3WTCA

Crystal structure of gox2036
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
259
structure length
259
Chain Sequence
MSLSGKIAAVTGAAQGIGKAIALRLAKDGADVILLDVKQDTLAETAKEVEALGRRAVALTADISNRDQFRSTLADAAKTLGGLDIMVNNAGICQVKPILDIEPAEIEKIFSINVQGVLWGMQAAATLFKEKGTKGKIINACSIAGHEGYPLLGAYSATKFAVRALTQSAAKELASSGITVNSYCPGIVGTDMWVTIDKRMAEITGTEIGATYKKYVEGIALGRVETADDVAGFVAYLSSSDADYMTGQSVLIDGGLVFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative oxidoreductase
publication title Crystal structure of Gox0525
rcsb
source organism Gluconobacter oxydans
total genus 98
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wtcA00
5IDQA 1QRRA 3KYDB 4OIMA 4YAEA 2BFAA 4ZRMA 1NR1A 3N7UA 1NAHA 2CDBA 4I5GA 3WNVA 5HTOA 2C5AA 2EEZA 4BNVA 4YA6A 4R3NA 3UF0A 4GAEA 2HK8A 2O3SA 3WNQA 2PY6A 1V0JA 1AHHA 4BKOA 3DBRA 3I3OA 3VPGA 2Y1OA 3TZHA 1E3SA 4OGWA 3W8FA 1CRWG 2X5JO 3DZKA 3PDJA 4GKBA 1HETA 2ILTA 4OAQA 3RKRA 1J49A 4OOFA 4P4LA 1DPGA 1V3VA 1O94A 2WEKA 3RUCA 2IXBA 2DUWA 1GUYA 1ZXLA 4BNZA 3K30A 4UULA 1P31A 2D0IA 3GF4A 1U1IA 3VPFA 2GCGA 3HDHA 1GYQA 4P38A 2J5QA 4HV4A 1E3JA 2FR1A 2E6UX 3AM4A 3E5MA 4OXKA 3WGIA 4MIYA 1E7YA 1JKJA 3GMDA 2CDAA 3D64A 4NH4A 5C7IO 4R68A 4A0SA 1TB4A 2GN9A 4E5YA 2NVUA 4ND4A 3IP3A 4R54A 4D0RA 1LDMA 4R4JA 5G0WA 4HKTA 1ULSA 4HX5A 1N2SA 3C1AA 5ER9A 2IYPA 2IRWA 1FF9A 3D1LA 3GZNA 4J1TA 1NQAO 2X9VA 3NV9A 4MIOA 4R9RA 1FJHA 1O9BA 5TJHA 3K6JA 4J3FA 4BV9A 2CVOA 1Y1PA 1Y9AA 3WB9A 1XDWA 4GGPA 2VRCA 3TFOA 5FEUA 1R0KA 1C1DA 2JL1A 3VH4A 1RKXA 3FR7A 4DUPA 4XRGA 4DQVA 4BO3A 1IZ9A 2GN4A 2E49A 1ID1A 2Y1CA 1KVTA 3BMNA 1NR7A 1JAXA 2QG4A 3GY0A 3VPSA 4LVCA 3F5QA 1LNQA 2A9FA 1LUAA 3A1NA 3P5SA 4ND5A 2GYYA 4UEJA 3UVEA 1FK8A 2HSDA 1D3AA 1NAIA 3DMTC 4GMGA 3WYCA 1EFLA 2C7GA 5ER6A 3RUAA 6LDHA 5KNLA 4XR9A 1O5IA 2V6FA 3JYOA 3K5PA 4WK6A 1LLUA 2AE2A 3HUDA 1DFGA 3U9LA 1JVSA 1LSSA 2Z1MA 4ZJUA 1ZH8A 1JTVA 2Y93A 3VDRA 3I9KA 4J7UA 2RBEA 3HNPA 1W73A 3FR8A 4DQUA 1GTMA 4XYBA 1ZK0A 4ND1A 4DPKA 3QVXA 2VWQA 4RF2A 4YAJA 4R01A 2UYYA 3AUAA 3FBGA 2GO1A 3MOGA 4IGFA 4BKQA 5FI5A 1JKFA 2P9EA 5I7EA 5HA5A 2CNBA 1LSOA 4L4SA 1M76A 1IZ0A 2YDXA 4IDDA 4GI2A 4H16A 1PR9A 2GF2A 4NQZA 4Z3KA 4I08A 3JQEA 3OJEA 1GYPA 1YBMA 4TZKA 5ITVA 2WYWA 1IPFA 1A71A 2PGJA 4WOJA 5JAIA 1A7AA 2G5CA 5DZSA 1JWBB 3D3WB 3ZHYA 2VT3A 4O63O 4BNMA 4D3FA 1I3LA 2CVZA 1M75A 4ZHSA 5EPOA 2I65A 3TSCA 4DL9A 4ALKA 3P2OA 3WIEA 5ICMA 3WX0A 5A04A 1PS9A 1E6EA 4XWYA 1F12A 2VUTA 3PHIA 3H8VA 5LDGA 4DTIA 2ZJ1A 5JY6A 3PJEA 1K89A 4WNCA 1LRJA 4U8GA 4XB1A 4MIEA 3SC6A 3JD1A 1GPJA 4ALNA 1QYWA 3GHHA 3ABIA 5JAQA 4OKNA 3WWZA 4Y6RA 4ESOA 3GUCA 4GVLA 4NJOA 1Q0LA 1D8AA 4WLFA 2QX7A 3AU8A 3VC7A 2NTVA 3VVCA 4FW8A 1YRLA 5DCUA 1R4MB 3SVTA 2RHRA 4RVDA 2R00C 4FFMA 3DZBA 4K26A 4CV3A 2HMSA 1N5DA 2IDZA 3KHUA 1DBVO 4EGFA 4PLFA 5BQFA 1ISJA 4CMJA 4BGEA 4FFNA 5AXAA 2AEMA 2X6TA 4PZEA 5T8KA 4PLVA 1PGNA 3ZZNA 4Q39A 1EEHA 1HT0A 1PWXA 3KSUA 1UDBA 2EF1A 1ISHA 1HE2A 3BMOB 3MJ4A 2FHSA 2PD6A 1C1XA 3BMCB 3OJLA 2JCYA 4YJFB 4E4YA 4DC0A 1HF3A 2Q4EA 1AE1A 1RM0A 5DN9A 2YQ4A 1ARZA 4UUPA 3PHLA 2WD7A 2BKAA 3GOHA 3EW7A 3UHAA 4O5OA 3DFUA 5KKCA 1ZVMA 3ICCA 2BD0A 3O8QA 2JAHA 3TNLA 4OSOA 4UVGA 3ADPA 4E32A 4R5HA 2VYVA 4YB8A 4UVHA 5G0VA 4Q9NA 1SNYA 3ASVA 4GSLA 5TJ9A 3CKYA 4GPD1 4J7CA 3AI1A 1G0NA 4WEOA 5KTKA 1G6KA 2PWZA 1O0SA 3JSAA 4Z0TA 5C37A 4DBZA 5DOZA 3PGXA 1PU2A 4E0BA 2NLOA 5C3MA 4I9HA 3EHEA 3ZWVA 2JHFA 2DBRA 4RO0A 5KIAA 4OHUA 3EMKA 3LF2A 3ZNQA 4YRBA 1TEHA 3F3SA 4L74A 3DDNA 1UH5A 1GZ6A 3RC1A 4WOKA 3JD4A 1DO8A 1GAEO 4DIOA 2CY0A 3CMCO 4KZPA 3HB4X 5JPIA 1E1MA 1E1KA 5EN4A 1JAYA 2EERA 4OQYA 5BR7A 3RI3A 4YT8A 3K92A 1MC4A 4ALMA 3TZCA 3D3EA 2AQHA 3JV7A 4NBVA 4CR6A 1E0DA 1E1LA 3FNFA 3E03A 2D5CA 1DIRA 4PFJA 1P44A 2VT2A 1ISFA 4XQCA 3JQCA 1H9BA 5L4NA 4RLHA 3DHEA 4BNJA 1ZJZA 3O38A 2P9CA 4KWHA 1GEEA 4JP2A 1B7GO 4C4OA 4PCVA 4IBOA 4Q3DA 3V1YA 1SOWA 3FWNA 3RUFA 3EYWA 3L77A 4FR5A 3F4BA 3PIIA 3RC9A 3E5RA 3PHHA 3IOYA 3WGHA 2AXQA 4CM4B 4CLOB 1W4ZA 1UDAA 1KS9A 5A9TA 1N92A 2ET6A 3WGTA 2PZJA 1NASA 2GPTA 3PXXA 4BNTA 4H7PA 2FY8A 2TMGA 2C5EA 3GVXA 3LT1A 2HAEA 3CMMA 4OH1A 3QVSA 2HCTA 1FDSA 1DHRA 3JYLA 4JQCA 1GU7A 1H93A 4XJTA 4EJ6A 1WW8A 1YONA 1RM5A 2Q1TA 2IE0A 4LCEA 2V65A 5JLAA 4N18A 5L40A 3CZMA 2YW9A 1QV6A 2XAAA 4N5MA 2IYOA 3A28A 1H0KA 2OO5A 3V1UA 3LC1O 3E8XA 4Z9XA 1B8PA 3BMQB 4E5KA 4BO2A 3VDQA 4JX8A 1HSOA 3U09A 2C59A 3DZJA 2PD4A 1UZNA 3GAZA 1IULA 4RJTA 5JC8A 1B15A 1DFHA 1T2EA 3DMTA 1WNTA 5FFFA 1SAYA 2B35A 2YUTA 3HFSA 1WVGA 1HDZA 2W98A 4BO1A 4EDFA 1WZEA 2IXAA 4AL4A 5CG1A 3C24A 5JCXA 2O50A 4Q3BA 1YH3A 1QYVA 3AI2A 4MOWA 4NHEA 1K6IA 3EZYA 1LDNA 4JXKA 3MJCA 4IJKA 1P1RA 4CLOA 1WDMA 4HFRA 3PHJA 4QO8A 3DHNA 5L95A 1SEPA 1PS8A 1NXQA 3MJTA 4B3HA 1ORRA 3ZWWA 1H2BA 3U0BA 5F21A 5HM8A 1ZEMA 3QWFA 3V1TC 1E3EA 4N54A 4RPHA 3BTUA 2P68A 4F45A 3AM3A 3LZ6A 4YJDA 5JY1A 1GYRA 3F9IA 2PTGA 2DTXA 4LCJA 4KUEA 1ZSNA 4DIBA 4ZU3A 3D5QA 5EMHA 3ON5A 1K3TA 1LXCA 2CUKA 1RYDA 3VZSA 1TVEA 1U28A 3L9XA 4QT0A 1BXGB 2O7QA 1F8FA 1WDLA 4IPTA 3ZCXA 5GZ3A 1SOVA 3AOEC 3BMQA 3CTMA 3H5RA 4J9UE 4PG4A 9LDTA 1B26A 2E37A 2W2LD 3KLPX 1BW9B 4RDHA 3OF2A 4ZD6A 4AJLA 4E3ZA 5I7SA 4XGKA 