4PSCA

Structure of cutinase from trichoderma reesei in its native form.
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
220
structure length
220
Chain Sequence
WPSINEFLSELAKVMPIGDTITAACDLISDGEDAAASLFGISETENDPCGDVTVLFARGTCDPGNVGVLVGPWFFDSLQTALGSRTLGVKGVPYPASVQDFLSGSVQNGINMANQIKSVLQSCPNTKLVLGGYSQGSMVVHNAASNLDAATMSKISAVVLFGDPYYGKPVANFDAAKTLVVCHDGDNICQGGDIILLPHLTYAEDADTAAAFVVPLVSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Carbohydrate esterase family 5
publication title A Cutinase from Trichoderma reesei with a Lid-Covered Active Site and Kinetic Properties of True Lipases.
pubmed doi rcsb
source organism Trichoderma reesei
total genus 74
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2014-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pscA00
2JIDA 5ALXA 3C8DA 2ES4A 5KREA 5CH5A 3HYSA 4BATA 4GDMA 2V9ZA 5ALJA 1ACLA 5AK3A 4K5QA 1BU8A 3BF8A 3STXA 3FLAA 4I4CA 2WIKA 2OCIA 3DJYA 3WZMA 5EHXA 2Y6UA 5EHQA 1QIIA 4P08A 5T4BA 4J0IA 1MU0A 1JMYA 2AJLI 4C89A 1CUXA 4DNOA 4Q05A 4RNCA 1UFOA 2EDCA 3OC0A 4Q1VA 3CCCA 1VLQA 2BAGA 2IX9A 3A2NA 3YASA 2CJPA 1MX1A 5ALRA 3KXPA 2ZYSA 1EDDA 4EY6A 4QWMA 3ZLUA 1K63A 3KD2A 2C58A 1ZJ4A 5AIAA 3SC2A 5AI9A 5DYYA 2O7RA 3ZPXA 4LYDA 4FNMA 1XRRA 5LKRA 1CUFA 2WIJA 3WKAA 2Z8ZA 1A88A 2VT7A 1OXMA 1ZI8A 2WG0A 1MNAA 4ZI5A 5HZGA 4MYDA 4FMPA 1CUSA 4S0XA 4X7BA 4UHHA 2CBGA 5JALA 4G4JA 5BOVA 4MYSA 1E3QA 4DSAA 2PBLA 4BDTA 1XLWA 4AQDA 1E66A 3F67A 2JEZA 1H2ZA 3WK4A 3TGLA 3IDAA 4H7KA 4LXGA 4UHCA 3KDAA 1XQWA 2WHPA 5CT6A 3T52A 4G9EA 5EGNA 5C7YA 3WKEA 1N8SA 5HF6A 2XT0A 5AM0A 3WA6A 1CIJA 5K3DA 4OYLA 3BXPA 1AX9A 4BCCA 4JYMA 1HQDA 2GYVA 5JAPA 4M0MA 4UFNA 4KE7A 2FJ0A 5IVKA 1QIHA 2H1IA 2PU7A 4BZZA 4CCYB 3JWEA 3N2ZB 4Y7DA 4G5XA 1GT6A 3WZLA 3WWEA 4UBJA 4B9AA 3IBTA 1XZKA 4W1RA 3R0VA 4X93A 5ALNA 1SC9A 1TCCA 5DNUA 3D59A 1X2EA 4UHFA 2WUFA 5DWDA 4ETWA 5AKZA 3R3VA 4GBGA 1UT6A 3OOSA 3W06A 1QGED 1XQYA 1F8UA 3HXKA 1XZDA 1IZ7A 4FBMA 4MWSA 4K6KA 1J2EA 4I19A 1I6WA 4OB6A 2AJBA 5EFZA 1GPNA 2B9VA 1PV1A 5FPQA 3C45A 4EHBA 2HA2A 5AO9A 3X3HA 4J03A 1U8EA 4J0HA 1XZLA 5JAOA 1OCEA 3QMWA 2V98A 3LP5A 1QJ4A 5CT5A 2OGTA 4P9NA 5JARA 3G0CA 1H2WA 2V97A 3W9UA 3WA7A 2Z3ZA 3L1HA 3HACA 2BJHA 3QYJA 5AM5A 5DLPA 1EDEA 1VE6A 2G63A 4MJ3A 4E14A 5AJHA 5H3HA 5DTIA 3U0VA 2JGFA 2ORYA 1DQYA 2OAGA 3C43A 1S8OA 1USWA 4J0JA 1DQZA 4B0PA 1MTZA 1E8MA 2Y6VA 5AP9A 1XRMA 3VVMA 4CCWA 3Q0TA 3WMRA 5ALUA 3ICVA 5ALGA 1C7IA 4CIBA 3EQ8A 2DCMA 4WY5A 3FVRA 3NOXA 3R40A 2QUAA 1EK1A 2DSNA 3WL6A 1XZJA 4ZV9A 3C70A 2E3JA 1HKHA 2VA9A 5LZ7A 1CUJA 5JANA 5AM1A 1JKMA 3IIIA 5A2GA 5ALHA 2C0QA 2RONA 4U2BA 2RI6A 1LPPA 3D2BA 7YASA 3I2JA 5AOCA 2P8SA 1GKLA 5JYCA 5CW2A 2QXUA 1GKKA 1IVYA 3A2LA 4BB0A 3IUNA 2RGUA 1UKBA 3GBSA 5AKLA 1XFDA 3QMMA 2WUEA 5AKGA 5ALZA 4P93A 2JGJA 4H35A 5AI6A 4D9JA 2NW6A 4N8SA 5A7HA 3B5EA 4BRSA 1GXSA 3O4GA 2XMRA 1UKCA 3R41A 4HXFB 3W04A 4W1SA 1ORVA 4FDMA 2HRRA 1P0MA 4OU5A 4DGQA 4ZRDA 1ZIYA 4LIPD 2XUGA 1VZ2A 2VJAA 1MJ5A 3H2IA 1XRLA 4UBOA 1Q83A 2QJWA 1TRHA 1A7UA 2XMQA 2JGLA 3M82A 1IZ8A 5FRDA 5LYYA 4U2GA 1WHSA 4ROTA 5JZBA 3BJMA 4M0FA 3HLKA 1QONA 2XMCA 3BDVA 2B61A 4MQLA 2QT9A 1SCQA 2VF2A 1BEZA 3FAKA 4H18A 1P0QA 2XUDA 3U1TA 4U2FA 3G9XA 5HKAA 1Q84A 4AZ3A 4K6GA 1ZI9A 1BROA 4E46A 5J3JA 2RHWA 1CPYA 1MAHA 3ZI7A 5CXUA 1O6FA 4BVLA 4LKOA 5ALTA 4HZGA 4OD0A 2GYWA 1H23A 5AM3A 4KAJA 3TEJA 2WIDA 5AKXA 4LXHA 5AI0A 1XZGA 1NX9A 2WTNA 1ACJA 2AJ8A 1BS9A 1UXOA 1PFQA 1A8QA 1BCRA 1GPLA 3AIOA 2HA0A 3RKSA 2ZSHA 3HC7A 5ESRA 1G4HA 1JI3A 4KRYA 5EIAA 4EY4A 1XRQA 1AC5A 1JFRA 4HRXA 5CURA 2XMGA 4QNNA 1C7JA 2HA5A 5IKXA 2XMZA 4NVRA 4AB1A 1DX4A 5HQ3A 1YA4A 3I6YA 5LP1A 4AO6A 3DL7A 4FFVA 3WLAA 4G8BA 1MT3A 2DHCA 2VT6A 1R1DA 2OXEA 2PL5A 3ESAA 1JJBA 4J0CA 3LCRA 3ED1A 3HJUA 3SWWA 1QFMA 4AMZA 2XUKA 3C6ZA 2Y1KA 2PPLA 5E4TA 3IB3A 3GFFA 3UUEA 3G7NA 3GZJA 3H2JA 2BKLA 1CUZA 4JNCA 4Y2YA 3MUOA 2C4HA 3BJRA 1JJIA 4U2DA 3K9BA 1J06A 5DYTA 1EHYA 3HZOA 4X97A 4XJVA 1JU3A 2PSHA 4B82A 1P0IA 1YAJA 1WCYA 3UMJA 5AH0A 2HIHA 3PUHA 4Y2VA 5JAHA 2H9YA 2ECFA 2XQIA 2K2QB 2H7CA 1X70A 1YA8A 2OQVA 1H22A 1YB7A 3C6BA 4WFIA 4MEAA 2H7YA 1Y37A 2Z8XA 1YSCA 5AKJA 4BC1A 3EIOA 4N5IX 4DTCA 5AM2A 2WM2A 3RLIA 5K3FB 1THGA 1Y7IA 4UFPA 4TGLA 4BTLA 4C4YA 3I2IA 1EH5A 2VQ6A 2D5LA 5K5EA 2WFLA 3BWXA 3OURA 1YR2A 2ZJ6A 4ZV7A 3LIPA 4AO7A 4BC0A 1UOQA 3QPDA 2JGIA 5DJ5A 4CG3A 4DNFA 5ALFA 3PDCA 3PF8A 5AKYA 4IH9A 3RM3A 1A8SA 3AJAA 3KWJA 1CFJA 3STWA 3D5EA 3DL4A 3H1BA 3PI6A 2PSDA 1K8QA 4L72A 3I1IA 2X76A 1VXRA 2HHAA 1ZICA 2HU7A 2RAUA 4BDSA 1WPXA 4EB0A 1XZFA 3D2CA 3AIMA 2QS9A 3WYNA 4QDOA 1QTIA 5T4FA 1MX9A 1R9MA 1LGYA 5K3BA 1N1MA 5CH3A 2XQJA 1K5PA 1KEZA 3V48A 4C88A 4CFSA 2DHEA 4IH4A 4AN0A 1IUOA 3QMVA 2DQZA 2XUHA 3E0XA 3I28A 2QXTA 4I3FA 3C5VA 4DLNA 5JD6A 3B3QA 3ANSA 3EF3A 1XKTA 5KBYA 2C0PA 3KWFA 2EDAA 1EI9A 5CT9A 1DINA 3PF9A 2JEYA 4JEIA 4J0KA 4EUSA 4FLFA 4WFJA 4FKBA 3IULA 2OLEA 1ODCA 4X71A 2JBWA 4GWLA 1X2BA 3WWPA 3W9BA 3WI7A 5FPPA 1BCSA 1CEXA 4Y2QA 5A7GA 4M0EA 3QZUA 1AQLA 3A70A 3R3WA 5EI5A 3QVMA 3IVMA 5AK6A 3G8YA 4P92A 1HBJA 3W2TA 2VTVA 4BAGA 3TJMA 2QKYA 3RK4A 4BYMA 1N5MA 3DOIA 2XUQA 3WJ2A 2PX6A 3WIBA 3V1LA 5CT4A 3R3XA 