3WTCA

Crystal structure of gox2036
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
259
structure length
259
Chain Sequence
MSLSGKIAAVTGAAQGIGKAIALRLAKDGADVILLDVKQDTLAETAKEVEALGRRAVALTADISNRDQFRSTLADAAKTLGGLDIMVNNAGICQVKPILDIEPAEIEKIFSINVQGVLWGMQAAATLFKEKGTKGKIINACSIAGHEGYPLLGAYSATKFAVRALTQSAAKELASSGITVNSYCPGIVGTDMWVTIDKRMAEITGTEIGATYKKYVEGIALGRVETADDVAGFVAYLSSSDADYMTGQSVLIDGGLVFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Gox0525
rcsb
source organism Gluconobacter oxydans
molecule tags Oxidoreductase
molecule keywords Putative oxidoreductase
total genus 98
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wtcA00
5T64A 2OGUA 3KRTA 3VHRA 3ZNPA 2ZYGA 4Y6SA 5JBIA 2B5VA 4M49A 3DZIA 1JN0A 1RPNA 2YDYA 1U2DA 2G0TA 1DSSG 2E6UX 3DZKA 4YAEA 1RM4A 5ADHA 4LGVA 1GUZA 3LF2A 3RJ5A 2JFGA 3JQEA 3ZWBA 3R0IA 3VKVA 2W2LD 4BNXA 3JYOA 2EERA 4ZQFA 2J3KA 3INRA 4OOFA 1WVGA 1PR9A 5L7TA 4JROA 4BKQA 3W6UA 4DMMA 5DBIA 4L0QA 4ND2A 4HXYA 5HS6A 4BNNA 1HEUA 4D45A 1LRLA 4GH5A 2HRZA 4JBIA 1NPDA 3PJDA 4EJMA 3OBBA 3KYCB 5LC1A 4RVGA 1DFHA 1KEVA 1YGYA 3OEWA 3V1YA 1FK8A 5H81A 2VWHA 4TZKA 2UYYA 3HN7A 4ALKA 4OM8A 5F5LA 5G4KB 2H1SA 3K30A 4M1QA 2DVMA 4BNTA 3QWFA 4XDZA 2WTBA 4CR7A 1A5ZA 1T1SA 5BT9A 4PRLA 3VVCA 1DIGA 1YBAA 3GVIA 4GSLA 2H9IA 1T4BA 4FB5A 2CDAA 3ZHYA 5T5QA 4FN4A 1P45A 1B15A 1OZAA 3GDOA 3UAGA 1T1RA 3BMNB 1KVQA 1CRWG 1NM5A 3QWAA 3WR5A 3JD3A 3W8DA 1MG5A 2EG9A 1HLDA 3MJCA 5G0WA 4BNIA 1T24A 4EUHA 4AJIA 1KVSA 2W8ZA 2FP4A 4UVEA 4XRRA 4B7CA 1W6UA 3GGPA 3EVTA 3IIEA 3DMTA 3PP8A 4D7AA 4J7XA 4IDGA 3W4KA 1EQ2A 1GQQA 1DIBA 2P2SA 4YYZA 3TPCA 4DRYA 1FDVA 1MXHA 1ZK1A 4M89A 4U0JA 1MG0A 2E48A 3QVTA 3MJSA 4A5OA 5L7YA 2UUOA 4CR6A 3SBOA 3HFSA 3VPXA 3PI7A 2C82A 4UUPA 1NPYA 1UZNA 1YDWA 2HMWA 3ENNA 3PPIA 2G82A 4I08A 3U4HA 2IE0A 3FBTA 2VRCD 4NBTA 1VSVA 3DBHB 1PJCA 1WLYA 3QA9A 1HE3A 1LLUA 1PS9A 1QV6A 3ZWMA 1U4SA 3MJ4A 3OIDA 2X5OA 3NYWA 1WWKA 3OP4A 3PHGA 4GQAA 3RD5A 3A06A 5JFOA 1CWUA 2DTXA 1PGNA 1PWZA 1TEHA 4FC6A 1A27A 2I76A 4E6PA 5KVSA 3ICCA 2B35A 4TRRA 1TT5A 1YOVA 4MDHA 1BHSA 3GFBA 4QO7A 1HSOA 3ZWPA 1PJ2A 3U4CA 2HDHA 2Q3EA 2YUTA 1MB4A 3QVXA 4A0SA 2XF8A 3H3FA 4MVJH 3FSRA 2FPGA 3T7EA 4R01A 3GG9A 3CXRA 5ILGA 4Z9YA 5AXDA 3TNLA 1GFSA 3O26A 4AICA 4YT5A 2G1UA 4PLTA 2O3JA 1ULUA 4R51A 4RF2A 4PCVA 1O9BA 4M55A 3DOJA 3IDSA 3C1AA 2V6GA 3BTVA 1B2LA 1HSZA 4AFNA 1Z6ZA 3OEYA 1IE3A 3INTA 1LNQA 3C7AA 3EVNA 4BO6A 1X7HA 5BQFA 3PFFA 3UW3A 2D0IA 4XYEA 2X6TA 1YS4A 3D5QA 5DP2A 3SJ7A 4Y6RA 1LX6A 5AXBA 4CMJA 3JQ7A 1LLCA 3F5SA 1ENZA 1JQBA 4HKTA 4L4SA 5KOIA 4XJSA 4LCJA 4YAJA 2VWGA 3G3EA 1E6EA 3OMLA 3QJ5A 4Y6PA 1T26A 5KJ1A 4GGOA 1C0KA 1DJNA 2F00A 3G49A 1E92A 1ZJYA 1B8UA 1GUYA 4XR4A 3AW9A 3OSUA 1W73A 2Y1DA 3DBRA 4E12A 2Y68A 1XQ1A 2O7QA 4WOKA 3IJPA 1HDYA 1R4MB 4LRSB 1ADBA 2WE8A 4EUFA 4RPHA 1GADO 4BQRA 4DIFA 5CG1A 1PJTA 1JTVA 3DZGA 3F3SA 4RVUA 3OJEA 3LT2A 1XDWA 5TRTA 3BXXA 4AVYA 1B16A 1YJQA 4WLVA 5A3VA 1I36A 3GZ4A 3AOEC 1H2BA 1U5CA 5ES3A 4HBGA 5DOVA 4D3DA 3PEFA 1BW9B 3E1KA 4OSOA 3TL2A 3C7CB 2AMFA 5A3JA 4YT4A 5I9MA 2JJYA 1HE5A 1UXKA 2HUNA 4XYGA 2V6BA 3ZGYA 3QVOA 1WNTA 3RFVA 1RM0A 2NUAA 2SCUA 2R00C 3MCVA 3S2IA 3I6IA 4HFJA 1P0FA 3H2SA 4IPTA 3W8EA 4DGSA 4YT2A 1PTJA 3FN4A 1GPDG 1Y8QA 3MJTA 1PJ4A 1NQAO 1VPDA 4BO3A 3GMDA 1KEUA 5A9RA 3RU9A 2ZIZA 3MTJA 1ZCJA 4Q3CA 1PQPA 4ZD6A 5JDCC 4AJ1A 1UXIA 3LC7O 2J6IA 3HDYA 5C3MA 3F47A 1KY4A 1KY5A 1B0AA 4GKBA 3WTBA 3QVWA 3ZHBA 3HZZA 5TNXA 1ZVMA 4GMGA 3KM0A 5KJCA 2NWQA 4BO5A 1N1EA 2VNSA 3FR7A 4YJHA 1IUKA 3RI3A 3RUFA 5THQA 1KVTA 3WIEA 1ZJZA 2P4HX 3DBHA 2PKQP 1UDCA 2RAFA 2GO1A 3RAJA 4E33A 3DEYX 5TF4A 3M2PA 1AXEA 4YA6A 5DZSA 2HMSA 4Z9XA 3F1KA 4CPDA 1ZK4A 4CMEC 1DAOA 2UUPA 4RCVA 1GDHA 3ROMA 1SOWA 4PLVA 5A5FA 3R3SA 4GLOA 1AGNA 3RUCA 2PNFA 1GL3A 4Y67A 4B4WA 2Q50A 5EJ2A 5IFLA 3WQSB 4UUNA 4Z0HO 4NNJA 5LDGA 1LSSA 2GDZA 2A35A 4IGFA 3NRCA 2YDXA 1F12A 1HF3A 4DWVA 1ZSNA 3ETEA 2GNAA 5JW6A 1HZJA 1EE2A 1AHIA 5TS3A 5A02A 3FF4A 3I9OA 3ZV5A 1LSJA 3DO5A 4O5OA 4DPKA 4DPMA 3WLEA 4YQYA 3KYCA 2ZTLA 2Q2VA 3COSA 3DR3A 2RIRA 1PR3A 2YHIB 1DRUA 2DBQA 4ID9A 3KVOA 1HKUA 4D46A 4Q3EA 3BTOA 4OGWA 1D3AA 1P1KA 3DFZA 1C14A 3LYLA 4CM8A 2CSUA 3ETGA 4H3VA 2EKLA 4PLYA 4F6CA 2E49A 1E7QA 3U62A 3ROQA 4DYVA 2VUTA 4TMFA 1C3VA 1SMKA 3K5PA 1LLQA 4GSKA 3RIHA 2X8LA 2BI8A 5JDCA 2EGGA 4NBVA 4CMCA 5CFZA 3RFXA 1SO8A 3MOGA 3PGXA 1PZGA 4LW8A 5IZCC 1N92A 3H65A 1C0PA 2CFCA 5KJFA 4MVJE 4WNIA 5AXAA 3HDHA 3GZNA 5DCYA 3OJOA 4AG3A 3UCXA 3DHYA 2X1HA 4WCFC 3UKOA 5GZ1A 1J0XO 5F3RA 3IUSA 2DFDA 2V6FA 3E18A 1TA4A 3AWDA 1I2ZA 4CV3A 3AJRA 3KYBA 3M1LA 3H8VA 1XLTA 4ALNA 3AOEA 2HK8A 4A26A 1HDGO 4J9UE 2ZTMA 4C7KA 4Y9DA 1N7HA 2NVBA 2DUWA 2C2XA 3DAGA 2PD3A 4TSKA 4MP3A 2I9PA 4F45A 3TFQA 1IZ9A 3U9LA 1LEHA 1T25A 4UUMA 2A94A 3I9NA 2YQ4A 2AA3A 1DIHA 3PYMA 2AG8A 2ZQYA 3ZN2A 2AW5A 5IN5A 5A9SB 3STHA 1Z45A 5JDIC 3LC2O 2DC1A 1X0VA 3WX0A 3I6QA 4AJHA 5JAZA 1QXSA 3ADPA 1HWYA 3IS3A 4WLOA 3E6AA 5CEFA 2Y05A 1WZIA 1I24A 3RKUA 3DZFA 3F1LA 1X1TA 2Y1CA 3F4LA 3LF1A 5BNTA 5C7IO 4D44A 5JO0A 2UV8A 3L4SO 3QSGA 3CPSA 4RPGA 4WUVA 1D8AA 4DL9A 2VT2A 4MIOA 1ADGA 1LDYA 4YJFA 5JCXA 1A72A 4D43A 