2AOUB

Histamine methyltransferase complexed with the antimalarial drug amodiaquine
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
289
structure length
288
Chain Sequence
SMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inhibition of histamine N-methyltransferase by diverse drugs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histamine N-methyltransferase
total genus 111
structure length 288
sequence length 289
ec nomenclature ec 2.1.1.8: Histamine N-methyltransferase.
pdb deposition date 2005-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2aouB00
3LBFA 4LG1A 5DLYA 3OZSA 2OKCA 3REOA 4LWPA 4PGHA 3C6KA 4U7TB 2NYUA 4U7PB 5EKUA 4PYQA 4X41A 5K03A 3DP7A 3B3GA 4M38A 3EMDA 1EAMA 3TQSA 5E1BA 2ADMA 3SGLA 4C07A 2G1PA 1RI2A 4KWCA 1ORHA 2NXJA 2NXEA 1N2XA 2VP3A 3BXOA 5EEGA 2AOTA 4Z2YA 2XVAA 1DUSA 5GP1A 5DTMA 3R24A 2XBMA 2BR4A 3DLIA 5EZSA 1ZKDA 5CVDA 2XYRA 3OE5A 4DCMA 2CL5A 2IIPA 3B3JA 5KVAA 3P2EA 4YV0A 3FUTA 1RJDA 4DQ0A 3HCAA 2I6GA 3A26A 3CBGA 2VDVE 4KIGA 2IDKA 1NV8A 3OZTA 3T0IA 4C06A 4ER6A 5F2KA 3UJ8A 5BW5A 1JTEA 2PKWA 3FYDA 3HVIA 2BH2A 4BLWA 4BP3A 3DH0A 3JWJA 3MQ2A 2OYRA 4DKJA 3KKZA 2UYOA 1BHJA 1D2HA 2AN4A 4PYIA 3FPFA 5BP7A 1YFJA 2OZVA 2ORED 2YX1A 1RJEA 2PSSA 3HTXA 4OBWA 3UJCA 3G88A 4HTFA 1X1AA 1MHTA 3FTDA 2H00A 2PXXA 3DXZA 3KPYA 5E2BA 3KPWA 5KS2A 1YZHA 3CGGA 3FRIA 1G38A 4FS8A 1IM8A 3GO4A 5EHGA 3KQQA 2I9KA 5CCBA 4YUXA 3CC8A 3H2BA 5GIPE 4BLVA 4R6XA 2OB2A 3CCFA 3FPJA 3G2OA 3KR1A 4OBXA 5E9JA 2ONYA 4O29A 1R8YA 1TW2A 2OBFA 3KQPA 1NW3A 2NXNA 5EMKA 3UJAA 3MAGA 3G2PA 3MB5A 2BM9A 3SVZA 3FZGA 1XDSA 1ZHFA 1I1NA 2P35A 4XUEA 3T7RA 4F86A 5LQAA 2IH4A 4E31A 1L3BA 3BGIA 3HEMA 3LHDA 2R6ZA 2AVDA 2FHPA 2QM3A 5FCDA 3G5TA 4ZTBA 3FPGA 1R18A 1EJ6A 3E23A 5C1IA 1U2ZA 2O05A 4ER7A 2O0LA 5T6BA 3M6UA 4PYNA 4ER3A 5FWAA 2JHPA 5CVVA 5EEHA 4R6WA 5EHIA 5IKMA 5K05A 3TOSA 5K01A 4X60A 2V7EA 2ZBRA 2P1DA 4QQKA 4WXHA 4CKBA 4FSDA 4AZVA 1JG3A 4E2WA 5LQJA 4POOA 3GJYA 5D1NA 2WK1A 3LDGA 4MIKA 3FYCA 2WA1A 2GLUA 3P8ZA 4Y2HA 5DX8A 3G7UA 5E9QA 2YXLA 3MERA 4PYOA 4G56A 5EOVA 5E9WA 1R6AA 3FUVA 1JR4A 3HCEA 4CWAA 1I4WA 2NP6A 1BOOA 2EX4A 4E32A 4QVKA 2IH5A 2VDUE 5E8RA 1L3IA 5DPMA 3AY0A 3P2IA 3AWIA 5FA5A 5G02A 4F85A 5MHTA 2ZBPA 1QAQA 3ID6C 1KYWA 3BZBA 1N7IA 1SUIA 5K8VA 1NBIA 1D2CA 4P7JA 3JWIA 5GINE 4H0NA 2ZLBA 5LQNA 2QRVB 3NWEA 5JUWA 4AZWA 1Z3CA 1YFLA 1SG9A 5B1SA 2GH1A 3R6TA 2NP7A 3KQSA 3TPZA 3UJ6A 3GGDA 5DXJA 3TRKA 4NECA 4PWYA 1P1CA 2B3TA 4OQEA 3AXTA 4PYMA 2C7OA 2AZTA 4M37A 2PV0A 5ERGB 5P8WA 3LCUA 5FQOA 3G8AA 5HILA 5DM4A 3HCBA 3NTVA 3KQYA 4QPPA 5EVJA 1H1DA 1G55A 3A4TA 3NMUF 2UZ4A 1VP3A 1UIRA 1X1BA 3K0BA 1X1CA 4GF5A 2PX8A 4R8RA 3NDIA 4RTLA 3GRYA 1QAOA 2EG5A 3QOWA 1NW8A 3C0KA 3TFWA 4GOLD 5CUQA 5CVUA 4E33A 3P9CA 3THSA 2F8LA 2IGTA 1XCJA 3GXOA 3GRZA 5DRYA 5M5BA 2YXEA 3LCCA 2YUIA 4RWZA 2AR0A 2FPOA 2Q41A 1SUSA 2ZFUA 4KIFA 4IV8A 1EQAA 3I5UA 1RI1A 3JWGA 5FHQA 3HM2A 3O7WA 1Y8CA 2ONZA 2JH8A 2AOVA 2PX5A 3I53A 3WSTA 3KPJA 4F84A 2Z6AA 3O4FA 2XVMA 2VDWA 1NKVA 5K0CA 5FULA 2GS9A 3RIEA 5DRTA 5GWXA 3GCZA 3PVCA 3FUXA 3V8VA 1KR5A 5EG5A 4HC4A 4PONA 5EMMA 3EVGA 2CMHA 4GUAA 2BR5A 1N7JA 4RV9A 3BGDA 3ME5A 1WXWA 2P8JA 2AOWA 3GWZA 1RI5A 3NDJA 1DL5A 1FP2A 1QZZA 2DPMA 2G71A 3MCTA 5E1DA 5KQRA 5BXYA 1I9GA 3KQVA 3MTIA 1M6YA 1SQFA 4BP1A 3PX3A 1AQIA 3FUUA 1L9KA 4FZVA 7MHTA 3I64A 2EFJA 2H1RA 3KU1A 4QPNA 4AX8A 1JSZA 3UBTA 4HG2A 3AJDA 4C04A 1XCLA 3MTEA 3KQMA 2G70A 2UYHA 2DULA 4HGYA 3K6RA 3O31A 4BLUA 3HA3A 3ER9A 1B42A 3EMBA 3DLCA 4GOOD 3G2MA 3AXSA 3MCZA 1VE3A 4KDCA 1T43A 4RYLA 4UOEA 5C9ZA 4OX9Y 5KQSA 2E5WA 3ELUA 1SQGA 3OE4A 3LGAA 3B7PA 4EMSA 4DM3A 4PGGA 3P9KA 2QE6A 2IH2A 3UA3A 3LBYA 1YB2A 3LSTA 2IBTA 4FP9A 3DMHA 2Z6UA 2XYVA 4CXMA 4CKCA 3CKKA 4KRGA 4LWOA 3FPEA 5FUBA 2OO3A 3UZUA 2OY0A 2OPBA 2PBFA 3KR0A 5JR3A 5LQKA 3FTFA 1KPHA 2P41A 3A7EA 4JXJA 4A6DA 4RVDA 3CJQA 5K0FA 3A27A 4DCGA 2QYOA 3EVFA 2AN3A 5T67A 5HOQA 5EKXA 1JSXA 2JG3A 1O9GA 5EQJB 1UWVA 1Q0SA 3HA7A 2IPXA 2OB1A 2P7HA 2P3QA 3BUSA 3KQTA 4E2XA 2P3LA 3G2QA 2BZGA 3KHKA 3R9XB 3CVOA 4YUYA 3V97A 2EJUA 4AUKA 3M6WA 1PJZA 1NE2A 4RTJA 3TM4A 3DR5A 4FT4A 3NVKI 3EVBA 4P7FA 2FRXA 2ZIGA 1ORIA 3IEIA 4RX1A 3IV6A 5LR6A 1JG1A 5ICGA 4ISCA 5E2AA 1EJ0A 3B5IA 5FA8A 3VSEA 3TKYA 5K0LA 3M6VA 3A7DA 5HZMA 1IXKA 2ZVJA 3KPUA 3UWPA 1M6EX 5DTQA 1F38A 3CJTA 5F2OA 4BY9E 4KW7A 1PRYA 2O06A 5DSXA 2CKDA 3GRVA 4GC9A 3NWBA 1X1DA 2ZZNA 2GAFA 1L1EA 3DXXA 2PWYA 3HCDA 1QANA 2PT9A 5DTRA 3SX0A 3BKXA 3TKAA 4AZTA 2PXCA 3EVEA 3PT9A 4QDKA 4R05A 2ERCA 2P3OA 4X61A 3THRA 3NW9A 3DUWA 4CTJA 1KPIA 1NW5A 2AOTB 2IFTA 2UYCA 2B78A 3LDFA 3HCFA 4PYLA 3KR9A 3OU2A 4EVIA 2HMYB 3I58A 5K09A 3TMAA 2JHCA 1XXLA 4ATNA 3HNRA 4QVGA 1JQDA 2PVCA 4EK9A 1BKYA 1FJXA 5E1OA 3BGVA 4OQDA 3TR6A 5EMJA 4C05A 1MJFA 1WXXA 3F4KA 3BWCA 1INLA 2N47A 2YTZA 1OR8A 2VS1A 3SXJA 3VC1A 2GB4A 2JH9A 3LECA 3KQOA 3IYLW 1TW3A 2JJQA 3SSMA 3ER8A 5IH3A 4PCAA 3EVAA 1ZGAA 2BM8A 4ER0A 3PS9A 1O9HA 3NVMB 3VC2A 3GRUA 4P7GA 3LKZA 2QRVA 4DF3A 4YMHA 1VLMA 3TM5A 3UA4A 2I62A 4WVLA 3EGVA 2NXCA 4R8SA 3QOXA 4PYKA 1L3CA 5EZQA 2AN5A 5T64A 4E2YA 5BW4A 4V0QA 2Y1WA 3HCCA 1IY9A 5DX1A 