2AOUB

Histamine methyltransferase complexed with the antimalarial drug amodiaquine
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
289
structure length
288
Chain Sequence
SMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histamine N-methyltransferase
publication title Structural basis for inhibition of histamine N-methyltransferase by diverse drugs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 111
structure length 288
sequence length 289
ec nomenclature ec 2.1.1.8: Histamine N-methyltransferase.
pdb deposition date 2005-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2aouB00
2AZTA 2EFJA 1EAMA 2O07A 2PXCA 2XVMA 2YTZA 1U2ZA 4GOMD 4QPPA 2UZ4A 4LWOA 3M6XA 3I64A 3OE4A 1Y8CA 3FTCA 4PCLA 2P8JA 1YB2A 3TPZA 1ZGAA 1BC5A 3E05A 3OZRA 4GBED 4P7KA 2ZIFA 1XCLA 3C6MA 1BOOA 2ERCA 3CJQA 4MTLA 3BWBA 2ZW9A 2CWWA 2YX1A 4QDJA 4E32A 3MB5A 5D1NA 4CKBA 3M6WA 3DMGA 4HG2A 3NWEA 1NBHA 5T6BA 2P41A 4ISCA 1RI1A 3PX2A 3P71T 3K6RA 3LL7A 3ELWA 1FBNA 5K0EA 2PJDA 3DMHA 4RTRA 1SKMA 3A26A 2PX2A 4IKPA 4WXHA 2FCAA 5K0GA 2QYOA 1NE2A 3O7WA 2PVCA 2G70A 4OBWA 2ZCJA 3B3JA 1WXWA 4HGYA 5H02A 2P3OA 2IP2A 2P7HA 4X1OA 4HGZA 1NKVA 3ERCA 2OY0A 3A7EA 3CJTA 3QV2A 1VP9A 1ZKDA 4YMHA 5MHTA 1L9KA 4PYIA 5CCXA 3PS9A 4RSRA 1UFKA 4CXMA 1ORHA 4ATNA 4FGZA 3JWHA 4DA4A 3KR0A 4KRGA 5DT2A 3TQSA 3UA4A 2V7EA 5KQRA 4GQBA 2N47A 4RTJA 1D2GA 1G8AA 1X1BA 2GLUA 3TMAA 5K0FA 4OBXA 4BP3A 5EVJA 1AQJA 5EG5A 1VPTA 5FCDA 3HCEA 5EKXA 5GIPE 3FYDA 1P1CA 4O29A 4KVZA 1P1BA 1QYRA 1QAMA 3SXJA 3GJYA 3CCFA 3GRVA 2UYCA 2IDJA 4FSDA 2JH9A 5GOZA 3FTFA 3FPFA 5DPMA 3KPVA 4LG1A 4HC4A 4A6DA 1X1AA 1EQAA 2AOVA 1L3BA 2ZIGA 4QTTB 3P97A 3FRHA 3AY0A 1VQ1A 4YV2A 3E7PA 3SSNA 1IM8A 2ONZA 4EKIA 2YXDA 2YXLA 3NVKI 1QANA 3V8VA 1Z3CA 2HWKA 3UA3A 4QPNA 1OR8A 4AZVA 4PYKA 3EVEA 4GEKA 2AS0A 4MIKA 3EMDA 2ZZNA 2C7OA 3T0IA 5DM1A 3FPGA 4FT4A 2AVNA 2GS9A 5HOQA 2NXCA 2NYUA 1P91A 3HCBA 1G6Q1 1NW7A 4RVHA 1MJFA 4LWPA 5LQAA 3DULA 3T7TA 3ER9A 4ER5A 2CMGA 1UWVA 2PLWA 2PX5A 1NW5A 2HV9A 4FP9A 1XXLA 2FPOA 2C7PA 2UYQA 2OYRA 3EGVA 5GWXA 3KPJA 3VC1A 1WY7A 3F4KA 1JSXA 1NW3A 3LKZA 3PVCA 2Y1WA 3P9KA 5FULA 3BT7A 4BLWA 4RTPA 3G5TA 1M6EX 1FJXA 5F2NA 2PX4A 3G88A 3VYWA 5T64A 4E33A 5EGSA 1KIAA 3CKKA 4E31A 3FPJA 2HTEA 3OZSA 2PKWA 2EX4A 4BY9E 3PLAE 5U4XA 3I9FA 3TFWA 3A27A 2YR0A 1L3CA 3B7PA 3S68A 5ICFA 3UJ7A 1JQEA 3BGDA 4Z2YA 3TLJA 4QQNA 1SG9A 5EPEA 3K0BA 2IPXA 5FHRA 1ZQ9A 4HTFA 3HVHA 2P3LA 3FUUA 4JXJA 4C07A 5EMKA 3BXOA 1G60A 5K0LA 4RWZA 2YXEA 1WS6A 4AX8A 1YZHA 2P40A 3LPMA 3DLIA 3VSEA 2IBTA 3SMQA 2JHPA 3KHKA 2IIPA 5FHQA 2F8LA 5DX1A 2VDWA 2QY6A 4U7TB 2WK1A 4RVFA 2O0LA 5EZSA 5FUBA 4CKCA 3LKDA 5LQRA 5KVAA 3KR2A 5EHIA 4DZRA 2EJUA 1SVUA 3HM2A 3GDHA 3KQYA 3TM4A 9MHTA 3ID6C 3BGVA 1NV9A 5DM2A 5EC8A 2HMYB 2ZZMA 3CVOA 2IFTA 3GO4A 2AOUA 2AOTA 1JSZA 3HA7A 5LR6A 3DLCA 4RTNA 3EEYA 2E5WA 2V74B 4AZTA 1F3LA 3ELYA 4QVKA 3H2BA 3DP7A 3TM5A 5IH3A 4RTQA 3BWCA 5K0JA 5HIJA 2K4MA 4NECA 2BR3A 1O9GA 4OA5A 4PNEA 5GM1A 5CVEA 1R18A 3BGIA 4DMGA 1XVAA 2YQZA 1ZHFA 3G7UA 1RJGA 3IHTA 2ZSUA 4PCAA 2XYVA 3DTNA 2PBFA 2VDVE 3HA3A 1VLMA 3MQ2A 4C08A 3FYCA 4KIGA 3KQSA 1L3IA 3KU1A 3MERA 3R6TA 1SQFA 2O05A 5EOVA 8MHTA 3GRUA 2GB4A 1JG4A 1JG3A 2BR4A 2G72A 3Q87B 4RVGA 5KQSA 3JWGA 3DXZA 2WA1A 3PFGA 2JHCA 3GXOA 2ADMA 5CVDA 3P2IA 5KS2A 1FP1D 3Q7EA 3MCTA 3RODA 3UZUA 1VL5A 1FPQA 1H1DA 2B3TA 1KXZA 4E30A 2DULA 4C06A 3KQOA 3TKYA 4F86A 5FADA 5DXAA 5F2OA 3CGGA 2OPBA 2Z6QA 7MHTA 4A6EA 1JQDA 1R8YA 5E1MA 3FTEA 3G8AA 3LX6A 3THSA 4RX1A 2NXNA 3O4FA 5BW4A 5DTQA 5E1DA 5EHGA 4PONA 3JWJA 3KQQA 4PGHA 4R6WA 5DTRA 4AZWA 1JR4A 2FK7A 3OFKA 1DL5A 2R3SA 2NP7A 3FUTA 3HCDA 2NXJA 2I6GA 3UJCA 2ESRA 3AXTA 2I62A 3DMFA 3OPNA 4E2YA 4RTKA 2OBFA 3M70A 2NXEA 2YVLA 2Q41A 3CC8A 4YMGA 3UJ9A 5K01A 4GC5A 5GP1A 4GOLD 2ZWVA 3BWMA 3C6KA 3LECA 3GRYA 4EKGA 2I7CA 2VP3A 4X60A 2PT6A 5HEKA 3HCFA 4RTMA 3NW9A 2OZVA 2QM3A 3KPYA 4HRAA 4PYMA 5EIFA 1P39A 1KHHA 1HNNA 2ZULA 2XBMA 2AVDA 4QVGA 5CVVA 3LHDA 4GUAA 1KPIA 2UYOA 3X0DA 1Q0SA 5DLYA 1DCTA 4OX9Y 5E8RA 5E8JA 4KDRA 4ER6A 1X19A 1B42A 4XUDA 2AN3A 4POOA 3EVGA 2Y1XA 5LQNA 4CTKA 3T7SA 4Y30A 3GNLA 4RTSA 5CM2Z 3AJDA 5FQNA 4HTFB 3LDGA 5BW5A 2CMHA 2H00A 4YV0A 3UBTA 1I1NA 3FRIA 3GRZA 2HR1A 2ZLBA 3LGAA 4EK9A 3FZGA 1XJ5A 3SGLA 4P7JA 3HVKA 5K0NA 2G1PA 3IYLW 5EEGA 2AOWA 3SSMA 2ORED 4XCXA 4YUVA 3OU6A 1DUSA 2H11A 3G2PA 4XUCA 2ZFUA 1MHTA 1N2XA 3SX0A 3PTAA 2PXXA 2QRVA 1AF7A 4DKJA 3R3HA 1SUIA 2GH1A 4KIFA 4U7PB 1NW8A 4GF5A 3UJ6A 4HH4A 3LDUA 2AOUB 3OFJA 2AOTB 5DRYA 1V39A 5DSXA 2B2CA 3FUXA 3L8DA 4YV1A 3EVBA 3O31A 5GIOE 4IV0A 1X1CA 3A25A 3IV6A 3FUVA 4Y2HA 2YUIA 5DX8A 2HNKA 1RI5A 5BP7A 5KYGA 3UJ8A 4EMSA 1ZG3A 5C0OE 5CVUA 4R8RA 3A4TA 3HA5A 5C9ZA 5K05A 4B17A 5K03A 5DRTA 3FPEA 5CVJA 1RJEA 2AN4A 3ME5A 2A14A 1VE3A 4IV8A 1L1EA 1YFJA 5E1OA 2ZBQA 3M6VA 2PY6A 4KWCA 3G89A 4E70A 3QOWA 2AN5A 3R24A 4MQ4A 5LQKA 4R6XA 1NW6A 4GC9A 1IXKA 4G56A 2R6ZA 4X41A 2ZZKA 4YUWA 3BZBA 1RI2A 4FS8A 3GRRA 4L7VA 3GU3A 3NTVA 5DSTA 5G02A 2BM9A 2VZ9A 5T67A 3C3YA 2PWPA 3KQTA 5P8WA 1KPGA 5DXJA 2ZWAA 4DM3A 3EVZA 4ER0A 1WXXA 2XVAA 5DM4A 5EMMA 3G2QA 3NWBA 3ORHA 4QDKA 1EG2A 