2AOUB

Histamine methyltransferase complexed with the antimalarial drug amodiaquine
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
289
structure length
288
Chain Sequence
SMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histamine N-methyltransferase
publication title Structural basis for inhibition of histamine N-methyltransferase by diverse drugs
pubmed doi rcsb
source organism Homo sapiens
total genus 111
structure length 288
sequence length 289
ec nomenclature ec 2.1.1.8: Histamine N-methyltransferase.
pdb deposition date 2005-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2aouB00
3DUWA 2PX8A 1O9HA 5CVJA 5LQRA 5EEHA 1KXZA 3BGDA 4RVDA 1L3BA 1RJDA 2OPBA 4HH4A 5DM1A 4CKBA 2PWYA 2IH4A 4NECA 3DH0A 5K0BA 2HTEA 3DMGA 4MTLA 3G2MA 4LG1A 3AY0A 4DKJA 3DLIA 2ZBPA 2GH1A 4GUAA 4C08A 1NV8A 2O07A 3B3FA 3O31A 2PLWA 1QAQA 3KPJA 5B1SA 3VC1A 1G38A 3OZRA 4FZVA 3TR6A 1F38A 5FTWA 5K01A 2JJQA 3G8BA 3E05A 2EJUA 5FHRA 3AWIA 1YFLA 1XDUA 1NW5A 1R00A 2OZVA 3P97A 4OA5A 4OQDA 3EVGA 2B3TA 1JTFA 1NW6A 1WS6A 3OCJA 5HILA 1L9KA 3KR0A 4LECA 1YUBA 4YUVA 5LQCA 2R3SA 3VC2A 5T64A 3GGDA 4G56A 2BH2A 1RJFA 3HCDA 1NT2A 4YV0A 1D2HA 2WA2A 1VLMA 5EIFA 2PBFA 3A26A 3HVHA 1P39A 1KP9A 3NVMB 1SKMA 3MAGA 2OB2A 3OU7A 3DOUA 3BWYA 4KW7A 4X1OA 3SX0A 2IPXA 4AZTA 5LSAA 1JSXA 1P91A 2P1DA 3TKYA 3NJRA 5K0FA 3NVKI 5DTMA 3HCFA 4HRAA 3KQQA 3B89A 5HIIA 3P2IA 3DXZA 1XCJA 2XYVA 3G2OA 4U7TB 1M6EX 2QRVB 4LWPA 3HEMA 3M6UA 3HVKA 1N2XA 4C04A 3R3HA 5EEGA 1FBNA 5DSXA 1X1AA 5E8RA 1ZQ9A 1JG4A 4V0RA 5EMJA 5KQRA 5HEKA 2OBFA 1XDZA 3FPJA 1O9GA 3LL7A 4KRGA 4FT2A 3IEIA 3R0QA 5E1MA 4Z2YA 4PYJA 1RJEA 3UBTA 2ZCJA 3E7PA 2IBTA 3THSA 2B25A 1SQGA 1KYZA 2AN3A 4PYLA 4V0QA 3DLCA 4EVIA 2ZBQA 3HA5A 1EG2A 3M70A 4GBED 2BZGA 5GOZA 3UJ8A 3BT7A 2QY6A 3HCAA 5FCDA 1ZGJA 3G2QA 2ZSUA 1VIDA 3UJ6A 2HR1A 2Q41A 2ZLBA 2PJDA 4GOOD 3T0IA 3UJCA 3KKZA 3SSMA 4DZRA 2OYRA 2ZW9A 3LECA 4FSXA 3R6TA 3FPFA 4PYMA 5EHGA 3TM5A 3EEYA 3KQYA 3ELDA 3OE4A 3P71T 4E2YA 5LQJA 2G71A 1QANA 3NWEA 3B3GA 3JWJA 2A14A 3O4FA 4K6MA 3REOA 2G70A 4ER0A 5JUWA 2PXXA 5K0JA 2FCAA 3CBGA 4DCGA 4IV8A 4OQEA 4MIKA 2AN4A 2FHPA 3SR4A 4Y2HA 2AOWA 3CCFA 3SMQA 1EJ0A 2PXCA 3LDUA 3PT9A 2E5WA 3UJ7A 3BXOA 3SXJA 3A7EA 3PTAA 4PWYA 2G8NA 4R6XA 2YVLA 2NP6A 2FK8A 1VQ1A 4XUDA 1BOOA 5CIYA 4DF3A 1IM8A 2PY6A 3PLAE 3A4TA 5E2BA 2QRVA 4HTFB 4QTTB 4M38A 2O05A 5KS2A 3NMUF 5FULA 2AVNA 1JSZA 1YZHA 1MJFA 4OA8A 3OU2A 5GM1A 3NDJA 3RIEA 4WVLA 3FUTA 4QVKA 1XXLA 4P7JA 2XBMA 3DMHA 3GNLA 1G55A 2Z6UA 3CGGA 3GDHA 5CVVA 4X41A 5BXYA 5K03A 4IV0A 2PVCA 1NW8A 2O06A 2ZTHA 4RWZA 4RTOA 2XVAA 4RSRA 2VP3A 4ER7A 5HFJA 5GM2A 5KYGA 1KR5A 2CMHA 3ELYA 3EMBA 1XJ5A 2ZULA 3FPGA 4B17A 3MTEA 4ER5A 3ER8A 4C03A 5EOVA 1DL5A 3F4KA 4GQBA 4C4AA 1X1CA 3ME5A 4PYNA 2P7IA 4C07A 1RI5A 5DTQA 2BR3A 1O54A 3I9FA 7MHTA 3K0BA 2JHAA 3SVZA 5IH3A 5FWAA 5FQNA 3ANXA 2HV9A 1VPTA 2EJTA 2ONYA 3RODA 1U2ZA 3BZBA 2XYRA 5DLYA 3KQPA 4A6EA 4RTLA 4RTSA 3LSTA 4R8SA 1D2CA 2AOTB 5BW4A 4QPPA 4M36A 3PFHA 3TRKA 4ZTBA 2YXEA 1AQIA 1TW2A 3KQWA 4PIPA 4U7PB 1MHTA 2WK1A 1NBIA 3EPPA 4KIFA 4YUYA 3I5UA 1PJZA 3OFJA 4RTRA 3AJDA 4GOND 4PIMA 3UWPA 3BKXA 2VS1A 5EIWA 3KPUA 4BLVA 5DTRA 4RV9A 5K0NA 4MHTA 1QYRA 4LWOA 3GRZA 3I58A 5DWQA 3A27A 2PX2A 4HTFA 2GLUA 5EHIA 5F2OA 5C1IA 1R8XA 1SUIA 5D1NA 4F84A 2HMYB 1L3CA 1ORIA 2NP7A 3UJDA 3KR9A 5DRYA 3HVIA 1JG3A 4QQKA 5DM2A 2YQZA 4RVGA 2ERCA 2R6ZA 3G88A 3P9CA 4XUEA 4ATNA 3LCVB 4AZWA 3PB3A 2C7OA 2IDKA 4ER3A 2ZIGA 3MCTA 2LD4A 4OBWA 5T6BA 1XCLA 5K09A 1KHHA 1RI3A 1BHJA 1L3IA 5BP7A 4C06A 10MHA 3ID6C 5K0EA 4AX8A 2EG5A 4P7FA 4PGGA 4IKPA 2GPYA 2FPOA 5FWDA 4BLWA 4Y30A 3HNRA 3IHTA 5CVUA 1P1CA 3GXOA 3K6RA 5FA8A 3SSNA 3TMAA 1JG2A 3KU1A 2CKDA 2O57A 3SSOA 3TFWA 4F86A 5F2NA 3FUWA 4GC5A 3HTXA 1ZKDA 2P3QA 2XVMA 5EG5A 4DM3A 2H11A 1OR8A 3GRRA 3GRVA 4R8RA 5EGSA 2UYHA 4IWNA 2C7RA 1NW7A 1Y8CA 2PX5A 2ZZKA 3BWBA 3HA3A 2IDJA 4OBXA 4XCXA 2IGTA 2I7CA 5CCXA 3FUUA 4H0NA 1UFKA 2AR0A 3LBYA 3ER9A 1R74A 5EKXA 1YB2A 5GP1A 3GJYA 9MHTA 2Y1XA 5G02A 3HM2A 2H1RA 2P8JA 4KWCA 3MGGA 3G5TA 5MHTA 4BY9E 4KDCA 3KQTA 5E1BA 2P3OA 2AOTA 2ZWAA 3CC8A 3KQMA 2AOXA 3P9KA 5EVJA 5DX0A 1FP1D 1RI4A 5ICCA 3CJRA 3FPHA 1EQAA 3LGAA 3I53A 3PFGA 2IH5A 4EK9A 3G8AA 3CVOA 4FP9A 5EZQA 3UJ9A 4C05A 4RTKA 5JR3A 2UYQA 5EZSA 3TM4A 8MHTA 2FK7A 4KVZA 2GAFA 2NNWB 2ADMA 2G72A 4QQNA 5ERGB 4OX9Y 3C0KA 2Y1WA 3EVDA 1WXXA 3X0DA 2NXCA 4P7KA 3ERCA 3ELUA 3FPEA 4MQ4A 1NE2A 3G5LA 1WXWA 3UA3A 3O7WA 4QPNA 3DMFA 4YMGA 2AOVA 3NDIA 4FS8A 4M37A 2ZVJA 3PVCA 4O29A 2ZZNA 3P8ZA 5CVDA 4QTUB 1SUSA 3C6KA 1SQFA 3BWCA 3G89A 3T7SA 2UYCA 1I1NA 2OKCA 2PWPA 3EMDA 3HCBA 3DR5A 4P7GA 4BP1A 4POOA 2YX1A 1M6YA 3L8DA 3P2EA 2ZFUA 3FTCA 3NW9A 3EVCA 2NYUA 3DTNA 3KQOA 4PINA 3M6WA 3THRA 3I64A 1P1BA 4QDJA 2CL5A 2VDVE 5EMLA 3EGVA 3R9XB 5DXJA 1JQEA 1RI1A 3KQVA 2AOUB 2IIPA 4PGHA 2DULA 3BUSA 4PYKA 3TOSA 1Q0TA 2VDUE 4P58A 3OZSA 4KDRA 3EVZA 1JQDA 2EFJA 2GS9A 3TKAA 4AUKA 1YF3A 2PKWA 2HNKA 1DCTA 4EKGA 3MTIA 3CJTA 1G8SA 4MWZA 5LQAA 4CTJA 2QM3A 4YUZA 1DUSA 4WXHA 4E31A 2ESRA 2NXJA 4A6DA 5K0GA 5P8WA 2UZ4A 1HMYA 2IH2A 5FHQA 5DPMA 2CWWA 3A7DA 1BC5A 2P3LA 3AXTA 2FYTA 