1ESNA

Structural basis for the feedback regulation of escherichia coli pantothenate kinase by coenzyme a
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
311
structure length
311
Chain Sequence
QTLMTPYLQFDRNQWAALRDSVPMTLSEDEIARLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEDLLQTWYINRFLKFREGAFTDPDSYFHNYAKLTKEEAIKTAMTLWKEINWLNLKQNILPTRERASLILTKSANHAVEEVRLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PANTOTHENATE KINASE
publication title Structural basis for the feedback regulation of Escherichia coli pantothenate kinase by coenzyme A.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 101
structure length 311
sequence length 311
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2000-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1esnA00
2Q0HA 1OKKA 4DDUA 2YWHA 2OFWA 5EUMA 2BBWA 4GP6A 2ZSDA 4TN1A 3VR2A 1GTVA 3DO6A 5C18A 3IPYA 2UVQA 1CP2A 3QIAA 5JMTA 4TSFA 4NYJR 2RGBA 4GPTA 5KO2A 4TL9A 1E9FA 1SVOA 4M21A 2H17A 4TTRA 3WMEA 3E70C 1GDDA 4HYYA 5HTKA 4EJSC 3PUYA 1ODFA 4M1TA 1XMSA 3QPVA 1E0AA 4Y0AA 4HAXA 3AGPA 4L15A 1DS6A 4B3FX 1XTSA 1OE0A 1P2VA 4FMCB 4MGZR 2OFXA 3K1JA 5AUQA 1XFAA 3VR5A 4EAQA 4CRWB 5KDOA 2D4HA 1PUIA 3KUCA 4OYHA 4C0AC 3RS7A 5G41A 5G3ZA 4DIDA 1AKYA 3CX8A 2ZAOA 1AQUA 2EW1A 3PJRA 1PUJA 3OEHA 2JCSA 1NBMD 1KGDA 2QY9A 2XAUA 4E03A 2JLYA 4A4DA 2BJVA 1RYHA 2V55B 2W00A 1XZQA 2AWNA 2NO9A 1NLZA 1VG8A 3Q8XB 4YDHB 4P3YA 1W0JD 3EASA 4G5OA 1XJCA 2HLDA 1P9RA 3GD7A 4KO8A 4BLTA 4AKGA 1YZGA 2W2TA 3TH5A 4TMZA 5TVKA 1COWD 2WWGA 1ZC4A 4CEIA 1XMJA 2BBTA 3F0TA 4NPHA 4QC2A 4QL3A 3EPHA 3S1AA 4FIDA 1IXZA 3CKLA 1NVWQ 1QG4A 3SYLA 2X19A 1E69A 2XB4A 3QKSA 1GP2A 1EG7A 2DFLA 4LPSA 5EXPA 4PZLA 4P4UA 4HB0A 4PC3A 2AHOA 3MAAC 2OAQ1 4BLOA 1CIPA 2FFQA 3C5HA 2ODNA 2Q9AA 4AI6A 1E2KA 3AP1A 4Q1AA 1FQKA 3TW4A 3PR1A 3B6EA 3SE0A 4TLAA 4KBFA 1XXHE 1OJLA 4QG7A 1XPRA 2XX3A 3K70B 2WKRA 2BKEA 2GJAA 2ZR7A 5DISB 4EPRA 3THOA 2D2FA 3FMIA 3NXSA 4OKSA 1W7AA 2ZEJA 2XOKD 4UXIA 1SKYE 3PG5A 2DWPA 4M0LA 3T5GA 4DIEA 3AH8A 4WVFA 5G53C 5AK0A 5BQ5A 3WXMA 2CE7A 1XMIA 4IVPA 1Q1QA 5EXTA 4GSYA 3DMNA 4JLKA 3FVQA 4QHYA 4WA7A 4D4KA 3AVTA 2IS1A 2W0MA 4RZXA 3CONA 5GJBA 4D4LA 1S96A 3VX3A 2GEDA 4FCTA 5F2EA 2FEOA 1IBRA 1E2DA 2F9MA 4FCWA 1ONBA 2IL1A 4PFSA 4ON9A 1T6NA 2ODBA 5L8VA 2VA8A 1Z28A 4I1VA 4LYJA 1KAOA 3WP1B 2F7SA 1T0HB 5JEEA 3JVUA 4CEHB 2QP9X 2ZJYA 4NYIQ 2OZEA 1XJ0A 3THWB 5H8WA 5FOVA 5C2JB 5FUWA 4F91B 4F38A 3NBZC 4GL2A 4XSGA 1NJFA 1Z47A 4QOSA 1W49A 2ZTSA 4JT2A 1VKJA 5KNCA 3H86A 5DGXA 1D9XA 1CXZA 4NMMA 1YR8A 3KUDA 3PEUA 4Q00A 1NN3A 2JLUA 1KMHB 1SQ5A 3V4RA 5F9HA 2GCOB 2QQ0A 4KODA 4E07A 4EQ6B 4G5GA 5M04A 2ZRHA 2O8EA 3BERA 1KI2A 4A0HA 2FU5C 2QAGB 4HAUA 1GWNA 1V43A 4PX9A 4PO1A 4ZKEA 4C7OB 2YWEA 3I32A 1E99A 3RS4A 3SBDA 1KHTA 4P4SB 2RH5A 1J90A 5SZHB 1LS1A 3FPAA 3C15C 3PUWA 1DTSA 4DHEA 1KI8A 1M7GA 2JLZA 1NBMA 3ZLJA 1Q20A 2IYWA 4S2EA 1G7SA 4GDFA 1GIAA 4EJSB 3AB3A 2P65A 3DOEA 5EE5B 1DPFA 1W0JA 2G83A 3K8YA 3Q7QA 2CK3D 4GZLA 1US8B 1VCOA 5BN3A 3AF3A 3D6TB 1COWA 1YE8A 1ZD1A 1MABB 2IF2A 3B9PA 3CO5A 1JJVA 4QKQA 5B64A 4C0BA 3LFUA 1W36D 2OEPA 4TTPA 2ZJOA 4DLVA 4M4SA 4B2IA 2MMGA 4LJ4A 1LS6A 1ZRHA 3NH9A 2RHMA 2WJVA 4LYAA 4AYXA 1JI0A 1EWRA 3IILA 4A6PA 3P32A 1VDZA 4B44A 2QM8A 4XSHA 4JLPA 4D4MA 4G5QA 2EQBA 1FNMA 2KI5A 4GI7A 3KTAB 3X2SA 1YU9A 2VSXA 4HUQB 4Q47A 5TXGA 2RGXA 4EFLA 4CT4B 4L16A 3DVLA 4OHVA 5J4HA 1XXHA 2QZ4A 4E22A 1NVVR 2VP9A 1OT3A 4CEJA 1BO6A 1RIFA 1UBGA 1E96A 1E9DA 1XJQA 2C2HA 4RFSB 3DEFA 2JJ2D 1MRSA 3BBPA 1KAGA 1T0JB 3TW8B 4JVLA 5A4JA 1UFQA 3MWLA 1H8ED 4XJXA 4B47A 2ZRPA 2F1RA 1Q1BA 1VMAA 4JL6A 4ARZB 2XTMA 1OH5A 5AJYA 3AUXA 5DYIA 2GBLA 2DYKA 2EFCB 1NMZA 4KV9A 4NZYA 3VMFA 5LD2B 2IX3A 3GPLA 3GEHA 4LV6A 2G0NA 1IY2A 3BH0A 2NZJA 2SHKA 5UKDA 4IDHA 2C5LA 3H1TA 5JZVA 1Q0UA 1YZNA 2ZJ8A 3A4MA 2H16A 4Q1BA 1D6JA 3AP3A 4A36A 1N5JA 4LJ9A 3IO3A 3ICEA 4ZDWA 2P5TB 5DIFA 2UZ3A 4JZKA 1I4DD 4AD8A 4ZI3A 3ADBA 2GZAA 4O2RA 2O0JA 2FOLA 2GJSA 3ZVNA 2XNSA 3EA5A 4RY2A 1W47A 4ZV4A 3FDIA 2IHBA 1Y63A 2QMUA 5TARA 2HT1A 4TMWA 3U61B 3EIEA 5P21A 3R7WA 4ACBA 3DHWC 1KDPA 1M34E 3QXHA 1A82A 1QDEA 2Q9BA 5CB8A 2PLRA 5JECA 3NEYA 2AK2A 2HCJB 2FH5B 1E94E 1R0XA 1W2GA 2CEAA 3SYKA 2YINC 1OFTA 2OCPA 4OHWA 5JWHA 5C4MA 3DDCA 1Q21A 3J81k 4B2LA 4LUCA 2ANBA 4W5JA 4BFUA 5D3MA 1E9EA 2Z43A 4R71A 4ITRC 2OFOA 3ZS9A 1KJWA 2XB2A 1RFLA 2V7QD 5LB4A 1U2RA 3K0AA 1L4UA 2DFKB 2KE5A 4AY2A 1ZUNB 1GZSA 2CMKA 4G5RA 1NMXA 1AN0A 1XEXB 1MV5A 3DKPA 1P61B 2HF9A 3NBXX 4Z8YA 2IYRA 2CK3A 2DWQA 3SN6A 2HJVA 1MH1A 4NH0A 5IRCD 3FHOA 3HPRA 5IK2D 3GJ4A 1S9HA 4JVSB 2QPTA 2BV3A 4JL5A 4YONB 4D0NA 1E2JA 5GJCA 3AVWA 4YMSA 1KMHA 1E2QA 1OYWA 1GOTA 4IOKA 4IOJA 3T5DA 3NH6A 1FX0A 1LY1A 2G6BA 4JLAA 2QAGA 1QHHA 4DCTA 5BWMA 3C41J 2KB0A 1G16A 1R6BX 5K8IA 4TYYA 4C7OA 3AKDA 1SVSA 2QA5A 3PENA 4P4SA 1YZLA 1YJ5A 4OI4A 3DM9B 3A4LA 2J0SA 2VP4A 3CX7A 1P72A 1NIJA 4UJ5A 4B6FA 5B30A 1DARA 2LKCA 2IW3A 1UDWA 5BYJA 4Q9LA 3QG5A 3MWKA 4N1AA 3QSYA 1F2TA 3BE4A 3B2EA 2Y8EA 3GLHE 2HF8A 4GT1A 4P32A 2JJ2A 3KKMA 3P20A 1SXJD 1US8A 5FI1B 2IUUA 1K8RA 4GOJA 4LK2A 5CITA 1H8EA 2CHVA 2A30A 2JGNA 3IEVA 2IYUA 2OV2A 2FZ4A 5FPTA 