3WTCA

Crystal structure of gox2036
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
259
structure length
259
Chain Sequence
MSLSGKIAAVTGAAQGIGKAIALRLAKDGADVILLDVKQDTLAETAKEVEALGRRAVALTADISNRDQFRSTLADAAKTLGGLDIMVNNAGICQVKPILDIEPAEIEKIFSINVQGVLWGMQAAATLFKEKGTKGKIINACSIAGHEGYPLLGAYSATKFAVRALTQSAAKELASSGITVNSYCPGIVGTDMWVTIDKRMAEITGTEIGATYKKYVEGIALGRVETADDVAGFVAYLSSSDADYMTGQSVLIDGGLVFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Gox0525
rcsb
source organism Gluconobacter oxydans
molecule tags Oxidoreductase
molecule keywords Putative oxidoreductase
total genus 98
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wtcA00
2O2YA 4PLFA 4DLAA 2D5CA 1U4SA 1X14A 3MJEA 1GD1O 4XGNA 2DBQA 3OA0A 5A05A 2Q45A 4LMPA 4MKZA 5JCJD 1HTBA 4E4YA 4Z0TA 1MG0A 1UXJA 4GLOA 2JFGA 3UCEA 1UP6A 4I9HA 1QYDA 3EW7A 4NFSA 4BNHA 3DBRB 4NJOA 3E18A 1RKXA 2X86A 1PEDA 3CKYA 3NJ4A 2OO5A 4II2A 4FR5A 3AY6A 4PLPA 1PU2A 3EGOA 3V8BA 2EP7A 1SB9A 3INTA 3QWAA 4OAQA 2TMGA 5G4KB 4AJIA 1NM5A 4F6CA 4K6FA 2PGJA 5HM8A 2VRBA 4XKJA 5C7LO 5IG2A 5JXWA 2J5QA 3PJEA 1LLUA 2QZ9A 1P1FA 3JQ6A 4O0LA 5HS4A 3JQBA 3I9JA 1YVEI 1PGQA 2WJPA 3SJ7A 3FR7A 5DCYA 1PL6A 2C59A 2PA3A 4CPDA 1I8TA 3I83A 5TT0A 3JCZA 4R51A 3WS7A 3DBLB 1MLDA 2BGKA 4NU6A 3C85A 5BR7A 1P44A 4B8ZA 2O2SA 5A9SA 1CDOA 3R0IA 1X1EA 2DPGA 4RPJA 1DDOA 5GMOA 3VC7A 3JYNA 4CMGA 1D1SA 1LUAA 1PS8A 4MOWA 4YBZA 3KEOA 4YJGB 1F12A 3U62A 4OL9A 2PGDA 3IAHA 4CR8A 2PFGA 2IZZA 1B14A 2JHGA 3I3OA 3P19A 1NFQA 4PLZA 4UVGA 1PZHA 3PK0A 4OXNA 1Z73A 3GEMA 3TZCA 3GPIA 4PLVA 1LSUA 2AA3A 3JQAA 4OHUA 1BW9B 1V0JA 1A72A 3S1LA 3LC7O 3DOCA 2QZZA 3EZYA 3D4NA 4FOSA 3ZW8A 4LVUA 3V1YA 2VWQA 3JD0A 3SEFA 1GZ3A 3DOJA 3RSHA 1MXHA 3ZW9A 1OAAA 1D8AA 4CM8A 5A02A 2GASA 3T4EA 2C0CA 2H1SA 2WSBA 4L4RA 2DPHA 5EMHA 3BMQA 5TT1A 3PWSA 4WUVA 5B1YA 4B3JA 1D7OA 1I30A 3LC2O 3ZWPA 3L6OO 4HBGA 3JQ7B 3A28A 2Z1NA 2PZMA 3C3XA 3UW3A 3Q11A 3EMKA 3HG7A 4BGEA 3IKTA 2DU8A 5JC8A 2P91A 2Y1GA 3ITDA 2NVWA 3DZIA 4B3HA 3I9OA 4D43A 2V6FA 4J43A 3UAGA 3HDJA 1SOWA 1ZMTA 1OMOA 3GHHA 1F06A 1ZEMA 1SAYA 3PPIA 1QV7A 1YS4A 3WDSA 3AU8A 2OP1A 2BHLA 3QVSA 4XQCA 1CETA 4R01A 2JD1A 3IMFA 2ZK7A 5DOZA 3UUWA 1HZJA 3E8XA 4YRAA 4E0BA 4C7JA 3CXRA 3ANLA 1RM0A 3AWDA 4OO3A 4NU5A 4YRBA 1IPFA 2PY6A 2W2KA 4FJ2A 1HE3A 4UEJA 5JC1A 3H7AA 3NDIA 3WGHA 5FEUA 4YWJA 3I6IA 3E9NA 4URFA 4XGKA 4XX0A 2PGLA 3NGXA 2O4UX 3BMOA 4TSKA 4OH1A 3KETA 5AQ1A 3SJUA 5GZ3A 1CJCA 1EZ4A 1E0DA 1PQPA 4PVDA 3OJ0A 4WNCA 4BMVA 3KYCA 1IY8A 1H2BA 1E92A 3EVTA 1GUYA 4ZQGA 3S2FA 1JA9A 5K6AC 2P68A 2O4CA 2HCTA 4ROSA 4HNHA 1YBVA 4BS9A 1XLTA 1QLHA 4MKRA 4R54A 5FWNA 3QW2A 1LDBA 2Q2WA 3GG2A 5EQFA 5EL0A 1H0KA 3WFIA 5U4QA 1SOVA 3FN4A 4WCFB 5A9TA 2NWQA 1UDAA 5JCJA 4WCFC 2IEBA 4J0FA 4XQEA 1HF3A 3NKLA 1HEUA 1YJQA 3KM0A 2O3RA 1BG6A 2VTEA 4RDIA 2B5VA 4RPGA 3NUGA 3ZU3A 3ROMA 4TVOA 3DEYX 1DIBA 3WWYA 2ZQYA 4IIVA 1E3WA 1JKFA 1JWAB 4XCVA 2AQ8A 1G0NA 2J5KA 4CM4B 3IOYA 4EGFA 3OIGA 3HN7A 2JFHA 4IJVA 3VH3A 2QYSA 2Y99A 4TRRA 5CEJA 4XD2A 3OP4A 1M6WA 5A9RA 3DBRA 1N5DA 3CUKA 1WW8A 1I0ZA 1V8BA 3CMCO 4IDGA 2WYVA 1TB4A 3GAZA 2FWMX 5C5IA 4ZVVA 5L7TA 4XR9A 5A04A 1LLQA 3MWDB 1R4MA 4JP3A 5L95A 4IGEA 3HFSA 1DLIA 4NHEA 1N8KA 4WCFA 4GSLA 3ZH2A 2WMDA 2JFFA 4CL8A 4A7PA 3GT0A 4GPD1 1C0KA 3H4VA 1E7YA 1Y9EA 4CUJA 2G82A 3MWEB 4R16A 4FC7A 4CJXA 5HWSA 2J3KA 2VNSA 5FI3A 4Z9FA 3JQ8B 4ALIA 1N2SA 3VZQA 2V7PA 1WMAA 3DFUA 2D1YA 4L76A 2Y0DA 1UXIA 3U09A 2JD0A 4II3A 1DIAA 4MP3A 3NRCA 2BMAA 3EDMA 1MC4A 2VWGA 3PWZA 4P4GA 2B69A 1A9ZA 4XIYA 4Y6PA 4WLVA 4O59O 4TVBA 1SCUA 3H5NA 3H2SA 1UAGA 5I7FA 1DAOA 2Y0EA 2W2LA 1YOVB 2Y1EA 1DOHA 4BNMA 2RBEA 2CF6A 4Y98A 4XRGA 1K5HA 3ASUA 3D4OA 3PYMA 4JP2A 4RDHA 2Q1UA 2UDPA 1IZ0A 5J23A 3DBHB 2W2KB 3GEGA 2PZJA 3UGKA 4MKXA 1CRWG 2Q49A 4E5KA 3PP8A 3PJGA 3WJ7A 4CLDA 3G3EA 1L7DA 1RJWA 1PL7A 2NQTA 5ENDA 1W8DA 3WFJA 2GN4A 1ONNA 2A94A 1KVUA 1HETA 1LI4A 4MVJF 3T7CA 1JKIA 3TL3A 3ZZNA 2P5UA 3FSRA 5F1KA 4UREA 3DAFA 3PGJA 4AJLA 1LA2A 2NVBA 3HDYA 1PZFA 3BTSA 4J9UE 1JLLA 1PR3A 1S7CA 2I76A 1PX0A 1LDEA 1LJ8A 2I3GA 3TL2A 4DLBA 1VL0A 3E6AA 4J7XA 4Z9XA 3RBXA 3WSVA 1KIFA 1EDOA 3I9KA 4CM6A 5BSHA 1OFGA 4WLNA 1HXHA 1JKJA 1EQUA 4JBIA 2Q1TA 4NBTA 1EK5A 1Z7BA 3H6KA 4BV8A 2PZLA 1D3AA 4CMIA 4DTIA 1YJ8A 3WICA 1IUKA 5IDWA 5IDQA 2Q1SA 4HADA 2GDZA 4R5MA 1PL8A 4EUFA 1VJ1A 4WLOA 3RFXA 4A27A 2AXQA 3JYLA 3LC1O 3WG9A 4PFJA 4B4OA 1ZW1A 1B8UA 2EKLA 2RHCA 3VPXA 4BNYA 4EEZA 4B4VA 4OXYA 4CMHA 1U3VA 2OP0A 1ZNQO 5DCUA 5KJFA 2OL4A 4WE3A 4WECA 3PIIA 2E4AA 1NXQA 1X7GA 3D64A 5CDSA 3QQPA 2P9GA 1EE2A 3WTCA 4J0EA 4MVJM 4RGBA 2DQ4A 2GN6A 2WYWA 4ZD6A 4NQZA 3B1FA 3HB5X 4OSOA 1K3TA 2ZB8A 3X2FA 3KYCB 3K2EA 1WXDA 5K9ZA 1I3LA 2YFHA 2C5AA 4I9UA 3GH3A 1NWHA 2DUWA 3LLVA 4AICA 1HYHA 3FBTA 2ZATA 3QV1A 4U8GA 3UN1A 1QG6A 3DZKA 2FP4A 4INAA 1NAIA 3SLKA 1KY5A 3IUPA 3MJ4A 4FN4A 1MG5A 3ZNQA 2J3JA 4PLWA 1ENYA 1ISFA 3QWFA 4BGVA 4Q3DA 3ZGYA 4J7UA 1Y7TA 3KB6A 1JVBA 2ET6A 2HRBA 4J91A 4LN1A 1I36A 1WDKA 3FRJA 3AI1A 2Z95A 4H7PA 3ONDA 4U6SA 1AN9A 3NYWA 4UVHA 3KZVA 3ZWCA 4ND4A 1KY4A 1MXFA 1OI7A 3I4CA 4FJ0A 1F14A 4GAEA 3ABIA 3B1JA 4BNFA 2RCYA 4LGVA 3KO8A 4LK3A 3OSUA 2PD6A 4R68A 