4PSCA

Structure of cutinase from trichoderma reesei in its native form.
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
220
structure length
220
Chain Sequence
WPSINEFLSELAKVMPIGDTITAACDLISDGEDAAASLFGISETENDPCGDVTVLFARGTCDPGNVGVLVGPWFFDSLQTALGSRTLGVKGVPYPASVQDFLSGSVQNGINMANQIKSVLQSCPNTKLVLGGYSQGSMVVHNAASNLDAATMSKISAVVLFGDPYYGKPVANFDAAKTLVVCHDGDNICQGGDIILLPHLTYAEDADTAAAFVVPLVSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbohydrate esterase family 5
publication title A Cutinase from Trichoderma reesei with a Lid-Covered Active Site and Kinetic Properties of True Lipases.
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
total genus 74
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2014-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pscA00
1W52X 1H2YA 3OPMA 2Z5GA 3K9BA 1TCCA 3FLEA 5BWCA 2C4HA 3GUUA 1E5TA 4RNCA 4KE7A 1LPOA 5FP0A 3F98A 1DTEA 3ZLUA 1VXRA 2AJBA 3G0CA 2GBCA 4C87A 1MPXA 4P9NA 1N5MA 4KRXA 3C6BA 4W1RA 2ORYA 2VEOA 1G5FA 5LZ9A 2RGUA 2XE4A 5E2IA 1NX9A 3DOIA 1AZWA 4TVKA 2WFLA 2BUCA 4AO7A 4L72A 1JT2A 4INZA 1EVQA 5ALYA 2DHCA 4BP9A 2B9VA 4B6GA 4PSCA 4UFOA 1YA8A 1BCSA 4PV7A 4WFJA 2JGIA 4DNFA 5C8VA 4QZVA 1A8UA 2OPHA 2JGMA 2V97A 3STUA 1AGYA 5BV7A 3I2KA 3B12A 3PFCA 3F96A 1CUIA 3DJYA 4CI9A 1YASA 2ES4A 2P8SA 3DS8A 5K3FB 3H0CA 4ETWA 1JJFA 2FX5A 1CQZA 3ANSA 1QIDA 1ZD3A 4J0IA 1CUHA 4EZIA 3MUOA 2Z3ZA 1DT3A 4FBLA 1R50A 4H77A 1UK8A 1E8MA 2WHRA 4BTLA 3Q8WA 1A8SA 4GEGA 4H7JA 1GXSA 1LPPA 3PF8A 1TCAA 3O0DA 3H04A 5CH8A 4WY8A 4N8EA 5ALWA 1VZ3A 2XT0A 2OCLA 4YX9A 1KU0A 4EUSA 3H17A 3NWOA 3WQHA 2OCGA 2WG0A 1QOZA 5ALEA 4DNPA 4F0JA 2X8BA 5FDFA 3F8SA 4G8DA 1FJ2A 2IITA 2I3DA 2JEYA 1MAAA 1QO7A 2VT7A 2XDWA 3O4HA 3DDUA 3G02A 5D7BA 4GW3A 2FJPA 1WOMA 5CT4A 1LBSA 3ILSA 4LYDA 3R0VA 2V9ZA 2Y2UA 4W9RA 3KOOA 5HQ3A 4X97A 4KAAA 2IX9A 2PUJA 1CUUA 3G0DA 1T2NA 2ZYRA 2J3DA 1WB6A 1QTIA 2Z8ZA 4G8CA 2PU5A 3I6YA 4HXFB 3CN9A 4ARAA 1LPAB 1USWA 2ZJ6A 5ALUA 3H2IA 4OB7A 2HA0A 3HABA 3WK5A 4LYEA 2XMGA 3IIIA 1X70A 2XMRA 4EBBA 5CT6A 4Q3LA 1SFRA 1EDEA 4FBMA 1XZAA 2OGZA 2ECFA 2HU7A 2V96A 1ORVA 1DINA 1EINA 1ZI6A 2QUBA 2H7CA 5AKHA 4J0HA 3AIMA 3A2NA 5DNUA 5IKXA 1ZICA 4HAIA 5DJ5A 4UBMA 2PX6A 2WM2A 3AIOA 3ESAA 4QWWA 1QZ3A 3DNMA 2PPLA 1QIJA 5KBYA 3AZOA 3R3VA 1VA4A 3JW8A 5AP9A 3H1AA 1L7AA 4XJVA 4ZREA 4IH1A 3QH4A 5FRDA 4YK7A 3F97A 3A70A 4N5IX 4J3JA 3LIPA 2BUAA 1QJ4A 4M0EA 4UHDA 5LZ5A 2YH2A 4CG3A 5A62A 1GPKA 5AI9A 1IUNA 4DNOA 5AKZA 3RK4A 5IVDA 3ZLTA 2HFJA 1WM1A 2XUPA 4BDTA 2JGEA 1ORWA 2XB6A 3C8HA 6YASA 5A71A 1LLFA 2ACEA 2JGFA 4NVRA 2PSDA 4E14A 2Y1KA 5AI5A 5SYMA 1XQXA 1E89A 1WB4A 1HKHA 4BCDA 4FNGA 1UK9A 3WWOA 5JARA 1BN6A 4QDUA 4PNZA 2OG1A 1E8NA 4HVTA 3IB3A 4FNMA 1ZGBA 2DFPA 4B84A 2Y2VA 4X91A 4BZZA 2ZYSA 5EHXA 3QVMA 1CUCA 3H19A 1XZJA 4UFNA 2VJBA 2WUFA 1XLVA 1VJ5A 3GELA 3R3UA 3W04A 5I7UA 3NOXA 3IUJA 3IUQA 4YPVA 4ZXFA 4Y9SA 4G4JA 1NU8A 4QDZA 2CKMA 1MJ5A 4Y2SA 4B83A 4C4XA 2QT9A 1TAHA 3GBSA 4UBNA 3DL7A 2GBGA 4Y2PA 2WHPB 2HA7A 3KDAA 4GI1A 3C43A 1JU3A 4MXDA 5AKEA 3D59A 1GPLA 3FAKA 2OQIA 3C6XA 3ZPXA 5J3JA 4KAJA 1CUWA 4L9AA 1W76A 3I2IA 1GT6A 4Y2UA 4BTVA 1F6WA 4B9EA 5C8ZA 1KEZA 2C58A 3R41A 3DKRA 2XUQA 1IUPA 5DLPA 4A23A 3Q0TA 1VZ2A 2CB9A 5JIBA 3CN7A 3DLTA 5AM1A 5AM4A 5JAHA 1EHYA 3HZOA 1J1IA 5LZ8A 4EA6A 3VJLA 2AJLI 1HLGA 4BDSA 4MEBA 2BJHA 4UPDA 4Q82A 3WLAA 4TPKA 3FYUA 4BATA 1DWOA 1MTZA 1FFBA 4KR0A 4CFSA 5DYYA 1N1MA 4JYPA 4KEAA 4L0CA 4J0JA 4FLFA 2PBLA 1UWCA 1PV1A 2XLCA 1XZFA 1X2EA 1CUJA 5HF5A 4EY6A 3F9CA 2WIGA 1ZJ4A 2VATA 1BS9A 5DYTA 3FLAA 2PSJA 3WI7A 4PSDA 5JD6A 3HJUA 5ALTA 4FTWA 3CXUA 5E4JA 2QKYA 1XFDA 4BB0A 2HL6A 2ZYHA 1MN6A 2RI6A 1AKNA 2AXEA 4IO0A 1TRHA 3BJMA 2ACKA 4KJXA 1CFJA 4QE3A 4P92A 4JYMA 3M82A 1C7IA 2BGRA 1QLWA 5A6VA 1DX4A 2JGJA 4H0CA 3F67A 5IVIA 4LXIA 1XZHA 5AH0A 3D4LA 3QPCA 4DGQA 4C89A 1R1DA 1CUYA 1CUFA 3I1IA 1MO2A 3QBJA 2RHTA 1U8EA 1L7RA 3W9UA 2D0DA 2PSFA 4ZV9A 4K6KA 3VXKA 5ESRA 1YSCA 4ZI5A 3OOSA 3QMWA 4P93A 4GECA 3BE8A 1XZCA 4J7AA 4JEIA 1EK1A 2H9YA 2RHWA 4WCVA 4B0PA 1LPNA 3UUFA 1BU8A 1EH5A 3EF3A 1B6GA 1H2XA 4TGLA 1DQZA 5CXUA 3STTA 3WK9A 1IMJA 3OG9A 1LPBB 1UKAA 1Y7HA 1ZJ5A 3D5EA 2VA9A 2C5FA 3LP5A 2HU5A 4S0XA 2XUGA 3ICVA 4X6YA 4DTCA 2BUBA 1F0PA 3WYDA 5JATA 4KAFA 4OD0A 2K2QB 2WQZA 2XUAA 1CV2A 4KRYA 4Y7DA 3BDVA 4JH0A 1N8SA 4X6XA 1KU6A 4PQEA 3VVLA 4MJ3A 1GKLA 3G8YA 4EB0A 2XUDA 3AFIA 2J4FA 1SC9A 1UKCA 4X71A 2XQIA 1JFRA 5FPQA 4UHFA 4C01A 3ESDA 2WTNA 3KWFA 1J2EA 5CH3A 1BROA 4AN0A 1GPNA 1N5RA 5HK9A 1Q84A 2YYSA 3EBLA 5DTJA 5CH5A 4FFWA 1LBTA 3VDXA 1XRMA 1MNQA 1XQWA 1DT5A 2BFNA 1XLWA 5YASA 5CXXA 3C87A 4U2DA 5K3AA 4N8DA 1Q83A 3C70A 5CT8A 4UBLA 3R3WA 4AO6A 4BE4A 4WFIA 4BAZA 4PSUA 5D6OA 1R3DA 4H7KA 4DMHA 2YXPX 1O6GA 3WIBA 5AKIA 1G42A 2WLSA 1AC5A 1CEXA 3KWJA 1UFOA 3VISA 4U2BA 3PDCA 4JNCA 3A2MA 5LYYA 3IURA 4FWBA 5HFAA 5K3DA 4U2GA 1OCEA 3S2ZA 4U2FA 3IDAA 4LXGA 3DD5A 2AJCA 5CTAA 1Q0ZA 1DX6A 1WHSA 5AKKA 5A2GA 4Q34A 3U1TA 1WCYA 1BCRA 1Z68A 3ED1A 4BC1A 5DYWA 3BXPA 2OCKA 3I2FA 2CJPA 3DOHA 4J0DA 3C5VA 4YASA 4HRXA 3SK0A 3U0VA 1AMNA 2WG1A 5FV4A 1R4ZA 5AI0A 4K5QA 3K2IA 4BC0A 5SYNA 3SX4A 3EQ9A 1P0MA 2GBFA 2VQ6A 2XMZA 1CIJA 