3LUPA

Crystal structure of fatty acid binding degv family protein sag1342 from streptococcus agalactiae
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
283
structure length
283
Chain Sequence
AMKLALITDTSAYLPEAIENHEDVYVLDIPIIIDGKTYIEGQNLTLDQYYDKLAASKELPKTSQPSLAELDDLLCQLEKEGYTHVLGLFIAAGISGFWQNIQFLIEEHPNLTIAFPDTKITSAPQGNLVRNALMCSREGMDFDVIVNKIQSQIEKIEGFIVVNDLNHLVKGGRLSNGSAIIGNLLSIKPVLHFNEEGKIVVYEKVRTEKKALKRLAEIVKEMTADGEYDIAIIHSRAQDKAEQLYNLLAKAGLKDDLEIVSFGGVIATHLGEGAVAFGITPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DegV family protein
publication title Crystal structure of fatty acid binding DegV family protein SAG1342 from Streptococcus agalactiae
rcsb
source organism Streptococcus agalactiae
molecule tags Structure genomics, unknown function
total genus 86
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02645 DegV Uncharacterised protein, DegV family COG1307
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1180.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein Tm841; Chain: A;domain 3 Hypothetical Protein Tm841; Chain: A;domain 3 3lupA02
3.40.50.10170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lupA01
1VPVA 2G7ZA 2DT8A 3JR7A 1PZXA 3PL5A 3LUPA 1MGPA 3FDJA 3FYSA 3NYIA 4X9XA
chains in the Genus database with same CATH superfamily
4LKOA 1R4NA 3O7WA 4PTZA 3QENA 1XEAA 1Y3FE 1K5PA 3HR4A 4MW4A 2NNWB 2HRCA 1U2RA 1JIXA 3HGMA 4X9XA 4ESVA 3R20A 4XQ0A 4EBBA 1ZGHA 3DBLB 4MP3A 5D3MA 3W77A 2I4IA 3KXDA 5AVZA 3KJNA 1QM5A 4HS4A 2C0PA 2JAUA 3PUWA 5HE8A 4CI0B 5K2OA 5ES4B 3AL0C 1Z47A 1ITZA 4E11A 1UJBA 3WLTA 1QCZA 4ZKDA 3OHSX 1Q2XA 1T0HB 3LQ4A 5K4AA 3LCVB 3H1FA 4XARA 1PBTA 3ND7A 4F46A 1HLPA 4EW2A 3E7XA 3JR3A 3KX2A 5J40A 4UBKA 1ID8A 1BDBA 3OEHA 1IXZA 3NGMA 4D92A 3B1FA 3C6KA 4L9AA 2ON6A 4QTXA 4DQXA 2NTVA 2PUJA 5A04A 4JCOA 4E0BA 3THWB 2JZOA 4PCVA 3GPIA 4Q21A 5BSMA 5JSZB 2JFQA 1W6UA 1Y5MA 2ICAA 3AWDA 1RXSA 4JB3A 4XFDA 1NF9A 4FOLA 3JQRA 1GAEO 1JIUA 2PLFA 2R6JA 3X2FA 3L6EA 4CUKA 1UBCA 3SBDA 1LV8A 3LD9A 1AQNA 1UJCA 4JI4B 3FPHA 3NAGA 1FX0B 3REQA 1RABA 3MFQA 2C07A 2IIVA 3C24A 1SG0A 2QN8A 3FGPA 5FTKA 1XZQA 2VF8A 3CEMA 1DWOA 4YRZA 3H4VA 2ORIA 3KJFA 4UZEA 3W06A 3L79A 2Q2WA 4ASUA 1FK8A 4ZRNA 4L76A 5IULC 5ELXA 1RFLA 3T94A 4INPA 2ZB3A 5A7HA 1L7OA 4R5HA 2C5EA 4ZYVA 4RJLA 5GQSA 1CP3A 3OWXA 4GE3A 5LWQA 2PTGA 3OZIA 3GRRA 2J85A 5CTJA 5JSHA 5LJLA 4PW0A 1VFNA 1H05A 2DHEA 1CT9A 2P35A 1V11A 3ABRB 3E2IA 1VPVA 5C81A 4AZ0B 1VIAA 4RYLA 4RY9A 4HDRA 4KXQA 5LA6B 4OSOA 4QUHA 3ULKA 2G5TA 2IU4A 4KPUA 3O0DA 2CK3D 4HPWA 1KOLA 4GLFA 4LK3A 4HAIA 4LZPA 3KXLA 1EDZA 3K8YA 3NVAA 2LUOA 3SF8B 2DPMA 4Q1DA 3O2JA 1P17A 3DE3X 4KIGA 2BFDB 4NAVA 1D2AA 4J91A 4Q7QA 3GRFA 2DCMA 1C9KA 5LL6P 1Y6FA 2J3IA 1P1KA 2C92A 3EC7A 4HQ0A 2GILA 2ACEA 2Q5HA 5CXQA 1OASA 3QPBA 3K9CA 2C5LA 4NL4H 5FPTA 2EZTA 2HZBA 4QUJA 3H9BA 3WMGA 2DKFA 4HDNA 2QSUA 1R5JA 1RYDA 4ZCTA 2RD2A 4LJ5A 3OOWA 4FS8A 3OOYA 4PLFA 3TW0A 1P7CA 3QXCA 4J0JA 2BLLA 1XL0A 2YZMA 3FOFC 1I4WA 3BE6A 3B1VA 3LAWA 3N6VA 3OPNA 3P9YA 4YRLA 2VAVA 4PFKA 3PKZA 1JU3A 5TGDA 1DG9A 1HDIA 3GBVA 2BIFA 4E5YA 2HGZA 2YV2A 3KB8A 3X1MA 5KWEA 3C48A 1H2YA 2ZRCA 4BWYA 1ZWKA 1CYDA 1XNJA 2EZ8A 4GKKB 1UFOA 3P0IA 2JK1A 3CUUA 4M54A 1Y4AE 4UD6A 1KQGA 4XWKA 4DIMA 3PLAE 1YE5A 1WPXA 3DM5A 4PLTA 4B6PA 4JVSB 4CCYB 1SBNE 1DAOA 1L5FA 3FY4A 4B80A 3DG9A 4DKJA 2JZNA 4PNEA 1CERA 2XMGA 1H1DA 4U63A 1E77A 3AY7A 3KR1A 4TMWA 1IEVA 4KXFB 2AEEA 3PRKE 1IJBA 1ELOA 4JUAA 5EFOA 3P5SA 2VHCA 1CV2A 3PFCA 4KUGA 5IBQA 4WNAA 5KYYA 1O3YA 5KUTA 1UANA 4FZ3A 3VR4H 3UUFA 3C43A 5IDWA 4H15A 4YWJA 1G5TA 5C8YF 4OHVA 4WESA 5LOVF 4LNAA 4HZIA 4F3YA 4ZDJA 1L5YA 1XTJA 1AURA 2Z8XA 1XVUA 3QI2A 4QICA 3TLCA 3DEKA 4JJEA 2AOVA 5F1OA 4G6ZA 1VBFA 3M4JA 3W8RA 4B6SA 4BB5A 4DV3B 1F06A 4W82A 4E2ZA 3BDVA 3QVGA 1GPMA 2ZSHA 4AF8A 3G5AA 1CVIA 1Z0ZA 3G49A 3ZDYB 2CL0X 2O2XA 4B76A 1OGYA 1U94A 1CTQA 3FNEA 2BRUA 1BJRE 1K08A 1J8QA 1SK8A 1SQFA 3CRRA 2J59A 2JIQA 5DXFA 1NFRA 2D7CA 2ZBDA 5KSZA 3D0RA 1N2CB 1N7JA 3QE4A 1KPGA 2X9QA 2WM3A 1NYRA 2JGAA 4QOEA 5CD1A 5DV9A 5HIMA 2NPFA 2DR0A 3LP8A 3SZ3A 4ROTA 3A0UA 1U1CA 4L8GA 5CNIA 3UMVA 3N2KB 3WDKA 3WLLA 1E9FA 2AI3A 3IDSA 1SVOA 2C9OA 1QPZA 1QF7A 4H1VA 4G9EA 4OKIA 3BCHA 3NIWA 4ISCA 2OZPA 4CBVA 1SVUA 3UXEA 3BYZA 4BLTA 5DTEA 3LRPA 1VL8A 3EEQA 5GVSA 5LMZA 1RWNA 1SBIA 1PR0A 4TV8F 4BWVA 4HGZA 2FQ1A 2HSJA 1LC0A 1R4MA 4JB8A 4MR7A 1R50A 4AKSA 3P2MA 2B99A 5CBKA 1C50A 2G63A 1QSGA 4WIAA 4ZZ0A 3PGLA 1DPGA 3Q5GA 4X1KB 1LUAA 1NI3A 1VBMA 1VIYA 1WCIA 1HEIA 1KI4A 2ZI3A 2YRWA 3BCRA 5IBCA 3QE3A 3FLMA 1QGED 2C42A 1J9EA 4J1SA 4MYHA 4BJ3A 5CU7A 3NWJA 2GMWA 4NWIA 1U8CB 2ZTLA 2ZAOA 1AKTA 2ZEJA 1QHIA 1Y9ZA 1WW2A 2ZW9A 3DEAA 5DPMA 1L4FA 3A4LA 4IYRA 5AJZA 1GPYA 2DWUA 4FMCF 5EZ6B 5TGZA 1PLJA 5A2GA 3FM9A 5ECWA 4MQFA 2GR9A 3RYIA 3PF8A 4XE5A 3WLSA 3HNPA 2FDCA 1O89A 1TM5E 3MC1A 1E4OA 4JEUA 1B00A 1E7MA 1IG3A 1N2EA 1ULZA 2UYQA 3ER6A 1ZSVA 2V6FA 1Q1GA 1H22A 4S1VA 1GQQA 2A5GA 4PR0A 5COBA 1P7PA 4YYZA 4YT8A 1TU4A 4I1IA 2ECPA 4PLGA 3AC0A 1E3IA 3G0CA 4P3YA 4AJPA 4ZHSA 3LNCA 4EI8A 2GLXA 2ZT8A 1LPOA 2EYUA 4UE6A 3V1YA 2WT8A 3RVLA 1A9SA 2PG3A 4ARSA 2OYCA 3GFTA 4CU5A 5F2NA 3E9MA 4XR4A 4BO2A 4B71A 