4DA9A 3PLNA 1MC4A 1YRLA 2CY0A 3DBLA 3FNGA 1YL7A 1MXFA 1UDAA 1ARZA 5TC4A 3ANMA 1E7MA 4HFNA 1K0UA 4ZRMA 4D42A 3PJFA 3QV1A 1K5HA 1UP6A 5IN4A 1YDEA 2P4QA 1XQ6A 2DTEA 3VAZA 3IKTA 1UXGA 3C85A 3W8FA 4RJTA 3WJ7A 1DHRA 3F6YA 1GZ4A 1E3WB 4BNFA 2BFOA 4R1NA 2WM3A 2Q1UA 3NDJA 4AJ4A 1LDNA 1K6XA 1H5QA 1L7EA 4O1MA 1FF9A 4BO8A 1OI7A 4K6CA 1MFPA 5F5NA 1P9LA 3N7UA 2BELA 3VKUA 2C5AA 4ZHSA 1PQUA 3KEQA 3AUUA 4FCCA 3U5TA 3WOHA 3PQEA 2V7PA 1BW9A 1H0KA 2NV6A 4ALMA 3DOOA 1J5PA 5LCXA 2B4TO 2OO5A 4PIVA 1W0CA 2FPPA 2J8ZA 4QUKA 3ZWXA 4IJWA 2AQIA 4IY1A 3TOXA 4GWGA 3UUWA 4CM9A 3ETDA 3O8QA 3PGJA 2HRBA 2W98A 2ZJ1A 1KYQA 3HADA 4BQPA 5JAIA 3PHLA 4U6QA 1Z7BA 1LRJA 3VPSA 3WGZA 1O94A 1Z73A 3CMMA 2ZJ0A 2IEBA 3G1TA 2HMTA 3GVPA 1KETA 2A4KA 4L76A 5BSHA 5JYEA 3KSZO 3ZU3A 4AL4A 4DC1A 4FFOA 1NWCA 1P74A 4OQZA 1M2WA 3ITKA 1UUFA 4JJGA 3NT4A 4QTZA 1C1DA 3I9JA 4E32A 1UAGA 4I9HA 2EEZA 3JYQA 3DMTC 3H3JA 4MPDA 1YL6A 3PIDA 2YFQA 3O38A 3R1IA 4GAEA 1Z82A 3ZNOA 4N5NA 5AYVA 4CUKA 2P91A 1LDMA 3KETA 4P4NA 4A27A 3RQSA 1C1XA 3H6KA 1HXHA 3BHMA 3OECA 3OJFA 2ZB3A 1NTOA 3I4FA 1E3SA 2EF1A 1GZ6A 2NSDA 2PZKA 3NGLA 4HUJA 3H9EO 5FEUA 1UZMA 3KB6A 4R9RA 3GOHA 4CQLA 1AE1A 4TZTA 4OJNA 2ZCUA 3H9JA 1GV0A 1DC4A 3GPIA 2VUSA 1LQTA 5J23A 1ZEMA 5ENVA 1E7RA 2HLPA 4LN1A 1WP4A 5HRUA 4D3SA 2NTJA 3KUXA 3EY4A 3PIIA 4Y8VA 1PZEA 1QLJA 3GG2A 4FW8A 4IIUA 1H6BA 2Y1EA 4LISA 2DPGA 4BNJA 1I2CA 3AM5A 1NXQA 1SZJG 5AQ1A 3GUYA 5IZ4A 3WWYA 4NHEA 4B7XA 3Q11A 5TIIA 1Q2XA 2NU9A 3LDHA 4E21A 3OETA 2VHVA 2FPIA 2OZPA 3JYNA 4J1TA 3PDJA 4CLRA 4CLRB 4ZN6A 5C7LO 7MDHA 4NBWA 3FRJA 3V2UA 4U6SA 2CUKA 1WW8A 3GGGA 4Z3DA 4BV9A 4CMAA 3L77A 6LDHA 2AEJA 4XYMA 3TZQA 2XXBA 5HS4A 1G6KA 1J49A 4OL9A 1A4IA 3NGXA 2Q2QA 2YJZA 8ADHA 1JVBA 2PV7A 4KOAA 4E31A 3WWZA 1KVUA 2JCYA 3CUKA 1MX3A 4CR8A 4WLEA 3QY9A 3ZNQA 4Q3DA 2PZJA 3Q1LA 4AJPA 1O6ZA 2BFPA 4W6ZA 3E9QA 1PS8A 4XA8A 4XYLA 4FJ1A 2VTDA 5CDYA 3S2EA 5A1TA 2GN9A 1ZFNA 1YWGO 5GMOA 3OIFA 3AM3A 4CQLB 4EEZA 4FBGA 3KV3O 3RCBA 4GX2A 1GYQA 1KVRA 2O4CA 1QYDA 5U9CA 1ZO8A 1M75A 3C1TA 2FOIA 4J49A 4CLDA 4YJDA 2Q99A 2WWRA 1IY8A 1PQWA 4L8VA 4BO2A 3WICA 3OH8A 1H9BA 4KQWA 4XB1A 3WB9A 4JP2A 5CDSA 2AEFA 1M67A 4UVHA 1XU9A 2AE2A 4IMPA 4O63O 1R16A 1RM5A 4CLOA 3L6DA 4J2OA 2Y1FA 5EN4A 1QLHA 4BB5A 1PIWA 2FWMX 4CJXA 1T2DA 1R6DA 5FI5A 2DQ4A 1B14A 2CVZA 1N2SA 2DUUA 2D5CA 4J0FA 3FI9A 4PG5A 3BMQB 3O4RA 4CV1A 4EJ0A 1HDZA 3DBVO 3NT2A 1HETA 1WMAA 4CLHA 3KZVA 1Y5MA 3VH2A 3D5TA 5JPIA 3WYCA 2VN8A 1K6JA 2VYVD 5ICMA 2OOSA 2AQKA 4XJTA 1GR0A 4PG8A 4AJKA 4I9UA 2VHXA 4B3IA 4BKPA 1V9LA 4QO8A 3ZWCA 5C37A 4PLFA 2EJVA 2C0CA 4CM7A 1U4OA 1JWAB 2EIHA 2NU6A 4XRGA 1LLDA 3BTUA 3O03A 1EBUA 1NBOA 1U1IA 4WK6A 5DBGA 4EZBA 3ZHXA 4KQXA 1NHGA 3TL3A 1GY8A 3GLQA 3AU9A 4KUGA 3A28A 1PZHA 4BO9A 3JQFA 3BMCB 2O3UA 1KC1A 3GFGA 5JO9A 2NVUB 4DLLA 3CE6A 3TZCA 2BLLA 1SPXA 2YV3A 3WFJA 3FPLA 3R6DA 1E3WA 4RF4A 2JKVA 1LA2A 1P1JA 3CTMA 4JNKA 1O0SA 4KZPA 2EGHA 4MVJD 1DO8A 3MJVA 4JJIA 1C0IA 4WPGA 1YL5A 3TZ6A 1J4AA 3AY6A 4JCOA 3OFSA 2YHUA 2VYVA 4K9DA 1DXYA 5JNLA 4RVDA 1PGPA 4BNMA 3WYEA 3OF2A 3S55A 3DAFA 3OHSX 3WNVA 3GGOA 4KUHA 3DL2A 5JAMA 3VH1A 4OOEA 3ZV3A 4RL6A 4MKRA 2B5WA 1GUFA 3WBFA 4CMKA 2GD1O 2QZ9A 3BIOA 3TN7A 3ASVA 3OA2A 3VTFA 2YW9A 1HDRA 1VRWA 4GI2A 1UXJA 3GZNB 1JAYA 4IDAA 2QX7A 4M8SA 3FNHA 1D4FA 1NFRA 2RH4A 3R3JA 2QG4A 4PLWA 4CM3A 5I7VA 5ICSA 2GRAA 5G0SA 3K92A 5KVQA 1UDBA 3UH1A 4BO0A 1RWBA 4CUZA 3INGA 4M54A 3AFNA 4RPLA 1V0JA 1NAIA 2NM0A 3GH3A 4FDAA 2JCXA 4FS3A 1PGJA 2C2YA 4ZJUA 4IXWA 1H6AA 2FSVA 4TQGA 1DDOA 5EPOA 2P9GA 3GN1A 3EGOA 4BNHA 4I9NA 4PZDA 2QQ5A 3TJRA 3TRIA 1GQYA 1C1DB 2P9EA 2CDCA 2Y66A 3HHPA 4NZ9A 3S2GA 4BL5A 2UVDA 4FC7A 2QW8A 1XG5A 1XIVA 4CLEA 4R1SA 5TT1A 1NPTO 2GYYA 4NIMA 4L74A 2BI7A 2O2SA 1A7KA 2PGJA 4EDFA 4PRKA 1YB5A 4PZCA 3AM4A 4PGFA 3WMWA 1H2HA 3MWEB 3ROPA 4IDDA 1DFIA 1ZK0A 3NX4A 1PEDA 2WYVA 9LDTA 4YRDA 1V3UA 2NLOA 3NAQA 1Y1PA 4J3FA 4S3MA 3QW2A 2Y99A 3FWNA 4UVDA 3AUSA 1BG6A 2PKRA 1P1FA 4CMGA 4R16A 3VOSA 3K73O 3HG7A 4YAGA 5COBA 4FFPA 1M66A 2EHDA 4XQ9A 5JMPA 3D4NA 3UXYA 4Z0TA 1AUPA 1KEWA 3AI1A 3G17A 1QORA 1E5QA 2H63A 2PZLA 4OXKA 3AY3A 4BGUA 2JD1A 3GEMA 2DKNA 4HP8A 4XB2A 3JD2A 2Q49A 2CDBA 3KO8A 4TVBA 4J1NA 5CP8A 3JQGB 1VJ0A 3GRPA 3GN2A 4OXYA 5BSGA 5JE8A 1YQGA 4RF3A 1EUCA 3TDKA 3WQQA 5B4TA 1LXCA 1GQ2A 4BGEA 5A05A 4W99A 1E7WA 3JV7A 3EC7A 3I9MA 3LT0A 4I8XA 3KOUA 4ITUA 4WLNA 3UCEA 4F6LA 1ZUD1 1VKNA 2F1KA 1HZZA 3HB4X 2EV9A 3PYLA 4R5HA 3H5AA 3JQAB 1GCOA 1Q0HA 4ONEA 3I52A 1DEHA 4BKOA 4HV4A 1K3TA 5KCZA 2CNBA 1N9GB 4JXKA 4DBZA 3HDJA 1HTBA 1IL0A 5G4LA 2CVOA 1H6DA 3VPFA 2NVUA 4B4UA 1VJ1A 4QEDA 5K9ZA 1ONNA 3PQDA 3WIDA 1MC5A 4CQMA 4GVXA 1JWBB 5DBFA 1A9YA 1WDMA 4W7HA 2Z5LA 3BZUA 3ASUA 5BNFA 4UUOA 3ZHZA 3P7MA 1CERA 4YEDA 2NTNA 3NV9A 2HSDA 4U0KA 1ML3A 3H5RA 4B8ZA 3V1TC 5L95A 2Y0CA 3A4VA 3L9XA 4XDYA 2B0JA 3G1UA 3WXBA 2POQX 3EZLA 1DRVA 5AXCA 4BNZA 1BTOA 4BB6A 3UFXA 1Y8RA 1SB9A 2WJPA 3B20A 3BMCA 1HL3A 1R0SA 4IDCA 3BMOB 1OAAA 1S6YA 3NJ4A 3ZNNA 4XWYA 4URFA 5AVOA 3AI2A 2WD7B 3IUPA 3C1OA 3EZYA 4LMPA 1NQOA 3L4BC 3OJ0A 3OA0A 3UVEA 1Y9EA 5L40A 6ADHA 3JD0A 3P19A 2I3AA 1Y8QB 1U7TA 2CVQA 3DBRB 1IB6A 1B3BA 