4QDTA 1Y7IA 4BE9A 5A7FA 4I3FA 3HYSA 5LP1A 1VE7A 2PSHA 5CT5A 5JZSA 4XVCA 2XMDA 5JASA 4CG1A 1CUEA 1D07A 4FHZA 4MWTA 2QS9A 4Y2JA 4KYVA 4H7HA 2WIJA 4QDXA 2O7RA 1LPSA 4G1FA 4GDMA 1CUSA 5JAPA 1MAHA 3HRHA 1CUXA 2JIDA 4B82A 3G9XA 3H2KA 2D5LA 1XRNA 2QVBA 4B85A 4BP8A 5JAOA 5FXMA 5BOVA 1OILA 4GLBA 2QOEA 2WUGA 3ESCA 3I2HA 3C5WP 4MWSA 4OB8A 1LGYA 1CUAA 2O2IA 1QIIA 2W22A 3PI6A 5LZ4A 1VE6A 4X85A 1IVYA 2V98A 5AIBA 4X95A 1RP1A 1LPMA 1R9MA 5ALXA 1CRLA 2QR5A 2EDAA 5HK8A 4BRSA 2DCMA 2C5GA 4DSZA 4OSEA 2CZQA 5I8PA 2I03A 3IUNA 5EIHA 2HFKA 4AMYA 4DLNA 3QM1A 4C6HA 4ZWNA 5AKYA 3O4GA 2XUJA 5AM2A 1QIFA 3QPAA 3OM8A 5KREA 2C7BA 4FKBA 1L7QA 2ZVDA 4GHWA 2C0PA 2W6CX 1WB5A 1XZBA 3FCYA 1EI9A 3O95A 1B41A 3H1BA 3RLIA 4QNNA 3OURA 1QE3A 3BF7A 4GWLA 3I6MA 4O08A 5LIPA 3MUNA 3IULA 3PF9A 2DHDA 2RIPA 3DCNA 1GZ7A 2OGSA 1S8OA 4ZV7A 3C8DA 1XZKA 4OU5A 4W1QA 4U2CA 3QMMA 2XUIA 4UBKA 4F21A 2RONA 3D7RA 1BEZA 1BEEA 5HF8A 4KE6A 4BYMA 1JU4A 3WWPA 2Y6UA 1ETHA 3W2TA 2WU4A 3WYNA 5HCUA 5K3FA 4KE8A 2I3ZA 4BAGA 4I4CA 2PVSA 5BWBA 5C8XA 1U2EA 4G9GA 4CCYB 2QTBA 1HPLA 3AZPA 5CURA 3G9TA 4WY5A 3WA6A 2OLEA 1GQSA 4QA9A 4C4ZA 3A2LA 5LLSA 4DSAA 1MNAA 2HHAA 3FWHA 4OB6A 4G5XA 5AOBA 1XLUA 5T4BA 3G0IA 1ACLA 1EA5A 2CUTA 3C6YA 2VJDA 1CUZA 4EY7A 1CVLA 5EGNA 2NW6A 2QZPA 2WTMA 2XUKA 3GFFA 3YASA 2WU3A 1ODSA 2GYUA 5EIEA 3AINA 3E1GA 3G0BA 4GXNA 3N0TA 3G9UA 5CBKA 4F5ZA 5T4EA 2O2HA 5HF6A 3UMJA 3W06A 1XRRA 3B5EA 5ALHA 3WK6A 5JANA 1OXMA 1A88A 3IVMA 5AM3A 5IH7A 1YR2A 3WJ1A 4RE6A 3GZJA 1GQRA 4B81A 2GYVA 2CMFA 3FYUC 3O9MA 3D2BA 1G4HA 5ALFA 1F0NA 2VJAA 2OCIA 1FFAA 2G4LA 3IUMA 5AO9A 2WFLB 3WL5A 1W6RA 1K6EA 3WJ2A 3HI4A 2WKWA 1DU4A 4Y2VA 3A6ZA 1QIEA 3TEJA 2HM7A 2B20A 5ALNA 2XQJA 1QTRA 3T52A 5T4HA 3FLBA 2WHQA 5JALA 3DKKA 2J3QA 2QJWA 4D9JA 4EY4A 1TQHA 2O2GA 3LCRA 3QYJA 5JAUA 5LKRA 5ALDA 1UZAA 4AQDA 4FLEA 2J4CA 4UBIA 3VKFA 4H7IA 4DMCA 1E66A 2AJDA 4WFKA 3MGAA 4K6GA 2FJ0A 4L3WA 5K5EA 2JEZA 4AXBA 3I2GA 4MQMA 5KWJA 4BVJA 1TK3A 3WKCA 2WIKA 1ACJA 1K63A 4K6HA 3RKSA 4MQLA 2VT6A 2RAUA 1XROA 2H7YA 5AK6A 1R9NA 4V2IA 4ZGBA 4J03A 4FMPA 4A5SA 5EHNA 3BWXA 4C4YA 5D3KA 3L1HA 4I19A 1THGA 5CMLA 3TGLA 1TKRA 1YCDA 2QXTA 4EY8A 5AI8A 2WG2A 5JADA 1EVEA 1ZD4A 3HXKA 4CCWA 2WJ6A 4KACA 3AIKA 1DQYA 1MU0A 1T4MA 1H23A 1EX9A 3V1LA 2ZYIA 3PUIA 1ZOIA 3I1YA 2HA6A 4UBJA 4GBGA 4ROTA 1SCQA 5ALPA 2XQGA 3STWA 2HA2A 4EHBA 7YASA 5A7HA 3R40A 1XZGA 3PUHA 2HU8A 5HQ3B 2GYWA 1QFSA 4UFPA 2PU7A 5FKJA 1I6WA 5DNVA 1EXWA 3IBTA 4P08A 4H7DA 4IH9A 4G4IA 3ESBA 1VLQA 3V1KA 4UBOA 3WK8A 2G5TA 3TRDA 1GGVA 1Q0RA 3KD2A 5AI6A 3VVMA 1CUVA 3CCCA 4QEKA 5AHXA 4BBZA 3EQ8A 2WHPA 5JD5A 2UZ0A 4UHHA 1FFCA 3DQZA 2JF0A 1YAJA 2X5XA 4HRYA 2QM0A 4HXEB 3O4IA 4HZGA 1EB9A 4FLMA 1UKBA 3WIOA 3WKEA 2X76A 2BKLA 5AK5A 3FNBA 2HA3A 3HACA 2VF2A 5AJHA 3D0KA 5KWIA 3SC2A 3W9BA 3ZLVA 3VJMA 1RYYA 2HA4A 2XUHA 4DM7A 5I9IA 1QIHA 3M3DA 1IZ7A 3O4JA 3EQ7A 2ONCA 4G4GA 3CCBA 3PICA 3JWEA 5AM5A 1MX5A 3UUEA 2Z3WA 4OUKX 3AUKA 4OYLA 5ALZA 1EK2A 2OQVA 3FSGA 3WL6A 5IVHA 3I28A 2XUFA 4ITVA 3W05A 4X3CA 1XZMA 1EDDA 3GA7A 3P2MA 1HDEA 2WFZA 2WFMA 1JMYA 3ICWA 3OC0A 3OTQA 1WPXA 3ZWQA 4NMWA 1ZD5A 1XQVA 3BDIA 4AZ0A 2XMSA 4AN1A 4G9EA 1YS2X 1ZI9A 1JKMA 1U65A 4AMZA 1YS1X 4AO8A 3HLKA 4OCZA 1RWQA 5K3EA 1AUOA 1BE0A 3HEAA 2BGNA 1CPYA 4XIIA 4NZZA 1EDBA 4FDMA 3DL4A 5HFNA 3WL8A 5FLKA 2WSLA 1K4YA 4XWGA 1LNSA 4DIUA 4NS4A 1K5PA 1GKKA 1R88A 5C81A 1O6FA 1W1IA 1IZ8A 5EI5A 1QO9A 2QRUA 3DEAA 3B3QA 4WJLA 3E4DA 3QZUA 4RGYA 1BRTA 1CQWA 1IUOA 2R11A 4KE9A 1ZIXA 2QJRA 2B4KA 5C7YA 3NGMA 2QMQA 5DNWA 3RM3A 1HBJA 3V1NA 3NUZA 1JJBA 3V1MA 4K2AA 5AM0A 1H22A 3D2AA 3PE6A 4H7EA 4Y2YA 5ALLA 4Q1VA 1E3QA 1P0QA 3K6KA 4LIPD 3BF8A 1UOOA 4WDQA 1SOMA 3LIIA 3D3NA 2AJ8A 4EY5A 2ZJ7A 3LLCA 1P0IA 4FFVA 5CT9A 2OAEA 5JZ9A 3H2JA 4E11A 4HS9A 3M81A 2ROQA 5AKJA 3C45A 3R3ZA 3QPDA 1C4XA 3MVEA 1ZD2P 1A7UA 2DHEA 2WJ4A 3FCXA 2JGKA 3C6ZA 3H18A 5LKAA 5D3ZA 4B7ZA 1E8DA 1WHTA 1W75A 5JD4A 2C0QA 3PFBA 2G63A 5AKGA 4N5HX 1F8UA 4WDRA 5IVKA 4ARBA 3WWCA 4CIAA 3I2JA 3WL7A 3FYUB 3H2GA 3DYVA 4BCCA 1TIBA 1XKLA 4BVKA 2XMCA 3R3YA 2WUEA 4X90A 3X3HA 4UHEA 3SWWA 2CEKA 1FFEA 5ALGA 4W63A 1XRLA 5AIAA 3QITA 4B0OA 4J0CA 2XLBA 1QONA 5CW2A 4H18A 5FUMA 4DYHA 2B61A 5K3BA 2JGLA 1YA4A 1HL7A 1XQYA 4M0MA 1G66A 1Y37A 1CUBA 1EB8A 2DQYA 3BL8A 1UOPA 4A16A 3GROA 5T4FA 3STYA 2HRQA 5EFZA 4B80A 2DSNA 1UOQA 3WWEA 3AZQA 3V48A 1THTA 1LZLA 4UHCA 5E4YA 2H7XA 3WZMA 4RE5A 2HA5A 5AK3A 4B9AA 3ZI7A 1XZIA 2WILA 3HC7A 1AX9A 4Z49A 1VXOA 5CRIA 1BN7A 3EIOA 4JUIA 3FBWA 3T4UA 4IH4A 1JMKC 1XKTA 1MX9A 1UK7A 5ISMA 3TJMA 1M33A 5ALIA 2HDWA 2VSQA 4QDOA 1K8QA 2R8BA 4UUQA 4QWMA 1SCIA 2G5PA 4AZ3A 4Y2QA 5HF9A 3G7NA 1FFDA 5JZBA 3FSGD 4CIBA 4HTAA 3ANTA 4PF1A 1XRPA 4U2EA 3LS2A 2OXEA 3FVTA 3H2HA 3R3XA 2WUDA 5ALRA 3BIXA 4LHEA 3JYHA 4BVLA 2ZSIA 5HKAA 5A7GA 3L1IA 2HRRA 5AK4A 3DYIA 4E15A 4F60A 2VAXA 2WIFA 1PJAA 2WIDA 1C7JA 5AKXA 3V9AA 1CLEA 2BAGA 3N2ZB 4W1PA 1J06A 2XMQA 1ZIYA 2VTVA 4OPMA 4MEAA 3WA7A 4AX4A 3WZLA 3L1JA 4DMKA 3E3AA 1JJIA 2JBWA 4X93A 1AQLA 2PUHA 2PSEA 1XZDA 4Q05A 1SCKA 1YAHA 3STXA 4OU4A 2Q0XA 5ALSA 1CUGA 4X92A 4IHAA 5AOAA 4X94A 3S8YA 1ODTC 3AILA 1ISPA 3G0GA 4LKOA 2EDCA 3STVA 4IQ4A 1LZKA 