4PSCA

Structure of cutinase from trichoderma reesei in its native form.
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
220
structure length
220
Chain Sequence
WPSINEFLSELAKVMPIGDTITAACDLISDGEDAAASLFGISETENDPCGDVTVLFARGTCDPGNVGVLVGPWFFDSLQTALGSRTLGVKGVPYPASVQDFLSGSVQNGINMANQIKSVLQSCPNTKLVLGGYSQGSMVVHNAASNLDAATMSKISAVVLFGDPYYGKPVANFDAAKTLVVCHDGDNICQGGDIILLPHLTYAEDADTAAAFVVPLVSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbohydrate esterase family 5
publication title A Cutinase from Trichoderma reesei with a Lid-Covered Active Site and Kinetic Properties of True Lipases.
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
total genus 74
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2014-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pscA00
3A2MA 4EY8A 4IHAA 1UFOA 3I1IA 2XUGA 4FKBA 2XQIA 1XZKA 3V1MA 5EIEA 4Q82A 1CUWA 2VJAA 2XQFA 4BC0A 2OCIA 5AM5A 3PF9A 5A6VA 3D59A 2VAXA 1SCIA 4GBGA 1PJAA 1EDEA 4B9EA 4F5ZA 1BU8A 1JKMA 4G8DA 4FLEA 3ANTA 1QJ4A 3OM8A 1AKNA 5ALLA 1HBJA 5A7GA 5LIPA 1DWPA 3TJMA 2XMQA 1ACLA 2PSJA 3IVMA 5ALFA 3G0CA 3MUNA 1ZGCA 5SYMA 1CUGA 3HSSA 1CFJA 2VA9A 4PW0A 5CT9A 1UT6A 2C0QA 3HACA 2VJCA 4CIAA 5AO9A 1VOTA 5K3DA 2WLSA 2BCEA 3WL8A 5HZGA 1EA5A 5DNVA 4E15A 5IVDA 2XB6A 1DU4A 2OGSA 2XMZA 5CH8A 1HPLA 1WM1A 1QFSA 1JJIA 1GKKA 2DQYA 2G5PA 3GUUA 3FLEA 1QFMA 5ALKA 4GW3A 4LIPD 2QZPA 5ALHA 5LZ2A 2W6CX 3K2IA 3WIBA 2HM7A 5JALA 3MVEA 5K3FA 3IDAA 3O0DA 3I2GA 4H7DA 5A2GA 4ZXFA 4QA9A 1E8NA 3H17A 3C43A 3M82A 1E5TA 1UXOA 4KJXA 3QZUA 4QWMA 5T4BA 4BYMA 3WWPA 4K6GA 3G9XA 1GGVA 3LLCA 1VA4A 4RE5A 4JUIA 5AKEA 5HK9A 1HL7A 3D5EA 2VT6A 3T52A 1LPAB 1X2EA 1MPXA 4GHWA 1MU0A 1W52X 2XMDA 4GXNA 4WCVA 2B61A 4OYLA 4ZV9A 4Q1VA 3R40A 1AX9A 3I2FA 3D3NA 4J7AA 3PI6A 4BC1A 2AXEA 4AQDA 1YASA 5FKJA 4J0HA 5ESRA 5HF8A 3D2BA 5AI4A 1TIBA 1XZGA 5ALPA 1QIMA 4CIBA 1A7UA 3JYHA 4EBBA 4C88A 3DL4A 4AO6A 4HXGA 2WUGA 5T4EA 2JIDA 3VDXA 4HAIA 5HKAA 5DNUA 4BTLA 5A71A 4L0CA 4CCYB 3R41A 3HXKA 5T4HA 4H7JA 4J0IA 2OCLA 2Z8ZA 5ALSA 1Q0ZA 1VE7A 3DD5A 2CMFA 4HRXA 2G5TA 2QJRA 1YS2X 1VLQA 2WU3A 4HRYA 3PF8A 1QZ3A 3C45A 3PUHA 4Y2VA 3VKFA 4Y2PA 1QIDA 2PKYX 1BS9A 5DYTA 2HHAA 3L1JA 3SX4A 2AJBA 2OGZA 1EX9A 5HFNA 3MGAA 4YASA 5KWIA 4AZ3A 2Y1KA 2CKMA 4GEGA 2DFPA 2OPHA 2HA0A 1MAAA 1UOPA 2ZJ6A 5JD5A 5AKHA 1UOOA 4G8CA 5CH3A 4INZA 1MX9A 4UBLA 1QE3A 3GA7A 1I6WA 5EHXA 3GROA 4ROTA 4LYEA 4RPCA 1WB6A 2JEYA 3BJRA 5C81A 4OB6A 5E4JA 1CRLA 4E14A 1E89A 2ACKA 4ZI5A 2G4LA 3H2JA 4X00A 2HFKA 3I2IA 1YB7A 2HA7A 1KU6A 5H3HA 5JAOA 3FYUC 2ZSHA 3AZOA 5AOCA 2H7XA 3OOSA 4W1RA 2OXEA 3GFFA 1AC5A 4C89A 1EI9A 4HXFB 1UKCA 1P0QA 3BXPA 2BUCA 4A23A 4QE3A 2BGRA 3FVRA 5C8XA 1ZD5A 3FWHA 2PUJA 3ZWQA 1CQWA 2HA3A 4ZGBA 1IUNA 4AZ0A 2HA6A 2D0DA 1TCBA 5FV4A 5K3FB 4J3JA 4DNOA 5C8ZA 4Y2JA 2XMBA 4Y2TA 1CIJA 2WJ6A 5FDFA 1EVQA 4GWLA 3ZV7A 5BWBA 1ZJ5A 5LP1A 2EEPA 1AGYA 1QIKA 2QS9A 4ZWNA 1ACJA 4C01A 1EH5A 1LZKA 1LPNA 4ARAA 4C6HA 2VQ6A 4BATA 4QLOA 5IH7A 3IA2A 1F0PA 4G8BA 1UK9A 1MJ5A 1QTIA 5AKKA 1H2YA 1XZAA 3V1LA 4F21A 5I9IA 1ZI6A 3DEAA 2WJ3A 4JYPA 3WWOA 3FSGA 1CUVA 5ALXA 3R3YA 2GBCA 4MYSA 2QXUA 3H1AA 4XVCA 1XQVA 2WIGA 1TQHA 3IULA 3OTQA 1CUHA 4UUQA 5IVKA 4GECA 1ODTC 1O6FA 1BRTA 4PNZA 3KSRA 4KRYA 5SYNA 3UUFA 4KACA 3ED1A 3A2LA 2WSLA 4AN1A 2VT7A 1KU0A 1O6GA 5AJHA 3VJMA 2FX5A 1CQZA 5LYYA 1H2WA 2NW6A 2WTMA 2ZSIA 4AMYA 1NU8A 2ZYSA 3OURA 5CXUA 1XFDA 4WJLA 4QDUA 5AKYA 2WUEA 2XUKA 5JAPA 3NUZA 3GELA 1AMNA 1R1DA 3WWDA 1SCKA 3ESBA 4K6HA 1F8UA 3VVLA 4N5HX 3WMRA 4GLBA 3WK9A 4DM7A 3D4LA 4C87A 6YASA 5FPPA 4G4GA 1WHTA 1UKBA 5CRIA 5CT5A 5AI0A 4W1QA 1HQDA 4DMCA 3C6YA 4H35A 3QBJA 1EVEA 3HC7A 5JD4A 2VTVA 3G0BA 1DWQA 2FJ0A 1EB9A 2PM8A 4P93A 3R0VA 1YA8A 4WFKA 1CUAA 3CN9A 3PDCA 4L9AA 1MNQA 1ZICA 5AHXA 1JMYA 5JD6A 5K3EA 4JNCA 4Q3LA 3BDVA 2XUDA 1B41A 4FNMA 2PX6A 2YH2A 1AURA 1FJ2A 4U2DA 1WHSA 1IZ7A 4B82A 3WZMA 2B4KA 3ICVA 1MTZA 4X71A 4H7IA 4JYMA 2HU5A 4PV7A 3U1TA 3W2TA 1THGA 1LPOA 4EZIA 2PSHA 3WL5A 2XLCA 1N5RA 2HA4A 2G63A 2XMCA 1LPSA 4X6XA 5LKAA 4EY6A 4WDRA 2ZJ7A 4B83A 3ZLUA 1Y7HA 3I6YA 3PFCA 4G9GA 4YK7A 5HKBA 5AKGA 3H1BA 5EI5A 4YPVA 4BRZA 4W1PA 4BE4A 2OCKA 4WY8A 3RK4A 1IZ8A 3V9AA 3ZPXA 2BAGA 4UBKA 1XRNA 4BZWA 4EY7A 4MQMA 3RKSA 2RHTA 3QMWA 4G9EA 1EDDA 4X95A 3W05A 2RONA 4N8SA 2XDWA 4UHDA 4O08A 2WUFA 1IVYA 3C5WP 2BKLA 1QO9A 2V98A 2J4CA 1X2BA 3LIIA 4BE9A 5K5EA 2YYSA 2K2QB 1CUZA 4OSEA 5JASA 3DJYA 3H2IA 3W04A 4IH9A 1NU6A 1GKLA 3DKKA 2QUBA 4PQEA 1UK6A 1QOZA 5DYYA 4JEIA 1GQRA 3DKRA 5F4ZA 1MAHA 1ZIYA 4HVTA 4BBZA 5JZBA 1GQSA 3QPAA 1JI3A 3WYDA 4TGLA 4UBMA 2XQKA 3NGMA 2AJ8A 2BGNA 5DTIA 4DMFA 5FPQA 3ZLVA 2XMSA 3ESAA 4A5SA 4UHCA 2R11A 2V9ZA 1X70A 2WM2A 3IIIA 1BN7A 2DSNA 4M0FA 5CT6A 1A8SA 5JYCA 4Q3KA 3F8SA 3PICA 3F96A 1E3QA 3EF3A 3C70A 5FRDA 2WHRA 5ALQA 1BE0A 2CEKA 4U2BA 2UZ0A 3KWJA 4BTVA 5D3ZA 2XLBA 2OG1A 5K3AA 2V96A 3DOIA 4DSAA 1BEZA 4ZREA 3ILSA 4AO8A 2WIKA 3BWXA 1MT3A 3AZQA 4I19A 4IH1A 3V48A 4WDQA 2WG0A 1VZ2A 1K8QA 3OG9A 3AILA 4FOLA 3V1NA 1TK3A 3FVTA 4W63A 5K3BA 1CUEA 3WWEA 3YASA 1J2EA 2HA2A 4QDXA 1B6GA 3ESDA 4Y2YA 4UFOA 5ALRA 2JBWA 4I4CA 2HDWA 4QWWA 4F60A 4IQ4A 4CG1A 1ETHA 3I6MA 3K9BA 2QTBA 