1ESNA

Structural basis for the feedback regulation of escherichia coli pantothenate kinase by coenzyme a
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
311
structure length
311
Chain Sequence
b'QTLMTPYLQFDRNQWAALRDSVPMTLSEDEIARLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEDLLQTWYINRFLKFREGAFTDPDSYFHNYAKLTKEEAIKTAMTLWKEINWLNLKQNILPTRERASLILTKSANHAVEEVRLRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PANTOTHENATE KINASE
publication title Structural basis for the feedback regulation of Escherichia coli pantothenate kinase by coenzyme A.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 101
structure length 311
sequence length 311
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2000-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1esnA00
3KXKA 4KITB 1NG1A 2D2EA 3WHKA 5IK2A 2WOJA 2BC9A 2H92A 2QY9A 4LJAA 4BLQA 4DLVA 3DZDA 1Z08A 2PJZA 4UXHA 1U99A 3I8XA 4UNSA 5IHPA 5DE3A 4KU4A 3NH9A 2AD1A 4LHXA 2JAQA 1ZC4A 3P27A 3DKPA 4M53A 4F4JA 4YMVA 2BBTA 4PFSA 3THOA 3WMFA 1W0JD 1KI1A 2GA8A 4WW0A 1L7VC 4KYIB 1P2TA 3H0KA 3QXHA 4KLZA 5JEEA 1HA3A 1Z0DA 2KWIA 1DELA 2ODWA 1QRAA 1T0HB 2HJVA 5FI0B 3E5HA 5HKKA 1MO6A 1OFHA 1YZNA 3R20A 5KYKA 2R8RA 3CPJB 4K81B 4RD0A 3W90A 1JPJA 1YR7A 3B1XA 1FP7A 2ZS8A 1Z6AA 3I8SA 4CIDA 1C1YA 1LS1A 5B64A 4S2EA 1ANKA 4HAYA 4DCNA 4YMSA 2QP4A 5F3WB 1N0VC 3RANA 4AK9A 4OQMA 4E5UA 2F1JA 3TBKA 4CW7A 1LFDB 1WXQA 2CBZA 4TMKA 1PVOA 4DKXA 2QEQA 4NCKA 2R62A 1Z06A 1TL7C 5DI3A 4DSNA 4GOKA 4QBGB 1NJGA 4ZDKA 5CJ2A 1XDBA 4CEHA 3BC1A 4M4SA 1JQJC 1W36C 4PC6A 3U6BA 4MGIR 1JR3A 4H1UA 4Q48A 1TADA 2WWGA 1DE0A 1GWNA 3VU9A 4GMXA 1S4QA 4HYYA 3H2YA 4DLWA 4RZ3A 4MRPA 2H8KA 1P9WA 4YMUA 4OQNA 1E2FA 5CJPA 5FPSA 4LYAA 3RS0A 2L0XA 3VMFA 3KQNA 1NSTA 3ADCA 4TYWA 3BFVA 1DAKA 4FD2A 1N6NA 5KSOA 3AVVA 2XSZD 1MRSA 2ATXA 5KPDA 4RKEA 3IUYA 1US8A 1JEDA 2VF7A 2AWNA 4Q1FA 3W9YA 1TU4A 4A0RA 3KFVA 1XTRA 3B9PA 2ERXA 5FTKA 1T91A 1II8B 2ZJYA 4C3ZA 2VHQA 5FUYA 1DAIA 1RPZA 1TQ2A 2X19A 2EWWA 2GZHA 2ZJAA 3OIVA 1XXHE 2EYQA 3LLUA 4D4JA 4QBFA 2IYZA 2OBNA 2NG1A 1Z63A 1OIXA 1ZAKA 4QBIA 2O8DB 1E0JA 3IQXA 3K0FA 5EXTA 4B34A 1HYQA 4FN5A 1ODFA 2G1JA 1KJZA 3RC3A 4LDJA 2WOOA 4XWKA 2P5SA 4GPTA 1VMAA 1JPNA 3MWKA 4UXIA 5HPYB 3BFKA 3K0CA 3VX4A 5K8IA 3H86A 2P3SA 5EUMA 1VCMA 2QUZA 1RYHA 1XZPA 1QHHA 4Q19A 2ZR9A 1HQYE 3THXA 2I1VB 3MSXA 1MR3F 3AB3A 3SBDA 4BRWA 3R7WB 3REGA 4TMTA 4C0SA 1R5OA 4Q5IA 4ZKDA 3I4LA 2KSQA 2XNDA 5C1BA 2W58A 2KBFA 5F9HA 1LS6A 1F2UA 2GETA 1XMSA 5JSZA 4FINA 1XMJA 3A1VA 2FU5C 3NDBB 4HAVA 2JLQA 3T15A 3U2QA 1NRJB 2FPKA 1JR6A 4DCVA 3OZXA 621PA 3SR0A 3GEEA 4F92B 5KTYA 3NH6A 4EUNA 4RD3A 4RZUA 2GJKA 3M4YA 3QXCA 4W9MC 1KI9A 3L8ZA 3QEOA 4EJSA 2YINC 1G9XA 2PJRA 4C7OB 5L8VA 3I72A 5G3ZA 3EZ6A 3Q8XB 3WBJA 4QGGA 2DFNA 5AUPB 1UFQA 3ADBA 3NVAA 5DGXA 2QPOA 2OT3B 5JS7A 4B73A 3DM9B 4G1UC 4TL6A 1N6HA 3T61A 1CJKC 2B21A 5ANRB 5B2ZA 1F3OA 4JVMA 3O8BA 2GK6A 1G5TA 2C5LA 3FMIA 1DOAA 4PAQA 3BS4A 4HZUB 4LBZA 3A1UA 5HE8A 3KJGA 1G41A 1YHNA 3ZIAD 4ESHA 4M9SA 2GKSA 4JLVA 1UJ2A 1X8JA 2BMDA 1QHNA 2G1KA 3B7GA 5EP1A 3LBHA 5TY0A 2B8WA 1QVRA 2IHBA 1I2MA 5LD2C 2WJIA 2YJTD 2O8FB 3IHWA 5EXPA 2ZJ5A 3AH8A 4JJKA 2FSIA 4QOSA 1GM5A 1RRFA 2ODEA 1QF9A 4PHHA 3RLFA 1CJMA 2ZAMA 3BH6A 1Y63A 4JZKA 2DFLA 2EW1A 4KJZA 2D7CA 3AQ4A 1G8HA 1W5TA 1ZJ6A 1Q20A 2AKAB 1G17A 3NXSA 3TAHA 1TPZA 3U3OA 3LWNA 4P4UA 3PXGA 2WKRA 2ONKA 4Y0AA 4MKHA 1GZSA 1YU9A 2FSFA 1IN7A 1NN5A 3VQTA 5IRCD 2JLZA 4F38A 4HLUA 2KE5A 3IPXA 5EP4A 1U0LA 1ZYUA 1JBKA 2AL7A 1E9DA 4LWZA 4AWXA 3FKQA 4B2LA 2V3CC 1R0YA 4EKDA 2VTKA 3SU8A 4XWAA 2QG6A 4O25A 4DRZA 2IS2A 1QG4A 3ZIAA 3H1TA 3BIFA 2FV8A 2KB0A 5AUOB 4D2IA 4P4SB 2CL7X 3DVLA 3NBYC 4YC7A 5AJYA 4D26A 1YZLA 1XXHA 1NG9A 1KZ7B 2C77A 4V0ME 4KI0A 1KDOA 1R0XA 1UBGA 3WP0A 2IEZA 1IQPA 3PV0A 4PPFA 2UZIR 3SHFA 2Z0MA 1F60A 3KQKA 1CP2A 2RGNA 3B1YA 1E1QA 3OIUA 4CT5A 1RE0A 4RVCA 5FBRB 3AKYA 3FYHA 4BRUA 1K6MA 4QHTA 3X1YA 1II9A 4EFMA 1S3GA 4TZ0A 421PA 4DXAA 4EIWA 4L16A 2BJVA 2J1LA 3JZAA 2ZE5A 1P62B 5C4GB 1COWA 4DSTA 2OHFA 4XSHA 2CE7A 4LBVA 1A2KC 1E79A 3A1WA 3FB4A 3LVQE 4B3BA 1E99A 4HSEA 2QAJA 1G8FA 2VP2A 3A4NA 3K9NA 1XEWX 4DLRA 4TMXA 2JEOA 1J99A 4Z8YA 3OESA 4PQFA 5JCPA 1S96A 1LF5A 2YWFA 1EWRA 4IJMA 5DI3B 4C2TA 4FI3C 3GLHB 5F2EA 1NVUQ 4A92A 1H8HD 3QKRB 3QKSA 2QAGC 4PZLA 1OH6A 4Z1MD 4Q4HB 4US2R 2ORIA 1QHYA 3FFBA 2QZ4A 3K0EA 2GESA 3U4QA 5LB4A 3A1TA 4M1OA 4Q66C 3MWLA 2ZAOA 1F2TB 5H1YA 4OHVA 2ZSFA 1CJUC 2WWIA 1VCOA 3EZ7A 2YWHA 1ZNYA 2W6JA 4TLAA 3GLFE 1NLFA 1WBDA 3WXMA 4LHYA 3PUYA 1OB2A 2H17A 4F7WA 3QPUA 4XJXA 1I4DD 1Z83A 3F5FA 2VP4A 2GF9A 1OLOA 3SJBA 3SJCA 3TSZA 3UXMA 4OHXA 3GJXC 5C46F 1Q12A 2GHIA 4NPHA 2BMEA 1OKKD 4LJYA 2HCBA 1RFLA 2ZRBA 4LUCA 4M1YA 1D6JA 2HV8A 4M9XA 4Q21A 2R6GA 1KKLA 2NIPA 3CZQA 2IBMA 5FPHA 1F48A 3KKOA 1U0JA 4LYFA 1E6CA 2EFGA 3WHLA 2GJ8A 2QRNA 3KKQA 2OLJA 3DL0A 1M7HA 4RD4A 1E4VA 3SFVA 2BHRA 2FFAA 4DLTA 3AVXA 3B6EA 4I1VA 4M9QA 1H8HA 1XD9A 4HLDA 3GLGB 2VSOA 4IDHA 4LV6A 3TR5A 1Z6YA 2F1IA 2PEZA 3UMRA 2BM0A 3AF4A 4M0LA 5JMTA 4QG7A 4Q7MB 4HLQB 2F55A 2WAYA 4JT2A 3GLIE 2VF8A 4BLSA 3GMTA 4CVNA 5L3VA 3U7HB 1UBEA 1D8TA 3AUYA 2BEKA 3EC1A 