2DQZA 4FOLA 2YASA 4OYYA 3BIWA 5DTIA 5EIAA 4BAUA 2GBIA 4X6UA 3ZV7A 1TCBA 2XQKA 2HADA 1X2BA 4Q3KA 4H7FA 1FSSA 1AURA 1YB6A 5ALJA 5LZ7A 5FOQA 2QUAA 3FVRA 2CBGA 1MT3A 1MX1A 3WK4A 1QIKA 1QIMA 2XI4A 2HIHA 2XQFA 5EHQA 1NU6A 1CR6A 5AOCA 1JI3A 1J07A 4BZWA 2I78A 2ZSHA 2VAVA 3WKBA 2XUOA 4CG2A 2XMBA 4E46A 3G9ZA 5ALOA 1QIGA 4J0KA 4N8SA 1VOTA 1P0PA 3I6ZA 4MYDA 3WMRA 2PL5A 2FUKA 1W4LA 5HZGA 5H3HA 2WJ3A 2GZSA 4BRZA 2E3JA 3FYTA 3IA2A 5AI4A 2OAGA 4Y2TA 3M83A 5EHZA 2PKYX 4QLAA 4X00A 4J0GA 1VKHA 4XX1A 4G8BA 3HSSA 2QXUA 4W1SA 3BJRA 1QGED 3WK7A 3KXPA 3O9VA 5HKBA 4AB1A 3E0XA 1XZEA 3KSRA 5DWDA 5K3CA 4Y2XA 2GZRA 1WPRA 1A8QA 5F4ZA 5E4TA 3VJKA 5AICA 4C88A 3D2CA 1ZGCA 1CUDA 2O7VA 4DMFA 1PFQA 1H2ZA 1DWQA 4Y2RA 1ODCA 1XZLA 3FOBA 5LZ2A 4RPCA 4PO3X 1ZI8A 4M0FA 1DWPA 5FPPA 1U4NA 1YB7A 2VJCA 1UXOA 3RARA 4X7BA 2OGTA 2ZJFA 4CCYA 1QFMA 3WKDA 4LXHA 5ALQA 5ALVA 5AKLA 3WKAA 4Q3OA 2H1IA 2BCEA 4ZRDA 2IIVA 4UHBA 4H35A 4DNQA 1XRQA 2Y6VA 4QLOA 1HQDA 5ALKA 4PW0A 2PM8A 1UT6A 1VA5A 4HXGA 1UK6A 4MYSA 2DR0A 3AJAA 5JYCA 3QMVA 2Z8XA 2EEPA 5ALMA 2LIPA 1H2WA 4BCBA 3WWDA
chains in the Genus database with same CATH superfamily
4O4HA 3TB4A 7ABPA 2MR6A 3KPWA 4HMQA 2IA5A 2IXBA 3PFKA 4HEJA 3N8HA 4WLNA 4MEJA 1XTRA 2QTAA 4JMLA 3V2UA 1ZN2A 5IANA 3ZCXA 2QVXX 5FV7A 2JHFA 3HCBA 3QBVA 2I7TA 5ILOA 2C4HA 4BQEA 1I5RA 2PO5A 4C2UA 2JD2A 1E7SA 3A4IA 2P6UA 1KC1A 3R5KA 4GMXA 1EXDA 3E1KA 1JIUA 4K9NA 1M6NA 4GZMA 5K3OA 1P81A 4HVAA 5HMMA 1Y5NA 3K6SB 5BN4A 1BGWA 1LF5A 3ZBQA 1VXRA 3WIUA 4EHLA 2IZOA 1Z6XA 3EISA 2V1XA 4HV4A 4C87A 3ZHCA 4PX2A 2NSDA 4X8LA 4ZAVA 5I7VA 1N5MA 4KRXA 2VJMA 2ZUVA 2PKWA 1DAHA 1VLLA 4FP9A 4LJ8A 2JCVA 1MLDA 4N5LA 4OATA 2O48X 4W1RA 1A0OA 2XE4A 3L0YA 4RV9A 5HKOA 4AS1A 1C0EA 3FF1A 4C0JA 5L53A 3FRHA 1NX9A 3FGOA 4AJPA 4CQMB 1AZWA 1J33A 4IHKA 1PD0A 4UUAA 2O0KA 3S1AA 4D9KA 1ZN9A 2JLVA 3B13B 3W5VA 4DIOA 2VHWA 2UYOA 4OQXA 3T5PA 1JIKA 1VPDA 2D0OB 1Y33E 1MB3A 4I6EA 1U99A 3JAWA 1ZIDA 3AETB 5EIFA 2OYRA 4E07A 2WJJA 4L6AA 4KQIA 3F2VA 2LNDA 2RCNA 2BBTA 3LDUA 3LL7A 4IEIA 3SIRA 4BP9A 2I76A 1N6LA 1VBMA 1VGVA 2B9VA 4JOCA 3ZQUA 1LX6A 2CUNA 4HQKA 2P8JA 3SE7A 4DLBA 4LF9B 3OCXA 3B8HA 3R0QA 3RKUA 1GZSA 1VKNA 3B51X 3VYUB 3W7BA 4G4SP 4REQA 1UJNA 1YA8A 4TVBA 3ZZTA 4PYRA 1L4YA 3EGWA 3MOIA 5J2TA 4ZU1X 1EK6A 5GADl 4DNFA 1A5AB 4UJ5A 1V7ZA 3E81A 4UXIA 2LCQA 1FQKA 3WHIA 1UPBA 1VGRA 1KH2A 4LGYA 1FDOA 2Y99A 3STUA 3O3OB 2WB4A 2IC5A 3I2KA 2QYSA 2Z1NA 2PKQP 5FD8A 1DBPA 1RLJA 4AIIA 5HRAA 3QTLA 1Z73A 4O4JB 3PFCA 4HOYA 3Q8MA 1UODA 1F8XA 1OOEA 2EZ4A 3DE3X 2WFAA 3DE7X 4BEWA 1NC1A 2WIAA 5HKKD 5HZMA 4GX2A 1AH2A 1MG0A 1T4GA 2HDOA 1WMDA 5AUNB 4W5NA 5A4FS 2CD7A 4QJ5A 1Y63A 2G06A 3ELYA 4HGQA 4QPCA 5GINE 2I4IA 2Q6OA 1I3MA 1AS3A 2FPUA 1YASA 2ES4A 2H2IA 2V7EA 4IIHA 5K3FB 3H0CA 4NQRA 2Z9BA 3H4IA 2GCPA 1JJFA 2PL3A 1OYYA 2Q3FA 2X40A 3F5FA 5EEHA 3U1VA 4BFUA 1CZOA 3RASA 1SGWA 1QIDA 3LHIA 3RNOA 5KJEA 4DDMA 5JXWA 2WKSA 1VLMA 2H5LA 4U7DA 2P6MA 2YBEA 1H4TA 4D0NA 2JGDB 2OO3A 2OV8A 1O03A 1RLMA 3Q9NA 1V5FA 4XIYA 4BQRA 4EDFA 3HRKA 1S89A 4N0PA 4CN8A 3CH4B 5ECDA 1YHYA 3OIGA 4DYVA 1VJTA 4H77A 2WHRA 4BTLA 3ICCA 4IIJF 1BXGB 2FHPA 4CQLB 1OAAA 1QQTA 3IQDB 3WTCA 3Q8WA 1A8SA 1L7BA 2ZTUA 5B3KA 3GEEA 2P77A 1TU3A 3CCFA 1HNXB 1GXSA 4NJEB 5DM70 1EHCA 2JA2A 2M2IA 4G01B 2QPAA 3QY0A 3O0DA 2CLLB 2WUVA 2E4WA 5HJ7A 3WJAA 1HM5A 1EP3B 4LZNA 5ALWA 5HCNA 3IGFA 4UDOA 2J33A 4LDZA 2OSVA 3DT6A 4RGVA 4BFSA 2Z9DA 4I1UA 4DPLA 1VZ3A 2RBEA 4CM5A 3H5AA 1QR6A 3WOHA 1JVSA 3QU5A 4UZFA 4EH1A 1PLKA 4XUCA 1OR8A 3ZGLA 1IWPB 2Q99A 3NWOA 4LGVA 3WQHA 4JB0A 4Q3EA 5DULA 3D64A 3THXB 3IH5A 3VO1A 2W6MA 3KYJB 2B4TO 1YRYE 2FFBA 2OCGA 3IO3A 4MVJF 3OE7A 4PNPA 5ALEA 4JSYA 2IPMA 1AF4A 1T8YA 3FFWA 3BCSA 3F8SA 3UJAA 4B45A 4F0JA 3K71B 1FJ2A 3NJ8A 2V3CC 1L6IA 2JEYA 1MAAA 1NR1A 3HXPA 1QO7A 2GZHA 2RJOA 3CWQA 4ZCPA 2PS1A 5C7OO 2IXEA 4BKQA 4TXNA 1WKBA 5ETJA 4EFNA 5EKUA 4LEIA 3T54A 2CKDA 4GRIA 1LBSA 3PKIA 3U4CA 2KPOA 4LYDA 5ES4B 1A9SA 4U02A 4QM7A 3WLJA 3R0VA 3ZW8A 3L3BA 1DC8A 2Y2UA 1H5UA 1PUIA 4ZEOA 4W9RA 4EUEA 3RSQA 5AVWA 1ZMBA 2G9ZA 4LA4A 3ZWBA 2UUPA 4HGYA 1B6TA 5HWSA 3KQSA 1TTHA 4ECAA 1Y1QA 3NHJA 5K0ZA 2OHJA 3L8EA 2OC9A 2IDMA 4N03A 1E1RD 3WISA 1OFHA 4HVLA 4KUGA 4DTIA 3F6CA 3PXGA 3B70A 3OKAA 2Z8ZA 4F2PA 3MA0A 3RQIA 2GRJA 3QVGA 2PU5A 4OQEA 2PUAA 5E7MA 3PNMA 3EGDB 4IJUA 3PNLA 5MHTA 4X1KA 5T3UA 3FYDA 2CL0X 1KI2A 3QXJA 3IV9A 5J58A 2FWMX 4YMIA 3NIWA 4RTRA 1USWA 1SBIA 2VAWA 2ZJ6A 3PIIA 3DKIA 4HJXA 4WV3A 2MR5A 4MYHA 5ALUA 3MLBA 4MIOA 2O8BB 1HFWA 2DC1A 2QUJA 4OB7A 2HA0A 3T9BA 2Z98A 3WY9A 1UPTA 4J1SA 3WK5A 1URPA 2VDQB 2BM1A 3IILA 3ELDA 5IYZF 5LLDA 1G38A 3T5DA 2AE2A 1UEIA 2XOKD 3IIIA 1X70A 2YVLA 3K70C 2XMRA 3NHBA 1OTXA 3WGMA 5THQA 3CYFA 3O94A 4EBBA 4O59O 5CAEA 3I4CA 2CJWB 3GGJA 3KZCA 2JKVA 4LJLA 3NGLA 4Q3LA 5LOVB 4DKJA 3L79A 5FLYA 4QXRA 1R0SA 4MCAA 3TOXA 3GARA 2BTOA 1Z4OA 2GWRA 2Q9AA 3PEUA 3K5WA 3WAJA 2CL6X 4BMYA 3CJRA 2HU7A 2GOYA 3MXOA 1D8TA 1X1CA 4HWOA 2NUAA 1RRFA 3CBQA 3HN2A 4ES6A 1QHEA 2CJYA 2GVZC 1DINA 2AMLA 3BICA 3FETA 4H9GA 4IDOA 2W8ZA 3BB4A 3N7AA 5BSEA 5EE9A 4U0JA 4B3DA 3GNSA 4L76A 3PXAA 2H7CA 4ETIA 5FA6A 4ND7A 1KYVA 2AG8A 2ZPUA 4XSGA 2VDWB 3GPBA 