3LUPA

Crystal structure of fatty acid binding degv family protein sag1342 from streptococcus agalactiae
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
283
structure length
283
Chain Sequence
AMKLALITDTSAYLPEAIENHEDVYVLDIPIIIDGKTYIEGQNLTLDQYYDKLAASKELPKTSQPSLAELDDLLCQLEKEGYTHVLGLFIAAGISGFWQNIQFLIEEHPNLTIAFPDTKITSAPQGNLVRNALMCSREGMDFDVIVNKIQSQIEKIEGFIVVNDLNHLVKGGRLSNGSAIIGNLLSIKPVLHFNEEGKIVVYEKVRTEKKALKRLAEIVKEMTADGEYDIAIIHSRAQDKAEQLYNLLAKAGLKDDLEIVSFGGVIATHLGEGAVAFGITPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structure genomics, unknown function
molecule keywords DegV family protein
publication title Crystal structure of fatty acid binding DegV family protein SAG1342 from Streptococcus agalactiae
rcsb
source organism Streptococcus agalactiae
total genus 86
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02645 DegV Uncharacterised protein, DegV family COG1307
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1180.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein Tm841; Chain: A;domain 3 Hypothetical Protein Tm841; Chain: A;domain 3 3lupA02
3.40.50.10170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lupA01
1VPVA 3LUPA 3PL5A 4X9XA 1PZXA 3FYSA 3JR7A 3NYIA 2G7ZA 3FDJA 1MGPA 2DT8A
chains in the Genus database with same CATH superfamily
4LY9A 3CKLA 5F7ZA 2XUZA 4JITA 3ORFA 2X5XA 3M6UA 1EHCA 1NONA 3DPIA 3O90A 4G0YA 1JS1X 1YS9A 4YS6A 3HGQA 3UBTA 1RDFA 5JZMA 1JJIA 1TIKA 4W63A 1EVLA 3O2NA 1LW6E 2XWJI 2XDYA 1J22A 3C8UA 1ZIOA 3RFFA 3K6SB 4PAMA 1HNWB 1VBKA 1SJ9A 5DLQC 1XYGA 4FSHA 1SG6A 2J4CA 3H9JA 5DLPA 2O57A 2FU5C 3UK2A 2GRJA 1IM2A 4M8NE 3FPFA 5J1SB 3FOZA 2P0AA 4J2OA 1JSLA 2G0TA 4YHHB 2GESA 1I4TD 5JU6A 4A5SA 3CFYA 1DKUA 1T9HA 1V26A 1K6IA 3MPUA 3QKIA 4M1OA 4R71A 3UK6A 5KTTA 1WBDA 3KVOA 1KC3A 1NUAA 5EJAA 4K9SA 2F3SA 1RZVA 4IXDA 1BVYF 3DMTA 3RIMA 1N2HA 1TVKB 1IHPA 4FINA 3ICQB 4WH0A 3I9V1 4X44A 2BD0A 5B2EA 3KETA 4RA9B 5EOVA 3RVLA 5KSYA 5DM70 3WGMA 3G7UA 3FOEC 5KHLB 3VAZA 2QMHA 1XCOA 5CLIA 5AXCA 5EXTA 4QULA 1WETA 1Q1ZA 2VK8A 3GDHA 4TYQA 4EI8A 2YS6A 3H18A 3LUDA 1VPVA 2CXHA 3CRZA 4J6EA 3ZI0A 4B71A 5ES3A 2RGXA 3MPOA 2Q45A 1E1QD 3EZFA 4ALJA 3FVRA 1KIMA 3DVAA 4KPGA 4QODA 3L7AA 5M29A 5H3CA 4ZZ3A 1RMQA 1GRQA 1CDZA 3QEMA 5EE3A 2D2FA 1DWOA 4OQNA 3QKRA 4MVJI 3UWSA 4U0KA 1RTKA 4LZPA 5CLQA 3O8QB 4ZCLA 1XVIA 2I55A 5FUXA 4A8TA 3UXHA 3UC5A 1M0SA 1KYWA 2IGBA 3RK0A 1UJ5A 1XMVA 4E2WA 4EW3A 2L42A 3V32A 3ZXIA 3OX1A 3ZU3A 3JVVA 3W6PA 5BQPA 4EAAA 1JR2A 4G0QA 3THSA 3OQHA 5D5HA 3FWYA 4ITVA 1UWKA 4ETMA 4NBWA 3VKUA 4ZCRA 2ZBFA 2VAVA 4IF6A 1MX3A 2MHCA 5GQSA 1T6BY 3R6GA 1ZO8A 2FZEA 4BLTA 2PMKA 1F9AA 1G4UR 2YIVX 4G41A 1NIJA 1XDZA 2BEKA 1DNPA 1N9GB 4M4SA 3TOXA 4IJMA 4C21A 5KYUB 1AKQA 1XTTA 2PKQP 3IH5A 4RETA 4W7SA 1TYAE 3M1AA 2HPZA 2G9NA 2XB8A 4DLPA 4UUPA 4HWTA 3ELBA 1ZR2A 4ETNA 2CVFA 4F4JA 4C7VA 1B00A 2Z2JA 1W9HA 4RD4A 1GXSB 1P0QA 3BXZA 1IN1A 1E94E 4N0DA 1WTAA 2GLUA 5JCZA 4KRFA 2GO1A 2XWSA 5LP1A 5CLHA 4PLZA 2JFFA 1Z0KA 4ALMA 4POOA 2QRVA 1C29B 2ATCA 3BJZA 4IIFA 3SS7X 1OLSB 2NZYA 2XLCA 4LF8B 3PE4A 5JD6A 4NZ9A 4D6XA 4BBZA 5THXA 2JNWA 2XQGA 4IY1A 1I7PA 4E0BA 5JH7B 5JXGA 3TLMA 4XJSA 3G1UA 2BGNA 2I6QA 1WF6A 2AG5A 2ISQA 2JLCA 3AZPA 3EIQA 5CU7A 3DEJA 3DJFA 3NBXX 4IJQA 3IIIA 4QYMA 4BLQA 3N1UA 2A5LA 3RYHA 4L9AA 3EC7A 4ZRDA 5T57A 1PFKA 3T3MB 1TX4B 1UK6A 1RI3A 3Q7SA 2J3DA 4O33A 3ZYCA 4RENA 3K9CA 4TL7A 3BDAA 2B0CA 3F7NA 3HYLA 4AZVA 4LJKA 1XQ9A 1Y89A 3A1NA 4TUYB 4Z1OA 3KHKA 1QB7A 2B61A 1Y6JA 2R62A 3ANYB 4QKQA 4C29A 5KOHB 3KSDO 5T3UA 1W85B 1SO8A 2CUZA 2J9GA 2QTVA 3KB2A 3B85A 1GAQA 3DBVO 1ZU5A 1O6FA 3UUWA 2VPTA 4JBHA 2M1XA 3CG4A 5EJIA 2O07A 3HBNA 4RSGA 4WADA 5J4YA 3OESA 3IDFA 3O84A 2WIKA 3PXUA 3ILXA 1ZUIA 2D00A 3IUJA 3JSAA 3K2QA 5DNAA 3DE4X 5AT1A 4DSAA 4M87A 4E1BA 5KNDD 3WJ2A 5EWJB 2VDOB 1JFRA 1KP2A 4UUQA 3L0SA 4NSNA 2G9VA 4CCWA 1XQVA 1M0EA 3BH0A 4ZYZA 5DIZA 1GSHA 2O19A 3AL2A 3K5PA 2BT4A 5CIWA 4RORA 5ALVA 4FFPA 3DT6A 5JSQA 4D1YA 3CSUA 4GL4A 3LE8A 2BL4A 3G49A 2ZSDA 1ZSVA 1QYWA 2EZ4A 5CXSA 1ENYA 2HD4A 3QELA 1BFKA 2VF8A 5F5XA 1T1IA 5BN3B 2LBPA 4POAA 1NGSA 5EG5A 2DC1A 2IXAA 4M9CA 3M4XA 4N6OA 3V97A 1UEXC 2QOEA 3H3FA 3MF4A 2WAYA 1MRZA 1N5KA 5FOQA 2NZJA 2R6AA 1QAQA 4Y2YA 1QGED 3R3JA 3VPFA 4Q05A 1Z63A 5EVCA 4M1TA 5I8PA 2EBHX 3EXG1 2X86A 5DDIP 1T8PA 4QFCA 1ZJ4A 3DOEA 3LFTA 5AMXA 3AB7A 2JATA 9GPBA 1H8HD 2J08A 2J6IA 3L7KA 3QY0A 3VKVA 4BQOA 1MQ9A 1OA1A 2BEUA 2HU2A 4YCAA 4EX7A 5A3RA 4KE7A 3DO8A 4XM1A 2P9CA 2JIMA 2HPAA 1G20A 3I37X 1JI3A 2ODEA 4IEIA 4N5LA 3QVUA 3TCKA 1Z5WA 4M2LA 2AE1A 4N5MA 2XX3A 3MRXA 5D87A 3OQ1A 1Z2NX 1QYXA 2NZXA 3PLAE 1ISPA 5AI8A 3HVUA 3PQEA 2OV4A 5DLEA 2V5VA 1CR1A 1SC4A 1UPBA 1DQYA 2ZBDA 3EJWA 3EXFB 5G3YA 3OZXA 3SX4A 1UJNA 1YDGA 4DLXA 4EFLA 5LQUA 3LGSA 4QDOA 2ZI3A 2D5CA 4WKGA 1R6TA 1E2GA 1EB9A 1OX6A 1WLYA 1XNJA 2Z9CA 4PSKA 1JFTA 5FOSA 1MO6A 2GPWA 5LQMA 4EB0A 4P5EA 1S4QA 5J59A 1UXJA 4UFNA 5EHNA 3PDIA 4YAOA 4HN9A 2GZ3A 4UBKA 1W25A 2DKOA 2A9VA 1U6JA 2RJ3A 4RXUA 1TAUA 4PIPA 4PZCA 4CM4B 4B47A 5E1DA 4RDIA 2FZWA 3ZCSA 3DVLA 4OHWA 3T5AA 3D5TA 4FNAA 1PHRA 1MJ5A 1PNRA 3CR3C 4QGSA 4C07A 3T1YB 2X23A 2Q8QA 4D4KA 3GFOA 3U4QB 2EFHB 4MGZR 