5FA5A 4P7GA 3EVAA 3U81A 4RTOA 2GPYA 3TKAA 1PJZA 5E2AA 1M0EA 5EIWA 4PIMA 3GWZA 2IH4A 2ZBPA 1YUBA 3LBFA 3AWIA 4GOND 3SVZA 3EVFA 5JUWA 1JTEA 1F38A 3T7RA 4CTJA 5K09A 1XDZA 5DWQA 2O06A 3DXXA 2WA2A 3P9NA 1VP3A 3SM3A 5K0BA 2Z6UA 1INLA 3LCVB 5CIYA 1KR5A 1RI3A 3G8BA 5LQJA 2ZBRA 3IEIA 4PYJA 1JTFA 2PX8A 2DPMA 3PT9A 4GOOD 1G38A 4EVIA 1M6YA 1NBIA 3HVJA 3MHTA 2EG5A 3UJAA 4MHTA 4X63A 5FTWA 4BLUA 3EVCA 5HIMA 2PSSA 3UFBA 3R9XB 4R8SA 2BR5A 3AXSA 3C0KA 3JWIA 3HVIA 5E9JA 2PV0A 1WZNA 1XTPA 3DR5A 3G5LA 3ER8A 2C7RA 2AOXA 1O9HA 4FR0A 3A7DA 5EMLA 5HIIA 1KPHA 5E9WA 5EKUA 2JH8A 5LQUA 4C04A 4F85A 3P2KA 2GAFA 2P35A 1YF3A 4M7RA 1NT2A 4RTLA 3HCCA 2H1RA 5FA8A 3G2MA 2BZGA 3UJDA 5DM0A 3MAGA 1IY9A 4QQKA 4XUEA 3D2LA 4DF3A 1YFLA 2P3QA 3QOXA 5CCBA 4E2XA 3WSTA 3M33A 3P9CA 2OKCA 4F84A 4DQ0A 1EJ0A 3FPHA 3NVMB 2QRVB 1KYZA 4PYNA 3ELDA 3RW9A 2OB2A 4QTUB 1R00A 1G55A 1PRYA 2GA9A 3EMBA 3LDFA 3G2OA 4ER7A 1YZ3A 3GIWA 3HCAA 3BUSA 3MGGA 3ELUA 2Z6AA 3KQVA 2XYQA 3HP7A 2PWYA 3M6UA 4PYQA 1XCJA 5DTMA 3DUWA 5HZMA 3I5UA 3FUWA 3B89A 1BKYA 1HMYA 1JG1A 1EIZA 2P1DA 3GCZA 1R8XA 5ICEA 5CUQA 5C1IA 4RV9A 2NP6A 4FSXA 2OO3A 3TRKA 4C03A 4IWNA 2ZTHA 3OE5A 4C4AA 4EQZA 1JQ3A 2BH2A 3DH0A 2UYHA 4PINA 4YUYA 2P7IA 2VS1A 3DXYA 5LSAA 1Q0TA 3E23A 4M36A 5EQJB 1ORIA 4AUKA 1RI4A 3M4XA 3EVDA 4YUZA 2OXTA 3KQWA 3R0QA 3UWPA 1KP9A 1BHJA 4C05A 2KW5A 3LCUA 5E9QA 1RJFA 3TOSA 3OZTA 3HEMA 5EMJA 4ZTBA 4OQEA 3E8SA 3KPUA 3KQMA 3OU2A 4V0QA 2PT9A 5HILA 1AV6A 5EZQA 5DX0A 4UOEA 1EJ6A 3RIEA 2ZIEA 4LECA 1X1DA 1FP2A 2FYTA 3FTDA 5LQCA 2NNWB 3OCJA 2IDKA 5IKMA 1QZZA 2QE6A 3P8ZA 5CD1A 5FWDA 1O54A 3VC2A 1XDSA 5ERGB 3GGDA 1WG8A 4BP1A 5ICCA 3ANXA 4BLVA 2O57A 5E2BA 3PFHA 2G8NA 4HSGA 5ICGA 5JR3A 5M5BA 2I9KA 4DCGA 2FRXA 1KYWA 3LBYA 3TR6A 2C7QA 5FQOA 4R05A 2IBSA 1I4WA 1VBFA 5FWAA 3UJBA 4ER3A 3HNRA 3NDJA 4MWZA 4KDCA 4KW7A 3NMUF 3NJRA 3EGIA 4V0RA 4M38A 3THRA 1AQIA 2IH5A 2BM8A 3V97A 1SQGA 3PB3A 4RVDA 4AZSA 3OU7A 3SSOA 3MTEA 3DOUA 4P7FA 5GINE 2JG3A 5K8VA 3I53A 3EPPA 1SUSA 3CJRA 3B5IA 4K6MA 1TW3A 3LSTA 3PX3A 2FHPA 1R6AA 5K0CA 4PGGA 3I58A 2CKDA 4PYLA 1I9GA 2AR0A 1D2HA 3REOA 3MTIA 3EEOA 1NV8A 4H0NA 1T43A 2XYRA 3P9IA 4PIPA 5D1HA 4FZVA 3CBGA 1N7IA 2OB1A 1JG2A 3B3FA 2G71A 3BKXA 4DCMA 3KKZA 4M37A 4RYLA 10MHA 1UIRA 4FT2A 1VIDA 2B9EA 1N7JA 2B78A 4PYOA 3EGEA 4E2ZA 2IH2A 2PXAA 3NDIA 4OA8A 4X61A 1XDUA 3KQPA 3LCCA 5EEHA 1QAOA 4CWAA 5BXYA 2VDUE 2ONYA 2PGXA 2ZVJA 1QAQA 4WVLA 2FK8A 4CKEA 2JJQA 1RJDA 2LD4A 3KR1A 5F2KA 1TW2A 4E2WA 5HFJA 3KR9A 5HIKA 1ZGJA 2CL5A 4P58A 2IGTA 4PWYA 5E1BA 3MCZA 5GM2A 3SR4A 2JHAA 4OQDA 3BWYA 1G8SA 1R74A 4YUXA 3HTXA 1TPYA 1D2CA 3BKWA 3B3GA 3C3PA 3KPWA 3P2EA 5B1SA 2B25A 2EJTA
chains in the Genus database with same CATH superfamily
2VH2A 1V37A 3G7SA 3MWGA 4P6VF 4EG6A 3GMTA 3ZJYA 1P7PA 3WTCA 3CRRA 3GNTA 5JFGA 2AD5A 1DV1A 2DLNA 3ESXA 1R7RA 2E55A 2E82A 1AM4D 4YNBA 2MYTA 1YQDA 2LPMA 3I30X 2RJOA 1Z26A 2H1SA 4EB3A 5I6DA 3MB5A 4ZI2A 5D1NA 3AL3A 3C41J 3LWNA 1K6XA 1A3CA 2HI0A 1E2JA 4PLCA 2KPOA 3NTQA 4BBJA 5BQFA 4UBKA 4XGQA 1HEUA 3QUQA 1ULHA 3A6HA 3LF2A 3CF4G 1YNOA 1JXQA 2DLCX 3F2IA 3GCGA 2FMIA 4K6GA 3AFIA 3ZVRA 2DWPA 1PGPA 4QE3A 3OCUA 1E9SA 1QLHA 2C4MA 2XMQA 2QYOA 4QT0A 1MXFA 4UHHA 1XVLA 1OH5A 5AVOA 1L2TA 1RPNA 1VG8A 2QROA 1RU3A 2XUOA 3MJDA 4DYHA 5IAOA 3WQHA 2Y77A 2P7HA 1OI7A 1G2OA 4F9EA 4ZOBA 1WD5A 3QWBA 3I04M 5JO0A 1PUJA 3ZHXA 1VPVA 4BXOB 1ZKDA 2IGBA 3E2IA 4EHHA 2I1QA 1FTWA 4C78A 4H6XA 3HB1A 1JHAA 5CCDA 3CRW1 1ZD9A 3HV0A 4FGZA 2PFSA 1XE3A 3CO0S 3F0TA 5BNWA 4I5FA 1R0ZA 4KRGA 2ISQA 4ZQHA 5F51A 3ORYA 2V7EA 1T9AA 5JG7A 3WZLA 3TTYA 4AROA 1G8AA 3KAQA 1EFUA 4F7WA 2FQXA 2OXCA 4S3MA 4OHPA 3SHQA 3URKA 1X39A 5BRNA 5D87A 1JALA 1UT8A 1HFJA 2IV7A 1F1BA 5DV9A 4P7BA 3JASB 1ZIDA 4JGGA 3DE1X 4MO9A 1J5PA 4NE2A 2L42A 4NV3A 3DC7A 1RAAA 3GX1A 4K9RA 4UMEA 1OWOA 1CQPA 2GM9A 1PZXA 1KYYA 1QOZA 2JH9A 3OURA 1X1SA 4YV2A 4QTTB 1NP6A 5KJ6A 4N1AA 4BV9A 2NV2B 4CT5A 4X6UA 2JAOA 3W2EA 4E3ZA 5AW0A 3PZBA 2KX7A 3VAYA 1K4YA 2O1SA 4JJFA 4P2BA 3K1YA 4XQCA 3C1OA 1BN7A 3L6RA 3I73A 1T0JB 1ECPA 1PV2A 4TVKA 4O3FA 3IHKA 4U9UA 3TTSA 1YCFA 5KSWB 1Y5IA 2GSWA 4X45A 3MINB 3ND5A 4ZCIA 3CWCA 7REQA 1NRIA 3DE6X 5FYQA 3W3AH 2RH4A 3GYGA 4ZAFA 4DY4A 2O2ZA 4L8LA 4RPHA 2SKCA 2XTJA 2CXRA 2J32A 1ZIPA 3M1LA 3DULA 5D86A 4E5DA 2GZ1A 1VG0B 3T7TA 4E4YA 1Z0FA 4P3XA 3W0LB 5A0VA 1SVKA 4RKWA 2MINA 1UM9A 3A6EA 4Q00A 3H65A 5SYNA 2OV3A 1KSHA 4K0KB 3X1JA 1OC2A 4AYXA 1XNRB 4OSEA 4X20A 1X70A 1SUCA 2CHGA 3IP1A 4IH9A 4ZYTA 1G5PA 1PVOA 5I7RA 4NBNA 1P45A 2W6OA 3CLTC 1ZH6A 1IOZA 4QBKA 3OEHD 5EGNA 5LYYA 1LU9A 2NU7A 4UTOA 3HXQA 5KNBA 2R2AA 2HTEA 4MQLA 3HLKA 5TQVA 5F7JA 3AVUA 3I72A 4WGGA 3B7PA 3R9XB 5JADA 3NBFA 4QG3A 4WNCA 4DAEA 4C4ZA 3K0BA 5FHRA 3W9YA 1J0BA 1ZQ9A 4R0NA 1MAHA 2ORIA 3T12A 4C07A 3ZH2A 2H1CA 2A67A 5E6SB 4BWVA 4WNIA 2JGJA 1R8QA 1II9A 4IMPA 3F9RA 4D9NA 1TFRA 3DOHA 3X1WA 2OSVA 3R3UA 1E1CA 3KYCA 5J59A 2Q0QA 1Z6AA 2VDWA 4RS3A 3CUEF 5REQA 3GT3A 3N75A 5HF6A 1S02A 4UVEA 4FMBB 2WU4A 4Q1BA 5LQRA 1Y5RA 4J03A 4DC0A 2ECOA 4DZRA 3EGDB 3TM4A 1E4EB 2YY7A 4YGYA 4BLOA 1X2BA 3SHFA 4EGSA 4BJ5A 3H4VA 5AKZA 4MV7A 3NO4A 4UCWA 3PI7A 1GUAA 4ZEVA 