2LDXA 1Q1BA 4NS4A 4QELA 2GARA 1A69A 3OPMA 4A8JA 2WIBA 3DFFA 3OFND 1YKFA 2NO9A 4JLNA 1XN1A 1CJMA 5H9VA 4AS1A 1JEDA 3DTVD 2QRNA 1K5HA 4FFRA 4EUSA 2V0GA 4BV3A 4YAUA 4X00A 4W8GA 4D8WA 1SBQA 3M70A 5IDQA 2LRHA 3QPDA 2QTAA 4KPFC 3H13A 3IV9A 5BNIA 3TH5A 1NXXA 3K1TA 4KQHA 4Z5XA 3K9GA 2NSHA 1UMCB 1H23A 2QGFA 3UK1A 2RHWA 3RVBA 2E3JA 1V9CA 2XQKA 5ALJA 3WS7A 4QXQA 3R6GA 4FYKA 4Q4DA 1VP3A 2OBFA 2ST1A 2FEOA 4FMDF 4TPKA 1WCYA 3R9KA 1TCCA 2GUGA 3BSFA 2N9UA 2W2MA 3KK0A 1Z4IA 4Q1CA 5B3AA 3WKCA 2Y71A 5K3DA 3U4QB 3BSYA 1P74A 1Y5RA 2G3YA 3ICVA 1NG1A 1TQ4A 4XYGA 5JLAA 1RXYA 3W79A 3VR6A 1HX7A 5I7UA 3G6KA 3LBNA 3ENQA 4OGLA 2BFCA 2WILA 5HOEA 3U44B 2GK7A 3F5MA 4O4LA 4JR0A 2D1QA 1N2OA 1R00A 3VKFA 1MAVA 4K86A 3DEJA 2SECE 4UJ5A 3VPBA 4BWFB 4EG1A 4J49A 2QJOA 4NG5A 1D2CA 4CKXA 2YL2A 5INTA 3EW7A 1L1QA 1G64A 3G17A 3GUYA 2ZJYA 1WDWB 3JR7A 3O8QB 4QOGA 4CYMA 2QZ9A 4FTWA 3NONA 3U19A 2WJAA 3M4YA 2GFIA 3KOYA 4UUQA 1ZU4A 1QX3A 4QECA 2OV4A 2EJWA 2GEJA 4A2CA 3LV8A 3T3EA 5IH7A 4G5RA 2O8BB 1NY5A 2H2AA 1GGJA 2Q46A 3UV3A 3ZWNA 3JQ9A 3GLGB 1Y4UA 2WSYB 5IJXA 1L7RA 4KXVA 2NZVG 3KVVA 3VH2A 3QVXA 1Z45A 3BOSA 2EL9A 2ZANA 4XTRA 1U9IC 4AZTA 4XYLA 4YMGA 4L4ZA 1VJTA 1BWRA 4DRXB 5JWHA 3WY9A 3GLHB 3QSYA 3C3XA 3LUFA 4MYDA 1L5KA 3WKBA 3Q12A 1DV2A 1TZMA 1ZI8A 2LR0A 2DECA 2R2AA 4LISA 3X43A 1ZD1A 5IXJA 4N0MA 1YS7A 2O7NA 1GPUA 3CG4A 3K5HA 3TVYA 4ZZ1A 1NR5A 1F0YA 4DCMA 4E5KA 2JVIA 5B30A 1K4YA 1TAHA 3GJ4A 4KSYA 4PPYA 4U6SA 4V1CB 2RBGA 1UZMA 5AXCA 3TZQA 3VSCA 2IZ7A 2EJVA 4QJ4A 4AMYA 4K46A 1UAGA 3U3RA 5JDCA 3Q2KA 2I4NA 4ON9A 2IHKA 2QR3A 3OF2A 3I6ZA 1V1JA 3TNLA 5DASA 4NYJQ 3RAJA 4D8TA 1DTSA 2JJ1D 2IYVA 1D0IA 1LRLA 2WIDA 2O9JA 1NURA 2HD4A 4RY2A 5SY9A 3FHTA 1HE4A 3A1CA 2C5FA 4BFYA 3K1ZA 1V2GA 1E1RD 4IDFA 2WYOA 1WTAA 2QZJA 3WWYA 2TMKA 2C8VA 2ORVA 4JLOA 1RQLA 3W5IA 3L8EA 2MSCB 1ZOOA 1Y5IA 3LUJA 4HNQA 4YAEA 1C1HA 1VOTA 3D5TA 3WK8A 5K3FB 3NFYA 4EMSA 5D1NA 4ESOA 4F0JA 1TM7E 2JBHA 2V8BA 1Y8RA 3FZQA 4NJOA 2MSEB 1EHCA 2Q4TA 5JD3A 3SK0A 2I7DA 3UAWA 3R0ZA 2ZRPA 1AKEA 4OJNA 3UAVA 4BMSA 3U7HB 3BXXA 4AXXA 2ZB2A 4TV8A 2A1UA 2DBYA 3C3EA 3H5AA 3WSTA 3ZGZA 3UYLA 4Q03A 4KLRA 4GF5A 3WLFA 4L95C 1YZHA 1FS5A 3EGXB 4I50A 1LEHA 3DUFB 1V95A 4RPLA 4URFA 3IULA 1Z26A 2RONA 1UINA 1GQ2A 1PR2A 2OHJA 4ESHA 5KJ1A 4ZV9A 1NMZA 2VT2A 3K4PA 4FGKA 3ML1A 4YO7A 4XDGA 3L5KA 3BILA 1I2MA 2G1JA 3FWHA 1K7FB 4UNQA 1SXJC 3QTLA 4MA4A 4UHBA 4DDWA 3D7NA 3BWCA 3GLIE 3MLEA 1CUJA 1GSOA 2QI9C 4LXUA 3TTYA 2IHBA 1EXWA 4YJ2A 2GCEA 2VDQB 3OQIA 2PQMA 3O4JA 3QYPA 3S0JA 4DV5B 3OQOA 3PSAA 4LPSA 5DIFA 3ZE1B 1PV2A 4BQIA 8GPBA 3C1AA 4H31A 5EJFA 2QRLA 4HUQA 2ZJ7A 1KMHB 3BMOB 3HEBA 1PS0A 5KYWA 2BWJA 4HDSA 3NIDB 3SR4A 4GR4A 2H7YA 5KVSA 4MKRA 1BGVA 1I32A 5HX7A 5K7SA 3EF0A 4TQAA 3WG9A 4E94A 1TD9A 3MMXA 4ZXFA 2QX6A 2X3UA 2FJPA 3H3XA 4N7BA 1HKHA 1ZGBA 1OWLA 3A2MA 2FY8A 3ZPXA 2KHZA 2X3FA 3ACBA 2VEOA 2I99A 1TJ4A 3H1BA 1GVNB 2QI9F 3ODPA 1XZ8A 1J5PA 1FSPA 1WMBA 4E1BA 2OBNA 5ABPA 2VFAA 1G7TA 1VKHA 2HLPA 2X1VA 3GD5A 4UEOA 5KTYA 1SKMA 3PJRA 2GVNA 2IY7A 2WKQA 4B3RB 4EEZA 1R5OA 1WUIS 3EFBA 3CCCA 2QPAA 3UPTA 3VHXB 2GA8A 2J48A 3FOCA 4CNBA 1H2EA 4NCNA 1DT5A 2G77B 4GZ3A 1ESDA 1W87A 1Z25A 2B83A 3IBCA 3QYAA 1TLFA 1CF2O 2XE7A 3QNUA 2O1SA 1W5SA 4RTPA 4FXOA 4GP7A 2HJHA 1O08A 3KOOA 1WEKA 4U0JA 5AKEA 3V80A 2HRRA 1X1QA 3NVKI 2C9MA 2QE7A 3PB3A 1MGPA 1BS9A 4IS3A 3R7DA 1ONPA 4AY4A 5B6IA 3E5MA 2ISQA 3OT1B 3RHTA 2PHZA 4I0WB 5DN9A 1LBQA 2VK8A 1VPEA 5FP0A 4QEZA 3AVUA 5TMBA 1ZN9A 3JSAA 2PZLA 1J49A 2Y1OA 5FJJA 1BXRA 2DQKA 3WGIA 1EFRD 4G2TA 4FQ5A 5FBVB 5EZQA 1LNSA 4URXR 1SUIA 1YHYA 1EUDA 3ELYA 3VR1A 4JUCA 3GJXC 3OX2A 4ALKA 3IHWA 1G2PA 3PDIB 5CM9C 2PKCA 3VYRB 4Q3LA 3MRVA 3CX8A 3ETEA 3MCWA 2XMBA 5KYVA 3A4IA 3WRYA 2P2NA 4Y9TA 2ZIFA 2H1FA 1NXTA 5ITZA 1JV2B 4LZWA 4LYYA 2C8KA 2G70A 2GAAA 1T8WA 2HCBA 3OTGA 4QAJA 4BZPA 5AP9A 4NULA 4E14A 3IQIX 4GBMA 4Q4JA 5CB4A 2P68A 3IC5A 3TW8B 3VX4A 4Y1GA 5JASA 5KAMA 2GJSA 1M2HA 4QYSA 1PFYA 5JAQA 2JGDA 5IT9A 1RWWA 3RW9A 3MXTA 3STYA 4QDUA 2Z58A 3V8EA 3HM2A 1S0UA 1KI9A 4W7HA 3FZEA 1L9XA 4UARA 3SP1A 3VISA 2GKGA 1FU8A 3L4EA 5J43A 1IPFA 2W90A 5IAEA 1Y0BA 2PCLA 3BXZA 1Y1LA 4JLPA 3FIJA 3NUQA 1VI6A 1M76A 1WUKS 1XZCA 4KO1S 5AXAA 1HQDA 2BEUB 3URMA 3WA6A 3O1IC 4GG1A 1CZNA 4RIGA 3FUTA 2IYPA 3ZWMA 3ROMA 1DFHA 1VGRA 1I80A 2QTWB 3GEEA 4MV7A 1OQAA 1S8NA 3DOJA 1WDLA 3PQ2A 3VVMA 4BMCA 2P9CA 3VI4B 4M9CA 2FX3A 2EEZA 5A4FS 1BDIA 1RBZA 2HIGA 1MENA 2PRJA 4JVNA 4M46A 5IH3A 5CYOA 4DMKA 2Q3LA 2ZJ4A 3MWJA 4N76A 5HF5A 1U7PA 3DP9A 4A0SA 1V47A 4C2BA 1BGXT 3VOBA 2PT9A 3E5NA 3WGZA 4MQ5A 4M1OA 1OYVA 1KJWA 1S3GA 2IXDA 5DW3A 3N39C 4Q7LA 2JAPA 1OKKA 3DL4A 3TXYA 4WBXC 4FFOA 3BHIA 3H0EA 1XB2A 1U2QA 4FNGA 2PGOA 2ZZNA 3PENA 5A2QA 3NBFA 1NQXA 1Q12A 5A3RA 2JARA 5KQSA 3SGLA 1U63A 1G0OA 1DEXA 4RYDA 5DVZA 1JQEA 3ENKA 1LPSA 3PDHA 5FBWB 5GGXA 4GR9A 3W1EA 3ESCA 4N5LA 1B74A 3VDQA 4YRSA 1V5FA 3SZUA 3Q87B 5IHPA 5EY5B 1KOJA 2MSDB 2NACA 3FPAA 3WKAA 4E2YA 5HKKA 2QLTA 4WOPA 2E89A 1W5TA 1KJYA 1LDGA 3CZ5A 4NOMA 1FLDA 7AT1A 2GDZA 3ZE8A 1ZD8A 2JLRA 3EIWA 1M6VA 4E5NA 1C3OB 4EVRA 3PX7A 4DDKA 2BW0A 3EQ7A 3L7DA 3OMWA 4EYKA 3BMCB 1U4NA 2WV7A 1QRUA 2BGIA 3H5OA 1YZQA 2PA0A 1RHRA 2WUEA 3OPYB 4YWHA 3VHLB 3BD9A 1GPJA 