LR0A 2EF0A 4IDEA 3DEAA 4LRTB 5CLHA 3I62A 5DWVA 3B2NA 3NHZA 4X0EA 2FMKA 3OG9A 3W05A 4O0MA 4O0LA 3NUGA 1BXKA 4BKOA 3R7NA 1FDOA 2H1CA 4DLRA 3IX7A 3OJXA 4NOJA 4PX3A 5TF0A 5DHSA 5G4KB 3SC6A 4MWTA 4FWBA 4G8JA 4GI1A 3E70C 4NBVA 4QG7A 4TVOA 2ONJA 1NVXQ 4BLTA 1W9HA 4YXWA 3OPVA 1JAXA 4DY6A 2HIMA 1NJSA 4TL6A 4O33A 2HLPA 5J4KA 1VJCA 4UFPA 1L4UA 1XRQA 5D3MA 1AMUA 3PFFA 2FZGA 3QMMA 4KMMA 3C97A 3PTZA 4LPKA 4KPFC 1VHDA 4R83A 5F5NA 3D2CA 1R6TA 3L46A 4P31A 1T26A 3EIQA 5GQSA 1N0UA 1ZI9A 3ROMA 2OV2A 1OZAA 3O3NB 1L8XA 1RWKA 2GILA 3R9XA 2DQ4A 1DJPA 1WCIB 1ZKMA 4Q7LA 1IM5A 3VBCA 2YWJA 2IOHA 3K2IA 4FUTA 4MAAA 5BSUA 2AL7A 2I6UA 1G8YA 4FCCA 2CHQA 1ZRNA 3V4FA 1L8AA 3IC5A 4YO7A 3DT9A 4JCOA 4Q9IA 1LXCA 2CBGA 2WQ6A 2BR4A 2YWDA 4JVMA 4PGHA 1OYYA 4K6OA 1YL7A 2GAFA 1F51E 2UYYA 1Q7RA 3FOEC 1XZHA 2BMEA 3DEFA 3IDSA 4IDPA 4EJSB 1Y6FA 4ZK2A 1EU1A 3OZGA 4NSNA 1BWSA 3W90A 4Q7JB 4GE3A 3WMWA 1XYGA 1XFAA 2ZJZA 4X6XA 3U7EB 5DGHA 3ZDRA 4FSHA 3JASB 3MOIA 4E0BA 4YT4A 2E4ZA 1N7HA 2BFMA 4YQZA 4WEQA 4DGQA 3DF9A 4AZ3A 1C30A 1S8OA 2JCVA 5JSUA 3BSSA 3C70A 3GHHA 3NPMA 3NBQA 3QKRA 1WU7A 4KUGA 3TLGA 4TTSA 4E5NA 5JNLA 1YF3A 4UVHA 3FCEA 4YNBA 2J6CA 3LT0A 1D6NA 3CMCO 4G0ZA 4GX0A 5LOVA 2E5FA 3K31A 4TMWA 4JYZA 1Q1NA 2BMJA 2V0CA 4L72A 1BQEA 3VV2A 1H05A 2EFDB 1Z34A 2EEZA 4DQKA 1TF7A 4YRGA 2HYDA 3AHGA 1GFIA 2H7XA 4K9OA 3W9UA 4H7IA 1Q0QA 2A9JA 2IYVA 5AI4A 4KI0A 3SFZA 4NYIR 2QPOA 2Y2VA 1AQIA 4NEQA 3DZJA 2N46A 5BOSB 3DHYA 3K9FC 5JEEA 3GLQA 3GP3A 4M7OA 4MWSA 1PWYE 2NPIA 4RVHA 5T8KC 5I7EA 1QRAA 5FHQA 2JGMA 3DL4A 3THXB 5AK6A 4YAGA 1JJBA 5CA1A 2XY4A 3ZXUB 1QFMA 1T8RA 2B7LA 3MD0A 1LI5A 2OHVA 3BE8A 3BCUA 3TLKA 1M0SA 1UWCA 1PQWA 1F9EA 1IBSA 5DI3B 1OXUA 2AFIE 5FQOA 4A8TA 2BSXA 3P4XA 3WO0A 2IHJA 1YK1A 1DXYA 1FSPA 2G36A 3M70A 3S2YA 1RHKA 2ZROA 3CRVA 5E38A 3D5TA 3L2OB 2P9JA 1NXSA 2XLCA 2AW3A 4YVFA 1K08A 4OQZA 3EBLA 2JARA 3QJGA 2QXUA 5LDDC 4R7TA 4NPCA 1GFZA 2JD2A 3SQXA 1Z62A 4FNGA 1FFHA 1R6XA 4FEYA 4BVGA 3LT5A 1QLJA 4MRMB 4ND2A 3IVMA 4CMEC 4FE4A 1KEUA 2BEVB 5BURA 3UB3A 1SXGA 2AI3A 1YA8A 1G8SA 2PRSA 3AXTA 5HYVA 2A5FA 5EE0A 3W8NA 1SK8A 2ZSJA 4DLAA 4RDXA 1T10A 4IV0A 4F3YA 1QGUB 4JSRA 1R4AA 1KO1A 2FPWA 1ZNZA 1YBAA 5E6UB 3I8XA 5FUWA 3SFVA 3GZJA 5FBVB 1RXYA 2ID7A 3TRFA 3BOSA 5KTPA 3OESA 5BMVF 2BOVA 3RU9A 2XGJA 2J7KA 1E3DA 5BSFA 5FBQB 3LA8A 1JLKA 2QZSA 3K96A 5CGZA 4AKSA 4BFZA 2D0OB 4BUJA 4DUGD 3VA7A 1AKEA 2FR1A 2WWHA 2QYSA 3KYBA 4MW2A 1Q77A 2XD9A 4JLKA 3VC1A 4KREA 1BYIA 1F2VA 1EUZA 4FEEA 2I03A 5A03A 1K6IA 4OAQA 3MJHA 3DMFA 3I0NA 2BFWA 3TBFA 2H4HA 2HJRA 3M2TA 1UWLA 4Q16A 2ZE6A 4RVGA 8ABPA 1U8TA 5DLQC 1HX7A 2ZR0A 5TY0A 2CFOA 1T2FA 4L2IA 1KZ7B 1WY5A 2ZZKA 4PHFA 4XGQA 5FP0A 4YR7A 2WFLA 1KI7A 2VRWA 3UH0A 3GEHA 4H35A 1SU8A 1LRJA 4HWOA 3TR0A 3KTFA 3LCJA 4PIVA 3KQVA 4RY0A 3VAZA 1GCGA 3DBRB 1M2JA 2Y0PA 5G1NA 4QPNA 3TCNA 3IR5A 2PX6A 5CAEA 1E8MA 2RI1A 2Q49A 4FHDA 3SC3A 1PFVA 1O6FA 5ELMA 4R2JA 1GWNA 1ILEA 1RQLA 4NOMA 4DDHA 5TS2A 4MP6A 3MJ4A 4Q03A 5CEJA 4XGKA 2AMVA 3P4UA 2FR0A 3M5PA 4WVLA 3QY0A 3D3JA 3T1QA 2VJNA 2C54A 2ZJYA 1KSHA 2EKLA 3E18A 2R6CA 4RWZA 2XE8A 4IXNA 5KTYA 1XQXA 3STTA 4G0XA 1E5DA 4ETWA 4J76A 4MW1A 2ZJ2A 1KQFA 1FX0A 1VG1A 2XWSA 3GFVA 5IMBA 2QD2A 2QAIA 1K4MA 1PX0A 4HQKA 2HU8A 2W2PA 1RPJA 3W7VA 3IUJA 4HDSB 1MC4A 2CF5A 2FOLA 2Q2WA 2Y2UA 3MCWA 1WLSA 2JI6A 1P7VA 1ADJA 4Z99A 3PX7A 1WP9A 1DIGA 1DKMA 4LZAA 4MUMA 3NEJA 3CEMA 4B6QA 4ZMRA 1Q2XA 3IJEB 2BE7A 3OT1B 1DJOA 4X7BA 2RGUA 2PEZA 3B70A 5T7BA 3JZMA 3FPFA 4F12A 1BX0A 1ISIA 2XDQA 3AP2A 2YIVX 2X7XA 3HB5X 3KYIB 4G56A 4H9GA 4MULA 1E9VA 3C41J 1XD2B 3DHEA 4QEZA 3PXEA 4BGVA 3DR5A 1VA4A 1Z17A 4B2IA 4YRPA 1I10A 5IM4F 2L19A 2QE7A 4KWEA 1J23A 1JLSA 3CUTA 3FOCA 4JZKA 1G2IA 3NC0C 4HRXA 4KK4A 4B3IA 4FTWA 1SEPA 3R8XA 1Q0HA 2G80A 4IFTA 3VZDA 3EIOA 4ENWA 2AJBA 5ALOA 4ZGWA 2PGOA 1D9ZA 3O8OA 4QD3A 1ZA1A 3NONA 2I62A 1T0PA 5IYZF 2DERA 2CC2A 2Q9AA 1JDNA 2K7FA 1WQ1R 2C9DA 3DE1X 2QTZA 3INTA 2VA9A 4RADA 5I8PA 3OCVA 1K3FA 1NBME 3R5XA 3NJ4A 4XUDA 1IRIA 1YVUA 4OTZA 1XYVA 4F4HA 1T5HX 1EJ0A 2V8OA 3LC1O 2ZRMA 2LTAA 2O9JA 3K1JA 4MCIA 5IG2A 5JNVA 4HLUC 5G02A 3H2HA 1SVOA 3H9JA 4GGMX 4W5HA 3ITDA 1TYCA 2HY7A 3IERA 1GNLA 2EW2A 4WEOA 4XLLA 5T6MA 3ZJ4A 1UDXA 4BFXA 4BKQA 1XZBA 2F62A 4IHQA 3RR2A 1P81A 4QFMA 3UFXB 1CG6A 3VISA 4AP9A 1P18A 4TV8F 3DP7A 4HMOA 5IUKC 1WW2A 3N2GA 2JFUA 4LJKA 4L1KA 3AFGA 1KMMA 3N70A 4IM7A 1N1EA 3O1HB 4FCWA 2A2ZA 2NO6A 3EZ7A 4CYMA 2FSUA 2J9XB 3C5CA 4HCJA 4O8CA 3O4JA 5IEBA 1LI4A 4ZHSA 3N6XA 1CUJA 1DAKA 1LJ8A 2AN1A 1J06A 4FMDF 4JVLA 5GVRA 1EFTA 4TKUA 1A4XA 3W4KA 1R15A 4A91A 1WXEA 1KEKA 2O2EA 1I1HA 2CZGA 5KSPA 5FWYA 5B4TA 1UKEA 4DMCA 1YMQA 1KFEB 1KYWA 2AJDA 1VHLA 4KMRA 4LOKA 3DKRA 5AKEA 4H16A 4Z7NB 3QSYA 4FI3C 2H16A 1GUDA 2HRBA 2J9RA 3U56A 1DC7A 2PNFA 2Y0EA 3LXMA 