4PSCA

Structure of cutinase from trichoderma reesei in its native form.
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
220
structure length
220
Chain Sequence
b'WPSINEFLSELAKVMPIGDTITAACDLISDGEDAAASLFGISETENDPCGDVTVLFARGTCDPGNVGVLVGPWFFDSLQTALGSRTLGVKGVPYPASVQDFLSGSVQNGINMANQIKSVLQSCPNTKLVLGGYSQGSMVVHNAASNLDAATMSKISAVVLFGDPYYGKPVANFDAAKTLVVCHDGDNICQGGDIILLPHLTYAEDADTAAAFVVPLVSHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbohydrate esterase family 5
publication title A Cutinase from Trichoderma reesei with a Lid-Covered Active Site and Kinetic Properties of True Lipases.
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
total genus 74
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2014-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pscA00
1TKRA 2WIFA 4N8EA 5DYYA 4W1QA 3OG9A 1SFRA 3ANSA 3H2JA 2WJ4A 2Z8ZA 4M0MA 5AO9A 4UHBA 1DT3A 4G1FA 4U2EA 1H23A 2OGZA 5SYNA 4BRZA 1BN6A 3G8YA 3FYTA 2JEZA 3I2JA 3U1TA 4JEIA 1SC9A 1H2XA 3LIPA 2OCKA 3D3NA 4B0PA 4QE3A 3F8SA 4C88A 4M0EA 1W76A 1BEEA 1N8SA 4I3FA 4UFNA 5AKLA 3RARA 2XUJA 4OU5A 4FNGA 5CT9A 1LPOA 4QLAA 3AZQA 1UK8A 3W05A 1H2ZA 3IUQA 1XQXA 4OYYA 3IVMA 1Y7IA 1QIFA 4RGYA 1TRHA 4Q3KA 3WK6A 2DHDA 4BAZA 5K3BA 4W1RA 3WJ2A 3UUEA 2FX5A 2DQYA 3H2GA 2XUOA 3D5EA 4GDMA 5CT5A 1W6RA 1EI9A 4EUSA 5ALTA 3F67A 2XE4A 5K3AA 2ZJ7A 2Z8XA 5AK4A 4MYSA 5AI4A 2GBFA 2WIGA 1CUEA 5ALNA 4CIAA 5ALIA 3JWEA 1WB5A 1IUOA 3FLBA 4QWMA 2OQIA 2QUBA 4ARBA 3QM1A 2VJDA 1EX9A 2OLEA 1CUWA 2OCGA 1Q83A 3WYDA 1GPKA 1S8OA 3H0CA 5CW2A 2QJRA 3H2IA 4Y2TA 2HIHA 3LCRA 4C89A 1TCBA 3ESCA 2PM8A 3O95A 1EVEA 1RYYA 4BVKA 2GZRA 2HADA 3DL4A 4FLMA 3WI7A 2CEKA 4C87A 3MUOA 3M3DA 1E8MA 1JI3A 4F5ZA 3WZLA 2O7VA 2DHEA 7YASA 4CI9A 2XLBA 4LXHA 4J3JA 4RNCA 3AJAA 4U2BA 5A2GA 3WA6A 2C58A 4UHDA 4BAUA 4WFIA 5AIBA 5J3JA 3V9AA 3ICVA 1BE0A 5CURA 2PUHA 3KDAA 4Q82A 4YK7A 3AZOA 5AHXA 4GI1A 3QBJA 1ZD3A 5A6VA 3KOOA 1E66A 4ZRDA 3C70A 1VA4A 2PU7A 5LIPA 1LLFA 1CVLA 1GQRA 5AI8A 1ORVA 4ETWA 2XMCA 3WL6A 3UUFA 3FLEA 5ALZA 5AH0A 1LPAB 4BVLA 5C81A 4CCYB 5LZ5A 5HK8A 3WK8A 4H7KA 2XUAA 3K9BA 3DNMA 2VEOA 3JYHA 3QH4A 2FJPA 2ZSHA 4UBMA 5ALMA 2QXTA 1ZI8A 4B0OA 3I2IA 3IUMA 4DSZA 4Q3LA 1BU8A 2XUHA 4GECA 1WPRA 2CUTA 2XQIA 4KYVA 1ZI6A 2C4HA 4ARAA 1JMKC 4L3WA 2XMBA 2WTNA 3R41A 4B84A 4Q3OA 3FBWA 1ZIXA 4FWBA 4FHZA 5HF5A 2GYWA 1A88A 3I6MA 3WA7A 5AK3A 2ORYA 3OTQA 5AM2A 1JU4A 2UZ0A 2ACKA 4BTVA 2C5GA 4H7DA 3C6ZA 5D3KA 1IUNA 4Y2UA 4J0DA 2HL6A 2JGMA 5CMLA 5C8XA 4B80A 4XWGA 1XZKA 1QFMA 4DMHA 1FFEA 5AM0A 3D59A 5CT8A 4FDMA 4W1PA 3DJYA 2PBLA 4OU4A 1DQYA 2ACEA 4KE6A 4J0IA 3K6KA 1OILA 2AJBA 1FFBA 1K8QA 2QMQA 1CUGA 5BOVA 4CCYA 2JGIA 3F98A 5AK6A 2H7CA 4J0CA 2O2HA 4RPCA 1BS9A 4EY7A 1HPLA 4Y7DA 1XQVA 2WM2A 3IA2A 3HXKA 1GKLA 3HI4A 2JEYA 1W52X 1NU8A 5BWBA 3G7NA 4MWTA 3ESDA 1ZGCA 3Q0TA 5LZ8A 4B9AA 4LYDA 1QZ3A 2JGKA 2WJ3A 3IBTA 2C0QA 1DU4A 2XUIA 1LPNA 1J1IA 1K63A 1UK7A 3HJUA 4X97A 1UKAA 2Y1KA 1XRNA 1CUBA 3GFFA 4PSCA 1AZWA 3BDIA 3BIXA 4DMFA 4H0CA 1CUDA 1XROA 3DYIA 3NGMA 1GPLA 1XZEA 3M82A 1ZJ4A 2RAUA 3SK0A 3U0VA 6YASA 3O4JA 5DNWA 4OD0A 3WK5A 1IMJA 2PSDA 1YR2A 4AMYA 1F0PA 1OXMA 1CUVA 2XMSA 5AKHA 4IHAA 5DTIA 4Q34A 5ALXA 5AI0A 3AIMA 2QOEA 1Y37A 4CG3A 3P2MA 3W9BA 1YA4A 5LZ7A 1HBJA 1CUJA 5K5EA 2RIPA 4KRYA 1DX4A 3FVTA 1ODTC 4EZIA 1XFDA 3KSRA 1CQZA 2Z5GA 3A6ZA 3WLAA 5DNUA 3ILSA 4IH9A 5JADA 5EHQA 1WCYA 2QUAA 3OM8A 3HACA 4WJLA 4OB8A 4A23A 2PVSA 1QIMA 3WKDA 1XKTA 5IVHA 1XZCA 5HKAA 1QIJA 1GPNA 3N2ZB 1EDBA 5DYTA 1AURA 4KEAA 1AGYA 4H7EA 1BCRA 5AKXA 5E4JA 1XRLA 3W04A 4Y2SA 1DT5A 4B83A 4QDTA 2X5XA 3MUNA 3CXUA 1YASA 3AIKA 4EB0A 2XMRA 2VJAA 1L7AA 2WU3A 1N5MA 1VJ5A 1TAHA 4EY8A 5KREA 2Y6VA 1P0QA 3KWFA 2WUGA 2H7XA 5IH7A 3I28A 2WIKA 3H1BA 2DFPA 4LHEA 4C6HA 2CMFA 4K6HA 4ZI5A 1MX5A 4DMCA 4J0KA 4UHFA 3DKKA 4W9RA 2HRRA 4K6KA 1QIHA 3HSSA 4TVKA 5AK5A 1BROA 1O6GA 4QDOA 4AO6A 2B9VA 2PUJA 4HAIA 5E4TA 3STUA 2V98A 3ESBA 1ZD5A 2WLSA 3X3HA 1YA8A 4G8BA 1XZAA 4J7AA 4LYEA 5AM3A 4Y2YA 3DS8A 5ALYA 2G5TA 5IVDA 1CV2A 1YSCA 2FUKA 4ITVA 3QPCA 1XLWA 1I6WA 4RE6A 4G8CA 1CUXA 3WZMA 3QYJA 4DIUA 3AIOA 2OCIA 5AKEA 2WJ6A 1YS1X 1W1IA 1AQLA 4DNQA 1RWQA 4H7FA 1EINA 1UK6A 4YPVA 4QLOA 3WL8A 5D3ZA 2HA6A 1USWA 4A5SA 1AKNA 2DR0A 1H2WA 1YS2X 2XB6A 2WUEA 1VKHA 5K3FB 3BE8A 1QTIA 3G9ZA 3D4LA 3R3VA 3C6XA 5HQ3B 4PSDA 4HXGA 1QONA 5ALHA 2JGLA 1JMYA 2XQJA 2ES4A 1DWPA 4GBGA 5H3HA 2I78A 3W06A 1P0MA 4HS9A 1QIKA 3HC7A 2OQVA 2VA9A 2XUDA 5JZBA 4ZREA 5AICA 3DDUA 3IB3A 4BDTA 4Y2VA 2E3JA 1UOQA 4LKOA 4MWSA 2P8SA 3BIWA 1FSSA 4MJ3A 4WDQA 4UBKA 5KWJA 1AMNA 4Y2JA 4CG2A 1SCIA 3H17A 2GYVA 2GYUA 3L1JA 1CUSA 3C6YA 5EI5A 1ACJA 2ZVDA 3O4HA 5FV4A 5ALWA 1XZBA 4UHHA 5DTJA 1WHSA 4KAFA 2PU5A 4BCBA 1E8DA 1ZOIA 2OAGA 4KACA 4JUIA 3GZJA 4W1SA 5AKYA 2BUAA 4FNMA 5EIHA 2GBCA 1PFQA 3H1AA 3EF3A 1KU6A 1MO2A 2YASA 1R9MA 1QJ4A 1WM1A 1K4YA 3VXKA 4PO3X 5IVIA 2J4FA 1P0PA 3MVEA 4X94A 1CQWA 2WFZA 1YB7A 5K3FA 4WFKA 4UFPA 3E3AA 1F0NA 2VAXA 1GXSA 3G9XA 1B41A 4P92A 5HQ3A 2XQKA 3SX4A 2VT7A 3RK4A 3QZUA 2HA7A 2W6CX 4NVRA 4AN1A 3FYUB 3WKCA 5CH8A 2XMQA 4S0XA 2HA4A 1ODCA 4J0GA 4PV7A 2V97A 1ZJ5A 1Z68A 5AIAA 5JATA 5DLPA 3STXA 1KU0A 2WHRA 