3JZDA 1USGA 3BC1A 3PGJA 5KYXA 5IH3A 4PCVA 4LTNA 4HDNA 4WD3A 5EJ4A 4BBAA 1R18A 3BGIA 3K5PA 1WW8A 3G7UA 1G7CA 1RJGA 3GWGA 2VK8A 4URVR 5AW3A 4RZUA 4AZ0B 1GAXA 1HDRA 1UANA 2VQ3A 3O03A 4XX0A 5C35A 1Y34E 3AF2A 1LPOA 1LJUA 3AGQA 4AJIA 4NCBA 3H9UA 1O97D 5AI8A 2VP9A 3RQIA 2QZZA 1JT9A 3IO3A 1Q14A 4KRXA 1WU7A 3TZKA 4KCGA 2Q6OA 5I8WA 3NEJA 2ZYSA 4JHLA 1UZMA 4BB9A 2ADMA 2QR2A 4URWR 2OHOA 4R9VA 3IALA 3HKBB 4L3WA 1U3VA 3ONNA 2NSHA 4JVOA 3C7DB 4CCYB 2WT9A 1BFDA 4R1OA 1U6JA 2PIDA 3FKJA 3I9LA 1H0KA 3I04A 2V96A 2EHJA 3C6BA 3LC7O 4HFJA 4MICA 1NVEA 5F1OA 3KZKA 4ZZIA 3V1NA 1O6FA 1SCUA 3QXJA 3MTAA 1H6BA 3RRMA 3ZGNA 4WINA 1V5GA 4ONEA 1OWLA 4G5SA 1R88A 1WL8A 3KQQA 5I45A 3I8XA 4H7PA 4LOAA 2AI1A 3I5AA 2ATXA 4JR1A 1MW8X 3FNFA 1M83A 2DPYA 3IIKA 3L7DA 1PGNA 2FG7C 2AFIB 2ESRA 1V47A 3GJTA 1IN6A 5CT5A 4LXGA 1UBKS 1CY2A 2HLHA 3GUUA 4RTKA 3CEHA 4HTAA 5IKPA 3ZTYA 3AHIA 2NUTA 1IDOA 3C6KA 4W8OA 4BFYA 5LXTF 1X42A 4CTMA 3CX3A 3HCFA 3X44A 5JYBA 1H2HA 2MMCA 1ZVMA 4IKOA 3ZU5A 1HQCA 5HOEA 4KFCA 4KJZA 2OAEA 2PUBA 1X7GA 3RS3A 4I9NA 5HF5A 4W9MC 4H16A 3EZXA 4KAJA 1NVDA 1SXQA 1ZXBA 3IR6A 3DD5A 3ZDZB 1DE0A 4RE6A 4PAGA 5FTKA 1QGED 3HJHA 4OJQA 5KYWB 1T4MA 3DWFA 3FPCA 1YZGA 2QQGA 1Q2XA 2WWTA 3KYIB 4ARVA 4JT9A 4CF5A 3IR7A 4EW1A 5HRUA 3EMVA 2GF0A 4P7JA 4MK4A 4R1MA 5ES3A 1C50A 2O6HA 3Q2IA 5ECYA 3VVMA 4DN6A 3H9JA 4IOJA 2ZETA 4V0SA 6AT1A 4XCXA 2O7QA 3F49S 4NJEA 3BFPA 1QU3A 4YRTA 1C80A 2X1LA 5I7FA 4TMKA 3TSAA 3SI7A 4BKRA 1UM8A 3ZVLA 1VPDA 2WT4A 4KIFA 4S1WA 2JZNA 3V1TC 1Y4AE 2YJZA 4UCQA 1UZNA 2V6GA 2A58A 1X86B 2PLAA 3BGOS 3O31A 4IV0A 1X0VA 3ZE1B 3FVRA 4ZKEA 1C30A 3IQIX 3CXRA 1WHTA 1XZPA 1F2UB 3HB4X 4P82A 2HXYA 4XIFA 3GEDA 3O9ZA 2WTMA 3SSAA 4ARZB 2IITA 3DKVA 2FUG6 4FJ1A 4EGCB 1SCIA 4AW9A 4FNMA 2XB6A 3SE0A 3NJ8A 4FIZA 1WV1A 3U7GA 1PEAA 1UH5A 3DMRA 1XMSA 2A14A 3C15C 5FNVF 2A3RA 4BRWA 4DLSA 1YB1A 1R9JA 5AHOA 4WCDA 1U8YA 4XYBA 4RHYA 1P5FA 1IHOA 2Z2JA 1MVLA 3Q9UA 4HS9A 1E3SA 2IWHA 1O57A 2G77B 3E48A 1E61A 4X41A 1NGSA 4C43A 2R1VB 3LUGA 1W93A 1A5AB 2CVZA 2WSMA 3G2NA 2VZ9A 2XZTA 4JOQA 3C3YA 5AOBA 4LV8B 1WUTA 2FEXA 2Q4DA 3P0RA 3MBIA 5FPSA 1XCMA 1A04A 3ZBPA 4M53A 4G4GA 3T7KA 2YMQA 3EZNA 4QYMA 3N2YA 3K0CC 2OLKA 1N0UA 1XYGA 5A3QA 1P1JA 5CB0A 3H0CA 1TF5A 1J2JA 1XQ9A 3W8FA 3Q7SA 4G25A 2IYPA 4Q1DA 4P7GA 2NWQA 2R6DA 4HUQA 3TGLA 4LVCA 1SCDA 3TXAA 3AUSA 1K5HA 3GWZA 4EEZA 4IQ0A 3BPSA 1JHQA 2JLWA 3OCVA 1KVUA 1QOPB 1PEDA 4PPGA 1JTEA 4WI1A 5IMBA 5LZ9A 2YV3A 2ARKA 2O06A 4WWHA 1NUTA 5K0BA 3ITDA 3LCVB 5J5VA 4YI5A 2EBFX 2HSEA 3LO5A 3OCWA 1RRGA 3UFXA 1WBBA 1JTFA 1DAOA 4G1EB 2DPMA 2IWRA 4TS3A 1X7DA 4JJ6A 2ZVPX 3U9LA 4L74A 1Z8NA 5HKKA 1NMYA 1LLDA 2E7ZA 2JFPA 5FBKA 4GPZA 3EVCA 1O08A 5KCZA 2H8GA 5TPZA 2XQKA 2VP4A 3I83A 4AS2A 5L8VA 2JATA 3U40A 5T4HA 1IDN1 1WZNA 1KZGB 1MO5A 2Y9MB 2F3RA 4FPXA 4GKVA 4X1IA 4F5DA 1DEOA 3HKDB 2XSZA 4N65A 4YRCA 4MHSA 5K9ZA 2CV0A 2FV8A 1E3WA 4IDBA 2OQVA 2MU1A 3A7DA 3FCCA 3S2GA 1CSEE 1LWOA 4JSRA 4AD8A 1PQ4A 2YVQA 3SC4A 4HDSA 1L5FA 2GX6A 3PRKE 1NFFA 4F3NA 2C7GA 2X9GA 4XUEA 4GP7A 1KZ6A 4W5WA 3QOXA 1KQ3A 1JR3E 2LXNA 2HDOA 2ZJ6A 3KKLA 1KFBB 4BO3A 4NE9A 1JBQA 2QTMA 2CL6X 5ERYA 3JALB 1A8PA 4IHJA 2PX3A 4UZFA 3LDFA 1PDWA 4I55B 5E4YA 1VHQA 5EE0A 3IT3A 2H0QA 1SNYA 1GNLA 4C7KA 4RHEA 2PL5A 3RYFB 3DZGA 3W6PA 1AOXA 2OXFA 1N5IA 4TLMB 1X7ZA 2I4NA 4B0OA 4BPBA 4K26A 1IL0A 3QEKA 4KK3A 2NTNA 3N70A 4J2TA 5KQGA 5DM60 3F6PA 1YKGA 3WADA 3TH5A 4EF6A 4KQMA 6ABPA 1O0CA 4C03A 3V3KA 3BH6A 4D8UA 3ZOZA 2GNOA 4YX9A 3RADC 1D9ZA 3UWOA 1WLSA 1A98A 2DC1A 2UZ0A 2XPCA 1Q15A 3FFAA 4MR9B 1L5MA 2AL7A 3W5HA 3BMOA 4PX2A 2GJ9A 3M4XA 3RAJA 1Y7HA 3T9CA 4LF8B 2NMVA 3GLRA 3OE7A 1C5KA 4IX9A 5LBTA 2C5EA 3QH4A 1V8ZA 5BN3A 4OGWA 3EBPA 2J0VA 5JALA 5KTSA 3HN6A 2FPIA 4PLHA 2YZNA 3OZTA 3VO2A 4E7OA 3RBAA 2JFFA 1KL7A 1Z13A 3OHSX 4RCVA 5GOTA 1SVSA 4ES6A 1SU7A 2QN6A 3EQZA 1J23A 2H2AA 3H42B 3EF1A 2JFYA 2ZIEA 1QKKA 3R0XA 4UOEA 3GMSA 1TUBB 1X38A 1C8BA 2JJYA 1IOWA 3PEEA 5F77A 3BL5A 4AWAA 4CQLA 1PL6A 1YOBA 5E3JA 3YASA 1LPPA 1RBYA 2QE6A 1PTKA 1Y80A 5BT8A 1U3WA 2L2QA 3AETA 3QVJA 3V1KA 4LF7B 3F7MA 3HY6A 3HSSA 1QHHB 4H1HA 2ZJAA 1WR8A 4YAJA 5BT9A 4DKXA 2J9RA 1P7ZA 1QTNA 3CEAA 5K4HA 1EHYA 3DO5A 2FRXA 1PFQA 2R87A 1IOLA 4KITB 3QMWA 3U1VA 5DEOA 4HUTA 5KOYA 3U6KA 2BGTA 3AIKA 3G13A 4BUZA 4NCAA 1GGNA 3NOVA 3EIWA 2FZEA 4PZPA 2RHCA 3OD5A 3RTBA 5EHNA 1V7PC 3ZE2B 2LBPA 1TMKA 3R41A 4AZ3A 5AW2A 1W19A 1GWNA 5JO9A 1OD6A 2JLVA 3IXQA 4FLMA 1MV5A 3L7BA 4BBPA 4TTQA 1DFHA 3CJRA 3UAYA 3EK2A 1PEKE 3OX3A 4JWTA 4X1YB 1OQAA 5AKEA 5LLTA 1HXHA 4L15A 5AKKA 3MNFA 1GCUA 4BMYA 3DVAA 2AMJA 3T5MA 2V1XA 1P18A 1G8PA 1A95A 3EW9A 4PYLA 3ZD8A 1NBMA 2IXAA 2DFTA 2QPTA 2Z43A 3KWJA 1QX4A 2QMZA 3KTOA 4LA4A 1SCJA 4KXUA 1KJNA 1FNDA 3UHJA 3A2KA 1UFRA 3MS2A 3V42A 1O3YA 1D4AA 3OT1B 4BFWA 2IE8A 1S2DA 3PJFA 4OB6A 3RSQA 2ZUEA 1P2FA 2XUHA 1S8NA 2NVUA 5AUQA 5J2UB 3IDAA 1FRZA 2GBFA 4E2ZA 1ORWA 2DBRA 4PHFA 4Q12A 4GLJA 4FQ8A 4LHYA 1Q1AA 1Z83A 3ENQA 2JJQA 2ZUDA 3RUAA 4QHYA 1YJ5A 4BRSA 1UPCA 2O8BB 5F2KA 1LPNA 1MC4A 1NLUA 2RKBA 1Q7RA 3URMA 2B20A 3GEGA 4NENB 3G79A 1FDTA 2FPGA 2EATA 3GVIA 3S3TA 1U98A 3GYBA 3PTLA 1R74A 4HRVA 2LW7A 1CEXA 