4PSCA

Structure of cutinase from trichoderma reesei in its native form.
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
220
structure length
220
Chain Sequence
WPSINEFLSELAKVMPIGDTITAACDLISDGEDAAASLFGISETENDPCGDVTVLFARGTCDPGNVGVLVGPWFFDSLQTALGSRTLGVKGVPYPASVQDFLSGSVQNGINMANQIKSVLQSCPNTKLVLGGYSQGSMVVHNAASNLDAATMSKISAVVLFGDPYYGKPVANFDAAKTLVVCHDGDNICQGGDIILLPHLTYAEDADTAAAFVVPLVSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Cutinase from Trichoderma reesei with a Lid-Covered Active Site and Kinetic Properties of True Lipases.
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
molecule keywords Carbohydrate esterase family 5
total genus 74
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2014-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pscA00
3H2HA 5HK8A 1WM1A 5HKBA 1C4XA 4AN0A 5DYYA 3STXA 4AO7A 4BATA 3G02A 4IH9A 4K6GA 4G8DA 5AIAA 4BVKA 2J3DA 5AH0A 1U2EA 1QIMA 5HCUA 3DYVA 2I3DA 3A2NA 4QWWA 1USWA 4OUKX 2HRQA 4ZXFA 4CIAA 4UBOA 2VJCA 5AKEA 2JBWA 4BC1A 3EQ9A 2GYUA 2PSDA 3TGLA 4B6GA 3KOOA 3PFBA 1SCIA 5AOBA 5FOQA 1P0MA 3AILA 1JJBA 3PUHA 4UBNA 2HU7A 3WWEA 3S8YA 1QLWA 4EUSA 2AJ8A 5JD6A 1XZEA 2OGTA 4WJLA 4OYLA 1F0PA 3WWPA 2XMQA 3FVTA 3G9XA 5AKJA 1GXSA 3ICVA 2WUFA 3WIOA 1Q84A 1AQLA 4EY8A 2GYVA 3D3NA 3R40A 2CJPA 3DJYA 1WHTA 3C6ZA 2V9ZA 1YA4A 2WILA 5AI9A 4AXBA 1SC9A 2O7RA 4AMYA 3BF7A 4V2IA 3WL6A 4G8CA 2GBIA 2H7CA 4QDTA 4X97A 3D2BA 4Y7DA 5K3DA 4J0GA 2AXEA 3O4GA 3G0DA 3FSGA 3H2GA 5ALZA 2ZSIA 5C8XA 4N8EA 4OB8A 4X6XA 3V1NA 2DQYA 1EX9A 2DHCA 5AK6A 2GYWA 3RARA 4B7ZA 1LPOA 3V1MA 5CMLA 4B81A 4DGQA 3UMJA 4GHWA 4GLBA 4FLEA 3VDXA 3M3DA 2PL5A 5I7UA 3BDIA 2DHEA 4H7FA 4MXDA 2PBLA 1HQDA 3R0VA 5I9IA 1MX9A 4QZVA 4Y2QA 2V98A 3C8DA 3DDUA 3HYSA 4KACA 1JT2A 2FUKA 5JAOA 2JGMA 2BJHA 