1TCUA 3KEQA 4AJNA 4J2HA 2FZGA 3KPVA 2P5YA 3SIPA 3O82A 2YZNA 1T9ZA 4MI1A 2QVCA 4R9RA 721PA 2FFAA 5JD6A 1MNAA 1RJEA 3KEMA 4DY4A 1CUHA 2PUBA 4YQFA 3AIOA 3DJYA 2JAOA 1STOA 2IPLA 2OM6A 2YWCA 3HDGA 4EMBA 2ANBA 2CBXA 4E1VA 2V6IA 3NHKA 2X40A 4RCVA 4DV4B 1A4UA 2BFBA 3EGDB 3MGKA 3D5QA 3NV9A 3ORHA 4IEEA 3RS0A 1I7DA 2X19A 3BMQA 3GPCA 3NVDA 4KXYA 1GYQA 3NJ4A 5HTOA 4R0MA 1QQBA 1NLFA 1NMXA 4CV3A 1BVYF 2VYVD 4OP2A 3QIAA 1UC9A 5KVCA 3PNKA 1PHPA 3FTNA 3HVKA 1DAHA 2CXTA 1HMPA 3HA2A 4M1WA 4UNNA 3VTFA 1VCNA 2ASVA 1O95A 4W9NA 2O2SA 1ADBA 4YASA 2I2CA 2PWBA 3M6WA 5MN4A 1EUCB 2JJQA 3RVJA 4BQEA 4BV9A 2PZBA 2OG1A 1W1IA 4F45A 1YD7A 1PWZA 4YLGA 5IN4A 2PIDA 2V3WA 5ES3A 3WGKA 5H80A 3FCAA 1OAAA 1E4YA 4NNOA 2NVWA 3MRSA 4FZRA 5KNBA 3CT4A 1CY4A 1UIMA 3QOWA 5HFJA 4ZPXA 1AKWA 4G1UC 2FFHA 1C29B 1OFTA 1BRTA 1U7OA 2NVUA 3L7YA 3U9TA 2BTOA 5EEHA 5J5CA 3PDCA 4CDRA 2ZYHA 5JBNA 1QKJA 1UJMA 3IQFA 1KF0A 2BEWB 2ID4A 4DJTA 1NVKA 1J25A 1ZESA 1SVSA 3FKJA 1E1QD 5C18A 4IRMA 2VG8A 1NVDA 1Y48E 3PPYA 4D79A 1SNYA 3G1UA 1KGSA 2OG2A 4NEHB 4YRQA 1ZJ5A 3F6BX 2GBGA 1TUBA 2JFWA 5EWMA 4G1CA 1QH0A 2HMWA 3TQCA 4HQLA 1Z7GA 1Z0DA 3EZXA 3IEIA 3QTTA 4MUIA 3TRDA 3CUTA 1D5WA 1UZUA 5G4LA 4JYZA 1MJGM 5LWHA 4IKPA 3ZD6A 4XJSA 3BSWA 3ESRA 4PCLA 4OXKA 3L5OA 1XJQA 3C3KA 2ZSEA 3QF4B 2IOYA 1G66A 3LQRA 4QTTB 5C5IA 3MBIA 2BMJA 5LZ4A 1CR0A 3F4BA 2CFRA 1OF1A 5AI5A 4EI9A 3AFIA 3NTRA 4C4TA 2I3BA 1CDEA 3P2JA 2REQA 1OZHA 5GJWC 1Z7WA 3SIXA 2Y9PB 2VBCA 1LSUA 2OBBA 5SZJA 2OGSA 4J4TA 5ER9A 3GUHA 2VUHB 3NTLA 4RIIA 4AKEA 1MOSA 2ERCA 4NE9A 1UBNA 4N3BA 1FDUA 1W85B 2BAGA 4O2LA 3DBOB 3BRSA 1O96A 2J3KA 2BFEA 1VHWA 4K8RB 4C9BA 1VMKA 2JH3A 1Z2CA 2P6OA 4MS3B 3SIRA 3U5ZB 1XPRA 3I2HA 4F97A 2AKEA 2WE7A 4NEGA 4JJ6A 3Q15C 4AWXA 2QZ4A 2O1EA 4OXRA 2HDNB 1A5TA 3PFBA 4QLAA 5AW9A 3I92A 5I9MA 3S1AB 4DC0A 3O8OA 1FYDA 1UCFA 3A6JA 1W5AA 3RM3A 3W9UA 4Z99A 3WLPA 4EG3A 3LUGA 4H1WA 1CY2A 4OB7A 4BNGA 5BNZA 3AZOA 5EP2A 4G09A 2NSLA 5J1SB 2PANA 2CDRA 4CMAA 4N5IX 3R9WA 3IEUA 4U2GA 1I51A 5A7GA 4C4RA 1OW3B 4XX0B 4UAJA 4GX0A 3OUUA 1IVNA 1IZYA 1N1MA 3ZH2A 5CDSA 2N75A 5GGYA 1DEHA 4YHHB 3QVSA 1QQ6A 2JGKA 2Q4EA 3EEFA 4LXYA 5ANRB 3N7UA 2H7XA 4OQDA 2IP2A 1Q7RA 3N5CA 4TL9A 4WA7A 1DG3A 5M29A 3KQKA 3UPUA 1YMQA 3ORFA 1RLTA 4TQGA 1UBGA 4I9UA 4UUOA 3HU1A 3ZQKA 4B3CA 4Z4CA 3MCAA 3IQEA 4NRDA 4J7UA 2WKWA 4LHVA 4D9CA 1QBGA 2GCOB 1BX1A 3DTTA 4ROSA 3DMDA 1TQHA 2XF8A 3K1JA 4GGMX 4I5IA 3U0BA 5E7IA 2AK3A 3DLPX 1UT6A 2NIPA 4I1VA 1ZOSA 2R751 4WADA 3HO6A 2ZCJA 2RHMA 2JFBA 3VYUB 1O0BA 4RF4A 4KYUA 5IK2A 3H0CA 2ZTMA 4LRTB 5ERXA 3R7NA 3OEED 4BRWA 5CDFA 1F2VA 5KNCD 1RC1A 1SAYA 1JAZA 1W47A 4EVSA 3ZG6A 4H60A 1IOLA 4OMDA 3F78A 2ZT6A 2FCAA 2GCNA 4GPBA 5ALLA 3TVTA 4AP9A 4HSEA 1F14A 1OYYA 2EW8A 3FB1A 4GXNA 3IXQA 2IYYA 4KE7A 1M10A 3O7MA 1ICEA 3SHFA 4F71A 5C7OO 2C96A 3DWEX 2CNKA 1R8SA 4PSCA 3WMRA 3UJ8A 3RIXA 5LC1A 2Y66A 2QTNA 4KFUA 1ZNWA 2ZSUA 2F8MA 3Q7QA 1FTSA 2EWVA 4AS3A 1WUHS 3NBXX 5EN4A 1JQAA 2H1IA 1LK0A 3BK2A 3LY5A 1NE2A 2WDZA 4LJSA 3CO0S 3NJRA 4JI0B 3DLBA 1W2GA 3OJ0A 3Q7EA 1VL0A 4QG7A 3UVEA 2QLLA 3L8HA 1N32B 5EUBA 1Y81A 4UM5A 2P0YA 4J7AA 2JCYA 5L9AA 2DFDA 3C3PA 4G5OA 4MRSA 1XD2B 4WNYA 3OZSA 2XB9A 1T4DA 1WZEA 3DP7A 1J8MF 5JQGF 4MUEA 3UMFA 2JIMA 4UBMA 4OL0A 2XZDA 4M1QA 2JL1A 1IZZA 4WECA 3NKVA 4QSMA 2AMLA 1M1YE 1PQYA 2DBZA 2VO1A 3DVAA 2ZJ6A 1CIJA 1ZK2A 1PU2A 3BH7A 2WHPB 4IGIA 4R8SA 4Y9DA 1GPH1 3S2GA 2M2IA 3GRVA 5CNJA 5IFKA 1R8JA 4CJXA 5LMNB 1C1XA 4RA6B 2AFIE 3S28A 3T41A 4R81A 4DLWA 1NQOA 1G5IA 4DM7A 1ILEA 3J7AC 4PC3A 1PHRA 3ISTA 3P9NA 4GPD1 2O3QA 3TL2A 5J1TB 2A9QA 2HADA 3L93A 4GMFA 4IHJF 3SQMA 5H4GA 4LYAA 2B5VA 1G291 4HQFA 1CWUA 3GEHA 1KQ3A 4N3AA 2GJ4A 3DAFA 2J7KA 1SVLA 4DNXA 1G8SA 1VDZA 4GOJA 2DHQA 1A98A 3EODA 3KVYA 4K9SA 2L19A 2WMNB 2W43A 4UTOA 3BMNA 5I4KA 4RWEA 5H0IA 3CKKA 5EJIA 4RPHA 2FW6A 3A1UA 3IIEA 2CJYA 3OMXA 1TA0A 3G1TA 4BS9A 3G2NA 1EGMB 1BE1A 4IPTA 5HHTA 4IH4A 4BPRA 3PE6A 3D8RA 1BEUB 1DIRA 3W78A 2ZT7A 5I7RA 3KEGA 4X45A 1UKAA 2CT8A 5HBGA 4DADA 2ZIUB 2YV4A 1B8NA 1ZGGA 3HJCA 3F9IA 3MUNA 3BDAA 4G0YA 4WLFA 1JVNA 5IJ9B 2IUSA 2CK3A 2IELA 3CLKA 4IW3B 2PZ8A 2XI4A 1FRFS 2X2FA 1Z29A 1YQDA 3R74A 2F4VB 4E4YA 2QROA 2AH5A 2NUPA 5JFTA 4NLLA 2BGMA 3GJ5A 4OGFA 3RVSA 3BGIA 4OI4A 3EFOB 5EPOA 1X6VA 3OTHA 3UCFA 3C8UA 5BV8A 5KOHA 1IM5A 1YMVA 3IUNA 2VBFA 3KU1A 3A11A 1PFGA 5ALWA 5EWJA 3GT4A 3WI7A 3F8TA 4QU5A 4GECA 4C0HA 1TO1E 3KXPA 2ZIEA 1PLKA 1YR1A 3MINB 3N7AA 4TL7A 3UWPA 3M3DA 2PLRA 4TTVA 1LXCA 1YQTA 3ZY4A 3DDZX 2QTVB 2GHQA 5K0FA 4CODB 3NHJA 2QT0A 5TV2A 1YQ9A 1XEFA 4CKWA 2UYGA 3JQAB 3ZY6A 1UR5A 2XVYA 2IYEA 5JS2A 1HTWA 2HV8A 2MINB 3FFBA 4LY6A 4E6EA 4FFDA 4KREA 3O0TA 1Z5PA 1RP1A 1UWVA 3D2CA 5L3SB 4S2UA 1Z6GA 2ZRFA 2PGDA 2JLXA 1T43A 2QMEA 4AJIA 4I36A 2VH2A 4QLBA 2SCUA 4C78A 1KMQA 2OPBA 3RYTC 4K6CA 4YMUA 1KY3A 1PS8A 1QV7A 2ZP1A 1M6HA 4CEHA 2YMMA 3DC2A 2W6NA 1RKQA 2E2WA 4U2KA 4B5LA 2J46A 1XLTC 5HIAA 1OVGA 4XLTA 3WNVA 4HZUB 1CUDA 1JKFA 1XTVA 3H2BA 3WNCA 1VC2A 4FHFA 4HOYA 3B52X 3PGXA 4RD6A 3M82A 4R69A 5DT2A 1GGHA 1ZY2A 4HDOB 3I2KA 3HFJA 4JL5A 4L5YA 4YRRA 5EXDA 2IIBA 1P62B 1YBFA 4HAZA 3G8DA 1E0AA 5IJZA 1WB6A 3N2GA 5BN4B 5DK6A 1M8KA 4ARZB 3QJYA 1M34E 2HFKA 3CURA 4M0PA 3T7RA 1P77A 