1OHHD 3LAWA 3GCXA 1Y7IA 3PC8C 4QDZA 1AA6A 1B76A 2P9CA 4ZHQB 1LK0A 5BUZA 4DKJA 2YWXA 3JYHA 1DJOA 2ZXUA 1C1DA 2PM8A 3CIFA 2FMXA 5K5EA 5ILGA 3FMVA 3EXG1 1N6KA 3PPWA 4JLSA 2H06A 3QF7A 4URXR 1MA0A 2E4ZA 3KNZA 2D1RA 3ZLVA 1ISIA 1XB2A 2PWZA 1GXSA 1AK1A 3A2MA 1GGJA 5C8YA 3CJQA 3JTEA 2G04A 3L6OO 3WLRA 5LDHA 2XZDA 5G3YA 2FF5A 2FRDA 1AZLA 3ESRA 3PHJA 4XM0A 4NP6A 1CEQA 1V35A 2AFHA 3E7DA 3F96A 2QMEA 3C6YA 3C97A 2KQUA 2P41A 1KORA 2I2DA 3BJZA 3MUEA 2QTZA 1SKMA 1AV7A 6NULA 2EWMA 3MWDA 3W79A 5MN5A 1NE2A 3NHKA 3SK0A 4B3TB 4EI7A 1GPAA 3NB0A 3L0DA 3THWA 1AQUA 1NFQA 1VBNA 2RD2A 3ESAA 3HO1A 3K0AB 2JASA 2P90A 2ZRBA 4M0PA 4RZIA 1ZXLA 3S7TA 4US0R 1LPBB 3QX8A 5HMLA 5A5GA 4C2TA 1L9KA 1A2BA 4AQ7A 5JS7A 1YDGA 3ANTA 4AMVA 3PDIB 4ESOA 1XNGA 1E4VA 1ZMOA 3D4BA 3JWHA 2HIGA 4HK4A 3E3MA 4MWCA 3R3VA 4MKHA 4KX3A 5FTLA 1U6IA 3RFUA 1E89A 3C4VA 4GE3A 2XT0A 5ALEA 1E62A 4EY4A 2XNDA 2II6A 4FMPA 5JYDA 2EHDA 1XSEA 4GGPA 3VNQA 4ZVPA 4C01A 1M8KA 2Z9BA 5JNVA 3S27A 1RPAA 3OBBA 1A69A 3FG9A 4LJ4A 4RKQA 3TSYA 1R5NA 2XMGA 3NHJA 3AR5A 1PDOA 4WOCA 3T0GA 3U4CA 1QU2A 2PT5A 2OECA 2F1HA 1EQAA 1RFLA 2ZIGA 1EHIA 3BFXA 4NTZA 3NVKI 1ZUNA 2V5UA 4YRMA 5DGHA 4ZCMA 4MJXA 2QAGC 3DZBA 2H0AA 2UVPB 3EA0A 3ZDRA 1AKMA 5ALOA 4DARA 2J3DA 1F0YA 2XBUA 5AYVA 2AJCA 5I5GA 3VPXA 4PN7A 4AK9A 2NO9A 1C81A 4MRAA 3LI2A 2YC4C 4MUFA 4WECA 4XOUA 4I81A 3EZYA 3R5SA 3U9SA 4LMPA 1G6Q1 4G36A 4WFKA 1E9CA 2DR2A 4TMYA 1K86A 2JJ8A 1HR0B 1T3HA 4PFKA 5JLAA 1TZ2A 1OC4A 2HA4A 1KYXA 2WFZA 4DLRA 1ETHA 4GRIA 1YZYA 3EAQA 4Y6LA 4MDYA 1UKCA 3ZBUA 5AKIA 1XQYA 4LBYA 3ZI0A 2V98A 1WCXA 3GJ7A 1KTIA 3DYBA 4JITA 1E0SA 1H2RS 2GJSA 4JJ4A 1CHDA 1A9SA 1T36B 4F11A 4TSFA 1U1DA 2GESA 3CLUD 4YFVA 5BR1A 2Q2NA 3FPJA 3TF5A 3DW1X 5LMUB 4M46A 5AR1A 1YB6A 2BGRA 2OFXA 4YROA 4ALMA 1U9IC 2Y1LA 4G41A 1GNSA 1LV8A 2W2KA 2ID4A 2X58A 4F6RA 1XZJA 3TLJA 5K3OA 4IGFA 1Z0ZA 2G07A 4LRXA 4MDFA 2CUTA 1N92A 5BVGB 4PNPA 4EW2A 4JX9A 2VJMA 3B6ZA 1DCMA 3EFHA 1PKXA 3V4ZA 1ZP6A 2X7HA 5I9LA 2DFLA 3BXFA 1CTQA 1MEJA 5AOVA 3TTXA 1FSZA 3DLIA 1ZH8A 4MWDA 4KAXA 1EGVB 4Y6QA 2NU8A 4CIBA 1YHNA 5BSRA 4BNJA 1TTPB 2A5LA 2FFBA 2QI9C 2QY6A 2YYSA 4KI0A 3C4QA 1XRPA 2A1IA 4JLJA 4AY5A 2BGJA 1J7JA 2Z58A 3QVOA 5AOCA 1T13A 1H5QA 3DF7A 5BV2P 3C3XA 3FGOA 2HY7A 3BGVA 2XT9A 4OJKA 3ETEA 4ZT5A 3GO4A 3NHUA 3CINA 2O1XA 4D9FA 1Y89A 4YCBA 3MMPA 1YWGO 4IIVA 2F3UA 4J76A 1NXSA 1UBFA 3EHDA 4WZBB 3UWMA 4CMHA 3BQNB 5F9FA 3P94A 1I14A 1QGZA 5FOTA 3EOAI 1C1XB 4TS4A 3QXXA 4RE5A 3G9QA 2JLCA 2SKDA 2ZSUA 4AJOA 1H2ZA 3B3QA 4M0MA 1RCTE 3X1DA 3MQ2A 1VLMA 4FKMA 2W9XA 1X13A 1L3IA 2FW0A 2QTCA 1MJGA 4HNAA 1PR0A 1Z5PA 2ZATA 2QORA 2PUDA 4TQAA 1N2EA 4HR7A 4RLHA 2WA1A 4G1BA 3CEPB 2BMDA 1QE3A 4IXNA 4Y0NA 3LBHA 3W34A 4QTYA 1G8FA 4I5DA 1RZRA 4QO8A 1VL5A 2Q5JA 4R31A 4UD6A 2Q6LA 4HLQB 3AF6A 3NDBB 2C95A 1C4XA 3KUDA 5DTEA 3KQOA 4FUTA 3ZWPA 3L6UA 1CQJA 2ZYDA 2MYUA 1ODJA 2ZIAA 3MTJA 4Q3AA 1JLSA 3HGTA 4RW0A 1R8SA 1ZEJA 1T34A 1FRQA 3GVCA 5KOIA 5DNAA 4QG7A 5KKAA 1MUUA 2ZE5A 4D1YA 2PQMA 5IPFA 1V3TA 1OZGA 1HT2E 1L5QA 1ZAYA 2GCOB 3NUGA 5FFNA 1IBMB 3FYUC 1VCHA 1RE1A 1XZAA 3M70A 2NXEA 2YWHA 3CNHA 3TAUA 1GTVA 4FHCA 3VU9A 4GOLD 1AU9A 2C59A 3BCRA 3KVVA 4MQEA 2PT6A 4J3JA 4RA6A 3TCNA 5ARCA 2AG6A 3JQFC 4FVTA 4C89A 4ZGWA 1JFFB 1JIXA 1H85A 3KPYA 1GEGA 4QOJA 5FTNA 2QN8A 2K2WA 3FNEA 5KNBH 4FFOA 4FEGA 5EPUA 3VYUB 4YPOA 5FUQA 3WDSA 1DRKA 3H2KA 1KA9H 4CLEA 5I51A 2ZUFA 1V3VA 2WYIA 2PX6A 3SIWA 4TXJA 2ORVA 4OHOA 5E4JA 4YCMA 3ZTTA 2RBEA 4LSMA 1GGMA 2GGSA 1DV2A 4MP8A 5CM2Z 2PLFA 1FDSA 2Y99A 1A1SA 4KKVA 4OI0A 2BP7B 1WWKA 1W30A 1GG9A 1SC9A 4L6AA 4DMRA 3UBTA 3HDTA 3UWSA 2QRGA 3LGAA 3ADKA 1X7WA 4PC7A 1O6GA 4JNCA 5EJIA 3PDWA 4B6FA 1UAYA 3P5BA 4RXUA 2ZTSA 3GRPA 3DPUA 2ORED 4RLFA 5FO1A 3SSMA 3JQ7A 1N2CE 3OU6A 2RGYA 1AGYA 2A92A 4QYIA 2FEKA 4IOLA 1HOTA 4YFYA 3E3LA 3RANA 5ESWA 4D9CA 4DSOA 4S1NA 5SYMA 1LVHA 3IPRA 4YP0A 3TBFA 4N3BA 1FJ2A 3RJZA 1KI6A 3KL2A 1EMDA 3HU3A 3WLAA 2UXCB 3OCYA 4IIJB 4L5JA 4Y9UA 4CQMA 4KE8A 3RYTC 2G7MC 3KEQA 2H54A 4MRNA 5HMMA 5C18A 4Y2HA 1KMHB 4E15A 3H5AA 2DUUA 1JAXA 5LYJB 1G3IA 4X1KA 4PR3A 4NPCA 4PTLA 4GL2A 1C2TA 3LC1O 1FVFA 4Z0TA 3A4TA 4I4TA 4YVFA 1OLXA 3AR2A 2JRLA 5AFSA 2XVXA 4YQFA 5FV4A 2F48A 3BQMB 2W90A 1PGOA 2NO4A 1ESNA 1RJEA 3LD9A 5KX5A 4PXAA 3W2FA 1VE3A 5JVDA 2HMWA 4IV8A 2B9VA 5D00A 4NZMA 3RVOA 1IVNA 1P4HA 3IULA 5TVKA 3T7DA 1M1XB 1WW3A 5KDLA 5F3DA 1UJCA 3PL1A 3SWWA 3L8CA 1J33A 4EHJA 2QN3A 4J0CA 1JU3A 2QXUA 1NL3A 3ES9A 3IESA 4YWJA 1G8HA 3RQSA 3VVCA 5E4FA 4YIHA 3L4KA 3GRRA 3GU3A 1E1RD 2QG6A 2YHIA 2ERXA 3LFHA 5DYNA 3S44A 2WB2A 1G20E 4GWKA 2FW7A 4EG5A 2Z04A 4KYVA 3EVZA 3FA2A 5IM5A 4DNOA 1SXIA 4K87A 4MJ7A 1X1EA 2R44A 4N8EA 2JGRA 1BH2A 1GT91 2VK1A 3FKSD 4QPCA 1O95C 4BUCA 4J7UA 3NZEA 5CDFE 2HK8A 4Y9SA 4LGVA 5EMNA 2HBZA 2IYSA 5T41A 2C83A 3MSCA 4GI2A 1KQGA 1RYEA 3I01A 1Z16A 1Z47A 3AMVA 4NI5A 4HWPA 4ZCQA 1XMVA 1KO1A 1JIQA 2AYYA 4BIIA 1CUCA 2EDAA 2RH5A 1KFCB 1XDZA 3FI0A 3GVHA 5C1BA 3K6SB 4I55F 4CQJA 3JVDA 2REQA 5JDCA 1KYVA 3DDOA 2XUIA 3QVLA 3BJEA 4NBLA 2XNKA 1G38A 2WSLA 4K3VA 4XWGA 1LTKA 1XZGA 3ZDBA 2JLSA 2R79A 3I12A 3MJHA 4IQFA 5G4LA 4O63O 5BO5A 4A8JA 2G9UA 3L7CA 