3WTCA

Crystal structure of gox2036
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
259
structure length
259
Chain Sequence
MSLSGKIAAVTGAAQGIGKAIALRLAKDGADVILLDVKQDTLAETAKEVEALGRRAVALTADISNRDQFRSTLADAAKTLGGLDIMVNNAGICQVKPILDIEPAEIEKIFSINVQGVLWGMQAAATLFKEKGTKGKIINACSIAGHEGYPLLGAYSATKFAVRALTQSAAKELASSGITVNSYCPGIVGTDMWVTIDKRMAEITGTEIGATYKKYVEGIALGRVETADDVAGFVAYLSSSDADYMTGQSVLIDGGLVFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative oxidoreductase
publication title Crystal structure of Gox0525
rcsb
source organism Gluconobacter oxydans
molecule tags Oxidoreductase
total genus 98
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wtcA00
1E1LA 1LDGA 2J6IA 4ZQHA 5KKAA 3KEQA 4A7PA 5GZ6A 4CLRA 4QXMA 3UCEA 3GZNA 4NU6A 3NDRA 1YVEI 1FK8A 2QW8A 4MP6A 5CG1A 3R1IA 5U9CA 5HTOA 2QRKA 3BXXA 1DC5A 4ND2A 3U4CA 4PVCA 4F6CA 5JAIA 4HNGA 1H2HA 3QE3A 3SC6A 1Y8RA 2JAHA 3IJRA 3BHJA 6LDHA 1UJMA 1DO8A 1DJQA 2Y67A 2EKPA 2IEDA 2E37A 1DPGA 3KRTA 4OXNA 3ITKA 5DZSA 1A72A 3PI7A 4MJLA 4PFJA 4BO5A 1ID1A 3JYQA 2G17A 4U7WA 2PLAA 5JY1A 4XEHA 3IMFA 2Q2WA 2X23A 1JLLA 3G1UA 1NVTA 2CNBA 4J4BA 3WTCA 3HSKA 3PQDA 1Z82A 3BMOB 2HJRA 4NHEA 2H6EA 1HDOA 3R0IA 5DF1A 2DPHA 1M75A 3HFSA 5K9ZA 1EQUA 2B69A 4PLWA 5A1TA 2HRZA 4BNFA 4HP8A 2NQTA 2V6BA 3JQBA 3DZFA 4G2NA 1VJ0A 1IZ0A 3LF1A 1E3IA 3WJAA 3PK0A 2GO1A 4B7XA 3QA9A 3JQGA 5J23A 3ICPA 1O0SA 1DHTA 4QUKA 4Z0HO 4CM8A 5KJ6A 4WPGA 3RCBA 3WQQA 3Q9NA 3WYEA 2NNLD 3ZV6A 3LLSA 3GVIA 5AYVA 4I5GA 3EC7A 4PRLA 4K6CA 4LGVA 1W6UA 4MDHA 1GADO 4PIVA 4IY1A 3JD3A 1DHRA 1P1RA 3DOCA 1DOHA 2Y0DA 3BMQB 4JN6B 1YOVA 4ZJUA 2OFPA 1O8CA 5TNXA 4HKTA 1UR5A 4NK5A 3GN1A 3JD0A 5B4TA 1M2WA 1RM0A 4IXWA 1XKQA 3SVTA 1YH3A 4FFOA 4MP3A 5BSEA 2X0IA 1LLCA 3DC2A 3OIDA 4C7KA 3ENKA 4RF3A 4KWIA 1QXSA 3WIEA 1EUZA 4NBWA 4INAA 5LCXA 1EFLA 2VUSA 3OJLA 3PYXA 5DCUA 3D4NA 3AWDA 3DAPA 3BIOA 4BHTA 3TSCA 2O4UX 4W9NA 4DIOA 1K6IA 1QP8A 3JCZA 4WKGA 2B4QA 4YPOA 1P1FA 1GQYA 2A35A 2CF6A 2NU6A 5JS6A 3NJ8A 4OO3A 2DBQA 4R01A 2PNFA 4YJGA 3GK3A 3PRJA 3I9KA 1E6UA 3RASA 2FHSA 3OHSX 3U9LA 1MB4A 1DBVO 3CPSA 2E48A 4KDFA 4JBGA 1PL7A 1YL7A 3N74A 5BQFA 4WLOA 4LVCA 4U6SA 1HRDA 4WCFB 5AXDA 4YJHA 4RVSA 5FI3A 1U2DA 4OQZA 1TA4A 5KVCA 4EGFA 1K3TA 1B26A 3ZI0A 3U09A 1U2GA 4Z3DA 5G0UA 3PLRA 1T4DA 3C8MA 2ILTA 1P1IA 5EIOA 1KVUA 3ZWMA 3F1KA 5I9NA 3K9QO 1D1SA 3GHHA 3PHLA 3LC2O 3ETGA 3C7CB 3MJ4A 5KJ1A 2H5LA 1LEHA 1GUYA 2I99A 4EJ6A 3TZHA 2P9GA 3M1LA 4XR4A 4DMMA 4BNVA 4WASA 4U0KA 2OBYA 3PTZA 3B1JA 4J3FA 4L0QA 2HMWA 3N58A 3DAGA 4RLSA 1HDXA 4BNGA 1I2CA 3RJ5A 5FEUA 3ZN2A 2EKQA 2VN8A 2HU2A 3DO5A 4IMRA 1XGKA 4CUJA 4DA9A 1YL5A 4P8RA 2W90A 1WPQA 2F1KA 4GLOA 1CRWG 3TZQA 3GVCA 2DU8A 3JQEA 3ZV4A 1D3AA 1R37A 3HG7A 4IJUA 2YZ7A 3ETDA 2J3IA 4DGSA 1PJBA 1LX6A 4GMFA 1NWHA 4AFNA 1TI7A 2UUPA 3OEWA 5LDHA 2O2YA 1H9BA 3JYPA 4BKRA 1ZK4A 3K8ZA 1LA2A 4IPTA 5EJ2A 3E6AA 4MINA 1C1DA 2D5CA 3EY4A 1NP3A 3I5MA 3ZDFA 1NQTA 3M1AA 3S2EA 4II3A 3V1YA 5TGDA 3WYCA 3L9XA 3RKRA 1HDCA 2VCYA 4R41A 4GX5A 4PGFA 5CP8A 1SAYA 2DBRA 1B8VA 3WLEA 1ZMOA 4YT8A 4GWKA 2YV1A 3NGLA 4UVIA 5B1YA 4E5PA 3C1OA 3VOSA 4BNLA 4RF4A 1PR3A 3P2OA 4K26A 1VJ1A 1I3MA 2XOXA 4C7JA 5CG2A 3OA2A 1HE4A 3RD5A 3QWHA 4OOFA 4E5NA 2IYPA 3AOEA 3BYZA 1F17A 1WAMA 1C0IA 1PJCA 1O9BA 2BELA 2FN7A 1KS9A 2I67A 5KVVA 3JQ6A 3KV3O 2ZTUA 1VSUA 3NDJA 3I6QA 4RPLA 5TX7A 1ML3A 1EDZA 2JFFA 3K73O 4GMGA 4XD2A 4N5MA 4DC1A 3FR7A 4FN4A 2UV8A 3Q0EA 5CEFA 4E5KA 2ZQZA 4XRRA 5K6AA 4BKOA 4IIUA 4Z0PA 5BSFA 1MXFA 3IIEA 1HZZA 3GAZA 3QY9A 3H8VA 2AW5A 1ENYA 3ETEA 3NTQA 3TL2A 4GX0A 4R68A 2R6JA 3HN2A 3WR5A 4BNIA 3CIFA 3JQFA 4R1NA 1C0KA 2JL1A 3F1LA 1Q1NA 2EWMA 4RJTA 5AXCA 2NU8A 3ZU2A 1C3VA 1UDAA 1PGJA 3MWEB 3ZWOA 1UP6A 2FRDA 4N18A 4J1TA 4ONEA 4YAIA 5B12A 4MO2A 2AMFA 4YTEA 1KEUA 2G1UA 4FB5A 4NU5A 1UAYA 2VYVD 3CXRA 4W7HA 4DLAA 1JVBA 1ZSVA 3DBRB 4J4HA 3ADPA 5JCXA 1QRRA 5KVQA 1U7HA 4L75A 4TQGA 1NQ5A 1W4ZA 3VH2A 3GC6A 4E13A 2NQ8A 4Z6KA 3RI3A 4DQUA 3G1TA 1NPYA 1ZO8A 4OYRA 2WJPA 3DMYA 4RORA 2H1SA 4XX0A 3RC2A 2NWQA 2DUUA 3UXYA 4PVDA 1DLJA 4QSMA 1YJ8A 3U62A 1RJWA 1Z74A 2O48X 3H5AA 4IDCA 4MIOA 5EPOA 2PV7A 4XYEA 4BO1A 4ND3A 1YRLA 1GQ2A 1NAHA 4OOEA 2X9GA 1GUZA 4CMBA 3OICA 3EYWA 3IDSA 4IJVA 2VZ0A 4NR0A 1JTVA 3NTRA 3FCOA 4WEOA 4YEDA 3FWZA 2YHIB 4AJKA 3AM5A 3GNQA 5A9RA 1H2BA 4R9RA 1K89A 1F14A 3H5RA 4FSHA 4PLYA 4RZHA 5AQ1A 3OQBA 4YJFA 3WS7A 1DC3A 3WBBA 1K2WA 1ONNA 2BGLA 1U3UA 3OP4A 2NADA 4KQWA 4Y67A 2V7PA 1EQ2A 2VRCD 2XXJA 1A7AA 2C5EA 4J91A 1E5QA 1PZGA 2LDXA 4D79A 2POQX 1BXZA 2OP0A 1M6WA 1XYGA 3I1JA 5GZ1A 3QV1A 3RFTA 1IHXA 3LT0A 2GF2A 1YS4A 1EEHA 1H6CA 4XIJA 2O3UA 3Q2KA 4EI2A 1GPJA 1K5HA 2YFQA 5DN9A 1BSVA 4M89A 2GD1O 1E7YA 1ZK1A 1ZW1A 6ADHA 5IXSA 4MVJI 1E3SA 3NKLA 4MP8A 3LF2A 1TT5A 3MJVA 3PPIA 4IMPA 1B3RA 4MKZA 5B4VA 2C82A 3AUSA 3U0BA 3F47A 4FGSA 4XYBA 2CZCA 3EUWA 5BT9A 3BMOA 4W6ZA 2CSUA 3I9NA 2AHRA 1Y9EA 4BMNA 3BHMA 4M54A 4DPKA 3RJ9A 4ZQFA 5T8KA 1KBZA 4BVAA 4CMEA 4JJIA 3BTUA 4KQXA 2IZ0A 2NVWA 3ANLA 3GT0A 2YDXA 5A5EA 1O95A 2Q1UA 4XGIA 5IXYA 4UEKA 3LLVA 3ENNA 2DFVA 3OQ1A 4R1SA 3AU9A 3MEQA 1P77A 1IY8A 1EZ4A 3AY7A 2DTDA 2RH4A 2VHWA 3HN7A 3QRWA 3UHAA 5EESA 