3ZV3A 5KJ6A 4Z3DA 4DVJA 4TZKA 1Q0LA 2PTGA 2JJYA 5CEFA 4RL6A 4GKVA 5IXSA 4EITA 2HMWA 4BO1A 3RUFA 1X1TA 1DHTA 2H9IA 3QRWA 1XCBA 2FSVA 2XXBA 2VYVD 3S55A 5FF9A 3U0BA 2FPGA 3KYDA 5A5FA 1EUCA 1ONOA 1EE9A 1EDZA 4U0JA 3WGGA 1CIVA 4NJMB 2VHXA 3RI3A 2BFMA 1F17A 4CMCA 1ENPA 5TGDA 5JCXA 5JW6A 3OIFA 5L40A 5BNIA 1IHXA 5K0ZA 1ZO8A 1LQUA 4MVJD 2AE2A 1P1IA 1ZSVA 1NFFA 1MV8A 3IS3A 2X8LA 4Y8VA 1YL6A 4A0SA 4CV3A 4RO0A 4OYRA 4ND1A 3C24A 3PDUA 3WMWA 1ZH8A 3OQBA 3ZV5A 2VUUA 1R0LA 1IYZA 1E77A 4E32A 1C1DB 1BVRA 1UDCA 5TIIA 2PKQO 2QYTA 3ZWBA 3F9IA 1VE9A 2SCUA 3A06A 3ANMA 5IDYA 2GERA 4RF3A 4P38A 4B79A 1HDZA 6ADHA 3KBOA 1ZXBA 1Q7CA 2C29D 4RVUA 3RU7A 1UXGA 4DBZA 3HWRA 4JN6B 4BNZA 4KMSA 4PLCA 1I3MA 5IZ4A 2Y0CA 2AEMA 1WZEA 2GZ1A 3GZ4A 3RBZA 3ZWMA 2O3UA 2DM6A 2VN8A 4R4JA 5B37A 2CDAA 1WDMA 4BO7A 1FDTA 3CE6A 1O6ZA 4J4HA 1VLLA 3K2BA 3GDOA 4Q9NA 1UZMA 1E7WA 4DPMA 3HDQA 4HXYA 4XDZA 5DF1A 1VL8A 5T57A 4K26A 4F3YA 4J7CA 1X7HA 3ZNNA 4I5GA 4EEXA 5TJ9A 3QWIA 3NT4A 2Y67A 4R1NA 3A9WA 2R00C 2ZYDA 2Q4EA 1GAEO 3INGA 2X5KO 3DHYA 3LT0A 2Y1DA 4D7AA 1ULSA 3KHUA 3CTMA 5C7OO 3O38A 3VKVA 3HSKA 3D3WA 4JGBA 1DIRA 1HLDA 2VTDA 3LVFO 4YB8A 1K89A 5JY6A 3PRJA 4BQPA 2HQ1A 5ICSA 3QHAA 4ZQFA 3JQCA 5IFLA 3LT4A 3EY4A 5HS6A 4BO2A 2J8ZA 4YDRA 5ICMA 3PVZA 1XR3A 5CPBA 3LQFA 1GFSA 1HDGO 4MVJH 4CQLA 1GQQA 2IZ1A 1IE3A 1R16A 3ETDA 3PLRA 4XQGA 1GZ4A 3GFBA 4P8RA 5TSDA 1R0SA 3OA2A 4A03A 2YHIA 5JFOA 3ZHYA 1YDWA 5DZSA 5ILOA 3ZHBA 8LDHA 2B4RO 2DFDA 1XELA 1YB1A 1A7AA 2FPIA 4GMFA 4B4WA 3WGZA 3TN7A 5CAEA 1RWBA 1RYEA 1YB4A 4IMRA 4YVFA 5F21A 3ADOA 4YEDA 3NTRA 2VYNA 3ANNA 1Y8QA 4PCVA 3LF1A 4RVGA 3T7EA 1U2GA 5DULA 1KOLA 1EEHA 1HKUA 1SEPA 2W4QA 3Q2KA 5L7YA 4CMEC 2J6IA 4PVCA 3K73O 2FN7A 4BO3A 1HDYA 1U3WA 1LNQA 4CLOB 1KEWA 4YXFA 3VPGA 3IC5A 3JQBC 1TLTA 1S6YA 1VC2A 4TRJA 4UUNA 2X0NA 3V1TC 2BKAA 1LLCA 3F3SA 2RHRA 3W6ZA 4EJ6A 4UUOA 4M54A 1QKIA 2O7QA 3AUAA 3AM4A 4FOOA 2CY0A 2X5OA 2B83A 3ASVA 3GDGA 4J1QA 4JBHA 4PG7A 3RJ9A 1NP3A 5G0UA 5U1PA 4CMBA 3ZNOA 2I67A 3FBGA 1T1SA 3PQEA 1LRLA 3NT5A 4TKLA 4EDFA 2JD2A 3DTTA 4P4NA 4TKMA 3LSYA 3OM9A 5DT9A 4HFNA 2NVUB 2B4TO 3ZWYA 4N5LA 2AEJA 4I1IA 4YR9A 2YY7A 3TZ6A 4PLYA 7MDHA 2GZ2A 2JCVA 4GVLA 4HY3A 3L4BC 2DC1A 4W82A 4DBVO 1Y9AA 4NG5A 5TJHA 1YBMA 3M2TA 1N1EA 3K5PA 4XYEA 4E12A 3IKVA 1E5QA 4RVSA 3EHEA 2E37A 4ZQBA 3KLMX 4AJHA 1GL3A 5F1OA 4R5HA 2X9NA 3EYWA 2VUSA 4WLFA 5EN4A 3VH4A 4MP6A 3H9UA 4M86A 3AU9A 3IIEA 1DC5A 3ZNPA 3ON5A 1UP7A 3WBFA 2UAGA 3F46A 4XYBA 5CDYA 2O3QA 2UYYA 2VHWA 3WGIA 2QRKA 1Z74A 5KKCA 2OUIA 1DBVO 3AUSA 5GZ1A 1DRVA 3VH1A 1Y5RA 5JSFA 2CSUA 2Y1FA 4FFPA 2X0RA 1QXSA 3WLFA 4HKTA 3QVOA 1KETA 3QWHA 4D0RA 3JYPA 1H94A 2W98A 4NBUA 5T5QA 5U9CA 2IYOA 2OBYA 4YT2A 1KC3A 2AQKA 4W7HA 4KQXA 4D3DA 5IDXA 3K92A 4AL4A 4Y9DA 3EC7A 4HWKA 4MINA 4QSMA 4BKRA 3E5MA 2HJSA 4JXKA 4WOJA 1HSZA 3BA1A 1PJSA 1OZAA 3C7CB 5DDIP 1HLPA 3PHIA 3OH8A 1E1MA 1F0YA 2AMFA 2I99A 2IZ0A 4CODB 3DHNA 2PD4A 1X0XA 3E9MA 3DZBA 2D8AA 4L9RA 4AVYA 2VRCA 1NWCA 2GSDA 1E1NA 2Q2QA 3AM5A 3H5AA 3GNSA 4FFMA 4FFOA 4FFLA 4A5OA 3GN1A 4OKIA 4RZIA 3BMOB 3CSDA 5BSGA 4IBOA 4UAGA 1O89A 3UICA 2FZEA 5JO0A 4WLUA 5H81A 4ALLA 5IN4A 3SVTA 1VKOA 1Z82A 3AOEC 5KOIA 3U4IA 3DDNA 3H3FA 2XPCA 2YHIB 3CINA 5LDGA 4W99A 3ZV6A 1H6CA 5TRTA 1N92A 1B16A 5A06A 2HMSA 1G1AA 2ZIZA 4AJNA 4D44A 1LRKA 1RM5A 1EVYA 4KOAA 1W0CA 5TC4A 4NBVA 4BNJA 3I9NA 2EXXA 1LDYA 3H9JA 3HADA 4KWHA 4GQAA 2C54A 2EIHA 4RF4A 5GZ6A 3ZWXA 5JMPA 3JQFC 4XDYA 3TFOA 5G0TA 1C14A 3BTOA 1OC4A 4IDCA 1UH5A 4E5YA 1E6WA 2YQ4A 3G1UA 3SXPA 4O5OA 3C7DB 1J4AA 3DMTC 3X2EA 1WAMA 1YDEA 2R6JA 3G0OA 2BLLA 2WTBA 3FR8A 3KEQA 5G4LA 5ITWA 1HDRA 2NM0A 5I7EA 4PZEA 2WE8A 3DO5A 1HDOA 1UR5A 2WYUA 4HFRA 3IQDB 3MEQA 3VVBA 5CP8A 3Q0EA 5TLSA 2IDZA 3VOSA 1NYTA 4IXTA 3COSA 4H3VA 2C20A 2PWZA 4YACA 4BKUA 2I66A 2W8ZA 1BXGB 1M66A 2V6GA 1VL6A 4E5PA 1BRMA 4IQ8A 2X4GA 1BWSA 1DEHA 2D59A 4G65A 2OBNA 1PTJA 1R4MB 1R37A 2VYVA 4UULA 4WCDA 3T4XA 1EQ2A 4G81A 1BXKA 4KUEA 1HDCA 1LTHR 2WM3A 2YV1A 2ZB4A 1IHYA 4J90A 3F4BA 1ZK1A 3I5MA 1GTMA 3AOEA 1E7MA 3I9LA 4RQTA 4MPDA 2ZB7A 3TJRA 4DYDA 2H6EA 4WGGA 2NQ8A 1NVTA 4ZJUA 4QO7A 2VUTA 5EPOA 1YQGA 2QX7A 3UCXA 3LF2A 1VJTA 3E82A 4PZCA 3H8VA 1DFHA 1ID1A 3JQ9C 2X22A 1YE3A 4DUPA 3H9EO 1CERA 1GV1A 3WJAA 2XXJA 3GMSA 2EW8A 1XGKA 1NQ5A 3K6JA 4FBGA 2O23A 1LLDA 2IEDA 1X0VA 5A1TA 4XB1A 5B4UA 4YRDA 2IXBA 4U7WA 4E2WA 1LQTA 5JE8A 1R66A 4CM7A 3ZU4A 2Q50A 8ADHA 5ITVA 3RROA 3IL2A 1T2CA 3GZNB 2RAFA 3GVPA 2NVUA 1DAPA 1OBFO 4LSMA 1KVQA 1YL7A 4CR6A 4FB5A 3GNQA 3L77A 5JDIA 1MFPA 5ILGA 3F5QA 4N54A 3AM3A 1XA0A 4IZIA 4QECA 3WYBA 4XQ9A 3KSDO 1GY8A 4R69A 5L45A 2HUNA 4ESOA 1XU7A 3PHLA 4DC1A 9LDBA 2VHYA 3DZFA 3K9QO 3ETEA 4D46A 1E6EA 1IL0A 2A9FA 5DP1A 3D4PA 2BD0A 2QRLA 5KTKA 3ULKA 4KTTE 4M1QA 4CM4A 1I3KA 2BGMA 3PQFA 1J49A 4H15A 5G0VA 5KKAA 4DWVA 5JAMA 1R4NB 3RFVA 2YQ5A 3L6DA 3WNQA 2D4AA 1RPNA 3MZ0A 4R1UA 3U4DA 1IULA 1HDXA 2BGLA 2QG4A 3CH6A 2WDZA 3MJTA 1PGJA 5EINA 4ALKA 3ROPA 5CG1A 1NTOA 2VHVA 4J2HA 3TZKA 1B3BA 3UXYA 1T26A 1YQXA 1Q2XA 1DFIA 2O3JA 4ZQEA 3ENKA 1Y8QB 2B36A 4Z0PA 5H82A 2YDXA 4DIOA 3GFGA 1SO8A 4ND3A 3OJLA 4IQ0A 5K6AA 1XYGA 4LRTB 3DZHA 4ALNA 