2HUPA 4LV8B 2A3RA 4CVNA 2WZQA 4KU4A 1EWQA 4PR0A 1CBUA 4PC6A 3T1TA 3THYB 3Q72A 4LCBA 1KI9A 4XOIA 2ODWA 2J5XA 1D2NA 3CUEF 3ASZA 4PTLA 1TX4B 3EXAA 2RCNA 4BWYA 1TF5A 3FFAA 1KO8A 1E2EA 4TYPA 4RCYA 4TMXA 1E9AA 3JZMA 4M1KA 1RRFA 3RDPA 4M9XA 2FGJA 4TL8A 3GJ8A 2O8CA 2ZSBA 3SU8A 1OXTA 421PA 2MSCB 5E95A 1QHXA 1OXUA 1QHIA 1AGPA 1SVMA 4RFSA 1NVXQ 1A2KC 2RGNA 4I4LA 1A5TA 3UK6A 1OB5A 2NOAA 3QQ5A 1JXOA 3AV0B 4IVRA 3LX5A 3UWOA 4L9SA 1ZNYA 3L0IB 4DCVA 3LVQE 3EZ9A 5TDHA 3EZ7A 1ZM2A 5B57C 1HEIA 5JRZA 2JA1A 3U7EB 4NYIR 1A7JA 4C0QC 2F3RA 4LHXA 1G3UA 1A4RA 3QUSA 2O8FA 2K5UA 2PBRA 4NE2A 2CVFA 1CS4C 2ZS8A 3MJHA 2PZEA 4X8OA 1OF1A 4MDEA 1C4OA 1ZM9A 3WRXC 4URYR 3FKSA 1AS2A 2V7QA 2Z6VA 4MRRA 1E2FA 2EYUA 3BD9A 2FJUA 4HDOB 4MYCA 1T5IA 3T06B 3CZQA 4DCUA 2O8BB 3L0PA 4WZAE 2PJZA 1D8TA 4HI0E 5EP2A 1RZ3A 3MRSA 1EX7A 1XD2B 3KJIA 4WW0A 3WNCA 4BZPA 1DAGA 2HCBA 4B2PA 4NHOA 2P0EA 1Q57A 3UMSA 4MUAA 3NBYC 2RHDA 2QMHA 5IK2A 4Q4HB 2FGKA 5DLQC 1G8HA 2JLQA 2QRZA 1TADA 1J70A 1X6VA 2R8RA 621PA 3RYTC 2P6RA 3H0KA 2FV8A 2MSDB 3A4NA 3HU1A 4ZCLA 2R65A 1G3MA 4B32A 2NZ8A 1NSFA 5AUOB 3TQCA 1P7CA 1P2TA 2FMXA 4IW3B 1Q12A 3VKGA 3KKPA 2FX3A 3TR0A 2NQ2C 1BH2A 5FR2A 4HB2A 3PEVA 3PITA 4EKDA 1KI1A 4JKIA 1N3BA 4JBXA 4LWZA 3AVQA 2OXCA 4TL7A 4X8HA 3THXA 2DFTA 2GF0A 1KNXA 4Q4LA 5C46F 4L4UA 2ZPTX 3ND9A 1MOZA 4XD7D 2GAOA 2DFNA 3CRMA 3NG1A 1XEXA 1CRPA 3AVXA 3QKRA 2EWVA 3U7HB 1E4VA 2BM1A 3WYFA 3SBEA 2ZUDA 1BS1A 1SXJA 1M7HA 4PQYA 2FN4A 1G6HA 1KKMA 3QF4B 3K9NA 3VFDA 2XZOA 1R8QA 1U94A 3KB2A 1TQDA 1AGRA 2RGAA 3FWYA 4M9QA 3W90A 1NKSA 4HZUB 4HUTA 4FI3C 1AA9A 1G6OA 5CIWA 1S4QA 1KDOA 1M6NA 2HYDA 4RCZA 4PPQA 3H84A 3X1XA 2X2FA 4GMDA 4B74A 3Q85A 3VU9A 3T34A 1KMQA 1TQ2A 2ZRMA 4RFVA 5CB6A 3G0HA 4UNQA 1EK0A 1R8SA 1TMKA 3JZAA 5SZKB 4JSTA 2ZU0C 3I73A 1OFHA 1TF2A 2WIAA 2AXPA 3CIOA 4G5SA 4GZMA 1KKLA 2GTPA 4W9MC 1GL7A 3QXJA 1G1MA 2FEMA 1KI7A 2AFIE 3I61A 3T35A 1V5WA 2F1HA 3CF0A 4C2TA 4RD0A 3VQTA 4US0R 2G9NA 3SQXA 4B6EA 3RHFA 1OV4A 4JBYA 3QPUA 4RSGA 3N70A 4AKHA 3K0EA 4Q01A 5J4LA 2OT3B 1YZUA 4OJKA 5FTMA 5JS7A 2FFAA 1FMLA 1GUAA 3TR5A 3U3KA 1NY6A 1T8UA 1XTKA 3DMDA 4OK3A 2VP0A 1R10A 1F48A 1Z0DA 4CEIB 1JPNA 1ZP6A 2JJ8A 4LZZA 4TL6A 4Y0VA 3T12A 2ZROA 3W8RA 1XEWX 3U44A 2J3EA 2AWOA 5JBQA 4DVGA 3C7KA 3V4FA 2XSZD 3N2IA 1U99A 3QKSB 4TLCA 4A9AA 5BW8A 4D82A 4IRUB 1P9WA 3LA6A 3GJ0A 4PANA 1U9IA 4H1VA 1G5RA 2IYLD 3NTUA 2I1VB 2GBLC 2QP3A 4GP7A 4TYQA 4Q7KA 2CL7X 2RGDA 3AP2A 2Q3HA 4H9GA 4NBSA 3REFA 2A5JA 1ZUIA 1ESMA 4IOLA 1FTSA 1S8FA 2L0XA 3SDZA 2V6JA 1DG3A 2QRNA 2GA8A 2OBMA 1XP8A 1EFRD 2ECKA 4C0JA 4JVNA 4MKFA 2YC2C 1KK2A 2V54A 1W4RA 3O8CA 1E9BA 1OIXA 2BMDA 4FWIB 4PQRA 3I8XA 2YYZA 1NI3A 2WICA 3O47A 3K0CA 4IDOA 5EZ5A 4MA4A 1YR6A 2C99A 5FR1A 4M8NE 4DLXA 5CDFE 1M8PA 3MFYA 4XD7A 2WIBA 3VKHA 2CL0X 2CE2X 2O8BA 3WYAA 3IKJA 3R8CA 1M2OB 5DNYB 3SS8A 1OFUX 2ZJAA 1N5KA 5C4GB 1KZ7B 3BK7A 4QGAA 3MMPA 2JAQA 2DWOA 3CW2A 1JR6A 3TE6A 1PLLA 3I8SA 3AVPA 3GJXC 2N1BA 1R2QA 5KUTA 3EPLA 4JLNA 5BXQC 4ZDKA 4D4JA 3FFBA 3B1YA 5DN6D 2D62A 3QI2A 4TMVA 3ADDA 3H2YA 1OHHD 1GRQA 4R9UC 3KXKA 5FPYA 1QHNA 4BRUA 3KFVA 2JEOA 4JMPA 3UMFA 1ESNA 3UKDA 1XTQA 2CNWD 3KFXA 1DAFA 1MO5A 1TNDA 3R9XA 1KO5A 1T91A 1CULC 1Q22A 3P27A 2FNAA 4LV5B 3ZS8A 4B35A 3MJRA 3LV8A 4CGZA 1BYUA 2GESA 2J87A 2W6ID 4GRAA 4M1OA 5J5CA 4B33A 3PEYA 2OESA 2FPLA 2IC5A 3LVRE 3M4YA 4ERNA 3BIFA 4HSEA 3W3ZB 1W36C 2HV8A 2J0QA 3NBFA 4YQFA 4UKDA 1A1VA 2ZJZA 2OLJA 4AKIA 2CCKA 2IK8A 3FMFA 3RS0A 2BEJA 2FZLA 3BB4A 2P2LA 4OQNA 4I81A 4A92A 1P62B 3QF4A 2QAGC 3P4YA 4HB3A 3IPXA 2ZS9A 3CRQA 1UEIA 2ZRLA 2CVHA 3TUIC 2IUSA 4B73A 1TUIA 2R6CA 1UJ2A 4TLBA 4HZUA 1PV4A 1DAEA 3TUJC 4BGDA 4XWAA 1Z0KA 4KFTA 4FMCF 3TRFA 1W4CA 1ELOA 4GOKA 2DHRA 3O8DA 4B43A 3HYTA 3C4JA 1JB1A 3NHAA 2BKUA 2C8VA 4OK6A 3N2EA 3CBQA 5EXXA 1Z6AA 2WJJA 1NNEA 2A5FA 2WAXA 5G3YA 2XSZA 1NP6A 4N3NA 1JALA 1N6HA 5L3SB 1AIPA 2ZYTX 3W6OA 1E0JA 1K5GA 2IS6A 1OLOA 1R5BA 1L7VC 3Q5DA 1W5SA 1EXMA 121PA 5EUQB 3F5FA 1Z6GA 4XVUA 5HR5A 4I99A 4LJ6A 2OO7A 5HKKD 4U7DA 3ZZ0A 3HJNA 2YOGA 2WTUA 1XXHB 2CCGA 1EFUA 1JQLB 4CEJB 2WWIA 2KJQA 3IDQA 2RB4A 3RS2A 5GVRA 1RKBA 4MH0R 2DR3A 2OBNA 1SGWA 1UEJA 3WHLA 1W1WA 4ZKDA 4F4CA 2G3YA 5HE8A 5JWOA 1SKYB 2BHRA 3VR3A 1OYYA 1C1YA 1IXSB 2WJGA 3FMOB 4PSKA 5IT5A 3EZFA 3ZGXA 1ZCBA 1YHNA 3P4XA 4JS0A 2RGNC 3BWDD 1KNQA 1KZGB 1Z2AA 1XTRA 5FPSA 3IBGA 2I3BA 4YMWA 3RWMB 1XD9A 3H4MA 3RANA 4JLBA 2AK3A 3KXLA 2G77B 3BRWD 5J4VA 4HB4A 4A2QA 5CYOA 5LD2C 2ZU6A 3OIUA 4DWJA 3ZZTA 2HEIA 2QROA 2ZI9A 3KX2A 1Z0AA 2WAYA 1N6IA 1NL3A 3TSOA 4OBEA 3X1WA 4GFDA 3RS5A 4TLEA 1WXQA 1M7BA 4N0DA 5DN6A 5GVSA 3PEWA 2ZXUA 2PMKA 4BFTA 2JASA 1OHHA 2A7QA 5FBLB 2BEKA 2PCJA 2CNWA 4OHXA 2QGZA 2QL6A 3I62A 3GLGE 3QJYA 4LHYA 1ZBDA 2X2EA 3R7WB 5JRJA 3LWNA 1CR1A 3B5JA 1K6MA 4HDQB 1GVNB 2G1JA 2R6GA 4U5XA 1KSJA 3AF4A 5DI9A 4DUGD 3SJAA 1P9NA 2AX4A 2GJ9A 3AGQA 4NP6A 1BOFA 1FNNA 3E5HA 3EIQA 2QSZA 2FSIA 4QHSA 3UG7A 1J99A 4ESVA 4JYBA 1EGAA 1UKVY 3U3RA 4B76A 1XB2A 2WJIA 4L9WA 3EPKA 3IUYA 5D3MB 4QGFA 4Q1FA 5EZ6B 3W6PA 2ZJBA 1JQJC 4ABYA 1U0HC 2ZRNA 1ZCAA 3K0AB 4RKEA 3U7FB 4QNRA 1KI3A 1ZM3A 4OQMA 4XVRA 1F3OA 4LGMA 2R6AA 2Z83A 1GL9B 2EFGA 2WWYA 5TMPA 