1P0MA 3NOXA 3VVMA 4FBMA 3WZLA 3O9MA 1LNSA 2Y2VA 4Y2XA 1XLVA 3X3HA 5DYWA 2I3ZA 5A7HA 4DNPA 3QYJA 4EB0A 1MO2A 2JF0A 1WB4A 4RE6A 3U0VA 1CLEA 2OAGA 2QOEA 4KE6A 1F0NA 1GPLA 2Z8XA 1BEEA 3WKCA 1JU3A 3PE6A 4PO3X 4H7KA 3Q0TA 1DX4A 2J4FA 1F6WA 2AJDA 1A88A 1ZD3A 4OD0A 2WHPA 1UK8A 1EXWA 5JAUA 3HEAA 1QO7A 4QZVA 3DOHA 2GBFA 5CH5A 5A7FA 2WJ4A 3C5VA 3BIWA 4U2GA 5HK8A 1J06A 2QJWA 1ORVA 2GYUA 3ICWA 1PV1A 2YXPX 3H18A 3PUIA 5ALYA 2QUAA 1FFDA 3VJKA 3G9TA 4V2IA 5EFZA 4Y9SA 4Y7DA 1SC9A 2QVBA 2H9YA 3G02A 1KEZA 4NZZA 4BAZA 2X8BA 5JATA 1TRHA 5IKXA 3H2KA 1D07A 1M33A 1CVLA 4IO0A 3EIOA 3BL8A 4Q3OA 5LZ7A 3VISA 1WPRA 4MWSA 1YAHA 1BCSA 1XZDA 5AI6A 3QPDA 4FTWA 1ZI9A 1ZGBA 4OPMA 1BROA 4G4IA 4AXBA 3I2KA 1H23A 2VJDA 3HRHA 4JH0A 4AX4A 4DMHA 4W9RA 2ES4A 1CUIA 3R3XA 3K6KA 5EHQA 4FWBA 2C4HA 2XE4A 3AIMA 4KE7A 4KYVA 3C6XA 3H19A 4K6KA 2FJPA 5FUMA 1UWCA 4OUKX 3WI7A 2GZSA 5EGNA 5KWJA 1IUPA 5BOVA 1QIIA 2H1IA 3FLBA 2O2HA 4FHZA 5FOQA 4PF1A 2O7VA 4WFIA 1MX1A 2VATA 1QLWA 5CT4A 4DNQA 3A2NA 3B3QA 5J3JA 2XI4A 4UHFA 2O2IA 3AZPA 4B0PA 4BB0A 3QMVA 5D6OA 4UHEA 1S8OA 4QDOA 1OCEA 1N1MA 3DLTA 5AK3A 1QGED 3DYVA 3DDUA 3HZOA 3WJ1A 2VSQA 3CCBA 5AM0A 3AINA 1R50A 3P2MA 2E3JA 5ALWA 4BP9A 3IUQA 4HXEB 1YS1X 3FCXA 1XROA 1CPYA 1R88A 1H22A 2PVSA 4BCBA 3E1GA 3FAKA 1A8QA 5T4FA 4LXGA 1OILA 5LZ9A 1CUSA 2ONCA 2ORYA 2WFLA 1EHYA 1EB8A 3I28A 3L1IA 3IB3A 5AKJA 2CB9A 2Y6VA 3R3WA 5AK6A 1WPXA 4CCWA 1XZBA 1ZOIA 4C4YA 3BE8A 1XZHA 3QM1A 2BJHA 3STYA 5ISMA 3IUJA 5ALOA 3E4DA 5ALDA 4BRSA 2PSDA 4N8DA 5EHZA 4Z49A 3IUMA 2X5XA 4FFWA 1TKRA 4UFPA 1VKHA 3VXKA 4DGQA 2ECFA 5HQ3A 1XZMA 1MX5A 4Y2SA 3N0TA 1JU4A 5LZ4A 2WHPB 3QPCA 2PL5A 3DYIA 2B20A 2XUIA 2OQVA 2D5LA 5YASA 5JANA 3B12A 1THTA 4P9NA 1U2EA 5IVIA 3N2ZB 4MEBA 1LLFA 3BF7A 4H7EA 3L1HA 2H7CA 2HRQA 2JGKA 4X97A 1XRQA 4UBNA 1Q84A 3CCCA 2VJBA 4NVRA 1G66A 2XMRA 2ZYIA 4P08A 2PSEA 4B85A 4ARBA 4J0JA 1C4XA 1R9NA 3EQ9A 4YX9A 4UFNA 4BDTA 3QMMA 4J0DA 3KWFA 3D2AA 1GXSA 3WKEA 2J3DA 3KXPA 3WLAA 5DTJA 4HTAA 2WTNA 4H7HA 4B84A 5AM2A 2JGEA 2HA5A 4X7BA 3S2ZA 2EDAA 3T4UA 1W1IA 5ALVA 5HF5A 2RIPA 2PU5A 4UBOA 2WFMA 1GT6A 4L72A 4UHHA 4B6GA 4B7ZA 4QNNA 4CI9A 5FLKA 1SCQA 2HL6A 5E2IA 4MJ3A 4FLFA 1T4MA 3H2HA 3LS2A 5CW2A 4RGYA 1W75A 2RHWA 1K6EA 4OB8A 2LIPA 5KREA 4EY5A 1Y7IA 1VJ5A 3QVMA 4EHBA 3WA7A 4FMPA 1WOMA 1EK1A 4U2CA 1K5PA 3STUA 4M0EA 1WCYA 2XUHA 2XUJA 4AN0A 2HADA 4KAJA 2OGTA 5AKLA 4CG3A 1IUOA 2BUAA 5K3CA 3FNBA 1UK7A 2AJLI 1L7QA 2GBIA 2B9VA 2PUHA 4M0MA 5DJ5A 3FBWA 3RM3A 4J0KA 2HU8A 1ZJ4A 2W22A 1G5FA 3W06A 2R8BA 3ZLTA 3STWA 1YR2A 1U8EA 1W4LA 1QIFA 4BCCA 1FFCA 1Q83A 4KE8A 3TGLA 5AI8A 5JAHA 3H04A 4FBLA 4KEAA 1XLUA 3F67A 3WK5A 5AKZA 3WA6A 3C87A 5IVHA 1XZCA 2JGFA 4DIUA 4X6UA 3AUKA 4OU5A 3WKAA 4LYDA 4BP8A 3W9UA 2H7YA 3KDAA 4PSCA 4MYDA 4BVLA 5AP9A 1OXMA 2QM0A 4H77A 2WFLB 2P8SA 1HKHA 3W9BA 4S0XA 3WJ2A 2JGIA 1Q0RA 1J1IA 2Z3WA 1WB5A 1JMKC 4MQLA 2GYWA 4DSZA 4FLMA 4AB1A 4P92A 3WK7A 3SWWA 3F9CA 3R3UA 1U65A 2WIDA 3D0KA 3DL7A 1LBTA 1XKLA 1L7AA 4Y2QA 1UKAA 4UPDA 1ORWA 3QH4A 1USWA 1CUCA 3FSGD 1MNAA 3OC0A 5ALJA 1XZJA 3CN7A 4OB7A 2ROQA 4DMKA 5ALZA 4RNCA 1CUJA 3NWOA 4H7FA 3JWEA 3A70A 1RYYA 4ZRDA 1XZFA 5HQ3B 1XQWA 3WIOA 2WG1A 1C7IA 5JZSA 1C7JA 4DLNA 4KAAA 4FNGA 1XZIA 3EBLA 1E8DA 1QIGA 2I03A 1CUYA 1TCAA 4ETWA 4N5IX 4GDMA 2XUOA 4WFJA 2IX9A 1PFQA 5CMLA 3C8DA 5E4YA 3UUEA 1FFBA 1G4HA 1TAHA 5AKIA 1LPPA 3LP5A 2Q0XA 2DHCA 3FCYA 1R3DA 2ZVDA 3WKBA 2OCGA 3WL7A 4UBIA 1FFEA 4HZGA 2C5GA 1DQZA 1JT2A 1ODSA 3H0CA 3FYUA 1TCCA 4LHEA 4AO7A 2CZQA 2OAEA 2HU7A 3BDIA 2CUTA 5CBKA 2C5FA 5C7YA 5D3KA 5CTAA 3O95A 4DNFA 2HFJA 4EA6A 4XX1A 3ANSA 3LIPA 1CR6A 3G0DA 5EIAA 2WG2A 2QRUA 4Y2UA 4X94A 1Z68A 1EINA 2CJPA 5ALIA 3WK4A 5ALNA 4U2FA 4TVKA 1LPBB 5C8VA 1N8SA 3HABA 1QIEA 4UBJA 2Y6UA 4J0GA 2C7BA 1L7RA 3O4JA 3C6BA 5AKXA 1EK2A 2AJCA 3STTA 2JGJA 3IBTA 1NX9A 1VE6A 5AK4A 4BDSA 4MEAA 1YB6A 3I2HA 3D7RA 1EDBA 4G4JA 2PSFA 5FXMA 3AJAA 4X6YA 2C58A 4N8EA 3OPMA 4BVJA 3IURA 5LLSA 5BWCA 1R4ZA 4Q05A 1QIHA 1CUXA 2YASA 4LKOA 5AI9A 1P0IA 2IIVA 4OCZA 5JZ9A 3A6ZA 2VEOA 1QIJA 1XQYA 2DQZA 4ITVA 3IUNA 4F0JA 2XUFA 2HRRA 3KOOA 4EUSA 2WUDA 4I3FA 1VXOA 3I6ZA 4OU4A 3Q8WA 1ZD2P 5JADA 2ACEA 3O4GA 1VZ3A 3CXUA 1ODCA 5ALTA 3KD2A 5JIBA 3C8HA 4WY5A 3TEJA 2XT0A 1CUBA 1UZAA 2WHQA 3M83A 4G1FA 4A16A 5A62A 3DQZA 1JFRA 3V1KA 2JEZA 2ZYRA 3STXA 2C0PA 5ALEA 2WKWA 3AIOA 3HLKA 3O4HA 4LXHA 4X92A 4H0CA 2XUPA 1CV2A 4DTCA 1DT5A 3SC2A 1YA4A 5BV7A 1QONA 1DTEA 3TRDA 4NMWA 1CUUA 5ALGA 3S8YA 2JGMA 5HCUA 1DT3A 1VXRA 1XKTA 1P0PA 3BF8A 3MUOA 4QLAA 5HFAA 1A8UA 1XLWA 7YASA 5CURA 2WIJA 5DLPA 4DYHA 2FUKA 1J07A 2WFZA 1FFAA 2HIHA 2QR5A 3H2GA 4KR0A 3STVA 1AZWA 4GI1A 1XZLA 1U4NA 1XRLA 3B5EA 2RI6A 3WKDA 2PPLA 3BJMA 4TPKA 5EHNA 4W1SA 1LGYA 2OQIA 2VF2A 3R3ZA 1ZD4A 1YSCA 5FP0A 4OYYA 2XQJA 3QITA 1H2XA 2WU4A 2O7RA 2ZYHA 3AIKA 3F97A 3G8YA 1W6RA 4FFVA 2I78A 2VAVA 3O9VA 2O2GA 3DNMA 3F98A 3G7NA 1DQYA 5LZ5A 1ISPA 3FOBA 4B0OA 2DHEA 3EQ8A 1H2ZA 2DCMA 3PFBA 3O4IA 4X85A 1VA5A 3WK8A 3FYTA 3FYUB 3DCNA 4B9AA 3FLAA 4XJVA 5AIBA 2PBLA 4PSDA 1LPMA 5AIAA 5AM1A 5LKRA 3R3VA 4B80A 4L3WA 4K5QA 4XIIA 3RARA 5LZ8A 1GZ7A 2DR0A 3VJLA 5AM4A 3DS8A 1W76A 4BZZA 3GZJA 2RGUA 4UHBA 1HDEA 