1C3VA 3MTGA 4CR7A 1ORRA 3NV9A 2VCYA 5HA5A 1RM4A 2JCYA 4K1LA 3H3JA 3WXBA 5I7VA 4GSKA 4KUGA 3KXDA 4JQCA 4W9NA 2A92A 5THKA 1DFGA 2AHRA 3D0OA 3QY9A 2RH8A 1QSGA 4PRLA 1P1KA 3BYZA 1AHIA 1SB8A 3DBLA 1LDGA 2BF7A 1EBFA 2Y05A 4BHTA 3OF2A 4OOEA 1T2FA 4R3NA 5EERA 4YT8A 3KRTA 5BNTA 1FDWA 3GUCA 1YH3A 3W4IA 2CVZA 5IZCA 3PEFA 1AGNA 3WOHA 3MJCA 3CZRA 2OFPA 3D5TA 3KV3O 4O6VA 4AJKA 2DBRA 4JBGA 5L51A 3WYCA 3U9LA 2JKVA 3GMDA 1E3WB 4FGSA 4OM8A 1GZ6A 4ITUA 1I5RA 3S2IA 2X58A 4LCEA 3L9WA 1N9GB 1T2DA 3BMCB 4GVXA 1U8XX 4HX5A 1UZLA 4BNWA 4CMKA 4EJ0A 3KVOA 5LC1A 1KBZA 1HRDA 2LDXA 1N7HA 1B15A 1MX3A 3E5RA 2VRCD 3DBVO 3JQFA 4ILKA 1DC3A 3ICCA 4MJLA 2NV6A 1KERA 3TDKA 1P0CA 4N5NA 2QW8A 5JAQA 4IM7A 2P9EA 1KYQA 4EW6A 4P22A 4JROA 4EI2A 1E1LA 1V9LA 2DT5A 1DLJA 2X1HA 3V2GA 4XJSA 3B1KA 5C37A 2JAHA 4M89A 3L4SO 4RZHA 3HJAA 3FCOA 2CVOA 1ISGA 1PWXA 3IP3A 1ZEJA 4JJFA 2DLDA 3DZGA 1ML3A 3C8MA 4OJNA 3CIFA 3MCVA 4E31A 5TNXA 1XKQA 4Q3EA 3AI3A 1WVGA 3RUHA 3FWZA 1E3JA 4BUCA 4M87A 2I65A 1LEHA 3A1NA 2AW5A 3E9QA 4BNLA 5HRUA 4AJOA 1U3TA 3FTPA 1LDNA 1HSOA 1Y6JA 4S3MA 4AJ4A 1KVSA 3UVEA 1M76A 4FFNA 1UAYA 3RUDA 1ULUA 1L1FA 1BHSA 2Q1WA 1O94A 3OIDA 3UH1A 3GVIA 1P3DA 4IDFA 1A5ZA 1V3UA 2BFAA 1LC0A 4Q3AA 1H93A 1FK8A 3QE3A 5HTOA 3DBHA 2HKIA 4DYVA 1B8VA 1YGYA 3DAPA 2AG5A 3RBVA 4BO4A 1JDJA 1V3TA 2IE0A 4YA6A 4I5EA 2PKRA 1JN0A 4BO6A 1AXEA 4GWGA 2CFCA 2UUPA 3AUUA 3DZJA 3FNGA 1A27A 3W1VA 2J3HA 3GA0A 3GRPA 2E82A 4CL3A 2AE1A 2Q2VA 2YHUA 3IJPA 2FR8A 2CUKA 4B7CA 5KVQA 4F6LA 1NAHA 4B8WA 5BQFA 3RVDA 3GGOA 1ZK2A 4QXMA 4BIIA 1NHWA 3RUEA 2BI8A 2ZCUA 4CQMD 2EGGA 5DBFA 2WD8A 4YPOA 1XIVA 3RJ5A 5KIAA 1DC4A 1NQOA 4YCAA 2FMUA 3K31A 2YYYA 5L3ZA 4GX2A 1PJBA 1X13A 1VRWA 2Z5LA 1GQYA 1XU9A 1I2CA 4OOFA 4TRNA 4CUZA 1H9BA 1ONPA 3H9QA 4YYZA 3WMXA 5EQDA 1IB6A 3GOHA 4KQWA 4PLTA 1PQUA 4YAGA 3IDSA 4RJTA 5G0WA 2DTDA 2PZKA 3ETGA 3H9GA 3I9MA 5G4KA 1GUFA 1GYQA 1JVSA 4E30A 2P2SA 3D3EA 3GRKA 4JCOA 2BFOA 4J6FA 1P1RA 3INRA 3N58A 1HE5A 3HZZA 1QMGA 1QYCA 1E3IA 2X0IA 1NVMB 3FPLA 5IJZA 2IODA 3FWNA 3PI7A 1O9BA 3LYLA 2VYND 5DCWA 3QWBA 5MDHA 1U28A 2C2YA 3ROKA 3ZWVA 4C4OA 1ZZEA 1BGVA 2DAPA 1ZSYA 2ZTVA 3MOIA 3SBOA 3PYXA 1Y8RA 4WPGA 1YXMA 3NT2A 3LLSA 2QIOA 5B12A 4OGWA 4OQYA 3OBBA 3ZN2A 2HDHA 1TXGA 1UJMA 4MVJP 1XHLA 1XSEA 3RAJA 4RPLA 2POQX 1QP8A 2GF2A 1A9YA 1JAYA 3G79A 3QIVA 3RKUA 2NUAA 4W6ZA 3ONFA 4CQLB 5KVVA 3TFQA 2DKNA 1U1IA 3P2OA 1M2WA 1P77A 1SC6A 2GNAA 4WK6A 4DIFA 2Y93A 4I5FA 1W6UA 1DXYA 1A4IA 3JD3A 1QYXA 3PGXA 4RVDA 4ID9A 4TRMA 3RUCA 5ADHA 3VKUA 3LK7A 5COAA 1Z7EA 4YJHB 3ZU2A 2OZPA 3QSGA 3PZRA 3I4FA 3RD5A 1GUZA 1U3UA 2R2GA 4P4LA 3WB9A 2V6BA 3HB4X 1YOVA 2YV3A 3GY0A 4IPTA 1ISJA 1PZGA 3WIDA 4D3SA 1RYDA 1TEHA 2Y1CA 1ZK0A 4Q39A 1HT0A 1K0UA 3S8MA 1CF2O 3F47A 4R9SA 1B0AA 4ZGWA 2EERA 5IZCC 4FGWA 1ZBQA 5L4LA 3E03A 4DREA 4J2OA 4QO8A 2X0JA 5F3RA 4DIBA 1GADO 3HQ4O 4O63O 4CQMA 4N5MA 1Q7GA 4NJMA 3GC6A 1N7GA 4GWKA 5DOVA 4E2XA 3JD1A 1VI2A 3NJ8A 1VSUA 4N7RA 4D42A 3DOOA 4N18A 3OEWA 3FF4A 4HV4A 1DC6A 1ADBA 1EFKA 1T2AA 2B4QA 4BMNA 2JAPA 3DB2A 4W9NC 2RIRA 5F1PA 3KYDB 4JIGA 2OOSA 2VT2A 3ROQA 1LBEA 3D5QA 4I5DA 6LDHA 3V5NA 3N7UA 4GBJA 3RC1A 3TOZA 4QX6A 2EEZA 2G76A 4D79A 1ZCJA 4FSHA 2HMVA 3E48A 3RU9A 3F1LA 1I10A 1O0SA 4RVHA 3FPCA 1VJ0A 5CEEA 3BAZA 4FS3A 1Q0QA 4IXWA 4IIUA 2GR9A 4MDHA 4S1VA 3S2EA 2EKPA 5JAIA 4DMMA 4KDFA 5FI5A 2UUOA 2X5JO 3P5SA 4E6PA 3VVCA 3HFGA 4E5NA 1Z6ZA 4B3IA 1N1GA 5CDTA 4CLEA 2GO1A 4QT0A 1NVGA 2HK9A 1P1JA 4CLOA 3PHGA 2C7VA 5THQA 4CUKA 3TZQA 3RC2A 1WMBA 4J9VA 5CPFA 4GGPA 3GLQA 5COBA 1JW9B 1FJHA 1QORA 2G5CA 3GUYA 4RQUA 1ADGA 5T6BA 4ZICA 3KSZO 2E49A 5KVSA 2YV2A 4QTZA 2NACA 1BMDA 1Y81A 2V6MA 3EVNA 2E6UX 4BNGA 3PQDA 1YBAA 1IZ9A 1PSDA 1E3EA 4BKPA 2PH5A 4MIYA 1A71A 1B26A 3V1UA 1ZJZA 1BXGA 3TF5A 4U5QA 3V2HA 2AQIA 4XYGA 1N9GA 3BMCA 1U8FO 4DRYA 1XQ6A 1P9LA 1PJ2A 1DO8A 2X9GA 4EYEA 3PZBA 4J49A 4IGFA 4KDEA 2YZ7A 1MC5A 2C07A 1PIWA 3C7AA 3B70A 3ZV4A 4K28A 3ITKA 3GVHA 2GUGA 1G6KA 3Q9NA 2X9VA 5ER6A 3VDQA 3ZHXA 4NBWA 4MVJG 4NI5A 3AOGA 4MIEA 5JNLA 3UCFA 2HU2A 1H6BA 1GEGA 2WEKA 3KOUA 2D5AA 3BHJA 3I23A 3GHYA 4IDBA 5ENVA 3WNVA 4GGOA 2H5LA 1P31A 2G0TA 2TMDA 5KCZA 2ZJ1A 4W4TA 4YAEA 2PD3A 1NPTO 3R6DA 1R4NA 5JDCC 1U7HA 4OXKA 5AXAA 4FIZA 1ZK4A 3M6IA 2HLPA 3DONA 3NAQA 3E1KA 1QRRA 1H9AA 3OEYA 1HL3A 4FJ1A 5CG2A 3U4HA 3O8QB 5G0SA 4ND2A 4CMIB 3I52A 1ZIDA 5BSFA 4HFMA 4Q3NA 1E3SA 2GRAA 2O50A 4BNNA 1T25A 1BDMA 3RWBA 3U49A 1NBOA 5EESA 2O7SA 3VH2A 1EVZA 2EP5A 1LSOA 1GPJA 4IY1A 4BNUA 1YQDA 3JD2A 4IS3A 3QJ5A 1TT7A 1K2WA 1NQTA 2I5PO 3VZPA 4LW8A 3UOGA 3JQEA 4PN3A 1Q1NA 2Y68A 5A3JA 1BDBA 4CLHA 1DJQA 1GDHA 4CV0A 3BHMA 1KVRA 4L74A 1LX6A 1TI7A 1ZSNA 4CLRB 5C3MA 3JQDA 3OJOA 5HBRA 3GVXA 3IJRA 2FSSA 4L4XA 2NTJA 2X7HA 1CYDA 2EG9A 3PIDA 1CWUA 2FOIA 4E13A 2HO5A 3PJDA 3PHJA 1GPDG 4L75A 1NASA 3DTYA 4IDDA 1B3RA 4BV9A 4D3FA 1E7SA 1PWZA 2PR2A 5I7SA 2VWHA 3AJRA 3OFSA 3DFZA 2PNFA 1PJ4A 3VTFA 1SPXA 3W8FA 1AHHA 2JL1A 4E33A 5JO9A 1C1XA 3GEDA 1BSVA 3AUTA 4BB5A 3OETA 3P2YA 4J1SA 2EHDA 4AFNA 3W8DA 5JDCA 1MUUA 3BMNB 3UF0A 1KS9A 3NDRA 2HRZA 4D41A 2C5EA 3PHHA 1XG5A 3CEAA 1W4ZA 3ZDFA 5CFZA 4W7IA 2E48A 5JBIA 1DSSG 2Q3EA 4BOYA 1SBYA 