4HTFB 4DA4A 2HNKA 4IKPA 4E70A 3LX6A 1ZQ9A 1Q0TA 1F3LA 1QAMA 3ANXA 2IBSA 4FT2A 3BWBA 4RVHA 3L8DA 3P9NA 4K6MA 5DM0A 4LECA 3DXYA 3BKWA 4XUCA 1UFKA 4EQZA 4EKIA 2QY6A 3S68A 5CIYA 5HIIA 3LPMA 1NV9A 5LSAA 1RJFA 3MGGA 4XUDA 5GIOE 1JG2A 1AF7A 3EGEA 3OFKA 4YUZA 1SVUA 4V0RA 4ER5A 5LQRA 1KHHA 3E8SA 5DX0A 5GOZA 2UYQA 5DSTA 3UJDA 2ZZMA 5EGSA 3EGIA 2Y1XA 3E7PA 3U81A 4E2ZA 2HR1A 1KPGA 3FPHA 2PX2A 3M6XA 3DMGA 5C0OE 3LCVB 5E1MA 3X0DA 2V74B 1O54A 2PLWA 4CTKA 3C6MA 2EJTA 1JQ3A 5DT2A 1EG2A 1HNNA 2B9EA 4DZRA 2G8NA 5FWDA 3KPVA 4RTRA 5EIFA 3HP7A 1VP9A 5K0NA 5E8JA 5FADA 5FQNA 4QTTB 3CJRA 5LQCA 3OZRA 2JHAA 2PX4A 3FRHA 9MHTA 4P58A 3BWMA 3KQWA 3GIWA 3M33A 2FCAA 3PX2A 1ZGJA 3R3HA 5CM2Z 3FTEA 1FBNA 1VL5A 3JWHA 4B17A 4GC5A 2PGXA 5DXAA 3M70A 3EPPA 2AS0A 4XCXA 3E05A 2ZULA 2P40A 3P9IA 3UJ7A 4HRAA 2YXDA 3VYWA 2FK7A 2ZZKA 2PT6A 4HGZA 5KYGA 3HVJA 4MTLA 1SKMA 3OCJA 1YUBA 3Q87B 5HIMA 4OA5A 5U4XA 3KR2A 3SMQA 2AOUA 3QV2A 1NT2A 4MHTA 1XDZA 2YR0A 1XJ5A 2HTEA 3G89A 5EC8A 1NBHA 1R00A 3ELYA 5ICEA 2ZW9A 2ZWVA 1FPQA 4RVFA 4X63A 1AQJA 3I9FA 4RTKA 2ZCJA 3ERCA 3FTCA 2ZWAA 1G8AA 2ZSUA 1P1BA 1RJGA 2YVLA 2A14A 3EEOA 1JTFA 4X1OA 5D1HA 1X19A 2LD4A 2NNWB 5DM1A 3EVZA 1KIAA 4QQNA 2ZBQA 5HIJA 3SSOA 3Q7EA 4L7VA 5F2NA 5ICCA 3EVDA 4GOMD 2ZTHA 4FR0A 5CCXA 4RTMA 3IHTA 1R74A 3G8BA 4GQBA 2IDJA 1DCTA 4YV1A 3MHTA 1XTPA 3LKDA 5EMLA 5HEKA 1VIDA 2C7QA 4IWNA 3OU6A 4PIMA 3B89A 5DM2A 4YUVA 10MHA 8MHTA 1VQ1A 3DULA 3PTAA 4RTSA 2O57A 3G5LA 3A25A 3SM3A 2KW5A 3M4XA 1WS6A 5CVJA 2H11A 2PWPA 1G60A 3EVCA 4MQ4A 5CVEA 1G6Q1 3P2KA 3P71T 3RODA 3PFHA 3LL7A 4PINA 1NW7A 3DMFA 3PFGA 4A6EA 2YQZA 5GM1A 3BT7A 1WG8A 2GA9A 3T7SA 4KDRA 2PXAA 2ZIEA 1KP9A 4RVGA 2OXTA 1ZG3A 2HV9A 2B25A 1RI3A 1WY7A 4IV0A 1VPTA 4YMGA 3SR4A 5FHRA 4C03A 1XVAA 5DWQA 3OFJA 4CKEA 1D2GA 1JQEA 3PLAE 1TPYA 4FGZA 1KYZA 2K4MA 5K0JA 3UJ9A 1NW6A 2CMGA 2ESRA 3P97A 4PCLA 5EIWA 5ICFA 1M0EA 1BC5A 1V39A 3SSNA 2P7IA 3B3FA 3HVKA 4QDJA 3UJBA 5LQUA 5EPEA 1XDUA 2PJDA 2WA2A 2HWKA 3T7TA 3OPNA 3ORHA 3TLJA 1KXZA 3GU3A 4RTPA 3HA5A 1G8SA 4PNEA 5K0GA 3OU7A 4Y30A 1AV6A 4RTNA 5HFJA 1HMYA 4M7RA 5HIKA 4HH4A 2G72A 5CD1A 2I7CA 2Z6QA 2CWWA 2AVNA 1EIZA 4GEKA 2XYQA 2R3SA 1WZNA 4FSXA 4PYJA 4RTQA 2PY6A 2BR3A 3DOUA 2FYTA 4YV2A 1JG4A 3LDUA 4C4AA 2C7PA 4PIPA 1R8XA 3EEYA 5FTWA 3R0QA 3UFBA 3GNLA 4RTOA 3HVHA 3C3PA 4EKGA 2IP2A 1P39A 2B2CA 4HSGA 4P7KA 5H02A 4OA8A 4YUWA 1RI4A 1P91A 2C7RA 3C3YA 1YF3A 2AOUB 4C08A 4AZSA 2ZIFA 5K0BA 3ELDA 5GM2A 4KVZA 4RSRA 1YZ3A 3GDHA 4M36A 4GBED 2FK8A 1VBFA 3PB3A 1QYRA 2O07A 3RW9A 2AOXA 3D2LA 3BWYA 3FUWA 3GRRA 4GOND 4MWZA 4QTUB 4E30A 4DMGA 5K0EA 1FP1D 3DTNA 2VZ9A 3ELWA 3NJRA 2GPYA
chains in the Genus database with same CATH superfamily
4MUXA 5DGTA 2JIQA 4UHJA 2V03A 4OOEA 3ZE8A 4LGYA 2FCRA 5AXDA 4GZMA 3NBFA 2ZQ5A 2WT8A 5CB4F 3EMDA 3MMNA 4EB6A 1EESA 1IQ0A 5H82A 2JS7A 2A1TR 4FI3F 1YQDA 3BF8A 1QKIA 1S5PA 4U0JA 1UMKA 5EQFA 1DUSA 3WIOA 2DR2A 1KK2A 1LVUA 3DLIA 4LJAA 3ZTYA 1ZXLA 1G1AA 5HS4A 4B7UA 3OE5A 2CL5A 5LP6C 4G5XA 4R8LA 3JATB 3E48A 1VGVA 4ZO6A 3G9TA 3NALA 1N6OA 2AGVA 3CBGA 5DULA 4JJIA 1RHJA 1DEAA 3L02A 1GZDA 3QOYA 3T0IA 4L3VA 4C06A 1ARZA 4B45A 4MEJA 4C78A 3GXBA 4ZAWA 5LOVB 1RKVA 5BN5B 4S04A 4B3HA 1XRPA 2JI8A 4U2KA 1M8PA 1W85B 1C7EA 1YZUA 3MQ2A 1ZS9A 4P93A 1BHJA 1DVRA 2JHGA 4PYIA 1LDNA 1ZZEA 3VC3A 2WSSA 2II6A 1YVPA 4M3NA 5FJJA 1W36B 3U62A 1WETA 1E8DA 2OZPA 2VPYA 3BMOB 1XD8A 2GCOB 2FP4B 2NUTB 1IBCA 2P4SA 5ITSA 2GJKA 1SVWA 3N2ZB 4P4LA 4FS8A 5JAUA 2FDCA 3KQQA 3DMTA 3N28A 5G1OA 1F0YA 2ZROA 5KEIA 1BOFA 1W5BA 4C3OB 1Z4QA 3NEPX 1KSFX 2XF8A 3UHPA 3WZ2A 4Z6KA 3ILYA 5H4HA 2Q5QA 2J67A 3CG4A 4O0LA 4RK5A 1UBFA 3RVSA 3SEAA 1T9BA 3SDBA 3W79A 1R4NB 1USKA 2NXNA 3PFWO 1JS1X 1YDFA 1J09A 4RL6A 3FZGA 3LC2O 3UIEA 4QZVA 1SXJA 5JDCA 2C2OA 2P35A 2RHLA 1Y8QB 3ONVA 1S01A 3IKJA 4IMPA 3T7RA 1EXWA 3WI7A 2ZB2A 3ZU6A 4L4ZA 2CV1A 4HB2A 2E4WA 1R8SA 2I8CA 3IDOA 2R6ZA 1Z2PX 1EFTA 5FWYB 3H1PA 3A6PC 1ZCBA 4KJXA 4C3ZA 4E08A 4M8KA 3VZBA 1UKCA 2FE1A 3GA0A 1GTJ1 4U2CA 5DBIA 3PI7A 2N1MA 2QTHA 1NRIA 5A9SB 4MKIA 3KYJB 4ZP1A 4R1TA 3TBKA 2I6FA 1PWXA 4L5YA 2GPJA 4B8ZA 2L19A 4EEKA 1SK8A 3GFQA 4V0NA 2QSJA 3E1KA 1U0LA 4DQDA 4TKUA 3SZMA 4AWBA 4FSDA 4KUEA 121PA 1JG3A 3FKQA 3JWEA 1HDZA 4HDRA 2WMDA 2UZ1A 5D1NA 1JGTA 1PKEA 3K0CC 4Y2VA 3MERA 1LC0A 4ZEWA 3AKZA 3L0YA 3UUFA 2PVPA 5GPBA 1JT2A 4KGDA 3MCVA 3IEMA 3KEGA 4O2AB 4XQ9A 5HRCA 4E5MA 2BC9A 5E8RA 2C1EA 2CEKA 2Z57A 1R5NA 3IESA 3ZH9B 1FYFA 1YKFA 5JE8A 3PNSA 3OOYA 4LYGA 1Q3TA 1KEEB 3LBNA 4J7CA 3P9XA 4KAAA 1D4AA 4LTDA 3WISA 2X9QA 1W25A 4RZXA 3G59A 4K6GA 2CDNA 4ILKA 2YV5A 1HXHA 2J3QA 2LPMA 4M22A 3A8TA 5HIAA 4TROA 3R9WA 2A1UB 3IPRA 4Q4AA 2P5YA 3I9MA 3KKNA 2QRLA 4AICA 4IOKA 2FXVA 1YB6A 4U2FA 1WUKS 2PL3A 4DFDA 2GN1A 4DIOA 4RCVA 2ZR9A 2RKOA 3G1UA 4TTPA 5C5DA 1PLJA 3BQ9A 3KVVA 5KHAA 3COWA 1P81A 4ZU6X 3U9TA 3G9XA 2LCQA 1H6DA 3T3EA 4F8EA 2WHRA 3QG1A 4AY6A 4BNHA 2QX9A 3CWZA 4O4IF 5ALXA 2OWDA 4IWXA 2DUWA 1IWPB 2H63A 4DLAA 4DV3B 4D6PA 1RS0A 5AVSA 1PHRA 1NVUQ 2ODAA 2XPCA 4H27A 4QLOA 3QK7A 2IS1A 1LW6E 1NN5A 3B36A 3ZJ4A 4TV9F 5CFQA 3DVAB 4X71A 2V7XA 5BQ3A 1VE5A 3UXMA 1JE1A 3VR5H 1R4MA 1RU3A 1CUEA 