1RRCA 1CHDA 1HI9A 1JYSA 3KQYA 5LWQA 1JFSA 1UT8A 3GJ5A 3LUHA 4FEGA 4NEQA 1AV6A 4AC9A 3OFND 1Y9AA 4DUZB 1QOQB 5DJ5A 2EHDA 4E7OA 1GEEA 2DUMA 2PX6A 3AIOA 3CBGA 1R0XA 4IEEA 3I5UA 5FWAA 5BPHA 2X41A 1NT4A 2WKPA 2VQ3A 5KOJA 1L5HA 4AU1A 3JQGB 1JQLB 1GKIA 4GP9A 3DGFC 4HEA1 2A9RA 1T3TA 2BMAA 1GA4A 5AP9A 1L7AA 1O97D 1DC5A 3O8RA 4JL6A 4GQBA 4Q9KA 1KYQA 1KI9A 1HFKA 1QH0A 1ZFNA 4Z86A 4D56A 1E61A 2GF2A 3MMZA 3QH4A 5FRDA 3LF2A 3PYMA 1SOUA 2AK3A 3EWIA 3W0LB 2NU9B 5KNLA 2VDOB 4FMCF 4YBZA 3PL5A 4F3TA 3F97A 5IWCA 2V7GA 3FDZB 2P65A 3HN6A 4E22A 2PZMA 4IRXA 4GXQA 5KWSA 4JN6B 1Z0FA 2ZTLA 4IINA 3MSCA 1JGTA 2BSAA 3M6LA 4MRRA 3GZNA 3GLIE 4M0EA 4A4DA 5D01A 3TUIC 4V39A 5IDVA 3QVTA 1PQUA 2V54A 1E1CB 3E4CA 4QOGA 3DPSA 4CG3A 4CR7A 1JDNA 5AI9A 4D8WA 1TADA 3IXMA 4DNOA 3RK4A 1IN8A 3NQ41 3KKZA 1PS9A 2H11A 3UJPA 2XRYA 4RTQA 5FB3A 1JAXA 3ZLTA 4MKRA 1S9HA 2FCAA 2PUDA 2JAHA 1T43A 3LWZA 2NTYC 4ITUA 2ZI3A 1SVOA 1RM0A 1N5IA 3AF2A 1KBZA 1WXQA 4BDTA 1LDEA 2NYRA 2HK8A 3C8HA 4II7A 5KQGA 1B3RA 3OWXA 1MB9A 1S96A 4MO9A 5KHLB 4GOKA 1MJFA 1EAMA 4DBLE 1YJQA 3PE3A 3RK0A 5C8DA 2N47A 3A3YA 2GJ9A 3IVCA 5SYMA 4WN9A 4QSHA 4BCDA 4AJKA 4MIKA 4AG6A 4HWRA 2X4DA 5JARA 4Q9IA 1T9ZA 2GX6A 2POQX 1NMEA 5BT8A 1U7DA 1W88A 1E8NA 3IB3A 4B3SB 1ZGBA 3T3DA 4B84A 2W42A 1C3JA 3PDWA 1U8TA 1K27A 5A4AA 5CYGA 2AI1A 4HR7A 3KXDA 4D4LA 4E32A 4MRAA 1HYBA 5L7TA 1S1MA 4DBVO 1XDDA 4LY9A 2BL4A 1M2OB 3LX4A 5IAKA 5G40A 3H19A 3W7VA 2KMLA 2HSZA 3KR2A 1E6WA 3ND6A 4TWAA 3RVSA 4Z4FA 1LDNA 3K6SA 3LBFA 1V96A 1KEEB 1E1NA 2N46A 2PVPA 1HDIA 2B7LA 2IXFA 2O2CA 2ORWA 3GOQA 4R1UA 3U19A 3PGKA 5NULA 1R12A 4LV5B 3K4QA 4BNNA 1T1IA 2G72A 4K03A 2IPAB 2WAYA 4GIBA 5TGTA 4W5RA 3W04A 1T5IA 4LECA 4QHYA 2QL5A 3WLIA 5JXIA 1K3TA 3IUJA 1K9SA 1QHGA 2H3EA 2A7QA 3D8NA 3IOCA 4UVGA 4LPKA 4ZQFA 1K88A 3RLFA 4K87A 3NTQA 4L4UA 5EPUA 5ICFA 5HUQA 5AJTA 2DR2A 4PQGA 2WSIA 4PTLA 4QDZA 1DEHA 3V34A 4OBXA 1J4AA 4F11A 2IHNA 1UJ2A 1MJ5A 1GJRA 3CT4A 4Y2SA 2GF9A 2VDJA 2JANA 5LQSA 2L0XA 3B7GA 4AWXA 4B83A 5J4KA 4FQ5A 4R69A 1LD3A 1JEQA 4M83A 1OLOA 3VI4B 3R0JA 2GUGA 3KVOA 5COQA 4FT4A 4UEKA 3GBSA 4UBNA 1ABBA 2BD0A 3OY7A 3JZIA 1Z4NA 1E5QA 1MB2A 2A8YA 4W7IA 1E94E 3V8PA 2ZTSA 3PHJA 5K0CA 1Q7BA 5EQFA 4PRYA 4DT1A 1N6PA 1DLJA 3KDAA 4GI1A 4IFEA 2WE8A 4DW8A 5JO0A 2Z04A 3ORQA 1LXCA 4EQ6A 3AY0A 5GV7A 4CR8A 1GDHA 3IQEA 1GPLA 2O5EA 1QOPB 4DABA 1AHPA 2XB2A 3GJRA 1W47A 4GMGA 1HF3A 1GPH1 5DOZA 1PDVA 4XI9A 2PV7A 3WWYA 2P3SA 4EL5A 1X87A 1DBRA 1XCMA 2ZWMA 1W76A 2OKCA 4P8RA 1KJWA 1AK1A 4BN0A 3MRVA 2UKDA 3OOWA 4Q4HA 3V8BA 5C8ZA 2B5VA 1RYDA 3BWCA 3CKMA 5JNTA 3T99A 4DLPA 3DTYA 3QPVA 5TEWA 2C9CA 1QYVA 1TRKA 4UU7A 4A1OA 2FW1A 3GGDA 3FYHA 1KP9A 2C58A 3O7MA 2YICA 1UQUA 3OLXA 4LXXA 3UMFA 4UM9B 1IRXA 3ZI0A 1WXWA 4YAEA 4CN9A 3SSNA 2ZB4A 5C5CA 1IMOA 2GD0A 3DKRA 4LCBA 4ZI7A 4A6XA 3A9UA 1P0CA 3R09A 4R3WA 1NLYA 1SC6A 4RH0A 3OTOB 2WINI 3OOYA 3Q4GA 3BQMB 1NDHA 1VZ2A 3OZAA 1B74A 5H4GA 1GWNA 2BMDA 3KUXA 4O2BB 1P6QA 2O7SA 4NATA 3DLTA 3H9JA 3N7UA 3UUWA 1WXFA 2WYIA 4S1TA 1EHYA 1UQTA 3AI2A 3HZOA 3SLRA 4MLDA 3TLMA 1V3UA 3VPFA 3ZCTA 5SZJA 3SI7A 1NLMA 2UVDA 3RYFB 4DFDA 4EW1A 1KYWA 4EA6A 1WSBA 4DRZA 3BRSA 3R6TA 1OX5A 4KN5A 1DMSA 4KLRA 3T9CA 4KO3S 1YT5A 2C97A 4HDAA 5IMSA 1VLZA 2R1TB 1TTPB 3P9XA 4M0PA 5JQWA 1Y6JA 2FOLA 3BL5A 5DCUA 3H75A 1KGSA 5AXAA 3GFRA 4FHFA 1CBUA 1HLGA 4CUZA 5BNFA 2BMVA 4D3FA 4JENA 3DTVB 3HUTA 3LLUA 4UPDA 3IAFA 4YCJA 3IQGX 2J5BA 8OHMA 2UZ4A 1DO0A 4PWYA 2NO0A 4JODA 2BH9A 4TL8A 2CYAA 2PT5A 3FYUA 5F2NA 1DWOA 2G7ZA 2XA1A 4C7OA 2AKAB 4N48A 3I5MA 4RHYA 3GBPA 4KR0A 1IAVA 4P0QB 1O54A 4XIJA 4IUCS 4XPIA 4ZAFA 1SQ5A 2BMWA 3VO9A 1DXYA 4ZIRA 2E6KA 4H6XA 5B58C 4BGDA 3T3EA 2G40A 2VOEA 1R6TA 4MI6A 3U3DA 2BEVA 4AZ0B 1LBQA 4PFKA 4BX3A 1KSHA 1U7HA 2EFJA 3A28A 3FTCA 4QUIA 5EJMA 5FAXA 4YWJA 2EKZA 1JSCA 3ELBA 3ADCA 4F4IA 3ZVNA 4O4IF 1CWUA 2VCYA 4FLFA 2PBLA 5HE8A 3FCUB 3TTYA 3Q6IA 5K6AA 1G7RA 1UWCA 4CKCA 3O2JA 3U49A 2Z2KA 1X2EA 3Q6NA 4IR7A 1MORA 1CUJA 1YS6A 5TVGA 4DCGA 5JZOA 2OHXA 1RI5A 2CXHA 2FJUA 3NR2A 3TW8B 1M1NA 3IB6A 1BMTA 4G9BA 2J6HA 2WJGA 3LY7A 3PWTA 4OOFA 1RMYA 2VATA 4QO7A 1XGKA 3THRA 4AECA 2PEZA 1BNCA 4G24A 4RQUA 1W4AA 4XD2A 5A06A 2A5FA 5CCBA 2FNAA 1VB5A 2JLCA 2OQ2A 3IR7A 2V3WA 4M86A 5BY2A 1BCRB 1V47A 1JJ7A 4ZALA 3DMYA 3K32A 2MINA 1DO8A 2GCNA 3O93A 3LW8A 1P8JA 5FL3A 3V55A 4C3UA 5J59A 1Y1RA 4GVPA 1GTL1 4Q3NA 1TCVA 3D4PA 2R6AA 5A5VA 3WLLA 1P39A 2O2JA 5E4JA 1SBNE 1PUXA 2XNHA 4LZZA 1D5WA 4TMYA 3SS7X 2XCTB 4MPJA 4PYOA 4P84A 4EYGA 4KVAA 1XFDA 2HRZA 4G89A 3PKJA 5HYVA 3V6LA 2WQ7A 2ZYHA 5LM3A 1SHTX 1A9RA 1JEEA 5JFGA 4P3XA 1QQ5A 3ZDZB 2C5BA 3AY6A 2JG3A 2EU8A 2CVZA 4IO0A 5KQMA 4KBGA 2G9UA 1X80B 1L8QA 3CNLA 4TT3A 3R7NA 3BJMA 1WUKS 1J24A 4HCJA 2VQEB 1XDWA 2M6KA 1UPXA 3RIHA 1A82A 4HDRB 3CVJA 4X63A 5C0OE 1EM8A 4E70A 1TM5E 2DGDA 1H3EA 2X19A 1IZZA 2AC2A 3M82A 3UK0A 2H4WA 4AKTA 4C3ZA 2PBZA 5KEIA 4MHTA 1JH8A 1VI5A 3S2IA 4LXIA 5JSZB 3G2KA 4R1LA 5DB4A 5CB8A 5JT1A 3ET5A 4YCDA 2I6XA 5AH0A 1Y9DA 1JALA 2MIIA 2Q5OA 4E4TA 4C89A 1E6KA 2QEQA 3KLOA 1M5RA 1QPBA 1CUFA 3CEMA 4IHQA 2R6R1 1TW3A 1PT8A 2F3TA 4LJ7A 3T7TA 4D0RA 2GTHA 3QBJA 4MV8A 10MHA 2I29A 4KIFA 1T9DA 4WZBB 5CB6A 