3TIFA 4BEWA 5JNWA 1ZD3A 4DV5B 3BWMA 5C8XA 1T2EA 5DCUA 3PQ4A 4UVDA 3O8DA 3BQMB 1U2DA 3ONFA 1XKLA 2HV9A 1PG0A 4D02A 2G9NA 1F0YA 1AXGA 4RCVA 4NULA 3T5GA 2O0LA 2IYFA 3AY6A 5CDYA 3MFYA 1PQYA 1QMPA 3OQPA 1NBMD 4BFUA 1OFUX 4RYDA 8OHMA 3Q41A 2P79A 4D8YA 4PO1A 5AM2A 3ZDAA 3OZVA 1QB8A 3L0PA 2PS1A 3LA6A 2NZ2A 1JEEA 2WPDD 1IZ8A 5C7OO 5JNUA 1QQ5A 5T4HA 3GDFA 1HT1E 3ITEA 3N8HA 1IATA 5BN3B 1Y5LA 2IEDA 2ACKA 2ZQ5A 3T8YA 1NGSA 4INJA 1SQ6A 1G2PA 4M83A 3DLTA 1TECE 1XJCA 3VSEA 3ZU3A 3OBIA 3HE3A 5K6TA 3P94A 3K0SA 2X8JA 1WZEA 5J47A 2DF8A 2XT6A 1CD5A 1NONA 4K6FA 1MX1A 4ARAA 2REOA 4MWEA 1HNWB 1PJLA 2ODNA 3D3WB 1MBZA 2ZVJA 3ML1A 2P0YA 5I4BA 4B6RA 2ERYA 5FOUA 2GCNA 1KRHA 2P68A 4NBTA 3GAAA 1X70A 2WV9A 4W1SA 2DPHA 5DHQA 3SZ3A 3TJZA 1EXMA 1S2NA 2IP4A 1SD1A 3KEQA 1S9HA 4FEAA 4BO6A 1FVFA 2J7PA 4I6GA 2GAIA 4MVJF 3GNSA 1ZMRA 4PLYA 4ARIA 4R3NA 2VDOB 3RHZA 3A6GA 3ZWOA 1L5OA 1DMSA 1V8PA 3T15A 4AF7A 2NU9A 3EN0A 3EXEA 4IRMA 2ETXA 3M6WA 2WM8A 3AV0B 4MA0A 4DNPA 1E2JA 2QTFA 3HSKA 3HVKA 5FBLB 2EARA 5T4BA 3HVHA 4YA6A 5BN3A 1RC1A 2RHGB 1D5CA 5TT0A 4D9NA 4HGQA 4NH4A 5ALVA 1WKCA 2A5LA 3BRWA 4EJ0A 2ZSIA 1J8QA 1XWIA 2BJWA 5CAEB 1FQKA 3QQ5A 5EKTA 5BNFA 5ITWA 3MT8A 1O0SA 2CW5A 2YIMA 3IAHA 3IO5A 4ZQGA 1STOA 1MEOA 3GUVA 1NLUA 5DYNA 2QD4A 4EGFA 4Q3CA 4ZVVA 1BXZA 3K0CA 5EIEA 2O0MA 1KYTA 2FG7C 3N2YA 1VPTA 1TGYA 4U2BA 1ZEMA 2Q1YA 2XZDA 3OOSA 2HU2A 3IT3A 3SYRA 1XDZA 4D82A 1M72A 2YMQA 4E5UA 2ZYWX 4AZ3B 3UUGA 3ABOB 1E3WB 1ECGA 4Q47A 3C5WP 5FJIA 4HS4A 3HCPA 2R48A 1EVJA 4CMAA 3DBHB 5EYPB 3WQRA 3N3BC 4NFLA 1BHQ1 3OIVA 4NZNA 3VNAA 2ZJ6A 1ZXLA 4OGWA 3WKDA 4WD3A 3WTBA 3H1PA 3QKSA 1T8YA 4N0DA 1SGWA 2O14A 4IIHA 4OXRA 3ZGYA 2FW1A 2X86A 2GBGA 1WXWA 1F4PA 2Q7XA 5DYWA 3WMRA 4BY9E 2YJ5A 1E69A 5BVHA 4N82A 1V3QE 2YIJA 1XDWA 3FR8A 4I0WB 1N6KA 3Q88A 1P91A 3FBWA 3QOWA 3TYXA 4EGAA 2O7SA 1PJTA 3NKVA 3H86A 1XVVA 1JPNA 3AHHA 4PYMA 1E9AA 3NEAA 1E9EA 1ZS9A 3UWDA 2OQ2A 3CFYA 4WOJA 1ISHA 3J81A 4IZIA 3LUPA 2ACEA 4MQEA 2JPDA 1XQWA 3CF6R 3VJMA 2VP6A 3HSSA 4MPDA 3DNPA 2CWWA 1A2KC 3PT9A 2RFLA 4PX5A 3RIYA 1JSLA 1PW5A 2O3UA 1PJCA 3G85A 2RHJA 2VI5A 3N2NA 1ODCA 1Y63A 5BSWA 2PPLA 1WIWA 1M75A 3HL0A 1QTQA 3ZXYA 1EX1A 4PCLA 1T3ZA 2I0FA 1POXA 5HCNA 3I05A 4YAWA 1SXJD 3MCAA 1XVTA 1GNTA 1PFWA 4Y8VA 1KH1A 3FHOA 1IOZA 3ZE1B 3PB3A 1QRTA 2MYTA 2XWQA 3IDZA 4D8TA 2GCPA 3DWEX 3X2SA 3T06B 5I6DA 5AYVA 5FAKA 2X0RA 2M1XA 4D25A 1DEXA 2GBFA 3ENQA 2JEZA 2QVBA 3FB1A 3PNYA 4WCFC 2V9PA 4B3BA 1JJ7A 1U0GA 1NXWA 1W88A 1GZSA 4UCXA 3GCZA 1YFZA 4E46A 1U7HA 4HO1X 1LB1B 2JAOA 4Q05A 3C5VA 3MWDB 3VX3A 3JD0A 4JA2A 3G0CA 3FAZA 4GT1A 2PKWA 4MAMA 3ECCA 1DAMA 4JSTA 1N2IA 2FGKA 2O4UX 4MR8A 4DCJA 1WZNA 3AVOA 3CQ9A 3P9PA 4DBVO 3GB9A 3GRKA 2EQBA 1XFDA 4X84A 3P9IA 4ECEA 4HXFB 4BECA 4ZWNA 5BSVA 4QPDA 5KZMB 1ML3A 4MMYB 5C5EA 4HJXA 1SVSA 4X65B 4PS0A 1O6CA 2QQEA 3OQNA 1CNEA 3NYQA 2J07A 2F1OA 1GAXA 1K7EB 4LNHA 4PYIA 4PVDA 1FMFA 2PJDA 5HFJA 2X3FA 3NOXA 2OGTA 4GLBA 3T7CA 3MOSA 5TLSA 1KAMA 5THKA 1TM3E 2XGSA 2I3BA 2PZEA 1VKJA 4O5OA 2PX5A 1Y3HA 3DVQX 3GCWA 4GYYA 1UUFA 3QVTA 4JUBA 1LTKA 3KUUA 4KFRA 3GFBA 3QYJA 3MTBA 4B73A 4QDOA 1TJ4A 1VCHA 1RI4A 3UWOA 4DJDC 4QU5A 4ERXA 2AFRA 1KDVA 1T1IA 1M66A 1FTSA 1W29A 2ZI6A 1ZNYA 4M0UA 5KU7A 5I7AA 1XQ1A 4ZCIA 3KLPX 3ZDXB 4TMZA 1U9YA 1ZCAA 3DT6A 3WBKA 2ID9A 1Q1AA 3FYUB 3V8EA 4BN0A 2ASVA 5EHIA 3WQSB 5K3CA 5CW2A 2B8JA 1XEWX 4YO8A 2NN3C 2XUIA 3KYJB 3DFIA 2Z2YA 3P2YA 4FBMA 1GZ3A 3VYRB 2NMVA 1VJGA 5KJEA 2GYYA 2YYSA 3B6IA 1VI5A 4QASA 3CEAA 4NEHB 5FQNA 4TKVB 2QRUA 3RSZA 4GLOA 2FWBA 3UXEA 1TK2A 2FEPA 2X7HA 2E5LB 3P0JA 5K51A 1NJGA 3SI7A 3AR4A 2YRXA 2AEJA 4JX9A 2E4VA 1DARA 1I3KA 4Y2PA 2QN8A 1V16A 3TLCA 4AQYB 1CTQA 1DFGA 2Y9PB 3GN1A 1ZU4A 3N87A 5H1YA 1P39A 3C4VA 1OLOA 3TLXA 4QKQA 3MNFA 2IH5A 1ECFA 4BV2A 4TWZA 1QQTA 4IJ5A 4OGGA 2YS7A 4MDHA 4YV0A 2H2DA 4MV8A 2NZJA 1O9BA 1JA1A 5DX8A 3BB3A 2F8TA 2OZEA 3FR7A 5JNSA 5M04A 4O1IA 3ETCA 1X1DA 5IHXA 3K3PA 1EG7A 1SBZA 1R4NB 3O1JC 2OXIA 3GOHA 2WD8A 5K20A 2QL5A 3KSAC 2BMAA 3AF2A 3ETNA 1QVAA 1YS7A 1RLOA 3C24A 5KX5F 1E6CA 3ABQB 2AR0A 3KB6A 4LGVA 1XU4A 4KO2S 2UZAA 4GQAA 4Q19A 1XKQA 4PQGA 1V11A 4UULA 3RFCA 1WABA 2BPOA 4CM9A 5JAUA 1G59A 1G9TA 4DZTA 1SB9A 1W1UA 2GEFA 1X14A 2HZ7A 3CR7A 4NFSA 4WY8A 3ZNPA 4BVKA 1NT2A 1DBPA 2VJKA 4WKOA 3PSAA 1GG9A 1P60A 5MDHA 1PR5A 1KU0A 2JFQA 4K8OA 2XQVA 4HNUA 3RHFA 2RE8A 1WXGA 1EH5A 1ZD4A 3IO3A 4IUBS 1JPUA 3E5MA 1FLVA 1Z4JA 2GHRA 4QRDA 5IUNC 1ENYA 2IHVA 1IAQA 2KSQA 3NEYA 3DOFA 1L5ZA 4CT0A 1GZVA 3TDKA 1P4SA 2Q3JA 4D3ZA 3D64A 2PGNA 2PM8A 4UHBA 1SEVA 3K0AA 4HMPA 1P62B 1EX6A 3JQDA 4UMDA 1U63A 2DWPA 4JMPA 4B84A 3LECA 3C3BA 4R3UC 1S0UA 3CNBA 4MKFA 4UE3S 5E1BA 2O8CB 1XRMA 1JP7A 2YC4C 5LMNB 3PUYA 2ZR9A 3PF9A 2GR9A 1EZZA 5AM5A 3FFTA 4NU5A 4C0WA 3NBAA 1Z75A 1JDSA 4RD1A 3CISA 