4A16A 1BS9A 3ZI7A 2IX9A 3WZMA 2OGSA 4EB0A 3O9VA 2ORYA 1G66A 4Y2SA 1VZ2A 1XZFA 4NZZA 2CBGA 4ZV9A 3FVRA 2V96A 1MJ5A 2BUCA 3N2ZB 4ZWNA 1EI9A 2HA0A 2PSJA 2Q0XA 5JAPA 1JMYA 1N1MA 3FLAA 4C01A 1VJ5A 3DOHA 2Z3ZA 1XLWA 4FKBA 2Y2UA 3C6BA 2ZJ6A 3C5VA 5A7FA 4QE3A 3O4HA 3I2IA 4AMZA 1THGA 1DQYA 2O2HA 2WIFA 4B85A 5AIBA 1QFMA 1SFRA 1XRQA 2QUBA 4ZRDA 1EB8A 2G4LA 2JGJA 1XZJA 1MN6A 3QYJA 3F9CA 1DWPA 4DNPA 3DS8A 1FFDA 3I2JA 1EVEA 1HL7A 4Q3LA 2OQVA 3JWEA 5A2GA 3WL7A 3FCXA 3H19A 1QO9A 3VVMA 1E89A 2QXUA 1XZCA 4J3JA 3IULA 1ZD5A 3W9UA 4FNGA 4PV7A 1VE7A 4K6HA 1NU6A 3R41A 4BYMA 3QZUA 4HVTA 3TRDA 4RE5A 3GA7A 1UK8A 3QVMA 4EY6A 3CN7A 1X70A 5HQ3A 1A8QA 2Z8ZA 1E66A 4YPVA 4MEBA 4E15A 5J3JA 4U2GA 1H2XA 3MVEA 4KE6A 3Q8WA 4GW3A 2WHPB 5T4HA 5ALUA 5ALFA 3IUJA 3F67A 1VA4A 4LXHA 4M0EA 4CIBA 5IVHA 1MX1A 2GZSA 4DMFA 3HXKA 4B0OA 5AI4A 3OPMA 1QIGA 2DFPA 3PI6A 1CUFA 5LZ7A 2XUAA 1CFJA 4G1FA 3T4UA 5LZ2A 1R3DA 4C89A 4OCZA 3STWA 1TAHA 5AKKA 3I2KA 1MNQA 1GKLA 4NS4A 1HDEA 4JH0A 5AKHA 1LPNA 5FLKA 3WKBA 1LPSA 2J4CA 2QRUA 5AM1A 1HLGA 2QT9A 4N5IX 4GDMA 1FFEA 2XMGA 4P08A 1QGED 4DLNA 2OG1A 1WCYA 4DIUA 1CVLA 2VQ6A 4BP9A 3L1IA 1CUWA 3NUZA 3F8SA 1DINA 4Y2TA 2WJ6A 4IO0A 1XZBA 4FMPA 1FFCA 3WWOA 3DL7A 3VXKA 4PSUA 1IZ7A 2D5LA 1U65A 4L9AA 1CQZA 1CUYA 3I2HA 3OM8A 1ORWA 4X85A 1CUJA 1QOZA 2YXPX 1CV2A 1LPAB 2O7VA 2WSLA 4BZWA 1CUBA 1XQVA 5DTIA 4J03A 1WOMA 4RE6A 3H1AA 2AJDA 5K3FB 4Y2XA 4DNFA 3FWHA 2XUGA 6YASA 3D7RA 3I6YA 2EDAA 3IUNA 4OB6A 2HDWA 4B80A 1QIHA 3G7NA 3VJMA 4QLOA 1Q83A 5JASA 2GZRA 3EF3A 2ACKA 5CT6A 4FBMA 3I1IA 1VOTA 1TRHA 2PSEA 2WFZA 5ALPA 2ZYIA 3QMVA 4H18A 2HU5A 1FFAA 1N5RA 4JYMA 4DNOA 5A6VA 2JGIA 1DWOA 3D5EA 3HZOA 4XVCA 3VJLA 1CR6A 4MQLA 5EGNA 5CTAA 4B9AA 5ALJA 1R9NA 3STYA 5ESRA 5LZ8A 4N8SA 3CN9A 2G5TA 2XUDA 1MPXA 3M81A 4BRSA 