2ZQZA 5G4KB 3ZDFA 4CQMD 3GN2A 3NRCA 3HJAA 2WM3A 4WLEA 1NVTA 1NWHA 4EBFA 4CMBA 3B1JA 1Q0QA 1UZLA 4WECA 2C2YA 2H1SA 5J23A 7ADHA 1C0LA 3DOCA 3I9NA 4RPLA 1P0CA 3JQ8B 4W9NC 3TZQA 1HEUA 1IHYA 1NX6A 1GQYA 1L7DA 1ZXBA 4TWRA 1Z73A 3WOHA 1O6ZA 3P19A 3H9JA 1GADO 2ZCVA 5U4QA 2Q2QA 3JQAD 4YRAA 3ZWYA 5ITWA 1C0KA 2R00A 4UUNA 1YKFA 5AOVA 5JAZA 4AG3A 1VSVA 3H7AA 4G2NA 1RJWA 4UVEA 2IEDA 1PEDA 4BGVA 3H2SA 4E5NA 2VCYA 5JDCC 5IF3A 4QFDA 1SPXA 1JVBA 5U1PA 3AK4A 1CQJA 3QIVA 4JJGA 4B7UA 1U4OA 2BELA 4R1SA 2PR2A 3I9MA 3L6OO 4GVXA 1KY5A 1BW9A 4DXHA 5L45A 1KERA 1VJ1A 2R6JA 4PRLA 5G4KA 3L4SO 5T64A 4IGEA 2NU7A 2Q1SA 4XYGA 3SLGA 1CEQA 1H2HA 1ADFA 3DO5A 4PG6A 3ROMA 1PJ3A 1CDOA 3HN7A 5F1KA 3Q9NA 3S2GA 5JAMA 1BDMA 4PLPA 2V6MA 1Q7GA 4BMVA 1I24A 3ORFA 4R1UA 1CIVA 2JKVA 3AU9A 3EVTA 4NU5A 3RKUA 3W4KA 3IAHA 3JQ8A 3FNEA 3RJ5A 1ZMOA 4L8VA 2XXJA 4B4WA 5H82A 3OP4A 1M6WA 3F4LA 5TT1A 3X2FA 3MWDB 2IZ1A 4OL9A 1UXHA 2H63A 3VKUA 1V3UA 3AY3A 2POQX 3MJSA 4XR4A 1R0SA 2HLPA 5IDXA 3BTSA 2YV3A 3TQHA 3AY6A 4PLTA 2IZ0A 4RDIA 2C0CA 3ONDA 1PJQA 3IKTA 4CLEA 3I9JA 3R3SA 3LF1A 4RVSA 4XQGA 1MP0A 3C3XA 4Q3CA 1GUFA 1GCOA 1VE9A 2GERA 1LA2A 1X7GA 4FGWA 3W6UA 2ZK7A 3ZU2A 1K6JA 4HNGA 3GGPA 3RUIA 5CP8A 3JD0A 4KWIA 4RVHA 4GX0A 3PP8A 2GRAA 4MP8A 4OYRA 2PA3A 2O3UA 4GX5A 1ADBA 3CXRA 4Y98A 1OFGA 5AXDA 2QZZA 3CINA 3DZIA 3TZKA 3W4IA 4CUJA 3AY7A 3OQBA 4NI5A 4PIVA 1IPEA 1CF2O 2P91A 3T4EA 5IFLA 1I3KA 4R9SA 2EKPA 1SMKA 3QWHA 1ZFNA 3QP9A 3OA2A 3U4IA 2PZLA 1U7HA 4AJKA 5DCWA 2QQ5A 2VYND 1E5LA 3DMYA 1A27A 4Q3EA 5EQDA 4WUVA 4CM6A 1WMAA 4KMSA 2RHCA 1VPDA 3RU7A 1I5RA 1EVZA 1OOEA 1QYDA 4B3IA 5L7TA 1OMOA 4BO0A 4M55A 1T2CA 4YAGA 4Z3DA 3OEWA 2J8ZA 1HSZA 2AEJA 3F6YA 4BS9A 3AJRA 3WMWA 4XZ3A 4UAGA 2NQ8A 3PJGA 3PK0A 1PL6A 1A4IA 4RPJA 3HG7A 3KTDA 2YJZA 3FNHA 4J4TA 4F6LA 2Q3EA 2PZMA 5F1OA 5KJCA 1ML3A 2ZTMA 4N5LA 5KJ1A 2W2KB 3GC6A 1PQUA 4NBTA 2JFGA 2VOJA 3M6IA 4Y6PA 1HLPA 3PRJA 3BZUA 2H9IA 4O59O 4W4TA 2C07A 3A9WA 2FMUA 3IUPA 3EC7A 4J1QA 3SLKA 4F46A 3ONFA 4INAA 1DC4A 2DUUA 3L0DA 4FD3A 5L9AA 1UAGA 2HO5A 3JQ6A 2C29D 4JROA 3U3XA 1KOLA 2GN8A 3CUKA 4AJEA 2C20A 1NTOA 3NDJA 4AJOA 1WWKA 5I7VA 5THKA 2B69A 3HHPA 5IAAA 3PQDA 4RVUA 5EL0A 2ZIZA 4QFCA 5KKAA 1YBVA 3JD2A 5G4LA 1NHGA 4IJWA 4ZA2A 3WGQA 2XXBA 4FBGA 3ENNA 4CMHA 3GUYA 1Y8RB 1IB6A 4CM9A 3NGXA 3RC7A 2QYSA 1LEHA 5A1TA 5IZ4A 1XGKA 3VPXA 1HYGA 4BNFA 4FB5A 3WGYA 3PIDA 3B1KA 4HP8A 5EIOA 2JD1A 2W8ZA 4P22A 3IUSA 3D4NA 2HMWA 5FI3A 5KCZA 5JW6A 4UREA 1F06A 2GNAA 4I8XA 1GV0A 1DIHA 5MGBA 1OAAA 2FWMX 1ZK3A 3ZV4A 1PQPA 1JKIA 1DIAA 1LRLA 4GH5A 3ENKA 4CL8A 1NPYA 3AOEA 3QWIA 3MWEB 2UVDA 2NVUB 4J1NA 2WJPA 3VPHA 5CPBA 3NEPX 1E92A 3OA0A 4IMRA 3SXPA 3IS3A 2RCYA 4ZQHA 2OORA 1JQBA 1GEGA 2YHUA 2FZEA 1YBAA 4CLRB 4NBUA 3GZNB 2X9GA 3DAPA 4RPKA 3GVIA 3K9QO 5ENVA 5KVCA 5BNFA 2VOEA 1JDJA 4J4BA 1MGOA 3GQVA 2SCUA 4HFMA 5JNLA 3DBLA 2OP0A 1XIVA 4F6CA 5L51A 3HZZA 4RVGA 3RSHA 3IP1A 1YOVA 1Y8RA 3HWRA 4MVJG 4J16A 1C1DB 3UCEA 4H15A 4RQTA 2Y68A 1UXJA 5T67A 3IKVA 1BMDA 3BMNB 1X1TA 3PVZA 4AJPA 5B4VA 1ZMTA 1C0IA 3GEDA 4XYEA 4YJGB 2BFMA 3OICA 5DF1A 4YCAA 3WTBA 2JD2A 2NU9A 3UICA 2NQTA 2WD8A 5F5LA 1LLCA 3CH6A 4EZBA 1PGPA 3H4VA 3ZWCA 3KETA 3D7LA 3S2FA 2NNLD 1XEAA 3PQEA 1R15A 1K0UA 4K6FA 4U5QA 1EK6A 5JDCA 1NM5A 5I9MA 3JQDA 3FNGA 4B7CA 1U9JA 3AW9A 4XEHA 2DQ4A 4KQWA 2VTEA 3OQ6A 1X13A 4AICA 1B14A 1ZK4A 1B3BA 1H5QA 2DTEA 4CQMA 4CLRA 4BNGA 4FOOA 3ONEA 1RM4A 3TFQA 5A02A 1FDVA 4MP3A 4IQ8A 4AJIA 2FR8A 1MX3A 5ILOA 4ZQEA 1EDOA 2PFGA 3Q2IA 2X5OA 1DRVA 4PG5A 1IOLA 4XQEA 2DFVA 4Z6KA 4PLHA 1H6AA 2W4QA 4KUHA 2G17A 4HWKA 4O0LA 3TOZA 4WJZA 2Q2WA 1ONOA 4M8SA 1T25A 1UDCA 4YJGA 3WGOA 2VZ0A 3D0OA 3G3EA 1XA0A 4B4OA 4BNUA 1Q7BA 1R4NB 1E6WA 4BKPA 3WWYA 2FRDA 1PWZA 3GGOA 5TC4A 2Z1NA 3JQAA 3WJ7A 2QRKA 2UUPA 3GDFA 4IJVA 5DBFA 1IUKA 4YT4A 5TLSA 4CLDA 4B79A 1ZUD1 3QA9A 3HQ4O 5DP2A 1B2LA 4WLUA 4QSMA 3RBVA 2NACA 1E7QA 2C2XA 2J6IA 3A06A 4XQ9A 1LDYA 4J2OA 4CLXA 3GFGA 2J3JA 2WSBA 1OZAA 1NVMB 1UR5A 1EFKA 1PR3A 5T6BA 1PGQA 3DL2A 4JCOA 3KV3O 3UCXA 1RWBA 2O3JA 1ZSVA 2BI8A 3BA1A 4Q3AA 5IG2A 3UOGA 3T7EA 1T4BA 2B4RO 3HADA 2X4GA 2QRJA 3Q3CA 1WMBA 5KOIA 4TRJA 1BVUA 1P1KA 4R51A 1ZK1A 5CEFA 3DEYX 5ILGA 5CEEA 3Q11A 4OOEA 4MVJE 5JCJA 1EMDA 1T2DA 4LRTB 3O4RA 2GZ1A 3QJ5A 4B8ZA 3FPCA 1HLDA 1YB1A 1XQ1A 1I32A 2YFHA 5G0SA 1XYGA 1RYEA 1YVEI 4ZVVA 2YHIB 4CV2A 3O03A 4DQXA 3GK3A 1R4NA 1ZEJA 4TVBA 1DLIA 3KLMX 2PKQO 1MLDA 1C1XB 4CUKA 1DRUA 1KETA 4WNIA 3AM5A 3WQSB 2Q49A 3GN1A 2EXXA 1VI2A 2VRBA 1U3TA 4WE3A 3U4CA 5JO0A 1TT5A 2EW8A 2WD7B 4BQPA 3QWAA 1K6XA 3RFXA 1KC1A 3F5SA 3O8QB 2BLLA 4UEKA 3PDUA 4M54A 2HU2A 1P1IA 3PPIA 4BV8A 4FJ1A 1BG6A 1B8VA 2ZYDA 1DIBA 4CMKA 4JK3A 4IDFA 4E2ZA 3AFNA 2JHGA 1QR6A 1ZK2A 2UUOA 4ND3A 3GFBA 4FFLA 4OJNA 3JQ9C 1Z74A 4H3VA 2QW8A 4HNHA 4IDGA 2QIOA 4JBHA 4BKUA 1GZ3A 3RAJA 3BTVA 1X0XA 2Y1GA 4YAKA 3I6IA 4OXNA 3UN1A 5F5NA 4L4XA 4QQRA 4XD2A 2D3TA 1P1JA 2DTDA 2AG5A 2DVMA 4R3WA 4J7XA 2OP1A 3EGOA 2LDXA 2VYNA 5HBRA 1NFFA 2YHIA 4I9UA 4P4GA 4L75A 1SB9A 4CV0A 1IE3A 2EGGA 3ZU3A 4DMLA 1C0PA 3WSVA 1DXYA 1YWGO 1PZFA 1X7DA 1MG5A 4NK5A 2ZTLA 2NWQA 1I0ZA 3V2HA 1U3WA 3BHJA 4DGSA 2O3QA 3PEFA 3C1OA 