3WL7A 2XUFA 2EDAA 5E4YA 4Q05A 4HRYA 2XQFA 4BYMA 3IULA 3VDXA 4FOLA 1AC5A 5ESRA 2WG2A 4CIBA 4H35A 2QKYA 3A2MA 3E4DA 1U8EA 5CTAA 1GZ7A 2I3DA 5ALSA 1X70A 1P0IA 4NZZA 4NMWA 1ZD2P 4P93A 2PPLA 5AI6A 2GZSA 4AO7A 1CIJA 4FMPA 4L72A 4UFOA 5K3CA 5JARA 2ZJFA 1VXOA 1MU0A 3WKEA 3I2KA 2HHAA 4WY8A 3R3ZA 5FUMA 5CRIA 4PNZA 5I9IA 3EBLA 2QT9A 5FXMA 1HL7A 1QTRA 1CEXA 2X8BA 4E46A 4WCVA 1CR6A 5BWCA 4AB1A 1L7RA 3BDVA 1R50A 2AJ8A 3FYUA 1SOMA 4B85A 5EGNA 2WQZA 3HEAA 3VJMA 3H04A 4I4CA 4N8SA 5CH3A 3AINA 2FJ0A 4C01A 2H9YA 2R11A 2XUQA 4BC0A 3PFBA 3DOHA 4YASA 4UBOA 5HKBA 4FBLA 4XJVA 4CG1A 2XMZA 4X71A 1THGA 2YH2A 4X91A 1R1DA 4E14A 3V48A 5ALRA 1MTZA 5AI9A 4B82A 4UPDA 3C87A 1Q0ZA 4G4IA 5ALJA 4GXNA 4W63A 3H19A 3WK7A 4B7ZA 1E8NA 4PSUA 2ROQA 3STTA 1UT6A 5EFZA 3O9VA 4ZWNA 3DQZA 4OCZA 4BCCA 2PKYX 1WOMA 4LXGA 4G9GA 5DYWA 4B81A 4H7HA 1FJ2A 4HRXA 5FP0A 4C4XA 5AM1A 3LLCA 2OGSA 5D7BA 1MJ5A 5LP1A 4RE5A 3C43A 1G4HA 1UWCA 1IZ7A 1E5TA 2HA5A 3DKRA 1N5RA 3IUJA 1X2EA 4BZWA 1D07A 5ALDA 5ISMA 3FVRA 1YCDA 3VVLA 1VZ2A 2PSJA 5JD5A 3CN9A 4K5QA 4OB7A 4MYDA 2HFKA 3T4UA 4HXEB 5HF8A 3G0CA 3K2IA 4IH1A 5A7GA 3Q8WA 1A7UA 1Q84A 4EY5A 3R0VA 5HZGA 4FLFA 1LPSA 3EQ8A 3A2NA 3DOIA 5FLKA 1IVYA 4G4JA 4OB6A 4EBBA 4HZGA 3G9TA 5AOCA 4KAJA 4UHCA 1QIDA 2HA2A 3QMMA 5ALVA 2Y2VA 3C5VA 4U2DA 4CFSA 4AX4A 2C5FA 2Y6UA 5YASA 2CB9A 1J07A 1QFSA 5JYCA 2XMGA 3H18A 1GKKA 2XI4A 1YAHA 5JD6A 3D0KA 3WK9A 1UK9A 2IITA 5AKKA 4BZZA 2G63A 4UBJA 4KE9A 3GUUA 3WKBA 1Q0RA 1R9NA 2BKLA 4V2IA 3C8DA 2PSFA 3VVMA 4BC1A 2DSNA 4Q1VA 3TGLA 2OG1A 3JW8A 3RKSA 3I6ZA 2DHCA 4M0FA 1EK1A 2AJDA 4U2FA 2WKWA 1XLUA 3GROA 3R3XA 1BCSA 1LBTA 4N5IX 3SC2A 1JFRA 1XZGA 1F8UA 4OPMA 3F97A 1DQZA 1X2BA 4LIPD 4TPKA 4QZVA 1VOTA 3WIOA 5AOBA 1L7QA 3FAKA 1JKMA 5AOAA 4OUKX 4ZGBA 2HDWA 5ALKA 4KE7A 3W9UA 2BGRA 3C8HA 4FBMA 4D9JA 4DLNA 1T4MA 1XRRA 3FOBA 4MXDA 2JGFA 2RGUA 3G0DA 5AP9A 3ZPXA 2EDCA 1ZGBA 4MQMA 3LS2A 5BV7A 3I2HA 3G9UA 2QTBA 3FYUC 2BAGA 2RHWA 1IUPA 2WUFA 2QXUA 3I6YA 4G9EA 1THTA 4E15A 5IVKA 3DD5A 4X95A 1QO7A 1SCQA 4U2GA 2RONA 4X00A 3TJMA 1ZI9A 3DCNA 3OURA 3QMWA 1BN7A 2QS9A 4AXBA 2VSQA 4NS4A 4PF1A 2ZJ6A 2WG0A 3WWPA 2XQGA 4KR0A 3ZI7A 4X3CA 3KWJA 3ZV7A 3B12A 2XUKA 2ZYRA 1QE3A 4X7BA 4X6YA 1EXWA 1G66A 2GBGA 3FWHA 2H1IA 5CT4A 4AO8A 1BRTA 5EHXA 4X93A 3WKAA 2VT6A 4XX1A 1CLEA 1HDEA 3DYVA 4DTCA 2C7BA 1QIIA 1W75A 5ALGA 1XZMA 1CUAA 4TGLA 4GW3A 5T4EA 3WWCA 2H7YA 1U65A 5FDFA 4DGQA 4DNPA 5DWDA 3B3QA 4EA6A 1A8QA 4MEAA 3VISA 3R3UA 2XUPA 4QDXA 1B6GA 3EQ7A 4DNOA 4F0JA 1EA5A 5AM4A 3HRHA 2BUCA 5JIBA 1R3DA 1DINA 5LZ2A 2CBGA 3S8YA 1CUUA 2HU7A 4UUQA 5A62A 1MX9A 5EHZA 1CFJA 4FTWA 2WIJA 5EIEA 1HLGA 3GELA 2QR5A 2ZYIA 2WILA 4QDUA 5C8VA 1QO9A 2QRUA 2J3QA 5LYYA 2WU4A 4QNNA 2BGNA 1C4XA 2XT0A 3ZWQA 1TIBA 4EHBA 4Y2QA 4A16A 4BATA 3V1NA 4G5XA 1LPMA 3ED1A 2XUGA 5ALPA 3IIIA 2HFJA 1LZLA 5LKAA 5JASA 4BB0A 2C0PA 3AFIA 2IIVA 3I2GA 2B61A 1QGED 1YB6A 3QPDA 3W2TA 5C8ZA 3PE6A 3BJMA 4HTAA 1UOOA 3EIOA 2WFMA 3CCBA 4WY5A 4BTLA 4KE8A 3G02A 1WPXA 2ZYHA 5E2IA 5FPQA 1XZHA 3HLKA 3M83A 1ZD4A 3SWWA 5I7UA 2OAEA 3QVMA 3H2KA 5T4FA 2VTVA 3ESAA 1ETHA 3AILA 3BJRA 4KAAA 3DLTA 4UHEA 3NWOA 4HVTA 5ALLA 1UXOA 4WFJA 3VKFA 4X85A 4Y2PA 4FFVA 3STYA 2WSLA 2B20A 4OSEA 2Q0XA 4LXIA 3FSGA 4FFWA 1ODSA 1U4NA 2NW6A 2W22A 4QWWA 1SCKA 3V1KA 4BDSA 3D2CA 3UMJA 5HCUA 4GEGA 4EY4A 1LPBB 4Z49A 4J0HA 1XQYA 3I1YA 3IUNA 3WJ1A 5CXUA 5AM5A 5A71A 4CCWA 4KRXA 1DX6A 5CXXA 1DWQA 5T4BA 1E89A 1CUFA 3VJKA 4IQ4A 4G4GA 4IO0A 1YAJA 1IZ8A 1EDEA 3FNBA 5A7HA 1K5PA 3G0GA 4OYLA 5FOQA 4EY6A 1XRPA 3G0BA 4I19A 1VXRA 1FFDA 2O2IA 3KD2A 5JAOA 1OCEA 1MN6A 4G8DA 4F60A 5T4HA 2CKMA 2OGTA 2AJCA 2BCEA 1KEZA 3FCYA 2D0DA 1BEZA 5JAPA 3WYNA 4GLBA 1ISPA 1MX1A 1CUZA 1H22A 4X92A 3PICA 4AZ0A 1ACLA 5K3EA 3BWXA 4ZV9A 4O08A 3PUHA 4U2CA 3PI6A 4B9EA 3O0DA 5IKXA 1C7IA 3AZPA 4X6XA 1JT2A 1EVQA 4BCDA 5FKJA 5JAHA 3LP5A 3BL8A 1W4LA 3R3WA 2YYSA 2HA3A 2K2QB 2WHQA 2VATA 2B4KA 3C5WP 2ZYSA 5AKGA 4N5HX 4J03A 1TQHA 3I1IA 1FFCA 3DEAA 1XZLA 1R88A 3IDAA 3KXPA 3PDCA 1JJBA 1HKHA 2JBWA 3R3YA 3STVA 2Z3WA 1EHYA 5JANA 1N1MA 2WFLB 1MNQA 4QDZA 1VLQA 4C4YA 4H7IA 5JD4A 1WB6A 5AKIA 2EEPA 4XVCA 2QVBA 4PQEA 4BVJA 2VAVA 5KWIA 2JIDA 1R4ZA 2Y2UA 2I3ZA 2VQ6A 1M33A 1RP1A 3YASA 4BE9A 5JAUA 3O4IA 1F6WA 2BUBA 1PV1A 1G42A 5AI5A 2XMDA 5HK9A 3PF9A 1LPPA 1LNSA 4DNFA 2WUDA 2WIDA 3O4GA 4Y2XA 3V1MA 1XZIA 5EIAA 1EH5A 3ZLTA 1CPYA 2AXEA 2JGEA 1WHTA 4L9AA 4MEBA 3S2ZA 4X6UA 3DL7A 3F96A 2CZQA 4PW0A 2R8BA 3IURA 5SYMA 5JZSA 1LBSA 2XLCA 2BJHA 1QOZA 2I03A 3ICWA 1E3QA 1GT6A 3A2LA 4Y9SA 4H18A 4QEKA 2ECFA 5I8PA 2OCLA 4UBIA 2JF0A 1UZAA 1FFAA 2WFLA 1WB4A 1EB8A 2WTMA 1XKLA 3NOXA 3C6BA 2PSHA 5FRDA 3HZOA 2QZPA 2HM7A 5C7YA 1NX9A 3OOSA 3CN7A 1UKBA 2PSEA 4FLEA 3H2HA 3HYSA 4DMKA 1QIGA 3R40A 1XRQA 4MQLA 4AQDA 3T52A 2DQZA 1MAAA 3FSGD 4IH4A 4FKBA 4AMZA 2AJLI 3CCCA 1U2EA 1MPXA 4QA9A 3WWEA 3VJLA 1XZJA 1VE7A 3STWA 3N0TA 4F21A 4JYMA 2V96A 1XLVA 3WIBA 4B6GA 5ALUA 3TRDA 2JGJA 3RLIA 4INZA 2LIPA 1AX9A 2PL5A 3PFCA 1XZDA 2RI6A 2OPHA 5JZ9A 3QMVA 4GWLA 5ALOA 1EK2A 1CUHA 1LZKA 3WQHA 1K6EA 1C7JA 4AN0A 1MNAA 4HXFB 3AUKA 1A8UA 1XQWA 3FCXA 5CBKA 1UFOA 1UOPA 3QPAA 4XIIA 5LZ9A 1CRLA 2ZSIA 5ALFA 1J2EA 3RM3A 4DM7A 