1ESNA

Structural basis for the feedback regulation of escherichia coli pantothenate kinase by coenzyme a
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
311
structure length
311
Chain Sequence
QTLMTPYLQFDRNQWAALRDSVPMTLSEDEIARLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEDLLQTWYINRFLKFREGAFTDPDSYFHNYAKLTKEEAIKTAMTLWKEINWLNLKQNILPTRERASLILTKSANHAVEEVRLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PANTOTHENATE KINASE
publication title Structural basis for the feedback regulation of Escherichia coli pantothenate kinase by coenzyme A.
pubmed rcsb
source organism Escherichia coli
total genus 101
structure length 311
sequence length 311
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2000-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1esnA00
5BYJA 5J40A 4EPXA 3EAQA 4YMTA 1JAIA 1W2GA 3AF4A 4Q4AB 1AQUA 1OPXA 2AFHE 1UAAA 2O8BA 3SYKA 5K8LA 1N6KA 2X2EA 4D0LB 3ZZ0A 1S9HA 4DCUA 1W36B 3ZQ6A 1LF0A 2FU5C 4QGGA 4BFVA 1IY1A 4ASUD 1MRNA 4NCKA 2OESA 4LY6A 4PC2A 1W0JD 1E69A 2DWOA 3L0PA 1GVNB 3P32A 1M8PA 2J0UB 1F48A 4BEBA 2O8FB 2VHQA 2O8EA 4KJZA 4Q1EA 4RKEA 3F8TA 4TLDA 1HTWA 4N0EA 4H1VA 3ZS9A 4GSYA 1T3SA 4IFEA 1ZAKA 1N6HA 3GD7A 3WXMA 4C4PA 3IHWA 4BFWA 3DZDA 5G3YA 3R8FA 4HEJA 4QC2A 1HURA 4P4SB 1II9A 5GJCA 3SN6A 4LGMA 1XD2B 1NVWQ 1T5IA 2ZRIA 3QXXA 2VEDA 3QBVA 1AKYA 2F3TA 1YZLA 2XNDD 4DB2A 3C5CA 1KO8A 2XXAB 4GOJA 5E7IA 1GFIA 4KVAA 1NVVQ 1CP2A 4AKIA 3CZPA 3QXHA 2EW1A 3LH5A 2H1LA 1H8ED 2VH5R 2YWGA 3TAUA 3SQXA 4RD3A 4E07A 1G8HA 2ZEJA 4TTQA 3VNVA 4TZ6A 1N25A 2YHSA 2V4ZA 2C95A 1TQ2A 1W1WA 4TMXA 4CEIB 1OXUA 3GFTA 1ZIOA 2OCYC 2IYXA 2P6RA 2XB2A 4C2UA 1YHNA 3IBGA 4Q02A 3W8RA 1EX7A 4BLSA 2WJIA 3KQKA 1D5CA 2QRNA 2ZAMA 3VX4A 1KKLA 1S8FA 5E7JA 1ZM9A 2WKQA 5KHOC 1P72A 3U3JA 3UMFA 4IDOA 4MUBA 2ZJOA 2ZYVX 5JWHA 3A4NA 2NMVA 2J3EA 2CNWD 3F5FA 3BH7A 1RRFA 3NEJA 3A1UA 5FTLA 5EXXA 2IYQA 1M7GA 4JLNA 1XF9A 4QJ5A 4TN1A 4URZR 3VNUA 2DB3A 1S1CA 3PUYA 4G0NA 4LPKA 2FSGA 1AM4D 1JJ7A 2ZRKA 1COWA 1M34E 4ZKDA 4TLBA 4OQXA 1ZD9A 5DNYB 2GK6A 1E0KA 4EPVA 1DO2A 2JEOA 5JMTA 3Q7QA 1KJZA 2CHQA 3K09A 5TB5A 2ANBA 4DUGA 2FSHA 1ZNWA 1UKEA 1HV8A 2J87A 5BN5A 1DE0A 2QAJA 3CIOA 3LAWA 4RCZA 4V0NA 2F1RA 4MRSA 2QE7A 1Z29A 1NRJB 3L2OB 5CYPA 3ZVLA 1L4UA 3W9YA 1W4RA 4DB4A 2R6CA 2YWEA 3PJRA 2IYYA 3FWYA 2ANCA 1VG8A 2ZUDA 3FB4A 2R44A 2YWFA 2IUUA 4V0OA 3I32A 3NBFA 1CR0A 4BLPA 5CITA 1DARA 3CLVA 2ZRFA 1FUUA 1NF3A 1P60A 3WRXC 3W6PA 2DCUA 3MSXA 4YMWA 4JSTA 2BCGY 2WHXA 2K5UA 4QGAA 5FTNA 1TL7C 1ZUHA 1F2UA 2GDJA 3TIFA 1RRGA 2ATVA 4HUQA 3REFA 4V0MA 2C2HA 3PUVA 3G0HA 2GEDA 4PAOA 4W5JA 3HU1A 3TH5A 3U3MA 2WM9B 1JPJA 2Q6TA 3IQWA 3AVYA 1V43A 4W5WA 2DFKB 2EFCB 1MO5A 1P2UA 3VMFA 2GNOA 2F1IA 4LJ9A 1YE8A 1E2NA 2FEOA 1IY0A 4P3YA 4AG6A 5BW8A 2JLVA 1R0WA 1OXSC 1SGWA 4NCNA 3N5CA 4TMZA 2OAQ1 4Q1AA 4A6PA 2CL7X 5FTJA 3CX8A 1SVWA 2B7BA 4ZCLA 2O8BB 1EK0A 5KDDA 4NCHA 1MR3F 2Q9AA 2PH1A 3RS0A 4EPTA 3AP3A 2OV2A 4DSOA 3IUYA 4EUNA 5E3HA 4PZLA 1E1QD 3VR3A 4Q1DA 4TYQA 5FOWA 5CK5A 2JJ1A 4MYUA 4NYIQ 3DL0A 3ZZUA 2YOFA 1O87A 3DEFA 1CJMA 3SE0A 3VR4A 2VA8A 2FN4A 5FI0B 3GJ3A 2O8EB 2FG5A 3UXMA 4PQYA 1DVRA 3RS7A 4FXPA 1LB1B 1Z0KA 2JATA 5SZIA 1FZQA 2ZE8A 3GJ4A 4B73A 2GVZC 1YR9A 2ZJZA 1F3OA 2X8AA 1AS0A 3NIBA 4G01B 4HSEA 2QEQA 2CJWA 4PSAA 4O2LA 4BFSA 3OIUA 1XTRA 2MSDB 2VQSA 2W0MA 4WBSA 2IYWA 1Q20A 1OB2A 1OFIA 3WYGA 2J7PA 3EPKA 2GXSA 4MKFA 5FOVA 1GRRA 3HP1A 4LV8B 5L3SA 1HY3A 3TE6A 1QHSA 3G5UA 5EP2A 2PEZA 2EYQA 2HYDA 4MGKR 4RZ2A 1AKEA 2NPIA 3M1IA 5AK0A 1U0LA 4OHZA 2REXB 2DHRA 3U7FB 4JLMA 4R2HA 4YMVA 1XTQA 3NG1A 4Q1FA 1G7CA 1XZPA 2Q9BA 5FPHA 4PHHA 2VPPA 3DOEA 5GJVC 4R71A 4MRRA 2FE4A 4C0LA 3GCGA 4QL3A 3LX8A 1W36C 1BKDR 3QBTA 4FMCB 4AD8A 2I1QA 3QXSA 3EPJA 3L8YA 3ETLA 3DKPA 4TL8A 3KJIA 1C1YA 1AZSC 2ZUCA 2UZ3A 5L3RA 3FGNA 3Q8XB 4R2IA 2Z43A 4OQLA 3VR5A 3RNLA 2F55A 4KO8A 3CKLA 3V4RA 1Z6YA 3BORA 4OI0A 5GJBA 5CJPA 4HAXA 4RVCA 5DIFA 2F3RA 5F98A 2CCJA 5IDVA 4BRUA 2B7CA 2OFXA 3SBEA 4OHYA 4TYYA 4WZ6A 5CLQA 5KPJA 2JJ2D 2QSZA 4DSTA 1D9XA 1KDTA 3BXZA 4KBFA 1PLJA 4IEIA 1R5BA 1MV5A 3TRFA 2V8OA 1JQJC 2GZHA 3LRPA 1D2MA 4CGZA 1ZBDA 3FKQA 3ND9A 1RVDA 3EZFA 4O2RA 2BIFA 3CPEA 2OUKA 2QN6A 3SHWA 2H7VA 3UG6A 2W2VA 2EFGA 1F2UB 4I81A 5A0FA 4G5RA 3QVUA 2W2TA 3QIAA 1GKUB 4HUQB 4OHVA 4B44A 2FSIA 3D31A 4BUJA 5JRJA 4YMSA 1GITA 1W4AA 3M4YA 1ONBA 4ESHA 1DO0A 3H2YA 4WVFA 1XWIA 5E7MA 5TARA 3W8NA 1VMAA 4B6FA 1EFHA 3QPVA 2JLUA 1XEXA 4F7WA 3UWKA 4NPHA 4OQFA 4CT5A 5EZ6B 2PBRA 3BIFA 3X1YA 5FL7D 1GRNA 1VCIA 1Z0FA 2XTMA 2GEVA 1Z06A 2OZEA 4HDQB 3OE7D 4D0NA 3ZVMA 3SR0A 2VP4A 3CRW1 4LBZA 4LHXA 4ASUA 1IBRA 421PA 1ZNXA 4AI6A 2IT1A 4WXRA 1VCMA 4QHSA 3CF0A 1FFHA 4DT1A 5FPKA 4F92B 1YKSA 4TTRA 4FCTA 4LUCA 4DVGA 3LW8A 1S9DA 4ZIRA 3WMFA 1IAQA 5EXTA 1B23P 3QSYA 4GRAA 3U2QA 5P21A 3UATA 5DISB 1CULC 4BZXA 1J70A 1SQ5A 2C9YA 1XCGB 2OBMA 3NTUA 2D7DA 2Q21A 4IHQA 3I1FA 1XB2A 1NVUQ 1TUIA 3JZMA 1CRPA 2CJWB 1SXJA 4QG7A 1JI0A 4B2LA 5LPNA 3I5YA 1UEJA 2CHVA 1G16A 1CR2A 5EE1A 1GTVA 1W44A 2YWHA 2YC2C 5G3ZA 5L3SB 1Z0IA 5IK2A 1NMXA 3BBPA 3I72A 2Z83A 3RWOA 4V0ME 2IC5A 1IHUA 4QXAA 2CDNA 2KBEA 3ZQJA 4NCIA 2QMOA 1VIYA 3AVUA 