4AT1A 1E59A 5JI3E 2XOXA 4NBUA 3WHLA 1RXWA 4C7OB 2AKAB 3PNPA 1QUEA 3T06B 4YR9A 1B2LA 4WY5A 1UBGA 3RW9A 2RH8A 3BAZA 1Z2DA 3DMGA 3KKOA 2FPIA 1EI9A 1Z34A 3CX8A 3N76A 4R6WA 3KZXA 4M55A 4N47A 3A9RA 2WWWA 5DM4A 3O83A 3AVWA 3B6IA 4RACA 4M86A 1CR2A 2VWHA 3R75A 4H7PA 1GPBA 1O89A 3MGGA 1IPHA 1WW8A 3OJXA 4I9FA 3LKDA 3OVMA 5H83A 3VQTA 3HY4A 3V1TC 1Z22A 1BOOA 4HX5A 5AJWA 3TB6A 4P82A 4RTQA 5JQGB 2X14A 4ZTUB 2IYZA 4A6EA 2C9MA 2FSIA 2B30A 1XTJA 3GZNB 1CT9A 1Q7EA 3OG9A 4L78A 5HM8A 4EPWA 4H9GA 3C6YA 3TSZA 4R8SA 2QD3A 2V4MA 1Q1EA 1CJUC 1LPSA 1NULA 1R4NB 1U9ZA 1XTUA 3AETB 3DCNA 3E48A 4YUWA 1NG9A 3C5WP 3QVKA 4M37A 3JW8A 4CQLB 3CUVA 2OCKA 5F73A 1P7YA 2NVUA 3FDJA 1U2DC 5G0UA 1Q7TA 3NPMA 4HRAA 1GNQA 2Q5OA 2WWRA 4AC9A 1UMDA 4WY2A 3WWDA 4A4DA 1S2DA 2DFNA 3Q8MA 3CZAA 3GXOA 3RSGA 2G07A 3SDZA 2XBLA 5LA6B 1T2EA 5FB3A 4TM7A 1YB5A 1KDRA 3I2GA 4AIRA 1T9BA 1MX1A 4E3WA 4TTSA 4EYQA 5B6JA 5JAZA 1JG4A 1QLHA 2II6A 3I73A 1FS6A 3OF3A 3QU4A 5IT0A 1UH5A 3JYLA 3MWLA 5DP2A 4ZK2A 2IXFA 3Q7RA 1G3UA 1SQFA 4PG7A 1TQ2A 2XODA 4YWHA 3NEPX 4U2FA 3TIXB 1KY4A 4M8IA 1XVLA 3HDGA 1DDGA 3KLOA 4IUCS 4PBSA 4Q18A 3AWIA 1D2CA 2JGJA 3WBFA 4URVR 3QYAA 1T8TA 3QXHA 1XPOA 1PZGA 3A1CA 1HYBA 2BFEA 4FOLA 4GWLA 5KNCA 3GHHA 2BKVA 4B3TB 4V0OA 1CQIA 2QVYX 3ASVA 3EG5A 1K3UB 4TT8A 4OYRA 2XMSA 1NRXA 4E30A 2VLIA 4TKMA 1CRLA 3GMTA 4V0LA 2KX7A 2RGGA 4EFDA 4BV8A 3O94A 1LLFA 2JCVA 2IEIA 2P9YA 3QV2A 4OJYA 5CT8A 1ZH8A 1IUKA 1RCFA 4URYR 2DETA 1XHEA 3A36A 2VNJA 3E82A 2JFOA 2Q5IA 1I4DD 1U0RA 3PA6A 3AUJB 3UZUA 5MFZA 2CLMB 4GKAA 4MH0R 4MVJH 2J0EA 4REOA 2GDJA 4CL3A 1EFHA 2YY6A 3CTPA 3HN2A 1RAGA 3INGA 3JQAB 4JSRA 3IQDB 1HT1E 4ZQIA 5EWLA 1BKYA 1VLLA 2Q7XA 3IIEA 3R9XA 2ZVJA 5ECDA 1GOTA 1IDOA 3QQPA 2QL7A 1AQNA 4HNUA 5C5DA 4V24A 3LXUX 3ODGA 1DG1G 2ZZMA 3QXCA 1NRWA 4UATA 3VC3A 5I9NA 1JQLB 3NXKA 1VMEA 4QFBA 4YYZA 5ITSA 4KVFA 4IICA 2GHQA 3VR5D 1MQAA 5AJTA 3EG9B 2B82A 4CKYA 3DV2A 1KQNA 1US8B 2VJOA 3HCFA 2Q4OA 3LT2A 4DLWA 2YTZA 1REQB 2A5YB 5EE5B 3WL5A 5ILOA 4NXMB 2WJAA 4RTOA 2J3MA 3F97A 3PCRB 4XEHA 1MUUA 5BVHA 4OL9A 1ODJA 3QFSA 3ZI4A 2I76A 4RCVA 3OE4A 1WBJB 4LYFA 2RI1A 2NOAA 2VJYA 1NMSA 1I2ZA 1PNVA 2BHTA 1YBFA 2MR6A 3LKBA 3NKLA 2VNKA 1UDBA 4S0XA 4J0IA 1ZZGA 1M8FA 5HUQA 1JR4A 4YP7A 2YMPA 4UVIA 4BNDB 1ISJA 5CPFA 1UFOA 4GFDA 1PEKE 5CW2A 1BN7A 3I01M 2WJYA 1Z4NA 2DF8A 3ABRB 4ZXFA 3EGDA 5B64A 1NLUA 3ASZA 5HFNA 2QE6A 5MHTA 1B1AA 1ISFA 1G5PA 2FK8A 1CQZA 2XT0A 2F7SA 4G6ZA 3ANLA 4RD1A 4JP5A 3ZXSA 5FTNA 5FULA 1U9IC 5BOSB 2C04A 2ID4A 3BIXA 4H6VA 4YDSA 4JAVC 4X90A 1DQZA 2C9ZA 1UXHA 4I1YA 4AURA 3QLJA 1AT1A 4YRRA 2FLWA 3HSKA 4DADA 3OEHA 5AESA 3GJ8A 4RELA 3U3MA 1GVHA 1YZVA 3OEED 4N3CA 3LXXA 3DQZA 3R3ZA 1WXQA 1P0MA 2QW1A 4D41A 3ZD6A 3AF2A 3Q9LA 4KWTA 2BFBB 5K3AA 1N0IA 5JPCA 2PSJA 2POQX 3DTVB 2JG3A 1JBKA 2RGUA 1G9TA 3LDFA 2QR5A 5GPBA 2CXRA 3UG7A 3AY0A 4TKVA 1LRLA 3GLIA 2Y92A 3LLMA 4PVDA 1HNXB 1P2UA 3R0QA 3KK0A 3PC8C 3S7ZA 3IXLA 1MEEA 1MRNA 2YWDA 3YASA 1MXHA 1EXDA 4LSWA 1O8BA 3AVPA 1YASA 4QUKA 3L7NA 3ML1A 4HRYA 1ZOIA 1G8SA 2AN3A 2VP4A 3C2QA 2C4WA 5C34B 3UK0A 4GRAA 2Q5JA 2FPSA 3TUIC 1IOLA 1ZPDA 4F0JA 1CS0B 1QBGA 1TYEB 1SKBA 1X7HA 2CHFA 3PWTA 2XRFA 4UQPA 5F9FA 1LK5A 3R6LA 1I3LA 4MJ3A 5KYXA 3K9QO 5IXYA 3JQEA 3AFMA 4RVDA 3RRNA 1GPH1 4RJTA 2R7NA 2Y4OA 3TDKA 3WC4A 4ZCTA 1G7SA 4K9PA 1PL7A 2Q8NA 4RM2A 3HPQA 1QE5A 1ACJA 3UB3A 2H6EA 4DBLC 2ZS7A 3CLHA 4ARUA 4BNTA 3ADCA 5J5AA 1GFZA 1SVNA 4NYJQ 1QCYA 2B2XA 4ZN6A 3V1MA 1IN5A 1JHXA 1NL3A 1NR5A 1U0NA 3F6RA 5KVQA 1ZXBA 5KYTA 1CQJB 3D8NA 2QTNA 1WPQA 4CTNA 4XXHA 2V96A 1H6CA 3RE1A 1V1JA 1M6VA 3MWDB 4QUIA 3ZI7A 1UJCA 1W5TA 2EGUA 3E7DA 3OKPA 5F7XA 3UKJA 4HTFB 1AJEA 2W6QA 3C7DB 2V8OA 2AMJA 3RJ5A 1JQDA 1XC7A 3OTHA 1YJ5A 3ROQA 3TM4A 4AZWA 4OMDA 1CF4A 1BSVA 2QJFA 1DIBA 2D8AA 1MENA 4QRHA 3JRXA 3DOOA 2AG6A 3UKDA 1A9ZA 3EA5A 4PSDA 2ZVPX 3P9QA 4EMUA 4WNIA 2O5CA 1L5SA 2IZ5A 1PTJA 2BGLA 1U2TA 3N8DA 2PM8A 5EJMA 5CDSA 4OQQA 4OQZA 2KE5A 3T3PB 3S4YA 3ACCA 2PA3A 1ANKA 2BDUA 3H2ZA 3WZLA 4JMLA 3OZVA 2R6R1 4HXGA 4DV3B 2XYRA 2RJOA 3IEIA 3PUYA 4QPNA 4YC7A 5JZOA 4PU0A 4MROA 2GS9A 1X2BA 3VV2A 1HYEA 4JI0B 1UFRA 4MCAA 4OH1A 3DZGA 3STUA 4MQEA 2RHMA 3QPVA 3Q1KA 5TF0A 1PFVA 1PJ2A 4I0WB 2UYQA 3F96A 1S02A 1DIGA 3NOXA 1Z7GA 3IBGA 5FIUA 1BGWA 3WHIA 5BUZA 1DZIA 2ALJA 1G8FA 3BJRA 4FDUA 1OXBB 3U4IA 5ALTA 1FZTA 5AW8A 1ZESA 1SUSA 4G5RA 1OI4A 1QMGA 1M6YA 4FS3A 2D5LA 4NG5A 2O20A 4HDMB 4KPEC 4LRYA 2HCRA 4HVAA 2LDBA 2ZRMA 4HEQA 2HREA 4YMGA 1ODLA 1JZTA 2FFQA 2QP9X 4R8MA 2F1HA 5ELXA 4ZP1A 1W2WB 1XTQA 1JG7A 1C0KA 2HLDA 2W9XA 3AUXA 3LF2A 2ZCUA 3RC1A 4BY9E 4R2KA 4DN6A 4NAVA 5LWQA 1QCDA 4KIGA 2J0QA 4GBMA 1AQJA 2YVAA 3IP5A 5COBA 5H9WA 2IT1A 3EC1A 5AHXA 3T9AA 1QRAA 4BE7B 2NACA 2WILA 4OJNA 1Y34E 1ZSYA 1K2WA 3A0RB 3QBTA 4WDQA 4WNCA 4DIDA 3RDPA 4RHUA 3U7QB 5DX0A 1VKNA 2BR4A 2D13A 4PR3A 1EVJA 1P3DA 1KL7A 2AOUB 3WDLA 3ZQJA 2V7EA 4YV7A 5JROA 2QVZX 3VR3D 2E49A 4IOJA 3KOXA 2VSXA 4RHTA 5FOWA 1HQCA 3OJFA 5JZVA 3C6ZA 5BSRA 1NHGA 4BNMA 4F9FA 1P75A 4ZT4A 4M1MA 5BV1A 1FDWA 4ZICA 1A4IA 4R2LA 2R8EA 1LI5A 2CSUA 2JFNA 3D43A 5KU7A 1R5JA 4WEQA 1KJWA 1LBTA 4D80A 3MWEA 2O7QA 3AFOA 3B1XA 4B87A 1OTXA 3EWNA 1UIMA 4K03A 4P08A 2TMYA 2H4WA 3LIIA 5ETJA 3OZIA 3FOFC 1E9FA 