4H7IA 3QPCA 4QA9A 5FV4A 4C4YA 5YASA 3DKRA 1M33A 1JI3A 2WG0A 1UT6A 1ODTC 4DSAA 5HF8A 1ODCA 2XDWA 2VTVA 4WFKA 2QJWA 2HA5A 4OPMA 3FNBA 1YSCA 2B4KA 4U2DA 1J06A 1AURA 1UK6A 4MJ3A 1BN7A 3G0BA 2DSNA 1KEZA 2HA6A 5LZ4A 1D07A 2K2QB 4Y2YA 1XRRA 1QIKA 3OOSA 3PFCA 5EIHA 3NWOA 1BROA 4J0DA 3ZLTA 3K2IA 5T4FA 2GBCA 4B84A 2BKLA 1CUVA 2VATA 4BAZA 3HEAA 2VJAA 4EY4A 1U8EA 5DTJA 3G9TA 5JANA 1K4YA 1ZIXA 2C5GA 1LLFA 2WUDA 4HS9A 1JJFA 3TEJA 1YAHA 1XKTA 3DYIA 4FNMA 2CMFA 4UBIA 2WHQA 2J3QA 1XROA 4UFNA 4UHHA 1IUNA 2FJ0A 1ISPA 4X94A 5IKXA 5JD5A 3UUFA 3BF8A 1T4MA 4X7BA 4KE7A 1ZGCA 4G4JA 4BE9A 1XZKA 1BCRA 3DL4A 4M0FA 2PUJA 5AKLA 2OCGA 3I1YA 5ALLA 1UXOA 4WDQA 4DNQA 3U1TA 5AICA 2QKYA 3IBTA 3WK5A 3M83A 3LP5A 3ANSA 4PSDA 2VAXA 3IVMA 4P92A 2PPLA 4AQDA 4WDRA 2JEYA 1DT5A 5DWDA 4OU4A 2XQGA 4AN1A 2XI4A 3ANTA 1LNSA 1XRMA 4C88A 2BCEA 2ES4A 3QM1A 3KD2A 4XWGA 3SWWA 1A88A 5LIPA 4BRZA 1H2WA 2EDCA 1EK2A 2Y2VA 3JYHA 4BAUA 1RWQA 1E3QA 4G4IA 2PU7A 1EA5A 4DMCA 3NGMA 4X91A 5EIAA 2WJ4A 5ALWA 3D59A 4K5QA 4GEGA 3I28A 3G0GA 3K6KA 3FCYA 1R4ZA 4WY5A 3WKDA 3BDVA 1E8DA 2JEZA 1DT3A 2AJLI 2OPHA 4K6KA 1NU8A 2D0DA 4LXIA 1UFOA 5T4EA 3ZWQA 2G5PA 2VSQA 1QFSA 2OAEA 4W1SA 1XQXA 2X8BA 2J4FA 1EXWA 3RKSA 2PU5A 1AZWA 5ALRA 3PE6A 5AM0A 5BWBA 3DCNA 3BJMA 1UKCA 2PVSA 4ARAA 1AC5A 1H2ZA 1W75A 1YR2A 1E5TA 4INZA 3R3ZA 5KREA 3ILSA 5JALA 5HFAA 1ZD3A 1CUUA 4FTWA 4A23A 1VE6A 1MAAA 2PM8A 5HK9A 2XMCA 4M0MA 1XZHA 4CCWA 1ZOIA 3HJUA 1HPLA 1QE3A 1P0PA 4GECA 3BE8A 1B41A 3HC7A 4J0JA 1BCSA 5JARA 2XQJA 4KE8A 1EDDA 3FSGD 3WA6A 3D0KA 4DSZA 5LKAA 3QBJA 3W9BA 1MNAA 1MO2A 1BEZA 4Q3KA 4BTVA 1HKHA 1TCAA 4FOLA 3WJ1A 4MYSA 3D2CA 2ZYSA 1FFBA 1XLUA 4QLAA 4G9GA 4X71A 2OQIA 4MWSA 4N8DA 5C7YA 1R9MA 3G0IA 1OXMA 4TGLA 1QTIA 4MQMA 1ODSA 3QH4A 2RHTA 3FAKA 2I3ZA 3W2TA 1VZ3A 4P9NA 1CIJA 