1ESNA

Structural basis for the feedback regulation of escherichia coli pantothenate kinase by coenzyme a
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
311
structure length
311
Chain Sequence
QTLMTPYLQFDRNQWAALRDSVPMTLSEDEIARLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEDLLQTWYINRFLKFREGAFTDPDSYFHNYAKLTKEEAIKTAMTLWKEINWLNLKQNILPTRERASLILTKSANHAVEEVRLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PANTOTHENATE KINASE
publication title Structural basis for the feedback regulation of Escherichia coli pantothenate kinase by coenzyme A.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 101
structure length 311
sequence length 311
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2000-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1esnA00
1E0KA 1UBEA 2XOKA 3WNCA 4LJ6A 4A82A 5JS8A 4TMTA 3CPEA 1LW7A 5DI3A 4U00A 1N5JA 4WAUA 3RRMA 1NVVQ 3HU2A 2WJGA 4C0HA 4XWAA 2OLJA 4WZ6A 3KKPA 1ONBA 1XCPA 4OYHA 4BRWA 2XTMA 1YZKA 3VTKA 4E09A 5GVSA 2IEZA 2O52A 2QSYA 4WW0A 1PUJA 1EFRD 2RGEA 2RAPA 5AJXA 1E9FA 2F7SA 3ZZUA 1K8RA 2V55B 3A1TA 3GJ5A 4FMDF 3ZYCA 3ND8A 1DELA 3QXCA 4Q9IA 5HKKD 2O5VA 4B48A 2D74A 4DJTA 2W58A 3W3ZB 4D0LB 4BRUA 2BMEA 1SQ5A 2CNWD 2CLDX 5CLLA 2ZITA 4A9AA 1M6NA 2IBMA 4P33A 2FPKA 2FG5A 2REOA 1SKYE 1GRRA 2OCYC 2YC4C 3P26A 4A6XA 4MITA 2PT7A 4B47A 1E2LA 3TNFA 5F2EA 4C3ZA 1ZM2A 621PA 1E1QA 2GRJA 1OKKD 1CULC 4JZKA 2ZYTX 4EJSC 1IONA 2ZSAA 3L0IB 4RZUA 1A2BA 1XEWX 1IY0A 2BKEA 5EXXA 4B71A 4JLVA 1UKEA 2GJSA 4BGDA 1DADA 1T91A 5KUTA 5G3ZA 2WAYA 4IXNA 4JLMA 3SR0A 3WMFA 3TGPA 3VFDA 3I62A 1WRBA 4LJ8A 3SE0A 1NMYA 3AV0B 3I32A 4CEJB 5HE8A 1MABA 3C7KA 4PANA 4OK5A 4B2IA 3FFBA 3AB3A 1G8FA 2P2LA 3RLFA 2C77A 5J4HA 3EPJA 1EX7A 1IN4A 3UMFA 1JR3A 4RZ3A 3ND9A 1W1WA 2ZRAA 3PITA 3CF2A 4UXJA 3BD9A 1FX0A 4TYYA 1IAQA 4Q1DA 3AKDA 1GZSA 3VMFA 2CJWB 3KUDA 1Z29A 1DO0A 1C9KA 3H0KA 4K81B 1NP6A 4M9QA 2VA8A 2W00A 3KKNA 4MQBA 3SNHA 3QKTA 2ASEA 4QBGB 1LS6A 3KL4A 3CX6A 2D3WA 1Z6AA 4XWKA 5TB5A 2R6GA 3CNNA 2OG2A 5HCNA 1H8ED 5F98A 1L4UA 1HQCA 1UDWA 3FOZA 3CRVA 5DYIA 5JSZA 3CB4A 1NI3A 1VG1A 3BH7A 1RJ9B 2DCUA 2OM2A 4G0NA 4Y0AA 4LBZA 1OIXA 3RS3A 4EFLA 3GJ8A 2FOLA 2JA1A 2OBMA 2UKDA 1ZUNB 2GXAA 3KQNA 1U81A 3I8XA 2GVZC 2ZRMA 3W6PA 4QGHA 2QTHA 4KODA 3GJXC 1FFHA 5GVRA 2NIPA 1KI1A 2A3RA 3BB1A 4EPYA 4TLAA 2V7QD 4LK2A 3T35A 4GZLA 5C1BA 1UBFA 4PPGA 3I73A 4G5OA 2KSQA 2NOAA 1NG1A 2J45A 1KYIA 3LQQA 1E2IA 2GAOA 4MYTA 1PV4A 4TYWA 2V1UA 3AP1A 3SBDA 4HDQB 3REGA 2D7CA 3OAAA 2Z4RA 1OPXA 5DSZA 3IBGA 4JIMA 5IDVA 1KNQA 1SVSA 2CVFA 3DHWC 2QN6A 2P0EA 4YMWA 2IS2A 1S1MA 3ZD7A 2FZLA 4WXRA 3LFUA 2YOGA 5DLQC 5A5GA 2GJ9A 5AUNB 2FU5C 1IN8A 3N2IA 1BKDR 3HR7A 5FOWA 4E07A 1KTVA 1K5DA 1CJTC 2ANCA 4FMBB 1E96A 3A8TA 4AYXA 2B92A 2PMDA 5KSZA 3K0CC 3FKSA 5AR1A 3CPHA 4MUBA 1OSNA 4QRHA 1W36C 3KJHA 2WJYA 5KDDA 2W83A 1NJFA 3GEHA 4MDFA 1E0JA 3DOEA 1CR4A 2G88A 4Q19A 1G6OA 2ZI3A 1XEXA 5KDOA 3A4NA 3ZVRA 1R0YA 2PH1A 3L2OB 5JWRA 3MRSA 3B9PA 1US8A 5H68A 4RFSB 1VMAA 2R8RA 2XSZD 3T12A 2V1XA 5B2ZA 4JYCA 3TLXA 1L4YA 4OHXA 2ZS8A 5SZHB 3I8SA 4B34A 3LLMA 4XD7A 3VHLB 4LPSA 2ZJ8A 2MMGA 5DN6A 4AURA 1E2QA 2P5SA 2H1LA 3GCGA 1YHNA 3C41J 1UJ2A 1KDTA 2JJ1A 4DCSA 5F3WB 3QF7A 2SHKA 3AGPA 5CM8B 4UNSA 2D62A 1U0JA 5FR1A 1HEIA 5JEDA 2R6DA 2HF8A 4MGZR 4HB2A 1TF7A 4POAA 2N46A 5FBRB 4L16A 3CF0A 4EFMA 1E2DA 2LCFA 4TZ0A 3OHMA 3TUJC 2QMEA 2ZRBA 4Q48A 1GAJA 1KO1A 2GKSA 2PJZA 3A4MA 3GJ7A 4GP6A 1JPJA 4I1UA 2C9YA 1GIAA 1G3MA 1Z2AA 3T1OA 4ACBA 4R71A 2F43B 1D9ZA 2FEMA 4XJXA 2GCNA 2IYTA 4CIDA 4M1YA 3TUZC 1KJWA 4KSBA 1YU9A 4O0MA 3W90A 4A36A 1W36B 4OQMA 5IRCD 2ZJBA 3D3QA 4PHFA 4C7OA 1LB1B 3CRRA 3AVQA 3THXA 1II8A 1U8AA 2EWWA 3N5CA 4GP7A 3OEHA 4KI0A 3THOA 2H5EA 3TRFA 1K6MA 3UG6A 4DUGD 4U7DA 2ZM5A 1N5LA 3T1TA 1KI9A 1SKYB 2OT3B 4ZIRB 2WWWA 5BN4A 4BFYA 3ADBA 1F2TB 1KO5A 1W5TA 2ZR9A 4OI1A 3UWOA 1TUEA 3KB2A 3MFYA 2NTYC 1OXUA 3W8NA 2WWFA 2OLKA 5HTKA 1YZNA 4Q01A 1AN0A 5FBWB 4A2PA 3EZ2A 4BEBA 4D0GA 5L8VA 2RHMA 2IS1A 1XP8A 2VL7A 4BUJA 4JLOA 4DCNA 1M2OB 1M7GA 4JT4A 4JVNA 1TL7C 4MKGA 4YLGA 2O0HA 4KHZA 1AA9A 1IM2A 4LBVA 1HT1E 2ZJYA 4LRWA 1J2JA 4YXWA 2OESA 1NRJB 1T4GA 2VP5A 3R7WA 1A7JA 2ZRIA 1N6OA 2B8WA 3GJ0A 4PR0A 4HAUA 1N6IA 3C5CA 2IWHA 4LHXA 4UXHA 5JJKA 4DSNA 3IPXA 1P9NA 1N3BA 4OI2A 2PZEA 4FMCB 4QBIA 4CVNA 5JMTA 5KOYA 3AVXA 1NIJA 2KE5A 1QHHB 2AWOA 3KX2A 2DB3A 1XZPA 5EZ6B 2VHQA 5EXTA 1AGRA 2B7CA 4CGZA 4C0BA 5C4MA 3WBKA 3NHBA 4CRWB 3ZVLA 1Z6TA 2J5XA 4KFRA 4DSTA 4K8OA 5FPKA 2G0TA 4OL0A 1TQ6A 5LD2C 1GL6A 1I4LD 1OLOA 1PJRA 1NKSA 3L0PA 3X1ZA 3BIFA 1NN0A 3BBPA 1KZ7B 1P9WA 4V0LA 3U3JA 2BKUA 1FOEB 1SXJD 2JDIA 2QP3A 4DIDA 3QVUA 2QG6A 3NBYC 4TSFA 1WP9A 1U98A 5CYPA 2WAXA 4AYWA 2DY1A 3PEVA 2ZE5A 4L4UA 3EA5A 1JQLB 3W9YA 3W6NA 5FL7D 2ODEA 2R65A 5JZVA 1E2MA 1EFTA 2ZVPX 1CJVC 3QENA 2AX4A 3QQ5A 4GMXA 1X6VA 3CZQA 3QPWA 2DR3A 1SXJE 4QG7A 2GVDC 2HCJB 3K9LA 3Q8XB 1ZAKA 4EPXA 1G3UA 1KJZA 3QIAA 1P9RA 5AUOB 3X1DA 5IK2D 2PEYA 1M1YE 2A9KA 1KY3A 4TL8A 3NBFA 3A1SA 2QMHA 2NO9A 4B3GA 2GESA 1RIFA 4URUR 5JWHA 3GLFB 2QEQA 2X2FA 4BZPA 1ZW6A 4AC9A 1NY6A 3MLEA 2DYKA 4LI0A 4WXPA 4ACAA 4A0FA 4OBEA 1U99A 1BOFA 2AR7A 