4KCGA 1A82A 4URVR 3CRVA 2RAPA 1Z2AA 3W5JA 2CEAA 2CVFA 2GWHA 2ZIAA 3VR4A 3GFTA 4LBYA 2QMEA 4EPXA 1UDXA 4LC0A 4ACAA 3Q7QA 4EPWA 3V00A 1FQJA 1PLJA 4HB0A 1E1RA 3CM0A 5CDFE 1A4RA 1IXZA 1PUIA 2AFHE 3NEJA 3BB1A 1A2BA 4FMDB 3O8RA 2HXSA 3NIBA 4QJ4A 1S1CA 3FWYA 4DCTA 1E9EA 2WWWA 4MGKR 1OH5A 4OBEA 4OQXA 2F9MA 5UKDA 4PZZA 3ECCA 2FN4A 1QHGA 5AJZA 5DH9A 1ZCAA 3BB3A 3BERA 1NLYA 1Q22A 2QMOA 4H1VA 2W83A 4IOKA 4HI0E 1TU3A 3LX8A 3AP2A 4FCVA 1E2JA 4JSTA 1SZPA 4LJ8A 2YV5A 4ZDWA 1UBCA 1CULC 2J0UA 2OLKA 1KY3A 2JDID 3DHWC 2J7PD 1B0UA 3AVUA 3K1JA 1E2IA 4JL5A 1RRCA 1YZTA 1XWIA 3ZS8A 3HU2A 1KMQA 3FE2A 4PTLA 1T0JB 1OJLA 1CLUA 3CX7A 2EFCB 3QEJA 5JWOA 2IYTA 1KK2A 2VSXA 3FKSA 2N46A 4R2IA 5E7JA 2JLYA 1YQTA 1G4UR 1OT3A 1AN0A 1N6PA 2C99A 1XMIA 2AN9A 2IF2A 2Q3HA 5FBWB 3Q5DA 4MUAA 2YZ2A 5FOUA 3IBYA 2FFHA 2RMKA 2ZRAA 1G6HA 4HLCA 4LHZA 1DS6A 4FIDA 1LTQA 5FFMA 3EARA 4FWTA 1DTSA 4JVLA 4PO1A 4AURA 2WSMA 3IPYA 5FI1B 2JJ1A 3RS4A 1UBFA 2A7QA 1LV7A 3B9QA 3HU3A 1ZVQA 1VHTA 4L9SA 4MQBA 1W36B 4FMCF 1MRNA 4ZIRA 3LFUA 1EFHA 2O8CB 4IW3B 1ZNZA 4GMDA 5FR2A 3A4LA 3NHAA 4ARZA 5SZJA 1D2EA 3KQUA 1NBMD 4IEIA 5FTJA 1DADA 4W5WA 3B2EA 4C0KA 4TZ6A 2JLXA 2Z83A 3VKWA 5DHFA 2HYIC 4IDNA 2CLSA 3C5HA 1OYYA 4NYIR 1QBKC 1QHIA 5F98A 5FUXA 1LVGA 4KVAA 2P6RA 2VYFA 221PA 1AKEA 3CH4B 1Q1BA 2ZJ8A 4OL0A 2QTFA 3E1SA 4HB3A 3V4RA 5DN6A 5BN5A 3SQXA 2X8AA 5FUVA 2BEJA 3GQBA 4JLPA 4M2LA 3WNCA 2QGZA 2VP5A 2JLUA 2ZYTX 3QG5A 1XRJA 4LCBA 4B3XA 1GILA 2HCJB 4MKIA 2ECKA 1BMFD 1DBSA 4EFLA 4KVGA 2WVJA 4C9BA 3J81k 1N6RA 4DLUA 2A30A 4NYMQ 4Q4JA 3LO5A 4Q9LA 4A0FA 3PUXA 2ZVQX 4ASUA 2ZSEA 4TTRA 1CRPA 1IXSB 4JMPA 3EPLA 5KNCA 4CGZA 4RKFA 3KJIA 3GLIA 3NDPA 5L3QA 2BM1A 4M8NE 1WP9A 1G7TA 1T4GA 3LVRE 2F43B 2B8TA 1X8LA 3BFXA 1HQCA 3ZZUA 5JEDA 3B78A 4O2LA 4PSAA 4A82A 3TSOA 4PZYA 3WBKA 4RD2A 1TTTA 4C0AC 1EESA 2VP9A 4MGZR 1X8KA 1SXJA 5BYJA 4GSYA 3BH0A 3LAWA 3GJ3A 1AM4D 5CDFA 1ZM9A 5DSZA 4EAQA 4JVNA 4QJ5A 4YQFA 3RABA 2HT1A 1UKVY 4TLDA 4XSGA 3EZ2A 4NL4H 4X8HA 1R0ZA 1EFUA 1GL6A 1MABB 4DSOA 3UATA 3QOFA 1W2HA 3PCRB 2OCBA 3QPWA 3T1QA 2ZI7A 4QGFA 2P65A 4IOLA 2BIFA 4TLBA 2ZRLA 2WJJA 5KHOC 3LRPA 5AJXA 2E87A 1R7RA 1OHHA 2WMOB 1FMJA 3GLHE 2REOA 4PSKA 2WIAA 3KB1A 3QF4A 3X2SA 1S1MA 3ZD6A 5IK2D 4IOMA 3K0AB 3RRZA 3K09A 1BMFA 1WQ1R 3CRW1 3U61B 2VIIA 3MRSA 1Q0UA 5CM8B 4EPVA 1A5TA 4F91B 2C03A 2XB4A 1CF4A 2IS4A 1O87A 2G9NA 3X1XA 2QBYA 5TXGA 2ZREA 1DEKA 1KO4A 4I4LA 4M1MA 3P32A 4BPBA 3TVTA 5GJVC 4RFVA 1KSGA 4OI2A 1GNQA 1VYTA 4C0HA 3I1FA 1G4AE 2C04A 2ZITA 3K0CC 3SEAA 2NOAA 3OEEA 1RJ9A 3THYA 1FW6A 1JAIA 5H68A 2NZJA 3GFOA 1CS4C 3W6NA 4JKYA 5DHAA 1KI7A 4RZXA 1CRQA 1Q21A 4F4IA 5LD2B 5HKKD 1NKTA 4NP6A 2IHYA 1MO3A 2KBEA 1CIPA 1NY6A 1OV4A 3IILA 2BBWA 3TIFA 2J0QA 2ZXUA 2NZ8A 3KXLA 4W7SA 2CVHA 3VAAA 2WM9B 1WBBA 2F1HA 3LBIA 2IUTA 4JBWA 1XJQA 5L3SA 4MGYR 3Q85A 4Q1BA 5SZHB 3TGPA 3B82A 2BDTA 4PAMA 3UMFA 2GTPA 1R5NA 5KSPA 2OSBA 4NU0A 5AJWA 3JZMA 4LHVA 1KKMA 1KNQA 3R8FA 2OZEA 3F8TA 4EJSC 4CEIB 5DISB 2GF0A 3BBPA 1NKSA 4AKEA 2W0MA 4UNNA 3MUFA 5KDDA 1AGRA 4I1UA 4BLOA 1E0AA 2ZJ2A 3PQCA 1HUQA 4GP6A 5FPTA 5EE0A 2IYVA 4M1SA 5JWHA 3OFND 3TAUA 4HDCA 1IN6A 5LDDC 1JR3D 4G5SA 2G6BA 2ZU0C 3H84A 4V0KA 2C96A 5K8UA 4HDQB 1CJTC 1JI0A 3UG7A 5JJKA 1DARA 1P75A 1TF7A 3DDCA 4URUR 3ZVRA 3RDPA 4GZMA 1NVXQ 4JL6A 5EQTA 1LF0A 3FPAA 4Y0VA 4MDEA 3AVTA 1J70A 4LJ6A 1GNRA 3D7MA 1G1MA 1YRBA 1XF9A 2QN6A 2XTNA 5G40A 2ZRKA 2ZROA 3ZLJA 1Q3HA 2PH1A 1VPLA 2RGGA 4XTCS 3QBVA 1HEIA 2X2EA 2NQ2C 2UKDA 5BN4A 3C4JA 1JJVA 4GDFA 2ZI5A 4JLJA 4TL9A 5KOYA 3BOSA 4P31A 3EPJA 1BKDR 2W2VA 2ZYUX 521PA 3PEWA 2XJ9A 3FGNA 3QENA 1M7GA 1KI6B 5JCZA 4AIIA 4X8OA 4OYHA 4RFSB 2F1RA 4ZDJA 3PR1A 3K9HA 4NYJQ 4TWZA 1E2LA 1IN4A 3WYFA 2ZI9A 4HDOB 1R4AA 2GVDC 1N5IA 5EE9A 2JLWA 4Q1EA 1N6LA 3X1WA 4UNQA 4XH9B 4D80A 1IHUA 1R6BX 1SVMA 2XEXA 4QNRA 4NONA 3W34A 1S3SA 3F3YA 3OFNA 3KTAB 3T1TA 5GADl 4HLUC 4NZYA 1B23P 4LC1A 1U98A 2QM7A 2QRZA 1VYVA 3PEVA 5D3MA 1I4TD 1XD2A 2Z4SA 1VG1A 3QI2A 5GJCA 2QAGB 4G5QA 1IOZA 2FF7A 3AP1A 2XNDD 1QZXA 4XOIA 3PEYA 1GUAA 2GDJA 1U8AA 4ZPXA 3VHXA 2XGJA 1TF2A 3AF2A 5FR1A 4AC9A 4OKSA 4BZXA 3VNVA 4DEXA 3A8TA 4LX0A 3ZQ6A 4OK5A 4BLPA 3K8YA 1NN1A 3TMKA 2VHCA 2WTUA 2ZRDA 3LW7A 4M1WA 2JJ8A 1N6OA 2WJGA 1N25A 1UADA 2QE7A 2D4HA 1G3UA 3GJ5A 1TQ6A 3G0HA 2WZQA 1KDTA 1ZM3A 2ONJA 2RGNC 3CONA 3BORA 3WY9A 1N2CE 2FMXA 1J8MF 3K53A 4HAWA 1L2TA 4QRHA 1W46A 2YC4C 3ZVMA 4IVPA 1T8UA 5FTNA 4C2UA 3HYTA 4BLTA 2CK3D 2DYKA 1G3QA 4NBSA 4POAA 3SE0A 5C2JB 3K9LA 4PC3A 1M74A 2F9LA 2QA5A 4Z8XA 3SYNA 3KDSE 2VP6A 3FFAA 2DCUA 3QKUA 3SFZA 4D25A 3ADDA 4O3MA 5TDHA 2R65A 5J4LA 4KODA 1E9BA 2XXAA 4BGDA 2A5FA 4A8JA 4DLYA 1KTVA 4QKQA 1CEEA 1T5IA 2V54A 3NHBA 1UEJA 4LRWA 1W48A 4GOJA 2ZS7A 1DAFA 3AKCA 3NEYA 4LJ4A 3EASA 1IJFA 1EXMA 1KSJA 3U6KA 2FJUA 4D4LA 3FMOB 2IK8A 1P60A 4JVSB 2XX3A 2XNSA 1IN8A 3CUEF 3EAQA 2Q21A 3QG1A 4UXJA 2IWHA 3ZVNA 5HZKA 1X1SA 2RCNA 2CCJA 5J4HA 3L82B 2EVWX 2RGDA 4LYHA 2G77B 2O0HA 4G01B 4OK3A 3IHLA 5CM9C 3TQFA 1XEXB 1ESNA 3W8RA 2ODBA 2ANBA 1U90A 1TX4B 1IY0A 2G0NA 2OAQ1 1GFIA 1ZP6A 3OAAA 4LJ7A 1AS3A 3CNOA 1M2OB 5P21A 2IEYA 2QL6A 2FEOA 3BB4A 4NYMR 2CK3A 5E4FA 5JHGB 5FBQB 2MMGA 