4EFMA 3U60B 2IWHA 2AD5A 3GMTA 2CHQA 3VTKA 2ZVPX 3D8BA 2XXAA 2H5EA 1BYIA 3QVUA 3ZVMA 3IQXA 1W36B 1VCNA 3R20A 4WOPA 1SXJC 5EJEA 4E09A 2WPDD 1MRNA 5DO9A 4A82A 1II0A 1ZM7A 2X77A 4MYUA 1FX0B 3MSXA 3KQNA 4B3GA 3B82A 1QHHB 1CJKC 2J7PD 2YWFA 2HJGA 2QI9C 3TVTA 2AKAB 3CRRA 3G5UA 4TQUS 5JWRA 5AUPB 1NIPA 4WBSA 5E7MA 4FWTA 4NCIA 1Z0FA 5TV2A 3NIBA 4QHTA 3A1TA 2AXNA 1WCV1 3CLVA 3OHMA 5KDLA 5HKKA 2B7BA 4NU0A 2D2EA 5J4KA 2CDNA 3AF1A 1TAGA 2D06A 1F2TB 3Q9LA 1NG1A 3CM0A 4RD2A 1J8MF 8OHMA 1WB9A 1R0WA 3AKYA 2VHCA 4BEBA 1OB2A 3ZIAD 1G5TA 2BWJA 2PLFA 1G20E 2H8KA 1B23P 5HZKA 4AC9A 1Z2CA 3WNBA 1KI6A 4MQBA 4PHTA 2BIFA 1FOEB 2XTNA 1NG9A 1PJRA 1DEKA 1DO0A 2BCJQ 5JHGB 5L3SA 2IHYA 3V00A 2IYSA 4DDTA 1XEFA 2EWWA 1G7CA 1P2UA 3PUXA 4RJLA 3O8RA 3K9GA 3U7GA 3SYNA 2ATXA 5K8UA 1E6CA 4M1WA 2W58A 2O8CB 3GP8A 1L2TA 2B7CA 4PHFA 1QHSA 1Z08A 5FTJA 2JLVA 1E3MA 1X8JA 1G21E 3KQUA 2R6FA 2XOKA 2GCPA 1VTKA 4FW9A 2ZITA 1U9IC 3GLGA 4HEJA 4NCHA 1HV8A 3K0FA 3HR7A 1J2JA 3MWYW 2IUTA 1F6BA 4Q7LA 1Z22A 2IYYA 3KZ1E 1H8HD 2IWRA 3GLFE 2O8FB 3C5CA 4FD2A 2IXGA 1Z6XA 2LWIA 2JLXA 4LC0A 3X1ZA 3RC3A 5JHHB 3HDTA 4JJZA 1YR7A 4PO8A 2C9YA 2PL3A 2PEZA 4FXPA 1Z06A 5IDVA 2RGEA 2REBA 3KDSE 1W5TA 1WMSA 1G18A 4LY6A 1ZM4A 1G4AE 5CM9C 1CLUA 2OCBA 3EW9A 4DEYA 1NN0A 3F3YA 3CH4B 3K0CC 4JT4A 3BH7A 2CHGA 2OM2A 3A1SA 3SFVA 4YDSA 1ZIOA 2V6IA 3DOFA 1H65A 4LC1A 2FG5A 2G88A 1CJMA 1QZXA 1G291 2EYQA 3SJZA 5KYKA 3KQKA 2RMKA 4YMVA 4PPFA 1PZNA 4TQAA 1G8GA 4IVQA 1UPTA 2TMKA 1XZPA 2WPDA 3A8TA 1XPOA 1IHUA 3LQRA 4IXNA 4URUR 2PCLA 3RRZA 3TSWA 1WP9A 3B1XA 3Q3JB 4M53A 3U4QA 2J7PA 4A15A 2ERXA 2QPAA 4ZO4A 2VP2A 4Q9KA 2VLIA 3LDAA 5LB2A 5FH9A 3TLXA 1W4AA 3EARA 1AM4D 1ZIPA 4UJ3A 3EPJA 3THXB 2C98A 3NWJA 4RKFA 1N0WA 4KBGA 1MT0A 4MYHA 5IHPA 1RE0A 1M74A 1R5OA 1CR2A 4HATA 1U8ZA 5J40A 3QKRB 4LDJA 2ZRKA 5BN4A 3GLHB 1SXJB 4QGGA 1ZUHA 2WSSD 3K53A 4U02A 3VR6A 2VH5R 3ZIAA 1E0SA 2E9SA 1VYVA 2AR7A 4NYMQ 5ELXA 3ECCA 4Q4AA 1TU3A 2OLKA 1JXMA 4QJ4A 4QBIA 1JR3E 5FBQB 4NKRA 1JR3D 2B21A 4O2LA 1G8FA 3CRW1 3AVYA 3UXMA 3X1YA 2JDID 3VU9B 3TAUA 3GFOA 1G7TA 1CJUC 1FP6A 1CR0A 3EA0A 1NVUQ 1T3SA 1DOAA 4BFSA 4V0LA 1KO1A 2JLRA 1W44A 2Q6TA 2MSEB 2ZQ5A 3B9QA 4Q02A 2E1RA 1F60A 4WIAA 4I1SA 2QEQA 4ASUD 2P67A 5JI2E 1TTTA 4PZYA 3CPEA 3QE0A 2NO7A 3WYGA 3QVVA 3LBNA 2XJ9A 1WF3A 2WSMA 4MKIA 2VHTA 3V9PA 4TT3D 1KDTA 5J4YA 3GEIA 3MCAA 1FP7A 1QBKC 1RW4A 3IGFA 1Z6TA 4KXFB 1LTQA 4BZQA 3WHKA 3QXXA 1H8HA 4A1FA 5AUNB 1P3JA 3B13B 3GLFA 1AZTA 2QMEA 4URZR 2B6HA 4D81A 3SEAA 5EE1A 5FTNA 1XTJA 2WWFA 2AN9A 4EPWA 2X8AA 3L82B 4JJKA 2ZSEA 4MRPA 2WKQA 4PC7A 4C0KA 1JJ7A 1SZPA 1TU4A 1Z07A 3IBYA 3ZZUA 3U44B 1RPZA 1D9ZA 3QOFA 2WKPA 1N6KA 1XNJA 3AKEA 4KLNA 1OH7A 3LH5A 5FPKA 3MWJA 4EDHA 1D2MA 1II9A 5CLLA 4E5UA 4HAWA 2J9RA 4YMUA 4X8LA 1DG1G 4CW7A 1IJEA 2P3SA 1HURA 1S9DA 4TTQA 2YOHA 2XITA 3W5JA 4HLQB 4JVMA 3SI7A 1E1RD 5FOXA 3SHWA 2V1XA 4ACAA 3U6KA 2MMCA 2ZRGA 5TB5A 3TNFA 1HYQA 2C04A 2ZRCA 3KJHA 5HE9A 2C96A 3EWAA 1G17A 4IDNA 3LRPA 5FOTA 3WY9A 3EIHA 2GCNA 1UDXA 2FPMA 2NTYC 1X8KA 4NYJQ 1F5NA 2GXSA 3ADCA 2Q21A 4J0QA 3EG5A 3FYHA 3W8NA 2UZIR 2D7DA 1IXRC 2CLSA 4ZIRA 4LBZA 1OFIA 1N0UA 2P6UA 3CH5A 4F4JA 2CJWA 2ORVA 4MRNA 3OFND 4A0FA 2ZE5A 1XRJA 4V0ME 4A8JA 3IO5A 1E98A 1GKYA 3M1IA 3I1FA 2O8DB 2ODEA 1BKDR 5CK4A 1L8QA 3ZVLA 1GKUB 1XCMA 4EPXA 3GJ5A 3EX7C 5EP4A 1Z5ZA 4TLDA 2WVJA 3B1VA 3SJBA 1DAIA 1NMYA 1P2SA 1G9XA 3BAFA 2WJYA 3SNHA 3B1WA 4BLQA 2JDIA 1TQ4A 5JJKA 2V1UA 1U8YA 3OZXA 3ICQB 2JJ1D 3OIVA 3ZDQA 4BFXA 4Q4JB 1S1MA 4R2HA 3RS3A 5KU1A 521PA 3RNLA 4M9SA 4RD1A 3FB4A 3X1DA 4ASUA 3CX6A 3E2IA 1HTWA 4HAYA 4Q1EA 4ESHA 1SHZA 3GCGA 4Z51A 3GLHA 2PX3A 2YOFA 2J0VA 3OF5A 2BOVA 1Z29A 4ZDIA 2YV5A 4LX0A 4TT3A 4A6XA 2KWIA 4HAZA 3U3OA 2DY1A 4M22A 1KI4A 2NPFA 1KY3A 4HLCA 3PUZA 3CPJB 3QEJA 2JLWA 3CNNA 1DAKA 2DCUA 3TBKA 3BGWA 4MGIR 1S3GA 1QF9A 2GXQA 5DYGA 3BFVA 4US1R 4DXAA 2QMOA 4BFVA 1R5NA 5CYPA 1PVOA 4V02A 3VNUA 4ZI2A 4XH9B 2OSBA 2Q9CA 3RVBA 1K5DA 1Z83A 2G0TA 4XVQA 2OG2A 4LBYA 4PXAA 4BLSA 1NY5A 1W2HA 1KIMA 4U00A 3QKTA 1CTQA 1ZNZA 4KJZA 4BFWA 2WMNB 1OPXA 1ZU4A 4HLUA 2C95A 3DZ8A 3OESA 4QXAA 5E4FA 1G3IA 2N46A 4KI0A 5BYKA 5FUYA 4D26A 5H70A 5DH9A 3U2QA 4NCJA 3T1QA 1E1RA 2EFEB 3A1WA 1GILA 2F9LA 3MGCA 1I2MA 1G19A 3GJ7A 4DSUA 1SVKA 1EFCA 3QY0A 1FPMA 2F43A 5KNBA 2FSFA 1RRCA 2XJ4A 4LYFA 1N5IA 3NEJA 4LJ8A 4LJ7A 5L3QB 3ZD6A 4ZCMA 3IIKA 2J59A 5CJPA 2H92A 4Z54A 1ZD8A 4LOAA 1OXVA 1RRPA 2VBCA 3CRVA 2YKGA 4LPKA 1HE8B 3OE7D 4DSOA 2QAJA 1E2LA 1TEVA 3PIRA 3KXIA 1FUUA 3ZVRA 4G01B 4L5BA 2HT6A 1FZQA 3VHXA 5ANRB 1GFIA 3NKVA 3OFNA 4RD3A 1UM8A 2GILA 4OQLA 2FFBA 3KB1A 2NG1A 2WWXA 4FMDB 5KSYA 3UIEA 2OXRA 3RSLA 2QE7D 6Q21A 3GLIE 2W0SA 2W6JD 1N6OA 3VX4A 4IXMA 3WMFA 1YVDA 5JS8A 3AM1A 4XTCS 4NCKA 2Q3FA 4WXRA 4KFUA 4Q18A 2NO1A 2D3WA 1J7KA 1RVDA 4KITB 1HE1C 4BECA 4C2UA 1SVLA 4NCNA 3WP0A 4AKEA 1WE2A 1Z3IX 1Q3HA 2NO6A 2JJ1A 1W48A 4H1UA 4MKGA 5FBWB 3OAAD 3QXSA 4P31A 2ZSFA 3HPQA 3AF2A 1NKTA 1GRRA 5HCNA 1E2MA 4TMKA 4IOMA 5L3VA 4NONA 3BFKA 2ZJ2A 1HT1E 1ZYUA 1X3SA 1DADA 2FWRA 2XGJA 1KY2A 2GXUA 3WMGA 4Q7JB 2IEYA 4D25A 1QRAA 2O8DA 1JPJA 1ZW6A 3RLFA 3I92A 4TWZA 4JIMA 2CL6X 5HPYB 1RJ9A 1GNPA 2O52A 