1XJ0A 1E0AA 3CR7A 3DM9B 4XSGA 4D4KA 3W34A 4X8OA 4Q4AB 2XEXA 1FP7A 4HUTA 4AKIA 3VKGA 3SQXA 5B30A 3U7HB 1WF3A 4DIEA 3UMSA 1KO7A 5DE3A 821PA 2IYVA 2VP9A 4ZDIA 1COWD 3IKJA 1KMQA 2QE7A 1C1YA 1S3GA 5DHFA 1ZCBA 5KHOC 3GLHB 1VCIA 4IDOA 4IVPA 1ZC3A 5GJVC 1RYHA 2W6IA 5F9HA 4M4SA 1SULA 1EK0A 4ZDJA 2IS4A 4ZCMA 4L5BA 4LV5B 2RHDA 2QROA 5G40A 2ZRCA 2ZRLA 5EP3A 4F4JA 2YNMA 1UKZA 3OFND 2CCJA 2GETA 3QKRB 2O8FB 1ZNYA 4UNNA 4KV9A 1IJFA 4LX0A 1Z0FA 2ZRNA 4GOKA 5FFMA 1SZPA 1TTTA 5DI3B 4PHHA 2TMKA 4FI3C 2GDJA 5CK5A 5G41A 3IQWA 2L0XA 2D2FA 2C8VA 2OILA 2W2VA 2A5FA 3I3SR 4D81A 5JECA 2UZ3A 2HEIA 1NSFA 5HZKA 3VU9B 4EPRA 1F48A 2B8TA 3MCAA 2ZPTX 3NEJA 4XOIA 4JL8A 3AKYA 4PSAA 2DFTA 2IYYA 4PC3A 4YMSA 3HP1A 3EWAA 1IXRC 1NVVR 1FMLA 1Y63A 1AGPA 1W0JA 1N0UA 3VR6A 3ZIAD 4A0HA 3GLIA 2F3TA 3GJ6A 1GM5A 1IXZA 1E1RD 1Z0KA 1JQJC 1NSTA 1SGWA 2ZS9A 3CNLA 2JAQA 3EC2A 4ON9A 5BWMA 3PEWA 4QBHA 2A5YB 3AF1A 3NBZC 1RFLA 4B33A 2QPAA 4LYFA 1LVGA 1T3SA 1NLYA 1CKEA 1SVMA 3I92A 4GZMA 3GD7A 3TW8B 4I81A 2ONKA 2VHUA 4EIWA 4JLJA 5E7IA 5EXPA 1XMJA 4E5UA 1AS2A 2EFHB 1GUAA 2F9LA 1RE0A 3L0SA 2I1QA 4NU0A 3CX7A 4JVLA 4UKDA 4B3FX 1D2MA 2ZRKA 5EE1A 2WV9A 1G8PA 1OH5A 4B44A 1HYQA 2HV8A 5CIWA 4A8JA 5BW8A 1MABB 1YZTA 3CM0A 1OE0A 1NJGA 3HPRA 3OIUA 4PQFA 2VP6A 1FL9A 5FI1B 4O2RA 5L3QB 4B2LA 5JLJA 2C78A 1IY2A 3RVBA 4EQ6B 3B5JA 4NPHA 1SXJC 5E7MA 1M8PA 2NO1A 4IXMA 2ZXUA 3MSXA 1EFRA 1N2CE 1R5BA 1BO6A 2OFXA 2UVQA 4QBFA 4U5XA 2G6BA 1HY3A 2ZRHA 4F93B 1GFIA 1XU4A 1HE1C 3VHXA 3VX4A 1I2MA 1XTIA 3P4YA 1JXOA 2RGCA 5HKKA 2PLFA 2IX3A 3QKSA 1HV8A 3QF4A 1Q20A 3RC8A 3G5UA 4M8NE 2CNWA 4A2QA 4GNKA 2XNDD 3LH5A 3AP2A 3RS7A 4B73A 1XTQA 3LLUA 4TMKA 1DOAA 3ZS9A 1OF1A 4LV8B 3SFZA 3U7FB 2YOFA 2ZE6A 1MO4A 4RD1A 2HDNB 1OFHA 3WNDA 3MWKA 5JSZB 1OKKA 2VP0A 1CP2A 5JI3E 4EPWA 5K8UA 1PVOA 3HR8A 2Y8EA 1E98A 2I1VB 2V9PA 4TLDA 4HDOB 2WOJA 1E79A 5L3SB 3SQWA 2IA5A 4BFTA 1S1CA 3QBVA 3V9PA 4G3XA 2CK3D 4LSGA 4QFMA 4L8GA 4PO9A 1PZNA 3KXLA 1OW3B 2GEVA 2RH5A 4P4UA 2I3BA 2WSSD 1E9AA 5DYGA 3SU8A 3PUWA 3QXJA 1AM4D 1NG9A 1XTSA 1IXSB 3E5HA 4NKRA 1AQYA 4PAQA 4Q21A 5FR2A 1WCV1 1R8SA 4B3DA 2O8DA 1KI4A 3V4RA 1KI6B 2IYXA 3AVOA 3K8YA 5JHHB 3TMKA 2O8BA 1NN3A 2O8EA 2XNSA 4PO8A 1ZC4A 4WVFA 5JRJA 2C9OA 1RYFA 1G291 3NDPA 3FTQA 2ZR0A 2ZIAA 1KI7A 3BERA 5C18A 1XNJA 3WXMA 2YOHA 2MSEB 4UXIA 1LF0A 1W47A 4JKIA 1JNYA 2NO7A 3AEZA 3CKLA 1VKJA 2P3SA 3X1WA 2E9SA 3EASA 1KI3A 4M9ZA 2OEPA 2NG1A 4FINA 5KDLA 4BECA 4AKEA 2NPIA 5FTLA 1DO2A 4F4CA 4X8MA 3B1XA 2ZUCA 4N3NA 2DFKB 2ZU6A 2QRNA 2ZJAA 1QDEA 3WYGA 4LGMA 1AZSC 1GG2A 1ZIPA 3JZMA 3IO5A 3B82A 1V43A 3EPHA 2P65A 1T9HA 5FPYA 4Z8YA 3EZFA 1JALA 1US8B 2C5LA 1CEEA 1N5IA 1XD2A 4D4JA 4QJ5A 3WHKA 4I1VA 5TARA 3VAAA 1DG3A 3EG5A 3IPYA 1Q22A 3QUSA 3AQ4A 4OK6A 2RCNA 5SZIA 4JLNA 4MA4A 1UPTA 3GLGB 1G18A 3EX7C 1N6PA 3PUYA 4WBSA 4HAWA 5JCPA 1WDTA 1TPZA 1LF5A 1Z22A 3AVPA 1XB2A 3E1SA 1S2MA 2ZROA 1G3QA 1NN5A 4YMUA 4QGAA 2BHRA 5AK0A 2Q21A 1S9DA 3CIOA 2WICA 3SYNA 3ZZTA 1KKMA 2RB4A 2CHVA 3EZ7A 1DTSA 3LVRE 1F60A 1O3YA 1W36D 1BYIA 3SJAA 1DAIA 3KKQA 1NVWQ 2AD5A 4Q00A 5CK4A 2C9CA 3O8RA 3TK1A 3ETLA 1ZD8A 5FTJA 4H1UA 1KGDA 4JLBA 2N1BA 3IBYA 1AKEA 4MKHA 3K53A 5EE3A 3BB3A 2PZGA 5EJEA 2LKCA 5EP1A 3S1AA 2VF7A 3MWJA 1JJ7A 4PZYA 4IOLA 3THXB 3M0EA 1II8B 3I1FA 2JATA 4NYIQ 1RW4A 3BAFA 1B23P 5GADl 2IYQA 5LBIA 4AG5A 4F92B 2JLWA 3M6AA 3FHTA 1QVAA 2YWEA 2J0UA 1CS4C 1G5TA 1GKUB 1S4QA 2XSZA 4EDHA 2OCAA 2LWIA 3PVSA 4KSCA 3NDBB 1R7RA 2H7VA 3FHOA 3U3RA 1YRAA 2GF0A 5FOVA 1XXHB 3MG9A 3LVQE 2QY9A 2JLYA 4ZI3A 1VIYA 1T5IA 2BEJA 5K8IA 2GEUA 3LXRA 4TT3D 4BLRA 3BRWD 1HURA 2H92A 2QMUA 4ARZA 5LB2A 2OCPA 1N5KA 4D0NA 1G16A 4BQSA 1P6XA 3K9GA 4W7SA 1E2GA 1U0HC 2BMJA 3UMRA 3I5XA 3PEUA 4GI7A 3FMFA 2ZSBA 2NPFA 2RGGA 4P4SA 5J4LA 1W49A 3B1YA 3ASYA 4TL7A 1KZGB 3IIJA 2QQ0A 3HWSA 3O8BA 5FUVA 2CLCX 5HE9A 3DKVA 1P2TA 2A7QA 2XB2A 1GILA 3R7WB 4AI6A 4JVSB 2BM0A 3MWLA 1VYTA 1NVUQ 2IUUA 4DHEA 2ZTSA 3Q3JB 1GNPA 3TAHA 3MJHA 1Q21A 2F55A 2DBYA 3SYLA 3MUFA 2RGAA 1F5NA 1E69A 1Z0DA 1NY5A 1Z83A 3I4LA 1ZM3A 3NXSA 3KJGA 4NYMR 2YKGA 1E9CA 4DT1B 1MKYA 3T34A 1T0JB 3K09A 2GNOA 3TVDA 3VR2A 3PV0A 5EZ5A 5KSYA 3D7MA 2OXCA 3GFOA 4RSGA 1KKLA 2OCBA 1DAMA 2VPPA 5E3HA 1RZ3A 3SI7A 4DUGA 3NG1A 4HUQA 1YR9A 4FMDB 1ZU5A 1ZD9A 2YWFA 2FPMA 4KVAA 1W7AA 1KO8A 1U2RA 4MDEA 2VIIA 4GBMA 2PBRA 1MH1A 4M0LA 1Q0UA 1E2FA 4DC9A 4DZZA 1OT3A 3NHAA 2WIBA 3KQUA 1U9IA 2IF0A 2PL3A 4WZBE 3PXGA 4BFUA 4V0NA 1DVRA 1G7RA 1XPOA 1G5RA 3LBNA 4LZZA 4OQLA 4YQFA 4HLUC 1NBMA 4EPTA 2V3CC 4Q1FA 1R0WA 5FOUA 2IHBA 4US1R 5EE0A 4O2LA 2RMKA 1ZRHA 2CL0X 3W5IA 1NMXA 2GCOB 3EWSA 4Z8XA 4R7ZA 1UEIA 3NC1C 3E2IA 3F5FA 1K5GA 1JR6A 4MKIA 1KMHA 4IFEA 1PLJA 1EWQA 1T6NA 1G4AE 2AXPA 2FE4A 1IY1A 3FGNA 3N2EA 2IS6A 1X1SA 1AJEA 4M9SA 3Q7PA 2ZYUX 4DKXA 4LV6A 3B9QA 4JLPA 4A0GA 4Q4HB 1E94E 4MKFA 3U4QB 5DNYB 3FWYA 4IOJA 4LC0A 2ONJA 3ZJYA 3KQKA 1Z63A 2WWIA 4OJKA 5AJVB 1Z07A 3J81k 1D2EA 2GXQA 4DWJA 4C9BA 4W9MC 3GLFE 1F3OA 1CU1A 1G4UR 4Q18A 3WYAA 5G53C 2F6RA 3IQXA 4A92A 3G0HA 4NE2A 2J0QA 1ESNA 2X2EA 4BFXA 4HZUB 1A82A 2VP2A 1GRQA 1CLUA 4B76A 2IHYA 1WBBA 2Z6VA 3IO3A 2EWVA 2V6JA 1QG2A 4TN1A 3SC3A 1SXJA 1A1VA 4IRUB 4P31A 3C8UA 