3HEAA 3KEQA 5DXAA 2UYHA 1I1OA 1C9NA 1DTWA 4RZQA 1HE8B 2CXOA 5JRZA 3QENA 1QH1A 3C3WA 3RUDA 3C74A 3K9BA 5JO9A 4DNFA 4YMUA 4ES6A 1EJ0A 3UB2A 2PCLA 4ER5A 5CX1B 3FCYA 4PR0A 2FB9A 2VI5A 2MSDB 3FVTA 3JZDA 4MMXB 3RODA 4QEZA 4C4AA 4EFNA 1W96A 5L7TA 1YR2A 3HZRA 4PCAA 3OLXA 5HQ3B 2EF0A 4LYAA 1MJFA 1R88A 3GLHB 4UULA 5JCOC 1QVVA 3JQFC 4C3ZA 2HHAA 5AM2A 1COWD 1T0PA 2JGNA 3TSAA 1RW4A 3KOMA 1DHTA 3H13A 4FI3F 3VU8A 4HGOA 5JAIA 5EL0A 1NQUA 1IHXA 1WV0A 3JD2A 1LY1A 3JD4A 3MIIA 1UJ6A 2K6GA 5IN4A 5K3OA 2PSDA 3PFFA 1CX9B 1J5PA 2BKUA 2YN2A 4LOKA 3UV7A 1TVEA 4OQYA 4Y6GB 1YHYA 2ACWA 2QZSA 3JWIA 5CBPB 2ZBUA 1YZLA 5IJ0B 1RNLA 4DEYA 1SRQA 3A28A 1T5HX 4UU8A 3CW9A 2CL0X 5EE1A 2WYUA 5D86A 5H02A 1HG0A 4PO1A 3RV3A 3TD9A 4OAPA 4BQRA 5IABA 5K0FA 1GA6A 2LGJA 4KN6A 3IT3A 3M81A 4Q9DA 1WDKA 2A1TS 1QUFA 4MMYB 3GEPA 1I4EB 4FFMA 1GLVA 4O5OA 2V7QA 3MUOA 1MQSA 1H2XA 3FVVA 1JQ3A 2ZUDA 3GGGA 2HSJA 1H6DA 5LP6F 5LP6A 2HF7A 4KPUA 3LUPA 1U4OA 4Y6QA 1XVAA 2WWTA 4DCNA 4E12A 1FTQA 2YL2A 2VOJA 1W1UA 3MK31 3Q6MA 4ME6A 2FRDA 4OXXA 2XDAA 3SSAA 1OWMA 3IBCA 3S40A 3QE9Y 2HA2A 5TX7A 4BQQA 3PPVA 2J85A 2RI6A 3V4VB 5EXSA 3ZR4B 4E4TA 3SXUB 5DYIA 2ODAA 1NQWA 2D1FA 3PYLA 5ECWA 3ZZTA 3AOGA 5IAEA 5CVUA 3S0JA 3U9TA 1E3TA 2OP0A 3PXGA 3KZMA 2ODBA 4CEIA 1N3BA 4BNFA 1PJ8A 3TW8A 1TYZA 4R01A 4Y7DA 4FONA 1VFPA 2ZFUA 4TOIA 4LY6A 3QG5A 3SEFA 2PH5A 4WXRA 3ZVLA 1CTQA 3DL4A 3ASUA 1KYQA 3H75A 3OZFA 3O2SB 4OLFA 4P53A 4GPTA 2O2YA 4QASA 1VDMA 4WCFA 4PX3A 2PGDA 2Q21A 4KFSA 2PHZA 4ZZ0A 3CX7A 5EJGA 3CZ9A 5IVIA 3HKDB 2V3WA 4CTKA 5IF9A 5KWEA 1FYWA 1KO5A 5KKCA 2NXEA 1S3SA 4X41A 4CLOB 5EJ9A 3EZGA 4RY8A 3A9VA 2CCKA 3RJZA 5IJWA 1HKHA 4KR7A 2YC4C 4QTTB 3KSBC 3C6XA 3NFRA 4PLFA 4LRQA 1NI4B 1XCBA 2ZSBA 2JANA 1T0HB 2IW1A 3C3AA 3DKVA 3GLVA 4WBSA 5CNMA 5I9LA 4LDZA 4NU0A 4ZOLB 3ICOA 1X92A 5AI5A 4WL0A 1SHZA 1QC5B 2FZGA 3GL9A 3M3PA 3W5HA 3JQ8B 1E0KA 1F8XA 2LR0A 4QTUB 4GR5A 4CKWA 3GLUA 2OO5C 3JQQA 4EG5A 1WCIB 1JLLA 1E20A 1PSWA 2TRSB 2I6FA 1DQRA 1WAMA 2WLSA 3IX7A 4OFBA 1RFLA 3OM1A 3LAWA 4C06A 2ZT6A 3PGMA 4RIEA 1L7NA 4KN8A 4A2CA 1Q3TA 2UXBB 4PPNA 5GZ6A 1GG8A 1RE0A 2NQ2C 4KH0A 3JYOA 3T99A 2ZQZA 3RO7A 3OPYB 2D1TA 4HLUA 2QTBA 4RQAA 5D5PA 2BSXA 2EG9A 2HZ7A 3CRMA 4LZOA 1L3CA 2B98A 1E1RD 4QOSA 5I9MA 4YMVA 1P81A 4IHJB 4MWSA 1VB3A 1KK2A 4ROTA 1WA5A 3OD5A 2EIXA 2Z1DA 3OX3A 3A3YA 4AKTA 3R74A 1XBTA 2ZRBA 2C5EA 4CDMA 1M5RA 2JH8A 1YZHA 5EWMA 4K6CA 1L3IA 3R8XA 5A5EA 3SCZA 2JHAA 1NUSA 3BD9A 3AQ4A 2H5IA 5AJZA 3M9LA 4JR1A 1W35A 1T5DX 1QH8A 1T9AA 3LKZA 4R69A 4DC1A 3STVA 3P9ZA 2Q7DA 4WJLA 5IZCA 1Z5PA 2O6LA 1Y3BE 2Q5FA 5DNEA 2NYAA 3PJGA 4MP6A 2QUAA 1Z12A 3FDXA 3G79A 3OQBA 3S1AB 3E53A 1ITZA 3EDMA 2HWKA 5EXPA 4BRZA 5BW5A 2VRNA 1DMSA 3B2NA 1OX4B 1YA6A 1R1DA 5HGJA 4YYEA 2VKQA 4F2HA 3Q9UA 1ISHA 4QXAA 3LM8A 4IQGA 1YGYA 2PWYA 2VAMA 3NI2A 2FPPB 4CKBA 4HDSA 2NP6A 1UMBA 5E1OA 6Q21A 5JDIA 1W59A 1EVIA 1K4YA 2YJTD 3N6RA 3FI9A 4YP5A 1GTSA 1FYVA 1QFXA 5AM5A 3SJ7A 4OATA 3QG1A 5CHEA 1PS9A 1SNYA 3EVCA 3LW8A 2BFOA 2P67A 3SYRA 4C6TA 1JR3D 1WZNA 3IJEB 1NASA 1N8TA 3RV4A 5CH5A 3HI6A 2A14A 2BHSA 2XDQA 4IG4A 2EKBA 3PEUA 4MS3B 2W4IA 4HT3B 13PKA 4FC7A 1N5LA 1F8UA 3PYMA 4HD8A 4IRUB 2XUOA 1UFKA 1HDGO 4RV5A 1CUZA 1MCZA 1T6YA 3IE2A 3PVCA 4UMVA 1EFCA 2VHCA 1H05A 1EFUA 5DBEX 4F1JA 2VDUE 3CVYA 4M89A 2V3CC 1A3CA 4BEBA 3DOFA 3KTOA 4EFMA 1CIVA 2CFSA 3ORYA 3Q11A 2I80A 3KYDB 3QMWA 1L5HB 3WS7A 4A92A 4DJAA 5KWVA 3BIFA 2X7HA 3UJ8A 5I45A 5LJLA 2I91A 3GPIA 2VUSA 1D2HA 1QBKC 1FU4A 2NTJA 1QFZA 1V0JA 4AF7A 5C5CA 5JVDF 5JVDA 3T1QA 5B3JC 2QXYA 2J3JA 1U7UA 1NUQA 4MI9A 4FEGA 1H1LA 3M6FA 5DI3A 2IXGA 4FCWA 4AAYA 1VA4A 2F3PA 1YVEI 4XE5A 4PNPA 3AP1A 4MW0A 1NDHA 3FTDA 4LHZA 4LWPA 1P31A 1XFAA 2DSNA 1C1DB 3CZ4A 1BWSA 5E9JA 5I5GA 2PUCA 4NESA 4KI7A 3SJZA 3VH4A 2HWXA 1IAQA 1L7QA 1LLCA 3IO3A 4OK3A 5ALNA 4IPTA 5DN6A 3T12A 2XW6A 2P3QA 3O1JC 5AQEA 3E61A 4LQCA 3QVLA 2IXEA 4JLVA 2B99A 1KHTA 2VT7A 2ZANA 5IVDA 4O08A 1POXA 4W9RA 2HLHA 3QFRA 1ULZA 4ID9A 2HXGA 2PUVA 1Y7IA 3DZJA 3KWMA 4WKOA 2YWFA 4MS1A 3TQSA 4IIGA 4B4WA 5LKAA 4A6XA 3BMOA 3FNIA 1JLRA 1X9GA 3N0WA 2GEKA 4JCCA 5ENZA 3TVTA 3ZVNA 1BKSB 5EE9A 3E7XA 1C81A 1QHEA 1T6XA 4XJXA 4GMXA 1ELOA 3HCOA 2O8FB 1EFRA 5EIHA 3RU9A 1K86A 1UPUA 1C4KA 4Z0TA 4MCJA 4NP6A 2O4CA 5FLEX 1UAGA 3H1FA 1C7JA 4JU8A 3PRYA 1AHHA 2ZE5A 2FXVA 1A96A 2FW6A 2ZTMA 3DWIA 2IZOA 4OAQA 2MSEB 3IQXA 4RTLA 4RH1A 4Z49A 1N9ZA 1F7VA 5DCUA 5LNK1 5JZ9A 2X19A 4GEKA 2GD6A 4I1VA 1BS1A 3LY8A 1LU9A 5J3JA 4L8WB 2AFIE 4X7PA 2EGHA 5JBNA 1L4GA 1XAHA 2AZDA 2M6RA 2AW3A 1WMSA 1G1MA 2ANBA 4LOLA 3S2ZA 2AR9A 3R09A 4YAGA 4YUZA 5DI9A 1K5HA 3ZU5A 4LYDA 4WY8A 2XQIA 3CBGA 5FAKA 1TT5B 3EVFA 1U11A 3CF4G 2DHRA 1MMFB 1KU0A 3U3RA 5K20A 1P74A 5ED0A 3GLFE 3T1TA 4CTMA 2G76A 2HIMA 1OLXA 5A3VA 1NF8A 2QD4A 3FOWA 3M2PA 1YMUA 1FYXA 4X6UA 3K94A 1WHTA 4WI1A 2H0AA 4LFCB 3HJCA 3M4ZA 2PG3A 4G65A 2C2BA 2BTOA 1FFBA 1WHSB 1E1YA 1I24A 5ILQA 5IZ4A 5F35A 1JE0A 1GG2A 2ACVA 1JAIA 2VZEA 5J63A 1VIYA 4XSGA 1N2XA 2ZWIA 1BA2A 2B7CA 3A6FA 1F48A 3EQ2A 3MBIA 4HB0A 1SUCA 2BEWA 1FP7A 3PX3A 5JECA 3E9CA 2XD9A 4E32A 5JAHA 3CQ9A 1B1CA 5BMOA 4KQJA 3TPFA 3FPCA 1KRXA 4A0GA 4UHCA 1FRNA 2DFPA 3WV4A 3E0XA 1P4AA 3Q1LA 3S2FA 3D02A 4W9NA 3TTWA 4N8EA 2HJGA 4MX8A 