3FUVA 2BR4A 5LQNA 4GOLD 1Z3CA 3OFKA 4M7RA 4GF5A 4AZSA 1X1DA 3P2KA 3TQSA 3GCZA 5LQKA 5HIJA 1XDSA 2ZIFA 3HA7A 3DULA 3LDGA 1D2GA 2JG3A 1R6AA 2PT6A 3G7UA 1YFJA 5E1OA 3JWHA 2IFTA 1B42A 3C6MA 4CWAA 5ICFA 4RTQA 1VE3A 3MHTA 2N47A 2BM8A 3PX2A 2BM9A 3KHKA 3LDFA 1KPHA 3PX3A 2EX4A 2B2CA 4E2ZA 4E33A 3FTEA 1WG8A 2NXEA 3GRYA 1QAMA 3GWZA 3E8SA 2PSSA 3OZTA 5M5BA 3EEOA 1X1BA 3OPNA 3FUXA 4RX1A 2ONZA 4YV1A 1M0EA 1RJGA 3WSTA 1I4WA 4CKEA 5K0CA 3FRHA 3P9IA 5HOQA 4PNEA 3M33A 1RI2A 3IV6A 2I6GA 2XYQA 1UWVA 2YUIA 4HSGA 3H2BA 1KPGA 3KPWA 5C0OE 3LPMA 3C3YA 3IYLW 4EKIA 1R18A 5KQSA 4RTPA 2PXAA 4QVGA 3EGEA 4GOMD 3Q7EA 5FA5A 3FYDA 4CKCA 3KQSA 2OY0A 3B7PA 4YUWA 4CXMA 3G2PA 2PV0A 4FT4A 2O0LA 2IBSA 5K05A 5ICGA 3CJQA 5CM2Z 1AQJA 1R8YA 2B78A 1EIZA 3BWMA 4X60A 4F85A 5GIPE 4PYQA 4RTJA 2AOUA 1JTEA 3JWIA 5DXAA 3KPYA 2B9EA 1FP2A 3GU3A 5DM4A 5C9ZA 4PYOA 2Z6QA 3BKWA 1NKVA 5DRTA 3VSEA 3HCCA 1WZNA 5CVEA 2HWKA 3MERA 3JWGA 5EMMA 2YR0A 1ZGAA 3DXXA 1G8AA 4AZVA 1XVAA 2JHCA 2UYOA 3M4XA 5GWXA 5U4XA 2ORED 5CCBA 5HIMA 5DT2A 3V97A 2AN5A 4DA4A 4L7VA 1UIRA 1N7IA 2C7PA 1G6Q1 3LHDA 1V39A 2GB4A 3NWBA 3GO4A 2K4MA 1EJ6A 3GRUA 1VBFA 1KPIA 2PGXA 1L1EA 3AXSA 5HIKA 2ZZMA 5CD1A 2PT9A 1AF7A 1NBHA 2PX4A 2JH8A 2OXTA 5EKUA 3E23A 3SM3A 4HG2A 2AVDA 2YXLA 4E70A 5LR6A 3KPVA 4DQ0A 1JG1A 2QE6A 3U81A 1ORHA 3FTFA 3HP7A 2FRXA 2P7HA 1VL5A 3HVJA 4PCLA 4RVFA 5ICEA 1IXKA 2OO3A 2JH9A 3UZUA 4EQZA 3CKKA 3VYWA 4RTMA 2BR5A 3DXYA 1F3LA 1X19A 2P40A 4BLUA 4FSDA 4XUCA 3MB5A 3Q87B 2GA9A 3T7TA 5HZMA 1KYWA 1AV6A 5T67A 4E2WA 3LCCA 4R05A 1BKYA 2QYOA 4ER6A 5E9QA 4YUXA 3KR1A 4X61A 3FTDA 3T7RA 4BP3A 3QOXA 2Z6AA 1HNNA 2IP2A 1IY9A 3MQ2A 2F8LA 1NW3A 3B5IA 5DX8A 3TLJA 3R24A 3TPZA 3EGIA 1KIAA 2C7QA 2V74B 1QAOA 3OU6A 5LQUA 4GEKA 4FR0A 4PYIA 3EVAA 3KR2A 5CUQA 4HGZA 4X63A 5FADA 3S68A 5KVAA 4DMGA 5GINE 5E9JA 3B3JA 4HC4A 2ZBRA 1Q0SA 2AS0A 3UJBA 3UFBA 4HGYA 4KIGA 5EPEA 1VP9A 5H02A 4CTKA 3P9NA 4PCAA 5IKMA 1FPQA 3EVFA 1FJXA 1T43A 1TW3A 3SGLA 3V8VA 1INLA 3BGIA 2ZIEA 3GIWA 4ISCA 2H00A 4E30A 3QOWA 2I62A 4RYLA 5BW5A 2ZWVA 3DP7A 4RTNA 1ZHFA 2DPMA 2JHPA 4JXJA 4E32A 5E9WA 3LKZA 3NTVA 5EC8A 2VZ9A 3M6VA 3UA4A 5GIOE 4YV2A 1PRYA 2WA1A 4R6WA 5DX1A 1TPYA 1I9GA 2YXDA 5EMKA 5FQOA 4EMSA 3LKDA 1WY7A 3PS9A 5K0LA 2G1PA 5DSTA 2NXNA 2P35A 3FYCA 3LCUA 1H1DA 3RW9A 1G60A 1VP3A 4QDKA 4FGZA 1YZ3A 5D1HA 5K8VA 3UJAA 3OE5A 4UOEA 2YTZA 2AZTA 5E1DA 2VDWA 3A25A 3ELWA 3FZGA 3M6XA 1EAMA 4GC9A 3ORHA 4E2XA 1ZG3A 3C3PA 3LBFA 2KW5A 2OB1A 3BGVA 3MCZA 1JQ3A 1NV9A 3EVEA 5E2AA 5FUBA 4PONA 2I9KA 3D2LA 1QZZA 5DM0A 3LX6A 2CMGA 3QV2A 4DCMA 2V7EA 4YMHA 1SVUA 3FRIA 1SG9A 1N7JA 5E8JA 1XTPA 4RVHA 1JR4A 3EVBA 5EQJB 3HCEA 5F2KA 2P41A
chains in the Genus database with same CATH superfamily
5KSYA 1LEHA 3DUWA 4XDZA 3QFHA 1P0MA 1W2WB 2BFFB 4QUDA 5TC4A 3KAPA 1SD5A 4B8YA 3ETCA 4AX4A 1GYPA 3TMKA 1FVHA 2CZGA 1Y1QA 3C1TA 1EX9A 4CKBA 1DEKA 4F60A 4XFJA 4UM9B 1KWKA 1JIJA 4B6EA 4PC7A 1Q22A 3OIFA 2B69A 3OPYA 1YR2A 2QN2A 1LLFA 3E82A 1QUFA 2QJFA 3MWDA 3N0VA 1Q3TA 1QFMA 2HMUA 3QENA 4LJKA 4PTYA 3RKUA 5D5PA 3W8EA 1QV9A 2YN0A 2Y76A 4WHMA 4O4HB 1AGXA 1SKBA 4Y7DA 5AVVA 1S02A 5K6RA 3C6BA 2GCOA 3TRJA 1KYIA 2ZRPA 4JLKA 4G0PA 1OE0A 3OBIA 4G0XA 5FHRA 1Q0LA 1N2CA 4KGXA 2ZE7A 4GNKA 5C18A 4MCHA 3SBDA 4XJSA 1HLFA 1NW6A 1AX9A 3OCJA 3RVNA 3PF9A 2IPAB 1E63A 4G4SP 4PBSA 1WAMA 2NSYA 3PC7A 4EJSB 2CYBA 3E4DA 2GZSA 2R3SA 1KFKB 3TLYA 1BD4A 3WLNA 4S35A 2GERA 1JMYA 1Q21A 5H80A 4OHPA 1BX0A 3CSUA 1JMKC 1P7YA 3VU9A 4BPRA 1YB4A 2BFEA 4PFJA 1PN3A 3RGGA 3GDFA 4WBSA 2ATCA 3DOUA 2FPPB 4X1OA 1JU9A 5LSAA 1M8GA 1LTHR 4IDPA 5I8ZA 3I2JA 1NPYA 1KYTA 3C4QA 1KZYC 3GBSA 4RHCA 1H8HA 4DC9A 3DXZA 1TYDE 1H8EA 4YCBA 1T3GA 4DTCA 4F6CA 1NAIA 4U7TB 2Z4SA 1JLHA 2QTLA 4UM7A 2WYIA 4L27A 2UZ3A 4KO2S 2O7SA 3MS7A 1IJFA 4LTDA 3OO0A 4RA6B 3HYTA 3FMOB 5C52B 3SM9A 2IKSA 4BHTA 2BKUA 3ZEIA 3IB6A 5EEGA 1B0AA 4YQFA 3FLMA 4GI1A 4BCCA 2PZJA 1JA1A 4C4ZA 3O93A 2WUWE 5KDOA 5HEKA 3ZY2A 4RPLA 5A7HA 1P3Y1 1UMBA 1X8KA 2RK6A 3FPJA 1MHPA 1RJEA 1OX6A 1WULS 2QSYA 1TB4A 2X2FA 4NPHA 2WVJA 4B82A 2R97A 3R3XA 1W88B 5KOHB 1FA9A 2GM4A 2YJ6A 1CDDA 1Q44A 1W4LA 3UJ8A 3VKWA 3OECA 4EO9A 1NYTA 1UQRA 3UOAB 2W90A 4X7RA 5FCDA 5FV7A 1K5HA 1LBQA 1H3FA 2C77A 4MROA 3AF5A 3SD7A 4LJLA 5FEMA 5DW3A 4HRVA 4S24A 2ZLBA 3T0IA 5AUOB 1OYOA 1UDWA 2ZOSA 2E7ZA 3DB2A 2OYRA 4NU0A 4KAAA 3E27A 3R6TA 1XB2A 5IG2A 1FMJA 1Z83A 1PWZA 2PN1A 2VVTA 1WOMA 4LHVA 4LYAA 3AV0B 1CDZA 4PXAA 4UNNA 1LVHA 3PUIA 4K9OA 3BK1A 1A77A 1FRQA 1UC5B 1TO1E 2QS9A 2X58A 4K6MA 4BNFA 2BRUA 1XDBA 4FR2A 1RE0A 4ZRNA 4EB6B 3K3PA 5K45A 1PR3A 1KMHB 2XUHA 1I7PA 3OIUA 3OZFA 5J2TA 3KFLA 1XDDA 3TVTA 4F71A 3EF1A 4WECA 1RMQA 1X7WB 4IJ6A 4TQAA 1I3NA 1WP4A 3FHJA 4AP6A 4E09A 3QWAA 4RY9A 1G3UA 1QHHB 1PWEA 4Q93A 1U81A 5JWHA 2VF8A 3TLMA 4DNPA 1EUCA 4BJHB 3INRA 4N76A 1BOOA 4NSNA 2NUTA 2XCSB 5B4UA 3THYB 4BQSA 2YH2A 4J29A 3WE7A 2O05A 2L19A 5F35A 1HDGO 4ZIRB 3NBYC 2P2LA 1HE4A 2FPMA 1MJFA 1Y4SA 2HX1A 2YRXA 3L5OA 5GM1A 1UKCA 1SCDA 3AJ9A 3S8EA 2IEYA 3U44A 4DLNA 4XVCA 5JH7B 2HRQA 2IBMA 4UTRA 4W9NC 4PSDA 2FH5B 1VL1A 4MKFA 4YAEA 5A3SA 2CFIA 1AA9A 4QFDA 1YBMA 3AF6A 3BRQA 3BEOA 3D4NA 5JSHA 