4C4ZA 4BBZA 5LLSA 4UBLA 1QIEA 1CUCA 1H2YA 4J0JA 3ANTA 1GQSA 4K6GA 3A70A 2G4LA 2BFNA 5DNVA 4GHWA 4WDRA 2VF2A 2PX6A 4ZXFA 2QM0A 4BRSA 5ALEA 4K2AA 4ROTA 5EHNA 1ORWA 4H77A 3D7RA 1TCCA 1TK3A 2D5LA 4P9NA 1EB9A 2OXEA 1CUIA 1CUYA 3I2FA 3WK4A 3MGAA 5HFAA 2CJPA 4E11A 5HF9A 1VE6A 3LIIA 4Y2RA 1VA5A 3ZLVA 4H7JA 1AUOA 2YXPX 1XRMA 1HQDA 1VZ3A 1XZFA 5DJ5A 4JH0A 1PJAA 3O9MA 1JJFA 2WHPB 5LZ4A 5LKRA 4BE4A 3WL5A 4N8DA 4P08A 2Z3ZA 3V1LA 2O2GA 1NU6A 2X76A 4UBNA 3BF8A 3WMRA 3HABA 3ZLUA 2VJCA 3F9CA 1EDDA 3B5EA 2IX9A 2QJWA 1TCAA 1DWOA 5ALQA 1GGVA 2J4CA 5KBYA 1G5FA 3OC0A 3PUIA 5HFNA 3C45A 5AJHA 5AKJA 1QLWA 1O6FA 3G0IA 1A8SA 1MT3A 3EQ9A 2G5PA 3OPMA 2O7RA 3PF8A 3D2BA 5JALA 2HU5A 3E1GA 2V9ZA 3GA7A 1T2NA 1DTEA 2GBIA 4AZ3A 2WG1A 2J3DA 3FLAA 4L0CA 3NUZA 4JYPA 1UKCA 3D2AA 5AKZA 5F4ZA 4ZV7A 4DYHA 4BAGA 4JNCA 2HU8A 2DCMA 2XDWA 1JJIA 3L1IA 1LGYA 4YX9A 2HRQA 4KJXA 4BP9A 3WWDA 1MAHA 3M81A 3GBSA 4DSAA 2RHTA 5K3DA 3BF7A 1J06A 1JU3A 3BXPA 5FPPA 5A7FA 1ZIYA 4BP8A 2ONCA 5CT6A 3E0XA 5CH5A 5D6OA 2WHPA 1Y7HA 5HF6A 3QITA 3L1HA 4X90A 2VJBA 2HA0A 1ZICA 3TEJA 3WWOA
chains in the Genus database with same CATH superfamily
2GWHA 4N8EA 5DYYA 1RXWA 3S27A 1BW9A 3SE7A 4Z4FA 5HILA 2BY4A 3ZHYA 4YLGA 4LE2A 5MHTA 3K1AB 2W4MA 1GL7A 1ACMA 2JJYA 3E9MA 4HV4A 1TK2A 2J5QA 4YA6A 1HFEL 1VFNA 1ZAKA 2Z0MA 2ZJ4A 1XX6A 5LIRA 1J8MF 3QQ5A 3E05A 1DT3A 4JBLA 4U2EA 2XB8A 2QL9A 2OWDA 4Q7QA 3UJ9A 2PMWB 5F78A 4L5IA 1C3EA 2GB4A 5BYJA 1NVGA 2JEZA 2WZDA 3DR5A 1L7XA 1YR6A 3NTLA 5AK0A 5EKUA 3WRXC 2GETA 3M7IA 4OP2A 4E1AA 1H2XA 3E7XA 2AQ8A 3TVYA 4RACA 1ZD8A 1ISMA 4TMFA 2CD7A 1S01A 2IXGA 2OCKA 3LIPA 1SXGA 5K4GA 4UEKA 2UYYA 4V0SA 2ZZNA 4QE3A 4AM8A 2J9FB 2W6OA 1R9JA 3PE4A 5JSZA 3BGSA 4OHCA 3QVGA 1TF7A 3HDYA 1NP3A 4HMQA 5A6SB 1PDWA 1SGWA 3HHEA 4M99A 1SCUA 3PXUA 3JVVA 2VDRB 4UFNA 5AKLA 3RARA 3VUFA 1OW3B 2C1EA 2CVZA 3OZFA 3TIVA 1RWPA 2UXBB 3ZY3A 1LPOA 2RDMA 1U81A 4ZEWA 1N7JA 1SUCA 1BJRE 1J25A 3DBHA 3EGIA 3IMEA 4C05A 1XXHA 4KXQA 2CNKA 4YDRA 2E6UX 1NJ1A 1X7XB 2OMKA 3EBOA 3KWMA 5CM9C 4NOLA 4IZOA 3MMZA 3IVMA 4N7MA 1ZC3A 3DO8A 3NIBA 5K6AC 3NZEA 2ZATA 4F2PA 5ECYA 5D01A 1YWGO 1XCBA 1PBTA 3WK6A 3KELA 4XIFA 1QP4A 1YMVA 4TMXA 1NG1A 4OQQA 4AZ0B 1T8RA 1P2BA 1RPAA 3BQNB 4RD6A 4W1RA 4IIBA 4QREA 3ZQUA 4QBIA 3A27A 4YI3A 3W1EA 4KCGA 4GUDA 1YDGA 1VB5A 4WE3A 4ZC8A 1OY1A 3IEIA 2V6IA 3IRVA 2JFBA 3MWYW 5AVKA 1EFPB 3AESB 2J6HA 3HHPA 5BWLA 1AMUA 1J2TA 1UIMA 1RBQA 2VHXA 2XUOA 2QVZX 4II3A 4PC1A 2X7HA 4L4XA 4XPIB 4ZVPA 1Y48E 2I6FA 2X13A 4RSGA 1WBJB 1D1SA 2Z2YA 4MS3A 1KA9H 4PHCA 3CZCA 5JPDA 4GD3Q 2P1RA 4FGZA 5TB5A 1IY9A 1DAHA 3SKVA 2BZGA 2NV6A 3CH5A 1YDMA 3GMIA 2FY8A 1DADA 4QG7A 2QENA 4B87A 1DJQA 1JA9A 1JMVA 4A0SA 4CM8B 3ESQA 5BN4B 4P38A 5AK4A 1K6MA 1POXA 1G98A 1E6KA 3OQPA 4PG4A 5DW0A 4K1LA 1ZW1A 2GBFA 4MDEA 5IEBA 1QV7A 1GUAA 2BGGA 1JQAA 2I91A 1Z9BA 1ZHFA 2H07A 3SNKA 3NBYC 1IUOA 5FI0B 4WBNF 2O8BA 1UDAA 2OQIA 4WXPA 5J2UB 2Q3LA 3O6VA 2CCJA 2DTXA 2WW8A 5CNIA 5IXYA 2IH2A 1N0HA 5I7EA 1VCHA 4E2WA 2GK7A 2VJDA 3QM1A 4Q7LA 3PDHA 4YRSA 1RXUA 2IP4A 3PTZA 2A8YA 4Q1AA 3CLUC 2WEKA 3AR8A 4MVJM 1WD5A 3RVBA 1Q83A 2FQXA 1GPKA 1Q1BA 5CPFA 3TRKA 2ZYVX 4EHAA 5DNAA 4ZZ1A 2HIHA 4N03A 4NU0A 4DSOA 4DLBA 3UXMA 3EGWA 5ECGC 3DKVA 1J0DA 5E2BA 2GRJA 3ECAA 1JEQA 1H9AA 4AMUA 1L8XA 2ZU6A 1FL9A 1H6AA 4RMJA 5ECWA 2WKSA 4I81A 4N3GA 4TZTA 5BN3B 2QMHA 3VPCA 2QD4A 2PNJA 3D6JA 4GGMX 5IYZA 3OX4A 3K31A 1ATZA 5BW6B 4IUYA 1B00A 2CF5A 3MUOA 1EVJA 4G5QA 4UNIA 2Q07A 3RC9A 1Q0SA 1QHGA 2J0UA 1Q7RA 2LVBA 4BX2A 1JI3A 3DLAA 2HV8A 3WZLA 4WXMA 1K9VF 3M5WA 2GR9A 2X0EA 4CM4A 1KR5A 1NMEA 4RPLA 7YASA 1UAGA 1ZBDA 1PBNA 4P58A 4LJYA 2FPOA 5HIIA 5C0OE 4NS1A 3TEMA 2JKVA 1SUWA 1U7HA 5J1TB 4JI6B 8AT1A 1C4KA 1OAAA 2XLBA 3A14A 4K9OA 4ZEXA 1YFZA 5H4HA 2W2NA 1H0SA 4PX9A 4EI7A 3MOSA 1PZMA 4J3JA 4KQCA 2XTMA 4RNCA 4FW9A 3TB6A 4B35A 4C4RA 3BSFA 3SBOA 1P4GA 3BQMB 3EG9A 3GF4A 4K0KB 1ZW6A 2NOAA 3DBRA 2HB6A 4K9QA 1ICEA 3ZHUA 3AV3A 2BISA 4KVAA 4UHDA 4UUMA 3WA6A 2J1LA 7AT1A 3KT8A 4IICA 1JAZA 2DUMA 1E3DA 3LBIA 3TJRA 1DG1G 1N7IA 1DIOB 3ZHZA 3S2YA 2IYOA 4A0RA 3PG5A 2P2DA 4BUZA 3HV2A 1SBQA 1WOYA 2R6GA 4HPXB 1NUUA 4MYHA 3OZIA 4GPIB 3WB0A 3V5NA 1NUPA 4N41A 2BI7A 4D0RA 4PLTA 2IC5A 2C3MA 1N6RA 4G6ZA 3MBIA 3KYDB 2PUHA 2IZOA 1D8AA 4G07A 5CURA 4EEKA 1AKTA 4DSNA 4F4FA 1L7DA 2FPLA 3G85A 3AZOA 3QJ5A 3T9EA 4F86A 2L18A 5A5EA 2Y0DA 4NV0A 3L3BA 1H4SA 5EVJA 3KYJB 1L0BA 2C9YA 3QBJA 4DV1B 2ZWVA 1I2ZA 1WG8A 1Z17A 2PZGA 3KOOA 1NTOA 1XPRA 2EL9A 2RKWA 4MKRA 2QX8A 4JMPA 4YCCA 1G8SA 2XXAA 2HCTA 3CV3A 5LIPA 4UTOA 2QTNA 4C43A 1O4WA 3RU3A 4YJHB 3KJHA 4EHLA 1W29A 2FWAA 4V03A 1GNLA 3C3BA 4ETWA 2A58A 1NXSA 2P3LA 1QU3A 4ZIRA 2ZQYA 1RWXA 4HX9A 3NHZA 5ALZA 4XIJA 4UUAA 5IC5A 4WZAA 4B7CA 4CM6A 3H8JA 1TQ8A 4LOLA 1OZGA 4OHFA 4H2DA 2JPDA 3KJZA 3FTDA 4TUYA 2WVGA 4R83A 4ZVVA 3T0FA 5C81A 1C8KA 1N6IA 4J91A 3VHQA 3PGA1 2FW6A 4H1TA 1FDSA 1L4BA 1KJ9A 4V3BA 3HUTA 3WOHA 3ZU4A 1D9XA 2A0UA 3P96A 3KP1A 3F47A 1J9ZA 3QUBA 3L6DA 2A92A 4QULA 3WK8A 4E5NA 1HTWA 3DFKA 2CXUA 5A5DA 5GJBA 3QEOA 2XUAA 1YKGA 2GCPA 3E53A 4EO4A 4ZVQA 3A6JA 3PQCA 2HWWA 4FWTA 2CL5A 4MULA 3WBBA 4K6CA 4UBMA 4H17A 4J1TC 1VSBA 4KR3A 2CFTA 