5C2JB 1Z0AA 4URXR 1AIPA 4KBGA 1FQKA 1G3IA 2WKQA 3AF0A 3EIHA 1NLZA 4YMVA 2ZAMA 4TL6A 3U3MA 2XOKD 2WWHA 4HYYA 4BE7B 2EFGA 3IEUA 2FSHA 1NL3A 3GLHE 5FL7A 4KCGA 4DCTA 1E0SA 2YVUA 4O25A 1CIPA 4M1MA 4NYJR 1UM8A 2OBLA 3I72A 4K46A 5H70A 1I4DD 3BOSA 1MV5A 1JPNA 3UIEA 3VKWA 4D82A 2WPDD 4ITRC 3ZD6A 1JAIA 1L7VC 2G0NA 2AWNA 3CZPA 4X8HA 3KKOA 1G41A 5IK2A 1LNZA 5C4GB 4CEIA 4KO8A 4Q4JB 1Q1ZA 3WRYC 3KTAA 4TQAA 4P32A 2QP9X 3H1TA 4B6EA 2C2HA 2HJGA 3K0FA 3KQHA 2X8AA 1NF3A 4TTPA 5CIQA 2QAGC 1MO5A 2FV8A 1O87A 5GJWC 3TAUA 3W8RA 3CF6R 1KK3A 2FSGA 1Z8FA 4S35A 3TVTA 2Z0MA 3TH5A 1CR2A 3K70C 4GOXA 2MMCA 3UK6A 4G5GA 1MT0A 3AH8A 1IN7A 1YZQA 4ZV4A 3TSWA 4M21A 1COWA 1Z6YA 4HLCA 4KBFA 3BORA 5D3MA 1G5PA 2QGZA 3VR3A 4BLOA 2F3RA 4JSYA 5CJ2A 3LBIA 1UBCA 4RFVA 1FNMA 3BFVA 3K0SA 4DLZA 2XX3A 4TLEA 2ODBA 2RGXA 4OHVA 1X86B 4ZDWA 3QE0A 2FX3A 2IT1A 1MRSA 2CL7X 3K0AB 2FWRA 2ORIA 2IK8A 1FZQA 3AF2A 3OFNA 3MJRA 4M9XA 2EW1A 2ZR7A 3RSLA 1QHIA 3CBQA 4LYAA 5TXGA 4N0DA 3SS8A 3VR4A 5CB8A 1Z47A 2O8CB 4TQ9A 2W6JD 3SHWA 1D2NA 2ZANA 3BB4A 5FOTA 1KAOA 2PCJA 2QAGB 4M53A 3UPUA 1YJ5A 4QNMA 1W48A 2QZ4A 2FSIA 2JCSA 2IC5A 2XTZA 2V6IA 5FPHA 5JCZA 5JS7A 5KO2A 3BS4A 2QBYB 2R2AA 4MUAA 2WTUA 1Q3HA 1VTKA 2R6FA 3K1JA 1OFTA 1SHKA 4EUNA 1E9DA 1E9EA 3B6EA 1XPRA 2ZETA 3K70B 3E70C 5E95A 3ZIAA 1P2VA 1SVWA 1XD8A 1S9HA 3GJ3A 4B74A 3CPJB 1GKYA 2P6UA 1RPZA 1E1RA 1KOFA 2W0MA 4UJ5A 3QKSB 4C0JA 2JLSA 2QSZA 3QF4B 4KFSA 4BLQA 1PLLA 2IF2A 4B75A 4QJ3A 1KSGA 1E6CA 1X8JA 5JJLA 4OJQA 3R9XA 2V8OA 2BJWA 2BMFA 1XDBA 5DH9A 3GQBA 4HI0E 2BOVA 4CEJA 4D4LA 4DXAA 3BFXA 3P1JA 2ERYA 1BMFD 1P73A 3IHWA 1JEDA 1J8YF 1OJLA 1YVDA 4Q7LA 1X8KA 1FUUA 2GAAA 3WMGA 5CLQA 3Q9LA 1Q3TA 2FFAA 4I1OA 1W0KD 2BC9A 3EC1A 1G21E 4BASA 3Q5EA 1I4TD 2EU8A 2PZFA 1IQPA 2AHOA 1TQ4A 4U02A 4JLDA 2JLZA 2CJWA 1YR8A 2PLRA 3OAAD 3FE2A 5HPYB 1OIWA 1F2UA 4ESVA 3L8YA 5DHAA 4OQFA 3TSZA 4IOKA 4LJ5A 2BDTA 1W5SA 5A0FA 2Q9BA 1W4BA 1FPMA 2IXFA 1N25A 4BPBA 1VYVA 1YQTA 4Q7KA 4D4MA 3VNVA 3PQCA 3SBEA 2DFLA 4A0RA 2ZJOA 2QAJA 1KHTA 1XJQA 2KI5A 5DGXA 3MD0A 2YWHA 4QGFA 5CM9C 2FEOA 2QUZA 2O8DB 3SN6A 3CO5A 4BEJA 2YHSA 3MWYW 2XXAB 2O8EB 1E2NA 1ETUA 3FHCB 2GJKA 3FKSD 3HDTA 3P4XA 4BFWA 3PEYA 2WZQA 5HCIA 5DIFA 1TADA 4Q1BA 5E7JA 4ZI2A 3LW7A 1RJ9A 1T3HA 2IYSA 4UNPA 3TJZA 4B2PA 4D25A 2JJ2D 2E1RA 2NZJA 3SDZA 4RKEA 2FNAA 4TLCA 3WYFA 2FFQA 4EJSA 4R2HA 2QI9C 2WOOA 4HLQB 1XEWY 3THYB 3RDPA 2VHJA 4DLUA 1UKVY 3SOPA 2FSFA 1TUIA 3HYRA 4FCVA 4CEHB 4TL9A 4F7WA 3MGCA 1Z5ZA 1ZUHA 2J7PD 1G7CA 3T5DA 1P61B 1A4RA 4PHTA 5JEEA 3ZVNA 1KDPA 2KJQA 3KKMA 3G82C 3M1IA 2DFNA 3AKEA 5ANRB 1E3MA 1OXVA 2KWIA 4KAXA 1J70A 2GZDA 1GL9B 3DMNA 2CK3A 5FTNA 4GOJA 4QGGA 1EWRA 3UANA 3FB4A 5K8LA 2D2EA 2J0VA 1LY1A 2D7DA 3R8FA 1SVOA 4W5HA 1NIPA 2WSSA 3B8HA 1U94A 4LJ9A 2F1IA 1P2SA 2X19A 3C14C 3QPVA 4RCZA 5BYJA 4CW7A 3A1UA 3BE4A 4IVRA 4NCHA 3GLGE 5DO9A 2J59A 1BS1A 1XX6A 4M1TA 4ZCIA 4ZCLA 5TDHA 1Q1EA 4M1KA 1KNXA 3DZ8A 5E4FA 3LY5A 3AVUA 4NCKA 2K5UA 2WJIA 2EYUA 4OQXA 1VPLA 1HH4A 3LNCA 2ZREA 4LY6A 3LDAA 3OE7D 5FPTA 4AWXA 2OZEA 3K9HA 4OKSA 4ZO4A 4DRZA 4HSEA 1Z0IA 2WJHA 4G01B 4NCJA 4DB2A 3KXIA 4OI4A 4V0MA 1G8HA 4PPNA 3SYKA 2BBTA 2QT1A 2IYUA 1GNQA 3TIFA 1RRCA 3PJRA 5IHPA 3OF5A 4MH0R 3S1AB 3SJBA 3ZDQA 4B43A 3SZRA 5FBVB 3PUVA 4O3MA 1M7BA 2HUPA 3PUXA 1R5OA 2AKYA 2MSDB 2Z83A 4ZKDA 2GBLC 1RRGA 3AF3A 3DL0A 1OV4A 4LBWA 5FTKA 3U61B 3WY9A 4XVUA 3R9IA 2VSFA 2YWGA 2ZRPA 4GPTA 4WOPA 2ZJZA 2EFEB 2OFWA 5CJPA 4LC1A 2RGDA 2YYZA 1EXMA 2P5TB 2P6RA 3P32A 2ZS7A 2ZVQX 4E03A 3NH6A 4YXWD 1Z6GA 3B60A 1TU3A 1AS0A 2J0SA 5LB4A 1T0HB 3BH6A 1DAGA 1HT2E 1XXHE 5JRZA 3RRZA 3L0OA 2FGKA 4BFVA 3QEOA 1G8GA 3NC0C 1CRPA 1XF9A 2F43A 1U8YA 4LJAA 4JKYA 5FOSA 4EFNA 3K0CA 3VQTA 1KSJA 3B1WA 5AUQA 3L43A 1T8TA 4YC7A 3I61A 1XMVA 4NZYA 3KDSE 2GWHA 5AJWA 1SVLA 4Q9HA 2HT1A 1PLKA 4D80A 1JEEA 1NMZA 1XTRA 4RY2A 3K9NA 4QM6A 5AWFC 4JBWA 5TV2A 3RC3A 2WIAA 4ASUD 2DWQA 3U6KA 4PSKA 4R98A 2JLUA 1NNEA 3ADDA 1OB5A 2NMVA 2BBOA 2GEDA 2VQSA 3HJNA 1CRQA 1GDDA 2W2TA 1BIFA 1OFIA 4Z51A 4ZIRA 1I2DA 3KUCA 5GJCA 1F2TA 3DVLA 4A4DA 5J4KA 3RNLA 3UWKA 1QHXA 4PHGA 1FX0B 5BQ5A 1AKYA 1E4YA 2WJVA 4TMVA 1CJUC 4F91B 5KU1A 2ZYWX 3R8CA 1W46A 4NTZA 5J4YA 4A2WA 3LO5A 1JI0A 4B3CA 2HXSA 4W5WA 1OHHD 3CH4B 4HUQB 2QM7A 2JLVA 2H57A 1CTQA 1T8UA 3GPLA 4NP6A 5FI0B 1KY2A 3QXSA 4AKHA 4P4TA 4PFSA 4PC6A 1R0XA 1E2PA 3QEJA 1DE0A 2BWJA 2HJVA 1Z6XA 4DLVA 4N0EA 1E99A 1FNNA 3U3KA 1NN1A 1P62B 5KNBA 2PCLA 3CX8A 4TT3A 1ZUIA 3KJIA 4DLYA 2XGJA 1GKIA 3PR1A 1SHZA 3B85A 2RGBA 5ELXA 4Q9JA 2FN4A 1CJMA 4BLTA 1FMJA 2CVHA 1GVNB 2VHTA 2EYQA 4IEEA 4MRPA 1VIAA 4G5QA 2OE2A 2C95A 1UDXA 1AK2A 1QHHA 4B6FA 4DVGA 1VECA 4ZPXA 3IUYA 2ORWA 4DEYA 1M74A 3T06B 1G64A 2IYRA 3U7EB 4R9UC 1QF9A 1A2KC 5P21A 4BWYA 2IYWA 1TQ2A 1TEXA 2ZI6A 1Q57A 3LX8A 3HPQA 4FD2A 4Q9KA 1HQYE 1R10A 1KJYA 221PA 2JGNA 3REFA 2P67A 3MMPA 1UAAA 4TYQA 3GJ4A 1JJVA 4JBYA 4CT4B 2ATVA 4LHVA 5UKDA 1G6HA 5FUYA 4FWIB 4RKFA 1E9RA 2LKDA 2WMNB 1DS6A 4IOMA 1MRNA 1XZQA 2C98A 2FA9A 4PC7A 2P6NA 1UEJA 3BH0A 1H8EA 4GSYA 4BFZA 2EFDB 4HAZA 4II7A 2DPXA 4C2UA 1R5NA 3L82B 2R9VA 4OK3A 1G3RA 3W5JA 4CDGA 5CB6A 1IOZA 4L9SA 1QHSA 2ZUDA 4D6PA 4YDHB 4M1WA 