3FVQA 3EA0A 1S4QA 3QG1A 2W0SA 4HDOB 2E87A 1NN1A 2PCJA 4NTZA 1XTSA 4FCWA 4DLZA 3KUDA 4ZDJA 4JJZA 1RC8A 3RS2A 2W6ID 2J0QA 3ZVNA 4MYHA 4LOAA 4DBLC 4LC1A 4Z8XA 3OFNA 4D26A 4D0GA 3H4MA 3MCAA 1RPZA 2IBMA 4B47A 4IW3B 4KSCA 1KSGA 2C96A 1JR3A 2BHRA 3P27A 2VHCA 2ZI7A 2PZEA 1XX6A 3K53A 3THWA 3GLGA 2QROA 3KB2A 4XOIA 2QA5A 2IYZA 4R9UC 4ZI3A 2A2ZA 1GL9B 4I1OA 4M1MA 1VHLA 2ZPTX 3NKVA 3CF6R 3CWQA 3A1SA 3NBZC 5HTKA 2IX3A 3K70B 2NGRA 4B3GA 3OZXA 4PANA 1E2MA 2OAP1 1MH1A 2A5JA 1N6RA 4DRZA 3G82C 1SHZA 4QBHA 1E79D 3OHMA 4C9BA 4GP7A 1KI3A 3Q85A 4AC9A 2AKAB 4M1YA 3TW8B 1E0SA 3EPLA 2G77B 3R7WA 2QMUA 5JRZA 3V4FA 1G4AE 3WBKA 1NSFA 1E2IA 1XNJA 4B2PA 2JLXA 2NOAA 2CCGA 1ZRHA 3ZH9B 2FV8A 4C30A 2GHIA 1KI7A 4NYMQ 3K0EA 1E4VA 4ZDKA 4DIEA 1IN5A 4D4LA 4R98A 3A8TA 2IYTA 1QDEA 3C16C 4OHWA 1R7RA 4HLUA 4XTCS 3TKLA 3T61A 1VG0B 2QGZA 3TVTA 1CTQA 1FMLA 1BOFA 1N6NA 1Z2CA 4XVRA 2QE7D 2OT3B 2R62A 4HLQB 4TL9A 5JI3E 3MG9A 1G7RA 4QOSA 3L82B 1E2FA 1XEXB 4LJ5A 4NDZA 1BS1A 5J4LA 4V0LA 3DZ8A 3SHFA 3U3KA 3T1QA 1U94A 5EJEA 5KDLA 4P0TA 4MGYR 2WICA 4FMDF 2D06A 1HEIA 1KKMA 2O52A 3GLFA 3I5XA 3D8BA 1UEIA 1CIPA 1RRCA 1HQCA 1E1QA 1G17A 5C46F 5JLJA 3AUXA 1G64A 4MRVA 4PAQA 3CUEF 1ZM3A 1E32A 2QU8A 2ODWA 4NHOA 4TYWA 4GNKA 4DT1B 3PITA 1P61B 4QNMA 2G6BA 5TV2A 3EIQA 4G1UC 4MRNA 4TMWA 2ECKA 3K09C 4ZIRB 2ZETA 4DLRA 1AA9A 4RD1A 1U9IA 4GZLA 4A2QA 4GBMA 2ZE6A 4AYTA 1P73A 2XJ4A 3D3QA 2MMCA 3Q7PA 4A4DA 3TVDA 4JKIA 3CW2A 3PFIA 2D4HA 1FW6A 2AHOA 5CM8B 1G8YA 3QKSA 1Z3IX 3UG7A 2C04A 2FA9A 3KKQA 2VTKA 4JLKA 3SBDA 3E5HA 2NZ8A 1SXJB 4DLUA 2PEYA 3C8UA 3GJ8A 1A2KC 1OE0A 4IKEA 2ZS9A 3VR2A 2JJ1D 4B34A 3AF1A 5M04A 1LW7A 2P65A 3HU3A 1LF5A 3O8CA 3LXXA 1NSTA 2WWGA 3SFVA 3CH4B 4LHVA 3EX7C 3FKSA 2GXAA 3WYFA 3HDTA 1ZM4A 5B58C 3KZ1E 1Q44A 1GDDA 2IXGA 4Q4HA 3ASYA 3FPAA 2BM1A 1XJQA 3WNBA 1FTNA 4BASA 2WMNB 121PA 1E2JA 2QQ0A 5FOTA 1G7TA 3ONWA 4FN5A 3J81k 1TX4B 2RGBA 4GFDA 4O3MA 3EZ9A 2OLKA 2J7PD 5CB6A 1Z83A 2J5XA 2CHGA 3B1XA 3B1YA 3AM1A 5G40A 1YZQA 2OILA 4EKDA 5GVRA 3TUJC 2FFBA 4Q47A 2XAUA 2AL7A 1SULA 4AKEA 2B6HA 2YV5A 2XSZD 4A0GA 1NY6A 1S96A 4I1SA 3GLGB 3THWB 1XTKA 4PR0A 3R9IA 1NN3A 2D62A 4DDTA 3NBXX 2JJ2A 5EE5B 1OKKD 4CEJA 2WMOB 5F3WB 3NDBB 2RHDA 1E9CA 4GP6A 2ZRBA 4PSVA 3GJ5A 1P4SA 5KSZA 1GG2A 4ZV4A 1HT1E 4BFYA 4JVMA 4I1UA 4IJMA 4OJQA 3Q5DA 3HPRA 4JZKA 2VHTA 2QAGA 1Z47A 1U8ZA 2PX3A 4JT2A 3R7WB 1SXJE 3U60B 3M6AA 3PCRB 4A8JC 4C0HA 3DMDA 3FMPB 1VTKA 3DM5A 4IOMA 5AJZA 5JS7A 3OAAD 3UKDA 1T8UA 5FI1B 4GOXA 3GLHA 5AJWA 1W2HA 1U81A 1CLUA 1E2GA 4Q48A 1Q21A 3U7HB 1Z6TA 3I62A 2BMEA 3E1SA 3GJ7A 3KXKA 1CF4A 4KU4A 2ZRLA 4PZYA 4XVUA 4DCNA 4UXJA 5AJXA 3BC1A 4LX0A 4MQBA 4U02A 2DR3A 3QXCA 5SZJA 4RFSA 5ELXA 4XIGS 4FD2A 3KQLA 5FR2A 5FBQB 4LYAA 1U98A 4KFUA 1TQDA 2DPXA 2WSMA 5FBWB 1IXSB 1AGRA 4M1SA 3NXSA 4UXHA 3GLFB 5TXGA 3WMGA 1GNRA 1R0ZA 3HWSA 3TSOA 5K8IA 1GL7A 3AKEA 3IEUA 2A5FA 2FPMA 1JR3E 2Q0HA 3ZVRA 1ZCAA 4JT4A 2QPTA 1FL9A 3B7GA 4D4JA 4RFVA 2GXQA 1CR4A 1WRBA 1TADA 2CVFA 5AWFC 3U3RA 2DFLA 1OFHA 4LV5B 3K70C 3VKGA 1ZP6A 2H17A 3UMSA 1KDOA 5FFMA 2NO9A 1XP8A 2IL1A 2NO7A 5EE0A 1UM8A 5KYKA 1TQ4A 2BMJA 2OBNA 2CEAA 4L4UA 1GRQA 2RH5A 4EFLA 4C2TA 3VAAA 2ZJ2A 4M8NE 2O8CA 4FW9A 2QGNA 1TEVA 3QKSB 3QNUA 2RKOA 4LJ8A 4URVR 1Q57A 1Z6AA 2C98A 5H68A 3A4MA 2FFAA 1G5PA 2ZRGA 2ZROA 4D82A 3NC0C 1KI9A 4DSUA 3ICQB 4NYJR 2JLWA 2N42A 3FFAA 1K8RA 2QTHA 3K9NA 3KDSE 4Q19A 4EJSA 5LB2A 3PUZA 2GZDA 4M9XA 1HYQA 4DLWA 4V03A 3R20A 5GJWC 4UNNA 2OE2A 3IPXA 4LJ7A 3VX3A 3ZS8A 1WBDA 4GI7A 2JLZA 4M1TA 3EA5A 5GVSA 4Q4HB 3VTKA 1Q1BA 3PENA 3V9PA 3B8HA 1OT3A 2W6IA 2DFNA 4M4SA 4UNQA 1MT0A 2P6NA 2CLSA 1GUAA 1SXJD 4ACBA 2B8WA 1QG2A 521PA 1OW3B 1XEWY 4Z1MA 5DE3A 4EPWA 3UMRA 4YONB 2E9SA 4OQMA 1W5TA 3VHLB 1OXVA 2WWWA 4Q7LA 4RY2A 1T91A 3I8XA 4HB3A 1EFCA 4WZBE 4PHTA 3GLFE 2ZVPX 3OEED 5L3QA 3LFUA 1EG7A 2ATXA 5IK2D 3B2EA 3N2EA 3TR5A 4WW0A 1P9WA 4LK2A 4Q5IA 3TR0A 3GEIA 4JL8A 4MA4A 2H18A 3CWZA 2P2LA 3BFKA 1VHTA 1OV4A 3D6TB 4L9WA 3RHFA 2FZ4A 1NP6A 3IILA 2BCJQ 2WVJA 1IJFA 1FX0A 1KI8A 2ZRJA 4LDJA 5AUQA 2OSBA 1E79A 1IN4A 2H8KA 5FOUA 4B3BA 4B48A 3BAFA 2F7SA 1W5SA 2VSFA 3L0SA 3PUWA 3ZDQA 5GADl 3GFPA 3BGWA 1HE1C 3OFND 5IRCD 4B3XA 3P1JA 1IXRC 2GTPA 2ZTSA 5E4FA 2QAGB 2BEJA 2AXPA 4Z8YA 2G1KA 5JEEA 2CLDX 1JR3D 1XTJA 4BZQA 4DWJA 1R5NA 2V55B 4H1UA 1FQJA 1XTIA 4V0KA 3C4JA 3WYAA 4EAQA 1YJ5A 4LV6A 2DFTA 2GJKA 3AH8A 2JASA 5JHHB 4JLBA 1DAKA 5JJIA 3EIHA 3GLHB 4QBGB 1E2DA 2W6JD 3FE2A 2WJGA 4IOJA 5AUNB 1A1VA 1N5JA 2ZJBA 1Q1ZA 2VP9A 1CJKC 4FMCF 3QPUA 4AK9A 3SDZA 4D81A 1OF1A 3SOPA 2NPFA 4L16A 1YZTA 1NLYA 3EXAA 3TSZA 3PEYA 3SFZA 4CEHA 2HCJB 2X77A 3EW9A 1G3UA 2AXNA 2W00A 2VL7A 4ZCIA 2ZYWX 1G3QA 3RANA 3KJGA 1Z63A 5LD2B 5FUYA 621PA 3CNNA 2RGCA 1E1RD 3VKWA 2FPLA 2R8RA 4BFTA 4PZZA 1JQLB 2HCBA 3NC1C 4QHYA 3PUXA 3X1XA 4B33A 3WHLA 4LJAA 5EQTA 3ZLJA 2QG6A 3QXJA 3K0FA 3ADDA 4JYBA 2GF9A 2LCFA 2L0XA 5LB4A 1U0HC 4LRWA 2JIZA 4FWTA 2V1XA 5FPYA 5JWOA 3B60A 4OK5A 1E9SA 3NBYC 4PQFA 2QI9C 3EC2A 4LZZA 1VYVA 3AEZA 2HF8A 3UANA 1X8LA 3AF2A 1PJRA 2ORVA 1RKBA 4F93B 1Z8FA 2RAPA 1QHGA 1AGPA 3NH9A 2BKEA 5DHAA 3FFBA 3FMFA 1F2TA 4LHZA 3B6EA 1EWQA 4IRUB 4PPNA 5AJYA 4OQNA 4JLJA 1YRBA 