3BA6A 2FN7A 5EJAA 4IV5A 4C5BA 3COJA 2V0NA 3IAS1 4ER7A 1BYIA 1U9YA 2QQFA 1FEZA 3I39X 2XRMA 3KIPA 4CEIA 2P9FA 1PSDA 4HDOB 1XJ5A 3QELB 2GM3A 4NDZA 4AL4A 4DJ5X 2AXEA 5KINB 4OYHA 4BVGA 3D31A 3O8CA 4KR3A 8AT1A 1AK2A 3GZJA 4IAOA 2ZJOA 3KOMA 3NDRA 8OHMA 2EV9A 1C4XA 3VHQA 2J5QA 1G6OA 1J2EA 1FRFS 1NRIA 1U04A 3C8UA 2YRWA 5CHYA 4ZQFA 3AH8A 3W0LB 3WKCA 4D5GA 4HUQB 2FI1A 2XYRA 1C3OA 3TOCA 3D43A 5HDQA 3L6UA 1UXIA 2O0MA 1G0OA 3I01A 1K7SN 1TJNA 1XBTA 3I4CA 3K20A 4LSWA 4MB0A 2AB0A 5H7XA 5JQGA 3FR7A 3ITDA 3PWSA 1YZYA 2XMCA 1P2SA 3H5LA 4L6CA 3W6NA 3WKEA 1G8HA 4BQFA 3VPFA 5HKAA 1N34B 2WTBA 2O3JA 3DL2A 4IHJF 3D1VA 1RBZA 2NUPA 3ZD6A 3ROXA 3KCQA 3ODGA 2MSWA 5ARBA 5JMOA 2ZT5A 1OBFO 3MINA 2C94A 4MOWA 4EJMA 4MHTA 1WUIS 4DARA 3HUEA 1WZ2A 2VI5A 4AMVA 2JIMA 3K8YA 3QVMA 4FW9A 2LTAA 1Y9JA 3USCS 2HHAA 4DXHA 5CDTA 1GXSB 1UC8A 1C7QA 3ND6A 4WK0B 1VMIA 1VE1A 3HVIA 3F8SA 4HLUA 3VOTA 4BUCA 5C5EA 1AUPA 1JQLB 4DQDA 4E5UA 4UUAA 1HSZA 2I4RA 2DFVA 2IDKA 3EEIA 3IOMA 4UCFA 4X00A 1M6HA 2WWIA 3MCTA 4ER3A 10MHA 2X5KO 2HRRA 2QI9F 5EKTA 5T3YA 2DXIA 1L4LA 2WJVA 1IEWA 1XZFA 2IQ5A 4Q1BA 1X7YA 1CR1A 1AE1A 2HEGA 3IHTA 1YA8A 2VJKA 2R44A 5A71A 5F2NA 4J2TA 3UMVA 2OL4A 3R0XA 4ADSG 4QUAA 2VZ0A 2O7RA 2XKBA 2O6LA 4W5JA 1ZKDA 2P3QA 2Y0PA 3RQIA 1YZGA 2VQDA 3LQRA 1N5LA 1XCBA 3HR7A 1DXQA 1J9EA 4J16A 1UMDB 3GRRA 2UYHA 2ERYA 1Y8CA 2ZZKA 5A4KA 2YIDA 3AUFA 3WSVA 1R0ZA 3B6IA 3I72A 3IELA 2Z3VA 2QAGB 1UFKA 2V58A 5JBQA 2I6XA 4PIVA 5ISMA 1GCIA 4INJA 2VAWA 4D8TA 3KXKA 1U99A 2A35A 3GJYA 3RSZA 5JV5A 3AUAA 4B7CA 3FFAA 1N4AA 4U5QA 1MDBA 1G41A 1YQDA 2XW6A 4YB8A 3WLOA 2ZYDA 4QC2A 4EQ6A 1KEEB 2VNHA 2W0MA 2EGGA 3L7LA 1ZW6A 1P7PA 3FVTA 1DBIA 1QNLA 2NTEA 5GJBA 1RQXA 4IDDA 1Y9AA 4G3XA 3CF4G 4DNFA 3PQ3A 1R3DA 3AHFA 4X71A 4X94A 1LTKA 1A7UA 3CLRD 4QDOA 1TCVA 4QOSA 5LC1A 3RTEA 4UU1A 7REQA 1Z5PA 1FOEB 1RJ9B 2OBLA 2AG1A 3FX2A 4J0QA 4OFBA 2CLIB 3GF4A 4UNRA 5JSZA 5IKEA 4NONA 2P2YA 1Y48E 3E35A 3R3SA 4G4IA 4IMPA 3K2EA 3H3XA 4KUGA 5H83A 2Y1WA 2RGEA 5IDXA 3PEEA 2Z1NA 2VP2A 3U5ZB 3ZV3A 3O91A 2QLMA 5KSWB 1A69A 5KBYA 4UFPA 1K4MA 1KO7A 3RVLA 1UMCB 3KWFA 1QGAA 2FF7A 3DAHA 2EDCA 2X9QA 3QPVA 3A3NA 3M6MD 4UQOA 4XM0A 4FGSA 3X2FA 1RXEA 2R8RA 4G5YA 3HMKA 5E7JA 1E4EB 2JI6A 1SQFA 2GPBA 3JD1A 2UYCA 2PJRA 1X9GA 1DKNA 1T3ZA 1IOLA 3PC4A 3L1IA 1UF9A 4FZ3A 4LZZA 4YCNA 1G3IA 2VHYA 3NBZC 2ZKLA 1IUPA 1L7RA 4N8EA 4JQSA 3QBVA 2ZRJA 4TLLB 2GXUA 1Z33A 4OAPA 5D3KA 3RUEA 1ZUNB 5BNWA 2GA8A 3EGVA 4D43A 5KKAA 4CW7A 3OZIA 1EK0A 1P1JA 3GGGA 1JQEA 5J2TF 4PGHA 3IR7A 3TOSA 5CB4B 4L9RA 5E2IA 3E61A 1F1BA 3G82C 4AD8A 1SHKA 3RTDA 3HRHA 1JQDA 5TVKA 1DMSA 5C8YB 2EFEB 3FGPA 2ZATA 3HJBA 3I34X 3LIPA 3NETA 4EKGA 1LPBB 1RXSA 3O8QA 2GOYA 1V7CA 4MINA 1DUSA 4C3OB 1YA4A 2Q3BA 4GDFA 2C3UA 3ETEA 4OAQA 4NCAA 2WWYA 2W5UA 1J2RA 3BFPA 1I6LA 4DSZA 3THXB 3QKRA 1NN1A 5IF3A 3SC3A 2ETVA 4X95A 4QWMA 4B6JA 3GW8A 2WE7A 1CUHA 1C4OA 1L5RA 5H70A 2P1ZA 2LKDA 1CULC 3DM9B 4L76A 4P3PA 4RAQA 4YDRA 4B0OA 3QF4B 2V98A 1TCBA 1QIDA 2PT6A 4JLBA 1MLDA 2OFPA 4BVJA 2AR7A 1ONOA 3A4LA 3WRYA 4NV0A 3AEZA 3A9WA 1ULBA 1G9XA 1HEYA 4IH4A 3ZH2A 3RUIA 1QC5B 1P9WA 1X1BA 4A0FA 2ZIVB 4PLFA 4E5MA 3KK0A 1SIUA 4ZQGA 1RLTA 4DA8A 5DI3B 2VYFA 4PNEA 2WZCA 4RMIA 4XDYA 1XEXB 2C5SA 3TLBA 1JEAA 3FH0A 1RHKA 2PLRA 2YW9A 2V3WA 3DBHA 2I6GA 4J43A 5EYPA 4EYOA 3RUPA 1N9GB 3H2BA 3QF7A 4RFLA 2YWJA 3GLFA 2OD9A 1MAVA 1Y4AE 3IE2A 4MB6A 2FW8A 2CXNA 3M5PA 3VJMA 1YV9A 3KE8A 3UWDA 3C70A 1CC1S 1UBOS 2PD3A 2H2DA 4A0RA 2WE8A 4M1TA 4TKVA 1A8UA 1H6DA 1QR6A 1A96A 2H2HA 1JDUA 2W4QA 1ODFA 2AF4C 1W59A 4HYEA 1ZWKA 2XNCA 5HOEA 1SURA 5JQGF 2BEUB 3F97A 3T8YA 1D8AA 3GT0A 3WAKA 3U56A 3U7GA 3EMVA 5ELMA 2QXYA 3GJTA 5IZCC 3GJ5A 4RA9B 5CVEA 2ECQA 4P0TA 1QCYA 1X1SA 1XU7A 2V9PA 2VPXA 4Q6BA 1BGWA 3ZCPA 3SQNA 3COSA 3M4XA 1VE9A 3NDPA 1UKAA 4X7PA 5GWXA 3JAMA 3QEMB 2FFJA 5DT2A 3W5AA 4N0MA 5H68A 2VNAA 4DCSA 3MELA 3DHVA 1V39A 5AJZA 1CY4A 1V5GA 1VCIA 3RV3A 3IDOA 4WUTA 3WHIA 4YONB 4M83A 3S55A 2G28A 3L0OA 1F2TA 4JASB 1XP5A 2CCKA 2EW2A 3LLVA 3PFBA 2JH8A 3SQOA 4MNTA 3N87A 1SQ5A 3ZU5A 1I1OA 1JG1A 1ZOSA 1OLSB 4OB6A 1VL5A 4LQ4A 4HZGA 4E5YA 2HCTA 1J2YA 1EGQA 2QHXA 2HGSA 4MW5A 1M1YE 2RHWA 3OCUA 4HNSA 1YJXA 3DVAA 4JUFA 3ZGOA 5JVDA 1K7XB 4ENPA 3DXYA 3B1FA 4Q12A 2WJWA 1XRSB 2KI5A 4HRYA 5JTTA 5ARCA 2VSOA 4KE7A 4GLBA 1ECPA 4Z7NB 3KZXA 5E6RB 3EGDB 4L78A 1PHRA 1TT5A 3QEJA 4QAJA 1XEFA 5AIAA 3TBKA 3FTDA 3T7RA 2BM1A 4L1KA 3QOXA 3ZDZB 1XEAA 4GP6A 3OLCX 4RZQA 1J8FA 5F77A 3B5IA 5F23A 1WB9A 1RYHA 3F6EX 2WJJA 4IBOA 1Y5RA 2W6QA 4KH1A 4KNVA 3WMXA 1CUDA 2PS3A 1U5AA 3F9IA 2C42A 2ZP1A 1QGZA 1APBA 1II0A 3C1UA 4YAGA 2PPVA 1RXWA 3PXDA 5F21A 3UG7A 2HNBA 4H3VA 1HG1A 2WJAA 4ARIA 1YK1A 5HF8A 3G8YA 3DKKA 4QM7A 4H9GA 1QS0B 4ZVPA 5GGYA 1XFDA 1IRXA 1K8RA 4GHWA 2K6GA 3LUBA 4RHEA 4BTEA 1FJXA 3CX8A 2WMOB 2FB9A 3IBFA 3JWPA 1PGJA 2QR3A 2WSSD 4UUQA 2QDKA 4CM1A 2DPMA 4IGIA 3CZ9A 2GFIA 3FYUB 2C1EA 2A5GA 1M2NA 3MC1A 4PLVA 4O4JB 3GDGA 1Z15A 1GVHA 2P27A 4RHTA 3N58A 1VL2A 4ITUA 3AY7A 5DX1A 3T12A 1I9GA 5DWVA 3KLNA 5EMKA 3VPSA 2VFAA 1W1WA 5TPZD 5DSTA 1N6LA 5U9CA 2W6IA 3GG2A 1W2GA 1T10A 3OWXA 4OP2A 3TL2A 3JQAA 1FJGB 1XZDA 3V4LA 4DR3B 