4LMPA 1D1SA 3T7CA 3ZNOA 1BRMA 1R12A 3O9ZA 2G82A 1E77A 3JCZA 1U2GA 4WLOA 4B4VA 4L73A 3NJ4A 4AFNA 1QKIA 1N8KA 3OIFA 4IINA 2HJRA 3G17A 5AVOA 1ZCJA 2DC1A 4AJJA 5DBGA 5HRUA 2DKNA 1C3VA 2BMAA 4B4UA 1EQ2A 2YQ5A 4XRRA 3P7MA 2HMUA 5A3VA 3DTTA 2HQ1A 2X0NA 2EKLA 1ISIA 4PZDA 2ZATA 1HRDA 2Z5LA 3PFWO 2OGUA 1ONPA 2O3RA 1D1TA 1U4SA 4A26A 3S2EA 4KQXA 4Y67A 2NUAA 1W8DA 3C7DB 3LT0A 4IQ0A 4NFSA 3FRJA 4XYLA 5B4UA 3AUSA 3K2BA 1PJBA 3PYMA 4PLWA 4BO7A 4RQUA 2PGLA 4OO3A 1WDKA 4BKRA 1A7KA 4JJIA 4BO9A 1UZMA 4BUCA 3V2GA 2D1YA 1F0YA 2Y1DA 1U3UA 4DIFA 1A4UA 5COBA 3L4BC 4JJFA 1DSSG 4TKLA 4RF5A 2O4UX 3RUDA 2GDZA 3K31A 2R2GA 3DOJA 4NJMB 1M2WA 3TWOA 5I9NA 1RM3A 1PL8A 2BFPA 3OECA 1Q2XA 4BB5A 2BHLA 2HKIA 2X0IA 4I9NA 4RF3A 1Y6JA 2GR9A 4EEXA 1CETA 3P2YA 4XKJA 4GGOA 4GQAA 3ZWPA 3M1LA 1X15A 2NV6A 4L0QA 4LSMA 4EW6A 4CR8A 3ZU4A 2Y67A 3AUUA 1UXKA 3GVHA 1X7HA 5EESA 4AJ2A 2B5VA 4XIYA 5G0TA 3F1LA 3VAZA 1KBZA 1BTOA 2AMFA 1SC6A 4ZQBA 3WBBA 3OMLA 4LMRA 1E7SA 1ENOA 1LBEA 4BNYA 1F8GA 3ZV6A 3S2IA 3H9EO 1KYQA 1I30A 3VKVA 4TMFA 1NPTO 1BVRA 2OBNA 3JQBC 5JBIA 5C7OO 5ICSA 3GT0A 1ZJYA 5DNAA 5F3RA 2LDBA 2Q4BA 3GEGA 5GZ1A 1V3TA 1DAOA 3Q0EA 5KJEA 3VH1A 4EJ0A 4LVUA 4M1QA 4DMMA 3ZW9A 1T4DA 2VHXA 5BNIA 1A5ZA 5CG2A 1Z82A 1DDOA 4ALLA 3WQRA 4FS3A 4NJMA 3FTPA 4Z0PA 5TF4A 3G79A 1T2AA 4J1SA 5I8WA 4LN1A 3IC5A 3NKLA 4XDZA 2FPIA 3KZVA 1X0VA 3QQPA 5BSHA 3X2EA 3E18A 3RVDA 3DB2A 2EW2A 2CZCA 4J43A 5FF9A 1RPNA 1XKQA 5A05A 5CDYA 3U5TA 1IYZA 4CM9D 2UV8A 4I5EA 2Q2VA 1HE5A 3ZW8A 1JW9B 2EHDA 5IN5A 3JYQA 3I6QA 1PJ2A 4RZHA 5C5IA 3ZGYA 1QG6A 2DT5A 3OJFA 3VH2A 3CPSA 4D3SA 2DLDA 1IY8A 3ZWMA 2I9PA 2B5WA 1ZKMA 1LQUA 1H94A 4YACA 2DPGA 4YR9A 3BIOA 2CDCA 3GNQA 3BAZA 3QY9A 4A7PA 4TVOA 3VOSA 1UXIA 2NU6A 3H5NA 1U3VA 3KYCB 4YBZA 3GRKA 1EUCA 2X0RA 1UP7A 3QVOA 3UXYA 4JP3A 3M2TA 5JYDA 2EKQA 3WQQA 1PS0A 1DAPA 1GFSA 2WYVA 4R1NA 3K96A 5U9CA 1LLQA 3GGGA 4QUKA 1CERA 4R69A 2FOIA 2CSUA 1YQXA 2JFHA 4OM8A 3ZWXA 1A9ZA 3EUWA 2BGMA 2OZPA 1B8UA 3SJUA 1OC4A 3GPDG 2JJYA 2IZZA 2RIRA 1YDEA 1KVQA 2B4QA 3KBOA 3AUTA 4A03A 1ZBQA 2VUUA 1N7GA 4WLVA 1CQIA 3JQ9A 4MDHA 3E9MA 2EWMA 3STHA 1WAMA 2NSDA 2EP7A 3JQ7A 2OOSA 4J0EA 3ZNPA 3FWZA 3ST7A 4II3A 1HDYA 3VTFA 2G76A 1GCUA 2AQKA 4NDNE 2VRCD 2X9NA 3U49A 1DJNA 2X23A 3BTOA 1HWYA 2EV9A 1XU9A 2I3GA 2OL4A 3MTJA 1NHWA 4LISA 4XA8A 3U62A 2J5RA 4AVYA 3BXXA 4HBGA 3QSGA 1XG5A 1H6CA 4XDYA 3G0OA 5JMPA 1PGOA 3RUHA 1DEHA 1AHIA 4MO2A 3DWFA 3KYCA 1P74A 5TGDA 3GR6A 1EZ4A 4M49A 5BSFA 1DC5A 4KTVE 1KEPA 1GQ2A 1NPDA 4YRDA 2I6TA 1NVGA 1T2FA 1FDWA 3INRA 1HDRA 3G1TA 4CMEC 2WMDA 2GGSA 1E7RA 5TRTA 3ANLA 3ICPA 3RBZA 5BT9A 4BB6A 4WLNA 4MVJF 3WIDA 3GH3A 3COSA 4JIGA 4PRKA 3WGZA 2FZWA 3LC7O 2QYTA 3LSYA 3JTMA 4CMAA 2F00A 3CZRA 1E7WA 2PK3A 4FFOA 2AEFA 1HL3A 2VQ3A 4RVFA 4ALIA 1MA0A 4JNKA 5C7LO 2ZB3A 2X22A 3IL2A 3H3JA 3FBTA 1JLLA 3CEAA 3NGLA 3NAQA 1UXGA 3ZNNA 4BO4A 1YXMA 5AXBA 4MVJP 5I8ZA 2E82A 4G5HA 3UUWA 2E4AA 3KEQA 4LW8A 1VKNA 4PG8A 4IZHA 3HFGA 3I83A 2FSVA 4IY1A 1QLHA 1DFIA 4HADA 5BNTA 3WICA 3D4PA 4IDAA 5EINA 3GAFA 2C7VA 4JBGA 1CJCA 2X0JA 4FSHA 1O8CA 4GX2A 3BHMA 4MVJM 4YPOA 1FXSA 2FPPA 1HDCA 3GMSA 3S1LA 3UH1A 1DC3A 3V2UA 2P9GA 4KP7A 2NTNA 1E7MA 3EAGA 1GZ4A 3GEMA 3K8ZA 2DU8A 1M67A 4NK4A 5F1PA 5KVVA 3L4BA 3WR5A 3Q2KA 4BNXA 4ND2A 4E33A 1B0AA 2VWPA 3ROQA 2AE1A 4NG5A 1EVIA 4CQLB 2FPGA 5JSFA 1CWUA 3KM0A 1YL5A 4Z9YA 1XR3A 3F46A 5AYVA 4RGBA 4MVJH 1ZW1A 1LC3A 2GZ3A 2H6EA 1LSJA 2BGKA 2D2IA 2Q1UA 4RLSA 5I7FA 3CSDA 1ADGA 2JCVA 3LDHA 1U5CA 3KEOA 3OM9A 4CV1A 1PIWA 3TF5A 4D7AA 3GDOA 4DBVO 2Y0EA 3ITDA 5L4SA 1S7CA 3KSDO 5CEJA 4LRSB 3I9LA 4E5PA 1HZJA 1E3IA 3FHLA 1ISMA 3C1TA 3GDGA 4FIZA 1KEVA 4KDEA 4N5NA 3PTZA 5A9SB 1R0LA 1GL3A 1V6AA 1HDOA 4BO8A 3WJAA 1EK5A 4EITA 1E1NA 1EE9A 1SO8A 3JQBA 4YYZA 4CMCA 7MDHA 1YS4A 2EG9A 2DFDA 1PX0A 4DYDA 2BGLA 3GHYA 3LVFO 4PLYA 1KEUA 3WYBA 5L3ZA 1Z6ZA 4OXYA 3DBHB 3BYZA 3KVOA 1LLDA 3E1KA 4XIJA 4CMIA 4MVJI 1YL6A 1JWAB 2YZ7A 2WTBA 4ONEA 3DR3A 3WG9A 3C7AA 4BMSA 4CQLA 2VYVD 5H83A 3DBLB 4FDAA 4DA9A 5LDHA 4WGGA 4RL6A 5HS6A 1YOVB 3IDSA 4R41A 4IQGA 4M87A 3ZH2A 4BNNA 3DAGA 3OIDA 3INTA 2OMEA 4WCFC 1I36A 2CFCA 1LI4A 3SEFA 3TN7A 3LYLA 4IIUA 3HN2A 1NFQA 4J90A 1OI7A 3Q1LA 1H6DA 2DPHA 4W99A 1JN0A 5B1YA 5HS4A 4W7IA 3JD3A 4GWGA 5A9SA 4GSKA 2FP4A 1N1EA 5CDTA 5GZ6A 3VZRA 3INGA 1FMCA 1V8BA 3C8MA 1TLTA 1DIGA 2JFFA 3JQGB 4NFHA 4YJHA 4XYMA 1HXHA 3SX2A 4TRMA 2EGHA 4FQ8A 1YL7A 4I5FA 3IJRA 1NBOA 2P5YA 5L7YA 1MB4A 1ONNA 4RCVA 3TZ6A 1NNUA 3DBHA 4ZQGA 4JLWA 4CQMB 4CM5A 4IS2A 4J2HA 4OKIA 2XOXA 3KUXA 2D8AA 3I52A 1MG0A 4Y8VA 4D0SA 3ROKA 4FJ0A 3RBXA 4DLLA 4QEDA 2O2SA 4D44A 1U2DA 1Z75A 3EDMA 3ZWBA 4PN3A 3DTYA 4BNIA 3R3JA 2HK9A 2GZ2A 2A94A 2CMDA 3ZV5A 1QXSA 3NUGA 4MVJD 1KY4A 2PNFA 4W9NA 5JO9A 1MFZA 2ZTVA 1N9GB 1Z7BA 3W6ZA 2QRLA 1HE3A 4CPDA 3FF4A 3GVPA 3I9OA 4HY3A 2PH5A 3VTZA 3F47A 1LDEA 1KC3A 1U8XX 3JQAB 1TT7A 3IQDB 3ITKA 2ZYAA 4NNJA 4IDBA 5B37A 4HFJA 4C7KA 4BIIA 2IODA 3RROA 1VC2A 1LTHR 3H2ZA 1UJMA 1UUFA 2OBYA 2IEBA 3JQGA 4U0KA 1P45A 4BMNA 3NDRA 3PLNA 2PV7A 4BHTA 3VH3A 3FSRA 3WXBA 3NTOA 1KVRA 5I9LA 2VZ9A 2W2LA 4PVCA 4D43A 3RIHA 3KOUA 4UUOA 1J6UA 5K9ZA 2HJSA 5A06A 2CF5A 2TMDA 