3ZLJA 2CL6X 2EVWX 2NQ2C 1Z0JA 1XEXB 1R0ZA 2J9RA 4AYTA 4LYHA 3QVVA 4QHTA 3QPUA 5SZKB 1P2UA 3IIKA 1D9XA 1W4RA 1XBTA 1ZINA 3GLFA 2IXEA 3OEED 1G7TA 3O8CA 4JL6A 1X1RA 1D8TA 3A1WA 3QOFA 4MRSA 4XVQA 3U6BA 5CYOA 2WJJA 1W44A 4CEIB 3LQRA 2V7QA 4RD6A 1DARA 1R6BX 3B13B 1VG9B 1N6RA 2BIFA 3ECCA 4JMPA 4Q9LA 4AG6A 3EARA 5BN3A 1X3SA 1JECA 1WQ1R 2B6HA 4NONA 2FZ4A 3OESA 3RS0A 4C0QC 4KXFB 1FTSA 5EE5B 2YJTD 3CWZA 1P5ZB 3JZAA 4CZ2A 2QMOA 3AUYA 3IHLA 3GLHA 5KYKA 3RAPR 2GXSA 5FPSA 2G9NA 2VSOA 5EUQB 2CBZA 1HTWA 2JIZD 2QPTA 3RABA 1Z3IX 2QU8A 3TW4A 1OXTA 4DSUA 1JB1A 2G3YA 3RS5A 1N0VC 3GEIA 4DDVA 1RC8A 3AVWA 3RWMB 3WP0A 3A36A 4QM7A 4Q1AA 4KLNA 1Q44A 2OO7A 4MYCA 4C7OB 4D26A 2QRZA 3QKRA 2O8FA 1GP2A 1XMSA 2CLSA 3H2YA 1W2GA 3ZS8A 4NHOA 2HLDD 2ZI5A 3EZ6A 3FPAA 1J99A 4OI0A 5M04A 1MR3F 1XRJA 3A6PC 2IUTA 2R6AA 3AUXA 2I4IA 3BJIC 1G8YA 2CE7A 4LDJA 1Q1QA 1SKQA 2A5DA 3ASZA 1OXSC 2G83A 8OHMA 3VU9A 2BCJQ 2WPDA 4QJ4A 5HR5A 2D4HA 4QNRA 3PG5A 3U2QA 3ZQ6A 3RHFA 3K70D 3GFPA 4YMTA 4DEXA 3V00A 1ZVQA 2PJRA 2ZEJA 4B3XA 2WKPA 3W6OA 4MRNA 3WRXC 4DDWA 5JI2E 3KB1A 1G17A 1ZM9A 2QPOA 2XTNA 1U8ZA 2Q3MA 1R4AA 1UADA 2IUSA 2R62A 2JEOA 4FIDA 3R20A 2Q3HA 4MGKR 3LBHA 5FBLB 4Z1MD 1XPUA 4RD3A 2DWOA 2NGRA 2QTVB 2XZOA 4UQOA 2GCPA 2IW3A 2WVJA 2BEKA 4KJZA 4DLXA 1NVXQ 1ZU4A 1ZJ6A 1OB2A 4P3YA 3CLVA 5KNDA 1WB9A 2FGJA 3KXKA 1ZMXA 3D31A 3KQLA 1E2KA 1EFUA 2VTKA 4L15A 4QKQA 1V5WA 1E79D 1UF9A 1ZIOA 2JASA 2J41A 1FW6A 3X2SA 2D06A 4CYMA 3M4YA 4EPVA 2BV3A 1ZNXA 2ZSDA 3FMIA 3OZXA 2A5GA 3B78A 2CCGA 3T1VA 1OH6A 4MGIR 1DBSA 3ADKA 3KFVA 1QHGA 4ZKEA 2FF7A 1YKSA 1G1MA 1H8HD 2B7BA 1GRNA 3PIRA 5BYKA 1EFHA 6Q21A 1ZM7A 1BYUA 4NCIA 2QT0A 4NMMA 3T1QA 1KK1A 3ICEA 5L3QA 1II9A 4EQ6A 4KVGA 1DAKA 2UZIR 1YZLA 5BN5A 2PT5A 4DLTA 3CW2A 1F6BA 2OBNA 1N0WA 4TMWA 2J7KA 3DPUA 1Z28A 2GBLA 3AKCA 4PTLA 1D5CA 1F2UB 2W6JA 1X8LA 1P4SA 3OIWA 4Q02A 4AY2A 3C15C 4Y0VA 1IJEA 2PMKA 2VRWA 4C30A 4DLRA 4JLKA 4DCVA 4UNQA 4IDHA 1EG7A 1VYUA 4GT1A 2W2XA 4PAMA 2G1KA 4YONB 2IL1A 3NKVA 3H4MA 1ZM4A 4M1SA 3IEVA 3B2EA 4C0AC 2ZSEA 1ELOA 1ZP6A 3Q72A 1KI2A 1Z2CA 1TX4B 5CDFE 4DLWA 5DISB 4C0KA 2QA5A 4IEIA 4EJSB 3THWA 1P60A 3X1XA 2RGNC 1TU4A 4PSVA 1OXXK 3CRMA 4Q03A 5L3SA 3ZZ0A 4KFUA 5JBQA 2ZI4A 1QG4A 3HU1A 3O47A 2V4ZA 3T61A 3LW8A 1PUIA 2J3EA 2ZQ5A 5EQTA 4NL4H 1ZYUA 4Q4LA 4LHYA 3Q85A 1FP6A 5FL3A 1QHNA 3DOFA 1BMFA 1XJCA 5KSPA 1G7SA 3IDQA 5LDDC 4IDNA 4RD2A 5EUMA 2IEYA 4PQYA 1W0KA 1KAGA 2FJUA 2HCBA 2Q3FA 4P0TA 1HE8B 1KI6A 3P20A 1N6KA 4TYNA 3CONA 2EQBA 4IHQA 2X77A 5BXQC 2WWXA 2VHCA 3GEEA 1GNRA 2GILA 2VO1A 3V4FA 3TQFA 2HYDA 3GFTA 5DI9A 5JJIA 1M34E 3OIVA 2Q0HA 3TBKA 4RVCA 3WNBA 4F38A 5FH9A 5KSOA 2ATXA 4JS0A 1OYWA 1YR7A 1TQDA 2GK7A 4Q1EA 1B0UA 3SHFA 5LPNA 3EPKA 2C96A 2JJ2A 4A8JC 1ZCAA 1VCNA 4Z54A 4AK9A 1FUKA 4HLDA 1MO3A 2XITA 5GJBA 5EE9A 4H1VA 2ZRFA 3F3YA 3WBJA 1KDRA 4LYJA 2QL6A 3U44A 2WWGA 3FMPB 2ZE8A 1DEKA 2F9MA 1GSIA 5L3RA 2J7PA 2X1VA 4I99A 4LBYA 5JWOA 1EESA 1VG8A 4LPKA 4US0R 2PX0A 2DHRA 4Q66C 3GLGA 3AP3A 3RS2A 2CHGA 4WZAE 3GLIB 2WWYA 2GJAA 2ZU0C 1E1QD 1W4CA 2ECKA 1XCMA 2FPLA 2WM9B 1IN5A 1OYYA 2BVNA 3ZVMA 4MYHA 5EP2A 1UKYA 4GRAA 3U3OA 3UKDA 1VDZA 2AN9A 2REXB 4UJ3A 3RYTC 1VHLA 4KLZA 1YZGA 3WMEA 3NH9A 1AZTA 3QBTA 2ANBA 4HDCA 4C0LA 2IWRA 2GA8A 1CF4A 4GDFA 4WIAA 1R2QA 3DKPA 1DPFA 4URYR 3PUZA 4IDPA 4MRRA 2VP4A 2CEAA 2NZ8A 2H17A 2ZI9A 3U60B 1TAGA 1J8MF 4GL2A 4M1OA 3D6TB 1JR3D 3KFXA 1P3JA 4JLAA 4Q5IA 1U90A 4TMXA 1GOTA 2NO6A 3O8DA 2WMOB 3IIMA 4FMCF 4V03A 3DM5A 2YV5A 3HYTA 3T5GA 4URVR 1VCMA 3H84A 4E22A 5JFGA 1KK2A 4V0OA 3OE7A 4A8JB 1NLFA 3EXAA 1S96A 4QOSA 3IGFA 1OIVA 2CDNA 3TE6A 1XFAA 1WBDA 2J46A 3A1VA 3A37A 4URZR 2ZUBA 4HB3A 4HAVA 3JVUA 4W5JA 3A4LA 4GFDA 5D3QA 1IBRA 4G5SA 5H1YA 1E2JA 1JR3E 2C04A 4FN5A 1XXHA 5H8WA 1ZNZA 4KYUA 1GITA 5JHGB 4JT2A 1OH7A 1SVIA 1KDOA 5TMPA 4MGYR 3ADCA 2FFBA 2VLIA 3CWQA 2R6CA 2AXNA 2OUKA 2BMDA 2FH5B 3H86A 4TYPA 3LWNA 1NBMD 3C16C 4JBXA 1DAEA 2AK3A 4Q47A 4LCBA 4IJMA 2CHQA 2REBA 1CXZA 3QXHA 3UXMA 4NYMQ 2VEDA 2Q9CA 5J4VA 3VR5A 3SEAA 4HB4A 3N70A 4DCUA 1IN6A 1J7KA 4Q7MB 4C2TA 4EAQA 4JVMA 3X1YA 1W4AA 2AK2A 4OQNA 3F8TA 1N6HA 1EFCA 2OSBA 3QI2A 3EW9A 2XJ4A 3CH5A 1GWNA 1TF2A 4FWTA 4DT1A 1NBME 1SVKA 2WHXA 3TR5A 1L8QA 4I1SA 4J0QA 2BBSA 4YDSA 1Y3AA 2ZI7A 3AVVA 3CNOA 2GJ8A 3PCRB 1RRFA 1YZUA 2Z43A 1HA3A 3P27A 1AQUA 3RANA 4ASUA 2HXYA 4S2EA 3BC1A 2ODWA 2O0KA 2ZJ5A 4NCNA 4UNRA 5C46F 4OHYA 4G5RA 1ODFA 1TEVA 2XZPA 3OIYA 2BM1A 4FXPA 2WSMA 121PA 5KTYA 2O8BB 3GP8A 4PPQA 2WKRA 1LTQA 3EAQA 3VR1A 2FDCA 1OHHA 2BJVA 3BGWA 2J87A 4L9WA 2OAQ1 3AM1A 1IHUA 1QZXA 3C4JA 2G77B 4IW3B 1TF5A 1MO6A 1QRAA 1WA5A 3LD9A 1XCGB 2XNDA 3SJZA 3FMOB 2OAP1 4KU4A 1E9SA 4C0SA 4MYUA 1CJKC 3U7GA 4B35A 1OH8A 2GCOA 1LFDB 1YRBA 2E87A 2JJ8A 1E2EA 4PO1A 3ZQJA 1LS1A 5IF9A 2QNRA 3TKLA 1G20E 1TNDA 4XD7D 3CR8A 3R9WA 2ZE7A 3DO6A 3ZGXA 5DN6D 4EKDA 4NDZA 3ICQB 1RKBA 2YZ2A 2JJ1D 3VX3A 1VG0B 3EIQA 1Q12A 4Q4HA 1QBKC 3FKQA 3U4QA 2Q6TA 3QY0A 1XWIA 4XVRA 1XD2B 3NEYA 4JYBA 1UFQA 1E9BA 2XZLA 1NKTA 4B3BA 5EP4A 4ESHA 3AVYA 1Z06A 1JAHA 3UG7A 2KBFA 2FMXA 3TR0A 5LD2B 2BBWA 3QG1A 3B1VA 3IILA 4HZUA 3RSOA 4XIGS 2A2ZA 2CXXA 1W2HA 1RRPA 4LJ4A 2VH5R 4C4PA 2HYIC 1JBKA 