4WLVA 2A9QA 3A2NA 3NP7A 4UC0A 2GETA 3I5UA 3MVEA 1MIHA 4HUJA 2QLNA 1M2GA 5IW8A 3D4LA 3ZCQA 4B3IA 4CM4B 2C3OA 4CZ2A 2IX3A 3GP8A 4B43A 4JK3A 4RBNA 1HMPA 2DR3A 4IH1A 3FFAA 4ZC1A 5JPDA 1GEEA 3GAFA 4O4IB 4UHEA 4B7AA 1ZXBA 1K97A 3ENWA 4YAEA 3LS2A 5KYWA 2QVCA 2WKPA 3WC4A 1P3Y1 2HRCA 3A37A 3AKEA 5HRUA 3HFJA 5AW8A 5JVDF 3VHRA 5ITVA 4TZ6A 4Z99A 2UUPA 2A94A 3IMFA 4HMQA 3MIZA 3H11A 5EQDA 4KN8A 1SPXA 2P8JA 1RCUA 4TL8A 4Y2JA 3THYB 2ZBGA 4QU8A 1QZZA 3B9PA 5E0OA 1WE2A 1SQ5A 4QRIA 1BMTA 2G71A 2W2NA 4TTTS 2F4NA 3TZEA 4CKWA 3AF6A 2BKXA 1FSPA 2XTAA 1OLXB 1UANA 3EF3A 4OUDA 5T3UA 1AQIA 1ZVVA 3I64A 1A0OA 5A04A 2RGBA 4JLMA 1PG5A 3UBTA 5CGZA 3UEOA 2BGKA 3K4QA 2RFLA 3LYLA 6LDHA 3JQBC 4S2UA 1QHGA 3F9RA 1RQLA 3AQ4A 2C2XA 3Q6IA 3JQ7B 1SBHA 4N82A 4NZMA 1OLOA 5JI3E 3RVPA 3PPWA 4FX5A 2GZRA 1FFWA 4GP9A 4BB6A 2C00A 2GBCA 1YQGA 5CYGA 4N5HX 4QLBA 2E5WA 3ELUA 1SZCA 3IS3A 4KDFA 2AC7A 4LHEA 4QHSA 5TGDA 1E1CB 3R9KA 4ZXFA 4L8GA 4B6PA 4CL2A 4RE5A 5F9MA 4AO8A 3QX8A 3SQOA 3AR7A 4NPAA 4BMYA 1LBQA 1YOBA 3MAAC 5F3DA 4E13A 1C0PA 4ECAA 2G1UA 2Q49A 4J2OA 2OBXA 3HC7A 1SKQA 2AE1A 2OY0A 1E3QA 5JR3A 1Q1BA 5JBNA 3ACDA 3FTFA 3BBLA 4B2YA 1ABEA 1M2EA 3EW7A 3SFVA 4OHCA 1S4MA 5JY1A 4G65A 1QG0A 1OF1A 4BO0A 3UWSA 1O5IA 1UJ6A 2XBUA 3N8GA 4HAYA 4RVCA 2JG3A 1YS1X 3CKYA 1R64A 2F43A 2OFFA 5B53A 3MTDA 3C3CA 1ETHA 2OBLA 4JUIA 5DW0A 5AKEA 4GX5A 4O4JA 4OH7A 4GSLA 4DIDA 4G1MB 3UGJA 1USUA 2H4ZA 3GX1A 3JSAA 3AETA 5AKYA 3ZGNA 3ZBQA 4P80A 3ETGA 5E6SA 1A8UA 1KP3A 1MENA 1GGKA 1C9MA 5JPIA 3DTVA 4R2MA 1RWMA 1QDEA 2X3FA 1VSQA 1G5PA 4LE0A 3OPYA 1EB9A 1S9DA 2JIZA 4QUBA 4G4SO 3SIRA 5DTQA 4X6UA 3OKPA 3BERA 4NP6A 4TXNA 4B3CA 1BN7A 3FSGD 4I6GA 5BSFA 4BY9E 5K4AA 3S2UA 1GN8A 4DLBA 2YS6A 4DR7B 2O06A 3HK2A 2V5VA 5SYMA 3B82A 1L1EA 4BRSA 2E48A 2FG6C 1T5HX 4R0MA 2RGRA 4AZTA 2JGDA 5IJAA 3ICPA 4GD3Q 2Q8QA 2A5JA 1ZNQO 4TL9A 5AWFC 1MV8A 4L2IA 1ZUIA 2FPIA 2BRUC 4F4DA 1BWRA 2AFRA 1N2ZA 2F9MA 2P1RA 3AHJA 3HDTA 4Y2XA 5FLYA 1BX3A 1E5DA 4KAXA 4N54A 4Q3BA 4KXNA 2JANA 1YB4A 1BE8A 3NYWA 5A4DA 4UTVA 5BWNA 2CVHA 5CFPA 1E2HA 3JZMA 5K3FB 1Z7GA 5DYGA 4OXXA 3OTWA 1HG1A 3E27A 3F74A 1T3TA 3GQBA 4WESB 1KDPA 3C74A 1LGYA 1T9ZA 2J33A 2OT3B 3LPLA 3QE0A 3RUDA 2RGCA 2ZK7A 3KYDB 3QE9Y 4JI4B 3IYLW 2XUQA 3ZCVA 3I2KA 3D3KA 4PCAA 4GT1A 1T8PA 5JQGB 4H3SA 1Z5VA 1V25A 3U37A 1BA3A 4NFSA 1V8BA 2ZYHA 3LKZA 3IAM1 1F9AA 4CGYA 1EVIA 4PVCA 3VNSA 1AOXA 2NXCA 4J7AA 4G5SA 2D1SA 2R6GA 3QVLA 1UFVA 2WSMA 4J6FA 4NZYA 4AUNA 2IU4A 3EGWA 3N70A 3NHFA 4TKZA 2RBKA 4RFSB 1IY9A 1JHYA 4HTFB 3STXA 4IKPA 4HF7A 2XMQA 1DP4A 1YRWA 3MLEA 2DX7A 1KFCB 2WAXA 3AESA 3N2EA 1ZQ9A 4KR9A 4DLWA 3A6ZA 1M5UA 5KHOC 4LXTA 3BWBA 3FYHA 1RTKA 2ZEJA 3PCXA 1NASA 4YMLA 4LYYA 3PIDA 1YS6A 5A62A 2R1VA 3BKWA 1NW4A 2A5FA 1AQ6A 4QTZA 2ZRDA 1TUBA 3RO7A 3AW8A 2V9ZA 2VXBA 3LPMA 1NV9A 3LVFO 4CLRB 3MGGA 4XUDA 3FWNA 5CYOA 1AF7A 3EGEA 3ZHSA 5JROA 3HFGA 1X92A 5D3ZA 1VYUA 4MRNA 3FR7A 1ZW6A 3ILXA 2GAOA 1P61B 2IEIA 3PC8A 3V1MA 3ADCA 3H5LA 1RABA 4G9GA 3CUKA 3FM9A 4XSHA 3UF0A 4U9IS 4HBZA 4UZEA 2OV2A 3HKDB 5IZCC 2BTEA 1M8FA 3BJMA 3NAQA 3QBJA 4QHTA 1JHPA 2PAFA 3L4BC 1XVTA 3GG9A 4MYRA 5DWVA 3GG2A 4K9KA 1OJLA 3ZGYA 3FB4A 2FUEA 2JIRA 2FZEA 1AKVA 1NZJA 1X3SA 1E9RA 1EWVA 3P96A 2I54A 4JBLA 4QDZA 5DIFA 5E8JA 1VHQA 3LD9A 4DVGA 5JFTA 3FMPB 2PNFA 1ORDA 3CQ9A 2SICE 2ZVPX 4KX3A 4EX7A 1DS6A 1IL0A 2H2WA 3ELBA 1GPLA 3D8UA 5CA1F 3PXAA 4JT2A 4B17A 1KQGA 1ZGBA 2PGXA 4RMIA 3GK3A 4O4LA 4JB0A 2WJHA 3ILHA 5MGNA 3U60B 1D1TA 2K5UA 2ZULA 1FB5A 3UPUA 3HJAA 4N7BA 4YRZA 7YASA 3D2CA 2QMZA 4B09A 3JALB 4LJYA 3K8QA 1AZLA 5CT4A 5KNDD 2XUZA 2QKYA 1YWGO 3OEWA 3OBIA 1MXFA 2QW0X 2YY5A 4QU5A 5GGXA 1ZITA 1NT2A 2XWBF 3TD6A 4II7A 4PO8A 2WUDA 1MO3A 1TMOA 3UTDA 1WX1A 2HHCA 4JVNA 1YAJA 4BBPA 3NFRA 3P4YA 4RFSA 4W4TA 3HB7A 4G23A 4DOMA 1P1BA 1EFKA 3CRRA 4O2BB 4ZARA 4LBWA 1H1LB 2MDTA 2G63A 4LY0A 4X1OA 3RF6A 4CL8A 2FB9A 3FKJA 1KMQA 3GN1A 1W1IA 3REQA 3O1JC 4Q7LA 1CRLA 2O7VA 4MW7A 3LY7A 2RG7A 1G41A 2C2GA 2LCFA 3I34X 4LYJA 4ED9A 2M6SA 3RFVA 1PK8A 2NO7A 3GEIA 1KERA 4FBGA 1T2UA 1ILWA 3ZJ5A 2C7QA 4IWNA 5IASA 3B89A 1NF9A 4TKVA 4M6WB 2OHJA 3NRBA 3LQ2A 4PC7A 3M4XA 1YASA 1C3JA 1HQCA 1SD1A 1CZKA 2EOAA 1G60A 4WMLA 3C3XA 1G6Q1 3FNRA 1K7EB 1AH2A 1CY6A 2Z2YA 5TIIA 1SKAA 2H0QA 1JHDA 3KJIA 4P4SB 3U3DA 2GA9A 1BGWA 4M1YA 2JJMA 4RGYA 4AKSA 1TU0A 1V5WA 3MRSA 2H3EA 4N6GA 2B25A 2OV6A 3G0GA 3TGPA 4UAVA 4IV0A 2FA9A 3SR4A 3MBIA 1SXJE 3DBRB 3RYFA 1E9VA 4UVDA 1N2CE 1T34A 1UT5A 4ZT4A 2FPPB 2CFIA 1QV7A 1TZMA 2AF4C 2K4MA 3MG9A 1X2BA 2Z04A 3MPOA 4OP1A 2J9FB 1JIKA 2D1YA 5CIWA 2CVZA 2HWYA 1VLZA 1BEEA 3NM6B 3UT5A 1XF1A 3T7TA 2I3GA 1IRXA 2A84A 5J4KA 1XALA 2D1FA 5HJ2A 1EX1A 2CFTA 1EEHA 3NRCA 3OKFA 4H60A 1OWLA 1CR6A 1TYBE 2V8OA 1HMYA 1UKYA 2VFAA 1DOZA 3RKRA 2G72A 4YUXA 5BVGB 4UBJA 4GEKA 5IC5A 1EIZA 4B3SB 3EDMA 1L5HA 1IEQA 4LJ5A 5IU6A 4N5DA 3HCPA 2PY6A 1YKGA 2HDNB 5EHQA 4QAQA 4IHAA 4TX1A 2C7PA 3F98A 4BO9A 2WTEA 3A1UA 3ZGZA 4LMBA 4MVJH 3RYTC 2BTQA 2C4MA 4Z9YA 4XW2A 2DGDA 3NTQA 1PFYA 3BA1A 3R5XA 4RKQA 3OJXA 1NQAO 5P21A 2XNJA 3OIGA 4NNOA 2H85A 1N78A 4W82A 3DVRX 1XA4A 2HSJA 2OP1A 4AZSA 3LLSA 3ONEA 3SVTA 3A05A 1OIVA 4MDHA 