1LRKA 1Y7TA 2GN6A 4JBIA 2NU8A 9LDBA 3W1VA 1LQTA 1HDXA 3B70A 3DZGA 3Q9UA 3LT2A 1X14A 2E48A 4CMEA 2FSSA 3GG9A 4GKVA 4MPDA 4U6QA 1J0XO 4S3MA 5A4DA 2BFOA 2CD9A 4MJLA 2O23A 4CM8B 1N9GA 2DBZA 3UW3A 4BO6A 3KYDA 3OSUA 1OC2A 2Q45A 4NMHA 3WFJA 4DVJA 3PWZA 3WBFA 3WDSA 4NFYA 3WYEA 3ZHXA 3PFFA 1F14A 5IZCC 3WMXA 2CF6A 5JMWA 3AFMA 3ETDA 1E3WB 1QMGA 4TRRA 2VZ8A 5KWEA 1I2BA 5A5FA 1TT5B 2HRZA 2B4TO 4O1MA 5JS6A 5L53A 1UAYA 2FR0A 5K6AC 4EI2A 1QYCA 4Y9DA 3LK7A 1NQ5A 1HZZA 4ZQFA 3OQ1A 2NVWA 5CPFA 2D59A 4FFPA 4GLLA 2X58A 4CM7A 3DAFA 3G1UA 1NWCA 3WS7A 4F3YA 2OHXA 1ISGA 3S55A 4DC1A 3NT5A 4L76A 1GR0A 2WWRA 5BSGA 3PGJA 1W6UA 3N58A 4U7WA 5H81A 5LC1A 4CLHA 1SEVA 3PJDA 4PG7A 3ULKA 1WPQA 4YXFA 2Y0CA 4FC6A 3SC4A 1DRWA 2Y99A 4IIVA 4BL5A 1T26A 4UUMA 3I5MA 4DPMA 1I8TA 2WDZA 4CM8A 1P1HA 4K9DA 1AXEA 2EJWA 2GD1O 2I99A 4GL4A 4E12A 4P8RA 4IXWA 2VWGA 4UVDA 2NADA 2A92A 5K0ZA 3EZLA 1PJ4A 5B12A 1EVYA 5IDWA 2PGDA 1E3WA 1S6YA 2AQ8A 5CDGA 3ZHBA 4WCFB 3ROPA 4TKMA 3L9WA 5IXSA 1NQOA 3AI3A 3C7CB 4W6ZA 2FN7A 4BOYA 1XLTA 4E5MA 5IXYA 1VLLA 1LDGA 3CIFA 4NPCA 3R0IA 5BSEA 2VNAA 3QVWA 1TI7A 1EUZA 4N7RA 5TSDA 1ZZEA 2HUNA 4I5DA 5DOVA 2AA3A 4IZIA 4II2A 2DM6A 4JN6B 5CHEA 2W90A 1R37A 3VZQA 1JU9A 1NYTA 4NIMA 8ADHA 2B36A 1VRWA 3FCOA 4KDFA 2UDPA 3V5NA 3ZI0A 1QP8A 5JDIC 2Q46A 5DP1A 1YGYA 2D4AA 3QRWA 3RJ9A 4J91A 3IMFA 1T24A 3M2PA 3GRPA 2ZB8A 3OETA 2J3IA 4QO7A 1E5QA 3D5TA 1XQ6A 3E9QA 1P77A 1HDGO 1OBFO 3E48A 5TT0A 4WKGA 4RZIA 3OH8A 1X1EA 2CVQA 1DC6A 1HYHA 3PWSA 2VHYA 4UVIA 2B83A 3LQFA 4E6PA 2ZB4A 4WCFA 2X86A 4FN4A 1YB5A 4D41A 1Q7CA 3W8DA 5KVQA 3UKOA 4A2CA 1DOHA 1PQWA 1YJ8A 4PLZA 4Z9FA 2RH8A 1SB8A 1HE4A 3NX4A 3TL2A 3PYXA 3DXFA 5FWNA 3FPLA 1I01A 1ZNQO 3V8BA 1GQQA 4QXMA 4P4NA 2PKQP 1R66A 1DHTA 2EP5A 4DYVA 3JYPA 5CAEA 1GDHA 2ZKLA 2Q1WA 3D3WA 5DULA 1KIFA 1D4FA 1Y8QB 3ZU5A 5L4LA 5ADHA 1DB3A 1B3RA 1TXGA 4J9VA 3GA0A 4ITUA 4EUEA 2DAPA 3H5AA 4J0FA 1QYXA 4DREA 1QV7A 2Q50A 1BXZA 2AW5A 1J5PA 3JQFC 3GPIA 2GLXA 1BDBA 2QZ9A 1N1GA 2YFQA 1YQGA 4U0JA 4UEOA 1PJLA 4IUYA 3PQFA 2D5AA 4QTZA 3WSWA 3RFTA 5JFOA 2QHXA 1GD1O 1QORA 2VHZA 3ANNA 3KRTA 4L9RA 4E2XA 2AHRA 3TRIA 1BGVA 1B16A 1PZGA 3SJ7A 3MTGA 3GNTA 1P1FA 5G0UA 1R4MA 4LK3A 1LSUA 1V35A 1PL7A 4ALJA 3FD8A 4R5MA 3Q6IA 4KTTE 3KYBA 1K5HA 1SBYA 2VUSA 1SCUA 1Q0HA 1BXKA 4RF4A 1I10A 1ULUA 4OMUA 4FPXA 4IS3A 1LDBA 4XX0A 4D46A 5TQVA 3BMOA 4ILKA 3MZ0A 2HMTA 3ETEA 5DCYA 3BMCA 1Y5RA 4M89A 4YJFA 3LLVA 4FFRA 3O26A 3HSKA 1H9AA 3RCBA 1Y8QA 1IL0A 4YQZA 4XJSA 4BVAA 1WP4A 2BH9A 2VHWA 3FN4A 1R16A 1MC5A 4LGVA 1DJQA 3ETGA 1L7EA 4NR0A 3KSZO 4NU6A 2B0JA 3IJPA 3EK2A 2PZKA 5KVSA 2XPCA 1P33A 1AUPA 3B20A 1EBFA 3NYWA 3TPCA 1O89A 1Z45A 3DC2A 1XU7A 5COQA 1VL8A 3L07A 4J49A 3WLEA 1PJCA 3NJ8A 1MFPA 3M1AA 4MVJA 1GY8A 1LU9A 3PI7A 5EERA 4Y6SA 4J6FA 1AN9A 3OJ0A 2YY7A 4AJNA 2VHVA 4E30A 2I76A 1I3NA 3RFVA 3G49A 1FDTA 4RORA 1PJTA 1VSUA 1VJTA 3A4VA 1U7TA 5IZCA 5ES3A 5KJ6A 3DFZA 3MCVA 4R1TA 3MEQA 4W7HA 3W8EA 3R1IA 4MKZA 2ZYGA 4BGIA 4B7XA 2EIHA 4EYEA 4L4RA 4M86A 1PTJA 3VHRA 4NBRA 1O95A 1VL0A 1U8FO 1XSEA 5K6AA 3E6AA 3H3FA 2YYYA 5AXCA 1XCBA 1CYDA 2VTDA 1ZSYA 3PZBA 3HDYA 4K6CA 3HDQA 4DWVA 1HKUA 3S8MA 3SBOA 3UCFA 3HDJA 5EQFA 3H9QA 3QV1A 2J3HA 5IDYA 4GWKA 4BO5A 3DHYA 2P4HX 3H9UA 3JQ7B 3H65A 1A72A 1E3LA 3QLJA 4FJ2A 2I67A 4WASA 4XB2A 3RU9A 3OEYA 2V6GA 4S1VA 1ENZA 4R16A 3I1JA 3MJVA 4YDRA 1EQUA 4CM4A 1FDUA 3DZFA 3OIGA 4GMFA 2I5PO 2VWHA 4ID9A 4U6SA 4QX6A 5ENDA 2DBVO 2PH3A 4ZICA 4D79A 3NT2A 3H6KA 1GUZA 2UAGA 4TZTA 2YV2A 2EJVA 4XGIA 4IM7A 4BNLA 3QWBA 1V9LA 1SZJG 5AQ1A 3HE3A 8LDHA 5G2OA 3RUEA 2Y1FA 4MINA 4IDEA 4C7JA 4MKXA 2Y0DA 1MUUA 1XWFA 2WE8A 4TSKA 2NM0A 2HK7A 4XGNA 4WEQA 1E6UA 4B3JA 4BNWA 4NZ9A 3RD5A 1LC0A 4BNKA 4K1LA 1I2ZA 3NTRA 4YWJA 5TX7A 1VL6A 1BWSA 1D7OA 5CFZA 1P9LA 3DOOA 2ZCUA 2GSDA 4KUGA 2DBQA 3EY4A 1TA4A 4CL3A 1YDWA 5A9RA 4FGSA 4D42A 1AXGA 2I3AA 5B4TA 3ANMA 3QHAA 1K2WA 3K73O 4EEZA 2GUGA 5JDIA 3QE3A 4A5OA 3MJEA 1Y9EA 4FC7A 2C82A 1I3MA 4IXTA 5GMOA 3RASA 1N7HA 4B8WA 3KO8A 2G0TA 5L7WA 5A3JA 3PHGA 3OHSX 1P3DA 1EDZA 3KB6A 1T1RA 1GPDG 4TRNA 4WCDA 1EE2A 2Z95A 3BHIA 3AWDA 2YDYA 3TL3A 2O3TA 2O48X 1HTBA 5CDSA 3RC2A 1QLJA 1W0CA 3DZHA 3ASUA 3PWKA 4KOAA 4GX1A 2OFPA 3OJOA 3DBVO 3NT4A 2V7PA 1BXGA 4TQGA 4E21A 1UP4A 3OFSA 3QW2A 3U4DA 3UAGA 2NVBA 5JE8A 4I1IA 1BHSA 3FI9A 4TROA 4W82A 4X54A 2X8LA 3RQSA 4HFNA 4YTEA 1M66A 2PKRA 2A35A 4E13A 1GV1A 5THQA 1YJQA 4EUHA 2VNSA 3D4OA 3ZV3A 4IJUA 1UP6A 3GG2A 3IIEA 4CUZA 4DLBA 4QECA 1R6DA 4CODB 1ENYA 2AG8A 3JQFA 4Q3NA 4A27A 1VM6A 5CDUA 1LJ8A 1JA9A 5JCJD 4A73A 5KJFA 3T4XA 2Y05A 1ENPA 1M6HA 4O6VA 4YT5A 2P5UA 4FCCA 4EUFA 4OSPA 3K2EA 5TIIA 3WTCA 1NQTA 5EJ2A 1ZO8A 4BNHA 1C14A 3PYLA 5DDIP 5T5QA 2BI7A 1Q1NA 3I4FA 4YVFA 1NP3A 4G65A 3MOIA 4DLAA 1HYEA 1P0FA 4IMPA 4CM1A 5MDHA 3DONA 1Y81A 3C85A 3WGGA 3L6EA 4CM3A 5IJZA 3TDKA 4CR7A 2PLAA 4E2YA 3QVTA 4PZCA 5DBIA 4CJXA 3N74A 3R6DA 4CMIB 4E31A 1WLYA 3E9NA 4ZN6A 1L1FA 3RWBA 2RH4A 1NFRA 1BSVA 4XCVA 1PJSA 4JGBA 3VVBA 3B6ZA 1LX6A 4YT2A 1G0OA 3PZRA 1YQDA 3ZWOA 3I23A 2Y66A 4YQYA 3L6DA 4D3DA 2AQIA 2X1HA 4ROSA 1MXFA 3EVNA 1F17A 6ADHA 4K28A 4DPLA 4OQZA 3TJRA 3PJFA 4FOSA 3PLRA 3ZWNA 3GZ4A 