5AM3A 5HF9A 1N5MA 3G9ZA 4FDMA 3WYNA 1XRMA 4E11A 4MXDA 3UMJA 2OLEA 4H18A 2PU7A 1ZIXA 2WQZA 4KE9A 5I7UA 4CG2A 3AFIA 1Y37A 5DWDA 4KRXA 4AMZA 2XUAA 1E8MA 2CBGA 4QDZA 5AH0A 2DHDA 5CT8A 4ZV7A 1SFRA 3E3AA 4BAGA 2WIFA 5ALMA 2BUBA 1JJBA 2BFNA 2QT9A 5EIHA 1DINA 1CEXA 1RP1A 4G5XA 5AK5A 2Z5GA 1R9MA 1HLGA 5AI5A 4D9JA 2Z3ZA 4QEKA 1YCDA 4IH4A 2Y2UA 5E4TA 1XRPA 5JARA 3BIXA 2QXTA 4C4XA 1XZEA 4BCDA 2GYVA 4LXIA 3GBSA 5AOBA 1LBSA 3SK0A 4C4ZA 4XWGA 1CUDA 3RLIA 1FSSA 1CUFA 1K63A 2QMQA 2J3QA 2IITA 1DWOA 4QDTA 5KBYA 5DNWA 4X91A 1SOMA 1YAJA 1LZLA 2GBGA 3D2CA 4X3CA 3WQHA 5ALUA 3WWCA 3LCRA 2EDCA 2JGLA 3E0XA 1IMJA 1MN6A 2RAUA 4U2EA 4BVKA 5AOAA 2ZJFA 1GPKA 5I8PA 3WK6A 4Q34A 4EY4A 2X76A 3G9UA 1BN6A 1AQLA 1GPNA 3HYSA 4HS9A 1AUOA 4MWTA 1QTRA 1ZI8A 3JW8A 1JJFA 4J0CA 3HJUA 4E46A 4PSUA 1DX6A 4B81A 2XMGA 4BAUA 5D7BA 1XQXA 3G0GA 3WL6A 3M3DA 2XQGA 1T2NA 1UOQA 3G0IA 5AICA 2V97A 3EQ7A 4KAFA 1BCRA 5HF6A 4CFSA 4X93A 4NS4A 4Y2RA 3I2JA 2WILA 3HI4A 1G42A 2QKYA 1E66A 3ZI7A 2I3DA 3M81A 4CCYA 3I1YA 2GZRA 4J03A 4K2AA 3ESCA 2XUQA 1XRRA 4X90A 5CXXA 1RWQA 1K4YA 3C6ZA
chains in the Genus database with same CATH superfamily
2VYVA 3WXBA 2X9VA 4Q1DA 4QOHA 4PZEA 3ZDDA 2UUAB 1YQXA 4KYUA 4U00A 2G8LA 3UTCA 1X87A 3B3JA 3EAQA 1UKEA 2FETA 5KVQA 1HL3A 4DADA 1TA4A 4RVFA 3MQFA 4ZICA 2Z6UA 3AQ4A 1XI2A 1NW4A 2R65A 3W7VA 1L1QA 1NVBA 3C7TA 1OAAA 4RHCA 1OYVA 3ILXA 4Q4AA 2XZOA 2XQIA 1XZKA 1Y5LA 4LF8B 1RHUA 1KI9A 2VJAA 1SWVA 1FYDA 3V6MA 1QYWA 1E6WA 3KZ1E 4D3SA 5BN3B 2KBEA 1AUXA 4TRRA 3LLVA 1CEYA 5LA6F 5BOSB 1G6Q1 2P0AA 3QUAA 2OCIA 2BPOA 1N9KA 2EBHX 4IIDA 1O6ZA 2P2DA 4BWYA 1FNBA 5DGTA 5E8JA 3OJ0A 2XIQA 4ZRNA 3ICQB 2QRPA 1BQ4A 2B2CA 1M1XB 3CH7A 3H8SA 4HWGA 3UOGA 3QNUA 1SCIA 2MSWA 3GJYA 1JR4A 2WWWA 5KZMB 2X14A 3EG9A 1EDEA 1ONNA 4MCIA 4DDHA 4MV1A 4P2BA 3RYHA 1NJ1A 1JKJB 4O1HA 1BFUA 1JBKA 1Y4AE 1BU8A 2GVDC 3I9FA 4JSRA 5CM8B 3REQA 3L77A 4TMKA 1DBWA 4XEHA 4G8DA 4GMHA 1NKVA 1GV1A 3SF8B 2UDPA 4URFA 4BEBA 3RG2A 4XFDA 3OM8A 1AKNA 1PJCA 2OYSA 3L49A 2IGTA 1XSEA 3FTQA 4H1TA 5T67A 2MOKA 2LXNA 1VPWA 5ESWA 4XYBA 3TJMA 1VHJA 2BZSA 2YIVX 3HUFA 5DU2A 2R8EA 2JIMA 1TECE 3DEFA 3P9PA 3W1VA 2ZSDA 2BE7A 1YKFA 2VPYA 3FUWA 1N2OA 221PA 3HUEA 3IBSA 2ATEA 3O8QA 2OYCA 4DV1B 3NDJA 5JJIA 1Y3BE 1SK8A 3HSSA 4WBSA 5B4TA 2PGNA 4M7PA 3DBRB 3PPXA 1VI5A 1E2EA 1Q21A 2WYVA 5IF9A 1Y0BA 3O7WA 3NONA 4AY4A 4MGEA 4A26A 1G9TA 1GQFA 2XGGA 2BCEA 1T0UA 4NOMA 1B1AA 3UY4A 5KTSA 1LI5A 3CVWA 4LDNA 4JV5B 4MWZA 2W8BB 5AVYA 3MMZA 1ZHOA 2C99A 3EVDA 5HZGA 1K08A 4LZLA 3OZCA 4ZVMA 1MW9X 1YQQA 2QAGC 1TJNA 3K5IA 2ID4A 3TLGB 2GERA 1KAMA 1RHQA 2J32A 4KFUA 3HFRA 2YQ5A 3DHVA 2W98A 4RV9A 3U4HA 2AEEA 3KVRA 4G5SA 4JT4A 5IVDA 2I2CA 2XB6A 3IOBA 4I46A 3EWIA 5IG2A 1RPZA 4RTNA 5K9ZA 3L7IA 1KQGA 2OGSA 1T8TA 4CRWB 1SC3A 1TIKA 4R8VA 3AHDA 2IVFA 3ESQA 1PN3A 3CH6A 4L4ZA 3GPCA 3S8EA 4G5OA 1MEEA 3LUJA 4JB0A 4B3BA 4DLXA 1AKTA 3GVCA 2C4UA 1L1EA 1HZZA 5F51A 1E9DA 3W5DA 2JFXA 3B1FA 3L46A 4GW3A 4RM2A 2QZPA 1L4BA 4A03A 5LZ2A 3GLFA 3EA5A 2W70A 5JY6A 3HXMA 1GYRA 3HXOA 1DS6A 2FEMA 3A58B 2GEKA 2P35A 3H87A 2QYSA 4KOAA 4RGQA 2YJGA 4WKGA 1QF6A 4LV5B 1CC1S 2HM7A 2GPAA 3OFND 5JALA 5EUMA 3NYWA 5FLYA 4ISCA 1CJUC 1Z0DA 2H1SA 3QEOA 5CM2Z 2H4YA 3WBKA 5KCMA 3NPMA 1H8HD 3TLEA 4EKIA 1NFFA 3OZUA 3V2UA 5CFQA 2A0UA 1I2AA 2CK3A 3ITNA 1JDSA 4LYYA 4BLRA 4EM6A 1GCUA 3L43A 3P45A 4OP1A 1UBEA 5BW8A 1W36D 1VCNA 3O3NB 4KPEC 3LT5A 3Q7SA 4DVJA 2F48A 4N54A 1FS4A 3NIDB 3ECCA 3TQSA 5A5FA 2GOYA 3CYFA 3PIIA 1H1LA 2GD2A 3C41J 4J1QA 4EG3A 3CKKA 1A9YA 2X9NA 3JD4A 3LBNA 2JLBA 4B6RA 4DY6A 4TKUA 1Z6YA 2O3JA 2WHXA 1L5QA 1CFZA 2RH5A 5T4BA 2AFHE 2QQ5A 1S3GA 1H2FA 4BYMA 3WWPA 1H69A 4GQBA 4KV7A 4DLVA 3GQVA 4D25A 1DQRA 1WMSA 1RPJA 2FQXA 4DEYA 2XVMA 3EVAA 4DTIA 3AU8A 1VA4A 4PO9A 4RE5A 5H9WA 4JUIA 4JOBA 3QVJA 2NZYA 4WK6A 5HK9A 3VR5A 1NXTA 3D5EA 4NSNA 5DOVA 4YRNA 2CVFA 3AY7A 1JNXX 4KSYA 1MIOA 3SYNA 2Q4OA 4QUHA 2XHEA 1XMXA 1GN9A 4L74A 3RSFA 3X1WA 5BN4A 3PFIA 3QGMA 2CDAA 4PPGA 1MPXA 4GHWA 4B2IA 3ZQJA 4E3ZA 1ZCJA 2OL4A 3A8TA 5JO0A 1W52X 1YZVA 3LDHA 4NH0A 3TQCA 4QLBA 4MUMA 2O6LA 3T34A 1NULA 3OOYA 4WCVA 4EJFA 2C2HA 4RIFA 3P9ZA 1KJQA 1T15A 4MRAA 4Q1VA 3DDNA 1Z63A 1YI0A 3JQFC 4FR5A 3ZG6A 3EFHA 3EPHA 3E82A 2GLXA 4GMDA 1LI7A 2JLRA 4M3NA 2O3RA 2BGKA 5EP1A 4LFCB 4KDFA 3DBHB 5KINB 2RI1A 2Q5QA 3INTA 2QWXA 4MB2A 2QG4A 3SOZA 5JMOA 1CQIA 3CE6A 3EVEA 4ZU6X 2I6GA 1YZYA 4F7DA 4BC1A 3TXYA 4EFLA 5HKLA 1YHNA 1K88A 2AGVA 3H11A 4KK4A 2Q2NA 2WJHA 3QPUA 5D1HA 5BQ5A 1KZ6A 4DRXB 1FY2A 1BCRB 2H08A 2PH7A 3VAYA 4Q4JB 3D2BA 1XCBA 5BQOA 4E3WA 4E5YA 4ZEVA 3FSEA 3HCBA 5DI3B 1DKRA 4L76A 3A3PA 5AI4A 4NPCA 2NP6A 4PBRA 4TXNA 4YQFA 3QPWA 3SOPA 3JY6A 1QIMA 4G37A 4NPHA 5DNYB 2IYWA 4G9BA 5BO5A 2WT9A 2FZ4A 3UVEA 3UAVA 2N47A 3OZRA 3DL4A 4TS3A 1TEXA 3W2FA 3KJQA 4FYKA 4PYLA 3HEBA 1XTTA 2ZPAA 3EY9A 3KB2A 4GOND 1Q44A 5DNAA 2P3QA 5T4EA 2NVWA 4KBYA 4PWYA 3DLAA 4CLRA 4KMSA 1G6HA 4UEKA 3H13A 3AR5A 4BV8A 2W58A 1FPQA 3RRYA 5EE0A 1MXHA 3IPXA 3R41A 2VBFA 3AI2A 2C82A 3BZUA 5CHYA 3TEFA 1U3WA 5FNVA 3RS0A 4BX9A 3RJZA 5T4HA 1IULA 2IP4A 1HQYE 2EGGA 4CLDA 4CLOA 4A4DA 4JB2A 3O31A 1XCJA 3WB0A 2JIRA 1ZP6A 4NONA 3DBVO 2GCPA 2B25A 5KYYB 