3EVTA 2VHYA 2GZ3A 1ARZA 1QYCA 1XQ1A 3KLMX 2FZEA 1PJLA 1NYTA 2VHZA 4TVOA 1WZIA 3DDNA 3QVOA 3BMQA 2P4HX 2VT2A 1DFHA 1MC5A 4CL8A 2F00A 1OBFO 2CDAA 1A4UA 3EDMA 4Q39A 3MZ0A 5JDIC 5HBRA 1I01A 3KYDB 3BZUA 3KTDA 5DP2A 2YYYA 2R2GA 1HXHA 1VL6A 1IB6A 4XQEA 1SOVA 3QW2A 1R0SA 4TMFA 4YAGA 1PJTA 3WJ7A 4XR9A 1LI4A 3GLQA 2BRUA 5THKA 4XKJA 5JSFA 5G2OA 3GVHA 4Y6PA 1UH5A 4BNWA 4YRAA 4PG6A 2I3AA 4ESOA 1YDWA 1YBVA 3RFVA 4XYGA 2HK9A 3Q6IA 2VT3A 3D7LA 4OIMA 3LZ6A 5I9LA 3WICA 1VKOA 3COSA 4TRRA 3L4BA 1D8AA 1BVUA 1YDEA 4M87A 2O3JA 2VRCA 2WEKA 3MJTA 5G4KB 1PS0A 2DFDA 3NT4A 3VVBA 3M2TA 1A5ZA 1UXKA 1HYGA 3H3FA 2Y66A 2OUIA 4A27A 4AICA 3I23A 2FOIA 1YWGO 4BV9A 3DONA 2Z95A 4JGBA 2I3GA 2J5RA 4ALJA 1HL3A 1HDRA 4E5MA 4EUFA 3CEAA 3ZV3A 3PDUA 4RQTA 1V8BA 1X1EA 2GN4A 3ST7A 1YGYA 3E5MA 3TZ6A 3WNQA 3O8QA 2Z1NA 3ABIA 4OSOA 1ZK2A 2C7VA 4WLEA 1E7QA 1WXDA 1HLPA 4WCFA 2Y1EA 1NQAO 4TKMA 4MIYA 3GDGA 2CVOA 1LSUA 3QVTA 5MGBA 3GUCA 1GFSA 3ADOA 3I52A 1SEVA 4M1QA 3VZQA 1ISIA 1M67A 4L76A 2RH8A 1MC4A 3ZHBA 3DAFA 2C2YA 3JTMA 4IQ0A 4JXKA 2EF1A 4OGWA 2AG8A 5HS6A 3UW3A 3CE6A 1QMGA 1A9YA 3W8FA 2PD3A 3P7MA 4HY3A 4NFHA 1S7CA 3EGOA 3IAHA 3VPGA 1U4OA 5DBIA 1PZEA 1E0DA 3A1NA 3H9EO 2TMGA 4J1SA 4Z9YA 3Q2IA 2HLPA 2YJZA 3Q9UA 4R9SA 1YL6A 3U5TA 3MCVA 3GQVA 5TT0A 1PGPA 2PKQP 5TQVA 5L95A 1HYHA 1K6XA 3B70A 3WGQA 3IKVA 1QV7A 4L4SA 5BSHA 3C7DB 4NDNE 2AQHA 2DBZA 1AXGA 4KMSA 4IGFA 2O3RA 3ZWCA 2BFPA 2GN8A 2PGLA 5T67A 3I6IA 4MVJM 4CUKA 4RF5A 1MV8A 4BKPA 4GSLA 3IKTA 4CM4A 1IULA 4I9UA 3H9GA 1UDCA 3D1LA 1PQWA 1NR1A 5A3VA 1LLDA 2QHXA 2XXBA 1T1RA 1ZK3A 1ZXLA 3DBVO 4Y8VA 4F3YA 2ZQYA 2Q46A 5TT1A 1R0KA 1DJNA 2VTDA 1YBMA 3HFGA 3GVPA 3LSYA 4IDGA 2JJYA 3ITDA 5H83A 2J3HA 1E1MA 2O4CA 4PLCA 3WLFA 4DBZA 2GZ2A 5TJ9A 1QV6A 1NHGA 4UREA 4EZBA 2OOSA 3DBLB 5A9SA 4RVFA 4UAGA 4DL9A 1DFIA 1KEVA 4IM7A 5A9TA 1IPEA 3NT5A 3CKYA 3JYNA 2O3SA 1SB9A 3E5RA 1B7GO 5COBA 1Y5RA 2NM0A 4YQZA 4DC0A 3HZZA 4O0LA 4O6VA 2Q1TA 5ENDA 1XWFA 1VC2A 3PIIA 4UEOA 1LSSA 1AHIA 1BWSA 1OZAA 4J7CA 1ISHA 1Z45A 4JJGA 4XDYA 4EDFA 1RKXA 2P9EA 3RAJA 4RVUA 3GG9A 2D4AA 3OJEA 1VJTA 3QVXA 3K2EA 3HB4X 1ZJZA 3AY6A 3NX4A 3D3EA 4TROA 3HHPA 1YONA 4I5EA 4EUEA 2VRBA 5FF9A 5I7VA 1EVIA 1B0AA 1IE3A 2FP4A 3FHLA 3VTFA 2FSSA 1UP4A 3ON5A 4RL6A 1I2BA 2NVBA 3SEFA 2CMDA 3INRA 1B16A 1NVMB 1PZFA 3WBFA 2PK3A 4RLHA 4UULA 1OC4A 2C20A 5KWEA 4WNIA 5AXAA 4K1LA 5A4DA 4CLOB 1OFGA 2B35A 1VL0A 3RIHA 3NJ4A 1YXMA 2BFMA 4CM3A 3W6ZA 4EJ0A 2X6TA 1ZVMA 1N1EA 4URFA 5F21A 1K0UA 1A27A 3NUGA 1PWXA 2EXXA 2XF8A 4Q3BA 5JNLA 1Q0LA 2Y0CA 4IDFA 4B4UA 3WQSB 2Q2VA 1XELA 1EK5A 1Z6ZA 4CM6A 5L4LA 1QORA 3ONDA 1DRUA 3VH3A 4HUJA 4YA6A 4IBOA 5KJFA 4BS9A 4FFLA 2QYTA 2Q50A 1FJHA 1T2AA 4FOSA 4MKXA 4YT2A 2NU7A 4YRDA 4NQZA 2W4QA 2PGJA 3N7UA 5L7TA 1O89A 1ZCJA 3AI3A 1EE2A 1WW8A 2ZB4A 4FQ8A 4CMIB 2PGDA 3Q11A 4FPXA 1H6DA 4GBJA 1X14A 5HA5A 2QZ9A 4MVJE 1GV1A 2WE8A 1T4BA 1GDHA 3HUDA 2BI8A 3FNGA 2EG9A 3K2BA 1HDGO 1G0NA 3DTYA 2PZJA 4JCOA 1S6YA 1N1GA 2VWHA 1E5LA 1GY8A 2Y93A 3BTVA 4GKBA 4YT5A 3S55A 2HSDA 3PIDA 2A9FA 2DM6A 1I3NA 1HEUA 1QG6A 4AJOA 5B4UA 5JPIA 2J3KA 2P91A 2FZWA 4LK3A 1MG5A 3C1TA 4W9NC 1T2FA 1JA9A 2DTEA 2WD8A 3HE3A 4HBGA 5ES3A 3TF5A 3DHNA 3U4DA 2VWGA 2Y1CA 4JX8A 3DR3A 4WLFA 1U3WA 1UZLA 1J5PA 1QYDA 1U5AA 2VNSA 4R51A 4P4LA 4BO6A 4BMVA 2O2SA 1DSSG 4E0BA 3FSRA 3VAZA 3AW9A 4O59O 1GL3A 2JHGA 2DBVO 3LVFO 3AJRA 3BA1A 4MVJA 5COQA 3T4EA 2X5KO 4NPCA 3NRCA 1T2CA 1I5RA 2DAPA 5A04A 3SJ7A 1W8DA 4UVEA 5DBGA 3T4XA 2RHRA 3W1VA 1ONPA 4PLZA 3C24A 1PQPA 3RBXA 1GU7A 2D0IA 3F5QA 4XZ3A 3OIFA 3GPIA 2O3TA 4KUGA 1V3UA 1K6JA 4NFYA 2X5OA 2HQ1A 1GAEO 3DOOA 3GEGA 4B3JA 5JYDA 3FWNA 1PL6A 2QIOA 2WMDA 4ZHSA 1L7DA 4BO9A 5KCZA 3NV9A 1E3WB 3SBOA 2NU9A 3FR8A 4I8XA 1DIBA 1U3VA 5DOVA 1AE1A 4CMKA 4NZ9A 5C7IO 4ZVVA 3S8MA 3GHYA 1R4NB 5IZCA 4JBIA 3WG9A 4E32A 4PG4A 4E6PA 1ZZEA 4XIYA 3KB6A 1ZIDA 5AXBA 4ZGWA 2G0TA 5KNLA 1GCUA 2YUTA 5I8WA 1ZSYA 1MP0A 2C07A 2ZJ0A 1HYEA 4FJ0A 4KP7A 4L4XA 4XJSA 1E1NA 4ND4A 1PGOA 1C0PA 2EW2A 3IS3A 2Z5LA 5G4KA 1BW9B 5IN5A 4HV4A 2VHVA 3DZHA 1I0ZA 3RU9A 1NBOA 2HMSA 3PQFA 2OORA 4E2YA 1BHSA 1HETA 4WNCA 4YRBA 4ZICA 3BAZA 3AY3A 2AQKA 3GOHA 4YDRA 1E6WA 5LDGA 1FDSA 3QP9A 4DQXA 1CETA 1MXHA 5IZ4A 1D7OA 3NDIA 3W4IA 3IL2A 4IQGA 4BNUA 1TEHA 4FFMA 4ITUA 1SPXA 1TT7A 5DOZA 4O1MA 1X7GA 1CIVA 1ADCA 3NGXA 1YKFA 2FPIA 2EIHA 2OO5A 3WFIA 3ZNOA 5ER6A 3AU8A 3ZHZA 1NFFA 1B3BA 3UICA 4ID9A 4XGKA 4GVLA 1M66A 4ZQEA 4IJKA 3A28A 3WXBA 4TSKA 1TXGA 2X0NA 1X7HA 2PZMA 1DDOA 3GDOA 1N7HA 3OF2A 4R69A 4GVXA 2AG5A 2HMVA 2Y1OA 2W2KB 1DAOA 4BO3A 3GGOA 4CQMB 3L6OO 4AJLA 4U8GA 4AJJA 2GN9A 2I66A 2C29D 3DMTC 4GQAA 2NV6A 2WSBA 3H9UA 5JLAA 3GR6A 1ISGA 2BF7A 4PG8A 3WWZA 1A9ZA 1N92A 3DXFA 4D0SA 3JQ9C 1VE9A 4FJ1A 5JCJA 1ZJYA 5A05A 3TQHA 2D3TA 1O5IA 3GFBA 4EBFA 3D3WB 1DRWA 2ZB3A 4S1VA 4F45A 2GUGA 1ZFNA 2Y1FA 3DHEA 1LDEA 1PL8A 3OSUA 4FC7A 1I36A 5U1PA 3S2IA 1R6DA 3GF4A 1N5DA 3KVOA 4YAEA 2HK8A 5K6AC 1QLHA 1UXIA 1GZ6A 1W73A 5EERA 4D42A 1ORRA 1DC6A 3DQPA 4OAQA 1ZUD1 3PJDA 3RWBA 4E30A 2EP7A 4PZEA 2C5AA 3EVNA 4IJWA 4CLEA 2X58A 2BFOA 3F4BA 2ZATA 4Z9FA 1DIGA 1R16A 2Q1SA 3PWSA 2JCYA 3OECA 1HDYA 1KIFA 4A0SA 1N8KA 4H16A 3GRPA 