2HRBA 4BGUA 3LU1A 5JXWA 1T1SA 2A4KA 1PZHA 4LSWA 4AJHA 2O2YA 2X5KO 2G1UA 3LC2O 3LLSA 4YJHB 5DT9A 4E2WA 3F1KA 4PLCA 1KEWA 5FYDA 2P4QA 3I4CA 4ZGWA 3A14A 2JAPA 2F1KA 2OUIA 4URFA 4AJ4A 5JYEA 4GBJA 4EJMA 1YO6A 2B37A 3TOXA 4YEDA 2Y1EA 4MKRA 3JYNA 4CMGA 3GNSA 3B1FA 3W4JA 5COAA 1I2CA 3ZWAA 1I33A 5HWSA 2HMVA 1WZIA 2ZB7A 2J3KA 2NTJA 4Z0HO 5GY7A 2YV1A 4DRYA 2ZJ0A 3UFXA 3UGKA 2HDHA 3NTQA 3ZN2A 5A03A 1VJ0A 1G1AA 2V6BA 1PZEA 1H6BA 1PGJA 1MXHA 3E82A 1AGNA 4ZRNA 3H9GA 2JD0A 1MV8A 2WYUA 2XF8A 2O7SA 3HB5X 3LT4A 1EUDA 2I66A 2WE7A 5TS3A 1KVSA 5T8KC 4YAIA 4D45A 2O4CA 4BQRA 3AOGA 4PGFA 1Z7EA 4MP6A 1QSGA 1KVUA 4J4HA 4NBWA 3ZHZA 1A9YA 3KXDA 3DBRB 4GLOA 5T57A 4PLGA 3ADOA 2OXIA 3DQPA 2BF7A 4IDCA 1YB4A 4WPGA 1ZIDA 1J4AA 5LCXA 3WLFA 5A5EA 1IHXA 2GASA 5IN4A 2VN8A 2ZTUA 2W2KA 2BRUA 2JCXA 3CE6A 3VZPA 4PVDA 1VKOA 2H5LA 1XELA 3GLQA 5JC1A 4RPGA 5TNXA 4HUJA 2J5KA 2P2SA 1U5AA 1YE3A 1EVJA 1EBUA 2X7HA 3OBBA 3WFIA 1WXDA 3GVCA 3U4HA 1ADCA 2ZQYA 3NDIA 4RV9A 4A10A 2Q99A 4AJ1A 3FTNA 2C54A 1XHLA 2RAFA 1DLJA 1Y5MA 4G81A 4HXYA 2PD3A 1PSDA
chains in the Genus database with same CATH superfamily
1HURA 1W48A 4X1YB 3OLYA 4Y1FA 6Q21A 1MJGM 4ZRMA 3QEBZ 2CL6X 1YZVA 3FBWA 1XLVA 2W6PA 1CR2A 2DOKA 1KHHA 1SQ0A 2G9VA 5HK9A 1I7DA 2WHYA 2OFOA 2MSEB 3DGFC 1ZVKA 1B74A 1ZCBA 1QB7A 1IIBA 3WYAA 5AVUA 1V0JA 1QIDA 1P39A 4BKOA 1I4WA 4ZHQB 3VPGA 3TZHA 1A4RA 1CRWG 3PDJA 3KXPA 4GKBA 1C29B 4C22A 4JXZA 2ILTA 2OHGA 3OCUA 4MR7B 4OOFA 2WICA 4YMLA 3MF4A 5D86A 1W94A 1GQRA 2BEVB 1BD4A 4HGYA 2ZJ7A 5B2ZA 2DHCA 1ZNZA 5EHNA 3NANA 3CH5A 4BP8A 3PV0A 1W4BA 4OXIA 2D0IA 2IA5A 5FPPA 2GM4A 2DWPA 4JGIA 3LW8A 4GGMX 2GCGA 3HDHA 4Q9JA 5CR9A 4P38A 4HV4A 4JB0A 1XLUA 1XEWX 1DCMA 5INTA 4OXKA 2E6UX 3AM4A 3E5MA 3H1BA 4QGHA 1DO0A 3I09A 5KCMA 1QQTA 4MEJA 4CVNA 4EJSC 3LNTA 4IILA 1WTCA 2REQA 3CNQS 2R6AA 3I1FA 4UD2A 1I3OA 4KO1S 2ORED 4NH4A 3U6KA 3MAAC 4E5YA 5A2GA 4D0RA 3IP3A 1U8YA 5CD9A 3AETB 1Y7LA 5TMDA 1C8BA 1QG2A 1AV7A 3T1YB 4I3FA 5A4DA 2PX4A 3DNPA 3P9IA 4G8BA 3H42B 4KQHA 4J1TA 5A3SA 1NQAO 3TBFA 3KOXA 1A9XB 2JATA 4RBNA 3OOWA 2ZSDA 4RUKA 3K6JA 3DYIA 3H83A 1TM3E 2AJCA 3CPHA 4F38A 1HKHA 4BV9A 1T3GA 2CVOA 3U3KA 4DY4A 2DEUA 1D2RA 2VRCA 3FPAA 4GGPA 4HNVA 2AD1A 3CNOA 1C1DA 2JL1A 3FCUB 3KZOA 2R1VB 1RKXA 2B8NA 4DQVA 1FS5A 1NYLA 2Y1CA 4PNZA 5AVTA 3BMNA 4EHAA 2FGJA 4IUCS 2JFXA 1DQSA 1FLAA 3VPSA 4PYNA 1H2RS 1LNQA 3DT6A 2CLCX 3QVMA 2A9FA 5ALJA 3L1VA 3TM5A 2YZ2A 3GJRA 3P5SA 3VDXA 4ND5A 2GYYA 1VA4A 3R7WB 2C42A 4DIEA 3ZDCA 5DN6D 5FXMA 3TLGA 1NW7A 4B74A 3U60B 5HFJA 2C7GA 4U9IS 3AVWA 3LE8A 3EF1A 1DQZA 4F9FA 1O5IA 2QVLA 2V6FA 3AL3A 1HLFA 2C1XA 1IQUA 4JUAA 3D3QA 3SKYA 1LLUA 1M34A 3TIVA 1WP9A 2GPBA 4JITA 4LS3A 1SUBA 2QMHA 4BMYA 4ZJUA 3AR4A 1PZXA 3B9QA 3DDWA 3LP5A 3OHMA 3CPJB 3MUOA 2PX2A 2BJWA 1I2DA 1W73A 4DQUA 4MQFB 2XCRB 4CIWA 1WY7A 1GTMA 3HPRA 4GEKA 2IV7A 3MT0A 4QELA 3TSYA 1QK5A 1M8GA 1Y3IA 1ESNA 1AHNA 2UZ4A 4RF2A 4YAJA 4OGGA 1WNFA 3BGOS 1E9CA 4N0QA 4H3HB 3O21A 3DE1X 4JZKA 3WGJA 4FCWA 4F4HA 3NALA 3AKEA 2YOFA 2G9QA 2PVSA 5UKDA 4EZIA 1U28C 5HJ5A 3L4JA 3P2JA 3I1YA 4Y2JA 3WDLA 1M2GA 1C7RA 3RSCA 5H02A 2GF2A 3B3JA 3AHDA 4Z3KA 3IMGA 5J4VA 3AVXA 1DARA 3OJEA 1FSGA 1XVLA 1DC7A 2FW0A 1J33A 3G9UA 2MR5A 4LV5B 4JI7B 1KSHA 1IPFA 2YWGA 2C95A 1A97A 2PGJA 2YIVX 2Q3HA 3HSSA 4MDYA 4WOJA 4HVLA 5M34A 5CAEB 4M1EA 4DLXA 4ZTZB 4FYXA 5DZSA 1JHMA 1Z29A 1MO6A 2PWAA 3KKZA 3L2OB 5ITZA 2VT3A 4EH1A 4RHTA 4KO3S 1BU8A 1Z6QA 4D3FA 2BAGA 5AI6A 5H3CA 1CUJA 4HH1A 4ZHSA 4KQJA 4HF7A 3P2OA 3WIEA 4ALKA 2GF0A 5CUQA 4A8JA 5A04A 3TTYA 3WNZA 2WR8A 1T9KA 1HT3A 3QUCA 2RH5A 1ST3A 5DHRA 4WI1A 5DTIA 2NZVG 2OKGA 5TE9A 2I87A 1OXSC 3KJGA 3OM8A 1MC1A 5HDQA 2Z8YM 5GONF 1KWKA 1DCTA 1SUAA 4Y2PA 4D02A 1QNFA 1UOPA 2AI2A 1F9AA 1GPJA 2RGNC 4CKWB 3NHLA 1P1CA 1NTRA 3DDOA 3Q2OA 4X92A 3WWZA 1E98A 3GUCA 3WQHA 4NJOA 1G291 4B17A 2QX7A 1UMCA 2W58A 2CBGA 1J0DA 1MRZA 4RVDA 2QA5A 1MEEA 1MJFA 1YE5A 2HMSA 1V16B 5CA0F 3F7OA 1DBVO 1KF0A 3G5LA 3FIJA 3I32A 4AY5A 3K9FC 5BQFA 1YK1A 1K4KA 3ETCA 4PZEA 5T8KA 1FNBA 3ZZNA 1F4VA 1MN6A 2RK6A 1JFTA 1PWXA 4QGBA 3A70A 1UDBA 4WXRA 4MW2A 1HE2A 1J5XA 3BMOB 3JXEA 1KS2A 4HTAA 1GG8A 4U6NA 1F7UA 4TLEA 3DMDA 4ZVUA 1C1XA 1TZBA 5EP4A 2JCYA 3I6BA 5IAJA 4D6YA 1MB0A 4C4YA 1DXOA 4E4YA 4NV0A 3X2SA 3V4ZA 5DN9A 5TQ2A 1SM4A 2YQ4A 3C5CA 1ARZA 4GXNA 4UUPA 2ERYA 1HX7A 5TPWA 3AEKB 4KN8A 4ZMBA 1UFKA 4LBYA 2WAYA 2PYIA 2CC2A 4G24A 5LZ4A 3DFUA 3W9BA 1FRZA 3ICCA 3O8QA 3TNLA 3DVAA 3JR7A 4DLPA 1MZVA 3MRVA 2X5NA 1UPUA 4R5HA 5ENZA 5ERXA 3KQPA 4E32A 2QR5A 5KSPA 3GEBA 2EEPA 4EJSB 3UWOA 1N2CB 1Z6YA 3CKYA 3MT8A 4TN5A 3JQRA 3GRZA 3RVMA 5AVXA 4A6DA 4FKMA 1K9SA 4KXUA 4DBZA 1G3QA 1JLSA 5DOZA 1XZQA 4AW9A 4F3TA 5KSOA 2ONYA 3ZWVA 4RO0A 2DBRA 5L3RA 4CFSA 1OAOA 1V47A 1W88A 1TM1E 2Q0QA 1TVKB 3KAQA 4YRBA 3EMKA 1IH8A 2V98A 3LF2A 5KIAA 5K2OA 1V5GA 1YUMA 4L74A 4DDMA 1M0WA 2XDQB 4CL0A 2K7ZA 5EIWA 1TEVA 5JI3E 4FINA 3CMCO 4KZPA 1TUIA 4HXGA 5IBQA 2UZIR 1E1MA 2PMKA 3RJTA 1ATZA 2F3SA 2BJVA 3N2YA 3TVDA 1XDDA 2EERA 4OQYA 3VAYA 3QG1A 2OV6A 4XWWA 3ABSB 3PRYA 3JV7A 5KS2A 3FNFA 2XVXA 4K8OA 3C3KA 1NOJA 4GQBA 5CX1A 1D6SA 2LGJA 1T8SA 1X3LA 2XCQA 3PSHA 5CB0A 4BWVA 