4PAWA 3KXKA 4QQ8A 2AN5A 3ED1A 3TMYA 3D6HA 3L4JA 3NKFA 3J7AC 1H9CA 4Q3EA 1JVSA 1P74A 2B0JA 1M83A 2XB6A 2X15A 1HBJA 4CIDA 3PPIA 5LJLA 2WWYA 4KPYA 1XCJA 1QO7A 2PUJA 3LZDA 4RMHA 1K3UB 1P75A 1RWVA 4JROA 4G4JA 4KWTA 4DEXA 5CLLA 1WBDA 3LWZA 1LBQA 2OCYC 3FETA 3IUMA 3WWOA 3LLUA 3CZRA 5K8TA 5C4IA 4G0NA 3WGVA 1WHTB 2E85A 3DE4X 3BJRA 2YWHA 6NULA 5H70A 2A9FA 4BE7B 2XCIA 2WD7B 1XXLA 3TKLA 5AVWA 1DUIA 5FPHA 5FF9A 4PCAA 2WD9A 4PSUA 2CLEB 1HLGA 4I1RA 4W1PA 3U3ZA 4BJHB 2BFBB 3WSVA 4MCAA 1FPMA 1X1AA 3MJVA 4Q39A 4ISCA 5DPMA 3R5FA 3V7UA 3VPAA 4EG5A 2IW1A 5DYGA 3NCTA 3P26A 1WSAA 1Y34E 4MTCA 3VPSA 5A6SB 4HUJA 2BFCA 4HOYA 4Y0VA 2QRLA 3UJBA 2ZM5A 5GADl 2QLJA 3WLOA 4Y0AA 1AZWA 2D8AA 3K35A 3L49A 4GC9A 1ZY2A 1JKMA 3L7BA 4LJSA 3UMVA 3LZCA 4DADA 4BLSA 1FFGA 2DP4E 3P9YA 4NLLA 4BGUA 4WQMA 3V32A 5KTOA 4J7AA 4M37A 3TIIA 2VXBA 1P7WA 3ZDQA 3EXFA 4KXMA 4ZDJA 3DZ8A 3HBNA 4QEDA 4KH0A 3TKYA 2ZS7A 2XXBA 4NOLA 4Y1RA 2ZIFA 4EQ6A 5KUTA 2B34A 1IN4A 4YLEA 1VIDA 4MRMA 1QRSA 4ND3A 3K15A 1UC5B 2GZ2A 4DCVA 1YHZA 2PJRA 3SNHA 4V3BA 4E5SA 4U8GA 1L4EA 3PNBA 3VHQA 5AO9A 2XQGA 4X1IA 3RBAA 4YS6A 3TQCA 4M7PA 4C7XA 3COWA 3V6MA 1DAIA 1RPTA 2BDTA 3NDJA 5KX5B 2W2KA 2JAPA 3QZUA 4UMFA 4OJMX 4I1SA 1QHFA 2OZLA 1HQKA 4QUJA 4LHWA 5MHTA 1MO2A 2W8ZA 4D41A 4YRIA 4LZPA 1HNZB 3EQZA 5SV2A 1XLTC 1YJ5A 3U6KA 1ZIOA 3PKIA 1NUUA 1SCUB 4JQCA 2JLQA 4MPJA 4PSCA 5DYIA 5BWOA 4O3MA 4YONB 2ORWA 3ZWNA 1SRQA 2X1HA 1MNAA 1JHXA 1SUCA 2AV6A 2VP3A 2EERA 3JQ9A 3PC8A 3R3XA 4FFVA 4GOXA 2D0PB 3DBOB 4F1WA 5ADVA 1X80B 2FJPA 3K0HA 4EGQA 3AEUB 3K9CA 3DL7A 5IMSA 2HSWA 4WXEA 3P2OA 5I01A 5JAPA 1WB6A 2W58A 1WQ3A 4JQYA 4F2PA 4NXMB 3AF1A 2HCFA 5FO0A 2OMKA 3EE6A 1T5BA 3SLGA 4PC6A 3PXGA 3KZMA 4LZZA 2X2EA 2XMGA 2NSLA 5DK6A 1KQ3A 2HHJA 4QOFA 1R0WA 3DB1A 1GCUA 2PGLA 2FZWA 3WGYA 3QIVA 4MHOA 3L0IB 1VJ5A 2WMNB 1KTVA 1T2VA 1VKZA 2C3YA 2PK3A 2X40A 3H1BA 3KLOA 4QUKA 4ZPXA 4I19A 4LX0A 3OF2A 5JOQA 3BAFA 1GQQA 1CS0A 1UFOA 4OI4A 2IZ5A 4YJGA 5T67A 2JCGA 5LQDA 1R10A 2CXQA 2BEWB 3X1YA 5K4HA 3N2EA 3CKMA 1RRMA 1F06A 2OGSA 2EHDA 1F2DA 4L0QA 1XQ9A 4YIKA 2JIBA 2A1UB 4L85A 1DWOA 2RHMA 3JZAA 3PDUA 2ZKIA 4AKIA 3RRBA 4DUGA 3P5SA 4DFDA 3DFMA 1OGYA 3U39A 2I2CA 1LCIA 4HTFA 4N5IX 3K0FA 1QAOA 3ZH9B 5FT9A 3PFCA 1OI3A 3GLFA 3OCUA 2C1EA 4YRNA 3LPMA 3DOCA 2GM3A 1L5KA 4CMHA 2DM6A 4GVLA 4URYR 3TO5A 4J0FA 4EMUA 4ENQA 4CL2A 4KAAA 3KZCA 4EFMA 4CEHA 1D6SA 4L9WA 1FP7A 4X8MA 3KLMX 3CX6A 4J2HA 4H3KB 3VPFA 4AN0A 4EY8A 1PUJA 5ALWA 2CBZA 4QYMA 5HWSA 3BQNB 4CIAA 3IQFA 2INGX 1QO0A 4I36A 4DUZB 4P4UA 3RRYA 3H5NA 2AC4A 3F8TA 1KMNA 4I66A 4N6OA 1BROA 1V96A 2EIHA 1P80A 2OPBA 2RH9B 1CIPA 4P3KA 3OIUA 3D6TB 3IB3A 4I3GA 4ZXFA 3UK0A 5FX2A 4IHJB 4J0EA 2E3JA 3BB1A 3F71A 3H2IA 4M8NE 4NE9A 2XA2A 1XEAA 3LOPA 4Y2QA 5CYPA 3R5JA 1O5OA 2C94A 4B46A 4GX1A 3ESDA 2ZSAA 4P33A 4Q9LA 1ISJA 3NV7A 1TQHA 4U00A 3U3RA 1ZONA 3JD1A 2VIIA 2UVPB 1LJUA 3H5AA 4NABA 2CMHA 3RVRA 3EIXA 3R9XB 1YRLA 1DP4A 3RFXA 4JEIA 2RGXA 4NMWA 2XRFA 3RAEC 4X1KB 1NF2A 4K9NA 1WDTA 3E03A 4CQMA 3K16A 1KEVA 1NTOA 2ZXEA 1CR2A 1YMUA 3H2KA 4HYQA 1Q0ZA 1L4HA 3DBRA 1G3UA 3IAFA 1N77A 2WZQA 3KVYA 4PZCA 1MAHA 4FOPA 1BMTA 4LDAA 3MLAA 1MPTA 1RCUA 3ZBUA 4EW2A 1DQRA 4YUZA 2K87A 5FA6A 3JS5A 1GTG1 4ZYVA 3K72B 1S4QA 3OQIB 1FRVA 4P0PB 2JIOA 1CIVA 3DOOA 1OFIA 3PG5A 4CQMD 5KWSA 1RP1A 4WGFA 3EA5A 1A7AA 5F2OA 1CJSA 1ZH2A 2JFVA 2JIPA 2IZOA 3LGXA 3LU1A 2LXNA 4CFZA 2OK8A 1GARA 4ZRNA 2O0HA 3C6KA 1KEEB 2TMYA 1HSZA 2Q3HA 2ZTHA 1N3LA 1ELOA 3T4UA 5A7HA 3LS2A 3A4IA 3K1AA 3NYWA 2JD1A 2X5XA 3ZKWA 3DAOA 1ML4A 1EFPB 3NIGB 5ILOA 1QU2A 3H4IA 1CEYA 1P2TA 3FOWA 1J00A 4B3HA 5EIWA 2RG1A 3DVRX 1E2BA 1E20A 1Z88A 3GLHB 4A0RA 1H8HA 1F5SA 2G7MC 3D4OA 3LG2A 2VBIA 3PP8A 4NYMQ 4NNJA 4WW0A 3BK2A 3V3KA 3VR3D 4CM3A 5C1OA 5DT9A 2AZTA 5HOQA 4D4MA 5JFGA 1IIBA 3HRIA 3N07A 3PXCX 1U65A 4G8CA 3URKA 4U7DA 1IQ0A 1UXJA 3UHJA 5DB4A 5PNTA 3K70C 4MSUA 3AHEA 2FSHA 3BFVA 2GHIA 4KQ2A 4ZDWA 1VLHA 3NJRA 5FPKA 1JF8A 5K0TA 3TNJA 3KSRA 3QVKA 5CXSA 4LBWA 1BD4A 1GSHA 2GRUA 5KTTA 4ALIA 4JXZA 1ZM9A 1U6IA 3HCRA 1Z5NA 1M8GA 3F6CA 3IEPA 4NQZA 2Q0HA 4QGFA 4C3VA 2IYQA 2Z8XA 2H3HA 4LOAA 3AEQA 1ODSA 4IEEA 3BRQA 1B8UA 4DG5A 4W8HA 3IV7A 4WN3A 2PZKA 5K0EA 1U90A 2C95A 1J2JA 3R0XA 4TLLB 4KHPB 1JHUA 3M81A 3VI4B 4AZVA 4P53A 1F2TB 4KX5A 1GYQA 1S1CA 1YB5A 4FHGA 4WFJA 2PYIA 5HK9A 4E5KA 1CP3A 4R51A 4KYTA 3ZIAA 4BAGA 5IC4A 4RA9B 3G2LA 1CJMA 1CERA 3I58A 1JKJB 4F6RB 4ESOA 3PV0A 2GDJA 4B4VA 1VFPA 5JO9A 2C7OA 2UZ3A 3VUEA 3ER9A 3KKLA 1DL5A 2MJLA 3PRYA 3BZUA 4BJ5A 4UAGA 3LY8A 4BZXA 1P0IA 3E8MA 2LV8A 2C9ZA 1W2GA 4FHZA 3E3AA 2BEKA 2GD2A 3KNZA 1IU9A 4MV0A 3MPUA 5IT9A 1XQVA 3C7DB 2HJ9A 3LH5A 1WD7A 2BGLA 2GAAA 1TFRA 2VN8A 1RZUA 3EISA 2MYUA 2OSBA 3M6UA 1UT6A 4H7JA 2CJWB 3TEJA 3UJNA 1H94A 2G04A 5KHOC 4J4BA 1M8FA 3FRJA 