1T24A 3VPHA 3SLGA 3JQAB 1CQIA 4PG8A 5KJ1A 2IYPA 2HAEA 1T2EA 1DB3A 2NTNA 4PG6A 3RKRA 3QVXA 1FDSA 2YFQA 2VNAA 4JJIA 1Y1PA 1WDLA 3CPSA 4R3WA 1WPQA 2A4KA 4QQRA 3GVCA 4LRSB 2I6TA 3JQ7A 3O03A 5FFFA 1W73A 2Q99A 2ZKLA 4IZHA 3RUAA 1B8PA 2C2XA 2WD7A 2OMEA 2CF5A 3GAFA 3K8ZA 5TF4A 5L53A 3AFMA 5L9AA 4NK5A 1UUFA 3IP1A 3OMLA 3O9ZA 1TT5B 3G1TA 3NTOA 2PK3A 4XZ3A 3HE3A 3K30A 1YL5A 3U3XA 3A14A 3PDJA 3BTUA 4XEHA 1HE2A 3HN2A 3TNLA 3TZHA 1FF9A 2DVMA 4YQYA 2DUUA 4ZRNA 2EJVA 4BNKA 1PJLA 1XQ1A 4TQGA 3OQ6A 5EIOA 2NU8A 4BL5A 5F5LA 3TPCA 5A3VA 2FR0A 2P9CA 3VZRA 3FTNA 4TWRA 5AXBA 4CM3A 4E5MA 1UXKA 4IDEA 2WWRA 2ZB3A 3GG9A 3U4CA 3WTBA 4BNIA 3GR6A 2XAAA 3KUXA 1MP0A 3LU1A 4WEOA 4XYMA 1ADCA 3UKOA 4EZBA 2ZQZA 1OOEA 4FDAA 2ZTLA 4A73A 1YRLA 5FYDA 1K6XA 1E5LA 1Y5MA 3LZ6A 2Q46A 2ZTUA 4O1MA 1I01A 5B4VA 4KP7A 3F1KA 5EJ2A 4E2ZA 1XEAA 4IQGA 5KJCA 4YJFA 2EF1A 3WWZA 1ZJYA 2BI7A 4R1TA 4NZ9A 4NR0A 3JQ9A 3AI2A 4XWYA 4NIMA 1LSJA 3TRIA 1B7GO 4GLLA 4J4BA 2Z1MA 4B7XA 3FNFA 2GGSA 3WQQA 4CM5A 3WGTA 3L07A 4L0QA 5JS6A 4Z0HO 3M1LA 1V35A 1IOLA 4PZDA 2ZTMA 5F5NA 1ZXLA 4BO9A 4NMHA 5KVCA 4CM9D 3D3WB 3ORFA 4TROA 3Q9UA 4WOKA 5BNFA 1PJCA 2HK8A 3H65A 1XWFA 2HJRA 1SZJG 3VTZA 1Q7BA 2R00A 1JU9A 1HYEA 3VPFA 1KEUA 3HDHA 1PGNA 2AEFA 4WLEA 3M2PA 3Q3CA 4WNIA 4HP8A 1VM6A 4EJMA 2EW2A 3HNPA 3C1OA 1DHRA 3WSWA 2YUTA 3WX0A 1ISMA 3BMNA 3A4VA 3W8EA 4Y6SA 3GK3A 2DTXA 3B6ZA 2NU7A 3GZNA 4PRKA 1UP4A 1O95A 4DGSA 4L73A 1U7TA 2YW9A 2ZYAA 3PWKA 3HUDA 4RLSA 1YWGO 2VT3A 3ENNA 2WE7A 2J5RA 2AQHA 2XOXA 1NFRA 1JQBA 1U2DA 2CZCA 4A26A 1GYPA 4CLRA 4ALJA 4ZU3A 3JSAA 3TWOA 1I2BA 3QA9A 3G49A 3WR5A 1VSVA 3R3JA 1VKNA 4MP8A 4LVCA 1WWKA 5IF3A 5A03A 3DL2A 4J3FA 4MVJE 3ICPA 1MGOA 3NTQA 3JQGB 5B4TA 4IJKA 1FDVA 3RQSA 3S2GA 1PS9A 3RASA 1NX6A 1BW9A 4GX5A 1ZUD1 2OHXA 1ZVMA 4BNTA 1GCUA 2LDBA 3O4RA 2PH3A 1H6AA 2DFVA 5GY7A 1KEVA 2B5WA 2BELA 3DAGA 2ILTA 4J16A 4NNJA 4M55A 3VDRA 3CMMA 1EFLA 1P74A 5IXYA 2PLAA 5T64A 3JD4A 3BMQB 1TA4A 1H6DA 1NR1A 4YTEA 5JYDA 5A9SB 3RCBA 1Y8RB 4JLWA 2NSDA 3WQRA 4ND5A 2GN8A 2DBZA 5I9LA 3L4BA 1O5IA 4Z3KA 2C7GA 5LCXA 1X15A 3PFFA 5TS3A 1ENOA 3AK4A 4HUJA 1K6IA 4GI2A 4XGIA 2EKQA 5JPIA 5BSEA 2VHZA 2OORA 4EBFA 2I3AA 4WASA 4NFYA 4OKNA 5JY1A 3QVWA 2HMUA 4U0KA 3ZU5A 4UVDA 2BH9A 1C0PA 5T8KA 3C1AA 3KLPX 1TT5A 3PYLA 2GPTA 4R41A 2G1UA 4BKOA 2O3SA 1MA0A 1NHGA 2W2LD 5L4NA 5I8ZA 4GX0A 5DN9A 3EK2A 2BFPA 1NPDA 1I33A 4BKQA 5DBIA 3NGLA 3WGYA 4GKBA 4JJGA 1BTOA 1SMKA 1HE4A 3NX4A 4DXHA 3VHRA 4DPLA 4M49A 2CDBA 2EV9A 3GPDG 2IRWA 1QYWA 2B37A 3MOGA 3JQAD 3DXFA 4JK3A 4A10A 5DNAA 3R3SA 4F46A 4M8SA 3ZWOA 2VQ3A 4YAJA 5IAAA 4RPKA 4BGIA 1C0LA 2Q4BA 2D3TA 1U9JA 5KNLA 1AUPA 2FPPA 4KTVE 4BVAA 4AJPA 2G17A 1C1XB 1A4UA 4L4SA 4YQZA 4ZQHA 4DC0A 3GDFA 4C7KA 3ZWWA 1LRJA 3R1IA 1CEQA 3HHPA 4PG4A 1D4FA 2NTVA 2F00A 3SC6A 4IINA 4Z9YA 2OGUA 1ZK3A 4YJFB 4CM8B 4DA9A 4NFHA 2VWPA 4MO2A 3JV7A 1AXGA 3FNHA 3WLEA 3OQ1A 1KC1A 1EUZA 4HNGA 3EAGA 3ST7A 2FZWA 3RFTA 3Q6IA 5CDUA 4MVJI 3RIHA 4E21A 4DQVA 4KZPA 3LT1A 3QP9A 2CDCA 3AY7A 4KUHA 3P7MA 3ONEA 4U6QA 3OECA 1ZMOA 3TOXA 1R15A 2FY8A 2W90A 4CM1A 3JQ8A 1LC3A 1ARZA 4OSPA 4YJGA 4FFRA 4XJTA 5L7WA 4RORA 2H63A 1EVJA 4NH4A 2X23A 4ZRMA 4PG5A 2GD1O 5G2OA 4IJUA 4KWIA 1HWYA 1DPGA 4QFDA 1Q0HA 2HK7A 2X6TA 3D1LA 1KVTA 1LXCA 4HFJA 5JMWA 1NR7A 1T1RA 4Q3CA 1U4OA 1ZKMA 1OC2A 2QQ5A 3MJVA 3PFWO 3FI9A 1GYRA 3KSUA 2FHSA 3Q2IA 1I32A 4PGFA 1PJ3A 4BO8A 4CM9A 1PJQA 1EVIA 4FD3A 1GCOA 3F6YA 1E1KA 4J1NA 4IDAA 5LDHA 4DLLA 2I9PA 2GLXA 1DIGA 4G2NA 4J4TA 1AE1A 1P1HA 3ZWNA 4I08A 5I9NA 1EUDA 3F4LA 4ONEA 4F45A 1B2LA 4YJDA 3O26A 1GEEA 4UUPA 4OMUA 3V2UA 4CV1A 1GV0A 1PZEA 4J1TA 2P4HX 3C1TA 3BIOA 3DMTA 5CHEA 4ZHSA 3BXXA 5T67A 3AY3A 1TVEA 2FR1A 3DC2A 3JYOA 5A5EA 3I6QA 9LDTA 2GCGA 1ADFA 4EUEA 3H5RA 4DQUA 4RPHA 4D0SA 1RM3A 2NU9A 3O8QA 4XRRA 4UEOA 1WNTA 3DQPA 3JYQA 1DRUA 5JYEA 4UEKA 3L9XA 1CQJA 4BO5A 4BMSA 3U5TA 1QLJA 3WGOA 1GQ2A 2BRUA 3F5SA 4LSWA 1NQAO 1MFZA 3VPSA 5COQA 1ISIA 1BVUA 3DMYA 5L4SA 1YB5A 1HYGA 2XF8A 2F1KA 4DQXA 3W4JA 7ADHA 3RC7A 4CQMB 3BHIA 4XIJA 1I3NA 1PJTA 1YO6A 3GNTA 4QEDA 1Z45A 4FQ8A 1K6JA 1EK6A 4NDNE 4ALMA 4I8XA 4RVFA 1UXHA 1VPDA 3B20A 3D7LA 3GQVA 2J3IA 3PLNA 2VZ9A 1V6AA 3EZLA 3LDHA 4NBRA 3PXXA 5TQVA 5JAZA 4MIOA 4L8VA 4TZTA 4OQZA 3JTMA 1UDBA 4CMAA 2HSDA 4OIMA 4UUMA 1X7DA 3QLJA 5C7IO 1T4BA 5I9MA 4Y6RA 2GZ3A 4BB6A 4BO0A 1R0KA 1M75A 1P0FA 4YT4A 2B35A 2D0IA 3MTJA 5AVOA 1EMDA 3LT2A 3GGGA 4WEQA 1LSSA 1P45A 1WP4A 4XB2A 5JDIC 1IPEA 1WLYA 1JWBB 4XR4A 1PGOA 2UVDA 3JQGA 1A7KA 2CVQA 1DJNA 1PS0A 4IMPA 1I2ZA 4R9RA 4JNKA 1T4DA 1KEPA 1LU9A 1O8CA 2GYYA 2VOJA 4D45A 4DPKA 2O3TA 1J6UA 3I1JA 2P5YA 3DWFA 4RF5A 4H16A 4EUHA 5AXCA 5A4DA 4QFCA 3VAZA 3W6UA 4YAIA 4UVIA 2CD9A 4GMGA 5ER9A 3K96A 4TMFA 3ZHZA 5KWEA 4AJ2A 2ZYGA 4CLXA 1V3VA 4DMLA 1E7QA 2NLOA 4GL4A 4PLHA 2UV8A 3FD8A 2P4QA 1C1DA 2Y1OA 3TQHA 3AFNA 1E6UA 3RUIA 1G0OA 1FMCA 3RC9A 1LDMA 1PR9A 5MGBA 1PGPA 2B0JA 3W4KA 3AW9A 1FDUA 1HZZA 4WKGA 3KTDA 3WYEA 3BZUA 1C0IA 1ZFNA 2V65A 4I9NA 4BGUA 5I8WA 1J5PA 4YAKA 4E2YA 3PTZA 4FCCA 5AOVA 5KJEA 3DHEA 3SX2A 3BTVA 2YDYA 2Y66A 5TX7A 3WQSB 3STHA 3UHAA 1M6HA 5T8KC 1D1TA 1UZNA 2QRJA 1ENZA 5ES3A 5BT9A 4JX8A 