1G8FA 1BMQA 1XTPA 5DISB 5J2UF 5JNWA 1OIWA 1XN1A 1ZI8A 1EPUA 2Y05A 3DPSA 2PLWA 4G5YA 4FGLA 3A4IA 4YLYA 3IUMA 4RTJA 1O1YA 3P27A 2PZBA 2ADFA 2HSZA 3MD0A 1W9MA 3NBZC 4GKAA 4XOIA 4YYZA 2GWRA 3WVNA 2XVYA 3LHKA 4BO0A 1QCYA 1Z63A 1WPRA 3GVHA 2AG6A 2XQIA 4P4SB 1OYVA 2IH5A 2GM9A 4YCBA 2XEXA 5DHTA 4EQZA 3E3NA 4G5RA 4L3WA 1NA5A 2WB4A 3LBYA 3Q11A 5SZIA 5KVSA 1YOVB 2R8ZA 4MOWA 4CF4A 4HQLA 2EV9A 4IXMA 1OASA 2EIXA 1I51A 2R1UA 3N58A 4Q3OA 2ZIGA 2ZI5A 2OBFA 3ETDA 3PPVA 4OI1A 5ADUS 1XNJA 1A8HA 1FXSA 4JIMA 4OSOA 1YZFA 3Q0IA 4B75A 3WA7A 3GO4A 3K70B 1J0XO 1KMNA 4G0PA 4FCCA 1O5IA 4C08A 4ZHQA 2AG0A 1UXJA 4BTVA 1PWXA 1GV1A 1ELOA 3PQ7A 2O8DA 4Z8YA 3SR3A 3EJ6A 3MS4A 3CW9A 1L4FA 5LA6B 3NHWA 1IN6A 5D3KA 4I14A 4Y2UA 3W6UA 5CYFA 2ZRFA 5I7AA 3U4CA 2B4AA 3OEEA 4IJVA 4AS3A 1RZVA 2IDKA 5ENDA 1DMSA 4HDKB 1ZXLA 2F1JA 2GARA 4TQGA 5EIXA 4U7DA 4B80A 2EJUA 1Z0AA 4OVKA 5KWEA 3I3SR 5ICCA 1QFMA 4FDTA 1Z35A 5U4QA 3UJAA 3E2IA 1QGAA 2FG7C 4CMEC 1U3WA 2RGAA 2Q5EA 5IARA 1JYSA 3D59A 2AI1A 3H9JA 5CT8A 4AJ4A 4KMRA 1RXVA 3IO5A 4KC0A 5H9VA 4KXLA 3LT2A 3HR8A 2Z2XA 2C9OA 4ISBA 4YJ3B 3ODPA 3EWSA 4QLBA 4OU4A 1DQYA 4FYJA 3KO8A 2G82A 3ZWDA 1SD5A 4KE6A 1TMYA 1P5HA 4YAWA 1H1LB 1DBSA 1TM5E 2ZB4A 2ZIFA 3B85A 2X8AA 3K6KA 2C2HA 3LUCA 3GJ4A 4G5GA 4XFJA 4JLBA 4CLOA 4UNQA 3ASYA 1Z74A 1IBKB 5B7QA 4RZ2A 2NU8A 4BFVA 4MK4A 3RI3A 3PHLA 2HT6A 3DCJA 5LBIA 5DNYB 1CUGA 5A3JA 1J0AA 4ZOCA 1TZ2A 3QNUA 2YN0A 1R0BA 4ZV4A 1N9ZA 1ZJJA 2C95A 4HUJA 2VRWA 5AK6A 3ZBTA 5TRTA 3MFQA 3GIDA 1C7ZA 4N7RA 4Q5IA 1ZA2A 3ZE7A 1G21B 2P5SA 5A3SA 5LR6A 5LU8A 2O2HA 4H0FA 2EFHB 4BX0A 2B8JA 1IB0A 3BMOB 1E7SA 1RI5A 3HY3A 3KKMA 1BS9A 3N7UA 3V1TC 2C5EA 4ZTZB 1JIUA 5C52B 4NENB 3CNQS 3L93A 1HPLA 3N53A 4M1QA 3M3PA 2GNPA 4HL6A 1PVVA 4C78A 2X3UA 4GMKA 4JP2A 4K28A 2EVWX 4LV5B 3COZA 3BICA 3F3YA 4PIMA 3T3OA 2AWNA 2VUIB 3CW2A 1YIAA 3M89A 4BFLA 5BWBA 2CLKB 3BPSA 3G7NA 2NVBA 4B8WA 4DV5B 1L2TA 4MWTA 2GSWA 3KOUA 3V3KA 1ZGCA 4Q3CA 2AVDA 4FHDA 4RKQA 3W5JA 3OPYB 2JATA 4JA2A 2X4IA 4FIDA 5C5EA 3OFND 1KI1A 4PZEA 5KNBD 2NAPA 1NNSA 3R74A 1Y4ZA 1N1DA 2R97A 4Q9KA 2JGKA 1U0LA 1XTRA 1PP4A 1LPNA 3KHSA 3A9VA 3H83A 1F7VA 1WDMA 1X1QA 4N1AA 2XTZA 3L2OB 1BCRB 4I1IA 3P2EA 1V47A 4PQYA 4RAQA 5JC8A 1FMTA 1ILEA 4DCTA 4OFBA 4R71A 2DJ5A 2FLWA 1E98A 1XRNA 2GF9A 1YI8A 3GFFA 4PSCA 1ID1A 4TL7A 4ZYUA 3ZJVA 1KFJB 4L8WB 2C04A 3D3KA 1DOZA 4CLHA 3IR7A 3BIXA 1VSUA 4INJA 4DMFA 1CUDA 1HDYA 1XROA 3F9RA 3ZU3A 3RREA 4XSVA 2O2SA 1RQXA 3BH0A 4UEWA 2NO7A 2V4MA 1XZEA 3CNEA 3NHUA 1QYXA 3MBKA 4MIEA 5L8VA 2H1SA 2DY0A 2FEPA 2WWFA 3DNFA 4XUGB 4CUJA 1BHO1 3B9RA 4NCKA 2NUTA 5FWXA 2FXIA 1W8IA 4J75A 3TDNA 4CF7A 4XXHA 2QAGC 5DNWA 4GI5A 4NV3A 3G1WA 3H97A 4PYOA 2X4GA 4EVQA 4OD0A 1XA0A 2B30A 1NRXA 4QTTB 3GQBA 4AUEA 2V7XA 5FF9A 3W5VA 1EJBA 1DCFA 1IMJA 3ETGA 1OFTA 1SKUA 2QRMA 4BO8A 2QRVA 3WC4A 2C4NA 2PSDA 4M9XA 1KMIY 1YR2A 4D8YA 3VAYA 4FDAA 6LDHA 1AGPA 4WLOA 4M0PA 4B3GA 2V5UA 3VR6H 5BXQC 2XMSA 5LA6F 3KJQA 4DCGA 1UOEA 3SIWA 2R1ZA 4CQLB 3THXB 1MABA 3PS9A 1GTSA 4F6RB 5ALXA 2FW7A 1MA0A 2LXNA 2OY0A 3O2SB 5EP3A 2AEFA 3H6KA 2QOEA 1FX0A 3AM5A 3EBPA 1ZUHA 2AOTB 3QELB 4LHWA 5E6UA 1QQTA 1YA4A 3B1ZA 2JGDB 4ZAGA 4KRYA 1Q14A 3PWTA 4MPRA 1GARA 4NDAA 3HWX1 4DREA 1VDZA 4G1UC 1X1BA 2FR8C 2K5UA 4NABA 3KYCB 3T06B 4LWPA 1RTKA 6CHYA 1R37A 3A6ZA 3E81A 1BHSA 1ZNXA 1VL5A 4L2IA 4PCVA 5K8TA 1RRCA 5TQ2B 6Q21A 3RKRA 2C2OA 1BX0A 2O3QA 2DWOA 4YJ3F 2J6IA 3SSNA 3KTAB 3ZHOA 5B3JC 1LWNA 3OE7A 4C2AA 3PVCA 2R6DA 1SVWA 4CM9A 2BHRA 1XOIA 2QUAA 3OM8A 3OOEA 1KI2A 1RM4A 2GFIA 3V7NA 5BR1A 1OGIA 1R5NA 2COEA 4WJLA 4MGIR 4KG7A 1JKFA 3L4JA 3O1IC 2D1FA 2Y66A 3R6LA 5CM2Z 2IIPA 1VYTA 1K3UB 1R0LA 2PVSA 1I30A 4JBGA 3M6AA 1VRWA 2X8JB 1KDZA 4II7A 4Y30A 4JLJA 1XZCA 1QH1B 4UEQA 2NO1A 1QIJA 2ZSAA 3OFJA 3O82A 4F9EA 1EDBA 1L8AA 2V9CA 4F38A 4YCSA 2D1TA 1V8FA 2DR3A 2ZEJA 2BM9A 4TVBA 5IMBA 4TMTA 3UXEA 3P9YA 1PYOA 4L78A 4UMFA 2PQ6A 3AP1A 4JU8A 5COAA 4YRFA 3I72A 4EECA 5CA1A 3TM4A 4JOBA 4GRDA 2YS7A 3MJ4A 1GU7A 4V0RA 3W04A 5IABA 3ICCA 4MLCA 2F9LA 3K94A 5KTOA 3LX6A 4PAMA 5L3QA 5JPCA 3NBAA 4WESB 3Q7EA 1KRHA 1KI7A 1IY0A 3ZU5A 2VFAA 4XGIA 1UBTS 2OXFA 5DVZA 3PNBA 4ZJPA 4F5DA 4EB0A 3K6SB 1O5OA 1WUJS 1T6YA 2XMRA 4LTDA 4BGUA 5CEJA 1L7AA 1QK3A 1G18A 1B8NA 2FH5B 4BVFA 2P5UA 4EAAA 3JQAA 4KP7A 3BXZA 5DGIA 4F9FA 3NIWA 2GZ3A 3ICOA 4LXQA 4E09A 4EY8A 2WMDA 5KREA 3I61A 3EF0A 4Q4LA 1PTJA 2W4QA 1CETA 3QLVA 1Z88A 3S1AB 1OZFA 3E35A 3GVXA 2QX9A 3KWFA 5J4LA 3EQZA 2AZTA 1PGQA 3D54D 3I28A 4GOLD 4XWOA 1KEWA 1YRHA 4LHEA 4TT3D 1BNCA 5SY9A 4K6HA 3JD0A 3W8RA 4JT9A 3LNCA 5EWLB 5TSDA 1T5LA 3VR5A 4JLWA 2XRFA 4JLKA 5KTYA 5ANRB 1U1DA 2RGXA 2HKIA 4F8JA 4HYTA 3R76A 3ZK8A 3WADA 2NZXA 3H9QA 2WHXA 5IULC 3QVXA 4BLPA 1UJ5A 3L0BA 3AUUA 1E7MA 4W9RA 1KZ4A 3GCWA 3I8SA 4N7BA 3BVPA 4INPA 2HRRA 1YBVA 5DZSA 3SEAA 3R1IA 5HCNA 1E2KA 3HSSA 3QG1A 1PTKA 2PD6A 2J45A 1P9LA 2V7TA 5I8WA 3QWFA 1U2GA 1DV1A 1NF3A 4KSBA 5D85A 5EP4A 3R0XA 1K98A 1TZBA 3NT5A 3BZBA 1US8A 2VXCA 2WYHA 1B42A 1Z83A 2B9VA 2HXGA 1U0OC 2R60A 2W2OA 1E3SA 2I2DA 2PUJA 4RK7A 1N2CE 2V58A 3TTWA 4AVYA 2F9MA 1RCFA 3EUFA 4E4RA 4YT4A 1T8WA 1YA8A 2VHVA 2EQAA 2XGSA 5LUAA 1TMOA 4C2TA 1HT3A 2IZ1A 4LZLA 4NJMB 