3UWKA 3X1ZA 5C4MA 5JS8A 1MO5A 2VSFA 4OI0A 2Z6VA 4TSFD 4WBSA 1ZUNB 4YONB 4YMTA 1E69A 2DY1A 3TUZC 2YKGA 1G19A 1KO1A 1CR1A 2XOKA 2QQ0A 4GNKA 2DWQA 5KO2A 2GZAA 2BV3A 2PZFA 2F3TA 2C98A 1H8ED 3SC3A 3LQQA 1IAQA 1YVDA 3U5ZB 4S35A 1X86B 1FX0B 3BJIC 4JJZA 3S1AA 1FP6A 2FX3A 4HAXA 1D2NA 2XZLA 2CJWB 5EP3A 1T5LA 4L5BA 1ZM7A 2DHRA 1PLKA 1TUEA 1ZM2A 3MCAA 5BQ5A 5F9FA 2BOVA 3TNFA 2EFHB 1E1QD 1XMVA 1GAJA 1R10A 3RHFA 5JHHB 1JB1A 3C16C 5CB8A 4HB2A 3PJRA 4FWIB 4NHOA 4PAOA 3EG5A 1KAGA 4ILEA 2J9RA 1ZRHA 1OE0A 2GRJA 3LA6A 5GJBA 4Q00A 3LXRA 4PC1A 4DT1B 1COWD 4OHYA 5CK4A 2O8BA 2CLCX 2PZEA 3QE0A 1E79D 1KK1A 3JVUA 4QHYA 3UPUA 2QGNA 4R2HA 2IYLD 1RRGA 4MRRA 1DAHA 3RNLA 4W5JA 2D62A 4GZLA 4IRUB 2O0KA 2JLSA 3EX7C 1KOFA 4L15A 2GEDA 2FFQA 1M1YE 1E96A 3TVDA 2FA9A 1Z22A 4TSFA 4XVRA 1JAHA 3O8DA 4UJ3A 4ACBA 1R0WA 1P4SA 4UNRA 1UAAA 2YWEA 1XCPA 4B3CA 1E0KA 1UKZA 4RCZA 1H8EA 3DZ8A 1KK3A 4MKFA 3I5XA 1KMHA 4QM7A 1PJRA 3TUIC 5B57C 4I81A 2V7QA 1E2HA 3SYLA 1U8YA 1NSFA 4B32A 3IQWA 5FL3A 2C9CA 2W6JD 4OI4A 2VHTA 4PHTA 3HYRA 2WAXA 2QPTA 1N6IA 2ZE7A 2N1BA 3OIWA 2F7SA 3QXXA 2CL0X 4QGAA 2P5TB 3MGCA 3BD9A 1RRPA 721PA 4IKEA 4JLMA 4JIMA 1T3SA 2E9SA 2ZSBA 2EYUA 2GAOA 2ZU6A 5E3HA 2ASEA 3KQLA 1VIAA 3IDQA 1AQYA 2B7BA 3QVVA 3VX3A 4U02A 2R6FA 5C18A 5FH9A 2EU8A 4FCWA 2R6CA 1R2QA 2OFOA 8OHMA 3HWSA 2O8EA 2TMKA 2D7DA 3CF6R 1TMKA 4PPQA 1XCMA 3ETLA 4V0NA 1W4BA 3NWJA 2V55B 1E0SA 4LPKA 1M34E 4CEHB 1GTVA 4A15A 2VP0A 4HZIA 2W00A 1ZW6A 3IIKA 4BFYA 1WE2A 3FMPB 5FOVA 4ZKEA 5BYKA 1XD2B 4G3XA 4C0JA 1NIJA 3VU9B 3LV8A 2FGKA 2ZVPX 1BS1A 4U7DA 3AGQA 4DIEA 5KPJA 3M0EA 1GG2A 3UWOA 4QGHA 3OEHD 4Q7JB 3CRQA 4PQRA 2PX3A 2D74A 3IO3A 1XTJA 3P26A 5AJVB 3V9PA 4QJ3A 5IF9A 1U9IA 2PBRA 3RRYA 2OXCA 4U00A 5KUTA 3RRMA 4PX9A 1DPFA 2IYUA 1G3MA 3OF5A 1E1RD 4I1OA 4IVQA 1BYIA 2ZSAA 1US8B 3E2IA 3KFXA 1ZUHA 5CB6A 1HH4A 4JLBA 3RWOA 1UKYA 2NO0A 5ELXA 1W4CA 3CWQA 3C41J 2IUUA 2ORWA 5HE9A 3BK7A 2BKUA 4KHZA 3QQ5A 1OF1A 3QSYA 3LD9A 1BOFA 3CPHA 3WNDA 2ZSDA 3K0FB 5JI3E 2H5EA 3HU1A 1D9XA 2WSSD 4MYHA 4EDHA 3EIEA 3QXJA 2GJAA 3N2EA 1XPRA 5HZHA 1QDEA 2ATVA 3PFIA 2RGXA 4KBFA 2AK2A 4NKRA 1Z07A 1G6OA 4WA7A 5J4KA 3AF0A 2RH5A 3ZD7A 3QNUA 3SJAA 2GXSA 1QHHB 1GVNB 1DVRA 3L2OB 3THXB 1XPUA 5KNBA 3HR7A 4M1TA 4LBWA 1UDWA 2ZUCA 4TMVA 4UQOA 3T1OA 3QKTA 3V4FA 3C15C 1W0KA 2FZ4A 4D4MA 1SXJC 2OV2A 5EJEA 4CEJA 1GL7A 2ZRIA 1F2UB 1UPTA 3OEHA 2PT5A 4TL7A 5JSZB 3FVQA 4MYCA 3N2IA 4URYR 3CZPA 1WCV1 3FKSD 2VH5R 2I3BA 2NO1A 1XTSA 4HUQA 1R8SA 3KZ1E 4P3YA 1OXTA 1ONBA 2OAP1 2JA1A 4NCHA 2OUKA 1L4UA 2OM2A 2FPLA 3MMPA 2JCSA 2IX3A 2NO6A 4EJSB 1OH8A 3T1VA 3TJZA 1E2MA 2OFXA 4V0OA 3VHLB 4JLKA 3THWA 2JJ1D 2PEYA 4WZBE 2PX0A 2ZJBA 4B35A 5KSYA 1OXVA 3QBTA 1HT2E 3U44A 1FUKA 3K09C 1ZD1A 3B1VA 4R9UC 2G0TA 2C9YA 1NBME 1SKQA 2O5VA 2FGJA 4V0MA 4URZR 4BFXA 3QXSA 1ELOA 2K5UA 2R6AA 2C95A 2WSSA 4IXMA 4PO8A 3TW8B 5AK0A 3BE4A 5JWRA 1KAOA 5KU1A 2ZRHA 2ZRPA 1PV4A 1T3HA 2DFTA 1VG9B 2V1UA 3W6PA 3W5IA 4C30A 3FHOA 4B74A 1ZBDA 4A0HA 3CRMA 4JT4A 4PQYA 2WJYA 3KKNA 4K8OA 1A1VA 3NC0C 5DN6D 2W6IA 4KAXA 5E7MA 1G8PA 3GEHA 4LJ5A 3CKLA 2G88A 4CF7A 5CK5A 1ZU4A 3I73A 4FMBB 4XD7D 1LNZA 3LLMA 5KNDA 3EPKA 2WWFA 4OK6A 1HE8B 2OEPA 3EXAA 1WRBA 4P4TA 3WRXC 4LK2A 6Q21A 1CXZA 4E03A 1U8ZA 4F93B 2ZRNA 3E70C 4UKDA 3ZDQA 3RSOA 1CR4A 2V6JA 1SVOA 1Z8FA 3D6TB 3MJHA 4KV9A 4FMCB 3T34A 1D2MA 5GVSA 2JJ2A 4ASUD 1LB1B 4XWOA 1TEVA 4B48A 1ZINA 1FTNA 1TNDA 4RSGA 3EZFA 1ZD8A 2FFBA 4A9AA 3GFPA 3AVQA 2WICA 4NCIA 3T06B 2HEIA 3CR7A 3F0TA 2Y8EA 1JEEA 1JXMA 3NBFA 5AWFC 1T9HA 2QTVB 3VKHA 3GLFA 2IYQA 1SXJD 1S9HA 1OIWA 2AFIE 2XTZA 1EFRA 4K46A 1VG8A 4TN1A 3W8NA 821PA 2ZE8A 4LYJA 4KSBA 4LV5B 1HTWA 1P61B 2JATA 2R6DA 4DZZA 4ZCIA 2XB2A 3PITA 2HJGA 1HY3A 2YNMA 1E2PA 3IBGA 3LXXA 2REBA 1E9FA 3R8CA 3WYAA 3RWMB 4BEJA 1DO0A 4A6PA 1XXHB 2ZETA 3DEFA 2WJHA 1GIAA 3AVOA 2AWOA 2EFEB 2IW3A 3MD0A 1GKYA 2FSGA 3B60A 3SHWA 4XD7A 1OHHD 3RS3A 3GPLA 1AKYA 2JIZA 4QBHA 4X8LA 1W1WA 3MJRA 4MRVA 1KI8A 3DOEA 5A0FA 5TMPA 1W47A 1MV5A 1NN3A 2BWJA 4HEJA 4DWJA 1AS2A 4YXWA 2J59A 4D0NA 1IN5A 3VFDA 2J46A 3CB4A 1Z47A 4DDUA 1W2GA 1II8A 1XB2A 5SZIA 1E98A 2ZE6A 1YZKA 3DMDA 3TW4A 4IVRA 2CNWA 1VIYA 4BASA 1UEIA 3B13B 4Q1DA 2ZRMA 2JLVA 1TUIA 1P72A 2A5DA 2HYDA 1Z0JA 1YRAA 4AYTA 4O2RA 2QP9X 4FCTA 1YZUA 2A78A 5CYOA 3OEED 1G3IA 2O8DA 2GBLA 1Z0FA 2WIBA 4HATA 1G5PA 2ANCA 4TTQA 1YR6A 2YOHA 4HUTA 1T3LA 1YKSA 2ZR7A 3K70C 4ZCMA 1YR8A 3QKSB 3P4YA 2GVZC 2WBLC 5AUNB 3CF0A 2UZ3A 3KKPA 1MT0A 4JLAA 1OFUX 1R5BA 1Z6TA 3U4QB 4WZAE 3R7WA 4GL2A 3G5UA 4NCNA 2PL3A 4LSGA 3H4MA 5EUQB 2Q0HA 1NVWQ 2EQBA 2QMUA 4A0GA 2A5YB 3KX2A 3PG5A 2C8VA 1NIPA 1X3SA 2FWRA 3UKDA 2ZRGA 3GJ7A 3EZ9A 4LV8B 1JNYA 1G18A 4DVGA 3LH5A 3AV0B 2IF0A 3DO6A 4IFBA 4PXAA 4WOPA 5GVRA 4LOAA 3SYKA 3FOZA 1EGAA 3U7FB 3RVBA 3VR6A 1ZC3A 2X77A 1G7CA 3Q72A 1XPOA 3RYTC 2XITA 3C7KA 3U3MA 4ZDIA 1RIFA 4C7OA 1NN0A 2RGCA 5G53C 3NBZC 4E07A 5HR5A 4L8GA 3GD7A 4BZPA 2IXFA 4DDTA 2B92A 1ZIOA 1Q1EA 4TT3A 2ZUDA 4WVFA 3PUVA 2PLFA 5JZVA 4Q03A 4KFUA 4KYUA 1SGWA 3Q7PA 4A8JC 4DDVA 2WJVA 2YWGA 1Z5ZA 4BFZA 1K5GA 4BEBA 1FNNA 3QVUA 1KZGB 2HLDA 4TYQA 5EE5B 3PUZA 4L4UA 4BFSA 1E3MA 3CPEA 2RHDA 1E9RA 4HZUA 4Q18A 4LGMA 