4PSCA

Structure of cutinase from trichoderma reesei in its native form.
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
220
structure length
220
Chain Sequence
WPSINEFLSELAKVMPIGDTITAACDLISDGEDAAASLFGISETENDPCGDVTVLFARGTCDPGNVGVLVGPWFFDSLQTALGSRTLGVKGVPYPASVQDFLSGSVQNGINMANQIKSVLQSCPNTKLVLGGYSQGSMVVHNAASNLDAATMSKISAVVLFGDPYYGKPVANFDAAKTLVVCHDGDNICQGGDIILLPHLTYAEDADTAAAFVVPLVSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Cutinase from Trichoderma reesei with a Lid-Covered Active Site and Kinetic Properties of True Lipases.
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
molecule keywords Carbohydrate esterase family 5
total genus 74
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2014-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pscA00
4KRYA 2V96A 3BDVA 4Y7DA 2PKYX 1QONA 5D3ZA 2XUAA 4OUKX 2HA0A 4GI1A 1ORVA 1JU3A 1F6WA 2XLBA 4Y2RA 5K3AA 5JAPA 3SK0A 3LCRA 4X00A 1A8UA 3H1BA 5K3FB 4BAGA 1P0PA 3DDUA 4BP8A 5IH7A 1J07A 5HK8A 5CT6A 3W9BA 2PU5A 3K6KA 4QLAA 2XQFA 3FLBA 1BN7A 3WMRA 5H3HA 3RK4A 1XLUA 4J3JA 4ZRDA 1ACLA 1BN6A 4U2CA 3X3HA 4EY4A 5A2GA 1ZOIA 5HF8A 3WWOA 4DM7A 2BAGA 1CUWA 3ZLVA 2E3JA 2XMRA 3NWOA 4MWTA 3A2NA 4IQ4A 1UK6A 3G0CA 3HYSA 3VJMA 1W75A 4BRSA 4P08A 2BGNA 3H2KA 4TPKA 3V1KA 3BDIA 4FFVA 4XVCA 5BWCA 1MJ5A 1MPXA 3G9XA 5ALIA 5EFZA 2DQZA 4M0FA 3ZLTA 1YS1X 3C5VA 3HRHA 1K4YA 4CCYA 4D9JA 4ZI5A 2WIFA 2G4LA 1BU8A 1ODCA 4ETWA 5AIBA 4H7FA 5FRDA 1DQYA 2OPHA 1L7RA 3O9VA 2QXTA 2O2HA 4Y2VA 3ESBA 1I6WA 2V9ZA 4A5SA 1PFQA 1N5MA 5AKHA 4AZ0A 1WB6A 1ACJA 3OOSA 3IA2A 5CURA 3QITA 2OAGA 1VKHA 5K3EA 5SYNA 4Q34A 3WA7A 1FJ2A 3UMJA 1ODSA 5A7GA 1CUBA 4H7JA 3V1LA 5JADA 3B12A 3CCBA 1Q83A 1UT6A 3BIWA 4WFJA 4BRZA 4UBNA 2PSEA 3DOIA 1EHYA 1XKTA 3FYUC 1DU4A 2Z3WA 4UHDA 1UOPA 4ZV7A 3C6YA 3R3ZA 1ZD3A 3VJLA 1WM1A 2H7XA 1QIDA 2R11A 1R50A 5FXMA 2OAEA 3WKDA 3L1JA 1JI3A 1XQWA 1FFDA 4AX4A 2XMBA 5FUMA 2ZYSA 4FOLA 2VAVA 3I2GA 4F0JA 3G0IA 3UUFA 4G9EA 3DD5A 4M0MA 1LLFA 3KD2A 3WWCA 3WYNA 1E8DA 1UOOA 4KR0A 5AKKA 5JIBA 1ZD4A 4BDSA 4N5IX 1H2XA 3GA7A 2VATA 3IDAA 3PUIA 3FOBA 1WOMA 3WL5A 5DYYA 5DLPA 3HI4A 1XZMA 4P93A 1EB9A 1HBJA 3G9TA 4CFSA 5BOVA 2DR0A 5ALMA 1EVEA 1BEZA 5ALYA 3PI6A 3WL8A 3KWFA 1LPBB 1DQZA 3E4DA 4UHFA 2Y6UA 5A7HA 2OCKA 3OURA 4L0CA 2OCIA 1AX9A 5AKZA 1MX5A 4JEIA 1F8UA 1TAHA 1CUEA 4NMWA 4HVTA 5ALQA 3IULA 1QTRA 1K5PA 1XFDA 4ZREA 3YASA 5HQ3A 1A8QA 2O7RA 4WY5A 2XMDA 5ALGA 3WWPA 3JYHA 2VJDA 5J3JA 3AZQA 1YSCA 4UPDA 2ZJ6A 4DLNA 4AO7A 4H7IA 3FSGA 4YK7A 2WLSA 3ZI7A 3AZOA 1QIGA 2HFJA 4H18A 1ZIYA 4DMHA 1AZWA 2HU8A 2XMZA 1J1IA 2GBFA 2J4FA 2GYVA 4CI9A 3HXKA 4CIBA 2XUJA 4J0CA 4Y2JA 1C7JA 4Q3KA 3DS8A 3WI7A 2H1IA 5C8XA 5E4JA 1VXOA 1D07A 2CBGA 5DYTA 4TGLA 4FHZA 5JANA 1BCSA 3LLCA 3QYJA 1CUSA 4QLOA 5HKBA 1WB5A 4H77A 2CUTA 4PQEA 4A16A 1UWCA 4J0JA 3M81A 1H2YA 4UHHA 4W1PA 1XZKA 2O2GA 3DKKA 2Z3ZA 4X6YA 3H0CA 1ISPA 2QM0A 5SYMA 3FVRA 2PBLA 3W2TA 4BP9A 2ACEA 3G0DA 2WU3A 4FKBA 3M3DA 4B6GA 4DNQA 5LZ8A 2CEKA 4ZXFA 5CT5A 1QTIA 4IHAA 4X90A 5AH0A 2JGLA 3L1IA 5EIEA 1HLGA 4DNFA 2AJBA 2CZQA 4WFIA 3I6MA 4AB1A 1C4XA 1BS9A 4RNCA 2EDCA 3H2HA 4F21A 5KREA 1VZ3A 4JYPA 1CUVA 3D3NA 4FDMA 5HZGA 1KU6A 3CXUA 4FLFA 5JD6A 5HF6A 5C7YA 1U65A 2VSQA 2WFLA 3R41A 5AKIA 3WIOA 3C70A 5K3CA 1N1MA 1EB8A 1GZ7A 5D3KA 3T52A 4WY8A 5JD4A 4MYDA 5AP9A 1WHSA 2AJCA 3D2BA 2JF0A 4PF1A 1CUUA 4LIPD 5AIAA 4MWSA 1CPYA 1O6GA 4IO0A 1JT2A 3G9UA 1LPAB 4B81A 1EX9A 4ARBA 1FFBA 4FWBA 4Q3LA 3VKFA 4U2GA 2JIDA 1XZGA 5EI5A 3HEAA 4GECA 3WKBA 5LKRA 4E14A 2H7YA 2J4CA 2BCEA 3LIIA 3DQZA 4K5QA 3H19A 2WUEA 4J03A 5EHXA 1QJ4A 2JGKA 2XMQA 3OTQA 2XUFA 1VJ5A 2JEZA 4NS4A 1R4ZA 4RE6A 4XWGA 4H35A 2Z8XA 1P0IA 4FTWA 4WDRA 4OYLA 4Q1VA 5ALDA 5ALTA 3H18A 3G8YA 2O2IA 2WJ6A 1DT5A 4QWMA 4H0CA 4HAIA 1LNSA 1GQRA 4N5HX 4FBMA 2I3ZA 1QO9A 3TGLA 2B4KA 4X94A 1GPNA 1XRRA 2EDAA 3FVTA 3O0DA 5ALJA 5EGNA 4LKOA 1AGYA 4AO8A 3FNBA 1XZFA 3A70A 2ES4A 2RHTA 4PNZA 3QVMA 1R88A 2XUIA 1A8SA 1YASA 1XZCA 2RHWA 3NOXA 2XUGA 3AILA 2DFPA 4ZWNA 1GXSA 2C58A 2OGTA 4MEBA 4MXDA 4X6XA 4C89A 1XRQA 3RKSA 1GPLA 4F5ZA 3C45A 5I8PA 1K6EA 3I2KA 3GUUA 1B41A 5AO9A 5AI8A 1VA4A 3ESCA 1K8QA 4ROTA 4PSUA 2DHDA 1EDDA 4IH9A 4RPCA 2VJBA 1Q0ZA 5AKJA 4EY6A 2HHAA 4AZ3A 1QIJA 2QUBA 3SWWA 5AJHA 3IUNA 2VF2A 3C6ZA 2WJ3A 4G8BA 2BUCA 1LGYA 4N8SA 5K3BA 4AMZA 2PL5A 4Q05A 2C7BA 1Z68A 2IX9A 1VZ2A 4UBJA 4G5XA 4P9NA 2B20A 1G42A 2BUBA 1XQVA 1OILA 1THTA 2WFZA 3G0BA 5HFNA 2OG1A 5HK9A 3F98A 4UFPA 3C5WP 4QDZA 4BAZA 4B84A 1HKHA 4G8DA 1ZIXA 4GEGA 2RGUA 1IZ7A 2AJLI 4LYEA 1HPLA 1TCBA 1FFEA 4KAAA 4UBMA 4LYDA 5CTAA 1YA4A 1EH5A 3KDAA 1ORWA 3WK6A 4UBOA 4FFWA 1DWPA 5AK4A 3FYUB 4BAUA 4DYHA 1L7QA 2XQJA 4C87A 1VLQA 3FYTA 3VDXA 1MU0A 3I2FA 1NU8A 1TIBA 3VISA 4KE8A 3N2ZB 4WDQA 2QKYA 5E2IA 2R8BA 5HFAA 4B7ZA 4W9RA 3WYDA 1E89A 3CCCA 5YASA 1DTEA 4QZVA 4Y2XA 5AM0A 5AOBA 4BTVA 2CKMA 5A71A 2I3DA 3PUHA 5CW2A 2Z8ZA 3QPAA 1XZLA 3HC7A 2QJRA 4RGYA 4BDTA 4K6KA 1X2EA 4QDXA 4KACA 1A88A 4P92A 4XJVA 2QRUA 1MTZA 1VXRA 4XIIA 5FPPA 5A6VA 1G5FA 4J0GA 2QMQA 2C5FA 3FAKA 3CN9A 2HU7A 2WUFA 3O4GA 5AKXA 4UHEA 3FCXA 1JKMA 1F0NA 4QE3A 2PSHA 3NGMA 3BWXA 2QUAA 2HA4A 1CQWA 5IKXA 1ZD2P 4G8CA 