4B81A 3BBLA 3GVIA 3O75A 4YUXA 3QLUA 4UCXA 3QX3A 2PRIA 2PMKA 4ZOLB 3JD2A 1E4EA 4QT4A 1CF4A 5J5AA 4RD0A 3UWSA 2O8NA 3RRXA 3N0XA 3OZGA 4QQRA 1SZCA 1YR9A 4HDMB 5ALIA 5T67A 2JGEA 5AKZA 4IMPA 3ITNA 2BFWA 5JMPA 3NALA 1B23P 4LHYA 1QRSA 2XODA 4M0CA 3L6CA 1CU1A 1VPLA 2ORYA 3A14A 3EIFA 4RADA 3PIRA 1TVCA 1X13A 4HLUA 4UMFA 5FL7D 1ZVVA 2BGGA 1R7RA 4NMMA 4EFKA 10MHA 4DIBA 2LE0A 2E6KA 1UKYA 2HREA 4YQYA 3ELUA 3ETCA 4JMPA 4XUEA 3N2LA 4BY9E 2J3JA 4JNKA 3TLGA 1ESZA 3GLFE 5KJFA 2QM3A 1S3SA 4M9QA 3WLHA 4BC0A 2PKEA 2Z8ZA 5HKLA 1BW9A 2MDTA 4YMLA 3LT4A 4Z9FA 4C0WA 5L40A 1BHO1 4CEIA 3DZJA 2QMQA 4URVR 2YCLA 5EIAA 3O84A 3GX1A 4JHXA 2FI1A 4L5BA 1BCSA 4MVWA 4RVCA 4G23A 5LCXA 4MRVA 1MU0A 3R40A 3TRFA 2GD2A 3AB7A 1I0IA 3C6ZA 3KC2A 3QKRB 1V45E 1LDYA 1CZOA 2HYDA 1XTPA 2FG6C 3GLTA 4RSGA 4X95A 2B5OA 4OA8A 5ALQA 3R8XA 2SHKA 3URKA 2BL4A 3HNRA 3WIVA 3TLMA 5ADVA 5C0OE 4B3JA 3K9WA 4Q9KA 1OFHA 1KJNA 4O02B 3UHJA 1ABEA 2BCGY 2CUTA 1EWTA 5AUQA 2QD3A 1KZ4A 2HBZA 3LPAA 2HIHA 2PUWA 2XTMA 1ODCA 3U5TA 3IQGX 1FFEA 3AXTA 3RVDA 4F5ZA 1YC5A 2IDKA 1YC2A 4HP8A 5LA6F 1HETA 2XUOA 3TKYA 2NXCA 1KFCB 1R8XA 3EDYA 3OEWA 1R0YA 3N0WA 4ZKEA 3R3XA 2ZYAA 4D1YA 3E9CA 3HP4A 4DQLA 2XBMA 2J33A 3ONWA 1U02A 4B43A 3RVKA 2GAIA 1GPAA 1MOQA 4ZQCB 2ZWVA 4ZTBA 1WPGA 4KTVE 1CRPA 2WT4A 4JLVA 1X70A 3HSYA 4ALJA 1R3UA 1V48A 3S6JA 2PUHA 4J07A 4WCFB 3DGEC 5AKGA 1X8LA 5HUHA 3ZU6A 4YRIA 2C7QA 2WQ7A 4YP5A 5HGXA 2C5BA 2W6QA 1E32A 3HUFA 3MMSA 3CC8A 3LUHA 3N76A 2LDBA 1MG5A 2P3OA 2BONA 2ZRNA 3ESXA 3OTWA 3REGA 1HQKA 2JFOA 3M6FA 3WWOA 1DARA 1H42A 3DTVA 5T3UA 2VTKA 1D5CA 4RC9A 3PNBA 4LC0A 2CD9A 4O1IA 3AEYA 5K8LA 1HPLA 4Y30A 4DW8A 4KKVA 5BQFA 1JALA 1RU3A 2FJ0A 1XXHB 5B1DA 2Q5LA 1WV0A 4QWMA 4V0QA 4Z1MD 4TYMA 3LE8A 2VNKA 3W2HA 4OK6A 4D8VA 3D7KA 1HRKA 3HYSA 1P9OA 1PKXA 5IBPA 4DM3A 4Z54A 1AXEA 4XX1A 4CF7A 3EUWA 1GUAA 1LX7A 3U7QB 4BQSA 3AVVA 1ZM3A 1I3CA 3PDWA 4HB2A 4TLEA 1QGZA 2IFTA 4HF7A 2G6BA 1V3VA 5JAMA 3IB6A 2PR2A 3ANMA 5K8IA 1W48A 5DNDA 2IYOA 3WISA 1J90A 2RG1A 5ECGC 2G36A 1WWKA 5D6OA 1GTL1 1TO2E 5LR6A 1N3YA 3AG5A 2EX0A 3NS7A 1BDMA 4L8LA 1ORIA 4J0IA 5KHOC 3THXB 1J07A 1DEOA 3GFGA 2J7PD 3OH8A 4IL5A 3PNMA 1DQPA 4IQ0A 4MV4A 4UM9D 3G2MA 5GOTA 3IIMA 3MWYW 5HDBB 1U2ZA 2BZ1A 4Z2YA 3TD2A 2BZ0A 3GNSA 4Z4HA 5LD2B 4GE0A 4P4SA 2PWAA 3KP1A 5EIBD 1KEWA 2NT3A 3G23A 2Q7XA 3IUJA 4IICA 2FMFA 2E49A 2FPIA 3WYAA 1WX1A 1KJQA 2XTJA 3NHSA 1ZRHA 4LKRA 4E21A 4MUMA 4E30A 4US2R 3GGOA 1OD6A 5TJHA 3W90A 4M9UA 4U2DA 1OXVA 4BQPA 1WXEA 1H0RA 2H92A 2QX4A 3DMFA 4NDAA 2HBQA 4AWAA 1YI8A 1NKSA 4K6OA 5JCZA 1E5TA 1JSCA 2ZBPA 5EL0A 2WFAA 4HNVA 1IPEA 3DVRX 5BYBA 2PMBA 1NVWQ 2BKAA 4OQNA 2WAMA 5IFLA 4HLQB 3RS8A 4DCNA 3GI1A 4AZVA 1M1ZA 3HDQA 5KU1A 2DLDA 1CJUC 2RHBA 4UQOA 5GTDA 3FUXA 3ASVA 3QW2A 2IUUA 2QN3A 1GILA 3OKPA 3VSDA 1FEZA 4ZO8A 3UYKA 4NG4A 3GHHA 2AZ4A 1WHTB 3JWEA 1N8TA 1RRVA 3LCCA 4NQZA 3TTTA 4DA8A 3W4IA 3SS8A 3RROA 5J2TB 5K8UA 4O4HB 1RHKA 1JVSA 2XCQA 3UXYA 5AT1A 1D9ZA 3QPCA 4ZZIA 1AGYA 2EATA 1UMDA 1CRLA 3KYCB 3VVCA 3CLTC 2O57A 1EIZA 2JJ1A 2R8XA 3D64A 3WNDA 4ZMRA 1E8MA 5AW6A 3ZJTA 2WTXA 2O8CA 4KX5A 1UC5B 3M9LA 2LV8A 3F4KA 4YAJA 4QGHA 1VJCA 1KYTA 3QK7A 5CVDA 5GZ6A 4A7PA 4YJDA 2P2LA 2WG1A 5J63A 4N1AA 4GM1A 2QYSA 2YC2C 3IA7A 1E1RA 4ZI7B 1YXMA 1E92A 4N6NA 1AY0A 2HRDA 4LF4B 3U61B 1NSYA 4I5EA 4KWIA 5T7BA 3PITA 1YB6A 5CJJA 1YQUA 3DCYA 5FDFA 1YBMA 3E3NA 3O91A 4KN5A 3LC1O 1JG4A 3DZCA 4LI0A 3LXUX 1QQTA 2AJCA 3IVGA 3QG5A 4ITUA 1I7QB 2W22A 4MQLA 3JQ6A 5DEOA 1EWVA 3G2HA 2VDOB 4KBGA 1K92A 2WJIA 5I9SA 3SU8A 3TFOA 2CV0A 2NYRA 1QIKA 5BSTA 3P0RA 4KQIA 1HZZA 4N0EA 4C89A 2QPOA 3V7UA 3WV5A 4I14A 2OQ2A 4YRBA 5I3ZA 3IPCA 1GA1A 4K9QA 2PM8A 5F1YA 4MJ7A 1JA0A 4N8EA 3MQFA 4MUKA 3T3OA 4MEAA 3FMGA 2M6SA 1B42A 1ZNXA 2L2QA 2OCDA 1BVUA 1RI1A 4EYOA 2D7DA 3GOHA 3U81A 1GRVA 3QWAA 1MXFA 4HEHA 3STHA 3PJDA 1JFSA 4BO3A 3P27A 2JRCA 4DG8A 4F60A 2VP9A 2GBLC 1PO7A 1M2OB 1SGWA 3ABQB 3PQ4A 4PIVA 4YREA 3LTEA 4GOLD 1DUVG 3NORA 4LX8A 5FTJA 4K88A 1GU1A 4C20A 1N33B 4IVPA 2ECFA 3ZYZA 1VIMA 3IHLA 2QW0X 2EW2A 2XT6A 5LXTA 2GF2A 2FOIA 2CLKB 2CZQA 4ZVRA 5BXQC 3JVUA 1Q7EA 2P1ZA 2ONYA 4QE3A 5DSXA 2WJWA 1FYVA 3D4LA 3QX8A 2CB0A 3F3KA 3N2NA 4EUNA 3R8FA 1TECE 4CW7A 4RH3A 3Q8WA 2H4ZA 2OZKA 2PD4A 5DNYB 1J0DA 1VMIA 3D7MA 5T4HA 3BRWD 1T5OA 4ECEA 3N8KA 2O2YA 2Q3HA 3PUVA 1F1BA 3I4FA 2AW5A 5AK0A 1P9RA 1TEVA 4UFOA 2EXXA 3LGXA 1L5GB 2QM0A 4XGNA 3VPXA 4RDIA 4P4LA 2ZAMA 2ZBQA 3FYUA 1Q20A 2QSZA 3B9QA 1SVWA 4W8OA 5DISB 5CB0A 1IY2A 5I6DA 4U7GA 2H0AA 1WO8A 3GJYA 3AV3A 2CGEA 3DZHA 3P0EA 4UCFA 1E0KA 2NQ8A 4L15A 2IVFA 3IKTA 1USWA 2ZRHA 2HRZA 5TT1A 3VKWA 1ZJ6A 2QUKA 1ECGA 2QL7A 3AHFA 1XZJA 4B8YA 4TS9A 3TBKA 2C9DA 1TYAE 1HT0A 1NJFA 1K98A 2C7BA 1LLCA 5HJ5A 1PCXA 1KIAA 4V0ME 1J9GA 4N0PA 1BXZA 4FYMA 5D6NA 1TUGA 2V74B 1L3IA 3G13A 4WKNA 5FUMA 3ME5A 3H1GA 3KJIA 5FT9A 4B3DA 1P91A 5KB3A 2YX1A 4KO8A 2IGTA 5BY2A 4NQRA 1EEXB 1LVHA 1M5TA 4TWJA 3NEYA 1WBDA 2Z8YM 2KW5A 3T4PA 1KI8A 1ZK3A 4JIMA 3A32A 1AQYA 4JYAB 3DA8A 2XGMA 2X9VA 4P4GA 1WRBA 2I54A 3ZBUA 1N92A 2V7WA 2XAUA 5FCDA 1NRJB 2P5UA 1JSRA 1ADGA 2WPDD 1G4HA 1OJ7A 1FRZA 3TRHA 4DSUA 4EZBA 1EUQA 3ZE2B 3ICQB 2HBRA 4G0NA 3MTJA 2CXUA 3NNNA 3I9LA 4P5EA 1E9AA 1KO1A 5CW2A 4CTNA 2XKBA 1DIOB 