3FOZA 2O8CB 3FHCB 3SJZA 1Q3TA 5DHFA 2C77A 3BJIC 1RZ3A 2RMKA 1T8TA 1TQ6A 3U44B 2WV9A 3O8RA 3TQFA 4TLEA 5KNBA 1OH6A 5JJLA 4HLUC 3GLHE 2FNAA 5DO9A 2HYIC 3Q5EA 2WJJA 4JMPA 4X8HA 1N0VC 2KJQA 3RWMB 2NTYC 3IIJA 4EJSB 3MAAC 2ORWA 3EWSA 1W46A 3KL4A 2F6RA 2HUPA 4IDPA 4G3XA 3ADBA 2WPDD 3IO5A 5JCPA 1TPZA 5CLLA 3ND8A 2A3RA 2X2FA 2ZITA 1BMFD 2RGEA 4PXAA 4A0RA 5DYGA 1DS6A 1ZNZA 2AK3A 3ZIAD 5TMPA 5L3VA 1E9BA 3K8YA 1W48A 2QORA 2V6JA 4KSBA 4B6EA 5L3QB 1RYHA 1A7JA 4JS0A 1QVRA 4EQ6A 2VYFA 3FKSD 1KO5A 3BK7A 2UVQA 2ASEA 4MYTA 1T0HB 2XSZA 4Q9IA 5F9HA 2WJHA 2ZS8A 1PV4A 1XJCA 1C4OA 1AK2A 1NVXQ 2YNMA 1JR6A 1U9IC 1OKKA 3GJXC 4BRWA 4JIMA 5FBLB 2A5YB 2ZSFA 4DEXA 2GZAA 3LBIA 2ZYUX 2QT1A 1FX0B 2JCSA 2WKRA 3I73A 5K8UA 2IS6A 3L8ZA 4TL7A 1QHHA 3AKCA 1SKYB 2BBOA 2UKDA 4GOKA 1RIFA 4QM6A 4F4IA 4N0DA 3PG5A 2O8DA 5EE9A 3OAAA 1OHHA 1W0KD 4UNPA 3BH0A 3W6OA 2G0NA 4CDGA 2Z6VA 1I4DD 2ZRMA 5EZ5A 2QTFA 1E2HA 3B85A 2VF8A 1GSIA 1MKYA 1N6LA 1S3SA 2IYLD 3EWAA 1GOTA 4M1OA 4QJ3A 4CW7A 1GKYA 1SVIA 2O5VA 4A0HA 1J8YF 3RAPR 4B35A 3T35A 4KV9A 2YYZA 1FP6A 4F4JA 4TSFA 4ON9A 2HV8A 1M7HA 1OIVA 3LXRA 1HUQA 4OI1A 3ZD6A 2V1UA 1E2QA 1EWRA 1LVGA 5EUQB 4BFUA 4KI0A 1AS2A 1FP7A 4HB0A 4CEHB 4PHFA 2XZPA 1IY2A 2GAOA 4W7SA 2V9PA 5CK4A 1SVKA 1X8KA 2BBWA 5KNDA 3F0TA 4ABYA 2IWHA 5HKKD 1FQKA 4B32A 1G5TA 1KI1A 2GAAA 1CR1A 4TQ9A 5BYKA 2NO1A 2KSQA 1CU1A 4G5SA 3UPUA 3HPQA 3W5IA 1ZM2A 4MUAA 2OXRA 4XH9B 3K0FB 2WJVA 2W83A 1Q1QA 4U5XA 5KSOA 4URUR 2ZRPA 4IOKA 5D3MA 4US2R 1N5LA 5B57C 3DPUA 4GL2A 3CM0A 3DKVA 3T34A 1E94E 2JLSA 4LBYA 1XFAA 4Q4JA 4Q7KA 1IXZA 1UPTA 3FMOB 2XGJA 3RC3A 2J46A 4HZUA 2ZSDA 1PLKA 2YOHA 2QP3A 2B8TA 3RDPA 1F6BA 3Q9LA 1F2TB 3IEVA 1OIXA 1SKYE 3OESA 2QAGC 4XD7D 3KQUA 2R2AA 4LJYA 4YC7A 1E2LA 1ZUIA 2PT7A 1JNYA 1NIPA 4B74A 2QM7A 3QQ5A 1VYUA 2V3CC 4GDFA 3DDCA 2JLQA 1KK1A 3MFYA 4HAUA 4BLTA 4Q1CA 2ZRNA 4HI0E 3K0CA 1PUIA 2QMHA 3AUYA 2ZJYA 1ETUA 2GVDC 3QKRA 4B3DA 2IYUA 4NBSA 5C2JB 3AVXA 3R8CA 4L15A 1JAHA 4TYPA 5DGXA 1T0JB 2PLFA 3EZ2A 4LBWA 3MLEA 3LQRA 1A5TA 1AIPA 4L5BA 4XVQA 1Z0AA 2ZRDA 2C9CA 3AVVA 2EYUA 3QG5A 5EE3A 5LD2C 1UFQA 2LKDA 2J0SA 4XTRA 1Z0JA 3MWKA 4C0KA 5FPTA 4QBFA 4OK3A 1R0XA 2QRZA 1NLZA 3OEEA 1Y3AA 2VP0A 1KDPA 4MRPA 1P2TA 1W47A 3T12A 1N6PA 4EFMA 4BGDA 3HR8A 1IM2A 2O0HA 1OFUX 4KBGA 2QZ4A 4LYHA 4EQ6B 4DCTA 3ZYCA 8OHMA 2OG2A 1GKIA 4JLVA 3U61B 4Y0AA 3KKPA 1GIAA 4PC6A 3TQCA 4QRHA 2PZFA 1UKZA 3D7MA 2QENA 4HB2A 4HAZA 3NHBA 4LSGA 4NL4H 2BBSA 1WQ1R 3W34A 4DCSA 3QI2A 3AVOA 3EG5A 4J0QA 1KI6A 2IHBA 4Z1MD 4HDCA 3P4YA 4EPRA 2VSXA 4UJ5A 3U5ZB 1G291 1NJFA 1QHHB 4PO9A 3OIVA 1E96A 1ZYUA 1I4TD 2OXCA 2RGDA 1G6HA 4D4KA 5DN6D 1TU4A 1Z6GA 3CH5A 1R4AA 3LO5A 1XMJA 3QJYA 3W6NA 2O8DB 1N5IA 2HXSA 3KUCA 3OIYA 1CJVC 3MGCA 1Z22A 4RD6A 4Q9JA 4A6XA 5EP3A 2IS2A 4E5UA 3CR8A 4PPGA 2BEKA 1YZGA 4RD2A 2W6JA 4NZYA 3H86A 4XJXA 4EJSC 2QMEA 2X1VA 3MJRA 1QF9A 3A1VA 2HXYA 3EZ7A 3AVPA 3QE0A 2CK3A 2AKYA 1TNDA 2VHUA 1W49A 2ORIA 3IIKA 1XPUA 2OCBA 4UNSA 1KK0A 1Z2AA 3SZRA 3NEYA 4FCVA 5H8WA 1P75A 1UDWA 3BH6A 2GBLA 1A2BA 3PIRA 1TF7A 3LW7A 4M22A 4NONA 1E1RA 4US1R 4ZO4A 2WJYA 4Q9KA 4BWYA 4IEEA 1NKSA 3BB1A 3BERA 2VF7A 4Q7MB 1GZSA 4ZI2A 3Q72A 1XZQA 2OEPA 1GP2A 3U6KA 2CMKA 1C9KA 2R9VA 5J4HA 3K0AA 2HT1A 2WKPA 2BDTA 1UBFA 2R6FA 5JS8A 3T1OA 1US8A 1XMVA 2WAXA 4D6PA 4QBIA 2AD5A 4OJKA 1G7SA 5KO2A 3BS4A 5D3MB 4IXNA 3AKYA 2VSOA 4AKGA 1Y63A 5J47A 2HT6A 3AGQA 1B0UA 2ZR9A 4Q4LA 4Q4JB 2CVHA 3IHLA 3RS3A 1HH4A 1QZXA 2CCKA 4IVPA 2ZI3A 5K8TA 2XNSA 4HZUB 1OJLA 2ONJA 3AVQA 2NIPA 3KKOA 4MYCA 4MDEA 1G1MA 4DLXA 4M1WA 4LYJA 1YU9A 1SVLA 1ZM7A 1OLOA 3VKHA 1ZD8A 1IJEA 3T5DA 4KODA 1BYIA 2A5GA 3QVVA 4TQAA 4RJLA 1RW4A 2JIZD 4URXR 4LHYA 5KUTA 1LTQA 3LVRE 4LYFA 5JCZA 3CO5A 4AURA 5HZKA 1JPNA 3SC3A 3PV0A 3U44A 2WOOA 3IIMA 4Q9LA 4KITB 4RZ3A 3QKRB 5D3QA 4OHXA 3AB3A 3RVBA 1BIFA 5CDFA 2WPDA 4NE2A 2CBZA 2IS4A 2RCNA 2P6UA 4RZXA 3BE4A 3K1JA 2V7QD 2BVNA 1BMFA 3C15C 4WOPA 1YR8A 3L0IB 2NO6A 2WWHA 2Q3HA 3UIEA 2NZJA 3ZIAA 3CF2A 3LBNA 2EFDB 2I3BA 3KXLA 1LS1A 5EP1A 1X1SA 4C0QC 4BZPA 1VYTA 4JLDA 2ZI6A 1E2EA 5HE9A 3U4QA 2VRWA 4NYJQ 3HJNA 3TJZA 4PFSA 5HPYB 2FDCA 4TT3A 1Z07A 3F3YA 5FTMA 2QSYA 2WAYA 1QBKC 1WXQA 2W58A 3AKDA 1G20E 1LV7A 4YDHB 3ADCA 2RGNA 5B30A 5UKDA 3GEHA 4HB4A 4ARZA 3THXA 2J0UA 2PZGA 1H65A 3O8DA 3LX5A 2OLJA 2PX0A 1Z28A 3MWLA 4S2EA 4JBXA 3PXGA 3W3AA 1OXTA 1XEWX 2WOJA 4QKQA 1S2MA 5EXPA 3RSOA 3LBHA 5KTYA 1RE0A 1KI6B 4MKHA 1E6CA 1M74A 1X6VA 3WP0A 4I1VA 5BQ5A 3EPHA 1R2QA 4C0JA 3PEUA 821PA 5FOSA 1W0KA 4AYWA 2FFHA 1FUKA 4Q9HA 1BYUA 1ZU4A 1MOZA 3AVWA 1DBSA 4AY2A 1QRAA 1NMYA 3P26A 3EARA 4DDUA 1CBUA 4IXMA 3B82A 4B2IA 1N6IA 4OI4A 3REGA 4BPBA 1KAOA 3OF5A 1KGDA 4UJ3A 4OL0A 5CJ2A 1WF3A 1R8SA 3CONA 4P33A 1NNEA 2BJWA 4M9SA 4NU0A 4BFXA 1K5DA 1N2CE 2HLDD 4FWIB 4KVGA 4PTLA 1IQPA 4M2LA 5HKKA 2VBCA 3AQ4A 1M6NA 2R6GA 1NG9A 2Z0MA 4AIIA 4EDHA 3LQQA 3BB3A 1OHHD 1UDXA 1PUJA 5ANRB 4PC7A 1U8AA 3H84A 2GA8A 1OXXK 1XBTA 3E2IA 2ZYTX 1KO7A 1N6OA 4LBVA 3CRQA 1MO3A 3LLUA 1E9AA 4RD4A 4DXAA 4DHEA 2BMFA 1G3RA 3K0AB 4QM7A 2PJRA 4DCVA 4Q01A 4TSFD 4PO8A 4P32A 1US8B 221PA 1VCNA 1NIJA 2FSFA 1W4CA 1H8HD 4WZAE 4DSNA 1KMQA 2D3WA 3JVVA 1JEEA 2A7QA 3HYRA 5LDDC 