4FDMA 1A8SA 1UK7A 2BUBA 1QIJA 3OC0A 2LIPA 3E3AA 3CXUA 4CG3A 2XLBA 5CURA 1YA8A 2BFNA 3DD5A 4J0IA 5KWJA 4KEAA 3F97A 5A7GA 4C4ZA 5C81A 1NX9A 1UOQA 3UUEA 4J0CA 4QDXA 2ZJFA 1PFQA 4W1QA 1K8QA 3A2LA 3K9BA 3SC2A 3WWCA 5CT9A 1IZ8A 2ZJ7A 4UHCA 2XUJA 1XZAA 1ZI9A 2P8SA 1XZDA 1RP1A 4BDSA 1LPMA 5I8PA 3FLEA 1TCBA 3N0TA 4AZ3A 1UK9A 2WM2A 3WLAA 1ZJ5A 3ESBA 1YCDA 1YB7A 3GFFA 4TVKA 1QONA 3I2FA 4BCDA 3QITA 1YAJA 4EHBA 1LPBB 1QIEA 3AFIA 4MYDA 1XRNA 2CKMA 3VVLA 5KWIA 2PSFA 3AJAA 3LS2A 5K3AA 3LIIA 4PO3X 1X2EA 2WIKA 3T52A 5C8ZA 1AGYA 3M82A 1R1DA 3EIOA 3DLTA 1CQWA 4IH1A 1EINA 4J7AA 3F98A 1EH5A 3QMWA 2XQKA 4RGYA 3CCBA 3C5WP 2WFLB 1XZLA 1IUOA 1ACLA 1GPKA 5CH8A 2O2IA 5E2IA 2DR0A 4H35A 5EHXA 4PF1A 5K3CA 5AI0A 5AKXA 1IVYA 4NMWA 4JNCA 1MTZA 2VJBA 1THTA 2OAGA 4NVRA 3L1JA 3LLCA 1IUPA 1F6WA 1U4NA 2HM7A 3AIKA 2R11A 2XLCA 3WA7A 2XMSA 2XMZA 3WWDA 4L72A 3VJKA 4OSEA 4I3FA 2QJRA 2YYSA 2Y6VA 4H0CA 4LYEA 3DKKA 3H0CA 3V9AA 3EQ7A 4X93A 3R3VA 1ZIYA 2PUHA 3MUNA 4GBGA 3A2MA 1LPPA 5EHZA 1Y7IA 2ONCA 4YX9A 1H2YA 4Z49A 2XUFA 2EEPA 3PF9A 5CH3A 1Q0ZA 2PSHA 2ZSHA 4Y2UA 3TJMA 5CT5A 5F4ZA 4CCYA 2CUTA 4I4CA 1VLQA 4Y9SA 5EI5A 4F0JA 1Y37A 5AM2A 4KRXA 1GPLA 2PX6A 4BDTA 3KDAA 4U2FA 4U2BA 2XUIA 2HRRA 4UHBA 4ETWA 5JADA 3MUOA 1XZMA 1YASA 5ALTA 1S8OA 2H7YA 1J1IA 1H23A 4Y2JA 2HA7A 2WTMA 1CPYA 3PF8A 1UOOA 4ZI5A 2NW6A 3GELA 5CH5A 1ORVA 1CUZA 1MX5A 5CW2A 2XE4A 3Q0TA 2C0QA 1L7AA 1WPRA 3WL8A 1I6WA 4LKOA 4AZ0A 5ALKA 1WHSA 4BVLA 3W05A 5ALIA 3FYUB 2AJCA 4UFPA 1JFRA 5DNVA 3RM3A 2OCIA 4N5HX 4K2AA 2C58A 1C7IA 2OCLA 3WYDA 3I6MA 3GBSA 3C87A 4L3WA 2RHWA 5CT8A 5A7HA 5DNWA 2WIDA 2I03A 4MWTA 3E0XA 2CZQA 3GZJA 3GUUA 4BCBA 4Y2VA 4AO8A 2QUAA 5IVKA 5ALMA 5JATA 3FYTA 4H7DA 4WFIA 4QEKA 2XB6A 2WG1A 5AP9A 5AK5A 4HRYA 1GT6A 2DCMA 5HZGA 3AINA 5JD4A 4DM7A 4HAIA 