2VJCA 5AKLA 3D0KA 1XZIA 3OM8A 5LZ5A 3WKCA 2GBIA 1IZ8A 1ZD5A 3WK7A 1XROA 5JZ9A 3F9CA 4MQMA 2WHPB 3BJRA 1W6RA 4DMKA 5LIPA 3D4LA 3GZJA 1FSSA 2Y6VA 1CUXA 4UHBA 2VJAA 1MO2A 3F8SA 1SFRA 3IUJA 1Q0RA 1XZAA 5BWBA 1RWQA 4KE6A 2J3QA 4DNPA 3IVMA 1W4LA 2WTNA 2OQVA 1XZJA 4GLBA 1R1DA 3OPMA 5DWDA 2OQIA 3R40A 5D7BA 1NU6A 3I28A 3GBSA 4EY8A 4U2BA 1EI9A 1Y7IA 2PM8A 3IUMA 4H7KA 3AZPA 1QO7A 3Q0TA 3WL6A 4DIUA 2DHEA 3BJMA 1EA5A 1OCEA 4W63A 2WUGA 3PICA 4AO6A 3I6YA 3H04A 2OLEA 4HTAA 2WG0A 5DYWA 3STUA 3WQHA 3ZV7A 1XLVA 5ALLA 1DX6A 1SC9A 4BB0A 3DJYA 2G5TA 4DMFA 4Y2SA 3JW8A 4N8DA 2XUDA 1T4MA 3AJAA 1IUPA 3IBTA 4W1QA 5K3FA 3STVA 4NVRA 5EIAA 2ZYRA 5AKEA 5AI6A 5DNVA 2H7CA 5HF5A 3GELA 1SCKA 2I03A 3T4UA 3WK9A 5AI4A 2WIJA 3IUQA 3AUKA 3KWJA 3WK5A 5CT8A 4C4YA 4FNGA 1QIKA 3I2HA 3DCNA 4X85A 3W9UA 5FP0A 1FFAA 2GYWA 2WQZA 2WJ4A 4ARAA 1AMNA 2V98A 5I9IA 1X2BA 5DNWA 1ZI9A 5KWIA 2X76A 1FFCA 4BBZA 4DMCA 3B3QA 3QM1A 1UK9A 5CT9A 1O6FA 3I1IA 2XMGA 4CG3A 2ZVDA 1ZGCA 2C0PA 4KYVA 3S2ZA 1XZEA 3ICWA 3H17A 3DYVA 3AIMA 1R9NA 1EXWA 5AHXA 1CVLA 1U2EA 2PVSA 1MN6A 3HACA 2XLCA 4LHEA 4DSZA 1YR2A 2XQKA 4BCCA 2XI4A 5IVIA 3QMMA 4WCVA 5IVDA 5AM5A 1ZI8A 1USWA 3ANTA 2JBWA 4JNCA 2HDWA 4B82A 3WK8A 3RLIA 2JGMA 2YH2A 5AICA 1YB7A 3HABA 3UUEA 4DNOA 3VJKA 3V1MA 3FLEA 2H9YA 4Q3OA 3C6BA 1LBTA 4BZZA 3I2IA 4PSCA 4OPMA 1HQDA 3BL8A 5JAOA 4E11A 4WJLA 4LXIA 4Y2QA 1AUOA 3R3YA 1LPMA 1XRMA 3DLTA 3W04A 1CUCA 3D59A 2QZPA 1LPOA 3AFIA 1BROA 3DL4A 4U2EA 2O7VA 5T4BA 4I4CA 4MJ3A 4Y2YA 5IVKA 2WFLB 4UHCA 4X91A 4B80A 3EQ8A 1CUZA 1YAHA 2W6CX 1BE0A 3A2LA 1WPRA 1JMKC 4UUQA 2AJ8A 4OU5A 4ZGBA 3QPCA 4J0IA 1LZKA 5T4EA 3D2CA 2WIKA 3R3UA 3O4JA 3E0XA 2RIPA 5DTJA 3A2MA 3OG9A 4J0DA 3WJ2A 5DJ5A 2Z5GA 1G66A 2HU5A 1HDEA 1P0MA 1QE3A 2YASA 1BRTA 1LZLA 3PF9A 5ISMA 1U8EA 5AK3A 1UKAA 3H2IA 2ZYIA 3F97A 5LZ4A 4J7AA 4BC0A 5JZSA 3R0VA 4AN1A 4FNMA 4UBIA 3STWA 1R3DA 4K6GA 1GKKA 5DTIA 2BFNA 1ZGBA 3DL7A 1R9MA 1MAHA 4G4GA 1Q84A 1XLWA 3V48A 3WWEA 2QJWA 2HA2A 5KWJA 3O4HA 5I7UA 1S8OA 1Y7HA 1W52X 5ALXA 1NX9A 4BE9A 1QLWA 2BJHA 1TQHA 2HA5A 3WJ1A 1AC5A 5K5EA 3FBWA 2VAXA 3E3AA 3A6ZA 2AXEA 3GFFA 1VOTA 2HL6A 3QPDA 1IMJA 4QDUA 2GYUA 5AK5A 1W76A 3WKEA 1CUIA 4H7DA 3FLAA 4BYMA 3QMVA 5JD5A 5T4FA 1BCRA 2GZRA 2VT6A 3BXPA 1TK3A 1ZI6A 4OB8A 3PFBA 3HJUA 5LLSA 2WUDA 3F67A 4AMYA 1P0QA 3B5EA 1CEXA 1CV2A 2QR5A 3KXPA 2QS9A 5AKGA 3HLKA 1XZBA 4HXGA 4DSAA 1QFSA 4L3WA 2I78A 3DNMA 1CIJA 2LIPA 3SX4A 1VE6A 5ESRA 2WKWA 3P2MA 2WIGA 2FJPA 4U2DA 2WHRA 2PSJA 3FSGD 3QBJA 4I19A 1GPKA 4EB0A 2OXEA 4KRXA 1LPSA 5AOCA 3M83A 2ZYHA 4BCBA 2PSDA 1QIMA 4C4XA 3WWDA 5ALRA 1M33A 1ZJ5A 3C8DA 1DWQA 1UK7A 1LPNA 4X7BA 2XUHA 4W1RA 3AINA 5D6OA 5A7FA 4Y2TA 4DGQA 3ZWQA 2ZJFA 4N8EA 4Q82A 2VTVA 4PW0A 5CH3A 1DINA 1DT3A 2ZJ7A 3I2JA 1A7UA 3BF7A 4GBGA 2ZSIA 3TRDA 5HKAA 5CBKA 2XUOA 4OYYA 4Y9SA 5HQ3B 3O4IA 1EDBA 3D7RA 2D5LA 1GT6A 1JMYA 1N5RA 4HXFB 2ECFA 5ALPA 1OXMA 3E1GA 1CUJA 5ALWA 4V2IA 3N0TA 3EBLA 1EVQA 2HADA 5FLKA 1CUGA 1C7IA 4S0XA 2HA7A 3ANSA 5CXUA 5IVHA 1UZAA 1JJIA 1F0PA 5LKAA 2WILA 1SCQA 1VE7A 2XQGA 1CFJA 1UFOA 1YAJA 7YASA 2FJ0A 3DOHA 2C0QA 2YXPX 5EHNA 2QT9A 4K6HA 2D0DA 1CQZA 5ALEA 2W22A 3RARA 4PSDA 1THGA 2B61A 2G5PA 2GBGA 2GBCA 4L72A 3G7NA 4OD0A 5JZBA 3L1HA 5JALA 5CH5A 1UXOA 2WHQA 3CN7A 2XDWA 5ALVA 4HZGA 1UOQA 4QEKA 1JJBA 4EA6A 4CCYB 3PFCA 4EZIA 1TCCA 4UBLA 4GW3A 3EIOA 4EBBA 3FWHA 2JGIA 4YASA 4RE5A 3BE8A 5C8ZA 1MAAA 2CMFA 2CB9A 2V97A 3MUOA 3GROA 2WIDA 5ALZA 5ALKA 5E4TA 2DSNA 1H2ZA 2HRQA 1XQYA 2ACKA 5HCUA 4EUSA 3PDCA 3VXKA 2ONCA 2VA9A 4QWWA 1QFMA 1X70A 2HFKA 4J0KA 5ALSA 2EEPA 3F96A 4IH4A 5ALNA 1W1IA 1AURA 3C43A 4B0OA 4YX9A 2GZSA 3DEAA 5AM4A 1CUAA 2Y2VA 3KOOA 3W06A 4OB6A 1GKLA 1YA8A 2K2QB 5KBYA 1CR6A 4Z49A 1H2WA 3STYA 2WTMA 5AI0A 4EY7A 1EDEA 3V1NA 2WG2A 3ESAA 1CUDA 3ICVA 3ILSA 2UZ0A 2BUAA 3G9ZA 3STXA 3H2GA 5FKJA 5AKYA 4B9AA 3VVMA 2ZSHA 1WHTA 3G0GA 1QIHA 1EINA 1QZ3A 3C8HA 5AM2A 4HS9A 1CLEA 4Y2PA 4G1FA 2JEYA 3QZUA 4MEAA 3H2JA 5LZ2A 2DCMA 4MYSA 1CRLA 2G63A 1MX9A 3WK4A 3VVLA 4C01A 3Q8WA 1CUHA 3STTA 1E8NA 3D5EA 4G4IA 4HRXA 5LYYA 1E5TA 1RYYA 4NZZA 4E15A 4GWLA 5FPQA 5CXXA 3IB3A 2C4HA 1IUNA 2Y2UA 4QDTA 1QGED 3QMWA 1TCAA 2J3DA 4KEAA 4HRYA 4OCZA 4JYMA 2B9VA 5LP1A 4OB7A 4G9GA 1J2EA 4GHWA 6YASA 3U1TA 2WFMA 2XUKA 3OC0A 4E46A 4F60A 1EK2A 1IVYA 1XKLA 4X71A 1RP1A 5CRIA 2XMCA 1U4NA 2IITA 3EQ9A 4CG1A 4KE9A 3BIXA 3G02A 2WSLA 4B85A 4M0EA 2HM7A 2Q0XA 4ITVA 4WFKA 5EHZA 1LPPA 1QIEA 1T2NA 4X92A 4K2AA 3WIBA 4GDMA 1IUOA 4UFNA 1JFRA 1MT3A 2HA3A 3WA6A 1Y37A 3AIKA 2PX6A 1SOMA 2P8SA 2XE4A 3R3XA 4O08A 3FYUA 1UKCA 4B83A 4EY5A 4IH1A 4FLEA 3I6ZA 5JATA 1UK8A 2VT7A 2WM2A 2XMSA 4W1SA 1G4HA 4AN0A 3WZMA 4GXNA 3MUNA 2JGEA 3C87A 3EF3A 4I3FA 5AOAA 1HL7A 4A23A 3EQ7A 3ED1A 2RONA 2YYSA 1L7AA 1WB4A 2JGFA 3R3WA 3M82A 2CJPA 3LIPA 3JWEA 2DQYA 2ORYA 3C6XA 4C4ZA 3SC2A 3R3VA 3H1AA 5CMLA 4YPVA 2OGZA 2HA6A 2PSFA 1K63A 5T4HA 1E3QA 4FBLA 4U2FA 4L9AA 1DX4A 5AM1A 3WL7A 5FOQA 4BCDA 4BTLA 2QVBA 1YS2X 4X95A 1GGVA 4BVKA 4QNNA 3U0VA 2PU7A 4AXBA 2RAUA 4LXGA 4LXHA 5ALFA 1AQLA 2X5XA 4H7EA 4B0PA 2RI6A 4BZWA 1DWOA 1B6GA 3O95A 5AM3A 1EK1A 2WHPA 5ALUA 3QH4A 2DHCA 4QA9A 2PUJA 1ZJ4A 1XZDA 4BVJA 1JU4A 1XRLA 3RM3A 