3KTFA 2VJPA 1WAMA 4QREA 2NU6A 2TMDA 1RKVA 2W83A 4Y1FA 1A8SA 1MLDA 3CN7A 3HL0A 3RYCB 3KUKA 3VZSA 3T3OA 2VXYA 2CLSA 2CJFA 5G0SA 4O6VA 1P0QA 2AFVA 2VYVA 4R3NA 4DPMA 1DDGA 1XPUA 3LX4A 5FWXA 3QZUA 4RTLA 1W5BA 3QA9A 2Q7DA 1FZQA 1Y6JA 3WGMA 1TGVA 5IEBA 3WSTA 3NIBA 1SPBS 3FVWA 3M33A 3NLLA 2IJGX 4NHEA 4Z9YA 1ADJA 5KDDA 4C7OA 1UAAA 2V7BA 4E32A 4KVAA 2OB2A 2CK3D 2XIJA 3I92A 5EA2A 3EX7C 1D0SA 1G55A 3KT6A 4B3CA 3HRIA 4DIOA 1ESDA 1KDRA 4XLLA 2Z6AA 2C31A 4B5LA 3ASVA 4Q4LA 3TRIA 2BFFB 1N77A 3OPYA 2IOQA 3DUWA 4C5AA 1X9GA 1MAWA 3LQRA 1BKYA 5JSZA 3FMIA 1PLLA 3GCZA 2WG1A 3F78A 3OD1A 1H2EA 3EZ9A 4FEAA 1HE1C 2ISCA 3PKZA 5ICEA 4PQRA 2FPPB 3G0BA 2NP6A 1DAIA 2ZDQA 1FYVA 3U7HB 1XZKA 3KTAB 3C14C 5IVKA 2ECFA 4YJ3A 5CT4A 5EQJB 1Q0HA 3SYRA 2NW6A 4E88A 2JAWA 5JAZA 4O4HB 1WXQA 2ZP1A 5EVCA 4DSAA 1JYEA 1Y8AA 4ABTA 1MB9A 5DWVA 5F9HA 4DA8A 2A1TS 2N46A 4HO1X 1T1EA 1TVKA 5JU6A 1DC4A 3O6VA 5KSPA 1JLRA 2ZCUA 1MA3A 3ZY4A 3WYGA 3RKRA 3D4NA 1Z4LA 3NR2A 3FDJA 4MB2A 3ZHZA 2XMRA 2OV1A 1T3TA 3B52X 2X4GA 1SCKA 2IYFA 1AV6A 1QQBA 1YS4A 3WK4A 5AESA 1Y63A 1IEVA 1EJ6A 5LN1A 2WKWA 4XCQA 2BCGY 3BE6A 3PUZA 3F46A 3LPDA 3LYLA 1NJ5A 5FOSA 5K0ZA 4R5HA 1Y6GA 3V46A 3HRHA 2YNMA 3VC2A 2IYQA 4C30A 4BFSA 3HS3A 1IZ8A 4L4ZA 3KZNA 5SY6A 5J2UF 1IULA 5C32A 3R5FA 1A5SB 2ZJ2A 3EC1A 3O21A 1B23P 2C7QA 1H0SA 4PBRA 4ZI7F 1QYCA 4MEJA 5ELMA 4TN5A 3UJBA 4KQIA 5IAGA 3WLTA 4GECA 4GW3A 1NW9B 1XPOA 4MA4A 4QFCA 5ADUS 1J5XA 2RCYA 5GVSA 3RAGA 3GLGE 1FU7A 4DBLE 3UN1A 4F1WA 3UMFA 2VEDA 2DKOA 1E6UA 3EPKA 5K8VA 3F71A 1WDLA 5EERA 4OUDB 1TM2A 1A77A 3NBAA 4N39A 3RUIA 4AULA 2DFVA 2FHPA 1SXHA 3R8XA 4OXRA 3Q8WA 3G0DA 4Q9HA 5L3SB 2YASA 5LWQA 2PHZA 1GSOA 1BHSA 1WTCA 1OCEA 2H1IA 3K09A 4YMLA 4UEWA 4P4NA 1QZXA 2FETA 5TEVA 1EU1A 3GOQA 4IDGA 4X3OA 4GKJB 3VOSA 1LDEA 3U7FB 3PWSA 3OQOA 2QRMA 1F9EA 5IKOA 4U7DA 2IC5A 4OK3A 2XHZA 3H6GA 2X9NA 3HO6A 3O0TA 1DQYA 2NZWA 3CRNA 4FLEA 5DI3B 3UXEA 3VOAA 1UBOS 5JBQA 3K35A 1HDGO 1I7PA 1M8FA 2V7GA 1BS9A 2ONYA 3HCOA 4CM4A 4QLAA 4HFMA 3DBRA 4GNRA 3UUWA 4I1PA 1JG6A 1T4GA 4HQ0A 2XW6A 5YASA 1QK3A 3ACBA 3KSBC 1RQRA 3AHCA 3RVMA 1IN7A 1KOFA 4C4PA 1FNBA 3D1JA 4O0MA 2CDRA 4K2HA 2JHAA 5THKA 4YY3B 2WWGA 1Q7TA 2XA1A 5JZSA 5E6RB 2O4UX 2H51A 2CN1A 4ACBA 3VR5A 4PNHA 1XF9A 2HFJA 1S3SA 4RADA 4XGRA 1N3BA 3S2IA 1XRJA 3HLYA 4Q37A 3V2HA 1NMZA 1VCMA 2WOJA 2W6ZA 4IF4A 4IIUA 5F5XA 3STUA 5A03A 3PFWO 3AU8A 1OXTA 2WHXA 2ZT8A 4G4JA 4INJA 1S2NA 5BW6B 2VHWA 3ZK9A 4GM0A 3T99A 4MGHA 1C0IA 2ZIFA 2OP0A 2BGIA 1CZKA 2CWWA 4QDJA 1T4BA 2JIMA 3HL4A 2IRWA 4B35A 3Q2OA 3U4AA 4F04A 1FS5A 3NORA 5AICA 3QTTA 4UHEA 2D59A 2JDID 3WLOA 4B76A 4LOJA 1ZMTA 2HLPA 2H48A 4OSPA 3CG4A 3RSOA 5LIRA 3TIGA 4RTRA 3THYB 2FX5A 3GHYA 1EX6A 1U1GA 1OT3A 1SA0B 2VAMA 4F5WA 4QHSA 1E2EA 3F98A 5L4SA 2V3VA 4HB4A 4N40A 5H02A 4X8MA 3ITNA 3AVPA 1Q22A 4QIHA 2O5RA 1EUDA 4LJ9A 5LMNB 1JLMA 1YNSA 1BFKA 2J9YB 4WKPA 4X9XA 2GLTA 5CHEA 4CMGA 1DBSA 2F9FA 2E4XA 3D4PA 1VE6A 5K8IA 4LWZA 4XGIA 3KR0A 5F52A 3P0EA 4F93B 4WOKA 4X3PA 4O02B 1OFGA 2NVOA 1AKEA 3PTZA 4ITUA 3R5KA 3AESA 2XV1A 3VYRB 4F45A 3Q6MA 5JS2A 1AHIA 1PWEA 5LP6A 1ZJYA 1U81A 1FTSA 2Q0SA 4IHAA 4E5KA 3PXAA 1P1CA 2OV8A 4IS3A 3T5PA 5GIPE 2WG0A 2X77A 1XTJA 1VDMA 3DOOA 3ZS8A 1NXVA 1NW4A 4S35A 3O2SB 1CUWA 1IY8A 1CVIA 2GBPA 1ADCA 2IDJA 2FZWA 2GPBA 2R9VA 2OEPA 4IDAA 5DPMA 2FPXA 4HC4A 4CCWA 1C2YA 1L3BA 1M1YB 1XHEA 2R48A 3I5YA 3FLEA 4TKMA 1V26A 2R6FA 3LNCA 4J94A 1P7VA 4W6QA 4Y1RA 2PVPA 3I09A 4G9BA 1PKEA 1QANA 2AV6A 5AXCA 3ADCA 3ZHQA 4Z51A 2ZIWB 1LF0A 3VM6A 4BGUA 1E32A 1NF2A 3H97A 4L0QA 2Q1SA 4N7MA 4BJ1A 2PBRA 1JKFA 5K0TA 1Z2OX 3F7OA 2J45A 3KCNA 3LGXA 2C3YA 4FT4A 3BG5A 4DM4A 5IJ0A 4QGBA 1QHIA 2AVNA 1KI2A 3AG6A 3KJHA 3R0IA 5FOVA 4U63A 3SLGA 3MUFA 3S8MA 4DT1B 3ER9A 1JLLB 5KAMA 3H1BA 3TO5A 1RZVA 5SY9A 3MIIA 2NO6A 1M73E 1S8FA 3LBIA 3RARA 4KUGA 2VK4A 2BBSA 5KNDD 1FU8A 2ODQA 4WZZA 3AW9A 2ENUA 2XCTB 4MW0A 4HLUA 4EYEA 4DMUB 2IHNA 5ELLA 4NU8X 1QX3A 3USZA 1Y1LA 1M6EX 1N25A 4UCFA 3TJMA 1DTEA 1I4DD 1NT4A 3OC6A 4AF7A 4LHXA 4ZVVA 4C4SA 1FJXA 4BY9E 3PLAE 3A9WA 1UMBA 1FA9A 4Q6BA 2D7CA 5F5NA 5LOVA 3I9FA 4IO0A 1S7GA 1UXGA 3K0FA 3N87A 5CH5A 4IL5A 4UDNA 1ZRHA 3IMCA 2ZPUA 3AGPA 1OYYA 3OEYA 1QHXA 4CI0B 3PJEA 5CX1B 1EESA 4XR4A 3KOXA 3AUTA 2ONJA 4D9BA 4JI3B 2Z3VA 1WS6A 4WK4B 4CL3A 2P8SA 4BO9A 2MDTA 2PRSA 5IAKA 3NNNA 4UU0A 2ID8A 4JBYA 3WMWA 1YOVA 2X8WA 4LKRA 4QBTA 4B73A 4CKCA 4PPFA 2D06A 4YWHA 3R1IA 4DIUA 4N5DA 3TLEA 2CWDA 1XELA 1KERA 2Z6VA 3PC7A 1KI7A 2YJ4A 1L5HA 2R6AA 2RH8A 4A5OA 1D09A 4KHZA 1NJ6A 3D59A 3X1XA 5IKEA 2IYAA 3CISA 4H2DA 2FUG1 1Z18A 2CDAA 5J2TB 1DEAA 3BREA 3OP4A 1WSBA 4ETWA 2DECA 2H2HA 2JJMA 1XAJA 3C7KA 1GR1A 1PLKA 2NUBA 2Y92A 1UK8A 2W71A 3RUPA 5HIJA 1Z45A 4RQTA 1B00A 1U5BB 2K4MA 1P0FA 3BMQB 1E6EA 1SOUA 2B0JA 3OEED 2UZ1B 5FL7D 1IB0A 4DILA 3UH1A 2EF1A 1PTJC 2JGAA 3F9CA 3FNQA 4LXQA 5T3UA 5IAAA 2HF8A 3J7AC 1V0JA 1GGVA 1ST2A 1XEWX 2O52A 2XWSA 2G72A 2CKMA 2XX3A 3DD1A 1LUAA 2W2LA 4FX5A 3AVVA 2J87A 1CZRA 4GLLA 1PJQA 1XU9A 1W5EA 3VNSA 3OVMA 3SY8A 1BEZA 3GA7A 4OHUA 5JI3E 3CX7A 4DJFC 2WSIA 4CG0A 5EESA 1J8MF 4BFCA 1R0SA 1ZS9A 3VU3A 3GLIE 1KY4A 1DTWB 2J7PA 4FGSA 2WM9B 