3IEXA 4U3JA 4YTEA 4UNIA 1WQ4A 1CB0A 2K5UA 1U7DA 2DRIA 1G66A 6Q21A 2DMRA 2H1CA 3NOVA 1KZ9A 3PGA1 4UOZA 2JF0A 4X44A 4ZI3A 1US8A 3EVEA 2P2SA 4N41A 1K3FA 1MAWA 2OO5A 4OJYA 3R44A 2DSTA 1WHTB 4YP9A 4ZJUA 1JFRA 1SK9A 1ZOIA 4Z86A 2D1YA 3O90A 5A3QA 2BWJA 3DTTA 1KYQA 1H1LB 4H3SA 3T3EA 4M1QA 1KNQA 3HKCA 3EXFB 2PFKA 3JR3A 3R77A 1SU8A 4JEUA 4YHBA 1A4XA 1AQNA 4LRQA 3AFNA 3PNSA 1T9KA 3E4CA 4X65B 3DG9A 3QX9A 4UUBA 1T1RA 4ND4A 1CJTC 1XF9A 1CDEA 1ZVMA 5K20A 4QOFA 3FAZA 3K1ZA 1G8MA 4DKJA 4KXXA 3DNMA 3D8BA 3QE2A 5I7VA 4YRNA 1IXSB 5GGXA 3REQA 1BWPA 1TM1E 2NZVG 4FZVA 4DB2A 2I1VB 4KN8A 4PRYA 5IC6A 2WQ7A 2GMWA 3LT5A 3VHXB 4IIVA 2RAPA 1KFJB 4OVKA 3NKVA 3ZW7A 2HCBA 2HQSA 1T8WA 3DV2A 2FW1A 1U0SY 2VQ6A 2B3TA 2WNSA 4QDXA 3SI7A 3T5TA 3BIFA 4ZHQB 1AXGA 1CEQA 1ZIPA 2ZTLA 3CZ4A 3K09C 2GPTA 2OHIA 4UXHA 4CR7A 3I8SA 4GX2A 2VWHA 1QP0A 2CCGA 2YYZA 1V26A 3OOHA 3QLJA 5K3AA 4RNCA 4M1WA 5IF9A 4Z4CA 3VZSA 1HSOA 4UCXA 5LLTA 2GBFA 4KW7A 1XDGA 1E3TA 2HBYA 4MJLA 4ZOEA 4XB2A 2E89A 5A3JA 2JNWA 2P9CA 3RSCA 4YWJA 4NBUA 4R9NA 3HRKA 4DA7A 5HX7A 1X7DA 5HMLA 3II6X 4Z8XA 4PGAA 4R4JA 1WMDA 1UKZA 1YVDA 2DX7A 3O4RA 1UBGA 2YVAA 1Q0RA 3MQ4A 1Z8NA 2R86A 3O8LA 5HVNA 4OM7A 2GRAA 1YQXA 1VSUA 4GR5A 3CNEA 4AJNA 4B80A 2BMVA 3BMCB 5DSZA 1GRNA 1JF8A 4HDKA 4GD3Q 4LOHA 4CMEC 6GPBA 3PEWA 3JX9A 2O7NA 3QZUA 3PXBA 3TX6A 2QJOA 1W7AA 5G1OA 1TLFA 1Q12A 1U2DA 2ECKA 2V6MA 3BE6A 4N5NA 1Y6RA 4RFVA 4HWRA 3SYRA 3NB0A 1MB9A 5AH0A 2N42A 4G4JA 2F1JA 3TLAA 4BVAA 1L7PA 3KXDA 5D6OA 1U3UA 5LYYA 2W2LA 3BT7A 4Q01A 3PEUA 1GPUA 4NBWA 5A6SA 2A5YB 1ZGJA 3IAM6 2XECA 3HN7A 3PGLA 5DCYA 4M0EA 1VIDA 2FWNA 3D0QA 2MYNA 1E66A 3DOJA 4NHEA 3TDKA 1A5ZA 2RHLA 4K8RB 4ZEOA 4K6GA 3GUYA 5EHGA 3VX3A 1OT5A 2BVNA 3H6HA 4Y2YA 2GTHA 4F2HA 5JCJD 3CX4A 2PQ6A 3JWJA 5IBQA 5JVDF 3WRXA 2I2DA 4H7PA 4LF9B 3UHOA 2ZDHA 1VJTA 2SICE 1FVOA 3IFSA 1X80B 3GFBA 4G1FA 4RORA 4OHUA 1EP3B 4RWEA 2X0EA 1TVKB 2R84A 3E81A 3RS0A 1YL7A 4YAKA 3LCMA 4G24A 2ZR7A 3QA9A 1ISJA 1VC2A 1HOTA 4NMMA 4HDSB 2NACA 1RM4A 3SDSA 1CUYA 1NMZA 5ALEA 1EP2B 2PU7A 1UBLS 1QRTA 4PE5B 3UJ7A 4I9NA 3RS5A 4I6GA 4RKWA 5G0UA 1E6CA 4NK4A 4B4UA 4QL3A 3IODA 1LBTA 3M34A 1T36B 3FPLA 2GBLA 2VH1A 1D07A 3CUTA 3DO5A 3S2EA 3X2SA 2R8ZA 1GPMA 1M75A 2WLTA 2P30A 2WP0A 3BGSA 3N8NA 3NM4A 2P79A 4FYWA 3A4IA 5HPYB 5K8CA 3ZWXA 1O95A 1WZUA 3IKTA 4EOGA 2W2TA 1Y4DE 1RADA 3N86A 3OJ0A 4JELA 4PHHA 1VPDA 1Z0FA 2O8FA 3HACA 2YWXA 3P52A 2Y4NA 4C78A 4H17A 1RS0A 3N2KA 4H7KA 3FUTA 1MVOA 4WOKA 1XTQA 4P7JA 1ZICA 3UCXA 1H85A 1XSEA 4ZPXA 4CFYA 3R6DA 3L05A 2R7KA 2H1VA 3FHCB 1X1EA 2FRDA 4HN4B 3WVNA 4HUTA 8ATCA 3MTJA 5AK5A 5EJMA 5KNDA 2XUGA 3B48A 3OOJA 4Y7CA 1CZRA 1T1GA 1JJVA 2X8JB 2REQB 2YV2A 1OVGA 1KS2A 3QE4A 3W8FA 4EZBA 1O8BA 3IPCA 3CEHA 1YQTA 5KTOA 2FWRA 2HIHA 3GFRA 3IBYA 4JC0A 5BYBA 4XEHA 2PZGA 4C0QC 1ONNA 4N03A 4WESB 4D8UA 1MC4A 2RMKA 3DDZX 4C2TA 3DCIA 2BLLA 1ADYA 1T8SA 1H0KA 4O3MA 2XCQA 1K5PA 4NDNE 3U13A 1SIWA 3Q41A 3CCCA 3BXEA 2P8SA 2ZYUX 3AHGA 3I9FA 3VYSB 1F8XA 2JHAA 3K0BA 1CY0A 2WINI 4KTTE 1OJ7A 3TKLA 1CZKA 1SN7A 1Z17A 3TUJC 1MAHA 1GUBA 1GV1A 2GUGA 2YC4C 1SY7A 1TM4E 1H8HD 2VXYA 2WHXA 2ZJ0A 1C1XA 1H8ED 3BZBA 3B38A 3B85A 3WO0A 4XGNA 3KQPA 4YJDA 1S2DA 4KNWA 3URMA 1D0VA 1LK7A 1WDKA 2BFAA 3TZLA 2CDCA 1SKYB 2XYHA 3HDGA 4X8OA 3EWSA 5L4NA 3FVVA 3CV3A 1Q7RA 4KXLA 3AUKA 3A0RB 4QD3A 2QMYA 3RJ9A 2FOIA 3KQWA 4QU5A 4NWIA 1XZGA 4OXNA 1DRUA 1AQLA 4R1SA 3VGPA 3DD1A 3AJDA 4QGSA 1N7GA 4AMYA 4YT2A 2OK7A 4RZ2A 2P5UA 3KPUA 2E1RA 1ZD4A 2I8CA 4M1EA 4CEHA 2H2IA 1C9EA 2YINC 4GBMA 3FNIA 1IEVA 4L3WA 4WJLA 4NYJR 2GLUA 2Q6TA 3M9WA 4D3SA 4RQTA 1R8XA 5E7QA 2ZRBA 4YQEA 4Z8YA 2H52A 2JFGA 3PFIA 3SIXA 3EXHC 4Q3DA 3F6CA 1MNQA 3KR9A 2GFHA 4NZPA 2IQIA 5DM2A 3V2GA 4PNZA 4AZWA 3GJXC 4EGSA 4NABA 4Q9KA 5CDSA 1GWNA 1VLHA 1PYDA 1TFRA 3HADA 1WDTA 5B3KA 4P4UA 3L0PA 3C6XA 4QG7A 2ZUFA 3AUTA 1TJ4A 1KHHA 5C7OO 1JU3A 2ZCVA 4I4TB 1X0XA 1UPBA 1JG7A 4IKPA 1MIOA 2P68A 2XUAA 4BFWA 2J3JA 4J1TC 1FYWA 3DMDA 5BOVA 4DQKA 1YR7A 4CKWB 2CKDA 1A7JA 2DFTA 1YE3A 1U0EA 2ID9A 2J87A 2DG2A 3AUYA 3N2GB 2TECE 3OY7A 4JS0A 1ST2A 3BEDA 3NFRA 3BJEA 2B4YA 3BXZA 4KFUA 1JQBA 1H65A 2HHJA 3BFXA 1SCUA 5EGSA 5CUQA 2IZ5A 2BTEA 1KGDA 2IDJA 2IXAA 2X1MA 2Z95A 3TZEA 1JHVA 2V7TA 2YJNA 1YD7A 2H48A 1N5KA 1R74A 4W5TA 1ENYA 5GP1A 4JOQA 3EBPA 4WKCA 5KTSA 5DHQA 5G02A 2JLBA 4BFZA 2ZRNA 3R3WA 4UKDA 4EY3A 1W25A 2AHRA 4XWYA 3P9KA 1L7AA 1ZGCA 4TRMA 1BHQ1 2E18A 4QASA 3TE6A 1ODSA 2ZK7A 1OIWA 3HZRA 5BORA 3M0EA 4MUNA 5LQSA 1HXHA 1VKZA 2NAPA 1SUPA 3ZZTA 4NDAA 4X84A 3BF7A 1KK0A 1YJ8A 3TQQA 3TM4A 2XKKA 2RH4A 2VT3A 2VP6A 8MHTA 3L7NA 2PLAA 4I1IA 2FK7A 5AJUA 4D2IA 4ZICA 2OXEA 3PEYA 1S8AA 3H6KA 3HNPA 1O87A 3PQFA 1E2NA 3RLFA 4S04A 1E1MA 4DMKA 1VIYA 4BEJA 4ZEMA 2XDQA 1XO1A 2DHCA 1TRKA 4BUJA 1VI6A 3G5LA 4ZQBA 3HKEB 3FYSA 1RWQA 3NDIA 3B1YA 4HWOA 4LBYA 4CL3A 3ZQ4A 5EHZA 2ZYSA 3GEEA 3F96A 1A2BA 3O2JA 2GYWA 4TMFA 3L8YA 2ZYTX 4N7JA 4EJ6A 1XNRB 3ONDA 1EFUA 1TX4B 3W9UA 3RUFA 3TW6A 3NGLA 4GS5A 5TNXA 1ATZA 1F5NA 3GT7A 2R1TA 4RLHA 5DGDA 1L7OA 2XA1A 3ECCA 4OGKA 1EX7A 5EHQA 2EWMA 2AIRA 3PIDA 1JAHA 3D3JA 1VKJA 5KI6A 4LY6A 1SGWA 4LMRA 5IANA 3P96A 3QUSA 1MJ5A 1G21B 