5E4YA 3AIOA 3LS2A 3IURA 4CG2A 5FDFA 5C8VA 2WG1A 2Y1KA 3KSRA 4FLMA 2C5GA 5BV7A 5FV4A 1WPXA 5JAUA 2XQIA 4JH0A 5JAHA 3ESDA 3K9BA 4BC1A 4XX1A 1TRHA 3DKRA 3PF8A 5HF9A 4B9EA 1YB6A 1KU0A 1E66A 2VEOA 2QTBA 2XUQA 2XB6A 1ODTC 3WKAA 1QOZA 5LZ7A 3HZOA 5AK6A 4BVLA 1PJAA 4X6UA 5AI9A 5JYCA 1SCIA 3PE6A 4JUIA 3ZPXA 2HIHA 5F4ZA 4ZV9A 1QIFA 4BATA 4QDOA 1MX1A 1UKBA 2WU4A 4KJXA 2HRRA 2AJDA 2QOEA 1XQXA 4UBKA 3K2IA 5CH8A 5AI5A 5C81A 1E8MA 3FCYA 3LP5A 5K3DA 4H7HA 1BEEA 4X93A 2OCGA 3MVEA 5EIHA 4CCWA 2PPLA 3DYIA 2FUKA 4C88A 4J0HA 4TVKA 5LZ9A 4Y2UA 4G4JA 5A62A 3WZLA 1GQSA 5ALOA 1ETHA 1XZHA 1PV1A 5ALHA 1KEZA 4BE4A 4KAJA 2BKLA 3NUZA 3W05A 4EHBA 1H23A 1CUYA 4UFOA 2JGJA 1JJFA 2XUPA 1VA5A 1XRPA 2VQ6A 4KE7A 3O9MA 4MQLA 4C6HA 1H22A 3V9AA 3TJMA 5EHQA 1MNAA 5DNUA 2BGRA 4DTCA 5JASA 4OSEA 4PV7A 4X3CA 4CIAA 3ZLUA 3D2AA 4PO3X 3I1YA 4KAFA 2NW6A 1QIIA 1J06A 4X97A 3MGAA 3WLAA 2X8BA 4FMPA 4OU4A 1YCDA 5CT4A 2XT0A 2PUHA 1AKNA 4AQDA 1N8SA 4INZA 1MNQA 3S8YA 2QXUA 3HSSA 5JARA 1TKRA 2FX5A 1CUFA 3BF8A 2IIVA 1XRNA 4HXEB 3IIIA 1LBSA 2ROQA 2OCLA 3TEJA 1WCYA 1ZICA 2OGSA
chains in the Genus database with same CATH superfamily
4FSXA 3O8BA 3VPFA 4Y6PA 1HE2A 2QG9A 4PX5A 4YLYA 4XQ0A 2Q50A 3BDVA 4I5EA 1NZJA 3NX4A 4KWHA 3EZFA 1M8GA 1PFWA 4PHTA 4DEXA 4GKJB 3VSDA 1KBQA 1B2LA 1IEWA 4NY1A 4B2LA 4PZLA 4DDVA 1MVNA 1PZMA 3LWNA 2GWHA 4G0MA 5LUBA 1MOQA 3F6BX 4HQLA 3AF6A 3DT9A 4Y2RA 5B55A 3G5AA 1WVMA 2DKNA 2VP0A 1Y6RA 3U17A 3U7QB 4BNWA 3PDHA 1A8UA 3WLJA 4NNJA 4Q7LA 3TD9A 3AVTA 1DAPA 1MZPA 4RJLA 2R6AA 2NAFA 2WNIA 4GGOA 1P0PA 1ZJ6A 4BP8A 5ICMA 4X20A 4GYKA 1T1IA 3I58A 4OHCA 4MYHA 3JVUA 1LFDB 1M6NA 3R7SA 2V3WA 3E5MA 5D3MB 2Q9AA 1U1CA 1T8WA 1L1QA 1XXLA 2WOJA 3CMCO 3L5KA 3LHSA 4LRXA 1YRWA 2IVFA 1IEVA 4Q00A 1J4AA 4WASA 4DA6A 2WEKA 4PN7A 5EE1A 5AD1A 3V33A 1PWXA 2EATA 3RVSA 2D7DA 3PFHA 1BN7A 4D5EA 4KR6A 4RLSA 3IA7A 3NT2A 1NXXA 4YJGA 2MSCB 1PL0A 4JT2A 2YV1A 1TXGA 5H3HA 1SBZA 2H11A 2IYSA 1G2PA 4JR0A 1EUCB 3ROPA 2AYZA 1SVIA 3ENNA 3RK4A 4KRFA 4L3VA 3FFWA 4IEIA 3PFGA 2JCYA 4J3JA 2D0PB 3PQDA 4PX9A 4DCGA 2A67A 4A92A 4PTLA 2VHCA 4M55A 4M76B 1IWPB 1O89A 2BFBA 1HC7A 2O2DA 1GARA 1OASA 4II7A 3SYMA 5E9AA 1CS0B 1WIWA 3MS7A 5DI3B 3SC6A 3BB4A 3PBKA 3L8EA 5LYJB 1IHPA 2WLTA 2UYHA 2G4VA 2YC4C 2BAGA 3FI9A 4Q3EA 1Y8QB 3SHVA 3A2NA 4BLQA 5BQ5A 1UK6A 5DISB 1X7WA 5FULA 1V95A 3EHEA 4ZVMA 5D51S 5LQNA 4B32A 4ENRA 2IDJA 1W75A 3QW4B 4EG1A 4YBZA 2EV9A 2R6FA 2BGWA 1J49A 2HIMA 3HFSA 4B2PA 4XM0A 3PDIA 3BDIA 2BISA 4Z6KA 3I3OA 4EYOA 4FFVA 1BMDA 1U6JA 1P7CA 4Q9NA 4Z86A 2C92A 2VNSA 3G9XA 2BTOA 2WUWE 4LHVA 1ZU4A 3JQAA 4A1OA 2X4LA 2XNHA 3LLSA 3P9XA 3ETEA 3Q0IA 2VHEA 4ZQGA 2P9GA 1QCYA 2B6HA 1I36A 1NIPA 3HRHA 3ZLTA 4W7IA 3KZVA 3OCJA 1K66A 2G71A 3JZMA 3IILA 2FMXA 3HI6A 4ETWA 2JLSA 1ML3A 1PBTA 1ZUNB 4JKIA 2X4DA 4RMIA 1XU9A 3UOGA 5KMGA 3FNGA 1J8DA 3GFOA 2AFRA 3JS5A 4I5GA 4LWZA 4P3NA 4LGYA 1L7RA 4M0DA 1SULA 4AKEA 1AV7A 4HN9A 4J0QA 2EFEB 4YO8A 1N2ZA 4C9BA 5FBVB 4DKJA 4LDZA 1M8PA 1LVUA 3N8KA 4NTZA 4O4JB 3THRA 5JAIA 4RA9B 3KQTA 3O8DA 1I6WA 1L5SA 3LY5A 1EK5A 2LNDA 2QN1A 3OKAA 3LFUA 3RUCA 1USGA 1TMKA 1F8FA 3O4VA 4P7FA 2B5OA 2VRCD 3DLPX 4N1AA 4JP3A 4XRGA 1H4SA 3E53A 2AI2A 3GRKA 4PAQA 3ZE8A 4FD3A 3DV0A 1JWAB 1WB6A 4R3WA 1E9VA 4O3MA 4I9HA 3M5WA 5GWXA 1JPNA 3JQPA 4D43A 2AOUA 2FFJA 3KJQA 3SJAA 4QXQA 3QITA 1LLDA 2XNCA 4WWHA 4BEBA 1IHXA 2F64A 4IJKA 3LA6A 3UV3A 3ZWVA 4MVJM 5SYNA 4Q34A 4M37A 5A3SA 1BX1A 2XWSA 1WU7A 4A2CA 2RAPA 5A04A 2H1FA 1ZVJA 2L42A 5A7GA 4MRRA 3T9CA 4BFTA 1YZFA 2F8MA 4H6XA 1RKQA 3KZCA 4KHPB 1D4ZA 2I6GA 3BIWA 2IT1A 3P7MA 4QFCA 4PFKA 5E0OA 3DOIA 1EHYA 1HEUA 1XKTA 3FSEA 2DFVA 5B3JA 3W5IA 1UPAA 2I7TA 3I5MA 4BQOA 4WV3A 1RMTA 3H1EA 1Y98A 1G7CA 4GX2A 4K9SA 1M1XB 1E9DA 3TPCA 4ZGWA 3U44B 4UNRA 5LQAA 1EA7A 3IUPA 3AOEC 4RQTA 1YR7A 1CRQA 3ORYA 3RG8A 4YT8A 3P4YA 5JRDS 4MUJA 2XNDD 2XZTA 3OIDA 3PIRA 5DRYA 4AWBA 2AE1A 5FO0A 2OORC 4ZCLA 4DAOA 2H7XA 4WA8A 1RM4A 4WKPA 4EAAA 2HDOA 4B3TB 4R8MA 3ADKA 1YBHA 4M1MA 2J5BA 3OPYB 2PFKA 3DWEX 1BHJA 1U8UA 1XXHB 2H3EA 2XB8A 3HGMA 2FEAA 3KQOA 3UAXA 2E55A 4E1VA 1EZZA 4UTRA 4XD2A 3L1JA 3O31A 4MV8A 4QUAA 1TUBA 5K2OA 3RS7A 1WX1A 3ZYZA 3E5HA 1JZQA 2UV8A 5BN4A 4D0RA 3D6TB 3LYUA 5LA6F 1Z2DA 4CN9A 1GP2A 2XAAA 2JRCA 2WZDA 4NXNB 1UC8A 1QYCA 2AN9A 3NOVA 3L7KA 4FHFA 2HPHA 1OLUB 1EBUA 4UREA 1ECGA 5CW1A 4DUGA 1YTUA 1ZEJA 3TI7A 2O2JA 1Q74A 3P2JA 5H59A 1LLFA 1RWVA 1Y3CE 3H16A 3KD2A 4L4YA 5FTKA 3SDZA 5CFPA 2AZXA 1KF0A 3N1UA 1JXQA 3QBVA 5AKKA 1NG1A 3ZY2A 3AUXA 4OQDA 3O2JA 3OZEA 1XTZA 1H2XA 4TLEA 4US0R 1J25A 5CBPB 4KZPA 1A2QA 2JFHA 3EEQA 1ZK3A 3M1YA 2QIPA 4BO3A 5CDTA 1ZZGA 1HE8B 1NXWA 5BR1A 2YFHA 1VCIA 1NP6A 2H8KA 1YE8A 4PYKA 4PAMA 3WL5A 5DYYA 3W34A 1M9NA 2PKRA 4TWRA 2XYRA 4OQXA 3L0YA 2EW2A 1CR4A 1DMSA 1PSWA 5DLPA 2Q2NA 5GJVC 4HAVA 4KYUA 3HBNA 4X61A 3GDGA 4PINA 1EB9A 4WSOA 5KJEA 4KO4S 1V8ZA 2D59A 2GN6A 2Y0EA 4GKVA 5F1YA 4OI1A 2HU2A 5BOVA 2O8EB 1CERA 1HFWA 2V45A 1MW8X 1H9AA 3D3WB 1J8YF 3P2IA 4YJHA 4I81A 5ALMA 2EJUA 4CEJA 4DA9A 1BEZA 3KXLA 2KX7A 4X54A 3D54D 1K7FB 1DZIA 2CEAA 2FQQA 5U1PA 3PI6A 3KWFA 4BO9A 2F1RA 2XOKA 1YVEI 4OGKA 5LU8A 1EM8A 2H1SA 3ECCA 4QREA 4N5DA 1LPBB 1NRJB 4DLPA 