4BAZA 4C87A 1ORWA 3LLCA 3JW8A 3FVTA 1QOZA 1AUOA 3OPMA 1ZIXA 3O9VA 4B7ZA 2HA4A 4X94A 3ZWQA 1W52X 1P0PA 4Y2RA 2VJDA 4BE4A 3UUFA 4OPMA 1QTRA 5FOQA 1CVLA 3WKCA 2QVBA 2ZYRA 2AXEA 2RHTA 2XUFA 4Y2JA 3H19A 3AZQA 5CH8A 3WKDA 3C6YA 2ACKA 4KE6A 1EK2A 1NU6A 1UK7A 3I2KA 3LS2A 4H7DA 1YAHA 3AZPA 4GHWA 1W1IA 5C81A 3IA2A 2W6CX 3I2GA 4HS9A 2DFPA 3H1AA 3AZOA 3N0TA 2OCLA 1T4MA 2JGEA 2X5XA 2I3ZA 3VDXA 2C5FA 4FWBA 4NS4A 5ALOA 2FJPA 3E3AA 4KEAA 2XQKA 5K3CA 5JZSA 3ICWA 2XMDA 2WJ6A 2DHDA 4ZREA 4AN1A 4OUKX 1E89A 4YK7A 4H7EA 3ESCA 4GXNA 1R4ZA 3WJ1A 2XQFA 3FYUB 4CG1A 3P2MA 5JD5A 2J3DA 1YCDA 4DYHA 4IQ4A 2GBCA 2QMQA 2EEPA 2FX5A 1Z68A 4PSCA 4BBZA 1DT3A 5LZ2A 4H7JA 1YS1X 1AGYA 4ARAA 1J07A 5AM4A 4X90A 1R88A 4PV7A 4UBMA 2RIPA 5AI5A 3EQ7A 4GEGA 5FP0A 1ZJ5A 1CUYA 3C8HA 3GA7A 1CR6A 2XLCA 3L1JA 2BUAA 2YXPX 4BVJA 3V1MA 1IMJA 2WFMA 1WOMA 1WB6A 4A23A 1CUBA 4UBIA 2HFKA 2PU5A 2WIFA 1CUHA 1SOMA 2G5PA 4B0OA 5HCUA 2HL6A 3CXUA 3WL7A 1JMKC 1XZCA 3S8YA 5LKAA 2HRQA 3FWHA 4H77A 1DU4A 5ALWA 4BVKA 4X85A 5AOBA 2WTMA 1WHTA 5ALYA 1DWOA 1XLVA 4KYVA 2ZVDA 2CUTA 1QIKA 3ILSA 2J4CA 2CB9A 4PSDA 4HAIA 1UK9A 2GBFA 4NZZA 1FFCA 1ISPA 3PFCA 2LIPA 4H0CA 1QIMA 2OCKA 5DTJA 5JATA 2V96A 4W63A 3FOBA 1FSSA 5JD4A 3WWDA 5JADA 3H18A 3FLBA 1T2NA 4B6GA 3D4LA 1QIJA 5SYMA 3G9UA 4V2IA 1BN7A 4Y2XA 1UZAA 1EVQA 5IVDA 4KE9A 2XUJA 4WFKA 1XKLA 2PSEA 1YASA 1XZAA 5BWBA 4PSUA 1ZD4A 2PUJA 4KJXA 1XROA 5D3KA 4K6HA 4X6UA 5I9IA 4WDRA 5AKIA 2PSFA 5EIHA 4IO0A 2ROQA 3D7RA 5FV4A 2OAEA 4UBKA 2WUGA 2WUDA 3V1NA 1A8UA 1J1IA 1TKRA 1QZ3A 4AO8A 1RWQA 4UFOA 5ALPA 4PQEA 1LPNA 1CUVA 4QEKA 1MAAA 3WIOA 1QIGA 4J3JA 3GELA 2XE4A 4C4XA 3DNMA 4CCYA 1ODSA 3DEAA 5HK8A 1PJAA 2ZJ7A 2XI4A 1UOPA 1VA5A 1C4XA 4PNZA 4B83A 5LZ4A 2GYUA 4L9AA 4EBBA 5DYWA 3D0KA 1LPBB 4QLOA 3AILA 5LIPA 4X92A 3M81A 2O2HA 1ZOIA 3WK7A 5D7BA 4EY7A 2WHPB 1QFSA 4G4GA 2GBIA 4QDXA 1XQVA 2BGRA 3WK9A 4BP9A 4PW0A 1D07A 3FYTA 5ALSA 4BCDA 2QUBA 4W1QA 4FTWA 4WCVA 4H7FA 3VJKA 4B9EA 5JASA 2HADA 2XUPA 4Y2PA 3O4IA 4RPCA 3D3NA 1BRTA 4O08A 1RP1A 4KAAA 4LYEA 5AKEA 3RARA 1W6RA 3EBLA 3H2GA 1EX9A 2ZYIA 1LPOA 5ALVA 2XQGA 1L7QA 2WU3A 4KE8A 4WJLA 3G0IA 4W1PA 2QTBA 2PUHA 5CXXA 1MX5A 2WKWA 4G9GA 1Q0RA 4XVCA 3IUQA 3I2FA 3FSGD 3GROA 2WG1A 3SX4A 3SK0A 3C6XA 1YS2X 5T4HA 1L7RA 3FNBA 3BIXA 2B20A 4AZ0A 2Q0XA 2H7XA 1ZGBA 5HFNA 5AKKA 3HRHA 3STVA 4ZXFA 2I03A 1CUCA 4UPDA 1EINA 1OILA 2C5GA 4OYYA 2J3QA 1FFBA 4E11A 1W75A 2VJBA 5AOAA 1L7AA 5HF5A 2IITA 4IH1A 2Y2VA 2HU8A 1DX6A 3A6ZA 1ZD2P 1G42A 1UKAA 5CT8A 5JAUA 2YH2A 3EQ9A 2DR0A 3VKFA 4OSEA 3F8SA 1W4LA 2WJ3A 1DT5A 2QZPA 3QM1A 5YASA 1MNQA 3STTA 5I8PA 5LZ8A 3OTQA 4UBLA 1FFEA 4HVTA 2O2GA 1ZGCA 3QPAA 3F98A 2PSJA 3KOOA 1ETHA 2PVSA 5ALDA 3FBWA 3I6MA 1TCAA 5JZ9A 4INZA 3R3UA 5C8XA 1Q0ZA 1IUPA 1LZLA 5HFAA 1LLFA 4UUQA 1QLWA 3IURA 2B4KA 2O2IA 4DIUA 2Z3WA 5LLSA 4Q82A 5ALIA 4CG2A 2CZQA 5IH7A 4X6XA 4JYPA 2BCEA 1QIFA 4AMYA 4YPVA 5DNWA 3DQZA 2WSLA 2WLSA 4F21A 3FCYA 3F97A 2VSQA 4F5ZA 1QE3A 4DMHA 4J0GA 4QDZA 5JIBA 1B41A 2QRUA 1AMNA 1CUEA 1HL7A 3R3ZA 4GW3A 3ZLVA 4FFWA 2XUOA 3AIKA 1XZEA 4RGYA 3V1KA 4QZVA 5EHZA 3HEAA 1RYYA 5KWJA 5ALLA 4MQMA 4B81A 4UHBA 3O4HA 5ALEA 3I2HA 3STYA 1F0NA 4PF1A 5AI8A 4Z49A 5HF9A 1U65A 1FFAA 4B85A 3BIWA 1XQXA 1H2XA 2GZSA 2XUIA 6YASA 1NU8A 5K3EA 1XRNA 1GPKA 2YASA 5CRIA 3ZV7A 1IUNA 1TAHA 1CQWA 5BV7A 2HM7A 1XZHA 2XMBA 2OG1A 1MPXA 2OCGA 3T4UA 3STUA 2PM8A 4U2EA 4RE6A 3MVEA 1FFDA 1WPRA 3BDIA 3DYVA 1KU6A 1TCBA 1XLUA 3DYIA 4GLBA 2ZJFA 3IUMA 4FLMA 1N5RA 4NMWA 1SCIA 4DSZA 4H7HA 3O9MA 4XX1A 1BN6A 3O95A 5A6VA 2IIVA 1GQSA 4QWWA 4X6YA 4TPKA 3G0GA 5EIEA 1TIBA 4YX9A 1VOTA 3OG9A 1CUIA 3D2AA 2VAXA 5DNVA 2CEKA 4W9RA 5ALMA 5IVIA 3NUZA 3H2KA 4GECA 3DCNA 1LBTA 5F4ZA 1CUWA 1EB8A 1QO7A 4DM7A 1UWCA 2WU4A 1AKNA 3ESBA 3FYUC 3AUKA 3CN7A 4FOLA 4Q3KA 4DMFA 1LPMA 3QBJA 4XWGA 4DNPA 1W76A 1JT2A 4Y2SA 5A62A 4QA9A 4BZWA 4U2CA 2DQYA 1G5FA 2J4FA 3DS8A 3KSRA 4X91A 1M33A 2QM0A 2HA3A 5E4YA 2G5TA 3BE8A 3H17A 1VJ5A 5LZ9A 4OU4A 3L1IA 1MN6A 5E2IA 3WL8A 2Z5GA 4K2AA 1QIDA 3FLEA 5KWIA 2XMSA 2OGSA 5K3AA 1JU4A 2I3DA 4ZWNA 3QPCA 3BL8A 3JYHA 4DMCA 4N5HX 1VA4A 5HQ3B 1CUUA 1K6EA 4HRYA 2G4LA 5ISMA 5K3FA 5CTAA 2WQZA 2HFJA 3CN9A 1UK8A 1ODTC 1UOOA 2JF0A 2XUAA 1F0PA 2OQIA 1CUAA 5CMLA 1R9NA 2VATA 4CI9A 1E5TA 2OPHA 3H0CA 4CIAA 4KRXA 1CUDA 1HDEA 4MEBA 3VJMA 3WK5A 2OGZA 3NGMA 1YB6A 2AJCA 3DLTA 1LPAB 4UHEA 3K2IA 4DMKA 4G4IA 1QO9A 4Q3LA 5BWCA 1JJFA 5C8VA 4Y2TA 4HTAA 5CBKA 3ESDA 1TQHA 2JGMA 5FLKA 3G0DA 3M3DA 4A16A 4E15A 1B6GA 5HF8A 4KR0A 2X8BA 5D6OA 4QDUA 4A5SA 1XZIA 1LNSA 5AIBA 4N8EA 1LPSA 3HABA 4JH0A 3O0DA 5AK4A 4QLAA 4MXDA 1EA5A 5HK9A 1CV2A 3PFBA 1H2YA 1E8NA 3E4DA 2BGNA 4GI1A 5LZ5A 5A7FA 4EY8A 4EY5A 3DDUA 3A2MA 3MGAA 2XLBA 1DTEA 1SFRA 4KACA 3I1YA 2WFLB 4LXIA 3BF7A 2HU5A 3HSSA 1U2EA 1F6WA 5IVHA 3DD5A 2VJCA 2GZRA 3E1GA 3TRDA 3G9TA 5AKHA 2D0DA 2VEOA 1K4YA 1EVEA 4X3CA 4JUIA 3W05A 1GGVA 4UHDA 4PO3X 2WHRA 1WB4A 3I6ZA 2WJ4A 1TK3A 1XZBA 3ZLTA 2WILA 3MUNA 1KU0A 1VZ3A 3VVLA 4L0CA 1CUGA 3GUUA 1LBSA 4BRZA 1E8DA 5FKJA 4OCZA 3G0BA 4HXGA 4BAUA 4UBNA 2PKYX 4FLEA 1SCKA 5E4JA 2AJDA 3WYDA 3LIIA 1GQRA 4LHEA 4YASA 4HXEB 2YYSA 3V9AA 1VXOA 4B84A 2C7BA 3K6KA 5ALKA 4FHZA 3WWCA 