1FCJA 4NYIR 3RYFA 1BDHA 4M22A 3L49A 1PZXA 5AO9A 5I7EA 1LTQA 3HHEA 5DW0A 5A5VA 3CNNA 4YUZA 3TXYA 2WWRA 2NXJA 3DTVB 4UJ5A 1X42A 5CVCA 5DGTA 5K0GA 2J6IA 4XVUA 2EFCB 2YCLA 3UV6A 2QLTA 2R6R1 4HATA 2BFEB 2FP4B 2R1VB 4PLYA 1UXOA 3PUKA 3MRXA 2JFXA 4H1VA 3WZ2A 4BO1A 1KYVA 4PLGA 2X42A 3DULA 5INTA 1J21A 4EVQA 2R7NA 2FWJA 2V54A 2QPTA 3ZYZA 2X0IA 1YCFA 4L8FA 4L8YA 5KX5A 3OE7A 4YRIA 3UIEA 3AEUB 1J7KA 2X4GA 1JJIA 1O0SA 1NRJB 2QT0A 3I9MA 1I32A 1K5GA 3TTXA 3ZJ5A 5HDBB 5FL7A 5IWCA 5AK3A 5CITA 3H8VA 3E8SA 3ABZA 2DKNA 3FMFA 3ROFA 2WM2A 4BFVA 1FSSA 4LXYA 1V1RA 1UKBA 3K15A 2VJAA 1TMKA 3KD3A 1BWRA 1D09A 1UWVA 2Z8YA 2BZ0A 4G1MB 4JB0A 3IVAA 1VRVA 2Y92A 3HJHA 4Q1EA 4CZ2A 1WU7A 1T1IA 1BOFA 1UXHA 4FYPA 3NWOA 1P7VA 3E58A 1YVEI 2AI1A 1XMVA 3OD1A 2O8BB 1KL7A 3UQZA 3B1XA 3HJCA 1SVNA 3G0BA 4J76A 2IS2A 3M5WA 4JT8A 1NNEA 1SHJA 1RMTA 2D2EA 4OSEA 5KNLA 4PYQA 4JV5B 2VSXA 1RAFA 5PGMA 4WASA 3QVSA 4ALJA 2G4VA 1XPOA 1E94E 1QB8A 3JQPA 2JPDA 1W0KA 4QJIA 4BNWA 4OHYA 4LXUA 3DV9A 1YC5A 3OTOB 3QVKA 4HI0E 2EP5A 4M0FA 4ZVVA 1Q1BA 2W83A 3IBCA 4IDAA 4LI3X 4QPCA 1XD2B 4CF7A 4JI2B 1C50A 3HABA 2DZDA 3LX4A 4R81A 3SDZA 1XZCA 2OFXA 5JHGB 3CLTC 3DMTC 3TTYA 2BJHA 4A6XA 1WCIB 4TN1A 2O2XA 4R1OA 1C7RA 1AURA 3EGWA 2WWTA 1JN0A 4RQBA 1LCIA 2HAEA 3EFHA 3IP9A 3GLIA 3LO5A 1Z37A 2GLTA 2O1XA 4YX9A 5BVGB 5AI6A 3E3OA 2P7HA 1AXRA 1RZ3A 5HK8A 4FOOA 8ABPA 3HKBA 1EXNA 4WX2B 1IUNA 4MVYA 4DJDC 1T4GA 3GQVA 1E2JA 2WIBA 2B4QA 2O0JA 3TRHA 4DMHA 1S2LA 4JI7B 2IODA 2OUKA 4GGPA 2AJBA 4LDRA 1NFQA 1YRBA 4TN5A 5HFNA 4CMJA 1E0JA 3IMCA 1SHLA 2FJPA 1T2FA 2V9CA 2Q3FA 3PQ8A 3LT1A 4FJ2A 2QPOA 3EISA 3T7TA 4CV2A 1TRHA 5CAEB 5FLXA 2QYOA 1QFJA 2V7GA 4L8WB 3RFVA 5BSGA 4UTVA 5GVRA 1YZKA 4ENTA 2Y99A 4LJRA 3ZJYA 4XIYA 1W8IA 3QU9A 1NC3A 4EW3A 4D79A 2ZE8A 4FFLA 1SWWA 2WAOA 3SXPA 5L3SA 3TLJA 1EVIA 4EATA 3TPZA 2NPIA 4LV5B 1OGJA 1G2IA 5EJ8A 2HBZA 3JQFA 5LQUA 1YO6A 5JJKA 2XMPA 1N25A 4ZOLA 4NS1A 4QDZA 4LXHA 3QJ5A 4TXJA 2M6SA 4MZDA 3S68A 3KJFA 3TW4A 5GINE 1E59A 3ITEA 4DLRA 1G291 3UGQA 2ZBRA 2B35A 2DQZA 3PR2B 4DJAA 1T13A 1P1RA 3H97A 3O8OB 3V48A 1BHSA 1DHTA 5KNDH 4PU0A 1I30A 1NR5A 5ALWA 1J23A 2FMXA 1B0UA 4B3BA 2RC5A 2PVPA 4D8XA 3U48A 3AF2A 1CUJA 2FKNA 3R9KA 1F5SA 4MPPA 3RJZA 4MQEB 2VNJA 4UMEA 2CHQA 3CPEA 3U4DA 4ARUA 5GIOE 3VDNB 5TT1A 4G0YA 1YZUA 4TLMB 4W9MC 4XIJA 1MUUA 2OQVA 3F6YA 3L07A 2HSZA 3EIEA 4HN2A 1D3AA 3K71B 1UT8A 5K8IA 5D1HA 1CX9B 3C48A 1V8ZA 5IT4A 4K6CA 1FE8A 5AR1A 1VECA 5E1DA 1F4LA 2BI4A 1UBRS 4Y0VA 2X0FA 1J70A 4ZYZA 2AK2A 3TIVA 5DIZA 1BS1A 2RBGA 3ENKA 1Y82A 3HUFA 2MSCB 2I6TA 4OP3A 4Q7KA 5JE8A 4B3JA 3VISA 1MH1A 3MB8A 1OFIA 3C15C 3DOFA 2X2EA 2HWXA 1TKAA 1JI0A 3LNCA 3A14A 4YRFA 4Q02A 2QG9A 3T9CA 4W5NA 4NH0A 4B6OA 1GUZA 5CVJA 2WDPA 3SBOA 3ZWVA 2E49A 2XB2A 4RNDB 1OX4A 3UCFA 1Z29A 4LJSA 1OT3A 3SZOA 3AR6A 4Z4EA 2N3ZA 3ANNA 4CG3A 2PMWB 4D81A 1N33B 1YK0A 2VR1A 3P4UA 2QJRA 2H4ZA 2GVNA 2P4UA 4BWYA 1FNCA 4L4RA 3B8EA 4C08A 4MV1A 3U37A 3SIWA 3WB0A 5A2GA 5DWDA 1GDTA 1VBNA 2W98A 4DIOA 2WSYB 1EH5A 3GLGE 3BMXA 1JZQA 5A9TA 4QU8A 3DE7X 4IXMA 4UULA 5YASA 1XL1A 4CUJA 4BNGA 4UQLA 5D3ZA 5IDVA 5IEJA 4XYLA 1A72A 3E05A 4BIMA 1DV2A 2CV1A 3KL2A 5C1DA 3RVPA 3TIGA 2GZ3A 3VR1A 2EEZA 4OQDA 3W2GA 4ZMBA 3WLJA 3EVGA 2RGBA 2QU7A 2BGKA 2ZJFA 4FB4A 3OQJA 3M3PA 5HILA 4W1RA 1OXKB 4DIEA 2E48A 1TMYA 3P32A 2C2WA 2CW5A 3X1ZA 3OQVA 1Y6GA 4Y1EA 1ABEA 4C20A 1HDRA 1ZI9A 2Z04A 2BH2A 1AD2A 1NT2A 2HHCA 2A2ZA 3EBOA 2KJQA 3OICA 4LGVA 3V9AA 2YL2A 3HP4A 3OTQA 4QXMA 1FFXA 3HVHA 1P39A 5EQDA 2X8BA 4KQ2A 2OB2A 3TZCA 4BB0A 2J07A 2PYIA 2XF8A 4BEBA 3SX0A 2P1DA 4B6QA 2O8DB 2EIHA 2EKQA 4LV8B 5HF9A 1W96A 1L1RA 2CJXA 4G1BA 5FI0B 4AO7A 2WU4A 3WK9A 4Z7QB 1LDGA 3ESCA 1T3HA 1KAMA 4HQFA 4E4TA 4NV3A 1G17A 2ECOA 2O0KA 3UMJA 1N2XA 1NXVA 1FJ2A 3QUQA 1ZM3A 2QBYB 3IXMA 2NV2B 2ZJ1A 2W42A 2FWMX 2JLWA 1PG0A 4CM5A 1UBHS 4NY1A 4OKSA 4PY2A 4ZWNA 4QTYA 2X0JA 1E9SA 4PEVA 3O8DA 2Y1EA 3DMYA 1JAXA 2K87A 4FX5A 4X1YB 2C00A 2QUBA 2XDYA 2WD7A 4P4SA 2HCFA 3SZUA 1DQNA 1DRKA 1G4UR 3FHTA 1RC1A 4M6WA 1UWCA 4US2R 1QMPA 2W2VA 1VRWA 5CXSA 1RXYA 3CMCO 4XPIA 1QM5A 3OQNA 2W6ID 4JIGA 1L8AA 2BFPA 3VKVA 5F5XA 1ICEA 4XWOA 4ZJZA 1LZLA 3JQAD 1MEOA 2R2AA 1A7KA 4BFUA 4YHHB 4F04A 5ALLA 5J2UB 3PICA 3QKTA 3HZZA 3LECA 2FSHA 3UVEA 3FPFA 1QYWA 2KMLA 3UHPA 4EHKA 2VJOA 1Z63A 1Y7LA 5EUBA 3SOPA 4JK3A 1QANA 2IYUA 4FKMA 3D0RA 1MPTA 1MVNA 2DWQA 4O1MA 5TS3A 4BX9A 4NRDA 3PHGA 5ALUA 3TB4A 1QQBA 4O2BA 4F2WA 1CEEA 3MMSA 4GQIA 4UTZA 1NTRA 5D3QA 2FVXA 4CYMA 1QRRA 1R6UA 2G1JA 3CT6A 3O21A 4NH4A 3Q0TA 4MRPA 4TL9A 3M6AA 4UC0A 5F12A 3SR4A 4CT5A 4DDWA 1KQGA 4J49A 1Z6XA 4EHDA 1EFTA 1SCAA 4DQUA 4G26A 3L04A 1O89A 3H17A 3SJBA 3LDUA 5LKAA 1OA0A 4NJMB 5ALMA 3V8NA 1VA4A 2BRUC 3OIDA 1P17A 2PKQP 5F76A 3QX8A 1X3LA 2WM8A 2YVKA 2WRZA 1E6LA 4ZOLF 3R3UA 4M9RA 2H59A 4U0KA 1DSSG 4Q15A 3AOGA 2D1SA 3MJ4A 3H0KA 4XUGB 4TQGA 5AVRA 1MH9A 3RT9A 1PFGA 1HKUA 2R87A 1LB1B 3I04A 3G5UA 3WP0A 4D0GA 3LCRA 4BGIA 1L4BA 3DAOA 3CVYA 4EPRA 4V1CB 3UW3A 1YHZA 2WIDA 4X41A 3L7YA 3HBJA 4CN8A 4J3JA 3WXMA 4ZVRA 2VRNA 1JIQA 1N5MA 2VL7A 1AOXA 3RB8A 4RF3A 1QP8A 4IYRA 3WISA 1OV4A 1IG0A 3CGWA 2W43A 1IG3A 3IAUA 3OCYA 3S2ZA 