2H1WA 2BT4A 5BN5A 1V5EA 3PGA1 1YA8A 4J76A 1DJNA 4WLUA 4DWOA 3AT1A 4A36A 4FGKA 1O6ZA 1OY1A 3FUWA 1XNJA 4UU7A 5FUYA 5FO0A 1EUDB 4CCYB 1FP1D 3TRDA 4E21A 1KY4A 4L08A 3SLKA 3LBFA 2WG1A 4ZOAA 5B3JA 2N3ZA 4CMKA 2JIPA 2QR5A 4YUAA 3T6KA 4ODIA 2ECFA 3ROZA 4K9MA 4P54A 2XKKA 3DHEA 3QLUA 2OD2A 2RGNC 1NBEA 1KS2A 3OE1A 3OIWA 4YHBA 1D4FA 4LF7B 2EJWA 2VWQA 5CLFA 3PQ3A 3FSEA 3EDCA 2WAYA 3JQFA 3W4IA 3BDVA 5TV2A 1JT9A 3OHMA 1YS2X 4DILA 1RJDA 1BDMA 3I73A 1PEKE 4J6EA 3RH0A 3TFQA 3A6KA 1US8B 1Z5PA 4K05A 3GFGA 3Q3VA 1KU0A 3JQ8A 4Q7KA 1V26A 3I9V1 1E2JA 1HURA 1RAGA 2V7QA 3F6PA 4WJZA 4PM4A 1N3LA 1ZJ4A 3KB8A 4EMTA 4A03A 2VJNA 1NJ1A 3JWJA 3LKBA 2AN4A 1Z2NX 5DGXA 2JGFA 2VTBA 1QP7A 3DE0X 1UIMA 2RSLA 3LC0A 3W2HA 3T9CA 5I9SA 3AHGA 4AX4A 2Q28A 2PCLA 3PG5A 3S2YA 2XDQA 3TH5A 3ICWA 3L7BA 4UM5A 3H8WA 4IHJA 1YFKA 1P44A 2Z5VA 5DHSA 1DAKA 5JFGA 3PC6A 2WZQA 5T8KC 2XUJA 2AMVA 3PWZA 4H15A 1MC5A 2V96A 5CCBA 4AZ0B 4Z4QA 3TSWA 4QTYA 1IN6A 3PYXA 3SXUA 4CR7A 4BVAA 5COBA 1L5GB 4AKEA 4D4MA 4TZ0A 1OPXA 3EXEA 4R6XA 4ENVA 1UOOA 1O03A 4GRIA 4L4UA 1IAVA 1CRZA 4ZQEA 4RHFA 1HFJA 4Z54A 2XADA 1NW3A 1LNQA 5TARA 3HZOA 1SUBA 2V8BA 2Q6TA 5KJEA 4BZZA 2GJAA 4TLDA 2HT1A 3KM0A 1GZ7A 3P0FA 4FN5A 2FH5B 2FZ5A 5EUCA 3EGDB 5F7JA 4E31A 3D8RA 1JMVA 3SZOA 3EPHA 3EY9A 5DHRA 3HO6A 4M1EA 1U1CA 5FV7A 3UGQA 2GCPA 4BVKA 1TB4A 3IPYA 3BH7A 2RJOA 4JX9A 4CGZA 3G2NA 1FDWA 1V3VA 1WXEA 4QUJA 5THKA 3O4GA 2LVBA 3CXRA 3HQ4O 4L9AA 3RFCA 3N7AA 2ZSAA 1CEXA 3I83A 3T9EA 4PYNA 4F9GA 4JYZA 4KO8A 3OC6A 2JHPA 5AHOA 4I1SA 2HJVA 4XVCA 1PIWA 3B2EA 1TCBA 2CLEB 2GZ2A 1U1DA 2YHUA 2H5EA 4R2HA 4CKBA 1S02A 5EJ7A 4HOYA 3B20A 4POOA 1USIA 1ZRSA 5BSWA 5AJYA 1V3TA 3DO5A 4FONA 4MA5A 3QEJA 2Z2IA 4GUDA 2ZDHA 2PIAA 3IPXA 2PZ8A 5EYPB 3U7IA 1GFWA 2Z2JA 4W6QA 2MSDB 2YVUA 1HX7A 1KVRA 3HDGA 4DIUA 1JIVA 5LN1A 1DCMA 2FG7C 2EQBA 4LOIA 4WESA 4WW0A 1A5AB 2JRLA 5TQVA 3VPFA 3D1JA 1L4HA 3FI0A 1OBVA 1MFPA 3QVUA 5T5QA 3ZLTA 5JT1A 4OI2A 1XZIA 5G02A 5E3IA 1G21E 1XZJA 2LW7A 3W06A 3M5CA 3NOQA 2DEUA 1JLRA 3P9SA 1OX5A 1NBIA 2RGWA 2VDWB 1XN1A 3H3XA 4NK4A 2V7QD 1OLSA 5HF8A 1XRRA 5I9IA 4QSHA 3NWEA 1E5VA 2A86A 5EPOA 3IXQA 4BNXA 5I8WA 1SHKA 4K8OA 1EP9A 1W36D 4XVQA 1XNRB 4UAUA 4BC0A 2AJ8A 1Q44A 2JGAA 1H2HA 3F8WA 1L7QA 4IDPA 4AJNA 4L78A 1XZKA 2AZTA 1BHSA 1G4HA 1XBTA 4WKOA 4W5WA 1KJWA 1TK9A 4FX2A 4G9BA 3BG5A 3A10A 2Q5FA 2G6TA 1ANKA 2GRUA 1Y7PA 2HQRA 2NU9A 4W6ZA 3NMUF 3UUGA 1O3YA 4P81A 3Q7SA 5IWCA 2C2YA 1XRMA 2XECA 3BMCB 4TMKA 3LPAA 3LO5A 4OLHA 1P1FA 5CU7A 4QDUA 5DNVA 2BSXA 3ZJVA 4KQHA 2ECQA 3T12A 3N2NA 2NOAA 1JHUA 4HQKA 4K8RB 4GRAA 3TUZC 4WOPA 1KZ1A 1C8VB 2ZBFA 1RZRD 1Y9JA 1Z8NA 3LXRA 3HDQA 1EFPB 3JARA 4TGLA 2CLSA 3LCCA 1MAHA 3PRHA 4R54A 3C7TA 1EQAA 2X4LA 4UAJA 2V65A 1F9EA 4MIOA 1REQB 3R76A 3WGZA 5IMBA 4YT5A 2XNCA 4B46A 4BVHA 1NN3A 2ONZA 4J0FA 2W2OA 4OP3A 3WFZA 1OIXA 1NYQA 3COSA 4MP3A 5F98A 2QPAA 3MWDA 4YNBA 1XSEA 3BREA 4YWHA 3STTA 5GWXA 1DIHA 2NQTA 4IDAA 5A7GA 5TX7A 4CKZA 3FUXA 5KJCA 4IG4A 2WJVA 3OT1B 4DARA 5TT1A 2F59A 2POQX 1XDBA 2GN4A 3E9MA 3CMCO 1A2OA 5F12A 4D80A 3QFFA 3QU4A 3FY4A 2G4CA 3W77A 2HRQA 4O33A 4BX3A 4JGIA 3A6GA 3H5NA 1JUDA 1U11A 4K03A 3UMFA 1UMBB 2UVDA 2NLOA 4FFLA 1E66A 4JYPA 3GAMA 2DF8A 4DY6A 2QM0A 3KYIB 3VV2A 2EFJA 3Q15C 2BDUA 2B8WA 1Q22A 1Z4JA 1C0KA 3OI7A 4US2R 2E0IA 2XNHA 3AQIA 4M53A 4O8CA 1EBFA 4X97A 2BN4A 2YWBA 5FIUA 1CJVC 4PPFA 3ESCA 4DLSA 1TD9A 3UUWA 1N2OA 2QK4A 5HKKD 1LWOA 3GDFA 3FBGA 1I7LA 1S0UA 3BILA 1WCIA 4CIDA 1A77A 4RENA 2RHRA 3REGA 2JCYA 1ECFA 1LBTA 4R1PA 4PGGA 1KGDA 4PIVA 5BT8A 5BR8B 1Z56C 3ADPA 1NJ5A 3LSTA 4B6FA 2Z6UA 3IP6A 3GLHE 4KK3A 1TCCA 3B53X 2Q1TA 1PT6A 3NV9A 3S5JA 4CKCA 4L8FA 1D2EA 2ZE8A 3U6KA 1JVSA 3KK0A 4UOQA 3RTBA 4R9NA 5LQKA 2PLRA 4FIZA 3IAFA 4G2NA 4JXJA 5JEDA 3THXB 2C3MA 1XJCA 2J08A 2P62A 3FYSA 5NULA 3IFSA 4RMGA 2DQ4A 2GUGA 2FMXA 2G9ZA 4F1KA 1DG9A 3KAKA 5K0FA 1LLQA 1QHSA 4WCFA 2Q1YA 4F9TA 3R3WA 2K87A 4GO1A 4JVOA 1QNFA 3KLBA 2KJQA 5CYFA 3SYTA 1OW3B 4B3XA 4B3FX 4WJLA 5IN4A 4KXMA 5H81A 3G2QA 5E0KB 1ZONA 2XUHA 4CMHA 3RSLA 1PR1A 1TVKB 1ZSNA 3S28A 5IBCA 2WVGA 1N8TA 3EBOA 1OWPA 3QI2A 2EJUA 3N2IA 1PJZA 1I6LA 2J87A 4LY6A 5FPSA 3OF2A 1K5GA 2Q3EA 4PLPA 4BFSA 4Q21A 4W1SA 2UUAB 1YQUA 3Q9UA 4U00A 1GP2A 3B5IA 1CUIA 1DIBA 4HZGA 4N39A 3OQNA 4FDLA 1V2GA 3VU9B 1U3GA 5J58A 4FM9A 1Z0KA 2G40A 1E8MA 1H8HD 1TE2A 2FR8C 3H65A 4Q4HA 5REQA 4XJSA 2C92A 1ZIPA 1G3RA 1ZEMA 2D7CA 2JASA 3QFCA 3SZ3A 3BHIA 5BR1A 1VE7A 4RHEA 3H83A 3QEMA 2SHKA 3WA7A 4BATA 5DCUA 1H2ZA 3IEUA 3ZDQA 1FQOA 1SN7A 2ERCA 3E3LA 4X61A 4XVHA 3WQRA 3UH0A 3G1WA 2EVWX 1R15A 2BBWA 2X9NA 4OO3A 1SY7A 4NG5A 1LVHA 2H2DA 4GI1A 3HDHA 3E8MA 4AJHA 1E9DA 4TVSA 5IANA 4RF2A 2VI5A 4LRYA 1XCPA 1JFSA 3R3XA 4YFYA 3AM5A 4CN8A 5IPFA 1SOUA 4IO0A 2B8EA 4IOMA 4U9UA 3VC7A 5EE0A 1XZNA 3TR0A 2XV1A 1U0NA 3QMPA 1QLHA 4PAMA 3HABA 3ND6A 5DFAA 3NVMB 3K8YA 1Z0AA 4N0MA 3KYCA 3QEKA 4MARA 4RZUA 3K8OE 1JHRA 3VC2A 3ZY2A 2QI9F 4EZIA 3TMKA 4N49A 3A9VA 1JQBA 1OXMA 5ABPA 3Q8MA 4JH0A 2OORA 4AS2A 1L4GA 2QAGA 3ZGOA 3KG2A 3RV3A 1P77A 2Q5LA 1XK6A 3W5CA 1HNZB 2V7TA 1PEYA 1XTQA 1G2IA 4LZLA 1D2RA 2FDXA 5LZ4A 1P2UA 4NBLA 4J2TA 2GPNA 1UZAA 1DOHA 4F72A 