3DHNA 4J7CA 4L4XA 2NQTA 2Q46A 2QZZA 3JYLA 4IINA 4XGIA 3SX2A 4CMIA 3RUDA 3NDRA 4G81A 2W4QA 3FHLA 2VZ8A 3NKLA 3WYBA 1I2BA 1IPEA 3ANLA 1YBMA 3SLGA 2D4AA 4XD2A 4N18A 1I10A 3JQ7B 4YAIA 1JKIA 1QRRA 3RC1A 1XELA 3AK4A 1I3NA 3ZWVA 3DMYA 4BNYA 3NTOA 1XYGA 5KNLA 3B70A 1Y81A 1ZMTA 4TWRA 3V1UA 3G0OA 4P4GA 2AXQA 1DLIA 5K6AC 2Q4BA 4Q9NA 2OORA 4J2HA 1EUDA 2PWZA 1PL8A 3Q3CA 1R4NA 4IS2A 1PS0A 2CZCA 4BMSA 8LDHA 2EW2A 3DFUA 3ZZNA 2AHRA 4FD3A 4NG5A 4QECA 3FR8A 5IF3A 1ISIA 1PGQA 3RC7A 4YDRA 2J5KA 3DONA 5TGDA 3DZJA 4DQUA 3UCFA 2VCYA 2G5CA 4W7IA 1FDSA 4HADA 2BD0A 5COAA 3AFMA 4O59O 5U1PA 4FQ8A 1R0LA 1YJ8A 1Z74A 1HLPA 2DU8A 4NH4A 3VTZA 1IOLA 5IJZA 1H6CA 1SBYA 5DULA 9LDBA 4ZQEA 4CV0A 4YT8A 3NTQA 1AHHA 5H83A 1IPFA 1DFGA 2YV2A 3FD8A 5JDIA 2XXJA 4FJ2A 2D5AA 4PLZA 3S2FA 2HU2A 1EVYA 5I7EA 1GTMA 1W4ZA 3Q9NA 4JQCA 2GR9A 5JY1A 4P38A 1JAXA 2GF2A 1UP7A 3JQ9A 5KIAA 2JAHA 2VYND 5LDHA 1XSEA 4RPJA 3C8MA 4MINA 1X13A 1QYCA 1X14A 3DBLB 1RYEA 3EDMA 4MVJM 4NMHA 5CDTA 1F8FA 4DVJA 1NR7A 2FZWA 4RDIA 1LC3A 2QYSA 4BNKA 4HFRA 2GLXA 2YV1A 3IKVA 3RU7A 3ST7A 2DBZA 3IOYA 3NT5A 4MJLA 1TB4A 4UREA 4E2XA 4NQZA 3A14A 2X0NA 4YQZA 1O89A 3WS7A 1HDCA 1LSOA 4CM5A 2GZ3A 3BYZA 3PDUA 3PQFA 4MVJF 2QIOA 1NWHA 1N8KA 5ITWA 4JBHA 1E77A 3CKYA 3LU1A 5IZCA 2D2IA 3KBOA 2WYWA 1R0KA 2HK9A 4EW6A 2JHGA 3L9WA 1RJWA 3F9IA 4G2NA 4ILKA 3JQAA 2C54A 3GAFA 1E1KA 3KSDO 4IQ8A 1DRWA 4YJHB 4A73A 2BGLA 1P1HA 2B83A 5I9LA 1HYHA 2AG5A 3DZBA 2EWMA 3PHJA 3I5MA 3DHEA 4EEXA 4EUEA 3PXXA 5T6BA 3FTNA 1Y6JA 3PWZA 4UVIA 4L4RA 1XCBA 1LSUA 1YE3A 2VHZA 3W4IA 3TZKA 2V6MA 3GR6A 4BO7A 2VUUA 4MP8A 3ZI0A 1F0YA 3DXFA 4HWKA 3VH3A 1LC0A 1A71A 3BAZA 5FWNA 1WDLA 2QYTA 3RC2A 1EK6A 4RGBA 4QX6A 3LT4A 1CQJA 1SC6A 2D3TA 3ADOA 5EESA 4KTTE 4YWJA 1ZIDA 4CUJA 1N9GA 1ISGA 5I8ZA 4E2WA 5DT9A 3W1VA 4MVJP 1Q0QA 1SEPA 4W9NA 2TMDA 1PZFA 3V8BA 3PWKA 5JCJD 3QRWA 5DF1A 4CMEA 1TI7A 3VZPA 5HTOA 4R54A 4IQ0A 4XKJA 2O3RA 4MO2A 4UAGA 1P0CA 1P33A 2VYNA 4B3HA 4FOSA 3VZQA 4B7UA 4Z0PA 1GYPA 1BGVA 3SXPA 1A7AA 1KBZA 2HO5A 5G0TA 4GL4A 2EKPA 3KYDA 1U3TA 2O50A 2X9VA 5DNAA 2C7GA 2CF6A 1O95A 2R00A 1GYRA 3CMCO 4WGGA 4PVCA 5IXYA 3IJRA 1T2FA 3K31A 2JCVA 3GHYA 5CPFA 3LLSA 3RUEA 4CM1A 3RUHA 3GC6A 4TVOA 5G0UA 1E5LA 4NFYA 1DIAA 3WSVA 1KOLA 4B8WA 1YO6A 2P5UA 3D4PA 4L75A 1G0OA 1L1FA 4XYBA 3GY0A 3AOGA 2XPCA 3JQAD 4R3NA 5DOZA 5F1OA 4C7JA 3V2GA 3K2BA 2ZYAA 3I1JA 4XR9A 1QMGA 5JCJA 2WDZA 5DP1A 1UR5A 2Y1OA 1KERA 3CSDA 4D0SA 1SEVA 3B1KA 1E7SA 4TKMA 2B4QA 4E2YA 3GHHA 1OC2A 1B7GO 1PJBA 1XEAA 1Y8RB 2B69A 4P22A 1OC4A 1HDXA 1BXGB 4AJJA 2PKQO 2Y0EA 5TJHA 2GERA 3SC6A 2IZZA 1XHLA 3EK2A 3I23A 5COQA 2FSSA 5FYDA 3X2EA 2RHRA 5F21A 4RV9A 3FTPA 4ZQGA 3U3XA 4RDHA 2C20A 1EQUA 4WJZA 4N7RA 2Q45A 2J3JA 1XR3A 5B4VA 1X7DA 5B37A 2P5YA 2Y67A 1ZW1A 3AUTA 4WE3A 4DLBA 4I5FA 2YFHA 3ITDA 4ZRNA 2WSBA 1ADCA 3AI3A 3Q6IA 5L4SA 3D1LA 3SEFA 1RYDA 2H6EA 2Q2WA 3P2YA 4OXNA 4Z3KA 4HY3A 3GA0A 4GBJA 2X5KO 4UULA 1ID1A 3HSKA 1CEQA 3JQDA 4ZU3A 4DLAA 5ER6A 4CV2A 1A4UA 3QLJA 1V35A 1GAEO 1DC5A 4ND5A 3Q0EA 1VC2A 1ZZEA 5K6AA 1IULA 4ZA2A 4OO3A 4PG6A 3I9KA 4HFMA 4YJGA 4ALLA 2HJRA 4YRBA 5A9SA 3X2FA 3L0DA 1U8XX 1LDGA 4QQRA 3VH4A 3WGOA 1I8TA 2P68A 5CEJA 3QHAA 3UOGA 2VHYA 3HDQA 1QV7A 5IXSA 3IAHA 4AJLA 4IMRA 5DCUA 4YTEA 1Z75A 3TOZA 2HMVA 5ENDA 2BKAA 3H9UA 4CLXA 4BKUA 4H15A 1T2CA 1GD1O 5TX7A 1A9ZA 5JMWA 1QYWA 1YQXA 4Q39A 5L4NA 3L4BA 2Q1TA 2JD2A 3VDQA 1RKXA 3IMFA 3LK7A 3GPDG 3WMXA 1DOHA 3ZV4A 5H82A 3TZHA 3E5RA 4AJEA 3JD1A 3UHAA 2IRWA 4BKRA 4J16A 4E5MA 2W2KA 5HBRA 4N54A 2H5LA 2PGDA 3DOCA 4J1SA 3T4XA 3Q2KA 3U49A 2TMGA 3PFWO 2DFVA 1NQTA 4GX0A 1Q7CA 4WLFA 3L6EA 5B1YA 1U9JA 4FGWA 4K6FA 4WEQA 4EBFA 1JDJA 2NNLD 2P9CA 2J5QA 4MOWA 1HYEA 4RVHA 4J4TA 1WZEA 1K89A 2OMEA 4PLGA 2O4UX 4BUCA 3I9LA 1JLLA 1IZ0A 2GSDA 4IDBA 1LUAA 1ONOA 3SLKA 2I6TA 5KJ6A 2J3IA 2GPTA 3LSYA 4DUPA 4YVFA 1I3LA 2LDBA 3HNPA 5TSDA 1VSUA 4LRTB 2YHIA 4P8RA 3JQ6A 3GDFA 5CEEA 1LRKA 1E3IA 2OFPA 3PJGA 4XIYA 3RUAA 1V6AA 4IIVA 4PLPA 4M86A 5L7WA 1JKJA 3ZWNA 1WXDA 2QRLA 4E30A 4B4VA 4IJVA 1NX6A 5IDQA 4QSMA 3ENKA 3RWBA 3RBZA 4FR5A 4D3FA 2O23A 3H4VA 3A1NA 2NU7A 4I5GA 3SC4A 2HCTA 4R1TA 1VL0A 5ER9A 4CL8A 3ZCXA 4LSMA 4KTVE 1DBVO 1K6IA 1EVIA 2PFGA 1NASA 4PZEA 2PR2A 4RPKA 2PH3A 4DIBA 3QIVA 2LDXA 1V8BA 3W6ZA 4E0BA 4E5PA 4ZICA 2QRKA 1BDMA 1QKIA 3S1LA 3DTYA 2YYYA 4II3A 1DB3A 1BWSA 1I32A 4D41A 3D3EA 3PWSA 4CODB 1MLDA 3RBXA 3EAGA 1PGOA 3D3WB 3WBBA 5HM8A 2ZTUA 4NK4A 5FF9A 4IJUA 5FFFA 4FFNA 3M6IA 2I65A 3LLVA 4WCFB 5EQDA 4WOJA 2Z1NA 1U8FO 3HWRA 4KWIA 2WD8A 4HNGA 4IJKA 4ZQHA 3GVXA 4ND1A 3V5NA 2JD0A 2DLDA 3PRJA 1D1TA 1H93A 4GLLA 2AQHA 2ZK7A 5BNIA 1SCUA 3ULKA 3ZWWA 1V3TA 1BDBA 1XKQA 5JSFA 1VE9A 1VKOA 4MVJG 2FY8A 4E5KA 5KVCA 3MJEA 3VVBA 2YZ7A 3BTSA 3JQGA 4X54A 1NYTA 3ZWYA 3TQHA 1EVJA 2NTVA 1C1XB 4RZHA 5K0ZA 2WE7A 2X0JA 3C3XA 2GCGA 2E82A 4GWKA 4MVJA 1P3DA 3RBVA 3BHJA 2WMDA 3DZHA 4U7WA 3B1FA 4J4BA 4EITA 2EP5A 2PD4A 3HQ4O 4CQMD 1QP8A 3PTZA 3AU8A 1OBFO 1G1AA 4WCDA 3FBGA 4JBGA 3ANNA 4XGKA 5EERA 4CL3A 1EBFA 1O5IA 1HE2A 1R37A 2OHXA 4BV8A 2A92A 1R4MA 4WNCA 1VI2A 4ALIA 2IZ0A 3H5NA 4MIEA 1KS9A 3E03A 3GQVA 1K2WA 4I1IA 4Q3BA 4XX0A 3WGHA 5L4LA 1EE9A 4O6VA 