4P22A 1KERA 1XR3A 1ENOA 1A71A 5BNFA 2R00C 1LRLA 1JKJA 4HWKA 1PJSA 2IDZA 1LLQA 4M55A 5T57A 2NVUB 5FI5A 3TNLA 3GDFA 2C0CA 3KSDO 4B79A 4DPLA 5JO9A 2D1YA 2GZ1A 3WQRA 3ANMA 4G81A 3A9WA 5I7FA 1F06A 3VZRA 1ZH8A 2BH9A 3JYOA 3ICCA 3KYCB 3L6DA 3O9ZA 1P31A 3P2YA 4DVJA 3FTPA 3DBHB 4FGWA 3JQCA 4QFDA 1I33A 2DVMA 3OA0A 3ZWXA 3ZHYA 4CR6A 3D4OA 4RGBA 3OM9A 4AJ4A 1JW9B 2IYOA 4P4NA 4L8VA 2VYND 1Z7BA 1KYQA 3TZCA 2JFHA 2ZCUA 4NIMA 3BMCB 2QQ5A 1P3DA 5F5NA 2DPGA 2GPTA 4Z0TA 2OL4A 1VM6A 3QWBA 3FI9A 4LW8A 5IDXA 1OI7A 2C2XA 3DBLA 4PG7A 2GN6A 3GY0A 4JNKA 4MKRA 4R1TA 5HRUA 3BTOA 3LC1O 4LMPA 3PZBA 3KUXA 3NAQA 4XA8A 3I4FA 1XSEA 1R15A 4I5DA 1PSDA 3VZPA 1FDWA 1X7DA 3ZWPA 3KBOA 1JN0A 4A2CA 2JHFA 4CLRB 1DIRA 3HWRA 1C14A 3WGGA 3UH1A 3FPLA 3JV7A 4D43A 4XRGA 1KEWA 5BNIA 4QEDA 2OBNA 3D4PA 4GKVA 1QYWA 3PGXA 1F0YA 4N5LA 2DT5A 4JBHA 4W82A 1XEAA 3ZH2A 2X86A 2P68A 1ENPA 4AVYA 1EUDA 1NVGA 3H2ZA 4EITA 1EMDA 1G1AA 1GR0A 1JDJA 1M76A 5JYEA 3LT4A 1SOWA 2Q49A 3LYLA 2P2SA 4TZTA 4S3MA 2HK7A 3KOUA 3G0OA 4CLOA 4BGVA 5I7EA 4ZQBA 1BG6A 2PD4A 2GR9A 4Z9XA 4BKUA 3KLPX 1GYQA 5C7LO 4WLNA 1WVGA 1VI2A 3GGPA 4RQUA 2B36A 5HS4A 3CH6A 3ZU4A 1OOEA 4CMEC 1TLTA 4C4OA 1HE2A 1VKNA 1OAAA 4RVGA 9LDBA 3JQGB 3ZWBA 1FMCA 1ZKMA 2Y99A 4CM8B 3O38A 5TC4A 4E21A 1VLLA 1TB4A 4I9NA 3STHA 5G0SA 1XHLA 1XIVA 2CDBA 1X1TA 1CWUA 2CF5A 3F3SA 4OSPA 4RPKA 5DNAA 3ZW8A 1ONOA 4MVJF 2RHCA 1XU9A 2PTGA 4B7CA 4YXFA 5THQA 4ZQGA 4L73A 3DEYX 1WDKA 3ONFA 1KVSA 4BV8A 3CUKA 3JSAA 2EJVA 4CM5A 3MJEA 3QJ5A 1E1KA 3RVDA 3ROMA 4JROA 5CFZA 4CMIA 5DT9A 1LDNA 2VYNA 1GZ4A 4AJ1A 2GASA 4QX6A 1UZMA 4FC6A 1KVTA 1NASA 2E6UX 4TRNA 1IZ9A 1N9GB 4CQLB 3DB2A 3T7EA 3WGHA 3V1UA 2J5QA 3R3JA 1FF9A 3OH8A 3SLGA 1P44A 3L4SO 3GRKA 3SXPA 3DZKA 2E4AA 3H4VA 2EV9A 1NQOA 3VPHA 3RQSA 2ZYAA 3ZZNA 1E3JA 3A14A 2NTJA 3OMLA 4KUEA 1KEPA 2JKVA 1V0JA 5L7YA 3ZNPA 5C37A 4JQCA 2EEZA 4CM1A 4J0EA 3WGZA 5JO0A 1R4MB 1C1XB 4R16A 3DOJA 1MUUA 3EZYA 1VL8A 3HQ4O 4RZIA 4CV1A 4D7AA 4EJMA 2D2IA 5JXWA 1Q7CA 3KHUA 4RPJA 2YW9A 3L4BC 3D5QA 1YQDA 2B0JA 1H5QA 1B15A 1XQ6A 3SX2A 2RAFA 3DZIA 4OQYA 1KY4A 4NBUA 4GGOA 4LCJA 1T1SA 3TWOA 1FDVA 3EMKA 1EBFA 4CQMD 2VUTA 2V6FA 3KZVA 4CJXA 5LC1A 3QLJA 3RKUA 3SJUA 4E2XA 3ROKA 3VHRA 3E18A 4BMSA 1NHWA 3LDHA 3H65A 4BNHA 4YAKA 4YR9A 1B14A 2H9IA 2UVDA 2JFGA 3ASVA 3GUYA 1LLUA 1BXGB 3KO8A 4O63O 4J49A 5CHEA 3L9WA 5DBFA 4BNKA 4GX2A 3INTA 3I3OA 1P9LA 3PHJA 3AI1A 4PLTA 4MVJG 2A4KA 3PYLA 3FNFA 5JDIA 2QX7A 3G49A 4MVJH 3WSWA 3H7AA 3RROA 3QSGA 1E3WA 4UUOA 4WOKA 4E4YA 5G0WA 1HKUA 1R66A 4DQVA 4B8ZA 3FBGA 2HJSA 4OHUA 1SNYA 4CR8A 1QSGA 1R4NA 5BNTA 3GMDA 3IP1A 3MJSA 4L9RA 3MOGA 1PZHA 3E03A 2UYYA 5JDCC 3ULKA 3MWDB 2GNAA 2E49A 4K9DA 1PGQA 3AFMA 4J7UA 2EJWA 2Q3EA 4J90A 4CV0A 4II2A 4LSWA 4BGEA 4EUHA 3VPFA 1BW9A 1M6HA 4WUVA 1ISFA 3K96A 4D46A 4HFMA 4JIGA 3W8EA 3TFOA 4KUHA 4UVHA 4EW6A 3WGTA 2V6MA 1GTMA 2UDPA 4CMHA 5DULA 5TF4A 3B6ZA 2O3QA 4DUPA 3CINA 3LQFA 1V9LA 5L4NA 1U1IA 4R4JA 4NG5A 3IQDB 3S2FA 5I8ZA 1HZJA 1Q0QA 2BD0A 4BNTA 4NBTA 3MOIA 3L6EA 3HNPA 1YJQA 1Z73A 2Y68A 2W8ZA 3AM3A 3WDSA 1R12A 3KXDA 2B4TO 1AN9A 4CLDA 5ITWA 4P38A 1BGVA 2O50A 3OIGA 4DIFA 3W4KA 3W8DA 3Q1LA 5U4QA 2TMDA 4HFRA 4G65A 2BMAA 1N2SA 4XB1A 2HMUA 3KETA 3ROPA 2NLOA 2Q99A 1LBEA 1BDBA 5TIIA 4KZPA 4NJOA 3H2SA 2W2KA 4AJIA 4CQMA 3V2UA 4Y6SA 1P0FA 2D59A 5CEJA 2CFCA 2YV2A 4ALIA 5ICSA 4XQ9A 4CMCA 2JCXA 1MFZA 3VKVA 1DAPA 1EVYA 4RCVA 3JQ7B 1HTBA 1NFQA 4KDEA 4HX5A 1J4AA 4ZRMA 1ADFA 2HMTA 3D3WA 4QO8A 1UP7A 3O26A 1EVZA 5TSDA 4TKLA 1NM5A 3C1AA 4E12A 4K28A 3I9LA 2JD2A 1QYXA 1UXHA 1DEHA 1VPDA 3JQ8B 5F3RA 3K30A 4LRTB 2FR8A 3I4CA 5K0ZA 2DUWA 4JP2A 3ZWAA 4EEZA 4YT4A 4J6FA 4J2OA 1YO6A 3K92A 1UUFA 2G5CA 4AJHA 2WD7B 1MA0A 5EQFA 4B7UA 3AUAA 2HAEA 4BO4A 2Q4BA 4NFSA 4GLLA 3PWZA 3ZNNA 2CDCA 4D41A 3ROQA 3PVZA 1NFRA 2IZZA 4GH5A 2IXBA 1P45A 4RF2A 4GL4A 2HCTA 2NACA 2VTEA 3C7AA 3AK4A 3CZRA 4AJNA 4BQRA 1GQQA 1MG0A 2OGUA 3TFQA 3C3XA 4ALMA 1PS9A 3ASUA 4PLPA 2IE0A 3M6IA 4QFCA 1E3LA 2X9VA 4LRSB 1IHYA 3DBHA 4RVDA 1XDWA 4UUNA 3GZ4A 4MVJD 3KSUA 3NT2A 1IPFA 1JAXA 1NPDA 3BMNB 4MIEA 4R3NA 5ITVA 1HE5A 2J8ZA 2ZTMA 5GMOA 4TRJA 3ZWWA 1Y7TA 5H81A 3AUUA 1EUCA 1T25A 1P1JA 1Q0HA 3BMCA 3TPCA 3GPDG 1I3LA 4BNJA 3FNEA 3UF0A 3RUIA 3CMCO 1ADBA 4OKNA 5JAZA 5KIAA 3DBRA 4QECA 2AE1A 4UVDA 3F4LA 3G17A 1Q2XA 1DXYA 3V1TC 1EFKA 5EINA 4CLXA 1GEEA 2E82A 4B4WA 4P4GA 4NNJA 1I2ZA 4XGNA 4D3SA 2EW8A 1WWKA 3LC7O 3VH1A 2VQ3A 3JQBC 3H5NA 4DREA 3WMWA 4H7PA 4PLGA 2ZJ1A 3GN2A 1UXGA 2SCUA 2C7GA 1MFPA 1V35A 1NPTO 1E6EA 2EP5A 2YY7A 4RV9A 1HSZA 2NTNA 1I3KA 7MDHA 1SEPA 5IN4A 1AGNA 3RUHA 2YHIA 2OXIA 4A73A 3H6KA 3L77A 3B20A 3C85A 1PJ4A 2EHDA 4BL5A 3P5SA 1I10A 2AEJA 1WMAA 2JCVA 2UAGA 4KWHA 4F46A 1TT5B 1PR9A 4XJTA 4CUZA 2IRWA 2CUKA 4D44A 4ALNA 1PQUA 1QLJA 3HDHA 1GV0A 4J9VA 4DPMA 5JBIA 4B3HA 1KC3A 2AE2A 4B3IA 4W4TA 5IDQA 4BOYA 3WGIA 3H9JA 4Y98A 2B5WA 5ER9A 1RM5A 4E33A 1L1FA 5ICMA 2RCYA 1Z7EA 4U5QA 3ONEA 4ZU3A 3PXXA 2FY8A 4HFJA 3WFJA 4M49A 1Y9AA 3B1FA 2G82A 1KVQA 1U8XX 3FNHA 2ZB8A 4OH1A 3UCFA 3VKUA 2AXQA 4FFNA 1QKIA 4GGPA 4R5MA 3VTZA 3LT1A 3U4HA 4R54A 1ENZA 4IGEA 1ZEMA 4WCDA 4DRYA 5C7OO 3JQAB 4TRMA 3KM0A 5JC8A 5IAAA 4BNNA 