3L0PA 4C0BA 3AVWA 2QORA 1OW3B 1G7SA 3AVPA 3JVVA 4MRNA 2ZYWX 5E7IA 1SVWA 1J7KA 2OBMA 2HF8A 1VTKA 2QT0A 4PHGA 4Q7LA 4PSVA 2O8FA 4FW9A 3T5DA 5FTLA 4R71A 2ZPTX 3CNNA 2Q6TA 4B3FX 2XJ4A 3TKLA 4M21A 5LPNA 1XTIA 4YDHB 5JLJA 2DPXA 3GLGE 1H65A 1X6VA 1X1RA 5CLLA 2A2ZA 2EFDB 1HE1C 4MH0R 1KGDA 3A1SA 4LZZA 4XTRA 3REFA 3RS7A 4GBMA 3WMGA 1HURA 1IY1A 2NO7A 2ZRJA 4DJTA 2NMVA 5H70A 2YC2C 3CWZA 4WIAA 2XZPA 3K70D 1WA5A 4G5RA 3EIQA 4DUGA 5A4JA 2AR7A 1XNJA 2AK3A 4DCSA 1L4YA 4GOXA 1II0A 3AVYA 4KLNA 1AZSC 4P32A 4OQFA 3U7GA 1P5ZB 1FTSA 5IT5A 2VPPA 1Q3TA 2VEDA 4D81A 2ORVA 1JXOA 2RGEA 2J0UB 5B30A 4D6PA 1GDDA 1GRQA 2QE7D 4CYMA 3N70A 3HR8A 4DLXA 4E09A 3LY5A 3QJYA 3TSWA 2D3WA 3AKDA 5HCNA 1Z2CA 4X8MA 1OXUA 2B6HA 1IY2A 4P4SA 4JYBA 2HT6A 3R9WA 1W44A 3BGWA 3UIEA 1SKYB 3FDIA 5EZ5A 1BYUA 4JSYA 3DOFA 3ZZ0A 2I4IA 2P6UA 1YZGA 4TLCA 2CDNA 3AKEA 1E2NA 2FG5A 2Q3FA 3QUSA 3ZJYA 1YJ5A 1TF5A 4B75A 3AP3A 1W7AA 1CR2A 1RYFA 2GXQA 2N42A 4N3NA 3QPVA 4N0EA 2I1QA 2PCLA 3QY0A 4PO9A 2AXNA 2NO9A 4C0QC 3HP1A 4LHWA 1VYUA 3I92A 4WZ6A 4IEEA 4ZIRB 1KY2A 4IXNA 5CIWA 2QSZA 3AEZA 5IDVA 3QIAA 1MO4A 4CZ2A 1KI3A 4ARZB 5DNYB 3GLFB 3K9GA 4BECA 1SVSA 1VECA 4IDPA 4N0DA 4B2IA 3GLHA 2HXYA 2O0JA 1XX6A 2Z4RA 2RKOA 4RZ2A 1PUJA 3QKRA 1XEFA 2HF9A 2X2FA 1CU1A 1VDZA 1WMSA 1P2SA 2MSEB 4Q4AA 1NMZA 2FNAA 4RJLA 4Q4HA 2AXPA 4MA4A 4D82A 1Z6XA 1E2GA 5A5GA 1G8YA 2ZUBA 1KHTA 1ETUA 3P4XA 2OBLA 3EPHA 3OAAD 5J4YA 2A5GA 2P6NA 1F2TA 3LW8A 1W0JA 5EXXA 3L0SA 2J0SA 3NG1A 3KUDA 4I99A 1XTQA 3T5GA 1U81A 1N5JA 2BKEA 4PPNA 5HCIA 2OILA 1FQKA 1T8TA 1P73A 2D06A 3VKGA 2XOKD 4Q4JB 2J3EA 5J5CA 4AYXA 1AA9A 1C4OA 3HPRA 3SN6A 4DEYA 3W6OA 2XTMA 4KXFB 4PC2A 5DO9A 5FL7D 5L3RA 1NP6A 2WHXA 2ZR0A 5L3QB 2WV9A 3GLIB 4AY2A 1EWQA 5DYIA 1NF3A 5FPKA 5CYPA 2ZQ5A 1NLZA 2JASA 3LDAA 3UMSA 4QFMA 2IYXA 1SXJB 4QXAA 4XIGS 3M6AA 1CBUA 2IUSA 1FPMA 4BQSA 1KIMA 4H9GA 4JLDA 3GLGA 2ZM5A 2NGRA 4ESVA 1J8YF 3TLXA 2C2HA 4KBGA 2YHSA 5FOXA 1ZD9A 1DAEA 1U9IC 3FHTA 1SVKA 1K8RA 2IL1A 2OXRA 5BW8A 2OO7A 2IWRA 1GNPA 4AG6A 2Q9AA 4ZV4A 4GI7A 2ZI6A 4YLGA 1OXXK 4CDGA 2BJWA 1EK0A 2V4ZA 4KFRA 3GP8A 4PR0A 3QF4B 3D3QA 2XSZA 3IO5A 1W4RA 1HV8A 1XD8A 5D3QA 2ZYVX 1FUUA 4KO8A 4Q9JA 4CRWB 3VR3A 5KSZA 4BFWA 3CBQA 4B76A 2QBYB 1DAGA 4ZI2A 3GJ0A 4DLSA 3LQRA 4B2PA 4A36A 2CCKA 1Z3IX 4AKIA 1DG1G 3RSLA 3SI7A 3Q5EA 2OE2A 2PT7A 5FL7A 5FOSA 4BUJA 1E94E 1SVLA 2PCJA 1W36D 1W4AA 2V7QD 3ND8A 4MKGA 4OHZA 3RRNA 2QU8A 2VLIA 5LBIA 3BAFA 1RJ9B 2Q9CA 3L0OA 3U7EB 3THYB 2V1XA 1KK0A 2VBCA 1XJ0A 2Q9BA 3TR0A 4FXPA 2ZEJA 3RS5A 4DLZA 1D5CA 3L8YA 3N5CA 4OJQA 5K8TA 1VCIA 3WP1B 3I32A 2AKYA 3IEUA 5FTMA 3C14C 5JI2E 1KYIA 1I2DA 3O8CA 4A2QA 4A2WA 2XAUA 2DWOA 3KL4A 4TMWA 3WRYC 4JBXA 1XBTA 5L3SB 3CX8A 3P20A 3FTQA 2V9PA 4BZQA 3KJEA 4NYIQ 2PLRA 2GXUA 4B71A 2BMFA 3HDTA 1ZUIA 3SZRA 4A4DA 4ABYA 4B3GA 1OPXA 3UANA 1NNEA 2PMKA 3RAPR 1XCGB 3MLEA 4ZCLA 2OCAA 4TYPA 1P7CA 3A36A 4A2PA 2CHQA 1MOZA 2VL7A 4MYTA 4P0TA 5KDLA 4BFTA 5TARA 4XVQA 4LI0A 1G291 3SJZA 2YOGA 3FHCB 3EIHA 4GRAA 3A6PC 1N0WA 3I62A 2C78A 121PA 3IKJA 4OI1A 1CTQA 2H18A 1SHZA 4KFTA 2J7KA 2O8CA 1XZQA 4NH0A 2W2TA 2ZRFA 2H16A 2SHKA 5JRJA 1NVVQ 1Z28A 1WB9A 3P1JA 2ZTSA 4JBYA 1TQDA 5G3YA 2CCGA 4M1KA 1GP2A 4US1R 2GCOA 2RGBA 2JGNA 3AUXA 3D31A 4TQ9A 3SS8A 3ICQB 2ZJOA 3O47A 5HTKA 1KSFX 4B44A 3MG9A 5J47A 3GCGA 2IC5A 1RVDA 1UM8A 2A9KA 3PIRA 4IDOA 3EC2A 1JQLB 4ITRC 4II7A 1VHLA 4DB2A 1N5LA 4NTZA 1XTKA 3LNCA 5JECA 2ZJZA 3I61A 3CW2A 3B85A 4US0R 1Q44A 4M9ZA 1RC8A 4AI6A 4YDSA 4EQ6A 5E95A 1CR0A 4DHEA 1CKEA 3OE7D 4A6XA 1TAGA 4URWR 4TMZA 1RZ3A 1EFTA 3BRWD 2V8OA 1G8GA 1N0UA 2REXB 3DM5A 2IYWA 1O3YA 3NBXX 2CHVA 4HAUA 4NE2A 3EWSA 4NMMA 4P33A 2FDCA 3KKMA 5H8WA 5DYGA 3C5CA 3D8BA 3UG6A 2WPDD 5D3MB 5JRZA 3ASZA 4EPYA 4AKHA 3K70B 1OFIA 1SKYE 1QHSA 2HUPA 1W0KD 2WKQA 3KB2A 1P9RA 1DG3A 1SVIA 1KI4A 3U3JA 5FBVB 4ON9A 3TH5A 5FOWA 2F43A 4NCJA 3HJNA 2PZGA 1P2VA 5DI9A 3WMEA 2P67A 1ZMXA 1Z29A 4D0LB 5EP2A 1SQ5A 3QF7A 4R7ZA 2WWYA 4MITA 1E4YA 4Q7KA 1XJCA 3AF3A 2VRWA 2MSDB 2MMCA 3Q3JB 2WKPA 2C9OA 4Q4AB 4RCYA 4YMWA 2PMDA 1OYWA 4LPSA 4PPGA 2QT1A 4J0QA 2ZI3A 1BO6A 3PVSA 4NYJR 2IA5A 4O0MA 2X1VA 4HB4A 4Q47A 3MAAC 1LW7A 3TQCA 2LKDA 1MABA 2VHUA 3CR8A 3CX6A 1EFCA 4MRSA 1W5SA 4IFEA 5BWMA 3EW9A 4GT1A 1GKIA 4QC2A 2IXGA 3OE7A 4DC9A 4CT4B 2NPFA 1XP8A 2R9VA 2J41A 2H1LA 2GXAA 3K0AA 2ZANA 4C4PA 1KJYA 3AF1A 2OCYC 1TEXA 1TQ4A 3LX5A 4TLEA 2DB3A 1N6KA 1Q1ZA 4IHQA 5DLQC 4Z54A 2GZDA 2GBLC 1DAMA 1E9AA 1HT1E 1YZQA 2OFWA 2WPDA 4G5GA 2XXAB 4A8JB 3PEUA 2GEUA 5AUQA 2VO1A 3CRRA 1UKEA 2QTHA 1G3RA 2W6ID 2LWIA 2FZLA 5FUWA 1P3JA 3SQWA 5TB5A 4URXR 3RC8A 4PC7A 4XVUA 2CMKA 2IS6A 3ONWA 1XEWY 1F6BA 3KUCA 4OQLA 1R8QA 4EFNA 2BBOA 3ZQJA 5JJIA 1SHKA 3NC1C 4E22A 2V6IA 4B33A 4IOJA 1WF3A 3IIMA 1P6XA 4JLOA 3W3ZB 4Z1MA 4LY6A 2JJ2D 2YOFA 4QL3A 5TV2A 1MKYA 4BE7B 3A4MA 5J40A 1KO8A 3I5YA 2YVUA 4KSCA 3ZVLA 4B6FA 4LJ9A 2QQEA 4PHFA 2QI9C 2IS1A 3SOPA 5KDOA 4AYWA 2FEMA 1SXJE 2AHOA 3A37A 3TRFA 3WYGA 4BLRA 4GFDA 4CEIA 2GCNA 3BXZA 4V03A 3IEVA 4JS0A 1T6NA 1EFRD 4RY2A 4TQAA 5SZKB 4Q1AA 2VA8A 1FOEB 4TYNA 2LCFA 4AKGA 4F4CA 2W0SA 1CJVC 3MWJA 3K0SA 4OJKA 4Q02A 5DIFA 1OKKA 1Q57A 3S1AB 2IYYA 3NKVA 3UK6A 4A1FA 1AZTA 