2VWQA 5BR7A 5HWSA 3U09A 3H7AA 1EVZA 1T2AA 3K8ZA 3JQBA 4LCEA 4DTIA 5L9AA 1GU7A 3WG9A 1Y7TA 4RQTA 2RH8A 1I3KA 5IDYA 2IYPA 3OQ1A 2XAAA 1EZ4A 3L07A 2FN7A 4GPD1 3B1JA 2JHFA 4W4TA 1HDOA 2HAEA 3BMQA 1DIRA 4JX8A 1YB4A 5I9NA 3CIFA 4MP6A 3WGGA 1M76A 2VHWA 4LVCA 2X7HA 1FDWA 3LZ6A 2CD9A 1X1EA 2EP7A 2WYUA 4OYRA 2X86A 1CETA 1E7YA 1EMDA 4J7UA 4PG4A 1I33A 2I3GA 2IODA 3GK3A 5C7OO 3ZW8A 3IP3A 2DM6A 2Y0DA 1I30A 2QRJA 3MTGA 2W2LA 4ZQBA 1ZK3A 3ZU4A 4CMIB 2C59A 4O0LA 1O8CA 1NHWA 2X0RA 3D3WA 1PL6A 5A9TA 4JP3A 1N7GA 4L73A 2XOXA 3QWIA 5A04A 2YQ5A 2OP1A 4IQGA 4NDNE 5ILOA 4INAA 4N5MA 3NUGA 3UN1A 3L6OO 3BHIA 3JSAA 2FHSA 4IBOA 4IDFA 1X0XA 3Q9UA 3IC5A 3JYPA 3OJLA 3DTTA 2D8AA 1DC6A 4Q3NA 5EMHA 5THKA 2IEDA 3PYXA 5DDIP 1E1MA 1BXZA 4DC0A 4HNHA 1BRMA 4NBRA 4R1UA 2D59A 3E48A 3F4BA 2ZATA 3QVSA 5A06A 1ENOA 4XGNA 2NVWA 1VM6A 1HYGA 5TJ9A 3GMSA 1IYZA 4H16A 1ZEJA 5G4KA 1PJSA 1NAHA 4EJ6A 1HE4A 2VT3A 2EXXA 2GGSA 3CZRA 1GEGA 4GVLA 1DLJA 2RHCA 1SAYA 2JL1A 3G79A 5IDWA 2YY7A 1E6WA 4R68A 3RC9A 4TKLA 4TRMA 3VPHA 1P1RA 4OAQA 3K2EA 3NDIA 1PU2A 3GVCA 1PSDA 4NU6A 2C29D 2VTEA 4OMUA 3GNSA 1CF2O 3GUCA 5KTKA 5KKAA 2C5EA 4I5EA 4W9NC 2DTDA 1GPJA 1UAYA 1ZK2A 5IDXA 1I0ZA 1T4DA 1WMBA 1ZXLA 2X9GA 2O3TA 3ONFA 3WGTA 2FRDA 1YQDA 5B4UA 3KLMX 1ZMOA 3KLPX 5TLSA 1AXGA 4E5YA 3C24A 1NVGA 2ZB4A 4RLHA 2D1YA 3VZSA 3CINA 3BMNA 2FR0A 1G0NA 1PJ3A 2E4AA 5B12A 2E37A 4J9VA 2QHXA 2O3SA 3MWDB 1LQUA 3WGYA 1FJHA 5CDUA 2ZB8A 3RUIA 1TVEA 1JU9A 4RF5A 4CLOB 4RORA 5JAQA 4BMVA 3WNQA 3PLRA 3RROA 1B8PA 1WPQA 3DDNA 2JFHA 4CM8B 2G17A 1WAMA 4QFCA 4FFRA 1GEEA 3UICA 4ND4A 2VQ3A 4QXMA 5I8WA 1FDUA 1ZXBA 3D7LA 4FJ0A 1Q1NA 5T57A 4MVJI 3E82A 2VNAA 1BVRA 2HKIA 1BVUA 3ROKA 1Y5RA 3NJ8A 3N58A 5I7FA 5CPBA 4PFJA 4CM4B 1R66A 1DPGA 4FSHA 1P44A 1P77A 1EFLA 4BNLA 3EHEA 4EI2A 4IS3A 4JGBA 4G5HA 3FNFA 4K28A 2HMUA 4PVDA 5A4DA 1TXGA 2O2YA 1XWFA 1E0DA 4BS9A 4R9SA 4BNUA 4GKVA 3M2TA 4DREA 4YAKA 2O48X 1JVSA 1GZ3A 3QWBA 2BRUA 3PHIA 3QE3A 3HN2A 1FDTA 3EUWA 3I3OA 3JQ9C 1XA0A 3K9QO 4N5LA 3JQCA 4OH1A 4R4JA 1NR1A 4H7PA 4XQEA 4C4OA 4DXHA 2OP0A 4YJFB 1KEPA 3LQFA 1SNYA 1PWXA 3PHHA 2B4RO 4RO0A 1YBVA 4GX5A 2EKQA 1NFQA 4JJFA 4ND3A 4NPCA 4Z6KA 3BA1A 1Q0LA 3JQ8B 3M1AA 5IAAA 3WDSA 5A03A 5T8KA 4R69A 1E6UA 4E2ZA 1LDEA 1N1GA 4RZIA 3CZMA 5KJEA 4YCAA 2DBVO 4K1LA 4NJOA 1JKFA 2I5PO 1EK5A 4PLHA 2OUIA 1CYDA 4GMFA 3JD4A 1EDOA 2FR1A 4KMSA 1U7HA 3CEAA 5JS6A 4KUEA 4W82A 4BHTA 1BXGA 4E3ZA 4Z9FA 1U5AA 3AY7A 3RFTA 3DQPA 1E3LA 3A9WA 2AEMA 1UZLA 2OL4A 1D7OA 2ZQZA 4J6FA 1F17A 2FR8A 1BMDA 1T2EA 4BNGA 3FPCA 4PLCA 3E8XA 4E5NA 5F1PA 2IZ1A 1M6WA 4TROA 2Q4EA 2Y93A 1CQIA 1JW9B 2HJSA 2DAPA 2B37A 5JYDA 3SJUA 4BO1A 4B4OA 4GGPA 2PGLA 2BH9A 1E1NA 2PTGA 4FFLA 1ADFA 4R5MA 3GEGA 4G65A 1H94A 2G76A 3P2OA 1MUUA 4MIYA 2O7SA 2DT5A 3WTCA 4YPOA 2X4GA 1MP0A 1BXKA 2PZMA 4NJMA 1MFZA 4CMBA 1PJQA 3ONEA 4IGEA 4RVSA 5HA5A 4BVAA 3WFIA 2VRBA 4LSWA 2VZ0A 3D0OA 5JXWA 4BIIA 1MA0A 1YKFA 4RVFA 3MOIA 1RM3A 1WDKA 2PY6A 2X9NA 4K26A 4WECA 3HFGA 3U4DA 4A10A 4U5QA 2GN4A 5CHEA 4S1VA 2BF7A 1NFFA 1JA9A 1EDZA 1V3VA 4J1QA 5CAEA 4WLUA 1FMCA 1ORRA 1EUZA 2ZYDA 3JTMA 3ABIA 2Q1WA 3AUAA 5FI3A 1YH3A 4HX5A 5TT0A 2PA3A 1ENYA 3H9GA 2VOEA 2IDZA 1S7CA 3S8MA 3E9NA 1QR6A 3MZ0A 3RJ9A 5T8KC 4F46A 2VWPA 4WEOA 3P5SA 1U28A 2I67A 4NFHA 3LT1A 3D64A 3V2HA 4LVUA 4L9RA 1NP3A 4J91A 5BSEA 1IHXA 3QWHA 2HQ1A 3ONDA 4P4LA 4J43A 1R12A 4DQXA 1B3RA 1P1IA 3OIGA 1TLTA 2Z1MA 3NTRA 1DHTA 3RASA 1VJTA 3GVHA 1C0LA 4A03A 1H9AA 3EMKA 5GY7A 5CDGA 3WGIA 1XU7A 5EINA 3ICPA 3PZBA 2RBEA 4FGSA 4OSPA 3IL2A 2JFFA 2GUGA 3KTDA 3C7DB 5JLAA 4YACA 4A2CA 1QG6A 4ZVVA 1X15A 4JK3A 2VOJA 3RVDA 3W4JA 2ZTVA 3HE3A 5L45A 3GEDA 3H2ZA 1TT5B 1YOVB 3WJAA 4WCFA 1KIFA 4NJMB 1W8DA 4BNWA 2IXBA 1MGOA 3GNTA 2R6JA 1Y9AA 2J5RA 5EIOA 4AJOA 3DB2A 4J4HA 4NI5A 4YBZA 2BGMA 3KEOA 1DAPA 5L3ZA 2ILTA 2GZ2A 3ON5A 4IZHA 1GCUA 3OQ6A 2RCYA 1ZH8A 2VZ9A 2NU8A 2GASA 3GAZA 2BGKA 4IUYA 2J3HA 3DWFA 4Q3AA 3ZU2A 4DIOA 4OIMA 1YONA 4II2A 1PL7A 3OQBA 1GV1A 3T7CA 2PK3A 3IP1A 1U3VA 1PJLA 3PVZA 2BFMA 5GZ3A 1PX0A 1Q7GA 3E5MA 1I01A 4AJ2A 4DBVO 1ENPA 4NK5A 3UF0A 1LDBA 4RLSA 4A7PA 2ZKLA 3QQPA 1ZNQO 1I3MA 4LMRA 4DPLA 4TRJA 3QP9A 2DPHA 1UJMA 1DJQA 3I83A 5BSFA 3HB5X 1ISMA 2ET6A 4NBUA 4NU5A 1M6HA 2BMAA 4D79A 4XEHA 3B6ZA 1YXMA 1BSVA 1NQ5A 1HRDA 4RQUA 4ZGWA 4JLWA 4WKGA 4YB8A 3PZRA 1LTHR 1ISJA 4FOOA 4XCVA 1D1SA 4U8GA 4FIZA 1LJ8A 3GF4A 5EQFA 1U2GA 3IQDB 3U0BA 3ZU5A 2NADA 4J0EA 2JAPA 5GZ6A 2X22A 5KKCA 1F8GA 3ZDFA 4IDEA 5JC8A 2I99A 1E1LA 1CIVA 2OBYA 4Y98A 1R4NB 4D0RA 4YRAA 1NNUA 4KDEA 1IHYA 2IYOA 3ZH2A 3EYWA 2W2KB 3ZWAA 1I5RA 1F06A 4I5DA 1E3JA 2BHLA 1VL6A 2UDPA 4FFMA 4BGIA 5C5IA 2CMDA 3FCOA 4XQCA 5L51A 5AOVA 3VZRA 2IXAA 4YR9A 5I7SA 1YVEI 1FXSA 1N5DA 4MKZA 3O8QB 2ZCVA 4OKNA 4R3WA 1KC3A 3K96A 3LVFO 3MEQA 3VC7A 2V65A 3H9QA 1SOVA 3VDRA 3K6JA 1ZSYA 4KWHA 1YB1A 1LBEA 2ZB7A 2O3QA 1QYXA 1R15A 3EW7A 1NVMB 3N74A 3HUDA 4PG7A 3FWZA 2PH5A 4UEOA 4DQVA 5F1KA 4QFDA 1ZBQA 3E9MA 1B26A 1VL8A 2AQ8A 4XZ3A 3TSCA 2WD7A 4KDFA 4OKIA 1XGKA 4JN6B 5ITVA 2B36A 3F46A 3TFOA 1P31A 3TWOA 5KVVA 1CDOA 1OOEA 1ONPA 4IXTA 3GDGA 2GN8A 4J90A 2Q1SA 4WASA 3ZW9A 4YXFA 4XIJA 5L53A 3GNQA 1F14A 1MV8A 