3UGJA 1DQZA 3E4DA 5IYZA 1G21A 1YC5A 3PNQA 4UHFA 2QMOA 3WRXC 1EQAA 2DUUA 4Q9IA 3V32A 4RYLA 3T4PA 3USZA 1Q6ZA 1YU6A 4HQNA 4M6WA 1V6CA 5ERXA 2AZTA 4IDBA 3RS2A 5BUQA 3VDNB 1ULHA 2IYZA 2A84A 4F6RB 4IQGA 3RSGA 5JMTA 3OZBA 2YMPA 1MX5A 4XZ3A 4DR1B 3RHZA 4QBIA 4NMWA 1OAKA 4HVTA 4PCVA 1UMCA 3WGYA 3HPQA 1QTRA 2BMVA 3IEUA 1YZHA 5B1EA 1V1MB 2BRUA 1XFDA 1XP5A 2ARKA 2IY7A 3LVBA 5G0TA 4B4UA 3RSHA 2O7RA 1E2QA 2W9XA 3VC2A 1L0BA 5NLLA 5B4TA 1KO4A 4KP7A 2D1FA 2A2ZA 1Y1QA 2XD9A 1O9HA 1WLSA 2O3QA 2BYTA 1BOFA 2F1KA 3HY4A 4AYXA 2R7MA 3QVJA 3K5HA 4LBYA 5FA8A 2W2OA 4I46A 2ZIXA 3E23A 4FMCF 1FP2A 4C4TA 3FSGA 1O7JA 3H6KA 1XAGA 3QJ5A 2KB0A 3L8YA 5A9RA 3P4UA 4NJEA 4ESHA 3LPNA 1J9GA 2PXHA 3A1VA 4M3NA 9LDTA 2IS1A 1TM2A 3FHCB 4TV9F 3VPGA 3J80A 3OAAA 1Z38A 3ICEA 1QIGA 1SUEA 3QYPA 2W2QA 2UU9B 1ZIYA 5IEJA 2B0JA 3C7KA 1ZLXA 2HU8A 1VKRA 2ETVA 2B2XA 1KMCA 4HD8A 3AQIA 1LDMA 3DHNA 3Q11A 2EJWA 3NI2A 1RIFA 4QQRA 4MRAA 1UEJA 4CI9A 3GLGA 4YCBA 4O0LA 4CIBA 2XUJA 4RFSA 1RW4A 4J0CA 3P9SA 3U4CA 1A9SA 1CY1A 3CS3A 4O3FA 5TNXA 4Q3KA 3WI7A 1SY7A 5KOJB 3OQOA 3GG2A 2PBRA 3DMFA 2I5PO 4R1UA 2HCJB 4MVJD 1U81A 4U5XA 5K3OA 2AD1A 4FHZA 4ZT3A 4S1OA 4DJFC 1C2TA 1S7GA 2HDNB 2G6TA 3QYJA 4KQWA 1Z5PA 1ILWA 4FGZA 4N3AA 4ODIA 5AVKA 4QYWA 1ZGGA 4C6TB 1WB5A 2BKAA 4F3YA 4Z8YA 5KTYA 3CISA 2R8OA 2XE6A 4OHVA 2O0KA 1L5HA 3T3PB 1NN1A 4F5YA 4ZK2A 3JQBA 5JHHB 4QUKA 1ID8A 4PQEA 1YULA 4PZ9A 3FDXA 1SHJA 1UWCA 4F9TA 1AKMA 3WGQA 4LSWA 3DWGA 4C14A 4GM0A 2OD2A 2EOAA 6ABPA 3HYRA 2IHJA 5IAEA 1KI2A 5JISA 1H2YA 3CLUD 1OOEA 4W1PA 1W4CA 4LJLA 3ZGNA 4IIXA 3DKKA 4B2YA 1TJ4A 5A5VA 4DR3B 1CT9A 3E3MA 1TZBA 2CE7A 5A2QA 4YP5A 1ISPA 1RBQA 4MV6A 4GZLA 1D9XA 2POCA 2YV3A 2ZEJA 5CPBA 4BBAA 2J3JA 2GSWA 1U2PA 2X86A 2PZJA 3L6EA 3W2TA 3ZEIA 1Y1SA 3IE0A 1CSEE 1K06A 1ZJYA 3KHUA 4BP9A 4W8OA 1WWKA 5GINE 1VRCA 1RM5A 1G38A 1H3FA 2C2OA 1H5QA 2PJDA 4RL4A 4NP6A 4UMFA 3UHPA 3PS9A 3IXMA 5EP2A 5BW8A 5CEEA 5AVYA 5IN4A 1SXIA 4TV8B 2H2GA 3NASA 3NW9A 2QM7A 1ZNZA 4BPBA 2Q1WA 3HXPA 3AVPA 3FVWA 1WSBA 5LZ8A 4U02A 3VOBA 4ZXFA 2ZBPA 3SHQA 4GL4A 1F7VA 1FTNA 2YJGA 4FNAA 2WV9A 3EE6A 4X90A 3V2UA 5EJ2A 1QC5B 3FNFA 3MOSA 3C5EA 5F9MA 3TL6A 4OOFA 3ZWDA 4LF5B 5MN4A 3RYTC 4G0NA 4AS3A 2CK3A 3OI7A 2YIMA 1XX6A 3D4OA 2NM0A 2YXLA 1THZA 1U8CB 3NHLA 2Q6LA 3GIWA 3HYCA 4WFIA 5HFJA 3NNSA 4UCQA 4UMEA 2JJYA 4JAVC 2CLOB 1YS7A 1K86A 2RSLA 1VL6A 3FRHA 1S2MA 5DO9A 3RRZA 2QLNA 2AOWA 2MMGA 2WAMA 3CVJA 3S7TA 4CM9D 5KREA 3SYNA 2XCIA 3H7AA 2ASEA 4OREX 3D3NA 7ADHA 4MHTA 1G8JA 2FK8A 3D8UA 3L4BC 2YXNA 3VR2D 4D9IA 1P73A 2OHOA 2Q41A 1NF9A 1U90A 1Z33A 3SDBA 4CUZA 4IHJF 1CE8B 2NACA 4R84A 1KEVA 4ARSA 3P2OA 5KNLA 2BH2A 4MICA 1XMPA 2K5UA 3LHKA 3S5UA 3JQRA 5KDLA 5BRAA 3EG5A 1Z0IA 4CUJA 1Z4KA 4XFKA 2QF7A 3IAHA 4HGYA 3TFWA 5ILGA 3VU8A 1G8AA 4FUTA 5EZQA 1Q7TA 1Z4LA 2OVFA 3RC8A 5K3CA 4OBBA 4OH1A 1RBMA 5FBKA 3VTFA 1EB8A 2A4KA 4L16A 4Q9AA 3WSWA 2R44A 4K87A 3UH1A 3T52A 4YRSA 3EPHA 2HV9A 5D01A 4LCJA 3W79A 5CR9A 1SRQA 3HL4A 4OO3A 1EQUA 1OX4A 3NWEA 2QN7A 3GU3A 4DB2A 2QL6A 1PTJA 4JZKA 2PRIA 1BQ4A 4TS4A 4D79A 1DFIA 5BVHA 4JUDX 4R16A 1VG9B 3K20A 1S89A 3PHJA 4IGAA 2YWRA 4TMZA 4WXRA 4A0SA 3RC1A 4PF1A 4IIBA 2J3IA 2G1KA 1IEQA 3G1WA 3JQFC 1D2AA 2Z9DA 3EXG1 3AUFA 4RCYA 3C6KA 3F5FA 2G80A 1CPYA 5T6MA 3QEBZ 2PWPA 5HKKA 2A1UA 1F3OA 2A88A 3O21A 3ZE1B 1YGYA 4AZ0B 3G9UA 3MTEA 4JS0A 4WTOA 2ZTVA 4YGXB 4A6DA 3LL7A 4IOJA 4PO1A 2V7XA 1LFAA 4M83A 4YJGB 3OJFA 1USUA 2BEKA 1EFPA 4B81A 1PJRA 3MM4A 3Q8KA 3ZGXA 2YQ4A 1LX6A 1AXGA 1NV9A 1SUWA 1YRQA 1GPAA 1XZGA 2CLMB 2I3GA 2ZITA 2F43B 2QMYA 3K0CA 4IOLA 3T8YA 3TYXA 4AUEA 1VBFA 3ILXA 2BBWA 1FMFA 4I50A 4JJAA 4OQEA 3OP4A 2RHBA 1EXDA 3WKBA 5LFAA 3PTZA 2PRYA 4F4DA 2DM6A 3GEEA 3STHA 2ZFUA 5TSDA 5C53B 2J4CA 1KMQA 3O0TA 3QPUA 4XOUA 3LIIA 4KXUA 4K5QA 3Q7PA 3H19A 5EQJB 4B4DA 1NG9A 4JJFA 3WYEA 1LTKA 5EWLA 4ZYLA 1QP4A 1YUNA 1GA1A 3D7SA 1AZSC 3GY0A 1O5TA 1T0UA 5KQRA 1UADA 1KHHA 4IV0A 5K6AC 3IOMA 9ABPA 5KWVA 3B7PA 1V3VA 4HNGA 2D13A 1S9DA 1CYDA 1N5OX 1PKEA 1UT8A 2AEFA 3IDSA 4KZKA 3TLBA 2BBSA 2V8BA 4B1FA 4DHWA 5CDFA 4FUQA 4RE6A 4OP3A 4XWGA 5E6SA 1MFZA 3OF2A 2Z8XA 4X5OA 4D4MA 3EODA 3TQRA 2QVZX 4EITA 2H18A 1YCHA 5JE8A 5B6JA 4WDRA 4E6PA 4OYLA 2UXBB 4RMNA 4N5MA 1DZ3A 1C29B 3M1AA 4RSHA 1PYGA 3TM4A 3H18A 3SS9X 4AJLA 4B5LA 4CMCA 4R05A 1UL1X 1GG8A 4CCSA 1RTKA 2P9EA 4QWMA 1Q7EA 4HF7A 4E5NA 3I62A 4H0CA 1QP7A 3EXG2 3IUSA 4EAQA 2NYAA 1Y3FE 1FBNA 4GX1A 5KAPA 3TMAA 1S96A 2OHGA 5A6SB 3FWNA 2PMWB 2W0MA 2ZM5A 1NBAA 1OU0A 4WH0A 1NVAA 4N5HX 2R3SA 4IUBS 4ENVA 3WB1A 3LUFA 1OH8A 4KNWA 2GZ1A 1A4RA 1A8HA 2VI5A 3B60A 2I3ZA 3FGPA 5AJYA 2JLUA 3FZNA 2O5RA 2WHXA 4HLNA 5LDHA 3SYRA 2ZUSA 1SD2A 4IF4A 4NDAA 4R69A 5ESWA 1Z7BA 5I51A 1PT6A 2B4KA 2ZJBA 2X0DA 1CZUA 2CBZA 4X94A 1U7WA 2CXHA 2OYSA 2WYIA 1EWKA 3L0ZA 3FB4A 3ECSA 2C7GA 2Z6VA 1L4MA 1K3TA 1UZUA 3WLTA 4B8ZA 221PA 3KSZO 5J5CA 2BFDB 5GZ3A 3Q7QA 5FBWB 2NXNA 1CRZA 2J41A 3VC7A 5HG0A 1G7RA 1HE5A 1XZFA 3A70A 3PJGA 1ICIA 4YPFA 1HNWB 3CX8A 2CLFB 3OT1A 2FRVA 2RHTA 4UAGA 4ZYUA 2J07A 1T1SA 3IT1A 3KZKA 2XUIA 1MKYA 1T1JA 1EKXA 4YO7A 1QANA 1J6UA 3L7YA 2JLWA 5KNDD 1IXKA 1WP4A 1XQ6A 3NYIA 5AJUA 3MIIA 2O07A 1NE7A 4GR5A 3G2JA 1QE0A 