1G19A 2PEZA 1T3LA 2IYLD 4LUCA 4R2IA 1HUQA 2GXUA 1XD9A 4KFTA 1J90A 2VYFA 4NYJQ 4RD0A 5FUXA 1E32A 5EXSA 2F1JA 1Z08A 3K0EA 4HLUA 5J5CA 4WA7A 2H16A 3QJYA 4ZDKA 2QGNA 1G9XA 4BZQA 4XSHA 3OEHD 1LV7A 3FVQA 3MAAC 1EGAA 4PQRA 1DAHA 3EZ9A 1C4OA 4MRVA 1II0A 1CR0A 5SZJA 4RFSA 4ERNA 3LA6A 3SJCA 2H18A 3AF4A 5KPJA 4HEJA 2BCGY 4BLPA 1YE8A 4TLBA 3EIEA 4PAOA 3TUIC 3K09C 3U5ZB 5B57C 1VHTA 2WBLC 5KPDA 4Q7JB 4TMZA 1KI8A 4QXAA 5F9FA 3CUEF 4RZ2A 2J1LA 2AKAB 3LV8A 4Q4JA 3AGQA 1A5TA 3ONWA 5FBQB 2RGNA 2KB0A 2J0UB 3LAWA 3QG5A 4GMDA 2GZHA 4TZ6A 3B1ZA 3OEEA 5IT5A 2YINC 1ZBDA 5TVKA 4TQUS 4N1AA 1U9IC 5L3VA 4NYIR 5TY0A 1XEFA 3QKUA 2AFHE 3TQCA 2Z5FA 4DDTA 4FW9A 4I4LA 4ARZB 3AVTA 1QVRA 2ERXA 3NBXX 5J47A 2XJ9A 4HB0A 3BWDD 2JLXA 4PZZA 3LXXA 4D2IA 2GK6A 4DLSA 1H65A 5K8TA 4Q1CA 4V0KA 4P4SB 4CT5A 2Z4SA 5FTMA 2IXGA 3L8ZA 1QHYA 4XWOA 2CMKA 2VF8A 3EPLA 2JIZA 2RKOA 3Q5DA 1L2TA 3SFVA 1GTVA 2ORVA 1KO4A 3BXZA 1FTNA 1ANKA 3NWJA 3CRQA 3QNUA 3K0AA 5B58C 1DAFA 1KSHA 1Q1BA 3NIBA 1N6NA 1VCOA 4TTRA 2F1RA 3JVVA 3NVAA 2JDID 2HLDA 1AS3A 4US2R 4FCTA 4TSFD 3LX5A 4LJYA 5FOXA 2O8CA 1KSFX 3FDIA 4PZLA 2OV2A 3A58B 1ZNWA 1E4VA 3I5YA 3PENA 5J40A 4M2LA 3QSYA 4LOAA 4PC2A 2QAGA 4HAYA 1KIMA 4QL3A 4KITB 1MOZA 4AKGA 2H8KA 1BH2A 1S3SA 3KJEA 4QC2A 4IKEA 1RVDA 4JJZA 2QBYA 2GTPA 2V54A 1S8FA 2OXRA 2QORA 4IDQA 2AD1A 1WMSA 4PC1A 4URWR 3RWOA 2ZAOA 1CR1A 5FUWA 2Q9AA 5AJYA 2KBEA 4KYIB 2QENA 4TTQA 3WHLA 2QTFA 2MSCB 5A4JA 4PXAA 4B32A 4HATA 2JLRA 3VNUA 2N42A 3BFKA 1CBUA 4QHSA 5CITA 2C03A 2FFHA 3FYHA 3RS4A 2A5JA 3PFIA 1XTJA 4Z1MA 3GMTA 4LHWA 2JLQA 1WE2A 1KMHB 1P72A 5HZHA 4HZIA 2QM8A 3NTUA 4XH9B 1N6LA 1P7CA 2IYZA 2ZJ2A 2XAUA 4NH0A 4A1FA 5B64A 3RRYA 1EX6A 2DWPA 2ODNA 4JL5A 2NO0A 3THWB 4LHZA 421PA 4ABYA 1M7HA 2XB4A 1DG1G 4QHYA 4OHWA 1FQJA 3T15A 1WXQA 2YC2C 721PA 1XTKA 2QE7D 3DEFA 2HT6A 4X8LA 1T5LA 1OFUX 5AUPB 4RD4A 1H8HA 4RJLA 3D8BA 3LRPA 4BLSA 3DZDA 2ZRJA 2W6ID 2C99A 3BK7A 1TMKA 4DB4A 3Q7QA 4PX9A 4CF7A 1SXJB 4TWZA 4RCYA 2A30A 2XXAA 5CDFA 4OHZA 2O0JA 4NBSA 3ZH9B 3KZ1E 4M22A 1JXMA 2VSXA 2ZSFA 4LJ7A 521PA 1XMIA 2W0SA 2ZRGA 3CRW1 2VBCA 3FFAA 2QP4A 3UATA 4IVQA 4V02A 4ILEA 3EA0A 4AD8A 2ZYVX 2ZRDA 3THYA 2GF9A 3C5HA 4PPFA 4CEHA 4IFBA 1S0UA 4HAXA 1E2HA 2B21A 4F4IA 2PX3A 1D6JA 4FCWA 4Q4AA 3TSOA 3KTAB 1R8QA 5G3YA 5KNCA 1W0JD 4JJKA 2HF9A 1ESMA 4A6PA 1GL7A 3K0FB 1P75A 1KK0A 4DSOA 2GHIA 4XTCS 1U0LA 3U44B 4DBLC 3B7GA 5AJZA 4AIIA 2CE2X 3VKHA 1UBGA 2A78A 2CCKA 2AFIE 4A15A 2AL7A 4DDUA 4V0ME 2QQEA 4BZXA 3HU3A 2F1HA 3W3AA 4H9GA 2R44A 2EFCB 4G1UC 3QXXA 1ZD1A 4RZXA 3F0TA 3WP1B 2G1JA 4BFSA 3RRNA 2GZAA 3DDCA 4LWZA 3GLIE 2OFOA 4JSTA 5D3MB 1YR6A 3DMDA 4XTRA 2OHFA
chains in the Genus database with same CATH superfamily
1E0KA 1OFVA 2XOKA 5JS8A 3HXOA 3UQYS 3GG2A 4RMGA 3SJ7A 1BH6A 2DKFA 2PQ6A 3CPEA 3FSEA 5TS2A 4CM6A 1C9JA 3F67A 4ENTA 4NULA 2E4ZA 3BREA 1T36B 2DGDA 4MWTA 4C0HA 1U2EA 4F71A 2FPIB 2R60A 4DTIA 1EVIA 1WKVA 1LPMA 1I94B 4HBZA 1GEGA 2VWQA 3A7DA 3MS4A 1YZKA 3LF2A 3T5BA 3WLPA 3BE6A 1ND5A 4EZBA 1YZVA 3U9SA 1CUFA 1QH8B 2QD1A 2XB9A 3PT5A 4M7PA 1EFRD 4J1TC 2RGEA 3DTVA 5K3BA 3TLBA 2YBEA 4JP3A 5AJXA 1E9FA 3VPGA 1SEVA 3ZZUA 5BR1A 1NQOA 1Y4ZA 4YH1A 3I6QA 4QLBA 3R0VA 4N76A 3ND8A 2FPRA 4UEKA 4X24A 2X76A 1QC5A 1MX9A 2O5VA 2XODA 1GRVA 2AI3A 2W58A 4RW0A 4D0LB 2QKYA 1SQ5A 1PYGA 2H7YA 4Y9SA 4OG2A 3WS7A 4EFKA 2CZGA 4P33A 1E6WA 3HNPA 2FPKA 4GPBA 4R54A 1V26A 1E3LA 3AHFA 2G0AA 2YC4C 2OCYC 3HYSA 5DGCA 4E08A 3L49A 1ISRA 3PRYA 4JASB 1L4MA 1ZSYA 4B47A 1E2LA 1CS0A 1M1ZA 1VZ2A 5I48A 1KEVA 1XP5A 1CULC 2PQ2A 4FKMA 1H4SA 1RWNA 2ZYTX 3KVNA 4IKPA 3T3OA 4EJSC 1IONA 4B3HA 3L0IB 3GVXA 3ET5A 3CG0A 4TKLA 3FLMA 3CSDA 1IY0A 1PKEA 3L1IA 5FNZA 3JRWA 3U48A 1C9MA 1IZ7A 1TXGA 3MTIA 2F3UA 1XZDA 3HCBA 3O92A 4B71A 1CP3A 4PO3X 2WAYA 3RF6A 3TGPA 3IUPA 3I62A 2C7OA 3SE0A 1U9JA 2GD0A 4FYIA 1NMYA 3LPNA 3UGTA 1EX1A 3AV0B 3GQBB 4CEJB 2RK6A 3HDYA 2PGJA 2Q50A 4OK5A 4PANA 2P2LA 4NU6A 1DJPA 2C77A 4D3FA 1BGWA 4ZV7A 1EX7A 1IN4A 3EPJA 4RZ3A 1I13A 2XUPA 1OI2A 1PTJA 2HHJA 3AUJB 3ETHA 2EZ4A 2W2LD 3ND9A 1WMBA 1KAHA 1MHPA 2NZ2A 2ZRAA 3PITA 1YBVA 4MMZB 2AZ4A 2WIGA 4UAGA 4UXJA 4LOIA 3IB3A 4GL4A 3BZUA 3EE6A 1OC2A 3UYLA 3VMFA 4ETWA 3SKVA 2Z98A 3NOOA 3E2PA 2JD1A 3KUDA 3QWHA 1XYVA 1Z2PX 4B87A 5CW2A 2X0EA 2BFFB 3GZJA 2HDOA 1T8PA 2VBIA 2Z3VA 2ZCUA 3EVAA 3H0KA 1Y4UA 4V3BA 3SQDA 3Q7RA 4WQMA 5TEVA 9ABPA 1VJDA 4S1VA 3R5XA 4LF9B 1WU7A 1LDMA 1ML4A 4JT9A 4MS1A 3RAJA 3HJFA 1NX9A 4GQBA 3LIPA 3JVIA 2O8NA 3GIDA 4OUDB 2CXPA 1A9ZA 1Z6AA 4X94A 4DMGA 4XWKA 4HNHA 1H1TA 3TEJA 3CNNA 4GSLA 3UB2A 5DM60 2EZUA 3MTAA 3FZYA 2CLIB 1H8ED 2TS1A 1L4UA 1VI2A 4N6OA 3CRVA 3PZBA 3HSSA 5DYIA 2QK4A 5AXBA 2O48X 1MZVA 1ZR4A 2GNAA 1VG1A 1RJ9B 4HLNA 3RIXA 3FI9A 1OIXA 3V1YA 4EO7A 4CMJA 3GRAA 4K7JA 2QT9A 1KORA 5ERXA 1FTQA 4KGDA 3TJMA 3ZI4A 3SF8B 2G9QA 4B3TB 4LYGA 3TD6A 4D02A 5BNFA 2Z8ZA 1CJCA 1X7GA 3WR5A 1GTMA 2VUTA 1A7UA 1U81A 2VJLA 3LY8A 2F00A 4RQBA 5C8YA 2ZRMA 2PO5A 2Q8NA 1WXFA 4G1FA 2O5RA 4AJPA 2PXHA 2HA3A 4BRZA 3AJRA 1UMKA 1KDZA 3CXRA 4KODA 3UAVA 1Y8CA 3GJXC 1DV2A 1FFHA 1IJKA 1KIAA 1KI1A 1TTHA 2A3RA 1OLUA 3BB1A 1NVKA 2POQX 2A88A 4EPYA 4TLAA 2V7QD 3FH0A 3QOXA 4LK2A 1DDIA 