4XSGA 2WBLC 5HR5A 4U7DA 4WXPA 2A78A 4YMUA 1E4YA 3DM9B 4XD7A 2WWYA 1XU4A 5L8VA 1YZUA 5E95A 1II8A 2EQBA 2VP2A 1Z08A 3TW4A 5JI2E 4JVNA 1G5RA 1T3LA 4I4LA 2OHFA 3MD0A 5G41A 1NBMD 2AR7A 1D6JA 4CYMA 3BOSA 5BWMA 3TBKA 3A58B 4A82A 3GLGE 2VHJA 4IFBA 4CVNA 2GK7A 1M1YE 1YRAA 4IVQA 3LVQE 2PMDA 3BRWD 4HLDA 1E9FA 4ZDIA 2H92A 4WIAA 4ZPXA 1QHXA 3QY0A 1N0UA 1ZMXA 4FI3C 2FOLA 3TLXA 5JSZA 1P7CA 2J41A 1R5OA 3X1ZA 721PA 1D2EA 4LI0A 1SVMA 4JKYA 1IOZA 2WSSA 1KK3A 1S3GA 6Q21A 1R0YA 1HQYE 1KO4A 3SYNA 2D2FA 3VU9A 2TMKA 3SQWA 1L2TA 4GMXA 2J45A 3GJ6A 5C1BA 3BFXA 4JJKA 1M2OB 5H1YA 3AP1A 1X86B 4HAVA 1NN0A 3WP1B 3DOFA 1J7KA 1KNQA 3EZ6A 1GNQA 4PO1A 3U4QB 2G0TA 3JZAA 3HR7A 2XEXA 4P31A 5EUMA 5FPSA 5FR1A 2C78A 1PLLA 4HLCA 1CS4C 1G8FA 1SVOA 4ZDWA 1MO6A 4O25A 3DMNA 1FNMA 4ARZB 3THXB 1UJ2A 3KQNA 4PPQA 4Z54A 4KHZA 4OKSA 1OYWA 2OFOA 3UK6A 5DSZA 5AR1A 1UBCA 2B21A 4NCJA 5DLQC 3FHOA 4UNRA 1EGAA 4B75A 1P2VA 1OYYA 1QHNA 4QHTA 1U2RA 1II0A 1OFTA 5DN6A 4EFNA 4BLOA 3EIEA 2GXUA 4PC3A 3CBQA 3QOFA 2UZIR 3CX7A 2SHKA 5BN3A 4GT1A 3B1WA 3CRVA 2IUSA 2HEIA 1V5WA 1EESA 1XRJA 4TQUS 3K0CC 3LY5A 3NHAA 4MKIA 3PQCA 3S1AA 4TL6A 1S1MA 2JAQA 4XWKA 2ZI5A 4N3NA 1IN6A 3CZQA 2GCOA 4DZZA 1PVOA 2CL0X 2HJVA 1N3BA 2IHYA 1OH8A 5BN4A 2ZUBA 3AF0A 4JBYA 3AGPA 5CDFE 1UADA 1U99A 2IYSA 4DIDA 4A36A 1SXJC 3BFVA 2QT0A 4HYYA 4ACAA 1DPFA 3CNLA 1W7AA 3ICEA 3ZJYA 2G88A 3T5GA 5DI3A 3UWOA 1DAMA 3C14C 4NKRA 1EFTA 1IONA 1GILA 3DHWC 4FINA 1X3SA 4ILEA 1ZIPA 2C03A 2R6AA 3A1TA 3ADKA 4N1AA 1F5NA 4RCYA 4F38A 4OK6A 2PL3A 4KFSA 1DEKA 4TYNA 1ZW6A 1E3MA 1DG3A 3OEHA 1IN7A 1WCV1 3QKUA 1TF5A 2BJVA 1KMHA 3HYTA 2CK3D 3K9HA 4LC0A 2HF9A 3LA6A 5HCNA 4D2IA 2FFQA 1KO1A 2FGKA 3NH6A 5EP4A 3A6PC 3O8BA 1FMJA 4MITA 4CZ2A 5G53C 2HJGA 1HE8B 1KZ7B 1Q12A 4RFSB 1P6XA 2GJSA 2ONKA 2NO0A 1VPLA 5IHPA 2ZRAA 4A1FA 1TF2A 2DYKA 1P2SA 3B78A 1XMIA 2Q9CA 2QM8A 4KLNA 2EVWX 4C0BA 1M7BA 4PSKA 2GRJA 1II8B 3GLIA 2GJ8A 2VLIA 1TUEA 5AUPB 3LDAA 2WWFA 4W5HA 2XTZA 1YVDA 4KCGA 1E9RA 3KX2A 3X1WA 5J4YA 2R65A 1EFRA 1ZCBA 3IPYA 2J9RA 4XSHA 1ODFA 3MWYW 2R6DA 3THYA 1N5KA 3GPLA 5KSYA 1PZNA 3IGFA 2FEMA 1KHTA 1Q3HA 5JSZB 3SNHA 2KI5A 1NLFA 1J99A 1DAIA 1JALA 1G41A 3QEJA 1ESNA 1EFUA 3VFDA 2V7QA 4HAYA 1RFLA 2QPOA 2GBLC 1UF9A 2WIAA 1KI2A 2GJ9A 2Z4RA 3RRNA 3IQXA 4HATA 4R7ZA 2AX4A 3VU9B 1QVAA 3R9WA 2FPKA 3LD9A 3FYHA 1VECA 2IW3A 4RSGA 5TY0A 2FGJA 3NWJA 4A92A 2HDNB 2OCAA 1WBBA 5KOYA 1JXOA 4C3ZA 2F1HA 4KFTA 1L8QA 4TLCA 1WE2A 2BOVA 2IA5A 2D74A 1S0UA 3WBJA 1G18A 4DC9A 1Z6XA 2RGXA 4L9SA 2QL6A 2QPAA 2Z5FA 5A5GA 5KPDA 2O0JA 2ZU0C 4DDWA 5FUWA 1BH2A 1XCMA 4JLOA 5CIWA 3WNCA 1OH5A 1GNPA 2C8VA 4QJ4A 4RZUA 2AWOA 3THOA 1Q0UA 1T9HA 2N1BA 3V00A 1G8PA 4CRWB 4MGIR 1QHIA 4ZKEA 4LHWA 1G8GA 1P62B 1XEFA 2OFWA 1X1RA 2D7CA 1SZPA 2NG1A 3MUFA 1W36D 1CJTC 4TT3D 1E2PA 3ZZTA 1MABA 1NVVR 2I4IA 3B9PA 3KKNA 1SKQA 4QGFA 1AJEA 2J0VA 1FPMA 2ZSEA 4D80A 3S1AB 1GAJA 1DAGA 4YXWA 4A8JA 4DLYA 2PLRA 3GMTA 4ITRC 5B2ZA 3RRYA 3RRMA 4B71A 5BXQC 4F91B 2REOA 2ZU6A 4K46A 1R10A 4AYXA 2ERXA 2GCOB 1KJWA 1NL3A 2HLDA 2ZJAA 3A36A 4OI2A 2XZLA 2RGGA 3I92A 3H0KA 3TAHA 1N0WA 1Q1EA 1ANKA 4CIDA 4ZCMA 1KDRA 3GJ0A 2ODNA 1E0JA 5TDHA 2WTUA 4ERNA 1KNXA 2OM2A 2P0EA 2BBTA 2WWXA 5DI3B 1JXMA 2C5LA 5JWRA 1Z0DA 4BECA 4G5QA 3KQHA 1XCPA 2FZLA 2H16A 1KTVA 3BB4A 1CEEA 2RHMA 4KLZA 1X8JA 1P9NA 4IDHA 4CT4B 4KAXA 1KAGA 3QEOA 2YJTD 2J1LA 3IKJA 2ZI9A 3N70A 3IO3A 4US0R 2RGNC 4F4CA 1KMHB 1H8HA 1WP9A 3RLFA 1GM5A 2FJUA 1EX6A 2AK2A 4JL5A 4QNRA 1D8TA 3WRYC 3PR1A 4A0FA 5FBVB 4A15A 3QF4A 4PAMA 1RJ9A 3EASA 1Z5ZA 1CXZA 3GQBA 1G6OA 3KFXA 2ODBA 1LNZA 2NQ2C 4G5GA 1DAEA 1NBMA 3GLIB 2ZSBA 1L7VC 3O47A 3AV0B 2ZAOA 3WY9A 2F1JA 2JDIA 5F2EA 4C0AC 4Q03A 1ZUNB 1J90A 4DLVA 1HT2E 2JA1A 4NMMA 4O0MA 5FOXA 3SU8A 5JFGA 1KI4A 3TSWA 1XJ0A 2C9OA 2YVUA 4LCBA 1G21E 1AQYA 1KY3A 3IDQA 3THYB 2ODEA 2IK8A 3DVLA 4Q18A 1FNNA 5DYIA 1DELA 4D4MA 4X8MA 1GWNA 2QNRA 4PC1A 4YQFA 5C4MA 2CLCX 1W4BA 3QKTA 4DLTA 2VP5A 2FH5B 2D2EA 4M0LA 1UBEA 3QPWA 3CPHA 4BQSA 2GJAA 4TTPA 3LWNA 2FWRA 5FTKA 2A5DA 3CRRA 2GF0A 3PVSA 2OO7A 4TMKA 4YDSA 2XOKD 1E99A 2XITA 3H1TA 4Q21A 2QBYA 1KOFA 3EC1A 4GPTA 1DTSA 1LFDB 2DY1A 2RGAA 1AN0A 3GEEA 5AJVB 2IS1A 3VQTA 1VIAA 4LJ4A 4Q66C 2P5TB 1T5LA 3WNDA 1YR6A 2FMXA 4NYIR 3A37A 4TLAA 1W0JA 3MMPA 3P4XA 1T6NA 1ZVQA 2QTVB 1XD8A 2X19A 3LLMA 4WAUA 2QP9X 2QQEA 2WSSD 4PQRA 3C41J 1KZGB 1E9EA 3C5HA 1YR7A 5KSPA 4C0SA 3CX6A 1DAFA 2F9LA 1VKJA 2G1JA 2F43A 1XPRA 2AFIE 2LKCA 2IEZA 1LY1A 4B3CA 1R6BX 4FMBB 4Y0VA 1KIMA 1MO4A 3RS5A 1E9DA 4IDQA 3KJHA 1U0JA 3T06B 3GLIE 1ELOA 4PX9A 2P5SA 2BM0A 4JLPA 1AS3A 2XNDA 3ECCA 1SHKA 3K9LA 1O3YA 1A4RA 3ASZA 4JLAA 1MABB 2WZQA 1OIWA 5IF9A 2AWNA 2EFHB 1H8EA 3L0OA 2PMKA 5JHGB 4A8JB 2ZI4A 3KXIA 1XXHA 1FTSA 2YOGA 2IEYA 2KE5A 3AF3A 5JECA 1TEXA 1UKVY 5EXSA 4K8OA 1WDTA 1ZINA 2F9MA 3CRMA 4M9ZA 3W3ZB 1KSFX 5KU1A 1E0AA 4LJ6A 1E98A 1TU3A 3IBYA 1P9RA 2ZANA 1OB5A 3RYTC 4Q00A 4OYHA 3QENA 3K9GA 5DI9A 5AUOB 2BWJA 3HU2A 2CE2X 5JJKA 1AZTA 4BLQA 4TMTA 3LNCA 1KYIA 2LWIA 3RS4A 1RYFA 3KB1A 2CNWA 4LWZA 2ZQ5A 1T3HA 3E70C 1XDBA 3MWJA 2N46A 5FUVA 1VG1A 4HUTA 1WA5A 2VP6A 3QF7A 1VDZA 4WA7A 3CB4A 4EPYA 3OIWA 2H57A 3B13B 3AP2A 2KB0A 2EFEB 