3CNLA 2NTYC 1RKBA 2P2LA 1E2KA 1EX7A 2J87A 1FNMA 4OHWA 4FMDF 1EG7A 2OG2A 2J5XA 2IYRA 3MWYW 1D9ZA 4DB4A 1P9NA 2QENA 2JIZD 3FMFA 5M04A 1G21E 2QSYA 4D4KA 4G5OA 3KXIA 4BFVA 2G83A 3AGPA 2R44A 1J90A 4YXWD 4TTPA 3B1WA 3EWAA 2IYSA 1G20E 3KJHA 1OSNA 2H57A 3Q9LA 4V0LA 2WWHA 4G0NA 4IDQA 2O8BB 5FBLB 2CNWD 1NJFA 1EX6A 2GNOA 2IT1A 2Z43A 3U3KA 1JJ7A 2W2XA 1V5WA 1M6NA 1KI6A 1P2UA 1ZNXA 1XU4A 5CITA 3U60B 1NMXA 1AS0A 4RFSA 3AM1A 2O52A 1OFTA 1U0HC 1XFAA 1AIPA 1LY1A 3L0IB 1GSIA 4JLNA 2IXEA 1ZU5A 4DCUA 4ERNA 1I4LD 2XZOA 1KO5A 1N3BA 3RS2A 1BH2A 4TYYA 5EE1A 1J2JA 1GRNA 4Z51A 4WXRA 4R98A 4Q1CA 4B6EA 1F5NA 1ZNWA 2ERYA 1ZM4A 1OIVA 3IIJA 4N1AA 2RHMA 1YR9A 4DSUA 2BVNA 3KTAA 3VTKA 2DR3A 5JJLA 2DBYA 2ZRCA 4U5XA 3DPUA 2YYZA 5G41A 1FFHA 2DWPA 1KMHB 1NI3A 1OXSC 4B3DA 4PANA 1N5KA 2QAGA 4EPRA 1KSHA 1Z0KA 3GJ8A 4QHSA 4L9WA 2VQSA 2WWXA 4Q01A 4JYCA 3T12A 3ND9A 1PLLA 1SULA 2BBSA 1K5DA 2CL6X 2R2AA 1E32A 3KQHA 4RD6A 2BCJQ 2B7CA 3DKVA 2GCOB 1KI2A 1NL3A 3ADKA 2D2FA 2KI5A 4I1SA 2F6RA 2P0EA 2GCPA 3PENA 2JDIA 1DO2A 3X1DA 1JECA 3OIYA 2J7PA 2ZI4A 4RD1A 2FPMA 4AD8A 3G82C 3EA5A 4QM6A 1E2DA 2HDNB 2ZS9A 1M7BA 4MDFA 4B43A 3OHMA 1WDTA 5K8LA 4EQ6B 3ZS9A 2O8EB 4NDZA 5AR1A 1GRRA 2VHJA 1GKUB 4TT3D 1GL9B 5EXSA 5JFGA 2CE2X 1ESMA 1L8QA 4BFUA 2H7VA 1QG2A 3B5JA 4WXPA 5EE3A 5FOTA 1S0UA 2NPIA 1E2QA 2QNRA 2HLDD 1KO7A 3ASYA 3BH7A 2GJ9A 2GK7A 3B1ZA 2FH5B 1IONA 3W3AA 1KNXA 1AQUA 1OB5A 2CXXA 1AK2A 5B58C 2UVQA 1IBRA 3MFYA 2A5JA 3TK1A 1VG0B 4MYUA 2GEVA 1E2EA 1S8FA 1NVVR 2F3RA 2OCPA 2Q3MA 2QROA 3VR5A 2JLRA 4JL8A 4V02A 3EA0A 2FOLA 4UNPA 2J45A 2DFKB 3SDZA 1V43A 1NBMA 2QMHA 3B8HA 3BWDD 3DMNA 1QHXA 5BN3A 5GJWC 3VR1A 3I3SR 5LB2A 4ZO4A 2FE4A 1IXRC 5CLQA 1Z0AA 3VNUA 1JR3E 4Q9IA 1JALA 5JBQA 1S9DA 4GP7A 1E9CA 3T35A 4AG5A 3LBNA 1IJEA 1XEXA 4W5HA 5EZ6B 1IM2A 4DUGD 3IGFA 1AJEA 1OH7A 4DDWA 2QPAA 1ZCBA 1NMYA 1VKJA 4MUBA 2GILA 3R9IA 4HAZA 4DIDA 3U3RA 1C9KA 4KFSA 4BWYA 2QM8A 1U94A 1BIFA 1G16A 1KDPA 4TQUS 4WAUA 4Q9KA 1Z6GA 1MH1A 3L43A 3CIOA 3CF2A 1E9SA 4Q9HA 4JKIA 1ZIPA 3M1IA 1G7RA 3VR2A 2KJQA 4QNMA 1Y3AA 4ZI3A 2EWVA 2AD5A 1W49A 2LKCA 5TVKA 3TE6A 3A58B 1FX0A 1GOTA 4D0GA 1A7JA 1UF9A 2CHGA 2WMNB 4CEJB 4TL8A 1QVAA 2AX4A 2CJWA 2MSCB 2QP3A 5BXQC 3R9XA 1KDRA 1VCNA 1FMLA 2OESA 1G5RA 2G3YA 3CH5A 1PZNA 3SNHA 5J4VA 2RGAA 4EPTA 1KJWA 1S2MA 2Z5FA 4M22A 4HUQB 3ICEA 3SBEA 2E1RA 3NTUA 1FZQA 3ZYCA 2BMJA 2GAAA 2RB4A 3ZH9B 4C0LA 5FPYA 2CLDX 2GJSA 4Q4LA 1Q1QA 3GJ6A 1RW4A 2BCGY 1NY5A 4DT1A 3THWB 2FSHA 3C8UA 1U2RA 3GEIA 3CO5A 3TUJC 4DBLC 4UJ5A 3PUWA 5CIQA 3U44B 3WNBA 3HPQA 3CLVA 3ZZTA 1YE8A 1Z0IA 1GITA 1M8PA 1FL9A 1AGPA 2A3RA 3GJ4A 2ODNA 2J0VA 3ZGXA 1G64A 4B47A
chains in the Genus database with same CATH superfamily
3KXKA 2Z2ZA 2QW1A 3HV0A 5EA2A 3JASA 1QVZA 2C88A 3IQDB 4CNBA 3H9GA 4MS4B 3NOQA 2JFZA 4JB2A 4AXXA 1KBZA 3AJEA 5MN6A 1TUBB 1ZX1A 3AHDA 3UHPA 3OHPA 1FTWA 4BLQA 1NNI1 2NU9B 2AZ4A 4DLVA 5C7LO 1R37A 3JD0A 4PSDA 3I64A 1FS6A 1YV9A 1PV2A 4UXHA 3OKPA 2ID4A 4PINA 2EBWA 1ADJA 4C2AA 2QDXA 2AD1A 4AUKA 3DCYA 5K45A 3DKPA 4WSOA 2PH3A 3ED1A 2IPLA 4PFSA 1QE5A 1W0CA 3HXLA 1XKXA 3THOA 3WMFA 3DE7X 4TKVA 1YBFA 4E7OA 1KI1A 2GA8A 1PR9A 5EHXA 2HC9A 2XZTA 1JEYB 4OQDA 2YYAA 2JC3A 2P77A 4IUDS 4M1ZA 1PBNA 2CSUA 4K28A 3QXHA 3H0KA 3JR7A 4QODA 4ATNA 4F6LA 3KOWA 1Z0DA 1YCDA 4F9GA 2NUPB 2X0IA 3IUEA 1QRAA 2OP1A 2HJVA 3H2IA 5D1HA 1W7AA 5G0WA 3S8YA 2FUCA 2R68A 3U56A 1E3TA 2GPTA 1YZNA 3R20A 4M0PA 5EERA 3VUFA 3BUSA 4D4IA 1YB1A 2W98A 2AF3C 3PXBA 2DLCX 1YR7A 4BUCA 4PPYA 4X6YA 2BM9A 4QRIA 5KTOA 1AX9A 1NATA 1XELA 5CT8A 4DCNA 1S7GA 1SBZA 5A71A 4AJ4A 1YVUA 4G26A 2BSAA 2XZDA 2IBSA 3ZG6A 4YH1A 4O8ZA 4CW7A 4BP1A 3KS9A 5H80A 5PNTA 3HCNA 4TTIA 4NCKA 3DR5A 2PD3A 4TQGA 1Z06A 4WKBA 4YBZA 1ZUD1 2ADOA 3JQAB 4NE9A 1Y6QA 3K1AB 5CJ2A 2WG0A 2QN7A 4FFBB 1FFGA 2V6BA 3EG9A 3PQ5A 4B17A 3AR7A 4Y67A 3OUUA 4OPMA 1KQPA 4EGJA 3I9FA 5JJCA 1G8MA 4PGHA 4B2YA 4POOA 5KVVA 5KQGA 2BFCB 1TADA 1RI5A 1DE0A 1GWNA 1HFWA 2PO5A 4KW7A 3VU9A 1Q91A 3OIFA 1Z45A 5ALSA 3PQ4A 1EDZA 1RP1A 2CNDA 4WK2B 2CLFB 2Y05A 3CKKA 5EIWA 5KYTA 2AC7A 3G85A 3SHTA 2L0XA 5B3JC 3ZCUA 2DQSA 4FI3F 1QIFA 4YRMA 1PP4A 4L1KA 3VUEA 4QLOA 3KYDA 5DXAA 1NLUA 1Z34A 3F6SA 1DJQA 2XSZD 4BZZA 1UXKA 4CQMB 1NX9A 3AVVA 1DC7A 2AWNA 4Q1FA 4NG5A 4YK7A 3G2JA 4UBIA 2RK4A 2ERXA 1YDHA 5F64A 5FTKA 1NXQA 1GPWB 3FY4A 4C3ZA 3AR2A 4MUYA 2FFJA 2WPNA 3ZHSA 4AY6A 1TQ2A 4OL9A 4QUEA 2EWWA 2ZJAA 1CVRA 2FQWA 4PLVA 1FVOA 1XXHE 2QOEA 3LLUA 3O1HB 1HYGA 4FFLA 4ND8A 4QBFA 4U6SA 4ARVA 4BN4A 4PN3A 1TTHA 7YASA 1P5JA 3CE6A 1Z63A 4PZDA 4UE6A 2WV7A 5EXTA 3LRXA 4IR7A 4A26A 1KL7A 4P86A 3KVVA 3NDJA 4GDMA 2G1JA 1GYPA 4BO3A 2DHEA 1KJZA 2MHCA 5AXCA 3MA0A 1VI2A 1G2QA 3UJ7A 4EDFA 4YAGA 2B69A 2P5SA 3ETHA 2H3HA 4GPTA 4HX5A 1JPNA 4BMSA 2PFKA 4UXIA 3WGLA 5HPYB 3VX4A 4EHHA 2P3SA 3S40A 1VCMA 1GNLA 1BHJA 1XZPA 2H51A 2QUZA 1R4MB 4L6AA 3LPCA 3A4IA 4A8HA 2JFOA 3MGGA 1WZUA 3MSXA 1Y6GA 3AB3A 3SBDA 3PLNA 1XWWA 4BCBA 4TMTA 4DM3A 2M98A 3ONFA 4YJFB 1R5OA 2XHZA 4Q5IA 3I4LA 1F4VA 2YASA 1JDSA 2CNLA 2KSQA 4WZBB 5ECYA 2YZMA 3IV7A 4M0MA 5C1BA 3B48A 2PPVA 3BD7A 1HDIA 1LS6A 2GETA 3FSGA 1XMSA 2XMCA 1GQRA 3VA7A 1XMJA 3A1VA 1JT2A 3B36A 1EA5A 