4J7AA 4TVKA 3VISA 1CLEA 2QJRA 2WHQA 5AI4A 4J0DA 1HPLA 2HA6A 4QDTA 2I78A 4BTVA 1EB9A 3WKBA 1UK6A 3VJLA 4C01A 4AX4A 4BE9A 3WK8A 4ARBA 4XIIA 1GZ7A 1ZI6A 4WDQA 3F9CA 1THTA 2WFZA 4C4ZA 3ANTA 4Y2UA 3PE6A 4FNGA 4F0JA 2HA7A 3DKKA 4QE3A 4ITVA 4G1FA 3R3YA 2XDWA 3H2HA 1WB5A 2WG2A 1EXWA 4MWTA 3FCXA 2JGKA 2VAVA 1FJ2A 2FUKA 4OB7A 1BE0A 2XB6A 4IHAA 2O7VA 2ZYHA 3HI4A 5EHNA 1R50A 1XRPA 3OM8A 1CRLA 3G9ZA 3DKRA 1QIEA 4KAFA 3NWOA 4F60A 4X00A 3FYUA 2BUCA 1VE7A 5FXMA 5ALQA 1MO2A 4AXBA 2WIGA 2HDWA 1XZMA 1G66A 4OB8A 3C87A 4L3WA 3FSGA 5HKBA 1AZWA 5C8ZA 3IUJA 1HLGA 4C6HA 3C5WP 2ACEA 2BFNA 2Y2UA 4G8CA 1LZKA 3WQHA 3PUIA 4X95A 2W22A 2UZ0A 3DOHA 3H04A 1ZD3A 2QOEA 2ZSIA 3CCBA 3F96A 3WK6A 2R8BA 3VXKA 2CMFA 5I7UA 4ZGBA 3WWOA 5AHXA 2QR5A 1AURA 2BUBA 3O4JA 3QITA 4G8DA 2R11A 2GBGA 1VKHA 1DWPA 3QH4A 1WM1A 1ZD5A 3AINA 1R3DA 5FUMA 3AFIA 2CKMA 3B12A 3PICA 4WY8A 4RE5A 5SYNA 1Y7HA 4Q3OA 5A71A 4B80A 4EA6A 4BP8A 1O6GA 4DNQA 1BEEA 1EDBA 1U4NA 4FBLA 4Y9SA 5T4EA 4BCBA 4H7IA 4Q34A 3S2ZA 3G02A 1CQZA 1DWQA 5AK5A 3M83A 5AICA 4EZIA 5D3ZA 3Q8WA 3WL5A 2ONCA 5FDFA 4N8DA
chains in the Genus database with same CATH superfamily
4GM1A 1BKSB 4YT2A 1N9GB 2WYUA 4PZYA 2A3RA 2QT0A 2PYDA 3EZ9A 1SQGA 4GZ5A 4TYWA 3MTQA 4A8JC 4PX2A 2HPHA 3LY7A 1VE5A 5CH5A 3KCNA 1N5DA 2X40A 3CYFA 3AB3A 2WMOB 4GDMA 4L95C 4CT0A 4DEYA 5CCBA 4O8CA 2V8OA 2V9ZA 2O5RA 3BL5A 4J49A 1S96A 4LDJA 2P9YA 4QO8A 1Z25A 3D6TB 4EM6A 1E0DA 3JQ8B 4YUAA 1GZUA 2P30A 2PRKA 3C1UA 3FUXA 4JUCA 4PTZA 4IILA 3U16A 2R6JA 1HG0A 2VP3A 3O90A 4TSKA 1UXJA 5DLEA 5BRJA 2YCLA 3QVJA 2C98A 2CLKB 4PIVA 2Y6UA 1G8FA 3RC7A 3RIGA 4DCSA 5ITVA 1FLVA 3UAGA 5IXSA 3AF6A 1BS1A 2X9LA 1F2DA 1W4CA 3TZEA 4UTNA 4GDFA 2NO9A 2R7KA 1OUMA 4K9QA 4CTOA 1KO5A 1P5JA 5AUOB 1ZUWA 3QKRB 1LF0A 2QRKA 1E2IA 1JMYA 4BX9A 3FDXA 3FGPA 5DDIP 5I4IA 3B53X 2POQX 2X0NA 3Q8KA 4DNOA 2COKA 1KYWA 2O05A 1LU9A 1XTJA 2FSVC 2OVFA 4FGUA 1P73A 1CEEA 1IXKA 2OD7A 4Q05A 4BX3A 1LUAA 1KL7A 2HHJA 3CCCA 1VLQA 1I3MA 1S3GA 1O5IA 2IX9A 4P5EA 3TTWA 4CKYA 1P77A 5LUAA 3BWCA 5FPTA 1A7JA 4TKVB 3W3AH 3IJEB 2ZYSA 1EDDA 1U8YA 1TQ6A 3DMPA 3I0ZA 4QNMA 1X7WB 4EY6A 3L0CA 1Z06A 2WAXA 2YS6A 2IPLA 3O2JA 2FP3A 1JB9A 4MRRA 2GBLA 3RBXA 1MHPA 4CODB 2VK8A 1K63A 3KD2A 5CJJA 1OY1A 2B35A 4RTJA 3PHBE 2PX4A 3IDFA 1BNCA 4DILA 3N86A 1R0KA 2YICA 1JQJC 2WU0A 4JKIA 4ZVRA 3UWPA 1V35A 3CH7A 3ZPXA 3B85A 1TGYA 4KN8A 4ZCLA 5COBA 1XCBA 4RLSA 1Y4UA 3CLUC 2WU1A 3TOXA 3Q15C 1Z12A 2HQRA 3CA8A 3LF2A 4TMWA 3GRKA 3U31A 5KNLA 4BU1A 3JZDA 2ZSKA 1TAGA 2P78A 3ICPA 4LSWA 5DHTA 3RABA 1QE0A 4BMYA 2C2HA 5H70A 2COUA 3B52X 3SZ3A 3T9CA 2IHNA 1OXMA 3M6XA 1XD8A 2WG0A 5JSHA 3NEYA 1MNAA 2C8JA 4N5NA 4KLCA 4AKHA 2CK3A 2MWMA 5DI9A 5HZGA 4GR9A 2EL7A 2DH6A 4MQFB 1B8OA 1EZZA 4MYDA 1XEFA 8ATCA 4A6EA 1RQLA 1CUSA 3NANA 5AVQA 1NXPA 1B42A 2O59A 4BB5A 4I4NA 16PKA 1EK6A 4TMKA 4X7BA 1IBCA 5JALA 3ICEA 5A0TA 4DSAA 1E3QA 2JIZA 5IAAA 3IP9A 3BH6A 4KHPB 1I4LD 1PFGA 3KKPA 4F6LA 4LW8A 1CDOA 5KWSA 3HP1A 5H3LA 3PC4A 2D00A 1SUCA 2Q5HA 1E66A 1Y48E 2NQ8A 2ATVA 1H4QA 1IVSA 2CLSA 2CXHA 2JEZA 3I53A 2RKBA 3WK4A 4NJEA 2YV3A 5JD3A 4URVR 3OD5A 1UEJA 4F1WA 4C6SA 1XQWA 2FV8A 5CEFA 1OB2A 2HMSA 2P6PA 3NW9A 3EYWA 3T52A 3KTDA 2YN0A 3NWEA 2V7PA 2ZOSA 4FHCA 3T7RA 4L74A 1SNYA 4FN4A 5DT2A 3SJBA 3WIEA 3HPQA 7REQB 1JQAA 1WQ3A 3ZW9A 3FFBA 2AK3A 1SD5A 3PNVA 4H1TA 3Q3CA 3S5JA 3JPWA 4O63O 1XJ0A 5G1PA 3CHYA 3MNFA 3U7GA 4BE7B 2FW0A 2GSDA 4QGSA 4AKEA 2WE8A 1P1RA 4IYJA 4CF3A 5BVHB 4FS8A 2EIXA 5JO0A 4GXQA 1V1JA 3GGCA 1CIJA 1DUVG 4TLAA 1KMHA 4OYLA 1YXMA 2VZ9A 3S2IA 3INYA 2BGTA 5FUVA 4YAJA 2QL5A 4O2AB 4DEVA 4EG6A 2Q3MA 4I8XA 3DZIA 1DBQA 5DGIA 3RV4A 3ZEIA 5A02A 4DKJA 4M38A 1EUDA 4EMUA 4H08A 3DCJA 3NWPA 4RZSA 3AHHA 3PK0A 2GYVA 1JLLA 1TKBA 5JR3A 1N3IA 1ZITA 3IAUA 1SCNE 4A0RA 2JI9A 1VGRA 4WGGA 6CHYA 1Y42X 4MUJA 4IDGA 2ECOA 2Z5FA 1BD3A 4JENA 1IU9A 2WW8A 1HNWB 2O8CB 1ZU4A 1VSTA 1H93A 2ZQZA 1WY5A 4KXUA 3RSCA 3KXIA 1QIHA 2FUCA 3EA5A 4K0RA 2Z0MA 2D5BA 4BZZA 4CCYB 2GO1A 4RC9A 5HOQA 2W0SA 4X1IB 2ZCVA 2DR3A 1HTBA 3A27A 3PGJA 4NFHA 3TW0A 3NU1A 3WZLA 3NATA 2LXNA 2IIBA 4LWOA 3WWEA 5KYYA 4ZYUA 4B9AA 2R5NA 3IBTA 2VUIB 4ZALA 3FFTA 1TFUA 4LZWA 3WDMA 4C4RA 4OX9B 3PGMA 3Q3VA 1K75A 1UANA 4HVAA 5DSXA 3W3AA 4URWR 4EUKA 1XCPA 3NM4A 4HV4A 4RQUA 4CG0A 1O95D 2XUZA 1JXQA 1NI4A 1R6DA 3JX9A 3CX8A 4NZPA 4QU8A 1AHIA 1XK6A 1N92A 3D4BA 1U1CA 3ZE8A 1GG9A 3E05A 4HPWA 3RVBA 1R8QA 1TCCA 3SR0A 5L8VA 5DNUA 3WYEA 3EG9A 1J21A 2D74A 1V2GA 1WF6A 2DJ5A 3N5CA 1FSGA 1G5QA 2GJ9A 5C0OE 3L92A 1YIAA 4LJRA 1CYEA 1QG6A 4S05A 3KYBA 2AZXA 5I9TA 2ZP1A 2NSDA 4RTOA 2QNBA 3ZHXA 1ZGHA 3I92A 4EMTA 3KQYA 1ZCFA 4FR0A 2WJHA 2Y27A 4MI6A 1EFVA 4JP1A 1EJ6A 1GADO 2F43B 2Q29A 2Q3FA 2R2GA 3X1KA 1U6JA 1XMOB 3QEJA 5ED0A 1G21A 1QGED 1TC1A 1PJ2A 1TVCA 1V9LA 3DO5A 3R6DA 3V7UA 1CKEA 2B4RO 1F8UA 2FZLA 5HUQA 4HHEA 4YV1A 3ORYA 1K88A 3OCCA 3V8MA 3KPWA 4R41A 2ZKIA 4RD0A 1IN8A 2VCYA 3FUTA 1RI3A 4K6KA 5T3YA 5FO0A 3IR6A 2IEIA 5E0KB 4IIXA 2EFGA 4KQ9A 4PIMA 3T5PA 1KI2A 1KZ1A 2YQ4A 3M8KA 2AYZA 2VJLA 2OQRA 2XXJA 3NGLA 1E6UA 1NBEA 1W35A 2G28A 1ENOA 5MFZA 4XWWA 1GPNA 1DG3A 1PV1A 1E1CA 3R8XA 4EHBA 1RE1A 2OR3A 1JVBA 1FYVA 1L9XA 3DLIA 3E9EA 3V32A 