2IYTA 5B2ZA 4K81B 4G1UC 1OH8A 2R44A 1KJZA 2BMFA 2QORA 1NVVQ 2OILA 3K0SA 3KKNA 2VP5A 2XXAB 4QGHA 1N25A 4Q4JA 4EUNA 3HWSA 2P6NA 2BMJA 2ZI6A 3WRYC 4LJ5A 1S2MA 3QNUA 4TYWA 2NGRA 3LW7A 5JSZB 1GRNA 1U8AA 1IN6A 1E2GA 1G3RA 2VQSA 2H1LA 3CWQA 3TIFA 5JJLA 2KBEA 2ZE6A 1E2HA 1UBCA 4DSNA 3FGNA 2ZR9A 3I5YA 2IS4A 4B75A 1JBKA 1MO3A 1EESA 2GF9A 2WOJA 1MR3F 3RRNA 1BIFA 3PFIA 2ZIAA 3CB4A 4LHWA 4DLSA 1KSFX 1WBBA 1N2CE 2QNRA 4MYTA 4UNPA 4V0KA 5DHFA 4A2PA 1ZINA 2GZDA 1ZU5A 1G41A 2ORIA 2C9OA 4DLUA 4Q48A 221PA 3SC3A 3RABA 3FE2A 5K8TA 1KI6B 5JLJA 3L8YA 3OE7A 5E3HA 1Q3TA 4DB4A 3I4LA 2LCFA 1II8B 1Z8FA 1CJTC 2NIPA 4TZ6A 3DL0A 4M1YA 1DBSA 4MITA 4A0RA 1R4AA 1JECA 5AR1A 1VHLA 4C30A 3QF7A 3CZPA 2QE7A 5KSOA 1Q1EA 2C77A 4DZZA 2W6JA 1AS3A 1LV7A 3K09A 2ANCA 3NDPA 3OEED 1N5LA 4BFYA 3GLIA 2PX0A 4AG5A 1WRBA 2PJRA 4ZCIA 1EFRA 1C9KA 4OJQA 3R9IA 3VKWA 3PCRB 1UAAA 2Z4RA 3MD0A 1XCGB 5DI3A 2AD1A 1IM2A 3GLGB 1N6LA 1MO6A 5A5GA 2BDTA 2ONKA 3K0FB 1A2BA 4JL8A 3NDBB 1F2UA 3OAAA 2PMDA 1UBFA 1NBME 3CNOA 4DLTA 4EFNA 1FUKA 5CDFA 1KTVA 1JEDA 4MKHA 1KK0A 1VHTA 3LAWA 4AK9A 1OW3B 2F6RA 2WWHA 2QSYA 3L0SA 2AFHE 3HU2A 1WDTA 2IEZA 1NN1A 1E4YA 4EPTA 2ZI3A 3RWOA 821PA 3CF6R 4DJTA 1T8TA 1Q44A 1NSTA 2QT1A 4DDVA 5EE9A 5J47A 1KYIA 4V03A 4B34A 5FPHA 3BB1A 2VSFA 2IS2A 2FA9A 4S35A 2W2XA 2YC4C 1BMFD 2V9PA 2HXYA 2O0HA 1P60A 1NLYA 2WOOA 2VPPA 1YKSA 4YMTA 2ZANA 1G5PA 2ZI4A 4IJMA 1ETUA 4II7A 2QENA 4BLPA 4F4IA 3PVSA 3C16C 4A8JC 3FHTA 2W6IA 3BS4A 3Q5EA 1KJYA 2IYZA 4JLOA 4C0HA 4F7WA 2WWWA 3TKLA 3HU3A 1E9CA 4DKXA 3U4QB 3M0EA 4XIGS 1VCMA 3I5XA 2DBYA 2G1KA 2Z4SA 3TMKA 4Q03A 3ND8A 2ZETA 2VF8A 1S0UA 3WNDA 4C0SA 2A5GA 1DVRA 4CF7A 2DB3A 2OAP1 1MO4A 1G3QA 4UQOA 4US2R 4Z1MD 2RGGA 2H57A 4QM7A 5A0FA 4AWXA 1QHGA 4PQFA 5AJVB 3LXXA 2XTZA 4XTRA 3MUFA 5FL3A 1IOZA 2CCJA 1XU4A 4YLGA 3IIMA 5KOYA 3ADKA 3GQBA 3GFPA 4P4TA 2GEUA 1R0YA 721PA 1P75A 4Q4AB 1W4BA 1Z6YA 3CWZA 2A2ZA 2YJTD 4Z8XA 3M6AA 4URVR 1X1RA 2ZRFA 1MKYA 4GOXA 4RZ3A 3L43A 5JSZA 2XZLA 3K70D 3TK1A 1E2NA 4UXJA 4QBFA 4RVCA 1UADA 1AS0A 2WJHA 4MGKR 1JAIA 3G82C 1WQ1R 2YNMA 1X86B 4JLDA 3QXCA 4GNKA 4HZIA 2EVWX 3D7MA 1O3YA 2QG6A 3OEEA 4TQ9A 4M2LA 1M1YE 3UATA 4W5WA 1GM5A 3RC8A 1JNYA 3AVVA 1OH6A 4O0MA 5CK5A 5KHOC 2OCYC 1RYFA 3GJ3A 3SFZA 4XWOA 1IAQA 1D2EA 1IY0A 1NJGA 1YZTA 1ZJ6A 2GVZC 1DAHA 2W2VA 4V0OA 4CZ2A 2I1QA 4POAA 5FTKA 2ZYVX 1T5LA 2IYXA 3DM5A 2VHJA 2ZR0A 3IHWA 2GDJA 2J46A 5JCPA 2QP4A 4HLUC 2OBLA 3GLFB 1II8A 1LB1B 3NC0C 5KPJA 2ZUBA 3ETLA 2ZRIA 4IEIA 4PHHA 4JLJA 3B78A 3UG6A 1VPLA 3TGPA 2QN6A 2A9KA 2HYIC 3A36A 4PHGA 2HDNB 2R9VA 4OK5A 3W6NA 2PZFA 3P26A 2GHIA 5BN5A 1G8PA 4KCGA 2ZVQX 2ZSAA 1G8YA 4DEXA 3U6BA 1JEEA 4OHZA 4Q7MB 1IY1A 4MGYR 1FL9A 4I1UA 4M9ZA 4DBLC 3UWKA 1VECA 3BORA 4AYTA 5KNDA 5LPNA 1GITA 1OXXK 4KVAA 1BMFA 4WXPA 2QT0A 5G40A 4QNMA 5EP3A 5FBVB 2GJ8A 1U81A 3I3SR 1XF9A 2LKDA 4LBWA 2ASEA 1N6NA 2ZI7A 4DUGA 2WHXA 3LW8A 3RRYA 1FW6A 1ZNXA 4V0NA 4MRSA 3PUVA 4MUBA 3T15A 1E9RA 4KSCA 4JYCA 1EFTA 2C78A 5FFMA 3ZQ6A 1YRBA 4D2IA 5H1YA 1VCIA 4C4PA 3PXGA 4WZBE 4A2WA 3D3QA 1LFDB 2CLCX 4KHZA 1QHYA 2GAAA 1LF5A 4MRVA 1IONA 4P33A 1N6RA 3F8TA 3KL4A 1KO7A 1RC8A 4ZIRB 5GJWC 3LY5A 4M1MA 2FDCA 4Z1MA 2QPOA 3IQWA 4LBVA 2CJWB 1NF3A 1I4LD 1T3HA 4FINA 2XNDD 2ORWA 4Q9IA 1P73A 3LD9A 4A8JB 4FMBB 2PT7A 5FOUA 2V4ZA 4QJ5A 3LLUA 2Z0MA 1XMVA 1JAHA 2ZUCA 2EU8A 1S1CA 3TSZA 4GBMA 3RSOA 2VSOA 1QG2A 3DPUA 3LXRA 4WZ6A 3LQQA 1T3LA 3K9LA 2R6DA 3IIJA 1P5ZB 3UMRA 4DRZA 2GNOA 4UXHA 2W83A 3W3AA 4IDPA 3W5IA 4CT5A 5KSZA 5F98A 2O0KA 2BMEA 4K8OA 1GNQA 1UF9A 3SOPA 1R0ZA 3D31A 4IHQA 1AJEA 3FKQA 3DKVA 2QTHA 3A37A 1SULA 2Z5FA 1QVRA 4YC7A 3AKCA 3AF0A 4QBGB 4OQFA 3KJEA 1ANKA 2RKOA 3QPWA 1XTIA 5JEDA 5TY0A 1TUEA 1HA3A 5FL7D 2ZS7A 2EFHB 5D3QA 1VYTA 3B60A 1UKEA 3UANA 1T4GA 1G64A 3FKSD 4TYNA 2GWHA 3NHBA 2J1LA 1LNZA 2GZHA 3BXZA 4OI1A 2BCGY 1DO2A 4KFSA 1LVGA 4CEHA 4NL4H 3KQHA 4D6PA 3KJGA 3QBTA 3THWA 1D5CA 1HQYE 3C14C 1WA5A 4X8MA 3W34A 4B3BA 1YZKA 2VL7A 4L8GA 4ZPXA 4R98A 1KK1A 2IYVA 4Q9HA 3OIWA 4PO9A 3A58B 4LSGA 1IN4A 1U0JA 3HYRA 4KYIB 5AJZA 4BASA 4BEJA 2X1VA 2ZRJA 1FFHA 1ZNWA 4JLVA 4KLZA 4R2IA 1I4TD 1KSHA 4AURA 2GCOA 4DLRA 4PPNA 4EQ6A 5KTYA 2ZRBA 4OQXA 2OE2A 3A1UA 4C3ZA 3CF2A 3TAHA 3SQWA 2E87A 2QM7A 4NDZA 4O25A 3EC1A 4Q21A 2ZRDA 2J41A 2ZJ5A 3A1VA 4BUJA 3VR1A 2VEDA 2QBYB 5F9FA 3CNLA 3NVAA 3TUZC 1CKEA 3ONWA 3R8FA 2VYFA 3GEEA 4CYMA 5L3QA 4D80A 2ZM5A 4DB2A 3B1ZA 2NMVA 2ZI5A 4HAVA 4PAOA 2YHSA 3GJ6A 3TQFA 2F43B 4JLMA 1DE0A 1CRQA 3K09C 4EJSA 4AYWA 4YXWD 4PC2A 1PLKA 3PV0A 3Q7PA 4PSAA 1SXJE 5EQTA 3VAAA 2Q3MA 2CLDX 3AUYA 4IFBA 1SHKA 2NO0A 2D7CA 2QTVB 3LLMA 1MABA 2FE4A 2HXSA 3MG9A 2KSQA 2VHUA 4IEEA 2ZREA 1LW7A 2BBOA 1G7RA 2O5VA 4DLZA 3KKOA 2VHQA 2REOA 5K8LA 2XNDA 1TEXA 3BJIC 5FOSA 3VNVA 2WV9A 1O87A 2ZAMA 1TPZA 1TL7C 3U5ZB 1AZSC 1X8LA 1YR9A 5JFGA 3LBHA 4A0GA 1TQ6A 3L2OB 1CU1A 3KTAA 2VRWA 4LHZA 3ZD7A 4QM6A 4HUQA 2ZE7A 5CLQA 1S3SA 4Q5IA 4LI0A 5CIQA 1E2PA 1OSNA 1U90A 2B8WA 1CEEA 5GJVC 4G0NA 4P0TA 3LBIA 1RRGA 3WBKA 4D0GA 2BBSA 1E32A 3ZJYA 1N6PA 4D0LB 4FCVA 2OCAA 4ARZA 4B3XA 3GFTA 1HUQA 2GK6A 1KK3A 2ATVA 1VG1A 1NN5A 3B8HA 1I2DA 1ZC3A 4BLRA 2F1JA 4OHYA 3BB3A 2WSSA 3EAQA 4PZZA 3WBJA 