1IBMB 1W2HA 5K03A 2EQAA 1RAGA 1UDBA 2ATXA 3WNCA 1IUPA 1OC2A 4ZCPA 5H80A 3TLJA 2V7XA 3GLSA 2Q9UA 7REQA 2F1RA 4AVYA 3FUTA 2QTWB 2J0UA 4NCXA 2GWRA 3A28A 1M8PA 1PWZA 4UM8B 1Z73A 2PVCA 3AR8A 1NHWA 1EK1A 4RFSB 1F0NA 2ZOSA 4ZVPA 2FW9A 2ZE7A 2ZJAA 5DLEA 3TXXA 3ZD9A 3HKEB 1RIFA 1SKUA 3VNUA 1EP2B 2YZGA 3PQ5A 1GYPA 2X0EA 4MK4A 3W2FA 1I33A 3D8SA 4EG6A 2H17A 1AS3A 4KODA 4L15A 3ZOZA 4GICA 3O7MA 2Q07A 1J2EA 3KQWA 3NBMA 1U8UA 3ZWPA 5JS8A 1PZMA 2BF4A 4EHIA 2I78A 2OV1A 2H2WA 1CLUA 3Q5DA 3R6WA 4EARA 1UMBA 2X13A 2LP4Y 3AONB 1CFJA 3B9BA 5C7IO 2XPCA 4NICA 3L1HA 3RVLA 5JWRA 1A98A 3TG2A 2PX8A 3SX4A 3IRUA 1LVHA 2QSJA 4EX7A 4Z4GA 2HMTA 3C2QA 1FDTA 4RU1A 3ZHVA 3AG5A 1TZKA 2WMDA 2P8JA 1SUSA 2DAPA 3N7AA 2QBYB 2ATCA 3SYMA 3V7YA 1JKIA 3LC0A 3LPAA 3M0EA 5FR1A 1NA5A 2HN9A 4TYPA 4CWAA 4CR7A 2IX3A 4MJXA 1RD4A 1ODIA 1TTHA 1OKKD 2HUNA 3IUYA 5AT1A 1QIGA 1HYGA 1RQGA 2CNBA 2C2MA 2GBCA 2ZT6A 4G0OA 4J0CA 4XX0B 5ALXA 2A9QA 5A02A 3ZEIA 1U9IC 1TUBB 4YECA 3RSGA 5HRUA 1ONPA 2O1XA 4TM7A 1FS6A 1GPAA 1L5MA 2X22A 1XX6A 1JDUA 2YNMD 2AF4C 5ENVA 1J1IA 3HB7A 3HYTA 4V0SA 4XIGS 4FMPA 2BR5A 4N49A 4CEJB 2PL5A 2FMIA 3EH1A 1Y3AA 5A62A 3RM3A 5IABA 2I7VA 5DZSA 1GL3A 3OQ6A 1CW2B 5F2EA 2VNAA 2J4FA 1HL3A 5SYMA 4AYTA 5HR5A 3KUDA 3V4PB 4MWZA 4NJOA 2B1GA 5BQXA 3AEKA 4L08A 2JG3A 3AVWA 3H0CA 1I7LA 1TKCA 2VYCA 4GM1A 1XZEA 1J8DA 2ZWVA 3BMNB 3EJWA 1QAMA 1RRVA 2YMMA 3NLLA 1QV9A 3CVWA 4FKZA 4A8PA 1ZLYA 2BHSA 4MQBA 3LUDA 2GXQA 4EKNB 2ZT5A 4UNRA 1CQJA 1LDMA 1T2CA 2HI0A 2PR2A 5FPQA 1AVTA 1NOJA 3OQIA 4L75A 1FU7A 4D0RA 3FW1A 3Q15C 2G1AA 5CJPA 5H5JA 3T3EA 3GFGA 1OE0A 2XIJA 1NG1A 2EG9A 1CHNA 3BYZA 1QXSA 4G1UC 4NU8X 3WGUA 2QLBA 4ML3A 5GVSA 3L0BA 1UDAA 4PRKA 3UWPA 1GTRA 3KKKA 4WZBE 3ZVNA 5TMEA 3FFBA 1KA9H 2BBTA 1HZZA 2VJOA 3RHSA 4MWGA 1GL7A 4JY7A 5SY6A 1JAZA 2PD4A 3D8RA 3TRDA 5FWNA 3CLRD 4IL5A 5EWLA 4D8VA 4U7JA 4U0JA 1KERA 4AJKA 2C8KA 2C5BA 2BW0A 1OYOA 1GFWA 2A4KA 2B4RO 3PNSA 4N3AA 1YC2A 3D3KA 5JVDB 3HV0A 1WPXA 2UXDB 3ZXIA 3HGTA 4IIJF 1K0UA 3ASZA 4YRZA 1N6RA 3PDIA 3QLUA 2HU5A 1V7QA 4HDCA 4MEJA 2EATA 3VSAA 2NT4A 4BYMA 4DCGA 1HYHA 2W6PA 5ALHA 1SXJA 1G21B 1EBFA 3ORQA 3H1EA 4HEQA 4LWOA 2AJTA 4ZIRB 2WI8A 1YQXA 5EJ7A 1UL1X 3GEIA 3F46A 4QBKA 5H83A 3UGQA 2CUTA 3MBKA 2DQSA 1U0BB 4UM5A 2Z43A 3EBPA 3O91A 4EA9A 4XQGA 4O4IA 2GPNA 1VL2A 4JJFA 4X90A 5HOEA 4FYIA 4HFJA 3PUWA 4D45A 4OP1A 3IILA 2G1UA 1P9RA 3PHGA 4JD5A 3OHPA 5LQAA 4GOKA 1WP4A 1YR9A 3P9SA 5ECGC 1EB9A 3WNDA 4N5DA 5BW5A 1N5DA 3G0DA 4BB0A 3OO1A 1ZCBA 4ZC1A 2HDHA 4R1QA 5E9AA 2HTFA 2FPMA 1PNVA 3L1UA 4R16A 2VQSA 2I2WA 2NU8B 5IJ9B 3O93A 1VYHA 1PEDA 2F3QA 2ATVA 1RI5A 3D6JA 3KHKA 3OSUA 4OREX 4XYMA 1KDRA 1S8FA 2XD4A 5JROA 4YRMA 1XMIA 3CF4G 1L7XA 2QA5A 2QUIA 3T54A 1OXVA 3ESBA 1SK9A 4WRRA 1GTMA 4EVQA 2FE1A 1DXOA 1QE0A 2FLKA 3VTAA 4RK6A 3DEJA 3OM8A 4X7RA 2KBEA 5WRFA 1NVTA 2DHDA 1IQPA 5C7YA 4JYMA 3N05A 4JNKA 2C1XA 1I3CA 4LQCA 1UPCA 4UATA 3AG6A 2C98A 2HPHA 3ENWA 3ADPA 2YY7A 3GJXC 3RHTA 4IIFA 3KTDA 4PWZA 5DM70 5BMOA 1L4FA 4YMHA 2PZAA 1QHHB 3DM5A 2V6GA 1K8YB 1UKBA 3OWHA 1Z13A 3CSUA 4C07A 4FYVA 2H5JA 2HD4A 3VO1A 5FPPA 1T0HB 1N9GB 1U5AA 1E7WA 4KLZA 4UMEA 1T24A 3RQIA 1M2FA 4DRXA 3IAUA 1VZ2A 5E9QA 3DEZA 6ABPA 3E3LA 1YK0A 3QPDA 5DEOA 4PXYA 3RD5A 4MWDA 2J5RA 1TLFA 1FBNA 5A4FS 2F1KA 5HCIA 2IHUA 1TUGA 1D1SA 3ZTWA 4ZCLA 4S1PA 1ATZA 2I2BA 4L57A 3KZOA 4RH3A 2ZAGA 1FDVA 4JEUA 3GG2A 3IPRA 3G2JA 3LI2A 1QCDA 2ZU0C 1YE8A 4IX1A 4UDYX 5DNWA 2ERXA 3GJ5A 2AIRA 1VGQA 3FUXA 4HN2A 5M3BA 1M2KA 5I7VA 4PAOA 3PFIA 4MA4A 4I9FA 1WDMA 1F17A 3INGA 1HE1C 3FHLA 3VR6H 3F47A 3AUXA 3JZFA 4DHWA 4DUYB 3L6BA 3JPWA 4Y2HA 1PU2A 4LJAA 3GROA 1R27A 4ER5A 1CZRA 4U6SA 3R3JA 2PZJA 4ID9A 3GNLA 1Z6YA 4OHWA 3ZQ6A 3DZFA 4FYPA 3A6DA 2AOTB 3SLRA 5BP7A 2LCQA 2WZCA 1QK4A 3TOXA 3HKDB 5AW8A 4EI7A 2FJ0A 1YUNA 2GK6A 3LC2O 3RAFC 4B5KA 1KZ6A 1XC7A 2B6NA 2B98A 3FHJA 3KOYA 1S02A 4ZQFA 1DKUA 5HNKA 3L3BA 4QOJA 3ZGVA 2P6NA 1A69A 3B6EA 3ZVRA 3GJ3A 5C31A 2CNWA 2I5PO 2FMXA 2VJDA 1JFRA 5LB4A 4CMCA 4JA0A 5L3VA 3CLUC 3SQLA 1PJZA 1QHGA 5J2TA 2N75A 1XNHA 2AEEA 4G63A 4JGIA 4M86A 4OSPA 5AUQA 4E08A 3DMTA 1NMQA 2OLKA 2LDBA 3TL6A 1GNSA 4EF6A 1SZJG 4B2LA 3VVMA 1NMEA 3I4CA 4I8DA 4QA9A 3IVCA 1KIFA 1RQ7A 4UPDA 2Q3MA 4NDAA 2QM8A 2NYRA 3DBVO 2I2XB 1RM5A 2HXSA 1ND6A 3N1UA 1L4LA 4I99A 4IH1A 1UBCA 1IN7A 5HS4A 4H4DA 5HBRA 1J39A 4ZVSA 3V00A 3RDPA 1J5EB 1QIMA 3P0EA 5DLYA 5MN5A 2Q8QA 2Z3VA 5LC1A 3I9NA 2P69A 3JQ9C 2PGIA 1XDSA 3G9UA 1QE5A 1JGTA 1HZZC 3IDOA 4XDYA 2V5UA 2GZMA 2IV3A 1IXYA 1XL0A 4WBNB 1W9MA 2QRJA 3OCCA 2DMRA 3VGPA 2QAGA 3W06A 1P1RA 4HRYA 3WLIA 2QMYA 2I3ZA 3OA2A 1I3LA 3JAKB 3BA6A 3EA4A 3RRJA 1TU4A 4I4LA 4OA8A 1NQXA 4JJAA 2FF5A 2Q4DA 1SC4A 3HP7A 1K8XB 1ZUIA 3IH5A 2DG2A 1VLLA 2WUWE 3GAZA 3HBJA 4OJTA 3TSCA 1MUUA 1Z9BA 1C3OA 3QELA 4FGSA 5I51A 