4PLWA 4LVCA 4BNJA 4BN5A 2V1UA 1TOAA 1W48A 5EUCA 3AESB 3QOFA 2F62A 3OESA 3UGQA 4EGJA 3RHFA 1I14A 3GGDA 1DGQA 2QM3A 1OCEA 3LT1A 2J67A 1OROA 2IUEA 5D5PA 2PUBA 3KT3A 1W47A 2YFHA 2V98A 1JFLA 3PCXA 1OXVA 4MS3A 2VSOA 3BTOA 3KZXA 3LYLA 4I55B 1EUZA 5HBGA 1GGFA 3W1EA 3HA5A 2OGTA 4XM0A 4D99A 5ITZB 2JFOA 4R1NA 4Y7CA 1C3XA 2EGUA 2V97A 3P0JA 1SUAA 3WA7A 3HCWA 1Z5OA 4OJQA 2PH5A 1RLOA 1CQIB 3TQFA 4BNIA 1D2CA 2JH9A 1P62B 1Z88A 2G0TA 2XCQA 3EDQA 5TC4A 3UGKA 1WETA 1EDEA 1VE6A 3TLBA 4B17A 3OZ7A 3PPVA 3EMBA 2C9MA 4MB2A 1ZYUA 3AEYA 1GARA 5H3HA 4XSGA 4OF4A 4HUJA 4AJLA 4L5BA 4R98A 4D44A 4J94A 3MJFA 3HJRA 2R6AA 1L5OA 3CNBA 5CHYA 4ABYA 2ZI9A 4GEKA 5BQOA 1XJ5A 4MX8A 4EEZA 1G20A 4XDHA 3JRXA 3TSYA 1ZCBA 1CRWG 2L69A 4LV8B 2E0IA 4UE6A 1PR4A 4FZ3A 1LA2A 1RD4A 1MTZA 3OM0A 4RH3A 2OQ2A 2Y6VA 3VVMA 4RM2A 2CT8A 1CF2O 1CBUA 1GEGA 4GNKA 2GKSA 4W5WA 5ALUA 4BJ5A 1K5GA 5ALGA 4FE7A 3EQ8A 2NPFA 2WDPA 4C4SA 4EP1A 4UTZA 2FMUA 4CMIA 2LKCA 4BS9A 5ED4A 2ZPTX 1PLJA 4WY5A 1ZDMA 1HR0B 3CR7A 4GZMA 1MFPA 4U6NA 3AERA 3C4QA 2OV4A 1WLYA 5F1YA 1NT2A 1YS6A 5IBQA 3ZKWA 3HWSA 1GSIA 3DTVB 4XSHA 3L7BA 1CWUA 3VOAA 5CK5A 2XOKD 1PJ3A 5C5IA 3IBFA 1VE1A 2VA9A 3RFCA 3ZHCA 5LZ7A 3PJGA 1MABA 3HSKA 4IOKA 4OHVA 4F4FA 1IZ9A 4Z7OB 3R9KA 10MHA 1NUSA 3SE0A 1JKMA 3K72B 1P45A 2QQGA 2YZ2A 5HPYB 1VPTA 3KQTA 5JS8A 2HPZA 1FEZA 2ZQYA 3SIXA 3PXGA 1Y9AA 2HK6A 1H05A 4HNGA 4MP3A 2C0QA 3EULA 3B9PA 1UJMA 2BHSA 1Q44A 5AVOA 1M5RA 1UDCA 2GM5A 5KCZA 3FTCA 3F6RA 3SM9A 1YRAA 3CEJA 2JIQA 1X0VA 3Q2OA 4JJIA 5TQ0B 5KU7A 4RTNA 1T4CA 3AKEA 4EB8A 3LT5A 1V37A 1Z5NA 1E62A 2P8SA 3DAYA 4X0EA 5FNVB 2YUTA 2X8AA 3DVAB 4EENA 1GKKA 4N18A 4TV8B 2V6JA 2WYVA 4ZVVA 5HE9A 1ZN9A 3Q3HA 3HCAA 4YXWA 5IKOA 3R7LA 4EHJA 1OH8A 1JSLA 2WZQA 1E7QA 4BB0A 4YJFA 4Q1BA 5IFKA 5MF6A 5AW2A 3R0QA 5ILGA 5HW0A 1NM5C 2X7JA 4G1VA 3U4AA 1C4OA 2RGUA 3B89A 3QI2A 2VOEA 1EE9A 2Q1YA 2YWGA 3I52A 3QJ5A 1Y8RB 1E9VA 1XFDA 3Q87B 2IPMA 3V8RA 2WUEA 4KBFA 1CDEA 4P93A 1DSSG 1H1DA 4H35A 2Y0EA 1CEYA 1RYHA 2ZR8A 3ZEAA 4C2BA 1CR0A 1NULA 5D8DA 5B2EA 2IWRA 1NNSA 3VU1A 1W36B 4KRFA 4LBVA 1U0NA 1GCUA 3A9CA 3EOAI 5F73A 3V46A 1QHGA 4DUGD 1Z22A 5JXJA 2A9RA 4BRSA 4ZAGA 1GXSA 2CNKA 4ZI3A 3EMVA 2X1MA 1YFJA 1M72A 1UKCA 3GEGA 3JAWA 4I46A 1DIBA 2BDEA 2V45A 3CGGA 3LP6A 4W1SA 5J47A 3PRKE 1IWPB 1Y1TA 5LQJA 4C0WA 3NT2A 1M5UA 3GCXA 3S0JA 5G0WA 1D7AA 3SHTA 4UEOA 2HRRA 1P0MA 2NTNA 4V02A 2G1JA 4R7GA 4XVRA 3WFIA 2HV9A 1M8JA 4TM8A 1KE2A 5CFPA 5F2OA 3GLFA 2QRJA 2CFOA 1NTOA 4EQZA 5AVUA 2XUGA 3W78A 1LI5A 2VXBA 5DLDA 4B4WA 1MJ5A 3E8SA 2R8YA 1XRLA 3HKBA 1MXFA 4A0QA 3ZCQA 2EKLA 1EPUA 1WG8A 2Q6KA 3R9XB 5FD8A 1TRHA 1XU4A 2X2EA 1G2PA 2ZUSA 1TJ4A 1MVNA 4YRFA 2JGLA 3QKSA 2I4RA 2PGXA 4KN6A 3B5IA 3MINA 1FSFA 1GLGA 3BA6A 1PQYA 3BJMA 1QWOA 3HLKA 2B9EA 3PHJA 4WY2A 3VPFA 4B7XA 1ECJA 2NZYA 2Q3DA 2W98A 4MQLA 2Q8PA 3VR4D 4A8HA 2VTBA 2AYYA 4JT4A 5D5HA 2OHJA 2CNLA 1N0IA 1BEZA 1WKBA 1T36B 1ZH4A 1P0QA 3IAFA 5TQJA 3ZUGA 4DZTA 4U2FA 3IT0A 3K0EA 4IJ6A 3G9XA 3AKCA 1CXZA 1Y3FE 2H31A 1D4ZA 2PX5A 3A31A 4O02B 1QM5A 4BLWA 2G4CA 1Y3BE 4YAWA 3E81A 4LSZA 4ZDWA 1TB4A 1AKYA 2V7TA 3UHPA 2QMUA 2O3QA 3R7AA 4ZMRA 4Q3DA 4TV9A 1CJUC 1Y34E 1LFAA 2A3NA 1G4AE 2NYVA 4YO8A 4EUEA 4JT8A 1U3TA 3M5CA 4MYHA 1S2MA 3HCPA 1MAHA 2O52A 5CXUA 2PFGA 2M6RA 1TXGA 1MB2A 4Z9BA 3SD7A 4QYSA 3CX6A 4KQFA 4LKOA 2PN1A 3PEUA 3ZCTA 5DGDA 1DFIA 5TRTA 3U60B 2VTEA 4HZGA 4BMVA 5KSZA 1NR5A 1MO4A 3GJ4A 3N53A 4X63A 2GYWA 3SBXA 4PHCA 5F98A 1V8ZA 2R8OA 3A4VA 2N75A 2E55A 5ENVA 4LRYA 4KB5A 5AM3A 4KAJA 4BRUA 3WTCA 4WK4B 1DKUA 4ZK6A 1SKMA 4L85A 3GGJA 3ILYA 1U3CA 3EWIA 4P22A 3T38A 4HWPA 4EO9A 2HPVA 1Q6ZA 5AKXA 3C98A 4FMCB 3WL4A 2VP2A 1E0SA 4GICA 1P60A 3G8CA 5I7SA 2VXCA 2GNAA 1VSUA 1MQ9A 4KQCA 1F0YA 2JK0A 4NCJA 4C0HA 3CWCA 4MRPA 5EWLA 3GPLA 4IXDA 1JLHA 1HMPA 1LS1A 4QQNA 1UXOA 1YC5A 2AMFA 4H6VA 4I3GA 4BQSA 3DVLA 1PFQA 2DAPA 4HNUA 5JVDA 4GZ3A 3T1YB 1SWWA 3NH6A 4KNWA 4AF6A 1GPLA 3NHKA 2IYNA 4PRKA 4FX5A 4WKNA 3ZNNA 2HA0A 4GOJA 4H1WA 3FMPB 5LQRA 4BPBA 4HNVA 1PU2A 3DZCA 3KOXA 1G4HA 2ZR7A 3Q9UA 1F7UA 4EI2A 4O25A 1U5BB 1E0JA 1XP5A 4HBGA 2JLZA 3EUFA 1GJRA 1SVNA 1JFRA 5T41A 1W0CA 3I9OA 3RU3A 1PP4A 2XMGA 3LL7A 1U7OA 2H2FA 2NO4A 2HA5A 4P4UA 5KWEA 5BR8B 3TJZA 4Q12A 3ICQB 2XMZA 3QNWA 4RKRA 4NENB 3LCMA 4KQ2A 4XEHA 3RC9A 2O50A 2QDXA 4G1UC 3UJ7A 2IUUA 2GUWA 3G5MA 2C8LA 4I2NA 4I9FA 4KDEA 4KGXA 3I62A 2ODAA 2O8EA 5JHGB 4FFVA 3MMZA 4MKHA 4AJNA 1DKQA 1R0ZA 1K6JA 1MT3A 2J5BA 3T6KA 1G38A 1EDZA 5BSUA 2B1GA 2I6GA 2Q6LA 2ZDGA 4MLPA 4YDRA 1YCHA 5KNDA 3ED1A 4CM3A 2GLXA 2OC9A 4MKGA 4BX2A 2P8JA 1IY0A 2YYAA 4ZEOA 4AMZA 2VXOA 1JHUA 1C0LA 4CW7A 2Y1KA 5FX2A 4BJ6A 5FUQA 4B3MB 2LPMA 1H9BA 1M8PA 3GDFA 221PA 3KXLA 3QFTA 4MQEA 4YP0A 5E4TA 2KYRA 3UUEA 3G7NA 4CQMA 4F3NA 1SCAA 1YDEA 2ZVQX 3KNZA 1CUZA 4BO4A 4KPYA 2GPTA 4LJ9A 4KCGA 4DV3B 3CX4A 4B8WA 3VVCA 4FFBA 3C3JA 2WEKA 1R0XA 2C4HA 4K9RA 4B79A 4B6JA 4LF6B 3ACCA 2K7ZA 1MC4A 1UOEA 1T4BA 4ZT5A 1J06A 3H11B 1XTVA 2PWZA 3OZWA 1PKEA 1ZSYA 1U1FA 3AWIA 5DYTA 2ZB7A 5D2CA 3EGDB 3WNCA 4H6XA 1PTKA 3HYNA 1EHYA 3K9NA 4D3ZA 4DKXA 3EIFA 5E2BA 3OKAA 4HWGA 3M6WA 3OPXA 4X97A 3H16A 5K0GA 2NSLA 4JXZA 3U3RA 3QUQA 1EWVA 3KQPA 1SVIA 3BXZA 