1IOVA 2AS0A 2DJ5A 3D3JA 3ETCA 3GAZA 2WIJA 3HLTA 3QUCA 4H7HA 4KDEA 4Q7EA 1DEKA 3NYQA 3VYRB 2O1WA 1M34E 2ZTUA 2PX8A 4W5OA 2V8BA 4WBXC 1FMLA 1HDXA 2LD4A 3IDAA 1P17A 4BCCA 4Z3KA 3GY0A 1XRNA 1YDMA 1VJ5A 2A7XA 2R4QA 3LX5A 1R6XA 3LQ4A 4NYMQ 3W06A 3TNJA 3AIIA 4DLBA 2FPGB 1CYEA 2GXSA 4NPCA 4U00A 5EIBD 3RRYA 1E1LA 5JADA 3FJOA 1JKIA 4LPSA 3HS3A 1EAYA 4QEKA 4RXMA 4JSTA 3JQ9A 4H1TA 1QIMA 4N9WA 5C53B 1XLTA 4MNTA 2C9OA 5H7XA 1P0FA 2NO7A 4YBRA 5AD1A 4DA6A 3QU9A 3UMGA 4F3YA 2LUOA 4JMPA 1HYGA 4TTAA 1PR1A 4C1BA 1NF3A 1E3SA 4XRRA 2QL5A 2WF9A 2BEJA 5CT4A 3GBVA 4UAJA 1PQPA 1H4VB 1UIRA 3L8CA 2AYXA 3QU7A 1XB2A 1SIBE 3K0AB 3PFCA 2C95A 4G97A 1BYUA 3RSLA 2FTKE 1TZKA 3UY4A 5BQFA 3PQFA 4G5HA 4MVJD 4CLHA 1U3UA 1CWUA 3MJCA 2M2IA 5FJIA 1CY4A 3DUFA 4MUFA 4BNLA 1K7EB 1U9JA 3I9LA 5JC1A 1EAMA 1OFTA 4NE9A 1FJHA 2ZR0A 5A9TA 3RS3A 1U2ZA 2I5PO 3ZGVA 4ER7A 3D7LA 2PSEA 4BGDA 1T15A 2PCJA 3NHZA 4ZVVA 3BFVA 1RI2A 1UBKS 4ZDWA 1J5EB 4G4SO 1X8JA 1DEXA 3K9GA 4PINA 1CJBA 3N2KA 2OHGA 5JEDA 5LOVF 5LOVA 5EUQB 5F9HA 4BBPA 3KV1A 5CDFA 2P6NA 1FP4A 3BHIA 4GMHA 1CQPA 3N8GA 4ZDKA 1IHDA 3UWOA 2J7PD 2O7VA 3ZOZA 1WPRA 1YBVA 4TWBA 2QYTA 1IY2A 2DR0A 4LVNA 4YO8A 1BEEA 2FSFA 1MIOA 2JLXA 4TSFA 4MPJA 1TUBA 1PYGA 4K2HA 4BCBA 1I5RA 2CHQA 2K5UA 1RRFA 4A27A 2FMUA 4DANA 1U6KA 4MGEA 1JUDA 4XWYA 4E5SA 3MMZA 3W4IA 1LKZA 3KKPA 1AHIA 2WTMA 4TRJA 2ZPUA 3AOEC 5FFNA 1NZFA 4AY2A 4G1MB 1FYFA 3SZMA 1T3TA 2O2JA 4GZ5A 3F1KA 1V16B 1MAWA 1PD1A 3MUEA 2PZJA 1BE8A 2BEVB 4UNPA 2B1QA 4AMZA 1KJNA 1R15A 2V7BA 4C0AC 2PLRA 2XI4A 3PUXA 1KTIA 2O06A 4I55B 4FFBB 5AICA 1KFJB 1YDFA 3DBIA 3M7IA 1Y3AA 2G1JA 3R2JA 4OUDB 4RMJA 3USZA 2I7TA 3A6ZA 3O8NA 3R0JA 2VH2A 4AK9A 1NSFA 2F17A 2D7JA 4IJ5A 2VSQA 3L1UA 5DTIA 1IHYA 4G9BA 4J7CA 4B74A 5ER9A 1DO8A 1CUSA 2E37A 3NTOA 4L4UA 4HWRA 5DGTA 4NAHA 2IYXA 3FYHA 2XJ9A 4NDNE 4V1CB 3IKVA 1UZNA 1WZEA 2I2WA 4KKXB 4IUDS 4FBLA 4NCKA 5JDCC 5DFAA 5EHIA 4TKUA 4H7DA 2VNIA 1IIRA 1NPDA 1VE5A 1KA9H 4MRAA 4PS1A 2A33A 1LVHA 1LWNA 1XEXA 2P2YA 3FH0A 4PLCA 2DR2A 2RG7A 2MINA 3O9ZA 4CMHA 1L8QA 1B93A 1XL0A 3H2SA 1NXWA 2WM9B 4O4IB 1EUCB 2R65A 1WQ4A 3BPSA 4Q7LA 1IUPA 2YZMA 3NDJA 4JJGA 5D6NA 3MRSA 2NZWA 4BB6A 4HWSA 4MGKR 1PUXA 1SURA 5GMOA 2IK8A 4TYPA 1V5GA 3R7SA 1Y37A 3D2BA 1G3MA 5ISMA 4QPDA 1YFLA 4JLPA 1E7QA 2OBNA 4PPQA 1OBFO 2GD2A 1EVQA 1JHMA 3DOHA 5AI4A 5B30A 4GYJA 1GL6A 3ZXXA 1SXPA 4LF5B 3UAXA 1ACLA 1E2IA 2CZQA 2E1RA 4HB4A 4KBFA 4BO2A 5CFQA 4BO8A 1UL1X 1OI2A 4E5DA 4ML3A 1TM7E 5FTKA 1ZD1A 4HBZA 1XHLA 3PFWO 3TN7A 1DAFA 2REOA 2ZU0C 5F7OA 3E6AA 4KAXA 5EKUA 3EZNA 1TO6A 3UWPA 5TEVA 3QPAA 2ZRGA 3AI7A 5CLJA 2XGJA 4TYYA 3QKTA 5HUJA 1UM9A 2E4UA 3JARB 3QMPA 1CY2A 4O8CA 2ODPA 1GRVA 4IOMA 4LF6B 4TMYA 1DWPA 1OGJA 3LA6A 4ZQGA 4BQIA 5F2NA 4RKRA 3C1TA 4P3KA 1C30A 4EKEA 3JVIA 3CNHA 4C4YA 3P9IA 4RLFA 3FN4A 3JXEA 2G88A 5JMPA 4EITA 5K0JA 3GI1A 1CQXA 1JLKA 4LMRA 4JGBA 4TQGA 1TUIA 4C88A 2I99A 2I67A 4G26A 3IJPA 3LXRA 4ESHA 2ERYA 4FD3A 2RH5A 4BO5A 1Y8RB 4IVQA 1ZMTA 3RAFC 4Q1EA 2G8LA 1NZDA 3T9BA 2NSDA 1GYRA 1UKBA 2BHLA 2XVYA 5FT9A 8AT1A 2B7BA 4Y1RB 1AA9A 1OU0A 2AHRA 3DYBA 4ASUA 1RJ9B 3R7WA 4GE0A 5TPZD 3L01A 4EVRA 4LXGA 2EZ9A 4KUEA 3Q87B 2Y1LA 4LHYA 1RJFA 4ND8A 1K0FA 2IXBA 3U1VA 1SCJA 1CBUA 5HOEA 2I22A 5ENDA 1UWLA 1Y82A 2C99A 4IZIA 4CVNA 1I7LA 2V6JA 4CV0A 1JKJA 4FCTA 3K0CC 4ROSA 4DR4B 1ULBA 3PC6A 4F04A 1V3TA 1WXHA 4G3XA 2JEYA 3KUXA 1GNRA 2YWRA 4RZ2A 5F2EA 3BZWA 2EHJA 3PJDA 3C3EA 4A1FA 1NBMD 3AEYA 2P0YA 2BJVA 2GZMA 4BUCA 4R40A 2YFKA 2C3MA 1W19A 4Q4LA 3TBFA 3DFFA 4EL0A 4H17A 1M76A 2H1OA 3H1BA 1D1QA 1NAIA 3DDZX 2JL1A 5LZ8A 1DAOA 4CRWB 4GC5A 1V3UA 2ZVDA 3E3OA 5D7BA 4Z4FA 4MYHA 3GJYA 2X5OA 3SIRA 3BICA 3LDHA 2IQ5A 2QLNA 1J8DA 5FR2A 3LGAA 3N6XA 3N87A 4K9RA 1RPJA 1KY3A 4XFJA 2C4MA 2WU1A 4X8OA 4B8ZA 1CUFA 2QUHA 2AXQA 2WUVA 2ZI5A 1X1CA 1GUZA 5CTAA 3ZJ5A 2FN3A 2QX9A 3WJAA 3BBLA 4AZ3B 1I01A 2GEBA 3OJEA 5KVAA 4HMQA 2W37A 3GFSA 4N03A 4QBGB 1V6SA 1Z6ZA 1P2DA 1PDVA 1UBEA 2VPPA 5DN9A 4JB0A 4AUKA 1AK9A 5CTJA 1L6RA 2F43B 4RJKA 1OHHD 5K6RA 3IVGA 2GQ0A 4N12A 5H9VA 1G63A 2LIVA 2H52A 5AM0A 5HDQA 4GX0A 1W87A 5DBFA 5I7RA 4EW2A 4S1WA 2WIFA 4Z9YA 5I8ZA 3R7DA 5IAAA 2QWXA 4FZJA 2IHZA 3OOEA 4J75A 4WLFA 1CV2A 1RE1A 5DWVA 2HXYA 5EIEA 1E2BA 3A4VA 1O9BA 2V58A 4DV6B 5KYWA 3CRQA 5CT5A 3H9BA 3DTTA 1D2EA 3MJHA 1YKSA 3LWDA 1FSFA 3KR0A 1KI7A 1M34A 2H51A 4BJ5A 3PUKA 2G36A 4PQYA 3COPA 4LK3A 5CFMA 1KJIA 4RUKA 1KMHA 5JAQA 4ZDJA 4G5GA 3WLOA 3OIYA 1C2TA 2GPAA 4P84A 1MQ8B 1Z6GA 4TLMB 4EB6A 3EVBA 2GJ8A 2HKIA 2UZ1A 2CBXA 1SVLA 4B4DA 4OBWA 1C7EA 4KR0A 1GTRA 3ZDAA 1O94A 1SMKA 1Z0JA 2WSSA 4MRVA 3VPAA 1VLQA 2FPOA 4GMFA 4Q48A 1M5TA 3PCTA 5HXAA 2HWUA 3GJ4A 1U1DA 2MSWA 4Q93A 5DYTA 1XFDA 4ZALA 4KCGA 3TXXA 4CM9D 1AH2A 1TPYA 1YKGA 2FSUA 2XTJA 1C1XA 2PNJA 3CRW1 3TEMA 2H4HA 2QRQA 2ZG6A 5LBIA 3VU9B 3U61B 2NVWA 1ES9A 3RHSA 4CEHB 4ZAWA 1C5KA 2VBGA 4NV3A 1PCXA 1JDTA 4LCBA 3DBLA 2EJUA 4FMDB 5NULA 3UATA 3LBYA 4CLEA 3CYFA 4MAFA 4EG0A 1K2VN 2PBFA 4LVCA 5KKNB 5DLYA 2H1CA 4BVJA 3NAZA 2QZ4A 3TZ6A 1E6KA 1MAUA 4Q39A 4FSXA 2WHYA 4IOKA 2NP7A 2XUPA 3PHIA 2GJ9A 1W4LA 1XZQA 4YRQA 1R0WA 2CLOB 4R7GA 2YHAA 4PPFA 4Z4CA 1Y4ZA 1LRJA 1M72A 5I7AA 2FN4A 2NUBA 3OI7A 1ZYUA 4B0PA 1KVQA 3KS9A 1U81A 1EWYA 5JUWA 