3GFBA 4X1IB 1RIIA 2G1PA 3MQFA 1TKAA 1XZCA 1Z7EA 2WTBA 4IX1A 1OD6A 4W7SA 4F5WA 1QXSA 1BJTA 2W6QA 1A95A 1BGXT 1K97A 1DQRA 2L2QA 3AILA 5E6RB 1I7DA 2CLSA 2IE0A 5TT1A 2GNPA 5GOTA 1WCV1 2C58A 2NT4A 2OGTA 2TYSB 4HSGA 4MEBA 1GTRA 2GAJA 3M6MD 4B4OA 5JCJD 1GPLA 4HJXA 5H3LA 4DE5A 2BCGY 3C45A 2HCTA 1DXHA 5F7XA 3I2KA 3GP8A 5AO9A 1IC6A 2VPQA 2O2ZA 3MTGA 1A7JA 2Q3HA 2ZGVA 3H8WA 3TUZC 1YV9A 3MT8A 3JYPA 521PA 4REQA 1P4RA 2WA2A 2E4ZA 4DBLE 1RQ2A 4BZPA 3A04A 1XTUA 4RPCA 2HXGA 5AKJA 2VBCA 3UKJA 1EXMA 3PXDA 2I54A 4YHBA 1JG4A 1RWPA 2GJ4A 2QUBA 3NTUA 2I8CA 2R97A 3OMXA 5FUBA 3SVLA 5CCBA 3PXXA 4UEQA 4KQ6A 1P72A 2VF2A 3C6ZA 3CSDA 4TKVB 3TUJC 2QTFA 4Z4QA 1Z0SA 2UYOA 4B6FA 4W8GA 4EFNA 5JPDA 3CQ9A 4MWOA 2IWHA 4ZZIA 1PE0A 2BUCA 1LGYA 2OXTA 3FGOA 3BK7A 3S4YA 5GIPE 3IBCA 3FTCA 3Q3GE 3S28A 1K0FA 4MVJH 2X4GA 1E4VA 5HVNA 4QBHA 2IX9A 5F98A 4UBJA 1T3HA 4GMFA 4YCSA 4OEHA 3T7KA 2ADFA 2Q1XA 5JXHA 1E2EA 3EIXA 3LZ6A 4QFMA 2R1VB 1JT9A 2ZRAA 1A9PA 3U4MA 3GVHA 4WUTA 2SNIE 3U37A 4EGJA 4EHJA 1A0OA 1PL8A 1FVXA 3GCZA 1R0ZA 1D6SA 1TUIA 2CVQA 2VJKA 2V74B 4J6FA 1NT2A 2HF7A 4A03A 1D0VA 4O29A 1LI5A 3F98A 2Q27A 5EZYA 5JDIA 3DT6A 3FX2A 3DAGA 1FXWA 1YFJA 3VZBA 2Y4NA 4MINA 4QDZA 2FLKA 1Z2PX 2CNDA 4RTOA 1O97D 4BVGA 2D74A 5AVZA 4JJKA 3WLKX 1AKQA 1ZIXA 2GEBA 4EVSA 1H4QA 1NVDA 1Q5PA 1VYUA 1S02A 1LRJA 3IC5A 1BW9B 1IZ7A 2HTFA 2NXWA 4JBIA 3HFRA 1U3TA 5FR1A 3D7KA 3LUPA 1KYVA 1N2CE 4QUIA 4LPKA 4YS6A 1PFUA 3Q85A 2OHVA 1JSLA 4FNOA 1HZJA 3C3MA 5H68A 4OX9Y 1I1QB 4LYDA 1I8TA 3DFFA 4NFHA 3DEJA 3UIEA 4TT8A 3G59A 4AI6A 2ODNA 5DGHA 3H4IA 2PZGA 2QZ4A 3EFBA 3GPDG 2BFEA 5AK4A 3FYUB 1FDWA 4K2HA 4PHHA 4DYHA 2BGTA 1QRTA 4HGRA 4O5OA 3U1BA 1NDHA 1Z6QA 1BE6A 2X41A 2YHSA 2JVIA 3IAUA 4JC5A 4A9AA 3LGAA 3UAVA 1VLQA 3NDJA 4JSRA 2ZR8A 2I4NA 4YIHA 4H1VA 3I2FA 2Q2QA 1U9CA 3IMGA 2Z5VA 2Q3JA 1QQ7A 3DMDA 3VTKA 2E48A 2OBNA 5EIFA 2WWWA 1CS4C 1NJFA 2ZE6A 3ONDA 4L4ZA 4AZSA 1K4MA 2XJ4A 3SCZA 2UYCA 1N8KA 1NQOA 3BZWA 2CNWD 3N0WA 5THQA 1JYFA 4DAEA 5FUXA 4P38A 1CNEA 4JODA 2VNKA 2W98A 3IMFA 4MI3A 3OX1A 5AJTA 5HFAA 4W9RA 2XTAA 3TLMA 2JB9A 3WYDA 1EJ0A 4BNGA 2TMGA 3IGFA 1RAGA 4MK4A 5YASA 3T3NA 3GJXC 1NVEA 2Z6QA 4QZVA 5JSZB 4E14A 4Y2XA 3EA0A 3ROEA 3A1SA 4G36A 5AOBA 2NO9A 3CUWA 1XE3A 2CKMA 2GILA 2I3DA 3HKEB 3U4DA 2P40A 4L5BA 2OV8A 5IC6A 3SD7A 2QD3A 2NMVA 2QORA 1XDSA 2WVJA 1IDN1 2D5CA 1Q0SA 3QPAA 1WZNA 1XZLA 2OV1A 3B3GA 4PZUA 4B75A 3I39X 1N0IA 1U3UA 4AY5A 2R65A 4K6KA 3HUDA 4DBLC 3D1LA 2F17A 2G9ZA 3AETA 2OFXA 3MD9A 5DBIA 2FZ4A 5DNWA 5E1BA 4C7VA 4DABA 2GK3A 5I7HA 2IS4A 1V35A 4Z0NA 4ZDJA 2OMEA 4CIWA 1MTZA 1P4HA 5CCDA 5FPPA 3JATB 3LOQA 5J4YA 5JNSA 2C4MA 1QYXA 3PC4A 4J0GA 1CD5A 2J48A 4QX6A 3TW8B 2YOHA 1W35A 4A6PA 3IP7A 4LY9A 2WUFA 3OY2A 3O4GA 5C5EA 1B4DA 2GARA 2QGNA 3FCXA 4CM7A 3A9VA 1J2JA 2KLHA 3RS4A 4EGQA 2J6CA 3JAWA 5IJWA 3SQXA 1KP3A 1SBIA 3RRNA 3T41A 1E3JA 1J0XO 5FR2A 4C7MA 3MTQA 4Q5IA 3NGMA 3BWXA 1SOVA 3JU3A 4MJLA 2Y1OA 3BWYA 5FJJA 4WXPA 3ZK9A 3FPHA 1KY2A 4M1OA 3EUAA 3V7NA 4LE0A 4LFBB 1HE4A 2VEDA 1XV5A 2LP4Y 3IUEA 1ZD1A 3WLQA 3MAJA 3LXUX 3DO6A 3JTMA 3W1EA 5TGTA 4P4NA 1W25A 1LK0A 3BMNA 3BSYA 2RHCA 2FOXA 3CUEF 2GO7A 3GRPA 3IIJA 4A0RA 3R7FA 1IBMB 3RC3A 4V1CI 2MINB 1SIOA 1XC7A 5FTMA 3WKCA 4BV2A 2IKQA 3RE1A 1Q15A 4CLXA 2VYVA 3A4IA 1IZ8A 1NWHA 2W2LD 4BJHB 1ZD5A 2W2PA 1D4FA 4TUYA 3QP9A 4PC3A 4I4TA 1XROA 2H1HA 3ND5A 5HCIA 4D0GA 5JZ9A 4MQMA 1JUDA 1T9BA 1I2BA 3D6UA 1YKFA 2IS2A 2V65A 5TLSA 4ZDWA 2XKKA 3HM9A 3GZJA 3BB3A 5JEEA 2RJOA 1PUXA 2MSLA 2Y6VA 4MLDA 4RZUA 1ZN7A 2YIDA 1P8AA 2VYNA 3BBPA 3MT9A 4XB1A 4H16A 4J9UE 4YAEA 3V7YA 3JWJA 2WD8A 2YWXA 2ZRGA 1MO5A 4FKZA 3N8GA 1NM5A 2A0FA 4XQCA 3UB4A 1CC1S 3VBEA 1MO2A 3F8SA 5ES3A 4CU2A 4EW6A 2C5HA 3B89A 3DV9A 3K0HA 5I9SA 5CM2Z 2DT8A 2ZVPX 4BX3A 4G1MB 4MUFA 2GB4A 4QJ3A 3SQOA 3EXHC 1A5BB 2WIAA 1ZSYA 1NXQA 2J3QA 4YDSA 2J9XB 1RMYA 5K8LA 5SZJA 3TM5A 4GI7A 3BRCA 4MPTA 1PFVA 1W4LA 1WUKS 2BKVA 2FW9A 4U6SA 5J59A 2CGEA 3J81A 2JG3A 4GLBA 1XL0A 4OYHA 3V7FA 1ZFNA 4Y6OA 3ZOZA 3OPMA 3CT6A 2OQIA 1NJ5A 3WLNA 5IT5A 1TZKA 2HQBA 3A11A 2KS6A 3I28A 4PVDA 1U11A 1ZRHA 2D1RA 1F4LA 1EI9A 3DTNA 5K2MA 3T34A 4OQZA 2XY4A 3UV7A 4QULA 1DJNA 2VC2B 1PR4A 3GFRA 2NUAB 3TDKA 1UQTA 2WTAA 4F46A 4ATNA 2Z4SA 1UKEA 4H7KA 1XDDA 1P7PA 1KK0A 2IU4A 2O7NA 2YR0A 3AZPA 4JBYA 4JKOA 3Q41A 4LJSA 1QO7A 3LUJA 1RRPA 3HRKA 3Q0TA 3ZNOA 3RASA 1BVUA 3RJTA 4MWDA 2DHEA 2YVKA 3KUKA 3ZTWA 4R1MA 2IUEA 3E27A 3F6EX 1G8GA 3L6DA 4KN6A 3OTHA 5DK6A 1YDEA 4MA0A 2BF7A 1JZSA 4JC4A 4UEWA 2FE4A 3WBJA 5ADHA 3AU8A 2WUGA 1VM6A 1YZLA 1M76A 4IRMA 4X45A 5ELXA 4GUDA 4HJRA 2F9FA 3NORA 1NYLA 1ESDA 4PBSA 2AMFA 1BD4A 1UBCA 3AUUA 3HLYA 3QELA 4EGCB 3E9EA 2WG0A 5DYWA 1SC4A 5L45A 1KMNA 1N0WA 1BMTA 1NW7A 1UFKA 4G5YA 4NDNE 4RVUA 1L7VC 3CRW1 4BB0A 4TWAA 5BSUA 2HRBA 1U94A 4G2NA 3EIFA 4YJHB 4QPZA 3U4HA 4R6WA 5KI6A 2P6RA 5KNDH 3ONEA 1KMHA 2V9CA 1PJTA 1VJDA 1X7YB 3EVFA 5J4HA 1L5VA 5AW3A 2C04A 4Y2SA 1P2DA 3ON5A 4EG7A 4EB6B 3GUZA 4TTJA 3KVVA 1TF7A 2B69A 2A6PA 3MERA 2E7ZA 3K0KA 1OBFO 3CKKA 2A0XA 2R6JA 4W1QA 1T29A 2ZB4A 1Y8QA 4CMIA 5MFZA 2RBKA 4UOEA 3Q3CA 1S01A 2G17A 2PKQO 4IMPA 4BEVA 4WBNA 1QU2A 3THSA 5DNVA 1BWRA 5TEVA 2IWRA 1B3BA 3KSBC 