4YLGA 3T1TA 2IF0A 4AWXA 3ZGXA 1NKTA 1EXMA 1JECA 3C7KA 3KTAA 3QF4B 3KKMA 1RJ9B 4M21A 4BEJA 3NVAA 3SYLA 3M0EA 4OBEA 2PJZA 2VIIA 1IN8A 1UKYA 5FUXA 2G9NA 1I2MA 4C7OA 2GETA 2J7KA 4IDNA 2IXEA 5TVKA 4K81B 2BV3A 3R9XA 2PT5A 2GKSA 3RC8A 2B92A 5LBIA 1G4UR 4B76A 4Q1BA 3MRSA 2OBLA 1XPOA 1XD9A 1ESMA 4CF7A 3OEHD 3X2SA 3TGPA 3TK1A 3FTQA 4DDVA 5HCIA 4DEYA 2ZSAA 2ZS7A 4W9MC 2IUTA 3FDIA 1SVSA 2GCNA 1TAGA 1COWD 3DO6A 3CNOA 2REBA 2DBYA 1VCOA 4QFMA 4UKDA 3B9QA 4A2WA 1D2NA 4JL6A 3WHKA 2XJ9A 1KJYA 2ZR7A 4H9GA 2P67A 5B64A 2Q3MA 4A2PA 4BE7B 4DUGD 2OCPA 2XB4A 1I4LD 2J59A 1TMKA 4CEJB 2MMGA 1RRPA 1OSNA 2O0KA 1DG1G 2PCLA 1CJUC 3FHTA 1ZC4A 3TNFA 3TUIC 4II7A 3A1WA 2RB4A 4P4UA 5CB8A 1DAHA 1I2DA 1VG9B 4E22A 2ZJ8A 2EWVA 3SJAA 5SZKB 4AKHA 5HZHA 1P5ZB 2GWHA 1EFRD 1T4GA 2QBYB 2P3SA 2YZ2A 4QGHA 2WIBA 2YC4C 1A82A 1QHYA 5C18A 2FX3A 3VR1A 1E2KA 1ZJ6A 5F9FA 5FL3A 4JSYA 4TZ0A 1KK2A 2ZE7A 1G19A 4X8OA 2BC9A 1LS6A 4GZMA 3BD9A 2ZVQX 2IYVA 4MKGA 2AD1A 5CM9C 2G83A 1DOAA 2F43B 4JYCA 4Q4AA 4LPSA 3JVUA 4P4TA 2QUZA 4X8LA 3SJCA 2JLYA 2KBFA 1KY2A 4TWZA 5H70A 1JEDA 1NBME 1NI3A 2FF7A 4KXFB 2KWIA 5J4VA 2ZIAA 4BFZA 1XMSA 2BMDA 3W5JA 3I8SA 3RRZA 2I1VB 3RSLA 5HE8A 2ZE5A 3MJHA 2H5EA 3B5JA 3AVTA 2IWRA 3LV8A 4GMDA 1P3JA 4U00A 2G3YA 3X1DA 2O8FA 2DWPA 5KNCA 3U3OA 2MSEB 2XX3A 4M9QA 4UQOA 2CL6X 1XXHB 4JVLA 4A9AA 1NJGA 1ZC3A 1KSHA 4B43A 4DKXA 1CKEA 4JBWA 1F60A 3P20A 4V02A 3SJBA 1GL6A 3U6BA 5C4GB 5J5CA 1ZD1A 4UXIA 4M53A 3T15A 2GESA 4P4SA 1G9XA 2EWWA 3W90A 3PEWA 4PPFA 4KYUA 5CYOA 1WMSA 1XD2A 2MSCB 2Y8EA 4NH0A 1FOEB 3VHXA 1ZNYA 1DADA 4MDFA 1ZU5A 1G3MA 1J2JA 1NY5A 3NDPA 2XXAA 3GFOA 4HAWA 1G3IA 3Q3JB 2E1RA 4KFRA 1JJVA 3N2IA 2ZXUA 3RABA 3T1VA 4YXWD 3FMIA 5IT5A 2ZR0A 2JJ8A 5JEDA 2ERYA 2BKUA 2AN9A 4URYR 2A9KA 3L43A 4CEIA 4DJTA 3B1VA 3KFVA 4Z51A 2ZREA 3TUZC 2XTNA 5J4KA 1U90A 1QG4A 4D25A 2QP4A 1Q22A 5JBQA 4MH0R 1MRSA 1YZKA 4EIWA 1K5GA 3KTAB 1NG1A 2JGNA 2IYRA 1OH7A 3ZD7A 4KYIB 4E09A 4IVRA 3B1ZA 4XWOA 5KDOA 4C7OB 4B3FX 1KSJA 4JVSB 3VR6A 3SEAA 1YQTA 1D9ZA 2ZRHA 3TMKA 2Z4SA 4M1KA 2DWQA 2Q3FA 3U7EB 2VO1A 5JZVA 4BLRA 4TMVA 1K6MA 3SS8A 1NN5A 4NYMR 1J8MF 2JLRA 2QY9A 3I61A 1R8QA 3GP8A 5SZHB 4Q7JB 4POAA 2EU8A 2C99A 2A30A 1NMZA 3CPJB 4S35A 2CXXA 1XXHE 4FMDB 2CE7A 3U7GA 4HZIA 4IOLA 4XWAA 1JBKA 3K0SA 4AG5A 2IF2A 3K70D 1CRQA 2V6IA 5DH9A 4RD0A 4DLSA 1WB9A 2ZJ5A 1YZNA 4G5OA 2GILA 4I99A 1BO6A 3A4LA 2ZM5A 3CR7A 5FBRB 4ESVA 2JDID 4NP6A 2XOKA 3BWDD 5A4JA 5FL7A 4URWR 2XZOA 3KJEA 1U8YA 4PHGA 3QUSA 3OE7A 4RKFA 5CIQA 2WWIA 4L8GA 2GEUA 2V54A 3PEVA 2GCPA 3I4LA 4E03A 3WMEA 1JB1A 2YKGA 4MGZR 1UBGA 3I3SR 1L4YA 5FH9A 2IXFA 4FIDA 2ZRCA 2W2XA 1HA3A 3SI7A 2YINC 1TTTA
chains in the Genus database with same CATH superfamily
2VNKA 3M8KA 4IQ8A 3RC9A 3F3MA 4S0ZA 3QU4A 4TTVA 4X66B 5BYJA 2ZCUA 5J40A 1OLSA 3UJNA 3WBFA 2QB5A 1SZCA 3EAQA 4K2AA 5AK3A 2AFHE 5JDIA 1UPUA 3UUFA 1QH1A 3OKFA 4MW4A 4FX2A 4YP0A 5K8LA 1EG2A 3ZZ0A 1LXCA 1QLJA 1S9HA 3RS8A 1QP8A 2DX7A 3UF0A 2AZ4A 1JEOA 3KVYA 2QT9A 5CT4A 4QGGA 3BQMB 1X15A 2SICE 1L5KA 4DMLA 5IF3A 4IHJB 2FPPA 2JEYA 2JGFA 4LY6A 4P8RA 1E69A 2DWOA 4RWZA 3BT7A 2QSJA 3L0PA 3T54A 3OZSA 2X2PA 1XO1A 2J0UB 4MI1A 3T5TA 2VHQA 3F6YA 2O8EA 4H1VA 3ZS9A 1MZVA 4LRQA 2E4UA 3OLCX 3WQQA 1D0SA 3LY9A 3W5UA 5LYJF 1IE3A 1N6HA 3GD7A 3H04A 1TU0A 3O95A 3E5NA 2O1SA 2PNJA 3IHWA 4HDSB 2RSLA 4GH5A 4E6PA 3DZDA 2HU2A 5KNBH 3R8FA 3P0EA 4QC2A 4ZQCB 4O4IF 1II9A 3DT8A 1PX0A 3ANXA 1HKHA 4LGMA 3SN6A 1U3WA 2ORED 1XD2B 1T5IA 3QXXA 1UMBA 1IOWA 1DUSA 4WZZA 1AKYA 2F3TA 1YZLA 4DB2A 2B1RA 2V45A 4B40A 5CLFA 2OOKA 3A10A 2PH5A 4D9IA 4F5WA 1GFIA 3T4PA 1CP2A 3CZPA 3QXHA 2H1LA 5JH7F 4OBXA 1G2PA 4RD3A 2PVSA 4E07A 2OHJA 5IKXA 4L8FA 2QN9A 2H1WA 4OIFA 3BMNB 4U0KA 2ZPUA 4Y6LA 2YHSA 3HMQA 1BMTA 2QD5A 2VYND 4IIFA 1W1WA 3T7DA 4EEKA 1A9ZA 1DNPA 1ZY2A 1M73E 3F2VA 3RC7A 2P6RA 2IYXA 2E4ZA 1X7XA 3GRYA 2CDBA 5FCDA 4YPFA 3V6MA 3USZA 3W8RA 3L6OO 4N5HX 4QUGA 3WK4A 4FB5A 4WQMA 2JI7A 3VX4A 3JQ8B 4MJLA 4YUAA 2Y66A 3ZCQA 4K7JA 1EFPA 2D59A 3TQOA 2WKQA 2I67A 3EDYA 3T3IA 3HGTA 1OVGA 1USGA 3SP1A 5K3AA 4IDOA 5DBIA 2NNWB 4MUBA 3TQRA 3A4NA 4JV5B 4KHPB 2NMVA 4FTWA 1NR5A 4FYYA 4GXTA 2OB2A 4U5QA 2VJLA 1YBHA 2CNWD 4CF3A 4MQ5A 5IKPA 3BH7A 2FG7C 2YXPX 3B36A 3ZDEA 1ABFA 3I5UA 3IQFA 3OLVA 1XF9A 4URZR 2OGWA 4A0SA 3A0UA 1PT5A 3NNDA 3ANMA 3PUYA 1CHNA 4GLJA 1YBFA 2NUTB 4D56A 4H0CA 2AZMA 3T3GA 5SV2A 2ZT6A 1FDRA 4BZZA 4JI3B 2I87A 4TLBA 4CFYA 4OQXA 1HGXA 2P1DA 2GK6A 2DHDA 5M5BA 4I1RA 4EPVA 4BDTA 6CHYA 1DO2A 1SRQA 2I7DA 4Z9FA 2ZATA 2JEOA 1QMPA 3T41A 1HYGA 3K09A 1UC8A 2FSHA 1ZNWA 3QHAA 1RAIA 3O7MA 3CIOA 3NHKA 4BO4A 2P2ZA 4RCZA 1T2DA 4O4JA 4MRSA 2CSUA 1DC5A 1NRJB 3L2OB 4B3TB 3WV4A 4TLMB 1EQAA 1L4UA 2J3KA 3AK4A 1H2HA 3HBMA 3UANA 4DB4A 2YWEA 3SZUA 3FWYA 4I3FA 5CXQA 2PZBA 1VG8A 4U6SA 1FS5A 3HXQA 2B8NA 3FB4A 2PMWB 4WJLA 1QVVA 4REQB 1X7WB 3LC1O 2GRAA 2JFBA 1P1CA 2IUUA 4KRXA 4QTYA 1TLLA 2FEWB 3WRXC 1P60A 2FN9A 5B53A 1SFRA 5CITA 4JSTA 1S2DA 2O2IA 4TQGA 2AEEA 2WHXA 2IXAA 3TCKA 3ZG6A 1CYEA 1TL7C 1F2UA 1RC0A 5TRTA 4H7PA 1RRGA 1KZ1A 2HU8A 3REFA 4U3JB 4V0MA 4OFZA 4HRXA 3V1LA 3QOXA 4P0QB 2GEDA 1KZ4A 4PAOA 4W5JA 4AXBA 3TH5A 4FDMA 3KQMA 5AM4A 4CL2A 2W6PA 