2PV0A 1Q0ZA 1VE7A 3DD5A 4LGCA 2QVZX 3MT0A 2JZNA 4FSHA 3WOVA 3MMPA 1SELA 3Q11A 2AV6A 3H97A 3LQYA 4R71A 1QC5B 1YZTA 1E5LA 4K0RA 5TMPA 4F4HA 1XFAA 1VLQA 3GFQA 1DBSA 1M8PA 3KWMA 4RVGA 3KSUA 5ICSA 1VSQA 3HPRA 2JVIA 1DAOA 4JU9A 3A9CA 3G5LA 4C4OA 4G89A 2V4ZA 1UMBA 2WU1A 4Y2VA 4P54A 1F5SA 3JD1A 3Q3HA 3UJDA 4FOPA 1QIDA 1WD7A 2PKYX 3KPYA 1BS9A 1XVAA 3MFYA 4GYYA 1I5OA 5DYTA 5EE3A 2HJ9A 3RIXA 1YGYA 2KHZA 2Z5LA 3L1JA 3LHIA 3QU5A 2R96A 1OFIA 4FJ2A 3MTIA 1S5PA 2GVNA 2SKDA 2JCGA 3OMLA 2QMUA 4W7HA 1VG0B 2E4YA 2R751 3E9QA 4ZHQF 3KBOA 2PUDA 2LCFA 1ZNQO 3AR9A 1Z38A 2VC2B 1N2CA 4FGSA 4P58A 3AESB 5AK0A 5KNDA 2R1TB 3DR3A 3ET4A 1LK5A 1K6JA 1R0WA 2QZSA 5IC6A 2VDQB 3NOQA 3HKCB 4XB2A 5CDGA 3PYMA 2Y1KA 2B36A 2SBTA 2YS6A 1SC4A 2EATA 3L7LA 2EL7A 4GL4A 4RHTA 1PJSA 5KKAA 1Z0AA 1MW8X 1C7EA 4WGGA 3VBEA 2YDXA 2BGMA 3WDLA 4A6XA 4X41A 4R54A 2EZ8A 1ZHHA 1GV0A 2WHYA 3JQCA 2VN8A 5FBRB 2Q0QA 3C2QA 4FMCF 4C6RA 5JQGB 1X15A 3CUSA 4OG2A 4YIHA 4J90A 5JNLA 4INZA 2ODEA 3FUXA 5M2QA 4M0UA 3U4MA 5IT9A 4ETMA 3D8NA 3IUYA 3L6UA 5J4VA 2FUCA 3M5CA 1YC5A 4F7WA 2YHBA 5FHQA 3GLVA 1M3SA 2EJCA 3PSAA 3CRVA 3WTCA 1XJQA 3LKDA 4YRAA 3D1JA 1M34A 4AW9A 3NFYA 3M3PA 4GSLA 4HMPA 3U7FB 1OKKD 1RZVA 4G26A 2R8PA 3WGVA 5AUOB 3VGPA 1YDFA 1R5NA 2G83A 5K2OA 1TDJA 1KRWA 4AMUA 4FBGA 3EVNA 1BOOA 2ACKA 3ZZNA 4XSGA 3Q4GA 5LBUA 1EVIA 2AX3A 2GR9A 3C8ZA 3SEZA 3ZW8A 5CFMA 1AVTA 2W2NA 3O1HB 1YB7A 2AXQA 2FMKA 2WW8A 5CB6A 1EFVB 2MYUA 2HA7A 5B58T 3D81A 1IJBA 1YUNA 2CY0A 2QSJA 1JFFA 3FYUC 5DYGA 5JAOA 4GF5A 1VL8A 2JA2A 4ECAA 4DR5B 1F0KA 3EVCA 1U11A 2HDOA 4W1RA 2OXEA 2HMYB 4M60A 1YQTA 1YI8A 1GFZA 3GLQA 3S1SA 2W8ZA 4C89A 2PKXA 3MOSA 4KXYA 4DT1B 4JVSB 2WB2A 4OUDB 2ETVA 3E9RA 3BGDA 3GXOA 1WXIA 2AOWA 3EXFA 2IXEA 4KDRA 3ZE9A 1TPYA 4GGMX 4OFBA 4TYYA 4E5MA 1IWOA 1EUCB 2Q3BA 3UAYA 1B15A 1T9KA 3CWQA 5J5CA 3TQRA 3P20A 4YPOA 3FFWA 4E32A 2WM8A 2QUZA 4LMRA 4OM8A 3FWHA 3A0RB 1D1QA 1AGNA 1BE8A 4RFSB 5LP6C 2HT1A 1Z6PA 4LGVA 5NULA 1OLXB 5IU6A 1CQWA 1NQ5A 3GR6A 1IUNA 3ASUA 4HBZA 2I80A 5D85A 5TDHA 2HA6A 4AZ0A 4LWZA 1VLLA 5M7EA 2HWYA 1Q1BA 3BJEA 3PL5A 4Y2JA 5CYOA 2Q1SA 1JAZA 2H0AA 4Y2TA 2WJ6A 5BV2P 4QGBA 3MNFA 2VPZA 5KJEA 3OCWA 4DB2A 1MGOA 2VTBB 5TY0A 5AW1A 5I4IA 1KSFX 4OM7A 2XB2A 1DAEA 2VRCA 3I53A 1X7YA 2AHOA 4GLFA 4ZVKA 3H5WA 1DO8A 2Y1FA 4M37A 2QUKA 4WOPA 2RI0A 4PXSA 2ZBUA 1X7XA 3IMFA 4ZOBA 5HBRA 3F4LA 4ENRA 3KJZA 1OX4B 3NH9A 4RJTA 1PHRA 5LP1A 1H05A 1QIKA 2GWHA 3O8OA 3D7LA 1FYEA 2FXIA 4FX2A 3UGJA 1BHO1 1UBNA 2CLDX 4W5NA 1EH5A 4P31A 1O4VA 1TVEA 1YFLA 1KFBB 3T3EA 4CM1A 3AF5A 3PB3A 3TD2A 1LPNA 4YFVA 1N5IA 5KJFA 4BATA 5CDFA 1NJGA 3Q7EA 2Z8YM 3BK7A 1OIWA 4DILA 1JIKA 4D0RA 5LDDC 3BQ9A 1ZKMA 2RCNA 3EVTA 4C0JA 2AC4A 1XVVA 4YLYA 2L17A 5C7LO 3CEJA 1AKUA 1W4ZA 3BX1A 4DLBA 3PLAE 1R0SA 1QCDA 1DQPA 1GG8A 4WZBA 3ZC3A 2CFRA 3IOCA 2K4MA 2ZVQX 2CVOA 3NYRA 3S7TA 2B94A 4U9UA 2OHFA 1NMSA 1CUVA 1XN4A 3FSGA 3PC8C 4LTMA 2A33A 2CD9A 1G5TA 2QXUA 1YJAA 1L4LA 1ESNA 2PX8A 2R97A 3VH4A 4I4TB 2MU1A 5F5LA 2B82A 3I42A 1LSJA 3IDOA 3T7AA 3IULA 4DPMA 1Z73A 3JASA 1JLRA 2YX1A 1JEQB 2QVCA 3RREA 3ZBTA 1U1IA 1WSWA 5IVKA 2AOVA 5EZYB 3TKLA 1O6CA 3R7WB 1YRAA 2E4XA 1D2CA 1P45A 3F0TA 4WV3A 6NULA 1CCWA 1DXHA 2GAFA 3BMQA 1W2WB 4YLEA 5SYNA 4IDEA 3UUFA 1IU9A 3ED1A 4BJ5A 5FEMA 1C0PA 5FNVF 3CX3A 3AVYA 1MEOA 4YH1A 3C7AA 4AN1A 4HX2A 3U7QB 3HN6A 2VRBA 3SI7A 1GKYA 4D9IA 3JAKB 3ZXXA 1PSZA 3ROZA 4DLKA 3K5PA 4JLKA 4MH0R 4LOHA 2H63A 3KYBA 1KOGA 2WF8A 3N59A 5A5EA 5AXBA 3FI0A 4EFNA 2H3HA 2HPZA 3BWDD 3PENA 1TFRA 1CQZA 3GFBA 4Y1RB 2NW6A 2X0DA 2P9GA 2FPOA 2ZSIA 1NU8A 3W4JA 4IZ6A 4HF7A 3O6VA 3OURA 5FUWA 3RB8A 3RTGA 3ZHYA 3EZYA 3OPVA 4KBFA 3EXEA 1HA3A 3RAFC 4HUQB 1K8RA 1J7JA 2BH2A 1P5FA 1VCHA 4C4RA 1E69A 2I4LA 2MTBA 3TNYA 2KE5A 1HRDA 1PJ2A 2RB4A 1GFIA 3ED5A 4W7IA 3SX2A 3SYMA 3W2IA 3GELA 3TXXA 1E1QD 1GAQA 4UNRA 4FFRA 1SCKA 1V6CA 1YS9A 2NVOA 2VSXA 3ESBA 3CUWA 1F3LA 4BIMA 4K6HA 3DDHA 4RHUA 5EOVA 1LF5A 1UC9A 1DC6A 4JJ6A 3LPNA 2BEKA 3SBDA 3VVLA 4AKGA 1IJKA 2FSVC 2H4WA 1YOVA 4N5HX 1ST3A 4QU0A 4GLBA 2GN6A 5HIAA 2C8VA 5HTOA 2YJNA 2FVYA 3C3YA 3D4LA 5K45A 2QBYB 1L3CA 3SZGA 5E9WA 5AMXA 2L69A 3VOBA 1VRVA 3GFPA 4P84A 2P5YA 2IF0A 4CMAA 2CHUA 2AEMA 1LS1A 2FW7A 2YWHA 3ZD6A 1Z22A 1J9ZA 3FCSB 3HCOA 3HRIA 1O9BA 2VUIB 4HGQA 5TB5A 4BPRA 1FXSA 1R3UA 4NZPA 2ATVA 3V8MA 1JHDA 1HQDA 3O73A 1Z5ZA 3ND9A 1E1RA 2QTNA 2X19A 3OWXA 5GV7A 2UXDB 1YR8A 1QK3A 2C3MA 4H35A 4R3WA 3T3PB 1F2DA 1XVUA 4HFNA 1DX9A 1U02A 1ZSYA 2H2GA 5G1OA 1H66A 4AZ3B 2EX1A 3LCCA 3H83A 4IX1A 4PC1A 1J9EA 1HGXA 5KX5A 4HGNA 2PM8A 4P93A 3OM9A 1JB9A 3AR4A 5JDCC 4MS1B 2V7UA 4WFKA 4TT8A 5D3QA 2CXQA 2R25B 4E4YA 2QX9A 1HDOA 1PE0A 3PDCA 2G5CA 1BH6A 1MNQA 2DFLA 3AKEA 3M4NA 3M4XA 4K81B 1IAQA 2YMMA 4QO7A 1PJ8A 2QTWB 3SQLA 3NYIA 2QLLA 3STHA 1HFJA 1ZUIA 2XVAA 3FGPA 2QTCA 3RSHA 1JFLA 4OGWA 3DMNA 5JD6A 3EYAA 2PS1A 4LVCA 3GEEA 1X8XA 5AHOA 4G5GA 4QXAA 1JYEA 3A4LA 2XUDA 5K3OA 2XKKA 4E2WA 3H9QA 3R3JA 1RZUA 3OFSA 4U3JB 1LW7A 4B2YA 4WOCA 1MG0A 4OOFA 4D8YA 4M1TA 3B70A 2XRFA 3GLHE 5DT9A 2BFPA 3K6RA 1FJ2A 4AI6A 2D1SA 1S01A 3O75A 3AHGA 3PL1A 3UJCA 5L3VA 2XA1A 1O58A 3KZMA 3N2GA 3E35A 1N5JA 2R87A 3FYCA 2FFBA 3C1AA 4XX0B 1MTZA 