4I50A 4JX8A 2R6ZA 4G5OA 2KSQA 2NSJA 3AHHA 2J45A 5D3KA 4DQUA 5B55A 5KQLA 1PGPA 5T7BA 5TT0A 3WADA 1UJNA 4QFBA 2V1UA 4IIBA 4I08A 3BRCA 2XYHA 3SBDA 4WVLA 4H7KA 3REGA 3SKXA 2CJXA 2J3MA 2M6SA 4PLYA 1CSEE 1OPXA 2DHDA 5DM2A 1YMVA 4H7FA 3L05A 2N75A 1ORHA 2BHTA 4XQ9A 1HFKA 2WHPB 2JCBA 2O2DA 3NRBA 1NBHA 2H4YA 3NX4A 1NFFA 1IUNA 1A8HA 2ZULA 4D9BA 3IURA 1N78A 3KPWA 2QYSA 1XTBA 2GJ9A 5DLQC 1NVDA 1IN8A 1G2PA 1SZJG 1UMDA 3HR7A 4DHWA 4E07A 1KTVA 1Y3FE 5HHTA 1SBQA 3PTZA 4FMBB 4BAZA 3A8TA 3IMEA 4AYXA 3P0FA 3DV2A 1UAGA 5AR1A 2PGOA 4D98A 4MUBA 4OGKA 5IC4A 5KQGA 4X1IB 2FDRA 4R2JA 5KDDA 2W83A 3GEHA 2FUG6 3CNHA 3CBGA 2JFOA 4OHRA 2IOHA 1AO3A 2YR0A 3GRCA 4YAKA 5B4TA 4DV1B 4G0YA 4TZKA 1P4JA 2XRMA 3KOMA 3WTCA 3OUZA 1YQEA 1US8A 5H68A 4RFSB 2GVNA 3CR3C 2XGSA 3ABRB 4E6PA 2HWXA 3TLXA 1L4YA 5H82A 2R8BA 1BCRB 4XD7A 3VHLB 3D6AA 4LPSA 3CXUA 2GRAA 1QORA 2G7ZA 4AZSA 3SVLA 1RNLA 2JFWA 3VO2A 4AURA 4LNUA 4JXZA 1T25A 2VOJA 1UJ2A 3PD1A 3VRHA 5F3WB 2WLTA 3GLIE 2Y2UA 3K20A 3AOEC 4TYMA 4QSHA 3R7AA 5A0VA 2E4AA 1RYBA 3F71A 5B3JA 4TZTA 2X14A 2J07A 2NXCA 3WV4A 4ZXFA 1P3Y1 4E31A 4E94A 5CDYA 2CDBA 5IDWA 3ZVKA 1IBMB 4EMTA 2HHHB 5C5DA 4IBOA 4LKRA 4Q12A 3AI1A 4YP5A 2AB0A 1M5RA 2J32A 2FRVA 1P3DA 3W9SA 1Q50A 3WLKX 4BMSA 1YBHA 2ZRBA 4G4SP 5EYPB 5IN4A 1KO1A 4UUQA 2RDMA 4R01A 3G02A 2WYOA 3A4MA 3NHFA 2ZWMA 3PA6A 1SKUA 1NXTA 2C9YA 1YFJA 1GIAA 1G3MA 2NWQA 3ROQA 4RVSA 2EL7A 2FEMA 4G4IA 4HFMA 5KNDD 2GCNA 2IYTA 3TUZC 3EFOA 4LAFA 1KJWA 4KSBA 5GTDA 3NC4A 1YU9A 3W90A 1NAHA 4OQPA 4A36A 1DP4A 5IRCD 4R05A 1SC1A 1AU9A 1DWPA 2MSNA 3R2JA 2ZJBA 3D3QA 4NVRA 4QICA 1KE2A 4Z0NA 4DE5A 1LB1B 4PYIA 1U8AA 4GP7A 5DEOA 4D4IA 1DSSG 2R96A 2H5EA 4OQQA 4Y98A 4DUGD 4QX6A 3A9WA 4MZDA 2FWJA 2ZM5A 2E6UX 2D54A 3GBPA 1Y3IA 1DC3A 1L7PA 3WL4A 1NF2A 3UMBA 2OGUA 2PWYA 4RVOA 2OT3B 5BN4A 3H87A 5NLLA 3ADBA 5DGHA 3AUSA 2I2AA 2ZR9A 2DQ4A 4R40A 1NU8A 1PBTA 1GYPA 2OB2A 3NBAA 2X0DA 4ZYLA 3IL2A 3A9SA 3U3DA 2LZ0A 3UH1A 2CFCA 2GEFA 4C14A 2AN3A 4EG4A 4Y2SA 4WFJA 5ESDA 4QTYA 1YZNA 4G85A 3RSFA 4GLOA 3WFZA 1YOVA 1OT5A 1WNTA 2GASA 2Q6KA 5FB3A 3C45A 4P3OA 4BEBA 4D0GA 5L8VA 1F8UA 5BRAA 3CIFA 5KNCH 4B6SA 1ULUA 3ANXA 2IYEA 4M0FA 3S2GA 4E46A 4MKGA 3DQQA 3WHPA 1IM2A 2IOQA 4RJJA 1EFDN 2OXTA 5DNDA 1O95A 4YXWA 4CIXA 1J2JA 5C7IO 2OESA 1B14A 1QBGA 4PCVA 3ES9A 4X85A 4TKZA 4Z9XA 3LTNC 5LLTA 1GNLA 2IP1A 2D13A 3N2NA 1LI5A 1X94A 1YFKA 2O7SA 1YDEA 4RKRA 1C80A 1NBIA 3GJ0A 2LIVA 4FX2A 2WIFA 4KV7A 2IWHA 4O2BF 2G80A 4D3YA 4LHXA 3PHBE 3OT4A 1N3BA 3LVFO 4OI2A 1O8CA 1RJWA 4A5OA 5IZ4A 2DBVO 1RXSA 3QNMA 4EEXA 1NIJA 2CUTA 1ZOIA 4GRDA 2PSHA 3WLJA 5EZQA 3MWEA 1CYEA 3SJUA 4TM7A 4TXJA 2WB4A 4C0BA 3EXG1 4TV8A 5DPMA 1O54A 2GO1A 2J5XA 2Q2WA 4OJYA 4KQCA 5FPKA 5K4HA 2D1TA 2I9KA 1HYHA 3SX2A 3BWBA 5FIUA 4B4KA 1X80B 4KH1A 3L0PA 4EI9A 2Y1XA 3R6TA 5KYVA 3GRPA 4G67A 1OGJA 5FNVA 3C24A 5H3HA 3U3JA 2BKUA 2VUIB 3GZ4A 1ZRMA 4D9EA 2R1UA 4ZARA 4DIDA 2P68A 4B6OA 2FQ1A 4IINA 1DQYA 3DV0A 3NPAA 3NBYC 3Q3EA 4PPYA 1C3JA 1U1FA 5IJXA 3ROPA 1WP9A 5B2EA 2DCMA 2FZGA 4EKNB 2IHNA 3S29A 1WCWA 4MEBA 2GFHA 2WAXA 4DMLA 3RC1A 4ZICA 4ZAYA 2DY1A 1QSGA 3OM8A 1GPJA 4F84A 1TKRA 1BRMA 1RYMA 3EA5A 1E3TA 3H1FA 2CUZA 2FMUA 1OX5A 2WIKA 4FYJA 1I6WA 4U6QA 5CXSA 5FL7D 4Y30A 3N2ZB 3IOEA 4FJ2A 3H1GA 2GN0A 4HGOA 1WMFA 1H2BA 2P4HX 1DBPA 5AI6A 3SZLA 3UOWA 3CZQA 3SWWA 5FHQA 1YHYA 2FUCA 3FLAA 1KVRA 1SXJE 3K9LA 3PUHA 3ML1A 3EIWA 4MKZA 1KJZA 3QIAA 3KWLA 3ACDA 3SE7A 2LGJA 3TB4A 4AL4A 3HJUA 2PEYA 1M1YE 4O2BB 3V55A 1KY3A 1YCFA 3DJFA 4ISCA 1JT2A 1NF9A 2PD3A 1PL7A 5CX1A 2EJBA 2GESA 4B3GA 3TDMA 5JWHA 1WABA 1KBOA 3FAKA 3R4VA 1ZW6A 1NY6A 3MLEA 2DYKA 1IDN1 1HR0B 3OPNA 5JAUA 3E35A 2WVGA 2Q99A 3MNFA 1DJMA 2E5LB 4II3A 4K0RA 2IIBA 4D4KA 3W34A 4X8OA 1U9YA 4DCJA 1Z2DA 3JYHA 4KGVA 4EUSA 2H59A 1NR7A 4MWDA 1FP7A 1G5HA 2GARA 2ID8A 3PCXA 2FZKA 5B37A 4WXEA 2NP7A 5BOSA 4R4JA 3HYCA 3UWSA 3U7HB 2PG3A 3PC3A 2OCDA 3P2MA 1DHTA 1VQ1A 4FILA 3QLEA 5AVUA 3HCWA 4QOEA 3ETGA 1YONA 2HU7A 4HRAA 1S3GA 4RL4A 1K4MA 5F3DA 3CT4A 3G0IA 2HQSA 3SAJA 2WVHA 2I65A 2COUA 3TZBA 4GI1A 1J1UA 3DUFB 3AY7A 1G2IA 1CW2B 5F9HA 2C57A 3JR7A 1D2GA 2PGAA 4D9GA 2E1PA 1NAIA 2R66A 1Q5PA 1H0SA 3E27A 3DHYA 4KXLA 4L57A 5CVCA 4ZCMA 4YBRA 4RQTA 4XRGA 4YAOA 5G40A 2ZRCA 1W93A 1AKNA 1SU6A 1NMEA 5L4SA 3BSFA 1OCEA 5KAPA 3OFND 4HEQA 3QKRB 4IYRA 4UNNA 1PT8A 4KV9A 1SCJA 2VJNA 4MP3A 5JDIC 4W5RA 5EIAA 3UGKA 1EFVB 4N7RA 4E30A 4PYOA 3NCHA 1EDOA 3ORFA 2OHJA 3U4HA 1L4LA 4OXQA 4F96A 5AVSA 2OILA 2W2VA 1KEEB 1K3TA 2AOVA 1TZBA 3KJQA 1UQTA 4P92A 2UZ3A 4G5HA 4J9VA 4D9JA 2Z6UA 3GMDA 4P8RA 1NSFA 5IBQA 5HZKA 3DE4X 1PJAA 2D5AA 3K5IA 1F48A 1ZGHA 1RHKA 3G49A 3AKYA 4DLPA 1B8UA 2J5RA 1K98A 2JFVA 2Q41A 3EWAA 1Z12A 3EDCA 4WASA 1VLLA 1VKNA 3UCXA 3GLIA 1NTRA 2F3TA 3EHDA 2BZ1A 2ABWA 4QUKA 5BOVA 1Z0KA 1GM5A 3T0IA 1NSTA 3KAQA 5BWMA 1VBMA 2X3UA 4KPUA 4Q3EA 5I3CA 3PEWA 4QBHA 1D4FA 4KG7A 2MU1A 1H9BA 2VT2A 2QPAA 1XVIA 1CKEA 1Z7YA 4OV6B 1B6SA 1SVMA 1RQXA 4E1AA 2R1VB 3I92A 3VV3A 4YGYA 3TW8B 1T9AA 5J63A 3QUCA 1Y81A 4E5NA 3RSHA 2QTBA 3FDXA 2PU5A 1RWOA 3E9EA 3TZEA 3WLIA 1A97A 2EEPA 1PQ4A 1M2FA 2IUFA 1GUAA 1O89A 2Y71A 4HXEB 4MCHA 3LUBA 1K97A 1RE0A 2KHZA 3QY9A 4XPZA 4RDXA 