1EJ2A 2A5GA 2CXSA 5KVSA 4CEHB 1SUDA 3HCCA 3FDFA 2F43A 2D0DA 2PSFA 4ZV9A 2V4MA 3RFUA 1JHRA 1GGKA 1KJJA 3LUCA 1E79D 4N3CA 2WF9A 1Z3IX 2ONYA 3G23A 1LLDA 3NCTA 1YSCA 5I4KA 3QXSA 3ODGA 3V1YA 3PXDA 3NM4A 3QRWA 1E77A 2HXYA 1FP1D 2NM0A 2YZKA 4WOCA 1OA1A 1XMJA 5KI6A 1XZCA 2ZT7A 4JEIA 2OP0A 3GLUA 2QR3A 2E2WA 3T34A 3OPYB 3MHTA 2JCXA 5DX1A 2ZRJA 1FJHA 3OF3A 1LSSA 1H85A 1P8AA 3KM0A 4NBUA 3AUXA 3FOWA 4B33A 4ANFA 4XYMA 1K7SN 4P2GA 2YS7A 5BV8A 1UF9A 1HO3A 2FEMA 1VSVA 2IZ5A 2WDPA 3S2SA 1BEUB 3IEKA 3SOZA 5CDTA 2ZBUA 2BMEA 4J49A 2BTQA 4L5IA 5FBRB 4G0WA 5EUBA 1G60A 3UGJA 2VJYA 2KLHA 1H2XA 1XTJA 3HGMA 4QREA 2RGNC 2Z2XA 4NULA 2D4HA 2Y1LA 4QYTA 4TGLA 4V0ME 3U44A 3STTA 1S4QA 2D1QA 5JSHA 3K09A 1CS0A 3NHPA 1RWVA 2A9PA 2W48A 3PNYA 4L3VA 1WTCA 1RFLA 4L4SA 3HKEA 4JLBA 4MJ7A 1SELA 4YRNA 2C78A 1IY0A 2HCTA 3G1TA 4FFOA 1ZJ5A 4PVDA 3D5EA 4Y6RA 4CIWA 2BCJQ 3DPUA 4B75A 1SUPA 2C5FA 4KO2S 2P9BA 5TQ2B 4BFCA 2HU5A 1N2XA 2CDAA 5ERYA 1PW7A 3NLLA 1WZ2A 3AM1A 3PXXA 2BUBA 2J09A 1C9DB 1LJ8A 5CLIA 3R44A 2WABA 1KJ8A 3H86A 5DI3A 1QGDA 4RF4A 2ACWA 2EFDB 4J1TA 4MUKA 2JFVA 2X0IA 2E4YA 2G28A 2XUAA 2VWHA 3QKUA 4DCCA 1CV2A 5A9SA 2FUEA 1V16B 2RBKA 3U7QA 5CDGA 1JKIA 3DMDA 4KQKA 5BORA 4DA8A 3L4BC 2G09A 4RD3A 3JVEA 3PU6A 1W94A 4L2IA 1A27A 2O3UA 4OFZA 4V0QA 4AJJA 1A1SA 2L42A 2WPDD 3IDQA 3VU8A 1YC2A 3DBVO 1NXQA 4G0UA 2Q3HA 1GKLA 3N2IA 2XGJA 5JH7B 1Y5RA 2LE0A 2FAXA 3PKZA 5DRYA 3SLKA 3RYCA 2HF8A 4HZUB 5AMXA 5T3YA 3TGWA 3EXHA 3WL4A 2ZDQA 1YVEI 2H0QA 3DZDA 3H5VA 4RZXA 4Q1AA 5MN6A 4LY6A 1EKXA 1L1QA 2HNKA 3K8OE 3S2FA 5J43A 3SS9X 1PI3A 1WR8A 1JECA 4C22A 5TIIA 2OCAA 2W11A 1JFRA 1VI2A 5ITZB 1H2RS 3BXZA 4IUBS 1DQNA 4UHFA 2W2KB 4IVPA 4ZOEA 4BECA 4EG7A 3E84A 1SCUA 3K0KA 1Z29A 2KHZA 2RGGA 3KWFA 3EC1A 4GD3Q 5LP6B 3FYSA 3ZCSA 5DU2A 5EXPA 1BDMA 1QQAA 2HLDA 5FR1A 3I04A 4FYPA 2EOAA 4MR9A 1GPNA 3E8SA 3AHCA 4BVEA 1DAFA 1COWA 4K81B 3V1UA 1EWTA 1N5DA 5JISA 2IYEA 1WXGA 2GFIA 1OFIA 5DTJA 2HW8A 1IN5A 4RVDA 4ALJA 1YIAA 4X1YB 3N0XA 2HPHA 3NKFA 3PEVA 3B5IA 1G55A 1Y8RA 3HJGA 4KG7A 4MK4A 1XLWA 4M7WA 4YTEA 3TLGA 5AJUA 5YASA 3AF5A 5E0KB 2R8OA 5L3SB 3T7SA 4I1VA 5BO5A 3WDSA 3L4EA 5CLJA 3F3SA 3B3GA 1HT3A 3ZE6A 1YR1A 4EGCB 1B73A 4HL6A 1TW2A 1YQTA 1Y4AE 4PLVA 1QC5A 2D0IA 1J2TA 3INTA 5FJIA 3Q1KA 3QEMB 6LDHA 1DCMA 2EJCA 2Z2JA 1RHQA 3R3WA 4JYCA 4MVJM 5C35A 4KFUA 4KL8S 2CZCA 2GN8A 1YQXA 3ZDRA 3QFRA 1XMXA 1KHHA 2YJ5A 3P9ZA 2P2DA 1R3DA 2IF2A 1B1AA 1II0A 4RAQA 3WMWA 5EMNA 4P53A 4ZT6A 4DMHA 1NQAO 3FPSA 4JT2A 4RY8A 4WUVA 4DEVA 5I9LA 2BDUA 3HB0A 1FSZA 3RTDA 2FMFA 4EKYA 1H1LA 4HS4A 2CZGA 4MPTA 4TV8B 3CF4A 1AC5A 1ZR4A 5LCXA 4XSVA 3VISA 3WGJA 4U2BA 4OGGA 1K8XB 5HKLA 4MV4A 3PDHA 5LYYA 3SZGA 1W19A 4H1VA 4RD6A 2Q28A 1Z34A 1PDWA 1Y98A 1JN0A 2G8LA 4U2GA 4CM6A 4QOSA 4F5YA 3S2ZA 4ED9A 1O89A 2ZR9A 4P5DA 1YC5A 3V8MA 1IXRC 1U4OA 2I2FA 2Q1TA 2TRSB 3BKWA 3FPBA 4WQMA 3WGQA 1CFZA 4B73A 5BUQA 4RTKA 1L4BA 1QGUA 4CEIB 3L7DA 4IDFA 1TB4A 1GA1A 5EA2A 4LXGA 4I66A 3K73O 2P79A 1VG0B 4A0QA 1F38A 1PJ2A 5BMVB 2JJYA 1I01A 2QENA 3MJCA 4Q93A 5CTAA 5E1BA 2WTUA 4W8HA 1WHSA 2OOSA 5FPSA 4ZHQA 3ETCA 2PTHA 4HH3C 1E3JA 3B1WA 2HPAA 3OQ6A 1WF6A 3T5MA 1K6XA 3O8NA 3OA0A 1AKVA 3AUUA 3BJZA 4F6RB 3IJPA 3LYLA 4NYMQ 3JAMA 5DPMA 5HDBB 4N39A 4BNGA 4NV1A 1D9XA 2NWQA 2F1KA 2QLLA 4XOUA 2V6IA 3BXPA 3M8KA 5DYWA 1NW6A 3ITEA 4XEHA 1JQ3A 4OQYA 2IHYA 3I2FA 3IDZA 5F2KA 5BSVA 3VKGA 3DOHA 4J0DA 3RT9A 4RL4A 4HRXA 3SICE 2YMPA 3NANA 5TX7A 4F86A 3OJWA 3SK0A 5G41A 3P26A 1TPZA 1RYNA 2X9LA 4NCXA 3PTLA 5CVUA 5FV4A 1DXOA 3EY9A 3L7BA 2HDHA 2HK7A 3QF4A 4BX8A 4YS6A 3EUEA 4GVXA 5CW1A 3QKTA 4LUCA 5KYUA 2VP0A 1ETUA 4C30A 1U3WA 2HBZA 1T9AA 5H83A 3PRHA 4NH0A 2EKLA 1XD9A 2VHTA 1TJ5A 3D02A 3LC2O 1CIJA 1RQNA 3CKYA 3TVTA 5A7FA 4Q6WA 2IU3A 3OCYA 5HTOA 5CNKA 2DPXA 1MO6A 5CT5A 3A37A 1RDFA 5LQCA 1DRKA 2CV2A 4D96A 5CBPB 3A9CA 2WDZA 2OZKA 1L5ZA 3JQ8A 2J4DA 4FT2A 4MWGA 4TLLB 3SBXA 5FUQA 1QP8A 2AVDA 2XMDA 3OPVA 1YQ9A 1NBAA 1ODFA 3MFYA 4JBXA 2O8FA 1TGYA 1BVHA 2QRPA 2P67A 1F3LA 2AFHA 3GJ0A 2CMKA 4FHZA 1RS0A 2DTEA 1M2VB 2R8YA 2P2SA 5FFNA 5ITVA 3OX2A 2HHLA 4TV9B 2NQ8A 4PYJA 5C18A 4ND5A 1T6XA 2WNHA 1SQ0A 2PLFA 2FFJA 1THZA 5ES3A 2ZULA 1YZNA 2DBQA 4EA8A 2QS9A 4HXYA 4Q5IA 4D9NA 1P19A 2J0SA 1C8BA 1IVNA 4HAVA 4H7HA 4NE2A 2IYTA 1KWKA 4X60A 1E58A 1EQ2A 3L0SA 4XD7D 3TZHA 3DH0A 2O7RA 4ND8A 2P2CA 3NYQA 4DIEA 1XTQA 4GDMA 4UU0A 1SC4A 3BIFA 2EVWX 3MS7A 3ZR4B 4KH1A 5KX5B 2FWJA 5JAPA 3B3JA 3E9QA 1X7WA 2QX8A 3I3OA 3RF6A 1RC8A 1Q57A 1QDEA 2BGTA 1KQFA 1CUXA 4E30A 1QV9A 2EGHA 3FD8A 4JWKA 3IP8A 3WGIA 4M9ZA 1AN0A 3NTXA 4Q4DA 2HXGA 2VT2A 1IH8A 1XRNA 3BFVA 4LW8A 3DUFA 2ZANA 3AV0B 2VSXA 4FZ5A 4UD2A 4R05A 5JAOA 3RVRA 1VCHA 4NPAA 3AQ4A 4PM4A 2GXUA 5DIFA 3R5XA 1P5ZB 5BOVA 1GTSA 3E8MA 3NASA 3D4OA 2BLLA 2NVUA 4ARUA 1YS7A 4G0YA 3ESCA 3I2HA 3LHKA 1MQSA 4K9RA 3LXXA 3U3XA 3DAHA 4TYMA 4DR6B 2IYVA 2RGXA 3B1KA 1G3QA 4MWSA 1PFKA 3MRTA 3GWGA 5C1PA 2P41A 4JY7A 1G6KA 3IBGA 1CD5A 2WZCA 4F2GA 1Z2EA 1E4EB 3PQ5A 3OQ1A 5HTKA 1X1RA 2PA3A 3QUSA 3T38A 3Q8KA 1NPTO 1VE6A 1IG0A 5CA0A 4HT3B 1KZ7B 5K45A 2P90A 3GJZA 1IVYA 2ZRMA 2V98A 2MOKA 3LUKA 1KERA 2PUCA 2B2CA 1RP1A 3A4YA 1LPMA 2P4UA 5KJ1A 2BISA 2QU7A 1IBLB 