4OHCA 1ISFA 1GZ3A 3TMAA 1QAMA 1T8YA 3Q7TA 1E6LA 4H7IA 4PV7A 3AG5A 1V5GA 1YZQA 1U0LA 1XNJA 2ENUA 2Z57A 4AF7A 1FDSA 2PSHA 1JDTA 4BS9A 3VC1A 3AFNA 4IUBS 3SEFA 1N5RA 2I29A 2VXBA 5D87A 2BR3A 3I6IA 5A05A 2AK2A 5BW4A 3NH6A 5A4MS 1F06A 4RAQA 4K03A 2G63A 2H59A 3QKTA 4R9UC 2QTVB 4F2GA 5LQKA 2QNBA 3JQ9A 3N1UA 3U4DA 2ODWA 4Q3EA 1LPSA 3AEYA 4MI1A 4GSYA 5FCDA 4KXMA 4A2PA 1ZX1A 1NQAO 1RWPA 4MUYA 2LW7A 4L8YA 5EP2A 3OT1B 2O0HA 4H1UA 3DZIA 1O96A 3PX7A 3S1LA 3RIHA 2J67A 3PFCA 2DFVA 5D00A 3OLVA 3SQDA 4B2LA 3HDHA 3BTSA 4HI0E 1BG6A 2FB9A 2AZ4A 3ICPA 4G0ZA 2E5WA 5KYXB 2CNNA 2I4NA 2OCKA 3UFXB 1ESMA 3KFXA 4ND8B 3NM4A 2FN7A 4MKFA 3TTXA 3IRUA 2D00A 4WY8A 2H5EA 4CTKA 3QE3A 3DWGA 3NT5A 5CHEA 4YO7A 1I7QB 2GF2A 3V9AA 3ZPXA 1WXEA 3Q9UA 2PJDA 1NW5A 2BAGA 4MIKA 3TINA 3ETJA 3WV4A 4LNUA 4EHFA 3BKXA 3EJ6A 1KZYC 4HH0A 3W6PA 4TZ0A 5G4KB 3GQBA 3Q3EA 1JT9A 1KGSA 1QVZA 4NBKA 2F90A 2H00A 2MR5A 4M21A 4B4WA 3GP3A 4MQMA 2W2KA 3SJUA 4BBAA 2H92A 4EJ2A 1FS6A 1XXHA 2PAAA 3TZKA 2O05A 3HNPA 2NTNA 1AQYA 4HH4A 3WHIA 2J3IA 2JEOA 1OZHA 1QCYA 3NDPA 1IHYA 1U28A 4ZYYA 1JL3A 3TFOA 4ZANA 5BNTA 3PQFA 5A4KA 1K6XA 4MK4A 3ZUPA 2CNBA 2H1VA 3LSYA 4UHDA 4QXRA 1Q19A 3FDZB 4OJYA 2X4LA 3DOEA 1S4QA 1DI0A 1ZHFA 2Q2OA 2BKLA 2WPDD 3PNYA 2G72A 4Q9AA 2VHJA 5BY2A 1SH7A 3JVIA 1GR1A 1GWNA 1R0XA 1TJ3A 5DF1A 2J4CA 1X2BA 2JCBA 5K5EA 2ZE6A 2BHNA 1RRGA 4N7MA 2YWRA 4MGYR 4TYNA 1M0EA 2EFYA 2A88A 4OSEA 5AESA 4Z7QB 4GNKA 5A2QA 5JASA 5ARDA 3WICA 4QBGB 1AKRA 3OA2A 3OKAA 3RSZA 3HL0A 2DH6A 1NU6A 1U98A 4PIMA 5G0SA 3DKKA 4TMTA 3MRVA 4A0SA 1F8GA 3EMBA 1G59A 1KY4A 4GBMA 4EG7A 4KXUA 1SZCA 4HT3B 1PBNA 4N3GA 3LUPA 4JEIA 821PA 3UK2A 2LP4Y 1PFGA 1HT2E 1QYDA 2GHQA 2R6FA 3DKRA 5FBHA 3TL2A 4NHEA 1HUQA 5T41A 5BWLA 3G8BA 1B8NA 4Q4HB 3O94A 1RC0A 3JQAB 1MB0A 4EHNA 1WSBA 3OZWA 2JFWA 4ZALA 3NRBA 4BBZA 2VDJA 1N1DA 4KPYA 1OKKA 4UTVA 1ONBA 2R8ZA 3FJOA 3HU3A 3IEPA 4GZ5A 4ROSA 3PTAA 2P9FA 2WZBA 3DKIA 4QQNA 2IV7A 3FBTA 4ZEWA 4Y6GB 1R74A 1XOIA 4PHFA 4CM7A 2RH8A 1OW3B 3DMFA 2XY4A 2XQKA 4HVLA 4XVUA 2QYTA 2AJ8A 2J9YB 1PDWA 1VE5A 3KR0A 5FPQA 1OBOA 1PZNA 3H6HA 2G28A 3BRWD 4NATA 1B0UA 4CV3A 5C5DA 3ESAA 3IIEA 1ZR2A 3T5BA 5EJIA 4JBNA 4UOZA 2V9ZA 3NS7A 1R9JA 2D2IA 4J29A 5BRJA 2FPGB 4CKCB 2XKBA 3LXRA 2WEKA 1RJWA 1UPFA 3DL0A 4UQOA 4KX3A 2OWDA 1BO6A 3SXPA 4LY9A 3JARB 1R7RA 1KGDA 2R48A 3EEFA 3TCNA 2Y1WA 4HLNA 2F62A 1B6SA 1MO6A 5GOZA 2OBLA 3KJHA 4UM5A 4PIPA 2G5GX 1UFQA 2I6QA 2Q1UA 3PICA 4W99A 2B83A 4V0LA 4Y1GA 8LDHA 1EXVA 4Z53A 3ELWA 2CVZA 2XTNA 1E3QA 3ECSA 4JC0A 4JY7A 2ZYUX 4QAQA 3RF7A 4OBXA 3C70A 1M67A 2BFEB 2WHRA 1L5VA 2GASA 1CB0A 3N0XA 3OECA 1IY9A 1KS9A 1ZGJA 3AUAA 1EYZA 1JEDA 1YRQA 2QX7A 4NBVA 1NBME 2VDOB 4IHJA 1INLA 2BEWB 5BVHA 3GOHA 3K70D 1UMKA 1QYRA 1NVVQ 4Q1FA 4YI3A 5K99A 3KB1A 2MMGA 2CXUA 2W71A 4FFOA 2Q28A 1C7QA 3NHPA 2O2SA 2V96A 4YDRA 3DOIA 3RT7A 2V7GA 3G59A 4DSAA 3AHCA 4I1SA 2VT2A 3TGWA 4F72A 3CF0A 1BEZA 2PX5A 3DBLA 3ILSA 4H3SA 2WWXA 721PA 2A35A 3BSFA 3R6DA 4AO8A 1SUFA 3VI4B 3N28A 4DV4B 1EUQA 2D3TA 4I19A 3KKNA 3OHSX 5GIOE 4FEEA 4M8SA 4IH1A 3U6BA 2Z08A 3E7XA 4WDQA 1BKYA 1P33A 4MGZR 1M2KA 2IYVA 4EQ6A 4UM9B 2VF4X 4H31A 2WJZB 2WOOA 3BRSA 1KPGA 3INRA 3K7EA 1VZ2A 4UCWA 3I8XA 3E3LA 2QTGA 3USES 4CBVA 3G13A 1N3YA 1UM8A 4EPTA 2G9QA 2YWGA 2AG5A 1TK3A 1U7HA 4XIYA 2ZCJA 4LQ4A 5K0JA 1XO1A 8ATCA 3DT8A 1F12A 4PN7A 2QAGB 2RGWA 2K6GA 4OSPA 3PHGA 4U9HS 4ZPXA 1AMUA 1M8FA 1YO6A 5LXTB 2ZBQA 3W1EA 4IKOA 4DE5A 1ZK2A 2JFFA 4E1BA 2J31A 4J91A 1E1DA 3WWEA 4D9BA 3HVUA 3V8RA 4FD3A 1LQUA 3N86A 2K87A 2ZRHA 2IZZA 3E03A 5L45A 1U9IA 3A1TA 4J3FA 4F8EA 2ZXFA 1OB2A 4N5MA 2I87A 1NG9A 4WZAB 2ZBRA 4RNDB 3WLLA 1XWWA 1PGJA 1HR0B 2I9KA 2KLHA 5IJXA 1B6GA 5J47A 1FRFS 1JQBA 1UEJA 3HVJA 3PFKA 4KVAA 4QBHA 5DGIA 4EB3A 3AL3A 3KALA 4JP1A 4EYSA 5EZ5A 5C3MA 3RW9A 4DBLE 1WHSB 1V1MB 4YRTA 3UGTA 3K16A 4URHA 2DRIA 2EFJA 4JITA 5F76A 3KQSA 2YCBA 3EJWA 5EKUA 4IQ4A 4M7WA 5LL6P 2O3TA 4HX5A 1V7QA 5AVRA 2ID9A 5DM70 3M7IA 1H93A 4NU0A 4TV9F 3SYRA 5JY1A 5K0SA 5GGXA 1P0MA 3EF1A 3NDIA 4XAQA 1FOEB 2EFGA 1LNSA 1YQUA 2RHBA 2Y2VA 2VZLA 3GRKA 3P7MA 4R31A 3VYTB 4RULA 3VGJA 3ITEA 4Y7CA 3CRRA 3OZAA 4ARZB 2AA3A 4MDFA 5ECYA 5IASA 3BBPA 1URPA 4R68A 4TKMA 3JVVA 3L01A 4V0ME 3UYLA 5H4HA 1V5FA 2BFCA 2C3UA 3QYJA 2AC7A 2A78A 4EB0A 2UZ1A 4RE6A 3R9XA 1WB4A 4DCJA 3NOVA 4TLDA 2QOEA 3FTEA 4CG0A 3UOAB 2OFPA 1PDVA 2PZEA 3PTLA 3AV0B 3IRVA 3WKCA 1VFPA 5UKDA 3MXOA 3JALB 5DM1A 3PE6A 1GHTA 1XMPA 1O97C 1JLHA 3HCCA 1QYIA 1AK2A 1M2VA 2YC4C 3W3AD 4DCOA 3A1SA 1DX4A 4N49A 4AY6A 1WPGA 3COYA 4C43A 4NECA 3OUUA 1XK6A 4PPYA 2HUNA 5BSKA 3QWFA 4EA7A 2Y0CA 1ZOOA 3V7WA 1JDNA 1IBLB 1J90A 1T5OA 4Q7KA 4DLYA 5ELLA 3I5MA 1WG8A 5JAUA 3N39C 4NFYA 4AU1A 3WB2A 1JEAA 3RTCA 2JLZA 3W7BA 4JZKA 5JZOA 2BKVA 2HH9A 4A0HA 2BDUA 1Z5OA 3JAWB 4LYAA 5EKTA 2WJ4A 3WMWA 5EHZA 1JWLA 2A9KA 5LU9A 3PX3A 2GI4A 2FZWA 2OK7A 1KP2A 3AEKB 1J0BA 1MABA 2X7JA 3B36A 4CDGA 1LCIA 3KQTA 2ZWAA 4KR6A 1EFAA 3BAFA 3IAS1 5JUWA 2MIIA 3DP7A 1H6BA 2CLMB 2C7PA 4NE9A 4KBGA 4ZJUA 1P8JA 2VO1A 3H18A 1HMYA 2W6MA 5CCBA 4CEJA 5ALYA 1E9VA 1A2QA 1LS6A 3GFVA 2QUAA 1NMQA 2NUPB 1NOJA 4E2ZA 1AG9A 2ZB7A 3I01A 4FOSA 1KQOA 3AF2A 3WB1A 4RA6A 4HN9A 1DBQA 