3Q7SA 2ID8A 1RS0A 1DC7A 1VSUA 1IEWA 1R4NA 2IYAA 4JCOA 4UVIA 2FJ0A 2CV0A 2EFCB 4J0IA 5ITVA 3L77A 1MO5A 1P2UA 3BG5A 5C7LO 1NVKA 3C3XA 1XAIA 2PTHA 4LJ9A 1F51E 2MINA 3GAZA 4K86A 1E2NA 4AG6A 1IY0A 2X86A 1Y7LA 3M49A 3TLJA 3ZCPA 1SGWA 2JLVA 4NCNA 5ENDA 5A9TA 2A1TR 4FT4A 1FX1A 4OP1A 2BFPA 3CUUA 5IN4A 4OAQA 5HQTA 5C53B 3U26A 3G8AA 4Z4GA 1T9AA 2O8BB 2M9MA 1PZMA 4PZEA 4YP5A 1MR3F 5KDDA 2PH1A 3P9IA 2P9EA 1K98A 2OV2A 3P2OA 4BQQA 1SB8A 2OSVA 3IERA 3RU3A 1TO1E 2RHWA 1CWUA 3EGWA 4ZI5A 5FOWA 5KQGA 1WXIA 3SJ7A 4CDMA 1FA9A 2YOFA 3I34X 3WK9A 2O0LA 4OHPA 2NT4A 2G0AA 2Y99A 2JIQA 3C7CB 3FFXA 4KZKA 2H52A 4L73A 1MBZA 5ALOA 5FI0B 1U3TA 5FWXA 2QDXA 3TF5A 3DEHA 3RR2A 5ALNA 5CFLA 5CIYA 1DVRA 5IKMA 2H06A 2VJAA 4RX1A 4D41A 1XQVA 5A4DA 3AJ8A 5C3MA 1RZRA 1RWPA 5ILGA 1CNMA 3CW9A 4KQMA 4IDFA 4MWDA 2X8AA 2XYGA 1AS0A 1G6Q1 2C83A 3NIBA 4N0QA 4BX2A 4HSEA 3VPHA 3DLHA 1UOQA 1H42A 1MPTA 5DXAA 1P7WA 2EFYA 4F6RA 1TVEA 4KQFA 4BFSA 4RGYA 1B3BA 1QF7A 2XE6A 3F7TA 4OEHA 3OIUA 1DL5A 1F2VA 1BDJA 1TAHA 1YMVA 2R00A 2VQSA 3DMYA 1EU1A 1W6UA 1OFIA 3EK2A 2J7PA 3WE7A 5I7EA 1OB2A 1GU7A 2GXSA 2Y6UA 4MKFA 4X7RA 1PL0A 2QJOA 2QTZA 5DHRA 5K05A 1GPH1 1HY3A 2ZK7A 2FQXA 1DJNA 1RPJA 4PG6A 2R48A 3QRWA 2BGGA 1YDWA 3QBDA 5H3LA 1ZVKA 2EYQA 2VG8A 3E82A 2CWDA 3EXFA 4YRJA 3W7AA 5E6RB 3GEGA 4RZ2A 3A9TA 2NPIA 1YUNA 3GZNA 2REXB 1VJ5A 2CB0A 2W4QA 4JLMA 3A1EA 3NG1A 4JFAA 2IVFA 2B0JA 5LOVB 1YD7A 3G3EA 2Q9BA 5FPHA 4PHHA 2BFFA 5A5FA 4R71A 3HCPA 1S3IA 3T3DA 1V3TA 1K9VF 3MAGA 3GHYA 4ZO8A 4B6GA 3GCGA 4BCBA 4C0LA 5KTKA 1WOMA 3QBTA 4FMCB 4OHUA 4NCBA 2WFZA 4RV5A 1BE0A 1MIOA 1OI2A 3E6AA 2NZ2A 2RK6A 5ALGA 2P11A 4CDNA 1AZSC 1E8DA 1ZLYA 2ZJ6A 1VPDA 2UZ3A 2IU6A 1I6WA 4UBIA 3QTTA 4IDCA 2D00A 3RNLA 5GJBA 4KO8A 1WPQA 3NXKA 2C1XA 3CF4A 5T3YA 1WUYA 5DHPA 2P75A 3KDPA 1LD3A 1O9HA 1ZSNA 4U2FA 2QRJA 2F3RA 2WJ6A 4JB3A 2GRUA 3KWMA 4TYYA 1QIHA 2OFXA 4G9BA 4MINA 4KO1S 4BASA 3V9AA 3IMEA 4D8WA 3SQMA 1LDMA 3V4OA 1V25A 2CXTA 5ALQA 1FU4A 2VJQA 4YJKA 4RVDA 3BXZA 1GPWB 4IEIA 1MV5A 2QXTA 5A2QA 3G2KA 4JP8A 2QUAA 3LKZA 1LJ8A 1ODSA 5AJUA 3CT4A 3FOCA 3PF9A 1D1QA 2R68A 3RUEA 4DCPA 3KLBA 4UQPA 1KZ9A 2O6HA 3EZFA 4O2RA 2R8PA 1X80B 3SSMA 3CPEA 3CB2A 3H8SA 4B8YA 4DIUA 1ABEA 4G84A 4EW3A 1VE1A 2EG9A 2GKOA 1N2ZA 3HUFA 3LTEA 4CTMA 4HWGA 2G5CA 4RL6A 3DH0A 1Q19A 3KEMA 2EFGA 4FFBA 4NEHB 4Z9YA 5A0FA 3QVUA 1Q74A 2ZUWA 1X0VA 3ABIA 1J5PA 4OHVA 4N76A 1OX4A 1GITA 4OP2A 3QELA 1CE8A 1ONBA 4PIPA 3MTJA 5C81A 4CKCB 1XWIA 4B6QA 1OA0A 5G0WA 4JLUA 3ZBUA 4B6FA 1P3DA 2P41A 3UAVA 1O58A 3MQ2A 5F2OA 2WP0A 2UZ1A 1JVNA 5DYYA 1SCJA 1G5HA 4IIJA 1ZWKA 4NPHA 3H9UA 4ZRNA 4CT5A 2WUDA 1YJAA 2YTZA 2XWJI 3O75A 4GZ5A 2BE9A 4U7TB 5EZ6B 3GARA 4DRYA 3HBAA 3E03A 1ZL2A 2XD9A 1HBJA 1T8YA 4R51A 5A3VA 2P7HA 3ZVMA 1I7LA 1OZ0A 2HN9A 1H0KA 3SR0A 2AVNA 2DFPA 3CRW1 3N0TA 1BJRE 4WFIA 4EB6A 1IBRA 4N7JA 1VHWA 4YV2A 2IT1A 1VCMA 1E58A 4KN5A 2FP4A 3GROA 2ZTHA 4RJIA 2RHRA 3A6GA 1VB3A 1DKLA 1QVZA 3DFZA 3KYCA 3I9OA 3LW8A 4G4SO 1EEHA 1S9DA 4ZIRA 1IAQA 5CCXA 1B23P 3FBTA 4EA8A 4L75A 2WMDA 1ZO8A 5AD1A 3AWIA 3IAM6 3P0HA 4FFSA 4I5FA 1R9NA 5DISB 2W4MA 3UATA 3DAHA 1ZOOA 4AG3A 2G09A 4C7MA 3NTUA 4YCNA 2IHTA 2Q21A 5K8VA 4S1WA 3H3XA 2XADA 3GD5A 1XB2A 1T36B 4YAUA 5JTTA 2HK9A 1X9GA 1FJ2A 1S6YA 3Q9SA 4FE4A 2IUYA 1GT6A 4FYKA 1AGXA 1NMSA 2HF7A 2QK4A 4D44A 3SVTA 3FTFA 4ZT2A 3LKVA 2NNLD 3A4YA 3W2EA 1OD6A 1VJ1A 3D4NA 3DXFA 1PUXA 2C2OA 4C3OB 4CIVA 4CUJA 2FWJA 2GYVA 3GFRA 4KK3A 4RPIA 2XXBA 3JYLA 1NMXA 3RYIA 3I72A 2D2XA 1EX1A 2HZBA 3QEMA 4LSZA 5K3FA 5H02A 2OCGA 1VLMA 1IHUA 2NV6A 4GI2A 4IS3A 3BRCA 3ZQJA 4NCIA 2QMOA 5I5EA 1VIYA 2Q4BA 2QL7A 3K5WA 5MN6A 3F90A 3PHCA 1S4QA 2JFVA 1CS0A 2W0SA 3R8XA 2E87A 4FEYA 3WL5A 4ZYVA 4LZPA 4L6AA 3TDMA 2FWMX 2OXEA 4DLZA 4G89A 2J3IA 3DVRX 3SPXA 2CUZA 3R6WA 4C2BA 2J0QA 3HXMA 3ZVNA 4LOAA 1P77A 2OV4A 3G9XA 1THZA 1N7JA 3GRKA 4OJYA 4ZQGA 4JBGA 4QPCA 3U1VA 1Z15A 5DOVA 3BA6A 4D0GA 3H4MA 3SR3A 3TCXB 3WWCA 3V2IA 5EI5A 3OU7A 2OGZA 1DDOA 3G5TA 3HXTA 5CU7A 1KSGA 1JR3A 1JG3A 1BCSA 3EOBI 4G81A 3IUMA 2VHCA 2ZI7A 3H75A 3DMGA 5CH3A 2QM3A 2JBAB 5DLEA 4DLLA 2QTMA 2DPMA 4O29A 3A9UA 3HEBA 2IYZA 2O2JA 4FR0A 4ILKA 5WRFA 4ZI3A 3ETNA 1CUUA 1L5VA 4H6XA 1IEQA 3E4DA 3E35A 3GGGA 3GV0A 1VKHA 4KDRA 4L5AA 2X4DA 4FBGA 1XROA 2HPAA 1IJKA 1D2HA 2XR1A 1H0HA 4HMOA 2IXBA 1VE9A 3OA2A 1ID8A 4PANA 1E2MA 4I6GA 1MH1A 2BF4A 3OLZA 2IKQA 2EBWA 3M2TA 1T2UA 1WCIA 3FIJA 4M54A 3A31A 4DRZA 5B1YA 1BS2A 1LWNA 4DYHA 4G4JA 2QTAA 4Y2QA 4AC9A 4X84A 4Y1FA 1M83A 2YVAA 4M1YA 3IEPA 4LX8A 2FUG1 1S01A 2AJBA 4B2PA 4JOCA 3STWA 4EG5A 1KFKB 3CLKA 2FV8A 4YP1A 2GHIA 1G63A 1W25A 3FSGD 4XJVA 1BD4A 2XUJA 1GAXA 1C8BA 4BJHB 1WXGA 3CSDA 4DIEA 2BTOA 4WV3A 1V8DA 1VMIA 1XLUA 3JYOA 1ZESA 4R98A 1GDHA 1VHQA 3AG6A 3IQDB 4OHWA 4DF3A 2CV2A 2WWTA 1D4ZA 3V7YA 4DBZA 3FW1A 1SCUA 1SXGA 2WAAA 3TVTA 2PX8A 1Z2CA 3PNVA 2HMTA 4TL9A 1H69A 4ALMA 3V55A 3OECA 1IYZA 3TD6A 3L82B 1JTEA 4WVLA 4YECA 5ALJA 3ZBTA 2VDOB 3ZHXA 2Q5FA 3GZJA 3DZ8A 3NM4A 4W9NA 3EULA 1GR1A 4JWKA 4ED9A 2ZCJA 5KDLA 4IZ6A 4RHTA 3T9FA 4MUFA 1HLDA 3I5XA 1CIPA 2SBTA 1RWOA 1LVHA 3E7DA 4L4ZA 2BRUA 1G64A 3BMXA 3LG2A 4PGMA 3E5RA 4CI0B 2EZTA 1T5BA 3N6RA 1O54A 1IZ8A 