1ISMA 2UUOA 2CVZA 2Y1DA 4PRKA 1U28A 1YBAA 5KJEA 4RVHA 1V3TA 2D5AA 3TOZA 1NR7A 3ZW9A 1CF2O 2PH5A 3TDKA 3G79A 4NMHA 1ZNQO 2W98A 4J1QA 4WJZA 1SZJG 3PFWO 2I65A 1JKFA 4MPDA 3KSZO 2O7QA 1N9GA 1KETA 1Y1PA 4FDAA 4CQLA 4MOWA 1NX6A 3CZMA 3DZJA 3E9NA 4DWVA 4M86A 4FCCA 5JCJD 3OJFA 1BTOA 2HO5A 2Q45A 2CD9A 3BHIA 2BLLA 1U9JA 1XG5A 4FW8A 1G0OA 1PJQA 5IZCC 2GERA 1ZBQA 2GDZA 2WE7A 1LRKA 2A92A 1R4MA 1C1XA 3DFZA 3PQEA 3CMMA 4D45A 4DIBA 5DCWA 2LDBA 3KYDA 4AG3A 3B1KA 4NJMB 5L3ZA 4DXHA 3QHAA 1WLYA 5I7SA 2DTXA 4IDDA 2YHUA 4OMUA 3GEMA 4J9UE 4OJNA 1B8PA 3DZGA 4LSMA 2WTBA 5BSGA 1ADGA 5JAQA 2OHXA 3H9QA 1EK6A 3PDJA 2EKLA 1G6KA 2O23A 4BKQA 4J1NA 3GMSA 5G4LA 4BO8A 4FFRA 2PFGA 1U3TA 4KTVE 1QYVA 2X1HA 1J6UA 3ORFA 3OQ6A 4BB6A 2VNAA 4U0JA 4TZKA 3WWYA 3O8QB 4IUYA 2NTVA 4Q3AA 2JAPA 1NNUA 4AJPA 3JD4A 1WDMA 2EGGA 4O5OA 4QO7A 4L74A 3K6JA 3AFNA 3QWAA 3P19A 4FFPA 1BXGA 4JP3A 3A4VA 2X0RA 2BFAA 4N54A 2YFHA 3K5PA 1BVRA 5F1PA 2QG4A 4UUPA 4YACA 1LC0A 2X22A 3D64A 1Q7GA 3T7CA 4OXYA 3TL3A 4J43A 3DL2A 1BXKA 5GY7A 3S2GA 2QRLA 2ET6A 4R3WA 2WWRA 4LISA 2GSDA 1WZEA 3FN4A 1I24A 4XB2A 4BIIA 3IP3A 4KOAA 1F12A 3QQPA 3I9JA 4PLVA 1IUKA 1UXJA 4ALLA 3BTSA 5C3MA 1PEDA 5IG2A 3QVWA 2JD0A 3AOGA 1CYDA 4X54A 1PS8A 3RFXA 1LC3A 5CPBA 1HDZA 4CMGA 4XCVA 1Y8QB 3L07A 5EQDA 2VWQA 2YQ4A 1E7RA 5L45A 3AOEC 4LCEA 4W7IA 3ZWYA 1D1TA 3INGA 9LDTA 1QR6A 1ULSA 1SBYA 1V3VA 1WP4A 1WMBA 3TOXA 4DYDA 3V2GA 3RUCA 5MDHA 4ZRNA 2VOJA 1RM3A 4BUCA 3TRIA 1H9AA 1T24A 2Z1MA 2IEBA 4LMRA 1YQGA 5L51A 3PP8A 3PHIA 3PYMA 5CDSA 1KC1A 3WGYA 3IC5A 4E2ZA 4CV2A 1I30A 4RO0A 4CL3A 3VC7A 1LNQA 4DYVA 2DLDA 3PHGA 4YAJA 3ZWVA 4CM4B 4CR7A 5ILGA 2YV3A 4AJ2A 1OMOA 3KEOA 3EAGA 4PZCA 2FPPA 2HDHA 2QZZA 4NBVA 3E1KA 1AHHA 5C5IA 1LDYA 4RDIA 1YQXA 4ZD6A 3JQFC 1DFGA 1HE3A 3CTMA 1UAGA 2DC1A 1I32A 4L4RA 4E5YA 3VZSA 4CV3A 1AUPA 1H94A 1CQJA 1LDBA 3OETA 4YWJA 1HLDA 4WECA 4IQ8A 4LVUA 1H6BA 1EDOA 1E92A 3GEDA 5F5LA 3RUEA 3RUAA 3DMTA 4HADA 3M2PA 1O94A 5COAA 2OZPA 3R6DA 1YB1A 2W2LD 5A9SB 3UFXA 3V8BA 3FBTA 3JQ9A 4NBRA 1P0CA 2GYYA 2WYVA 1U4SA 5T5QA 4KTTE 4E31A 1E7MA 3JQ7A 1Y6JA 1XLTA 2Y05A 3PLNA 4H3VA 2J5KA 4JK3A 1A7KA 2VHXA 3HDYA 5F1OA 3KYBA 3F5SA 1SC6A 3G3EA 4YYZA 3R3SA 2DKNA 3D0OA 3UOGA 5JAMA 2BGMA 3IJPA 2GGSA 4NI5A 3QWFA 5KVSA 3PFFA 4N7RA 4IZHA 1P1HA 1EBUA 2D8AA 5CDUA 2X4GA 1F8FA 1E7SA 3JQ8A 1UZNA 3L0DA 3VDQA 2QRJA 2X7HA 7ADHA 4Q3EA 2O7SA 3UUWA 1PTJA 4K6FA 3ZU3A 2BI7A 4AL4A 2EERA 1JVSA 2NSDA 1ZXBA 1ISJA 4DMLA 2WD7A 3OEYA 1WDLA 1EE9A 1GYPA 1LU9A 2R00A 4IDBA 1WNTA 4WEQA 5TLSA 1H0KA 3E8XA 2V6GA 4A5OA 2I6TA 3RUFA 3LU1A 5KJCA 4BO7A 2JD1A 3GZNB 3JQAD 5AVOA 2PZKA 1C0LA 3S1LA 3VPSA 3GNSA 1LQUA 4ZN6A 2P5YA 3W4JA 1MGOA 2Q1WA 4DLLA 4Z3KA 3GA0A 3DFUA 2PKRA 1AXEA 3HJAA 4Q3DA 4BO2A 4D3DA 4JJFA 3WOHA 1VRWA 1Y8RB 4AJEA 3VDRA 4ALKA 3I9MA 4J2HA 3BMNA 4DLBA 4FS3A 2I76A 1U8FO 1YB4A 2PA3A 3EW7A 2BKAA 5TRTA 3NYWA 3ZWNA 3U3XA 2X5JO 1X0VA 2H63A 4ILKA 2B37A 2ZKLA 3MTJA 3RC9A 5KKCA 4Q3NA 2C59A 3VVCA 1PGNA 1JKIA 2P5UA 3JYLA 3ZHXA 3RSHA 3E9QA 1NTOA 5CDTA 4ND5A 5A03A 3FTNA 4QQRA 5CDGA 3O03A 4YBZA 3GNTA 1DB3A 5F1KA 5T8KC 1J49A 4R5HA 4XDZA 4JLWA 1DIAA 2WDZA 2YDYA 3F6YA 3PJGA 4N5NA 5JFOA 4CMJA 2FWMX 3EZLA 4PN3A 1PX0A 3E9MA 2YQ5A 4Q3CA 2X0JA 3D5TA 4XYLA 2WYWA 3RUDA 1JAYA 1U7TA 2W2LA 4XWYA 1RWBA 3JD2A 4J4TA 3WMXA 4CLHA 4B4VA 1LDMA 1JWBB 4ROSA 5IF3A 1ZEJA 2VZ8A 4FR5A 4FOOA 1GPDG 3PZRA 1TVEA 1YOVB 2AEFA 1Q7BA 3NEPX 1F8GA 1P1KA 2ZTVA 5JE8A 1GZ3A 1LTHR 5HM8A 5B37A 5JY6A 4CM7A 3HDQA 2WYUA 1P74A 1GEGA 2OP1A 2IZ1A 5GZ3A 3MTGA 1NXQA 1NAIA 4IXTA 5IDYA 1NWCA 4BNYA 5L53A 2I5PO 5L40A 1R0LA 4A26A 1E3EA 3ZNQA 3DZBA 3VPXA 1P33A 5TJHA 5A5FA 3OBBA 5G0TA 5I9MA 4CMAA 5A02A 4XQGA 3DHYA 1J0XO 4BGIA 1H6AA 2FR0A 1LQTA 3HDJA 3F46A 3WTBA 2AEMA 5A3JA 4FJ2A 5ENVA 5CAEA 4YJDA 3JQAA 3RU7A 2VYVA 3U49A 2NUAA 4YJGB 4J0FA 5JMWA 2ZYDA 2HKIA 3PJFA 1DIHA 4W99A 1VSVA 4D3FA 2WM3A 1DC4A 4I08A 4R1UA 2CY0A 1BMDA 3QIVA 2DQ4A 4PLHA 1X13A 2RBEA 4IS2A 3HADA 1OC2A 3ANNA 4M8SA 5IDWA 1MLDA 3MJCA 3TN7A 2IODA 3GFGA 5A06A 3TZKA 4I9HA 3DTTA 4CM9D 1X0XA 4RDHA 3RBVA 3E48A 2ZB7A 1CQIA 4YJHB 3IUPA 4DTIA 1ZK0A 1GCOA 1FDTA 4WCFC 1YB5A 2VZ9A 4WE3A 1RPNA 4BNMA 3IUSA 3V2HA 1HF3A 3PHHA 4EYEA 2AA3A 3ZV5A 1CEQA 1PIWA 3GG2A 2FSVA 4XYMA 2B4RO 1SCUA 1H93A 1FXSA 1D4FA 4XQCA 3ZCXA 4NJMA 2XAAA 2J3JA 1O6ZA 3ZU5A 2GLXA 1GUFA 1RYEA 3EHEA 1KY5A 3UN1A 4MVJP 4PZDA 1B8UA 4OM8A 3IOYA 2ZK7A 4WLUA 2GRAA 3E82A 3K31A 3GGGA 5AOVA 3ZGYA 2BHLA 1JU9A 2VOEA 5T64A 4WGGA 1ULUA 4QT0A 3CSDA 1MX3A 4GSKA 5CDYA 1DLIA 3WX0A 4GPD1 4BNXA 2B5VA 2Y1GA 2X8LA 4UEJA 4E3ZA 4GWGA 3U4IA 5ADHA 5KOIA 1IL0A 3VH4A 3OJOA 2V65A 3PWKA 4OL9A 4G5HA 5TS3A 1RYDA 1JQBA 3LT2A 1KOLA 3UCXA 3LK7A 1LSOA 5JW6A 4GI2A 1E7WA 2PH3A 4WOJA 4I5FA 1C1DB 1EVJA 4B8WA 1V6AA 3F9IA 1U5CA 1CERA 2EGHA 1IYZA 5CEEA 5G0VA 4YB8A 3UGKA 2QYSA 2ZYGA 2Y0EA 1T2DA 1X15A 2Q2QA 3FD8A 3WB9A 8ADHA 5JC1A 4WK6A 4UUMA 3X2FA 1LJ8A 1HT0A 1T26A 5CPFA 4RPHA 4CODB 4IZIA 5L4SA 4YCAA 1ZSNA 5JDCA 2Q4EA 2PWZA 4WLVA 4BO0A 5H82A 1Y8QA 3NTOA 3WGOA 1FDUA 4IDEA 4ND1A 4J16A 2P4QA 1Y5MA 1HWYA 5DP1A 3RBZA 4YVFA 4IIVA 1E77A 1HSOA 3OJ0A 3A06A 3Q3CA 4CM9A 1BDMA 2A94A 4Y6RA 3RC1A 