4FCTA 4Y7DA 3OKPA 4X8HA 1EJ0A 2H9YA 4QAJA 4J43A 3V4ZA 4C07A 3G02A 4XQGA 3OQIA 5SY4A 2FPMA 4B74A 4YMLA 1QGUA 1X13A 3ZCQA 4F11A 5JATA 1OLUB 2C83A 3NHAA 1E6UA 1VKZA 3GIWA 1E1MA 3EDQA 4M6WB 5TT1A 1WR8A 1MC1A 4A8TA 1XYGA 4KJZA 4CMEC 1FLNA 4B33A 3K71B 2BONA 3ASZA 4NE2A 3W2HA 5FOWA 4M46A 5JZVA 1M33A 1NHWA 3T3IA 4E07A 1J99A 1SVSA 3I3SR 1N9ZA 3KHSA 3EIOA 4P7GA 1VJCA 3GRUA 5F33A 3O93A 4O4HB 1ZD1A 4MWSA 5DYNA 4YCBA 3TR5A 3WGOA 1EPUA 3BL5A 4DLLA 1G2PA 5A9SB 4KR2A 1GD1O 2HEIA 5AI6A 3UNXA 3LUAA 4MTLA 4AP6A 5AOVA 3I12A 1M6EX 2VBGA 1P1BA 3NHBA 2HPVA 3PFGA 5AVWA 1GLVA 1UDAA 3W1WA 3J81A 5M04A 3NLLA 1QHNA 3QKSA 3W79A 1NC1A 3ODPA 1TA9A 5CA0A 1WAMA 3I76A 3WLIA 4QARA 1R8QA 2FFHA 2OCDA 2WAAA 3I58A 4JH0A 4CMIA 4DMHA 3TTTA 4K05A 3ZEAA 1KK2A 4QUBA 4W9RA 2BFAA 1ML4A 2VK4A 1WW8A 3IX7A 2OY0A 4WN9B 1CUIA 2ZYTX 3LTNC 1QH1B 3R3XA 1EA7A 4BNHA 2BFFB 1K6IA 5GQSA 2F7SA 3DLIA 3F90A 3B1VA 4HQOA 1J70A 4RDCA 4JEMA 1YR7A 3LWZA 7REQA 4EYKA 3DMDA 1EP3B 3GN2A 4DIFA 1SUBA 3H19A 1EX1A 4H4EA 3AEQA 3GFOA 4CTJA 4BO2A 2AE1A 2WVHA 3I5XA 1KJZA 3GD7A 2C5LA 2JG3A 3GMDA 1KRHA 1G8HA 2OV8A 4YAFA 1NYLA 4B45A 4ZTZB 1HE3A 1X7WA 4OUKX 4CQMD 2DPGA 3KYIB 5KCZA 1X1BA 4A1OA 4L3VA 1DKQA 3DG9A 3FLBA 4F84A 2O2HA 4UXHA 3H6KA 1FTSA 4WE3A 5FOQA 4PF1A 4B7CA 5JJBA 4MDEA 1LXCA 4KRFA 1T4DA 4F96A 4WFIA 3CNNA 3THWA 1UMDA 3N6RA 2YMLA 4R40A 1P60A 4DJAA 2VOEA 4DNQA 1Z8NA 4BRUA 2FSHA 3TQFA 3JYLA 3SQNA 5HZHA 3B3QA 3D7SA 5IX8A 3TUZC 4I3HA 2DR3A 1DAIA 2PX3A 4UHFA 2O2IA 4RHFA 3AZPA 1L7DA 4RA9A 4TQAA 4LMPA 4PGGA 3GG9A 2ANCA 1A50B 3TQQA 4Z4IA 1UBSB 3FPAA 3ILYA 1Y8QA 3RUCA 4Q03A 4WXHA 3WNZA 2ZJ8A 1LDGA 2FSSA 1Q5PA 1EM8B 1N1MA 1RQRA 4F9EA 3O92A 4JLWA 3IQGX 4YC7A 4NMLA 5AK3A 1ABFA 2ZS9A 4KN8A 1GNPA 1U1DA 4EYQA 1T0IA 4D0GA 3TBHA 4FS8A 4MWBA 1L8XA 4GI2A 1P6XA 4I9HA 5C1IA 1GU7A 3X2SA 1ESEA 4U5XA 3OE1A 3PS9A 4L5YA 4WOBA 4TMYA 2D7DA 2YBEA 5LLDA 3AY3A 1ULUA 1UJ5A 5TMBA 5AM0A 3AINA 3AVTA 3AGPA 1Z56C 3FA2A 4RHYA 3IXLA 3P2MA 3AF4A 2LDBA 1P2BA 4CEIA 4Z8XA 2C4KA 2FWIA 2X0KA 1ZN9A 2CYCA 3HJTA 3OA0A 4F5EA 4G25A 2WSBA 3ZWDA 1HEUA 2DC1A 4P83A 4Q48A 3NQ41 3DBOB 2CE7A 1EFPA 1MGPA 4KXNA 1CPYA 3R23A 5DO9A 3OU6A 3WLJA 1NQWA 2PVSA 3OY7A 4OKIA 3LQ2A 5MHTA 1N1EA 1NRIA 1NT2A 2J3EA 2ACVA 2WU0A 3GZTB 4NK5A 4RPLA 4BCBA 1NVXQ 1M2WA 4QL3A 4LJ4A 1L8LA 3RI3A 4GP9A 1GNVA 3FROA 4S35A 3A4VA 2YBDA 1TT5B 4DCPA 1IVSA 2JA1A 5BSTA 5LBTA 1LFDB 1TZCA 1U9ZA 1YBMA 5T4FA 1D5WA 1I51A 4DZZA 5J4YA 2IU0A 2XB9A 5IKEA 5HCIA 5KKNB 3O3CA 3ORYA 3PG5A 3G88A 4RKYA 5LP6B 3QXJA 3QK7A 2ZDQA 4F2HA 5LZ9A 4DMUB 1T4CB 4KQIA 3U1BA 2GM4A 2ZAGA 4YP7A 4UE6A 1EVZA 5A06A 2REQA 3F47A 2V0CA 1NR7A 3IPCA 4B3MB 2WFLA 1P7WA 1G55A 5K4AA 3BRWA 2VDWA 3I9V1 1TZKA 4TLEA 2OOSA 4WW0A 1REQA 4L9RA 1FP7A 1VIDA 5BNIA 1UBGA 3L1UA 3ZWVA 1PSDA 3LX8A 1SVUA 2CB9A 3ENNA 5G0VA 3PR1A 3WBBA 4EDHA 1RXWA 3GPDG 5AK6A 1IHDA 3FZEA 4BJ3A 4CGZA 4QQKA 4R6WA 3BD8A 3Q85A 4Q3AA 4YLGA 5F9FA 3FYDA 2VUSA 3LXUX 3EGCA 4NYMQ 3NBKA 1QRTA 3F9RA 4V0RA 5ISMA 1IDOA 5IVPA 3IUJA 2VKTA 4BO8A 4JROA 4WZ6A 4C6TA 2IIQA 5AWFC 2IUYA 5DN6A 3CZPA 5E3IA 1ZUNA 3KTAB 2PCLA 4V38A 3RBXA 5MDHA 3X43A 3U44A 1J8DA 1TKRA 5KYGA 3CISA 1FMTA 2PIAA 3ZD9A 3ZYCA 4UFPA 3TF5A 1FRVA 3SMVA 1TZ2A 1SBCA 1PJBA 1SG9A 5DX1A 4Z9AA 3CNOA 3SDBA 4FMBB 2AG0A 1J20A 3CEPB 2ZTHA 3LT2A 5DCUA 5HQ3A 4N3AA 3D6NB 5GJWC 3MJTA 1MX5A 4DDVA 1ESZA 1ZK0A 4C7VA 1UXIA 2WHPB 4NABA 5ITZB 1QSGA 1ZK3A 3QPCA 5T3UA 2V7QA 3A2KA 2HLPA 5K6AC 4B4UA 4L51A 2WWTA 3BIFA 3R0XA 2NUTA 2YZNA 4KXXA 1C30B 2ZPTX 3CKLA 3WGHA 4OMFG 4DIMA 5K3SA 3HZZA 4MHTA 3DA8A 4OJQA 3LFTA 3EDCA 2BLNA 3ZHZA 5CA1B 5KIAA 3N3AC 3DDOA 3HYCA 2ZYGA 2P2CA 3F5SA 3KOUA 3LUDA 1LLFA 4AMBA 3WLOA 2EZ9A 1LLUA 4QECA 2B7LA 4ND3A 4RK7A 2IYLD 1I94B 2C59A 2CV1A 2PGOA 2YZ2A 4X97A 5BWNA 3OUTA 3Q15C 2F4NA 4G1MB 4M9SA 2YV5A 4MV8A 3VTKA 3W5IA 1GA1A 2AOUA 4QPNA 4NVRA 4DR1B 5FWDA 3ZCVA 5JVDA 4LXYA 1YF3A 2ZYIA 4P08A 2ZRCA 2ZT5A 3K1AA 4J0JA 4L8VA 1Y3IA 2JLWA 4Z0HO 3RS7A 4F4JA 3QBDA 3ES9A 1NVUQ 2BDEA 2ETXA 3IJ5A 3DOCA 1SOWA 3LF1A 1GVHA 3OJLA 4BDTA 2OV1A 3K9HA 2FUNB 1LSUA 2HOQA 3B3FA 4Z0TA 3TGPA 3N58A 1TO2E 2PN1A 4AIIA 2Q9CA 4DBVO 2QLNA 5IT4A 4RPKA 4PAWA 1GXSA 5THQA 2EF0A 2RBEA 2O3QA 5IULC 2E48A 2IHVA 4BVBA 4HDRA 3SJBA 3E22B 3OSUA 4EECA 3QUSA 1R8JA 1P1HA 3UC9A 3IESA 3ZGOA 4D3DA 4H7HA 2HA5A 2XQVA 3Q6IA 1XTSA 4M7OA 2EDAA 3AK4A 3WC4A 4YJFB 2AG6A 5FA6A 4FD2A 2ZB8A 3QVVA 4AKEA 3KHKA 4KPFC 2RIPA 5LPNA 2PU5A 2CZCA 3QV1A 1VJ0A 5HBGA 1KBQA 2XUZA 4QJ3A 2O19A 4I50F 4EQZA 1CYEA 4L72A 4ZC1A 4D4JA 1PNQA 4CI9A 1QH8B 2J46A 2ZDGA 3MAJA 4YECA 1VMDA 4JNKA 1DJLA 4MJ3A 4BNYA 3RSGA 3UV7A 5KQSA 3E3NA 4FLFA 3CINA 5ERGB 4EL0A 2YW2A 5I6DA 2FW1A 1NI3A 3LS2A 3TAUA 1NRXA 1XEAA 4UZEA 5REQA 5G2OA 4HZUA 4J9UE 3OHMA 1W75A 2CYBA 2Y0PA 5F9MA 3ZH2A 5I4BA 2XTMA 3GEBA 1EFLA 4CDRA 1T8SA 3IB6A 4LOLA 4YALA 2ESRA 2NSHA 4EY5A 1UXGA 4HC4A 3THSA 1NMYA 2HSJA 4FYYA 3K05A 2OWEA 5B3JA 2CNKA 1PGOA 2OZLB 1FUYB 2ORVA 4TMXA 3HYRA 2ZYVX 4A6DA 3HH8A 3W3AA 1W88B 4IDHA 1XG5A 3GGDA 5K0FA 1L5HB 2QRJA 3VU9A 4EHBA 1PYGA 2A5LA 2FGJA 2RG1A 2UUCB 2GD6A 1MFPA 2CFTA 4FMPA 3UGKA 4XIFA 3S68A 1V3QE 4YFYA 4OX9B 1P7CA 2F3TA 4PGAA 1Z29A 4A0GA 1LLCA 4N18A 4MUXA 