4FZRA 3HH8A 3SC6A 5KU7A 3CRZA 2GTIA 2J31A 2NSYA 2VA9A 3THSA 4BV3A 1A50B 1P2SA 4RDCA 2QD2A 4OHMA 3M3PA 3ROTA 4B47A 2B4QA 1MGOA 2DBQA 1PQYA 4NNJA 4HXYA 5HRCA 3FOFC 3QNUA 2X15A 1PF7E 2ZRIA 3NYIA 2YRXA 2IF0A 3CLRD 3RUFA 2FW8A 3UB4A 1A9QA 3EZ6A 1DL5A 1NONA 4DLNA 1HZJA 2EFEB 3HCDA 3ICQB 1AS3A 1UDAA 2VCEA 1JS1X 1BVYF 2D8AA 4FGUA 2ID9A 1DZ3A 5ELXA 5B3KA 5BUSA 2J9GA 3QYFA 1EFDN 4HAYA 3T41A 1TCUA 2ZTMA 4TRRA 2VHJA 3NUQA 1Z4IA 1AKWA 3EULA 4FFWA 4JVNA 3TEJA 2Q6KA 3VKVA 1N2OA 1XKXA 2CJWA 1ATZA 5C31A 1ACJA 3A6ZA 4P83A 4UQLA 1RXIA 1UC8A 2ZULA 4DA0A 5K99A 2WTAA 3QOFA 1HQYE 2CLHB 1Z63A 1KKLA 2VLBA 2W6JA 5LYJF 1PP4A 3FSGD 3OH8A 1DG3A 2R8BA 5L7TA 4OX9Y 1BYUA 3LRTA 4I50A 1X19A 3AF1A 2Q1YA 5TF0A 1RWMA 4NESA 2QZ9A 4ZVRA 5JARA 5K8TA 4YHHB 2GKGA 2ODWA 1NVTA 2QRPA 3NTLA 1PLJA 4QTZA 1E6KA 1NN1A 3RKUA 4W5OA 3OT5A 1IMJA 4R8MA 5DGTA 4D4MA 3TQOA 1DEHA 1UKEA 1YC2A 4B8ZA 1VBKA 3HVKA 4B2PA 1J1UA 2EXXA 1HE3A 3DDCA 4L28A 4D3YA 4EA7A 3KRTA 2M6SA 4ME6A 4KXMA 1TCBA 4WXYB 4BN5A 1XXHA 5EZ6B 3M7IA 3EYWA 4UM7A 4KXXA 3TD9A 3GAMA 1H22A 3QVWA 2CNDA 4I3FA 4Y2PA 4GPEA 4GQAA 3OZVA 2I76A 3BSWA 2VF7A 1BMQA 1GV0A 1EKXA 3OPXA 4PQGA 4BEBA 3RBXA 4DQVA 3DO6A 4JYCA 2WMYA 1WQ1R 1Z0SA 4OXQA 1UXOA 4L5CA 1UWCA 5FUMA 2W6ID 3Q0TA 4L27A 1U0HC 3HB5X 2QLMA 3ETDA 1XFAA 3T1HB 1QIMA 4XYEA 2WD7B 1M34E 1R5OA 3OAAD 2IZ6A 2R2GA 3B70A 3BIOA 4X24A 3U3ZA 3VR4D 3A1UA 3DT9A 2L17A 3ZDYB 3ZWYA 2GR9A 3JASA 4G23A 3IUSA 4WCVA 5DO9A 5DNUA 1PG0A 1Y3FE 2EAUA 5SV2A 1NXXA 2ADFA 4G56A 2WWIA 3QVUA 4BKPA 3S1SA 1I10A 1GPBA 4FCTA 4TV9B 2BM9A 2PU5A 2ZYWX 1Z5VA 4K6HA 4WH0A 4IICA 4ZZ0A 3JSXA 3WKBA 3DJYA 1FNMA 3E9RA 3VR2A 4R7TA 2ZITA 7ABPA 4BV8A 4TWRA 1ZCBA 3U61B 5A9TA 1NBOA 2E48A 5JV5A 1CR6A 3M9WA 3OKPA 4V0MA 1Y0BA 3H1GA 3PQEA 3NUZA 2GPSA 1M5TA 1VSTA 5FA5A 5FNZA 5IP5A 3T3IA 1R6UA 3UKOA 4C0KA 4CM8B 4RO0A 1KIMA 1RM5A 1AXRA 4LMRA 4PW0A 4B7UA 4BVGA 4JBIA 4PIMA 2WQ7A 2JJ1D 3LBFA 4GOND 1VYVA 1UP7A 4NZNA 1VJ0A 4ALIA 1XTSA 1F38A 5D6OA 2BWJA 3GZNB 5BSMA 4Z4GA 1ILWA 5LD2C 1MENA 2B7BA 2GD6A 1IWBB 1W88B 3I2JA 3OETA 1DBWA 3NANA 5CLHA 4YH1A 4EI2A 2ZBRA 1WRBA 1P0PA 3PT9A 2YWDA 4H3VA 1B74A 1KZ9A 1SWWA 3HA2A 3RRJA 3WAKA 2PZLA 4RZQA 5ULLA 4P3NA 3IERA 2I1WA 1WCYA 4WFJA 4N7JA 2OCDA 1WDWB 4G2NA 4NZZA 3V8RA 1SUDA 2H1VA 1I0ZA 3HVIA 3JD3A 5DI9A 4C4RA 4C4TA 3IDFA 1ETUA 4DZZA 1QDUA 4XR9A 1VJCA 3ZK7A 4BQIA 5A1JA 4O4HF 3KXKA 2BZ0A 2WWFA 4OIMA 2GM4A 4KQ2A 1PI3A 3E84A 2F90A 1SMKA 2JIZD 4M6WA 2W0SA 2GAFA 2P35A 4DSZA 1U63A 3UCFA 2O6LA 1ZO8A 2R60A 1HBJA 4LF4B 1U04A 4LGMA 4YT5A 5B2ZA 2HBRA 4RSGA 4MS4A 4AJKA 2OM6A 5EI5A 2J5XA 3B1FA 3D0RA 1Y33E 3L93A 3HE3A 1JBEA 1EP1B 1TKRA 2AMLA 4ZO8A 2PPLA 3JVUA 3JWEA 4MVJM 2G7ZA 2GA9A 4COOA 1Q95A 4ZYUA 1HNZB 4CIXA 2PJRA 2R5FA 3MGGA 3DZFA 4D96A 4I1OA 1W0JD 4IFIA 5ED0A 1QV9A 2AF4C 4LY6A 3OUZA 1GARA 1R10A 2FAXA 3RIYA 1EBFA 2D62A 4FDLA 4OXYA 3MFYA 2P1DA 5JZMA 1DWUA 4B9AA 3WLHA 1Z4KA 4U9HS 5K6TA 2ZXEA 1LXCA 4MGEA 4J0IA 3LA8A 3PNPA 3Q3EA 4P1ZA 3PJRA 3AX6A 1LSSA 1SG0A 4RULA 4IUBS 4K6KA 4CR8A 4IIDA 4F38A 2ZBFA 3VA7A 2XGJA 1AQYA 3C1TA 1U8TA 3U44B 1ISMA 1CUXA 4LTDA 1U7UA 1UBJS 3KT8A 4MA0A 5TT1A 2HJVA 3EVDA 4KC0A 4V24A 2GD2A 3UWPA 2QTBA 3DOFA 1T9GS 1KP9A 1MO3A 1GPNA 1G6KA 1TAHA 2GRAA 3ZDQA 1E6CA 3INRA 2PGOA 5ADVA 4EATA 1Q74A 4TKUA 2DKFA 3UYLA 3E82A 4RZSA 4QC2A 2IUUA 2LZ0A 4CFYA 4RD4A 5IT9A 2A7XA 1WO8A 2NNWB 2GYYA 1P61B 2GYWA 3MJEA 3JAWB 3DMPA 3QPVA 1ATIA 2F8MA 3LQ4A 3P9ZA 3TVDA 1GDHA 3DKRA 3TNJA 2WKRA 3ZCPA 4ZANA 5D8DA 3C85A 4BP1A 1W52X 4NOKA 4WBNF 4KR6A 1QH8A 1OXXK 1TCCA 2GA8A 2W2QA 3DPIA 1MORA 3FYSA 3K9NA 4Y6RA 3WVNA 4QOIA 4B3DA 2D1YA 3WKEA 2NQ2C 4AXBA 2QAGB 4H1UA 2VSOA 4TLLB 4LAFA 1VPEA 4UBMA 5FPYA 2PEYA 2HH9A 1FMLA 2BFPA 3LY7A 3KX2A 3LW8A 1QP7A 2C4HA 1N8SA 3A4YA 4XUGB 5GGXA 5T8KA 4OLAA 2CUKA 5TLSA 3ZD6A 3PLNA 2X9LA 2G9VA 4QL3A 2EP5A 3UT5A 2EKQA 2FMFA 3KDSE 5DGDA 2VRCD 3LH5A 2P5YA 2W2PA 1D2HA 1L4NA 3TQFA 3GFQA 3HUFA 1Q7CA 3DMDA 3EZ7A 4PG6A 3LQQA 3BAZA 1OTYA 1CY0A 3PNQA 1KEEB 4FD2A 4KMRA 3WICA 3FTPA 10MHA 1YK0A 2COUA 3GFBA 1P7WA 2NPIA 3E22B 3ZY2A 4D8TA 4DRXB 3RC2A 2ASEA 5CK4A 1OU4A 3UK7A 2AD1A 1SGWA 4QQFA 2Z30A 2HBQA 2H1WA 4IPTA 5CFPA 4HL6A 4ARUA 4W8GA 1G21E 4LDJA 1IYZA 4TMXA 2B2NA 2QMOA 1Y9EA 2VHVA 4HH1A 4IM7A 4HZUA 4B9EA 4DTCA 3A36A 3BJRA 3Q3HA 2OFWA 4U0JA 4DJ5X 3NJ4A 2YFKA 3PQFA 4ZCSA 2AZMA 5J1TB 5EZ5A 1F2TB 3COPA 2AEMA 3Q40A 4YACA 4DMFA 2JFQA 3D8SA 4JX8A 4AY6A 3ZE7A 2D8MA 2GN1A 2IPMA 3ZX5A 2QV7A 2FY8A 3F67A 3P2EA 4HWRA 3ZU3A 4A10A 3QIVA 5G1NA 1UPAA 3OC0A 3NTXA 4A2PA 1B6RA 1YJ8A 3M6XA 2WNSA 1UEXC 2I4TA 4IYJA 2QLLA 1YB2A 3DO8A 1STOA 3IKVA 4XDHA 2VNKA 2EU8A 1A8IA 3FH0A 1E0JA 2O8NA 2PJZA 2YWEA 1U0TA 2B1QA 1PJ8A 2VFAA 1JA1A 2YX1A 2ZW9A 3HB9A 3VR6H 4GX1A 3ZWOA 2OZLA 3BEDA 4YRFA 1G63A 4E1AA 5L51A 2QNIA 5JTUA 4CGYA 3GZ4A 2DPGA 5JS6A 2RI0A 3PEFA 2AN1A 4M7PA 4MVJA 3C3MA 3L9WA 1B1AA 5CP8A 1MRNA 3G59A 3KAKA 3WK6A 3UUGA 1BDBA 1QRAA 3NG1A 3P71T 2QUZA 4K9LA 3CSDA 3TX2A 4QEDA 4DNPA 4Z4CA 3AONB 4N5MA 1QQTA 3FTNA 2A0KA 4GICA 1FTNA 1LDYA 2W22A 2BMJA 1UZAA 2A2ZA 3FFBA 1L5SA 4IWXA 4K6FA 1I24A 2QIPA 3F9IA 2IP2A 3K8ZA 2G83A 4Y2RA 4UNPA 3GLVA 2GJAA 1BXZA 5G1PA 