3JQ8A 1FRQA 3W2HA 3CURA 3T15A 1NRJB 3IERA 2YXBA 3U2QA 1JR6A 1HWYA 5GONA 2WM8A 4FPXA 5C35A 4PYIA 3DVSX 5B55A 1O57A 2A57A 3PGVA 1MQAA 3GAFA 3NH6A 4J0GA 2OECA 4ILKA 1KP9A 2W6QA 4RZUA 1G0NA 3WHIA 3M4YA 4JR2A 4KXNA 4WESA 1VJTA 1JMKC 3JXEA 2PK3A 4ONEA 2JD0A 3QOXA 2P5UA 4YT8A 2PJRA 3QZUA 1YS1X 2CFIA 3HL4A 2OA0A 2WLTA 3R1IA 4MB0A 1H69A 4TWBA 4Y1RB 4U3JA 1BGXT 3ZWWA 2DFNA 2HPZA 3EXG2 2WFLB 2PKXA 1QRDA 2R85A 1PBTA 3M6XA 3RCBA 4F06A 3PWTA 5E6RA 3X1KA 2ZSHA 4IDGA 2J4FA 5J43A 4G1UC 1YUBA 1VFNA 2IHVA 2MINB 4EJ2A 3HV2A 4H1WA 3Q2IA 4WTOA 1TCCA 4BB9A 2GUGA 4AS1A 3WC4A 2GVNA 2OZKA 3EY4A 3L7CA 3O8BA 4JVMA 4Y2HA 4I9HA 3FMIA 3MYRA 3WBFA 3RBZA 1SUBA 4G1CA 3FCXA 5F5LA 5AM0A 4CMKA 3A1UA 3IMGA 3GDGA 3AUSA 5HE8A 3P4UA 3T5MA 1EFVA 4I4TA 4JJGA 1RSZA 1YHZA 4KIWA 5MGNA 1X8JA 2BMDA 2XDQA 1QHNA 2C3UA 3B8EA 1W35A 1SJ9A 3LBHA 3QVSA 4YALA 5TY0A 5HSGA 2IHBA 5LQRA 5LD2C 4NARA 2Z4TA 1N34B 1YA6A 3EFBA 1NLMA 1U0EA 1KZYC 4DILA 4B7CA 4NMWA 1R74A 3F6YA 3IHWA 4BIIA 1IPFA 2B20A 1I10A 4JJKA 1TI7A 4CDNA 1IN1A 2GRUA 2I1LA 3AWDA 3IRUA 3NWBA 3EXEA 2W6MA 5JS1A 3DMFA 3E1KA 3ZWNA 2ALJA 1T43A 1CJMA 1Y8ZA 3IB3A 3IPLA 4JZKA 1SCJA 4KJZA 1ZJ6A 2XUIA 2AKAB 1ST3A 3QVMA 3TAHA 1TPZA 3V6LA 2BGWA 5F1PA 1KFJB 4G86A 3U3OA 2PUEA 3L7OA 2BUAA 4R3NA 3JYHA 4P4UA 3OMXA 1GPUA 2H5LA 2BFPA 4MKHA 1GZSA 1C30B 4KXYA 1NN5A 3PDCA 2HFJA 3R0VA 4WY2A 4F38A 1YDWA 4FXOA 5ITZB 2C20A 5BURA 1E60A 2QE6A 1BXGB 5K6AA 1WU7A 2W37A 2FUG1 1UDBA 2LNDA 4MIYA 1BD4A 1QPGA 1VBKA 1ZN7A 1VL5A 3E7WA 2MYNA 4YPFA 1R0YA 1T4CA 1T2FA 3B2QA 3PDJA 4XEUA 4XWAA 2JARA 1I1HA 2QG6A 2GPSA 4O25A 3LLSA 2IS2A 1H1LB 2C31A 1HC7A 3ZIAA 2W2PA 2FV8A 3CV3A 3UGJA 1WWKA 1H2WA 1IRIA 2GCGA 3OKFA 4D2IA 3DVLA 4YJGB 3GP3A 4YAOA 2JJMA 3O3OB 2RIRA 3R2JA 2CMGA 4MDHA 4V1CA 1A4XA 5DULA 2C77A 3MAGA 2ZIEA 3TWOA 2JIPA 5AOCA 3AUTA 3QYPA 1CJBA 1J21A 3OY2A 1IQPA 1V3UA 3PV0A 4PPFA 1P8JA 3BIWA 2UZIR 4LX8A 1NX6A 3CLUC 2D5AA 3LKZA 3L5KA 4X60A 1CP2A 3GRYA 1QWSA 3B1YA 1E1QA 1RE0A 5FWXA 1X14A 2CMFA 2BE7A 4RWZA 1PJ8A 2PWYA 3FYHA 3DF7A 1BG6A 1YQEA 1JNXX 1J5XA 4ZAGA 2G36A 3ZWBA 4E46A 4QT4A 4TZ0A 2EGGA 1GUZA 2JFNA 2XWPA 3GCXA 3RFFA 3A9CA 1P62B 3H1AA 1BKSB 1N8KA 2MJLA 4DSTA 4XSHA 3NONA 5K9ZA 4MQEB 4ZRMA 3LVQE 4EHJA 1Z2EA 2NX2A 1E99A 4HSEA 1EUDB 3K9NA 2FAXA 2GWRA 5JC8A 4NSNA 2VT7A 2J08A 1Z5OA 4XCVA 4CM6A 2WF9A 2PLNA 4QXQA 3OQMA 1CZHA 5CURA 3OESA 4PQFA 4CDRA 1NI4A 2QX4A 2PLWA 4R68A 3AX6A 1EWRA 3OZIA 4AAYA 3QUCA 4EMTA 1Y5MA 3PPIA 4A8TA 4PCAA 1DWUA 1AY0A 2X14A 5FBKA 1PRYA 3LIIA 4R81A 2JHAA 1SG6A 1OH6A 1B6RA 4LQLA 1OR8A 4O1IA 3D6FA 1QYCA 3FNBA 2ORIA 3ZBQA 4NEQA 3RIMA 1GLNA 3K0EA 3R3UA 4FE3A 1QP0A 5DBIA 2OENG 4ZT3A 1F6WA 4I14A 4Q66C 2B61A 2MWMA 2XQKA 4IF4A 2RHHA 4P22A 5T67A 4OHVA 3CLTD 3NEAA 1H2FA 1VCOA 2WWIA 2YWHA 3EZ7A 2W6JA 3WGNA 2QTMA 2Y68A 4DV4B 1X39A 1EUYA 1EE9A 2FRDA 3L4BA 4LHYA 4WXYB 3H7IA 2CFRA 3PUYA 3FOEC 5KYXA 3QPUA 1DMRA 1IXYA 4XJXA 2XODA 2OCXA 2VP4A 4UBKA 2GF9A 4ZAZA 3BXGA 2P62A 3U62A 1U2EA 4OQPA 3L0BA 4G6ZA 3ZEIA 5F5NA 5CA1B 1E1KA 3TSZA 3UAYA 5B36A 3ZDAA 5C46F 2EQ5A 3GJXC 4WPGA 3CNQS 2GHIA 3HJCA 3AMVA 1OKKD 4RS3A 4Y6GB 3TNDA 3PFKA 1QWOA 2ZRBA 3PNVA 2FKNA 1K7SN 2IHJA 4LUCA 4M1YA 4TLMB 3PLAE 3C74A 3L8DA 1KKLA 2NIPA 2R7NA 2VXYA 3CZQA 4L6CA 4P5PA 3KKOA 4LYFA 4A6DA 4OQ4A 2J07A 2QXYA 2WIKA 1L4KA 3DL0A 5EQDA 1M7HA 3RT1A 4AZ3A 5AVXA 2R1ZA 1ESZA 4W1QA 3SFVA 3OJCA 4RKQA 1S2NA 2B2XA 2FJ0A 4CL3A 5DRYA 3TZ6A 4I1VA 3GFRA 3KTFA 5BP7A 1H8HA 4KPYA 5K8CA 4UE2A 3COWA 4H15A 2XT6A 3GLGB 4LV6A 1JFTA 1WXEA 3TR5A 1Z5GA 2PEZA 5KVSA 1F17A 4YEDA 2BM0A 2ZVJA 1SVUA 2GHRA 4FEGA 4QG7A 4AN0A 2J5QA 1PJBA 3MTIA 2NU7A 2F55A 1BQEA 3GLIE 2PFSA 3WLOA 4FOTA 1D8TA 3AUYA 1CDOA 4Y18A 5BRJA 1U0BB 5TPZD 3VNQA 1A82A 1YR1A 2YMQA 3PICA 4URVR 2RAPA 4KO4S 3WIOA 5HM6A 4ZU3A 3HXOA 2QMYA 1Z2AA 4QDZA 1GEGA 2CEAA 4WKNA 2CVFA 2BZ0A 3GFTA 4IQ8A 4DMFA 3IXQA 3I0NA 4KIUA 4W5NA 4S0XA 4HB0A 1W52X 1E1RA 2BMAA 5CDFE 3WKEA 1P4JA 2ZIUB 1XKQA 2D2XA 4BEWA 3PA8A 4S1NA 3IQGX 4XFJA 5H59A 3BB1A 1A2BA 4BAUA 5KNLA 1J06A 1UMDB 1XIVA 3F46A 4WOKA 4PWZA 2OHHA 1KVQA 4MGKR 3LUAA 2CN1A 3KPVA 3RG8A 1CDEA 3ON5A 3UWDA 1MEEA 4TXMA 5UKDA 4DPLA 4FBLA 1JJIA 4OX9Y 3FJ1A 3BMCB 3HRIA 5T4HA 2QR3A 4HI0E 1TU3A 1HOXA 3EHEA 4HGRA 4OYRA 3IPAA 1P31A 4L2IA 4LJ8A 1V37A 3P9NA 2NQ8A 4N03A 4ZDWA 3UBMA 1CULC 4MWCA 1ADFA 2ZSUA 1JFFB 1BEUB 2W6CX 3DHWC 4HDMB 1E6EA 1JF8A 3LUCA 1KGSA 2CVOA 3I6BA 4ZI7A 1IH8A 3DXXA 1RRCA 1WXFA 2B30A 4MULA 5CM2Z 3ZW9A 4OFXA 4LHEA 3EYWA 3HRHA 4BB5A 3ZNPA 1CLUA 3CX7A 3QHAA 4D7AA 1J7JA 3PWSA 4AMZA 3DCNA 2VSXA 1QV7A 1R0KA 3FKSA 5KX5F 1KFBB 2JLYA 2G7MC 5J4VA 1YQTA 1XZ8A 2C99A 2Q3HA 3LPLA 2AN9A 3PPXA 1ZK0A 3Q5DA 2YZ2A 4EF6A 5KVQA 2ZRAA 2ZVDA 1EEHA 1IFXA 5CGQB 1DS6A 3HB9A 3ZGYA 4Y9TA 3PXCX 1DTSA 2D1RA 1E7SA 4MWGA 3NOOA 3N5KA 4KLRA 4LRYA 5FI1B 1RXIA 3SD7A 1CETA 3WL3A 4E32A 1IQRA 1QFXA 2QD3A 2A7QA 1LV7A 1YOVA 3HU3A 2JCBA 1ADYA 1VHTA 3MJCA 4L9SA 3H8SA 4YIKA 1TC2A 3SLGA 4BMZA 2P90A 3RAJA 4AMYA 2O1XA 2R7LA 3KP1A 1Z56C 1AKNA 1UXJA 3C24A 1ZNZA 3CJRA 4IW3B 5DSTA 3A4LA 3BX1A 3NHAA 4ZJZA 3U0VA 5CDYA 1BVUA 3GRZA 1DADA 4W5WA 3CLKA 2RHTA 4PLPA 4C0KA 2QQFA 1IMOA 1M0EA 1CV2A 5DHFA 2HYIC 4IDNA 4L75A 