3FCSB 4L75A 1H5NA 2HXYA 4C3VA 1T9GS 3UMJA 1EQ2A 4MP6A 1LDNA 1SOVA 4IOLA 3WLQA 1VMDA 1EFVB 1NXVA 3NIWA 1HXHA 4ZU1X 5B58C 2J41A 3CMMA 1PKXA 2BJVA 2HSDA 4XGNA 1MB9A 5JAHA 4DLBA 5ICGA 4TWBA 4PTLA 3BJIC 5F1OA 2BDTA 3WFZA 1YE5A 3QPVA 2UUCB 1Z28A 4H60A 4ACBA 3BVPA 5A62A 2K2QB 1RM4A 1UP4A 1BG6A 3VOBA 3OFVA 2BVNA 1MLDA 4MR8B 4AY3A 2VRCA 3EF0A 3QFHA 2O2DA 2VA8A 4QREA 3K3PA 4WA7A 3EVAA 3WMFA 2HQOA 2V8BA 4A4DA 4LC1A 1T8YA 1ZZGA 1Y37A 1DBWA 1YSCA 5AKJA 2YXNA 2E1PA 4U7FA 2YYZA 5ARDA 4DTCA 2QY6A 2FCAA 1RLIA 2WM2A 3GNQA 3HB1A 3OTHA 2IY7A 1VL0A 3W5HA 1NF8A 3ZDFA 1HZZC 2J30A 1ZUIA 2K5UA 4TKMA 1LWOA 4FILA 3OSUA 4DLYA 8LDHA 4F8JA 5CNIA 3VU8A 1QBKC 2AE2A 4MW9A 3SNHA 1GL7A 3A3YA 3OT4A 3TLGB 4JX9A 4COOA 1RAEA 2BJWA 2I4LA 2VRWA 3O4RA 3O31A 4O1HA 1UWLA 2YJTD 2ZPAA 2QN9A 4K2HA 2Q2NA 4KZKA 4MS3B 3VDRA 2XT6A 2QN8A 3FPEA 5BSFA 2C77A 2V6BA 1AH2A 1N6PA 2M2IA 4NDAA 1O3YA 2BMWA 3BWVA 4WV3A 4OJNA 4YV0A 2JGIA 4GT1A 4CG3A 4OAOA 3PGA1 3ZHSA 4IV0A 4QOEA 2VDOB 3EXG2 4GXTA 1CDZA 3PDCA 5ALFA 3UV6A 4MCAA 4K0KB 4N9QA 4U7GA 4ID9A 5AKYA 1GRNA 1DXHA 1G9TA 1HNXB 3W8FA 4CKEA 2ZAIA 3ID6C 5LC1A 3DO8A 4MB6A 4ZK2A 4W5NA 2B8NA 2FFHA 3FYCA 2YJNA 1X7ZA 2GN0A 3AF2A 3IV7A 4R6XA 5BN4A 5A1TA 1PNTA 3VNAA 1MFZA 2VPIA 3H9QA 1CFJA 3STWA 2I55A 3D5EA 2YL2A 3KVVA 4PAGA 4B8ZA 2FZ5A 4Z86A 4JJGA 5TT0A 3TRKA 3PI6A 4DR2B 1WW2A 3VPCA 3ED5A 1ZAKA 1IZ0A 5EL0A 3RVQA 1KGDA 3BGWA 1L7EA 1G16A 1PUIA 2E5WA 1ETUA 3PJDA 5K05A 5F64A 2Q4DA 3Q9SA 2H4YA 3CEPB 3U40A 3BQ9A 2HU7A 2RAUA 2VZLA 1WPXA 5GGXA 2X9NA 4EB0A 4XB6B 2YN4A 1X8XA 2OCPA 3D2CA 1EHIA 1P2SA 2BELA 3FHTA 1UC8A 2XMPA 4UEKA 4ZHQA 3DFKA 1G5HA 2IFTA 4IWNA 3S7TA 2HO4A 4ILKA 5IAGA 3WYNA 1A82A 3NYRA 5JQGA 2DXIA 2CXPA 1PZFA 2QTLA 1PR1A 3FWNA 4CKWB 2CWDA 1T15A 3N87A 3A32A 5ELMA 3T1VA 3BUSA 2BZGA 3U5TA 4KU4A 4MYTA 4GMGA 3A6EA 1L7BA 4FYHA 1EWKA 1PL7A 1WDKA 1ZJJA 1N1MA 2GEKA 3R0XA 5K3BA 5CH3A 5SICE 2IXGA 1NBMA 1CVRA 1K5PA 4DDKA 3A04A 4O29A 5I4CA 4WZBA 2BGLA 4C88A 3EXEA 4YEDA 2DHEA 4OFXA 4QX6A 3SBDA 1EVKA 1AB6A 3IVRA 2GNOA 1RYMA 3NHYA 4RSRA 5DX0A 2FEMA 3E8MA 4ZAWA 4AN0A 1KR5A 4P31A 3R7BA 5E7MA 2F4NA 2RC6A 4RD4A 1VDZA 3PZBA 1L7VC 1D1TA 1SJ9A 1SG9A 3C5VA 1IY1A 4RVCA 4NIMA 3AHGA 4BQRA 2IXTA 3IP8A 2QD1A 2CHVA 1F7VA 4OXXA 3VU9B 3A3OA 4HUQB 2FPKA 2INGX 3FUCA 4B6OA 3SC4A 4DRYA 1VHJA 5CT9A 3BJEA 3UICA 3FDIA 1Q2XA 2DHRA 3PF9A 1J0XO 4C3UA 1Q0TA 1TNDA 3KB8A 4JOBA 4WXPA 5AJXA 5LBUA 4IXMA 1WZIA 4JDPA 4PYRA 4BUZA 2FZCA 1I2DA 4KSCA 5AD1A 1V26A 1L7PA 1LBEA 5JPDA 2FLKA 2A0FA 2QTVB 3WMXA 4HAVA 1GTMA 3MGCA 5C3MA 3EFOB 4UE2A 4CQNA 1OIWA 3IULA 2R25B 3D9QX 2PJDA 4IEFB 3OOEA 4OKSA 3KQUA 1QOPB 2CSUA 3UAWA 2OBMA 3KX2A 1KEVA 2CBZA 2DPHA 2JJQA 4GWLA 4R5HA 1H2AS 2ASVA 1C9NA 5B3AA 2CLEB 4MVJF 3SQMA 3SZMA 1XNGA 5FOVA 1T6ZA 2ZWPA 1S01A 1I2CA 2X7XA 2D54A 2R85A 2RGYA 1WWKA 1WV1A 3W6NA 3MJTA 3RRBA 3WHIA 5A7GA 1O96A 4WH0A 3UT5B 3HXOA 2WVHA 1C30A 4WNAA 3I5YA 4HQ6A 1KIAA 1E20A 2VYVA 4ZVSA 4IMRA 2V6IA 2VJMA 2FR0A 3FROA 3A70A 3MBOA 3R3WA 5IK2D 1TO2E 2I4MA 2QUIA 3LUJA 3QVMA 1DAGA 4WL0A 4O0LA 3FY4A 4IY1A 2FSIA 2RGCA 1FOEB 3IQWA 3PGLA 5DM1A 5EWJA 4BAGA 4D8VA 1LBIA 4KXFB 4QOGA 3ZCRA 1ISRA 4RF2A 2BFDA 4C20A 4DXAA 5K0ZA 1A9OA 3PC3A 4W5JA 3J81k 2OP1A 3GLHA 4XQGA 3RUPA 1N7GA 3GLFB 3TSAA 1X39A 3HO8A 3FUVA 2NXJA 5J59A 4Q16A 4CV3A 3V1LA 4ZCTA 1Z7YA 1OH7A 3QU5A 3ZX4A 1H9CA 2WWWA 3RRNA 1DOAA 2R4TA 3ZE7A 1N6HA 1SQ0A 3FIUA 1K27A 4HDKB 3RC3A 4EJMA 2JFNA 1KMQA 3R6WA 1YHYA 1EX7A 3P96A 1ORWA 1D4OA 3C4VA 1FRVA 3LKBA 3OO0A 3MZ0A 5HGJA 2CVHA 1TEXA 2DM6A 4IKOA 4MAMA 3VR6H 4DIBA 1EWYA 1GZHB 1XWWA 4V0SA 3PX2A 4RETA 1O94C 1PR6A 3KQSA 2ZSJA 3O9VA 4CMEC 4B7ZA 5HS4A 5GIPE 3SY8A 1WO8A 3S2SA 4BFVA 2PVPA 1QPZA 1TO6A 3LSYA 3FPBA 1GQ2A 3G5LA 1G64A 4XOIA 3L77A 3TQIA 2C54A 2ZKLA 3K7EA 1KQ3A 1HOXA 4GPTA 1CRQA 4QL3A 2CD7A 1EYZA 3D6MA 1MZPA 2JAXA 1EVJA 3UV3A 5I7VA 1M1UA 4UUMA 2VP5A 5CFQA 4TXNA 1E7MA 2HK9A 2FQWA 1QUFA 1IHYA 2QVBA 1Q95A 1D4FA 1KC3A 3BREA 3CJRA 3MQ4A 2JJ1D 4TV9B 1PEYA 4BL5A 3CVUA 1Q3TA 1O95A 2AOTB 4MAAA 1KF0A 4A0HA 3AUTA 4X8OA 3QBTA 3HGMA 1PWXA 3EBPA 3ZV3A 2ACKA 4EJSA 4E31A 2C94A 1H8HD 3IBCA 5J5VA 3MJRA 3ZI4A 3ADOA 4ZPXA 2CKDA 3T3PB 3AZPA 3TFQA 3LKZA 4BECA 3I6QA 2CYAA 1RTTA 1U8FO 4M89A 1GCGA 2P3LA 1DPFA 5G0VA 4TVOA 2NVOA 3P19A 2ZUVA 1SUFA 4IXNA 1GIAA 4LJ6A 3MS2A 3IA2A 4K6FA 3FNRA 3I2GA 4R8LA 4C3ZA 1C9MA 1YQQA 2DFPA 3ESZA 5KSOA 2PRSA 2FH5B 2VG8A 3E82A 4EG5A 2JGEA 3H2YA 4L9WA 4AJEA 2X5XA 4ML3A 2I3ZA 3F74A 3VDXA 2VDWA 5E9JA 1SBIA 1W88A 3E3AA 2O5CA 1DBSA 5EP2A 5B1IA 4KEAA 2XQKA 5K3CA 3OFSA 3T7CA 4UM9B 3LT4A 3EW9A 4B5LA 4FJ0A 4QJ4A 1VHWA 1LDMA 5JVDB 1KJIA 2XMDA 1DRVA 2V6MA 5DTMA 2BISA 1P2VA 2WQ6A 4L0DA 3EPKA 4AN1A 3IOCA 1U80A 3FA2A 4LPSA 4D45A 3IEVA 1HUQA 4GLOA 5HUHA 1AXGA 4DLAA 3U5ZB 1C9JA 4RHCA 1XF1A 2Q41A 2QX6A 3K31A 3JYLA 3QHAA 5BN3A 5IDQA 4TZ6A 1R4ZA 2ZJ0A 3ZDYB 1O58A 2Q3BA 4CG1A 3HU3A 1WBJB 2DLCX 2GYYA 3P2MA 4R1UA 4AJ4A 5L7YA 5DM70 1Z62A 1MRZA 4XQ0A 2XVAA 1BIFA 3KZ1E 1T1GA 4CM7A 1D2MA 2J0UB 1KHHA 2KI5A 2XWJI 1XB2A 2GZHA 2V5UA 3VHQA 1HRKA 2GBCA 3SZUA 2HMYB 2QMQA 3WIVA 1WOYA 3RH0A 1GKYA 3KQQA 3DT6A 4MW7A 5D51S 1ZFNA 3ZWBA 3DE7X 4BBZA 3OI7A 1PGOA 3GBVA 5LZ2A 