2R66A 4F9GA 4NHOA 3D7NA 4DT1B 3PITA 3UJPA 1IVNA 1N2EA 5TV2A 1PZFA 4TMWA 4UM9B 1IPFA 1H4TA 4XYGA 2P77A 3OFKA 3FX2A 5C3UA 3QU5A 4OUDA 2XJ4A 1Q7RA 1R8XA 1L4BA 2C84A 4Y0NA 3OEWA 3TVDA 1XTUA 1XWWA 3AUKA 3N8HA 1C9YA 4JKIA 4MS1B 4QYTA 2RHHA 1EJ0A 4MVWA 1JHYA 4TZTA 2WTMA 3RVQA 4F3NA 2V6GA 4L0DA 1GNLA 3ZWDA 4TGLA 2PX6A 3MF4A 2C04A 3D02A 3IP5A 2AW3A 1ZN8A 2P3LA 2X40A 3E5HA 3KKQA 3ZWCA 2GYYA 2PBFA 1MAUA 1RYBA 3AR3A 1RAHA 1JKJA 3GJ8A 1A2KC 1OE0A 3EDCA 1EZ4A 3SQDA 2HH9A 3NUQA 3JWIA 3QWIA 3A3OA 4IKEA 5PGMA 3SLKA 4B3RB 3TLGA 3AF1A 1F14A 1T9GS 1QGUA 1SO8A 1LW7A 1Z74A 2FETA 1AKTA 1O95A 2P65A 3EC7A 3HU3A 4OAOA 3TI9A 2O57A 5AXCA 3V1KA 1T2FA 4MO9A 3SFVA 4BKUA 3CH4B 4LHVA 2PZMA 3ZQKA 4MIYA 5C34B 4FHEA 2DETA 2ABWA 1SURA 2XBUA 3ZI7A 3PQEA 1P81A 4XM1A 2Y71A 2ZULA 4FFDA 2AR0A 3E7FA 2OCKA 2WG2A 3FPAA 1PSWA 4K26A 4OF4A 4I4IA 2OO5C 2WT8A 3KOZA 1JKFA 1UINA 3JYHA 1ZGCA 3L1KA 4RL4A 3WNBA 1R3DA 4UARA 4H4CA 3L93A 121PA 4INZA 2PKCA 4JJAA 4XDGA 5AVTA 1E9VA 1TYBE 2B25A 1G7TA 3L6UA 2QX7A 3MB5A 4X1YB 1CUIA 1X7HA 4HQKA 3D1VA 2O2CA 2J7PD 3IV6A 4KQ2A 5CB6A 4K6GA 1Z83A 2DAPA 2J5XA 4TS1A 1G5IA 3B1XA 1XF1A 3DEYX 3EF3A 2JD0A 3B1YA 3VPCA 3U39A 1I24A 2OORC 4V24A 3WDKA 5GVRA 3U7IA 3TUJC 1QPZA 2NXJA 3HBFA 1TC2A 3B7PA 4AKEA 1GQSA 3DVAA 5JROA 1ZRNA 2B6HA 2LV8A 4JX9A 4A0GA 3THWB 1Z75A 4I1SA 3PXDA 3GLGB 3OWXA 4PR0A 4CLRA 1QK5A 1UH5A 1NN3A 1J4AA 2D62A 3AEQA 5JD4A 1KQOA 2R8EA 1OKKD 4CEJA 2WMOB 1QMGA 2W6QA 1E7SA 2P8SA 3AX6A 2ZGVA 3JQ9C 2XNHA 3K73O 3VZSA 2RKBA 2ZRBA 4ZYYA 4PSVA 1AHNA 1OZAA 2W8BA 3GJ5A 4LGCA 5CLHA 1P4SA 5ALYA 5KSZA 3ZJUA 1HPLA 4H6WA 4E2XA 4JVMA 4I1UA 4UHKA 3FMGA 3TO5A 5EHZA 2JH3A 3HPRA 3OTIA 4JZKA 4WPGA 2PX3A 3PD7A 1A72A 1ZL0A 3PCRB 1A8HA 1EVLA 4A8JC 4C0HA 4J16A 4IOMA 4FT2A 1NDQA 2VK1A 5ITSA 3A1FA 4E08A 4I4CA 1KQGA 1DCFA 5EAIA 3LVBA 1V9LA 1I0IA 1SMKA 2AUTA 2WG1A 3FBGA 4NK5A 2FMTA 1CVLA 4JQOA 1U81A 4ZMSA 4UHDA 1B0AA 5J5AA 3SBXA 1CLUA 4B3HA 1GNSA 4TLLB 4F8EA 1UOOA 2WMYA 4G4GA 4UUNA 4RYDA 4JI7B 4P81A 4WL0A 3R0VA 2Z98A 1E7MA 2ZRLA 2ZAIA 3IDZA 3ICPA 3AMVA 4U02A 4JYAB 1SA0B 1OBFO 2VUHB 2YN2A 3QXCA 1AD2A 4GG1A 4GW3A 5SZJA 2JLYA 1NRXA 4AW9A 3PFGA 4YJDA 4WLEA 3BXXA 3AJDA 4FD2A 1B0PA 1H1DA 5FR2A 3GK3A 4NSNA 5AXBA 1JDVA 1U98A 4IGIA 5TMDA 1TQDA 2DPXA 4R0VA 3WISA 4FFRA 1QOZA 4WZBB 3RHZA 3CQ9A 2NYRA 1IUOA 1LLCA 2OFPA 5FNVA 4N3CA 1MU0A 4Q6BA 2E2WA 1GCGA 1NPDA 1TM7E 3MTAA 3VBCA 3AKEA 2ID4A 5K8IA 5ARCA 5LKAA 1HG0A 4K9RA 2NX2A 3E18A 4O2AF 3RVDA 4MNTA 2JCXA 2CVFA 2GXQA 3R3XA 1TADA 2KQUA 5IVIA 1OFHA 2O7RA 4FZRA 3K70C 4NJOA 4UC0A 4KPYA 3UMSA 2PUWA 3UT5A 1OJ7A 1EZ1A 3W77A 1CY7A 1BA3A 1C0IA 2YYYA 4HN9A 4BVAA 4AXXA 4WSOA 2CEAA 4L4UA 3ABSB 4ARAA 1T1GA 4EFLA 3VAAA 5AW2A 2JFQA 4FGKA 1A7AA 2QGNA 3FHLA 1TEVA 4QXPA 4P92A 1JHXA 4D57A 4F2WA 4LTDA 3BCSA 1HEUA 1W19A 2RB5A 2ECFA 3HZZA 4NU6A 3USCS 1GGEA 2WIFA 3Q6NA 1BMDA 5IWAB 3K0HA 2IHKA 2JH9A 3A4MA 3CLRD 2FFAA 2H07A 4IZOA 4CKBB 4ATNA 5E7QA 1U3GA 4JU8A 1KI9A 4BMXA 3ZVKA 4LHEA 3ICQB 4NYJR 3FFAA 2EDCA 4F21A 3K9NA 1GHTA 3KDSE 4YXFA 4EJSA 4GE0A 4M9XA 2GZDA 3AY6A 1WPXA 1HYQA 1KPGA 1YE3A 2ZP1A 4V03A 1DWUA 5GJWC 4BVJA 1PP4A 4ZEWA 5IASA 4BKRA 4PWZA 1A8QA 3GG2A 3MRXA 2Y9PB 4W9RA 1SBHA 2WR8A 5BORA 1VMDA 1OXBB 2JLZA 3GGOA 3EA5A 4M1TA 3PGLA 4N8SA 4Q4HB 5GVSA 1T9KA 5HDQA 3V9PA 1DAOA 4G97A 1OT3A 1MA3A 4JR1A 1W8DA 3DG9A 4FOLA 3VYVA 1ARZA 5JMPA 1UEXC 3K1YA 1GUAA 1U2PA 4G25A 4MXDA 5CYGA 1BVUA 1SIBE 4FGWA 4X95A 521PA 2EJWA 4BMDA 2Q1YA 3IT1A 1G8JA 4OQMA 1A4XA 3PZRA 4HNAA 2GI4A 4Q7LA 3RRFA 4QWWA 2XGSA 1T91A 2CLHB 4GZ6A 3SM3A 3H2GA 2HWYA 4UE2A 4PHTA 3GLFE 5GTDA 3OEED 2D5AA 5SYMA 2P1RA 1YC2A 2XGGA 4MP3A 3G7UA 2YN0A 3GIDA 3N2EA 4D8XA 4HXGA 1JSLA 1SPXA 2C3MA 3TR0A 5AHXA 2FSPA 1TRHA 1RWQA 1NW8A 1QIKA 2BM8A 4EL0A 3D6AA 3TNLA 2H18A 9LDTA 1IMJA 1R6XA 1UJCA 1FP1D 3COWA 2QNBA 1OQAA 4F8YA 2D8MA 3D6TB 4L9WA 3G0DA 4J1NA 4MB2A 3NDJA 3UPTA 1X39A 5FXMA 4MARA 2IBSA 1NP6A 1FX0A 2OUIA 3JU3A 4B48A 5HILA 1IN4A 3K2BA 1L7RA 3TTVA 1UWCA 3PRYA 5IW8A 3SIWA 4DDKA 3LWDA 3HRIA 3PK0A 3ZDQA 1RADA 4DA9A 1O0SA 1HE1C 4I1YA 3TR6A 5IRCD 4L0QA 1KAHA 2CF6A 2JGDA 4RKWA 3U31A 5E9JA 1ZH2A 5JEEA 1JDBC 3H18A 1JR3D 1XTJA 3ZW7A 5EHXA 2V55B 4EK9A 1XTIA 1YVPA 3G85A 2HWUA 1Z6PA 4RHYA 5I9TA 3WYAA 4EAQA 1F7UA 1OAOC 2X4GA 3M70A 3SXJA 2GWRA 2DT8A 5K3DA 5TT0A 2UXCB 5JJIA 3GLHB 4QBGB 1QGAA 4G37A 2YMPA 4QAQA 4R83A 1A1VA 3OMLA 1N5JA 3RUHA 1Q1ZA 1TMYA 1FJHA 4D81A 4DSAA 3NONA 5FFFA 3KT3A 1BWRA 4L16A 3GMIA 1I10A 2VDPB 1S7GA 3FD8A 3I12A 4EHIA 3AI1A 3F47A 3SFZA 3PEYA 2GJ4A 4UD6A 3P2JA 1YBMA 5T3UA 2HFJA 4QOIA 2C5GA 2XUFA 4Z7NB 1WW3A 2W00A 3GRRA 2B2XA 5KVSA 2OQ2A 2R7AA 4OPMA 4ZCIA 4XI9A 3RFTA 4RPHA 2O2SA 4JAVC 4PBRA 621PA 4CCYB 4V0SA 1JDTA 1E1RD 1HTBA 3AM5A 2R8RA 4BFTA 4YR9A 1YF3A 2HCBA 3NC1C 1YULA 4C7XA 5HRCA 1QIJA 1YZHA 1Y3BE 4LJAA 4YAJA 1JHMA 1P0FA 1PN3A 5C8YB 3ESBA 3QXJA 3ZNOA 2FW8A 1L7AA 5KX5B 3AY7A 3K9BA 4R41A 3TX6A 1DBWA 2GF9A 4JKOA 5SYAA 4XJTA 4PLYA 2JI6A 5DM2A 3NORA 4LJRA 1UJ5A 4GMGA 4OK5A 1EWTA 3H8JA 4M87A 3ZLTA 5IMSA 2FW9A 3IL2A 4L02A 2QI9C 3EC2A 1VYVA 3IXLA 3FVWA 3FSJX 4QASA 1I4WA 2MSKA 1BHJA 1NUUA 3AR2A 3LUDA 1AC5A 1TW3A 1E59A 4NJEA 5B1DA 4YRKA 2YUIA 