1GU7A 2RH4A 5DP2A 4CV2A 3CZMA 4IUYA 2NADA 4AJEA 1YKFA 2A35A 4PLGA 2C82A 4CMEA 1F8FA 3WIEA 4Z6KA 2DBVO 2DTEA 2CNBA 5DBGA 3EUWA 3IUSA 4RLHA 4UVEA 2OXIA 2NNLD 3UFXA 3QVTA 3Q1LA 2IXAA 3G17A 3OJFA 4X54A 4LISA 1NNUA 4AJ1A 4DL9A 2AG8A 2EGHA 1U5CA 4LMRA 4IJWA 3ZI0A 1DRWA 3GGPA 3WBBA 4RCVA 2PKQP 3MJSA 1XDWA 1YONA 3ADPA 2WD7B 4PIVA 4A2CA 2D2IA 1BXZA 1H5QA 2VZ0A 3L0DA 4GH5A 3ZCXA 4ZN6A 1E7RA 3ZWAA 4BNXA 1U5AA 3OICA 4Y67A 2VZ8A 1J0XO 1I24A 4NK4A 2NU6A 1L7EA 2ZCVA 2VOEA 1SEVA 4G5HA 4MVJA 1GR0A 3OHSX 2EWMA 1PQWA 1F8GA 5AXDA 1R12A 3DR3A 4R1SA 1P33A 3PJFA 3NDJA 4RF2A 2JHFA 4RV9A 2YJZA 2GN9A 4Q3BA 2JCXA 4E3ZA 2O48X 3FNEA 1WZIA 3N74A 1NPYA 3L6EA 3NEPX 4ZA2A 1JAXA 5CDGA 4FPXA 1R6DA 4FC6A 1H2HA 1QYVA 4NPCA 3VZSA 1MB4A 3SC4A 5IN5A 1SNYA 5AYVA 4GX1A 4QUKA 3H2ZA 5JLAA 3TSCA 2FRDA 4XYLA 3GN2A 2ZJ0A 5H83A 1FXSA 1QV6A 4IS2A 2CMDA 3GF4A 1E3LA 4BNVA 4CMJA 4YJHA 1Z75A 4BQRA 1DIHA 4YT5A 4K6CA 3FHLA 3OJEA 3M1AA 4WJZA 4LCJA 2QHXA 4XA8A 1EBUA 2EJWA 3KYBA 1ISHA 1QR6A 4AJJA 3WGQA 1M67A 4AG3A 1JTVA 4FW8A 4K9DA 4B4UA 2HMTA 4B7UA 2PV7A
chains in the Genus database with same CATH superfamily
1GGNA 1JHPA 1KMIY 3UIEA 2I3BA 4XGNA 4V1CI 3OA0A 3AFGA 3DOFA 2GH1A 5A05A 4LMPA 1XEWX 5JCJD 2PZAA 1K63A 2NO1A 4TUYA 3TD6A 4AKTA 5KREA 3PC7A 1MG0A 3UCEA 2G80A 2JFGA 1Z6QA 1UP6A 4LJ6A 1A5BB 3Q0TA 1VRVA 4BNHA 3DBRB 3ZI4A 4JLDA 4C08A 4TM8A 1PEDA 2OXEA 3F8WA 2V7BA 3AY6A 1CUVA 1KE2A 3W9BA 2D54A 3Q4GA 2EP7A 2UUCB 3SNKA 2O2IA 5DN6D 3WK9A 4PX2A 4CQNA 2VRBA 4TQ9A 1CC1S 1VMKA 2DERA 4LA4A 2UZ1A 4M60A 2E4VA 4YP1A 5AVKA 4AROA 2BCEA 1YVEI 3RSLA 3TW8A 5HRAA 2WJPA 3FR7A 2XUHA 4ZOLA 2FG5A 3SNHA 5L4SA 2FOXA 3IURA 3FOEC 5A7GA 1IWBB 4R51A 1EFRA 1IY0A 3PVSA 1FDRA 3GP5A 1Z3IX 3NWBA 1GL6A 3IQEA 221PA 3M3PA 3E3MA 4AU1A 5A9SA 3R9XA 1CDOA 2QJOA 4FMPA 2CUZA 2YCLA 1NN1A 3E7DA 3R0IA 5GMOA 5GVSA 3JYNA 2DJIA 3LDAA 4NLLA 5EIBD 1ESEA 4KX5A 1PS8A 1D8TA 4YBZA 2DOKA 2BDEA 4ZYLA 4Z3OA 1BMFD 5LSAA 2PFGA 3IYLW 3I3OA 1CY2A 3HN6A 1NFQA 1EX6A 1NMYA 1EP9A 4PLZA 4UVGA 4Y7DA 5JNRA 3WLTA 4OXNA 1Z73A 2FZ5A 3TZCA 3IVCA 3L46A 4DSAA 1GRCA 1LF5A 4PC7A 1TQDA 4MRMB 4PLVA 1LSUA 3HJTA 2AA3A 3KJGA 4GZMA 4L8WB 4Y2VA 4U7TB 3WK4A 5J2UF 1BQ3A 1ZOPA 1QHFA 1X3SA 5EUCA 2WUWE 3H8JA 1E2EA 1I4LD 1V11B 2XKAA 2P3LA 3DJFA 3AF2A 3ITEA 3LC7O 1PQ4A 5CB8A 5IULC 4FOSA 1R50A 3ZW8A 1J90A 4TYYA 3KUKA 3O1IC 2VWQA 3LA6A 5IT9A 2F4VB 3GI1A 4BC1A 1H0SA 1OAAA 2QI9F 3CW8X 3M9LA 4CM8A 5A02A 1WLSA 1D5CA 1NN5A 2H1SA 4TLBA 5CNJA 2DPHA 2M32A 1UBOS 2RJOA 3K94A 2OB1A 3UWDA 1E61A 2SECE 1GPWB 1R9JA 3D2LA 2HCJB 3JARB 4WUVA 1AK2A 2C2ZA 5H70A 3E7WA 4WL0A 4B3JA 2JBHA 2ZT8A 4HBGA 4I1VA 1NBHA 3T54A 2Z1NA 4JC0A 4NKRA 3WIOA 2FRXA 3H1GA 1C9KA 3UW3A 4PYJA 1Z5WA 5KB3A 4FMDF 5LQJA 1BHQ1 1O5TA 2LKCA 2ZS7A 5THXA 2DR2A 1Z5PA 3SI7A 3MINB 2B92A 4LZLA 3I9OA 1FP7A 2V6FA 2ZWVA 1K75A 2WB2A 4MLCA 1F06A 1ZEMA 3LY8A 4KV7A 4EY3A 2XOEA 1F6WA 2Q7DA 1QV7A 4BQFA 1TCUA 4OHWA 3VVLA 3MJRA 1UKEA 3PNQA 1VOTA 4FEGA 3TAXA 1UZAA 4U39A 3HJGA 1Y5IA 2V7VA 4FYPA 1R9GA 4ZK2A 4EB0A 4KYTA 4B46A 3LBAA 2ZK7A 1RQ2A 4AKSA 1Z0IA 2JIRA 3FAZA 3LE8A 5DOZA 4DS3A 3E8XA 4ZEMA 2V5AA 2XLCA 3JAWA 2QAJA 3CEPB 3CXRA 3E27A 2N9UA 1RM0A 1S2IA 2JCGA 4NU5A 1A2QA 1H0RA 1KMQA 2GAOA 3H16A 2EL9A 2XITA 1RQXA 4JB8A 1L7OA 3JZMA 1HE3A 2EL7A 2YICA 4UEJA 3V34A 4PXSA 5C18A 3NH6A 5JC1A 1GRNA 2RARA 1ST2A 1BGWA 2H1CA 3U80A 3NDIA 3WGHA 2NUBA 2G4CA 5CXXA 4EG1A 2ZPAA 1J56A 2VSXA 1SUWA 3IB6A 2H65A 1UKZA 4GXTA 1JP7A 4LYJA 2PGLA 4MRSA 3LUBA 2R97A 3IE2A 3M81A 1IHUA 5LJLA 1Y1RA 3ICVA 4PNHA 3QKRB 1TLLA 3CEJA 4OQNA 4ZANA 3SJUA 4A8JC 2XUDA 1EZ4A 1E0DA 1M5UA 1ZH4A 1YMUA 4H35A 1T1EA 1EFHA 2ZVPX 5E1DA 3DLPX 1BRTA 2Q3MA 1H2BA 1VBKA 4W5OA 4G85A 4EP1A 1E92A 4M9CA 4RXTA 1X77A 1E1QD 3OZBA 2I4OA 5FOSA 3SF8A 2O4CA 4PR0A 2GKSA 4HNHA 4ROSA 4L7QA 4TQAA 3GLFB 2DP4E 2L82A 1RWVA 2Q2WA 1UBEA 1W1WA 3V1LA 4D6XA 3EEYA 5FADA 2ZZMA 3O4GA 4MGEA 5U4QA 1SOVA 3B12A 4W1QA 5JU6A 5GADl 1E8NA 4OLAA 5A9TA 3S7ZA 4LQ4A 1X9IA 4HLCA 1SQFA 4AZ3B 3B6JA 1HEUA 1YJQA 3KM0A 2X7JA 4RXMA 2OYCA 3QLVA 3GUUA 3KLBA 5A3SA 3VR3A 3WLQA 5K8TA 4FR2A 3QGMA 4RPGA 5TS2A 1BHJA 2RGUA 5LOVB 4L6IA 3ROMA 5GV7A 1XTUA 3AJAA 3CR3C 4AP9A 1H23A 2VAPA 3G13A 3MPOA 1JKFA 2HA7A 1JWAB 3LLUA 4IWYA 1G0NA 4MV8A 2I4IA 4RENA 5FUQA 4AG6A 4EGFA 2Q6VA 2E21A 3TB4A 5DI3B 2CMHA 3P97A 3VH3A 2NSYA 4MH0R 4O33A 4AF7A 2F59A 2Z58A 1C9NA 4PONA 2VATA 4C0AC 4UDOA 1NJ5A 3OP4A 4XD2A 1LF0A 1M6WA 2C98A 5CEJA 1XAJA 3GLGA 3DBRA 1W7AA 1XRMA 3EODA 3IXQA 1WW8A 4KAFA 4R9UC 3AO0B 2AD1A 4JR0A 3H2KA 2WYVA 4BMYA 2MYPA 3M6UA 2FSUA 3EVEA 3A6FA 2YVAA 2VCHA 3P45A 4U7GA 5DASA 2WFMA 4ZVVA 4DILA 2B3DA 4RL4A 4O25A 5JALA 2QR3A 1LLQA 1SN7A 3MWDB 1R4MA 3KQSA 4JP3A 4EY8A 3TUJC 1WD7A 4A2WA 2CVHA 3UWPA 1F51E 3OD5A 4CG3A 5TGTA 3LQ4A 4UNIA 3LXMA 4HGQA 1L1RA 4BWGA 4D8UA 4D9HA 5DE3A 1R9NA 3GT0A 1KWGA 1E7YA 5AMXA 4CUJA 1TVCA 2BFCB 1VMIA 2EYQA 3HUUA 1KOJA 5CA0B 4R16A 4K1XA 1N1MA 5HWSA 1A0OA 1Z15A 2VP2A 2TECE 1RXIA 2WIBA 2XJ9A 4PYIA 3BN3A 4TUYF 2IYLD 5FI3A 3JQ8B 3HV2A 4ALIA 3BXGA 1N2SA 1CQXA 1AGRA 5EXXA 4EY7A 3COJA 1EXWA 1R27A 2JD0A 4QD3A 3SJBA 5C4IA 4II3A 1DIAA 2ZBQA 4RJJA 4BUZA 1FS4A 2HM7A 3KAKA 