1ULSA 2C07A 4IZIA 2X0IA 3JQFC 4TRNA 5IG2A 3HJAA 2VRCA 2A9FA 4F3YA 3I4CA 3ZV6A 5MGBA 4E13A 3ORFA 3KHUA 1DC3A 2X5JO 4BGVA 5MDHA 1QYVA 1E3EA 5U4QA 1J6UA 1NVTA 4UEKA 2HK7A 4DMLA 4PN3A 1EFKA 4CM9D 1LI4A 3JCZA 4NFSA 1CJCA 2FMUA 2PLAA 4ESOA 1Z7EA 1AN9A 2EW8A 5JC1A 2X23A 1SB8A 2C7VA 3DAPA 2UAGA 5EL0A 4OQYA 2BFAA 1UXHA 4UVGA 1TT7A 1ISHA 1LU9A 1ISFA 3GT0A 1B8VA 1ZSVA 2NQ8A 4CQMB 3DC2A 3T4EA 3KSUA 1VLLA 2NACA 1L7DA 3FNEA 3GRKA 3TF5A 5A5EA 2WEKA 2Z95A 2OBNA 3RKRA 5G2OA 5G0VA 4UEJA 2GZ1A 4LK3A 3PJEA 1UH5A 4EGFA 1OMOA 4IM7A 1QSGA 2DBRA 5DCWA 3WQRA 1OFGA 1ZKMA 3NEPX 1EEHA 4BNVA 1X7GA 3BMOA 3JQBC 4YJGB 4DYDA 3O9ZA 4QT0A 4BMNA 3RSHA 4CMHA 4CM4A 4CM6A 3OM9A 4B79A 3PK0A 1Q7BA 4BO4A 3CH6A 2GN6A 3UGKA 3JQ8A 4AJNA 5TQVA 3KXDA 2EJWA 3F5QA 4FPXA 2R2GA 3D4OA 3VPGA 4GX1A 4M87A 3WGQA 4MKXA 1HT0A 3WSWA 2W90A 4EYEA 1U3UA 2FZEA 2PD6A 4R41A 5T67A 7ADHA 4ROSA 1UP4A 3SVTA 2X58A 2Y1GA 2CF5A 2I66A 5DN9A 3KYDB 3Q2IA 3WLFA 5JY6A 4ALJA 3U4IA 4JIGA 4NR0A 4XQGA 4B3JA 4KP7A 4E4YA 5CG2A 5KWEA 2AE1A 2OXIA 3LC1O 4OHUA 3ZWOA 1U3WA 3OICA 4BOYA
chains in the Genus database with same CATH superfamily
1FS6A 5GM2A 3T9DA 2OGUA 1Z5VA 2XIJA 4RD3A 4A1FA 1FMLA 4NONA 5DRTA 1XPRA 2O8BA 3VNVA 2JIZD 4MRAA 1W36B 3EXHC 4G36A 2HZBA 4M49A 5BR1A 1X80B 3R7DA 1FMFA 1EG2A 2IV2X 1JN0A 2G0TA 2YDYA 3MNFA 2ROQA 5CRIA 3LX8A 3RLIA 1TM7E 5ADHA 3NEJA 1Z5WA 2R6DA 3ZWBA 2R1UA 1G8PA 4HF7A 3L0CA 3VBEA 4EQZA 2AK2A 2R48A 1QRDA 2RBKA 4BNXA 2GHRA 1DWPA 4ZQFA 3FYUB 1GAQA 3OZEA 1Z0JA 1WVGA 3THWB 3NYRA 4JROA 1M5TA 3KZ1E 2Q5HA 4OD0A 4ENPA 4C3UA 4C07A 1PNRA 4EKGA 3DO8A 1N1MA 1WTAA 2YOGA 3FH0A 1ZG3A 5BW6B 1RPTA 1J8QA 1PLLA 2Z3VA 1G2PA 3HABA 1Z25A 5LC1A 4AJ9A 2PIDA 2B1GA 2AKEA 3K0KA 5AKLA 3OEWA 2XNCA 4IWYA 2G3YA 1E58A 3X0DA 1L7AA 1FK8A 4HVAA 2C4HA 2AI2A 1KZYC 3AONB 2YY5A 2WZBA 2HNBA 2H1SA 4EZIA 3DKRA 5MN6A 3DOHA 4M1QA 4BNTA 3QWFA 1SURA 2GRUA 2CMHA 3P4YA 1RBQA 1G8MA 2ERYA 4KWCA 5JARA 2ODWA 3D6FA 4KK4A 4WY5A 1SUSA 2VJDA 4JH0A 1QQTA 3VVCA 3KP1A 5REQB 2ONYA 2W7TA 4EB0A 1QRTA 2B2CA 1XF9A 1BCRA 2ORIA 3K3PA 4FB5A 1V8ZA 2IX9A 2WWHA 2FQXA 1QYRA 5IASA 1CB0A 4FN4A 4Y6GB 4MTLA 3HBJA 5AI8A 2G1PA 1KVQA 3WR5A 4OGGA 2F9LA 2XEXA 3M4YA 5G0WA 3PUIA 1XZIA 1C4XA 3EVDA 5BMVA 2YIMA 4UVEA 4B7CA 1FYVA 4YJ2B 1W6UA 2R4UA 3IIEA 1JHZA 1QH0A 2AJCA 1GZUA 1WCYA 4J7XA 5DMXA 1EQ2A 2HSZA 2WIFA 1AY0A 1L5ZA 3OCZA 1JJVA 3B8HA 2BLNA 3Q9LA 2ZRGA 4Q4CA 4KI0A 2FX2A 3F6RA 3M5CA 1MIOA 4K6GA 4YYZA 1J20A 5HXAA 2RIPA 2WILA 3HKEB 4XWOA 2FZVA 4REOA 4M89A 1JLMA 1E1RD 3TPFA 4EY5A 1KR2A 1VLVA 2A3NA 3PA8A 3JSXA 3LOUA 1FW6A 2ZYVX 3HFSA 4NYIQ 3DVQX 4IGIA 4JLAA 4QXRA 3DFMA 2FF7A 4U5XA 5LLTA 2C82A 2XZDA 1A69A 3FVVA 5JALA 3W9SA 3X1KA 1J24A 4I08A 2J85A 3TGPA 2G82A 5J23A 1YA4A 2IE0A 3IGFA 1ST3A 1NUUA 4NBTA 2ZUTA 2H0QA 4HNRA 4RLFA 1HK7A 1VDZA 4ASUD 1UM8A 3LPAA 1PS9A 3PSAA 3HNOA 3MJ4A 3PHGA 3T7JA 3LHFA 3PXEA 1QIDA 1QHGA 3FUXA 2DMRA 2WAAA 3R23A 1KO7A 2PX8A 4HAOA 1AQYA 4E6PA 2I76A 1KMQA 5KVSA 4QLOA 2ZRBA 1GXSA 4MDHA 3FGOA 4QO7A 1CUYA 1PJ2A 3T3HA 5TQ2B 1JEEA 4BVHA 3EEIA 1P2TA 4NYMQ 2QI9F 1N78A 3AEUA 2EX0A 1RI1A 1SHTX 2FPGA 2RGNC 1N0VC 3FSRA 4Q7JB 2IHZA 1KZ6A 1T8WA 3E3LA 3MJDA 2W4IA 2YWFA 3EQ9A 5AXDA 1GFSA 2CLKB 2Y2UA 4X3CA 3CNOA 3Q7EA 2FSFA 4PLTA 4FVTA 1YQTA 4I2NA 4B31A 5AVVA 2MYNA 3F49S 4M55A 3ZLUA 3ESAA 1AS3A 1R88A 2EFDB 4L8YA 2BY4A 2NUTB 5B58C 2G7MC 3Q7SA 1PUXA 2VJMB 4BJ1A 4MVWA 2BAGA 4AFNA 1Z6ZA 3OEYA 2WUVA 1Y3FE 1RAEA 3SD7A 5JS2A 1IE3A 4YMSA 3FTCA 2RGYA 1LNQA 1ZL0A 1VA4A 2IDKA 5CNJA 4G2TA 3EVNA 2D00A 5DB4A 1WY5A 5BQFA 2H5JA 3CZQA 3DPSA 3LUBA 2C3MA 2QRVA 3DKIA 2V8BA 2YOHA 1QFYA 4ZALA 1TQ6A 3D5QA 4M1MA 3QOFA 2XCQA 1OT5A 5DM4A 1G9TA 1EXVA 3EJ6A 2DPMA 2D5LA 2GEKA 2J87A 3F90A 4PR0A 1PBNA 4BTVA 4MQEB 4L4SA 4XJSA 3ORHA 2BM9A 5CTAA 4QYIA 2YYZA 1E6EA 3QJ5A 1X7ZA 1QRUA 3RYFA 3HWSA 5HVNA 1T26A 2JIMA 1A2OA 4O4IB 5L3VA 3UWPA 4GYJA 2FUEA 1ZJYA 1B8UA 4YO8A 1OV4A 2WJGA 2X1VA 3IUEA 1AKTA 1TMKA 2ZEJA 4IMIB 2CFOA 1R1DA 1W73A 3BD9A 5HJ2A 3OZUA 1R50A 1KI6B 3A1SA 1O6GA 1PLKA 3H87A 2J0VA 2O7QA 2XUDA 3PCXA 5DTMA 3V1LA 3U60B 1MTOA 3VPCA 4KPEC 1D1PA 5FL7A 4RPHA 3HXLA 3UV6A 1CE8B 3FOWA 3A9VA 3TSYA 5IJAA 5GJCA 4QXOA 1VJCA 3A7DA 4BQRA 4EG7A 1I7DA 2RI0A 5FOQA 2W0MA 3LT2A 4QUAA 2WTEA 3RYCB 3L7CA 4AVYA 1X7YA 1B16A 2DECA 2IBSA 4QFBA 4WLVA 4ZVQA 1U8YA 1DG3A 1T0UA 3OQNA 3AOEC 3HJNA 4MLZA 5TARA 5DSXA 4I55A 2NXEA 1U5BB 1E89A 1I5EA 4ZCLA 5DOVA 4OQXA 2YCBA 4C88A 3ER8A 3LXUX 1SUPA 1E96A 3II6X 4DCNA 5CDHA 3E1KA 4OSOA 3TL2A 4W1QA 5GVSA 1Y7LA 3C7CB 5F1YA 5I9MA 1T9KA 4EUFA 1HE5A 4XYGA 2V6BA 2HWKA 3C6BA 2AMVA 3VU9A 1P7YA 1RM0A 4LJRA 1O95C 2R00C 2XB9A 4QBIA 2WFLB 1QTRA 4BQEA 5KYYB 2I91A 3U3MA 2WU3A 3I6IA 4HFJA 5ALWA 4DGSA 4YT2A 1E4OA 5IUJC 5JANA 1ZVVA 4BLVA 1CF9A 2AFIE 3HEBA 1JPNA 1NSFA 3ESCA 4BO3A 3UB4A 2ANBA 2ZIZA 2XCSB 3IQEA 2GHIA 1KY3A 4R2WA 4X60A 3LC7O 4HGNA 1ECPA 1XDSA 5FI1B 4YRPA 1G18A 2DOKA 4N6OA 4GKBA 2E9SA 4OBWA 4WKNA 3P9YA 2SKEA 3ZHBA 1YRYE 2P7IA 5JAUA 3M0EA 3PEYA 1XDZA 1P5JA 1REQB 4TXNA 3WTCA 1E5VA 4EJMA 4PC1A 6YASA 2LVBA 5HR5A 3OPYI 3RI3A 1I3CA 3H4IA 5THQA 1DP4A 1KVTA 1BVYF 1HTTA 1A82A 2ZJFA 2R25B 3S8YA 1L4FA 3EZFA 2YNMA 