3BFXA 2VIIA 4DCNA 5FL7A 4B71A 2BJWA 2RAPA 3QENA 5HZHA 3BOSA 1IN5A 2J0UB 4PAQA 1SVWA 2H7VA 3ASYA 4DT1B 3BC1A 1HQCA 2R2AA 1RJ9B 1E2IA 1GKIA 2F3TA 3FHCB 2C9CA 2CXXA 2ONJA 1JR3A 3O8BA 1GNRA 1ZAKA 2OUKA 3EWSA 1E79D 3K9HA 2R62A 3JVVA 1AQYA 4JKYA 4PSVA 1Z0IA 4IFEA 4Q9JA 2J45A 1W0KD 1EX6A 3T1OA 1Q1ZA 2KBFA 3ZYCA 2YVUA 2EFDB 3QBVA 1WBDA 2PT5A 2A5DA 4C9BA 4I1OA 4O3MA 2QUZA 3FOZA 3VR4A 5LDDC 1IN7A 2RGCA 3LX8A 5CM8B 5EE3A 4B48A 1VG9B 2V8OA 1DAMA 1YRAA 3CR7A 3P1JA 5KSPA 4C0LA 1X1SA 1KO4A 1R7RA 1E1QD 4DC9A 5B58C 3AVOA 3RAPR 5DE3A 4MDFA 1VIAA 4Q19A 1VG0B 1XDBA 4OI2A 4XWKA 2BM0A 3UPUA 1KOFA 4KYUA 1PLJA 1IQPA 1VYUA 4B3DA 3LNCA 3KQLA 2JLSA 1GG2A 4LJYA 2I4IA 1XEWY 2XEXA 4YXWA 1E9SA 2V3CC 4KAXA 3QKUA 2XZPA 2PH1A 3REGA 4URWR 3C8UA 3VHLB 4KSBA 4BPBA 1J8YF 2GETA 4HLDA 2FPKA 4PAMA 5AJWA 4B3CA 2B8TA 2IT1A 1KDRA 2IF0A 5JJIA 4KVGA 2J7KA 2FF7A 2WM9B 2P5SA 1DELA 4LYHA 3KKQA 3U3MA 3QEOA 4EIWA 4F93B 2CBZA 2BC9A 1TF7A 2ZRAA 5EP1A 1GL6A 2IBMA 4JBWA 3SZRA 4CDGA 1UBEA 1HY3A 3EZ6A 5HCIA 4UNRA 1P4SA 1FTNA 3RRMA 2JIZD 3U3JA 1XWIA 4AIIA 3MLEA 1P6XA 4KFRA 2QBYA 3DZDA 2QU8A 1GAJA 4PPGA 3SR0A 3GLIB 2IA5A 4BE7B 4IKEA 2JATA 4DDWA 2BVNA 1AK2A 2C03A 2ZYWX 3NC1C 1E0KA 2VP6A 4ZDJA 4CIDA 1HT2E 2FSGA 3FTQA 1Y3AA 3LO5A 3T1VA 4HDCA 5EXSA 5IF9A 1ZD9A 5DI3B 3B7GA 2YZ2A 1CF4A 1FMJA 3IHLA 1U98A 2VTKA 1OXSC 3L8ZA 4DLWA 4Q1CA 1KSGA 4G3XA 1F2UB 1OKKD 4UNSA 3L0OA 1XX6A 4ILEA 3FMPB 4FMDF 1NRJB 5FUXA 1YQTA 5LBIA 4N0EA 4BRWA 1SVIA 3A6PC 5DHAA 5KPDA 2ZE8A 4TSFD 4LJAA 2AL7A 3T61A 2GJKA 2QTFA 1IJFA 1XBTA 2VF7A 1UKZA 5E7JA 3THYA 4V0MA 5FI0B 2OHFA 3B85A 2GXAA 1CR4A 2D74A 4Q1DA 3ZQJA 3R9WA 1IN8A 4URXR 5KDDA 1B0UA 1EFHA 4OL0A 2GEVA 1Z0JA 4FN5A 4NTZA 2F55A 4OI0A 3S1AB 3AVUA 4EPYA 3PQCA 3I72A 4QRHA 4IDQA 1OIWA 5EE0A 1E79A 4TZ0A 3SJCA 4EPVA 1YZQA 4NYMR 2GKSA 4QBHA 4DSTA 3OIYA 1W0KA 2IXFA 1N0VC 4WAUA 1GSIA 2GRJA 5AWFC 2PEYA 3OEHD 3N5CA 2GK7A 4K46A 1VIYA 5JI3E 3CPHA 5F3WB 5DSZA 2H18A 3TJZA 1XPUA 1G4UR 2HLDD 1W46A 3EC2A 1HH4A 3QG1A 4QFMA 4RZUA 2FFHA 2QGNA 1E1QA 1ZMXA 3K70C 2QQEA 1QVAA 5C1BA 2AKYA 2J0UA 2N42A 2ERYA 4DT1A 4JSYA 3CR8A 5AJXA 3AEZA 4DCSA 2VO1A 2A5YB 4RD6A 2REXB 1U0LA 2NPIA 2WMOB 2IXEA 5L3RA 4RD4A 1XCPA 4QJ3A 1CJVC 1XD2A 4Q66C 1Z63A 2YWGA 1OIVA 2DPXA 3IEUA 4RZ2A 4Q4HA 4R7ZA 2GVDC 3W9YA 3HP1A 4BZXA 5FUVA 3AQ4A 1NLFA 4GMXA 5FBRB 3SHFA 2F1IA 2WBLC 4AG6A 5E7IA 1UKYA 3BH6A 2JIZA 4W5HA 5CJ2A 2UKDA 3E1SA 1T9HA 5H68A 5JCZA 2PZGA 1LF0A 5FTLA 4M1SA 5GADl 4LRWA 4W7SA 3TVDA 2IYQA 4DLYA 4TMTA 1L4YA 2O8EB 4PC1A 1XD8A 3ZH9B 4BQSA 3HR8A 1AKEA 4BFZA 4F92B 5SZIA 1FQJA 2FSHA 5SZJA 4LHVA 2ZYUX 4UNNA 2A78A 1SKQA 1ZVQA 5FOWA 2B92A 3EZ2A
chains in the Genus database with same CATH superfamily
2Q0HA 1OKKA 3PF8A 2QJFA 4ZYUA 3VR2A 1RXIA 2ZSDA 4TN1A 1PJ3A 4UPEA 5C18A 3Q1LA 2CN1A 4PTYA 3DTYA 4WLUA 1QUEA 5JZMA 1B3BA 2RGBA 4RSMA 4TV8F 5DM0A 4BJ5A 1O1YA 2CXTA 4TTRA 1N92A 3GDHA 3KYDA 4EJSC 1WHTB 3W5CA 3EDYA 4FFLA 5HMMA 1SOWA 2UVDA 3OQJA 1E0AA 4CFSA 4Y0AA 4L15A 4W1SA 3PR2B 1XHEA 4B3FX 1OE0A 3Q6NA 1P2VA 4HRYA 4HPXB 5ILGA 2EG5A 4A3SA 1CUEA 4LY9A 2OFXA 3G0DA 3BGSA 3R6DA 1GN9A 3HWWA 4OHPA 4XJVA 2D4HA 1RAEA 5DKFA 4EAQA 4Z5XA 3H0EA 3DFZA 2O7SA 2QRUA 4Q0MA 2UYCA 2B4TO 2AEEA 1EFVA 3KTDA 4FIZA 1Z0UA 1AKYA 3LRXA 4GLOA 4AN4A 2A35A 3DAOA 2ZAOA 3PQ7A 4E5KA 4F06A 1AQUA 2HU5A 4JVOA 3P4UA 2EW1A 4JYZA 4JEHA 1USVA 4UVGA 3RYFA 3SQOA 5DBHX 2DG2A 3ZTYA 1LSOA 3K8ZA 3LF2A 2V55B 2W6OA 1DSSG 2AFVA 3KZCA 3SIXA 4CCSA 1NW3A 5CHEA 1SUEA 1DRUA 3EFHA 3EASA 2JJYA 2ZFUA 4BLTA 1T15A 1V7ZA 1ZK3A 5E1MA 3PFCA 3TH5A 1OX6A 2VYQA 3H5RA 1M83A 5TVKA 4RJTA 1U9ZA 1EJ0A 1DZ3A 4YWJA 3V33A 5LOVA 1XMJA 5FA8A 4NPHA 4R84A 2ILVA 3LIPA 4Y7CA 4FIDA 3M6FA 3CKLA 2VJAA 3UAZA 4ZPJA 5HF6A 1PJBA 3TCNA 4YAWA 1E69A 3QKSA 2QZJA 5JVDB 4L5JA 2P0YA 1N5OX 3P9ZA 4NS4A 2C2WA 2WTBA 4G25A 2YXPX 3RRXA 3SG0A 1CIPA 5IDXA 1M0TA 1NWCA 1BXRA 2A5LA 2FFQA 3GL9A 2ODNA 3GAMA 1UDCA 1UBUS 2IV3A 1GZ4A 3TW4A 3COZA 3EEOA 3B6EA 3SE0A 1LFAA 1TK2A 1T36B 1QVVA 3OJFA 4KBFA 1XXHE 4TLAA 4QG7A 1XPRA 3Q7EA 1Q95A 3VYWA 4LXQA 3K70B 2PGDA 2BKEA 2GJAA 3IDOA 1LJ8A 4TKUA 5DISB 3SEQA 5FWXB 1Q1AA 3THOA 5JC1A 3E53A 2ZEJA 1U3FA 4MUIA 3T5GA 1Q0PA 1CYEA 4LRUA 1V25A 4FW8A 2PX4A 1TUGA 2XI4A 5G53C 3UW3A 2P2ZA 5BSTA 2CE7A 4LNUA 1XMIA 2FWJA 1Q1QA 3OTHA 5IP5A 3RVNA 2HJWA 5LDGA 2LW7A 4AJPA 1UBSB 3FVQA 3HMQA 1Z18A 2VHZA 8MHTA 2A92A 4HN9A 3F7TA 4EB6B 5F2EA 1N2CA 1VGVA 2FEOA 3L40A 4WT7A 4UOEA 3ELBA 3R44A 4Q6BA 1GUDA 5D8DA 4G89A 2GD6A 4FCWA 4DJAA 1ONBA 4PNEA 4HFRA 3CUTA 3FSJX 4PFSA 1H22A 4ON9A 2ODBA 1GAQA 2PQ6A 1JFSA 2IYNA 4KNYA 4OX9Y 5CR9A 1WUYA 3WP1B 4LYJA 1ISIA 2GPAA 4MUKA 2F7SA 5U4QA 1T0HB 4BMZA 1R6XA 1FXWF 3O38A 4NYIQ 5HFJA 2QK4A 2JGDB 2V5VA 3EQ8A 1J7JA 3IP1A 1YR3A 4LJLA 3S2ZA 3HS3A 3QUTA 4F38A 1ZOIA 2OQVA 4DABA 1LU9A 1RQNA 4P98A 1C4WA 4UEWA 2D1YA 2ZTSA 4UUPA 5KNCA 1H4TA 3VTZA 3G85A 4NMMA 2I80A 2V5UA 3ZU2A 2VYCA 3BIWA 1M6VB 4B31A 2JLUA 3NTOA 4YJGB 4EKYA 4KODA 4EQ6B 3KQQA 2ZRHA 1T29A 5F78A 1RM4A 3M3DA 4HAUA 1GWNA 1TMYA 2OD9A 1ZH6A 5A05A 4W1PA 3VNRA 4UBNA 4Q3NA 4BP8A 2A9PA 4EL5A 2RDMA 3SBDA 4YRQA 2WG1A 4C7OB 3WA7A 4AXXA 2RH5A 1J90A 3PDJA 2YHIB 3ON5A 4CTOA 4DHEA 