3LA8A 1Y1KE 3EXEA 2J0QA 1I5OA 2ECKA 4Y2YA 4I8DA 2NM0A 5BSUA 2XDQA 4TSKA 1Y5RA 1P2FA 3DM5A 3G2MA 4PIPA 5ALYA 2G5TA 1ZK1A 5IVDA 4MRRA 4RTOA 3E3LA 2B83A 2YWEA 3KZMA 1DAEA 1KARA 5CJPA 1WHSB 5CNMA 5B1HA 1E6WA 4N18A 3WDMA 4NK5A 2FUKA 1VRVA 2HK8A 4IOLA 4MW1A 3X1XA 1KH3A 1G1AA 1XLWA 2P3SA 3BTUA 4G1BA 4MCHA 4UE2A 3D3EA 5K51A 1TMGE 1VM6A 2JI7A 1OBVA 5KNLA 1QFYA 3U7IA 3N8DA 2JIMA 4D2IA 1IDOA 5AKEA 3I09A 5I9BA 4EMSA 1YS1X 2RI0A 2ISSD 4DMLA 1ABEA 2RGCA 4CRWB 3OQVA 1EINA 1EQAA 1GVHA 4MUHA 4QLOA 3ZDBA 3OQJA 1RM3A 3QGMA 2GJKA 2IYXA 2E1RA 1P33A 2X19A 1YJ5A 5ESWA 1USWA 2X0JA 3ZY2A 3U44A 4HQ0A 1PNRA 3MTGA 1H2WA 5GMOA 3OZGA 1QYRA 3SX2A 2RMKA 4NFLA 2ZK7A 3RUDA 3KB8A 1OI2A 4A03A 4ESEA 2BFAA 3D8RA 1YRLA 2H3EA 4R7TA 1I14A 3LDUA 4WKOA 1TGVA 2UVQA 4TMVA 3EH2A 4ZOQI 1N9KA 2JCYA 1W85A 1BO6A 1BU5A 2J0VA 1L5HB 16PKA 4RK4A 1KHTA 3D4LA 5AW8A 3QE9Y 3DDNA 3REQB 2D4HA 3R3VA 4RKRA 3EGDA 2YCBA 3U7QB 2IUYA 5A4AA 1A69A 2H17A 4HWTA 3CLRD 3GLIE 5ALHA 3L6RA 4C22A 1Z0ZA 3LUFA 1Y8RA 5DCWA 1IB6A 5HUJA 3ZS8A 3JQQA 1UC4B 5SICE 2WZCA 4JI0B 3O26A 1LCIA 3AFOA 4E1VA 1PW7A 2PUEA 3UWOA 1SVOA 4N6NA 3W06A 4AULA 3OLCX 1KJ8A 3U3RA 3U16A 2NTJA 5IJAA 5KINB 3OJ0A 3OKFA 2ONKA 1KHHA 5JMWA 2CYAA 1E6LA 2Q7XA 4Y6GB 5JZBA 2O4CA 4KHZA 5AICA 1S4QA 3IB3A 3Q12A 4BDTA 3Q10A 1UOQA 1LX6A 1NI4A 4LKOA 1XVUA 5EXTA 1XDZA 2EJBA 3QVLA 3ON5A 5ADWA 3BIWA 4QU8A 4BZPA 3LFHA 2JCXA 2JZNA 1VKRA 5KZMB 4MJ3A 3ONNA 3EPKA 1HURA 3L5KA 1REQB 3TECE 4Y2JA 4ANFA 4CG2A 4D57A 1JWLA 4RZQA 1JN0A 2OSBA 4D96A 2P78A 1XMVA 4KVFA 4BEJA 3L1JA 1B1AA 3NEAA 5TMDA 5HX7A 2BSQA 3C6YA 2CL7X 5LJIA 4NJEB 2ZRKA 3VYSB 4CV1A 3FBGA 1TC2A 1QS0A 2F4NA 3O4HA 3WNCA 4R1UA 3BWYA 3R9IA 2J33A 3DA8A 221PA 3VYTB 4EB6A 3FD8A 3P71T 4DZRA 4S04A 4KAFA 1PFKA 1WUHS 4UZFA 1MP0A 1D03A 4KTVE 4BCBA 1SXJB 3Q5DA 4R9UC 2Q4EA 2OAGA 3JVEA 5KQMA 1RYBA 4JUIA 2GOYA 5EXPA 3DZGA 1T2UA 1NLUA 1V5IA 2DH6A 5EKTA 4Q1EA 4OHZA 1ZUD1 3WZ2A 3D3WB 3C3YA 3MELA 2IYWA 1D2CA 3JZMA 1J20A 4D02A 1WMEA 1ZJZA 3JQ7A 1QJ4A 1SRRA 2BFBA 2HOQA 2FRDC 2RKBA 4ZA2A 3WMXA 4BX9A 5G0VA 3NHAA 3GEGA 3KSAC 4YAKA 1RC8A 1DUIA 2IOFA 3Q7TA 4PO3X 2J4FA 3A10A 3U81A 1JHRA 1P0PA 3ZE1B 1QPBA 2XBLA 4CN9A 2R0QC 2DEUA 1TVEA 3HDVA 1QOQB 1X8XA 2EEZA 2GN2A 2RK3A 4MLPA 4X94A 2XNHA 3OIWA 5EESA 3UGTA 3V2HA 4WFKA 1MO4A 5J59A 1P4JA 2YUTA 3HM2A 3C7CB 3NOOA 3OIGA 4M7OA 3W7AA 4B2LA 4DC9A 1F0NA 2D6FA 3DZHA 2H8KA 4KQ6A 3IUPA 2LDBA 4QOSA 5DTEA 2SKCA 4P92A 1FXWA 2E0IA 3LY9A 2CW5A 3TE6A 1Z4MA 3MCAA 2XQKA 2ZUDA 2VT7A 3GAAA 4KQWA 2P0AA 3AFHA 3HDHA 1G20B 2OGWA 1NQWA 4J7CA 2Z8YA 1FZTA 2W6CX 1BDHA 1RHUA 3F5DA 2V7QD 2X2EA 1IXZA 3M1LA 3NHFA 1UMDB 3FKJA 4ACAA 5BN1A 3FYUB 4V38A 3WKCA 1KI3A 1QGDA 3DV2A 4UNNA 2OAQ1 3PSAA 1QO0D 5BWMA 1J8FA 1T25A 2W6QA 4O0MA 3AVQA 4MUMA 4BJ3A 1RZRA 3E5RA 2QE6A 4AQ7A 1K2WA 4IWNA 1HDZA 3STXA 3DLPX 4OMUA 3LK6A 3A1TA 1VJ1A 2HHJA 4M8IA 1TU4A 1PR4A 1XF9A 3ADPA 3AVPA 3P0EA 1HRDA 1NMSA 3T1HB 4NZYA 3GN2A 3LYHA 1CD5A 4BS9A 4DLYA 2XUFA 5KTTA 4X7RA 4OQXA 5E4YA 1BFUA 1NQTA 1C4OA 4Q05A 4Y2HA 2FB9A 2YVAA 3ZY6A 3ENNA 1NNLA 3RWOA 3FOEC 5CVCA 3CF6R 2EP8A 3M4XA 1A2OA 5HIAA 1FPMA 1F2UB 4PG8A 5ESRA 4PYRA 3Q2IA 3F7NA 3SOZA 1C14A 4ARIA 4KU4A 4M1KA 2BDEA 4IO1A 3OA0A 2H2FA 1XZ8A 3T5MA 5KIAA 4WNYA 3RG2A 3DOCA 3E4DA 4GPD1 3SYMA 2B36A 4KFCA 1XTKA 3B7WA 4HDSA 2OP0A 5ALSA 1NXPA 1I4EB 1M5UA 2CDRA 4UZEA 4A8TA 1ST2A 2CUNA 5JTUA 5G1OA 4NMWA 3LBNA 2PXXA 1LTQA 1T3ZA 1VG1A 2VCEA 1YCFA 4OAOA 4OHUA 3H2BA 1NZJA 2CJYA 2F17A 4Z0TA 4OV6B 1XNHA 1UJMA 2ILVA 2PG3A 3ZLBA 4GX0A 5DWQA 1UMCB 1BRMA 4C7MA 5D2CA 4KOEC 5KX5B 1IHOA 3N8KA 1CIJA 3NNNA 1WMFA 4FMPA 4JJ8A 4LNAA 1KWKA 5IM4F 4UFOA 1NLMA 1H65A 1PAUA 3X44A 2XB9A 1E1RA 3V4RA 5JARA 3W5BA 2P90A 1WCIA 2VVTA 1KY4A 5KHAA 4W4TA 3U6BA 1M0SA 2CXRA 5FWAA 4FZRA 1GR0A 1FCJA 3I2KA 3MMSA 3WSTA 4TWIA 4WY8A 1C0IA 3R3ZA 5FUMA 2NYUA 1OTHA 1ZRMA 1IXKA 3SQXA 5A4FS 3HJCA 2GCGA 3SAJA 5BSWA 4JJ6A 1RWNA 2DVMA 3B89A 2AFIE 4J2HA 1WCXA 5I9IA 4XGRA 4H08A 3LYUA 1JQ3A 1A2KC 1RE0A 2WSYB 4GLOA 2OFOA 5FXMA 4FZJA 2P9ZA 2WTXA 3OAAA 1Q1NA 3D43A 1C0EA 1PJBA 5C4GB 3BXHA 1HL7A 5DM0A 4AYWA 3LT1A 4DUPA 1Y6GA 1OKKA 3SHVA 3EISA 3EFEA 1SN7A 3RSSA 2NSDA 5EVCA 2WMOB 1JPNA 4E46A 1J6UA 4YFVA 4IUDS 1CR6A 2FZCA 3BDAA 4X6LA 4D4HA 2ZI9A 3UENA 3RG8A 3ZZ1A 2P5YA 1JVBA 1FP7A 1U94A 2AE1A 3LD9A 5C35A 3WRVA 5A9SA 5I9TA 2ZE6A 4IHJB 4M1SA 4BO2A 2X0DA 3UK7A 1O95A 3HEAA 4TV8A 3RVMA 3PJEA 5AVJA 2VF8A 2IYPA 3DGEC 1JIQA 4N8SA 4D46A 1E7QA 1ORDA 5H8WA 1BS2A 4ID3A 2H9YA 3I9FA 2FN8A 4Q9HA 2R11A 4P7FA 2HPVA 4TRJA 4S05A 2XUQA 3TXYA 4UVEA 3PLAE 4LJ7A 1LRLA 4PPFA 3E84A 1JBQA 1PGNA 1JALA 2R5FA 3IQFA 3KE8A 3HGTA 4XGNA 2O3JA 4ZO6A 1XQ9A 4GP7A 2IU0A 3TR6A 3ZLJA 4P7GA 2UAGA 2PMBA 3IC5A 3NTQA 1EVIA 2E4UA 2WNIA 5KO2A 2ODEA 1YK0A 2AZDA 2YXNA 3EIHA 4WLUA 5EIBD 1UJBA 3CVVA 3V7WA 1YJ8A 2XMZA 2TMKA 4X71A 3OM0A 3EGXA 2BFMA 1U3UA 4DIEA 1RYNA 5KCZA 3Q5GA 1HZZA 1J8VA 1D5WA 1R1DA 2ET6A 3QX8A 3V48A 4EAQA 4JIGA 3IDFA 2ZTUA 3ZU2A 1R5BA 3U3ZA 3RRJA 3AT1A 1G2PA 4EZEA 4OA5A 5FTWA 2SCUB 3JD3A 4IP0A 4RD4A 2DC1A 3AOGA 3PGMA 2WI8A 1ECJA 4NHEA 3K9GA 3J81k 1R7RA 1AA6A 3EPPA 2IUSA 1KL7A 4LXXA 3ZHXA 4M6WB 4Q9LA 2B0JA 2LNDA 2MOKA 3HWRA 1EIWA 