1QGAA 3LXRA 3GXOA 3ZLTA 1OLXB 2VWGA 4TT8A 1P60A 2D4HA 2CFOA 5EKSA 2BTQB 4PNEA 3EGCA 2JFZA 3L7NA 4WLVA 2PX8A 4CGYA 4EKDA 4TVBA 3W5VA 1UAGA 5BURA 4P2GA 1RMYA 4KKXB 1P4AA 1VPTA 1Z0KA 2W2LA 1YOVB 5AH0A 4PHFA 4A8HA 4CKBA 5JQGB 1DOHA 3QLVC 2RBEA 3UZUA 4CTMA 5ELLA 1W34A 2FTKE 2LZ0A 1K5HA 3IPYA 2XMGA 3ONWA 1IZ0A 2FWBA 5J23A 2JI7A 2W2KB 4GBGA 4M0EA 3USZA 3YASA 2CLKB 4F9TA 3UGKA 3HEMA 2Q49A 4DG8A 2A30A 2W43A 1PRYA 2X2PA 3PP8A 5FL7D 3SYRA 2JAQA 4BVFA 1NC1A 4DR1B 2IHVA 4RAQA 1EZ1A 5E6UB 5FNZA 2IE8A 2NQTA 1QQAA 3NALA 3VOAA 2A94A 2G07A 4PCAA 4L5BA 2EGUA 2Q4DA 4TMZA 2P5UA 3FSRA 2XGJA 1CY7A 4ZV7A 1T6ZA 3PGJA 4GNRA 1LA2A 1J0EA 2NVBA 4Z0NA 3STYA 3ZDEA 2CWWA 5TQ0A 4LFCB 4OQDA 1X2BA 1FOEB 1MZVA 4J9UE 1BYIA 5E2BA 4TKVB 3LY9A 4ZQCB 1S7CA 1YS7A 1PX0A 3A6LA 3TL2A 3K70D 4OHKA 1UFKA 2CFSA 4BIMA 4CIAA 4WLNA 4IIBA 4XOIA 2JKZA 3IKJA 2QGNA 1YR3A 2PQ6A 3H6KA 3W5AA 2PZLA 3A11A 1W75A 4NV0A 4QATA 2DG2A 4CMIA 4QNNA 5IDWA 5IDQA 2QORA 5CYPA 1NP7A 2HGSA 3T1HB 2D2FA 2WNHA 1T8WA 4QXQA 2BWJA 4CFZA 3TIFA 3TD9A 1ND5A 3VFDA 3ZBTA 1MTOA 4R1MA 1ZW1A 4DA6A 5KQGA 2EKLA 4RULA 1LB1B 1T8SA 4LQDA 3IEMA 2FEAA 4K9KA 4B83A 4DABA 3CF4A 2QLTA 1N2IA 4B4VA 1RYNA 4RZ2A 2PXHA 3VBCA 1U3VA 1ZNQO 4XWOA 5KJFA 2VEOA 3IUNA 4WECA 1NXQA 3A32A 1ESMA 1X7GA 1Y1QA 2B1IA 4MUEA 4EA9A 3FDJA 2QE6A 3DW3X 2BKEA 2WUFA 5EXDA 4LWPA 3WTCA 3GD7A 3MAJA 3WQBA 2HBZA 2AN1A 1Z4OA 3P4UA 4DARA 1F4PA 5EJ7A 2HXYA 2WYWA 4ZD6A 4LECA 1YDFA 1Z12A 4NZYA 4UBNA 5AVXA 3MJHA 2CK3D 3KYCB 4LV8B 1LGYA 4QYIB 4QELA 5JS2A 2QXTA 3HO8A 1E6MA 3JU3A 4LNHA 5EXTA 1J09A 2GXQA 2MR6A 4DLVA 1IN1A 4IR7A 3BGSA 1NWHA 4OHPA 5G1OA 4U8GA 3FBTA 4QJ4A 3WKCA 1L4GA 1SVWA 2PS0A 4YP9A 4BFCA 3ZCPA 4RHFA 4ZZ0A 5AKGA 1XTPA 1ZHFA 3DV2A 4B82A 3JPWA 3SLKA 1NAIA 1KY5A 2ABWA 1D7AA 2DUNA 4D4IA 1JPJA 4BBPA 1TJ4A 4PLWA 4TV8F 1R3UA 3NHPA 3NYIA 1G6Q1 3P96A 5DIZA 4Q3DA 3ZGYA 3TE6A 1FZQA 4J7UA 1Y7TA 2Q5HA 4ZK6A 3EHDA 4LF8B 4LN1A 1XLTC 3RG8A 1FNNA 3FRJA 4HAIA 1EGMB 3FOCA 3QXXA 4U6SA 1O6FA 1AN9A 1WM1A 1W4BA 2ZIGA 4WN9A 1PD0A 3CN7A 2H16A 3DHVA 2FPRA 3KZVA 3EN0A 4Q9DA 4KR7A 1DZIA 4PSAA 5KDLA 1DXOA 1PDOA 3CN9A 1KR5A 1MXFA 3IDAA 4FJ0A 4QFMA 1UM9A 4M1TA 5EMNA 3X44A 4D3FA 4FLFA 3M4NA 4NZMA 2RCYA 2OMKA 3MCUA 3V97A 1PWHA 1C1HA 4JLVA 2Y77A 4D96A 2PD6A 1A9QA 4RCZA 4S2EA 3LZCA 2PTGA 4JKOA 4MV0A 2VNKA 2DQZA 3T3OA 3W2TA 1DT3A 3LW7A 4EITA 2HMWA 5AW6A 1X2EA 2C8LA 4N76A 1NNEA 1H8HA 1XLVA 4H9GA 4IUCS 5F51A 4YIHA 4CEIA 1HT3A 1GPUA 1ESDA 1ZGHA 3HB9A 1GL7A 1ODJA 4FT4A 4TL9A 5FF9A 3S55A 3U0BA 2FPGA 3BK1A 3MUFA 4ARAA 2O1EA 5HJ7A 1EUCA 4PAWA 3PPXA 3MCZA 5JYBA 2FGJA 2QD1A 4IIJF 1KYYA 3FZYA 3OCJA 2ASVA 1WV0A 2R5FA 3WGGA 4DA7A 3UTCA 2VHXA 4CIVA 1U2PA 4DGQA 3AF6A 2XSZD 5M7EA 1L8OA 2QTMA 4LJKA 4MW0A 2MSNA 1YZ3A 1KK2A 1E8DA 3OIFA 3ORSA 1PFQA 3N07A 3ANXA 5K0ZA 4MVJD 1LQUA 4FI3F 2BEJA 2AE2A 4GUDA 1ZSVA 4LYDA 1BD3A 2DWOA 3P9QA 1KSJA 3R7BA 5KPDA 2X8LA 5DYGA 2XD4A 3UXMA 3L4JA 1XTRA 4A0SA 1LI7A 1NJGA 3F0TA 5INTA 5K8JB 2ODNA 4ARVA 1ZH8A 3OQBA 4K2AA 1Z4QA 4Y2JA 1IYZA 1EK0A 2YUIA 1DMRA 5JSKA 2FN3A 2VJKA 4EFMA 1QB7A 5ALXA 2QYTA 4ARBA 4EZBA 5J47A 3SQWA 1EBBA 1VE9A 4MWTA 5AVUA 2DH6A 3BD9A 3B6IA 3DAOA 3VX3A 1HDZA 2I34A 1LFAA 3PA6A 1HMYA 2K5UA 4PPFA 5EJFA 4M36A 5F12A 4CCYA 4ZYVA 1BDIA 1E2BA 4RVUA 4M0PA 3PNBA 3RU7A 4PRYA 2IIVA 3IBSA 3HB0A 4QNRA 2AKAB 3SE0A 4BNZA 4KMSA 3WBJA 1URPA 2Y0CA 2H17A 4ECEA 2QUBA 3ZWMA 3GZ4A 4KLNA 2O3UA 3DJYA 1SIBE 2GUWA 4YCCA 5ALVA 4BO7A 4RY8A 2PRJA 8ATCA 3UNXA 1EX9A 1KHTA 2DWUA 1TIKA 3EQ8A 1OJLA 4XOUA 4I1OA 1TYCA 1P1CA 3R3WA 1WS6A 4R2WA 2XMPA 2XDAA 1DO2A 3MWJA 3V7NA 1QS0B 1E9DA 2PVCA 1G8FA 3KL4A 4DPMA 4CGZA 2CE2X 4RTOA 1AQUA 1VDZA 1SU7A 3ZNNA 1T36B 1X87A 1IHOA 3OX2A 4I5GA 1AKEA 5I8PA 3NT4A 2AG1A 5FBZA 4AWBA 4BPRA 1GAEO 2PANA 3USES 5D1HA 1T4MA 5JZVA 2R8BA 2V0GA 3DHYA 3LGAA 1Q57A 3LT0A 4D7AA 3KHUA 5E38A 3EQ7A 3DKKA 4Q03A 3CTMA 3LPDA 4RA9A 2P0YA 5EZ6B 4AMVA 3HSKA 1MD9A 2WFLA 4B74A 1DIRA 4MHSA 3GZTB 3I64A 3LVFO 4FIDA 4YB8A 1K89A 3G8YA 1RXVA 1GN8A 1ZN7A 3GDHA 3P4XA 3QHAA 3RQIA 5ICSA 3IA2A 4QOEA 3FFTA 1AGYA 4OU5A 4K81B 5FLYA 3LT4A 1CB0A 2Q6TA 1E62A 3OOJA 1U2ZA 1NMZA 3KSMA 3PSHA 5CPBA 3UT5B 3LQFA 3Q7QA 1HDGO 4A16A 3AHCA 4R83A 2YXDA 4AUMA 1P3JA 3PLRA 2G28A 4P8RA 5TSDA 3LP5A 3W7AA 2Y0BA 2YHIA 2FPSA 1YDWA 1NDHA 2XEDA 4Q4JA 4BAGA 1XQVA 3A4IA 3R77A 4UZSA 4UPEA 1C8BA 1Q1GA 2DFDA 3WI7A 1XELA 4DKXA 1A7AA 2FPIA 3L8EA 4QGAA 5BQ5A 3WGZA 3TN7A 1WXXA 3BWYA 3KKKA 1RWBA 1RYEA 1XCPA 2X3UA 1RRKA 4YEDA 1S96A 2OENG 3CTPA 4Q4AA 2VYNA 3UWSA 1ECCA 1GAJA 3T7EA 2JVKA 2IKSA 2ZLBA 5D3KA 1RFGE 3DOIA 4S1OA 1MOPA 5L7YA 3S27A 4CMEC 4BO3A 5JYCA 2R5WA 1V5EA 5EPEA 3L92A 3P26A 2CLDX 2QRHA 4ARSA 3DEHA 3SQOA 4CLOB 3VPGA 3OLCX 3C41J 4DJAA 1JJVA 1MZPA 3T7CA 3JQBC 3KJEA 5AJZA 1DAEA 2X0NA 2GVZC 2QD2A 3PKIA 2B21A 3F3SA 4GE3A 2RHRA 2Z8YM 3KVYA 4GPBA 4EJ6A 4AURA 1T1JA 3PG5A 3NMUF 3BJZA 5DNCA 3CX4A 3N86A 3AM4A 3ETLA 2X5OA 4FOOA 4J1QA 1AQ6A 4LNUB 3GFQA 2NSJA 2BR4A 3MRVA 2WHXA 1A9TA 3HCDA 4M7WA 2P6NA 5TMDA 5U1PA 3TSZA 4RTKA 2I67A 2Q5CA 3PQEA 2BMJA 2ID7A 2V5UA 5JNSA 2XBMA 4TKMA 3LRXA 4C7OA 2XCIA 4FDMA 1IMJA 2AEJA 4N5LA 4YR9A 2EF0A 3UOWA 2QTGA 2IWRA 5JZ9A 