4ZA2A 3GAFA 3SLKA 3I9OA 4UVGA 2PZLA 1PJ2A 3QWIA 5FYDA 3UKOA 4NH4A 5EN4A 3AI2A 2OMEA 3FPCA 4FBGA 1Y81A 4FD3A 4LN1A 4A03A 5L9AA 2ZTLA 2XPCA 2AQIA 3JQDA 3I83A 4DBVO 4HFNA 4F6LA 2GCGA 3W6UA 1UDBA 3PGJA 2FMUA 3WNVA 3X2EA 3O4RA 1CDOA 1I8TA 2FPGA 4Q9NA 3FF4A 4Y9DA 1XA0A 5HWSA 1ZMTA 4J7XA 3WYBA 4FIZA 2IXAA 3PEFA 2VUUA 3RC7A 1XU7A 4RPGA 3GVXA 3JD1A 5T6BA 2HUNA 1CJCA 1Z75A 2CVQA 3OFSA 5IFLA 2P9CA 3EK2A 4GX1A 1LUAA 1YE3A 3WSVA 4E2WA 1SO8A 2RIRA 5ILOA 4PCVA 4PLFA 1PJ3A 5FFFA 2NVUA 1PWZA 4B4OA 1T2EA 5JMPA 4H15A 4BGUA 1RM4A 1LSJA 2PR2A 2ZCVA 2FR1A 3UVEA 3KYCA 4BNZA 1JWAB 5DDIP 4CPDA 1IOLA 1GYRA 4QTZA 2PKQO 4TVBA 3HB5X 1A4IA 3WIDA 1XCBA 2ZIZA 4HNHA 2PD6A 2PY6A 4D0RA 4TWRA 4U6QA 3AM4A 4OKIA 2X9NA 4IDAA 4A10A 3FRJA 1SB8A 5DCYA 5FWNA 5KTKA 1GD1O 4I1IA 4BB5A 5L7WA 3SC4A 1LRJA 1N7GA 2B83A 5EL0A 4YQYA 4NK4A 2AQ8A 3QVSA 4PG5A 3V5NA 1LXCA 5IJZA 4HXYA 4IINA 5BR7A 3AUTA 5EMHA 1W0CA 2I9PA 1B2LA 4GAEA 8LDHA 3PJEA 4EEXA 3H3JA 2VWPA 3UAGA 2G76A 4BQPA 2HRBA 3DWFA 3GH3A 1DRVA 1SMKA 2C54A 4OXKA 1PU2A 4YJFB 3TJRA 2BGKA 1L7EA 1BRMA 1KVRA 4IS3A
chains in the Genus database with same CATH superfamily
4DIDA 2J6IA 3KEQA 2BYTA 5GZ6A 2XQIA 4ZIRA 1ECBA 1LNSA 1L4GA 2WT4A 1YTUA 1R5NA 4OI0A 4LYHA 1X19A 3H84A 3T3NA 5DU2A 4MP6A 2CHVA 5CG1A 1SBHA 3R1IA 1WDWB 3G2IA 1KL7A 4URWR 3TQOA 4K8OA 3AERA 2QRKA 3M3HA 1KEEB 3BXXA 1DC5A 3KOYA 4H17A 4ND2A 3E5NA 4WOCA 4BMYA 1W30A 3KT8A 2QY6A 4HNGA 2AJDA 2H7XA 4Y1GA 1GNVA 1YNSA 3KCQA 2D2VA 3BHJA 3R23A 2GNOA 1DJQA 2EKPA 3P0FA 2IEDA 3KLBA 1YD7A 2QRZA 4PYLA 4KXFB 4E2FA 3D8RA 1NW4A 2I78A 4OXNA 3L7OA 1Y3BE 3L8GA 4MJLA 4BO5A 5F9MA 1M10A 1M74A 1QGUB 4U7WA 4DR2B 4XEHA 2Q2WA 1JLLA 4EVQA 2V3WA 3R8CA 2ASVA 4JBXA 1XCMA 3V8PA 3AVVA 4PZZA 5K1ZA 3L41A 5CDFE 4C2AA 4RJ2A 2PVPA 5DF1A 5CX1B 2QZJA 1JU3A 5K9ZA 2I2CA 2B69A 1G7TA 3H75A 4HP8A 2NQTA 3ETLA 4OL0A 1ULBA 3DZFA 4Q3KA 1VJ0A 1IZ0A 2R25B 1CRPA 1EIZA 5JSKA 1E3IA 1UZUA 3T4PA 1TUEA 1S2IA 4NNOA 4B7XA 4GQIA 3GLUA 4CM8A 3ES9A 1M34B 2ZS8A 5KUTA 3GRYA 4WPGA 3RCBA 3WQQA 1XZLA 3TX2A 3WYEA 1N2ZA 5AYVA 3GWZA 2G7MC 3O4FA 4FEAA 3EC7A 4OPMA 3TSAA 1W6UA 1KMIY 4MUYA 2B2CA 3UTDA 2FZLA 2WHPB 1DHRA 3TTXA 2PSDA 2NQ2C 4RKFA 3O2NA 2AC4A 4DCVA 3BK2A 3DPIA 1DCTA 4ECEA 1JG7A 1T9DA 2D8MA 4NK5A 2YN2A 3I5AA 2P8SA 4JJAA 1I1NA 5NLLA 5C9ZA 1RM0A 4HQOA 4IW3B 2OSVA 4IXWA 5EIHA 3GP5A 1L5QA 5HEKA 2WV7A 3R7NA 3AINA 4FMDB 4IDPA 4MP3A 3OCXA 1SFRA 2J0UB 4C7KA 2A33A 3QVJA 3QI2A 4HLUA 3EG5A 5EE1A 2FPMA 1QXSA 3WIEA 4B83A 1QIKA 4NBWA 1MT0A 2RGWA 3E7PA 1L8XA 4BZXA 3GXBA 3R3HA 1WG8A 4IOKA 5B6PA 4ACBA 5DYTA 3QTLA 2HIGA 4I99A 2XKBA 2EFGA 3TSCA 2B30A 1L0BA 2FG5A 1K6IA 2O4UX 1XX6A 1G5TA 2F55A 2PX6A 2A35A 2CF6A 2VNJA 1PLLA 2VXCA 3B2EA 1BDJA 1MAHA 3UB2A 2Z6VA 3WA6A 1PUJA 2XA9A 3NJ8A 3L4EA 1RMYA 3PA8A 3QKIA 3G5AA 3PRJA 2JVIA 5E7JA 3MTQA 1WZUA 1E6UA 1GVHA 3PE4A 1V1RB 5D3ZA 3DDCA 1M7HA 4IQFA 2AFHE 3AHHA 1E94E 1RAIA 1XKTA 4AY6A 1XWIA 3IP6A 2X6QA 4TKUB 3ZXSA 4HMOA 2FFRA 3AFOA 3HBJA 3NQ41 3OPYI 4F3KA 5H4GA 3FRIA 4GUDA 4L0CA 5BQFA 4TV9A 4YRLA 3QI7A 4LVCA 1TU4A 1WIWA 5HJ7A 1KO1A 3HA2A 4DBLE 3IELA 1HRDA 4FFDA 4QTUB 3HYRA 3IJ5A 1RRPA 2P3SA 4JFRA 5AW9A 2QTZA 3GOQA 4JP1A 3GD5A 5LZ5A 4RHCA 1IHUA 1PJZA 3C6KA 4ZKEA 1WZ2A 1JNYA 2YV4A 3NPAA 4U1RA 4EGFA 3PCRB 1K3TA 2QI9C 2XNHA 4B09A 3U09A 3H1GA 1RVV1 4G0WA 3PLRA 4HR7A 5EIOA 5DSZA 4U7TB 3EIXA 3QFSA 1N3LA 2ZXEA 3F1KA 3OCCA 3RAGA 4QBFA 1NYQA 5I9NA 5LWQA 5CITA 3GHHA 1SC9A 1B0UA 3LC2O 4KV9A 3ETGA 2C42A 3PF9A 5ELMA 3TLGB 2CUNA 4WBNA 3D6AA 4E07A 4QREA 4Z5XA 5HKKD 1DI0A 2ZDHA 1LEHA 3N0RA 1KKLA 1TF7A 3H8JA 4D4GA 5I4IA 1XDSA 2P9GA 2ZJ2A 2QX9A 3LRXA 4DLZA 4EA8A 4AKSA 5BYJA 4BNVA 1MEEA 5KU7A 4KXNA 2XNCA 3B1JA 4J3FA 2PTHA 3MAGA 1ZM3A 2XZLA 3FCCA 2HMWA 3LPNA 1UPBA 2ODWA 4MV0A 4H4EA 4WA7A 5GM1A 4BNGA 3GEBA 3UT6A 4IV0A 1WUYA 3A2LA 3C39A 3KQSA 3ETHA 4GZ5A 4MUJA 1DT3A 4BWVA 3NBZC 3AH8A 2IUEA 4PGMA 5KBYA 1TK2A 2F43A 1YL5A 5CA1F 2HHAA 2Q6OA 3Q41A 121PA 1JPVA 4LWOA 1C7QA 2F1KA 4RGQA 1GT91 1CRWG 1U2EA 1KMQA 2N42A 3GVCA 2PFKA 4HAZA 3SDBA 3R3XA 4Y2XA 1Z6TA 4J3NA 1M2KA 4QGGA 2PS0A 2VTKA 5CXQA 1U4NA 3BJIC 5KYUA 1LX6A 2IHJA 3GUUA 4HSEA 4PO3X 5K09A 5J5VA 3BWBA 1NWHA 4AFNA 3ZLBA 2UUPA 4YMWA 1RJ9A 1QGAA 3CO5A 1LVUA 3GNLA 1IAQA 3LDFA 2F8MA 2O2YA 3QBTA 3JYPA 2ZPAA 2PMWB 1OFUX 1KNQA 2AW3A 2ZYVX 5CHYA 1ZK4A 1DAKA 3PD0A 2HM7A 4M38A 1L7VC 1H23A 1Z37A 2XUPA 2E2WA 5ALHA 2WJYA 4AO6A 3D7NA 4ME6A 4X84A 4N5HX 3I5MA 4F11A 3M1AA 4ZO8A 3T35A 4KPUB 1GO2A 5EKSA 4Q93A 3WYCA 3L9XA 5JECA 5LQNA 3RKRA 5JEEA 1HDCA 1RU3A 5E6SA 1K7YA 3T5PA 5MN5A 1XP8A 3KLOA 3EDOA 2ECPA 1NY5A 3CF6R 4HH0A 3TYXA 5CP8A 4YRGA 4NECA 4DR5B 4J0IA 1ZMOA 3IVMA 3QOWA 4Q34A 3T7RA 4HVAA 4JLUA 3VBEA 1CUIA 1LPAB 2WI8A 1N6NA 2V7BA 4RF4A 1U94A 1E9VA 4GR9A 5HIMA 3GFTA 4Q15A 3K5HA 3UPDA 2PT9A 5CG2A 3MIZA 3OA2A 2QD2A 2P4SA 2RGEA 2WF9A 5HDBB 2IYPA 5EKDA 2KLHA 1F17A 1V7PC 1CNFA 1YACA 1WAMA 4LZLA 1O9BA 2HLDA 4IHQA 1NUTA 5KSWB 1Y48E 3WIUA 2QL5A 4J7AA 3K4QA 1VSUA 3OFNA 4I4TB 3E9DA 1IXZA 4QC2A 1SOUA 3KWLA 1G4UR 4RPLA 4U2DA 1QR2A 4DCMA 3GJZA 3ZKAA 1RRVA 4I1YA 4OA8A 5C4MA 4TYQA 1A1SA 2ZJ4A 4DC1A 1ZQ1A 2C92A 2J4FA 2XQJA 5CEFA 1ITZA 5CT4A 1GL9B 