1P44A 3TG2A 5ICEA 3HI4A 1ZY2A 2GYUA 1GPBA 3JQCA 3QEJA 4K3UA 5L4NA 4RLHA 3DHEA 1ZJZA 1YR6A 4U5XA 2P9CA 4ZQIA 1JXQA 1UT6A 3SYTA 4OB7A 3TTWA 5LQMA 4GZ5A 4PCVA 2G9NA 2WWGA 4A16A 1VBFA 5EVJA 2QSZA 4Q3DA 2IWHA 3DE3X 1SOWA 5HKKD 5F23A 4C87A 3LOPA 4DCTA 3TXAA 3O4VA 1BDHA 1OFIA 1XRQA 3U4QA 1E1RD 3RC9A 5GM2A 4QBTA 3ICWA 1W4ZA 1UDAA 1ZBDA 3P45A 4PE5B 5IASA 2FQXA 2PZJA 1NASA 2GPTA 4JLJA 5JZMA 4NCJA 1IU9A 1GGKA 5ESWA 5AKKA 3ER9A 4JGGA 1YFZA 2FY8A 3GVXA 1SRRA 2YXBA 4O08A 3KTAA 3QVSA 5BW4A 4OMFG 1FDSA 4XJTA 3IIMA 1GLVA 1QV9A 4I9GA 3W7AA 4PPNA 3ER6A 2Q1TA 4PU0A 2WVHA 4ZVKA 3LD9A 4N18A 3TK1A 5L40A 1GKKA 2ISSD 3BGIA 1NMYA 1IBKB 5BWCA 1A8UA 2PS1A 3B38A 3MIZA 1NBHA 1Y5IA 1OJLA 1WM1A 4RIGA 2GBIA 3A28A 1H0KA 4RV4A 3K0FB 3LC1O 1SUCA 5H9VA 4E11A 2FDCA 3HRIA 2ZITA 2XQGA 2QTRA 3ABQB 3BM5A 3CW2A 3NH9A 3H5TA 5K99A 3FTFA 5BPFA 1JR3A 1JHRA 1HSOA 1Y89A 4JX8A 5ECDA 3K05A 3KX2A 5A1JA 1JLHA 3GXBA 3DZJA 2F2TA 1NC3A 2JKYA 1YI1A 3N0VA 5FTLA 3BQ9A 4UJ5A 3EFOA 3OQNA 4UOQA 3DMTA 4HWTA 1WNTA 4GBED 4LWPA 3UMJA 2YUTA 4WBNA 2H11A 4EDFA 1WZEA 1KU6A 4AL4A 4B6RA 3R7DA 1FMJA 2B2XA 3FZYA 5JCXA 2XVAA 3DTVD 3EEFA 1GSAA 1U9IA 4YCNA 1VGVA 1QYVA 2WC1A 3AI2A 4MOWA 1XPJA 1PWEA 2I4LA 4NHEA 1N0HA 1S8OA 2LE0A 4AUEA 2P3SA 1P1RA 2ATVA 4IXNA 1WDMA 2QXYA 4HFRA 2DKOA 4HYEA 3NQ41 3TZBA 1PT5A 3DHNA 5L95A 2HYDA 2EDAA 1S2OA 1NXQA 4WXYB 4HQKA 3CRMA 4MZXA 2I1VB 3PNVA 4RGVA 4H3SA 3COJA 5F21A 1DTSA 3OIWA 2JGDB 3QWFA 4M8LA 4F5ZA 4V1CI 2Q27A 4N54A 4F45A 3H0CA 5L6LB 3KV1A 4Y2VA 1GYRA 2PTGA 2DTXA 3KKLA 1TJ3A 2HIMA 2JH9A 5T4FA 3S27A 2WT9A 3GUUA 4MRMA 5DRYA 1ZSNA 3TQCA 4ZU3A 3GWGA 4MYDA 5D51S 4QDTA 5EMHA 4JLAA 5EIAA 4ZC8A 4C5CA 1RYDA 5GV7A 3HY4A 4LC9A 5BNZA 3NTUA 3Q7SA 2XWSA 4TMXA 5C1OA 3M82A 1SOUA 1WDLA 5DE3A 4XGRA 2V4ZA 3SQXA 1RJFA 1ZIYA 4LJ6A 1Z08A 3K15A 2PO7A 4DLSA 4EHLA 3C0KA 3KLPX 3I8SA 1X1DA 1ZLYA 2CHGA 3N1UA 3NO4A 1RI2A 2LCFA 3G8AA 4RDHA 1L7MA 4EYOA 1U65A 2BBWA 4KQCA 4XGKA 1BAPA 5G4KB 3ZDFA 4DCJA 5DN6A 2O2IA 1VYUA 2UYHA 5E2IA 4OEHA 4QM7A 4FHCA 2Q5JA 1UQUA 3NHAA 2XZTA 4DXAA 4G1MB 4DLWA 3B1JA 4OQXA 2FW9A 3I34X 1YJBA 1BHJA 1RIIA 1TKCA 4ERXA 4WECA 4PN7A 5I3ZA 1STOA 3E2MA 1E4OA 3CEJA 3EXG2 3F5MA 3HKCA 5FWDA 1XL0A 2TYSB 4F8YA 7ADHA 5KMGB 3KUKA 5DK4A 2OCAA 3FTCA 1TPYA 3GJ8A 3FPSA 3PI6A 1OCEA 1HEUA 2J9XB 2YW2A 3E9YA 3MRTA 1NSTA 2YJGA 3OU7A 1NX6A 3RV3A 3RSZA 1Z5GA 4GUDA 1SOMA 1L7DA 1Z0KA 2GSWA 2W4MA 4GOKA 4TWRA 4NDAA 4ZT4A 2BEUA 1E2PA 1O6ZA 3BC1A 3WOHA 5AUPB 2ZJYA 3P19A 3H9JA 4N0MA 4B45A 1G3IA 3OVMA 1WCWA 5D5PA 5IKXA 4H60A 2ZCVA 3CW8X 1T9GR 3IAS6 1ID8A 2QRNA 5ITWA 2G0NA 1C0KA 5AVQA 4FFBA 1YKFA 1XC7A 2FZCA 1RWNA 5IS2A 2IEDA 3GCZA 1Z88A 3H2SA 5IAKA 3RRZA 4LYYA 5JDCC 5JNUA 4G4JA 4QFDA 3IHTA 5DNCA 1SCNE 2EBFX 2AWOA 1R3DA 4UXIA 1SPBS 4GG1A 4KWEA 4NOKA 2C5LA 3FZNA 4EAQA 1W0KD 2V8BA 5FBKA 2DUJA 4R1SA 5BYAA 3H11B 2FXIA 3SJBA 3EHDA 3LS2A 3DD1A 3OZTA 4L5JA 5AK5A 1Y7PA 4ZU6X 5L45A 3TE7A 1RAAA 3RYHB 2F3UA 1AHPA 4D9IA 3L4SO 5DTJA 4A8HA 3FKSD 3MWKA 3R6WA 1OHHA 1CEQA 1EXNA 1XB2A 5EZ6B 2BHSA 3L7MA 5F73A 4MWSA 1PJ3A 2FR8C 3OTQA 1QPGA 3HN7A 1J8VA 2XKKA 1E6KA 3M49A 1FZTA 2VTVA 3SJZA 4K88A 4R2LA 2OAQ1 4IQFA 4TMKA 3C6XA 4LJ9A 1CIVA 2ZS7A 1XNRB 1WY5A 3JAWB 4QU8A 1ODJA 2IYLD 2OAGA 3IQZA 2QZJA 5AKXA 3I73A 5JQGA 3IELA 1JJAA 1ES9A 1JLKA 1MOZA 1PJ8A 2LVBA 4NONA 2F43B 1UXHA 4QXAA 3VYSB 1RC8A 1SIUA 2H63A 1SCAA 1V3UA 2A0FA 3E81A 3VKUA 4H1UA 3BWYA 5DM60 4HDSA 4O4IB 1T4CB 1YS9A 2AFIB 1L6RA 3LUKA 3MJSA 4I1SA 4YALA 4DJEC 1KU0A 1KY3A 3HJNA 4EHBA 5HW0A 1J1IA 4CTKA 1N33B 5IDXA 2PVPA 4MW0A 1TYZA 3AY6A 2XA2A 4PLTA 5DU2A 4RDIA 1PJQA 3ADCA 1HG1A 3I9JA 5FUBA 3IAAA 1R00A 3MMSA 4R7GA 4YUWA 1TEXA 1MP0A 3C3XA 4HQ0A 3R5SA 3MFYA 4Q3CA 1S7GA 4JBNA 5CLIA 1VE9A 3K9WA 4ZI5A 1XALA 3GJZA 1GQOA 1X7GA 4FGWA 4TYQA 5REQA 3V1MA 4EKYA 3LTNC 3GGPA 3RUIA 1GTG1 4RVHA 2H31A 1XVUA 4HXFB 4KWIA 4LHWA 1VL1A 3QUQA 5B53A 1ILWA 1K08A 1T91A 4ZJYA 1I7QB 1RQPA 2QTHA 4US2R 1EFRD 2AN5A 3PCTA 2QZZA 3CINA 1AKYA 1P7YA 3TAHA 1JBKA 2R6FA 4G0MA 4AZVA 2BBSA 4R1MA 4BLOA 5IFLA 2EKPA 4MTLA 1Z12A 4NLLA 3QE9Y 4O2AF 5MHTA 1J22A 2EX4A 2BDUA 5B36A 3R5FA 4JUDX 2O8BA 2ZE6A 2CUNA 3KJNA 3C3EA 2VYND 3A6GA 4Q9DA 3O8RA 3I2GA 5J1TB 4WUVA 2G71A 1WMAA 2Q07A 2RHCA 1VPDA 2W0MA 3EEBA 4X9XA 4DCUA 4YX9A 3EULA 1I5RA 4B3IA 4ZOLB 4AXXA 5HKBA 3OZEA 4M55A 1ZRNA 1T2CA 4Z3DA 3RTBA 1R64A 3D43A 4W8HA 3RT9A 3SSMA 1RHQA 3OEED 2J8ZA 3NBYC 1Y1QA 2Q6TA 3TLYA 3ZDRA 2LP4Y 2PZ8A 4BS9A 1CTQA 1EM6A 1XXHA 3FH0A 2BMDA 1KRXA 1A4IA 3HG7A 2BUAA 2ZYHA 3OF5A 3ZDXB 2XUOA 2YJZA 2FZ5A 3FNHA 4F6LA 2Q3EA 2PZMA 2Z04A 4FHZA 1FDOA 5AD1A 1Z35A 1ML3A 2ZTMA 1E3DA 2YZGA 4H0NA 4JC8A 4N5LA 4XJXA 3BH0A 4NBTA 2BSQA 1P62B 1J2YA 1HLPA 3FUTA 1K9VF 2A14A 1U7XA 1UZUA 3BZUA 3PRJA 4LBZA 1NXPA 1YI8A 2C07A 3IUPA 1ZNWA 1TK9A 1XRSB 4RK4A 3SLKA 4DMHA 1KOGA 1APBA 3P2MA 1IONA 1OZFA 4FD3A 1VE3A 2Q29A 3JQ6A 2HJGA 1GZDA 2W9XA 3EF3A 5H4HA 1IN6A 3G5AA 4G1FA 2FPUA 3U3XA 1Y5NA 4Z7NB 3OKAA 4UPVA 1JJVA 1KOLA 4K9RA 4DUYB 1P60A 2YWJA 3CUKA 1KK2A 3SI7A 4AJOA 1WWKA 2JKZA 5I7VA 1UAAA 1HT2E 2B69A 3C14C 5C1DA 3TRKA 5FA5A 4JYCA 2V9CA 5C0OE 4RVUA 5HKKA 5EL0A 5L3SA 2BHRA 2EFEB 3V7FA 3KT0A 4QFCA 