1DKMA 3IEKA 1JYSA 2GCPA 1MV5A 3MK31 1TO6A 4ZVMA 3ZW8A 1XLWA 1JRLA 1GZ7A 2FR8A 1Z7YA 1T1JA 2DTDA 2RHMA 3BSSA 3PGJA 4GU5A 4PCVA 4YRLA 4ZV9A 3PDIB 3RHFA 5GVSA 4L5YA 4DR5B 1SZDA 3SVZA 3ZH9B 3JY6A 4IDOA 4WGGA 5FWAA 1P4RA 1VPTA 1T5LA 5EN4A 4BMVA 3S8YA 4EI7A 4BV9A 3AJAA 2HK9A 1E32A 2Q5EA 4GSYA 1KE1A 1TC2A 2LCIA 1B14A 3R5XA 4GYYA 3HSSA 5EQFA 4TKUB 3V6MA 3H0CA 3T61A 1G7SA 3W6OA 2NG1A 3VBCA 1QO9A 3VO2A 2AOTB 1FQWA 2WWFA 3OOWA 4D0NA 4U00A 1JEYA 3IGFA 2IJGX 4U9UA 2ZKIA 3EXEB 3OPQA 3GLSA 4GMXA 1PE0A 4RPHA 4ZXPA 3L18A 1OIXA 2P2ZA 3GAFA 1WPXA 1H2ZA 2CFCA 3UPUA 3MTQA 1TKCA 4FYVA 2E82A 4IDGA 4BJ1A 2FR0A 2B4KA 4II3A 4AZ3A 4CCWA 5JEEA 1PWHA 1Y9EA 4ZZIA 1Z6YA 1PZEA 1CQZA 3M3DA 1T9DA 1OW3B 2JKZA 4DLLA 4PSUA 3H1FA 5F2OA 1IFXA 2VHCA 3L01A 4IH9A 1ORIA 4L16A 4OG2A 4N18A 3S40A 4ZYXA 2OD2A 1EUYA 3NXSA 3ZHSA 4KUEA 4B8WA 1QHNA 4S1PA 1Z26A 1K6MA 2DKFA 3V1KA 2ECPA 2ZIGA 1ZI6A 4U2GA 4ZAXA 3H4TA 4C3VA 1NLUA 4C06A 3V5NA 3H9CA 4O8CA 1QGUB 1SG0A 3ZU6A 3TLEA 4TMWA 1HUQA 1NQVA 2VJQA 1YCGA 3CRMA 2VYCA 3RJ5A 4TV8B 3PXEA 4HLUC 1DKRA 2AUTA 4BU1A 2J9FB 3NXKA 4KDFA 3CRQA 4LEIA 4R0NA 4R9RA 4LV6A 3B6ZA 2OGWA 1F0NA 1GRVA 1TVCA 4GIBA 5IHXA 2JJ8A 4ITRC 1Z6GA 1KNXA 2WF6A 2GXAA 1EFHA 1XZAA 3JQEA 3AR2A 4JT9A 1G4HA 4H0NA 3RS7A 1VA5A 1FQOA 5EJ5A 1UOPA 3KOYA 3MXOA 3JQ7B 4Q4CA 1KEPA 2RBKA 5TMEA 4O4IB 9MHTA 1OFGA 1O95D 3TIFA 1SQ6A 2ZYGA 5C2JB 1CP2A 4J16C 2QUIA 4IHKA 4ANFA 4JZKA 4ZVUA 2ZVQX 4ND8B 2H4FA 4KXMA 4MQMA 2H31A 5IK2A 1I0LA 4HAOA 1RHUA 1SA0A 3I2FA 5JNSA 3F3SA 2Z2ZA 3NRJA 4OJNA 3WGGA 3EUEA 4LXGA 1KDTA 1CUBA 1HC7A 2J41A 5KNDD 1HI9A 1GZUA 4B34A 5DM70 1VPEA 4PSVA 3OPVA 4IQ0A 5FWXB 5EZSA 1H2FA 2GF9A 4LA4A 3SR3A 3GN2A 1U6KA 1KQPA 4DV6B 3GH3A 3MJEA 2NNWB 1HDIA 4LOAA 3TN7A 3K9CA 5DF1A 1P80A 2IYAA 5IAAA 2P11A 2PO7A 3FPEA 2BOVA 4KR0A 4QYSA 2P65A 2FCRA 1NE2A 4XWGA 1OH8A 1C4KA 1AQYA 3PE6A 2XNJA 4MA0A 7YASA 2FPIA 1DE0A 4IUCS 4WCFB 3BD8A 3QMVA 1BS9A 5HHTA 4M55A 3WB2A 3JTEA 3ECAA 1ZVKA 3EF0A 5BT8A 3B2QA 1AC5A 3U7RA 3IAXA 5AQ1A 3L8DA 3T0GA 4CKCB 5LWHA 3DTNA 3ZLVA 4KFRA 4EBBA 4EGFA 4KZKA 4JLDA 1R10A 1J2UA 3SJAA 3DT8A 3ZIUA 5DXJA 4O2BF 2JI8A 1B16A 1HEIA 3SNHA 2O9JA 2AOUB 3WZLA 3NO4A 5EMNA 4UZSA 2UDPA 4PQYA 4GP9A 5IBPA 1HE2A 3PL5A 2MDTA 3ZBUA 3W4KA 1AUXA 2BI8A 4CIXA 1N2GA 3BTSA 3CN7A 4WNYA 4C4TA 4DTIA 4MQFA 3LWNA 2HNKA 2BFNA 5HW0A 4MGEA 3IJRA 4PNHA 1TYZA 2Y66A 4OFWA 1GG2A 1QIIA 1Y4ZA 3E3NA 4B48A 4DCJA 5P8WA 3PR3A 1BXRA 4PO1A 3A7DA 5FUMA 3HJRA 4LSZA 4CG0A 3T1HB 1GM5A 2F43A 5F3RA 1B76A 4GF5A 5EFOA 1K7EB 2L2QA 4TSRA 5SYMA 4AC9A 3C45A 4HDAA 4OYRA 1KDZA 3RC2A 2HW8A 2H3HA 1X7ZA 2X3UA 3Q6MA 2GZHA 2L17A 1U1IA 2OVFA 2BM8A 2N47A 3C43A 6CHYA 4EK9A 4AQYB 4ASUA 4E33A 2BEKA 3HYNA 1LK0A 3X1KA 3R0JA 4L0QA 1QAMA 1UP6A 1V95A 2JJ2A 3EF3A 3H1GA 4D44A 4E1AA 3MWJA 3CCBA 1RJGA 1UDXA 3D8TA 2YS7A 4OHZA 2YHIA 2WSMA 4MYRA 4UM5A 3UEOA 4IMIB 1ZD3A 4Q9HA 2IPOA 4P4TA 1SVOA 5E3HA 4BO0A 2WFAA 1IHOA 1XZIA 4U2EA 3WRYC 1XVVA 3ABOB 3COYA 4JJEA 3ZHZA 5BQPA 5I6DA 3LDHA 3MJRA 3QLEA 4DM7A 5KQSA 1PG2A 2X3FA 4GOMD 3ADBA 3MTBA 3W06A 2JCGA 3KQSA 3TS1A 2HU7A 2P9JA 3H2JA 3FFTA 4IJQA 2C2MA 3PQ6A 2IUYA 4KX5A 2H57A 1U8AA 4RK1A 3PENA 3L4JA 4WKPA 2QVGA 2Z08A 2ZYIA 5EPUA 4B2LA 4GWLA 1E7MA 2DHRA 1C8LA 4NP6A 4ARZB 4JH0A 1JR3A 1RYBA 1UXJA 2I0FA 2AMVA 1LQ2A 2VUTA 2QTVA 2W71A 2O7VA 1AMOA 3DS8A 2YR0A 1XRNA 5EXTA 2QOEA 3CS3A 1ZIXA 2JFNA 1ESMA 3K35A 1IRIA 2OO7A 1KEUA 5CFMA 3W9SA 5KHOC 3LBNA 4XIIA 4QJ5A 2HYIC 1AQUA 2CJYA 3F49S 1UIRA 3JR7A 4LWZA 3ZV4A 3LHDA 3QBTA 1ISGA 2K4MA 1FFHA 4DG9A 1EJ6A 1CJKC 3AIMA 3T3HA 4QLOA 1KMQA 2OV1A 2PT9A 3EARA 4HDMB 2HJWA 5CH5A 1M8KA 4C87A 4MYUA 1ODCA 3PIIA 4L9AA 5IVKA 3NAQA 5JCOA 4PHFA 1PEDA 3QVXA 2EQ5A 3PPVA 4E13A 2C1ZA 1LBSA 2TSYB 1PJ8A 5T4BA 2MYUA 2YDXA 2BCGY 1W4ZA 4QNMA 4RJ2A 5B1EA 4D9JA 5BMVA 4TTAA 3EIWA 2Z1MA 2YWBA 4C6RA 4XCVA 1V5WA 3I52A 3KDSE 3ORYA 3ZI4A 3ZHXA 2XUPA 3F4LA 3VAAA 2FEOA 2X8LA 3NEAA 1VLJA 1NXXA 2F8LA 2WKWA 4IDFA 5FEUA 3NGMA 2P4EA 1PL0A 4NBTA 2GZRA 2Z9CA 3PU6A 4MX8A 2O1EA 4F93B 4RE5A 2CXSA 3FB4A 1YSCA 1BIFA 3CXUA 3CISA 4QARA 3C4JA 4EFKA 5MGNA 3OKAA 1GPDG 4M9SA 4MP3A 3PXGA 3V2IA 1PV4A 1NVAA 4L51A 3VDXA 3LIIA 3RT7A 3V8PA 3OE7D 2OHOA 3F90A 3TMYA 3HEAA 4A03A 3T1NA 5FL7D 1ZJ6A 4J1NA 3Q3JB 2J0UB 3EZFA 3SJ7A 5CBPB 4A92A 1C1DB 1E79A 2YFHA 4WCDA 1K3TA 1U2QA 2I7XA 3WR5A 1L4GA 2FQWA 2Q3LA 3BCHA 3ZTYA 1FTWA 2V65A 1M1YA 3GPIA 1I4EB 2G63A 4DR7B 3LUDA 2BGUA 2EGUA 2X14A 4NENB 4IP0A 3RTGA 5LYJA 4M0DA 2V5VA 4DEXA 4F5DA 2VK4A 1SXPA 1UQUA 3IKJA 1CDOA 2OOKA 5FI3A 2C3OA 1KK1A 3HDVA 2MINA 1KOLA 4UW9A 4HH0A 4I5DA 2QP3A 3R9XA 4I2NA 1DAIA 2DQKA 1LJLA 2NZXA 2VNSA 1RWVA 3CMMA 3T7DA 3FJOA 1RXIA 1XXHE 1RRCA 2IUFA 4FN4A 5I3CA 3HB0A 1G64A 4YN3A 3OKCA 2XA9A 5GONA 3RBVA 3TSZA 3U1VA 4YV7A 5CB8A 5HWSA 1P7CA 3ZGNA 3RRBA 4UTXA 4YLYA 2GHIA 4R2KA 1W4CA 2CXOA 5LMCA 3HH8A 3UMMA 3JSAA 4AS3A 5BWBA 3ZN2A 3X1XA 4ZYUA 2LR0A 1XTPA 2MSLA 3DC2A 2HSGA 4KAXA 5AFSA 3HFSA 1U1DA 2MIIA 2RH8A 4W82A 4X6YA 4CM9A 4KREA 4MWCA 1PFUA 3HY3A 2IOQA 2Q4OA 3PD1A 3TNYA 1I1QB 2OO5C 3MLBA 3W5UA 5DLPA 3EPKA 3CE6A 4KTVE 3BMQA 4G9EA 4JC5A 1QG4A 2AZXA 1QCCA 1QIKA 1UKVY 1JBKA 2LNDA 1I7DA 