4MWZA 4H7PA 1I2AA 1NZFA 2VG8A 4MLZA 4DCPA 2JI4A 4R1SA 1K8ZB 5DT2A 1XC7A 3CR3C 3W4JA 3HG7A 2EDAA 3CF0A 4AKEA 4CVNA 2PUBA 2IP4A 1C41A 1KIFA 3B3AA 1R66A 2QE7D 1MDFA 4P6VF 4BRSA 3DL2A 2PWBA 2C5GA 4H3SA 1E9EA 3I9V6 4OSEA 2CZQA 4JUAA 5I8PA 1KP2A 4WBNF 3IUNA 1DRUA 3A1VA 1I1QB 3DTNA 2HFKA 3QMPA 4WK6A 4ZVMA 5FL7D 1TO6A 3LXUX 4DLNA 1ZR2A 4A0HA 3OTIA 3UMGA 2D7CA 4RD1A 4YAKA 1LS6A 1ZCJA 2LWIA 1IQ0A 3FR8A 4C6HA 4ZOQI 4QULA 2OHVA 4Z7NB 3O4GA 5EWJB 4JI3B 1QIFA 3IVXA 1I3KA 3SGLA 3F7OA 3MJRA 2AN9A 3QPAA 4IGIA 4J6EA 1DEKA 2C7BA 2PD4A 4O1HA 3WFZA 5I45A 5U4XA 2C0PA 2IDKA 2W6CX 1EUQA 3DR3A 3KG2A 2PRZA 4KN8A 1SUBA 2A92A 2GCOB 4IM7A 1XN1A 4BNHA 2FU5C 4O4LA 1PWYE 3L9XA 1B4DA 1MQ9A 3O95A 4JYBA 4P5PA 5CLHA 2BGJA 1QXSA 1ZAYA 1C9EA 1V7PC 2FHSA 1HNZB 1QE3A 4IIGA 1EUCA 2WJHA 3F4LA 3FTEA 4GWLA 1SG6A 3BXXA 1TQ8A 2DBRA 1KJZA 1ZH4A 4WVLA 3GG9A 1JIVA 2H4JA 1IONA 4MCIA 4BQNA 2CNWA 3PB3A 4ML3A 1F2TA 1S1CA 3IAUA 4G86A 2FUG1 4X7PA 4HLNA 1L7PA 1H9BA 2XA9A 3DCNA 4LK2A 5JCOC 1TCUA 4CMGA 3FSRA 2DJIA 3P0RA 4L08A 4LC0A 4YJDA 3IJEB 3Q3HA 4ZT2A 4CM8A 1EJ6A 4TRNA 2QV7A 1GZ7A 5HZKA 3M5CA 2IPLA 5FWNA 1P61B 4J4BA 4KXQA 3RK1A 5KREA 1JBEA 1QGOA 4GKVA 3ZXUB 4F21A 5EIOA 2I9PA 4C0BA 3O8QB 4JBWA 1FNMA 1MOZA 3ZHRA 1U11A 3OZGA 3QVSA 4LF4B 1C1XB 2QD4A 1WV0A 4QU0A 3ZQKA 2UYCA 1UXKA 3MQFA 1I2BA 1V3TA 2HK6A 1H4VB 4PS0A 2CV0A 3HWX1 2PCLA 3AKDA 2PX8A 3FCOA 3K72B 3OJ0A 1YDHA 1DC3A 2I6TA 3U40A 1P7WA 3L05A 3I6IA 3C3XA 4JQCA 4MV0A 1T1EA 3QLUA 2OB2A 3WWPA 2WJZB 5BSWA 3BGDA 2Q21A 3TW6A 4ZU3A 4DUPA 1KWGA 2VKQA 1OLSA 3LRTA 3OQIA 2H2FA 1L5GB 1TZCA 3AU8A 3W2TA 2A9QA 5GAJA 5KYWA 3AQIA 2G04A 3D4BA 3I09A 3QUAA 4JR2A 5CR9A 1T6ZA 2EFHB 4WEQA 4D6XA 5B36A 2IIPA 4JT8A 1Q0UA 4BAGA 5J4YA 5JVDF 1UDXA 1BG6A 1OFGA 2DAPA 4I4CA 5GOTA 4A8JB 3WMXA 3ZE0B 3AO0B 5C8XA 1I1OA 2BFAA 4CCYB 3M4ZA 1D2MA 2I2CA 5ECWA 5K8CA 2A1IA 1VL0A 4RZQA 3V5NA 3G9TA 4M9QA 2GKOA 2UXCB 1E5LA 3M9XA 2WTBA 3OP1A 1C7ZA 1GQSA 4EI2A 3WFJA 2FDCA 1OT5A 1GSIA 4MTCA 1LB1B 2QRKA 4GZLA 5LLSA 3UGKA 3WYBA 3ROKA 4DSAA 1NOJA 2Q6LA 1RKXA 3FWHA 2PXAA 4PAMA 5KDDA 1I36A 1HOTA 2AN4A 3CLRC 4ZKEA 4HNAB 2QTLA 4I50B 4IL5A 1YFZA 3VR4A 3OJOA 5BWOA 3TL6A 3RG8A 2ZWVA 4LF5B 2H4HA 2Q41A 4EJ6A 4LXYA 2YOHA 2Y4NA 1RZRA 4NYJQ 4RJJA 1QWSA 1NMSA 2O14A 3D43A 4KO1S 3Q7SA 4ZP1A 2R0QC 1KRXA 5CDYA 4IV0A 2QX6A 5A3RA 4WACA 1CVLA 2HX1A 4B3HA 1ZCBA 5C5IA 1I6LA 1DPGA 1QAQA 2WTMA 2XUKA 3ADOA 4FFMA 1MJHA 3RW9A 2VUHB 3WLSA 5A1TA 1DMRA 1D1SA 1ZLXA 1LA2A 2WU3A 1ZDMA 121PA 1K2WA 2ZSAA 3VU1A 5LMNB 5EIEA 4BBPA 1NV9A 1JLKA 5LQDA 3UH1A 3ILXA 4JLWA 2DOKA 4PTYA 3JATA 3QPBA 4O4HB 2R8PA 4GXNA 4LX0A 1MXFA 3G9UA 3RIEA 3QEOA 1KFJB 5T4EA 4LXQA 3TD9A 4F5ZA 3MWLA 1GADO 5HF6A 4DAEA 2GSDA 3OIVA 2GILA 2VUUA 3W7AA 1RM3A 4R2MA 2PNJA 3W06A 3T5GA 3K1AB 1AQJA 3KU1A 4HB0A 4RAOA 3AVYA 4XWOA 5JANA 5BRNA 4QM6A 1I0ZA 5E7QA 1DQPA 1BXRB 2FUNB 3AWIA 4WY2A 5AM3A 2YV5A 4GPD1 3GGGA 3X44A 1MUUA 4KBFA 4KFRA 4ZOAA 5BN4B 1M73E 2WW8A 5DFAA 4B6RA 3GZJA 1HDXA 3G8AA 1MF7A 1ZNZA 4RK5A 5AOVA 3O9MA 1GQOA 3U3KA 2G1UA 5BYAA 4IHJB 2BDTA 2EG5A 3LDHA 2VJMB 4YP5A 1F0NA 2VJAA 3B1ZA 2ZLBA 1RPAA 4G0XA 4A2QA 4UE6A 1GRCA 1U9CA 2CB0A 4EMBA 3DUWA 1FFAA 5F2OA 5K09A 1Z07A 3G1WA 4H6PA 2OM6A 4LAFA 2VYNA 3R7AA 4V0RA 5AO9A 5DX0A 1XZNA 4B40A 3TLKA 1NVUQ 3UJ7A 3AVQA 2QPTA 3D8BA 3AJ8A 4RLQA 3S99A 3LPNA 3V4OA 1KNXA 3Q7RA 4FDLA 2G5CA 4PX3A 1GCOA 3JAWB 4TUYF 4ZYVA 2QRLA 4D6YA 1J5PA 3AJEA 3U5ZB 3LJKA 1QAOA 2X0JA 2ECPA 2Q8NA 2R8RA 4I08A 5G1OA 4IQFA 3RF7A 4ENUA 5KKCA 5IT9A 1V9CA 4IOKA 4D4GA 4PZPA 1I10A 2I1LA 3Q0EA 2IY9A 2HM7A 3LL4A 1S7CA 2EJBA 4UXHA 3QPUA 2XQJA 1QTRA 2QI9F 2DUNA 3GW8A 3REQA 4QTYA 4YV2A 3EC2A 2C7VA 3FLBA 2R65A 3ZWWA 4LQ4A 2IH5A 1ZOOA 2ZETA 4IY1A 2Y92A 5J2TB 1R3UA 2AOWA 5F3WB 3KPUA 1MW9X 1JYFA 3PG5A 4OL9A 1E2BA 1Q1GA 5IJAA 4Z6KA 5JI2E 2J07A 1D7AA 2YW2A 3D5QA 3OQHA 1G5TA 1UZNA 3GX1A 4KIUA 4UNNA 4M1QA 3VNRA 3LCRA 4CR6A 1QAMA 4TWIA 1DGQA 1JHAA 1L6RA 4FM9A 3CLTD 4YMWA 1L5YA 3ZWMA 4KQCA 1Z6PA 1BVRA 4BJ6A 2QNRA 1CRWG 3KOZA 1J2YA 1RRMA 1UZAA 2N1MA 2YS6A 2QTHA 2ZBFA 3CE6A 4MV5A 3H83A 4NSNA 4AQDA 2FQYA 1NKSA 1XBTA 1OKKA 1H5QA 3WGLA 3GNLA 1Z0ZA 2J4CA 3VKFA 5IHPA 3AONB 3TD2A 1M2GA 2NU6A 3KTFA 3I05A 4PZZA 5K4AA 5CYPA 1AKRA 5KOHA 4FMDF 4CTKA 4WFKA 2XT6A 1KO1A 1V3VA 1XU9A 1Y5LA 3WMGA 4BBJA 1CQJA 1FRQA 1M6VB 3ZLBA 1LEHA 3LZ6A 3V3TA 1BWSA 1P7YA 3Q11A 2JEZA 1AS0A 1HG0A 2OSBA 4M60A 4UDNA 1FDWA 4TT8A 4MKIA 1Z2PX 5TPZA 5TMDA 5BXQC 3ADDA 2CCJA 3WNQA 5JEDA 4GL2A 3D7MA 4RLSA 1OZ0A 3UY4A 1YVRA 3OX3A 2HJHA 4IAOA 1J0XO 3DDCA 3JWGA 3WRXA 5MFZA 1NDUA 5J2UF 1K4MA 1XYGA 2DT5A 2D3WA 1UPAA 2R62A 2YXDA 4RM3A 4RY9A 1TUEA 1K8RA 5C8YB 1E4VA 3BTOA 1D2NA 3KXLA 4MUJA 1XROA 4MWOA 4PTZA 2H7YA 5AK6A 2JK0A 4XJTA 4INAA 4X20B 1P1RA 4FR0A 1OX4A 2NUBA 2OPBA 3DDSA 1NUHA 4Z53A 1GXSB 1ESEA 4CM9A 2PGOA 4B3BA 3N5KA 3WR5A 2GAAA 3PHHA 4NBRA 4A36A 3WB0A 4YCNA 3J80A 4PC1A 1FX0A 1HFJA 5HS4A 3OHMA 3L1HA 1CF9A 1YOVA 1PT7A 3PS9A 5CMLA 4GZ5A 1JDUA 3N87A 3OZDA 4XWKA 2CFCA 4Y1RA 5JDIC 3B52X 1V6SA 4EY8A 5CPFA 2Z6AA 1E0AA 3S1SA 3O82A 2WG2A 4OJQA 4LMAA 4BKUA 1IOLA 4YUYA 5JADA 1DUVG 1ZD4A 3IEUA 4KRGA 5A4IS 1VE1A 4QGAA 2WSSD 1M5UA 1P3JA 1CDEA 2AC4A 2AOVA 