2BM9A 4OGFA 2G1PA 3IXQA 3QNMA 3FTFA 4B82A 1J7JA 4QGGA 5JVDA 1HLDA 3VKGA 2G9QA 4QLOA 1UBLS 3I2GA 1EFVB 2WIBA 4DJEC 2DLCX 2BBWA 2VHWA 1IC6A 4UOQA 5LIRA 5EKUA 1WBBA 1IYZA 2P6RA 2IE0A 4MQ4A 3D7NA 1IY0A 1L7BA 1XEFA 2FK7A 2YHAA 4QBIA 3R7WA 2G6BA 3M9XA 4A4DA 3TL2A 3QXSA 3LT1A 3FDJA 4EMSA 3IA2A 1GPJA 1FNMA 1Q1BA 1UZMA 2RHOA 1OZHA 3R4CA 2VSNA 1MQSA 5LBIA 3AKDA 5AKXA 3UJDA 3BIOA 2XGGA 5EESA 3N8DA 3ND7A 4DDKA 2WWWA 2D2FA 2WYWA 1DQPA 4KWIA 1GPMA 1EFCA 2IVZA 4Y2VA 4ZYWA 7AT1A 2PE5A 3GZNA 4K6GA 3JV7A 4HWPA 2JBHA 1WUJS 3DO8A 2FCRA 1Z4NA 2QRGA 2VVTA 4G5QA 1SKYB 3PHBE 3H2JA 1P2SA 2SHKA 4PN3A 1RWMA 4D0NA 4YMTA 2QTTA 4O6VA 4DIKA 1O0BA 3CLTC 5GV7A 3CVJA 2IQ5A 3MCZA 3CG4A 4YCBA 5DBEX 3GLHE 3W9YA 2E4XA 1U2QA 3LLSA 3OLXA 2FR8A 2V45A 1UOQA 4IHKA 3RE1A 1T0JB 3MTDA 5U4XA 2ZGVA 2MINB 4EKGA 3CVYA 2DFKB 3BHNA 2DR2A 4YJKA 3HCDA 5JC1A 1ZH4A 2C5EA 1SBQA 3IQEA 4IGAA 1WF3A 4G9EA 1TQ4A 2QW8A 4IJWA 4AJLA 1YE3A 2R66A 2L18A 2VHUA 4OU4A 2B30A 4NU0A 1GTVA 2PO7A 5FBRB 2B94A 2QLLA 2VP4A 4CF3A 4F92B 5L3SA 1YFJA 3C6BA 3NQ41 4EUEA 4OHOA 2PSSA 1NDHA 4HGPA 4PYQA 4TXMA 1RI2A 4WDRA 3ROGA 4J4HA 3ZBTA 2YVUA 1DIBA 3H87A 2JGJA 1JE0A 2HC9A 4JFAA 4CN8A 2W6JD 3X1KA 2D1RA 3RUAA 3S44A 1LW7A 4ZVUA 3EULA 4RX1A 2ZBUA 2JFBA 4M98A 4FSXA 3PGJA 2ZRQA 3NHUA 3TD9A 4J4TA 2IWHA 1VA5A 3BMQA 1F8FA 3PR2B 5MFPA 2Q4RA 1E1QD 3JQRA 4Z4HA 4TKVA 5TT1A 4DB2A 5F7XA 1Z74A 3I0MA 1Y42X 3F2VA 1G63A 3SBEA 5KOJA 4WZBA 5A0VA 2CK3D 4NBWA 1PUXA 1UM8A 2Y92A 4QARA 1LGYA 5D01A 4TVSA 3V33A 3GLIA 1DX6A 3RNLA 1M10A 2RGAA 4R1NA 1M6NA 2YHIB 1SR8A 3TM4A 4ND8B 2WNIA 4TGLA 1DBWA 3JQAB 3U3MA 2QXTA 2XR1A 3IDQA 1I3OA 5EXDA 4U7FA 1U02A 5ISMA 1G55A 1LC0A 2J6IA 2ZUBA 1JTFA 4TL8A 4XUEA 4LRXA 1P9NA 4GZMA 4HNAA 3VMFA 4B0OA 2QQFA 2YXPX 2V7GA 2WR8A 2UAGA 1Z4OA 3IBFA 3LUKA 5GWXA 2HRDA 4DMGA 2EDCA 5K8VA 4QHTA 5AH0A 2FVXA 5FPYA 3A1EA 4R2WA 1JQKA 4PXSA 4AJIA 4Q00A 1HTBA 4ARZB 2UUCB 4R69A 4IIVA 2R1UA 4EENA 5BV1A 4XD7A 1CX9B 4JI8B 4JJZA 2MSNA 2OM6A 3ZVLA 1UBEA 1SA0A 3KT8A 4GC5A 4J94A 4Y1FA 4QUAA 5HKKA 3COVA 2WYUA 1GPBA 3LWNA 5I7UA 3ZHQA 1MG0A 5FEUA 4MGYR 3AF4A 2QN9A 4RIIA 3I2FA 2Q5EA 1W0JD 2YJZA 2JJMA 1NNSA 1T5IA 2ZWAA 3IMCA 1CDZA 1N6PA 2I65A 3VKWA 2JDIA 2Q5LA 4R8LA 1YHNA 2CMDA 1A71A 4F84A 2UVPA 1IWOA 3T3OA 2AJCA 3A9WA 4JT8A 4NZZA 1DIRA 2BGNA 5LR6A 4BZPA 5ESRA 1QVVA 4MS3A 1ZN8A 1KRXA 1QX4A 3FGZA 2W22A 1T2NA 1FNCA 3LUFA 5HRCA 2QZPA 5LOVB 4B6JA 2C57A 2XAUA 2C7QA 2IBMA 1KGSA 3HN7A 1PZEA 5ALEA 4NZMA 4DJAA 2Q3CA 3HP4A 2FSVA 3TQIA 2H52A 4XGNA 5L3RA 4BVLA 2EZ8A 3ANLA 1O8CA 1ZDMA 4HQ6A 3FBTA 2AG5A 1R64A 4S1WA 1W52X 1TC2A 2IF2A 1M1YB 1F1JA 2R87A 1JIKA 3B1JA 4ZMSA 4HEJA 1G5PA 3F7OA 3DL2A 2O8NA 3HNPA 2G6TA 1NVWQ 4LXHA 2YJGA 3PGVA 1QYIA 1VRVA 2R6HA 2RBEA 3II6X 4BMZA 3TBHA 2W2OA 5EWJB 2ODWA 4RHCA 1C3VA 1RWNA 5JPCA 3EQ2A 4GLFA 5C2JB 1MG5A 3FMGA 2QL6A 3JQ6A 4J1QA 3A6LA 3LRXA 5JBNA 1V9SA 4KQ6A 3T1VA 2CB9A 2WF9A 4DQLA 5ALMA 3AP1A 1JQ5A 1Y9AA 4YCSA 2QVCA 4V0NA 2RHWA 3N6RA 3TW4A 3GY0A 5JCJD 5EZSA 5IKPA 3NH6A 3T7IA 2QJTA 2W2NA 4DNFA 1SHLA 3ABSB 2YV1A 5LFAA 3A9TA 4UVGA 4C43A 1JR4A 3FRIA 4LTMA 4G0VA 5CCDA 1XKTA 4K03A 1Y4AE 1O95C 3JQEA 4XVQA 5CK4A 3L6CA 1E3IA 1O94C 4LNUB 3ST7A 3FE2A 4YRJA 4EHNA 5EP1A 1SVKA 3R09A 2QSZA 3IUPA 4KB5A 5NULA 3RIGA 3ZXXA 1VGRA 1KOLA 1Y9JA 4H59A 1JDBB 5DRTA 3A70A 4ZOLB 4CTMA 4CG0A 2RCYA 2YJ6A 4NEGA 3ZCVA 4FMDB 4ZT6A 3YASA 1YI0A 2ZSKA 3IQZA 2Z09A 4BJ1A 1QYVA 3N0WA 4I7EA 4YCJA 1NY5A 1DZIA 1U7OA 3H5VA 3L1KA 1GR1A 3AO0B 4HK4A 4FU0A 4O4JA 4PLGA 1H42A 5IM5A 1IEXA 2Z5FA 2I3AA 3BE4A 4L5YA 5IVPA 4EG4A 1WEHA 3EMVA 2GPSA 4ANFA 5DTQA 2D2VA 2JIZA 2G25A 2YY6A 3GPBA 3O2JA 4IHAA 1FB5A 2I1LA 1AD2A 4KLCA 3S8MA 1LPNA 2G4VA 3DFZA 2Z2XA 1GGMA 3P2EA 2DWOA 3NVAA 5AXCA 4IDGA 5DBFA 4MYUA 2ZRJA 4YV1A 2HIHA 4EO7A 1T6NA 2QMEA 4HN9A 3NHAA 4RF2A 1RMTA 2HV8A 1C4OA 3DOUA 2EIXA 1V48A 1T0UA 2GFIA 2OOSA 2VPTA 1E9DA 1U98A 3GFPA 4L78A 1NI4A 5DULA 1HORA 3AWIA 3TLMA 3RLFA 4MRSA 3RRNA 4PHGA 1D6JA 3UAWA 3H7AA 1AO0A 4PHCA 3TTVA 2WVJA 2YBEA 4KE7A 5A6VA 1N7GA 3NBZC 1VBKA 1ES9A 4V2UA 1IM8A 1MORA 1YZQA 3BWDD 4OHPA 1G60A 4RACA 4TLDA 5AKLA 2JEYA 2XNJA 5DBOA 3VTFA 3WIBA 3JAWB 4F8JA 2YV4A 2DHRA 4EVSA 3F3KA 4RTMA 3DV9A 3OTWA 3O4HA 4R0MA 2Y0BA 1VRWA 1C7JA 5FJJA 5EEGA 1QRDA 2QYHA 4JQOA 2IIVA 2QGFA 4MRRA 1Q5PA 2G40A 3IT1A 3RC1A 2HWXA 5DCWA 4Z9BA 1JEYA 4ENTA 3PD1A 4R1PA 2G5TA 4F5DA 1QGDA 2NUTB 3ZGNA 4XWOA 1W75A 4RETA 1ETHA 3I39X 5IK2A 4JL6A 3Q2IA 2IWRA 3GAMA 4I5DA 4BP9A 2GVNA 1JFVA 1LPSA 3OE4A 4H3HB 2RKBA 5KBYA 3EDOA 2JGIA 3QXCA 1CDOA 1ABBA 1DIHA 2VF7A 3Q5EA 1XZKA 1KAEA 4CBVA 3P96A 1NURA 4MIKA 1PT8A 3I5AA 3OZDA 2OBFA 3AW9A 4JP2A 4UU8A 5KQPA 3SC2A 2ROQA 2OP1A 2XMDA 2YWGA 1TNDA 4NR0A 4BO2A 4HNVA 2OP0A 3NGMA 3CG0A 3KRTA 3QTTA 4B6FA 4IOLA 5FWAA 3EEBA 1Q14A 2RKWA 4BFCA 3TS1A 