1AKRA 1C3EA 4I4IA 2JCVA 4GVLA 5TPZD 1UJ6A 3FUWA 4Q1DA 4XXHA 2ZRPA 2NT4A 4NYMQ 5LA6A 3SFTA 5BWBA 1OFVA 4RESA 3H1BA 4WKBA 4X8MA 1N1EA 1KRXA 2QYHA 4TMTA 4F96A 3IKVA 1RR6A 4FOLA 1M7GA 2DCMA 2Q8NA 2WSLA 3FCSB 3OE4A 3GL9A 3OO0A 3QXSA 3TGWA 4FDUA 4R5HA 1QUFA 2X9NA 4GL2A 5FTLA 1NZFA 1ZIXA 1EHCA 2G09A 2J3LA 2VUSA 3BREA 3IQWA 2Y76A 3ETJA 3LUFA 4MP6A 3VH4A 1UWVA 3WGUA 1DC5A 1X8JA 1QG0A 5HVNA 4W5NA 4S1NA 5FUWA 1WBBA 2P1RA 4X66B 2QMUA 3REQA 5CDYA 3CISA 2HCFA 1UAAA 1XDZA 2GPSA 5IYZF 2VHWA 3I1FA 2OUIA 1DBVO 1JDVA 1FSSA 3AUSA 3DW1X 4QASA 3BWEA 1E1DA 4HYEA 4IDPA 2CSUA 4FFPA 1E8MA 3T7KA 3UUFA 1QXSA 3FPKA 4CU5A 4BJ1A 3FTFA 3QWHA 4PO3X 4D0RA 2QBYB 2OXCA 3QVVA 1OXUA 5T5QA 3AWIA 2IYOA 1KC3A 4W7HA 2PSEA 4KQXA 1BCRA 4D3DA 2B6NA 4OQFA 5IDXA 2Z5VA 1QIMA 3FPJA 3V33A 2BFFA 4P7KA 1Q1AA 2PWPA 4QSMA 4MINA 3SZMA 2CNWA 4F9GA 1OVMA 4PC2A 1G3QA 2ZRGA 2GB4A 1Z2NX 3C7CB 4Y3UA 2FFRA 3IRUA 4F3RA 5A2QA 3WNCA 3U3DA 1U94A 1RW4A 4PW0A 5J1SB 4HLQB 1LPOA 3GRFA 3OUTA 2IZ0A 4DV3B 1K08A 3WC4A 3UMGA 4NFLA 5D3QA 1XT6A 5FXMA 4Q9AA 1Z26A 2HA2A 5BSKA 1W5BA 4HXEB 4OQPA 3DZBA 2D8AA 2XVXA 2BAGA 4RHTA 4AVYA 2P7IA 2VRCA 4JAVC 3CH5A 1OFUA 2O5VA 3O91A 1L5SA 2GSDA 1E1NA 2Q2QA 5L8VA 1U5BA 2XYGA 2CB0A 1E9VA 2F3PA 3H5AA 5BN1A 5H3HA 3KPUA 4C22A 2A78A 2WA2A 4OKIA 1UPFA 2ZE8A 1L1QA 3LHSA 3O8NA 3HABA 2JNWA 2F3QA 3CSDA 1V48A 1ZGBA 3EIEA 1YACA 1IRIA 3EMBA 1QGZA 3F9RA 1P3Y1 4ISBA 1ODTC 1AKYA 3E9DA 3CB4A 5DBHX 2WJ3A 4A6XA 1MVNA 4DL9A 2MYUA 5AJWA 5IMBA 1SC4A 3RYCB 3SVTA 1JI3A 1NOIA 4ZTZB 1E9BA 3OOHA 1LBSA 2R85A 3DV0A 4JDPA 2Q5OA 3DDNA 4RKRA 3HWX1 5LWHA 5LDGA 2VH1A 4W99A 5IARA 1N92A 4ETMA 1NQXA 2HMSA 5A06A 1V1RB 1LRKA 3N5CA 5F98A 1VZ3A 3EBOA 1YR9A 5TC4A 2X3FA 4NBVA 1CQZA 4BNJA 1Y48E 4XWKA 1MB3A 3C6KA 3ADDA 4FFSA 1VYVA 1I7PA 2VG8A 4MYRA 5D5PA 5AJVB 2PBRA 4DJDC 2C54A 3QBVA 5GZ6A 2XEXA 3TFOA 1O0BA 3BTOA 1OC4A 2C2BA 2JIOA 3IUJA 2BBOA 3KXIA 4KGVA 4O2AF 4A23A 1E6WA 2YQ4A 3B3GA 4HRYA 3G0OA 4N01A 2BLLA 4HWPA 4QLBA 2ZSUA 2KQUA 1UJ2A 2W93A 4JVNA 4YNBA 1Y0BA 1S3IA 4AECA 1SHUX 1X7ZA 2A9VA 2IZ7A 1HDRA 5BV1A 5FWXA 3ENVA 5CXUA 4CEJB 1KRWA 4R1LA 2JVJA 2WE8A 1E2KA 2ZVJA 3O94A 2FPGB 4MQ6A 1BYUA 3CCFA 2YXBA 1N5LA 3CHYA 1TAGA 5ALFA 3MEQA 4U7FA 3MAAC 4TS9A 3ZC3A 4OAPA 2F3RA 4IXTA 4F4CA 2VA8A 2YIJA 4RD4A 4V02A 3G7NA 5A3RA 1UDWA 2I1VB 5C4MA 1TEVA 2ZWMA 3I30X 1TMKA 1VHJA 4IQ8A 1BWSA 2X4GA 3E1SA 4QRDA 4WA7A 2OBNA 1PTJA 4MGZR 1R37A 3FX2A 4MUBA 4WCDA 1CUHA 1J8VA 1GG2A 3A58B 4NX2A 4YS6A 2YV1A 2WM3A 2XB6A 4TV8A 1GA6A 3A3NA 3OIUA 4P3PA 4JGGA 3F4BA 2GEKA 2YOHA 1S8NA 1JHZA 5F4BA 2R0QC 1E7MA 2NO6A 1FTYA 1EAMA 2PKEA 1Y5NA 1SC3A 1HR0B 2I7TA 2OM2A 2PUDA 4ZJUA 1PFVA 7ABPA 2EWWA 5EPOA 5LXTA 2PT9A 1W2HA 1JEAA 5E9WA 1C50A 4I9GA 1O87A 2IELA 4INOA 5EIEA 2V3CC 4JZKA 4RK5A 1ID1A 5HUHA 3ID6C 3RK1A 3RTDA 3Q98A 4WX2B 2UXCB 4DUPA 2XWJI 2PAFA 2X2FA 3OT1A 2YRFA 1WTCA 3VJMA 1E6CA 2XXJA 3GMSA 1SZPA 1G63A 3A0UA 1G8JA 2QN9A 5CK5A 3VC1A 1JAIA 3BRWA 1TM3E 4NOLA 3A8TA 1T3LA 2ZT5A 2FUG6 4U7WA 3HU1A 1JILA 5JE8A 1UINA 4ZOCA 3CNLA 1R66A 2AFHB 2D1SA 3ZHVA 2G06A 1QS0A 1PLLA 4BX8A 2G7MC 5ITVA 4K6KA 3HVHA 4H6WA 2L2QA 4PCUA 3Q2OA 2DB3A 3H05A 2NVUA 5CFRA 4PFSA 2OKCA 2Q21A 3GEEA 3SHVA 1TAUA 1YL7A 2WSYB 5D5QA 1IXZA 1EFVA 3L77A 4PX3A 4IXMA 3EEQA 1VHTA 2PGNA 1AUOA 1XA0A 3AM3A 4N54A 4ZIRB 4QECA 2JHCA 5CD9A 3WGMA 3HI6A 3WLKX 2X8WA 3WRYA 2AOUA 1Z8DA 3K9QO 2F1JA 3O4HA 4TTPA 4Z7OB 1UT6A 3FPSA 2ZYRA 3C7TA 3W9YA 4Q15A 2NYUA 4FXPA 1IL0A 3VO9A 3D4PA 2X19A 3U48A 3ULKA 3ZD7A 4JXJA 1B6TA 4WFKA 3PDIB 3T3IA 3U3JA 1DKNA 3PQFA 3V8VA 4EKEA 5G0VA 2ZIEA 1WG8A 3K9WA 5KKAA 5JAMA 2NXJA 1XF1A 1I7DA 1BXRB 3DEKA 4YRPA 1L5FA 2D4AA 3LP6A 4K9SA 1MDFA 2D1RA 1RPNA 3NNDA 1SURA 4LF7B 4JQYA 2B7LA 1HDXA 4QYIA 4R1UA 1R5JA 4AK9A 3ABZA 5A4AA 3K2QA 3QLUA 1ESNA 1Z16A 1MQ9A 2Z9DA 3MOSA 3C2QA 1ESZA 4ALKA 1U99A 1L7VC 4UNNA 1NTOA 4J2HA 3LZDA 3OC0A 3TZKA 2J4DA 4EI9A 2AG0A 2HL6A 3EDQA 3K72B 2O3JA 1I4TD 3KZ1E 4ZQEA 5ITSA 5JQWA 2VBFA 3AF4A 3MMNA 3RGGA 4DSNA 1CR4A 4IYRA 4GICA 3S2IA 2QV7A 4YMTA 2GKOA 4JYBA 4AN4A 4JKYA 2XZTA 5HKBA 3LECA 5K6AA 4NJEA 1Z5OA 1D4OA 4ZYWA 5K6AC 1TMOA 4R1PA 5E3JA 3K6RA 3TLEA 1FFYA 2PSSA 1LLFA 3IPXA 1C3VA 3MTGA 3N8DA 3DMHA 3O93A 4D4HA 3BGWA 2XDWA 4Q18A 3X1KA 4PZLA 4QXAA 4RFSB 4XPIA 4C0HA 2Z2IA 2A92A 4ZT3A 4QREA 5THKA 1UJ4A 3VA7A 1WUTA 1J33A 3G7UA 3V6MA 1DWPA 4DIMA 4D92A 2ZYTX 2RGBA 1QK3A 2E85A 3N2KA 4XWAA 2DETA 1D07A 3A9UA 3IDFA 3DBLA 2QXYA 3TZBA 1M2EA 4JUAA 4U2EA 4JU8A 4QDXA 3P9PA 4NEHB 3RIXA 5CURA 2BGGA 4JQZA 2WVJA 5KHLB 5ARCA 2BF7A 2IITA 2QMOA 3HUTA 4YDHB 5LQSA 1JEYA 1IZZA 1G1MA 4P58A 3D7RA 4R3NA 2IZOA 4OOEA 4A1FA 5EERA 5DM70 3VKHA 5BNTA 5E7IA 5AOBA 3GUCA 1NE7A 3R44A 3G9TA 1WEHA 3W4IA 5IZCA 1HG0A 1J24A 4MRVA 4ZCRA 4KR6A 1MAUA 3ET4A 1U6IA 2FSGA 1V43A 1EUCB 1VGQA 2RD2A 4Q4LA 1Q95A 2BE9A 3VJLA 4Z4GA 5HUJA 4XAQA 4NEQA 2DBRA 5BN4B 4KQ1A 4DMKA 4X71A 4KNYA 5L51A 2ZM5A 1IOZA 4MQ4A 3ZZTA 1E3WB 4YDSA 5IWCA 5JD5A 4WZBA 3GV0A 1XFAA 1I5RA 3DLHA 2R6R1 2H18A 2JGKA 3EG9A 3L9WA 4TXJA 4GWLA 2DFNA 1UZLA 4B87A 1GLVA 1DDIA 3FSJX 5I3ZA 3DE7X 2DHDA 4CEJA 1GARA 4WT7A 4URXR 3QVUA 1HRDA 2LDXA 4JJKA 1DQPA 4HLDA 1MX3A 4PRZA 2VRCD 4S05A 