5D3QA 4MLPA 5KKAA 3CCFA 2SCUB 4CEHA 1NHGA 1E1RA 4PZUA 6YASA 1Y8ZA 3EQZA 1GL9B 2YWBA 2XXBA 4E4RA 2QMOA 4FBGA 3UJDA 4Q4AA 5FPKA 1MOSA 1X8LA 1Z2CA 1ITZA 1K88A 2MIIA 2VTKA 1A7UA 3NORA 1D2AA 4GICA 4D92A 2RGAA 1IB6A 4XTRA 5KNDH 2PT5A 2QYSA 2RDMA 4UCQA 5F1YA 5C5DA 5BSUA 1XGKA 3VPXA 5HJ2A 3ZE6A 4BNFA 1VPEA 2NSLA 3BG5A 2R97A 5AKEA 3PIDA 3B1KA 5CT9A 3OURA 1G4HA 2O2ZA 2QDXA 3IUSA 4P22A 3BQNB 4PF1A 1X2EA 5FI3A 5IBPA 2QW1A 2OK8A 4RWZA 2E5FA 1N5IA 2J9FA 4I4TB 4UREA 2GNAA 3NM5A 4DMGA 4NF2A 3REQA 3STUA 1ZP6A 4X8LA 1I4DD 2RHGB 2QN2A 1U2GC 1A50B 4G0UA 2YWHA 1DG1G 1A9PA 3GLFE 3UIEA 2AC4A 4UU7A 2QLBA 1Z15A 1EEXB 1PQPA 2VDUE 2VPIA 3ZY6A 4AQYB 2GPWA 3PNBA 1I0LA 4LZNA 4B6EA 3AOEA 3CVYA 4J94A 2XXAB 3L5KA 1LW7A 1X7ZA 2VSNA 4R8MA 4WTOA 2NVUB 3L7KA 5KU1A 2QTVA 2QT9A 4LJYA 3A9RA 4DQDA 4GR9A 4O3FA 1E92A 3OA0A 3SXPA 2EBUA 1B6TA 1RWKA 2A4MA 2RCYA 3ELBA 2JJMA 4KDCA 4PZLA 2FUG1 3S1SA 2YHUA 5A4JA 5A3RA 3B6JA 5ENVA 3GZNB 1ORDA 1KORA 3WC4A 1JZSA 5KVCA 1P6UA 3SOZA 3W5SA 2VOEA 2GFQA 5KPJA 5GJBA 3HV0A 1N1DA 2LV8A 4HFMA 4UE6A 1W4RA 2WNHA 2XVZA 3DBLA 2H4YA 1V6CA 4IRUB 4R8KA 4DDUA 5HIKA 4LNUB 3VV2A 1UPBA 3OX3A 4HVTA 1CY8A 5EEGA 1IHOA 5C18A 3HWRA 4MVJG 3QV2A 3EEYA 3QE0A 1JU3A 2K5UA 2R1TB 5AM2A 3KL4A 2RC6A 1UXJA 2CFTA 4JVNA 3IKVA 2NAPA 1X1TA 4RHFA 1SKAA 2FZLA 4ZAVA 3KJXA 4YJGB 1SVUA 4YFVA 3PD0A 4KFSA 2BFCA 2NU9A 4ZMSA 1OB2A 1XEWY 5F5LA 1JYSA 3CH6A 3H4VA 3ZWCA 2TMYA 1ZONA 2O8NA 1U1CA 1TCUA 4J2TA 4N49A 2HGSA 3ZOZA 2YWDA 4DNQA 1RYMA 4L3WA 3PQEA 1R15A 3DHWC 4R1QA 2OXTA 1NI4A 3W2EA 2O9JA 2QSUA 4GVPA 2W2MA 3OESA 4KJZA 1Y6FA 1EK6A 5AI0A 2IELA 3KK0A 2EL7A 1F2TA 3GLRA 4JT4A 3KKPA 2XBUA 4WFQA 4YGYA 3LGSA 1KAGA 2Q1YA 4XEHA 1NY5A 3UH0A 4E1VA 2KMLA 2VTEA 4AICA 1X13A 4C2AA 3E0QA 1V8FA 8ATCA 1IY2A 1WS6A 3AESA 5YASA 4DJ5X 4LX8A 5IJWA 1GO2A 1R4AA 1RM4A 5A02A 2JI9A 3ANTA 2OBBA 3NXKA 4DF3A 3PCRB 4ZFNA 1F2UA 2J09A 2R11A 3HBMA 1EDOA 4HDMB 3Q2IA 2X4IA 1D5CA 1MORA 1UBNA 4IO1A 4PG5A 2K6GA 5DWQA 2P6UA 5EXPA 4JU8A 4XWOA 2IH5A 4L27A 4ZCSA 4L5BA 5F7JA 1H6AA 1FFXA 5F2OA 5LQSA 1ODIA 3I2FA 2R8ZA 2I7DA 4M8SA 2IYTA 5KNDD 2E85A 3OY7A 4KRYA 1KNQA 3G5UA 1IVSA 5D3MB 3D0OA 3G3EA 1XA0A 1QFSA 2YN2A 3GLUA 1Q7BA 1ZAYA 1PWZA 2HA4A 1NMQA 4DLKA 3WJ7A 3GDFA 1FP6A 4TYPA 2I7XA 4QEKA 4CLDA 1UFOA 2G36A 3GEHA 1J2TA 6GPBA 3QA9A 5DP2A 2LD4A 2ACKA 2RGWA 4WLUA 2FPOA 3ORQA 2NACA 2C2XA 3O92A 2YWEA 1KJJA 5E3IA 4Q4CA 1IY1A 1KSFX 1BGWA 1YIAA 4CLXA 1XMJA 3JVUA 2JBHA 4XTCS 1EESA 2WSBA 2FPWA 4B34A 4DVGA 1W0KA 3W3AD 4RM2A 4L9AA 3SFTA 3SYRA 5A4AA 2V1XA 4I1VA 1OXBB 1N1MA 4PAMA 1RXEA 3AHIA 4H17A 1WPXA 2FN8A 2GAFA 1EI9A 2ONKA 2VF4X 2VSOA 2BZ0A 2O3JA 3GFVA 3K2IA 4DEVA 4HEHA 4Q4JB 3UY4A 3F3KA 3IUEA 3FKSA 1NF9A 1OLOA 2IP1A 5LZ2A 2DLCX 1T4BA 2FPXA 1KYYA 4YJ3B 3ZY4A 4CN8A 3AXTA 3HADA 5CFLA 1QVRA 3L7JA 4WNAB 3Q3CA 4DHWA 4GXQA 2D1TA 4X84A 4Z7JA 1JMKC 4TRJA 5DLPA 1QR2A 2PYZA 4QAQA 3M4XA 5FAKA 1ZK1A 2QLTA 1YJCA 1X80B 4IDHA 5FORA 2VDJA 4MVJE 2AN4A 4UBJA 1T2DA 2I3BA 1ZJ6A 1PF7E 3G8YA 5JCJA 3QJ5A 1HLGA 3ESQA 4HR7A 3UKJA 3FPCA 4NH0A 4YRLA 1JHYA 3O4JA 2PSHA 1YB1A 2TS1A 3SIRA 2YFHA 5G0SA 5KB3A 1CJMA 3PB3A 1BH2A 1RYEA 3SYMA 4CV2A 3O03A 4B3GA 4NJEA 2ZPAA 1R4NA 2XZDA 1ZEJA 5LOVF 1LK0A 2XRYA 4C21A 1XTTA 2FDXA 2WWFA 3V3TA 5BMVB 1E63A 3BJMA 1SOAA 3EH2A 3KLMX 4Q18A 3HCFA 3OQHA 2HSGA 2BGJA 4LYDA 1WBBA 1E20A 2O06A 4WNIA 2IBTA 1Z5NA 3WQSB 2Q49A 3T3MB 1A69A 1H8HD 4ZDKA 4GOOD 2EW8A 1AK2A 1SXJB 2JFZA 4AZWA 5BV0A 1K6XA 5JFTA 1KC1A 4UEKA 5EJ8A 1FTWA 3DUFA 1JV2B 3F49S 3QEKA 1P1IA 4H3KB 4BV8A 4FYWA 3KU1A 4FJ1A 2IOQA 2REXB 4AO6A 521PA 5PNTA 1JAZA 3HH8A 4QWWA 1MABB 4PSUA 1Z8DA 3C4JA 5HUHA 2QQ0A 1U63A 1NBME 2DG2A 2J41A 2UUOA 2WK1A 3GFBA 3D7KA 1LPOA 2C58A 3CKMA 4MV0A 4ER0A 2CDNA 1GKUB 3RRFA 3C43A 4L5YA 3AF6A 1KO5A 1UIRA 1RRPA 4NU0A 4RA9A 3TUIC 4C4TA 1PL0A 3RAJA 3P9QA 3G7UA 5K05A 1H8ED 3F6BX 4GM1A 2FEPA 4IOMA 5EGNA 3MLEA 4HJRA 1WKBA 1P0PA 1JYFA 2WIKA 4RKYA 2DTDA 2JH3A 4KLZA 2DVMA 4R3WA 2FG6C 3EGOA 5FFMA 3UO8B 2VYNA 4F04A 3HCBA 3KJFA 1VP3A 2YHIA 4DNOA 4P31A 4L75A 4IIJB 1SB9A 5F2NA 4FMCB 3ZXXA 2EC5A 2NUAB 2OHOA 3QXSA 1C0PA 2GPSA 2PSSA 3ND7A 3WSVA 1SG9A 4HTFB 2CBXA 1MG5A 2H4JA 2D2EA 3OEEA 4MQEB 4G9EA 4ZT2A 4WOPA 3C8ZA 7REQB 2O1EA 2W6ID 4RFVA 1EFTA 1T9BA 3GD7A 2XMSA 4EPYA 2C7RA 1PP4A 3D8RA 3FETA 5DIZA 1JUDA 3T7CA 3CUTA 4B80A 1D1SA 6REQB 5HJEA 1OU4A 4YPFA 3O9ZA 5AKLA 1JT2A 2DCMA 3V8EA 3W5VA 1E77A 1QOZA 2ONCA 3FPHA 3IAXA 3DV9A 4EVIA 4FYMA 5KX5F 3E3MA 4KMRA 4TWJA 2DSNA 1K5DA 4GE3A 4MGZR 5DHTA 5FWYB 1N8KA 3OIFA 1DKRA 2ZR9A 4L57A 3PNLA 3VDNB 4F86A 3N05A 5EXSA 1KI2A 3VC3A 3FOAA 3PXBA 3THYA 2ZAGA 3OFVA 4EFNA 2IBSA 1W5TA 2BR4A 4TVSA 1QF6A 2BMAA 4QHSA 2AG6A 4NWIA 2JLVA 1NVWQ 1QBGA 3W2IA 2RIPA 1RHMA 2C0PA 3HBJA 4O4HA 4WKOA 5ILQA 2VJKA 3A1EA 4I5IA 3RYIA 5A3VA 2OCXA 4YCSA 1NJFA 3FIUA 2EKLA 2W6OA 4C3VA 2ZATA 1C3JA 5FOUA 1OX5A 3T35A 2L19A 3NLLA 4CU5A 3P20A 3CJTA 2GXAA 1WKCA 4OBBA 1R10A 3RRMA 3UK1A 3V1KA 3VKWA 3S2EA 4CG0A 4Y67A 2YJ4A 3W5JA 1CEXA 1W8DA 3LT0A 4NFSA 4L6CA 4ZKEA 3HXPA 3E7FA 1KYWA 2DHEA 4P9NA 1PJBA 3B2NA 1QAQA 2IHBA 1RPTA 4RQUA 1A2QA 2OD9A 3KQQA 2PGLA 2NYUA 1QB8A 2JK1A 5CFMA 1QPZA 1L5LA 3QXXA 