2FUG6 4LISA 1M7GA 2NYRA 2GSDA 2IYWA 3PQ2A 3F96A 3VPDA 4COOA 2INGX 3GVXA 5EE5B 3U4GA 1W0JA 2G83A 3NAGA 1B41A 1C7RA 3Q7QA 2CK3D 3R3JA 1FP4A 1MX1A 1US8B 3WZ2A 1WDWB 4IBOA 4J4BA 1WV1A 2I6XA 5KWSA 4YLEA 1COWA 1X7GA 1ZA2A 4B2YA 1GCAA 3HA3A 1EFKA 2QXTA 4AL4A 4C0BA 2GBCA 3LFUA 4JXXA 4YRKA 1W36D 1ZISA 2ESRA 3ZCXA 2R48A 4HF7A 1K66A 2L18A 2PWAA 1EXNA 2AZXA 1M2JA 2AHRA 4LYAA 3TDKA 3IXMA 1EWRA 4FHZA 1NVKA 4H0NA 4R1LA 3EC7A 2QRJA 4A6PA 4M8IA 1VDZA 1W8DA 2ZK7A 3BRSA 4RQUA 4RVOA 4D4MA 8GPBA 4GI7A 5K99A 4M38A 4RF2A 4D9IA 3R0QA 1KVTA 3CLUD 1PGQA 3ESQA 1IBMB 2VSXA 4EUEA 3DV0A 2B83A 2OQ2A 3I5UA 5FV7A 3D3KA 3F47A 4N65A 3VBEA 4AZWA 2RGXA 4CT4B 3ZHCA 4L16A 3WO1A 4BTLA 2QZ4A 3IP9A 5JR3A 1BH6A 2P2NA 2ZSKA 4IFIA 1U5BB 2XD4A 4Y2GA 2IOQA 4RFSB 3T52A 4C4TA 3CQ9A 1Z74A 1KAGA 2VWPA 1G8KA 3C6YA 1VI5A 2I34A 4I2NA 3TW8B 4F8EA 3O84A 5A4JA 1UFQA 2QX8A 1PJLA 1YB1A 4B47A 5KQPA 1SOAA 5DNDA 2ERCA 4DFDA 2C9BA 3AJ9A 2Z08A 4JL6A 1VMAA 2JGMA 3CG4A 3IJRA 3IP8A 1YR1A 3ZWAA 4ARZB 4CKWA 4F7DA 2GBLA 1K7CA 2EFCB 1NMZA 2IUYA 5CFOA 2IX3A 1ZCFA 3HCPA 3GPLA 3ZK8A 5LQRA 2YWCA 2B3DA 3HCCA 5T6BA 3NV7A 1IY2A 4GI2A 5AOBA 2SHKA 3Q2IA 5UKDA 3OIGA 3ODGA 3FZGA 3H5LA 3NORA 4K3VA 1WF6A 5HS6A 3KOXA 4MO9A 1N5JA 4A36A 2IVFA 1L5QA 1Z35A 1Z4OA 3IO3A 1GT91 4ZDWA 2P5TB 2CLIB 1SR8A 2FJPA 4NJMA 4L78A 3CRZA 1CG6A 1FDUA 3C3AA 4JUCA 4ZI3A 1K06A 3BYZA 4P1ZA 2H9AA 2D2IA 3LKZA 2VNHA 4UM7A 4JBNA 1LPBB 2FZKA 1J5XA 5ALKA 2XNSA 2W42A 4BX9A 2FPGA 2FMFA 4DJEC 4J75A 3H2KA 1Y63A 5D7BA 4NBUA 4YAGA 4TMWA 4IKPA 2WD7A 1IK4A 1LLDA 2I67A 4HRXA 3R7WA 2Q4BA 3LT2A 1U2DA 2B94A 3NEYA 4BRSA 1DBVO 3QV2A 1JPVA 3GD5A 1OFTA 1WDLA 2OCPA 4NESA 4P7KA 4HGRA 4Y9UA 2AT1A 3E5MA 3RUFA 3J81k 2IIVA 4O4LA 4XLTA 1WY7A 4GGOA 3ZE0B 4LUCA 2ANBA 4C4YA 5J3JA 4W5JA 4OY3A 4BFUA 4TKZA 4X3CA 5D3MA 2Z43A 2F1KA 5AQEA 4CLDA 2ZTMA 2AJDA 1P74A 4LW8A 1KJWA 2RI6A 4Q7EA 3OOYA 5G02A 2VN8A 3UVEA 4A8TA 4NQRA 5LB4A 3B48A 3ANYB 4HWOA 3W4IA 4CQNA 3EQ9A 3UKDA 1F9AA 4ML3A 3ZDRA 3NYRA 3IP6A 1JFFA 2AQKA 3ZCSA 1EZZA 2CMKA 4CMIA 4ZQBA 4NBLA 1XZ8A 2ST1A 3DKPA 1HG0A 1P61B 4CKCA 4YCSA 4E1VA 1CHDA 2BFBA 4NH0A 1V8BA 3C48A 3D6HA 1BVYF 5K7SA 4H59A 4PRYA 3WAGA 2EEPA 3NUZA 1SBHA 2R8OA 2XKKA 4ABTA 4DEYA 4YONB 1PS9A 2C00A 3PP8A 4MS3B 2KQUA 1I3LA 2QPLA 1KMHA 4MAAA 1E2QA 5BT8A 4B3MB 2OWDA 1VMDA 1GOTA 3O1LA 4N5DA 4IOKA 4IOJA 3T5DA 5CIYA 2AOUA 4MV9A 3NH6A 3VZDA 1AZWA 3CIFA 4JLAA 2RCYA 1QHHA 4QVGA 3A04A 4Z4FA 3REOA 4X9XA 5EVJA 1DFIA 1SVSA 1TYAE 3B1FA 1L5WA 4DDHA 3P9IA 4FYYA 3LGXA 3D6FA 5FLKA 2CW5A 3CUYA 1I24A 5E6UB 3DR5A 3AFIA 2JI6A 2GZ3A 3ZV6A 4B46A 5D84A 4I4TF 2WNSA 5B30A 1FFBA 5AMXA 2LKCA 2IW3A 1BX0A 4OUDB 4QYSA 1YD7A 3QG5A 1XMXA 5LR6A 1S4MA 5D6NA 3QSYA 1F2TA 3LPCA 2ADMA 3GLHE 4GT1A 1L4EA 3E03A 4HH1A 4P32A 1X70A 1N9GA 3TZEA 2JJ2A 3GPCA 4BDSA 5DM4A 3KKMA 4I4TB 4WZBA 3CZ5A 4U2GA 5FI1B 3SSNA 3HV2A 4DS3A 4BBJA 2PUWA 4GR5A 4PG5A 3IA2A 4FTWA 2Q49A 2ZJ7A 4YP6A 5B3LA 3HCAA 2JHPA 1H0HA 3NT4A 4R8RA 2Q27A 3A25A 4MK4A 4NE9A 4C7JA 4PV7A 5FA5A 3BFPA 4IVNA 1T5TA 1CBUA 2ZQYA 3I9V6 4PR3A 3T1TA 3IDZA 4M7WA 4ZT5A 1NW6A 4NLLA 3PC8C 5DTIA 1I33A 2DZDA 4AP5A 3T1NA 1I14A 3EXAA 4GLLA 2XUGA 1HDIA 1TF5A 2IXBA 1EM6A 1R0KA 2EWMA 1E2EA 4RCYA 4JBGA 3GJ8A 3K7EA 2ZSBA 4RCVA 4XZ3A 1JH8A 1EM8B 1JV2B 1MC5A 2VRBA 4A91A 4YXFA 4BVFA 1CY4A 2JAHA 5A9TA 3FOEC 5TMEA 1OXUA 3CT6A 3CVOA 3PEEA 1AGPA 1SVMA 1SZDA 2FW8A 3GX1A 4OVKA 3JYQA 3WSVA 2RGNA 3BGIA 4I4LA 2H52A 5EPEA 1OB5A 1JXOA 4IVRA 2Q1WA 4D3DA 4DWOA 3L0IB 4DCVA 1MB0A 1SJ9A 4Y2UA 5ALGA 2XYQA 3N07A 5B57C 1HEIA 2OHGA 2JA1A 3IJPA 4YP5A 2DFPA 4NYIR 3TIGA 1A4RA 2PTGA 3RC2A 1UZUA 3SCZA 1D0VA 3PQ6A 2NPOA 1QUFA 3ANTA 2ZS8A 2Y2UA 4MI1A 3C3DA 1V1RA 3KVOA 2KPOA 5SY6A 4AJHA 4C89A 1C5KA 1OF1A 2JLYA 1XCBA 1S2DA 4I6JA 4ZVUA 2P3OA 1PEYA 3SF8B 5B6JA 2YS7A 3PHLA 3RR2A 3FKSA 3IT0A 1VQ1A 1FVXA 1GZVA 2V7QA 3PXBA 4IF4A 4MRRA 1E2FA 2JGIA 3F2IA 2NXEA 2PZ8A 1EXDA 3EMBA 2PRYA 1G5FA 5HWSA 4BNTA 2DY0A 1J0CA 4HDOB 4JC8A 4R9NA 3R4VA 3T06B 1IEXA 1AGXA 2O8BB 3PJFA 3DWGA 1WDKA 4WZAE 2PJZA 5ECWA 1HDCA 2X3FA 2WWRA 1RZ3A 1ADGA 1EX7A 4WW0A 4AVYA 2D7JA 2BFFB 3K1ZA 1P9LA 2BRUA 3N2NA 3K9FC 2B2XA 4Q4HB 2FGKA 1KZYC 3C3YA 2QRZA 1N1DA 1WKCA 3A26A 2RSLA 3P0JA 3GFSA 3KWJA 2D2VA 3RBZA 1SU4A 1CQZA 3CCFA 3SXJA 3LQFA 5LZ4A 4EUSA 1S7GA 4OL9A 1P2TA 1U2SA 4ZP1A 1D6SA 3QM1A 1B93A 2PGJA 3AHDA 1H69A 3OTIA 4JGBA 5D85A 1KZ1A 3I39X 5EEHA 1BH2A 1R18A 2BMVA 3FF4A 2CNDA 3GEGA 5DK4A 4YWHA 3OO1A 4JKIA 3TN7A 3K0BA 4I55A 1N3BA 2OXCA 4X8HA 4LOLA 1DC6A 3THXA 3RAJA 1CUAA 3QE2A 4L4UA 4ERXA 2H7YA 2ZPTX 2FE1A 3K6JA 4R5HA 3FVTA 3LCJA 3MTDA 1XEXA 2VR1A 2X3UA 2VUUA 3MJVA 1UPCA 3QKRA 4HQRA 4NK4A 3K71B 3NATA 1LCIA 4RZQA 4XEUA 3SBEA 2ZUDA 5L4SA 3QTLA 5JFOA 5JDCA 5J2TB 1VKRA 4JOQA 4KIUA 4KO3S 3IMEA 3GA0A 1R9NA 1T2NA 5SYNA 5LQNA 2HHHB 1FBNA 2D2XA 3DOCA 3MNFA 2VPIA 5AKJA 3AM3A 4S05A 1D2RA 1U94A 4BATA 2JGEA 3QRWA 3DE4X 5DM1A 1TQDA 3FWYA 4E2XA 4II2A 3W90A 3R7LA 5FB3A 4FI3C 1AA9A 4WACA 4B83A 4YH1A 2ZTUA 3JASA 4EY5A 1S4QA 4ZO7A 1KDOA 2HYDA 4IV5A 3PFBA 5JASA 1JZSA 3KZNA 3IPAA 4GMDA 4UU7A 5ADWA 3M1LA 1P45A 3E7PA 1J42A 2P78A 4OGFA 1AOXA 1KMQA 2BF7A 5AKLA 1BD4A 3UWPA 4RFVA 4CFZA 3AJAA 4GRIA 