3LC1O 4DQKA 3A04A 3AWIA 2ATEA 4JI7B 2OORA 3CW8X 5F98A 5FUXA 2TRSB 1M73E 5IU6A 2YICA 2P6RA 2NYAA 4OL0A 1KAEA 1WMDA 5EC8A 1ECPA 4JZYA 4AFNA 5ARDA 4BGUA 4JX8A 1TIPA 2BEJA 2V9CA 2H0QA 1DEHA 5J1SB 3K8ZA 2VDWB 4RF5A 1RLOA 4RU1A 2VP5A 3K9BA 3GELA 4UVHA 3RYHB 3UCEA 2JLUA 2V9ZA 2ECFA 4MGEA 2C3OA 1KJQA 5CDSA 2HCJB 4MKIA 3DTVA 2F3QA 2D0OB 4QICA 2FN8A 4R9RA 2X9LA 4C9BA 1N6RA 3JV7A 5IC6A 1UOQA 3ZJ5A 2A30A 5BRAA 4JI8B 3MGKA 3GZ4A 2G8LA 5FNVB 2A88A 1T9BA 1I9CA 1Z74A 2Z5GA 2KLBA 3AUFA 3LO5A 1X19A 5AI4A 3FFXA 5DTEA 4DAEA 5C3MA 1YL7A 1HDYA 4JMPA 5KNCA 3PJDA 3KJIA 3NDPA 5L3QA 2BM1A 2G0AA 1ZEJA 3GO4A 2QK4A 2F43B 2JFQA 4NU8X 2AR0A 1PJ2A 1HQCA 2Q49A 5IWCA 1BE8A 1H66A 4PX2A 4BB0A 4BBAA 1FBTA 1QTRA 1EINA 2RGYA 2XDAA 4XWGA 3TSOA 5FAKA 3UK7A 1TTTA 4MGZR 4PGMA 2QVCA 4YP6A 4BX9A 5BYJA 2QVYX 4GSYA 3QFRA 4MQFA 1I1QB 1FLNA 1W9MA 4CLOB 3HFJA 5AVSA 5DGTA 4EAQA 3PDWA 4QJ5A 1FMTA 2RH4A 3GVPA 2HT1A 5GP1A 4TLDA 3DP7A 2AFHA 2NADA 3LCUA 3EZ2A 1K8QA 3I2IA 2GKGA 3C97A 1R0ZA 3LL7A 4LQCA 2BGUA 2YIJA 1G8SA 4JD5A 1MABB 4LTDA 4DSOA 2ZYGA 2RC6A 3SNKA 3UATA 3PCRB 1IDOA 2OCBA 2FWBA 2ZI7A 1R4NB 4ZICA 2WJJA 4G5XA 2R6R1 2PR7A 3JWHA 3MUNA 2ZUUA 3OF2A 4OSOA 3E5RA 5AJXA 5DT9A 4BTEA 2WMOB 3PIIA 2GZ1A 1FMJA 4UVGA 2REOA 3FVVA 3OWOA 2ZT8A 4LNHA 1AQLA 4PSKA 5IAEA 4NICA 5IK2D 1ZXLA 1Y9AA 4M87A 3VOSA 1BMFA 1T4DA 4X6LA 1VLVA 4BNTA 3L01A 5GY7A 5LQNA 5K8JB 1A5TA 4NMXB 2XB4A 4DIMA 2QBYA 2DR0A 4DG9A 2G76A 4I2VA 4I4LA 1KO4A 5DK4A 3LP5A 1U0NA 5GJVC 1V8BA 4RFVA 5JD3A 3V4VB 4C6RA 2VPTA 4R2JA 2MIIA 3PPYA 5COQA 2ECQA 3VR6H 4BCDA 4X54A 1QO0A 3QE3A 3CF4G 2DKFA 4G0ZA 1RI2A 3E27A 3M33A 8AT1A 4EUHA 2G1PA 1FW6A 3CXUA 3NWEA 4LF4B 5I9LA 1BWSA 1JR2A 1BCSA 1OBVA 2NZJA 5CW1A 2YJZA 4J1QA 4JKYA 4XM1A 1WEKA 5E2BA 5A7GA 2XBUA 5DK6A 5K7SA 3MS2A 1UK6A 2JJQA 2TECE 4F4IA 2QYOA 1I7QB 5HKKD 5LD2B 1QX4A 3G2NA 1U3DA 1STOA 2E1PA 1U80A 4ND2A 3H5RA 2KBEA 3IUSA 2F00A 3HA7A 2POQX 3KSAC 2A9JA 2ZXUA 3S2FA 3VAAA 2CVHA 5CT9A 4FGUA 3GIWA 2C7GA 2BZ1A 2IUTA 1XJQA 4EJ0A 4RCVA 1MAWA 2BDTA 2YWBA 3O83A 3AEXA 2GYUA 2PGXA 1DHRA 1OI3A 4G89A 1Q95A 4CKZA 1N2GA 1J00A 3HKDA 4QBKA 3E1GA 4EJSC 3TTUA 5EWMB 1ZGHA 1NKSA 1JHQA 1HR0B 2W0MA 4X61A 4A2CA 3MUFA 1WG8A 4FYVA 2X6TA 3CUWA 2R5WA 1XQ6A 3MTDA 3PQCA 1TFUA 1Z2OX 3R4VA 4KACA 4MUKA 4OSPA 5EE0A 3RSZA 1Q84A 5I9NA 2PDAA 4HDCA 5LZ7A 1YT5A 3VI3B 4LE0A 1SA0B 5LDDC 1JR3D 1BVHA 2G6BA 3L1KA 4HDQB 1XTZA 4CM5A 1FP2A 1GPLA 1AXEA 2VJNA 4JC8A 4M88A 4O2BB 4PGGA 4C4TA 5A3RA 3NBUA 3QLUC 1P75A 4QRDA 3EDCA 2HJRA 3ZVRA 4CV0A 3QUTA 3KUXA 5B3KA 3KZKA 1XMOB 5FF9A 2OV4A 5SY4A 4EUKA 1WMBA 2ZIZA 3VKVA 1U4NA 2IKQA 3O8OB 3PD1A 4UHEA 1O0SA 3D7MA 3KALA 2VNJA 1YRBA 2ZRQA 3HO1A 5EMLA 2QN6A 5G40A 1JKXA 1E7WA 1P2GA 4BC0A 5JDCA 2QXTA 1I14A 2RGGA 4XTCS 4JB0A 3C4JA 3TRIA 2W4QA 3GDWA 3NAGA 2ZXEA 3FDZB 4K6OA 3G9QA 1BKDR 2JD1A 3LDFA 3A6GA 3OPNA 3SE7A 2I9KA 1KH3A 2FLWA 2J48A 4M6WB 2R7AA 5K0NA 4MYRA 1CD5A 3OC6A 3QEMA 4QU0A 4RVFA 4AIIA 4EATA 4YUXA 5J3JA 5DW0A 3C3PA 4LNUB 2ZYAA 2Q8QA 1FP4B 4NYJQ 4TWZA 2PUHA 5L7TA 3WYFA 2ZI9A 2HRDA 3H4TA 3NHWA 2GVDC 1N5IA 2GHTA 2JLWA 4PFQA 5IF3A 4MTCA 4XH9B 2DCMA 5ESRA 4QNRA 1SVMA 2XEXA 4ZCSA 4NONA 3MUEA 1U0RA 1S3SA 1B23P 3TQOA 4HLUC 4NZYA 1RBMA 3UV7A 2XCSB 4RTPA 1RHKA 3WWZA 3GVIA 3DLHA 2PT9A 4X1OA 2WHPA 2OO3A 4FOSA 4M8KA 1C1XB 4Y2TA 1J8VA 2NZYA 3PT5A 1IOZA 2GO7A 3AP1A 2XNDD 3BL8A 1JAXA 3O2NA 4IIUA 1TIBA 2L82A 4ZPXA 3H4VA 4MUGA 3AHHA 5AM4A 3AFMA 1LBIA 3CZCA 5FR1A 4P5EA 5M2QA 4BZXA 4W5QA 1ZJZA 4LNAA 1KEKA 1AKWA 1ARZA 3A8TA 3HZOA 4RA9B 4WD3A 4A5SA 4ETIA 5KBYA 3MTQA 3TMKA 4FYHA 1L1EA 3O03A 2WTUA 2H6EA 2ZRDA 3LW7A 3AR4A 4DIFA 1PD0A 4XA8A 5L4LA 1N6OA 2FVXA 2AYYA 5JC1A 2QE7A 2ERCA 4WKOA 3ZXYA 4EP1A 3FGOA 4P6VF 3PRYA 1J0BA 1GG5A 4FT2A 5GV7A 1B7GO 2BH9A 2RARA 4N9WA 5E9WA 1JBEA 3FNIA 1DUIA 1C5KA 1PW5A 2BHNA 2FMXA 3K53A 4BNKA 1R0CA 4BX0A 4AS3A 3BA1A 1W46A 2YC4C 4DDMA 5GIOE 3DR3A 5FTNA 4B79A 1G55A 2N47A 4YBRA 5EIXA 1HETA 1G3QA 2NV0A 5DGIA 4HJXA 1TTPB 3CFYA 4P5DA 2IFTA 3G02A 3K9LA 4JJFA 3SE0A 5A9SB 4PC3A 1M74A 3THRA 3DS8A 1ECBA 4Q6BA 3EBOA 3TDNA 4F86A 2VPXA 2DCUA 1HZJA 3W5DA 3B51X 2XXJA 5THXA 4D25A 4CTMA 3ADDA 3EFOB 3UENA 4JELA 3MWFA 1J97A 3QWFA 4QARA 5LP6C 3AL2A 3U80A 8ADHA 4WGFA 1B26A 4BZWA 2CBXA 1KS2A 3W9BA 3MOIA 1BJRE 1F0NA 2V54A 2HSWA 1XA4A 1DAFA 3HLYA 1OBHA 3I52A 1WDKA 4JBNA 3E7XA 1P91A 4KXUA 1EXMA 1KSJA 2A5LA 1A9RA 4K9KA 3OFSA 1XRRA 4G5HA 1QIMA 1XJWA 4UAUA 5B1IA 3UTCA 4OLFA 5B7QA 1L6IA 3KJXA 5FKJA 4DA7A 4UBOA 3CVXA 4KVZA 4R9NA 4MI3A 3LF1A 4LYHA 1FUIA 1SCIA 2G77B 2J3DA 1XRNA 2YJNA 4FHGA 3WWOA 5E8RA 1CVLA 1TVCA 2GNAA 3FOWA 3HSYA 4YDRA 1GQ2A 5LMZA 2Z2XA 2ANBA 1U90A 1I01A 2DBQA 3L1JA 4NZZA 2VNHA 3EB9A 3KDAA 3F1LA 3MXTA 4IG9A 3CHYA 3O2JA 1W85B 4CJXA 4CE6A 1Z7YA 1AE1A 4HH3C 4NYMR 4PCUA 4UVDA 4J7UA 2WKSA 2BP7B 4GC5A 5FBQB 2H8GA 4DW8A 4FVTA 4F1JA 3PNPA 2C4WA 1Y0BA 2BF7A 2PZBA 2WT9A 3DYVA 3CLSC 1E64A 1ZUNB 3E22A 4YAUA 2DY1A 3TUZC 3ORHA 4GNKA 1QQ5A 2XOKA 2DWQA 2ZPUA 3M2PA 5LA6B 2BKAA 1OFVA 1RJEA 3SC3A 3DV9A 3WMWA 5FT9A 1CEXA 1YVDA 1VA4A 2Z9CA 3EXFB 1NT2A 3FJOA 4D8UA 3BJIC 3U5ZB 3TLGA 2CV2A 1FP6A 3DL7A 5EY5B 4CKWA 1T0IA 1O4VA 3Q1LA 5CTJA 2ZBFA 5DYNA 