1YHZA 2RK3A 3MWFA 4U4AA 1AQ6A 1ZUWA 2P2GA 4PLTA 1WCYA 4I1OA 4O5OA 5EGSA 2WTUA 3M5PA 2XUHA 3H2SA 1IOVA 3V8PA 4DV6B 4U7PB 2OKGA 3CSDA 3GJRA 2O8FB 3MYRA 2XDQA 3RC8A 2G07A 5AKLA 2FPPB 4DM3A 2C5HA 3WNQA 2NXJA 3JVEA 4FUQA 2PLAA 5M29A 1FQOA 2BBWA 4KPUB 3E81A 4UNSA 2FP4B 4L15A 5K3CA 2XWBF 3A4NA 3FPFA 1L7QA 4UE3S 3KJEA 1X7GA 2B9VA 3EDYA 1T3GA 4L4SA 1R5JA 3GCGA 2FEKA 4RDHA 1PFYA 3UEOA 3Q7IA 4JXXA 4LFBB 4LDAA 5DK6A 4J0KA 1VPTA 4RBNA 5T8KC 4EEXA 4ZT2A 2GLTA 3B6EA 3KJIA 4G5FA 2GZ1A 3BHMA 2DKOA 3I37X 4FN5A 1GILA 1J8YF 2D8MA 1PZEA 3ESYA 4OQEA 3SN6A 2C2KA 4HB4A 3HWWA 1UZUA 1MRSA 5HMMA 1K1EA 1XNGA 2WD9A 1K5GA 3ZLTA 2NYUA 1VKRA 5J2TA 1IZYA 3CH5A 3ROKA 4J16A 1YR2A 3CWZA 4JBXA 5GVSA 5BXYA 4JYAB 2GH1A 3EPRA 1W4LA 3CV3A 4J76A 4MUAA 2WTXA 1FFCA 2BF7A 3W5SA 2YN4A 1E1NA 2VWPA 4Z9BA 3FPEA 5DTQA 2O59A 2K7ZA 4JP5A 4R9RA 4X7PA 5L9AA 4YCAA 3H04A 1LLDA 1ECFA 1QQTA 4V03A 1OFHA 3HR8A 3F67A 3WK5A 1DVRA 4YRQA 2DWOA 1IRIA 4RL4A 2VJNA 4Z9XA 2IHNA 4UTRA 3PD7A 4R1NA 3ZNOA 3COZA 4EKGA 3F5FA 5BYKA 1VMIA 1XHEA 1YZHA 2ZLBA 1XZCA 4J3NA 1UBOS 4REQB 4LJRA 4DIUA 4D43A 2NLOA 4HEJA 1YVPA 1JG3A 4EI9A 2J7PA 3HJBA 3WKAA 4ZVRA 2YN2A 4MO2A 3RBVA 3KDAA 4WLUA 3NHLA 3M6XA 1P2DA 2ZB3A 2JJ8A 1V6SA 4MYDA 4GX0A 2PUEA 1SCUB 3MINB 2JLCA 4QYSA 2GX6A 5AQEA 2JPDA 2P7HA 3EQ6A 5B6JA 2YZ7A 2UYCA 1FL9A 4HN2A 3H1FA 4NENB 4DY4A 1R27A 2I7TA 1E1CA 2GPWA 3NATA 1YRLA 3W9BA 1KAGA 4F86A 3INYA 1HURA 2JGIA 4UM8B 3WJ2A 1J1IA 1Q92A 2Z3WA 4BU1A 4CV0A 2OZKA 1QHHA 1KI8A 1Z25A 1ZXBA 2HBQA 3G6WA 4RD6A 3R8XA 4DQLA 3GLGB 3E1KA 1NHGA 4XB6B 3UAWA 1V8DA 2O20A 3FFTA 5A6SA 2GRJA 4J75A 1QB8A 1H2RS 4RENA 1D7OA 4P92A 4AB1A 1TEVA 2JFUA 3KU1A 4UEWA 5TPWB 2XRZA 4MRNA 2X4GA 1CRWG 5KHLB 1QYXA 4E09A 2B4TO 1ORWA 2FV8A 2HSEA 1L8OA 1U2ZA 1USWA 3AF3A 1KC3A 3LZ6A 4OK3A 3RF6A 1GTSA 1FUIA 3BMCB 3OC0A 3Q8MA 4Q15A 1XZJA 2A5YB 4HG2A 4JI7B 2XNKA 3VR3D 2N75A 3HY3A 3OMXA 4GYJA 4OB7A 3HRKA 5ALZA 4IWXA 4RNCA 3H1TA 2W2QA 1JB1A 4H7FA 3JWEA 5EMHA 3AEUA 3Q12A 5FBKA 3RYCB 2SICE 1A69A 1XZFA 4A9AA 4CV2A 3H6GA 3DVAA 3LUGA 2W5UA 3WIOA 3CT6A 4C9BA 5EHGA 2ZR7A 3B48A 2W6QA 3HA5A 2WG1A 3M34A 4PAGA 3KOMA 1LDBA 5EVCA 1C7IA 1N9GA 2AJTA 3I3OA 2OB1A 2G88A 1Q1QA 3ICEA 4LBVA 4LOIA 3EBLA 2KX7A 3R4CA 1OVGA 1SQ6A 2I03A 1FP1D 3NW9A 4HYYA 4UJ5A 3TLJA 3LPAA 3NEJA 2X5NA 4PFJA 2O8DA 3PHHA 1XVIA 3AUUA 5AHKA 3I09A 5JVDF 2GTIA 1NJ5A 1GITA 3SM9A 4EO4A 2WUWE 5CMLA 5BSRA 3A4MA 2X42A 4ND1A 1ST2A 3ROGA 3KJFA 3ETNA 3VPSA 1HRKA 1OE0A 5B12A 4NEQA 3ZDRA 4CF5A 4LV8B 3H8WA 1V7CA 4YMSA 3LYLA 3NXKA 2R6ZA 4K9SA 4KQ6A 4IRUB 1S3FA 1PV2A 3T7IA 1JAXA 5A1TA 3KZXA 2X5OA 4JUCA 1SVWA 4LJ5A 4JQCA 1HYHA 2JAPA 3D8UA 5TRTA 4NQZA 2IKSA 3WKBA 2J3KA 5AYVA 1C9MA 1I3KA 1TQDA 4TSFA 5J1TB 3QELB 3WL7A 4J1TC 1G0NA 2ZT8A 4YUAA 4HZGA 2C5GA 4ALJA 3V00A 4ITRC 4LF7B 1EUDA 4DIOA 3P2EA 3ADKA 1SZPA 1W0CA 4Y18A 3SNHA 3TOVA 3DFZA 2GZ2A 3ZW9A 4F56A 4YMUA 5LMNB 4ZQIA 1F48A 3A1CA 3JYOA 3O74A 1D2RA 2BGIA 4YMVA 2OO5A 3PGVA 2ZEJA 2FZEA 4ARCA 4MICA 5KO2A 5CLGA 4LHEA 4RY8A 4AO7A 4DV3B 3LE8A 2RARA 1DKLA 3BTOA 3PC3A 2P4UA 2CUTA 3PNVA 3I5AA 3Q5GA 2QGFA 1CNEA 4NBUA 4BMYA 5TJ9A 4EHKA 2C5FA 4H6WA 5CBKA 4C78A 3T1YB 5CTAA 1L7XA 2E49A 1CJMA 2HFJA 2YZGA 3K53A 1KDRA 3LIPA 4NZ9A 4Q1EA 5KYNA 2WF9A 3T6KA 2D1QA 1NYQA 2JHFA 3EGDB 1KR5A 4RJJA 2AFIB 4BVHA 2CXSA 4N6NA 4E03A 3A4TA 3ETEA 2Q3JA 5J9FA 2A30A 2TMGA 1Z68A 5KTPA 2Q29A 1P80A 3FRHA 4RKWA 5ALNA 1CBUA 1FBNA 1U2RA 4XGRA 3SDZA 2IV3A 3GO4A 2HV9A 4MV4A 4NNJA 2ZIAA 2X6QA 2B8EA 2DWUA 2QX8A 4FEYA 1DIBA 1ZRMA 2BTEA 1W0KD 3OBBA 1WF3A 3K0AA 5CDUA 3SX0A 4RM3A 1XZPA 4I1PA 1EK2A 1K7XB 2AJCA 4ZCPA 3STTA 3ONFA 4TQ9A 1U63A 1N7GA 2C4VA 1F2UB 4J2OA 1IWPB 3MUEA 4PZUA 1JEEA 1VE6A 3IP5A 3IQHX 3PGKA 5AK4A 2PX4A 3GRYA 4GC9A 2WWRA 1YB6A 3I2HA 3FXAA 4WVFA 5C53B 4K7JA 2CN1A 4EO9A 1CRPA 4GPIB 5WRFA 2AX4A 1FJGB 3FZNA 1T6ZA 3GA0A 3NM6B 2F3UA 1M0SA 2R7LA 3KK0A 1YT5A 3G7UA 3QVWA 5FXMA 2CBXA 3AVPA 4X6YA 5KDLA 2M6RA 3B9PA 2FGKA 3K0CA 1E96A 3UWMA 1N2HA 2C58A 2ZJ3A 5AVKA 2V8BA 3TB4A 1UT8A 4BVJA 1H5NA 4CNQA 3CC8A 1CUXA 3MJSA 1W85B 3CF6R 2JD1A 2OO3A 1HLFA 1ZM3A 4BUJA 1GGHA 1NVWQ 3LLMA 1Z0JA 3QXGA 3KQLA 3DZCA 3RGWS 2HQRA 1LSSA 4ZK2A 3V4VB 3ANMA 3BXXA 3H4IA 3AC0A 4XGNA 1G7RA 3DV9A 4ER6A 2PZAA 2PMKA 4OCZA 2ZM6B 4R05A 5FUBA 1TTHA 5J5VA 3NASA 1XQYA 3R8FA 4EHAA 1TCVA 2WWHA 1LBEA 3VPGA 1U6JA 2XUFA 4TLCA 2ODPA 2YUIA 3RE1A 3ZQ6A 1OD6A 4I3FA 4NULA 1RAIA 3NWEA 3PXXA 2C7QA 4MVWA 4YEDA 3EZ9A 3UGQA 4DFDA 1UC8A 2DFTA 2HC9A 3A06A 1RLMA 3I6ZA 2XNDD 3BAZA 3Q8WA 3RFTA 1ELOA 3T7CA 1Q20A 3SKYA 4M9XA 1HF3A 3TLXA 1QK5A 3LY5A 1P5HA 4KTTE 4Y9UA 4N3CA 2K2WA 2EJUA 1K8YB 3ADDA 3BMXA 5TSDA 1RAHA 1RE1A 3WGMA 4NYJQ 4QUJA 4M38A 5B2EA 1P4AA 5IKPA 3KD2A 2BSAA 3FZQA 4FYVA 4MW9A 1YHYA 1JHQA 3FVWA 1K3FA 4WY5A 5K7SA 1QGOA 1CUBA 1KHTA 2QF7A 1Q7RA 4PX2A 1E58A 1MRZA 3DNPA 1KFCB 4YA6A 4G1FA 2XCIA 1A8PA 2AYXA 4WBNA 1T35A 2CUZA 4TT3A 4FR0A 1J97A 3GAMA 1LWNA 5TJHA 2HXYA 4Z2YA 1E2FA 3LPMA 4OQDA 2QU7A 4QT0A 4ZJYA 4L4YA 4WXEA 4C0LA 3NT4A 5BQ3A 4FB5A 3THYB 4IZIA 4MPTA 4MA4A 1E4VA 3DQZA 1JHXA 2GJAA 3PUJA 1J8MF 3VYVA 2NO4A 1FW8A 4G2TA 4QD3A 4TTJA 4E5UA 1USGA 2JEZA 2ZYRA 3W5BA 3OPQA 1YIAA 4YCDA 2BSQA 1TF2A 