1RKBA 4F93B 1PJ3A 2RAPA 3NH9A 2A4MA 2PU5A 4UVDA 3B6JA 3GDWA 5LQSA 2ZSIA 2QTGA 3A6ZA 3B6EA 2ZJ1A 4EYEA 5DHUA 3TCNA 5DCWA 4UEQA 5H82A 1C1DA 1YRBA 3RYFA 1CLEA 2NVUA 1F1BA 1FXWA 4M0FA 4EGCB 4CM9A 3AM3A 1T3GA 3I1YA 4OQDA 2F48A 3BJIC 1KWGA 1T8TA 3T3HA 1UPBA 3GGPA 3R7NA 3GW8A 5HF6A 3I6BA 4TLEA 2XLBA 5KNBA 2PSHA 2EKPA 2VA9A 4HEHA 3EGEA 3ILYA 3N2KA 3TQQA 5BR4A 5JJLA 4U2GA 1N2XA 4HLUC 1F0PA 4MJXA 5IVHA 1PNVA 3AG5A 4CG3A 2DUNA 3PC2A 2DBZA 4DJAA 5A9SA 4KP7A 4U7FA 4TKVB 1P1FA 4JC8A 1WMEA 1TJ5A 1DWPA 1P6UA 4ND7A 4G85A 3UICA 1U2SA 3BJMA 4Q24A 1W46A 3KL4A 4RJ2A 2HUPA 4KQKA 2P79A 4IDGA 3AJEA 4FEAA 4ZALA 3W06A 3PL1A 1YMQA 4R1TA 5CLLA 5JNRA 2VDWB 4JGBA 4RADA 4Z9AA 1DQZA 1MLDA 5HMLA 3ZIUA 3NBAA 3OQOA 5KINB 3CW8X 3ZN2A 2FZKA 3KAQA 4DV5B 3ORHA 4ZQEA 1N57A 4EQZA 1FRQA 2AK3A 1GGKA 2EERA 2J9FA 3NT5A 3FSEA 2PD3A 4KAFA 5HKOA 4QTXA 2XB6A 1GZ5A 2V6JA 2DU8A 3ENVA 3L8GA 1RYHA 5IJAA 4KPUA 2WU1A 4JS0A 4QJIA 3SNKA 4UQLA 3TWOA 2RHOA 2XOEA 1KO5A 3BK7A 2UVQA 3ZHSA 2YW9A 4B6OA 1T0HB 2XSZA 3OICA 3KELA 3DDOA 2ZS8A 3KEGA 3O8QB 4L4XA 5CB4B 2XUQA 2BTQB 5DBFA 3TOSA 2YHIA 3GJXC 2C2YA 3ZBPA 4EYQA 2AHRA 3H2KA 1XNHA 4TUYF 4UVEA 2QT1A 1JU9A 5SYNA 1MW9X 3K16A 4NV3A 4AJNA 3IODA 3VI3B 1CUXA 3HHPA 2BP7A 3L3BA 4TL7A 2EP5A 3DB2A 1NSYA 1ORVA 2UKDA 4GOKA 4HRYA 4QM6A 2HIGA 4F1KA 1H9CA 4ERXA 4TWJA 3PA6A 4IMJB 4CNQA 1ORWA 3OWHA 4KQIA 3W6OA 1B6SA 2Z6VA 1L5QA 4PIVA 3PYXA 2QTFA 3GBSA 3TSCA 3PEEA 1S3SA 1VPVA 4CNBA 5FLXA 2Q5OA 4Y30A 4EFKA 3SX2A 4CW7A 4UAGA 1YQWA 3T9DA 2O5VA 4A0HA 4B35A 2Q5HA 1KEUA 1KBQA 1FP6A 4KV9A 1PKEA 3L7NA 4DRXB 1XZGA 1Z18A 2YV4A 3JALA 4J75A 2OCLA 4ZOLA 3JQ6A 4WX2B 1UFOA 4YJ2F 3IMCA 4J0JA 1LVGA 5EUQB 3BSWA 2QKYA 3TINA 2J30A 3FCXA 4KI0A 1FP7A 5BY2A 3DV2A 3FDZB 4PHFA 3W5HA 3IBSA 3N53A 2HU7A 2GAOA 2H0QA 1PR4A 2QRKA 1Q95A 2Z1DA 3ICOA 4MVJH 5CK4A 3FH0A 2PIDA 3F0TA 2DUMA 3OHPA 5HKKD 4PPYA 1KI1A 3FRIA 4ZVPA 1JEQB 4FGLA 1WSAA 4DNPA 3HCNA 1SVNA 3RBAA 4J0GA 4L5CA 4MUAA 4KQWA 3GQVA 3K0FB 1K3FA 2VDNB 5A03A 1NXXA 5ELLA 2F4NA 4G1CA 4RPKA 4XR4A 2J9GA 2C4KA 3RADC 4P83A 4IOKA 5TNXA 1G2IA 3TOZA 2YJ6A 1AA6A 4Y2YA 4RUKA 4TWAA 2EXXA 1YVUA 4HNRA 3FMOB 4Q7KA 4YCSA 1N32B 4HQOA 2L82A 3F1KA 4WBXC 5I9MA 4C08A 3Q9LA 3ZGLA 3QJ5A 2A7XA 1J09A 1KR2A 4W1PA 1SKYE 5JY6A 2NZYA 1RI1A 1RQNA 2QAGC 4WEQA 4BQRA 5A4MS 1Q17A 5CVUA 5JG7A 7YASA 3CVVA 5KJCA 1YOBA 3MXOA 2QM7A 3T7EA 2V3CC 3MPUA 4B7AA 1Y6FA 4GNRA 3W9BA 3O90A 3WIBA 2WSLA 4MAFA 1XR3A 2JGJA 4QEKA 3BBLA 1KK1A 3MFYA 4R40A 4X92A 3HP4A 5HYVA 2MHCA 4NG5A 1PUIA 5JMOA 4Y1GA 1ZX1A 2AF3C 4DR7B 4MLDA 2WU0A 2C2WA 3QKRA 4TOIA 3GA0A 1M1NA 3FTCA 3EJWA 3HXPA 3NCHA 4MWZA 1KY4A 4DLAA 1S5PA 4G65A 3OCYA 3Q0IA 1JAHA 1KVRA 1XRSB 4L15A 4TYPA 5DGXA 5CG2A 1T0JB 3ZHYA 5HTOA 1FW8A 1O94D 4KJXA 4LBWA 3UHPA 5F35A 1LBEA 3IQGX 1PNOA 4URHA 4ER5A 2CLMB 1N2BA 1Y1RA 2C9ZA 2P2SA 1OWOA 2BTEA 2ZRDA 3IRUA 3K5HA 3N2GB 4B4WA 3AVVA 2EYUA 1UFQA 3C3DA 2LNDA 4D9BA 1Z0JA 3ZE9A 2I2BA 4C0KA 4AUKA 1WXDA 2HJ9A 3F46A 3NOOA 4OK3A 1NLZA 4JJ7A 4OLAA 5I9SA 1X2EA 4YJFB 4LRYA 1HZZC 3EDQA 4MRPA 3SYRA 3UFXB 5H4HA 1SEPA 4IZIA 3JWPA 4BGDA 4UEKA 3O84A 2O0HA 4LYHA 1H9AA 2QV7A 3ISJA 4EQ6B 4U7JA 8OHMA 4N7RA 2FPUA 1M2EA 1H0RA 3ILSA 4LZOA 4NR0A 4Y0AA 3SMQA 1PTJC 1LQUA 5IYZF 2MOKA 3EW7A 3PFCA 3ADOA 4LS3A 3O4GA 1L5OA 4MB6A 4WZAA 1BVRA 1RI5A 2BBSA 1WQ1R 4DXDA 2WAOA 4HCJA 5B7QA 1OTYA 3MPOA 1GAEO 3DLBA 3I9MA 4EEZA 2PUDA 4PYLA 4HVCA 4JI5B 3DR3A 4FEEA 1P0MA 2PXAA 1F8XA 3MB8A 4WCFB 1NJFA 4BYMA 5IJ0B 5KNCH 4XW2A 3B70A 4X85A 1G6HA 1BTOA 5EIBD 4ENVA 2BN4A 1VFPA 3W6NA 2IZ0A 1XMJA 3SS9X 4ZI7F 3LGAA 1RQRA 1N5IA 1CJVC 2AJDA 1RCFA 1Z22A 3MGCA 3CKMA 4A6XA 3CMMA 3AR9A 4HDAA 2C94A 4J1TC 4JUIA 3L7IA 3PQDA 1HLPA 1I30A 4HWPA 4NOJA 4LDAA 4PPGA 2W6JA 3OJFA 3A04A 2ZBDA 4NZYA 4CETA 3GFGA 2X1VA 1W34A 4LTMA 3EDOA 3EZ7A 4RANA 3QE0A 1ML3A 3LCUA 5ALXA 4WJZA 1C8VB 4B31A 3C45A 4IXWA 3PNMA 4MO2A 1ST3A 3EVDA 1MVOA 4UNSA 1Z2AA 3NEYA 1P75A 4IV5A 1UDWA 3QYPA 3BH6A 3DULA 4W99A 2GBLA 4WBNA 1XDGA 3KQYA 4NIMA 4CN8A 1M0EA 1V1MA 1Z82A 4RHFA 3KTDA 3QUBA 4ZO4A 3V2UA 3JAMA 3PYLA 5HW0A 1CRLA 2P5UA 4AJHA 3OBBA 5LXTF 3BB1A 4ZI2A 2OEPA 3SZ3A 4EKEA 4PZDA 1ULAA 2YW2A 5IC4A 3KZKA 2CMKA 5KOHA 2XVAA 4HL6A 2CVZA 2FK8A 3MTQA 2WKPA 3X2FA 2E5LB 4YCCA 4RLHA 1UBFA 5HJ7A 5JS8A 1US8A 3QTBA 1NVAA 1PDVA 1TM2A 2WAXA 1RXEA 4QBIA 1JFTA 4OJKA 1IG3A 3AKYA 3VTZA 2FPOA 3RFXA 4EKIA 1I5EA 1PU2A 2HHAA 2ST1A 2A9QA 3F67A 3I05A 3I6MA 4TN5A 3TW6A 2ZR9A 3KP1A 4Q4LA 4Q4JB 2CVHA 4QFDA 3RS3A 3UVEA 1O6CA 1QZXA 4IVPA 1S2IA 2IZOA 3GI1A 3FROA 4KXMA 4M1MA 4AY6A 5ALHA 2HZ7A 3I6IA 2X3YA 1ZPDA 3KVNA 2B69A 1OBCA 2J3JA 3W8EA 4CCSA 1PIWA 1YU9A 4C4XA 1VB5A 5AVRA 2V0CA 1Z2DA 1B41A 1CF2O 4L8YA 3WMXA 3VKHA 4JP5A 1IJEA 1Y9EA 3T5DA 2F8LA 4MPPA 1NT2A 1XLTA 4K0RA 5EXEA 4Z6KA 5A3QA 5F51A 1RVV1 4KWHA 4V3CA 2C1EA 1TYAE 3LVRE 4CG2A 3AHCA 1OI7A 1JUDA 2GPNA 2VT3A 5ISMA 4ZI7B 2XDWA 4KITB 3IIMA 3E9MA 1HFWA 3C6KA 1FDSA 5D3QA 4F72A 2XRMA 4M8KA 1C30B 1Q3KA 1BIFA 2OAGA 4C7JA 2P30A 5K8CA 3QMVA 1G6KA 4H77A 5JAUA 4OQZA 2XGMA 3TIIA 5F7OA 2YXEA 4JASB 2E18A 1Z7GA 2V7QD 5CW1A 1BMFA 3GRVA 4WOPA 5E1BA 5IP5A 1WHSB 1E7QA 2NO6A 2VP3A 2WWHA 4EW2A 3IULA 3K8OE 5AW7A 2Q3HA 3SDBA