3FVRA 2EF0A 3RGGA 1QH0A 4NU0A 1KXJA 4JVLA 4KPEC 1VDMA 2QAIA 4Z7JA 1D2MA 5EE1A 1TK9A 4XQCA 1QQ5A 1G8PA 2H65A 5BVHA 4B44A 1HYQA 1XRRA 4Y1RA 2QIOA 2HV8A 3ZCQA 5CIWA 1XT6A 1QDLB 3FCUB 1MABB 2Y05A 5BSRA 5EJ8A 1JSRA 3KEQA 1O57A 1IBKB 1GTSA 1GNVA 3FPHA 3HPRA 3OIUA 4YROA 1P4RA 2VP6A 1KDYA 1UDRA 2RIRA 5CB4A 1B23P 5JLJA 5CXQA 5KJFA 4C7VA 4RDCA 3B5JA 3GZTB 4I4CA 5BSHA 5ALXA 3BL6A 5E7MA 4NAHA 3DS8A 1C1XB 4BNUA 5JXIA 3T5PA 5TE9A 2UVQA 4O02B 3C43A 2HK9A 3NJRA 1ZVJA 4KMOA 3IPRA 1H85A 1HY3A 1JYSA 2JHCA 4WJKB 1GFIA 1HSZA 1N5DA 3MEQA 4LQLA 1HE1C 3V8NA 5KYUA 3P4YA 1JFFB 5TS3A 2CW5A 1VSBA 5JVDB 3ILSA 5HKBA 2P7HA 1HV8A 4K03A 2NZVG 4D45A 1Q20A 5KTSA 3G5UA 4M8NE 4B73A 4E0BA 1BDJA 2XNDD 4UARA 3HQ4O 2VRNA 4EF6A 5ICMA 5IJZA 2PLWA 3QOYA 1Q15A 1OJ7A 2XUGA 4J0DA 3DVSX 3ZS9A 3SFZA 4CKEB 4IG9A 1BGVA 2ZE6A 2NADA 3C3EA 2PSJA 3ABZA 3V4VB 2HDNB 3ZE0B 1R1DA 1K9SA 2R1TA 3LZ6A 1GUBA 3EG9A 3NV9A 2VP0A 2UDPA 3GW8A 2UYHA 4KO4S 4HJRA 2J0EA 4EY3A 1YMQA 4FD3A 1M66A 3HR8A 1N0HA 4J0EA 3QW4B 2BFEB 1QIDA 3HB7A 3LNTA 4J03A 3ACBA 4I4TB 5G0VA 3SQWA 4BFTA 1MUUA 3QBVA 1R50A 5DNEA 3K8ZA 1VE6A 1LNSA 1J5PA 2CNOA 4S3MA 3WQHA 4LSGA 3E9CA 1JDSA 5GZ1A 1LVHA 4OAPA 1RXIA 3SXUB 1ML3A 5E2BA 5DYGA 3LUGA 1YCGA 4GIBA 3PHJA 5LKRA 1KS2A 3FWPA 1JVSA 4QD3A 1XTSA 1XRMA 2VJMB 1ZH0A 3O2JA 2VAXA 3E5HA 4U4AA 1AQYA 1KU6A 4PAQA 4Y6OA 8ATCA 3D59A 1R8SA 4B3DA 1ECPA 4NBUA 1BDHA 3AVOA 1C4WA 4F86A 3OA0A 4IL5A 1T1RA 3FVWA 1AXGA 5IAEA 1MVOA 3LCCA 4QEDA 2GF2A 1ZC4A 1J0CA 3V7FA 5JRJA 2AMVA 1PS8A 1RYFA 3HB1A 4L8VA 4HUJA 4TWJA 4X0EA 3TF5A 2EF1A 5BQPA 4ER0A 2K2WA 3FYUA 3A05A 5E1OA 1LF0A 1DMRA 2ZDHA 3PX3A 5DT2A 5JS6A 5AVRA 1DAPA 1FMCA 1JNYA 3IEPA 1ISSA 3AEZA 3CKLA 3KOXA 1RLIA 3LKZA 2A67A 3M6LA 4EY7A 3AQIA 3JWEA 4DDHA 2GHQA 4UMFA 1KI3A 3TIIA 2VDUE 4O8ZA 5JNWA 1ISFA 3NRJA 5KDLA 5BR8B 1O0CA 2GDZA 3KU4A 3N76A 2YY6A 1T9GS 4AQ7A 2VLBA 4DV6B 4N3NA 4DV5B 5EFZA 2QRJA 1BU5A 5JQWA 3K6SB 1JSZA 2F4NA 2GAFA 3WYGA 1Z38A 5D8DA 1K75A 1A76A 2XUHA 5AVOA 3SQNA 1RP7A 1XZFA 2P6MA 3IVCA 4FGZA 5BV7A 4AXBA 3WLNA 2C5LA 1HYBA 4D4JA 5HILA 3ANYB 4BGVA 3UB4A 1HO3A 2BN4A 3AQ4A 3AJ8A 3IAHA 2PM8A 2R5FA 3OQIA 4LOLA 4P83A 1UPTA 1V11B 4YJDA 1ONOA 4H1TA 1GGMA 4QELA 4K6FA 2H63A 1IHYA 2G04A 3EX7C 3HGTA 1HDYA 5K4GA 3ZU2A 3AONB 2PUAA 1TPZA 2C4VA 4WNYA 1H42A 2QQFA 1VIVA 1SAYA 3AVPA 1G59A 3NIFB 1L4NA 2ZROA 4Q3CA 4ZZIA 5T4EA 5DBFA 5HQTA 4HDMB 5CNKA 1C8LA 1GKKA 5AK0A 5AFSA 3NEAA 1XLWA 3ZZTA 5BQ3A 1KKMA 2RB4A 3U5TA 2QTMA 4B46A 1D6MA 3P0HA 3TPFA 3LT1A 1F60A 4C3VA 1VP9A 3FKJA 2DUNA 3MCUA 1C7QA 4D8UA 2IQ5A 1YB4A 1NVWQ 1JKJB 1BWPA 3D3EA 4ZOEA 4Q00A 3Q9UA 4CKWB 5IKEA 2C9CA 2DHQA 4L2IB 3HJGA 4JITA 1TJNA 1UZAA 5FTJA 2W8BA 3V42A 1CF9A 1YQ9A 3LQFA 1KGDA 4BL5A 2ZZMA 4KDRA 4YRGA 4S1WA 4XR4A 2H1WA 4DA8A 4DHEA 3K53A 5ALFA 5AESA 4LF5B 2DZDA 2HAEA 2PZGA 4ND5A 5AJUA 3NUGA 1RJGA 4IAOA 5E7QA 5H16A 5K3DA 2JD2A 3U1BA 3MOIA 4IOLA 5CVDA 3D1LA 1II8B 1E62A 2JFPA 1B42A 2OSVA 2EKQA 1MJHA 1JEAA 2O1WA 3UUFA 2ZTUA 4UCQA 2Y0PA 5AOAA 5ITZB 1WY5A 5LBIA 3G5TA 3VYTB 4E2FA 1SCDA 1AK1A 3JQ7A 3M6AA 3I53A 3AHIA 4IDEA 4EHDA 5JO9A 3NTXA 5EN4A 3K5PA 3PVSA 3NDBB 1R7RA 1FVHA 3FHOA 3U3RA 1AF4A 2J4CA 3DAOA 4AKTA 3H65A 3AW8A 5AM1A 1JQAA 3KELA 1EB9A 2Q62A 3U4IA 5KNBD 3VA7A 2GEUA 3LXRA 4TT3D 3Q1KA 3EGOA 5JD6A 3BRWD 5LNK1 2CXSA 3VBEA 3UT0A 2VUSA 3KPVA 5LB2A 2FZCA 3N86A 2OCPA 1WUHS 1YJAA 3MS2A 3O91A 4N6NA 4XR9A 4BQSA 2XNCA 1DIOB 1CEXA 2PMWB 4M98A 3PEUA 4QXOA 4KXQA 2XQGA 1KYZA 4P4SA 3B1YA 4EYQA 1A27A 2YQ4A 1C30A 1GCUA 2B3DA 3IIJA 5C5EA 1DIHA 1JSLA 4IFTA 1AZWA 5FUVA 5HE9A 4AI6A 3DKVA 2A7QA 2XMZA 3LJKA 3KWJA 2RONA 3CGWA 3HFRA 3BZWA 4QOFA 1UM9B 1NVUQ 1VYTA 1P7VA 1WOMA 3JQ9A 3OQ1A 2FF5A 1GNPA 2M6LA 1Q21A 2OMEA 1XYGA 3KP1A 1QOZA 3HA2A 5D5QA 2RGRA 2RGAA 1E69A 3NXSA 1N2CB 3STYA 4EI7A 3UJ3X 4X97A 4L1KA 5IAKA 2L17A 1PQYA 3IA7A 1T0JB 1Y7HA 4BMVA 4JP2A 2LV8A 3TVDA 1NHWA 1M75A 3D4LA 2A4MA 5AP9A 1NV9A 4YT4A 5AVVA 5KSYA 3DFKA 2OXCA 3GFOA 3LK7A 3FHJA 1KKLA 2QVBA 4RSGA 3MT8A 4PYMA 4AJ1A 1XTTA 2YDYA 3WKDA 5E3HA 2G6TA 2YRFA 4S1TA 3SI7A 2NZXA 2QRVB 4DYVA 2HLHA 2UZAA 4H16A 4BC0A 2JANA 2YWFA 1D2CA 3K9WA 1XN1A 4KVAA 3T4EA 3A3PA 1W7AA 1U2RA 2XB8A 5BYAA 2Y0CA 5LZ9A 2PFGA 3QVMA 2WYHA 5DM4A 5C5CA 1OT3A 3NANA 4LVCA 4N8EA 4WZBE 5B1IA 3PXGA 4JR1A 3TD9A 4XYGA 4I5FA 1O58A 1DVRA 4QYSA 1Q17A 5LXTA 1G7RA 2DT5A 2P4SA 4KRGA 1XHLA 3GLVA 1KPGA 2HIHA 5DDIP 5J9FA 3BE5A 4LZZA 4OQLA 5DW0A 2ZSUA 4EPTA 4YQFA 4O4HF 5BP7A 2V3CC 5FOUA 4P4LA 3U7RA 4FSXA 1CV2A 1TM4E 1P0MA 3F98A 5PGMA 1IPEA 4D74A 1Z26A 5EE0A 2C9DA 4O2LA 2BR5A 1NURA 2XNHA 5BUZA 3DKIA 4XLZA 1CUJA 3AESA 4R7ZA 3ISJA 3F5FA 1QPGA 4K9KA 3OZUA 1IL0A 2I7TA 3F8WA 2D5LA 3RJMA 5JUWA 1EWQA 4KXXA 2FE4A 1AHIA 2IEBA 3N2EA 4OKIA 4CKBB 1SBNE 3ME5A 3ONEA 1AJEA 3Q7PA 5DCYA 1MTZA 3PJDA 2BR4A 4LV6A 2WYWA 3AL2A 3B9QA 4N49A 4YMIA 3AM5A 3S8MA 1GA1A 3LDGA 4JLPA 3EXFB 1C3VA 3RC9A 3U4QB 2GLXA 1JG2A 5J58A 5BUCA 1IM5A 4LC0A 1NVFA 4J3JA 3KQKA 4S05A 2C2MA 1Z63A 5COBA 3L84A 5AJVB 1F14A 1OX6A 3NHYA 2DPYA 3OQHA 4U2FA 3SSMA 2I80A 2WU3A 1F3OA 2BM8A 1CU1A 4Q18A 4ZAZA 1URPA 1ZICA 3KXPA 3MSCA 3OKPA 1SOAA 4ZO8A 1OASA 1A82A 1JEJA 2VSNA 3LC0A 1RM4A 5BT9A 1E5QA 