1W5AA 2OK7A 2WJ6A 3KQQA 4R01A 2R8EA 4GKBA 3D3WA 3SZOA 4X7RA 1O94D 1ORDA 2N0SA 2XADA 4CGYA 4MR8A 3EVBA 3CEAA 1Y6QA 1J56A 3OECA 5H1YA 4V03A 1O97C 3T41A 4E21A 2OGUA 1O5TA 1PV2A 4RANA 2OFXA 5SZKB 3UJHA 2PGAA 3C3YA 3I8OA 5LMUB 3UT5B 1ZOIA 2W90A 5DXJA 1P7PA 3I1YA 5I48A 2IBSA 1JUDA 4FR5A 1VB3A 4AZTA 1F60A 1ZIPA 5EIXA 1MH9A 3EB9A 4NONA 3RBXA 4G5FA 3CZAA 5ALPA 4M1WA 3R9KA 3ZH9B 2AG5A 4BQQA 1E63A 2HA2A 4EHBA 3GLFA 3VGPA 2QZ9A 3TJRA 3R40A 4B3MB 5FWXA 3VPCA 1NUQA 2NZ8A 2Z6UA 4ENRA 2I99A 3UA3A 2NNLD 5AJWA 1SURA 2YHIA 4N6GA 5DCYA 1RZ3A 2DFTA 4EUKA 3KETA 4N18A 1B8VA 4E2FA 4AJ9A 2YY6A 4LRUA 1OHHA 2C2WA 1N25A 2IXTA 2A5JA 5FFMA 4ZVPA 1Z5WA 3PGMA 4NU6A 4TMFA 3QVGB 3MILA 2OLKA 3IBTA 3OZVA 3D1LA 4JITA 5DNVA 2JATA 3TYXA 3VPAA 4Z8YA 4ETMA 1JX6A 4P36A 4WX2B 5IEJA 4BFYA 3ZEIA 3WLKX 1U8CB 2I91A 4CYMA 3G5LA 5FBVB 3ANXA 1OLUA 4F9GA 5CDUA 1M6YA 4F38A 3ETNA 4EITA 3CCCA 3FHLA 3D7KA 3EBOA 4I9GA 4P5EA 5JXHA 2C8KA 5CAEB 4CIYA 2WR8A 1U6JA 3NT4A 1E9AA 5IJ9A 3LT5A 3T9AA 4BBZA 1GQQA 2OOKA 2G88A 2Y68A 3EQ8A 3HVUA 3PJGA 4YMUA 5JD5A 3FJYA 2UZ0A 2QNBA 1D4OA 1Z8FA 2JF0A 2YWJA 2BI8A 1V2GA 4UTOA 3WQRA 1T4CA 5F9FA 2DM6A 1F06A 4W9NC 2QHXA 3NHUA 4LOJA 2Y1XA 4Y9TA 5IKMA 4DCNA 1FJXA 4HRYA 2QM0A 3HDQA 5EJ7A 2WBLC 4QYXA 3P32A 3SSAA 3O4IA 4HZGA 5FOSA 5AXBA 1EB9A 4B76A 2QLNA 3ABRB 4FGLA 3C74A 3CQ9A 4ZMSA 3MWYW 1H93A 1V2HE 4A8PA 1CRPA 3GP5A 3A4MA 3KSUA 4JC5A 1GG5A 3KP1A 3QWBA 2XCRB 1WDWB 1JXOA 1LTHR 1OASA 4BVAA 1KEKA 5JAZA 1L3IA 1YWGO 4YV7A 2AOTA 1PR4A 2HA3A 1U1IA 2RGNA 2H07A 1GGEA 5AJHA 1FQJA 1SBHA 4L8VA 3ZBUA 1QR2A 1EWVA 2SCUA 1L8XA 1NMXA 3BZWA 3DEJA 1KQPA 4ZVNA 5A02A 1OH8A 2HTEA 2JHPA 2Y1OA 1W85A 2HLPA 1U3GA 1L5HB 1Z88A 2EBUA 2GZDA 3F6RA 4XVQA 5FEMA 1SHKA 3OY2A 1KO4A 3FWPA 1EZ1A 3N59A 2YR0A 1RYYA 2EAUA 4CF6A 1CY0A 4DRXB 4F5EA 2ATCA 3SU8A 4CT0A 1QP4A 4ERXA 1TD9A 5EJGA 4ZTUB 3AKYA 1QIHA 5IZCC 3A4NA 2P0EA 4U3JA 1EUZA 1EFCA 3E61A 4URUR 2EEZA 3IAM6 1GTVA 1YGPA 2BEJA 4WNAA 3UGTA 3W8EA 2NMVA 4C7JA 5LQUA 1SUSA 5AM5A 1GPJA 4PZEA 3M7IA 3VZBA 1KVTA 4Z0TA 1TZBA 2KLBA 2EBHX 3SIPA 4C08A 4EF4A 3UUEA 2QAGC 3OTHA 4IIFA 1PZGA 1V11B 3E18A 2ZT8A 1GO2A 3D31A 3JARB 4OYLA 4WGFA 1DP4A 4HP8A 1Z0UA 3K20A 3SR3A 2FG5A 2R97A 2G6TA 1ZC3A 2Z6VA 1HE1C 3KYIB 2OQVA 1FTYA 2J0UA 3FVQA 4FYYA 4UMVA 3P96A 3VH1A 3SFZA 3I28A 3K3PA 4HDOB 3HE3A 2PL9A 5DHSA 1N5KA 3RVPA 2ZJAA 4L75A 2OBFA 2FEAA 3OQJA 5LMZA 1EDDA 3GA7A 4BE7B 3P2MA 1HDEA 1ZGJA 2WFZA 1C9KA 1KAGA 2B8NA 1CU1A 3OKPA 4II3A 1QYXA 1RXSA 5A4DA 1VKZA 1WPXA 3EVDA 3FOEC 3TK1A 3OLWA 5L7WA 2FRDC 1E2QA 1XQVA 2FETA 5SICE 5B64A 3P2OA 4NG5A 4RKEA 2B2XA 2C4NA 3EEFA 5CLLA 1QBKC 1R0KA 1U28C 1EHIA 1U7ZA 1ZI9A 4MGHA 3AHHA 2FPLA 3K53A 3KOYA 1YS1X 3PD1A 4WN9B 3TKLA 2F64A 4AMZA 1XEWY 3O21A 4OCZA 2P6RA 2F3SA 1YS9A 1ISFA 5K3EA 1Q22A 1WZNA 1RLUA 2RSLA 1CPYA 4BO9A 1W88B 4XIIA 3U39A 2AUMA 4R7ZA 3WV5A 4JU8A 3PUJA 4EHDA 2M6SA 1YRWA 1NXTA 4Y7CA 2H4XA 1KA9H 3ENNA 4HEA6 5KSZA 4W7HA 1N0VC 5CLQA 4ZYUA 4L9WA 4MI9A 3R2JA 4JKIA 4FE7A 4RD4A 3WL8A 4BV9A 2YZGA 1GGJA 2P2ZA 1T0JB 2BPOA 1P4GA 3HUDA 2VNAA 3L77A 4K9LA 5KTNA 1EVKA 2VAMA 4GM4A 4Z1MA 1IVSA 3LUJA 3A9SA 1WULS 2R2AA 3K4HA 4A0GA 1EGVB 4KB5A 1UBSB 1GKKA 2FR1A 2C9YA 2XCQA 3GLHE 2WM8A 5DBEX 4BS9A 4F4DA 5KTYA 3EFEA 1ST3A 4MR7A 4NJMA 1SHLA 3IXLA 4GRDA 4YAIA 5C81A 4QQFA 3GN1A 2P5YA 3TLZA 5HGXA 2D8AA 1IZ8A 4Z0HO 2QRUA 2W4IA 5FAKA 2NO4A 1U3VA 4RL6A 4LX8A 3UPUA 5KDOA 1JIJA 4OYHA 4EHIA 3DYBA 3TIXB 3H7AA 1CSEE 2RK4A 5CK4A 3EFOB 1GG9A 3QFSA 4LC1A 1OYOA 3BEDA 3CF6R 4RGYA 3ZK9A 4QYWA 1JEQB 2BSXA 3BXEA 1IUOA 3TSOA 4B5LA 1Y6RA 1XJ0A 2ZFUA 3K0CA 1GDTA 1T6BY 4BMZA 2PVCA 4YJ2A 3DVAA 1LJUA 4Y1GA 4F9FA 1XXHE 3VNBA 3TTVA 4DT1B 1JSXA 1UBHS 2PRIA 3GEMA 5AW5A 3MXTA 5CX1A 4YXWD 2IU4A 2VSOA 4EQ6B 2JFOA 4U5XA 3HVJA 4YT8A 4ZU6X 2QN3A 3DFFA 3RM3A 5ICSA 2FN9A 1IBRA 3NUZA 4B4UA 1JJBA 3OZBA 2QW8A 5AM0A 1N2OA 2GEKA 5CA1A 4RIFA 3F73A 3H8WA 2LRHA 1YZUA 2HMSA 2N75A 4Q1VA 1W0JA 1J7KA 1ULBA 1E0KA 1V26A 3DT9A 3K6KA 4EHJA 2QN1A 5HJ2A 3PITA 2XBMA 5KOIA 3T1TA 1LU9A 3KOUA 2OZVA 3QV2A 4JJIA 3SQDA 1SKMA 1E32A 1CF2O 1SOMA 2PCJA 2YIMA 3D3NA 2ZDHA 1DKOA 1HTWA 4FE4A 4TLEA 3UO8B 1V8ZA 1XOIA 1Z17A 3FZYA 3PZBA 3NOOA 2LKDA 4ZOLB 4QXPA 2OAEA 2YXEA 4HPXB 4PZUA 2VTEA 4QRHA 5B2ZA 4YQEA 3UMMA 4E11A 3ZCQA 3VAZA 2BM0A 3F71A 4EB6B 3H3JA 1RQXA 1VJDA 2XVMA 3A1DA 2BY4A 4LTDA 4PRKA 3RS8A 1ZH8A 2OD2A 3MZ0A 3BORA 2FMIA 2R6DA 5JSQA 3LUDA 4GUDA 1QRDA 4FIDA 1ZW1A 3ZY3A 4HWPA 2A84A 3MG9A 1HT1E 3ABQB 3AHIA 3C6ZA 4G23A 4ZJZA 2B7BA 2WV7A 1XTVA 3FHJA 5D3ZA 4B7ZA 1V48A 2GTIA 5EINA 4LYJA 3WNDA 1HKUA 4JFRA 1G16A 2XEXA 1F6DA 3PGA1 3M89A 2CDCA 4C0KA 4DAOA 1H0HA 2OD7A 1TQ6A 1VHTA 2A57A 2DSTA 3C6MA 3HRIA 3LF1A 1W75A 4EG1A 3LHSA 1XLTC 3PFBA 3TQRA 3I72A 1RWWA 3KT3A 1KFKB 4DJDC 3E1SA 1CYDA 1W0KD 3UN1A 4RV4A 2FP4A 3P0FA 4HGZA 1NRJB 4LBWA 3WL5A 2GRAA 3KHTA 2GLUA 5IVKA 4QPNA 1EVLA 4BNWA 3IJRA 4DIKA 4EUNA 5BNIA 2R7KA 2Z1DA 4EJFA 5FBQB 4YHBA 1E2PA 4RD0A 2Y27A 4B6PA 4PXSA 4ENQA 2JFWA 3HUUA 1F8FA 3BK7A 3I2JA 2GEBA 4PR3A 3FYUB 2C92A 5G3YA 2OAQ1 3DKPA 4GOOD 3RI3A 3SC4A 3CNOA 4C4PA 4C7OB 1TA9A 2NTNA 2V0CA 1QH8A 4BP3A 1FZTA 4DLUA 3ETEA 1QFZA 4YDHB 3TQOA 4BCCA 4J3NA 4XPIB 