1WVMA 3GFOA 4PLPA 3EPJA 3DLHA 3D8BA 1UK9A 2AQKA 3UJNA 3LUAA 3ABRB 2FSIA 3M8KA 1UL1X 3ZJ4A 4LZWA 3W7VA 2O2GA 1XZMA 3A1WA 3DCNA 2VP6A 2O2JA 4C3ZA 5DEIA 3IBFA 3QBVA 4A8HA 5K0FA 3WA6A 3MTDA 3AHJA 4MW6A 1ZFNA 4BGEA 4G0XA 4TTRA 2A5JA 1MQ9A 2PZGA 2QN2A 3SZRA 4ACAA 5LZ5A 3FDZB 3L8GA 4FYIA 4HHEA 3K9LA 1F12A 1CJSA 2VPXA 4Q4HB 2EJVA 3SXJA 3NBQA 3ZIAD 2TECE 1N6LA 3FYUB 4YRSA 1WMAA 5AQEA 3S40A 3DLPX 3FKQA 3JAMA 3L9XA 2WR8A 3OQBA 2WM3A 2JLUA 1OI3A 2ILVA 1K7EB 2QAIA 4ZRNA 2CUNA 3C5EA 3G8CA 4QUBA 3O8DA 1VJDA 2IXDA 2GOYA 3A0RB 3NBUA 4K9QA 3NONA 4N5HX 2J46A 1AZSC 3WMXA 4JI7B 2C7OA 1F8UA 2CLCX 1YK1A 2VJYA 2ZROA 4TYYA 1GPH1 4C88A 1FXWF 4NRDA 4ESEA 1O6ZA 4FR2A 3ROEA 3VRHA 3I42A 4DLXA 3M3DA 4D45A 5FORA 3A10A 4TTSA 2PR7A 3CUKA 3MN1A 3BXZA 1W5TA 2DHDA 3D54D 2HQSA 2C7PA 1F14A 1N5OX 2GN8A 2IHKA 2H4WA 3JALA 3JYOA 1JLKA 1NNLA 2RJ3A 4PX3A 4XCVA 3VC1A 4AT1A 2EYUA 3C98A 3K0SA 3HUDA 3RYFA 1XDDA 2VHZA 5INTA 2HGZA 3O47A 1OMOA 5B58T 1JRLA 3HN2A 1TEXA 1V4VA 4EW6A 3ZEAA 2QTGA 2SCUA 3G88A 4GRAA 4RZ3A 1LK7A 3OWOA 1OLOA 2EX4A 2IIBA 1CZUA 3V1MA 4WOJA 5D7BA 4O4JA 2RE8A 3A27A 2YR0A 1QB8A 1CJTC 4HZIA 2L0XA 2LNDA 1M54A 3ESZA 3PXDA 5ICFA 4RJTA 2VTBB 4QQNA 3PF8A 2JF0A 2V9ZA 3A9UA 4OQQA 3D3NA 1HLDA 3ILYA 1TE2A 4KQEA 3W6NA 5DP2A 5JCZA 3VHLB 1QZ3A 3PU6A 4FYYA 2A0UA 3F73A 3EWAA 3OX4A 3ABIA 4MUXA 3GGOA 2XLBA 1ACLA 1AK2A 5BVHB 1RYFA 3P1JA 4I3GA 5ALFA 5BOVA 2Z09A 3QXHA 3TR5A 4XB2A 1TUBA 1DTSA 1GA6A 1ZH2A 5ENZA 5FBHA 3WMRA 1XU7A 1IEQA 4JBGA 4MI3A 2LV8A 1XHFA 5CIQA 4DFDA 2ZZMA 5HVNA 3INYA 2JAPA 2WUDA 3PX7A 4BFZA 4AKHA 1YAHA 4AX4A 4AZTA 2W8BA 3PR1A 4MQUA 3WHIA 1BX3A 3HKEA 1GL3A 2FP3A 2R6JA 1E5LA 3DL0A 2WP8J 4R1LA 1B3RA 2DWOA 1DAGA 1Y6RA 1QQ7A 1RW4A 2YQZA 1Q12A 1PBNA 4D5EA 3ETCA 5BY2A 1GGFA 2XYVA 1N2HA 4ED9A 3HMQA 1IZ7A 3DTNA 1YZVA 2WKSA 1B16A 4E12A 1TJPB 4MS1B 3KEFA 4JKIA 1EUCB 1NKSA 1P4RA 2YWBA 3MWYW 3GLFA 3FNGA 3WI7A 2J9XB 3VNUA 2JFXA 3EEFA 4KRFA 1I01A 1J09A 3O1LA 3LIPA 1GO2A 3OF2A 4JLBA 4QSMA 3KLPX 4YBZA 5CA1A 2B99A 3NHSA 1Y8QA 3QFFA 3ZJUA 5DBIA 1AUXA 4DDWA 5SICE 5JZVA 2QJTA 5DHQA 4A0RA 5HGXA 4LS3A 1TIKA 3LVQE 3RRYA 1PGQA 3P7MA 2ZJ7A 4X85A 5BSEA 3HJNA 4XH9B 1OLSB 2ZJBA 4REMA 1NN3A 2X40A 4A6EA 2X41A 4EY6A 3OT1A 4EKEA 5IBRA 3OZIA 1FRVA 4HMOA 4L2IB 4LRWA 2ACEA 1EFPB 4P38A 3N2EA 1MX3A 1K98A 4MS3A 1JHYA 2A1UB 2WF5A 2CHVA 4TXLA 4FTWA 1Y8RB 1T4DA 2GCNA 3Q7QA 3KWMA 3HSKA 2VN8A 4U7WA 3LCMA 1B8PA 5EMHA 2J0QA 4GOXA 5BN5B 4D4LA 5EYPA 3DMFA 1J8YF 1ZGGA 3IAUA 4ITRC 4AICA 2OBFA 3B1ZA 3LUCA 3LPCA 2PKCA 3TLGB 3SVTA 1ML4A 2J4DA 4LRTB 4RTMA 2I7CA 1SUFA 3IBSA 4GPAA 3TSWA 4EIWA 1N33B 1J8QA 1NQ5A 2HJGA 2JD1A 1FFYA 3AFNA 1Y9JA 4M55A 5ESDA 3WZ2A 4JB3A 4TLCA 5HE9A 4MVXA 1PW7A 4KUHA 4HLNA 4QVGA 2XWJI 5CVVA 4JWKA 1YUNA 4CBVA 4ZJUA 2C2MA 4ZHQA 2XRZA 2VJCA 4IGAA 3RTDA 5DU2A 3UW3A 3OJXA 2CMDA 2VNSA 1NOIA 3EVGA 1VHDA 5D51S 5FPHA 5JT1A 1Z5WA 5JQWA 4D9MA 3H9EO 2QWXA 2Q9CA 3GMIA 1ISHA 3LLCA 3CT4A 1II8A 1QTQA 3UMBA 4GIBA 2IDZA 1CZOA 3N2GB 3JATB 4UTPA 1E58A 4H3HB 2PZBA 1TC2A 3SGLA 5I7WA 5TB5A 1MQSA 1XD9A 2P9ZA 2X8JA 4WADA 4WRRA 1NA5A 4PZYA 5GQSA 2Q2VA 1RD4A 2MWMA 4G0NA 4NVRA 1GPLA 2P79A 1JKIA 4JZYA 4DDHA 1R6VA 2R8ZA 3PBKA 5F78A 3SX0A 2NPOA 5DN6D 4TV9F 4EG8A 3VO1A 1KK1A 3NWPA 5BORA 4DBZA 4C2UA 2JS7A 3UHAA 4OLHA 2WP0A 5HKOA 5DRYA 5KOJB 4BMSA 2B2CA 3GQBA 4GYWA 3VDXA 5GIOE 3QW2A 1CQXA 3IV6A 3MEQA 1G7TA 1KFKB 1V7QA 1YU6A 4MEBA 4EG1A 4YDRA 2F1KA 1P4SA 2FRDC 4KWHA 3T38A 3PDIA 2DF8A 5KYGA 1KAHA 2ZRHA 3E3OA 4BWFB 4LF6B 1AO0A 3SBDA 1HTWA 4JP5A 3RYHA 4EBBA 4K88A 5K05A 1SIWA 2XMCA 1FX0A 4JJGA 5L3VA 1AK9A 2PRJA 5EIXA 4FUQA 3INTA 3QKSB 4DXAA 2GXAA 1NVWQ 4QD3A 3MOSA 1OX4B 4P5EA 2WD8A 2HDHA 3DEYX 3FN4A 3PNSA 3K70C 4OG2A 3QPBA 2F8TA 4XD7A 3O93A 2AN5A 3GT4A 2JI7A 3HO8A 4MR7B 1V11B 2C3MA 4LYJA 4R6XA 2DBYA 5DN9A 3ZQ6A 2DWUA 4Y7DA 3BYZA 4TVBA 1GYQA 1AKYA 1IMOA 1EUYA 3MUOA 3SZLA 3GL9A 1S4QA 3MWJA 4P35A 1KNXA 1DXQA 5JCJD 4X92A 3H2GA 3WYDA 1EWRA 1RQGA 3D2AA 3OTWA 3MGBA 3CX4A 4G8DA 4MIOA 2VDRB 3T9EA 2XQJA 3DGFC 3B82A 4YRDA 2VHEA 5JNSA 1GFIA 1SR8A 4QDKA 4MJ3A 4WIAA 4A23A 5IF3A 4HVTA 5IJ9B 5KI6A 2VWGA 1B6SA 3IUNA 3NRBA 4IXMA 2FJUA 1L6RA 2H6EA 2VHCA 1PJZA 1ZUIA 3CR3C 2QRNA 3ORFA 3KKEA 4G8BA 5LKRA 3NBKA 3QW4B 4JB2A 3B2NA 4D9JA 4EY8A 2Q5CA 4J2OA 4NJMB 4BO6A 3K9QO 3AG5A 3SF8A 2NYVA 1N9GA 1HY3A 3O5AA 3IQXA 3PICA 1TT7A 1NOKA 3EBLA 1NTRA 4OFXA 5IDYA 2IV3A 1YJXA 1FLDA 2GJ4A 3TLAA 1KRWA 4MCAA 2ZS9A 1KU6A 1EWQA 2Y1OA 4EJSA 3BE8A 1H1TA 4RHCA 2VNJA 4XSVA 4QWMA 1BGWA 1EK5A 5CA0A 1UBGA 3TAHA 1MXHA 3WGQA 4HRYA 1PT9A 1RP7A 3ONWA 4JDPA 3FZQA 2ZB4A 5E9JA 1P1IA 2WVHA 5KNCD 4B71A 1E7RA 2YN0A 2JLBA 4CM7A 3SQMA 5BMVF 4LRSB 4FR0A 1ZHHA 3QFCA 4UEJA 4YRZA 2W2TA 4LDPA 2FFQA 1IHXA 2ETXA 1L6IA 2IYNA 3BDAA 4DL9A 5LQUA 4OYRA 1SC3A 2NO0A 2G5GX 2ZAOA 1DRWA 4K46A 3VPSA 2OCLA 2C5FA 1R0YA 2IYRA 1V41E 2EZTA 1DRJA 1VHTA 1WCWA 1YE8A 1PJ3A 4QQKA 5FBWB 4KLAA 1J99A 1KS9A 4QRHA 3SEZA 3HBNA 4R1PA 1VLQA 5IK2D 2YW9A 4L5IA 1MB0A 3DHNA 1CDDA 5DHRA 3L77A 1RQ7A 1UAGA 5ADHA 4B85A 1UJ2A 1A27A 3K1ZA 5L3ZA 1PRYA 1QYVA 2OHIA 3B7WA 4EI9A 2XDQB 4ZVOA 5U1PA 4BNGA 1NMEA 5IYZA 4FEEA 2C2YA 3HP7A 3O26A 3WLLA 