3QVUA 2ZYVX 3MMXA 3GELA 3DZHA 1DO0A 3HVKA 1FQOA 1L5KA 1W30A 3K53A 3T4UA 1DKNA 3WK9A 3A1UA 4DFDA 2WVHA 1JTEA 5D5HA 3AUKA 3TE6A 5K45A 3TRIA 1GAQA 1J8QA 5AJWA 4EQ6B 1E3TA 3N6VA 4QAQA 3WK5A 3WGVA 4KV7A 5JXIA 3V8MA 1UODA 4G24A 2B21A 4KH0A 2VJQA 4ND4A 4NCAA 3RD5A 2YY7A 4FNGA 3TJZA 4BKOA 3UG7A 5A1TA 3TOCA 2PZEA 2Q3DA 1SUCA 2HK8A 4RFVA 5ICSA 3E6AA 3AB3A 2ZK7A 1UMBA 4FM9A 3PEUA 4XX0A 4N5NA 4EVQA 5KNCD 3BB1A 3JZDA 4AMBA 3RYFB 4ND7A 1X2BA 4OL0A 1EVJA 1ZI9A 4G0YA 2EKBA 4FFBA 5BSTA 3OOWA 1BWPA 3Q8LA 3LF1A 3AEKB 2F67A 3JSXA 4N4AA 1FFCA 3SQLA 3T7DA 4K40A 4OM7A 3HCRA 3W7VA 3SQDA 3GLHB 4DQDA 1UK9A 1TZMA 5CT9A 2BSXA 2PXAA 4N3NA 3HADA 2R9VA 2PRSA 4HRAA 4OLBA 2ECOA 4REQB 2Z9BA 4TV9B 4AJ4A 2FEOA 3CIFA 4TWIA 2XMGA 1YQTA 2HSDA 1C3VA 7GPBA 4CG3A 1TRKA 2LKCA 1NXSA 2ZVDA 5K8CA 3M2PA 4Q1AA 4KYVA 2NU9A 4LGCA 4UEJA 2IYNA 3AIMA 5LQDA 5B7QA 3CZAA 2REOA 1JVBA 4GM1A 1I2CA 2NU9B 2FUEA 3RQIA 3OEED 3A6PC 4ZPJA 1D2RA 1HDXA 2QTAA 1NPTO 2I99A 4QPNA 3UAYA 3I61A 2HWUA 2XB4A 3QMPA 4QTTB 1F2VA 4FONA 3BTUA 4KYIB 1CHDA 4OSOA 1E3IA 3TNLA 4PLCA 2IYOA 3OQJA 2QN8A 1ZH0A 3K8OE 1MN6A 4N3BA 5JS6A 4U6QA 4LHEA 2ASVA 3GD5A 5LMNB 1LA2A 4J94A 4NBRA 2HO4A 1YR2A 1AUQA 1NM5C 4JLBA 4BY9E 1PGOA 2NV2B 2QTVA 1NPYA 3ZWXA 1YI8A 2A14A 3OZVA 2PG3A 1C5KA 2XI4A 5BQXA 2R2GA 1P77A 2BFDA 4JB3A 1YUBA 2ZI3A 5IVIA 5CK5A 1MP0A 3QMMA 4B3GA 3C5CA 1T5BA 4FGKA 4X3OA 1SM4A 2VWHA 2ZYAA 3RVBA 2BVNA 3V34A 1N6RA 3GA5A 4Z9YA 1MXHA 1MOSA 3C98A 3E4CA 1DKLA 1SC6A 1YMQA 2FPKA 2HDWA 4CDGA 3IAFA 3R6GA 3T35A 4LZJA 3RLIA 3WK8A 3AP3A 5ELLA 1ICEA 1NUSA 3DOEA 3AKZA 4CLRB 3C1AA 4KX3A 1RNLA 2VDWA 4CQMA 5AICA 3I2YX 1YB7A 2A58A 3P26A 1IIBA 1K89A 2OD9A 1U8YA 1R0WA 3JWPA 3DG9A 3BHMA 3VPXA 5CJJA 4DNOA 5LP6F 4LWQA 3ZZ0A 1JXAA 2A86A 2DZDA 3KJGA 5L53A 3AVWA 4UQLA 4Q3NA 4UTNA 1DFGA 1JDZA 1M8KA 2BFBB 3AGPA 4MO2A 1UQRA 3EDMA 4LCEA 1J1UA 3NWBA 4BZZA 1SGWA 4AJPA 4B71A 2OHIA 3NGLA 4YUAA 5FTNA 1GA6A 1OZ0A 4GM4A 4R0NA 1KDVA 4BKQA 4OFWA 3L7CA 2WAXA 4D80A 2GR9A 1VQ1A 3K0CC 2B1RA 2H0RA 3KR2A 4WJLA 1ZR2A 1X94A 2J3LA 4D25A 1LV7A 2DY0A 2EIXA 3QKRA 4WZ6A 1VJTA 1TJNA 5K20A 1Z56C 5LVAA 2M6LA 2DQSA 4PLGA 3DLTA 2IC5A 3SYTA 3BXEA 3DDSA 3GC6A 1PIWA 4EELA 2SBTA 1NOJA 1Y81A 4PCAA 4GGPA 4FFLA 2QZPA 4MGZR 1LPOA 1JX6A 1E5LA 2NYUA 3AFIA 3B3FA 5BV8A 3VNVA 4HWSA 1FIUA 2JCVA 3CZPA 2DHQA 1TVMA 2WU1A 5FCDA 3DL4A 2VDQB 3GRCA 2V0NA 4LBWA 4Y9RA 1LU9A 4MCHA 1CEYA 4I4CA 1Y80A 2G9VA 4KXYA 4EX7A 2OWDA 1AHPA 4QOSA 1YZVA 1W85A 3ZXSA 4AKSA 4OLJA 2WFLB 2H4HA 4S24A 4UQPA 2B2NA 4M88A 1DFHA 1CF2O 3ZZUA 3NBXX 3TZLA 1Q11A 1UKZA 3CXRA 3ROKA 3ZXIA 5CVVA 4MQFA 4HLUC 3Q8MA 3THYA 3CRRA 4GPEA 2G8NA 5KJFA 2SKDA 3E2PA 3PL1A 5KVSA 5H81A 2XA9A 4IHKA 4JUAA 3D7NA 2UZ1A 3A2LA 2GKOA 2XV1A 3KLBA 3OZCA 3HA7A 3PITA 2ZE5A 5CNKA 1A1SA 3LT5A 2V6JA 1IG3A 3D1VA 4PRLA 1JMKC 4UUQA 3BK2A 3Q4GA 3ZIUA 2NZWA 3K7EA 1UAYA 3A58B 4OU5A 2ANBA 3DBHB 4ZGBA 2XGGA 1JDUA 1DTWB 3IIMA 1U31A 4DSOA 5A5EA 3V46A 2DX7A 5B58T 1XUOA 3R3UA 1PDWA 3FTQA 4BO1A 4U0KA 1C3OB 4B4VA 4DRXA 2RIPA 2WHEA 3OG9A 2H2FA 3RFXA 1U4SA 3HCPA 4ISCA 1ECBA 3EG9B 4RK4A 1YRYE 2Z5GA 1JF8A 3GFPA 1D6JA 3D1JA 3IS3A 5IDQA 3P0RA 3SF0A 2AMVA 3SXJA 1U1GA 1NMSA 4ZCRA 1IXYA 1HDEA 3EZ2A 4D5GA 1OZAA 4RTNA 3OKPA 4UM9B 3BWCA 3H83A 4RELA 4LZWA 4DGSA 4DDTA 5JQGA 4HADA 3EPRA 3HN7A 1E92A 1G20B 2VJMB 4KWTA 4HR7A 5ISMA 4X7RA 3Q5EA 5DSXA 4RFLA 3EXAA 4NENB 2H2IA 4HN4B 3FVVA 2QN6A 1OU4A 1RQGA 4FYVA 3T38A 1KZ4A 3OMLA 3T1HB 4HDRA 2D1SA 1T9HA 3Q7IA 4ZEWA 4Y9DA 5CFOA 1E1YA 2CLHB 1S4MA 3ENWA 1ZOLA 4JBGA 4MYUA 5AW5A 1D8TA 3RF6A 3RVQA 3TTSA 5BN3B 2UYYA 1KKLA 2VAPA 2OBYA 1EFVB 1QCCA 1K1EA 4FYKA 2YVAA 2CNWA 3WSTA 1YIDA 4LOIA 4G1VA 1BCRB 4F3TA 2YXEA 4UZEA 5BSKA 5K0CA 2FN3A 2CCGA 1Z3IX 4EDFA 5KYGA 2CXPA 2R84A 1VIMA 1XTPA 4KCGA 5TVKA 5BP7A 4MSUA 1H2HA 1MAHA 2JC3A 1HT3A 4IHJB 5DASA 4FC7A 4JY7A 3H9GA 3WMEA 1HURA 1N2OA 4LZZA 2ZSBA 2QJWA 5K0GA 5KWJA 1DC3A 1T5OA 4KQ2A 5DB4A 2RGGA 2QUJA 3O4HA 4ONEA 3HE3A 1V8FA 4D99A 5DMHA 4UTPA 4FIDA 1ODLA 4D0SA 2PCLA 4FCCA 1CNFA 3ZU5A 1NY6A 1BFKA 4OXKA 5ECWA 4LOJA 4WIAA 1B3RA 5JSKA 1L7NA 3QVSA 2PTGA 2BGMA 2HA5A 2IXDA 4QGAA 2QX9A 1AC5A 1XMIA 621PA 1KSHA 4D9FA 5K5EA 2VHUA 3QX7A 3FBWA 4Q4JB 5KNBD 1NBME 2ZBRA 3L79A 3A6ZA 3CH6A 5C4MA 2C9BA 3TKAA 5FNVB 4UXIA 2HF8A 2JARA 4B6OA 1S8NA 2GKSA 3E35A 2VKQA 2XD4A 2PX2A 4H4DA 1CQPA 4YC7A 5EUQB 1KVRA 4S05A 3FUUA 1U0FA 1GUAA 3PQ8A 5TF0A 4RJJA 1KYWA 2ZYUX 4PEVA 1NW6A 4PYMA 1DKPA 4FEEA 3JARA 1PTJC 2I66A 5E38A 3UMVA 1FE8A 4XDYA 5BURA 2UZ3A 3EEOA 1JG7A 1L4YA 4UEKA 3RHSA 4R9NA 4Z51A 3ZHRA 3CV3A 4OB8A 4N7MA 3SF8B 3HJUA 3GAFA 2WUDA 5GV7A 2FZVA 4B4WA 2G88A 3LA8A 3OFVA 4EJ6A 1P0QA 1U9JA 5G3ZA 2ODWA 2VDNB 2YOGA 1ISFA 3MQ4A 4G1UC 2QR5A 4CKBB 1LC3A 1Y6JA 3HJBA 3P9ZA 4LKRA 5AKGA 4MWGA 3VZDA 2JA2A 1KP9A 1GY8A 4CT4B 4EI9A 4XLZA 3E1SA 2OV3A 5GADl 3HLKA 5K0TA 1NRWA 1XZBA 2BELA 3K9LA 4MYRA 2MYUA 5E8JA 1TK9A 3CCFA 2G09A 2GUGA 3AETB 3ETJA 1IG0A 2FEPA 2WM9B 3AY3A 3W6ZA 1V37A 1CIJA 4ETNA 4Z7OB 1Q1BA 2Y99A 1DRWA 1OAOA 2WKWA 3P2MA 5DBFA 1NR7A 4I55A 3S55A 5KVAA 4EARA 4DLWA 4R2HA 4Q9JA 5G1PA 3IO5A 3QBJA 5LXTA 3L7BA 4YRLA 3RR2A 4E12A 1I2AA 4EB0A 2RAVA 1H3EA 4QG7A 4NWIA 1RYHA 4KBGA 