4C6RA 1KORA 1YZ3A 1NJFA 4Y1RA 1J2UA 1D4AA 3ZWOA 1CRZA 2VH1A 3JALA 4G0PA 3WLQA 4YRSA 7AT1A 3EXHA 2QAGC 2YZNA 3B82A 1ND6A 2GK7A 3SFVA 4DMUB 4YXWD 5KYNA 2GETA 3NETA 3KSZO 2JAUA 2EFDB 4IDOA 3HKEA 4PHCA 4ENRA 5M34A 3VGJA 3DMRA 3W8EA 2I8AA 5JTUA 3ISTA 1UPAA 3ONWA 1OREA 2XUAA 4R84A 4A23A 1QQ6A 5FP0A 1K8QA 1Y1SA 1Q3HA 3WL3A 1X0VA 3ORSA 4CKCA 2IEDA 1EFVA 1OKKA 2IZ1A 2Q3MA 4DA4A 4PZ9A 2JI7A 3GO4A 2OORC 3LMKA 4PHTA 5IN5A 4KX5A 4OHZA 3C70A 4U5XA 3M2TA 4NH4A 3RPEA 5L3QB 1Y6RA 3G68A 4K9QA 5BW6B 3BZUA 4YAKA 5B3LA 4BAZA 4GOOD 3CSDA 3O91A 2O0JA 3W2GA 4JEMA 1Z37A 1N1MA 3F2IA 1QOPB 3BCSA 5L3ZA 5JLJA 1NYQA 4UQOA 4UEQA 3G2KA 4TYMA 4WESA 5KQMA 3OCJA 2PX5A 3STTA 2FHPA 4AQDA 4XYLA 2XUDA 1RWXA 2WK1A 1G8HA 4IV0A 5K2MA 2OXCA 3RVMA 1E4EA 1I1NA 2BKXA 3MTDA 4JLJA 4FGKA 3R6DA 4UHFA 4XWGA 3TXAA 1KFKB 2PX3A 1JFSA 1OLUB 3DV0A 2NTYC 3I01A 1XE3A 3EZXA 3K5WA 2XNDD 4DIUA 4EZBA 2MSCB 2IYTA 3WGYA 1GPNA 5K4GA 4HF7A 5BYJA 1HTWA 4D5EA 1E3EA 1A88A 2AEEA 3L1IA 1ISSA 3IMFA 1JHYA 1CFZA 1J49A 2QXUA 5BR1A 3CNQS 2VR1A 1GL7A 1TZ2A 3OHMA 1X1AA 3QNUA 1C7FA 1N6RA 4MVWA 4KYTA 5WRFA 2NU9B 3VU1A 2IPMA 1R6AA 1B23P 1P73A 5KX5B 4IFTA 4ND6A 3LQRA 2LDXA 1LPNA 5KVCA 2R44A 3KJNA 3Q0TA 3OE5A 5IYZB 1MVNA 5J4VA 3OZUA 1GV1A 1JQBA 3OO0A 4RPCA 1H93A 3AP2A 3KOZA 1D2RA 1VG1A 4YUAA 4ODIA 1ST2A 1UOOA 1RRVA 1Z4IA 2H18A 4AY5A 4EA6A 2Q0QA 4MV6A 2CF6A 5ES4B 3L6UA 2A9KA 1VHTA 5F64A 1BO6A 3COYA 3MMSA 4HY3A 4KQEA 1JYFA 1OXUA 3OLWA 3TZLA 5AI9A 4WQMA 1U2GA 3RIHA 3A6DA 1E6MA 1SC1A 2Y71A 4MWTA 1EUQA 2LXNA 4R5MA 3EEOA 3VO9A 3O3CA 4DVJA 4QTXA 2EGGA 5EVJA 2CWWA 1PR5A 2UVDA 2BYTA 8ABPA 4HH4A 4CQJA 2R1ZA 2YFHA 2WFAA 4UU7A 1U7WA 3ZS8A 2WE7A 4LJ9A 2YZKA 4U6QA 5FBLB 3H2YA 4GMKA 4PLVA 3I04M 4EUSA 4EA8A 3TI7A 5U4XA 4F97A 1GZ6A 3DMHA 5FWYB 3ZHXA 2O5EA 3TG2A 4ZCPA 2HAEA 3MVEA 3C4QA 2ZUCA 3GELA 3WYGA 3OZEA 3MLEA 3D0QA 3HNPA 1UFQA 2BMVA 2WB4A 3DWEX 4PYIA 4HGQA 3BILA 3GEEA 3S8MA 1SBNE 1Y6ZA 1NN1A 1UXIA 3DLPX 3N0XA 4J76A 4JUIA 1C0EA 3ZHCA 2WU0A 1T1JA 1HDRA 3HP7A 2J5QA 1EB8A 1ZXXA 1RI5A 4LHVA 1VE7A 3ID6C 3MAGA 2OKCA 1PU2A 1RYDA 2OP1A 4LDQA 1M2OB 4N18A 3EF0A 1ZS9A 1T5IA 1YS1X 4RQTA 1A7JA 2YJ6A 1KOGA 1LJLA 1KQ3A 3LBFA 2JJ1D 3RRMA 1NLFA 1TMOA 1EE1A 1GAXA 3GGDA 1U2EA 2O2ZA 4YJHA 2FOLA 1BCSB 4RVSA 3HDTA 1BWQA 1XXHE 3FAZA 3HCDA 3Q7QA 3OWOA 3P4UA 4CHTA 1MOPA 3C6KA 4GMGA 3GXBA 4M9QA 2XZDA 1WJGA 1TM5E 4O0LA 4XGKA 2CJXA 3WQBA 4A10A 2AOVA 3B52X 3D8SA 4N54A 3ZLJA 3SVTA 1XSEA 3VR0A 1V2GA 2HI0A 1OBVA 2BKEA 3OLQA 1VMAA 2VRWA 3RU2A 3IOCA 3U7JA 5F1OA 3LOPA 3IFSA 4PFQA 3T5CA 3EUWA 1U1CA 1GKYA 2PRSA 4FKMA 1B4DA 3UOWA 2IH4A 3KQQA 4DDTA 2B69A 1N92A 2NNLD 2PKRA 2R1UA 1E9SA 3AZOA 4RY0A 4C0XA 2RGCA 3DPSA 1RJWA 2ZB4A 3HB9A 1JHUA 4AZ0A 3G9ZA 4GOKA 1KSHA 5CXUA 3J81k 3EIEA 4XOIA 3RADC 1DT3A 3ZLBA 3NTXA 1S8AA 3E35A 3AHJA 3P9KA 4FFRA 2VHUA 4NKRA 3GHYA 3V5NA 3ER8A 4GPBA 1AIPA 4R16A 1C3XA 1IRIA 3N05A 2AVNA 4NOLA 3U0VA 1TF7A 1X14A 2FMHA 3DQQA 4BJHB 5ADUS 4Z9BA 2GBPA 5K0TA 3NM5A 5EIOA 3LD9A 3DBHB 4CT0A 1V1RA 4E6EA 1XO1A 2A35A 3A6HA 4WK0B 4HHEA 4Z3DA 3RS2A 1H0HA 1KJYA 1PJTA 2NXCA 3FFAA 3LV8A 3NBMA 3OBBA 1UXGA 5TJHA 1HEYA 3ACDA 4FFNA 4KZPA 5A2GA 3DLHA 1YBAA 3L41A 4LZJA 3DWGA 5K1ZA 4IV8A 4P7JA 1SVWA 4URFA 4DTIA 4JC0A 1XPUA 1H5QA 2D0PB 4KWCA 1IWBB 1RJEA 2JRLA 4N3BA 2ST1A 5A02A 5C1BA 3QPDA 1VL6A 1J5XA 2C59A 2N9UA 1R0KA 2O2XA 4NBSA 1ULUA 4JVOA 1UP7A 4G4SP 5NLLA 3TTVA 3UMSA 1J99A 3B3JA 3FPJA 4KDFA 5B12A 1AGNA 5FHRA 2HNKA 1RQPA 2ZUWA 1D0IA 2I2AA 5DCYA 1E6LA 4TT3A 5ALDA 9LDBA 5CCXA 4DV2B 1HDCA 1DAIA 3DAFA 2FR8C 4GUDA 2VCHA 5LN1A 3TGPA 2YQ4A 1E3LA 4O5AA 1OASA 4IXWA 4MUNA 5KAMA 3L7DA 5HP4A 1RHMA 1M83A 4C03A 2PRYA 3CR8A 1T0BA 1JBEA 1QIIA 3B70A 2Y66A 3P2MA 2XOKA 3SIWA 10MHA 1E1KA 2YY5A 3FRIA 2VP3A 4P4LA 3V8MA 5CK4A 3QKRB 4PRKA 2NUAB 1JIXA 2YV1A 4Q7QA 2YXEA 2F55A 3Q0EA 1Z36A 3V8PA 3RB8A 5DRYA 2SKDA 1LTQA 3FDZB 1AF7A 3T7AA 1XMIA 4G0XA 4ARZB 2C8VA 4C0BA 2P1RA 3A4MA 3NAMA 5TARA 4ZJUA 1NW6A 3DOUA 3EUFA 1FPQA 1KEZA 1XKXA 4KV7A 1Y5LA 4HR7A 1PTJC 5HZKA 3OLZA 2I4TA 3HL4A 4ZI7F 4ZI7A 4CEJB 2GCGA 4URXR 4IEEA 2HIGA 4ALLA 5K3FA 4HH3C 2E4ZA 5A4KA 1LUAA 2BFFA 5TT1A 2ZRKA 2W6JD 1O95D 1YZQA 2JIBA 4IDEA 1L5VA 4DL9A 4FNMA 2PUJA 2IYAA 2VF7A 1NFRA 1XD8A 2IRWA 4BU0A 4F12A 1KQOA 4LRWA 4D97A 5BR8B 3GAAA 3VZSA 4HNAB 5D3KA 3O1HB 1FCJA 1M7HA 2FWPA 3V8NA 1H94A 3BF7A 4H77A 3INNA 3FUVA 3HG7A 4M8KA 4NVRA 1L5NA 1PL6A 1XLWA 1Y7LA 3SC4A 4GLJA 1VXOA 4QJBA 1AQIA 3DKIA 4MKGA 2IC5A 4XD7D 1KEUA 1F17A 1I7NA 5AI0A 3PNKA 3IPCA 4AN0A 3H6KA 2NV6A 4H3SA 3N39C 3Q8XB 3OM8A 4CF6A 3PZBA 2QRUA 3W8DA 2HCFA 1A9OA 4WXMA 1RC0A 1Z68A 5IKOA 2BSAA 4TZ0A 4KXXA 4WTOA 2VT6A 1Z62A 3TBHA 3VAYA 3H5NA 1JWLA 4WZ6A 3JQ6A 2ZRDA 4FYJA 4MVYA 2KWIA 1FSZA 4XDYA 4D46A 1QRRA 5A4FS 1L7EA 3AEQA 2X3FA 2BSQA 4Z8XA 3W6UA 2YINC 3PPXA 3E70C 5FUYA 4ZO8A 2OYRA 4EUEA 2EYQA 5DEIA 3VR4H 1QRTA 3I28A 3M4JA 2XYGA 3RYHB 5EKDA 4KXYA 4P22A 4ZO6A 5E7QA 1XHFA 3DDUA 3PNVA 2EKLA 2Q99A 2QGNA 4A0FA 3RWBA 1A2OA 2AFHB 4M38A 4UFOA 5EINA 4Y1FA 4GP9A 4P31A 5JNVA 2PT7A 5KIAA 5JD3A 2H0RA 2O14A 4R9RA 5FUVA 4UCQA 2QTVB 1JYEA 3B3GA 2NSJA 1PD0A 2QTGA 5A4DA 3GW8A 2GRAA 1DPGA 1I5OA 3FHOA 4MR9A 2MMCA 5I9SA 1IN4A 4LF4B 2OAEA 4G1CA 1T26A 2WJGA 3NHMA 4B1FA 3FCAA 