4BUJA 1Q12A 4R51A 1PWZA 5DW0A 3GIDA 3N6RA 1OC4A 3WMEA 4NATA 4ARAA 1F8XA 1R88A 4K9DA 4IJMA 3OFND 3A06A 2BOVA 1SHJA 2RIPA 2PFKA 1E59A 5L45A 2JJ8A 1HZJA 3EQ7A 3KUDA 3LA8A 5FP0A 1ZJ5A 1I2BA 4D81A 3S1SA 4BXOA 4AF7A 1XWFA 1R6UA 3C8HA 3UYLA 4EG0A 2CV0A 5CDHA 4LV5B 1CR6A 1P2FA 2A8YA 2YHUA 3NGXA 3O03A 1KSGA 1PX0A 3RAJA 2FEXA 1V3QE 4ZVKA 3ZC3A 4YAUA 3LF1A 5J9FA 1V6SA 3DE2X 3C2QA 4UTOA 4CV0A 2YXPX 1E2PA 4ZA2A 3UT6A 1NAIA 4E70A 2O8DB 4R1TA 4G26A 4PZLA 4XA8A 4XX0A 3VR6A 4R8KA 4YRBA 2GJSA 4LZLA 3AVPA 2AX3A 2BI7A 4KKVA 1E4EA 1L5WA 1B4DA 1OBVA 1OAOC 3H13A 3VR4H 3FGZA 1NLMA 2OKCA 5BR4A 3JRWA 4ISBA 1J2UA 2GPAA 1C7QA 5FBHA 4FYVA 2HFKA 1JHXA 3IEKA 3AI1A 4TMXA 3GO4A 3RHTA 3HB0A 1SOMA 2G5PA 5JNRA 3EPRA 2ZRPA 3LGAA 1UKEA 5AW6A 2HU2A 4CHGA 3ZD7A 5D3QA 2QMZA 3LGXA 6REQA 2WP8J 4PHFA 2RH8A 2E48A 3AHCA 3ZHTA 2LW7A 2HRQA 5F1KA 3VZDA 4OUDB 3B8EA 4BFLA 2KBFA 4DCTA 2QN2A 2XBLA 3C48A 1VM6A 3DFMA 2BONA 3HY6A 4A7PA 1S2GA 2EHJA 1D2GA 3BMNA 1DG1G 4CV2A 4UDNA 4LDRA 5E6UB 5KAMA 2NXWA 3O3MB 2HCBA 4RFSA 4CQMD 2D3TA 2AC4A 2O1XA 2XOKA 1IY2A 5H83A 3Q4GA 2ZVDA 4BX8A 2CUTA 1P1HA 1T0HB 1UR5A 2NZ8A 2REQA 3DHYA 1XEXA 1ESMA 4MVYA 5CFNA 2ZE7A 2ZI7A 5ESDA 1XU9A 1BX3A 1KI6A 3DE0X 3KZMA 1TDJA 1DV2A 1M5TA 5ENDA 5FA5A 4DRZA 4OHXA 4YDSA 5A0VA 1RWVA 4ZYZA 4KWHA 3LRPA 2GBFA 2ODPA 3C7KA 4PLCA 3ZBPA 4CLOB 2ZUTA 3QVGB 3QG1A 1MENA 3BOSA 4XLLA 4AZWA 3K70B 1TE2A 3FI0A 3VNSA 1OU4A 3FDJA 3BIOA 4Q21A 3EDRA 1NUTA 3ZGNA 3KTFA 1H6AA 4WNCA 3O6VA 4P0TA 5F78A 4KTTE 4NMLA 3S4YA 1PR3A 2FEWB 4ZO4A 3W3ZB 2HSJA 4P33A 4TMTA 2I1VB 3FVWA 3BB1A 3CUEF 3ZV6A 4AS1A 1EEXB 2QIOA 3KRTA 4EHLA 1RRKA 1RYBA 3EJ6A 2X15A 4BLPA 1QIMA 4KQMA 2L18A 3F2VA 3RNOA 2V96A 2DFKB 4DBLC 3GVXA 4N9WA 5FUYA 3FOBA 3DE5X 1FSSA 4PSAA 1UBHS 1L4UA 3JQAD 4EB6A 1ONNA 2FFQA 1WXGA 3IKTA 4HZUB 3ZHBA 3PFGA 5ADVA 5JD4A 621PA 4W8OA 3CLKA 4J9VA 4XZ3A 4BP1A 5D00A 1T8PA 1K8YB 2ZE8A 1C1YA 3FG9A 4RVFA 5FNVF 3WNBA 2JCSA 4HNAA 4JQCA 3V42A 4QLBA 1QAQA 4P0QB 1JIXA 1D9XA 4B6GA 2F3PA 2H5LA 3BEDA 4DUGA 4EHKA 2QWXA 4EMSA 2FFBA 4TUYA 5EWMA 2FSFA 3GIWA 3LQQA 2XCSB 3AB8A 4AMGA 1QCCA 2TMYA 1KZ7B 3OU7A 3PNQA 4BTEA 1YQUA 1X7ZB 2GXSA 3GP5A 4KG7A 4V2IA 3NVMB 3JQCA 1WW8A 5BN4B 5BQXA 4Y2XA 1XNHA 1GG5A 1ULHA 1IWBB 4AC9A 4G63A 3DBVO 3PGKA 5HGXA 3OQ1A 3M6LA 4F7WA 3L7MA 5KQRA 2JAHA 4HCJA 3KYCA 3AW9A 1IOZA 2NPOA 4GX2A 4M37A 4WFKA 1FBNA 4V0RA 3SVZA 4BKUA 1G5TA 2O2XA 2Y9MB 3QWIA 1CJVC 1LI7A 2QX9A 4AY2A 1C8VB 1Z9BA 1X1DA 3NAMA 1BHJA 4E5VA 4PSUA 4TKLA 3TR6A 4N6GA 4WERA 4KJXA 3M6UA 2YVAA 5DLQC 4EPYA 3J80A 4EZEA 2XXAA 2AZ4A 1ZLXA 2EP7A 1MO3A 3GQVA 4ZHQB 5I9IA 4D0LB 4WDRA 1BA3A 5EIHA 1DO8A 3MHPA 2OORA 1OC2A 4IO0A 5EJ8A 2CXNA 2CL0X 1NMSA 1JA9A 2I8CA 4RMIA 4YGYA 4E13A 5BSHA 1IBSA 3MCAA 2BEUB 2AV6A 2OAEA 2P2NA 3K6SB 2HO5A 3VR4A 1FUUA 2WVAA 4C05A 3EVBA 5A5FA 1K0FA 4M60A 1UC5B 4AJ2A 3D8BA 2Q2VA 3KTOA 5F2EA 1TUEA 2X86A 4G8JA 1QZTA 1DC3A 1SB9A 2O6HA 3C8MA 5EYPB 4CL8A 2OHFA 1B23P 4N4AA 1QZ3A 2FFRA 3JARA 1RWQA 3N8KA 1U7UA 1Z5WA 3KEFA 3OIVA 4PQEA 2APJA 1GGHA 4BLSA 4S1PA 4KV7A 4PLPA 4P82A 3QW2A 4YJGA 1MAAA 2B98A 4KXQA 4D8UA 5L4LA 4RTSA 3WIOA 5FULA 3GELA 3M4JA 3VYUB 5LD2B 1JH9A 2FQXA 1B6SA 421PA 1UPUA 2I9KA 3T7SA 2RBEA 2C4VA 4DJDC 3RS2A 2F00A 4XRGA 2DFTA 4U4AA 2XI4A 2FDXA 4JJFA 1Y6JA 2PWBA 1DJNA 1GCIA 2NZXA 1PHRA 2EKDA 2X9GA 4P7JA 4N5DA 3LQRA 4OQ4A 1C3EA 3L1VA 2W0MA 4FNOA 3UOAB 4CXMA 2RHMA 2J9YB 3T94A 3C16C 2YWCA 4PRYA 4ZMSA 1CY4A 1NKTA 4M8NE 5G4KB 1XDUA 5H7XA 1QTQA 1CNMA 2B3TA 1HWYA 2DUNA 4QLOA 1W1WA 1XWIA 1U7TA 4G0QA 1TT7A 2YINC 3AILA 3TNFA 5LIPA 2VBGA 5JSZB 4YYEA 2CSXA 1NFQA 2NV2B 3OTOB 1O96B 5JNWA 3JD4A 1QCYA 4FXOA 4JA0A 2R7LA 3T0FA 1T1JA 2GT1A 4BFCA 3I3SR 2C84A 4ZVMA 2WHPB 3B3GA 2HW8A 1K06A 4JI2B 3TCXB 2GBIA 1G55A 2MSNA 4R1OA 1W4RA 2BGRA 1J97A 1HGXA 3GMDA 3IA7A 1O94D 3FYTA 3ZU6A 5LOVA 4JJ7A 3RTAA 1WNTA 5B3JA 2CW5A 5LMNB 1ADJA 4JIGA 4FTWA 3MD0A 4CM6A 1M6HA 3ANMA 3AF1A 4FMCF 2GRAA 1A2BA 2KLBA 4NEQA 4OBXA 2FPRA 5GP1A 5JV5A 3C74A 7MDHA 3QXCA 3PDWA 3UWDA 5J4YA 3N2KA 3H2BA 3O4IA 5JJCA 2A5FA 3DLAA 3PNLA 2AD5A 1C2YA 2RH5A 4LSMA 2DUWA 1F1JA 3AT1A 1Y5MA 3WE7A 4BNFA 4YAGA 3CZ4A 4DWOA 2Q62A 1I1NA 1SHTX 4YRLA 3IJRA 1ODFA 5LCXA 2XYPA 3UK0A 5MFPA 2HGZA 3EEIA 4ENTA 4C5AA 1E6LA 5AKEA 5CLQA 3G2QA 3WSTA 2NT4A 2PO7A 3RARA 1UQRA 1W6RA 2X13A 3A4MA 3FB1A 3OZDA 1UZNA 4R7TA 4WRRA 5JC8A 1CZHA 1IXSB 3I4CA 4IGEA 4WLOA 1W87A 5ALVA 4QUBA 5IUJC 3VVBA 4WJLA 5EHIA 5IDYA 5JZVA 1RZUA 1OLOA 1U3VA 2HBZA 1V8DA 1LLDA 3BH7A 4Q3NA 1D2NA 3TGWA 1DL5A 3CPEA 4RK4A 4RDHA 1FDIA 4CM8B 3QY0A 3SC6A 3GRAA 4G9GA 1A9SA 3LWDA 1J8YF 3MWGA 4QUEA 4HLNA 3GROA 1XTTA 4NNPA 2JFFA 4PLTA 4OHMA 2PH3A 1ISHA 1XD2B 1EXVA 3EVDA 2FPOA 4Z5XA 2AYXA 3HXTA 1BX1A 3FCAA 1E1DA 3C6XA 4NL4H 2NO0A 4FJ1A 1YS2X 1VIMA 5D1NA 2R87A 4QYMA 5F3DA 4PX5A 4G86A 3PQ5A 4ERXA 1CTQA 4E5KA 1L6RA 2XA1A 2IHUA 1QGUA 2YOFA 1SEVA 2QB5A 4QO7A 1VSBA 5IM5A 1KP3A 1OJLA 4ZPJA 4EEKA 5BNIA 4EJSB 2X8LA 1E3EA 5CNKA 2YIJA 3H8JA 4TLEA 4Q9IA 4ZRMA 5GJCA 4J6FA 4NI5A 3AJRA 5EXTA 4LCBA 4JHXA 4MUBA 1AN9A 3GFOA 4YBRA 3SJ7A 3W2IA 1VCHA 4NU5A 2FX2A 2I03A 2OZKA 1Q11A 4W9NA 1M0EA 5INTA 1GR1A 1VSQA 2A9VA 1T9KA 5LYJA 1GV0A 3CKLA 1N0HA 4JLPA 