5I9LA 3F5DA 3K6SB 1IK4A 1IZYA 2DPGA 2QUHA 5IM5A 5B7GA 4UZFA 3L8DA 2X42A 2R7NA 3P9NA 3UH1A 4KIWA 1YJ8A 1ISRA 2HPAA 4DREA 4JYCA 1C1DB 3JTEA 5HFAA 1MEOA 4EQZA 4AQ7A 1GRVA 5ALMA 4CR8A 1L8QA 3PIRA 2VTVA 4N0PA 4HO1X 1IY2A 5M29A 2H3HA 4RAOA 3WB1A 3M2TA 1OXVA 3GUYA 4YRCA 1T4BA 3E8SA 4PHGA 4IIJA 1DIRA 1WXQA 4BQNA 4GQAA 5C7LO 1AQUA 2ZZMA 3N8NA 3ZVKA 4O2BF 4TUYB 2XGOA 2D5IA 3L01A 4ZOLB 3A6HA 4CQMA 1QM5A 3RWOA 2ZBUA 3LY9A 3HADA 3TRHA 2H8KA 5EIBD 3NBXX 4EYEA 4XQCA 4U5XA 1NZFA 4GL4A 3OTGA 3C6MA 4JC4A 3E61A 1R3DA 3PICA 4M0LA 3ODGA 4HNRA 1SVIA 1I6WA 1XE3A 2YHSA 3C6YA 1G9XA 3H87A 3P2MA 1JKFA 2XMPA 3RSZA 4DLKA 3FRHA 4W7HA 2O8BB 5KOJB 5C8VA 5CRIA 3M1AA 1GG9A 3R3HA 4AXXA 3U1BA 4YRPA 1P5ZB 4L8YA 6REQA 3DLHA 1GG5A 4R3NA 4WZAA 4HDOB 4X9XA 4ENWA 3NBYC 3FAKA 2E3JA 2X1MA 4HRAA 4XEUA 1QO9A 1HZZA 4LCEA 2WOOA 1U4NA 1ZCZA 2AYYA 2FK7A 2FFQA 2NZYA 3D7LA 3G0DA 1SPBS 3H1TA 2JCXA 3HVJA 3LLMA 4NZOA 4R0VA 4B6OA 1G8PA 1ACMA 3H19A 5HIMA 1F5SA 3O1LA 5KKCA 3LUCA 1I8TA 1P2SA 1R6BX 3FBWA 4GI5A 4WD3A 2GZMA 3SR0A 2GUWA 3U7RA 4EG0A 5ICEA 1KC3A 1F1JA 2QLLA 1QG2A 2YN2A 4KGXA 4KBGA 5LZ8A 1GZSA 4EA6A 4CCAA 2ZWAA 1FXUA 1MO5A 2PYDA 3IIMA 3MB8A 4H08A 2X3YA 3QF7A 4OHMA 4D4KA 4RE6A 2AFIA 4UUNA 5CA1A 1PLLA 2YJ6A 5C5IA 1ILEA 3JZIA 4UUBA 1FTSA 4C7BA 5KTKA 1R4AA 3D9QX 3KTAA 4JDUA 2QAJA 4OQNA 5HIJA 2DBRA 1M7BA 4AO7A 1LV8A 1L8XA 2UVPA 3QU9A 1QPBA 3RIMA 4GR5A 1DKLA 4QL3A 3W2EA 3DF9A 2E4YA 5FUXA 3ZLUA 4HNTA 2CNOA 5FWXB 2Z1NA 3U3JA 4YV1A 2O20A 3N74A 1E4OA 4QE3A 1U5BA 3EPJA 3GVCA 5FNVB 3O73A 2CCJA 1RXVA 1GTG1 2AJCA 2DB3A 1KMHB 1T9GR 1DWUA 4ZDWA 1ZCJA 5TNXA 2WTUA 2AHOA 4OF4A 1O57A 2FFRA 4ZO4A 3U7EB 3V9PA 2OCKA 4A23A 2DSNA 4L72A 4TQAA 3AIOA 5ESDA 1FFCA 2O23A 2OXTA 1XTKA 1NN1A 2EZUA 4FFNA 1WY7A 2JLWA 1N6RA 1DV1A 1SULA 3A4LA 3NBZC 1PR3A 4CKEA 5AK4A 2D2VA 1PJAA 2YY6A 4DXDA 5JO0A 2PV7A 4CV1A 3HCRA 1ODKA 3YASA 2NUPB 2O7RA 2QAIA 4JT8A 4HVAA 4UTZA 4CIYA 2X2PA 3L7DA 2KS6A 3WYAA 3P94A 2BBSA 1TIKA 3R41A 1WPQA 1YVDA 2ZVQX 2CUTA 3OMLA 2FG5A 3CZQA 3U39A 4Y30A 5SZHB 1JAIA 3OCWA 4JMLA 5A6VA 1FJGB 3KB2A 3S1AA 2I71A 3K09C 3WYDA 1J06A 4BUZA 5HIKA 2GBIA 3B70A 2R3SA 1WKCA 2VSYA 3BD9A 2I2FA 3COZA 3HSKA 2BFFA 1EDZA 3JQ6A 4JJZA 1ST2A 2BR3A 1CNEA 2PVSA 1V8FA 2JJYA 3MGBA 4YV2A 3PUWA 5EJ4A 5B5SA 3EMKA 4BVEA 1KKMA 1N7GA 5HK8A 1GGJA 4MS4A 3ZJUA 1SCDA 3EEYA 2XE7A 1ULUA 1V6SA 2ZT6A 2AT1A 3EHDA 2TSYB 4S1OA 2WHPB 3UQZA 3W3AH 3T5DA 3ZK7A 5JW6A 2QLJA 1SUAA 1OU0A 4TSKA 3Q7IA 4P7KA 3KEFA 4KTVE 2L18A 5A6SA 4NDAA 5EJIA 4D3ZA 3DC2A 2JAWA 2XUPA 4KFSA 3A04A 2XIQA 3GDHA 3O8QB 4ZDJA 1R5OA 1AN9A 3FI9A 1YO6A 3PB3A 2VCYA 3GJ0A 2X8JA 1CQIA 2ZTMA 3FTQA 3MCWA 5LUBA 4AN0A 1RLIA 4TM7A 3K0FB 2Y9MB 3S4YA 2B4AA 4Z86A 5K3FA 2Y77A 5KVAA 4F4HA 4N41A 4Q7EA 2C3UA 4LWPA 1CT9A 5JD6A 4U7TB 3MM4A 4MP8A 1QGDA 4C01A 4TMXA 4PQRA 2XAAA 3HRKA 2EZ4A 1BCRA 3NAGA 1EK6A 2ISCA 4CF6A 5EPUA 4J1SA 3BL8A 3EXIA 3RT1A 1O96A 4QVIA 3T5BA 4JV5B 1WEHA 3L0CA 3R6GA 5AHKA 3SXUB 1JAXA 3IUBA 3QXXA 4Y18A 5EZSA 1T6XA 3QWIA 1CXZA 1QX3A 5EKDA 1GILA 5IBQA 3K05A 1N9GB 4LVOA 1KO8A 4R31A 4JLAA 5DHTA 2IF0A 3A26A 1Z35A 2TMYA 2WIDA 1U3TA 1WCWA 2BPOA 4LDRA 4CMGA 4D9JA 4UTRA 4L4RA 1UDBA 1N0IA 5AK0A 4U2DA 3WNZA 2BMFA 1YDWA 1WXGA 3GMIA 3T1QA 3EW9A 4KE9A 3ZS8A 3BXXA 4ZJZA 4LRTB 4DKJA 5E3JA 2W2MA 1RRVA 4C29A 3ORSA 4I9UA 3ZNNA 1I2BA 1EWTA 2H7CA 4IUDS 1XROA 3TF5A 2CNWD 4YGYA 2IWRA 1HRDA 2MCFA 3RVRA 2HA4A 3TLKA 5GAJA 3KOXA 3PGJA 4DWWA 2J5BA 1PQYA 1DQRA 1G5TA 3FRIA 3KYBA 5BOVA 1GUBA 1NIJA 1JR3A 1G98A 3NIWA 1YHNA 2XLBA 4R5MA 4GM0A 3MSXA 1JILA 1EM8A 4C4OA 5L8VA 2V0GA 3JQQA 1A97A 2PYZA 5EN4A 5LC1A 3VU0A 4C4ZA 4KE8A 1K92A 1SQ0A 2F8MA 3QFTA 4R8MA 1DX4A 5FLXA 2DCMA 4LMPA 4FB4A 1ESMA 1EK1A 4WCFC 1H4SA 2HRZA 5B58T 2A1TS 4AMVA 1UXIA 2DLCX 1FTQA 3QVGB 3BVPA 4FGUA 2OE2A 3GRKA 2XYPA 2VIIA 1ZHFA 1RLMA 3IIEA 1I1NA 1H8EA 4LQLA 5LA6F 3ZV7A 1ESCA 1U7HA 1NP7A 4TTRA 3OX4A 4LRXA 2ZSBA 1WUTA 3CNHA 2HPHA 4G25A 3RTDA 1WCIB 3GEGA 3BS4A 1SC3A 3OKAA 5D5HA 5IUKC 3X1JA 5U4QA 3UMCA 4OXNA 1EUYA 3KX2A 2GN6A 3QUAA 4ER7A 5B30A 1RXUA 3DFIA 3F7MA 3ZWOA 1ECLA 3LT2A 5JSQA 3DOIA 2GFHA 4Q19A 3TW0A 4MKFA 4Y8VA 4P2GA 1VDZA 2ZJ2A 5IFLA 2BE7A 3MOSA 3SEZA 1W5TA 2O9JA 2W37A 1UJMA 3EPKA 4XFJA 4Y2HA 5C34B 2YXLA 1CUJA 3CX3A 4LC1A 4R2KA 3FUVA 4ZVOA 1E2GA 2OENG 1JR4A 3U3XA 5GQSA 1I4WA 3DQQA 4H0FA 1FRNA 3WVNA 1QNLA 4RK4A 5ANRB 1XP5A 3EYAA 4CIAA 5AJUA 3TDKA 4ZVVA 3QUTA 1ULBA 1RZUA 2WQZA 3FIJA 3QUSA 5F77A 3TX2A 1GTZA 1VLHA 2ZRCA 3LUJA 2A92A 3TL6A 4YJ2B 1FDSA 3I3OA 4Q3LA 5FP0A 4UD6A 3FNBA 4NVRA 5DOVA 1IPHA 2VYND 2BFOA 1XMXA 3KU4A 5JVDA 4BGUA 4RDHA 2JI7A 2OMKA 1S2DA 1IBRA 1V96A 3AU8A 3ZZNA 4FFOA 2J0QA 1J70A 4MKHA 3W90A 4OTZA 4D0SA 5JAIA 4V3CA 1DXOA 4BXOB 1T8YA 1T8SA 3CRQA 4EW2A 3PLRA 4RNCA 4F38A 4R1OA 4F9FA 5DMXA 6CHYA 4GX0A 1GAEO 1W88A 2XWQA 2O0HA 4WXYB 3VR2A 4HX9A 2D00A 2CHFA 3IO5A 1B73A 1QAOA 3WLFA 1V4VA 1X14A 2EG5A 2PR2A 1K86A 1GG2A 4P92A 1PR0A 3DBVO 2LXNA 3NQ41 1QQTA 1VLQA 4GDMA 4NCIA 4XX1A 5CVUA 1OXXK 3P9CA 3ZCUA 4D44A 1AKWA 1XCJA 3GXOA 1ZINA 2DUNA 1P9OA 2IUYA 3DDHA 3JTMA 4DMKA 2FPOA 3V4FA 1M1YB 2C4UA 4RH1A 3ITKA 1XAJA 3GLQA 4B1FA 2XNKA 1UT8A 1F5NA 