2QSJA 2QTLA 3SLRA 3G0HA 3OCWA 1YC5A 3V1YA 3UMGA 3JZAA 5ESDA 5SZKB 2XAAA 5ICEA 3U7QB 2F8TA 3U80A 3RC9A 2PQMA 3QVKA 2FYTA 4GZMA 3C3PA 4RY0A 1RXCA 4YDQA 3QXJA 1V3VA 2ZR8A 4W9NA 5HDQA 1Y9JA 5D51S 3G2PA 4M9UA 1S02A 3F6YA 4XYBA 4IYRA 2B2NA 4HGQA 3VQTA 4US0R 3HKEB 3QHPA 2G9NA 2PUFA 4Z4HA 4RK0A 2M9MA 2CDRA 1M8KA 4ZT4A 4TS3A 3WLMA 3QPUA 5C3UA 3M83A 3MRTA 4AKHA 2JG3A 4JCCA 3G9UA 2CL5A 1NP3A 1EJ6A 5IXJA 1L4GA 1POWA 4DNPA 2OT3B 1JA9A 5KYGA 3Q3HA 1NU8A 4OJKA 5FTMA 3DC2A 4HHEA 1K7YA 1FMLA 1JIJA 1MAUA 3T6KA 4J0FA 3U4CA 2OPHA 2AVDA 3DMDA 5FLXA 3UAWA 4MROA 1Z0DA 1F48A 3NX4A 1QE0A 1UFOA 2QXYA 1YMUA 4I1IA 3RU7A 2FEPA 1MB2A 4YLGA 1F51E 1ZN8A 2VAXA 2XQGA 3K9WA 4ALIA 4WCFB 4XRRA 4HNAB 3W8RA 1VC2A 4ZYXA 3KJFA 1C0LA 4DVGA 2WVHA 3V4FA 2XSZD 3N2IA 5DNEA 5BSFA 1PS0A 4D82A 4NZOA 4X92A 1P9WA 3F71A 3R74A 1B42A 2CYCA 3V2IA 2PYDA 4H1VA 2W11A 2Z4TA 4TS4A 3UPDA 4CKBA 2NSYA 5WRFA 2P1ZA 3FWHA 5TJ9A 1LH0A 2ZIGA 1PR2A 3HL4A 1XZEA 2CL7X 2RGDA 5LVAA 1F8FA 3O92A 1TKAA 3RT7A 4H9GA 3T3IA 4F3CA 2P4SA 1ZR2A 4IO0A 2POQX 3LLVA 3TRKA 3K8OE 2YFKA 4HXYA 4IOLA 5EZYA 1VLQA 3KKZA 5DNVA 4KXQA 2XCSB 5KKNB 5G4KB 2Z95A 4ID3A 1QPBA 2V54A 1A8SA 3E1GA 3RF7A 1MQ8B 2C2XA 1YC2A 3NHWA 1C29B 1USGA 1GGKA 3DMFA 2VTBB 1EFLA 2O6LA 2YYZA 4RK1A 1LI4A 3O47A 3SBXA 5K3CA 2JJQA 2IZ5A 3E9YA 3FPBA 4MA4A 4MPPA 4QO7A 5BRJA 4N3BA 2C7BA 1XF1A 1L7AA 3GJYA 5A4FS 1OBFO 2JEZA 3AHHA 2QD2A 5AHKA 4DLXA 1M8PA 1OASA 3F67A 4XD7A 1KEZA 2WIBA 4D96A 5LQKA 2JLCA 1HLFA 2CE2X 2QXUA 4XQ9A 3WYAA 4CM9D 5EQFA 1PG5A 3FPSA 3HADA 5DNYB 5LBUA 5JADA 4WGGA 4R8LA 4UFNA 1AKRA 4WUTA 4QGAA 3MMPA 5DWQA 1YSCA 2UVPA 1QXSA 3WWEA 1JR6A 1PLLA 3KV3O 1BGWA 3I8SA 3AVPA 4D6YA 4O02B 3WOVA 1JPUA 1ZD5A 3ASVA 4MCHA 4JWTA 1PEAA 1Y80A 2J07A 2YXLA 4PYNA 5E7QA 1KEEA 1NVMB 2D62A 1Y7HA 1QNLA 2A9FA 2QM3A 1OXMA 3EDQA 3AWDA 2P6PA 3U1BA 2X0DA 2LUOA 5AVWA 3GBVA 2JEOA 1IB0A 1MFPA 1TMOA 1VJDA 5HXAA 1CD5A 1KO5A 2YY6A 2A86A 2IPLA 4WOBA 1Q22A 4Z9AA 4EDFA 5A2QA 2XT0A 1K9SA 3A1WA 5BW4A 3WIUA 1U4OA 3UK1A 3MJRA 4CGZA 4UW9A 3QVSA 4DQ0A 2GESA 2W6ID 2J87A 4GRAA 4B33A 3VPXA 5JS6A 3S1SA 2OESA 1P91A 2GR9A 1Y6QA 3CE6A 3HSYA 4HSEA 3UJ6A 1W36C 2C3MA 3NBFA 1A1VA 4UATA 2QTBA 1QCYA 3DT6A 1OC4A 1PSZA 2P2LA 4R51A 1XCJA 2K6GA 1AF7A 1PP4A 3QFFA 2QAGC 4X1OA 2ATIA 4HB3A 4YB8A 4K1XA 2V6MA 3IPXA 5T8KC 3DE5X 3CRQA 9ATCA 3SZLA 1I7PA 2DKNA 1X94A 2ZRLA 5L40A 5JU6A 3L7JA 2R6CA 1UJ2A 1G2IA 3CLUC 1O4VA 2VHVA 2FRVA 3LCCA 4Z3OA 3OCXA 3J7AC 4PQEA 2WU3A 1NA5A 3OHPA 5D3KA 5BUSA 4QXQA 4UCQA 1C0KA 5HQ3A 4FMCF 3PSAA 4E33A 2G5TA 2F3UA 4GOKA 3EXG2 3JQ8B 2EKDA 3FN4A 5C8YB 1WPQA 1JB1A 4ZRDA 3QNMA 3VPHA 2WW8A 3KQWA 2IEBA 4JWKA 3VR5H 5AVUA 5G3YA 2WAXA 2PKRA 1NNEA 1QGUB 3CMMA 4NOLA 1PVVA 2QTNA 3JVDA 4N3NA 4V38A 5DTMA 1ZUD1 1N6HA 2ZATA 3SXUB 3V9AA 2ZYTX 4JI7B 1E0JA 1K5GA 4TTJA 3M2PA 3NGXA 3Q5DA 2E85A 2UYOA 2SBTA 2A1IA 1FU7A 1Z6GA 2PRZA 4YCMA 5HR5A 3JS5A 3OSZA 3WL4A 1E8DA 4IG9A 1C7JA 3HFRA 4MHTA 2FUG1 3WSWA 2YOGA 1KP9A 1XXHB 4E5YA 2BJHA 3I4FA 2ZPUA 4AMZA 2WWIA 2FDRA 3BBLA 4DQVA 2RB4A 3TQHA 2DWUA 3NB0A 2F64A 1RKBA 2SKCA 2WB4A 3LY8A 4PFKA 4KWIA 4A16A 2NADA 3AONB 3R3ZA 4G0VA 1UEJA 2J6HA 3KHUA 4ZKDA 3R3YA 4ZZ1A 3AKZA 2V98A 3MT7A 3VR3A 4EHHA 3ZQUA 4B81A 5DB4A 2OBBA 2VC2B 3G8YA 1HLPA 1U80A 1YHNA 2V7XA 3P4XA 4JS0A 3UBTA 1AH2A 4UTXA 1KNQA 1Z2AA 4HTAA 3A9VA 3KE8A 5KCZA 1M8JA 2QS9A 2H1SA 4YMWA 2JH8A 3GRKA 1L4HA 4MI6A 3RANA 1QAMA 1V4NA 2JFFA 1BDBA 2PGIA 2QD4A 4MHSA 2VT3A 1GA6A 1WMFA 2G77B 3BRWD 3OZTA 3QEMA 3OI7A 1I5RA 4A2QA 1L7BA 1XLVA 4KL8S 2ZU6A 3OIUA 3PHBE 4G1EB 5F51A 2C4MA 2HKIA 4J03A 4NJOA 2X7HA 3RVOA 3LUHA 5ALLA 5GV8A 2LP4Y 3VSBA 1X38A 2TMYA 3GBSA 4EHJA 3FCCA 3ADOA 2J3JA 2Q8PA 1ZH0A 1WXEA 5DN6A 1M7BA 5D2CA 4FYWA 3C1UA 3PEWA 2ZXUA 4UUNA 2PMKA 4B7XA 2JASA 2QUIA 3IPRA 1MQAA 4Z4QA 4C4OA 3VA7A 1QIHA 3O26A 1VLVA 1ZMOA 1V1MB 4MCIA 3VOTA 2CNWA 3LL4A 1V26A 3QJYA 1SHLA 4RAOA 2X2EA 4OM8A 3PPWA 5ALFA 3V55A 4HDQB 4OXYA 2R6GA 1E1YA 1XZFA 3IUBA 4OLBA 1N2JA 2AJ8A 3TRHA 4KWEA 4DUGD 3AGQA 3NIDB 4TTSA 1FNNA 3DHVA 2FSIA 1BKSB 1J99A 4BBPA 4ZU6X 4CV3A 4YUXA 2WF7A 1M2OA 5BMVF 2NO5A 1KIFA 1WVIA 1XB2A 3DAHA 4XE5A 3WJ7A 4N76A 1IDOA 3W6PA 2W2OA 3WX0A 4YA6A 2X5JO 3K0AB 4EKIA 1UK9A 4KOAA 4QNRA 1CNFA 1E3WA 4HXFB 4MUYA 4OQDA 5FD8A 1GNTA 4WOJA 3MBKA 4CG3A 3O1IC 2O1WA 4LGMA 4GQIA 2R6AA 2EBFX 5BV1A 1V96A 3CKKA 5JCOC 5TMPA 4EY4A 5KYXA 4EFMA 3FZYA 3MBIA 3VTKA 2BW0A 1K4KA 2Y0PA 2XUOA 2NU8B 4YQYA 3W5VA 3D8BA 1A76A 4OQZA 1VCNA 1IL0A 5JUWA 2G06A 4WOPA 4FK8A 4QGBA 1K86A 4A82A 1II0A 2VAMA 2X77A 3DLPX 1FX0B 3MSXA 3KQNA 1MPTA 2TMDA 2IUEA 4B3GA 2CF6A 2WKSA 1OD6A 3LT0A 3ACDA 2YWFA 3H6GA 3LGSA 2QI9C 3TVTA 1I13A 2CYAA 1TQHA 1OFVA 1EDEA 1RHUA 3NEAA 4WBSA 1OLUA 1POXA 3IVGA 1EUYA 3VO9A 4QHTA 2H3HA 1VSUA 3AJ8A 3PGKA 3HVHA 3NTQA 2D2EA 4MVJM 1Y5RA 5HUHA 2CDNA 1PI3A 2P0AA 3VUFA 4MVJA 3ZCPA 3R5TA 4M89A 1QZUA 1TAGA 1YZVA 3GGOA 1E66A 4B7UA 3N9IA 2HO5A 4RK4A 5BPHA 3QPDA 2O0MA 3I6BA 3CM0A 4RD2A 4MCAA 4BL5A 4IL5A 1HYBA 4ZC1A 2H1WA 1W93A 4H3HB 3V4RA 4FN4A 4AFNA 1WB9A 4OQEA 3VVCA 3G0CA 3AKYA 4NV0A 5CH8A 4WFJA 1EEHA 1OYOA 4RHCA 1RHRA 5FNVB 1G5TA 1CVLA 3WIVA 2ZAGA 1B23P 5HZKA 1RI1A 1ZGBA 3I9FA 4HWGA 4AC9A 