3NWBA 4PSUA 3O93A 2ROQA 5KDDA 1OFUX 4G0ZA 5GONA 4M86A 1UT6A 2G0AA 1IAQA 3IXQA 4XJSA 2KYRA 3IP6A 1HM5A 3DQZA 1ZMRA 3DUFB 2DAPA 3JATB 4OCZA 5I4KA 4DCNA 2PKYX 3NUGA 4Q4AB 1FRFS 3L7KA 5HP4A 3AEXA 1VL8A 3LCUA 3QVWA 4G9GA 5K3OA 2WV9A 2XKAA 2JLBA 4BEWA 1UKVY 3AWDA 1T4CA 1ZDMA 1I2MA 2WBLC 3ITKA 1DKMA 1I33A 3JQ9C 3QPWA 4PAWA 4RJTA 3U6KA 1JDPA 2EJCA 4X1KA 1GR1A 2VZ0A 3HK2A 1JE0A 3V00A 1V5GA 4C0HA 1LNQA 3TQFA 2OGSA 3V33A 1BX1A 1KK2A 3V7UA 3ITDA 3R7LA 2D2EA 4P31A 3PC8A 4WZBB 4BRUA 3GVIA 2CE2X 2DETA 2J9GA 3ZEAA 4BVBA 2B4RO 4PLVA 3B70A 5KX5F 3WFIA 1I4DD 3NAQA 5J2TB 5LOVA 2HA5A 1BCSB 3DKRA 3IEUA 5JQGA 3DBLA 3ECSA 3UEOA 1ABFA 4E6EA 4L8YA 3I9V6 1EWYA 1KETA 1GTZA 2YC2C 4TSFA 2FEOA 3RU2A 3TQRA 3U3XA 4Q16A 3NM6B 4DG8A 3HJFA 2KS6A 1D07A 1UR5A 5ALDA 4X20B 1XALA 2VWGA 1A5TA 3VGPA 3VVLA 1TUIA 4ZHQF 2R84A 2EQ5A 2YV2A 1YGYA 1EWRA 1DC3A 2QB5A 4COKA 4PSVA 2BGKA 3CN9A 4MTLA 3N0XA 4WCDA 2HFKA 3O03A 4RY0A 2PZEA 2CXPA 2FSHA 3K1JA 1Y1QA 4HXEB 3T4UA 1X3SA 3K2IA 2G0NA 1KOLA 3ZV4A 3Q40A 5DBFA 5JNLA 2Y0PA 3ZE9A 1MC8A 3Q8WA 1GD1O 2QQGA 1ODLA 1SD1A 1LXCA 3R4CA 1T1IA 1LPSA 5J9FA 2IYNA 3NAZA 3TW8A 3JPWA 4RD3A 3WLMA 1JLLA 4B2PA 4W9MC 5E7MA 3WGGA 2IOYA 4MUBA 5C3MA 2R8RA 1N5OX 1XD8A 5FHRA 2ODBA 2DXIA 4K0RA 5JS7A 4IHJF 2OHFA 4OB6A 3RU7A 2X2PA 4EBBA 3PEWA 2CHUA 1X1RA 1BWRA 3LNTA 5D51S 1Y34E 1OXVA 3JZDA 5B6PA 1ANKA 4WSOA 1DDGA 2QYSA 1H0RA 3NM5A 3H3JA 4DLTA 1V6CA 4MUYA 4B43A 2CB0A 2NNWB 4V1CA 3TRIA 1X19A 5CDSA 2GPBA 2Y2VA 1GIAA 1ISGA 4K8OA 2AE2A 5LM3A 4CFSA 1HYQA 4CIXA 1YZNA 1P3DA 1Z0SA 2KB0A 4GI7A 2BDTA 3TTTA 1CLUA 3ISVA 2IZZA 5K8CA 3HP1A 3AR5A 3NONA 3QWBA 3JQGB 4HNQA 4F3YA 2XD4A 1LKZA 1GM5A 5DF1A 2HV9A 4X65B 4TLCA 3EC2A 5IN4A 1E99A 5FFFA 2IEDA 4X7MA 1M1YB 1BG6A 2FPIA 3D0KA 2PKQO 3FUCA 4R5MA 1Y8QA 2F90A 3CSSA 5F3DA 4PTZA 2E55A 1A9RA 4LWZA 1E4YA 1LW7A 4MWBA 4UBJA 5EUCA 1R8JA 3GEEA 4FIZA 3SVZA 2CF6A 4EB8A 5IZCC 1FUEA 4XQGA 2FSIA 1GZ6A 2BKLA 2AWOA 2J3KA 3NU1A 4KXYA 2UUPA 1ZESA 1VIAA 3BWBA 4V2IA 4ZU3A 3H16A 5AW9A 3SFTA 3UW1A 4BC1A 1WA5A 2CVHA 5TJHA 4AKSA 1BA2A 1MVNA 1TCUA 4CFZA 5JC1A 3DEIA 3NRCA 3HP7A 1EK1A 4C4OA 2AJDA 2BN4A 1N25A 1XLTC 4MKZA 2YJ4A 4PTYA 5LP6C 3T7KA 2DPXA 2UXCB 1KFKB 3EXG1 1U0SY 7ABPA 3GROA 1Y6RA 3KT3A 3PCTA 1YDFA 4F06A 3VC2A 5KYUA 1LBTA 4GUAA 4U7FA 1HDXA 2RKOA 1DXQA 3DOFA 3GFVA 3KEGA 2GS9A 4KQFA 3SC2A 1JFRA 4HK4A 5COBA 3DB2A 4TKZA 5IHXA 1C3JA 1VBFA 2BTQB 3C41J 4OPMA 4RPHA 1KVQA 2I4IA 4NTZA 2Q3HA 3T61A 4ETIA 1X2BA 4D6XA 2I33A 3BD7A 1C29B 4N76A 3PRYA 1L1RA 4LIPD 4UQPA 4QZVA 4GEKA 4J1NA 3WTBA 3GLSA 3COJA 1YL5A 1RLJA 3MCUA 4DR7B 1FDRA 1SUAA 5CM8B 3P9RA 4KWTA 3WL4A 1KC3A 1EHIA 3WDKA 3UJBA 3CJRA 1TM7E 5B3LA 1FQOA 2JD0A 1N0UA 1HT0A 3ESYA 821PA 1YULA 3KSZO 4OUKX 1DAPA 4TMZA 3CLTC 3O8LA 3W8EA 1YFKA 4ZYLA 2HDWA 5ALKA 5J5AA 1ZHOA 3W9UA 2QU7A 1WQ4A 2BGRA 3GFTA 5J2TF 4DLNA 4YMGA 3K4QA 4L15A 4XVHA 2VHUA 1N4AA 5A3QA 1SCAA 5B3KA 2H6EA 1OFGA 2AZMA 4EQ6A 3PX7A 1XJCA 1XRRA 1DG9A 1EFLA 2X5NA 4HEA6 1ZUNA 4R6WA 3QOWA 2C00A 5JNRA 3HFSA 3BRWD 3HKDB 5M2QA 1SCNE 2RGUA 4IJWA 4F1JA 4X0EA 1TJYA 4GNRA 2CJFA 1ZGBA 4RKEA 3H99A 2Z09A 3LS2A 4KUEA 3LDGA 4MUXA 2PTHA 4PS0A 4YVFA 3VU9B 3CBGA 3KKEA 5BV7A 2FPGA 2BGUA 2FZVA 3L0IB 2VWQA 2GN0A 3HR7A 2ZT5A 3I2HA 3C98A 1SOWA 2BFDA 1M76A 4JQSA 3EDCA 4GX2A 1F38A 2QTBA 4NOJA 3PUVA 2BAGA 2ECQA 4LFAB 2WUFA 2QXUA 2VWHA 4QXRA 3IT2A 4E15A 3DD5A 3M9XA 3THWA 3DP9A 3C5HA 3I01A 1M34B 1NUQA 1NV8A 2F43B 2VF5X 5DYIA 1AY0A 4U2GA 4JI8B 1ZX1A 1U9YA 3F90A 4ZCLA 1ZI9A 2GN9A 2WZBA 2IHBA 3DCNA 2Q4RA 3AF4A 5EWJA 4YP5A 3E8SA 4EUHA 4DN6A 4MVWA 1IN8A 4CL3A 2W42A 2C9BA 1N9GB 1YR9A 4FX2A 3W77A 3IE1A 4DMRA 3FIJA 4DR5B 4W8OA 3CF4A 1LF5A 4RF3A 1EGMB 4OAPA 5LMZA 1G2IA 2IVFA 2NP6A 2ZJ6A 1SZJG 4D4LA 5IHPA 4L22A 5AOVA 1GTL1 3X1ZA 1O6ZA 2FEAA 5CLFA 2WG0A 1C7FA 3F74A 1CC1S 1YUMA 4HUQA 3PXGA 2JDID 1K7EB 2VPZA 2TMGA 2VBCA 1I3KA 1R5OA 3A4VA 3AL3A 3P2OA 4KR0A 4X3CA 4Z99A 1R0ZA 5F1PA 5FOTA 3ZV7A 4DY4A 3ZE6A 4F85A 1HEUA 3NCTA 4REQA 3I4CA 2OV2A 3F4KA 1YQXA 2ZYRA 4XR4A 4B45A 2IYQA 2AG1A 3D0OA 4EDHA 3QWIA 5CA1F 1DCMA 1L5ZA 3LECA 621PA 3ZBPA 2JBHA 2K4MA 1KWGA 3TW4A 1FFWA 4OM7A 1X15A 4XM1A 1J7KA 3WO0A 2XCUA 2ENUA 1TA0A 4BL5A 5KU1A 5BSEA 2GHIA 1LJ8A 2AA3A 1YS4A 2A7XA 2R00C 4HLDA 4UU1A 5HWSA 1E0KA 3GI1A 3KJEA 2HWKA 3DL2A 2WY2D 2NWQA 1BQ3A 2REOA 4ARZA 1JIVA 2Z8YM 4QUAA 1Q15A 4B47A 4X93A 2DSTA 2PUVA 1RE1A 2BOVA 3AGQA 1I94B 2IHNA 4EG6A 1ZITA 3QX7A 2UUOA 4E70A 1J2JA 3ONFA 4FYWA 3HWWA 4PPNA 2VT6A 4D9FA 4XX1A 2R86A 1J0BA 4FN4A 3S68A 4LBZA 4JLMA 5IXJA 4KAXA 3BYZA 1HDEA 5PGMA 1U8UA 5C7IO 2H8GA 3QU9A 3BH6A 5F7JA 1VE1A 1SOUA 4L3VA 2NZYA 2HBZA 3CO5A 1YR1A 1K8RA 4EY3A 3AM3A 1T3LA 1CZOA 1KDTA 1M8PA 4KOAA 4LCEA 4DDVA 2PWZA 2O3TA 4HAOA 3REGA 3FI0A 1CUAA 5AWFC 3L06A 1DC5A 4UKDA 3WWCA 2OBLA 1U1IA 5HJ7A 3V1UA 2BGWA 2CMHA 3G5AA 1U65A 3IMFA 4X24A 4J8PA 4X60A 1JTVA 4WTOA 1P5RA 4DXDA 1Q0LA 2BBSA 4C0XA 3MINB 5DWDA 3D7NA 1T5SA 3B3QA 1XDSA 2Q0HA 4JUFA 1JHDA 4RUKA 2C2WA 3QSYA 1A04A 3I04A 3UC9A 4QPCA 5FWDA 2M1XA 3EXHB 2Z95A 3IOCA 4PIVA 3ZGVA 1EXDA 4TN1A 3VISA 1TOAA 3QBEA 4DIMA 3F6SA 4DMGA 4DV2B 3FNQA 1B6GA 4QDXA 4MRMA 3ER9A 4OXRA 1M1ZA 2GZ1A 4HMOA 3BMQA 4LGVA 