3TG2A 1MA0A 3FHTA 1T5LA 3QKWA 121PA 1P1HA 2LRHA 2WWTA 5LXTB 1UINA 3O2QB 1C50A 4ZYYA 3JWHA 1X3SA 5LQSA 3EDCA 4LDQA 5EKTA 1G60A 2QN2A 1EFDN 3BRWD 4BO2A 4Q48A 4C0XA 2WFAA 1ZK4A 4HVLA 1R74A 4U3JA 4R2WA 4BCBA 2PSDA 4A1FA 3PGKA 1GDTA 4JI6B 3INGA 4HP8A 4DARA 2EF0A 1XTSA 5F73A 4ZO6A 1AK1A 2ZQZA 3BMNB 3MJCA 1ISSA 2CXUA 2IKSA 3T5GA 4CMBA 2HCBA 3PXCX 3LTEA 3SJ7A 3KAPA 4HPJB 5DNAA 2GZHA 2C7QA 3QF4B 4FT2A 1A50B 1FX1A 3K2EA 4ZO9A 4BV3A 3BWEA 2CT8A 1L6RA 2H29A 2ZT8A 3DQPA 3OETA 1OA1A 4OL9A 4H6WA 3R4CA 4F6CA 3TL2A 2P9YA 1NHGA 1XSEA 4MCAA 4LHWA 1E18A 4PN3A 1HSZA 4UCWA 2XDQA 2DLNA 3ANNA 4HOYA 3NDIA 5DWVA 1XZNA 2KBEA 2PL9A 1SKQA 4JASB 1VE3A 4QPDA 3JSAA 1DINA 3I6BA 4MUEA 5D84A 4A2PA 4BNTA 5A4DA 3RNLA 5EJIA 1U2GC 5AJZA 2LZ0A 5HS6A 2ALJA 3IT2A 2ZB7A 1W0JA 3BMQB 3QLUA 4HO1X 2YDYA 4GBGA 2ZSIA 3G85A 4F9EA 1RHRA 1O94D 2JHGA 1SUIA 1RM0A 3RS3A 3TRDA 4JOCA 4ZYXA 4DR5B 5CBKA 1S8AA 4OYYA 1HNNA 1W59A 1IONA 4Y9SA 2YRWA 3A7EA 1T8RA 1MG0A 2A0YA 2JGAA 2E4UA 4L3OA 4NBSA 4CPDA 2RHRA 4ZO7A 2YN4A 4HDNA 1OXSC 3JR7A 5F9HA 2PK3A 5K9ZA 1QAQA 1OHHD 4HAZA 1GT6A 1J24A 1YS9A 4JI1B 4A27A 1JMYA 1LSJA 2J9GA 4X0EA 3E7FA 4C0WA 3IJEB 1NN5A 3FWPA 3O92A 3PHGA 1KK1A 5ALPA 1KC1A 1DC7A 2QMHA 4HRVA 2IIQA 4YYZA 2WMDA 1FSGA 2V7UA 3P9KA 2VHWA 3JQFA 2F6RA 2JFNA 4V2IA 3N0TA 2IYUA 3RVMA 3CLKA 5BN5A 1LWNA 2NUAA 3V4RA 2NU8B 2EG5A 1FCJA 2GBLA 4KXLA 5E3IA 1E3EA 2HADA 4D3YA 4CM4B 5E7JA 4P4SB 3LP6A 2IFTA 3O1IC 1Q3KA 1R8JA 3I3SR 4G26A 4MW2A 2Q21A 4LRWA 5FLKA 5JJBA 1E6WA 4LHZA 1B6RA 4XSHA 1R0LA 1C7IA 3HG7A 3TXYA 1X1RA 3FCEA 4WZAA 2HBQA 3KWMA 5CB4A 4EJSC 4CNBA 1M2FA 1QVAA 1S2DA 5IVHA 3MPUA 1ZXLA 1E98A 3AVQA 2OOSA 5JZMA 5LKAA 5DLEA 1SEVA 5AMXA 3ZWMA 1ODFA 2OCPA 4LOAA 1RAIA 3KEGA 4FZVA 2XQGA 5DBOA 4XVUA 2Q5QA 3OECA 3FI0A 4LEIA 4QHYA 4WN9B 1YWGO 4K9PA 5H1YA 1YAJA 3HP4A 1V43A 3RAEC 4H1UA 4KPEC 4KLCA 1OZFA 4GKKB 4CEJB 2C0QA 4NE2A 1RJFA 3MGKA 4UDYX 4HSEA 3MWDB 4L4RA 1EVZA 2DLDA 4K6HA 5EUCA 1W581 2C95A 2D0DA 1FJXA 4WZBE 1YL6A 4ZCIA 3MYYA 4QT0A 3B36A 4PS1A 1JQKA 4JENA 1GDDA 2F8TA 5EJAA 2R8ZA 1IJEA 1M6HA 3ORQA 3RARA 4LNUB 4IRXA 4UUMA 3AEZA 1DAIA 5B58C 1E7MA 1MQAA 2G5PA 1QVWA 2GBGA 2O1XA 1ONBA 4HUQB 4N3CA 4OD0A 5LA6B 1JWLA 3D4NA 2HEGA 4IDQA 2COKA 4KUEA 5JALA 5BVGB 2VZ8A 5LOVB 1JHDA 1UXOA 3GLHE 2F48A 4UNNA 2NN3C 4F8EA 4ZJPA 3ABZA 4FEYA 5A4IS 3DVAA 4XVQA 4J7XA 2HLHA 3ZHOA 2CVPA 4KQXA 4O4LF 2VDKB 5I4IA 3IAS6 5MGBA 1NQWA 1R5OA 3WYAA 3Q3IA 4W8HA 3WLOA 1M2EA 4TMFA 5KINB 4FJ1A 4K86A 2GM3A 1IVNA 4HDNB 2FXVA 4CCYB 1LD3A 1WPQA 1ZBDA 3PFCA 3IE1A 1KRWA 2FWPA 3K94A 2WQ7A 4YMVA 4UC0A 1E69A 3PDWA 4GW3A 3BJIC 1N34B 2AN3A 3H5OA 4JDUA 3C39A 1E2DA 4RCVA 1CS0A 2GEKA 3QFRA 1PV2A 4NJEB 4PG4A 5DGDA 3ZCXA 2XVXA 1BYIA 1W49A 4KXQA 1OREA 4BU0A 1U3GA 2YX1A 1CR2A 1UDBA 2YZGA 2E5WA 1DO8A 2ZSKA 4LQ4A 5MN5A 1KETA 1Z0UA 3M4JA 2CMFA 1J5EB 1G5HA 1K5GA 4L4XA 1N1DA 2P9TA 4YWHA 2NADA 3MN1A 3WX0A 4I9UA 3U1VA 1E1RD 3HBAA 3MWJA 2V97A 3MUOA 4NAHA 2DCUA 2B9EA 2WIDA 1L5LA 4URZR 4PQFA 2DSNA 2A57A 1OGYA 2JLQA 2P7IA 2JK1A 3B70A 3IQEA 5K6AA 4LXTA 5C5CA 3MRSA 4BN4A 4QXPA 3EDQA 3JQ9A 4CEIB 3DVLA 2XWBF 3MGGA 3PDCA 5GJWC 2O4CA 3EK2A 4QWWA 4N01A 5JQWA 4MB2A 2XGJA 4U8HA 2ZJ8A 5ALSA 1H2RS 2O3RA 4GKAA 1NJ1A 5CCEA 3WNVA 3A06A 1IHYA 4NBUA 4C0QC 1AVTA 3C3WA 4JJZA 4CF4A 5B2ZA 2FKAA 1P3Y1 5ALNA 421PA 2MTBA 1WW2A 4PLZA 4ZDIA 2I8AA 3ZU2A 5EQTA 2CCKA 4M9UA 2K4MA 4P2GA 4AX8A 1I7QB 4YCLA 4NF2A 1COZA 4MUKA 2BPOA 1BXRA 1RFGE 1Y0BA 3H1PA 3SQMA 3D5TA 1WTAA 4J1TC 1J5XA 3S0JA 4Y7CA 4QNRA 2O8BB 1F2UA 3B1XA 3ZW7A 2GD1O 5A02A 4CETA 3KOOA 2Y9PB 3N2LA 5ICFA 2YWCA 2IPLA 4X66B 1HQCA 3FUWA 4HDCA 1C9MA 1II8B 1QZXA 1G3UA 1XTIA 3R09A 5TE9A 1KYTA 4A0FA 1CR6A 1Y34E 5K0ZA 1FEZA 1H2WA 3H3XA 4GMXA 3UWMA 4ENUA 3DEKA 1F06A 4EGFA 3PNMA 4Q3CA 1Z6ZA 2FR0A 3OOEA 4ID9A 3WSVA 4EY7A 3V1NA 1ODJA 1PEKE 5BVGA 5LOVA 5EERA 3B5JA 4NEQA 4KUHA 2PGAA 1F38A 1U7TA 4P4GA 4D6YA 3CRNA 4O1MA 5LLDA 3PVCA 4NMMA 5H5JA 5I8ZA 2G4CA 3ASVA 4CYMA 2GD0A 3SJCA 1YDMA 1XAIA 3B1WA 5I7AA 5SZKB 4C20A 3QX8A 1U2TA 1E1DA 3IV9A 5IK2A 3GYGA 4FZRA 2H92A 4KI7A 4D7AA 5CLJA 3T3OA 4R40A 5IM4F 3UJBA 1P0CA 3BTOA 3CUYA 3RW9A 3DJFA 3H2GA 3I5UA 1IY8A 4OHYA 4PPNA 5D3QA 1JHQA 2VXOA 4B9AA 1H5UA 2ZSHA 4N0QA 4UMDA 2YXDA 2QRGA 4G89A 1KO7A 5KVQA 4BLRA 1YFLA 1T3SA 5BSGA 1WHTA 3OX3A 2XNSA 2NV0A 3TOSA 2JI9A 1GZHB 4OQ4A 2PUVA 1QZ3A 2QTCA 3U6KA 1RI5A 4JMLA 3TF5A 3A3YA 3L6UA 2VXYA 3GDWA 4A8JC 2Q49A 4PPYA 1IJFA 5CPFA 2VAMA 1BDMA 5F2EA 3V6MA 2E21A 1V39A 3COZA 4HS9A 1SG6A 3PUKA 2YZMA 4KL8S 4DHEA 3V8BA 1RFLA 3D3QA 5FQOA 5L4LA 1GGJA 1CXZA 2JZNA 3ABSB 1PQWA 3BSSA 3H2JA 4B45A 5LZ2A 1KEEA 2GF2A 1CY6A 2DCMA 2GPSA 2RKWA 4C7XA 2DMRA 3LPCA 2FUG6 4V38A 2I2BA 4PGFA 2A94A 3UT0A 2VDJA 4ENSA 5LWQA 1FS6A 4C01A 2GSDA 1GUFA 3Q8WA 2ZWOA 2QAGB 2OFPA 2Q3MA 1WDMA 3SC2B 3STTA 2ZRBA 3T7IA 6Q21A 3FPCA 1UBKS 1SU4A 1E96A 4TMYA 4YJ3F 3D5EA 3PC8A 1MD9A 1PJQA 4ARUA 1W87A 4G4SO 1WU8A 4U7PB 5FPTA 1E5TA 5LYYA 1I4DD 4ZVTA 3KLPX 3SEZA 8GPBA 4NZZA 5LBTA 1T35A 1IHOA 3DNFA 1YZYA 5LPNA 2X13A 2AE2A 1J33A 2DB3A 4EUKA 1ZUNA 1F9EA 2X0EA 4LYGA 4L5JA 5PGMA 1TEHA 2BFPA 2ONZA 2YOFA 3FFTA 4Q3AA 3IB3A 5DBEX 3UY4A 5BQFA 1PO7A 3VR4A 2D2IA 2PX5A 3JVEA 