4RHFA 4AMUA 3ZCUA 1Z2CA 1UFVA 1WCXA 4MQBA 3R5FA 5ALOA 4I0WB 4ZOBA 3UJPA 1Q6YA 1V35A 2BHSA 1E6MA 2I7VA 2R47A 2XTNA 4ZAGA 4YRJA 5I7WA 1I4OA 1PO7A 3KK0A 4ZANA 5HK9A 1FUYB 2BCJQ 1UZMA 4FSHA 4PZCA 4MP6A 1QZZA 2IYSA 4KBYA 4DDTA 2GD2A 1P2UA 3PUXA 4RH3A 3RSFA 4KMMA 4RJLA 1Z17A 3FXAA 3K9GA 4DF3A 3O8RA 3U7GA 2O4UX 1F8UA 3CUKA 5K8UA 3AWIA 1P0MA 3L8MA 5A7GA 4IDBA 4MLDA 5CW1A 2M1XA 2O8NA 1TJ5A 1L2TA 5JW6A 1EGHA 3T3NA 2UXBB 2A0KA 3DV2A 2PX2A 3KWFA 4PHFA 5IN5A 4QUGA 1QHSA 3BXOA 4NZZA 3UYKA 6LDHA 4OA8A 4KRXA 3PLAE 1E3MA 2Q3BA 3N39C 5JOQA 3ZI4A 3DQQA 1Q3KA 10MHA 3DZCA 4LYEA 4JENA 1UZLA 5LIPA 1PSWA 4IH9A 1TW3A 4PCUA 3GLGA 2OENG 1DRWA 1L4LA 1K2VN 5CCDA 5AHRA 3K0FA 2VJCA 3FDFA 4OH7A 2IV2X 4ARUA 1F6BA 2Z1NA 4IJVA 3DT8A 3TTXA 1K8XB 2IYYA 3EGDA 3VH2A 2C8LA 2BFDB 3C5CA 3EVDA 2DUJA 2OZLB 3I28A 3UAGA 3LU1A 3HB0A 3IT3A 5FO1A 2NUTA 2JLXA 3RC3A 4YYEA 3HDTA 2C1EA 1YR7A 3I9V1 4JJZA 1SCUA 2OV6A 4MR8A 1K3FA 3HG7A 2PLNA 4FXPA 2CXNA 1I51A 2JZNA 3U5TA 4OFZA 3K35A 2ZBEA 3KDSE 2CHEA 5E6RA 4O2BA 1QFYA 1G18A 1EI9A 3DGFC 1DQYA 3PX3A 1WCYA 4LY6A 3KPWA 3LNTA 4KRGA 2Q4OA 3U26A 3O1JC 2VFAA 3F8SA 4QPNA 4ZCTA 2CSXA 4MAMA 3F3YA 3CH4B 3QLVA 5HEKA 1KFCB 2I2FA 3OZAA 2OM2A 1JR2A 1MGPA 2D4AA 3CWCA 4JIGA 4KC0A 4FZVA 1ISJA 1B14A 2G88A 1Y5LA 3KQKA 1BHQ1 1XCLA 1P5JA 2HWWA 2RMKA 4YMVA 3BL8A 2WF6A 3KR1A 1MJFA 4ISCA 3L7MA 3PFHA 5ESWA 5SYMA 3WLIA 4IVQA 3RUPA 2ZBPA 3A8TA 3FM9A 4V24A 1IHUA 4UMVA 5AXDA 5IJ0B 1ENZA 3EHDA 1L7DA 1CUFA 5CVVA 1WP9A 1PFKA 1JHVA 3GRFA 4GE3A 4LTDA 2J7PA 4M53A 2IHKA 4ZO4A 1TM1E 2IHVA 4KNWA 3ZK7A 3NNSA 3OT1A 4FR0A 1NFFA 2VLIA 3DP9A 2PU7A 2EIXA 4LYGA 4RKQA 3TLXA 3G5TA 1XRSB 3EARA 4EO4A 3TNYA 2O7NA 1GUYA 5DLEA 3ABIA 1GPAA 5JH7A 2FQYA 5JANA 1H4SA 4MYHA 4X62B 4QRIA 1IFXA 2H0RA 2C5SA 2F48A 1P18A 2GVNA 3GA5A 1M74A 3NALA 2QIOA 3DUFB 4ITVA 5TEWA 1ONPA 3N0WA 4WXHA 1JH9A 2DPLA 1CSEE 2OA0A 5IKOA 2XH8A 3GLHB 5ADHA 4JC5A 1F20A 1JKMA 1SXJB 3VR6H 4FOOA 3EY4A 2WSSD 2AMFA 2VJOA 1IRXA 2VH5R 5FWNA 1FDTA 3ZIAA 2R4TA 1GGNA 3BMQA 2COUA 1VYVA 2XF8A 2WHPB 3OY7A 1Y82A 2NUAB 1ZDMA 3DZFA 4U2KA 1Y9ZA 4RA9B 4Z7NB 2WI8A 3HRIA 4CU2A 2HC9A 2OLKA 1JXMA 1M2VA 1SWVA 1V45E 2OQIA 3KP1A 4QJ4A 3EF0A 4UU8A 4WPGA 5FBQB 1WMBA 2C31A 3ICCA 4OATA 3B6KA 1E61A 3CN7A 2B21A 3ZZUA 1E7WA 5T8KA 2IDJA 1C4KA 1DIHA 2JDID 3OTOB 1N3IA 1TVMA 4QOFA 3G1TA 1CJUC 1N75A 1FP6A 1CR0A 3D8HA 4BFSA 2C7OA 3EFBA 4GBJA 4C7XA 1T24A 2XVAA 4GKJB 3B9QA 3T5AA 3AUSA 3JQFC 4Q4DA 3PS9A 1JQ5A 2QEQA 3ED1A 1UMCA 4Y2SA 4ASUD 4KE7A 1MNQA 3FYUC 1I0ZA 1GKKA 3PXCX 1VKZA 4X54A 5CD9A 4S0XA 4KR6A 2O5EA 3ONNA 4J90A 4YAOA 2X1HA 4JHLA 2X2PA 4UEKA 1AUOA 5J4YA 5LQCA 5SICE 4FEYA 3USZA 3MCAA 5K0LA 3RB8A 4Z0PA 1JU3A 4MCJA 4KXFB 4XDYA 1GPUA 4MWOA 4X44A 2AJLI 1LGYA 3M70A 5AJUA 5K09A 2IELA 1EVYA 1DJOA 1H8HA 1P3JA 1JN0A 3A2LA 2PS0A 3B13B 1YV9A 1YDEA 4R2WA 2B6HA 4ZCPA 2A0UA 5KOHB 3OFVA 3MAJA 5EE1A 4AUKA 1XTJA 1EGQA 3HB4X 3HZHA 4P81A 1RAHA 2QYOA 3GFBA 2LE0A 3L82B 1JDJA 2WKQA 1IPHA 1SZPA 4KQEA 2CD9A 3EG9A 1QIIA 2A59A 1VIDA 4HNRA 1H3NA 5AOAA 2O2SA 3Q7IA 3B6IA 4MQFB 3L4JA 3U44B 2WKPA 4K0RA 2AQHA 1VCHA 1KY4A 1ILWA 1QCCA 1E20A 4IQGA 1W85A 3KUKA 1UWLA 2WWVD 3VSDA 4GUDA 4JAVC 5BR4A 4AS3A 1NXTA 4Y98A 1JG3A 1GPBA 4YMUA 5ILOA 5E38A 3FROA 3UOAB 1OAOC 2I76A 1Z34A 2E18A 1XP5A 2C2KA 5BVGB 1R74A 2YOHA 4TTQA 2YVQA 3FPKA 1ZRNA 2HNAA 3JQGB 3NO4A 2IOHA 4E14A 3D43A 3I2IA 1CUZA 5F64A 4JVMA 4FYVA 3SI7A 1M34A 3OZCA 2JKZA 1E1RD 4MHOA 3PJDA 2V1XA 2P1DA 5EVCA 4Q16A 4LQ4A 3NBMA 3HNOA 5IMBA 1WZUA 5TB5A 3D59A 5BMOA 5BR7A 5F2OA 3EGIA 2QX6A 2C96A 4FDVA 4Z1OA 4IDNA 4D57A 2GZSA 3EQ2A 5IC5A 4W5TA 2BEVA 2MYTA 1FS6A 4ZI7B 1T2CA 1T0BA 2FPMA 2MWMA 2NTYC 1X3LA 2Z8XA 3JQ7B 4NYJQ 5C31A 4PLVA 4OB6A 4P3NA 1T2UA 1EEXB 4CL2A 2XMBA 3D6AA 5T5QA 3FGZA 3W8NA 2ONCA 5LU8A 4CM4B 2ZYHA 1FX1A 4QZVA 4LBZA 2P9YA 1GG9A 2JZOA 2JFXA 3CO0S 7ABPA 3CW8X 3DJFA 4UBLA 5CFLA 3EDCA 4YTEA 5CA0F 1W9HA 1VSVA 1CIJA 1XRJA 4WN9A 5HFAA 5AYVA 1NMSA 4A8JA 1NVGA 3WOHA 3NTLA 1JU4A 1NQUA 2ODEA 1LBEA 5IJ9B 2D5IA 3AC0A 1QQAA 3JQCA 2ADOA 1V6CA 2WYOA 4ARBA 1HFJA 3GJ5A 1L5OA 4FYJA 1EVQA 4JSRA 5K5EA 3UMCA 2BZ1A 3BMXA 3I37X 3ZE8A 1P2SA 1SA0A 1G9XA 1X1TA 2IE0A 4BS9A 4M83A 1F7VA 2I65A 2PG3A 5EUBA 5JBIA 2FMTA 3R9XB 5JJKA 5J43A 1QYWA 2EBUA 2IZOA 3ZDQA 4BFXA 1S1MA 1GCOA 521PA 5E3JA 4QDTA 3WHIA 2ZUTA 1QF7A 1TE2A 2WTEA 3RBAA 4EY3A 1KGSA 2IEDA 3AOEA 2BKVA 1IHDA 5AO9A 3HUEA 5JAHA 4NRDA 2YYSA 3P0EA 4RV4A 2PX3A 1YKGA 4FLMA 4F9FA 3W8DA 1Z29A 5AI9A 4ZDIA 1USWA 3PKIA 4M37A 4BKMA 2HH9A 1KJ8A 2AC7A 1FK8A 4ONEA 1EXVA 2BI8A 2DY1A 1Y1TA 2PMEA 3PCTA 3Q3VA 1KY3A 2OKCA 4UFOA 4YAEA 3K1TA 5ERGB 4LG1A 4ZXPA 4YP0A 5JXHA 3AEUA 4K6CA 2DCUA 2ETVA 1SPBS 1CS0B 3GFFA 4X3PA 1ISSA 1YQUA 3HJRA 1ZHFA 2Z5VA 1DKUA 4IILA 1QF9A 1VE1A 4OXXA 4LDQA 1C30A 2PAFA 4DXAA 1JWLA 4LXUA 1T9AA 1XQXA 4X24A 4PVCA 4E0BA 4ZYYA 1L6RA 3Q10A 4UUMA 4BGVA 2Z2KA 3ZWQA 2WY2D 4DA8A 4LWOA 2QN8A 3CA8A 4MIOA 5DMHA 3FR7A 4ZI2A 1GGEA 1R0RE 3FWKA 3RW9A 2WWTA 3FSRA 1Z83A 5KQGA 4Y2QA 3V8PA 5GQSA 1QF6A 3QVGA 2VLBA 4U00A 5FNZA 2XOXA 1CTQA 4Q4CA 1ZNZA 4KJZA 2X41A 2ZTVA 2QYSA 4OFWA 4EJ0A 4MB2A 4BFWA 3JAMA 4B6QA 1ZU4A 2OHVA 4KKVA 5C51B 3KDPA 3QBDA 2N46A 1W94A