3T15A 1XVLA 5H16A 4BVKA 2DY0A 1J20A 3R4CA 2P6OA 3SS8A 4FZRA 3BD8A 5EKXA 2ICAA 4KWIA 5JE8A 3U6BA 2CEKA 1FFEA 1LWOA 3CRRA 2FEWB 3OSUA 3PHBE 1P9LA 1SM4A 1TZ2A 3CUUA 1DDIA 4W63A 4UU1A 4UQOA 2YZNA 3NIDB 1CX9B 5TARA 3RUFA 3S55A 1YBFA 4B0OA 2QLMA 5LQAA 2YKGA 3TE6A 2XXAA 3NVKI 4J0CA 4KODA 4AY5A 4D74A 1QH1A 2DG2A 5FTWA 4JCOA 2XLBA 4CF5A 3KXIA 1EZ4A 3DE6X 4URHA 3FNFA 5IAJA 2IWHA 4B8ZA 4DMUB 1M1NB 3H2SA 2HK9A 4RIEA 2XT9A 4D26A 4UARA 3U1BA 5K3BA 5JJCA 2JGLA 1O8BA 1RQRA 4G2NA 4TKUA 4FE3A 4DCJA 2ZCJA 2XE7A 1DJQA 3BXGA 1LS1A 1U81A 4NU0A 4QOEA 3RTAA 1DE0A 2I0FA 5FBHA 1DELA 3GYBA 4NMLA 4JOBA 2ZRPA 4QSMA 4U6SA 1BH6A 3AEKA 1VE9A 1UC4B 4XDHA 3ZZ0A 3W5DA 1CR0A 4IFIA 4RY0A 1SXGA 4GUAA 1UOPA 5JYEA 3RC7A 3QSYA 3L8GA 3BGVA 5JD3A 1MR3F 2QAIA 1SBTA 4GSYA 1Z06A 2GEUA 2W6IA 3CO5A 5COBA 3TJZA 3HV0A 4CHTA 1K08A 3TMYA 4DY6A 1E2KA 3LBNA 4JASB 1SK8A 4BJ3A 4JWTA 5KAMA 5G0TA 2GJ4A 3GVCA 3QXHA 2VYCA 1WCXA 2DSNA 1S4MA 4LBYA 1NC3A 3VUFA 1XK7A 4NAVA 3FDJA 4MZXA 4MDYA 2H8GA 5HZHA 1SKYB 3P9YA 4B7UA 1G1MA 3FE2A 3OUUA 1RBYA 2HMYB 4X64B 3SG0A 4ZZ2A 3EVEA 5LUBA 1V5GA 3DOEA 2G9VA 4A2WA 4E2XA 4LSMA 2B1JA 2INGX 1E1LA 1EM8B 4RE5A 1JE1A 2HA5A 3DLAA 1GCAA 1OMOA 2DF8A 3PWKA 3QYAA 5AK3A 4ZT4A 4B9AA 1OBCA 4EF6A 2GQ0A 5G0WA 4CODB 4QOFA 1X8KA 4H27A 1YL6A 4Z49A 1WUYA 2C2KA 5JROA 2EF1A 4LOIA 3J81A 2QMZA 3K8QA 4HQOA 2YV4A 4S1OA 3L7IA 3EIOA 4OO3A 3NPMA 5DGIA 3IKTA 1Y6FA 4TTTS 3LPMA 4LKRA 4V0KA 1IBSA 1WQ1R 4Q9HA 5DISB 4TROA 3AVWA 2IY7A 3OMXA 4Y30A 1FVOA 2EJTA 2FKAA 2YRWA 1EVYA 1T8WA 1W87A 1JVNA 1G6Q1 2H9AA 3L0CA 5EE5B 4F8JA 1ATZA 1QG2A 4E12A 4Y98A 5ISMA 3AHEA 2II6A 1PSZA 2F43B 2AD5A 2HDWA 2JIQA 1W46A 4NK5A 4QDOA 3GR6A 3UCEA 3WDKA 1WU8A 4YMSA 2DLNA 1GGHA 1P2SA 4OHMA 1BVYF 2HV8A 3SZRA 1SC3A 2VBFA 1NF8A 3ZXYA 4D42A 4ZEXA 2Q1WA 4XPZA 5B7QA 4AS2A 1L3CA 2FZVA 3TAUA 5FUXA 2Z4SA 1XQ6A 1FFDA 3G7NA 1ZIOA 3LBIA 5KWEA 3EXIA 4CDNA 1V71A 3OMWA 4BVBA 1FUYB 3KKOA 2F8SA 2NSJA 3DHYA 4GLFA 1FP2A 4MW7A 1ZM2A 1KH1A 1MBZA 1XRPA 2CXNA 2V74B 3PXBA 4O4HF 4PG8A 1JT9A 3G68A 4I5DA 4WCFA 1X13A 1QB7A 4N0EA 1JPNA 3EAFA 5BQPA 1JJAA 2C7RA 3PT5A 1YTLA 2CNKA 4LHEA 5KUTA 3JYHA 3OPXA 3GRZA 2HO4A 3RC3A 3T7JA 3OEED 2X6TA 3EMDA 2VC2B 1J70A 1Y1PA 2BZGA 2IZ1A 5GV8A 2Q46A 3WBKA 1R0YA 4D45A 3AKZA 4MVXA 5HKAA 3HKEB 3L1IA 4F2DA 2DFLA 1QKJA 3DF9A 1OFTA 1P1FA 5F1YA 3UYKA 3ZCPA 1UT5A 2FCRA 3FUTA 4F60A 3NDIA 4YAFA 1PDOA 5DM4A 4M1YA 3RRMA 4PHTA 1KTIA 3P0HA 3DFMA 1C7JA 5LU9A 3P9RA 2HQ1A 1JDZA 5DI3B 2UUBB 1FTNA 3HYNA 3F3MA 2DBYA 2MSCB 3RIXA 1JDBB 2CDNA 4TTRA 5IXSA 4GLOA 3UKJA 3OZTA 1K7FB 5AVZA 1BRMA 1J06A 1MO5A 2G8NA 3KOXA 2B8JA 1GEGA 3H16A 1ZKMA 2XMQA 1ZK2A 3R6WA 4OPMA 1J0BA 4L2IB 3AUFA 2WLTA 2WJWA 3WA7A 1RCUA 3AEQA 4CDRA 3L1JA 4DMKA 5FT9A 2PLRA 3A1NA 3I23A 4WT7A 3MK31 3RYCB 2PSEA 5A4KA 1XZDA 3Q12A 4Q05A 3IHLA 3ZHXA 2W6PA 3HTXA 2E4AA 2JCYA 3EXHB 2VF4X 3TAXA 3E15A 4BO8A 4JROA 1GZ4A 5E7IA 4KNYA 3AY7A 3RVMA 4UTNA 2O1EA 3JYNA 2D2IA 3BGWA 4MV6A 2P9YA 4G5SA 5B7NA 1TFRA 5C2JB 2QT0A 4CGZA 5CM9C 4XQCA 4JFAA 5JQGA 3S8YA 1G8GA 2FLKA 2JIOA 5J2TF 1ONBA 1AA9A 1ISPA 1IWOA 1SCUB 3O2NA 3G0GA 3ZK7A 1IPHA 4KU4A 1SEPA 3MW8A 4YRRA 5I7EA 2QVZX 1P2FA 2DQZA 2G82A 2NZYA 4MR9B 1KRHA 2Y3IA 3KFXA 4WUTA 5BYJA 2QUZA 4OYYA 1V8DA 3VR5D 3KZMA 4QUDA 5DTIA 1EYZA 3WYEA 4EFMA 2O1WA 4G5YA 1W5EA 2OECA 3GFTA 3A8TA 1WB9A 3U48A 2V7XA 3EODA 4BAUA 1I3CA 4LTNA 2ZWPA 3CLHA 5C31A 2XQKA 3TZKA 5C52B 1O2DA 1Y8RB 2HADA 1ZOLA 2AK2A 2NYVA 5EVJA 2YIVX 2OXTA 2YYAA 1GDDA 3TLGB 4OI0A 4H7FA 2DPMA 3DEFA 1QFYA 1AURA 5ECGC 4AP9A 1IPFA 1TKBA 4K9QA 3CW9A 1NATA 2H00A 1W581 2OBYA 3D81A 3IHWA 3WB9A 5FOQA 5DBFA 4ZOLF 2FR8A 5TF0A 1QC5B 4UEQA 2GEJA 2PX0A 5SZIA 4EYOA 5KJFA 1Z0IA 2P62A 1Z7YA 3K9CA 3Q7EA 3OE7D 2QTGA 5CGQB 3A27A 3EY4A 3ZVMA 3L7KA 4YDSA 1GRRA 1TIPA 3G88A 1VIAA 1QIKA 1QIMA 4NOLA 5HIIA 3UB2A 2WNSA 4XGKA 1K92A 1NZJA 2IS1A 3MCWA 3GRFA 3S3TA 5DNDA 1R6AA 5JCXA 1H1LB 2R84A 3IAHA 5JY1A 1PQPA 2Q07A 1KVQA 2Q62A 3GPDG 3GVHA 4ZD6A 3T7CA 1Z7WA 1MB0A 3C15C 1EBBA 2CLIB 3O26A 4KTTE 5IT4A 1I4LD 4CLRB 4JBYA 2H06A 3WLEA 3A0UA 1KVRA 2H08A 3LKBA 1NR7A 1ZO8A 2WUWE 3JQAB 4KLCA 4PLTA 4WXYB 5TPWA 5DLQC 4ZYZA 2R751 4TWRA 3DZJA 1KKMA 3KLBA 3CRZA 1CE8A 4J0KA 4PZDA 4EJ0A 1P0PA 4MYDA 4KZKA 4RGQA 1Z37A 3M4NA 4HMPA 1QGUB 2ZYAA 1W4LA 4BWYA 3STHA 4OKIA 2VJLA 5I4IA 1ZVMA 2WYWA 3IP1A 2O9JA 4N76A 2RHRA 1RHUA 1X14A 1XT6A 3B38A 2BFCA 4GR9A 1NNSA 4HEQA 4MKZA 4KI7A 1E59A 1WHSB 1RPTA 2R86A 4ASUD 4BRZA 4ZHQB 4KPUA 2E3JA 4JCCA 3IA2A 1LI5A 1FXWF 5HJEA 1Y80A 1L5RA 4ZYYA 4YCBA 3U3MA 3VR5H 5EP2A 2GZMA 2OAGA 3CEHA 4HD8A 4FGKA 2PKYX 2ZYVX 3LA8A 3EXG1 3AWDA 4E4RA 3NAQA 1B93A 4J0GA 2HKIA 4D79A 3NORA 1D4FA 3AU9A 2FB9A 3GGPA 3SQNA 1JAYA 3MT8A 1YTUA 3BJRA 3A1FA 1R8JA 4FGUA 3K6RA 1IY2A 2P6PA 2JAOA 3CLVA 2GDJA 1QHFA 3BREA 3QF4B 2PE5A 1V0JA 3RABA 1FB5A 3O9VA 4XGIA 5JDCC 3OESA 5KYUB 1XD2A 3S5JA 3UXEA 1XIVA 3UB4A 3D6JA 3T12A 1PW5A 1ND5A 1S01A 5BSUA 1OTYA 1FZQA 1XKQA 1XZEA 4Z4EA 4DA6A 1UJ6A 2VK8A 2QG9A 5F4ZA 1WSWA 5E4TA 2Y1FA 2XTNA 3KUDA 4A73A 4MUYA 3PA6A 5IBRA 5I5GA 4KVZA 4YUAA 5FLXA 1CUDA 1LRJA 1C50A 2XOKA 4MQEB 2O7VA 4DMFA 3MOSA 2WK1A 3KXKA 1QM5A 1EGAA 2ANBA 3V8VA 1VSUA 2G25A 3WWZA <