3OOHA 1DCFA 5DOZA 1X7XB 3BIJA 4I66A 4QBGB 4EHBA 4H1TA 4QWWA 1HLPA 1OCEA 2KWIA 4MLCA 4QHYA 4BGDA 1WZUA 5JJLA 2GO7A 3CLUD 4ZV9A 5L40A 3WJAA 2GS9A 3FH0A 3WSWA 1TVMA 4F3KA 4AW9A 2ZQZA 3KKLA 1DJQA 2G5TA 3LO8A 2X76A 4QM6A 3JVDA 3A70A 4RANA 4YK7A 1XLWA 2PS3A 1LD3A 3RSHA 1V47A 3HWRA 1APBA 1DIAA 1P6QA 1B6SA 1LSOA 5CPBA 1RI5A 5I48A 4BMDA 4D6XA 2R84A 4EFDA 5EA2A 2DPYA 3KZCA 5KQRA 4D96A 2KSQA 5KDOA 1QORA 4M9SA 1VKZA 2QSUA 3PQ6A 1FY2A 1R1DA 3CV3A 4FZVA 4U6SA 3Q7TA 3H2SA 2H1RA 4YGXB 7MHTA 4E0BA 1NN0A 1XKQA 1ZM3A 5FBKA 1Q95A 2G1KA 4HJRA 2AXQA 3VMMA 4EY5A 1OFUX 3U2QA 1HDOA 2P2NA 3O31A 5MN6A 3ZGXA 1N32B 5BOSB 2JJ1A 3IIJA 3P9QA 4LCJA 1VE3A 4AKGA 1KYTA 5KQSA 4R9VA 1C8KA 5FR1A 5KIAA 1RC0A 4URFA 5EXEA 1KZGB 4RGVA 3PWSA 4D9HA 3H05A 2YYAA 4G1UC 3DVQX 3SR3A 4DLLA 2VQSA 4HFNA 5CFZA 1US8A 1IE3A 1VSTA 2B4YA 1L5OA 2HT6A 2I6TA 4IVRA 1Y8QA 5FUQA 1A50B 3DMHA 4J16C 3CH5A 4JY7A 4B32A 1CJBA 3B78A 4KRGA 1U7WA 3THWA 3LNTA 1JQKA 1H4TA 2CZGA 1Z39A 4H7EA 4MQ6A 3RS0A 2KB0A 2Z9BA 3DFUA 5ECGC 2WUFA 4GR9A 3TXXA 4IDNA 3AGPA 2GEKA 2VP6A 1AKMA 2LKDA 1FFDA 3AHEA 4DIEA 2CLHB 2FJPA 2JRCA 2HD4A 4Z9FA 4E07A 3L4KA 4ACBA 3RFTA 3Q8LA 3HR4A 5A0TA 1GFSA 3E5MA 4XB2A 2PT5A 1OLSB 1V48A 1UDRA 5BN3A 4LTNA 4REQB 5JRZA 1GZ5A 4D8VA 1WB6A 4V39A 4IHQA 4XYEA 4YJ2A 3T41A 3UOGA 1PGOA 2LUOA 2WD7A 4EF4A 1YS7A 2HA7A 3CUWA 1M34B 2CD7A 1OH5A 4P5PA 3CW9A 3AB3A 3CG0A 2I6SA 4A0QA 5CGQB 2PYIA 3RUIA 2A30A 5FOVA 1J42A 1P1KA 3RYCB 2I2AA 1Q3HA 4FYMA 3D4NA 4RW0A 3GC6A 1M6EX 5D6OA 4TT3A 1C80A 4ZZ2A 3F3SA 1F48A 2W43A 3EBPA 2HDWA 4DZZA 4QU0A 2OLKA 1KS9A 2R1UA 4OY3A 4ND3A 2NTNA 3HXQA 1ZQ1A 3V4RA 2R25B 1SJ9A 4QYIA 1BVYF 3AUUA 2Y0CA 4JR1A 4V0ME 5A3JA 2DUMA 3UAVA 3GPLA 4HXFB 5C1DA 4LJSA 5K3CA 2YWFA 2PZFA 5DYIA 1AQNA 3ZWQA 4HZUA 3R75A 1ZX1A 4ADSG 4DRXA 2BY4A 3CN7A 8ADHA 1I80A 1EWYA 2EKBA 3DHWC 3RSCA 4EVIA 1RVV1 2R5NA 1SCAA 2FPWA 3GFTA 2P27A 2FWNA 1M1YE 5FX2A 5C8DA 2B69A 1FJXA 1E77A 2H4WA 2BLNA 2FTKE 5IJZA 1PG2A 2QGNA 2J3IA 2IZ6A 3PHCA 4HI0E 5IJ0B 4PLGA 1PFKA 1PNTA 3L7KA 1C7ZA 1RPTA 821PA 5A5FA 2JJQA 1W75A 2ZAIA 2TS1A 5IH3A 5I7HA 3TK1A 3L06A 1ZVMA 1EINA 2PEZA 2QP9X 3D7NA 3F6CA 3O21A 4HX5A 4NAVA 3ULKA 4KQIA 2NVBA 4XQ0A 1BDIA 4UNQA 5EP2A 2KX7A 4WVLA 4QJIA 4X7RA 3QKUA 4F6RA 3GLFB 2HXGA 2PUHA 2WD9A 4PXYA 2IPNA 2P90A 5H16A 1VYHA 5T64A 5DX1A 2DFPA 3LHKA 3G5UA 5AXAA 2IBSA 1IOVA 2IYXA 5F5LA 4CMIA 1A8SA 1CW2B 1E0KA 5HZKA 1DAHA 1XQXA 4QNNA 3K9WA 2GTIA 4YCJA 3BOSA 5DBOA 1Q0PA 4GWGA 2GNOA 5AP9A 4OFZA 5KTPA 4WXEA 3S68A 4CEHA 5DISB 4XWWA 4AJPA 3CVVA 2CNLA 3EIXA 5A7HA 3SE7A 2CJWA 3TQRA 4QUGA 4V0RA 3BXEA 2IOQA 2IHJA 4UVHA 1NI5A 4OATA 4AG6A 1QH8A 3ZG6A 4MS3A 2GD1O 5LB4A 2R0QC 4ZFNA 5EERA 9LDTA 1PSWA 2C3PA 4NS4A 4X1YB 3PEYA 5LMUB 5BN1A 2ILVA 3RASA 2JFFA 1Z36A 2HCFA 4UMVA 1SKYE 4DMMA 2PRZA 3H84A 5TDHA 4EGJA 4YP0A 1OWNA 1VG9B 1KVTA 4RD0A 1FFHA 3IA7A 3KPVA 4G0QA 1G3UA 4EELA 1UAYA 1OD6A 1T1RA 1UWLA 2FEMA 2GKSA 3TL2A 3INGA 3S1AB 4EHJA 3SYMA 4CDRA 5AUPB 1HBJA 1KQPA 1KKUA 3PRYA 4J0IA 4B3TB 3FTEA 1UPTA 5CM2Z 4JELA 1FBNA 4HY3A 3ESAA 5EJ9A 3R44A 4XR4A 3E18A 2EBFX 1JR3D 2VJLA 4X1KB 2GYYA 2YZKA 2IYUA 4XIJA 3UJ7A 3QHQA 5FLKA 3WIEA 1PS9A 2W6JA 1ZIDA 3C7DB 4DM4A 2XYHA 3SJUA 2WUWE 3A1CA 2PRKA 4ZEOA 4TYPA 3R7NA 2HW8A 4JBXA 1ZK3A 3F97A 3WK6A 2MR5A 2F9LA 2P68A 3D4IA 3VPSA 2CF5A 1RPJA 2D4HA 3UMBA 2C8LA 4FBMA 3N2YA 4EJSC 4LXUA 2B3DA 5HF9A 2WE7A 2DWUA 5BNTA 1FTNA 3DF7A 4R41A 5AI9A 1M8GA 3PDHA 3OETA 4B33A 2NU7B 2YN0A 4Y0VA 1BCSA 1YE8A 2FPSA 1J0BA 3EQZA 4PFJA 4EEZA 5D1HA 4WKGA 2LD4A 4XLZA 3KZMA 4EI2A 1YE3A 5KNCD 1EHYA 2HWUA 4F60A 4XDGA 3OQMA 1XA3A 2BD0A 1RWBA 4GOXA 1JV2B 2IEAA 3NBQA 4GOMD 4MZXA 3RS9A 5L3SA 2TECE 1N9ZA 3GP3A 1QGUB 2WU4A 4OYLA 3MHTA 4UVEA 1XTIA 2QTCA 1XTPA 3KTDA 4ZCRA 4E5DA 4ZVQA 4JUDX 4YUVA 4LS3A 2AMYA 2C0CA 2C29D 3Q3GE 1KAGA 2H11A 3W2GA 4ZGWA 1HNWB 4JBGA 3WE7A 3RODA 1ZRHA 1NSTA 3DONA 4R1QA 4IZHA 3OLQA 3GUCA 3QPWA 2FPPA 5BOSA 2JLYA 5B6JA 2BM0A 4QATA 1TAGA 1ORTA 1YDHA 3BDIA 3CTMA 5FPHA 5TVKA 3GBSA 5EI5A 1E5XA 1XHEA 4E6PA 5ALDA 1K2WA 2EL9A 3OFJA 3SFTA 1Y3AA 1QG6A 1M66A 1UJ4A 2D06A 1QRAA 3O8LA 1D2GA 3K1YA 1TPYA 4GGOA 2RB4A 5B7PA 2QM8A 2MSLA 4NATA 4ZT3A 5ICFA 2HLDD 1JEYB 3B3FA 4WCDA 3HBLA 3L6EA 4QJ4A 4ESEA 5EINA 1NC1A 4AMZA 4YRFA 4BKOA 2QL5A 5CNIA 4EPRA 1DKQA 3FDXA 3GU3A 1S3FA 3HY3A 3RRJA 1TNDA 3M3PA 2W6CX 5DYNA 1B7GO 2YVQA 1D0VA 1YR8A 5ECYA 4AJKA 5TJHA 5HYVA 1WR8A 2V59A 2JAQA 4QIHA 1X7DA 1WM1A 2DWOA 3CFYA 4PLWA 2R6R1 5E95A 2X1LA 4XSGA 1XL0A 2IC5A 5IWAB 2CF6A 4PIPA 3AF0A 1R8XA 1P6UA 2DFDA 1RLUA 3UFBA 1N2IA 3GUUA 4ZOLA 2UYGA 3JVVA 1ECBA 4RA6B 1A4IA 4YLEA 2HSDA 3D6TB 1ZKMA 3VDXA 1R6XA 5HMMA 2YWJA 5G1PA 4UXJA 3JARB 5KAPA 2V7BA 4BFTA 2PSHA 1Z7WA 2PMFA 1F0NA 3N8HA 1NX9A 4CMAA 2PANA 2XRYA 5GM2A 1UBRS 5IDYA 3COPA 1UPFA 3LMKA 3IBCA 4GBED 4UUOA 1L7XA 3MRXA 4NL4H 2AZXA 1J2UA 3KTOA 2ST1A 1GDHA 4B8WA 4CMIB 4L9SA 3GMSA 4UREA 2VQDA 3TI7A 3KE8A 4RSHA 3U9SA 3SU8A 4GE0A 4NS1A 3REOA 2AX3A 3B3AA 2Z58A 2ZAGA 3PEEA 4EPWA 5FXMA 5A03A 2QV7A 2DY0A 3IEVA 1GUDA 1PDWA 4EJ0A 2QW1A 5LJIA 1U2EA 3EZ9A 4JU8A 1MGOA 1QO7A 4P3NA 2HU7A 4E88A 2D1QA 1QGED 4JBYA 4EVRA 4HUQA 5ERXA 1D6MA 2HPZA 