1TYZA 5AM3A 4CI9A 2J9GA 1JPVA 3COSA 2NV0A 3PR1A 1GQOA 2FE4A 1ZGCA 2C5AA 4HY3A 1J0XO 2ZAOA 4W8OA 3QBJA 4S35A 2OGUA 5G1OA 4KIFA 2P6MA 4Y2SA 5K2OA 5B3AA 1YFKA 5EJ6A 4P58A 4R31A 1W4LA 2I4IA 4KIWA 3HCAA 5TJHA 1Y6ZA 3FOBA 5ALSA 5LNK6 3AVVA 4Q9HA 4DIOA 1HDEA 1TJYA 2X8AA 2ZE8A 3CJRA 3EZ9A 3QPAA 2W71A 2XI4A 1T5SA 2CDAA 1JYEA 3ND6A 3K32A 3BIWA 4N0QA 5JD4A 4TTRA 2OO7A 2BRUC 1BCSB 5EZYF 1KE2A 4E3WA 2V1UA 2IODA 2GCEA 2RH5A 1IMOA 3A6ZA 3Q3CA 4CKBB 2XDWA 4IO0A 4LW8A 2ZTVA 4CODB 1QYXA 2GF2A 2A5DA 2Q21A 4FWTA 3RC8A 5JQGA 1HKHA 2QLFA 2V7QD 4K46A 4GRAA 3LRPA 3Q0IA 2DH6A 2FPKA 2WAMA 3BJIC 4MI6A 1J5XA 1NXOA 3VPHA 3L7MA 3O94A 2GI4A 4Q21A 4DCCA 4M99A 4NMHA 3D43A 1A97A 5JXJA 4K26A 4JZYA 5EJ2A 3TSOA 4GM4A 3LVRE 2VQDA 4V0MA 4J29A 3QEOA 2NO5A 4KE6A 1Y1TA 1MVOA 1M34B 1CYEA 2DPMA 5SZHB 4CIBA 3PEUA 1VXOA 1PE0A 2CLHB 2PJUA 2PMBA 3IPYA 2H2AA 4NYJQ 5HF6A 3HJTA 5I9NA 5NLLA 2GMWA 2PFSA 2KYRA 1W87A 2CLKB 3C8HA 1WS6A 2D74A 4GFDA 4ZTZB 2VWQA 3FLBA 2IHNA 2QKYA 5JMPA 2NOAA 1BH6A 1BNCA 1C9EA 2PUGA 2XNKA 3D4IA 2QLMA 3AY3A 1KI9A 1Z6QA 4NZOA 4AJPA 2AZ4A 4TLBA 3JYOA 1BXRB 1H4SA 3RGGA 1WR8A 4UOEA 2FP3A 3LPCA 2XECA 4LYJA 2H7CA 2AVDA 4JLUA 4WKBA 2O2DA 5LQCA 3EPLA 5E6UA 1OOEA 5E3JA 3MHTA 5KU1A 1KOGA 3BBPA 4CPDA 3TIGA 1Z18A 4QU9A 1H23A 4X1OA 1Z2AA 1HE4A 5H3CA 3U49A 1Y8ZA 1DQSA 5DX1A 3EVDA 3O0DA 2E89A 5ALGA 2E21A 2GHTA 4K5QA 3RS7A 1WDLA 1C0LA 4V03A 1F6WA 1CY0A 1RC0A 4WESA 2QUZA 4ZEXA 1SBCA 4KPUB 5C34B 3TK1A 1ZZGA 2QVLA 3DMDA 5HBGA 1VYVA 3W78A 4RORA 1PJSA 3UMMA 1L3BA 2IYTA 4G6ZA 3ACCA 4DVJA 5UKDA 3L0CA 1NHGA 4CKYA 3L4BC 3N0RA 1OIVA 2HDOA 4BLRA 3PC2A 3C3JA 3EGVA 4UPVA 4K9PA 1ZP6A 1XAJA 3AM4A 2VRBA 4GUDA 4FMCB 1C8BA 1WXDA 2QT0A 4C9BA 1M6VA 4XYEA 3IBGA 4E5MA 3FAKA 5J43A 3PITA 3BJZA 1GLNA 3RUIA 1BO6A 5D86A 3EVZA 1P17A 1GD1O 3B6ZA 3NZEA 3CH4B 3PRHA 4M49A 4RGBA 2W11A 1PQPA 2Q2NA 1PW7A 2NQ8A 3QEMA 4JB0A 4OSEA 3RWOA 4DN6A 3DTVB 5AW0A 4YAIA 5K3EA 3RBXA 2XT9A 3S81A 3K2EA 2AQHA 2R1ZA 4LJ5A 1B8OA 4ZO4A 5HILA 1HNNA 1E5LA 2RI6A 4GXQA 1XZGA 1KU6A 3TM5A 4FUQA 3PL5A 3KHTA 3ZGOA 5FTLA 4Q15A 3JQFC 4AWXA 2IE8A 5HM6A 3M1LA 2BZ1A 4OX9B 3A3NA 4QICA 4Q9JA 2A7QA 4GGPA 1WXFA 1W76A 2XF2A 2WWFA 1DKOA 4HDRA 2YMLA 3L6DA 4S1TA 3NIDB 3QKWA 4MDFA 1UBMS 3L7DA 1MEJA 4BLVA 3GEEA 2E82A 2VUSA 4W99A 3DMPA 1KRWA 4QUEA 4P32A 2OKCA 3F6YA 4TRNA 2POCA 3R3YA 4GYKA 3QOXA 4MQLA 3V97A 4D0GA 1L8QA 2Q0QA 3RCBA 1M5RA 3E7WA 4UFOA 2TRSB 4MJ3A 1Y4ZA 2IIBA 3AZOA 3FVWA 3LO8A 2GARA 2IPMA 3O9MA 3QU2A 5IAEA 3TZKA 1UR5A 3W77A 1JZSA 3E6AA 2GZSA 4MUAA 1SCNE 4OKSA 1GKKA 4NMXB 2O2JA 5CDFE 3HXTA 4PC3A 1B6TA 2BV3A 1IK6A 1MMFB 1GRRA 3DYIA 3JRXA 1AKUA 4U1RA 2OPHA 3USZA 5REQB 2BTQA 2ZU6A 1JJIA 2OHFA 3EVEA 1SIWA 3LYUA 3TI7A 5L51A 3EGXB 2G82A 4OXYA 5GZ1A 5EP3A 4Z3OA 1XXHA 3RF6A 2OYCA 4C4SA 5ED0A 4OHMA 4QRIA 4Z4FA 5I4KA 2LCFA 4V3CA 4Z6KA 4BKPA 1B8VA 3CZAA 3DKKA 1O6ZA 4MKRA 1PJ4A 4RIGA 5D00A 5GJVC 3KYCB 4WNIA 5ED4A 4PRYA 3C6YA 1ZH8A 4HB0A 2HJVA 2DX7A 3RVKA 3VNBA 3RTCA 1AGYA 1XZPA 2J6BA 5ALUA 2VXYA 4J03A 2QLTA 1XROA 2XOKD 1P4AA 1VBFA 2BONA 3GJRA 1BCRA 1N2OA 3HJUA 1D1TA 3UKOA 1N6HA 2XVXA 3EFOA 4GF5A 3TMAA 7YASA 2QRQA 1Z7WA 2PT9A 4K9KA 5AVVA 4K05A 3TECE 5GIPE 2DBVO 2XCRB 1G6Q1 3JR3A 5A06A 4P92A 3U19A 2YHUA 4BBJA 5L4LA 4CF4A 3MQ2A 3GA5A 1ZI6A 2Q4EA 3AUFA 1DO2A 1KVQA 1VMAA 1FVXA 2VAPA 4J49A 1OKKA 3SNKA 1VM6A 2DPLA 13PKA 2ECPA 1N2SA 1VIAA 5AR1A 5FA8A 1QJCA 1E2LA 2RI0A 2X77A 1NVMB 3OCYA 2MU1A 1EGMB 2PBFA 2EP7A 2HH9A 2GEDA 2DBYA 4L4RA 3WGMA 3I5UA 3VDNB 2NU8A 5CLFA 5KQSA 1KBOA 1R6AA 4YN3A 2I87A 3KQHA 4CIXA 5KDLA 2YJ3A 4R9NA 4HFMA 1GPUA 1LJLA 1EEHA 2XUQA 1D4ZA 3B5JA 4M9UA 4NCBA 1ZZEA 1CQIB 2GQ0A 5LXTB 5IFLA 1HZJA 3VAAA 3L4EA 3NT4A 4F3RA 1GKLA 5L95A 4TROA 4GRDA 3QE0A 5KTMA 1ZD9A 5K0BA 4XJVA 1X1CA 2PUEA 3B1WA 4NL4H 1A2OA 2OO3A 2P40A 4H17A 2ZBDA 1CETA 4OHUA 1PKXA 1TW2A 2FR8C 2CXRA 5LDGA 5BOSA 3D6FA 2GN1A 4ESVA 4ZEWA 3LLMA 1D2MA 3DVAA 2J0QA 2BKAA 1I2DA 1YQQA 3D6AA 1IPEA 2DUUA 2R1VA 3IIEA 2VJBA 3LFHA 4ZEVA 1ABFA 1H8ED 1SKYE 3F3MA 1Q21A 2DCMA 2H8KA 2PCLA 3T7DA 1AS0A 1C3XA 1Y9EA 2J08A 2BLNA 5TE9A 1W96A 1CU1A 2GWHA 2QY6A 2ZJ4A 2JRCA 1Z39A 3B12A 3JVIA 2FRVA 4F6LA 5B30A 1ZK2A 2CNLA 2PMEA 1Z63A 2RK3A 3CLKA 3WYDA 1E18A 4FHFA 2A9KA 4QDXA 3MXOA 2FPSA 4DPLA 4LZJA 4JSYA 4O4HF 1MQAA 1YZUA 4XD7D 3ZTTA 4QPCA 2R86A 1M1YE 1Q7EA 2O2SA 2C42A 4QXOA 1ZCFA 5TGDA 1EK0A 3S40A 1E4OA 1TF5A 2WB2A 2R1VB 1D09A 1TA0A 3I73A 1E2EA 3WLFA 5IS2A 1FFAA 2IS6A 3UCEA 2JCYA 1SUDA 3ICCA 1FFXB 3D0OA 3TVYA 4BU0A 5JXHA 4HPXB 2RHRA 1PL0A 5CG2A 4Y1GA 1A8PA 3FFAA 5KNCH 1O8BA 3USES 4LXYA 1J24A 5T41A 1KDOA 3LX5A 5LA6A 1VG9B 4Q02A 4CT4B 3LUAA 3R7LA 5KYKA 3EEIA 1EZ1A 1U28A 1I0LA 4M3NA 3TOVA 4PLPA 1D1QA 2NGRA 2E1PA 3MS4A 1ISRA 4H0NA 2VH2A 1W8DA 5IJXA 5DNYB 1P8AA 2BAGA 4ENPA 2H7VA 5I5GA 