1UANA 2QLBA 4ZYVA 1J24A 3UV3A 1EXMA 3HLKA 4QX6A 5CLQA 4C4PA 2UZAA 5JDIA 4OKNA 1SUIA 1UXKA 3BK2A 3EIUA 4LDQA 1CV2A 4PM4A 4XWTA 1DT5A 2ZAMA 2FMHA 3SC2A 2Z2IA 5CDTA 1ZH2A 3EIEA 1QPZA 3OMWA 2B1QA 2VHCA 3I8OA 1WCIA 4EITA 1DP4A 3OI7A 3RC3A 1PCXA 1ZZEA 1CUUA 3CZCA 3LY8A 1VIMA 2JGMA 1RRKA 2YFHA 4Q18A 3E84A 4BMXA 1DT3A 1XKTA 4JI6B 1P0PA 3EZ7A 1TAGA 5HFAA 5JXHA 2C2ZA 1YS6A 2J0UA 3QIVA 1GA4A 3K32A 3BILA 1XAJA 3NNNA 1E2MA 4D9NA 4EI8A 2VP6A 2XH8A 2YZMA 1G98A 1RHJA 2WFZA 5H8WA 1FFAA 1XRSB 2HIHA 2QSUA 3JQ8A 1RYZA 3LVBA 3M6AA 4PRLA 2RSLA 1QE5A 2ST1A 3AVVA 2C54A 2VHTA 4KR0A 4NX2A 3BWBA 3EOAI 1PQ4A 1QR2A 4RU1A 5CVCA 4Z99A 1A04A 3VTFA 2F3QA 5KSPA 3ETLA 3T7KA 1HM5A 2Q3HA 1XTUA 1LWOA 2W48A 2PZGA 2QRHA 1IN4A 1I0LA 3HDYA 4GNRA 4R2WA 3GWZA 1AF4A 2PX2A 1UWKA 4W1SA 1I3OA 1LGYA 2OQIA 4LK3A 1QWSA 3CZRA 1E3TA 1MDFA 1X1CA 4JJZA 4HSEA 1YRBA 3C4JA 1DRVA 3ROPA 5CCEA 4JN6B 1QQAA 3T7RA 2CL7X 4L16A 2XCTB 4ABTA 3H4VA 1KFEB 4BGVA 2C9OA 3BM5A 1Q0LA 4KXFB 4IFBA 1P81A 4C0AC 1HYGA 3ZBQA 1XN1A 2WU4A 2O7RA 2ZWMA 4FYHA 4K6FA 2QRLA 4RD4A 1EESA 4C4TA 1Q12A 1X94A 2N1MA 2OV6A 2XXBA 3HP4A 5TR9A 3UXHA 4K26A 3Q3VA 3CPSA 1R8SA 4YYEA 1U0TA 2KI5A 3BCSA 2IQIA 3HHPA 1O0BA 3O9VA 4O63O 4TTVA 2I66A 2GAAA 3L6EA 5JCOA 3F98A 1ULAA 2QZ9A 1LA2A 3LUFA 4OLJA 4JL6A 1PR1A 2AMFA 1POXA 2HT6A 2RJNA 2RGNC 1DQYA 4MCAA 1HEYA 4YRDA 3ZD8A 1WWKA 5LZ5A 3S5UA 3URKA 4M0DA 4ZVTA 2DHEA 1UUFA 1KOFA 2Q6IA 2QY9A 2WHEA 2V5VA 3MZ0A 3NIBA 4KXVA 1NJ6A 1XCGB 3AKYA 3H9EO 4I1VA 5CIQA 4F46A 1DAMA 4FYWA 5C18A 2W0MA 1VA5A 4JI2B 5IK2D 5DHQA 1X3LA 1IK6A 2H29A 4AURA 2HJWA 1E0KA 1I4WA 4MUHA 2TS1A 5KC8A 2ZJOA 4ZT3A 4B9AA 4BX0A 3FLAA 3RV3A 3V55A 1B7GO 1DL5A 4Z8YA 1GP2A 4KGXA 4ZIRB 4D8XA 5AM1A 5LKRA 4K9NA 3JZDA 1HG0A 3EULA 3TMKA 2A5FA 4NFLA 1KO8A 1P18A 3R3VA 3MAAC 5A1JA 4NYIR 3UJ6A 1JLMA 5L4NA 3UIEA 1XTZA 2JFBA 3IXQA 4BECA 3ZU3A 4K5QA 3OLWA 1USKA 4BNUA 5KWVA 1BYUA 2DR0A 2IZ5A 1K5HA 2I4MA 5AM4A 1DO0A 1J4AA 3IR5A 2P27A 2BW0A 1RPTA 2O3UA 4NNOA 3KPWA 2OBMA 4I4TF 4L57A 5DP1A 2ZBGA 5JSHA 2AWNA 3L40A 3IAAA 1N2CE 3I4CA 2WK1A 5EZYF 4PTYA 1MKYA 5AM3A 5BMOA 5BR1A 5HF9A 2P2LA 3OQJA 4BVGA 1P2VA 1Y1TA 2XB8A 1E77A 3UMVA 4Z4QA 3CF2A 1OGYA 4CR6A 4FZRA 4XZ3A 1GJRA 4XDGA 5C1DA 1OFVA 4E88A 1M1YA 3TVDA 3WSWA 1U99A 1JIXA 5KKCA 4AZTA 4MYCA 4X1YB 1PLKA 3VSCA 4E11A 3CF4G 4MXDA 4FQ5A 4LF5B 2HCTA 3NORA 3ZHTA 2Z0MA 2JAOA 4CM9D 5KAMA 3R7LA 2PU7A 2WDPA 4BB9A 4RH3A 3KOXA 2WQZA 1SU8A 3JV7A 2HJRA 4KE9A 2EBFX 3GNLA 5AR1A 1T9DA 2P9BA 2QR2A 3C3WA 1NI4A 4G0NA 3FSRA 2H16A 2V55B 1FRQA 2JATA 5KOIA 3AFIA 3P9SA 1C3OA 1PV4A 4DABA 3N0WA 1L7MA 1E0SA 1L4HA 1XAGA 4P5EA 4PNEA 4KRXA 1O5TA 1MUUA 1L5ZA 3FNRA 1U94A 4AMZA 1EIWA 3M6IA 2OHGA 2IEGA 3GIDA 4FHGA 1E8MA 4MIYA 2CBGA 3TM4A 1FJHA 4KL8S 2VHWA 2O1EA 2YHIB 4BKQA 3LSTA 3QX7A 2ZGVA 3M0EA 5EE9A 4ZV7A 2YCLA 5DIZA 5DN9A 3SEQA 1BWRA 4BVFA 5LMCA 1SFRA 1JNYA 1LRJA 1RCTE 1PGNA 3QKRB 1LH0A 2C00A 3TG2A 2RKOA 1JJBA 2PMFA 2R4QA 2X3UA 3NBMA 3AR6A 1VCOA 1J2TA 3AW8A 3PLNA 5EIHA 1E3DA 3U48A 3VR5H 1RIFA 1RYNA 1W29A 3FOEC 1XU7A 1RP1A 3OUZA 3FPLA 5EXDA 2BDTA 3PWKA 5G0TA 1R9MA 4D9GA 2HK6A 3EC7A 4IH4A 4WBNF 3ZV3A 2DQ4A 2Y2UA 3FKJA 2EBWA 2HDNB 4DG5A 4UAJA 5JSZA 1SEPA 1F6DA 4Q6BA 1TMYA 1W47A 2ZIVB 3UB4A 3BIXA 3IE0A 1X8KA 4JCOA 4A3SA 3Q40A 3SNKA 2FOXA 1MJGM 3HXPA 2P62A 4LXIA 3GBSA 2H54A 4EELA 3ZLBA 3D3JA 1S8NA 3QXXA 4L02A 3BT7A 3D5TA 3PWTA 3EWNA 3TPZA 2NU7A 4MJXA 4ZEOA 1F2TA 1FSSA 3KYCA 1NWCA 1VGVA 1G20E 1H42A 2Q21A 3LX4A 1KE1A 3ZWMA 5IPFA 5BYBA 2HXGA 2J0EA 2AG8A 2J3QA 2GCOB 3MBKA 3P71T 3TLYA 4QDTA 1WU7A 1MTOA 4A92A 4YCMA 4UNQA 4L22A 1WXGA 3D2LA 5KBYA 4LK2A 2EX4A 1EM6A 3EVBA 4AJ1A 4CF7A 5ADVA 4MB6A 4GD3Q 4YRCA 3MJHA 2FCAA 2OFXA 3INGA 4OX9Y 3VRHA 2Z2ZA 4ATNA 2ZRLA 4FFNA 1US8B 2C42A 2GXUA 3KETA 2X86A 4WK0B 2NWQA 3CUYA 4Y0VA 3WQHA 3DO6A 3ABZA 2GAIA 2C20A 3FW1A 1IXSB 2QZ4A 3CBGA 1XKXA 3GW8A 4B3IA 3U5ZB 3DLHA 2IOFK 2ZETA 2EDCA 1T3HA 3BS4A 3E0XA 3LCRA 3MFQA 1M1NA 5DK4A 3ZW7A 3IJEB 5JQWA 2AMYA 3ZV6A 5FBZA 4Y0AA 1KEWA 2B7CA 2OHIA 2QN1A 4W7SA 3WLEA 4AJ9A 5AOAA 1WBBA 1V5EA 1Z08A 2MSDB 4DCUA 4W5WA 4B17A 4RSHA 4GKBA 4WEOA 3G0OA 3QENA 2LZ0A 2X58A 4OMUA 1KYQA 4U6QA 1HC7A 3C8MA 5CVDA 3S99A 1D9ZA 3W8RA 1LK7A 2Q5JA 3G9UA 3ZDXB 1XA0A 5BXQC 4M1WA 1WUYA 4OI2A 4PPQA 1WNFA 1VLMA 1B73A 4GU5A 4OXRA 1VSUA 3G2PA 3HYSA 3OQBA 1IK4A 4HS9A 4PCAA 3FJ1A 2DAPA 1T2EA 1XZ8A 1GLNA 5JRDS 1P9RA 2H9AA 2NU9A 3BH0A 3HL4A 3OCUA 2JFQA 1ZI8A 5AVJA 1B8OA 2GQ0A 2H1CA 1U3GA 1C0EA 1S3IA 1G7TA 2IYRA 4GMFA 4HB3A 4RWZA 4HN4B 2WA1A 2NYRA 3CUKA 1BVYF 3EGEA 1Z6GA 4YMIA 1DEKA 4CT5A 5KPDA 1Z4QA 1QM5A 3OEWA 5JD5A 2HJHA 1ISHA 4Q00A 3ROMA 2IHJA 3ER9A 1C3JA 3TECE 3G0GA 1Z36A 1G18A 2JCVA 2C4NA 1JBQA 1LNZA 3MTJA 5AUPB 3GHHA 4JQYA 2VPWA 1PVOA 1DTSA 4I6JA 3KR9A 3OO0A 3G0IA 3UPDA 3ENKA 2RC6A 3DW3X 4YCSA 2DLNA 3EQ7A 1T25A 2Z56A 3UHPA 4BQQA 3S8MA 4C7OA 3DPIA 5NLLA 1RC8A 3KS9A 1OZ0A 4YHBA 1SVMA 2CKDA 3TE7A 4GZLA 4QO8A 1VI6A 1NWHA 2BJWA 4RFVA 2GK4A 1R4AA 1SGWA 1XF9A 3JRNA 2PD4A 4Y2RA 5E2AA 1QPBA 2BFBA 3SSAA 1JSCA 4KFRA 1Q7BA 5B1SA 3RRFA 5KNDH 1G42A 1K7CA 1J7KA 2QKYA 1NZJA 3EB9A 3QA9A 1YRWA 3WQQA 1E66A 2F1OA 1U90A 2ZI6A 3G8CA 3PFNA 5L3ZA 2IY7A 4PO1A <