5JMTA 1CUCA 1KXZA 4UMEA 3LC7O 2QMEA 4CDGA 3WRXC 1EINA 5AT1A 2PXCA 2WD7A 3BMQB 2WRZA 4V39A 4ZIRB 1YQGA 1MRSA 2XKAA 3GR6A 3VX4A 5HIKA 5FLYA 1V8FA 2Q5JA 2DTXA 2F9MA 2Q3HA 2FW7A 2VPYA 3JY6A 4XUGB 3SLRA 3A7EA 1FFBA 2VBFA 2JCYA 1NF3A 1JECA 1TYCA 2A0UA 4KQKA 3GEIA 1PEDA 2VJBA 3MRTA 5AOAA 4MV7A 5JZOA 5DOZA 3UK6A 3F5DA 5HF5A 5KTRA 4IDCA 4XYBA 2NNLD 1PTJC 4MCJA 5IHXA 1NV9A 1E3WB 3EC1A 3F3YA 3HJGA 1OX4A 5IJWA 4IH1A 1AGNA 1BGXT 1HFWA 3K2EA 1N2CA 1Z73A 4ZU6X 1LRLA 1P2TA 2UVPA 2PZ8A 2FTKE 1O8CA 1H2HA 3KKQA 2REBA 2H9IA 2VAPA 3N8NA 4Y1RB 1DJQA 4TL6A 1NOJA 4UXIA 1NR7A 1AV7A 1GLVA 5E2AA 3VKFA 2BHTA 3DDNA 2O2JA 3M4YA 4AFNA 2YOHA 3F8SA 1NMXA 1X8LA 3QXSA 3WRYA 4ARCA 3IV6A 2VSFA 1AV6A 1DT5A 1KQGA 3P2KA 3JQFA 2FSPA 1RE0A 2LCIA 3CISA 2NGRA 1UJ5A 3N05A 1N5IA 1OLSA 1M1NA 1WP9A 1YZLA 1O7JA 2HBYA 4FONA 1XXHB 3DMNA 5I5GA 3U39A 5LZ8A 4DA0A 2GB4A 2ZRGA 3ACBA 4ZAZA 4CIXA 2DGDA 2PYZA 4UTRA 1PJZA 1AK9A 3TDMA 3W2GA 1P3Y1 1BFDA 4UBLA 3CVJA 2X6QA 1YFKA 2O2GA 3F98A 3QPAA 5GZ6A 1NBIA 3KOOA 4N65A 4OSPA 1SHUX 1WXXA 1GZVA 1TK2A 1U0FA 4CEIB 4F2PA 3AI2A 4JODA 4Q7KA 5DEIA 2ZI3A 5GJBA 3K1JA 4NYMQ 2KW5A 1KH3A 1OJ7A 3FBWA 1WVMA 2XGGA 4OV6B 3R44A 3I6MA 3LMKA 1FFYA 4EG1A 3F1KA 3SJCA 3MGKA 1GTSA 5K20A 2XIQA 3EQ6A 1W5FA 1FQOA 3BAFA 3IVGA 4DQDA 2A14A 1A5BB 4INZA 1OSNA 1TX4B 3FXAA 4QUHA 3WGUA 4LF8B 5C8XA 4PLHA 1E3IA 5KYUB 1SXGA 5HFAA 3QVVA 1JIUA 1LLFA 2F67A 4IRUB 4G2TA 5JI2E 2EW1A 4CQLA 1UWVA 1N7JA 1DEKA 2FOLA 3CZAA 3IURA 3M5PA 4IFEA 4EW6A 4KGZA 4XTCS 5B64A 2FMHA 3IR5A 2B4KA 2CNNA 1QP8A 1IHOA 4YFYA 4MW1A 3WBBA 3FCEA 1UBSB 1RYDA 1TM1E 4QATA 5HCIA 1VL8A 4R6WA 4OMFG 4DM3A 3ASZA 2GF9A 4CG2A 6REQB 1KARA 4JI7B 1A72A 3B3AA 3VBEA 2IYQA 1HG1A 1RVDA 1GR0A 3FZEA 1UKYA 4FZ5A 1GNQA 1MAUA 2BCEA 3WGOA 4D8YA 4M8LA 1XZNA 4IFTA 5E6RB 1QIFA 2JIBA 1H3EA 4AMYA 2X5JO 1ENYA 4FGKA 4PQYA 4C4PA 5DNWA 1BEUB 3CV3A 3OQIB 4G5FA 3CKMA 1LJ8A 4AMBA 4QFMA 4F21A 4EK9A 2BFFA 1ESZA 1I1HA 1J25A 2FFAA 3OJWA 5TPWA 1DC4A 3TQCA 3BKXA 1YJAA 2QMYA 3FMGA 1GM5A 2AS0A 2F1HA 1B41A 3V6MA 4EZBA 1F8GA 3D1LA 3VR2D 3OE4A 5FA8A 4Z0HO 3SP1A 3WB2A 2FW8A 5BSMA 4CN9A 3HYCA 1A4UA 3BSSA 3ECSA 3PUKA 5G3YA 1PEAA 2CVPA 2AEMA 2G8LA 4RGYA 3HUTA 3C5CA 2Q1WA 1BVHA 1RYYA 5CFMA 5KWJA 3TG8A 3BRSA 5B55A 3LQYA 2EJCA 4MQMA 4B81A 2BBOA 1LSSA 3E9YA 4GMFA 4J76A 1U4SA 1Q22A 4RZ3A 4UHBA 3ZDXB 4Q7EA 3I2HA 1M6VB 4ZCIA 4PF1A 4HEA1 3HDYA 5TGTA 3FMOB 1FFAA 2DKNA 1T35A 3R6LA 2AKAB 3KV3O 4Q4AA 3B6KA 1HYEA 2ZU0C 1YJCA 2XUIA 2O7NA 4X8MA 1NU8A 3EVNA 1OWNA 1NVKA 2RBGA 4HEA6 5E7QA 5EEHA 3LCJA 4AG6A 4JUAA 4YJ3B 3SMQA 1HX7A 5HS6A 1HDIA 1S3FA 2Q5EA 3RKUA 5AW1A 2G71A 5IASA 3KYDB 1GPKA 1JG3A 2B4QA 4LNUA 2PBFA 4H1UA 4IBOA 5FOWA 2C4TA 3H99A 3RT7A 3E8XA 3S1AB 3L0PA 4IQGA 2GCNA 5BV7A 4JL5A 2DF8A 1YZVA 2HM7A 2PUCA 4TMFA 3EZGA 3AHJA 3VNRA 4ZT6A 1IPFA 2E21A 2H29A 2CF5A 2ZSEA 4NYMR 3UFXA 4X24A 2OMKA 4EYGA 2OK7A 4KWCA 1DNPA 3LY9A 1SEPA 5JY6A 4M1ZA 4MVXA 4RH0A 3DYVA 3O3NB 4A2QA 4QGFA 1AO3A 3JQPA 2EKBA 3PLAE 5H3CA 2P9TA 1EXMA 1QK4A 3PI7A 3Q2IA 4RK0A 2P7IA 1BQEA 2IKSA 3GARA 3JD0A 4FLMA 4JR2A 3QU2A 4EG7A 2ZT5A 3H3FA 3H4IA 1TUBA 4OGFA 3DWGA 3VC2A 1UM9B 3IBYA 3VO1A 3LQ2A 2ZWIA 3EXHA 2FPLA 1EX1A 3GRPA 1JKJB 2W2LD 2X42A 1EEHA 4NBLA 5AHRA 4YWHA 4AL4A 4PG8A 4DSZA 3F90A 1ZK2A 3K9GA 4JLSA 4LK2A 4XX1A 4Q66C 1JDPA 1BN6A 1O1YA 5JWHA 1ZVMA 3LC1O 1GQSA 2G1AA 2W37A 1C8LA 2UZAA 3BFPA 1WHSB 1UC9A 3KPJA 5CTJA 5CYOA 4B6PA 1W6UA 4PPYA 3F6SA 2CE7A 5BRNA 2VJPA 1EP1B 3QE3A 1JTEA 1X7XB 1KJ9A 3VUEA 3H7AA 4DT1A 2X1HA 4GSYA 1NQ5A 3A1VA 3ZYZA 2FN3A 3KLOA 3Q1KA 2P4QA 5K6RA 4EYSA 4KXMA 1SCUB 4ZJYA 3I61A 4BNVA 3T7KA 3R9IA 3D2AA 5EIBD 4J4HA 4AW9A 2CEKA 1A98A 1NQVA 4UU8A 3H75A 3KTAA 5ALMA 1PT8A 5IVIA 3LRXA 3NUZA 3HBAA 2O20A 3GLSA 1RI5A 4AZ3B 3DM9B 1I0LA 5AJWA 4MINA 2QVXX 4MQUA 1MO5A 2RFLA 1RQ7A 5IYZA 3JARB 2YFQA 4QQRA 3ZWCA 3ZW8A 2QHXA 2RI0A 1CUWA 4OXKA 1EB8A 2IBTA 3DVQX 3MLEA 3E7PA 4W8HA 1YQTA 1JIKA 3IQDB 2WU4A 1ZMOA 4A91A 1Z15A 3SIPA 4HYTA 3DXZA 3MTEA 1FMCA 3G59A 4LXTA 4DCOA 4MKIA 4Q3KA 4DMFA 1LPMA 3Q8LA 1NXQA 1YTLA 4XWGA 5FBZA 1EFKA 2GDZA 4QJ5A 1H8HA 1I5OA 1W96A 3CNHA 3R7WA 2VKQA 2JBHA 2DRIA 2FN9A 2C3YA 4GMDA 2JKYA 1G8AA 2C2GA 3ELBA 3M49A 3Q3IA 4NDZA 4PXSA 4Y67A 2F9FA 1JI0A 1KK0A 2TRSB 4WJZA 1JT2A 3CEHA 2PJUA 1B6RA 3C6KA 1T9HA 4NOJA 1RBYA 2PQ2A 3QEBZ 2DETA 2R6CA 4QA9A 4TV9F 2QW8A 3E9RA 4M0CA 2ESRA 3KOZA 4U2CA 4UUOA 1XTZA 4OLAA 4DGSA 4GMXA 1FP4A 2J4FA 4F3YA 1UBNA 2SKCA 4QBKA 3AO0B 1M33A 2AW3A 3D8RA 1ENPA 1K3UB 1FVFA 2HA3A 5ANRB 3BE8A 3DTTA 4WXEA 4GM4A 2AOUA 1BCRB 3CRMA 3TX6A 2VC2B 2BL4A 3LG2A 2YC2C 4NOLA 5KTYA 2QUKA 1IK6A 4FFOA 1P4RA 3JQQA 2BM9A 1E4VA 1GLNA 4FNAA 3AJEA 3P9CA 1PBNA 1NDQA 3LZ6A 4OBBA 2O2YA 1UJ4A 2BGJA 2P9QA 4JT2A 2VPPA 5DOVA 5FWNA 5KWIA 2F17A 2HCTA 4B2PA 5T7BA 1OYWA 5FPHA 2R6ZA 3LYHA 4L8YA 3ZLJA 2OGSA 3MTAA 3DNFA 3QXJA 3D6NB 2ZB3A 4PLGA 4ZWNA 1EUCA 1FDOA 3EXIA 3I5XA 5KSPA 3CBGA 3Q6MA 5H59A 5JVDF 3EWAA 4UEWA 4IIVA 1K6EA 1I0ZA 5SZJA 5A5GA 4FVTA 3Q12A 4KMSA 5TGZA 3SYKA 1KFJB 1C80A 2QI9F 4E5YA 5KDDA 2G70A 2WQZA 4EFMA 2CNOA 3CN9A 1JA0A 1TKCA 1VI2A 3QA9A 3GA0A 2PR7A 5IX8A 3FTNA 4R1MA 4IG9A 1CUAA 5IARA 1R9NA 4FSHA 1P2DA 3LKDA 3URKA 4EHFA 1ECBA 