5P8WA 3RC2A 4FOOA 1GQYA 1XMOB 3G2HA 1OVMA 4BNKA 2FOIA 3FPBA 3JATA 4UUQA 1UIMA 4NYIQ 4A8JA 1D7OA 2FZKA 4Y18A 2IGBA 2WA1A 4QYWA 4ES6A 4KG7A 4E1VA 4RK5A 1IRXA 1HT3A 1T9HA 2QG9A 5HF9A 3VSDA 3WJ7A 3WK6A 3U5TA 3KJQA 4FFWA 3TH5A 3CV3A 2QJFA 4N41A 4NI5A 1G8KA 2FWAA 3CT6A 3QW4B 5EIBC 3W2HA 1N2CA 3AU8A 4DWOA 1L7RA 1VFNA 3IQDB 4XARA 3V2IA 1GAWA 4JAVC 4RAQA 3D6VA 4XJSA 3T5BA 5HKKD 3PX3A 1FSGA 4KRXA 2DEUA 4NZPA 4HWSA 1PT5A 1NWHA 4DC9A 3IBTA 4LMAA 4AMUA 3CNEA 1A9XA 1MZPA 2NZ8A 4JH0A 1EWQA 5I7OA 1EK2A 1QQAA 2D59A 4LDJA 2ZIXA 4W5NA 4UCFA 1JLMA 5H59A 4QUBA 4P93A 2NTNA 1XZLA 3DKIA 4I3FA 4OXNA 3QHQA 1GGKA 1RHUA 4UVIA 4IOJA 1IY1A 3RJTA 4Q4AB 3DLPX 4C4TA 3A58B 1KAQA 2H8GA 5KSYA 2PQ0A 4B3MB 2COEA 1T6YA 5CEFA 5BSKA 3SK0A 1WO8A 5E95A 4HWGA 1WTCA 3Q8KA 4TPKA 5CDSA 3JQAA 2ZTMA 3OOJA 4WIAA 5FOTA 4H2DA 4RA6B 5AIBA 3RK0A 2W0MA 2RAUA 2BJHA 5KNBA 3E35A 5JASA 1HURA 3G13A 1NR1A 1I7PA 5C3MA 2PS0A 1SG9A 4HATA 3ZCQA 1FTQA 4N18A 5LYJF 4K81B 1O77A 1OR8A 1PL8A 3ANNA 3Q98A 1BE0A 1GU1A 3HDQA 4RUKA 3PQ6A 3K53A 2XUHA 1TJ5A 3D1LA 1PQUA 3V8NA 5KSWB 3ND9A 4N8SA 4QQRA 1ZK1A 1QG0A 3GYGA 3N2KA 2C4UA 5B37A 1NNI1 1J0EA 2F3RA 1GUFA 2RC6A 3DO5A 1B73A 1XMJA 3BJEA 1U04A 1ZRMA 1ODLA 1OILA 3QLEA 3RSLA 3I42A 3ZCPA 4TT8A 3QE9Y 2D00A 2V5VA 2Q6KA 3A26A 1R5NA 1U7DA 5CFQA 1S2MA 3OZFA 3HEMA 3HMKA 2VEOA 2F8MA 3QFTA 1C7FA 1SD2A 1CUCA 4M60A 3RU2A 2AQ8A 4AJ4A 1JN0A 4C08A 1JEQA 1RBYA 1DDOA 2BMVA 2HOQA 2ZYUX 3Q7PA 1K4YA 1MRSA 1N2GA 2YVLA 4WOKA 5HIJA 4IVPA 3VPDA 2ILVA 3UCXA 4JYCA 5I9IA 1ISSA 5MN4A 2MINA 1YGPA 3CR8A 4RVCA 3E3MA 3M5WA 5T4EA 1IULA 1U8XX 3MBOA 3WLLA 5IWCA 2G71A 4WLUA 1KZGB 4PG4A 4UBLA 3ETLA 3UUWA 5JYEA 1NJ8A 1R66A 4J0DA 4TKZA 1MV8A 4OU5A 1LBSA 2UZ0A 4Y6PA 4BO9A 2H1OA 2PPVA 3EZ2A 4IINA 1HQCA 3L8CA 1NI5A 4EL5A 1XZFA 1SQ5A 4G25A 2AYXA 3DAYA 4TTIA 1XN4A 3FYUC 3TIXB 2N0SA 2H0AA 4HR7A 1PZHA 1ZOPA 4P3PA 4TLCA 3F67A 3IQIX 2LKCA 3E1SA 3LT2A 5KSOA 1E98A 1BSVA 5HP4A 3BF8A 2Z8YA 2VDQB 3JRWA 3B1ZA 1XN1A 5JE8A 1V43A 3A14A 3QYFA 4W5QA 3QOYA 4CDMA 4B4DA 3IAEA 1K7SN 2TSYB 4KV9A 3VR4H 5CBKA 4CLRA 3HXKA 3C15C 4FBGA 2FPOA 2MTBA 1CUGA 4JVSB 4RPHA 3C7AA 1PK8A 2V59A 3G5AA 4HWKA 1YCGA 3TIVA 3WYEA 2B4QA 4X7PA 4CM4A 3W6UA 4LI0A 4KHZA 4MVYA 3PFNA 1VPLA 4EX6A 4G36A 1ZQ1A 4HNRA 1RFLA 4B33A 2EFGA 4UBKA 1QP0A 1I1OA 2I33A 1I4EB 1TQ2A 1UPXA 3SFTA 1BYUA 2ACVA 3LKDA 3ERCA 2NYVA 2IXEA 1XXHE 2X0NA 3UC9A 3G88A 4HMQA 1Z7BA 3DEIA 4QNNA 4TMKA 5LZ5A 1FP1D 3GCDA 1WMBA 3PDHA 1GRCA 3KD2A 4KFTA 3VJRA 1M1NA 3TINA 1BGVA 2FZVA 4TTQA 3VTZA 4G0WA 4NBNA 3BMCA 1DBVO 2FUNB 5FL7D 3SG0A 3D59A 2A9RA 1XZAA 1CB0A 1CJVC 4BWFB 5LLTA 2VPQA 1O94D 4QEKA 5AJXA 4ZEMA 1JXMA 3E9YA 4AYWA 4DA9A 3I6QA 3T3MB 1PTKA 2OBLA 3BKXA 1W48A 1MP0A 1XEWY 4J9UE 4R0NA 5BT9A 2OV6A 4FZ3A 4PLVA 3QBTA 3W9BA 3ZV4A 2R44A 5I9MA 4EHFA 1U6KA 3M6VA 4I5IA 2Z5LA 1X7WB 2ZANA 2OGZA 1S2IA 3HWWA 3HA2A 2JF0A 3IV9A 4MVCA 7MHTA 3H5RA 2QT9A 1E2KA 4WKGA 4TWIA 5AD1A 4FFBA 1Q95A 2OM2A 4OLJA 2X8JB 3G0OA 3HCBA 4O3FA 3QVSA 2GH1A 2QD1A 5BORA 1ZUNB 3GMIA 3JVDA 1WLYA 1SELA 1VTKA 1M1NB 1VBNA 1OQAA 2FSFA 2VYVD 2YVQA 1DS6A 1T1SA 2P0AA 4AG6A 3T7TA 1ILWA 3G2PA 5DBHX 1T9GS 1QH8B 2AW5A 1HY3A 4CL0A 4Z0PA 3IAS1 3SE7A 4KLNA 4E88A 5A9SA 1NG9A 2OXEA 3JALA 1QDEA 3OZRA 4M9ZA 1J07A 5F1OA 5A4JA 4M6WB 1IWBB 3AEQB 4P8RA 3X2FA 3P97A 4K8RB 3PDWA 5FADA 4KQIA 4ALKA 1N8TA 1RCTE 4PV7A 5JMTA 2GYWA 1LSJA 1QORA 3UB2A 3WIUA 4NCHA 1M6VB 3E8SA 3RUFA 1ORHA 3HGMA 1EFRA 1TM4E 2GPAA 5LLSA 3FCOA 4HX9A 1W4CA 4Q82A 4Y7DA 3FZEA 3V7WA 5C8DA 3OE7D 2B8WA 2G07A 2QTGA 1PNTA 3I72A 1J21A 2SECE 2PQ2A 3WC4A 3FGNA 1UQTA 2VAXA 1P29A 1E7SA 4H4CA 1TADA 3V4LA 3ED5A 3RREA 4YACA 3R0IA 9ATCA 3AETB 4EG7A 2BYTA 3B6KA 5AW1A 2ZI7A 2Y68A 3U4IA 3GARA 4NBLA 2ACWA 2GZHA 4CGZA 3HUDA 1H2FA 1E94E 4G5YA 4BFYA 1GVNB 1R4MA 2O1EA 2YDXA 1KMIY 4L3VA 4P54A 4XXHA 2AXNA 4LBZA 1NQTA 4UU1A 3WNBA 2WVAA 1IN8A 4AAYA 5JDIA 4AJJA 1O97D 2WAAA 4P4TA 2JLYA 1EVIA 5ALRA 3FB4A 2Q50A 2WJPA 4WZ6A 3Q6NA 5LNK1 4KXYA 1SUAA 1VKNA 4ZTBA 4AS1A 3AIKA 4LDZA 2QQGA 3W6ZA 4JP5A 2FAXA 1P7PA 2YL2A 4WV3A 4JOCA 5AQ1A 3TNLA 3K09A 5D51S 2ZS9A 1M9NA 3S28A 3L7AA 1CEQA 5J5CA 1B16A 1E2PA 3FPHA 2V5AA 2P5SA 3RRZA 2ZIEA 3P52A 2ZWOA 3IP8A 5CVEA 3LBYA 4DXHA 4CDRA 1JFLA 4JN6B 3Q3JB 2QGZA 2P4QA 3D9QX 4C03A 2IL1A 1U3CA 1TM5E 2GKGA 2EYUA 2KM1A 4DEYA 4EUHA 3RFUA 3LHDA 4UTZA 1JHZA 1DKLA 1KQGA 1M34E 2HHAA 1NM5A 1X19A 4NAHA 3N2KB 5DXFA 4DLBA 4EYKA 2FMUA 3ZWKA 4GSYA 2IUTA 1DKQA 1OJ7A 3QG5A 4DAEA 3G9XA 4E51A 4D79A 4C0SA 2HIAA 3CCFA 3VTKA 4C22A 1YR7A 2FFHA 3H3FA 3KLBA 4N0PA 3R74A 3GLFE 3X1DA 4BOYA 1QOQB 1HTWA 5IULC 1Y8RB 2G9VA 1IXSB 1XZJA 1G5QA 1TEVA 3ICOA 4QDJA 3ZE8A 3L0OA 1RACA 4WTOA 4MA5A 3TW6A 5C8YF 2AOXA 5HZHA 5CA0A 1PLKA 3TLGB 5JHGB 3T1OA 2QVZX 3LQ1A 4GKKB 4MV9A 1OBVA 4NCKA 3VO9A 3FYUA 3K9GA 