5JCOC 3FOEC 3WL3A 4B3HA 2BH9A 1GV1A 5EP3A 1A9TA 1JDTA 1M2VB 3CMMA 1SM4A 4JLAA 3KQOA 2JFNA 1KZ1A 1ZIPA 4MOWA 5KYXA 3JAMA 1TK9A 3OLYA 2ZE5A 4C7JA 5C8DA 1Z8NA 3HUTA 1LSSA 3OZRA 2I91A 4BLQA 3VYSB 2C83A 3KQLA 1B8VA 2WI8A 1RE1A 4K6HA 2QJRA 4AJ1A 3LX4A 3DWIA 3V8QA 3AUAA 4DLAA 2P6RA 3TLEA 2VTBB 3I5YA 1UQUA 4FYJA 1CD5A 3OCWA 4W1PA 2JLYA 1Z16A 3ESQA 1WUJS 3FMOB 2Q6IA 3KT6A 3BEOA 4LE1A 1QFXA 2CLFB 4NBLA 4XYBA 5CFQA 1L6IA 4WH0A 3WBJA 3QWHA 5ILQA 4DYDA 5LB2A 2QORA 2VS1A 2ZJBA 3C1OA 3VNBA 2FCRA 3M6XA 3VU8A 6YASA 1AK1A 3C5HA 2H1VA 1XA0A 4NZ9A 1IB0A 2Z3WA 1PJ2A 1QLHA 5CGZA 3AM3A 3ADPA 3BORA 1SU6A 2VAMA 1LSOA 3ASZA 1V1RB 4WKBA 4EFLA 3AFMA 4IG4A 5FWDA 4GUDA 4CTJA 5G53C 1ORRA 3CVJA 1W52X 4Y9SA 1YZLA 1MHTA 4NPHA 4BB6A 1IK4A 3DE5X 1UBLS 3HC7A 4YR7A 3OCVA 2EQBA 3T06B 1TZCA 4ZVUA 4ZDKA 1U3GA 1W5EA 3JYOA 1FUEA 4I9HA 2DETA 3ZV6A 5CVTA 4FI3F 5I8ZA 5CA0B 1PJQA 1PGNA 1F1JA 4ZVPA 1WNFA 3WRXA 3WSVA 1G5RA 3COPA 4B83A 3DQZA 4V1CI 4ZK6A 5JS1A 1QMGA 5FA6A 3RJ9A 2J6IA 3G59A 3TB4A 2VDJA 5IT0A 4M86A 5F64A 3ZU4A 1WBBA 4YRDA 4QARA 3I6QA 1FMJA 4TWAA 2F1RA 2IHNA 2BH2A 1NJ8A 2FLWA 4HAXA 4TYYA 1O6GA 2JAHA 4CQNA 3D6TB 1F3OA 1IATA 3SKXA 5H4HA 4ALIA 5J58A 4QBHA 1MQ9A 1Y7HA 4NR0A 4H59A 1PT5A 2AVDA 2X9GA 4TQUS 1XYYA 4IGEA 1U0NA 3FDZA 5D7NA 4IJQA 3T9BA 3FROA 4JBHA 2QXUA 2O14A 1XE3A 3DMTC 3RSFA 3UUEA 2EHDA 2B7BA 4J16A 4DA6A 2RB4A 4E22A 5CT8A 3OKFA 2IWHA 3FYSA 3GR6A 3IP3A 3N8DA 2GEUA 3H0KA 1L7EA 1ZG3A 4PBRA 4B8ZA 4BMNA 3SC6A 1I3NA 3LKDA 1C30A 4CKBB 3AL3A 3H99A 2IY8A 2VPZA 5A03A 3MJTA 2OORC 4UDXX 3VH4A 4ZEVA 4FBMA 4C6TA 1MQAA 1KAQA 4XB2A 4G07A 3AJ8A 4ESEA 3Q2IA 1RHQA 3TRJA 1LI7A 1RWOA 1I5RA 5ITVA 4C43A 2HKIA 3T38A 2YHIA 3LL4A 1DAEA 1XIVA 1R0RE 1RS0A 3H6KA 1I1OA 4QBKA 1QHFA 5JI3E 4NMWA 1JLMA 4E2WA 1C4KA 1ND5A 1EBFA 2BM1A 2I65A 2VPXA 1T0UA 1ZGJA 2DPYA 2F59A 2GZRA 3H9JA 1WSAA 3IAUA 3RH0A 4C0AC 1QKKA 3NBAA 4DZZA 1IU9A 4L4UA 4A0GA 4C0LA 1SUCA 4MB2A 2JHAA 4DUPA 3W6UA 3DVLA 1GVHA 1EX1A 3C3YA 4BRUA 5JSQA 3C85A 3AP1A 1V7PC 4FOPA 2PSDA 2YN0A 4N0DA 1JPJA 1DBPA 1U6IA 5JOQA 4GUAA 2H4FA 5HJ2A 1T2NA 5F5XA 3MMZA 5K3EA 2C1XA 2W70A 2XUKA 1T6ZA 2VYVA 2CHEA 2G88A 4F56A 3B53X 1E3JA 3T3PB 1DKOA 4DWVA 2DWQA 2ADFA 1NVVR 2C20A 4QPDA 2JFGA 4D6YA 3KR2A 4LQCA 3OQ6A 3UJAA 1GKIA 3U49A 1U5BB 1YS4A 5JNSA 3UW3A 3VI3B 1OU4A 5UKDA 4LHSA 3DLCA 1R2QA 2OP1A 4P38A 5CLQA 5TNXA 4M9XA 1PUIA 2VQ3A 3TXAA 2I80A 3GZNB 4OHKA 4QL3A 4M4SA 3W5UA 3IP6A 1SD2A 5BUCA 4JGIA 4EHFA 3DBHB 1ZKMA 1KVQA 3GWZA 3I6BA 1CUSA 1DIAA 1PZEA 2FSIA 1R0LA 4R54A 4R1PA 2AJDA 4JX9A 3M83A 4Q7KA 3H6GA 3D3NA 4Z49A 2XMZA 3K2BA 3DLTA 4ZAYA 4ZD6A 1D8AA 3KQSA 4G8BA 1K2VN 4ZO6A 2PYZA 3S2IA 5DBOA 3X1WA 4DLYA 1TE2A 3KCNA 3KEFA 2OCYC 2O8FB 1ZN7A 4TT3D 1E5XA 3EAQA 1GT6A 3A1WA 4YJ3F 1QRTA 4MYRA 1SFRA 3LDFA 2E5LB 3JQ7B 1DI0A 2EWMA 3EG9B 3EVZA 1ZS9A 1T9DA 5KVAA 3HDYA 2I6QA 4Q48A 1V26A 1EEHA 5I47A 1FNDA 4G97A 3T35A 3LVBA 3L4BA 3UJ9A 2JFZA 4BLSA 3R4VA 5DM1A 2O19A 1G8HA 2FWPA 5FUBA 1R6UA 2FPSA 1N25A 3KPUA 3T5GA 3ZLBA 4ZRDA 1NQVA 2HT1A 1YKGA 1AUQA 2OWEA 1USVA 4QJBA 5ALGA 1V5IA 3TQSA 4PXSA 3ZWQA 2FW8A 1DXYA 3B85A 4MW6A 4MCAA 3RD5A 1ANKA 1U1DA 3I4LA 5CXSA 5KQPA 2J0UA 4GDMA 1FJGB 1O7JA 2VZ0A 1JSXA 3A4YA 4BAZA 2PEYA 4Z7JA 4WLUA 3MFYA 3EAGA 2D1RA 3F7OA 3QXSA 3UG6A 3JQEA 1YV9A 4RXTA 2OB1A 1Q1AA 3DFIA 3K0FB 4LUCA 1QHHA 5GP1A 2NO6A 1CUGA 3DH0A 1V35A 3GP3A 4GMXA 2Z83A 3RTBA 3VPHA 3EH1A 1B1CA 2KMLA 1E20A 2VDNB 2I34A 1F17A 4PNHA 2F8SA 1EA5A 3A70A 4HB3A 1XAGA 4O4JB 4IEIA 2J9YB 4F91B 3ADCA 3OE5A 3WFZA 2BUAA 3OVMA 4X8OA 4ZQBA 2X9LA 3BQNB 3WIBA 5A4JA 6PFKA 2G06A 4RWZA 4GSKA 1CEYA 2OC9A 1WW3A 1Z6PA 1V1MB 4DCGA 2RAUA 1YDEA 2X8WA 3B60A 4EA6A 2FFJA 1KSJA 2VZEA 5FTLA 2UU9B 3T12A 1KBOA 2XH8A 2FR1A 4PYNA 3ZWBA 1RSZA 1CUUA 2M6KA 1IBMB 2ZREA 1UBSB 4CLDA 4B6GA 1YQQA 2AFHB 3G8YA 5LQAA 3NYWA 1XRPA 1GO2A 4EHNA 2H3HA 4TS4A 2RCNA 2Z09A 4KQFA 2B8WA 3VV2A 5JZSA 1A3CA 3PPWA 4FN5A 1YKSA 4MH0R 1S2OA 1NT2A 3UUGA 2QRVA 3HI6A 3AETA 4PRLA 2WDPA 4PZYA 5F3RA 2VQEB 3WL6A 1G20A 3F96A 1O6FA 1JSZA 4IDBA 4CXMA 5CBPB 3C2QA 2HJWA 5L3ZA 2VH1A 2AS0A 2FWRA 2YXPX 1NHGA 5CX1B 2F3UA 3EA5A 2EBHX 3PTZA 4RVNA 3WE7A 4F2WA 3TN7A 3RYHB 4FWTA 3ZWOA 4CDNA 1K9VF 1WKBA 5GAJA 3CW9A 1M2KA 2OO5C 4OJMX 2RGWA 2QOEA 4GOOD 5GZ3A 2XNDD 2W6JD 4Y3UA 2P2GA 3VAZA 4EO7A 1YJAA 5I7AA 1PIWA 4ZI5A 2HJSA 2B1IA 2BLNA 2FB9A 2OBYA 3O92A 2B2CA 3VH3A 3G0DA 2A7QA 1A5BB 3JWJA 3MPOA 3AVTA 5A6SA 3NU1A 5EOVA 1JWLA 1WAMA 4IJWA 4XD2A 4LY0A 4X20A 2OAEA 3OEEA 4Q82A 2FR8A 2PT5A 5A02A 5KNCA 2VHYA 2UZ4A 1XPJA 2ZJ0A 3UNXA 3IIIA 3K8QA 1XKTA 4FR5A 4JOCA 3U39A 2C97A 4DTCA 1P2FA 1EFCA 2NW6A 4P33A 3B3FA 1HNXB 1W4ZA 1MF7A 4J90A 1V7QA 3AXSA 4IFBA 5DSTA 1XNHA 3PJFA 3D54D 3PQEA 5AVRA 2JI4A 4G86A 1YR7A 2QYHA 1RYHA 1BKSB 1U0OC 2B35A 1IUNA 1RT9A 2EU8A 2WSSD 3PC8C 1E6MA 4V0KA 4K9NA 4Y2SA 3NTUA 4YT4A 1F2DA 3LLVA 2MJLA 3E0QA 2EFJA 2QTHA 2IV7A 3UJBA 4Q01A 4R98A 2ZR7A 5KOJB 1DUIA 4XM2A 4HUTA 2GO1A 1F6BA 2QYTA 3CS3A 3EK2A 3CX4A 3X44A 3A05A 4C6SA 4ZMSA 5KSOA 2PUEA 2JHCA 2NTJA 4CDMA 4C2UA 1Y8CA 4OB8A 4NCIA 3U0VA 5JISA 1VL1A 3IJEB 3U6BA 3NT2A 3OPYI 4LF7B 3R6WA 3RUFA 3EXEA 1U0BB 1FNCA 4MV1A 1F0PA 4WKGA 3K9HA 1RR6A 3QQ5A 5GV8A 4QPNA 1WVGA 3TJMA 1DJQA 4UNRA 2QRGA 3DCJA 