1L7RA 1ZW6A 1DSSG 3DR3A 3LFHA 5DGHA 4B31A 4UHEA 3GPCA 2Q28A 3B48A 5IFLA 2OUIA 1E1DA 2NV0A 4E88A 4MUKA 3W2EA 3DTNA 2UUBB 3AIMA 4OGLA 3M33A 3K70D 3N0VA 1RZRD 2ZXUA 4YV0A 2WA1A 3SKVA 2V6MA 5LWHA 1N2JA 4HTAA 3GLGE 4I14A 4GI3A 5EKSA 3S6JA 1SBZA 3VMMA 4D8XA 3I8SA 1W47A 3WBKA 2VVTA 1N6LA 4WK2B 3QELB 4DQ0A 1SHLA 2M1ZA 1DDOA 2D1RA 3HGTA 4I5EA 4L8LA 4MYTA 1ESZA 4ADSG 3IPAA 4N7JA 3BMCA 1ZRSA 1SD5A 2JW5A 2H2HA 2W2MA 4EJFA 5FV7A 4ISCA 1HE5A 3FBWA 2Z2IA 3KOYA 4I1IA 4A8JA 3P4XA 4GQBA 4MPRA 5BURA 5AQ1A 3KQYA 7REQA 2BUCA 1K4MA 3AR7A 3GGOA 4CDNA 2WHPA 4MRMA 4CG2A 5K8IA 4BNZA 1JP7A 5KTKA 1FJXA 5GVSA 1TO1E 4EO4A 3QFCA 4KU4A 2QYOA 4AY6A 2QXTA 3EDQA 1V35A 3M4YA 4QYSA 3ZV5A 2BEUB 4JC8A 3RSQA 3MCAA 4JZYA 3MCZA 4CGYA 3KFVA 4FDLA 3MNFA 3R24A 1PT7A 1G20B 4JK3A 1J0AA 4ZZIA 2AFRA 2G5TA 2Z9BA 5CGZA 4A16A 2YH2A 1EZ4A 3M6XA 3PD7A 1ZGJA 5IBRA 3IL2A 1A8UA 2DSTA 3BKWA 4TXHA 4O0MA 2HO4A 2UVQA 4IFBA 4XYBA 3VTKA 2FVYA 4BEWA 2ZM6B 2P6OA 1NA5A 3EZLA 3MUFA 4M53A 2PL9A 2FOIA 4PSCA 3S2EA 1XTRA 2RGAA 1TUGA 3I1FA 4U8HA 4G2TA 1HLPA 3R6WA 3KKKA 4EKYA 1XTVA 4LF9B 3EXIA 1T9GS 3ND7A 4KLRA 2NZ2A 3E4DA 5C31A 3E9NA 1QGDA 2JKZA 4B4OA 3KD3A 3QUBA 3RC9A 4WK6A 4K6HA 2HWWA 2H8GA 3ZLUA 3GNTA 1JJAA 2J6BA 3AHGA 5GY7A 1KI2A 2PGLA 5U1PA 2R7AA 3G23A 3CUTA 1ZD4A 1Q12A 4Q01A 2EKDA 3I52A 3P9XA 3PI6A 1BQ3A 3USCS 3WSWA 5LDDC 5JG7A 2WVAA 3AM1A 3UJNA 1RZUA 3PUIA 1ML4A 1XXHA 2ONYA 2IIQA 4NWIA 1HFKA 3ZNNA 3B12A 2DQKA 2AI2A 3RREA 3ETEA 5LJIA 4B6RA 1JR3E 1IJKA 3T9EA 2WF7A 3JATA 2QN6A 5KJ6A 1Q19A 3KUDA 2RHBA 3LY9A 1YE5A 3C3MA 4V02A 4YPVA 1SM4A 2QG9A 2FR1A 3DW1X 4X60A 1RYNA 2JAOA 3BMNB 4MW1A 3DVRX 4MW2A 2CEAA 3UUFA 5FAXA 1IM8A 4MPTA 2AC4A 2QAJA 1OWPA 4MQMA 2G17A 4YRKA 2WYOA 4MHTA 2Q2QA 1FUUA 2FPIB 4MINA 1PR9A 1XMXA 1BDJA 1KPGA 2BF7A 4MS4A 4RF5A 3TS1A 4YAIA 5CEFA 1TEZA 1JDBB 3ZBQA 4J7UA 1J9ZA 4P7BA 1RLMA 1HZZA 3FYUC 3EGWA 4GO1A 3F7MA 5CD1A 1DKRA 1AE1A 4YHBA 4GKKB 3S81A 3HYRA 3B1YA 1DJLA 2ZAOA 5ENVA 4A5OA 4FYVA 2FOXA 5K01A 4QIHA 5K51A 2V7PA 3TUZC 4AW9A 4RJLA 3CB2A 1OH6A 1U0LA 2CGEA 2AJDA 2NSLA 3MTJA 1XCJA 5DHFA 1P9OA 2OXTA 1HX7A 3OH8A 2FV8A 1UT8A 2GAJA 2I4RA 4Y6RA 2E5FA 2HJRA 4BKPA 3WB2A 3U6BA 1OAAA 3WLNA 2E9SA 3F1LA 5KQPA 4I4LA 4PGAA 1WM1A 1KK3A 3AFIA 2A9RA 3AUSA 4LPKA 3D6JA 4O2RA 4AY4A 1DCFA 1KHHA 3TRHA 5ALHA 2HMUA 5DKFA 5FNVF 5FNVA 2NVUB 3CB4A 3RGGA 3UHAA 1N3LA 2DX7A 5JD5A 1K7YA 3DOIA 1KI6A 3OIVA 2PVCA 3UPTA 1VKRA 2VDPB 1EWVA 3OCWA 1UMDB 2R6HA 2J4DA 4WA7A 3ACBA 1Y3FE 1YUBA 3OOHA 2JLBA 1Z6QA 3KIPA 1KYXA 1W52X 1VGVA 1UQRA 4R1SA 2O3QA 1GAJA 3IQHX 1LC3A 1U7XA 2IP1A 3KB6A 4IDBA 3WBJA 2YJ3A 2EJWA 2BH2A 1SK8A 4Q3OA 2CMDA 1WP9A 2MWMA 3LQKA 4H1UA 2FDCA 1VJ1A 4RGYA 1AKVA 4N0MA 5FTJA 4DZZA 5JW6A 1Z2AA 2X0KA 2XT9A 1UXKA 4J43A 1O5OA 5IX8A 5T7BA 2P2NA 1YQEA 4PYRA 1P0CA 1UC9A 4UPEA 4GKJB 1CEXA 4NATA 1F2VA 3NIWA 1HZJA 3UJDA 2I2CA 2QN2A 5TMEA 3II6X 4X8LA 3WKAA 1SUDA 2FUNB 3E9RA 1QM5A 4UM8B 3RS8A 2BFEB 3ZGXA 4ZCQA 3EJ6A 1SIOA 2JCBA 4QUEA 4HAWA 4HUQB 4BMNA 2PQ2A 3BGWA 2BFDA 2OO7A 3DULA 1CQIB 4DLSA 3F46A 3B7PA 4R3UC 5C52B 1PNTA 1MAAA 3BM5A 4KQHA 4PIMA 1AK1A 5SZIA 4RSRA 1YVRA 3IA2A 3CLUD 3A3PA 3IA7A 2HEGA 4D98A 4HFMA 1QIFA 4R2IA 3FMVA 4P4UA 4B9AA 3E15A 4JJ4A 2D2XA 2FZ4A 3ITKA 5AVJA 4DJDC 4H7IA 1NVEA 1X7YA 5EWLB 4FB4A 3QLVC 4G0NA 2XVAA 5I8WA 2Y2VA 1YMQA 3HPRA 3BJMA 4LS3A 4AUMA 4K87A 4BFWA 4B5KA 1Z2PX 4Q82A 3NHPA 2QV7A 3KDPA 2APJA 3R5TA 3CVOA 4US0R 4CQMD 5I3CA 4FKBA 4XCVA 5DM0A 4DQUA 1G7CA 1W2GA 1OD6A 2FX2A 3ASYA 5F1KA 1ECGA 3TH5A 4CMGA 1BN6A 2G0NA 4Y2QA 1T9CA 5C3MA 2AZMA 5HMLA 4E5UA 2H31A 3OM0A 1DUVG 4DQDA 2E4AA 5LQKA 1Y6FA 5EPEA 2C2KA 3KHSA 1QIHA 1WPXA 2Q4DA 4CETA 4KGDA 1T5OA 4ZPJA 2V6FA 3TG8A 3SYTA 4C6HA 1E7YA 4Y9UA 1JQEA 2E55A 3B20A 3WMGA 3UMVA 3COJA 1L5LA 5DCWA 1E7WA 3JQGB 1EDEA 4B7UA 4DMCA 1E7RA 1Y6GA 4RGQA 5KPDA 5B57C 3T7EA 1E3DA 4PC1A 4KQXA 1EA5A 2VJAA 1E69A 3A1TA 2GK6A 5T4EA 4I8IA 4MJLA 5A1JA 4UEJA 1SB8A 3Q3HA 3OCYA 3PIDA 4NE7A 1JDJA 1OXKB 2YVQA 3E3LA 3TTSA 5JFTA 1OB5A 3AY7A 2VDVE 1MU0A 2QY6A 3ETHA 2Z83A 4JV5B 3VNBA 1NVXQ 1K6MA 1XQ1A 2R8YA 2X1HA 4EY3A 2ZJZA 1X1RA 2Q5CA 3RYCB 4BP1A 2ZIXB 1NFQA 1G66A 1HTBA 1W1WA 8ATCA 1SXJD 3HP4A 3KU4A 1GV0A 4AJ2A 4H6PA 5G4KB 1L9XA 1MA0A 2IP2A 2HQOA 3GN2A 5HIAA 1K9SA 4C7BA 2R0QC 3H05A 4BIMA 1WXIA 4EKNB 2NQ8A 4L8GA 4TKVB 821PA 4P0QB 1KOLA 1JB1A 1O1YA 3A9CA 3NRBA 3DGEC 2PZLA 4BP9A 1W0JD 4OKSA 4PC7A 4AM8A 1E5VA 2XSZD 3A6EA 1TVKA 2ZRNA 2R84A 3JCZA 1GGMA 3U80A 1LS1A 3NHBA 4EAQA 1ORTA 3IURA 1AB5A 2ORIA 1VMKA 2YUTA 3AL3A 1L7XA 3FNRA 3WBBA 3ZEIA 4JKOA 3VKWA 1O9HA 1FUYB 1WXGA 1K6EA 2YQZA 2ZYUX 2YY7A 4QDKA 3PFIA 4TSRA 5DTRA 1HI9A 5B3KA 5KYXB 3WO1A 2OGSA 4OJQA 1BS9A 2VWGA 3AESA 4IW3B 2AKYA 1N0HA 1XDSA 4QRDA 4EKDA 1G3QA 1QKJA 2H2WA 1Q6YA 3AGPA 1AUXA 3FCSB 4NY1A 3U1TA 2Q4BA 2FDXA 9ATCA 1K5PA 1SVSA 1X94A 2HJ9A 4OPMA 4Q19A 2IS2A 4P5DA 1AK2A 1C7QA 2AOTB 4YJKA 3ECCA 1P19A 1FQWA 5CP8A 5MN6A 3O8QA 3P0RA 2AQKA 4G5XA 2ORVA 5DSZA 2P2LA 1II0A 2DERA 3V8VA 1Q50A 6CHYA 2CMGA 3AF3A 1AG9A 1P8AA 4DLNA 1SXHA 1KGSA 2EL9A 1T2UA 1HLFA 1HC7A 1RKXA 5BWMA 3FI0A 1LBEA 1GQ2A 1SG0A 2NLOA 5E6UB 2Z56A 3JWPA 3E7PA 1P4GA 3PITA 3BIOA 2YYZA 4DV0B 4Q3KA 1M6VB 3G2IA 3B6ZA 4LQDA 1AXRA 4R2JA 2JVKA 3C8HA 2XRYA 