1WXQA 3ZPXA 4LVUA 6CHYA 3RNOA 4B3DA 2PUAA 3P9XA 1KEPA 1RAHA 2C84A 3DE2X 3DDUA 4US0R 1HL7A 4ND6A 2BBSA 1LQ2A 1I01A 3QVGB 4IXMA 4LY3A 4LE2A 1UM9A 5EJ8A 1SQGA 5C51B 4LQDA 2I2FA 1N5RA 2IUEA 3WIDA 3TUJC 5CVTA 1ZC4A 2GLXA 4ESHA 2C7BA 4ZI5A 4BWGA 5HTKA 4LDRA 1J56A 2P2SA 3VOTA 2YFQA 2NZYA 3TNYA 3TQRA 2XMCA 4BQEA 1USWA 4BO0A 1CY4A 3OEED 2EX0A 4C4PA 2JATA 1JDVA 3B1VA 1Z2DA 4TXJA 1N0IA 4AMVA 2HA7A 4QWWA 4DTIA 5KO2A 3VI3B 3ZK7A 3EMBA 1JR6A 2QT1A 1ADFA 1WMSA 1Z8DA 1K5GA 2O57A 5TMBA 4PYRA 5B58C 1C8KA 1DJQA 3BIFA 2ILTA 4J0IA 1NXXA 3IS3A 1CZHA 4V0LA 1ULBA 4IYJA 3LVQE 5KNCA 5F76A 3MT7A 4JASB 1T3SA 5FXMA 3UT5B 2WW8A 4V1CI 2Y0CA 3UK7A 3NWEA 3ZIDA 2BGUA 4KTTE 4B35A 4D4GA 2OOKA 3FSGD 4FDLA 5FBKA 3ZY6A 1KO5A 5I5EA 1JB1A 3NIBA 2DPGA 1K98A 3QKSB 1TW3A 4ZN6A 5A4MS 5K3FB 3LQKA 4TN1A 3GDWA 2QB5A 4UTVA 5KNCD 1KIAA 3FPKA 5LXTF 5DT2A 4O5AA 4Q48A 5KJ6A 3RJZA 1VKRA 2OUIA 2R7AA 4PCUA 4R6WA 3Q0TA 3N0TA 1VL0A 3OE1A 1ZJJA 3V80A 1Z56C 2BFDB 3VRHA 1ZISA 3ILSA 1R2QA 2MMCA 1K0FA 4IRXA 3PUKA 4YRSA 4DA4A 2VDJA 2GYUA 2YKGA 2R6ZA 4DBLE 1T5DX 4IVNA 4B83A 5CD1A 3ESAA 3ILVA 1B43A 3ONVA 5LUAA 1WF6A 4LC9A 3DTVA 2WLSA 3TSAA 5BYBA 2XGOA 3GD5A 1NP6A 1QIFA 4QQKA 3TNFA 4UHHA 5SICE 1RXIA 5DYYA 3B6MA 5AJWA 3HNOA 4JLAA 3PGXA 3F78A 5KTSA 3B9PA 3SHTA 4B7ZA 3AC0A 4ARCA 5L4SA 1TGVA 3HA7A 1YS6A 5AM1A 1QF6A 4X5OA 1V5GA 2HQOA 2UYOA 1T34A 4ATNA 4WPGA 3RLIA 5AOCA 3SS8A 2W2LA 5JJIA 1OPXA 4JT4A 1Z07A 4L0CA 3ZE7A 1KYQA 2GSWA 3ORHA 3VR0A 4XWYA 5I7FA 3P19A 1K6MA 1EUDA 1QVWA 4BMPB 1FTNA 1RAAA 1QCZA 1FJ2A 3AOEC 4R5MA 3WGJA 1ZIYA 1I94B 1T0IA 3AIIA 3QV1A 4A1OA 4WLVA 5TDHA 1EEXB 3WBFA 2I54A 4Q3BA 4G5FA 3O8QA 1TE2A 4FYJA 3SKXA 1LSSA 2VAVA 4P38A 3SDSA 3WY9A 5K0FA 2HA4A 5FWXA 4G65A 2ZIUB 1E99A 4KIGA 4DBZA 3O3CA 3UQYS 3KSUA 1G8GA 3ZGLA 3B53X 2A57A 1H22A 1Y5MA 2JEOA 4GVPA 4U3JB 4QHSA 4M53A 1QF7A 5AKGA 4YUVA 4UD2A 4LYYA 1B74A 1W0KA 2IUSA 3SSNA 3I1YA 3C39A 5CYOA 1J8MF 3O82A 4CJXA 1UPBA 4BAUA 3QNUA 1F8YA 1JIUA 1JQBA 3QWIA 2C5SA 4Q1CA 1KGDA 2ODAA 3KBBA 4EEZA 1RHMA 2RGRA 4GECA 2ZVDA 4BXOA 1E4YA 1FJHA 1V4NA 2QPLA 2XGMA 2JJ1A 3RU3A 3SDBA 5TIIA 3DPIA 4AW9A 5HMLA 4QTXA 5JD3A 5J9FA 2RAFA 2IXTA 2AFIB 3DNFA 1DIOB 1TD1A 3U3KA 1G5HA 1BFUA 2W48A 4JOQA 1XQYA 3NG1A 4XH9B 5HJ5A 1PT6A 4YJ3A 3VMMA 2ZUVA 1ZMOA 4HG2A 4R8VA 4RHUA 2O2YA 4M38A 2IEBA 2EGGA 1JSRA 3DZHA 1H0SA 2QN7A 3OZSA 2Q5CA 3A1UA 4GUAA 4O8ZA 2B0CA 2QORA 3BKWA 3HWSA 3VSCA 1FTYA 3TUIC 4J16A 2W2TA 5A1TA 2W2LD 2G76A 2OSVA 5IAJA 4FMCF 4BMCA 5CEEA 1LLCA 2FRDC 5KYVA 3BB4A 4YFVA 3K5IA 4QAQA 2DQYA 3VDQA 3SVTA 2OHGA 3OECA 4LCJA 3PQ7A 4LSZA 1RKXA 2GEVA 3MN1A 4UBMA 1U8YA 2YH2A 1CVIA 3HKCB 3A10A 5ECDA 1FNNA 3KWLA 3LL4A 3VR2A 3ZC3A 2PIDA 2WKRA 3CM0A 1P4JA 2BHNA 2WSIA 3TQHA 4R2XA 3TF5A 5T8KA 1I6WA 1WHSB 1JHVA 2QN3A 1LK7A 5ARDA 5L6MB 3KOXA 5G40A 2FEKA 3EUAA 4MDYA 4XFKA 1GRQA 5JXGA 4O29A 1XTSA 2WQ7A 3ZDBA 4LJRA 5M7EA 4JU8A 1OBHA 2G5GX 2OCIA 1GPWB 1WXIA 3IVAA 4XFJA 3ILHA 5K8JB 1MT0A 2WOJA 3CW2A 3G82C 1VJTA 3EW9A 1ENOA 4OXKA 4RVUA 4Q9AA 3LAWA 4N01A 4OL9A 4RW0A 3ZJUA 3RSSA 1IZ7A 2OZLB 1V7CA 2VL7A 1KJYA 4PLWA 5KNBD 5KQMA 3F1KA 1Z5UA 3N74A 4A23A 2BMWA 5I4CA 1WVGA 5TARA 4YPOA 4JYAB 4NC9A 4AUMA 2P30A 1UWVA 1MXHA 4IJKA 1PWHA 3OZCA 2O8EB 2JGDB 1EK6A 3O83A 4L5CA 3KU1A 4OIFA 4BATA 2PXAA 1YAJA 3FBGA 1RYMA 4LXQA 4ZVMA 4HB3A 4TXNA 1VE3A 4I81A 3PIDA 3D7RA 2VLBA 4O4HB 2PNJA 1MU0A 3WL4A 3GEPA 4L5JA 2P9YA 4BNFA 3BD7A 2ZJ3A 2PUTA 3Q7TA 4MB6A 1ZHOA 2VUIB 1JXQA 2DFNA 2Q2QA 1ADGA 2VK8A 4NU6A 1OPRA 3T9BA 2MT9A 3BK7A 5LQMA 1NLMA 4TYWA 3KXLA 4PYKA 4IDQA 1SVMA 3KHUA 1VE7A 4OL0A 2AWNA 1ICIA 3UT6A 2NTYC 4E07A 4C6SA 2PLRA 2YZ2A 2XKJE 1FYDA 3OMXA 3I37X 1EDEA 3WDLA 2CLIB 4H27A 3JWGA 1XCLA 1LVGA 3BIJA 3FWKA 5CUQA 3A1NA 4UPEA 6REQA 4X62B 2I9KA 3JQ8A 1IN1A 5B55A 3WRYC 4A6DA 3FKSA 3T99A 1X6VA 1L5RA 3BDVA 3KZVA 4OOEA 1O96A 3TG8A 2EJWA 2CLMB 2QR2A 4V24A 1A4IA 1MLDA 2YYAA 3A0UA 1N9GA 2Q2VA 3K1AB 4JWKA 5HSGA 1RYNA 3K9NA 1ZKDA 2PKCA 3HWRA 4NIMA 2H2GA 5FYQA 5KHLB 1V7PC 2FX5A 5COBA 1EVZA 4RO0A 1NYQA 3DW1X 5FNVA 1GN9A 2IPNA 3BM5A 2PSFA 4BHTA 2BM8A 5CB0A 2VPIA 3NDBB 3C3DA 1GP2A 4IG9A 3TKAA 2AKAB 3H0EA 3ZD7A 1GL6A 4C78A 2GPBA 1Q22A 2WWGA 5IDXA 5JYDA 1VCOA 4L27A 2B5OA 1XAIA 5ICFA 4BAZA 3HVIA 2CWDA 4WECA 4KDFA 1Y5NA 4AJNA 1YUMA 1A8QA 4J7XA 2IKQA 2WHEA 5A0FA 4IHJA 4JQSA 1CB7A 2O5CA 4RCZA 1E2QA 2G5PA 3EOZA 1EP9A 1NNLA 1TRHA 1BFKA 1EM8A 4BFSA 3L01A 1DI0A 2ZBPA 2QRVA 4PPNA 4F4IA 5IJ9A 5KOYA 3PTAA 2XLBA 4G2NA 3FGOA 2LIPA 1Y1KE 4IS2A 1KARA 3TDNA 3ZHZA 2CNDA 1T8PA 1FSZA 5G2OA 5AKJA 5FFNA 4F1JA 2ISCA 1LZKA 1NKVA 3MJSA 4CQJA 5GZ3A 4G24A 1LDBA 2HL6A 3F8WA 2XRZA 3ZDFA 1IVYA 1ECCA 2ZIXB 4IIJA 5TGTA 1N4AA 1PQ4A 5JS2A 3ZS9A 4X93A 1V1RB 5JTUA 1M7GA 2PD3A 3I9KA 1E9FA 1MJFA 1R0RE 4RLQA 2GCIA 5B4UA 5BVGA 4JLNA 5MFZA 2D7DA