3LU1A 1ECPA 4OU5A 3I5AA 2AOTA 4KBFA 4TS9A 4AG3A 5GP1A 2JIZD 1BGXT 3UV6A 1VLVA 3I42A 1M6WA 2IOFA 1G42A 2PX0A 4JJ6A 4AS3A 2VG8A 3JQGB 4CJXA 4ZU1X 3NPMA 5REQB 4RY9A 2JJ1D 1AKTA 1P2VA 1NKSA 1XU4A 2WU3A 3C7AA 1E3IA 4MWDA 4YV0A 2VJCA 3HLKA 4KIGA 5ULLA 1WDMA 1EE9A 3EA4A 2ZRHA 3TSZA 3ZE9A 5BWLA 4M0UA 4UBLA 1W0JD 3OSUA 3SNHA 1CUUA 3HL0A 1IY1A 3E6AA 1Q12A 4BP3A 1WZCA 1ZIXA 2HMTA 2Q9AA 3AEKB 1D2HA 1Q21A 2XZLA 2BFBA 1FMTA 1H23A 4UTNA 1MV5A 2PJUA 1WL8A 4CETA 3U7QA 1CLUA 1GA6A 3PXGA 3UJCA 3MTBA 4DPLA 4RHUA 1GEGA 1SHTX 1ZOIA 4OVKA 4F3TA 2O3JA 3G2JA 2RKBA 1GUZA 3QX3A 3IC5A 2QD3A 4EDHA 2QROA 4BNVA 1TGVA 2WF6A 3DSRA 4PX9A 4F4IA 2C5BA 4JJGA 1P0PA 3H5RA 2V9CA 3BH0A 3FPSA 3P2JA 4GVXA 3IAXA 4CFSA 2Y1DA 5LDHA 1Q7EA 2Y4OA 2HJGA 4BV2A 4AQYB 1JIJA 4UFNA 1QH8B 3FPLA 3SVZA 1L7PA 1VOTA 2WNHA 1I5RA 4ZVLA 1ICIA 1PX0A 2ATEA 1CZRA 3TQHA 3DNFA 2ZIZA 2WAOA 1PK7A 5HE8A 1FC0A 2GXSA 3HEMA 4D0NA 4MO2A 1IJKA 5JWHA 2AVDA 5KWIA 3U16A 1BX1A 4ZMRA 2H6EA 2DM6A 1BXRB 4KO3S 2JVKA 3GJZA 2AXPA 3LC1O 4ZTBA 1REQA 3E9CA 4TV8F 1KVQA 2VDLB 2XQIA 5TVGA 5J5AA 3CPSA 1ZESA 2QD5A 4JQYA 1VE1A 3Q4GA 3GL9A 2I6XA 4JWKA 3WQBA 2WOJA 4BGIA 3MGCA 4M8LA 3V8EA 4MRAA 1VIAA 4NBRA 1HFWA 3UGKA 4E7OA 1DAPA 4Q1BA 5ED0A 2GLUA 5J2UA 3T7EA 1E69A 4CKWB 3RPEA 1ZBQA 1FRQA 2JIMA 3QW4B 3CNOA 2QOEA 3GCDA 4OQ4A 5FPPA 3ZQUA 4URXR 4MV4A 3KV1A 2VUIB 2HSGA 1Q0RA 3HB5X 3HBFA 3K53A 2AFHB 3L7MA 3M4YA 5J40A 1DBIA 2VDUE 1RQ2A 5DT9A 2Q0XA 3ABZA 3PVSA 1NUSA 5HA5A 4EW1A 2R4QA 4E4RA 5MHTA 2Y0DA 3DKVA 4UU1A 1L5RA 3T99A 3GMDA 1IU9A 3T4PA 1D2CA 4JEIA 3ANMA 3H1AA 4G8DA 4QBTA 2QPTA 3U19A 4C30A 3E58A 2IHVA 5B7NA 2E87A 3DAOA 1AN0A 1JHQA 1U7DA 3DBIA 4UEQA 1GKLA 3ENVA 1DMRA 1SBNE 2Y0PA 3U80A 2NP7A 4HNAB 4ND7A 1RWKA 1S8AA 1PT5A 3AXTA 1JJVA 1EFVA 2HSWA 4BJ6A 4TWBA 4P0QB 3B2QA 1Z4KA 3CR3C 3JV7A 1VE9A 3LSYA 4QXQA 1D1SA 3W7BA 3HCBA 1Q0QA 3FDFA 5LMNB 1S2NA 5DHPA 2HGZA 4QQ8A 5M3BA 4ALIA 4YAKA 4GF5A 1T25A 3I28A 4TVKA 5JZVA 2I2CA 3GRYA 4YTEA 2NO0A 4DWVA 4I55A 1LXCA 2C03A 4XGIA 4M0FA 4HDSA 1UBLS 4GOLD 2I9PA 4M0PA 4IHJF 4UHFA 4LYHA 3WKEA 2XCOA 2C77A 2ZYRA 3DP9A 4MROA 2YUIA 3NOOA 3QVSA 4MI9A 1W29A 1RADA 3VI3B 1VI2A 3LG2A 1N2BA 3QH4A 1BO6A 4H6WA 4HDKB 1J2TA 4HX2A 4LGMA 3KUUA 5I7FA 1NBME 3TVYA 3OQPA 1MU0A 5FWYA 4ZOBA 2ZSKA 3WSTA 4BO3A 4BMVA 4MW4A 3MMSA 1DEOA 4ND6A 4PRKA 1J49A 3CE9A 4BLSA 1HPLA 2HBRA 1ULAA 4UAGA 1E1YA 4JLSA 1W88B 4DA8A 3PHGA 1JBQA 3GMTA 3LLVA 3VZDA 4HC4A 1R0RE 3KJQA 4OMCA 4DEYA 1QRUA 1KXJA 1UAAA 2MMCA 3L4SO 5IVIA 4FEEA 5IMSA 3IE1A 5T67A 4FBLA 3TTVA 2VJOA 2R1VB 4W7SA 3N8DA 1ZH4A 2FE4A 3OCXA 2R60A 4WN3A 4XB6B 1OASA 3W6NA 3H0EA 4X45A 1G2OA 1NDHA 5J1SB 4PQYA 3RGWS 5TF0A 3CNEA 1S3GA 1SQFA 2G67A 2XSZA 4LI0A 4QFDA 1F3OA 1E1QD 1A95A 5K6TA 4LIPD 2VHTA 1F20A 1B23P 3E9DA 4YRSA 2DR0A 1T6BY 4PX3A 4Q9LA 1JHOA 5A1TA 2ZU0C 4TTQA 2R00C 3K6RA 2ONCA 4N01A 1O95C 3BHMA 4UE2A 5KTNA 1PNOA 3AINA 1K6IA 4KDCA 5BPHA 3AXSA 2R1ZA 1JNYA 1T43A 1GUAA 2P1ZA 3I6IA 1GPWB 1OXSC 4JP2A 1Q19A 1PL8A 3TTTA 2DPLA 1IQRA 4BQPA 5M34A 1FUIA 3I9KA 2H8GA 4EMSA 5A0FA 1P5JA 1QTIA 3HZHA 1G5IA 3R77A 4ZAGA 5TT0A 3ZW9A 1MW9X 3OA2A 4X1IA 3QBVA 2XZPA 1GCIA 1WQ3A 4ND5A 1G0OA 1PE0A 4NH4A 2P9ZA 2PBFA 3GLHB 2YINC 3P5BA 4AY5A 4GZ6A 3VAAA 5A4IS 4FFDA 3KFVA 4JSRA 4AJJA 3D4BA 3HJFA 1U9JA 3IVRA 2QD2A 1YCDA 3PJGA 5E4YA 3G49A 2WINI 2HQ1A 5HM6A 4TKUB 1RP1A 3KJZA 3ZBPA 1CYDA 3KIPA 2VPWA 2FZLA 4J7XA 5CB4A 3FTNA 3W5IA 2I2WA 2ZG6A 1E6CA 2OB1A 3OZEA 3I2IA 3BUSA 4EGSA 2G80A 5HX7A 2RHTA 2IEYA 4PAWA 2C96A 1N2CA 1ND6A 1SKYB 2INGX 2JEOA 2Z43A 3E2MA 3P52A 4IH9A 4NOKA 4YYEA 1U0BB 5MF6A 1IJFA 2FPKA 5IEJA 1ZC3A 2JCSA 1SC1A 3BXPA 3DO8A 2J9ZB 4NCHA 3WLEA 4DV7B 1K0UA 2ZS9A 3O6VA 3BICA 3FKSD 4MW0A 4P83A 3W34A 5LR6A 1S2IA 2ISSD 4K9RA 1XCMA 1CUCA 2ZSJA 5JZMA 1B0AA 4A2QA 2H7XA 3WLSA 1CNMA 3OCZA 4ZWNA 3EYWA 1CEYA 5FPTA 3K9LA 3AUSA 3FR8A 3DFKA 5ILOA 2VJKA 1E3WA 1UEJA 3VO9A 4KNVA 5J23A 2CKDA 2CXUA 2MINB 3RQIA 2ZZNA 2CHVA 2JJ8A 3ZKAA 3SFZA 1JEAA 3OJ0A 5KSPA 3H99A 5CBPA 2FN9A 4EHLA 1U2GC 4WXPA 1FX0B 1KPIA 2B83A 2CHGA 1TD1A 3KKQA 3RS3A 3SBEA 4KRYA 1P74A 3F90A 4Q66C 2NUTA 5K09A 2ECKA 1HDGO 1JA1A 1P1IA 1Z5GA 1JQDA 3AJAA 3V55A 5AVJA 3C24A 4JXZA 3IUSA 4KLAA 3VKUA 4H35A 2E1PA 2AL7A 3WSVA 4GECA 3RNOA 5AW0A 5JZOA 3LYAA 5EMJA 2CXTA 1MJFA 3O8CA 2JDID 3PUVA 1YU9A 2WQ7A 2XOKA 1O8CA 2YTZA 4RWEA 3VPHA 5BMVA 5JS8A 5C8XA 3WA6A 1AKRA 5I7OA 3VJRA 2J0UA 3EXG2 3VNQA 3ER8A 2BEWB 3MJFA 4IIHA 4A4DA 1OIWA 3AR9A 4ER0A 1H2EA 3WLJA 7GPBA 2WU0A 1JPUA 2SKDA 1EVEA 2EDCA 3O38A 4B6JA 2OZLA 1E1RA 4DNQA 4K6CA 1ZOOA 2BFDB 3CM0A 3EGVA 3FHOA 4M0CA 2JF0A 1YQ9A 1VIYA 1ZMBA 5G53C 1K5PA 1VPWA 3DFZA 4AF8A 2FSGA 2Y1WA 3LAWA 3KBBA 3D5TA 2ODPA 4H7DA 4KQFA 4E70A 5HWSA 4Q9JA 2J5RA 3NHAA 5HUQA 3F6SA 3WMWA 3WYFA 2XCIA 2VRCA 4X94A 2PH1A 3DWEX 4YJ2F 3FSGA 4JR0A 2UZ0A 4D57A 4KPYA 1C1HA 3VVLA 2Q3MA 3I52A 1R9MA 1HQKA 1EP2B 4YJDA 4C3UA 5CPFA 3UCFA 3UJNA 1NUQA 1T0IA 2IBMA 3L4BA 5DSTA 4QREA 1XAHA 1X1TA 2VSFA 1NFFA 3EGIA 1GKYA 5JH7B 4M9CA 1QIGA 1Y33E 3E7PA 3OP1A 4JIGA 5GOTA 3K16A 3OA0A 2Q9BA 4WNAA 4LV5B 1V7CA 1B1CA 1ZL0A 3U3RA 3LUAA 3GLUA 1F2DA 1XKXA 3KXIA 4MAFA 4QUHA 2PGNA 2VATA 5FWDA 