4XGQA 1ZGZA 3W7BA 1ZJYA 5GJCA 1AA6A 1HF3A 4UD6A 2PBRA 3FMPB 2QMOA 2C9DA 3N2NA 3X1MA 3MJ4A 3B6EA 3ZXUB 2R6DA 3KXLA 2O2IA 3F3SA 1AQLA 1G64A 1QIKA 2I1LA 2QGZA 4ZOCA 2ZXFA 3FPBA 2YMQA 5FBZA 4BX3A 1M3SA 1E0JA 2PX4A 1TK3A 3H0EA 1CIPA 4PXAA 3T4EA 3ZDEA 1N9GA 2HSDA 3UHFA 1TQ8A 1VA5A 5AHOA 3TQFA 4HLQB 4CLDA 2VHVA 5H1YA 5CURA 3PEFA 2IYLD 3KWLA 1QHYA 1Z8HA 1DLIA 4EPYA 5L45A 3SEAA 2BRUA 1OWLA 4GXRA 2G63A 4HNHA 4IGFA 1OFGA 4C05A 5JSHA 2GM5A 3FFWA 2VLBA 3G2JA 3UYKA 1N78A 1HFEL 4BP8A 2LTAA 1BH6A 1P9LA 5IULC 5BSWA 1QJ4A 1JTFA 5H3LA 3U4AA 4B6FA 5C1OA 5JNTA 4HAXA 1WCXA 2A0KA 2BE7A 4HAYA 4EJSB 5L40A 1K3FA 4MQEB 2A78A 3HMQA 2RDMA 2ZBRA 3AO0B 4YJFA 2YNMA 5AK6A 3B1KA 1X86B 3HLYA 3M6LA 1MLDA 3UUEA 3JAMA 2B3TA 1A04A 4Q16A 1X1SA 1M5UA 3ZWKA 1VIAA 4LDAA 1E2MA 3LUCA 1V8BA 1GZ5A 4OBXA 4ERXA 1A50B 3CMCO 5IHXA 3GRUA 3Q9SA 3LHKA 3H9GA 2YXLA 2GXAA 1ZN8A 2I8LA 1JU4A 3KHTA 2WAOA 3VDQA 5FOTA 4EY7A 3VMFA 1RVV1 2J3LA 1G8GA 4UUMA 1QHHA 4TUYF 4TUYA 1OZAA 2WV9A 1AGXA 4YNBA 1TQ6A 3CN9A 4WD3A 5EZYB 4RSHA 4BVAA 1SC3A 5KOHA 1E1CA 2PQ6A 1Y8ZA 4IHQA 1FMTA 3IDZA 1F6DA 5EZ6B 1L5MA 5ALXA 3H99A 1ZAKA 4WOPA 3VPXA 3IALA 1XIVA 4BTLA 2PAFA 2P75A 2TSYB 3VDMA 4RVGA 3EXG2 3NHRA 3F47A 4IIHA 2HMVA 4LY0A 5PGMA 4EUNA 5BSKA 3SOPA 2J46A 4QU9A 1SKUA 5ABPA 4CLRA 4Q1AA 2YCBA 5EWJA 2OBLA 2NU6B 4QQNA 1E92A 5SICE 3PGJA 1GTVA 3AFGA 4IDGA 5K2OA 5B1YA 3R7FA 2BFAA 2C8JA 2PTHA 2UXCB 4L5AA 4GBGA 5A7HA 5KNBD 1N5JA 1XA3A 1AN0A 3OZCA 4MWEA 3WRWA 3HVRA 1FEZA 4DBZA 4Q3DA 2AB0A 3OFVA 1NKVA 3E2MA 2QX4A 3EASA 2CNLA 2Y1WA 1PYDA 2IU3A 1UJMA 2HBQA 2IVZA 3NZEA 1JG1A 3L8GA 2Q2OA 1C3LA 2C3UA 2XMBA 2ONCA 4TROA 5F21A 4UTNA 3ITEA 2WIBA 3WWOA 1XRJA 1R2QA 2C2OA 2HN9A 2P9GA 3IPLA 3BORA 3OU7A 5C18A 1LLQA 1M10A 2C0PA 3OECA 4C0KA 5BN3A 4V2UA 5LMNB 2C4TA 4J8PA 5LM3A 1TKCA 1UBJS 1ZHFA 2H59A 3BAFA 4F8EA 3FF1A 5KOYA 3UMMA 4AJPA 2PZGA 2ONJA 4JJIA 3TZEA 2B8WA 3GD7A 4B40A 3AG6A 1D6JA 4A6PA 2AJCA 2PMDA 1G42A 1V11B 3A6JA 1DTWB 5A04A 2JBWA 3VVBA 3ZDZB 4F5EA 1QH1B 1ZL0A 3NHKA 5D00A 5JCJA 1NBME 3KAJA 5TDHA 3BT7A 1E2DA 3LZCA 2GPYA 3P0EA 3U4GA 3DLBA 4RDCA 2J0UB 5BQ5A 4NK4A 3PWSA 3LLVA 4HGZA 1X7DA 2HRZA 2ISSD 2VAXA 3VR4A 3ZYZA 2KLBA 1SBCA 1P44A 1TW3A 1Y5IA 3DS8A 5LB2A 4I1PA 4EHHA 3AMVA 3LQFA 2GFHA 4Q47A 5DT9A 2IV3A 4Z1MD 4YT2A 4BAGA 2ZI7A 3KWJA 4KFTA 1YRQA 3MJEA 1JEJA 1FXSA 4ZKDA 5EA2A 4JQSA 3KQKA 3U56A 4RVUA 3VM6A 4GX5A 4MLDA 4Q4DA 2DY0A 4A2WA 2O59A 4N82A 1U31A 3EXFA 4DYHA 4NCAA 3FYTA 3F3MA 3B6KA 1BVHA 4H7JA 3F90A 4IXMA 5G0VA 4DC0A 3PR1A 3EE6A 1XJCA 2D1QA 3PQ4A 4MQLA 3AI3A 1QK4A 3SBEA 3WB1A 1DBWA 4CR8A 5DW3A 5ED4A 3PSAA 1XJ5A 2P90A 1EQ2A 1MKYA 4RNDB 4D9GA 1MRSA 3V8RA 1B6RA 3WB0A 2CXQA 1QR2A 2QP4A 3LPMA 1JEDA 3MFYA 3FFTA 3MSXA 4CM4A 3KBOA 5AVZA 1PFGA 1HPLA 1ZM7A 1D07A 1IB0A 2Z1NA 3PYXA 1PTKA 3DBRA 3FKSA 2P35A 4E14A 4EW6A 2O9JA 2CYAA 3EXEB 4LSGA 2JASA 4WWHA 2IY7A 5EP3A 3RANA 3A25A 2WEKA 3N5CA 5LP6B 1EHIA 2PVSA 3O7WA 3PEEA 1G291 2VBFA 1BAPA 3FFXA 3WRYC 1W36B 5K0ZA 1LQUA 1Z47A 2CVQA 2DQSA 1ABFA 3KM0A 2PANA 2GHTA 1IBKB 2PYZA 3H2JA 3HBMA 4U2GA 3UTCA 5A9SB 1SHKA 1TC2A 2AI1A 4CG0A 5BWNA 4NV0A 4V1CI 3OFSA 1ECBA 2ZLBA 2ETXA 2AYYA 1VE3A 2X3UA 3CJQA 4L0CA 1HMPA 3RBZA 3S5UA 2LVBA 4B6OA 2ENWA 3EQ7A 3LCCA 4G25A 2X0FA 1KYVA 4GLBA 4MKZA 2OSBA 3K9NA 4GLLA 5ILGA 5I4BA 4Y2XA 4CEIB 3CE9A 3GT3A 5K8UA 5JQGF 5JQGA 2E5WA 2Z4RA 2R48A 3NGLA 4YAUA 4UARA 3TW8B 3SDSA 3KEOA 3VYWA 1YNOA 4TMWA 4WCFB 5I9BA 3BSWA 2HA7A 3VGPA 2H4XA 3GZTB 3QNWA 4OYLA 5GOTA 1R4NA 3AETA 3NYRA 2EDAA 4V2IA 5FPSA 3S2SA 3KLBA 1E96A 3F5FA 3KQMA 4J3JA 4WFIA 3U3XA 4X94A 5KEIA 4LJYA 2WINI 4OI0A 1NNUA 1ZSNA 2VPZA 2E5LB 4KN5A 1Q84A 3NQ41 4IZ6A 1VI2A 5FRDA 2X9QA 3DAYA 5DMHA 4C3UA 5LYJB 3NTRA 1Z6YA 4XUGB 5EC8A 1E1MA 4MULA 3UV6A 3WYNA 2W2LA 4JP8A 1ISMA 4B3RB 1GL3A 1IG3A 3NT2A 3FVQA 4AECA 6ABPA 1QTNA 2AKEA 4AFNA 4I4CA 1N2BA 1NBIA 4G01B 4TQ9A 2DB3A 2Q3DA 1JFFA 1B41A 1JSZA 3CLRC 4QSMA 4TYWA 2P3LA 3F6SA 4L5JA 1UPXA 4Y18A 5CT9A 1LTHR 1Z4JA 5KHAA 4FX5A 1P0PA 2VP6A 5TGTA 1YI1A 2AOXA 3R41A 2HLNA 3QIVA 1PR4A 4LOJA 3NOVA 2JFWA 2XHZA 4LV6A 4RKFA 3W4JA 4CKWB 4F5DA 4HWOA 2WWIA 1DARA 1DKLA 1MH9A 3ZGNA 4NMLA 5DXFA 5F5NA 2UXDB 2FWJA 3Q2IA 1HA3A 4JOQA 2IITA 4KSCA 3DL2A 2AR0A 4BO7A 4UTPA 4MIKA 2BFWA 1QRSA 2FXIA 3KKEA 4QJIA 4J16C 3DKKA 3UAGA 2QNIA 1SPBS 2PZAA 3KDSE 4PLYA 2FZCA 4JVNA 2VJKA 3NNSA 1D6SA 2O0KA 3KJFA 1N4AA 4IMIB 3WQHA 3PF8A 2OZKA 3RSHA 3IBSA 4L95C 2EKZA 4L5BA 3AY3A 4DREA 3TWOA 5JYEA 3HR8A 1DFIA 4RKYA 2DBYA 1QG6A 3L84A 5CK5A 2X77A 3KO8A 2O05A 2RHRA 3HUDA 4TV8B 3NV9A 2PZMA 2R00A 2WPDD 4CV3A 3AERA 2NU8A 1DE0A 1ESEA 1GG5A 1T3LA 2GHRA 1L7DA 4DWOA 8MHTA 2LE0A 1A95A 3N2EA 1YDEA 1U8ZA 1N0WA 2JAQA 2P11A 4PZZA 1TADA 1IM5A 2QK4A 1SH7A 5EWMB 3F74A 2JFPA 1Q0TA 3VTAA 1IJFA 3PHGA 2CT8A 5TMPA 2H57A 3PQ8A 4A1OA 1LSJA 4B6GA 2UYCA 1MTZA 4LDNA 3WKDA 3PP8A 1L4KA 2XAAA 3ZC3A 2JC3A 2D2IA 4CMAA 1MR3F 1VCIA 1S3GA 2XYHA 3A6GA 4ZT6A 1XCGB 4D45A 5HFJA 1X7GA 2G71A 2RIPA 4DDHA 2JLQA 4QM7A 1HOXA 2MU1A 2GJ4A 1YZGA 3VR6D 2BBTA 4XCQA 2HRQA 4PNZA 4P7FA 3IKLA 4A0RA 4Q6WA 4CKBB 3DC7A 3EG9A 1JQAA 1US8A 1GRRA 4HDSB 5EZ5A 1UMBB 3ENKA 4W5NA 2BGWA 2VYQA 5BN5A 4HATA 3WVNA 4L3OA 5MF6A 1WUYA 4U3JB 2ZYAA 4MV7A 1BX1A 3S2GA 1ZVMA 4NOJA 