1WBBA 1RXCA 1FDVA 2FMHA 4BBPA 3R0QA 2IPAB 1SXJA 5HIKA 1ST2A 3KYIB 3P0RA 2X8WA 3OMXA 1KFBB 3EEFA 1YGPA 1G3IA 2WKQA 3KEOA 1KOGA 1JFVA 2JFQA 3U3MA 2F62A 4RNDB 2H2GA 1UL1X 2WWHA 4O4HB 4UM5A 1KH3A 2PIAA 3H7AA 4HYYA 3IEUA 1NL3A 4MVWA 3GLHE 3O4JA 4DCTA 1Z5OA 2CKMA 4NG5A 1ORTA 1USIA 1CIPA 3DFUA 1ZIXA 1BZYA 1SXGA 1AKMA 2ZDGA 4LC9A 2FK7A 1UM8A 1GD1O 2G06A 3GEDA 1CDZA 5CXXA 3TX6A 3KWFA 4BTVA 1DMSA 2X9VA 1GADO 1SR8A 4J4BA 1VHJA 5A4JA 3ZD6A 1L7VC 2BY4A 2FW6A 1XI2A 1ZGAA 2QXTA 3CZPA 3K9QO 1RHJA 1H2AS 2YWBA 1WZCA 3KKOA 2FR1A 3MCTA 4TKMA 5C4GB 1BFKA 4KO8A 1YDHA 2W70A 1QFYA 3C0KA 2JD0A 2Q5LA 1AXRA 3MCZA 2QP9X 3H1TA 4B6EA 2C2HA 3NALA 4RPCA 1ZDMA 2X8AA 5IMBA 2WNHA 4LY3A 1PW5A 3DAHA 3FOCA 3QU5A 3ZXIA 5BORA 1J07A 1GPAA 5BQOA 2YVQA 4EH1A 3T3GA 4M7RA 3CNQS 2J3HA 1O0BA 3W8RA 1T8WA 2FSGA 1Z8FA 1NNSA 3P52A 2RI0A 3TVTA 3WLSA 1NOJA 4ZCPA 3JZIA 4IIJF 3UK6A 2H1SA 4LVOA 3QFHA 5EWLB 5D85A 4KMMA 1V8PA 4KWTA 5IZCC 3O4HA 1AF7A 3PB3A 1EK2A 1BFDA 1PQUA 5DP1A 3QVKA 2PJDA 4PZAA 3TOVA 1COWA 3A6EA 4HLCA 1K63A 2C5HA 4FEAA 3X3HA 4TGLA 3CE9A 4KBFA 1BQ4A 4NJMA 3SC4A 5JISA 1L0BA 2OR3A 1NLMA 2QGZA 4MARA 3F5MA 1MH9A 1KDVA 3H8JA 3ZY3A 4ND3A 3WKEA 4R1UA 3T38A 2LCIA 4BQNA 2E4WA 1K27A 3MMZA 4E2XA 2JCYA 3VH3A 2XX3A 3CC8A 5LNK6 2FMTA 2ODBA 4HDSA 4OF4A 5EMJA 1KFKB 3NPMA 2FX3A 2IT1A 3OUTA 3NGLA 3FF1A 3NGXA 1PR3A 3TQQA 4CTMA 5HJEA 2ORIA 2IK8A 2J67A 3H04A 4EYEA 2R751 3TXAA 3NHMA 4FUTA 4K26A 4Y1GA 3RSLA 5LSAA 1QHIA 1XZCA 3BCHA 3HKDA 4CPDA 5TXGA 2IOYA 3FWKA 4MV4A 1Z47A 3PGVA 3QE2A 1DRJA 4AF7A 2FLKA 3VU0A 1LQ2A 4TQ9A 2W6JD 1D2NA 3UHOA 2XDWA 1T8SA 2HQ1A 2CHFA 2WU1A 4MTCA 3B38A 3IV7A 2P9HA 4U39A 3W7VA 2PCJA 2I9PA 4M53A 1SCIA 3A25A 1HG1A 1YBMA 2ZBRA 3IKLA 3KVOA 2IGTA 4QNMA 3RVNA 2QZ4A 2AOUB 3HJTA 3LWBA 3VH1A 2OV8A 3FNIA 2P9CA 4DPMA 3BS4A 3EXHC 1CC1S 4S24A 1Q3HA 1OLXA 4EX7A 4PNEA 2BFAA 4A1OA 1E9DA 1PW7A 2QTVA 3B6EA 1WS6A 2ZETA 3HUDA 3K70B 5E95A 2BHNA 4GRIA 4OX9B 4IIJB 2XKJE 5JPIA 1S9HA 3L04A 1KPIA 1QCYA 4B74A 5DASA 4RKQA 4UBIA 2PS9A 2W0MA 1NGSA 3M4XA 4YRFA 4UJ5A 1NNI1 2QSZA 1TK2A 1VPEA 3R3VA 5IH3A 2RI1A 3VC3A 4BLQA 1JDNA 3VZRA 4O4IA 4QJ3A 3ER8A 2P11A 3PDIA 2OV1A 3FFXA 5AKHA 3WLEA 1KSGA 3UYKA 4GC5A 3H3XA 2IXAA 3HKBA 4TOIA 5JJLA 1AUVA 2MOKA 3GRYA 5KYNA 4JQCA 2OFPA 3H9CA 4GGPA 2BJWA 2PNFA 1XDBA 5DH9A 3EVTA 4HI0E 3HHPA 3UN1A 3VV2A 4B7CA 1Y6GA 1GDTA 4DXAA 3BFXA 2ERYA 2Z9BA 3OKAA 4CDMA 1FBNA 1OJLA 1IFXA 3FBTA 3MUNA 2GQ0A 1TCUA 4MWEA 2OBYA 5WRFA 3TXYA 3VXKA 1JE1A 3BXPA 1NYQA 3K2IA 1W0KD 2WG1A 3EC1A 1G21E 3F7OA 1GGJA 1PVVA 3ZI0A 4P0QB 5LBTA 3VKFA 1YJ8A 2AEEA 4JLDA 2ZQZA 3QV1A 4HWKA 3B3FA 2CJWA 2PL9A 2PLRA 3GRVA 3AIOA 4IKOA 3HGQA 5FJIA 3ODPA 1R15A 3ZDDA 1OIWA 3DBHB 1FYEA 1SB9A 2A1TS 3L8YA 4IJUA 4IOKA 2BDTA 1W5SA 2YWXA 2Q9BA 4DLKA 5LP6F 1FPMA 4R1LA 1VYVA 1XZMA 3MJDA 4Q7KA 3UOAB 4R6XA 3SBEA 3VNVA 3QQPA 4DIMA 1SK9A 1Y9ZA 3HBMA 3CJRA 2KI5A 1H2XA 3LUKA 4RQAA 2NUTA 2QUZA 3O9MA 3MWYW 3UF0A 3ZGOA 2NV2B 3S8YA 3HYLA 4GLFA 5CFPA 2O8EB 4U2EA 4LE1A 2ZZNA 1O8BA 4BFWA 3FKSD 4Z7OB 1YAHA 3HDTA 4AY6A 2ECQA 4EJ6A 5HCIA 5DIFA 3GRUA 2HMSA 2FLVA 4ZI2A 2CLEB 1T3HA 2QVYX 4HXYA 1N33B 4D25A 2JJ2D 3CF4G 3SDZA 4DAEA 2FNAA 4R2WA 5T64A 4QREA 1C14A 1OILA 3L8MA 4UU0A 3V4PB 1TPYA 2NZUG 2QYOA 3DEIA 1ZUNA 1PT9A 2QZ9A 3OI7A 4HGPA 5HCUA 5KWVA 4K6GA 3PL5A 1ZCFA 1UKVY 2BSQA 1TUIA 4CEHB 2V7XA 4FCVA 1OWPA 4TUYF 1BWSA 3SC2A 5TX7A 3C87A 1ZN2A 3T5DA 1N3YA 1M1UA 1A4RA 5JEEA 2KJQA 2FB9A 3DBIA 5C3UA 4Q3DA 4OM8A 3WLQA 2IELA 2DFNA 3AUKA 3PF9A 3PKZA 5ANRB 5EHZA 4ARIA 3ZDYB 2Y0EA 2GZDA 1GL9B 1LI7A 5KS2A 3EDRA 5EPUA 5FTNA 1L4BA 1XTZA 1XO1A 3B6KA 4X6LA 1GLGA 1J6UA 3L6UA 1TYCA 3RVJA 3UK2A 1SBYA 2W2KB 4IPTA 3R8FA 3RBZA 2NM0A 2QL9A 4HH3C 1NIPA 1PJ4A 4HDRB 3HG7A 1U8FO 3SZOA 3EVBA 2JFUA 2QX4A 4HEA6 1P2SA 4QFCA 4G0PA 1ZNQO 1EBFA 1SBZA 2BHSA 4NZPA 3LGXA 3T7KA 3ZOZA 5JCJD 2QOEA 4PAWA 4UTVA 3GLGE 1E61A 2J59A 1BS1A 1TU0A 1XX6A 2HRZA 1E4EA 4KQXA 4HNUA 3OWXA 4P84A 2N9UA 1C4XA 2PA3A 3PWTA 5ALZA 2HRCA 3DZ8A 4Z3DA 6NULA 3NLLA 4MW5A 2AN4A 5TQ2B 3QUBA 5IJ9A 2VPZA 4PF1A 2K5UA 3GZNA 3N7TA 4QQ8A 3OLWA 5LOVB 4OQXA 1WDKA 1JFSA 1VPLA 4RVDA 2PGLA 2ZIEA 3RG8A 1NQ5A 2G70A 3LNCA 2ZREA 4ARVA 2IV2X 1OMOA 2VK1A 1A95A 2OZEA 3TTVA 3QMPA 4H7DA 4MPTA 4UMVA 3THWB 2WJHA 4G01B 2AFIA 4DPKA 2CVPA 4OI4A 1AGNA 1SWWA 5BSWA 1CUBA 1M2GA 1G8HA 4PPNA 3RQSA 2QJTA 5B1SA 2BBTA 3CSSA 4EO4A 1GNQA 4ZJZA 3QJGA 2FSVC 1RRCA 5IHPA 2H6EA 3S1AB 3HTXA 4PLZA 1XMOB 3DTVB 1S89A 1RMYA 1JIJA 2HUPA 2AKYA 1APBA 4JLWA 4ZKDA 3DL4A 3EMVA 1Q2XA 1ATZA 3C6YA 4WFIA 4XVUA 4YT8A 4QPDA 1CHDA 1QC5B 3EIXA 2VPWA 1UBSB 2EW8A 3SHOA 3OCCA 3JPWA 4WOPA 3ZY4A 2ZJZA 2UZ4A 4N01A 5CJPA 2OFWA 2DERA 3T3NA 1OU0A 3AL0C 2XXJA 2YYZA 1EXMA 2D2VA 1C3OA 2QMQA 3K4QA 2OD9A 2JGMA 3RC7A 1Y3HA 3NH6A 1SC3A 3L7CA 1XDSA 1Z6GA 1QGAA 3VYUB 2W4QA 4EAAA 1CS0B 4FHFA 3BH6A 1NFRA 5G4LA 1X92A 2Y0DA 4XM0A 2L69A 4EG5A 1JBEA 2FGKA 4BN4A 1QH1B 2QDXA 1G8GA 3I2KA 1XF9A 1Y8QA 2F43A 1U8YA 5FPQA 1VJRA 3LO8A 1ONPA 1ABBA 3DOUA 1C81A 3FCYA 3K0CA 1KSJA 4X41A 3GUZA 4XLTA 5H59A 1MW8X 2OXFA 3EK2A 1FE8A 3BX1A 4G26A 4YC7A 3NOXA 2HKIA 4WRRA 3IQGX 5L45A 1SVLA 1SUIA 3CKMA 4UFNA 3HXPA 1PLKA 3BWVA 3VTZA 4QM6A 2L2QA