2RAFA 4YO7A 4E33A 2GKSA 3GV0A 3M2PA 1AXEA 2FGKA 4DLNA 5DZSA 3B5IA 2DXIA 3D6HA 3F1KA 1KAMA 5TMBA 2UXBB 1FSSA 1GZHB 3I2JA 3WDKA 2IIVA 4WFQA 4EY6A 1GDHA 1U0SY 1WCIA 2Q9UA 4YJKA 4PLVA 2JAOA 3FJ1A 1N2GA 4UBKA 3REOA 5HJ7A 2WQ7A 4GLOA 5EVCA 4RMHA 4MWBA 1JE1A 3RUCA 3AVXA 2XUFA 2HXYA 4ZOLA 2JGDB 3RW9A 2ZIGA 2Q50A 5EJ2A 1OFIA 3ELWA 5KSOA 4UUNA 1EFHA 1E79A 2FZ4A 3N05A 4FE3A 1LSSA 3MQFA 3PC6A 4HAUA 2KBEA 3E8MA 3GWGA 4RX1A 3BT7A 2ZIVB 3IAXA 3EB9A 3ETEA 3QVLA 2EKDA 3R3WA 1AHIA 4R9VA 3RBAA 5BWOA 3I9OA 3ZV5A 1J7KA 3M1YA 1ETUA 3QU7A 4W5JA 4DPMA 4AF7A 3KYCA 2GKOA 1Y3CE 3DR3A 4NZOA 3RS8A 5K05A 5KINB 2RIRA 4ID9A 2YHIB 4BLPA 1LV8A 1HKUA 3BM5A 4BKMA 3NASA 4A91A 3BTOA 3LYLA 3C4VA 3GQBA 1O7JA 3ETGA 3NYQA 4GL2A 2QYHA 1JMYA 1W94A 1E2JA 2Q6TA 1CC1S 3CWCA 4YH1A 1XO1A 4YV2A 1NUSA 2XIQA 2YMPA 3U62A 4X62B 4DYVA 1LH0A 2VUTA 3OUZA 1C3VA 2J9YB 3K5PA 3PR1A 4M2LA 1NKSA 4TMFA 1LLQA 3FZYA 4TS9A 3QPCA 1JQKA 1G66A 2PSFA 2RH5A 3RIHA 3VRHA 4X85A 4ZT6A 1UZUA 3IAUA 4NBVA 2C9YA 4N1AA 1ORIA 2BCJQ 3G7UA 4B6OA 5CA0B 3HJUA 3OZXA 4GZMA 3TDNA 3PNPA 4G4GA 4MQFA 5BQ5A 3H65A 3LY7A 1FL9A 3NI2A 1Z8HA 5AXAA 1O6BA 2ZE6A 3GZNA 3OJOA 2R96A 4ENSA 4GKKB 2X6RA 2YOFA 1WXEA 4KYIB 1VHQA 3FPBA 4JLVA 4BAGA 1V9CA 1G8GA 4REQA 4TN5A 4UDXX 4RYDA 3A6GA 2E55A 4FZVA 3G9ZA 4J76A 3SHVA 2V6FA 2CDRA 5FUWA 5LZ2A 3SBXA 4KXVA 5CFNA 1T0JB 1TEVA 3AJRA 3B6JA 4BLUA 4G25A 5AM5A 3H8VA 2IP1A 5H59A 4MUBA 1XLTA 2VKTA 3AJEA 3N2GB 3SYKA 2HK8A 3LX6A 1PSWA 1HDGO 2OHHA 3EF1A 4J9UE 1GM5A 4RLQA 1N7HA 3FFXA 1C3OB 3H1AA 3WL8A 2PD3A 1Z8DA 4LFAB 3IEMA 3KE9A 4JT9A 1R6UA 1X2BA 2GPJA 5EPEA 3OG9A 3I9NA 1CUUA 1WMDA 2R84A 1ETHA 2RHLA 3PFHA 1DIHA 3LXMA 2XOKA 3VKFA 4C0QC 2ZQYA 4TXJA 4N8DA 2AW5A 2J9RA 3AEKB 4BNDA 3FDXA 1RRGA 3STHA 1RI5A 3LC2O 3R41A 4QBFA 2PUWA 3IP6A 4HLDA 2ZJ3A 3PDHA 3ADPA 5B6PA 3IS3A 3E6AA 1GCGA 3JARA 3QUQA 3DTVA 2QTWB 3ZDBA 1K8RA 2ETVA 1F3OA 2C5BA 3GBPA 1ORTA 1VCIA 3QM1A 1I24A 4MWZA 1G5PA 1MX5A 2DQZA 3RKUA 2DPXA 1K3UB 3ZS8A 4BVGA 5BNTA 4D44A 5JO0A 2PGNA 3FPEA 3L4SO 4V0SA 1OAOC 2O2EA 2FOXA 3FAZA 1GAWA 3PRYA 2VT2A 4MIOA 1U2EA 1GKIA 1UIMA 1A72A 1TUIA 1Z07A 2HIGA 2VIIA 3BHNA 3BJRA 4L0DA 1MC4A 2HA0A 3QZUA 4IO0A 5D7NA 3U3OA 3FNGA 4I6EA 4RZSA 4YP5A 1ARZA 4KQ2A 3ANMA 4XCXA 1O6CA 1NOJA 3AB7A 3CF2A 4ZRMA 3GAMA 1ZH4A 1SIWA 4Q1VA 3QV1A 1J09A 2C8LA 2ATXA 1YVRA 3IAFA 2DTEA 1VHTA 4QVIA 1UXGA 3C85A 4UAVA 5DE3A 4KSYA 3E0QA 4JI2B 3TQSA 3F6YA 1GZ4A 5FWAA 4US1R 2CCKA 1R10A 3AEXA 2BFOA 2HD4A 1DQYA 1NT2A 1RAHA 1CT9A 2P9JA 2CLOB 3FNRA 4RZQA 1P80A 3NDJA 2DR3A 4DXAA 2M2IA 5C5CA 1UBLS 1H5QA 3UGQA 2VH1A 1E1CA 4IVRA 1NUHA 4O1MA 4P33A 4MR9A 4TMTA 3WISA 2WIBA 5JHHB 4K6CA 3RRMA 1ZISA 3ANTA 3RT7A 3S4YA 2CBXA 3L8ZA 3N6RA 4EGQA 2Z6AA 4MCJA 2L0XA 2NV2B 3QBEA 4ZDIA 1KI8A 3K4PA 2J0SA 1PQUA 1O5OA 2PUHA 4FCCA 1I7LA 5BYKA 1KEEA 2Q6KA 2BGTA 4WOCA 1QVAA 4PO8A 1BW9A 3J7TA 4Q00A 3SZOA 3CVJA 2O0HA 3AYXB 3DOOA 3PEEA 1M2OB 4MWTA 1HT1E 2LTAA 5LCXA 3R8XA 2KPOA 3AUFA 3RRZA 5A4JA 3HCFA 1FFGA 4TMZA 4M4SA 1B2RA 2J8ZA 2A4MA 4ABTA 1E1YA 1AQLA 5KMGB 3HVUA 2DSTA 4P5EA 3U7EB 1TTPB 3MHTA 4OAOA 2BMWA 4G5GA 3ETDA 1YCDA 3O8QA 3STUA 1C7IA 3PGJA 4NMWA 4B5LA 2NSYA 3ET4A 2C1EA 1Y6QA 1JLHA 3PHLA 4BQPA 1Z7BA 3VPSA 3CV3A 3LLCA 4TWIA 5FTMA 3CMMA 2BTQA 4IF4A 1L4NA 3BL5A 1WCIB 3FKSA 2HMTA 1C41A 1CJVC 3PG5A 4L76A 1YJ5A 2MMGA 5BSHA 3HJBA 1JFRA 5KDLA 5JEDA 4DC1A 3EIUA 3LYUA 1VLJA 3IO5A 3S44A 3HZHA 1FNCA 3R9WA 1NWCA 1NJSA 5KDDA 2DWQA 5AI5A 4PGMA 4G9GA 3NM6B 3FRIA 4D96A 3RJZA 1YHZA 1O9GA 3NT4A 4HI0E 4UU0A 5CD1A 2B6NA 2VJMA 1W5EA 3S29A 1I7SB 3SIWA 1FTWA 2EYQA 2VT7A 3UMSA 1GPNA 3DMTC 1JJAA 1RS0A 1Z5ZA 2Y9PB 3AG6A 1HZZC 1FDOA 4LOKA 2PGOA 3R1IA 4L3OA 5EI5A 1SBTA 4FGJA 1Y8ZA 3ZNOA 2XBUA 3M6XA 3MC1A 4WZBB 5JH7A 1SKYE 4QVGA 2EX4A 2ATIA 3QPVA 1O6FA 2C58A 1FTQA 3BZBA 4A27A 3RQSA 3H6KA 3TKYA 3CJQA 1E62A 1HXHA 4AKIA 1V9SA 3SOPA 4P7FA 1NTOA 1V6CA 1IEWA 1MMFB 3LP5A 1WU7A 1JG2A 1Y1SA 2EF1A 2NSDA 4U6NA 3LCVB 4YCLA 1F1JA 4LXXA 5FEUA 3IURA 4EX6A 3KB6A 1DWOA 3COYA 5EWLA 3WADA 3CF6R 4KXNA 1AK9A 4OJNA 1PBTA 2EF0A 2XNHA 3FGZA 3WGVA 2IHNA 3RVSA 1US8B 1FFCA 4FW9A 4MI9A 4OHOA 4OHMA 2JLVA 4H0NA 4F4UA 1NSTA 3O91A 4FONA 4JVLA 3AHDA 1E99A 1SXJC 3RQIA 5KTNA 1E7RA 2P65A 1EP9A 4LN1A 1Q1GA 1TZKA 1WG8A 2J07A 3CRQA 3K1JA 4RCYA 1XRPA 3PIIA 3EUFA 1E0KA 4X92A 1QLJA 2CJXA 3C3CA 1PW7A 2C04A 3ISVA 2Y1EA 4LISA 2DPGA 4MV0A 4C0WA 2A0KA 1RQPA 2CXSA 1GGNA 5JQGF 1QE3A 2E1RA 1PT5A 2PS3A 5BXQC 4EJFA 4JENA 3OBIA 4XLZA 3GUYA 4OGFA 4E14A 1QG4A 5DGCA 4HB0A 1UL1X 2R1TA 4MW1A 2WAYA 3DWGA 2WUGA 2ZRMA 4LI3X 2YRFA 1QIMA 3PDJA 2WZQA 4ZN6A 4JKIA 3JVEA 5M2QA 3KAJA 1GT6A 3H99A 1DAHA 1FX1A 4CKCB 3FRJA 2ONJA 2GSWA 3G2OA 4UMVA 2GDJA 3FB1A 1ZU5A 2R6FA 4UJ5A 3V2UA 2XUGA 1HDIA 4CEJB 6LDHA 2AEJA 2O0LA 2NZWA 2FMKA 1G6KA 1G42A 3G0BA 3D1JA 2VO1A 3B2NA 3L4EA 5E1BA 5F2OA 3KK0A 3KQKA 2YJZA 3PQ2A 4ER0A 1P9NA 3TZLA 2BONA 3M81A 4YBRA 1W36C 1KVUA 1O96B 2IDJA 3B6EA 2I3DA 4DV5B 4Q3DA 1RBZA 2CNKA 3OZFA 3P2EA 3KL4A 4AJPA 3FF1A 1SIOA 1MJGA 1GLNA 1T15A 4L22A 4W6ZA 3RO7A 4P0QB 2QRVB 4RKQA 4RKRA 4XA8A 2ZR8A 3AUXA 4MUIA 1RC8A 4NMLA 1V1MA 1YWGO 2XWSA 1C4WA 5I9BA 5GMOA 1ADJA 3CX7A 3ZCRA 2PIAA 