1NXOA 5DO9A 3T9FA 1H2BA 1SAYA 3LWBA 4LXQA 5TRTA 5A5FA 5HKKD 2Z58A 4XH9B 1QCCA 4C6TB 5CIYA 1RPTA 2XKKA 4H60A 1PHPA 4NU8X 2E87A 3ZN2A 2R86A 2CMKA 4ZVPA 1Z8NA 3MJSA 3RTCA 4E5VA 4AQ7A 1QQ7A 3CHYA 3EVEA 3C1AA 4JEHA 1VLMA 2PPVA 2DR3A 4O2BB 5H5JA 2WOJA 4LX0A 3KCQA 4QQFA 3MWFA 1PK7A 4UJ3A 1ZOPA 5ALGA 4U2EA 1QO0D 1EP2B 3OX2A 1FL9A 4KAAA 3OPMA 5BOSA 1J70A 2H1HA 4IKPA 4UM7A 4ZV7A 3ZHYA 1M2JA 2WYWA 3EVNA 4PN7A 1CYDA 4ZHQF 3HB4X 4M60A 4PPGA 1Q0SA 2X5NA 3NHYA 1N5IA 3QW2A 2AMVA 2MSNA 1O6CA 2YMMA 4DMLA 2WP8J 1FXWF 1AZLA 1FXWA 1JSRA 1LDBA 3A11A 3EHDA 3AEXA 3MTGA 2EQBA 4JGGA 5JVDB 4NXNB 4HAVA 2QYSA 3JVDA 1V47A 1NOJA 1TJYA 1AN9A 5DI3B 1H6AA 1H1LB 4R7ZA 3ZDFA 1U8AA 1GUYA 4OLBA 2JD0A 2BFBA 2I2BA 4MWCA 1IVNA 2PGAA 2O5RA 3DTVA 4IKEA 4X3PA 1ZNWA 3VO8A 4Z4QA 3OF2A 3DAHA 1RHKA 1GSIA 2WYHA 3F5SA 4PGFA 4X97A 2IU0A 5J4KA 4YONB 2ZTHA 4LKOA 3QF4B 3STWA 1MZPA 3U3OA 1DV2A 1P1HA 3ZG6A 4UTRA 3JZMA 2M9MA 3CW8X 1PGQA 3UAVA 1JIJA 4LUCA 3WO0A 3O3MB 3LW7A 1XTZA 4RHCA 1CY7A 4MS1B 4Z53A 3ZBTA 3CLKA 4G9EA 1DXYA 3LCVB 1HDZA 4TS3A 1E5DA 4QUHA 1DLJA 3W7VA 2J3EA 1O97D 1JXAA 3A37A 3IAFA 3HABA 3I04A 3D3KA 3O4RA 3R0XA 4FBMA 4BX9A 5HM6A 2NM0A 3VAAA 2Q1UA 2H4ZA 1RKBA 3K9HA 3HXKA 3IV7A 3O0TA 3QYFA 5K6AA 2VQ3A 3H19A 1K8XB 2VDJA 3OE1A 2EP8A 4BWYA 3DUWA 1OOEA 1WB6A 1YL5A 4UEKA 3VO2A 3B9BA 2Z04A 2XCRB 2F4NA 3OZSA 4EG3A 1PUJA 2BJWA 3THOA 3SX2A 4HAIA 4II3A 1ZI9A 1RU3A 5JQWA 2PU5A 4C08A 3IMCA 4DCPA 5HR5A 1CC1S 3DMPA 1XD2A 3CX4A 2HJVA 4XDHA 4XAQA 2IYVA 4OCZA 3ZZ0A 5KBYA 3QJ5A 4K0KB 2QIOA 2O1XA 1CSEE 5TR9A 1GNTA 5AVYA 4MI3A 5DOVA 3RSCA 1VCHA 2Y67A 1KVSA 1R5NA 1Z2OX 5I51A 1R0CA 4DLZA 4CJXA 1FDSA 4JB3A 4XD2A 2EW2A 3AB3A 1FDOA 4GDMA 4ND1A 2VYFA 4MPPA 3RRBA 1JB9A 2CHEA 1KE1A 4QUAA 4JQCA 1OLXB 5GJBA 2RAUA 2WFMA 1LX7A 3A4NA 3FNFA 3HYCA 1G9XA 1ML3A 1ZN2A 3BEOA 3BGSA 1K7SN 3LPAA 4N01A 4WECA 3CZPA 4IKOA 1ESCA 4RPJA 2B2NA 3O4VA 3G8BA 4OXQA 2WUWE 3H2GA 1E5QA 1CJCA 3PB3A 1B8UA 4ZAXA 1TAHA 2QPAA 4E31A 1BWPA 7ABPA 3INYA 1NVWQ 4YP0A 1J1UA 3O8LA 1GT6A 3WLRA 1EM8A 2FPUA 5LMUB 2BEWB 1AURA 2Z6QA 1C9DB 1CUVA 3PDJA 4OOFA 3JU3A 4TWJA 2O3RA 3VPCA 4ERNA 4F46A 1NP3A 3N5KA 3A6LA 4N7MA 1K9VF 4EW1A 2HTFA 1D8AA 2DWUA 3VSDA 4EVIA 4X63A 1T2NA 1KPHA 1X9IA 3MLBA 4RMGA 1GQYA 4WUVA 2RGNC 5D3MB 3VH3A 3D7KA 2AMYA 4J0GA 4MICA 2R7MA 3WYCA 4BV2A 1U2GC 1ZK0A 2H2IA 3NOQA 2CDAA 3W9UA 1R27A 3MT0A 4ZREA 3F73A 1Y3IA 4G63A 3BKXA 4JOBA 2CXNA 3OTQA 2BI7A 3IRVA 4J2TA 1ABBA 3I5AA 1DEOA 5EQDA 3T0FA 4JNCA 1D9ZA 1GQOA 3B60A 4OKIA 5KQGA 4CN8A 5DGCA 2Y1DA 2M98A 4Y6SA 3L7CA 5FA6A 3HNOA 3AVXA 3TQTA 1J07A 2H11A 3RUFA 3QYJA 5COAA 3PHLA 3O26A 5K0BA 1X3SA 2Z6AA 3AQIA 5CT6A 4QC2A 1KI4A 3G8AA 3L9XA 5DGXA 4N3GA 5AO9A 2Z09A 1O95C 1Y5RA 3NALA 3G0OA 4ZT2A 5KVVA 4Q02A 3GJSA 4OX9B 2QGFA 2Q9AA 3HXMA 4LBYA 3CXRA 3RRJA 3C24A 1DCKA 2HU7A 2CLEB 5LZ2A 2ZJ3A 1SU7A 2I9PA 4ZHSA 1GJRA 4Y2SA 4JWTA 3MCVA 2AOUA 1VJDA 3SDBA 3L7BA 3QTBA 3RG8A 1D4FA 1YRYE 4TLBA 4WOCA 2GCOA 1UAAA 4Z5XA 4PRZA 5AJHA 1BROA 1PV2A 4WIAA 4I81A 2YZ2A 3UXYA 4AO8A 1GA4A 1KDTA 3EB9A 1EK0A 3DFUA 4MPDA 4MGHA 4MRRA 3C6BA 3HXOA 2PUFA 3LG2A 4K1XA 3WADA 1PFUA 2OHIA 1DXHA 2KBFA 3N2KB 2Z3ZA 5TQ2B 3ZKWB 2L2QA 3Q3CA 5LOVB 3WIEA 1XZJA 3A2KA 1FP4B 1TU3A 4G4GA 4TM8A 5DNYB 2Q8PA 5FTWA 4I50B 3NCHA 4DCOA 5ESXA 4PZEA 1XGKA 3EW7A 3VJLA 5KSWB 4US2R 3K9WA 1HK7A 1TUBB 1J21A 2A5FA 2OXFA 4P4TA 4CF4A 1HTTA 2A0YA 2QM7A 2QW8A 2GWRA 2QU7A 4V3BA 3GAMA 3N07A 3SQLA 4AYXA 5CX1A 3RC7A 3QX3A 3GRPA 1PGNA 2W2VA 3ONFA 4ITUA 4TX1A 4L6IA 2WG0A 1U6IA 5SYAA 3QFFA 3MN1A 2C3OA 4UTVA 5HQ3A 2P69A 3GRFA 2C82A 4S2UA 4C6SA 3DE7X 2HB6A 2G82A 3GR6A 4U0JA 1ZM4A 3PDUA 4UNNA 2WF5A 2PUTA 2X58A 4NNJA 4DC9A 2N0SA 3NW9A 2B0JA 3LK7A 1CIJA 5K3DA 4BYGA 3FOAA 3IAXA 3OLCX 1K8ZB 2GAOA 1NG1A 3JAKA 3TCXB 2WNSA 4JYAB 3O74A 4EIWA 2BTQB 5IJ0A 1ODTC 1VSBA 3RS4A 4TYNA 5C8XA 2H29A 4J4HA 1E5LA 2ZYVX 1BHJA 1FFGA 2J45A 3DAGA 2YQ5A 3G9TA 5BVGA 3U49A 3AUYA 3QHPA 2I9KA 5B55A 5HIMA 1CVIA 3ZU4A 1XDUA 4TQUS 3ZTTA 2YVKA 2VEOA 5F77A 1ZRMA 4TKUB 2JARA 3K72B 1JEQA 3AF4A 3UGTA 1XEXB 2FK7A 2PKCA 3FWHA 2E0IA 1JH8A 5ANRB 3KRTA 2MINB 2JIRA 4NI5A 4QVKA 4D57A 3K30A 5LL6P 3NATA 5CVCA 1D6NA 2FLKA 2VXOA 2QUIA 4L8FA 4V0SA 3UPDA 3R0IA 4ONEA 4JQYA 2VHXA 4I08A 2A1IA 3R3YA 4KITB 1PV1A 1FVOA 2W4MA 4IJ6A 1V1MA 3N7UA 4QBIA 1JHRA 1GSAA 1CUXA 1MPTA 1UBCA 4L8VA 4MJXA 2OFWA 4DM4A 2CNWD 4DR7B 4K28A 1ZL2A 4BMCA 3WYFA 2GBLA 3LY5A 1U1EA 4ZJZA 3RASA 3SYKA 1IBSA 1QG4A 3FW1A 3ESDA 3LT4A 4A91A 4D3YA 3MCTA 1E3WB 1RHQA 2ECFA 1WY5A 4NQZA 4PBTA 2HR1A 2YIJA 3SGLA 4MW6A 5BQOA 5A2QA 1N1EA 1A8HA 3AH8A 3U4HA 1CLEA 4BFSA 4HLNA 3GVIA 2EXXA 3ETGA 5DWQA 3BFKA 3WAJA 4B3CA 3HP1A 4CIAA 1S3IA 4GPAA 4Q9HA 5E38A 1ONOA 2QSUA 2RCYA 2F1OA 2BUAA 4RF3A 4UM9B 2ZUSA 3LWZA 3K16A 3I42A 1SQ6A 3AIKA 3B51X 3FTCA 1UM9B 4HYYA 4K9DA 4YAFA 1C14A 2CL7X 1DHRA 1JHAA 3NP7A 4UCXA 1V4VA 3S1LA 1KTVA 1DO2A 3NDPA 4KC0A 5DNUA 1YDWA 2YS7A 1RT9A 1SZDA 3K09C 1C9KA 4H31A 5REQA 4KLAA 3I4FA 1C30B 3NKVA 1TIBA 2PLFA 5CFNA 2R25B 2C7BA 3Q3EA 5A71A 3AVTA 5E6SA 1NAHA 4JWKA 4EEKA 1XD9A 2VDWA 3TQCA 1UM8A 3ZV4A 2FWAA 3A9UA 1GARA 2E1PA 3H7AA 3LC0A 1CRQA 4J1TC 4PZDA 4ON9A 4CMIA 1NI4A 4TRRA 4YMHA 1F4VA 3A1VA 3KLNA 5FO0A 5I7HA 5B5SA 1BMFD 4BFCA 5ALFA