3B2QA 4JBXA 3HRHA 1UBHS 5BURA 3GIWA 2BUCA 3PD7A 2O9JA 1DINA 3GEMA 3OHPA 5KVAA 3OT1B 5CK5A 3GUCA 3H1EA 3ZXSA 4FE3A 4GOKA 3WGZA 1MG0A 3AR2A 1P5JA 4BMSA 4ZQFA 2A5DA 2C98A 1G8AA 1J0EA 3FCOA 3SEQA 4WXYB 4DIDA 2CWWA 4HB3A 1XTZA 1Z16A 2A4KA 3MRXA 4P98A 3HNOA 1ADGA 3I34X 3KHUA 3ST7A 1U3DA 3WRYC 1JDVA 3WB2A 1FXUA 3TLEA 4FKZA 1VMAA 1CJCA 2XHEA 2RHOA 3R8FA 1I24A 4D4MA 5EHZA 2W6JA 5EIEA 4FTWA 2WIJA 4J1TA 4DLWA 5DGHA 1NW9B 1LDNA 1ZH8A 2ZJZA 2QR5A 3RHFA 2H7VA 1L4NA 1Q92A 1BJTA 1O08A 2VHJA 2QDKA 3HCWA 1JYEA 2O8CA 1KI6B 2G9VA 4G0OA 3ZE8A 1O9BA 1UAAA 1XZQA 3GYGA 1Z38A 4FNAA 4LVNA 5LYYA 3K0SA 2PAFA 4QNNA 5C1DA 1C4XA 1IAVA 1N2GA 1TIBA 3MCWA 5HHTA 1O0CA 1RJDA 2BI4A 5I7WA 1G8JA 3KOZA 4Y2QA 4EA8A 1YXMA 1ODFA 3WIDA 2WWVD 1ESZA 1XPOA 4W5TA 3BWVA 3ZJYA 2VP6A 2ZRIA 4FHEA 8LDHA 3E7FA 3MRTA 1JKIA 4TL9A 3U60B 1BYUA 3B1FA 1M6EX 4Z86A 2A3NA 1WPGA 1L5SA 3O2NA 4F2HA 3FUUA 1T4BA 1UM9B 2OPBA 4ZVOA 3VTFA 1A82A 5BQ3A 4TXMA 1CULC 2B34A 4ZYWA 3MSXA 4IXWA 4BB0A 121PA 1EXMA 2VJQA 4HNSA 3ILXA 5DI3B 5IC4A 5ITSA 2X4LA 5KSYA 2CNOA 5AUQA 3I2GA 2C59A 2WTAA 5LUBA 4EMTA 1G60A 1GVNB 1G3RA 3UYKA 3PR2B 5KSWB 5C8ZA 3N1UA 3TAHA 3ZX4A 1ST3A 2KHZA 3PE6A 4D3DA 1M7GA 2EW2A 3C85A 3NI2A 1CCWA 3AI7A 2GXQA 2G77B 4RX1A 5CB4B 4FHCA 2P69A 5LCXA 1ZCBA 2WFMA 3WDLA 4TKVB 1Z37A 4PQRA 3UT5B 4L75A 4A0FA 1LS1A 1Y7PA 4WY5A 1W5EA 4JL8A 1Z7WA 3TSWA 3UAWA 2O3UA 1AN9A 4KE8A 5IBRA 5KU7A 2BZ1A 3FTPA 1QX4A 4M88A 1RQGA 5C51B 1AK9A 4LF6B 2PY6A 2VOEA 1S2IA 2NXWA 4HFRA 2B37A 1N6NA 2LBPA 3UK1A 1NF9A 3GRPA 2OKCA 1L4YA 3TXXA 2OAEA 5I7UA 4MWCA 3VRHA 2IT1A 2VTVA 3ESAA 1RLMA 3KFLA 3WLOA 4ZKDA 1J1ZA 3B20A 1CIPA 3SG0A 1MO6A 1Z45A 1C1XA 4I5FA 2HLDA 4RJLA 3WR5A 4ZVSA 4HVTA 1GGEA 2EBFX 3A1EA 1K6JA 4G63A 4OYRA 3C39A 4RIIA 3WIEA 2ATCA 4HADA 1XJQA 2XCSB 2YMQA 4A0QA 2ZUCA 2CLSA 3IT3A 4JBNA 2I4LA 5K2MA 4OJMX 4REOA 1U8XX 3E58A 2O6HA 3KQUA 4LTMA 3SQDA 5JJLA 2QJOA 2YRWA 3VC7A 2FPSA 2B82A 4G2NA 1V16A 2W93A 3HI6A 4RXTA 2WSLA 1NULA 2B20A 1FSFA 3BD8A 4OSEA 3FWZA 4QGHA 4UXHA 4XTCS 3B78A 4AX8A 4E3WA 3QXSA 3PUJA 1W4AA 2FRVA 2X6QA 4H3HB 3RTDA 4DV6B 2P7HA 1F8GA 3A04A 3KJNA 1U4NA 1Y1PA 4GO1A 5HMMA 3TX6A 2PUGA 3EMBA 1KQOA 1NN1A 3I0MA 4L4SA 3UATA 3KLBA 4N48A 4ENQA 1QQBA 2AVNA 4BDSA 2OZVA 3D2CA 1E7WA 1TCVA 3N0WA 4BX8A 5IMSA 1QP7A 4WCFC 3UCFA 3VR4D 1P5ZB 3O73A 4MVJH 1B23P 4PY2A 3P9CA 3GG9A 2ATIA 2OGUA 1ZGJA 3KU1A 3H0EA 4J0HA 4M0UA 1T3HA 1C1YA 2AMJA 3IUNA 4EJSC 2I9KA 2V3VA 1H0HA 1PU2A 3E70C 3K1YA 3QEBZ 2Y99A 3O94A 4E12A 4QPZA 3HJRA 5JH7A 1FNNA 2A5GA 3C14C 4EHDA 3Q8LA 4NXMB 2HMYB 4CKWA 1P17A 3AUXA 1G6OA 4MQEA 5DRTA 4ZVMA 5CXXA 3HU1A 4BECA 3TINA 3BQ9A 4HAZA 4AJLA 4HF7A 1CUFA 2YHBA 3VJKA 2XNCA 3HKBA 4IO0A 5HMLA 4CEIA 3LE8A 1FNDA 1N2JA 1IZ8A 1EDEA 1PHRA 4RLSA 1AK1A 2B25A 4GOOD 2WP8J 1W36C 1HSOA 3M6LA 4UMEA 3NUQA 2WUVA 4QBHA 1W2WB 3CSUA 2WD7A 1S9DA 5JSHA 3U5TA 5ES4B 2QYOA 2D2FA 2MSWA 4M0CA 4DA4A 3BB3A 4YRZA 2PJDA 3WLQA 1GQFA 4Q48A 4D9KA 3QEKA 4D0SA 3JARB 3OTWA 2ILTA 3CVWA 4F60A 1T8TA 3NW9A 5JNTA 4QC2A 2RHLA 4CDRA 3CR7A 4JD5A 4OFWA 2PKWA 5DN6D 2NZJA 5JS2A 4W5OA 1MFZA 1MCZA 2W37A 2WM8A 3KTFA 4IDEA 4JR1A 4M53A 3IILA 4M2LA 4ZO7A 5ENVA 5GONB 3ZQ6A 1LBIA 1RQPA 1KYIA 4P6VF 1RABA 3WYNA 1IHXA 2CHEA 1LNZA 2WA2A 3MTQA 4F12A 1R4NB 2D74A 4MI1A 3DWIA 1R4AA 1YBMA 3EMDA 3CPJB 4ZODA 2Q1WA 3EQ6A 1O7JA 3EVNA 3TMYA 1ISPA 1MX1A 4G65A 4JU9A 1Y1RA 4AI6A 1PV2A 4XAQA 5DMXA 1IEVA 5FPYA 1SKBA 5U1PA 3PICA 2GPSA 1D2NA 2KWIA 4CN8A 4ER0A 2HIAA 2GAJA 1ACLA 1P3JA 3BWXA 4KWIA 4TXNA 4ZCQA 4O08A 4ESVA 1H93A 3H3FA 2JJ8A 3ETHA 1P77A 3HJBA 2FR8A 3LLUA 3OX1A 4J29A 4U2CA 5EMHA 5GGYA 2F3SA 5FL3A 4EGAA 3EULA 1UPBA 2QE7A 2XCLA 3EVBA 1O6BA 1WVMA 3K0CC 2JFHA 3R24A 4HXYA 4KXXA 4HWSA 4TTJA 4XSHA 2Y4OA 4PU0A 5P8WA 5B3JA 1ZCAA 5FKJA 5JS1A 2QSJA 1X92A 4N4AA 2M32A 3Q9UA 1CQJB 3GLVA 2O50A 1A5SB 3TSAA 1HOTA 2CNWA 4HO1X 1NUTA 4WKGA 421PA 4R4JA 1ZXXA 1T8UA 3U4HA 1GFIA 2HA3A 4AKEA 2D54A 2K2QB 3F0TA 3M1YA 2VN8A 1P2GA 3K09C 1XXHE 2ZYSA 3E9YA 5C2JB 4J03A 1NP6A 4ARSA 3C1OA 5LFAA 3I1IA 1IUKA 4ND4A 1WV0A 1ISSA 1L8LA 2QTFA 1UFVA 3IDOA 4Z53A 2VNSA 3P32A 2B1QA 2CFRA 1SU4A 4HAWA 2H4WA 4LMRA 3TGPA 4BBAA 2RJOA 4IVNA 1H85A 3KXPA 4P4UA 3QFFA 1YCGA 3FM9A 3QXGA 5NULA 1JPUA 1PYGA 3MQFA 2WQ7A 5I7OA 4MQ5A 4Y18A 3HJAA 4QAJA 3WMFA 4S1NA 2PT7A 2P9YA 1WTAA 1KKMA 1K06A 2B8EA 3LY7A 4I50B 2DG2A 1K66A 2Z3WA 1CTQA 4U63A 5DBIA 4ZYTA 4LY0A 3A9RA 3EXIB 3S7TA 1B3RA 2KMLA 3T12A 4B3FX 1H94A 4KMOA 5SZKB 4QDZA 4AL4A 5KTNA 1RYEA 2O0MA 3SKYA 3GJ8A 4JLUA 4OHWA 4U1RA 3HVJA 1A4IA 3MLBA 4Y1FA 3SS9X 3V1YA 3LM8A 4BVJA 4JYAB 1YU9A 3DM9B 2VIIA 5JY6A 4GVPA 5FWYB 2V5AA 2FKNA 4C1BA 4DS3A 1FX1A 4S2EA 3RVSA 3D5QA 1GZHB 3DHNA 1YONA 3T5GA 4IG9A 5EIOA 1HI9A 2JIDA 3AOEA 3JYOA 1YKSA 3PI7A 4HGNA 1X38A 2I3ZA 2BIFA 3UMBA 1A2BA 3MOIA 2GPYA 2YRFA 4X1YB 3WQSB 3WGVA 5JAUA 4DDKA 1IH8A 1K7YA 1ZA1A 3IIEA 3NGLA 4PONA 4W8HA 5JRJA 2J5RA 3GP8A 4AYTA 3QVKA 3OF2A 3AJ9A 3KQWA 3RK1A 3WB9A 4WNAA 2PX2A 1CZKA 1J8DA 3PT9A 2YZGA 4FYHA 4HSGA 1C8VB 2YZ7A 3PNLA 3PNYA 1I01A 5HUQA 5AI5A 2F6RA 3RU9A 5CG2A 1IPHA 2XMDA 4IVQA 1OX5A 3VSCA 5K20A 4HNAB 3NYRA 2FDCA 2C5LA 2ZBEA 2ORVA 4QPNA 3NDIA 1E3LA 2QRZA 1T9GS 2PWYA 2QN9A 5LB2A 