3H16A 4EEZA 5LB2A 4IXMA 3DNPA 4GX2A 1GYQA 1XN4A 3NHYA 1QHEA 4WA7A 1VG8A 1HBJA 3A9RA 1RPZA 4EA6A 3BFVA 1XHFA 1ZO8A 1F4PA 4LZJA 3ANSA 2IP4A 2FOIA 1P2SA 3Q12A 4CZ2A 5DGTA 1NG9A 1IY8A 3VR3D 1EKXA 1T2NA 4L8VA 4RFLA 2CL5A 1H3NA 3A6HA 4XQ0A 3NU1A 5DTRA 4KQWA 4O3FA 3VR0A 4A3SA 1W85A 4JP2A 2R60A 4DMFA 2AEFA 3ETNA 3SC2A 1M67A 2V7GA 1UJNA 2AE2A 3TOVA 4QG3A 1QNFA 4EHDA 3RYHB 3AEUB 1RM5A 4N5HX 5DWDA 4RHTA 4WL0A 4NMMA 1Z4PX 2IU4A 4E70A 2Y1FA 5FUXA 2DH6A 5DM0A 5KC8A 2X15A 3VDMA 3WLIA 3WNDA 2DQ4A 1U9IA 3MSXA 2EFJA 3FE2A 1JTEA 2OAEA 4P82A 1BXRB 4G37A 2K2WA 4PG5A 3UENA 1YZNA 4CV1A 4E07A 3EODA 1WMAA 4UPDA 2AJ8A 3IR5A 3QELA 1R3DA 4CLHA 5KOJA 2VYCA 1M1UA 1Z6AA 2AFHB 3TLBA 5ICMA 4AKSA 2OOSA 2PYIA 4LGCA 2A30A 1X3SA 1U90A 2VHXA 3AJDA 1V9LA 4BUZA 2YWJA 1L5WA 3T4UA 3R9XB 3F0TA 2C0CA 3B3GA 3GH1A 4CM7A 5BV0A 4BEVA 3TEMA 2IEIA 2V59A 2RG1A 2HQOA 2L18A 2Z08A 4YJ2F 5DBGA 4EZBA 2PL3A 4KQXA 1VZ2A 5AKGA 1NHGA 2WFAA 4WBNB 1GY8A 1UBJS 3SYNA 2I9KA 3MM4A 3PUVA 1JDUA 1LY1A 2A5LA 4BN0A 3JQFA 1JH8A 2VJLA 3IAEA 2O3UA 1ZJWA 4B6GA 1WA5A 1MB9A 3DM5A 2NN3C 2PL5A 4W6QA 4F93B 1M34A 4YCSA 3CVUA 1USGA 4XUEA 3F8SA 2V9ZA 5FL3A 2CXHA 3JWEA 2XD4A 3IRVA 1ZUIA 2D0OB 1UBRS 4RF4A 5KU1A 3CTMA 1O0SA 1OFUX 1LBIA 4KZPA 4MVJD 2ZUDA 1YL5A 8ABPA 1QIEA 3AY6A 5SZKB 3KKMA 3EY9A 4D4MA 1UFQA 2NW6A 3N0RA 4DR5B 4PYRA 3KVYA 3L0BA 3U1VA 2FUCA 2O52A 1PGPA 4OQ4A 5BRNA 4PZAA 1EX9A 2O2DA 2ZSEA 2JJ2A 2Z83A 3EGDA 3R75A 3WGMA 3WYEA 4P3NA 4B2IA 3G88A 3RVKA 4A16A 1CEXA 3GFQA 3WNVA 4ZI7A 1I51A 4U2BA 3I8XA 5D2CA 4LGYA 3SG0A 3TJMA 2ZIFA 3I04M 3V8MA 3VA7A 2F1IA 5DIFA 4AROA 7AT1A 2JIOA 1RLIA 3GFRA 1OH7A 2IPLA 3BPSA 3WBFA 4CMKA 3BIOA 2ZAGA 1F60A 3TN7A 2X0EA 2HNAA 2YW9A 1NI4A 4GI2A 3ZKWA 3O84A 5AM3A 4M8SA 4CM3A 4KNVA 1UDXA 1Y6ZA 4PLWA 3PICA 4EAQA 5KNBA 3NQ41 2FFJA 4KW7A 2ZITA 2IU6A 3AETA 3COVA 4UTZA 1KJ9A 2AFIB 2MHCA 2OQIA 5CJPA 2YNMD 2RBGA 4NU0A 4DARA 5I8PA 1B73A 4BO0A 5CVEA 4OBXA 1D09A 3RHTA 3O1JC 3AFNA 3WRXC 1L8AA 5TQ0B 4X1OA 5AW5A 1NAIA 2NM0A 2HV8A 4KO4S 1LFDB 2ORWA 3EIEA 3GCGA 1P9WA 3WBKA 2JCXA 1BE0A 4RVCA 4EFDA 4H7IA 1EX6A 1IOVA 4A2QA 4IXWA 4XVHA 4CE6A 1NJ2A 2PS9A 1DCMA 4TQGA 4X64B 2M98A 1CUIA 1E6CA 1OBOA 2AFVA 2R5WA 1DOAA 2N47A 3MAJA 1C1DB 1UBUS 2ISQA 1OZ0A 1NC3A 2UVDA 4DN6A 1WE2A 2JBHA 2QW8A 2HF7A 4CLEA 4Z4QA 5DXAA 1SQSA 1NPTO 2C57A 1OXTA 1AO3A 1XTQA 4KE6A 4NIMA 1RMYA 4KO3S 2BI7A 4D25A 1AK1A 5EYPA 4KBGA 2ARKA 4RADA 1H2RS 1EJ6A 1YB5A 2Z09A 1IG3A 1GN8A 3CLRD 2XRFA 3KJIA 4XJVA 1DFIA 2O0JA 4OMFG 4S2EA 1YR7A 1ZK0A 4ZIRB 2XHEA 1MR3F 1R2QA 2ZSUA 3H3XA 3UATA 5KTSA 1EUCB 1Y1QA 2ABWA 3RS9A 1P2GA 4YRDA 4KMOA 2OOKA 3VSDA 1B6SA 1Z0UA 4J3FA 4S3MA 5C8YF 4J1TC 5FNVF 5CA0A 4UVDA 1GP2A 2IZ5A 1WNFA 2PKRA 3MWKA 3VR2A 2WJJA 4CMGA 2ZJOA 4R16A 3VOSA 1GPBA 2O54A 4JOCA 3UMGA 3O4VA 3FRHA 4DV0B 2OXTA 1RPJA 3L92A 4A0QA 2QP4A 4XQ9A 3D4NA 5B3JC 3ICVA 5K8LA 4Z0TA 1AUPA 3AI1A 4LS3A 3NHWA 4JP5A 5C32A 2DGDA 2H63A 4MW7A 3L1IA 1IM2A 4JLNA 3E4DA 4XB2A 2IV7A 4LG1A 1UBMS 1NN3A 1IATA 5CP8A 4HQ0A 4KE9A 1GR1A 5IX8A 3JQGB 3GRPA 2BF4A 2O20A 2OE2A 4WCVA 1EUCA 5ALQA 1ZKDA 2QLTA 4ILEA 5PNTA 3TDKA 1GQ2A 1NW5A 3USES 1JTFA 3RRBA 5DV9A 3DQZA 2ES4A 1CX9B 3PKIA 3H17A 3KOUA 4ZWNA 1U81A 1CP3A 1IZZA 1HZZA 1QH8A 3KNZA 4KQKA 1G17A 4PGAA 2QRNA 4QULA 4GM1A 1JHMA 4MYTA 2NUPB 5E4TA 4ESVA 1GCOA 4KJXA 1E6LA 1Q0HA 4HV4A 4CKCA 2B8TA 3KQUA 4CHTA 3TSZA 1GGVA 3ZGLA 1Z56C 4TKUB 4Z49A 4UDOA 2D54A 3FCXA 4DBZA 2HR1A 1EAMA 4JB3A 2X2OA 4C4ZA 2W00A 2CJWB 1N5OX 3FCCA 3VPFA 4B4UA 1VJ1A 2ZI6A 3PXDA 4JEUA 5FO1A 4BZXA 2YY6A 1MNAA 3PNBA 1QAMA 2A3RA 5D51S 5DBFA 1A9YA 1UPAA 2O2HA 4BQFA 1T5OA 3DHVA 4RK4A 2IW1A 1XMIA 4Z5XA 3EFBA 1G6OA 1E59A 1CERA 4YI5A 1KOJA 2NTNA 4MLPA 4ZYXA 5AKKA 2HSDA 5GGXA 4L4UA 1ML3A 2JBWA 3L7KA 4NHOA 1R9JA 3QX8A 2EC5A 4QDTA 2NPOA 3V4LA 4MGZR 5K7SA 1JHAA 2BDUA 3V2IA 3T35A 3EZLA 1DRVA 2ZDQA 4A6DA 1QCYA 2NPIA 1Z63A 2W2TA 4TZ6A 1N2CE 2BGIA 3H13A 1IMOA 2A0UA 5BN4B 4BB6A 3OPVA 4UHHA 1IHUA 4HGZA 3FETA 1LK5A 3NJ4A 2ZU0C 3LUPA 1KP3A 3ZNNA 2FSHA 4URFA 3R3XA 2QDXA 5K2MA 4HO1X 4D9FA 2WD7B 4NJEA 4CKWA 4AG5A 2XNJA 4HDRB 5CLLA 1JQ5A 1L8QA 3OJ0A 5SYAA 6ADHA 1JR6A 5BSVA 2I3AA 4P80A 4HYQA 3C70A 3DHNA 1KJNA 3CEJA 3KPJA 5TEVA 1DTSA 3LQYA 3K72B 4V2UA 4IINA 1A7UA 4MULA 3T34A 4D3YA 2WFLA 1Z34A 3RUDA 3NDRA 5KYYA 2FPKA 2KI5A 4R8KA 5AJXA 1PR0A 3NKLA 2JB9A 1RXEA 1ZHFA 3GRFA 3EISA 3BJMA 3HL0A 2QUHA 3L0SA 4JBYA 4YCBA 5F77A 3SLGA 2V96A 2QJTA 3TW4A 1OB5A 3K2IA 2UZ1A 4XD2A 3DDHA 4N18A 3UGJA 5BWBA 1AQ6A 2WG1A 4JWTA 1K8YB 4UBJA 5EZSA 3RC1A 3WICA 3FUVA 1DT3A 1XJCA 1XLUA 3NTOA 1XYGA 4K03A 4WK0B 4ZOCA 4G4SO 4BVKA 1Y81A 1EA5A 1UQRA 1ZMTA 3V1UA 3E9ZA 1BD4A 2Q0HA 4DZRA 5K6AC 4Q9NA 3EZXA 3CHYA 2TS1A 3MB8A 5EJ9A 3HM9A 4FM9A 3UWKA 1WBDA 3RHFA 3WP0A 5KI6A 4YUVA 1R4NA 2MR5A 4U7GA 3P52A 4PTLA 2F9MA 3HFJA 2Z2XA 2QVGA 1PS0A 1Y3BE 4BMSA 3AUJB 1N6RA 3DFUA 5EUQB 4FYKA 5DEIA 3ZHUA 1E8MA 1M83A 2FZLA 3IPCA 4ZVRA 1SWVA 3ZD6A 2I4NA 2JASA 3O8BA 2WB4A 3AXTA 1JDSA 3PJRA 4TVSA 5DNDA 5F3WB 4OKSA 1LPOA 2H1WA 4DQUA 5KYGA 4OPMA 3QENA 5LKRA 3HU5A 4YRCA 3EXG2 2G5CA 4Y0NA 5JD3A 1Z0DA 5EJEA 2G7ZA 2RHTA 2PXAA 1FDSA 4TLCA 3HXTA 4TT8A 2ZANA 4HLCA 2A57A 1G8JA 