4AZ3B 2X9NA 2KE5A 4HAWA 4CKEA 2B36A 4IJ5A 4NCAA 2YRFA 5KTSA 2J4FA 3IBSA 3V7WA 3VGJA 1DIBA 3F97A 5HTKA 4XASA 4R3WA 3VPCA 5DM4A 4QGSA 3CEPB 3E18A 4B75A 5KDOA 3EQZA 4LJLA 3HP1A 1I7PA 4EPXA 1T0IA 2RHRA 4MGZR 2AFVA 2C99A 3KUDA 3F2IA 2NU7A 4MQEB 4JJ4A 1RBQA 2OWDA 4QO8A 1JG1A 1GDDA 2FEXA 3FPKA 3RS5A 4WUVA 1VI2A 2FPPB 5JARA 4UHHA 4YV1A 5BUQA 3KBBA 5K3OA 2XZLA 4DA9A 1E2NA 4WRRA 2HMVA 4PRZA 2PAFA 3GC6A 3JZIA 4DLBA 4X85A 4KK4A 4G5QA 1XGKA 2BF7A 1X80A 2HDWA 4F85A 4O4IB 1U3WA 2FSVC 3B48A 3Q6NA 1ZMBA 2I71A 3A4NA 5IS2A 1X1TA 2Q9AA 1MO3A 1DXOA 1J5XA 1T5BA 3OQJA 4AD8A 1H3FA 5AW4A 2JS7A 3C3JA 3HU5A 4YCSA 1KJIA 2PZEA 2PSEA 4I55A 4F4CA 1VJ5A 1WULS 3V2HA 3G8BA 1PJBA 1X1DA 2IEAA 3FOWA 2PU7A 3QVWA 5SYMA 3STXA 2F62A 4EFMA 5DO9A 4DBLE 4EARA 2FRDA 2V03A 1YB5A 5JJIA 2WAOA 1CZHA 2YJNA 2DYKA 5CT9A 1F6DA 4YJ3A 1AB6A 1C0LA 4US0R 2Z0MA 2JIOA 2XBLA 2FP4A 3K0CA 3OWHA 2V6MA 3R5XA 4HH4A 4G0QA 4U5XA 1L8AA 1YR6A 4ZANA 5THQA 2QL5A 4Z6KA 2WB4A 4IJVA 1JS1X 5JATA 4D9FA 4JZKA 5BPFA 1YS6A 2VJCA 2AWNA 4UFPA 2FN3A 4Y2XA 3LYUA 2XT0A 4B7XA 1ZUIA 1N6RA 4KRYA 4QNMA 2OV2A 4KPYA 1BXGA 1ENOA 3AI7A 2FE4A 1C0IA 1QYRA 4CGZA 1A2BA 2E48A 2QUJA 3DFZA 3HB7A 2NUAA 4NZOA 4CMBA 3BREA 2QUZA 3E4CA 5DWQA 3R3ZA 2BGUA 3KSAC 2IV2X 1RKXA 2NQTA 2QRQA 4ES6A 4FYVA 2GRJA 4OLFA 1VBKA 2XWJI 3DZKA 2HFJA 4M89A 1RHJA 1EFAA 1M72A 2J5BA 5DFAA 1MO2A 3ZDAA 2AT1A 4DC9A 1XWFA 4WPGA 2BTEA 3BF7A 2JGJA 2JHPA 4RCZA 4DQ0A 3A2KA 4CF5A 2PGLA 4YBZA 4BLUA 4AFNA 3Q3JB 3RIMA 4E2XA 2ERYA 4O3MA 3QFSA 5FBLB 4ITRC 3HNOA 2PX5A 1Y42X 3KYJB 3MG9A 4HMOA 3PFGA 2R3SA 2GCPA 1IEWA 1T2CA 1O57A 3GW8A 4X5OA 3K2IA 4KXUA 2FQQA 3ON5A 3IHTA 1DC4A 2V7VA 4YGYA 3WMXA 3NHPA 5AVSA 1GITA 4NYMQ 4HVTA 1X0VA 2QDXA 4BBJA 2UZ1A 2CVPA 3LOUA 1BN6A 2J3DA 5HQTA 3UAXA 3TTUA 3WGMA 1J56A 1NTOA 4RD4A 4UDNA 2XLBA 2IF2A 2Q9CA 2FH5B 1UBKS 3VU9A 4PIPA 2J0SA 3ZQUA 4CL0A 1TK2A 1YFZA 4GPAA 4Z9AA 3JSXA 3Q9LA 4IIJA 1QLJA 1ZHHA 2YIVX 4OGGA 1GAWA 1XRRA 2ZIZA 3ZCRA 5FBHA 5L53A 3KJHA 3S2EA 2H06A 5ALRA 5E7MA 2D62A 1ZJ4A 2OGZA 4FDUA 4NKRA 2YVLA 3G85A 3L0SA 4FP9A 1XCPA 1NBOA 2CVOA 2VT3A 2XOEA 3KDAA 2CWWA 5LM3A 2YQ4A 4MDYA 4EEKA 4AVYA 3FMVA 4K1LA 4RPKA 1A04A 2WIKA 2R6GA 3OA2A 4WZ6A 4KGXA 3K1AB 1Z6XA 3MYRA 5BWBA 3NIFB 3N28A 1LI5A 4D6XA 2QWXA 2QYOA 3KG2A 2AHOA 5FL7A 1EM8A 5I51A 5BT9A 3HV0A 3RASA 4CKCB 3G7NA 1R16A 1I4DD 1FJHA 1S3IA 1ZMOA 3AYZB 4EEXA 6NULA 1AMUA 1E2HA 2O2DA 4P5DA 4DN6A 1ZOIA 1TLTA 4C7OA 4NZNA 4G9BA 1YS9A 1Z28A 2PMFA 4LZLA 5AWFC 4AK9A 2HPHA 1F9EA 2HF7A 1MO4A 1I0LA 5AKHA 2ZS8A 4IGKA 4ID3A 2W6CX 3F4LA 3OE7D 4CCAA 4GR5A 4Q3OA 2QQFA 3ZS9A 1COWD 2H11A 3SHTA 4DHEA 3UICA 4BTLA 5AJUA 3B7PA 1X0XA 5AIBA 5CYFA 2G0AA 4NBTA 2X86A 1Q0HA 2D5LA 1FPQA 2HA4A 2Z1DA 1M3SA 2DC1A 2FHSA 2PJZA 3DR5A 3QFTA 3N2IA 3K20A 4BZZA 1X8XA 1W35A 4J1TC 3F67A 1XU9A 2YJ4A 3SM9A 3Q3HA 3CNQS 4F3TA 3OU2A 2J3QA 1TI7A 1A9RA 2EDCA 3KZKA 4KI7A 3BMXA 3BQ9A 4PO3X 4AWBA 3KSBC 3INNA 1E3QA 3PQDA 1R8YA 2O59A 1T1IA 4GXTA 4PAWA 5C37A 3BTUA 4D2IA 1MG0A 4G5HA 1I6KA 5DHTA 2X5XA 3HY6A 2FK7A 1PQUA 3A26A 3CGGA 5EHXA 1P2VA 4FKMA 3IEKA 4DPLA 1KQPA 1IJKA 4ZEOA 1S4MA 4KLZA 3QWFA 1DMRA 2BHLA 3HCNA 4CEJA 3TMKA 5IUJC 5AQ1A 1JJBA 2LKCA 1RQNA 1GPLA 1I2DA 5ADWA 4BMYA 5DYGA 4P36A 3BEDA 3KYBA 1KYZA 4CUJA 3DKRA 1GQFA 4IDEA 4REMA 2HX1A 3UXHA 5LZ9A 3AJEA 4A2WA 2BFFB 1F7VA 4RA9A 1QCCA 1JTFA 1Y5NA 3DPIA 4G4SP 4PNPA 1YAJA 3B6ZA 2VPYA 2QD5A 2XYQA 4P54A 3WAGA 4AG5A 1OI4A 2Y68A 3HUEA 3R44A 5FPYA 4IH9A 5AW5A 3ZTTA 2FLKA 2QUHA 1T3LA 1U0JA 3CY6A 4MUGA 2IXFA 5IF3A 1WABA 2X0JA 3WZ2A 1VA5A 4Z1MA 3K32A 1J42A 2YWRA 4AKHA 1QYIA 1T9GR 4O2AA 3BXGA 1H69A 4Q12A 1PNRA 4ZYWA 4KJZA 1KTIA 4REQB 1NJSA 1UBTS 5EP1A 1JR6A 1N0VC 4B7AA 3NHMA 4AKTA 5FPPA 3UHFA 3T5PA 3PK0A 2JAXA 4TMTA 1CS0A 3NHAA 3KZ1E 1VG0B 2E82A 3JQ8B 3V2IA 1T2EA 1J70A 1SQ6A 3WLIA 1DDIA 4US1R 3X2EA 2MIIA 4W5QA 3EEYA 2PE5A 3HV2A 3G7UA 3MOGA 2OOSA 3U48A 3H8JA 5F7ZA 2XWBF 1O03A 1QO0A 4YPVA 5C4MA 1DDOA 4MZXA 5BW4A 3GRYA 2B94A 2J7PA 3LT5A 3WLAA 4QJ3A 1Z12A 3CLSC 1GZSA 5AXDA 1MB4A 2QQEA 1YZFA 1VECA 4DDTA 4YRKA 4PN3A 3OHPA 1QIFA 3PC7A 5G3YA 1FSZA 3P45A 3Q3EA 1V8FA 2M6RA 2X6RA 3HB1A 1WP9A 1UJ5A 4M0UA 1MXHA 2CUNA 5IXSA 4N65A 1Z08A 4L0QA 1GWNA 1A95A 1PTJC 3RI3A 1KP2A 4XXHA 5FIUA 1KWKA 3UT5A 1OPRA 2XSZD 4G36A 3AHCA 5K20A 1JHQA 3VR4A 1DBVO 1IRXA 1MFZA 4X61A 3ET4A 4YP7A 1JIVA 1NQAO 4NY1A 1U2DC 3LQKA 3UJDA 5T64A 3COWA 2VHQA 4WACA 3ENZA 4Z3DA 3ZWXA 1KI2A 2FR0A 3ODGA 2GXAA 4D97A 2I2DA 5HP4A 2OECA 3F3SA 2GJKA 4R4JA 3IPLA 5EXXA 1DOZA 3W2TA 2ID9A 4C07A 2WMDA 3COVA 4D3XA 1IUKA 1G6Q1 1KH3A 2A5YB 2XIJA 1JU4A 4LDAA 4OMCA 4ZXPA 3A28A 3IAS1 2VUTA 3BM5A 3V1MA 2E5WA 1S1CA 1GY8A 2R96A 3HB5X 3GB9A 4RESA 2OHXA 4B3XA 5IJ0A 4LQDA 3H19A 2PNJA 3IAS6 2DWPA 2PO7A 2FEMA 4YCLA 2C00A 5REQA 2W5UA 3PHGA 3DSRA 3QOFA 5KPJA 3ONDA 4G1BA 4RKEA 2PVCA 3AEUA 4RKFA 3P94A 4Q34A 3FH0A 4JP1A 4IIBA 4DRZA 1G21B 1IXKA 4YPOA 5EHGA 4BX3A 4MDEA 1NNSA 4WCFC 5BWLA 5AXBA 1EFTA 4EJ0A 2H9IA 2FA9A 4LRWA 3GJ8A 5L7TA 3JATB 4RUKA 2P3QA 3VO9A 4ARCA 1YDMA 1C9MA 3THOA 1VSQA 4MIYA 4XGQA 5C8VA 5SY4A 4YCCA 3BFJA 3H4IA 1N9GA 2EFHB 3BHJA 4QFBA 4ZAZA 4L4YA 4CMHA 1GTJ1 2OC4A 2EF0A 4YJFB 3ZJVA 1PJ3A 3NP7A 4GZLA 2BD0A 2E4XA 5DHPA 2D54A 3B9RA 4XJXA 3K70B 