3QMWA 1Y6FA 5BWNA 1PSDA 5IXSA 1EP3B 1TCAA 1W36B 1F20A 2AQHA 2P4UA 3SQNA 4CM3A 5KYXB 1CDOA 1EAMA 2EIHA 4YXFA 1F2TB 4M1SA 2Y71A 2FZ5A 4CTKA 2JKVA 5KEIA 3A4YA 4RVNA 2J33A 1LDEA 1PRYA 4B73A 5DCWA 3RYCB 3UO8B 2D62A 3OICA 1NMQA 1VCMA 3X1KA 3OLVA 4RZHA 5EIBC 2QVLA 3UFXA 5IVPA 2C7PA 1J2EA 2NUTA 3PCRB 4GHWA 4YMGA 4Y30A 2IUSA 4FJ2A 4JVMA 4CLHA 5KX5A 2W6JA 3CEPB 3BG5A 3Q9NA 4LE1A 3I0ZA 4XR4A 3TLJA 3TN7A 2JLXA 4GVXA 3DB2A 3IKJA 4WLOA 2FEKA 1M75A 2Y0CA 3CZ4A 1VYVA 1QPZA 1EK2A 4Q7JB 2DG2A 3FW1A 3OQVA 1RP1A 4O4IA 4KFSA 1OZGA 2HHLA 4PR0A 1TJPB 2BSQA 3FWZA 4CG1A 3AF5A 3U9TA 3DLHA 1GLVA 1L3IA 4I4TB 4MKIA 3BIXA 3QVXA 3H87A 1HLDA 4ZANA 4M0EA 3I4LA 3CM0A 2FFAA 2HM7A 2FP4A 1VHDA 1GFZA 2QRJA 1N3YA 3JQBC 3L0PA 4FW8A 4L9WA 4NJMB 4EUFA 4LJ4A 3M6AA 2Z83A 1GU0A 1LPPA 2WSYB 2W4QA 3KAKA 1VSQA 1IBSA 1T2NA 4X92A 3OHSX 2PUCA 5IAGA 4EDHA 4H60A 1Y8AA 3S2FA 3CKYA 3CF2A 4DLTA 2C78A 3M9LA 1XXHA 4ZU3A 3RVDA 3W3AH 3KG2A 1IULA 4CLRA 5CITA 4Q9LA 1JFRA 4YALA 2HAEA 3DLAA 3LUCA 1VG1A 1F12A 3AB7A 4R1LA 5BQPA 3WA6A 2YWJA 2EKZA 5BY2A 3A6LA 8LDHA 1RRMA 5E2BA 4AROA 3I05A 2HCRA 4UUAA 4HB4A 4EY5A 3H9UA 4OGLA 3UUWA 1J23A 2IU6A 1HFEL 5JATA 2BZGA 2WIBA 4EX6A 1KAQA 2GPJA 3GJTA 3K72B 4W1SA 5BQOA 2J87A 1TD1A 3OHPA 3M6XA 1AKVA 4MIEA 3MXOA 1KQFA 4J16C 4G23A 2QP3A 2FPMA 3ANMA 3C87A 1UDXA 2EZTA 4DPMA 5FEUA 3KQVA 4LF6B 1NFRA 1ZP6A 2R4TA 3FCCA 3HGQA 4M8KA 3IXLA 3ZDRA 4TVOA 3F90A 5EC8A 5AOAA 2OQRA 1H2FA 4BFXA 2QEQA 3LOUA 1UP6A 4RZIA 2FDCA 2A9FA 1SXJC 4TLBA 4M1EA 1FDSA 3JZIA 2RONA 1AGNA 2IZOA 3ZX5A 4Y3UA 1M67A 1VPWA 1U3CA 2JGFA 1FTQA 2IYVA 1I4OA 4QBKA 1CFZA 4TS9A 1JDBC 2G9NA 3LIPA 2ZIVB 4PGAA 3TLCA 1FMJA 4C4ZA 2LWIA 5IXYA 2LTAA 4YI5A 1KQNA 4DR2B 2PWZA 2HSGA 5DHAA 5KOYA 4G65A 3G6WA 4C29A 2ADMA 3RSZA 1IJKA 1KFBB 2C94A 1ONPA 4EW1A 3NHJA 2DH6A 4QSHA 2X19A 1YE5A 3ENQA 3PPXA 2PZLA 1LS1A 2GBLC 4MDYA 2YS6A 3T7AA 1DJOA 5J2UA 1UXHA 1HOXA 1Y1PA 2QMEA 4W4TA 5AQEA 2A0UA 2KJQA 3LQFA 1W4BA 4IUCS 2C3UA 2ZRQA 4U2FA 1N2IA 2ZCJA 1E9SA 2IYRA 1IU9A 5A4FS 3ZDZB 1DX4A 2X6QA 2K7FA 2G06A 4ZT4A 3WL7A 1G8FA 1EIWA 3S2SA 2ZS8A 4BCDA 1FSFA 3BXXA 2GD2A 3UXHA 3KUCA 4OXRA 3M1IA 3ABQB 4QNNA 4MPDA 2J9ZB 3EIEA 1T25A 3KALA 1KQ3A 4NU8X 1E9AA 3GT7A 1E60A 1NQUA 5H3CA 3K0SA 3GMSA 4DCTA 2WI8A 3BK1A 1WO8A 1JMVA 1Z2EA 2C9YA 2RAUA 1XWFA 2RHDA 4MW9A 4OHBA 2OXIA 2JD1A 5DGCA 5CG1A 2YN0A 3VPHA 4QBTA 1SVLA 4B0PA 3VNQA 3B13B 2IBSA 2ZYWX 2IXAA 1K5HA 5BYKA 4RL6A 5ILQA 1B6GA 4B5KA 3O95A 2J4DA 1SUBA 4U3JB 3A6DA 1NR5A 3ZN2A 4LAFA 5CDUA 1WMFA 1N7GA 3H99A 5A5GA 3QH4A 2IYPA 3KWLA 2Y1LA 3CVOA 4RIGA 4C3ZA 4OHKA 5TPZD 4JX9A 3O8RA 4S1TA 3RUAA 4D9EA 1UWLA 2BKXA 3FFBA 4DVGA 2DQ4A 1XRLA 3RM3A 4CTNA 4JJIA 3AIOA 3LS2A 3QJYA 4LXQA 4R5MA 4CM4A 2HMWA 3MJHA 4HYYA 2PZ8A 3QE0A 2FW0A 4JHXA 1L1EA 2BLNA 3G88A 4ND1A 1AU9A 3WGGA 3OQMA 2WG1A 2Y1KA 3UFBA 1PWEA 4FW9A 1JG2A 4NC9A 5GONF 4BP1A 3SKYA 5FV4A 5JBNA 3KCQA 2F3PA 3HNRA 5C8YB 3QUTA 3WTBA 2C31A 2XQIA 5BSRA 5ENDA 1XMOB 1MJFA 2D0OB 4BX2A 4RQAA 1YQEA 4UNQA 5KYYB 1CYEA 3DC7A 1IZYA 3EGXB 3TD2A 4R2XA 1KXZA 3GOQA 5JAHA 1EK0A 5H8WA 2H6EA 3K6JA 1GAJA 2N0SA 1E2PA 4EL5A 1THMA 4AIRA 3IDZA 4XYLA 5K4AA 3EGXA 3H1FA 4E5YA 3NS7A 1AJEA 2VNJA 3RJMA 1QJCA 1YB6A 2QTMA 4B9EA 4BLSA 4AJOA 1V9CA 4YT2A 4F96A 2XJ9A 5BV1A 3JQQA 2XRZA 4QXAA 4C43A 2BM8A 2H08A 2ZIEA 3UWPA 1N1GA 3R5HA 1UZMA 1XJQA 3PGLA 1QOZA 3PEFA 2F9MA 3BE4A 5LZ7A 4AFNA 4DM4A 3ZXYA 3W3AA 3R4VA 1N2EA 2NO1A 2W6OA 3UC5A 3C3KA 3EPPA 4LOHA 1OPRA 2PNFA 1J2YA 2NXJA 3R20A 4JUIA 1KERA 1EXNA 3ZPXA 3G13A 4RENA 1XD2B 3H75A 4GPTA 4FDAA 1RJ9B 4K05A 4QQKA 5B6IA 2ZU6A 1UDWA 2CL7X 4DLXA 5BV0A 3C8MA 2NO6A 3UH0A 1PBNA 4JL8A 4BATA 3P2YA 2PAAA 3HNPA 3LY8A 5EKXA 3T0IA 1X0XA 1O0BA 2Q5CA 3N2IA 3NIWA 3W78A 1GPBA 3QEJA 2HQRA 1G9SA 2V7EA 3PGXA 3LFHA 3DBIA 4OMUA 3HDQA 1VB5A 4OATA 5DM2A 2PH5A 3RTAA 1I10A 4YV2A 1QPBA 1JHMA 4LI0A 4C6RA 1TZJA 4D45A 1GYQA 1II9A 1E8MA 3OZ7A 4HQKA 1YHNA 4D74A 4EFDA 5CFQA 1C8VB 4G86A 3QI2A 3REOA 3L07A 2MJLA 1US8A 5FI3A 3ZWOA 1RZVA 3C1UA 1P2UA 3DYIA 3VAAA 3IKTA 4C88A 3OIYA 2Y8EA 4EMTA 3IPXA 1UCFA 3DE4X 1KR2A 6GPBA 1G6OA 4TRRA 2HLDA 3GAZA 4G4JA 4C4OA 5BSHA 1O97C 3GPCA 3BMCB 3OOJA 3WZLA 5TDHA 1K92A 1V8OA 2B82A 3WP1B 4JL6A 4OAOA 2O1EA 4U6NA 1DADA 4RETA 3N05A 1XZHA 1FRFS 2PEZA 3PC8C 4MB0A 2WE8A 4PPFA 4B6QA 1JFSA 5LM3A 3HXQA 2JK0A 3F0TA 4IDCA 2EYUA 4N18A 1KEZA 2DULA 1A9RA 2B0CA 1KGSA 4D9MA 4G8JA 2XA1A 4LX8A 1X6VA 4UTXA 1ZY2A 4PHCA 5HDQA 4RPIA 1SB9A 1XK6A 3NUZA 3ITEA 5G0UA 4F1KA 1H23A 4QUJA 4C0AC 1NSYA 1W19A 4P84A 5JYDA 3OQIA 3ZVLA 3KYBA 1TQ8A 4Q3BA 3TQCA 2JGJA 1N2CB 5A9SB 3W8FA 2FRDA 5K99A 4RXTA 1SBCA 2FK7A 3LKVA 1VA5A 2LE0A 4OQPA 2O9JA 2YFYA 2Y68A 4AZTA 4V3BA 1XRPA 3NTOA 1LDBA 1M34B 2R86A 1CF4A 1PFKA 4BBPA 1A5AB 1LY1A 1T36B 1VLLA 1E5DA 2PMBA 1FX0A 2VDMB 3TJMA 1CVIA 5K0FA 1P5HA 5REQB 3WHLA 4JP8A 1JZTA 1MDFA 4WOJA 4GP6A 5JS1A 3LX5A 1BO6A 4PV7A 4HMPA 1VMKA 4CIAA 3D2AA 4OQLA 3NTVA 2I65A 4R2IA 4PO3X 2AYYA 3CHYA 2GXAA 3KKMA 3U49A 1HQKA 2H51A 1N0UA 4NZOA 1H69A 4X97A 2G9QA 3OP1A 5JVDF 2DJ5A 1GTMA 1MQSA 3RIGA 1JJAA 3TAUA 4CV1A 4FMPA 1GKYA 2Q45A 4OU4A 3EXIB 5KS2A 5CT4A 2PHZA 3KPVA 4XARA 2IW3A 3AESB 4KJZA 3I9MA 4OHUA 4TTQA 3WXBA