5HGJA 2LGJA 2OLEA 2W48A 3RW9A 1XU4A 3BN3A 2ZQZA 1RFLA 5K6AA 3F4KA 4BKOA 2EDCA 3K0AA 4IIUA 3IIEA 4YECA 4Z0PA 4CV0A 3GAZA 5DXAA 4LRQA 4E5VA 3ETEA 1NI4A 3NTQA 4Y2PA 3RLIA 3TL2A 4NE7A 3LGXA 4CKWB 3NVDA 2JGDB 4EQZA 5BN5A 3MGGA 4A8HA 5IT4A 4UM8B 1O03A 3G02A 4R1NA 2I55A 5LOVA 2R7MA 2OHJA 1BCRB 4O4JB 1Q1NA 2AR0A 2CT8A 1WBBA 4GECA 3GLRA 1M8PA 1U3GA 4GR5A 4Y2UA 2A4MA 2ZBUA 2NU8A 4EHKA 2P6RA 4WK2B 4NZZA 3K6SB 1UDAA 3EGCA 2OCKA 3O94A 3N5KA 3SU8A 4BQNA 2FRDA 1LLFA 2WNSA 2OGTA 2QM3A 1AB6A 1EUCB 3PC8A 3GYGA 3ANYB 4RV4A 1CC1S 4YTEA 4YUVA 3KBBA 3D59A 3ZGLA 2WSYB 4ERNA 2VKQA 1UAYA 2ABWA 2ZXUA 1OYWA 3H19A 3BX1A 3E3LA 4J4HA 4AX8A 4EG1A 4S12A 2P90A 1U7HA 3TIVA 4EEKA 1BOFA 1UBNA 2XUOA 2QE7D 1IONA 1W4ZA 3VH2A 3NFYA 5C5EA 2HSGA 1DAMA 3AF3A 4LQCA 3WE7A 3ZCTA 4RHUA 4LF9B 3ICQB 3G1TA 4MUXA 2FG6C 4OYRA 2WJPA 3DAYA 3R6GA 3ZBPA 1LPPA 2H1SA 1FYFA 1YJCA 2YIVX 2CZGA 2NWQA 4JBWA 4XX0A 3VHLB 1B74A 1DEOA 1EGQA 1DLJA 3C6ZA 2O48X 2WWXA 5EPOA 3PGA1 4YPVA 4YJ3B 4MO9A 4PPQA 1JDTA 3T9DA 5KTYA 1GQ2A 1JXMA 1KBQA 1ABFA 2DWUA 3O84A 3MJDA 4OOEA 2X9GA 2W6JA 4CMBA 4US1R 2DHRA 1IRIA 3FJ1A 4P58A 3NTRA 3WZLA 2VUHB 3X0DA 3W5CA 1FVOA 3FJOA 1QIMA 4WEOA 4WXRA 4YEDA 2AR7A 2H3HA 2YHIB 1A9SA 3OIWA 1YZ3A 3K70C 4AXBA 4F9TA 4UCXA 1K89A 1F14A 2IT1A 3QELB 4Q01A 3DNPA 3B89A 4PLYA 4RZHA 3ZHSA 1QS0B 2XW6A 1DC3A 3WBBA 1ATIA 3CPHA 2QT1A 4POOA 2V7PA 4QASA 2IF0A 4GLFA 3BPSA 3NAMA 1EQ2A 1GG5A 1GG8A 1WNFA 2ZT6A 2A9OA 1F4PA 2C5EA 1Z38A 4J91A 4MDYA 4YRKA 4ZDKA 2IOFA 2POQX 2OP0A 1XNJA 4N7JA 2NUPA 5GZ1A 1FTNA 1LI5A 1I7PA 1IHXA 2ZBPA 4XUCA 1PZXA 2MSEB 3HVIA 2R6DA 3PC4A 5B2EA 5AVRA 1EINA 1VBNA 1YASA 3DYBA 4JJ4A 4Y0VA 2KBFA 4XTRA 1GPJA 2YFQA 3BCHA 3JATA 3LG2A 3ORQA 1Z17A 1L5OA 2PBZA 2GD1O 1E7YA 1ZK1A 1SC3A 1ZW1A 2SICE 3DBOB 4MVJI 5AVTA 1K9VF 2WRZA 1W93A 3LNTA 4MP8A 1SG9A 2DR3A 3Q8MA 1QRUA 3MJVA 2D1TA 3NVAA 1AQIA 2R6CA 4R8MA 1M2EA 2PCJA 4MKZA 2O14A 2UUAB 3UWPA 5ITZB 4M22A 4C7VA 3FJYA 1OA0A 2ZIGA 3T95A 3F8SA 2JBAB 2X2EA 2Q0XA 5IVIA 4HO1X 4FGSA 3W3AD 3F90A 2BEKA 3H86A 2FFAA 4XYBA 5BT9A 5LJLA 4IHAA 3MWYW 4Z8XA 4BMNA 1G5PA 1L7OA 2HLNA 2WJ4A 4DPKA 1VL2A 5T8KA 2Z8YA 4LDNA 5BMVB 2A9QA 1XZ8A 1ZI9A 5FHRA 2OCGA 2C9YA 4M9SA 4KQXA 3K9HA 3GT0A 2NVWA 2YDXA 3DE0X 3H9CA 2CFTA 2FPOA 1NVDA 4MX8A 3E0XA 4R1SA 1CYEA 1F20A 4PC7A 1U1CA 1P77A 3AJEA 4LJ6A 4D6XA 3TE7A 2RHDA 3QG5A 1H4SA 1L8LA 2DTDA 3FVWA 5I47A 1CF4A 2AD1A 3TR6A 2W83A 1D6JA 3EVTA 3EZ9A 1DE0A 4X20A 1ARZA 2HBYA 4M8NE 2MYNA 3FOWA 4PFQA 1NJ6A 5I3CA 1NYTA 5I45A 1J99A 2LTAA 4TV9F 4OBBA 5T4HA 1TYEB 2CUZA 1DKQA 1Y4ZA 4BASA 3HO6A 4CL8A 2WWYA 2F00A 4IDQA 4FMCF 5JDIC 1BEEA 2PWPA 4L8GA 2Z5GA 2IV3A 1QVRA 3BZUA 4QBHA 4C05A 1OLXA 4H4DA 5GADl 2ZDQA 1QHSA 3IAUA 4HD8A 1IB6A 3CNLA 1RQGA 3PNQA 1SOVA 4TMFA 4YAGA 4EJSA 1YR3A 4MUHA 4V3CA 1L3IA 1AMUA 4D56A 4DSAA 1C3JA 1CZOA 3K0KA 2AX3A 4IWNA 3UWDA 4UJ5A 5JSFA 2WV9A 1UBTS 2ENUA 5G2OA 3N8KA 3GVHA 5GONA 1EWTA 3A4MA 4YRAA 4PG6A 1AB5A 3GIWA 3X1JA 2V03A 1HFEL 2OFOA 3RFVA 3Q6IA 2VT3A 3BUSA 4LDAA 4Q7MB 3TSZA 3WICA 1Y7IA 1N2CA 3QGMA 1T8PA 1E2HA 1U8YA 3OQJA 4RELA 1YDEA 5K4GA 1T8TA 4M87A 2W0SA 4JYZA 1QP0A 2WEKA 1M9NA 3QEKA 4HQLA 3X43A 1RQNA 3D2BA 4FYVA 2OZLA 3KPVA 3OUUA 2RGAA 2YVQA 4FWIB 4V1CI 4IJ5A 2OUIA 4K3VA 4UDXX 1UT8A 1HV8A 1TYBE 2DPMA 3I23A 2UZ1A 4IDHA 2A0YA 5AT1A 3DONA 5EJ5A 4TTIA 5EZ5A 2XD4A 2GI4A 5EMLA 3EGEA 3LAWA 2K2QB 4IH9A 3UFBA 4E5MA 2VJLA 1MAAA 2CNWD 5EJIA 5K45A 1OX6A 3K9NA 2H4FA 4RQTA 1KQGA 1ZU4A 2XDQB 4IR7A 4M7PA 1P29A 3TZ6A 2DH6A 4BAUA 3O8QA 1U9IA 2PRZA 4OSOA 1IG0A 1WXDA 2PYIA 4D98A 2OECA 2BGJA 2A67A 3A1DA 3PD7A 3GDGA 4DARA 1XD2B 5ALSA 3HJUA 5ALZA 1I3OA 5MGBA 1Z22A 3OZGA 4OGFA 5C8DA 2PBLA 3T7IA 3KL2A 3I52A 1SEVA 1WA5A 2RHGB 4QYIA 5F98A 2FN8A 1M67A 1N6LA 1XDZA 1FFXB 1NMXA 2YZNA 3BK7A 3WK7A 1ZXXA 4L0MA 4XCQA 3IA7A 3OPYA 1CF9A 2XYQA 5GGXA 4KE8A 2VCHA 3TIIA 3I6YA 4IQ0A 4J03A 4V0SA 3GELA 4J16C 3H2IA 3EEYA 5C2JB 3PUVA 2IPAB 1MGPA 5ALQA 2FTKE 4DJFC 2IDJA 4HGRA 1QMGA 5C46F 4JXXA 1KE1A 3K1TA 1J9ZA 4KQIA 2PD3A 4I4LA 3STWA 1BD3A 4EHIA 1XC7A 1U4OA 4LXIA 2LBPA 2RKBA 3M3DA 2FQYA 2GARA 2JZNA 5TEVA 4CCWA 4UUQA 4BLQA 4FLFA 1NM5C 1FTWA 4GEKA 2WSIA 4IEIA 1MRSA 3KIPA 3U5TA 2XIQA 2Q3CA 3IPAA 4ABYA 5KDLA 3P4XA 1T4CA 2AV6A 3G13A 1PGPA 3CLRC 4R2JA 1LPOA 1NQVA 5T3UA 4D9IA 1GP2A 3RJMA 3MBOA 1K6XA 4QDUA 2MMCA 2Z1DA 4KXVA 3T3PB 4JI6B 1W7AA 4L4SA 3C7DB 3VO9A 5KVAA 5LXTF 4TQAA 1CQJB 2I7CA 2DBZA 4F8JA 3S8YA 1XTIA 4KMSA 4S0ZA 1E8MA 4RKRA 5M5BA 1JKJB 4OGGA 1R3DA 4TT3D 4ENPA 3WGUA 1UEXC 3L1JA 4RF5A 5DHQA 2IUUA 5LOVF 4CM4A 4GSYA 2JLWA 1NBIA 3E7FA 5D1HA 2HHCA 5JSQA 1MVOA 1O4VA 1BCSB 2ZRPA 3DE3X 3FDJA 3GT7A 4G4JA 4KXMA 4UZEA 1WETA 2XRYA 3IO3A 3JZFA 7MHTA 2VSNA 1J0BA 2AC2A 3BA6A 4MULA 3IAAA 4Z99A 1ZXLA 1U04A 5EPEA 1F4LA 2C0PA 2Y92A 1DJNA 3HL0A 5CYGA 1V48A 3D2LA 3HFGA 3GVPA 4IDGA 3ZHUA 2J3HA 4EUNA 1WCWA 2VS1A 4PLCA 3F6SA 4DBZA 3IALA 2HEGA 4IOLA 5G3ZA 2ZUTA 5BN4A 3ICVA 1ISRA 5C4IA 4PSAA 4DE5A 4BDTA 1OUMA 2TMKA 3B3JA 1W5FA 1FFGA 3DBLB 1T9GS 5J1TB 4S2EA 5A9SA 5JOQA 1DFIA 1KEVA 4IM7A 5A9TA 1IPEA 3MJRA 3NT5A 5LQAA 2QL7A 2X4IA 2ZIUB 1QYRA 2O3SA 3GA5A 2CJPA 4U2GA 1WQ3A 2Q3DA 3E5RA 2GBPA 3KR9A 