1JLSA 4OV6B 4TRJA 1CJVC 1JT2A 3P9CA 3PEVA 3OOEA 2Z6AA 1G3RA 1ZUD1 3EF3A 3JQGB 4EMTA 1T24A 3FNHA 1ZEMA 2XQGA 1E79D 5CK4A 3V7FA 1Z4MA 1KNXA 3COZA 2ABWA 1E5LA 4ZOLF 1UOQA 1G55A 3GAFA 5LU9A 5DBHX 2QN9A 3IAAA 3LLCA 3SYNA 1PJSA 3GV0A 2EFYA 4RJTA 2DY0A 2E87A 2PUVA 3B2NA 3HPRA 1NVAA 4ZARA 5BV1A 1TF7A 3CFYA 4J0GA 3V9AA 4FNMA 3AB8A 1E3TA 4M37A 4PYQA 5AKIA 1OFIA 5DYTA 1QH9A 1HTBA 4ZCLA 3TE7A 5B2EA 4DJJA 3E8MA 1TMOA 1SHJA 5B6PA 1I1QB 1P8JA 2DEUA 5LD2C 4RSHA 1MC5A 5I4CA 5JCJD 2VXYA 2D7JA 1QGOA 4HTFB 4B6OA 4EUFA 2J5QA 1QH1B 3LHSA 4JASB 5K5EA 3UBMA 1G9TA 1SIBE 1AF7A 4E7OA 3T3HA 4J0DA 4TXLA 3EQ8A 1ODJA 3BRWA 9MHTA 4L51A 1ZEJA 1F3LA 4LECA 2ZJFA 4MV9A 1NLUA 1SD1A 4P86A 3P9RA 2CVFA 3BZBA 3CLRC 3LZDA 3A9WA 2G83A 4JUFA 4RZQA 5FQOA 5AFSA 5IN5A 4QJ5A 2RIPA 3GEDA 1X8JA 1SQGA 2IWRA 5CPFA 3MTIA 3RFFA 1PZFA 2IXTA 4S1WA 3EQ9A 5A5FA 5LQSA 1AM4D 5F9FA 5I45A 1Y8QB 2YNMD 4CG0A 3HY3A 1Z5OA 5CAEB 3WJ2A 3W5BA 4DV7B 3CVUA 3R7WA 3FPFA 1QIIA 1XRJA 1IG0A 2WUVA 4XFJA 3AR4A 4XRRA 1DJOA 2HU2A 3CRVA 3PUYA 3BA1A 4DJAA 4RQBA 1MOZA 4L72A 4MV8A 3DO5A 3WK9A 5AW0A 1I4TD 4BDTA 3TSYA 1X7XB 3H4MA 1ZCFA 1J0BA 4WOCA 3NHBA 2IEGA 4RORA 1F8GA 1GDTA 1B0PA 3E82A 3SHVA 3CUKA 5DF1A 5CT6A 3M8KA 3GEGA 1U2TA 3OEYA 2C4NA 2CFIA 3DLAA 3G7SA 5ENVA 4EB8A 2AR9A 2GN4A 621PA 1OHHD 3CKLA 4IZ6A 1DAFA 3L01A 4RLQA 2XXAA 1MJGA 1UK8A 3HDVA 1KEVA 1Z9BA 3AR3A 2O4CA 1SUSA 2R47A 1KVRA 4J4BA 5NLLA 3KL2A 1Y9EA 4DMHA 3W6ZA 2WPDA 2HK6A 3UO8B 1YIOA 3LZCA 3T54A 1G6HA 4N6OA 1UM9A 3OY7A 5D3KA 1RXIA 4V38A 5EXEA 4DPKA 4WXHA 3WK5A 4G0OA 4F6RB 1WHSB 2QNBA 5JH7F 2NYUA 4Z0TA 1E62A 4QG3A 1PDWA 1W4RA 2WYVA 3AGQA 4O4HF 2X22A 4JKOA 2C8LA 4XJTA 1FDIA 1KYXA 3H42B 4L8VA 3MS4A 3TDKA 1NIJA 4CU2A 1CUCA 3MUOA 4PO1A 4BB0A 3UB2A 2AR7A 2CC2A 2XTNA 1H2XA 2GBIA 1DAGA 2WR8A 4NICA 3QA9A 3RUIA 4NCXA 1OXBB 2JCVA 5CP8A 5DYWA 3O8DA 4ZOBA 1YJ8A 1ISPA 1M2NA 4IDNA 4UU7A 3WL7A 4CG3A 3NRJA 2BZSA 3E1GA 1W36B 5HCNA 1N5OX 4H7IA 2B61A 1HZJA 3A6DA 3CRW1 4ZI7F 1ULBA 3CRMA 2AGVA 2VAXA 1M2GA 2D2FA 2R8EA 3L9WA 4MITA 3HADA 4RHYA 5ALNA 1THMA 1VL2A 1PGOA 1S3FA 2IE8A 3UEOA 5FAKA 1POWA 4TZ6A 4D6PA 4ALMA 2I67A 3NG1A 3RIHA 3D3WB 5BMVB 3FDJA 1CJCA 1L4NA 1XX6A 3FDFA 4PSKA 5G0WA 3MHTA 2R86A 3LPLA 3PVSA 4HT3B 2PXAA 4Q16A 4ZT4A 3GJ0A 4N39A 3O4IA 5BSFA 1W9HA 3ROXA 1AGXA 4UTVA 2GZSA 4E51A 1JI3A 1TTPB 4UVDA 3EPLA 3HJUA 4EIWA 1MGOA 4NVRA 1N5RA 1TNDA 3NCHA 1GKLA 4TWIA 2RGNA 5TMEA 3KKPA 3OE1A 5JADA 2VKQA 3P2YA 1NQUA 1XKQA 3CUWA 4GI2A 4QVGA 3C41J 1O54A 1Y5LA 3SSNA 1E2EA 3F7NA 5IPFA 5D51S 1ZH8A 5KNDD 2CXHA 2ILVA 3H11B 4ZQIA 3BWDD 4DYVA 3CJRA 4RJKA 2BGWA 4RTNA 4BQNA 1U0FA 1PR9A 3ETLA 4KO4S 2R25B 4IX1A 1QZXA 3O8RA 3HJTA 1Y6GA 4NCBA 1VRWA 2J87A 2YYSA 3MM4A 4N8DA 2HQ1A 3JQBA 1M9NA 4XYEA 5H16A 1EX6A 4M1KA 3UAYA 1FZQA 3LQ2A 4W5NA 2CJWB 3IVMA 3PHBE 2ZSDA 4MVJH 1YR3A 2P6NA 3QMWA 2Z08A 3KFXA 1OPXA 2HM7A 2P6PA 4Z8YA 4H9GA 4B3SB 2WYIA 5C7LO 4JWKA 2JD0A 5A3VA 2OR3A 7ADHA 3IDOA 5KTTA 3H5LA 3NWBA 4FXPA 3W5DA 1ZUHA 1H8HA 1PDVA 4DEVA 3GVPA 3TMAA 2MYTA 2XDQA 1UKZA 2CJXA 5JLJA 1C9YA 4FX5A 1RADA 1ONOA 4IXMA 3RVOA 2XF2A 3NW9A 1NBME 5E4FA 3TL6A 4OHCA 3PD1A 4ARVA 3LZ6A 3OFKA 1KZHA 4A6PA 1FMCA 1J2YA 1RMQA 1V5EA 2HL6A 5FKJA 3HCWA 3VAYA 4DLKA 1DEKA 5BN5A 1HQCA 5AVYA 4FE7A 1FX1A 2HSWA 2M32A 3U3DA 4ZVSA 2ZRGA 2PH5A 2WZQA 2E0IA 4CQMB 4EAQA 4G9GA 3M5WA 4U6NA 4BQQA 4RENA 4HUJA 1VJ1A 1JJVA 1H1LA 1T9GS 2REOA 4WHMA 4YQEA 1MT3A 3UMSA 5IZCC 1Z39A 4TYNA 1DC3A 2WYHA 4UULA 3DT9A 5ISMA 1O0CA 1VLMA 1W4CA 4C5BA 3KALA 2E4VA 4KH0A 3KV1A 4IM7A 4ENRA 4HDKA 2VN8A 4EB3A 1IUPA 3BZUA 4LG1A 3CB2A 4TWRA 1NW4A 1TJ5A 4CMGA 4DBLC 4DSOA 3LUAA 2P9TA 2ZUTA 2YOHA 5TS3A 1B4DA 3KYDA 5IZ4A 5I9TA 3R9IA 5IRCD 5JRZA 4FWBA 3W3ZB 3BFVA 4B5KA 3NAQA 1SZDA 1T91A 1J2RA 3OKAA 1BE0A 3UJ6A 4P32A 3M6LA 1MPTA 2QPLA 4B6QA 3U4DA 2Q3MA 1NUHA 2LTAA 1VMEA 3OZWA 3NO4A 1LBEA 4D9EA 3F74A 2F67A 3O21A 5JNUA 1R4NB 3V4VB 4BO4A 1RI5A 2XHZA 4JQSA 1VYHA 4C4ZA 2J9ZB 4EUEA 3E53A 1IE3A 1ZMTA 2BGTA 2XWSA 1GQRA 1QHGA 4R8LA 5D3MB 1XN4A 3ADKA 5HMLA 3WHLA 2AYZA 4I08A 5T3YA 4BNDA 3A10A 1DOAA 3A6PC 1LKZA 4CLEA 3EPHA 1GNQA 3HZOA 3UCXA 3OJEA 3Q8MA 1GPDG 3K5PA 4MUBA 1W93A 2HQSA 4FBLA 1U90A 2AQHA 1AKRA 1P9NA 1Z5NA 1H9BA 2F7SA 1H0KA 3WLMA 3PYMA 4M38A 2NOAA 4TT3A 1AHNA 3F5SA 3H18A 4F1KA 1AA9A 3SLGA 5CUQA 4B3GA 1HE3A 1V16B 4NMXB 1ZN2A 2CNWD 2X58A 3DFMA 3PHHA 2UAGA 4L9RA 4MS4A 3ZWAA 3B9PA 2GCIA 3WJ7A 4DUYB 2IEYA 3HXTA 1ZZGA 5DTIA 4CVNA 2ESRA 1AXRA 5HF8A 3PC4A 4R1TA 4TT8A 1VXRA 4R3UC 2XUDA 3PL5A 5B37A 1YGYA 2BBOA 3REQB 1JGTA 1P0QA 2AI2A 2CNLA 4TKMA 5IC5A 4MUYA 4LA4A 1T26A 3GDFA 3SX4A 5CA0F 5DGHA 1K9SA 4KZPA 4BBZA 2H7CA 4F7WA 1CE8A 1A7AA 3IAFA 4P80A 3T4EA 1RLMA 1SVMA 1XJCA 1F4PA 2W7TA 4TZ0A 1EIWA 4GHWA 1HT1E 2YRXA 1JDJA 4HBGA 4RVHA 3D0QA 5G1OA 2O3RA 1TX4B 3BG5A 3NC4A 4TVOA 4WN3A 5LDHA 1K3FA 2B78A 1GFWA 2YZGA 3EBOA 1TGYA 4M36A 1V11B 4ZQHA 1GU0A 3TM4A 4XA8A 1VXOA 2J32A 1FXWA 4D3FA 1MABA 3R09A 4RJJA 3WOVA 1LNZA 4HDRB 4B2IA 5B7NA 3SZGA 4KPUB 3TUIC 1VE7A 4Q24A 3AR5A 1UBRS 4LXQA 3T4XA 3THYA 1IBLB 2F4NA 1MT0A 3UZUA 1H2WA 5FPSA 4J6FA 3FGZA 4CL8A 2PZKA 1WM1A 3QVMA 5EQJB 3QKSB 4MMZB 3RRYA 2A0UA 2PGIA 5E8RA 4YJHA 4AS2A 1ORVA 1JG7A 1LDMA 4XGIA 4EELA 1M2WA 4WCVA 5JXHA 4OI0A 