1E3LA 5JJKA 2N1MA 1T5SA 1YFKA 2PH3A 3ZY6A 3K9WA 1BQ4A 3RYIB 1P9OA 2VYFA 1NQTA 3BA1A 3F2VA 3NGLA 3NHRA 4IWNA 1C1XA 3VO8A 3PKJA 2KB0A 2YFQA 3X1KA 2K7ZA 1HORA 2VS1A 4GSKA 4H0CA 3RIMA 1ZJ4A 2V8BA 2Z8YM 1A7UA 2HPHA 1HYGA 2P69A 3MELA 1D7AA 4CU2A 5JFTA 1PU2A 1DEKA 1SQ6A 1T0BA 3GD5A 1QNFA 4WZBE 4MKRA 3V48A 1EP2B 4ZDJA 2FLVA 2DZDA 4C05A 1V4BA 3SMVA 1M2KA 1QJCA 4GSYA 4YJ2A 3PXEA 3C7CB 4IR7A 4KV9A 4ZHSA 2HPAA 3KPUA 2DKNA 3OU2A 1GZ5A 1PEYA 1OFUA 4IZ6A 5DK4A 1E94E 1A4RA 4FS3A 1PWYE 3SC2A 4JFRA 3V4RA 4JLVA 1S8AA 2VNAA 1LPMA 4N0DA 4Z7JA 3RAEC 4TTIA 2WPDD 1Z5UA 2FZVA 3FZNA 3HNPA 1UJMA 4WESB 4AQYB 3DTVD 2O9JA 2JEOA 2PLNA 2Q49A 3MIZA 5FQOA 5AVQA 1I4WA 3T5TA 5IDXA 1R66A 4R16A 1OJLA 3NDJA 1DO8A 2NACA 4OCZA 2R8RA 2R7LA 3NQ41 4A82A 4E5UA 1JVBA 1GCGA 2QP3A 1L7DA 3WX0A 2ZJ3A 1M6VA 3CRQA 4BFUA 1W4AA 3QX9A 3ZX4A 3EY4A 4IDDA 1L4BA 1XROA 4ZOLB 3V97A 3DE0X 1FE8A 4M83A 4PQFA 3SSOA 3UAWA 1DC6A 4KLRA 4DLTA 1C0KA 1ZJZA 3QPDA 2QI9F 4XTRA 3E9CA 4DQKA 2FR0A 4RZ2A 3R8FA 3B1XA 4BP9A 3LUDA 4EZIA 3H4TA 5MFPA 5F35A 1OWNA 5GY7A 4CFSA 1E9EA 1FVHA 4C3UA 3E9ZA 2NZJA 1MX1A 2R1UA 5ESXA 3AZOA 5FUYA 5TMDA 2H1OA 1PX0A 4OAOA 2JKYA 2RHOA 3AF5A 1E7YA 4B3RB 4J3NA 3B3FA 4UXJA 2GASA 4G9GA 3JW8A 1VB3A 1T4CB 1UBNA 3O2JA 1KE2A 2VQ6A 2AKAB 5G53C 3RGWS 3PEWA 4NLLA 4OF4A 1CUAA 3HI6A 5C4MA 3FJOA 3DEFA 5EKTA 1W36C 1NC1A 1HT1E 1I4EB 2VJQA 2F67A 3DEIA 4H4EA 1Z34A 2HIMA 4H3KB 3RG8A 3VX4A 1ZN8A 4DR2B 1QVAA 2QJRA 5ALXA 3COYA 1UJ6A 4IFEA 4PO9A 4E2WA 2PWBA 1BCRB 2ZVQX 1RYNA 1ZGJA 2IYYA 3C5CA 3GNSA 4OSOA 4UM8B 3E18A 3TQTA 3I1FA 3TI7A 5GM2A 4Y2UA 1OVMA 5E1BA 5TQJA 2NZ2A 2HDWA 5CTJA 3T3PB 4GOJA 1DIOB 2UZIR 5K2OA 5EWJA 3PQ8A 3G5AA 4G5OA 4IIJA 4NZ9A 3RSCA 3QU9A 1U65A 3RUCA 1U3GA 1Q21A 1QPBA 3H84A 3C3PA 1D2CA 1GPMA 4ESHA 5EZYB 5IC6A 2VP0A 4ILEA 4KQ1A 1KC1A 2UZ4A 1BDMA 3PSAA 4H31A 4LWOA 3A04A 1PFKA 1WZCA 1WZIA 3I64A 3AJEA 4P81A 1FP6A 1H23A 3QLUA 2HX1A 1XEWY 1S9HA 1ZGAA 1EZ1A 2B1GA 2WJYA 3OZRA 3PUYA 3HSYA 4PGMA 1L7VC 1ZC3A 2A0YA 3BD9A 1HSZA 1TL7C 2A78A 2B6HA 4JQOA 3GGJA 3PI6A 1CQIA 1T5LA 2FP4B 4Z8YA 4UPDA 5JWOA 2FDCA 3R3WA 3AI3A 1RKXA 1XK6A 1XRLA 1CUYA 4LK2A 2B21A 1I5EA 1U80A 3CT6A 4HKTA 5T6BA 3CVVA 2O3TA 2P3SA 4MO2A 1AQ6A 3LL7A 2IQ5A 1FBNA 1K7YA 2ZRAA 5FL3A 2CGEA 2DQZA 4L73A 1UC4B 4IKPA 2DTEA 3AOEC 2G0TA 2CLLB 3P19A 2X3FA 4M8SA 1Y9ZA 2V9CA 2Q99A 3IIMA 5ALSA 1K3TA 3B3JA 5HBGA 1DX9A 3P27A 3GFSA 3Q3JB 5KEIA 2HF2A 3ADDA 5AVYA 4US2R 1G3UA 2R4QA 3BFKA 3IVRA 1BWRA 1QG4A 2M9MA 2CXNA 1UK6A 2C5HA 1VP9A 4XRGA 5ECGC 2OMEA 3TW4A 3CF0A 1RXUA 2I7DA 4PYIA 2KE5A 5CAEB 4Q05A 1UFKA 3UT0A 2ZSHA 4B3JA 3MGAA 1KK0A 3F5QA 3WBFA 4ZV4A 1G3QA 3FAKA 3LS2A 1E2QA 2XMDA 2Y6VA 3UA4A 2DPHA 3AR8A 3KYDA 1P6XA 1VM6A 2ACVA 3HR8A 4HS4A 3H6HA 1AHNA 3L3BA 3DPSA 2R6HA 1X1RA 2GLUA 2HLDD 1DSSG 3TMAA 4P3PA 2G06A 5HYVA 2QYSA 4NYJR 1A2KC 2ZU0C 1UPBA 3FYDA 4YR7A 1JDTA 2VR1A 2EGHA 5AKXA 4K03A 3IDOA 1JJAA 1PR1A 4JJZA 1YL6A 3RV4A 3TECE 2C5GA 2WHEA 1GAWA 3GJYA 3OQIA 1M1ZA 1RZUA 2F9LA 4O4IB 1TMOA 4F4DA 3BIXA 3OM0A 5TVGA 8AT1A 1QV6A 2EARA 1X1AA 2AOVA 1YHZA 1VQ1A 1G5IA 3CMMA 1CB0A 1IOVA 3A1EA 1KH3A 4F72A 4LIPD 3UGQA 3P26A 3HJFA 4RK1A 1U7PA 1I6LA 4Q3EA 2I7XA 1G0NA 2AS0A 2UUOA 1BAPA 2JGDA 3H1AA 2R11A 3RKSA 1JEQB 1T35A 4JLNA 4MAAA 4C5CA 1G1MA 2BFDA 3NPMA 3CUUA 5JDCC 2XCQA 1MF7A 3W9BA 1G3MA 4EVSA 4FFSA 3S1LA 1OASA 4PIVA 4QYTA 2F3PA 4A8JC 1E2PA 2FSUA 2PX5A 4K9SA 4BE7B 3PCRB 3HADA 5I9NA 1DQRA 2YXPX 1PUIA 2FH5B 3SQXA 2P0YA 2JA1A 1P1FA 1QR6A 1Y3CE 1BRTA 1TJYA 2ATCA 4FN5A 5MHTA 2V4MA 4K8OA 1OT5A 4DS3A 4FU0A 4W9NA 1XC7A 1EXWA 1ZNZA 2YZGA 1D1SA 2AJLI 1GJRA 4IUCS 3A3KA 1ZBQA 1U4SA 3LQYA 2ZJZA 2ZSFA 4I6JA 5LA6A 3L8HA 3EIXA 3GLHB 2C1EA 1E1QA 3WC4A 2X0JA 3KTAA 3UB2A 5CFNA 5KTKA 2JJ2D 2GKOA 2XYPA 5KNLA 4MLPA 1WABA 1SG9A 3OBIA 5EPEA 5B53A 1LLQA 2O1EA 2WILA 4LJAA 3U56A 2BY4A 4LI0A 2V7PA 2GN4A 4FCWA 4J7AA 4BVEA 2JFBA 3FMGA 4N01A 4Q34A 2A3NA 4QPJC 3TN7A 3U19A 3ZD7A 2Z2YA 1MOPA 3E9MA 2NZYA 3AEYA 4MQFB 2V5VA 3EC7A 2WJJA 1UXKA 3R3SA 4DQDA 4HY3A 5FV7A 1ZI9A 5DHFA 2DX7A 2PKRA 2X1HA 4HJRA 3BSYA 3W90A 2QU7A 1OIVA 3IKLA 4DW8A 5A6SA 4Z4HA 3O4VA 1XLVA 1Q0QA 1A9RA 2Y0EA 3C24A 2XJ9A 2QA5A 4Q0MA 1R6TA 1H1LA 2FQ1A 4M4SA 1C7EA 3BVPA 1H9BA 4I08A 4I8IA 1NN5A 2RKOA 1G8MA 1L9XA 2FMUA 1UXHA 4CMEA 4RTQA 2GEBA 2W4MA 1R12A 3VXKA 3M9LA 1U2QA 4FJ0A 4CLXA 4YCJA 5C5DA 5FI5A 3TRDA 3V9AA 5TXGA 4ZAXA 4ROTA 2CNWA 4G1FA 2H16A 5JD3A 3OJ0A 2XCSB 4OI1A 2Z0MA 5KTMA 4Y9TA 2F43A 2X7XA 3AJAA 4BNKA 1FFDA 3Q87B 2YNMC 3AM5A 4IDCA 1TRHA 2JLZA 3OIDA 2DH5A 2O7VA 1V43A 3P0FA 4YMUA 1K5DA 4M8LA 1A9OA 1LVUA 4LPKA 4YAOA 4BC1A 4F9GA 4MGYR 5LD2B 3N3BC 4B2IA 2DRIA 2J9ZB 1JQAA 3KK0A 3GPIA 7MHTA 3IT1A 1HK7A 1W85B 1EJ2A 3EZLA 5DTJA 2R4UA 4N8SA 1P75A 1PS8A 4D4HA 3JWPA 4FIDA 4M89A 2C4WA 2E89A 7REQB 2QDXA 4PO3X 3R9KA 1Q7EA 4C2AA 4MYUA 2BISA 1ND6A 3RJMA 5BW4A 5JASA 3NVAA 3JWJA 4PGHA 4QUIA 4WE3A 1RE0A 4TWIA 1JR4A 1ZI8A 3ZUGA 3N39C 1HRDA 4LHWA 2J33A 3OX1A 4EM6A 1MDBA 4DLWA 5JMPA 3ZNOA 3RF7A 4Q1VA 3LA6A 3U16A 2MINB 2ZKLA 5CLLA 2XADA 3AOGA 1P4GA 1UM9B 3K09C 4LXIA 4JLDA 2PH1A 4DA7A 5I4KA 1X80A 3OLYA 4QUJA 3A6LA 4ZCLA 2ZE7A 4X20B 4DV1B 2YVKA 4XLZA <