4KQMA 1E1CA 2SHKA 2GH1A 4JJZA 2ZIXA 1QORA 2XWJI 4NAUA 1NYQA 4TQ9A 3H2SA 2P6NA 2XMDA 1ESNA 1YS1X 3PA6A 4R2HA 2B99A 5AVKA 4RPKA 1Y8QB 4KBGA 1J8DA 2Z2IA 3FWNA 1SZJG 4YRGA 1TU0A 2C4KA 3UFXA 1KBQA 3O8NA 4L5CA 4G1VA 2AJDA 4D92A 1F7UA 5SZKB 4WFJA 4AROA 1ISPA 5FFFA 4B4VA 3SCZA 5T64A 3ILVA 1LDEA 1YZQA 1SD1A 2NO4A 3FCOA 3HCDA 3I1JA 4P82A 2YZ2A 5K8LA 2QZZA 1I5OA 1O77A 1AMNA 4C3UA 4OOEA 1E4OA 2ZGVA 1DDGA 1RXUA 1QTQA 4EMUA 4KVFA 2X77A 3HO1A 3LY7A 4TT3A 5C34B 1SELA 1VHWA 4KC0A 5LNK1 2C2HA 5DTMA 5IJAA 3U7FB 2YIVX 4UDXX 4HVAA 3T9DA 1U65A 4FSHA 4TUYB 5F9MA 1NZJA 3G2OA 3OF3A 1C2TA 2J3LA 4L85A 2ZU0C 5L3RA 3M6UA 1RKVA 2V03A 3EXIA 3KAQA 3DYIA 1RQ2A 1U9JA 3IIMA 2OPHA 1E89A 1G2PA 3B9QA 2UV8A 3R3HA 1D2AA 5EWJA 3I9NA 1BN6A 2QN3A 5FT9A 1NFRA 3RVKA 4BVLA 4MPJA 5ULLA 3C39A 5G3ZA 2EIXA 3IT3A 4YVFA 5E1MA 1TJ3A 5JXWA 2CK3A 1E3WA 1GPKA 1NOKA 2GM9A 2YRFA 1GZ5A 3E7PA 3EDYA 2I2XB 2DM6A 1QDUA 3P20A 3QWHA 4X0EA 2R47A 3OCZA 2OZPA 3DKPA 5F2EA 521PA 3L6CA 4EO4A 5K6TA 4PZ0A 3RREA 1YB6A 4TROA 2CXRA 2QDXA 1BMFA 3FCAA 3PUXA 4OD0A 3PQ2A 3RFTA 3ZX4A 1BCSB 4I1PA 4XSHA 2H07A 2AD1A 4YA6A 5LP6B 4EL5A 4ZV4A 4KKXB 1WSDA 4Q9NA 2Q0XA 2PMBA 3TINA 1Z4IA 1U2DC 4RENA 4BKUA 4J2OA 2RHGB 3HWX1 2WF9A 5CT8A 4WADA 2JASA 2EG9A 3HS3A 4AM8A 4A0HA 5H3LA 3KX2A 4Q1VA 2GYYA 5CEJA 2J0VA 2B83A 3KQYA 5E9AA 4C7KA 4OMDA 2ACVA 2G71A 3EULA 5CVTA 3GFGA 4B87A 3WV4A 1JKJA 4NCNA 3REOA 4D5EA 2ZYRA 3PQEA 5ALSA 1KQFA 2IHJA 4YRAA 1V11B 1YH3A 5AHKA 2WTXA 5COBA 4OLJA 1BE8A 1WHSA 5TF4A 1E9CA 2GJ4A 2IXFA 1CNFA 5BMVF 3TO5A 5H4GA 1LW6E 1U0LA 3HY6A 4FJ0A 2Z8YM 5CYPA 5K0ZA 4DT1A 5EHNA 5I7UA 2O54A 1XZKA 2X4DA 2PXCA 3GFPA 2YV5A 1R37A 2XVZA 1HDXA 2O4UX 5EVCA 3SXJA 3WRXC 3G5MA 1ZITA 2H1SA 2ZWPA 3FBTA 3K1AA 4HFMA 4HWPA 2I6UA 1NRWA 3SLRA 1P6QA 1UC4B 4A0SA 1QOZA 2B5WA 2DFKB 4BJ5A 1D9ZA 4JZYA 4D4IA 1HE5A 3SIPA 4WXRA 2IXDA 3WNQA 3PLAE 5E2BA 2QRVA 3ZTWA 3WY9A 1QQ7A 3MSXA 4GOXA 4A8JA 4DHEA 5AVWA 4ZQCB 1Y81A 3A2MA 5KTKA 2B8NA 1A98A 2WHPB 5ESWA 4JJ6A 3DE3X 2GBLC 3A36A 1XXLA 1O97D 2ZSDA 3DMHA 1LY1A 2Y1KA 2FE4A 4E3WA 3TCXB 3FCYA 3CGGA 1ADFA 3F5FA 2CVFA 3MILA 5CVVA 4ZYVA 4WZ6A 3NIFB 1O95C 3TW8B 3CFYA 3LVFO 3OC6A 1LI7A 1JJFA 2YJ3A 1FFWA 1YQQA 5G41A 3VPDA 1A2QA 3RS3A 2X8WA 1QK5A 4URWR 3GQBA 3L7OA 1WUHS 3L1UA 1FRVA 2DUJA 3EMBA 3ORSA 4KYUA 5AM4A 5GV8A 4B7ZA 2AMFA 2DFDA 2FRDC 2J45A 4PFQA 2HJSA 4RY2A 4C4AA 4GQBA 4DA6A 1MOZA 5BQOA 1M2GA 1HFWA 2WTUA 4ZJYA 1EUZA 1NOJA 2JLQA 3DCYA 4IDNA 1F6WA 1GZ3A 1O54A 1E7QA 3AKCA 1NI5A 4FYMA 5CFRA 1NF8A 1OROA 3MRSA 3ANXA 4H6XA 2R6GA 1YJQA 2HM7A 4YCJA 2RE8A 2NSJA 2CMFA 2R751 4YP1A 2J7KA 2R96A 1T2DA 3FE2A 5GONF 1NJSA 4A6EA 2PQ0A 3VOSA 4YT8A 3DUFB 4M9XA 3EH2A 4GR9A 3EODA 1N78A 5CA0F 3AX6A 2A9KA 3VUEA 4QBKA 3P1JA 1HZZA 1CY2A 5TS2A 1N9ZA 1NBIA 4JBHA 2CHEA 1UJ2A 1M1NB 1GGKA 3JQ6A 4RTRA 1S96A 1TGYA 3J7TA 3WYCA 4UD2A 4O2AF 5E7IA 3AERA 1GSOA 2AR9A 1OAAA 3MHPA 4NEGA 3OLQA 4MAMA 2H54A 1LNQA 2WT4A 3R0ZA 1YOVB 1EA7A 2GM5A 1CNMA 3GJQA 2ZANA 3PP8A 3H2KA 1ONBA 4G2TA 4ALLA 4DRZA 4Y6OA 3NHAA 5EHIA 2C2OA 1GCGA 4FDMA 4CU2A 1FJHA 4IIDA 2JGDB 2IYWA 1UPXA 3U3OA 2J46A 2AC2A 1S5PA 1GL3A 1P2UA 1RZVA 1X87A 2NTVA 2VUHB 3G0DA 4FGUA 4YROA 5I9TA 3A4YA 1ABBA 2GNOA 2HIMA 4LF8B 3VOBA 4QRDA 1HDYA 5JI2E 1B0PA 1H94A 2AFHA 4QE3A 2DHEA 2FPOA 4IDHA 3IXQA 5FTKA 1Q19A 2XAAA 4G5QA 4IFTA 2BDUA 4RTMA 3K0HA 4F86A 3QNMA 1IPFA 1NUUA 2HO5A 2PKRA 2ZSHA 3KEOA 3NZEA 5J23A 2RH5A 4OJQA 2QW0X 5I7HA 1LLUA 2H11A 2JW5A 3K4QA 5KAPA 5I7RA 3Q8LA 2A1UA 1V8FA 3H5TA 3L7DA 4JOBA 2WWWA 2NZYA 4JQCA 1Q2XA 3CLUD 5BRAA 4TRNA 2FF5A 1RZRD 1XMJA 3EQ8A 4I5FA 4MS4A 3OJFA 4MWGA 2QRPA 1QSGA 4HPWA 5IJZA 1OWNA 3KYDB 1A4UA 1XMSA 2VJLA 1BGVA 1F2UA 3Q7IA 4Y1FA 5ALRA 1M73E 1CE8B 5F7JA 2A84A 1SBCA 3OUZA 3PFGA 3HI4A 2AG0A 4TM8A 3WLAA 3FI9A 1VJRA 2IEZA 3INYA 3OHMA 3QXGA 4FX2A 4R69A 4WY2A 4D02A 5TLSA 5JO0A 1Y3FE 4Z9FA 1EHCA 3VR6A 1GKIA 1YDGA 2Z4RA 2JBAB 3D8RA 4TKMA 4AF6A 2Q50A 3NPMA 3OY2A 1NUQA 1BO6A 3K96A 1WXQA 4YJHA 2QENA 3V1YA 1PZNA 3OJEA 4LSMA 5HRCA 1Y1PA 1XMQB 3P7MA 3HM9A 4I5IA 4DG8A 3ELUA 4MVCA 4AN1A 1NSYA 5A9RA 4G4GA 5DMXA 3T3NA 2BFCB 3AR7A 1F4PA 4H0FA 1OAKA 2AHOA 3OAAD 4G8JA 5H1YA 4LCJA 4U2CA 1U6JA 4YP6A 4ZKDA 4FKBA 3CR3C 1E2HA 9GPBA 3A8TA 3CO5A 3BWCA 1OF1A 4LGCA 5BR7A 2QY9A 1BVHA 2VSFA 3NYRA 5KYGA 4C29A 1M2JA 1CFJA 1H0RA 4DREA 3S29A 3UUEA 2NYUA 4JMLA 3A4MA 1V4VA 2B20A 3F1LA 3I64A 4G1CA 4MVJE 4DL9A 4ENWA 1KRXA 1ZNYA 5JD5A 4DV2B 2I4MA 4M1ZA 1ZUHA 2FX5A 4V0NA 3Q88A 1U1FA 3EQ6A 1YRQA 2IXBA 3VFDA 4BFYA 3V4ZA 5JCPA 2QVLA 4N0EA 3AI1A 3BB3A 5GOTA 1FVXA 4E5VA 4P92A 2IY9A 1LPOA 4CTJA 3PSHA 1E98A 1F06A 1RD4A 1UK7A 3O6VA 3NBKA 3PE4A 4XARA 4ENQA 1ZOOA 2EATA 4FYIA 3D02A 4NXNB 2CWWA 1N8NA 4N49A 4LKRA 3DGEC 2B6HA 2HB6A 4N8SA 1L7NA 4L7QA 2NGRA 3PX7A 1PJBA 1FU8A 1PW7A 2IY8A 5EKDA 3EFOA 1DXHA 3STTA 3AB7A 4UASA 4R9UC 4XX1A 1PK7A 1YBVA 4TTTS 4RTQA 3KHKA 1IN6A 4G67A 5GJVC 3R9IA 5HSGA 4DIUA 1X8JA 2NXEA 1GG8A 3DBLA 4GWKA 5KOJB 1F8YA 4JJIA 4DIBA 2PSSA 4Q21A 3UHJA 1E7SA 2GASA 4RX1A 4L07A 3HG7A 5ELXA 4OAOA 4XASA 1MB3A 3FRHA 3P9IA 4EYQA 3OTGA 2VK8A 2FPLA 2RAUA 2DPLA 2IP1A 3PNYA 5H5JA 1N5IA 3ULKA 1FP6A 1EVLA 1O96A 1V96A 