4B17A 1RMTA 4G0PA 4UKDA 2QROA 4IIYA 3I8OA 2NV6A 4GIBA 4BE7B 4AKGA 4IM7A 3A04A 1SCJA 2B1JA 2G71A 3BCRA 4Y2UA 2YS6A 1BAPA 4JROA 5GONA 1V9LA 4DUGD 1P2SA 4IW3B 3V2GA 5B2EA 1OBHA 3T7SA 5C37A 2P0AA 4M89A 3L0IB 3PE4A 4R71A 4I6GA 1JFFB 3HJAA 3LJKA 5HF8A 3KWJA 1IWPB 1WP9A 5IBQA 1RXEA 2NUTA 3DR5A 4JJFA 4A0GA 3VSEA 3ZHQA 1ML3A 1EVKA 5CX1A 3HTXA 1ZNWA 3LUKA 3I9V1 2GCIA 2FF5A 4M1YA 4ZCLA 2J0UA 3ZIAA 3QUSA 3OAAD 1ABBA 1NQWA 3F5FA 1M1UA 1JLKA 3D0QA 4HDQB 2QN7A 1WVGA 2IC5A 3PL1A 4WXEA 4AN0A 3KALA 5J2UB 3RS0A 2RHWA 3A1NA 4LYGA 2AW5A 1GO2A 3BJEA 4G84A 3L8DA 2X0DA 4DCNA 5AK4A 4ZXPA 4EVIA 4RUKA 4H7IA 1A69A 3TOCA 3ZHUA 2ID4A 1ZAYA 1L5HA 1E3TA 1N8TA 1WUKS 1G6OA 2QMHA 2PAAA 1M76A 1G8KA 5C8YF 3VO1A 4FFNA 3EWAA 1W46A 1E99A 1M0WA 3FWKA 1O94A 3OIDA 3EG5A 5WRFA 3CKLA 2X2EA 1P3DA 4IDFA 4IVQA 5TVKA 2O2HA 1NW4A 1Z88A 1CJVC 3GFVA 3RS9A 5GIPE 4RD3A 3MG9A 1AOXA 3CCBA 5C8ZA 1AKQA 2MMCA 4D0GA 1NVXQ 1E20A 1YGYA 4DYVA 1BE8A 1PG0A 3QI2A 5J5AA 5BSUA 4NDAA 1YK0A 1GSOA 4I5EA 8GPBA 4YXWD 4FGKA 2Z43A 1BFKA 2N0SA 3ZXXA 4KQFA 2UUPA 1H2FA 1ZJWA 3R5XA 3FNGA 1XRNA 2FWRA 4BY9E 3L7KA 3E7PA 1KQNA 3GA0A 5TPWB 3GIWA 2YOFA 2Y4OA 5T41A 2XGOA 2G5TA 4UOZA 2AE1A 2YHUA 5BR1A 2VJMA 3ISJA 1Z2EA 3IVRA 3LG2A 1JLLB 4XW2A 4B7CA 5JTTA 1JDTA 1KPHA 4EUSA 4G37A 3B1ZA 3K4HA 4EYKA 4QXMA 5LQDA 3CONA 2WZCA 3O92A 1ACMA 1NHWA 2FRVA 2PE5A 5K4AA 1IIBA 2YASA 4AZTA 3DFMA 4NCXA 3L5OA 2BY4A 2HWUA 2ID9A 4B7AA 2YMPA 4CQMD 2EGGA 1XVUA 3EISA 3N2ZB 4IV8A 4ZAWA 5BQXA 2YWDA 3OZVA 3KWFA 1EYZA 2IHZA 3EGEA 4OCZA 5KIAA 1DC4A 1NNSA 2QX4A 1C3LA 2IOYA 5L3ZA 1RD4A 1P5ZB 3CZ9A 1FP4A 1PJBA 1Q2UA 2BM0A 2FETA 1X13A 4K0RA 3TXYA 1USKA 1FFWA 3ILYA 4RACA 4JI2B 2WJAA 5LIRA 3RTBA 3R6LA 2ENWA 1ONPA 1T5OA 3F7MA 2CJFA 3ZWDA 2WU3A 1IB6A 4PC6A 4KQWA 4P86A 4PLTA 1EIWA 4QDZA 2OGTA 4ITRC 1AA9A 4YAGA 3U4QB 5CB6A 2O5CA 5KU1A 3H9GA 3I2JA 4X7PA 1NW8A 1GYQA 1IDOA 1JVSA 1LK5A 4QUDA 5D8DA 5IC5A 1NXSA 2I22A 1HY3A 3DDUA 4ER6A 1WUHS 3CJRA 3HZZA 3N58A 1E3IA 4P3XA 4Y0VA 3LQQA 4O2AB 3N3AC 3RK0A 1GFIA 5KNBD 5JVDB 2VYND 4ENPA 2X6QA 3ASYA 3QWBA 5SYMA 1HNZB 4AC9A 1SUSA 2HW8A 4C4OA 3UPDA 5I7HA 3IUBA 4YJ3F 4WPGA 3C6BA 1FU4A 4HPWA 4W5QA 3PRKE 2OQVA 1A3CA 4CE6A 1GA1A 4OQYA 4IFBA 3FSGD 4MAMA 5JI2E 3JQQA 3OBBA 3P71T 1Z4KA 4AY6A 2RAVA 1XHLA 4A6DA 1AV6A 3GLVA 2X5XA 5DKFA 3JQRA 3G79A 2GO7A 3T0IA 2EG5A 2NUAA 2IWHA 4RU1A 1IK4A 1P4GA 5CVCA 5ES4B 1JSZA 1U1IA 3NI2A 3P2OA 1P77A 2AJTA 3I1YA 4YMLA 4QYSA 4UHKA 5CFPA 1T5DX 3RUCA 1VPLA 2GFQA 2GTHA 3MYRA 1J0CA 4LGCA 10MHA 4YJHB 1XZQA 3WXMA 2OZPA 4FILA 3TXAA 3QYFA 3I4FA 1X1AA 2AVDA 2R2GA 2AMYA 2ZAOA 4P4LA 4NAVA 2YV3A 2ZBPA 1XUOA 1FFHA 3W34A 4TWBA 3UAVA 2WB4A 5ALHA 1RYDA 2PKWA 1ZK0A 4YFYA 4BC0A 4ZGWA 4R9SA 1UBJS 5BOVA 1B0AA 3U37A 2C2KA 4Z54A 1ECGA 3OOEA 4OKSA 3KL2A 3L93A 1EWRA 1ZWKA 4LZJA 4B9EA 1AKWA 3HQ4O 2E1RA 4CQMA 2IYAA 5CA0F 4NJMA 2XB4A 3BX1A 1CV2A 1ES9A 1JG1A 1PHRA 1VCNA 2P1DA 2WK1A 3H8SA 3JD1A 3NJ8A 3IR5A 4E2XA 3L7BA 1BJRE 2BCJQ 4KXLA 1DC6A 1Y37A 4Y9TA 5DI3A 4BMNA 1GNTA 3REFA 2RIRA 1P9NA 1CQPA 2AEEA 1J1IA 4EUKA 1AZWA 1Z8FA 4UD2A 5CA1A 1EU1A 3LLMA 2H11A 1MEEA 5K3SA 3VKGA 1A4RA 5TARA 5HQJA 2DKFA 3N7UA 3RYCA 4QDJA 4MLDA 1VIDA 4OAOA 5GJBA 2O14A 2ZBVA 4DR5B 3IPCA 2A5GA 1BNCA 3ELYA 3EQ2A 1XPOA 3EXIA 3VNSA 3EZ2A 2HMVA 5EZSA 1LCIA 4RZUA 4M1SA 3RU9A 2YXEA 3V8EA 1ST3A 5E3HA 3WDMA 4XX1A 2M2IA 3PR2B 4J94A 4LG1A 5KBYA 3BWCA 3EPHA 2FPKA 4PZYA 2VVTA 3C4VA 3H5WA 2FFHA 3FGNA 4IIUA 3N75A 4H4CA 4S1VA 4AMYA 1S9HA 1H2AS 4C2UA 3ZE6A 4J0KA 2BLNA 3HO1A 3NHAA 2SCUB 4KDFA 1U7PA 2FPMA 1DBWA 2UUOA 3C5HA 1JHRA 1SCNE 3LPLA 1OFIA 3SVZA 3VVCA 3DS8A 5I45A 2GFHA 1PR2A 4CLEA 4QT0A 2A59A 2WVAA 1BJKA 2WJVA 1PR1A 2HA6A 4PYQA 4V1CB 1RPJA 1ZA2A 2CMKA 3IEIA 2DFPA 1CUWA 2QLLA 3BZBA 1WMBA 3MB5A 2FPPB 4I81A 4HYTA 2P8SA 4GGPA 4LBYA 3M0EA 1QHEA 3RKSA 1JW9B 2LBPA 1WB4A 3D6VA 4ANFA 4CRWB 2PRZA 1ADGA 1Q0RA 4AM8A 2CHGA 1XN1A 4ZZIA 4RM2A 3DMDA 2YV2A 3HA2A 4QTZA 4LZWA 4KSCA 3EGWA 2V6MA 3OESA 4YV1A 4I19A 3WK6A 1FTGA 4GR4A 1HDIA 3LTEA 3A2NA 1PSDA 2HX1A 4H59A 3EWIA 1MB0A 1Z4PX 3H87A 4MYDA 4BKPA 3FA2A 1ZJZA 4DR6B 1QVRA 3BIJA 3H9BA 3TF5A 4U5QA 4HNSA 4QUEA 5EIAA 3V2HA 3CC8A 2AQIA 1XQYA 4EZEA 3WE7A 4BE4A 1F48A 2C04A 3CUSA 4XYGA 4YMIA 4GG1A 3AETA 1U8FO 4YP7A 5HPYB 4CEHA 1PJ2A 3Q5DA 2W5UA 3WIUA 1DO8A 1JG7A 2VAWA 2E1PA 4DADA 4DWWA 4EYEA 1KI8A 4IGFA 2G9NA 1ZH6A 4KDEA 2W2OA 4LJ7A 2BGIA 5DSXA 1XTJA 2C3YA 4RTPA 1HT2E 3K0SA 2C07A 2C4KA 2JLCA 3BKWA 3OLXA 3C7AA 3W5JA 5AM0A 1YR2A 5LPNA 1QTQA 4OYLA 2WZBA 2WA1A 3ITKA 1Q3TA 4MB0A 4P7FA 2VK4A 1PG5A 3VDQA 3V4RA 1AGXA 4NI5A 4JXXA 4FE7A 4JJ4A 4ADSG 4LF4B 2W2VA 2IP1A 1VCOA 1ZXXA 3DLIA 1P2BA 4E22A 1JNXX 3I61A 4XD7D 5IT0A 5ECGC 4DT1A 5EXSA 1TD9A 1O77A 2QDXA 2XWSA 1P0PA 4MWGA 1L5RA 1SD1A 1FVOA 1SXJA 3GHYA 1XZPA 3KR2A 3G9QA 4IDBA 4NP6A 4MYCA 3VR5D 2IW1A 4YCBA 2BMVA 3GX1A 4FZJA 2GVNA 1ZONA 3CNHA 3HP7A 4QQKA 5LD2C 1O96A 4MDYA 1WMFA 4QG7A 1B6RA 3PA8A 2K87A 5AOAA 4FIZA 3M6IA 5GONF 1EFCA 1NW6A 2FSHA 1BFUA 3DONA 3NAQA 2V6IA 3FOAA 1P6UA 2E89A 4FJ1A 3T3HA 1JJFA 1JHYA 2NSLA 4MUMA 3I52A 2H1HA 4C29A 4PYOA 4MR8B 2B1QA 3MJDA 1FMFA 2YH2A 4R1OA 5BSFA 4HFMA 2OV1A 2XF2A 1KEEA 2MTBA