3IJEB 4YJ3A 4YRMA 3W6ZA 4TWIA 2FSVA 2JLVA 1WBBA 1KORA 4Y2GA 4YS6A 3X2SA 3ACBA 1JAHA 1XMJA 4A1OA 1Z28A 1QSGA 1TLFA 1FF9A 1Z07A 3DV9A 3IUNA 3M33A 3HO8A 4I4IA 4WPGA 2GEBA 4I9HA 5MFZA 4C43A 2BZ1A 1WUJS 4C7OA 2VBIA 1HR0B 2WF7A 3HI6A 3FLEA 4PY2A 1X70A 3L3BA 2Y6UA 4RLHA 3F73A 1JNXX 2QYTA 3K6KA 1PZNA 1IIBA 1NVKA 3R1IA 5AI4A 2PT7A 2Z08A 2P69A 3WHIA 4EARA 1ZD4A 3AILA 4A2PA 3RRFA 4ON9A 4KR7A 1NL3A 4FOTA 5CW1A 3R7AA 3T3DA 5BSVA 3RUPA 5JCOC 5FTJA 2C58A 1HWYA 1SCJA 2BGIA 3F7OA 1FPQA 4X8OA 5AOBA 5KC8A 2AK2A 1W5SA 3C7KA 2BGUA 1B2RA 1LU9A 4URWR 3ZVMA 3TZ6A 2VLIA 3KLMX 2IZ0A 4U7GA 1WMSA 4E6EA 1ZU4A 1WMFA 1VM6A 2XUAA 2NNLD 4L0CA 5I9MA 5CK4A 3EEOA 3GLGB 2NNWB 4CM8A 3MT0A 3V9AA 1A8IA 1Z4LA 3OQBA 5JNSA 4MR7B 3GPBA 2IHUA 3AR5A 3WLAA 1WPRA 1SIUA 2BEJA 2PA3A 2QR3A 4ENTA 4YRTA 5JLJA 5BW6B 3OWOA 2IYTA 4XOUA 1ZUWA 4DPMA 2JLRA 4ALJA 2ODBA 4RKRA 3RAGA 3ZGLA 4ANFA 2WVHA 1P72A 1J8MF 4PTYA 2YXPX 5D3MA 3S2SA 4AT1A 3KSRA 4EJFA 4E4TA 1XJ0A 1ORWA 2AMFA 3WP0A 2H1FA 1LK5A 3P2KA 2VJAA 3ICOA 4TTSA 1OTYA 3C3KA 2ZBEA 3E8XA 1F60A 3DEIA 3RRXA 3WLLA 2OC4A 1VDMA 3WGQA 4RD6A 2PLFA 3I9V6 2ZAOA 4NJMB 4QXRA 3TGLA 1V41E 5FB3A 1IXZA 1E1DA 3FCEA 2HK8A 3PQCA 5DASA 1AVTA 5FHRA 3NT4A 2DG2A 1VBKA 2IYEA 5FORA 2C3YA 4DSUA 2Y4NA 2WM3A 3PC7A 4O25A 1NW6A 3IPCA 5KYUB 3S40A 1G8JA 1LTKA 3E15A 3KHUA 3R7LA 5KX5B 4LSWA 5G3YA 3IVCA 3HKBB 3J7TA 3CRW1 3TLJA 2ZRQA 1VTKA 2QX7A 4JBIA 1DEHA 1DWOA 1EVQA 2QIOA 5HUHA 1D2NA 1HDEA 4JQCA 4UVGA 1HE4A 3NUGA 4LZWA 5IG2A 3H4VA 3CUTA 4RTNA 4O1IA 1POXA 3VR5D 3GEMA 4FI3C 2VK2A 4XOIA 1Z06A 5LNK6 3K15A 2LIVA 3FMGA 4HPXB 2C78A 1I5OA 4C89A 1ICEA 1L8AA 4EVSA 3EOZA 3TIXB 1Z4OA 4V38A 1TJ5A 2X5KO 3ICVA 3MQ4A 2CSXA 1MUUA 4XIIA 3GLRA 1G7SA 1U0GA 2C9YA 2DKOA 3FCUB 4UASA 3ZDRA 1ULTA 4RD3A 4XIYA 2ZRNA 4QAJA 1LX7A 3GH1A 1U0EA 3EC7A 2C2WA 4J1QA 3LQ4A 2OZLB 3TDNA 1IUKA 3C97A 5CTAA 1P91A 4DLUA 1GQYA 3RU3A 2ZJ4A 1VKJA 1P9WA 2Z8ZA 3BMNB 4JEUA 3UB4A 5KQMA 3NPAA 4KVZA 4RSRA 3T3PB 3HEAA 1DFGA 4AQDA 4CTNA 1JZQA 2G09A 1TF5A 2OKGA 2XBLA 4FKMA 4JVLA 3RW9A 4BGVA 1E9SA 4F93B 4WLFA 4MWZA 4QTUB 3DFFA 4DMGA 2DY1A 1T26A 1TCUA 1Q7GA 4G5RA 5DLYA 3QTBA 4A6PA 2OKCA 3ZVRA 4UFPA 3B8HA 4HHEA 3C6KA 4JOSA 2X5OA 1MA3A 2DHEA 1G7RA 5EKUA 4ABYA 2C2HA 2DLNA 4X41A 1XZMA 1L5LA 1EAMA 2PBLA 3IURA 2PL1A 2B5OA 3FNGA 5IJWA 1Y4ZA 3C5WP 4BO6A 3QWFA 3L0ZA 3MWEA 2VTDA 2EZ9A 3PGXA 2DUUA 5ECDA 2NW6A 3CY6A 4D9GA 2ONKA 3TD9A 4FLFA 4CV3A 5IUNC 1HDXA 2EJCA 3OJWA 4MAAA 3AO0B 5HCNA 1OYOA 2JH3A 4KQXA 3TW8B 2X7HA 3LIPA 4BO2A 5K8IA 3KP1A 1C3VA 3G6KA 1BMQA 4KOAA 1EAYA 1QRRA 2XB4A 2LV8A 1XDGA 3JALA 4TL7A 2H1IA 4BX2A 6AT1A 2IP1A 2QU7A 5L3SB 4Y2YA 2VCHA 2F3RA 2PGDA 4XD7A 3Q7RA 2VJDA 2FEWB 1KI6B 2ID9A 4JS0A 4TWAA 3AM3A 1KEUA 3DOJA 4L85A 4OBWA 4U5QA 5BV7A 1DPGA 3RUAA 5C32A 3FXAA 3WB2A 4ERXA 1KEWA 2O3UA 3EMVA 3NVAA 5F33A 4BZWA 5I01A 4IDCA 4IHJB 1RRGA 3QNMA 1GGHA 1JXAA 4KXFB 3S44A 3EGXB 5B36A 5JAOA 1KJ8A 3WYGA 2I9KA 1QP8A 1WW2A 2IZOA 3GRCA 2GTPA 2OG1A 4BLVA 3MWKA 1CJSA 3OOEA 3HGQA 2WYUA 4XWTA 2Z6VA 3KZ1E 5LU9A 1TW2A 3CN9A 3GEBA 2O6HA 2W22A 4G5YA 4YT2A 1CS0A 2XCLA 1ZAYA 2WAAA 1DMSA 2OHHA 5DV9A 4ZJYA 4WFKA 3AI2A 3D5QA 1NBMD 1QU2A 4ZZ0A 3CLVA 4GPEA 3JYQA 1Z0UA 4ND2A 4HWRA 3NUZA 3VU3A 1SBTA 4MYCA 4Q12A 4E3ZA 3VPXA 4ZJUA 1TUBB 3AIMA 2J46A 5T4FA 1DU4A 1R27A 2VRBA 3QGMA 4TXJA 5LP6A 4AS1A 1VL1A 2DECA 2C4NA 2JFPA 2VP2A 3BCSA 2NYAA 4IQ0A 3FPGA 1R18A 3FOBA 4QOIA 5BSHA 2G7ZA 3P0EA 3U4DA 5J4YA 3AF5A 4JENA 4ZAVA 3MK31 2W8BA 2H0RA 1A9YA 4NULA 1BJKA 2AFVA 5AI0A 4ER3A 2XTJA 2KMLA 2ZJ5A 2OCGA 1T24A 3EZGA 5EHIA 1U5AA 4PHTA 5D5QA 1B15A 1XA0A 4BL5A 2H06A 2FEAA 5EIXA 4WXHA 1U80A 5AVKA 2EKPA 4MPPA 1RAEA 4D0LB 1FU4A 2WA1A 4L0DA 5I3CA 3MBOA 4JITA 3EZYA 2BHTA 4PYOA 5LQSA 3TRJA 4KGZA 5JCXA 1F1BA 4C4RA 1Z3IX 4EECA 4HN2A 5BUCA 3U17A 3H86A 4BTLA 4K26A 4YXWA 3WDLA 1KEKA 5KJ6A 2EKQA 3WKBA 4LZZA 3HBNA 2V55B 3AY0A 4MWEA 3OICA 3I6ZA 2Q5EA 2P8SA 3GLVA 4NEQA 4RS3A 4YQZA 3DE3X 2VHQA 4CHTA 4F85A 2YHIA 2AFHE 3BZBA 1KQOA 3E4DA 4TV8B 1OYYA 3N6XA 4XM1A 1JRLA 2H4YA 4GPBA 2FX5A 2F3QA 3OZVA 4L6IA 3ZC3A 4PZDA 2ACKA 2OXCA 3DL4A 4X7PA 3T61A 4DCJA 1B1AA 4WA8A 3L9XA 1PJTA 2XEDA 1N6IA 1ZISA 2ZYIA 1TEXA 1EGMB 4Y1GA 1Y9DA 3CLKA 4M7PA 2ZPAA 4CF7A 3TPZA 3O47A 4YMIA 4HAIA 4NBNA 2Q62A 2E89A 3NOVA 2E1RA 2UZIR 1R9NA 1EVLA 2JBAB 2ENWA 2O4UX 3BTSA 4YRRA 5HILA 2GQ0A 3RKUA 5DZSA 2FEPA 3BHNA 5IVDA 2PUGA 4NYMR 1UKBA 1G55A 2WV9A 1O6BA 2PHZA 3B13B 2UZ4A 1OGIA 3OUUA 3LX5A 3Q1LA 1X1BA 2VK8A 5EXSA 1EK5A 3QY9A 2HCJB 4KIUA 5C1PA 2W98A 1DJPA 1IN4A 4IVNA 3AZOA 1SVSA 4GE3A 3RK0A 3DDWA 4FNMA 1NMQA 1CSEE 5JSUA 5F35A 3ZWWA 3JQAA 4LSZA 2CB0A 5DI3B 2J48A 1BEZA 5T4EA 3WMXA 2A1UA 5M5BA 3KHTA 2NVUA 3DD5A 3O2NA 4IUYA 4K81B 3AP2A 4KIFA 1J1IA 3Q98A 2FV8A 1R37A 1RI1A 3DOFA 1NMXA 4S1PA 5KI6A 5TEWA 1K66A 4EG1A 3R0JA 2Q3FA 2XIJA 3FYUA 4O1HA 4CPDA 5CDTA 1EUCB 4BFUA 2WMOB 4KXUA 4GM4A 2F8TA 2ZJBA 5AVZA 5JJ5A 1XFDA 4OUDB 1EVYA 4PN3A 4DCNA 2QAGC 3QPCA 4R8VA 4P4TA 3VSBA 2GJ4A 1H2BA 4N48A 2GPAA 4XCQA 1WHTB 4MGZR 3GROA 4PONA 5F78A 2OGSA 2NMVA 1FFYA 5AQ1A 3JYNA 3JQPA 1X39A 1GKUB 3NYIA 3DKIA 1Z2DA 3HNPA 3N05A 1IBMB 4HS4A 4DKXA 1ABFA 1C3EA 3BGDA