2VYND 3LBAA 5E7QA 2F1HA 1GAXA 1JHUA 1WQ3A 3OETA 3JAWA 5ICEA 1Q7BA 1AHPA 1YOBA 4HDNB 4JJ7A 3C8HA 1Z6TA 5F76A 1GPNA 1HC7A 2QZZA 3K0SA 3N2EA 4A8HA 4JJFA 4R2JA 4X63A 2I8AA 1JL3A 2PL3A 3GQBA 4LXXA 3WDLA 1KFEB 1MAAA 1JXQA 3HPQA 1YFJA 5CDYA 4GYJA 1ONBA 2QK4A 3CR3C 2ZYGA 4LZOA 4DV6B 5FI3A 3JVVA 3F98A 2EYQA 1R0KA 2E4UA 2PX0A 3T0FA 5BVGA 5C4IA 2HF2A 4G5GA 1M73E 4TRNA 5FR1A 1H94A 1IQRA 2Q6VA 2VVTA 4CMIA 3EEBA 2W6JA 2CVHA 1JAXA 4MRMA 2ZPUA 4XEHA 3SJCA 4B0PA 4QBGB 1D9XA 4CV1A 3LQ1A 2Y9MB 1LF0A 3KQPA 5EG5A 1INLA 5EMJA 1V2HE 2OVBA 1PK9A 4DIKA 1VMDA 4E3ZA 4XLLA 3WBKA 2BP7A 3IELA 4DXHA 3UV6A 5A9SA 5EE0A 2A33A 4WNAB 2K2WA 5KYYB 1DWUA 4FFBA 4E15A 2GYYA 4RX1A 5BWMA 1XZHA 5D84A 1XFDA 3GCDA 3NDRA 2H5EA 4WESB 2KB0A 4L5JA 2NGRA 3ZVRA 2VF5X 1C8BA 2P77A 3A4VA 1TT5A 4JLJA 4GOKA 5HQ3A 1RWQA 3ND5A 2JJYA 4HBZA 1IVYA 3UENA 2I2AA 4B4DA 2HPZA 5ADHA 3LO5A 4G0UA 1LDNA 2WWXA 3ZDBA 4B47A 1ZRMA 2HMTA 3DOFA 2X5NA 2P2CA 4MVJF 3TEFA 4DV0B 3VMMA 1IVSA 1PDOA 4I8DA 1L9KA 4BO8A 2BELA 4L9WA 1SBCA 1ZINA 3KWMA 1ORHA 5AW3A 5H83A 3BVPA 1PK8A 2Z6QA 1GG9A 1W1WA 4ENPA 4HQNA 2ZVJA 1JFFA 2ET6A 3BXPA 1Z2OX 1QFJA 1NOJA 2BR5A 1NHWA 2W2PA 1Z6QA 1NW9B 4NPCA 4CLRA 2LXNA 1R0WA 1TOAA 3CIFA 1F51E 2SKCA 4MLPA 1J6UA 1PL7A 4NAHA 1D2HA 1BX3A 3QHQA 4H1TA 3K0KA 5JWRA 1MEOA 5CDUA 3TCNA 1GCOA 3CPJB 3FBGA 1R4MB 2XCUA 2DPXA 4MR7B 4PBTA 3VX3A 3W05A 5B3JC 1A9XA 3MWEA 3ZW9A 1FXSA 4O29A 2YHSA 1WCIB 4A1OA 1ZVQA 4YMIA 2UYOA 3ISVA 4NF2A 1DADA 1X92A 3D6NB 3G9TA 2B1JA 4P4UA 4ENQA 1V8PA 2Z2JA 5FF9A 5JALA 1O6CA 3DOUA 4LFCB 1N9KA 3G68A 3L05A 1G60A 3B1WA 5AVQA 3OZEA 1C7RA 1E9CA 3HBAA 1PYDA 1B43A 3EQ2A 2W48A 2QUIA 3W4KA 1AZTA 2O6HA 2PX8A 1G4AE 4MQFB 3RYIB 3GJ7A 3HCPA 3VZSA 1RZ3A 1A8HA 1OUMA 3P8ZA 3U13A 3ZGXA 4CRWB 3N07A 4FOSA 1XEXA 4MVJI 3OO0A 1HNNA 5F2KA 2ZJ8A 3LHDA 4MA0A 4EPWA 4W5JA 3P2EA 5SICE 1WXFA 4EA8A 2IBSA 2EHJA 1R4ZA 1BDHA 3ZOZA 3CR8A 4IX9A 2E18A 4GFDA 1EFUA 2XB8A 2HHJA 1ZCAA 1OC2A 1NDQA 1R0SA 3WNBA 4RW0A 3PNSA 3SCZA 4RL4A 4AICA 5I5GA 2GPSA 2I2XB 5I7HA 3C16C 3PQ5A 5JFOA 5KTRA 1ARZA 2C7VA 3FNFA 4BATA 4BEVA 4YRNA 4KNYA 2WZBA 1YSCA 2JHGA 1NM5C 2HDOA 1ZX1A 3OQPA 4EG0A 4F93B 4BNMA 5EJ5A 4WEQA 3M6MD 1HE5A 1GIAA 1GFSA 4J0HA 4YUWA 1JKJA 7REQA 1KS9A 1CRZA 1LK7A 1TTQB 3DBLA 3N0RA 4PEVA 2VDMB 1PR4A 1YQGA 1T9KA 3NUGA 3KQTA 4LSWA 3I9JA 2J3EA 3RSHA 4ZYYA 1XQ1A 4IMRA 5EUMA 1JSLA 2VHUA 4YUZA 4Z2AA 1XLTA 1LWOA 1I5OA 2IYSA 2GBFA 2Z30A 4FGUA 4WZAE 3SJAA 3LX6A 3MCTA 4EUHA 1G0NA 1KI1A 3KTAB 4F2GA 2Z5VA 1Z8HA 1NP3A 3L6UA 1Q77A 2RB5A 1SO8A 1K6IA 2VSYA 3NBMA 5AK6A 3KKQA 4P7FA 5IANA 3RV3A 5IABA 3QM1A 2QJFA 4RULA 3K9FC 1AKQA 3NNDA 1FTQA 1KIFA 4OHZA 2CW5A 2XMDA 4LIPD 2PPVA 3PXBA 3TTVA 3QLVA 3J7TA 2MOKA 3L77A 1NC1A 3GFSA 3WLKX 1U9JA 1G1MA 2UZAA 3A06A 2WT9A 3HBFA 2DR3A 1R10A 2J07A 3CUVA 3JQFC 3LVFO 3QU5A 1C1YA 1SC3A 3LQYA 1AA6A 3GLIA 1MW8X 2BFCB 2K87A 2AMJA 4O4LB 3GA7A 4QYXA 2CL6X 4JDPA 1MIOA 3GARA 1FX0A 1NUQA 4IZIA 1RQ2A 1EWRA 4PS1A 4RXMA 1XA3A 4B7ZA 5JXGA 2AOTA 3BE5A 1DBIA 1QS0A 3GLKA 2CXXA 3TQIA 2NADA 3AF3A 4Q3AA 5BPHA 1I3MA 1IN6A 1G18A 3IA2A 1Z3CA 2AZTA 2X5JO 3FTPA 2XUFA 3BXOA 4CQMD 3OZ7A 4BGUA 1QVWA 3GBPA 4KVAA 1DQRA 5FHRA 3KDSE 4MVJM 2A94A 2CHVA 3AUKA 4JLWA 1CPYA 1YULA 4C03A 4FSDA 1EHYA 2X42A 4L5IA 3UAGA 4XRGA 1BROA 4F3CA 3BKXA 1WXGA 2R8RA 3IALA 4K3VA 4MICA 2C0QA 5COQA 5ERGB 1TPZA 4WXMA 1GD1O 1IY1A 1FDTA 1D2GA 2AV6A 1AS2A 3TKLA 1BA3A 1Y9DA 2MYNA 1Z4JA 1Z5GA 2VCEA 3BZWA 3Q0EA 4G5YA 3FMIA 1X38A 1VSBA 1AXGA 2PS9A 1WG8A 4KPGA 5IP5A 5JPCA 1E4VA 3KM0A 4YCDA 3D3JA 2QW8A 2OLEA 4FS3A 3ZV7A 1ST3A 4NK5A 5GVRA 5ESWA 1E9BA 2DFKB 3PUIA 2C84A 3FPEA 3LVQE 5FTWA 4MJXA 4Q05A 2BMWA 3OE7A 1OLXA 4QTUB 1M7GA 1COWA 3VZBA 3UANA 2VSNA 1KMNA 3OIDA 3EVEA 5EZYA 3DAOA 3W5HA 4KAJA 4DBVO 2MHCA 5E6RA 2N1BA 5JNWA 4NZYA 2V7QD 3QLEA 4OSEA 4R01A 2D5CA 2R6AA 2G9NA 1C9NA 3TI9A 4S1OA 3D1VA 2COEA 3GVHA 4GWGA 3ZEAA 4AB1A 1U4SA 1VCHA 2XUGA 3P20A 3OU6A 4O4IF 1F8XA 4IQ4A 1C7JA 5JVDA 3ROFA 3O4GA 8ABPA 2ZYDA 3A2NA 1OR8A 1Z62A 3LUDA 1OFGA 1S7CA 4G85A 1PX2A 4UM7A 4QATA 1XTZA 1U3UA 2H4JA 1YVEI 3ENVA 3I0NA 5F3WB 1ZGCA 4XVQA 2NPIA 3EA4A 2NT4A 3OEHD 1ZVJA 3E23A 3DFUA 3EXHA 3G89A 4ZN6A 1UDBA 1MTZA 2NLOA 1Y8RB 1YJXA 3STWA 4YK7A 1X3LA 3AP3A 3KE9A 1P7ZA 3DTNA 4PO9A 1TIPA 2J5XA 3BWXA 4LY9A 4TV8B 2A1UB 3DTYA 3A04A 2Q2QA 1WU7A 4LJ9A 4O1HA 5LUAA 1BWQA 5BWNA 2OMKA 1KFJB 2Y27A 5AESA 4I50B 5BSRA 3FIUA 3WP0A 1IN8A 1QOZA 4YIKA 3S8YA 2GEBA 4KQXA 3UAZA 1O94C 1VKZA 4MRRA 1YA4A 2CKMA 4PZAA 5BRNA 1I6WA 1P1HA 3U2QA 1PEYA 3IERA 3K6KA 4ZALA 3RREA 5JAPA 3RADC 4LI3X 4ASUD 3OCXA 5E6UA 5JR3A 4MEJA 5JCXA 2HSDA 1ULHA 1X7ZA 4BX9A 3F6PA 4RDCA 2MSLA 1U0EA 3FDIA 1HO3A 2GPNA 4HAUA 4PVCA 1QVRA 2Z8YA 1Q7CA 2R62A 2G4LA 4FMCB 1EA7A 1FCJA 2DHCA 4F11A 4HWGA 3RSLA 1YB2A 4YJ2B 4Q3CA 1PYGA 1QWSA 1N2GA 1XZIA 1SXGA 2OHIA 3I61A 1O5TA 1N5DA 2IZ0A 1RBMA 2XE8A 2P40A 4PYLA 2E1RA 4EG7A 5IF9A 4LVUA 2NU8A 3AFNA 2FSFA 1TEHA 1MC1A 2O3SA 1V4VA 3SR3A 4HUQB 2CUZA 1OAOA 2IHVA 4P35A 3WHIA 4D3ZA 4DDUA 3AHDA 1ULSA 4ZCRA 5KYWB 2R1VA 3MOIA 4HDSB 3N05A 4XGRA 4V3CA 1BVRA 4AKGA 3QITA 1D1TA 3PE4A 1A4IA 4H3VA 1US8A 3C1TA 1ZBDA 3DBRA 2P90A 2R7LA 1G63A 4AMVA 2D06A 2RAPA 3ZHTA 4CLOB 1VL5A 1IZ9A 2O3UA 4NE2A 5ESRA 1NMYA 1RXEA