1O96A 2D1YA 3R9KA 1H2WA 1F0YA 2Y1DA 3MCTA 1U3UA 5AKHA 2JS7A 4I2VA 5U4XA 3SIPA 3CRW1 4R05A 1TM4E 1U0SY 3L4BC 4JJFA 4M1SA 1WBJB 4RF5A 1J97A 5K0CA 2YC2C 4LFBB 2C9CA 3W5DA 4HNAA 2RHJA 4NJMB 3RJMA 2XUKA 3TWOA 2QB5A 5I9NA 4RJKA 1VP9A 1FPQA 3MB8A 1XJQA 2DPYA 1NNEA 2IPMA 1Q2XA 2YWRA 5J1SB 2X0IA 2HKIA 2C84A 4RF3A 1Y6JA 3CGGA 5SYNA 1CETA 2E3JA 4GGOA 5SZHB 3CRRA 1Q21A 1MAVA 4O4LA 1IY9A 5JXIA 1CS0B 1HFEL 5KYXA 3IMKA 3M1LA 4DDHA 3HXOA 2Z6QA 2PH7A 1DQPA 3A25A 2ZCJA 2D1QA 1X7HA 3F6PA 3VYTB 4XIYA 4BE9A 5IT9A 3IVCA 5G0TA 2BUBA 1CLUA 3F1LA 3R4VA 1RP1A 5JS1A 2IZ5A 2AMFA 4PHTA 3WBBA 2XLCA 4FYKA 4YONB 3R3WA 2WAOA 1VA5A 1F8GA 5A6SA 3P94A 2XITA 4H7KA 1I30A 4U9UA 2B25A 4O4JB 2I1LA 4CG3A 2OBNA 4JHXA 1FTGA 1YHZA 4OIFA 5C7OO 4N9WA 2YNMD 4HDAA 3LCRA 3D0KA 4KX3A 2Q4BA 1YULA 5FIUA 5GZ1A 1L4HA 1Q14A 5I48A 4OU5A 4I55B 3L8DA 1DAOA 1F1BA 1O6FA 3D7SA 5JMOA 3ZW9A 1EUCB 4PZ0A 1UC8A 5CG2A 4XGQA 1DDOA 1DWUA 2IP4A 2G28A 2PLRA 3KR2A 1H2FA 1WMFA 3DZ8A 2OVBA 3HJBA 4DSUA 4OY3A 4FS3A 4RZ2A 1XN4A 1HPLA 2JLXA 1NQXA 1M7BA 4MX8A 4LN1A 4LEIA 5D00A 1YQTA 3IBGA 4XDZA 2FPIA 3R8CA 3QQPA 3DAYA 1NV8A 4KMOA 4PFSA 5HMMA 2B94A 4WZBE 3ZXYA 4IKOA 1NE7A 3BGSA 3KUCA 4J43A 3L05A 3N0XA 5FF9A 4Y2XA 1N2OA 3GRFA 1PSWA 1QRUA 3RKSA 3SS8A 1QDUA 3NU1A 1KDYA 4E5DA 5CDYA 3U5TA 3EPJA 4OMDA 4XCQA 3F2IA 1R6BX 3KQWA 3BWBA 3RYFB 3KXLA 3TAUA 4LKRA 4AU1A 2O2EA 3MM4A 3LY8A 1NX9A 2YRXA 1PJ2A 4RZHA 3TYXA 5C5IA 3VUFA 1ZICA 3ZGYA 2AMVA 2DT5A 4J0DA 3USZA 1TLLA 4FFSA 3VH2A 3WLRA 3SVLA 3WKAA 2DLDA 3OPMA 1RAFA 3ZWMA 4ZZ0A 2XTMA 4DSTA 2NAFA 2HK6A 3D2CA 1H94A 1SKQA 1TLFA 2DPGA 1XCOA 1XRNA 4YR9A 4D99A 1JSCA 5KNDA 2A1TS 2X3YA 2IYSA 3QXCA 3V8VA 5IYZA 1G8HA 2F9LA 4TVOA 1BEEA 5K5EA 4R84A 3UQYS 1IC6A 3CLSD 2ZEJA 5DB4A 1X1QA 1BKSB 1Z39A 2FX3A 2C3YA 3GRKA 2X0RA 4JH0A 3WA7A 2ADFA 1SH7A 4OBWA 3UXYA 3BCSA 4JP3A 3DQQA 3M2TA 1F3OA 2AT1A 2NU7B 1RVDA 3AP3A 1G6Q1 3OCWA 1T5IA 2WFLA 3E9DA 3PG5A 3ZH9B 4B33A 4FWTA 4NCAA 1EXWA 1YTLA 2NUPA 4JLMA 1SHJA 2WYVA 2Z3ZA 4BFSA 1XQWA 3ZE0B 3HYRA 2QRUA 3GGGA 1EX6A 1CERA 2ZBQA 4HSEA 4R69A 1EG7A 5LZ8A 2CSUA 4OM8A 2DZDA 2HU8A 4WZ6A 1A9ZA 2X2EA 4O2BB 4E22A 5C8VA 1QGYA 4Z4IA 5JZBA 1KP3A 4E1BA 1W36D 1DTEA 2REBA 1RYYA 3NHSA 3SJUA 3T5GA 3VZPA 3C97A 2B1IA 3ZDZB 2JAWA 5KNCA 1BFDA 3L7OA 3KAPA 3KBOA 3SC2B 2PFSA 1F51E 2A59A 4ZI3A 1CQIA 3JQ9A 3T7IA 2B7BA 3JQ7A 1D7AA 5F4BA 1GQSA 4ZVOA 3SE0A 3ST7A 4II3A 1HDYA 4G5FA 2MMGA 2PUFA 1XZNA 1LVGA 4NDNE 2A1IA 2JF0A 5GGXA 3BORA 2X9NA 3QLUC 4EIWA 3K9NA 1VLVA 2X23A 4HLUC 5IT0A 3C5EA 1RLJA 2BMVA 3NNSA 3TXYA 4NPAA 1NHWA 4QGAA 4R9UC 3A6LA 4C0LA 1CY1A 1W76A 2RGXA 2J5RA 4DLRA 5BN3B 4LV8B 2VF5X 4HBGA 4LGMA 1VG9B 2JFQA 1XQ9A 3QSGA 1FMLA 3S68A 5JMPA 1M5RA 4DZZA 3AUXA 1AB5A 5F64A 1NUPA 2GA9A 1P74A 4KH1A 1E2DA 5E8JA 4M49A 2R5NA 4KTVE 1EFHA 3OT5A 4B2YA 1W1IA 1F2DA 3BICA 1F3LA 1XAHA 5JV5A 4J8PA 2I6TA 4B5KA 3INRA 3G1TA 1HEIA 1SD1A 4K03A 2WMDA 4F5EA 1TFUA 2XUPA 3BRSA 1NVXQ 3R9WA 2A58A 3ANLA 3ICPA 1G9XA 4ESEA 4V2UA 3W1WA 4MVJF 5C31A 1UC9A 1P2SA 4FS8A 3LY9A 1YRAA 3ZHUA 4TV8B 2FSGA 5BY2A 1GIAA 4KZKA 3WGZA 3GROA 2Y92A 3DNMA 3LSYA 1JSLA 1WZNA 2IX9A 2YXLA 3CZRA 1L0BA 1AG9A 1EB8A 2ZR0A 4FEEA 2VQ3A 2ORIA 3QLTA 4RVFA 3DOFA 1LJUA 4N4AA 1MA0A 4JNKA 5C7LO 1CUAA 2I2FA 2ZB3A 3MGCA 4FZ3A 3H3JA 1ZIXA 4U9HS 3FBTA 4CIYA 1GL7A 2VIIA 2BFBA 4BAZA 1H8EA 2C2OA 4A0FA 1E5TA 4IJ6A 4ED9A 2V1UA 4EMSA 5C32A 1UXGA 4RACA 5AM3A 1US8A 4ZRDA 1D5WA 1YXMA 5AXBA 4BO4A 4MVJP 2YS6A 1PFGA 3QFHA 5I8ZA 1HQYE 2HH9A 4G5HA 1RLTA 2I4NA 9ABPA 5C1PA 3GW8A 2Q6IA 3R3HA 1K8ZB 4PG8A 3KZMA 3I83A 2Q9BA 4IY1A 1QLHA 3BN3A 5BNTA 4TPKA 1XCJA 3V3KA 4RHYA 1HFJA 2B99A 5EINA 5C8YB 4COOA 1URPA 5MFZA 1W85B 1X1AA 2I9KA 5IVPA 4YMSA 3HKEB 3PPYA 1ML4A 4ZCRA 2FPPA 2H16A 3S1LA 4TQUS 3VU1A 2PRIA 3KSRA 1ZM3A 1HQDA 1WPRA 3IBCA 4MCAA 4QLAA 4MGHA 4BVKA 1XE3A 1OTXA 2OVFA 3K8ZA 3KUDA 4R83A 4NK4A 3ODPA 5F1PA 2KWIA 1RLMA 2VT7A 3NXSA 3HU2A 2NT4A 3Q2KA 5GINE 3CKKA 4E33A 1L8AA 4A82A 1RJ9A 2AE1A 3KSMA 2WWXA 2X0FA 2Z8ZA 1BDIA 2AXNA 1LPBB 1FA9A 5ISMA 2FHPA 1CWUA 2WHQA 3OZIA 5FQNA 2PJUA 4M53A 5AYVA 5K2MA 2XOEA 3KB2A 4WV3A 1Y3DE 4NMWA 3IA7A 3ZEAA 3RH0A 2PU5A 4BCCA 2HJHA 3HJRA 1QGED 4CKBB 4HEJA 3B7WA 1LC3A 4KAXA 2GZ3A 5ALFA 3SJAA 1XCPA 4CCYA 1SVNA 2R8YA 4RLSA 4CXMA 4C7OB 1KSJA 2GEVA 4QNMA 3CQ9A 1OFUX 4UPDA 2QRQA 1U5CA 5BN5B 3OM9A 1PNOA 4D0LB 3RK1A 4D7AA 2NYRA 2L69A 2Y0EA 4DBVO 1I4EB 3RT7A 1A9QA 2EYQA 1E9DA 5CEJA 2O6LA 3M70A 4LRSB 1I7SB 3HHEA 4OP1A 2PEZA 3K70C 1REQB 3OZCA 4FIZA 2ZT7A 3OI7A 3WRVA 2XX3A 5FTWA 1OWLA 3UXMA 1FU4A 1W4CA 3OT1A 2XYVA 1VPLA 4P08A 5ALEA 3INYA 2I55A 2DX7A 4GBMA 4KI0A 1GJRA 3GJQA 4NMLA 4TLCA 3GQBA 1OT3A 2DQKA 1EK5A 1ACLA 4EITA 4EUKA 1EDBA 2PDAA 4AKSA 1KPHA 2VK8A 4CMCA 3Q3VA 4RD0A 5B1DA 2Q6VA 3WRXC 7MDHA 1YS4A 1THZA 3F0TA 4WL0A 4G3XA 4CYMA 5J58A 1VI5A 2W6JA 1PX0A 2CHFA 3OT4A 5IJXA 5T41A 2HCJB 2ZSUA 2BLNA 4KB5A 4HAUA 3WYBA 3M34A 2ZJOA 4C03A 1XNJA 4MWZA 1MJHA 1D4AA 4C3UA 3CHYA 5EWLA 1LLDA 2LR0A 3O3CA 2AG0A 1FNDA 3R75A 3SZOA 3C16C 1J1ZA 5AKYA 3B1XA 4ONEA 4US1R 1XDZA 2Z58A 4P33A 3TVYA 3VPDA 1F0KA 1SCBA 4FDAA 3RYCA 4OP3A 1W19A 2HO4A 1T34A 2HJ9A 1AURA 1YOVB 2X77A 4NG4A 4M87A