4RE6A 1X7ZB 4C4PA 4BMOB 2VP2A 4FQ8A 3UW1A 1E20A 5GGYA 5JPCA 2OEPA 3ICQB 3EIOA 2IJGX 3OIUA 5FUBA 3C8UA 4RD2A 4JI0B 1EXDA 1IOLA 1JPJA 2X0FA 3RAGA 1SBYA 2WSLA 3IIMA 4HUQA 5B3LA 2QYOA 9LDBA 4ZQEA 1DU4A 2FG5A 4X20A 1X8KA 4JBNA 3NG1A 3ZY4A 1E8DA 4N9QA 2I6XA 1VCHA 1F8XA 3PT5A 2GF0A 4X8OA 4F5DA 1JBEA 3LWNA 1F4LA 2XXJA 4RNCA 2D5AA 2X19A 3EYAA 5I7EA 2JGEA 1GTMA 1W4ZA 3Q9NA 3ZH9B 1D2EA 4INZA 4JQCA 1XYVA 1JIKA 5AM0A 4D6PA 3MT8A 1JAXA 2GF2A 4EARA 3MJFA 5IH3A 2JKZA 5HG0A 3H9CA 3V55A 4ABYA 3OZVA 2RC6A 5SY4A 1O4VA 4DWOA 5FI0B 4ROTA 1KO5A 1H2AS 3WV4A 4RPJA 1IY0A 1FEZA 2KBFA 2MOKA 1X13A 1X14A 2QR5A 2XOEA 4NMHA 4C7OB 4TWZA 1WD7A 2FZWA 4B3SB 1DEOA 2QYSA 2M1ZA 1FZTA 3SX0A 2ZUVA 1YBHA 3IKVA 1Y63A 3RU7A 2ASVA 2OLKA 1TB4A 4JSTA 4WXRA 4GLJA 3TINA 2QBYB 3PGMA 1U7PA 4XPIA 4PSAA 1O89A 1DOZA 1HDCA 3KDAA 1LSOA 3OFKA 2ZDGA 2QV7A 3ITNA 1IBKB 2QIOA 1UDRA 1NWHA 3ZQUA 4DAEA 1WS6A 5ITWA 3K09A 1CZUA 1ICEA 2RKBA 2VP4A 3CKYA 3GRCA 2D2IA 2VDUE 1EB8A 2JK1A 3TLYA 1R0KA 2HK9A 2JCBA 2PO7A 3UWDA 4DFDA 1EX7A 3CLUD 5EIXA 1IEXA 1K27A 4WBSA 4RGVA 4RY9A 3GLGE 3EPLA 2O0MA 5CXQA 4FBLA 4XLLA 3KSDO 4DE5A 3D59A 2YVUA 5D5QA 2ALJA 5J43A 1P1HA 1N6IA 3KJQA 1HGXA 2H08A 2QQFA 3KALA 2EWMA 3ZUGA 3I5MA 4FEGA 4RJ2A 3EZ7A 4COKA 4TYYA 4CIAA 1JWLA 3IV7A 2IS6A 1V2HE 3DLCA 2H4WA 5C3UA 3FTNA 3PENA 2QY6A 2WA2A 4TKUA 5LL6P 2UVPB 2XMZA 4CU2A 2VHZA 2Q28A 2XB4A 4BFUA 4DJAA 5LMCA 5FPSA 3GR6A 4L95C 2DR0A 4HOYA 4MP8A 3OD1A 4EELA 5AVTA 1F0YA 1N0HA 3DXFA 1ESEA 3HACA 3IA2A 1LC0A 2FEOA 2XB6A 3BAZA 4HWKA 1PEKE 4QTTB 4KFRA 2A1UA 4DR4B 1MVLA 2KS6A 2JA2A 4R3UC 1G1MA 3R40A 4TSFD 3EG9A 4B2PA 2PUDA 4ZVNA 1K06A 1DUVG 3ADOA 4GR9A 5EESA 4AY3A 5CFMA 3GWZA 4CIDA 1ZIDA 2BP7B 4FYMA 4LPKA 1R0ZA 3QVGA 5TF0A 3W1VA 3KSBC 1Q0QA 1Z6YA 1UJ2A 4TT3D 1PZFA 4Z1OA 3V8BA 1WTCA 3Q1KA 1Z2EA 2CEKA 3PWKA 4EJSB 1QHXA 3QRWA 4QUBA 5DF1A 1SQGA 3R7FA 3RS3A 2BEKA 1K92A 3TMAA 3EW9A 4R54A 3PVCA 3VZPA 4OX9B 1YRHA 1FQJA 1P0CA 2I6QA 3W6NA 3JATB 2RGGA 4B7UA 3FIJA 1GYPA 2YNMC 2QLFA 1JFFB 4MCIA 1H3FA 1C9EA 1OD6A 3CF0A 4GL4A 2BFCB 3DR5A 4QASA 2H3EA 4U9HS 5G0TA 3VHQA 1TFRA 4IIFA 2C7GA 2CF6A 1O95A 2R00A 3D7SA 3OCYA 3CMCO 2B82A 2IY8A 4WGGA 3THWA 4QRHA 2ZGVA 3IX7A 4DLUA 5IXYA 3IJRA 3OM1A 3WLLA 5C8VA 4D9GA 3WXMA 3NPAA 4XEUA 4BFVA 4YPVA 3GC6A 2CMGA 2ZRHA 4D4KA 2E85A 3WQBA 2E7ZA 1DIAA 4TXLA 3U3ZA 1L9XA 5HQJA 1SCKA 1T3HA 4HS4A 3TQTA 1WPXA 4CXMA 2B8JA 2WIKA 1P72A 1L1FA 4F3RA 4C04A 5G3ZA 2JGKA 3AOGA 2ZJ8A 1JXAA 2BI4A 2BBOA 2XPCA 3MWEA 1Z5GA 4MPRA 4QAJA 4R3NA 4FDLA 4MWSA 3QOXA 4G8BA 1DC7A 4FYHA 5DOZA 1L5KA 1UMDA 3AIOA 4QHYA 3ZXIA 4A8HA 4KPUA 7REQA 5JCJA 1QMGA 4M1OA 5D85A 1YZGA 2REQA 4LDQA 4GR4A 2IHUA 3IBSA 1KTVA 4KKVA 5IT5A 3WK7A 4MQ5A 4RSRA 1G20A 1S4MA 1Z5OA 4OF4A 2X8JA 1MORA 3RKSA 2YJ5A 3IDFA 2NAFA 3KCNA 1OC2A 3PQ6A 4GDMA 4QTXA 5FWXB 1XEAA 1FFXB 1S02A 1Y8RB 2GAIA 3IERA 3M49A 3B52X 5LZ7A 4ENQA 4H27A 1RAAA 4QU5A 5H9VA 4AZ0B 2AOWA 2CCGA 5I7AA 2MU1A 2PKQO 2Y0EA 5GV7A 2GERA 3SC6A 4HPWA 2OZEA 3CLKA 1X9IA 4LDPA 1EU1A 4BV2A 1BU5A 2F6RA 3IXQA 4MUAA 4TL6A 4O4JF 5DK6A 2RHRA 5D86A 1A2BA 2B5OA 4DJFC 5HF5A 1TRKA 1A4XA 3PNLA 4KKXB 4PFSA 4RDHA 4WJZA 3GIWA 4P7GA 2J3JA 5K3AA 1XR3A 3VTKA 1FLNA 3IHTA 1PKEA 2KW5A 5B4VA 4TZ0A 5K0SA 3OT5A 3EDYA 2P5YA 1XQXA 2J30A 1BGXT 1ZW1A 3AUTA 3SVZA 5CFLA 1FTGA 2YFHA 3ITDA 4TT3A 1I0LA 3A1CA 5EZYB 5LYJB 1MNQA 4NS4A 1JU3A 2SKDA 5JCOA 4L5AA 1R6VA 4OYLA 4RIFA 4BB0A 3GB9A 4L4YA 1RYDA 4MS1B 4Y2XA 1H85A 1KK0A 3GX1A 2R4QA 3GA0A 1DAKA 3GEBA 5JI2E 4RTSA 4UULA 1ID1A 2BUBA 4XUGB 2VHJA 1CEQA 3LA8A 4CG2A 2ZDHA 2EFYA 2DHRA 5U4XA 1WSDA 4ND5A 1GAEO 4W9RA 4AK9A 3SSOA 1TKCA 1AUXA 2WR8A 2AFRA 3T12A 5HGXA 2XVMA 4KB5A 3PR3A 2Y8EA 3EFOA 4YJGA 4OLHA 5LXTF 3UA3A 1AKEA 4RTPA 1O95D 3VH4A 2FA9A 4DRXB 3N8GA 1AA6A 2CXTA 2P68A 5CEJA 1TC2A 3QHAA 3V8RA 2YZNA 2YZGA 1ZCZA 4C6SA 1Z8FA 1P2FA 3EQ2A 1XBTA 1EBBA 1Z75A 1E3QA 2VHUA 3KT6A 5C1IA 3TOZA 4YRFA 4AZ0A 1N5KA 2VPTA 4CLXA 4H15A 2CB0A 1T2CA 4RY0A 3HB9A 4AT1A 3AHFA 2F7SA 2WTUA 4O4IA 1BHO1 2FZ5A 2X8JB 4L0MA 5TX7A 5JMWA 1QAQA 3C6MA 1B1AA 5L4NA 4HL6A 1P7VA 3IKJA 2Q5QA 2Z9DA 3R6WA 4DABA 4KLZA 1IJKA 5HJ5A 3JW8A 1VJDA 2VP9A 2KE5A 3E2PA 1II8A 1DOHA 3A3PA 3WYFA 1NV8A 4BP3A 3NORA 3EOZA 5I4IA 5CCDA 3STTA 3NNDA 3BMNB 1EHIA 4M8IA 4M0MA 4EGJA 5B53A 2B8EA 3ND6A 4BKRA 4DDHA 1FUEA 5HBRA 1T91A 4N54A 1AZLA 1K4KA 2P4EA 3G0IA 1Y1RA 3U49A 1NBIA 3PFWO 4GX0A 4US0R 2CVPA 1ZOPA 2VATA 3F96A 3CA8A 3HBFA 3RFFA 1P0PA 4KHPB 3QV2A 1K8XB 3KUKA 1U9JA 4PS1A 4HWTA 4YCDA 3ZVNA 3PNVA 1X1DA 1G2OA 3BORA 4HD8A 4MYDA 4QXQA 1GGFA 1OT3A 5GONA 1YZUA 4MOWA 5I9TA 5IJ0B 5DW0A 1WZEA 1WUKS 4Q19A 4UC0A 3PVSA 5LQDA 4KODA 4A2WA 4BUCA 2ZIWB 4IDBA 4S12A 1IUNA 1ONOA 2XWJI 2VPPA 3LPLA 3A1TA 2I6TA 5DPMA 3MERA 4JD5A 4DUPA 3P5BA 1EK1A 1MV5A 3PE4A 5FBLB 4A0RA 5GINE 2C4MA 2BN4A 5TSDA 4BC1A 3NC1C 1OA1A 1UBFA 2JGJA 1ORVA 3E3AA 3Q8LA 1UKAA 1LRKA 2OKCA 1E3IA 3I6YA 1AH2A 2OFPA 1IOZA 3PJGA 3RUAA 3VJLA 4PLPA 1LBQA 1V71A 1AQIA 2H4JA 3OT4A 1TMYA 6PFKA 2H51A 2YJ6A 4IFEA 4W8GA 2BMFA 1XRNA 1JEQA 2NG1A 5FBWB 1NM5C 1NQWA 1SVNA 3UNXA 1AKMA 2A7QA 2PRZA 3ENKA 3FDZB 3HP4A 4J0QA 4LXGA 1ELOA 2Y1KA 2YZMA 1Y3DE 4P7BA 3RBZA 2I2WA