4DNFA 1XHEA 1J2YA 2WIDA 2QTAA 3O47A 1QQ6A 2MMGA 2FPPA 1FTYA 3ZLTA 5HSGA 2HEIA 3UICA 3EZFA 4I3HA 1NN0A 4L07A 1OHHD 3A6LA 2WAXA 4FXPA 1U8YA 4L9AA 4JZYA 3QQPA 1Z4IA 5FBVB 4KXFB 1R64A 1GTVA 5G1NA 5GONF 3I01M 1DAKA 4NBWA 1VECA 3E22B 3W8NA 3ROXA 1HT1E 5TQVA 4X6UA 3W2GA 4WN9A 1T36B 3SYKA 3DL7A 3ZWCA 4RYDA 5NLLA 2XVMA 3TLGB 3F96A 2XF8A 3I8XA 4ITRC 4PQGA 2GAOA 1QF7A 1U8FO 2IV3A 3AL0C 4OBWA 2JFNA 2JJ1A 4KO4S 2GI4A 1M7HA 2PDAA 3KT0A 5CHYA 3M5PA 2OSVA 2AZXA 1A76A 1F8XA 1ZNQO 5SZHB 1QOZA 2W83A 1SCBA 2B1RA 1IN4A 1E3QA 1LV7A 5KI6A 4BO9A 3OFSA 4Z1MA 3JQBA 1XNRB 3W90A 1XA3A 2SKEA 3H7IA 4H31A 4BB6A 1WX1A 2NSYA 3PNKA 4LVCA 3DEJA 2DJIA 2GKOA 1ISJA 3NHPA 2VDWB 4TTVA 4EVIA 2OCLA 2F8TA 1QVAA 4HX2A 4UBIA 3FOFC 1YMUA 4E94A 9MHTA 1GQ2A 4OLFA 4TRRA 3NDRA 1FFAA 3F9IA 2FN3A 2EFDB 3W8FA 3WGOA 1TD1A 3N2YA 5JQGF 4IUBS 2DBVO 1WB4A 2ABWA 2PT6A 5BOSA 2QN2A 5JDIA 1MAWA 2WTMA 5FOXA 1XKLA 2FPKA 4JYBA 2NX2A 1R8QA 3FNIA 2IEIA 3NVDA 2Q0SA 2QR2A 3ICPA 1Z8NA 4KNYA 1CS0A 3BS4A 2NUAB 2QZPA 4NFYA 5HDBB 1KAEA 5C7YA 2OOSA 2GRAA 3OOSA 1T0UA 2J30A 1VMIA 2PSEA 4FLEA 4BV9A 4BGEA 3IJRA 1DRWA 2RGEA 3H2HA 3A4LA 2ZETA 3K0AA 1SVIA 4MWGA 3GLGB 2ZE5A 2CKDA 2QW8A 1V96A 2HK7A 3QLEA 1XRQA 5EE1A 2DFTA 2E7ZA 3ZW9A 1J21A 3VZCA 2IXFA 4NARA 5I5GA 1X7WB 2QVYX 3CJQA 1PJ3A 4JMLA 4MV9A 3GJYA 4Q39A 2W43A 4XUCA 4QTYA 3TPZA 1SWWA 4OLBA 1G5IA 1PZGA 3KV1A 1OH7A 4D92A 2OK7A 2I29A 4QGAA 2MU1A 1U2EA 3TI7A 1RRFA 5CBPA 1HDRA 1MPXA 1KFEB 2JIZD 4KXMA 3VJLA 2VI5A 1KR2A 5MDHA 2WT9A 1VE7A 4DILA 3STWA 3IALA 3T1OA 5EYPA 2BEJA 1CIVA 1CE8A 1TM1E 3CUVA 4H6VA 4JYMA 5IAJA 1MOPA 3SJAA 3V8PA 4WZAE 4F21A 3THYA 1CF4A 1XLVA 2J6BA 5BNIA 2HMTA 4PLCA 1LV8A 4DIBA 2Z3VA 1TL7C 1XMJA 1XTUA 1U3VA 3P97A 3TRDA 1OV4A 3FOCA 3HDJA 1D5CA 4N47A 1GT91 1XYYA 1JEAA 4R69A 3PEFA 1CRWG 2UYGA 2A0KA 4PICA 3KUDA 1WCWA 4JLAA 3L43A 2C0CA 4YRGA 4KN6A 4O4HA 1YQ9A 4OFXA 2ZAYA 1KKLA 2X58A 4GZ5A 3R0ZA 3LU1A 2J59A 4B17A 1KP9A 1QRAA 5BSTA 5C37A 3CZRA 3KV3O 4PR3A 5FA8A 1LZKA 1CJMA 2FCRA 3C7AA 1Y98A 3U19A 1YE5A 4R9NA 1FDUA 2Y71A 5JO9A 3TKLA 2I4MA 3EY9A 3IQIX 1YQUA 3ZQJA 4AN0A 3AUJB 2GX6A 2W2VA 4HXFB 1CS4C 2A88A 1QG4A 3Q3JB 4OJNA 2SKDA 3KEOA 4DAOA 4PR0A 2R1VB 4Z7OB 1L5RA 2CK3D 3CEPB 5KEIA 1UFOA 1P91A 1UKZA 5HS6A 2NZ2A 1UOPA 4XIIA 3OH8A 2RHRA 1JDJA 3VKWA 3BIFA 2WWIA 3BWMA 1B43A 1JHZA 1ATIA 2E4VA 4D79A 5AYVA 3WFJA 2DX7A 3H1TA 5DGDA 1WXFA 3L7OA 3ZGLA 2Q5CA 1O4VA 1YRAA 1KAHA 3EEFA 3HN7A 4YR7A 4ZI2A 4WRRA 4JITA 1ZAYA 7MHTA 4IQGA 6ABPA 4Q1CA 1Y42X 2P2GA 3RFCA 4Q4CA 1CUCA 4CIYA 1H2YA 4EO7A 5JT1A 3H5RA 2VNJA 1P0CA 2WYUA 1FP1D 1ADBA 1ULTA 1IY8A 1BXGA 3ANTA 4NBLA 4RJKA 1LLUA 2QMZA 3PC2A 4K6GA 5FH9A 2IXAA 2PA0A 4W6QA 2PGIA 3EIXA 1T0JB 2AYZA 2OLKA 3A70A 1CEEA 1GTMA 5DH9A 4NBTA 3JASA 1J70A 3RVLA 5I5EA 2CCKA 1NF8A 3LXMA 3C1UA 4HBZA 2LKDA 4P84A 4N0DA 1ZSYA 4BLSA 4FWIB 2G28A 4BRSA 4K2AA 2HN9A 3P94A 3V4SA 1FSPA 1IQRA 3BGWA 1XD9A 4PCAA 3EOZA 2XB2A 5KWSA 1PG0A 4XARA 4JLOA 3ITNA 1E92A 4M22A 5EHNA 3R5TA 3EZ2A 3R9KA 3BBPA 3BGIA 5BQXA 4DNXA 5BUCA 2Q6TA 1MEEA 3K9LA 4MYUA 4AD8A 1P1CA 1FMLA 4MDHA 4EHNA 1Z3CA 3CSDA 2LIVA 4QASA 4RS4A 2FQWA 3DWEX 3OX2A 4B3DA 5HCIA 1DXOA 2CCGA 1GV0A 5FBWB 2CT8A 1TAQA 5CW1A 2QAJA 4CG0A 2FNAA 1QDLB 2OFWA 1V11B 1IOLA 1IPEA 1JG3A 4DHWA 3RIMA 4NXNB 3QYAA 3B1JA 4BVGA 3A0RB 3QF4B 3UAOA 2Q8NA 4TZ6A 3V46A 4BKRA 5BYAA 3Q2KA 3ZLVA 2JHFA 1E9BA 3NS7A 3C2QA 4BPRA 2YXPX 4DCMA 1FJGB 3GGSA 3MERA 1JLRA 1XRMA 4QSMA 3GJ0A 1QOPB 2OG2A 3VYRB 5LQDA 1VZ3A 1A71A 4BNNA 5DJ5A 2WSIA 1KVSA 2M2IA 4YUZA 5LJLA 4GR4A 2ZUWA 1X3LA 2V03A 1X87A 3P9NA 1PJAA 4ES6A 1XCPA 1JJFA 1AKQA 3DV0B 1YHNA 3LY8A 4IIJB 2E21A 1NPYA 5FULA 3GLTA 4C6TB 3AKYA 2VP3A 2X7JA 4N8DA 3WL5A 4INOA 3QX9A 1OH6A 4QVGA 2XE7A 3BE5A 1YVEI 2ZANA 5BSFA 4O4IA 1Z5OA 1U8ZA 3EAGA 3CMMA 3PEEA 2RGYA 4RFLA 5F2KA 2J4DA 4DA7A 4HWRA 3GP5A 3WMRA 3FTFA 1WTCA 3SZ3A 4MV1A 4B4OA 2JI9A 2ARKA 1HDIA 2IX9A 5EIWA 4F46A 4YV0A 5EZQA 2QUZA 5F76A 3WP0A 2ZAGA 1SA0A 3HN2A 4G67A 4RK6A 3UA3A 1AS3A 2PGDA 3VSEA 3GLFB 3RNOA 1E1KA 1WSDA 4DZZA 2J4CA 4HAVA 2M9MA 1WBDA 5FFMA 4EHIA 1VPLA 3WWYA 4DUGA 1PGOA 4DV7B 5CYOA 3WNVA 1PJLA 2ASVA 3DC7A 5AKJA 5L4NA 5FUXA 1QLWA 3GHYA 4BFTA 4PCUA 1I9CA 1MUUA 5D8DA 3OZWA 3EQ9A 2G5PA 2M6SA 3D2BA 3EGOA 4ZO9A 2JIPA 3E1GA 4NSNA 5A03A 1R6DA 5I4BA 5KC8A 3KPVA 2GD1O 1J4AA 3GA7A 3N0VA 2OUIA 4F6LA 4OA8A 5FB3A 5TE9A 5EJ9A 4JB0A 5L51A 1LTHR 4JEHA 1AU9A 3U4DA 4D97A 5BORA 4RGBA 4URYR 3H2ZA 2CV1A 4RF5A 2GBIA 2CVQA 4LZWA 3CX3A 4NYJR 3LMKA 3CH6A 1N8NA 2QV0A 3IBGA 1W44A 1R6VA 2IV2X 3FLAA 4F5WA 2FFJA 2Z1DA 1LH0A 4FYMA 5BRAA 4JYPA 4CMIB 3IKLA 2MJLA 4KV9A 4KPUA 4QGFA 5F4ZA 2P91A 1WY7A 2CLCX 2O5RA 4Y7CA 1WO8A 2Q4BA 2QLMA 2ZUFA 3PPYA 4B5KA 4O4JA 3PP8A 1T10A 4R9SA 3IH5A 2FPWA 3QUQA 3ZVLA 1E2BA 2RGNA 2VT2A 4HVAA 3GBSA 5DLYA 2Y1OA 4G37A 2JRLA 4LZNA 4YFYA 3SNHA 4EF6A 1SXQA 3LX4A 1CDDA 4R8MA 2YJ5A 3DDCA 3RVOA 3WGJA 3X1DA 3KEQA 3BJIC 4WV3A 1PV4A 3MGGA 1QAOA 3BXPA 2PKRA 5FPPA 2HMAA 4JKOA 1CVRA 1NR1A 5JVDB 1X6VA 4BP8A 2EZTA 1THMA 2XVAA 4RH0A 4NV1A 3INYA 3A11A 3M4ZA 2R2GA 3PUXA 1AGNA 1GYPA 1BH6A 2WKRA 1Q3TA 1WETA 2ZYGA 3RB8A 3T1YB 4HH3C 1LU9A 5FNVB 4MQ4A 1Y80A 5KKCA 3L1HA 3ABSB 3THSA 1KORA