1ODSA 4M9ZA 4XUGB 4O2AA 1T8RA 1LGYA 3A36A 1ZGZA 1QB7A 2VXYA 1RR6A 2NM0A 3QVGB 2F1HA 3HZZA 4O6VA 4YQZA 1XWFA 1X80A 1ND6A 4IQ4A 1LSSA 3AILA 4MNTA 1IN4A 5HUJA 2PS9A 3FX2A 3N6VA 4B8YA 3JRWA 1ECPA 3HV2A 4JV5B 1CQWA 2H1CA 3PG5A 1TLLA 4RVUA 1QIDA 5T7BA 2JA1A 2JAXA 3LWDA 3HKCA 4P3NA 4NV3A 2ZRHA 5JQWA 1VHJA 1UBRS 4KLAA 1E9AA 4WMLA 4EUEA 1JFRA 1K86A 1PL0A 1D5WA 4CEIB 1GL6A 4FP9A 1GN9A 5I7VA 1EVIA 1MNAA 3E27A 5GV8A 1DAFA 4M7OA 4WKOA 3HNRA 3K8OE 2PMKA 3PNBA 2QT0A 2FP4A 2INGX 2O1EA 3VTFA 3QENA 5FWYB 1K63A 3ON5A 3K09A 3SEFA 1FS6A 1JT9A 3N59A 2G9UA 1KZYC 1B16A 1NVMB 1PZFA 2QN7A 1V4VA 5CT6A 4WNIA 2NUTB 5AHKA 1FP6A 5A4DA 2WJ6A 1Z2CA 4CLOB 2OUKA 4MDEA 1MU0A 1BA2A 3D1VA 4PYOA 3SM3A 1A2BA 4CM3A 3W6ZA 3U13A 2QZPA 1H5NA 3K1YA 2W2XA 2YWXA 3R4VA 4LXHA 5A7HA 3TTTA 3U1BA 1EFHA 1UT5A 5KNBA 4URFA 3NHBA 1P17A 1L4FA 2OQVA 3R5HA 2G4CA 1Z8DA 2P27A 4H1TA 1TVKB 5D87A 5D00A 2Q2NA 3GL9A 4Q3BA 5C52B 3QVUA 1JIUA 4QPCA 4TUYB 1GTRA 3Q7EA 1DMSA 3W5UA 4AROA 1N7IA 3P4UA 1HK7A 1Y34E 3CU5A 3CZ5A 3V7WA 3EIEA 1CZKA 5DTMA 2ZWOA 2WNHA 1HDEA 4TWBA 4MXDA 3R75A 1VPVA 4WY8A 2MJLA 4YA6A 4ISBA 4IBOA 4DV4B 5ISMA 4FFLA 2GFIA 2V9ZA 1KYIA 3WMFA 4DSOA 2WHRA 3ZLUA 3DOIA 4G63A 5GVRA 3SE0A 4UFOA 4MKXA 1WB4A 4YT2A 2NU7A 1Y0BA 2FEWB 4MYSA 2W4QA 2PGJA 5L7TA 1EKXA 1O89A 3H16A 3AI3A 3P9RA 1FC0A 4CCYA 1SK9A 3GCDA 4DILA 4CMIB 1LJLA 4BKMA 1IDOA 4FPXA 5DTJA 5A4KA 4G89A 2G5GX 4GBJA 4GPBA 4WZBE 4GYYA 3GUVA 5ALWA 5AVQA 1GDHA 2EG9A 1W29A 3W6NA 4QSHA 1OA1A 2ACKA 2XQKA 3R44A 4EECA 5HUHA 2UXBB 4JXZA 2B5OA 2PZJA 3DTYA 1LPSA 3HJRA 1JHRA 1QF9A 2F1JA 3PDWA 4H1HA 1S6YA 2VWHA 3BTVA 1E5LA 1GY8A 2Y93A 3BXFA 3DFMA 1Z4MA 3GJ5A 4LSGA 2HSDA 2X7JA 2ZRJA 3BDVA 1EI9A 3PIDA 4N3NA 2OCIA 2SKDA 4DLKA 4RJLA 4ZAXA 1NMQA 1HEUA 4FX2A 1DELA 4HWSA 5D84A 5PNTA 3VZCA 3I0NA 4AJOA 1OY1A 2J3KA 4LYEA 4LK3A 3DE6X 1NXSA 2ZROA 4ZV4A 3E7WA 4HBGA 5AK6A 1XVAA 1GKUB 2AN3A 5GONF 3DHNA 3TW8B 5EJ9A 3SSOA 1ULHA 1YZHA 2ZKIA 2G3YA 4K9RA 4LJSA 4NE9A 1X3SA 2FUNB 3G8BA 3UATA 4D0LB 5A5DA 1DWOA 5HCUA 3PEWA 3PR3A 4PAQA 4R84A 4GYKA 3JU3A 4LXUA 3GU3A 4R51A 1TL7C 4RSHA 2YN4A 5EP4A 2O2SA 3I53A 3VVLA 4C2BA 4BWGA 1YFKA 1M1UA 2QENA 1DKOA 2RJNA 5E6UA 3HPQA 1GL3A 1WXWA 1M1YB 2DBVO 1YE8A 2REXB 3LVFO 3UMBA 4MVJA 1ZIOA 3SF0A 1W48A 5DE3A 1R2QA 1Q3KA 3E2IA 3FWHA 1I5RA 3RAEC 3WKCA 4TKZA 3PCXA 2D54A 2O8FA 2H17A 4A8PA 1W8DA 2GT1A 1Y3HA 1P4HA 4NENA 4OI1A 2RHRA 3I4LA 1O0CA 4G5FA 3KPUA 2GWRA 4HB4A 4IIJA 4PLZA 5H68A 1PQPA 4UEWA 1RHJA 2D0IA 2P0AA 2R97A 2R8PA 1WD7A 4PZYA 5EGNA 5EPUA 4B84A 1QHHA 3OIFA 3GPIA 2O3TA 3MQFA 4KUGA 1V3UA 4TN5A 3WSTA 4J3JA 2R5NA 4HNVA 1K6JA 2QN9A 4NFYA 2VSYA 3DZDA 3C3BA 3DNFA 1JDBB 1VJDA 1O58A 5K3AA 3GEGA 1DXOA 1DRJA 2BFBA 1BROA 2XCLA 1T1EA 3AG5A 3ZDCA 4MLDA 4LMAA 3AP3A 2QIOA 4HLDA 1L7DA 2O6LA 4ZYTA 4I2VA 3IP5A 4QXPA 5JVDB 1KAHA 5EWMB 1E3WB 4WXEA 5TMBA 3FR8A 3P94A 2MWMA 4LNUB 1U3VA 3R9KA 2C4VA 1AE1A 2CHUA 4IIYA 4HXGA 4O8ZA 1CUAA 4Z1OA 4XWKA 2DOKA 3CHYA 3VOBA 5HDQA 4DMFA 5I6DA 4DV5B 1O08A 5M34A 2DR2A 5KMGB 1AKEA 2CLFB 2ETVA 3R4CA 1IJFA 1U11A 1R4NB 2PVCA 1FNCA 5IZCA 4KAXA 4JJ6A 2IBSA 3AUXA 4YHBA 3BSYA 3FMGA 3WGMA 2QD5A 3G8YA 3IAM6 2GYWA 3DSRA 2XUZA 3EIWA 4L5YA 5FT9A 4YRRA 3HXPA 1ZSYA 4XJSA 5I8WA 2ZJ0A 4O8CA 8AT1A 1UMBB 2X9LA 3R7WA 1C0PA 1TQHA 1XEXA 3DXYA 5IN5A 2G9RA 2QPLA 3TX6A 2IPXA 3KYJB 2VHVA 1ZKDA 1DCFA 4P3OA 2IEZA 5AHRA 1NXXA 5EMKA 2VDWB 4EMSA 3H5WA 3JXEA 1I0ZA 1YFZA 1V3QE 2FSHA 5F52A 1NBOA 2C77A 3T38A 1DG1G 3K9BA 1UANA 4ZICA 2JIZD 2H7YA 1COWA 4DNQA 2CFOA 2WICA 4X8LA 3RFCA 2O54A 4LY6A 1E6WA 5LDGA 1Q0ZA 3QP9A 4K1XA 4YROA 1MXHA 5IZ4A 1LPNA 1G5HA 4IQGA 1JFLA 1VYHA 3FZEA 1TEHA 2KMLA 4Z1MA 2J87A 1VFPA 1AY0A 4O1MA 3WB2A 3OC0A 3KYIB 1RI3A 1ADCA 3CXUA 2OAQ1 3NGXA 2YFKA 3E7DA 2BBWA 2EIHA 2FPIA 2GEDA 2ZSHA 2CNLA 3EG9B 3KKQA 4MWBA 5LUBA 4MWZA 5ER6A 3AU8A 4FYWA 5AICA 2ZI6A 5AFSA 3BCSA 4MYRA 4I81A 5KQRA 1OFVA 5EMMA 1NFFA 2ZJZA 4MWEA 3UICA 4B4DA 5A6SA 4GVLA 3GARA 4UHBA 3AVOA 3H6HA 3LQRA 2OXRA 1N7HA 1JZSA 1R88A 2I0FA 3EF1A 1MKYA 3OZSA 3T54A 2F6RA 2HMVA 2Y1OA 3X1XA 4FD2A 2AOUA 1RHRA 3GGOA 4ZCIA 2PUWA 1KZ7B 2H5EA 2YWBA 3EC2A 4U8GA 5DHUA 4F3TA 1JEQB 2ON6A 4FHZA 4JJ8A 2NV6A 2OAGA 4U7PB 3GRCA 2OFXA 1G7RA 2GCNA 3H9UA 2H00A 2J08A 1Z3IX 2FQXA 3DXFA 3K2IA 2H29A 5BPFA 2VPIA 3JQ9C 5JCJA 3L0YA 1PYGA 2FW6A 1SKUA 5F9FA 1JXOA 3GFBA 4ITVA 4EBFA 4ARIA 5DHRA 2GUGA 2Y1FA 3JR3A 5J1SB 1XLTC 3OSUA 2XT0A 4FHFA 4H7DA 2VAWA 2CHFA 2J30A 2HK8A 2WVGA 4DOMA 1GXSB 1F2UB 3GJ7A 4XPIB 3U16A 3TLAA 1W73A 4F0JA 1M8JA 4CEJB 3HY4A 1ORRA 3RWBA 4BVBA 4J0DA 4CF4A 2EP7A 3GT4A 2GPJA 4O2AF 2X0KA 3EVNA 4IJWA 2X58A 2HRCA 2LV8A 4CLEA 5C1OA 5KTRA 2BFOA 2VATA 3IQXA 5L8VA 2ZATA 1KZ4A 1J33A 2PWAA 4FGKA 1TCVA 2J85A 4OFXA 1I4LD 4L07A 3DKIA 3RVSA 1B1CA 4A0SA 1TEVA 3OTOB 2OLJA 4H16A 2C1EA 1Y6GA 3BSSA 3P0EA 2WSMA 4NL4H 1KFCB 2E9SA 2WOOA 2ZUDA 4O4IF 4P22A 4RW0A 4ZVMA 1A71A 2GAAA 3KTAB 4CGZA 2R00C 3MMXA 1JLSA 2I2BA 4HWKA 2LWIA 3AEUB 3FGOA 3I34X 4RKQA 4M55A 2NPFA 2XZTA 3A4YA 4HLCA 2QXUA 4RAQA 5FI5A 3CC8A 4D46A 4DPLA 1JSRA 4LSZA 1A4XA 1L7XA 1R6UA 1KI7A 4MYTA 2B0CA 1KAQA 4PC2A 2CL0X 3CF2A 1OYOA 1TYDE 1V9SA 3CF4G 5I5GA 1DTWB 2VAMA 2CLCX 3VZRA 