1ZK4A 5D86A 2AE1A 3EY9A 4ZGWA 5BSEA 3LYAA 1H0HA 1DIRA 4UBIA 3THWB 2PSDA 1HE8B 2WYHA 4GYJA 2P2GA 1JS1X 1YS7A 3A06A 3E9QA 3RC7A 2CUNA 1NVBA 3BMOB 2WF7A 4CLXA 1P77A 3B7PA 4C88A 5IDWA 5EXXA 3O5AA 1IN4A 1EK2A 3HDHA 5IK2D 2IBSA 3R3VA 1E2PA 2W2NA 4FQ7A 4W7HA 4P4LA 4TL7A 3GNSA 3GNTA 3MJSA 2EQAA 3BXXA 3AP1A 1VHLA 2Q8PA 2EKDA 3VSEA 4N5MA 1UP4A 3J7AC 1GQSA 3JAKA 3S0JA 3T3DA 2ZSIA 3JAWB 4GKAA 4ACBA 1XQ6A 5DVZA 1ODJA 3U7JA 2FGJA 6NULA 3PDWA 1DEAA 2OWDA 2I1WA 1YKGA 4K9SA 2WG0A 2WUDA 2HK8A 2C3YA 3AW9A 2WAMA 4HSEA 4JLUA 2GETA 3ENWA 5CCBA 4FCWA 2WSBA 5DBGA 4OQFA 2IEBA 2W48A 3TAUA 3IPLA 1NNSA 2GB4A 3EB9A 3GO4A 4O6VA 1ZN8A 1CUIA 1BFDA 3OEWA 5ITWA 4EFLA 1LJ8A 1O1YA 2X22A 2OXTA 3CVXA 1RQGA 5DNAA 3JQ8A 3PJEA 3KZNA 1Z7WA 2KS6A 4IX1A 4DQ0A 4EFMA 5JC1A 4N0QA 3FTFA 1CIJA 1OY1A 1ZU4A 2ZBVA 3FIJA 3SF8B 3ZC3A 1M2OB 3P9SA 3AILA 5FBHA 1E2IA 3V33A 2CVZA 2C04A 1RFGE 3G2LA 4QUBA 2WSIA 3TE7A 4UPVA 2PGIA 3C6QA 4EM6A 4R7GA 1GAEO 3DBRA 1RP7A 1VJCA 3H4VA 2A94A 4PV7A 4RXMA 4DCNA 4NARA 5KMGB 5JZVA 4IQ4A 5TIIA 4TVOA 2A5JA 4RVNA 1ZIOA 1BQ3A 4FBMA 5BN3B 4CNQA 3IT2A 5GTDA 1T4MA 5BN4B 2F9FA 2E4XA 2WY2D 1VFPA 2R00A 4MV7A 4NPAA 2WV9A 5JSUA 1I10A 4UEWA 3EA4A 3DCJA 5LU8A 1P2VA 3B7GA 4GL4A 4UBKA 1YJBA 3O7MA 1QTNA 3GT3A 3QWIA 2YJ5A 4BMOB 5KOIA 1P81A 3HU5A 1EFVB 2GYVA 4TMYA 2J3KA 4IF6A 3UT0A 4X1IA 4X63A 5D3MB 2DVMA 2Q3HA 4TTSA 3FDZA 1QJCA 4RJKA 4BWVA 1BEEA 1CCWA 3OTIA 2HF8A 4M8NE 3T9FA 4L9WA 1DG9A 1I5RA 1PJ4A 4GWGA 4LZNA 4ZOBA 2J0SA 1QVAA 2BY4A 2E85A 4C5CA 1R7RA 3LUAA 5H02A 3BA1A 4A1FA 2YYAA 4CTKA 1UM9A 1IEQA 2EP7A 1OLOA 3EY4A 4ON9A 5AW0A 3JQFC 5ENZA 4MGHA 5EL0A 4P81A 4V2IA 1M76A 2JJ2D 3RSHA 2NUBA 3CLHA 1SVLA 4O25A 4Z54A 2PU5A 1XT6A 5JMPA 3IIEA 4KN5A 4U2BA 4R0MA 2WJIA 3GX1A 1FFAA 5EC8A 3GD5A 2V7XA 3UA4A 2I2CA 1U0OC 1ZJYA 4KYIB 3BDIA 3RYIB 3HN2A 3CVJA 4V38A 1GPBA 3F7NA 5TJ9A 1ECLA 1XL0A 4D82A 2J09A 3IERA 2BP7B 2H1LA 4QUKA 5AQEA 2YYYA 3JPWA 1QPBA 1QH1B 3Q10A 4W99A 5DBFA 1ZFNA 3CKYA 3RW9A 4GE0A 5LBTA 5HXAA 1JH8A 1GOTA 1P7ZA 4DC1A 1G5TA 1PSZA 1XAHA 3CH6A 3ELWA 3FZGA 1W8DA 3FKSA 2X0KA 3ANMA 3GPBA 3M6XA 4L4XA 4PM4A 4NNJA 5GY7A 1NBWB 3C3PA 4BUZA 1C1YA 3GI1A 1HEUA 3KBBA 4E03A 1YZFA 1R0LA 2EZUA 3BGVA 2JFVA 4Z49A 4Q19A 1Z28A 1AKTA 4EUFA 2QNRA 3QV2A 4BN0A 4RF5A 3VJRA 1NF3A 4KXNA 3VNBA 2FXIA 1DX6A 3D6NB 1QLHA 4DLTA 3EVBA 2HDNB 3HCEA 3F3MA 4NCBA 1QX3A 2PL3A 1NVTA 2XJ4A 2IUTA 3KYBA 5DYIA 5CDGA 2YWRA 4UAJA 4ZARA 4PZUA 1UDRA 1PT6A 2D0DA 4BN4A 2LGJA 3IP8A 5CURA 1U4NA 1N75A 2FFQA 5C7YA 2AD5A 2DGDA 4FU0A 5HG0A 3R5SA 4TSFA 1GAQA 1WY5A 1U7WA 2YN4A 1PFQA 1U5BA 1WDMA 2PDAA 3NHZA 3R0VA 4IVPA 4QUIA 4U39A 4WKNA 3U3KA 4B3SB 4AKHA 5K01A 1CJUC 3H8WA 4JBLA 3W79A 2HD4A 4B44A 4EKYA 3OKFA 4Q4AB 1G8JA 4JODA 5DASA 1B6RA 1YTLA 2C3MA 1AQ6A 2ET6A 1N6HA 1F0KA 4XWKA 3H5OA 2RI6A 3O0TA 1WS6A 4RFSA 5DHFA 2PUFA 4Z4QA 2EKLA 3T15A 3LK6A 1WV0A 1T0HB 1N6PA 5JCXA 5DNDA 3HMQA 1GA1A 2Y9MB 3PGMA 2R8OA 1O97C 1IHYA 1RJFA 2GBGA 1T9HA 2O3UA 1R0YA 2WJZB 3EHEA 3L8MA 1N9KA 1KRHA 1R5OA 1I4LD 1KDRA 2EC5A 1J2TA 4FYYA 2ZJ7A 3NVMB 3BB4A 4MQ5A 4WXEA 3P9ZA 4AWAA 4BFSA 2FOXA 4OXXA 2HY7A 2XB6A 4F7DA 2FSUA 4GDMA 1UBJS 1QK3A 3CXRA 3NJRA 4CHGA 4RIHA 5JADA 3PCRB 3UHFA 3MT0A 5ED4A 1KRWA 3QG5A 3D6MA 3ZK8A 1NU8A 4GPIB 4W6QA 3GP5A 4AY5A 1A04A 2OHHA 3JARB 5IMBA 2IUUA 3QI2A 4L57A 4Z51A 1Q50A 3VR6H 1ULZA 2D2IA 3ISVA 1E79D 3GLGA 1FBNA 2XADA 4FD3A 4H3KB 2DPXA 1ZZGA 1RE1A 4RW0A 4QFBA 3L82B 4V1CI 2OBFA 1YE5A 4LZOA 2HPAA 1WEHA 4J0CA 2RKOA 3UKJA 4ODIA 2HEIA 1QIHA 3RAPR 4K9QA 3T94A 3LMKA 3WHPA 4PYLA 4EFNA 4RU1A 3TTVA 4OSPA 3ONVA 1QLJA 3CH7A 1TYBE 3M70A 5GOZA 2WJYA 3BE5A 4IOLA 1L5MA 3O1LA 4Y1RB 1U8UA 4KWTA 1EWRA 3T5MA 3LW8A 4IJKA 3U1BA 2WJGA 2GR9A 3ZLJA 1UBEA 4PS1A 2Q2NA 4JBGA 3WWYA 2GKOA 5JFOA 1LLQA 5IULC 3OJXA 2W6MA 2PWBA 4R1MA 5CG1A 3B60A 2XZPA 2ZXEA 2ZIAA 3A9TA 5LQJA 1L8LA 4DSOA 1KJ8A 4YMTA 3NWEA 2BF7A 4JLNA 4OB7A 1CVIA 1SXIA 4EHFA 1U6IA 3QLVA 4LF5B 2C9CA 1ORRA 3U4IA 1Z2CA 2WU8A 1KO1A 1CV2A 2J0EA 2XMBA 1K8ZB 3CBGA 3QMWA 4XQ9A 1JT9A 3V7YA 3QEKA 4BNDA 1IAQA 1MDFA 4HDNB 2O4CA 2Z5GA 4ZCIA 2G9NA 1N2IA 2FHPA 3MUNA 3H5WA 2WD9A 3G5AA 4OGLA 4TZTA 5GJWC 1OI3A 4AY3A 1IK4A 2G88A 4OQNA 4RBNA 4A2WA 4LYFA 1KJIA 4ZEXA 4KIJA 4PTZA 2NO1A 4TLEA 3PRJA 2B7CA 2JLVA 2YVLA 4KXQA 4KMRA 5JJCA 5KU7A 1KH3A 2XD9A 2Z3ZA 2G09A 3OIVA 4R71A 4DF3A 1NT4A 3KQNA 1Z7GA 3GZNB 3O8RA 3RKRA 4BS9A 4HTFB 3TXAA 1QK4A 2XDAA 4IINA 3AVXA 1ZY2A 2R25B 3HXKA 3DPSA 4MI9A 1S1MA 4JKOA 3K0FA 3BXPA 1MQ8B 1FX0B 2CXPA 3CLUC 5IZ4A 1I33A 2G82A 2IP4A 2BMAA 4HGQA 1I3LA 1R6BX 4NTZA 4AU1A 4JT2A 3X1WA 1THZA 2PIAA 5IJ9A 4EHAA 3CB4A 5ALZA 1Q6ZA 2PJZA 4YMUA 2XVAA 1IH8A 1UJBA 1UINA 1Z2AA 3LP5A 3LUGA 1EAYA 4M9ZA 4QNNA 2XWSA 2HTFA 1TU4A 1A9PA 3LQYA 3K9WA 3W7AA 2XZLA 1Z0AA 1MKYA 3V6LA 3M1IA 3VU1A 4IXDA 3MTDA 1Y3DE 2VPTA 2Z8XA 3P0JA 2JIOA 1OD6A 4FILA 5TY0A 4DUYB 1JFFA 3ND8A 4TT3D 4BNJA 3FTNA 1QH0A 4HXFB 2EJTA 2ONYA 1RZUA 2XNSA 2C5HA 4HWKA 4RD3A 1N2SA 4FHZA 5HJ7A 3OJOA 1X0VA 2FR8C 1DX9A 2CC2A 4FINA 4N8DA 2DHDA 2NZUG 2Q6VA 4UBMA 1T6YA 2GEKA 2ZBDA 2PMDA 2V9ZA 4J0DA 4JGBA 1ZS9A 4NULA 2BFOA 3WAJA 3E5HA 4XWWA 1ETUA 4KIFA 4K6OA 4NMWA 3SKXA 3L7CA 2Q5QA