5F51A 1NW5A 3KKEA 4KLCA 2CJWB 4S05A 2JNWA 1E2UA 1YRYE 2P30A 3DG9A 4L5BA 4LZLA 2J5KA 1O2DA 2FN9A 4IHAA 2DHRA 4KZKA 5EYPA 5A3SA 3TYXA 2SKEA 4QSMA 3HP7A 4PBSA 5FORA 4TLLB 2C59A 1USWA 5F9FA 3QELB 4L5YA 5C8XA 1M10A 1WZNA 1R10A 4KB5A 1U0TA 3C16C 1D1QA 5CB8A 4EKNB 4DA4A 4NHOA 4GM0A 1O5OA 4PAOA 1LXCA 1Z2PX 3FB1A 2J9RA 1G8AA 2FN7A 3HXTA 1TD1A 3L7KA 3HP4A 3LA6A 4KMOA 3PE4A 2UXDB 4HQRA 1COWD 5AXAA 4OHYA 5CK4A 1YMVA 3CCCA 5ICFA 2I6XA 1A76A 3BTVA 5BSHA 5IHXA 1BJTA 4ZEMA 3IV9A 4ABTA 3DOIA 3ZTYA 1QRSA 3AIOA 1WR8A 1XAJA 4OO3A 1RPTA 4IRUB 3GMSA 3DHVA 3BWEA 4DRXB 3OFKA 1MH9A 1FQWA 4Z7JA 2B2CA 1GA4A 1KZ6A 1QIJA 1T35A 1LBEA 2Y9PB 2OHJA 2FMKA 2JAXA 3EWNA 3DAPA 3H7AA 4GSKA 1QCCA 3TE7A 3TVDA 1Q0RA 2QRGA 3GG9A 4HH4A 5TVGA 5JSUA 2HZBA 4FS8A 1WU8A 3C3MA 2G9QA 3QWAA 5COBA 5BSMA 4A7PA 4UNRA 5G02A 1WUYA 5HJEA 1U65A 1GTG1 2QVLA 5EN4A 5A4AA 1XJ5A 1LVHA 3A1EA 3DZ8A 4DIBA 1FTQA 4MS1A 4ZU6X 2HCTA 4KR2A 5MDHA 1DKNA 3IJEB 2V7QA 1BDJA 3PVCA 4B32A 2HH9A 3AHFA 1ZESA 2XMRA 4RZIA 1FXWA 3F6EX 3LCRA 2QPTA 3VVCA 1O5IA 1C9YA 2ZE7A 3OZSA 2N1BA 4QJIA 3RG2A 3ZE0B 3OMLA 2C57A 4NATA 1X15A 2P4SA 5JZSA 1RRPA 4LGVA 1LZLA 5LKAA 4GE0A 4CLEA 1N8SA 2E9SA 2Y1DA 2ZSBA 5AKLA 2EYUA 3KQLA 1BAPA 1BN7A 2ASEA 4V2UA 4B6QA 2B7BA 3CNBA 3EGIA 3QVVA 4INOA 5KU7A 5GMOA 2R6FA 3JAKA 4ZYYA 3ENWA 4ZHQF 2Y6UA 1R2QA 2ID8A 1JJBA 3GPCA 3HWSA 1N57A 1L5MA 1ULAA 4RAOA 4RKYA 1PU2A 1TMKA 1W5FA 1QSGA 3ETLA 4EI8A 4C78A 2Z3VA 2ZUEA 3NWJA 4UEWA 4RYDA 1JW9B 4LPKA 1M34E 2QTCA 4A15A 2VK2A 3BAZA 4ZT7A 2W00A 5E9AA 2R79A 3ZWPA 2M9MA 5CA0F 1G2IA 2GD1O 2PSSA 2PWAA 4RSHA 4BP9A 5BR1A 2FPOA 3F6CA 5G4KB 4E2XA 4C0JA 4UEJA 1NIJA 3Q6NA 1YO6A 3IP1A 4JVOA 2ZVPX 1R27A 2B7LA 3AGQA 1FRZA 3RNOA 1C7RA 1QIGA 5JH7A 4HNVA 1GG2A 2HIGA 4AP5A 2PBFA 3H0EA 3R6GA 3VR4D 3V9PA 4F60A 1NU6A 3JPYA 4HGYA 3EHDA 4K9MA 2J33A 3VNAA 1Q19A 3W7AA 5JAUA 5JAZA 1O1YA 1RHQA 4X84A 4ENTA 4BBPA 1G3MA 4JROA 3FOCA 4IVQA 4KQKA 5AI8A 4ZAYA 5K0BA 4J4BA 4UUNA 2LTAA 4Z7NB 4AU1A 3FYSA 4WNAA 4G41A 2YWCA 4ZYWA 4ER3A 4LWOA 1C3OA 3L1UA 5HE9A 3BK7A 4B3JA 2JI6A 4KQFA 1OF1A 1ORIA 3KSRA 4O08A 3V5NA 3ZE9A 1V7PC 1XHEA 3ROFA 1EIZA 4Q9NA 4YQZA 3WNDA 2ZSDA 1JIQA 3ZKWA 4R5HA 3K0FB 1O95A 4NF2A 4UBLA 2IDZA 1ORWA 4YRCA 5HKLA 3X1MA 5JI3E 1MXFA 1QF7A 2YMPA 4HTFB 3R5FA 3SEFA 4EDHA 1Y3CE 3EIEA 2GJAA 5B2EA 2OLEA 5J5VA 1FFCA 3HO6A 2I8LA 2ATVA 1B00A 1UOOA 4RO0A 1OTYA 3KL2A 4WFIA 2ZIXA 1G6OA 5KYUA 3ZY6A 4TV8A 3WL7A 3IT3A 1QOPB 2C42A 4TV9A 1XPUA 4FCCA 3SJ7A 4C4RA 1SOMA 1EFDN 2UZ0A 1BX0A 1UDWA 1HDXA 2ZUVA 3EQ7A 4LBWA 3QKTA 4UQOA 5DB4A 3T1OA 1G6Q1 3O73A 4I8DA 1SXJC 3QPDA 4MVJM 5JCOA 1GG9A 2Y9MB 3OF3A 4KNYA 2A35A 5TEVA 2ZRIA 4OUDA 3JQPA 1CZRA 1UPTA 1X1CA 2W6OA 3JQBA 5KNDD 2QTRA 2IOQA 3FVQA 3N2IA 1BA2A 4L0DA 2Q3BA 2EX4A 2AQHA 3L7YA 2DTDA 1Z38A 3G1UA 1JU3A 2VH5R 3MT0A 4D98A 1ND5A 4XWWA 3OO1A 1V47A 2FOIA 3KZ1E 1N2BA 3PCXA 4KDEA 1O6GA 1WULS 3DBLB 2H5JA 1ONBA 2OAP1 2QZZA 2AJDA 3G7SA 4CTNA 5IKPA 1V1RA 1Y6FA 1JEQA 3RJ5A 2FOXA 3MMPA 2JCSA 4I5EA 5IJAA 4EJSB 4I19A 1OH8A 3DONA 1FVFA 2EKQA 1E2MA 4V0OA 5G0SA 5C8YF 2PEYA 4E0BA 3A2KA 3ME5A 4QPCA 2ZJBA 4G0UA 1TU0A 1OXVA 1MDBA 2CXNA 4QT0A 2JHCA 1HT2E 3QBTA 3N8NA 3X1JA 4ZVMA 4OGGA 4B6OA 2AG5A 2G0TA 3F6RA 3GJTA 1TYDE 5CFLA 2B4TO 4QDOA 5DTJA 1NBME 1SKQA 1XAHA 1WVIA 2VCEA 2FGJA 2X0NA 4BQRA 3GA0A 4ETWA 1VXRA 5C0OE 1HDOA 1P1BA 1B0PA 1GYRA 1ELOA 2K5UA 3D7SA 3LYHA 3QXSA 4OHCA 4PWYA 4EW6A 5KU1A 3AK4A 4FGZA 4MS4A 1A8IA 5D6NA 1PQYA 1E1LA 1CERA 1M2FA 1TUBA 3C5EA 3A0UA 3K31A 3PU6A 4LIPD 2V1UA 1Z18A 3W5IA 4MEAA 3W5SA 1R9MA 5AO9A 4A0HA 1YSCA 5ER9A 1V1JA 1QYXA 3ETEA 4JT4A 1G8KA 5JG7A 1M1UA 4E5DA 1RM5A 3VKFA 1U28C 2WJYA 3KKNA 5D2CA 3UN1A 2ZW9A 1NM5C 2XTJA 4DPMA 4U2EA 3MTEA 3NC0C 5CAEB 1OYOA 2J85A 2W6IA 3GYGA 3HA2A 2M1ZA 4HAIA 5HKAA 4D8YA 4TM7A 2RONA 4CF7A 2CYCA 3BZWA 1HDEA 3SCZA 2QD4A 4I3HA 2C61A 2PX8A 4YJGA 3CZMA 5TGTA 3RVPA 4OKIA 1JEYA 4OK6A 3D0KA 1JB9A 2UZAA 4AMGA 5LNK1 2H9YA 4MTLA 5HVNA 5EP3A 1NP3A 1Q0SA 3WK5A 3O4GA 1RKUA 1Y4SA 4MLZA 4F93B 2IEAA 5J58A 1EFKA 1CR4A 3WGYA 2H0AA 3MJHA 3I2GA 4KV9A 4ZAVA 4RVNA 1D2MA 4XX0B 1GUYA 1LB1B 4FX2A 4WJLA 2AE1A 3OU7A 4MWTA 3ZDYB 1JTFA 3QV1A 3ZN2A 2B4AA 4UD2A 2GFHA 1I3MA 1ISSA 2V5AA 2A9FA 2IUEA 3DE2X 4Y2YA 3VYWA 4WLVA 4BB6A 4F71A 3EBLA 3CTPA 8MHTA 4OLBA 4NCIA 4LVCA 3VVMA 1U11A 3WLIA 1G2PA 2DLDA 3B20A 5AWFC 3ZHZA 1VGVA 4IIGA 2VZ8A 3GLFA 3FWHA 3VKHA 1Y3IA 3JQAA 6YASA 1S9HA 4KKVA 3K1AA 1PW7A 1Q0QA 2D1TA 1GGFA 2VJBA 1EFRA 1DV2A 3G2MA 4K46A 1DRVA 4Q37A 3LHIA 3O2SB 1I2BA 4FFBA 3S2ZA 4WXEA 4IKOA 4TN1A 1GQOA 3W8NA 3WAJA 4ZREA 1T2EA 1I3OA 1AV7A 1RPNA 5I9IA 4DZZA 2H0RA 4MAAA 3T1NA 3CF4A 2XRMA 4B0OA 2I2DA 2NVOA 1VE6A 1K88A 1PJSA 5JY6A 2W2NA 4UM9B 3CQ9A 3HB1A 3WYAA 4B3SB 1VB5A 3FPCA 2H29A 3S5JA 1XXHB 1N7IA 3SSMA 4BHTA 3DH0A 5CNMA 5C37A 3N2KA 5HF8A 5LNK6 5I51A 1V48A 2PRZA 2X7JA 2EFEB 4PVDA 5FJIA 3MD0A 3SHWA 5FBHA 1K6XA 2OCLA 3N59A 1EHIA 3D6NB 4XD7A 4PZCA 1AKYA 4R2LA 3RS3A 3STXA 1VBMA 2Q3EA 4GR5A 4CQMA 3OZDA 2QRPA 2M6SA 1DQRA 3I2HA 4MP3A 3UZUA 1AS2A 3FG9A 4PZAA 3OCUA 4TVSA 2G4VA 3CB4A 4QU9A 4D3YA 3EEBA 3JQ9A 3EMDA 4BKUA 1PTJA 3DMDA 2GEKA 2AB0A 4EF5A 1U6KA 1U5CA 3JQRA 1QH8B 2D13A 2R4QA 2UYGA