5HIKA 3JYOA 3ICCA 5BN1A 1N0UA 1U0EA 2EEPA 1I7QB 2HBQA 4MQLA 3H2KA 1RAGA 4DDWA 1PLKA 2JAUA 3EPLA 4ZT5A 2BFCB 1Z4QA 4EI8A 1O95D 4RGBA 3OM9A 3ACBA 5JRDS 1JW9B 4AF6A 3A7DA 2VYND 1Z7BA 2Q0SA 3DVAB 2OBMA 1IZ8A 4L8VA 4TZ0A 3S2SA 5JRZA 1NN1A 4DM7A 3WYGA 1J70A 3BMCB 4G1MB 5FAXA 4NCXA 4QU0A 2XMZA 3NOQA 4Z0TA 5IDXA 1I80A 3QWBA 5HXAA 3PWTA 5EP3A 4I46A 2QUZA 3PCTA 4MVWA 3SXJA 3CCBA 2WG2A 5LQUA 2PHZA 4HDRA 2J9FB 1CJTC 5CJ2A 1JAIA 2WFAA 3R40A 2X19A 3CUYA 3QHQA 4MKHA 1UKBA 1Z5GA 2OVBA 4JJZA 4LMPA 2VHTA 3WP1B 1ODKA 4BLRA 2Q3FA 3I4FA 3QMMA 4L6IA 3A25A 3SG0A 5LQCA 1XSEA 3C74A 3VZPA 1PSDA 4TM7A 4DDUA 3W0LB 2O2IA 3HCRA 1LW7A 3N5CA 4JVSB 4DLPA 1PFKA 2A59A 1JN0A 2G9QA 4CLRB 4L02A 1C14A 2O52A 1VTKA 1CUFA 3KOMA 4BRUA 2XB6A 3JV7A 3CNBA 3O8LA 4D43A 1TM5E 4KN5A 2CXQA 4QEDA 5DSXA 1Q19A 2JJ2D 4AU1A 4Z51A 5BNIA 3V7FA 1NF8A 3QW4B 2FPRA 1YCDA 2PUFA 4DN6A 1T43A 3JRXA 4HN9A 2C9ZA 4YGYA 3V32A 3GIDA 3RIMA 3B3FA 2B7BA 1PDVA 5AO9A 2HFKA 4P80A 5FJIA 4Q6BA 2HYIC 4MV3A 1KI9A 2BFDB 4LFCB 3V4LA 1JB1A 3O4VA 2X86A 1E60A 2P68A 4H7KA 4ZI7A 5JHGB 1ENPA 3ZYCA 3KQQA 3G2NA 1NDHA 1NVGA 1EVEA 1FDIA 2RGCA 3P0JA 1GR0A 5T3YA 2IHUA 3UGTA 3V4FA 1M76A 2HWUA 1PRYA 3PNLA 1UL1X 3LT4A 3A11A 5KX5B 3LYLA 3I92A 4IICA 4TZTA 4CIYA 5JMOA 3FDZA 2VR1A 1X92A 3C2QA 4AMYA 4YK7A 2PD4A 4MAAA 4UTOA 4RKYA 3KLPX 1GYQA 5DLDA 4FXOA 3FOZA 1KEEA 4V0ME 5EQJB 3MLAA 3AQIA 3GGPA 3HP7A 2IL1A 4MEJA 1JA1A 5CURA 1J5XA 4X63A 1RCTE 4WHMA 4F6RB 3FOAA 3WV4A 1AGPA 1HE2A 1S02A 1OX5A 1ST3A 1S9DA 2P9FA 3C4JA 2V0GA 2ZJ7A 3O2JA 9LDBA 4OX9B 3IILA 1ZKMA 2Y99A 1DAEA 2XWBF 5EIEA 1JF8A 4E21A 1J8DA 1T0JB 3STHA 1XIVA 2CDBA 2YV5A 4MB6A 3KXPA 4X9XA 3ZWKA 3CEMA 4MVJF 5BR4A 2W6MA 4RA9A 2HHLA 4OQDA 2QMQA 4B0PA 2GJ4A 2QW0X 3A0RB 2HBRA 1ORHA 1ZY2A 4B7CA 2HY7A 4ZQGA 5CX1A 3HP1A 1SHTX 3B5JA 1WDKA 4HAWA 1EFRD 4JFAA 4EG3A 2H1RA 2B7LA 4LYDA 1KVSA 4BV8A 2EJVA 3UOWA 3ER8A 4NFLA 3RVDA 1GOTA 5KNBH 5JAOA 2Z6AA 3C7KA 4JROA 3WL6A 5DT9A 3M7IA 3AVPA 4QX6A 1UZMA 1IFXA 1NASA 2O1SA 1D8TA 1P8JA 4TRNA 3ZY5A 4I8IA 4B75A 3LY8A 4CQLB 5I7OA 2HPAA 5K0GA 4N9WA 1VI6A 4X3OA 3C5WP 3B60A 4HGZA 5F2EA 2XBLA 3RK4A 3BSFA 5FTJA 1P44A 3PBKA 3SXPA 3R5JA 4Q47A 4JLMA 5IC4A 2E4AA 3H4VA 4INOA 4YDHB 3UGQA 2FMHA 4M0DA 1N4AA 3VPHA 1ODJA 4JDUA 3UJHA 5IYZA 2ZYAA 3FCEA 2R1ZA 3L3BA 2WHPA 1E3JA 4OEHA 1J0EA 4UZSA 3OMLA 2VP4A 2PVSA 1CULC 2GZMA 4M1ZA 3RREA 2Z3ZA 1KEPA 2X4LA 5L7YA 3ZNPA 5C37A 4JQCA 2EFCB 4AO8A 4LX0A 4WOBA 5LMZA 1UBSB 5LN1A 3S3TA 4HXFB 4CNQA 2HQRA 1D2RA 3JVUA 4D7AA 4WXYB 2A9VA 4RK5A 5ECDA 2ZBRA 4Q00A 4FR2A 2VP3A 3KHUA 4BVKA 1VJRA 5FUQA 5LSAA 3NYIA 1KK1A 1HT3A 1GCIA 2NO1A 2QBYB 1SVOA 2RBKA 4DEXA 3EXHB 2A1UB 3D6JA 3L1HA 1D1PA 4F96A 5FO1A 5JBQA 1KZ6A 4ARCA 2IS4A 2VZLA 4X93A 3UC5A 4ER3A 4LCJA 3TWOA 3FIJA 4QELA 3G0DA 4IV5A 1FDVA 4WL0A 3EQZA 5DBOA 1G5IA 1U6KA 4NAHA 2R8RA 1RXSA 1B2RA 3KZVA 4REOA 4RKWA 4CJXA 5LC1A 1VIAA 3RKUA 2PKEA 4L78A 5EHQA 4NBKA 1E0AA 1OQAA 1B14A 1WKVA 2JFGA 2QE6A 3GUYA 3OHPA 4LUCA 4DRXA 4OHFA 1L4HA 2WLTA 3K1JA 4GDMA 3EA0A 5EKUA 2Z83A 1REQB 1HH4A 2OVFA 4OQNA 5CFMA 3ESAA 2BTQB 3SIPA 2XWQA 3AKZA 1OSNA 3I3OA 4B7AA 3O5AA 3PHJA 2IP1A 1TM1E 4C03A 2PKXA 2GA9A 2A86A 2A4KA 3PYLA 3FNFA 4UZFA 4YJKA 1PHPA 2D2FA 2JIDA 4TKUA 4E7OA 5LYJA 2F8SA 2R60A 4MVJH 3ITEA 4J29A 3KQKA 2OPHA 2QI9F 3FOBA 4GMKA 4F7WA 3UV7A 4WOKA 3NEAA 4MUFA 5G0WA 2C7PA 3QF7A 1XXHA 4DQVA 3RO7A 3FI0A 1XD9A 3FFTA 3SN6A 3FBGA 1BWQA 2HJSA 3DF7A 4YJ2B 5D7NA 4JS0A 4C5AA 5FOUA 1SNYA 3IV7A 3IQWA 5GWXA 5BNTA 3AIKA 1OZHA 4D4JA 2NAFA 4M1YA 1CY6A 2CXSA 2GFQA 3T34A 5E7MA 4YWHA 3I2FA 4UQOA 2J6BA 2UYYA 3GFPA 4R8KA 2FPKA 1G21A 1EJ6A 2PX5A 1RYMA 3QEBZ 4EKGA 3L0IB 1ZGBA 1G8SA 1YOBA 4W5QA 1PGQA 1XZGA 4J7UA 3ZHVA 4II2A 4MHSA 1JKXA 2J59A 4P3XA 3INYA 4ZTBA 3VPFA 4EVRA 2NNWB 3SZ3A 4CTJA 2Q4DA 3I1FA 5ICGA 1A8HA 4WUVA 2FX5A 2IP4A 2VC2B 5H02A 3CUTA 3VDXA 4LHXA 3R20A 2LPMA 3TFOA 1HOTA 2Y3IA 4KUHA 4GDFA 4G9EA 2GESA 3HHEA 3HJTA 1ZNYA 2UDPA 5A0VA 5M29A 2V74B 3B6ZA 4KWTA 1YF3A 4DUPA 1UBKS 4XUDA 5JYCA 1WBDA 1V9LA 4OB8A 3O7MA 5K0LA 5KYYB 1BJRE 3WYDA 4A5SA 2IX3A 1U1IA 3G85A 4R4JA 3A6KA 2GM9A 3GLGB 5ALYA 5EIWA 3LPLA 3R9WA 5BN3A 2XIJA 5CXXA 1W4CA 4ASUD 5FQNA 1W75A 3HVKA 3L6EA 3ELDA 1MENA 4Y2SA 5FR1A 1Z73A 4KXQA 2Y68A 2J4DA 4I5IA 1YTLA 1AN9A 1YQTA 3JARB 3M5DA 1JH8A 4KI0A 4NV1A 2IS2A 4RENA 2IDMA 3BVPA 2O50A 4KQCA 4P38A 4UPDA 4DIFA 5K0CA 2Q8NA 2WKSA 1OASA 2BEUB 1GNTA 3X1MA 2Q07A 4MVXA 5EJAA 2IHNA 1XMIA 1N2SA 4N1AA 1F9EA 2HMUA 5KYWB 4QUDA 4Q1DA 5FHQA 4K7JA 4BLSA 5HZMA 5TIIA 3P96A 2OT3B 2AYZA 3WMRA 2CFCA 1XVUA 3MELA 5TARA 4ALIA 5TV2A 1RQ7A 4XQ9A 4TL7A 1D6SA 2JCXA 3BBLA 5E1MA 4ZYXA 2PUJA 1UKYA 3S1SA 3J80A 1DAPA 1EVYA 4KR3A 4R8RA 4YREA 4KDEA 1YMVA 1XHFA 3NC4A 3VGPA 5KOHA 3VJMA 3ILVA 4ZRMA 3WZMA 1XPOA 1WF3A 1BH2A 4QO8A 1UP7A 1IEWA 2QVZX 3T0IA 4EL5A 2ODBA 2WYIA 3EIOA 3W2GA 3TNJA 1NM5A 3QPCA 4E12A 5EJ7A 3OTIA 1UPUA 2ERYA 4K28A 4XI9A 5CK4A 4WKBA 1QYXA 1UXHA 1VPDA 2P69A 4QYXA 1PJRA 1QUFA 1YZFA 2Z4RA 4UMDA 5EZYA 3I4CA 1Z08A 1JSCA 2IYUA 3IE2A 4JP2A 4RQAA 4EEZA 3MWKA 1J8YF 1UCFA 4I4TA 4J2OA 1ES9A 4LBVA 1NXTA 1ACJA 2I4LA 2FMTA 1EXMA 5L3SB 4UE2A 3ZYZA 1GLGA 2JLUA 1MA0A 5EQFA 3AUAA