1RLJA 1T9CA 3FCOA 1X7YB 3JQFC 3LNTA 2AKYA 3WR5A 4QTTB 3AY6A 1MVLA 4GO1A 4TTVA 3SZRA 4D8XA 5K0EA 3I76A 4KRXA 3ZE9A 3O8CA 3UEOA 4NARA 1Z6QA 6PFKA 3PRHA 1CUDA 3HDVA 4IVPA 3ZN2A 3MLBA 1IN6A 3JQGA 4FC7A 3QLVC 1T0PA 2ALJA 3NC4A 3COSA 3D54D 4F2WA 2BMEA 3IHWA 2AJCA 1V48A 2J4DA 1AY0A 2V74B 2VDPB 2DH5A 1ML3A 4AY4A 2OGWA 4Q4CA 3DLTA 5CB6A 4TYNA 4I4TB 4P53A 4UHEA 1DS6A 3JWHA 4NONA 1KVRA 3LECA 4G4IA 4KVGA 2A33A 4Q3LA 2EIHA 5DBHX 4EF4A 1K7XB 2ONZA 3B7WA 3UXHA 1DBRA 3NQ41 3PQ2A 2K2WA 4D4HA 4PYOA 4LYJA 1QR2A 3GFVA 3H8VA 4G6ZA 4TXLA 4DPMA 1EZ1A 3UK2A 2V3CC 4NR0A 1G41A 1V7QA 5FLKA 3I01A 1UMCB 3EC2A 3JSXA 4RZIA 4US0R 5A6SA 4JYBA 3JQ7A 1QYIA 3TGPA 4LE2A 3KQWA 3GDHA 4OATA 4P4LA 2AGVA 4TYYA 2X0FA 1T5LA 1ZL2A 2GHIA 4A5SA 1AS2A 1YR9A 1XZIA 4G85A 1LNSA 5HIMA 4DUPA 5BW8A 1GGNA 2F3SA 3TZ6A 4WXHA 4J07A 1N9KA 1ZIDA 2HR1A 3R6TA 1LW7A 3FLMA 1MTOA 2AMVA 3CO5A 4NK4A 1QC5A 4JH0A 1OX4B 4QLAA 1X13A 3R5SA 4NH0A 3V4VB 4MXDA 2MSDB 1EA5A 1N2CB 2VP0A 3LW8A 5HK9A 1ONPA 3MPUA 1RWOA 2UVPB 2FDRA 1Y9ZA 3AU9A 4RDCA 3COJA 2R00A 1H2YA 1QS0B 3Q1LA 3E3LA 1JZSA 3SYMA 1M2VA 1OXSC 5BUQA 1A7AA 1ZVQA 3PXEA 3W6ZA 1BYUA 1M76A 5JNSA 4N3BA 2BKEA 4G0MA 3UF0A 1GQQA 1P19A 5A7FA 1QCZA 4CT5A 3ISVA 2AXQA 1QDLB 3A2MA 4H3KB 3DL2A 4HFNA 3DVRX 3LM8A 1UT8A 1SVOA 2WWHA 4RS3A 5GZ3A 1RQNA 1J2TA 1M2WA 2WFLB 4MR9A 4EHHA 1ZWKA 5EMMA 4C7OB 1IPEA 1VLMA 2IELA 3LHSA 1Q74A 1CY7A 3N7UA 4UOQA 4HQRA 3E9NA 2C82A 3RAFC 1C3OA 2SECE 3EA0A 2PQ6A 4MUMA 3ZWOA 3CLRD 3R7DA 2OK8A 3SSOA 3GLRA 2JH8A 3KLNA 2YMMA 4KVZA 1TVMA 2MMCA 4LVNA 3OEYA 4X84A 3EIEA 2FEAA 5LP6C 2OA0A 5AKHA 3GEHA 4KQIA 4FOSA 2VHEA 1HT3A 3Q11A 4PRZA 2X14A 4WADA 3U4QB 1C4WA 2IHKA 3BPSA 4HRAA 5IBRA 3V7YA 1CRPA 2WHRA 3MTBA 3ZV4A 1WB4A 4HPJB 3CINA 1KZ4A 3RQSA 1GGJA 5TJ9A 1KMIY 4ASUD 2WJ4A 3IAHA 3L8YA 1XZBA 3NWJA 1NY6A 3HZZA 4C7KA 3MUNA 3VC7A 3LVFO 1PWYE 1P7WA 4QUGA 4DLVA 1SR8A 2GH1A 4NE2A 3NRJA 4LOHA 2P0AA 4ZQEA 3BB4A 3T1QA 3TZCA 2G1PA 3GYBA 3MYRA 1AN0A 1KS2A 3A25A 5A4DA 4ED9A 1YQ9A 4Z51A 2VTDA 1BXRA 2CWWA 1CUGA 2QL9A 4IG4A 3VR5H 4RZHA 3P2YA 3EXFB 2AFHA 1K7YA 4I36A 5C46F 1E8DA 1ZK1A 1S8NA 2JGNA 3BZBA 5FKJA 1RHRA 4C5CA 3G0BA 5DMHA 4FT2A 4ZTUB 3HCNA 1MIOA 1JNYA 2ENUA 3OZAA 1XCJA 2HH9A 2Y8EA 1RXSA 1WDWB 3GRCA 4GG1A 4JOCA 3NTRA 4MS4A 3WB1A 3O91A 1P0FA 2O07A 4JGIA 4NCIA 1PUXA 1RM5A 3DCIA 3BK1A 1WABA 3AQ4A 3ZBQA 4UTVA 4I5GA 3UUGA 2IIPA 1SD1A 2EBHX 1J23A 5FFMA 2IV2X 3R8CA 2ZROA 1EWRA 3NAGA 4WZZA 4YASA 3EGWA 3RYFA 1CLUA 2YZ7A 4ZHQF 5HTKA 3AU8A 3V9AA 4DDMA 3TDNA 1UWKA 2FN4A 5JQGF 4B84A 2EYUA 2R60A 4HQ0A 3PTAA 4FHZA 3WWCA 1FX1A 1YO6A 4J7AA 4RIGA 5F3WB 3FW1A 4TVKA 1P5ZB 3U4IA 4LF5B 4U7PB 4J0DA 2E89A 2VZEA 5J58A 1OVGA 4QDTA 4BTVA 4OMUA 3AEKA 2F8MA 4Q0MA 3F9IA 2IF0A 1Q77A 1V5FA 2Z98A 5J4KA 1R6VA 1T0BA 5FA6A 2CMHA 2IYZA 4CR7A 1Z13A 2ZT7A 5KPJA 4KC0A 4X9XA 2C7PA 1ZHOA 1QXSA 3DT9A 3M3HA 1SZDA 1RXEA 2XNDD 1ZONA 2GARA 1K89A 5K4HA 3IELA 4GBMA 4LA4A 5M5BA 4G5HA 4O2LA 2G9VA 4BFWA 4D43A 2YNMA 1ZI6A 1JX6A 1WV0A 2AH5A 2YXEA 3F9CA 1SVKA 3KXKA 4MAFA 5E8JA 1XALA 4R16A 2GPSA 1JJAA 5ICMA 2WFZA 4Q15A 2PEZA 1P18A 1BCSB 4GOLD 4MCHA 2FA9A 2D5CA 4PU0A 4C4ZA 1MA0A 4IMJB 1KTVA 3ENKA 3ZUPA 4BBJA 2ZBGA 4BO1A 1RKXA 2FQ1A 5SYAA 3USCS 4OJMX 4ZI7A 1A4IA 1V6AA 3D7LA 4G1FA 3R3YA 2V1XA 1T5DX 4JCCA 3M5DA 1RWWA 4KDCA 3AK4A 1QF9A 1AE1A 3H2HA 1QHYA 1WB5A 1XF9A 1F4LA 3D7KA 5TMEA 3JSAA 4P3XA 5KTTA 3FZYA 4LJKA 1GFSA 1EXWA 1EKXA 3AR8A 3FCXA 1TCVA 2HQ1A 2JGKA 2VAVA 3OU2A 4WINA 2NP7A 4Y0VA 2OE2A 3QW4B 4OM8A 2PCJA 1EA7A 4IHAA 1GAWA 1EHCA 4WCFA 3RSLA 5EHNA 2JRLA 3SI7A 4WX2B 3TTSA 5L95A 1R50A 3ZJTA 4MVCA 3W2FA 1TUBB 2VL7A 2W8ZA 1KBOA 4RU1A 1SU7A 1EIWA 3S70A 1QGDA 1V95A 1Y4SA 1FSZA 2YHIB 1KY3A 3QNUA 3EDYA 1I32A 1AIPA 4W8GA 3G5AA 3DKRA 1QIEA 4KAFA 3DQQA 1JDBC 1H6CA 3IJ5A 4X66B 3BHJA 1D5WA 3PX3A 4CF5A 2PA3A 4DCNA 2QM8A 1Z7GA 4JC0A 2CB0A 4JV5B 2DZDA 2Q27A 4DUYB 1KVQA 4KNVA 1H2FA 2OLKA 4CEHA 1KQNA 1FJXA 5FXMA 3Q7EA 4DUZB 1MO2A 1B8UA 1EJ2A 2ABWA 3HA3A 1N1DA 4AY6A 2XCTB 2R1ZA 3NYQA 1JILA 2H1CA 2PWPA 2YWRA 4DLLA 5HMLA 3PHHA 5E1MA 3ZR4B 2N1MA 2JHFA 3CT4A 4K9NA 4IJWA 1HK7A 1D4AA 3KTAB 3MWEA 1VKNA 2ATXA 3C87A 4F5YA 2J31A 1W5AA 3VR5A 1XMVA 2EFJA 4KLZA 2C78A 5MN4A 3CSDA 3DBHA 3FCUB 3IUJA 3WHLA 5HJ5A 4BKOA 1NDHA 2IHBA 3BKWA 4JL6A 2ACEA 2X4LA 4PAOA 3X1JA 4D9EA 1U0LA 1RXYA 2AIRA 3ONVA 4G8CA 3GLGA 1EM8A 1SZJG 3H1EA 3WSWA 1ESDA 1W85B 4TKZA 2GDJA 2RGNA 2WSMA 4ZCMA 2YFYA 3E7FA 1PR2A 5ES4B 5KOHB 5LXTB 3ETLA 2OHIA 5FTNA 1QB8A 2P6UA 4JLBA 4EWLA 3MSCA 1OOEA 1I6MA 1LV8A 2M6SA 4DV7B 1L6IA 4OXNA 2BN4A 2QPAA 3I01M 5DGTA 2NADA 3ZE0B 4B3FX 2QOEA 4F3RA 3K6RA 5E1DA 1OD6A 3F96A 3M70A 3RFTA 3WK6A 2BEVB 1M2JA 4I6EA 1Q2UA 1R18A 4OIMA 1SVUA 3IHTA 1ZUNB 5KCMA 4AKIA 3NS7A 2CMFA 3PHLA 3MJCA 2C92A 2NU9B 5K8TA 2QR5A 1ZM2A 3TKAA 1AKMA 4DDWA 3K0AA 5BPHA 4YVFA 3O4JA 3P9RA 3P52A 4RQAA 1RCUA 4G8DA 5DLYA 5JEDA 4OBEA 1T3SA 2PQ0A 5L6LB 3IP1A 3F5MA 1GO2A 3GH1A 5EE5B 2R5WA 3QH4A 1CP3A 1UBKS 4B6EA 1Z82A 1ZD5A 2IHVA 3B36A 2C20A 3ORFA 4F93B 3HE3A 3ANNA 1A50B 4RZXA 4BKMA 4DLXA 2RKWA 2CKMA 2VF4X 2FG7C 2GD6A 3GZNA 2I33A 2WYOA 4O59O 3B12A 4R2MA 3UM9A 5HJEA 1UBOS 1SOAA 4NPHA 3ECAA 3MD9A 4D5GA 2XCUA 5SYNA