4W1RA 4W1PA 1E8NA 4ITVA 2ZYHA 1UOPA 1YS2X 2WKWA 4W63A 1H22A 2DHDA 2WUEA 1XRLA 2YH2A 3W06A 3IURA 4B83A 3KWFA 5BWCA 5E4YA 2JIDA 1ZI6A 4QDUA 5H3HA 4H7HA 3O0DA 1XRPA 2VJDA 1KU0A 4H7JA 2XMBA 3R3XA 1JKMA 4OD0A 4C6HA 1LGYA 4BZZA 3EBLA 2H7XA 3BL8A 1CUCA 4GI1A 4ZGBA 2WU4A 1QJ4A 4J0KA 2CB9A 4EY5A 3KXPA 3L1HA 2DQZA 2CEKA 5HF6A 4HXEB 3ICWA 5EIEA 3C43A 4Y2PA 4QDZA 3FBWA 4KAJA 1G5FA 1GKKA 3U0VA 5LZ9A 5LLSA 5FRDA 4KAAA 4Y2RA 1L7RA 3B5EA 3H2JA 4OU5A 4ZREA 3BWXA 5BV7A 3A6ZA 2W6CX 4B0PA 2C7BA 2O2GA 4P93A 3VKFA 1O6GA 4FLMA 1OILA 2C4HA 1FJ2A 2XT0A 5AJHA 1L7QA 1MT3A 3AIOA 3OURA 1DU4A 5FPQA 3QPDA 3BIWA 1CLEA 1CUAA 3SX4A 3W04A 3FOBA 4UBKA 2PKYX 2JGKA 5DJ5A 1PJAA 1O6FA 2ZYRA 2FX5A 1ZD2P 2B61A 2VT6A 4RPCA 3DNMA 1XQWA 4FBLA 5AK3A 4JEIA 5T4BA 4PNZA 1CUSA 4HZGA 2XQIA 5D6OA 5ALVA 4KRYA 4L0CA 4X6YA 1N8SA 1W52X 5ALDA 1X2BA 4DMKA 1VA5A 5ALQA 4E14A 2HL6A 3HLKA 2BUAA 3S2ZA 5CBKA 1CUGA 1WB4A 4AX4A 4BTLA 4UHEA 2BGNA 2OCKA 5LZ5A 1DWQA 2RI6A 5LYYA 5AKZA 2V97A 2VA9A 1W76A 3E4DA 1DTEA 3B3QA 1ZICA 1Z68A 2C0PA 4S0XA 5A71A 1R88A 3G0CA 1AKNA 4LIPD 4GXNA 3A70A 3BXPA 4UUQA 2Y6UA 5DYTA 4Q05A 3WKCA 1MU0A 1AUOA 2XMRA 4X6UA 2RGUA 3YASA 3V48A 1G42A 1RYYA 1SCKA 3OTQA 5ALNA 3BJRA 4U2EA 1LBTA 3V1LA 5DNUA 1GPNA 2UZ0A 2GBFA 3ESDA 1JMKC 1FSSA 2X5XA 1DQZA 3HSSA 5JAUA 3FYUA 1EDEA 3G8YA 4CCYB 4CI9A 4Q1VA 1AX9A 1JJIA 1F8UA 2ECFA 4ROTA 3WJ2A 4Q82A 3G9ZA 4XIIA 4WCVA 4G8BA 1B6GA 4HRXA 5JZSA 2BGRA 4OB7A 5JIBA 3X3HA 4E11A 3GROA 3AZOA 4QWMA 4EA6A 3NOXA 4X90A 1DX6A 3DEAA 2ACEA 3PUIA 4F60A 3LCRA 4Q34A 1YS1X 2XUOA 4UBJA 3WK6A 2ROQA 5AOAA 4X00A 2WQZA 2HHAA 3WIBA 5A62A 2W22A 5ISMA 1ZJ4A 5AM3A 4X95A 4FFVA 2WU3A 1XZGA 1EB9A 5D3ZA 4J0HA 3EQ8A 1EHYA 1Y7HA 2GBGA 3QPAA 5CRIA 4YASA 2HADA 2E3JA 2XUKA 5D7BA 3H2KA 5EFZA 3G9UA 4CG1A 4EBBA 1QIIA 2I78A 2HFKA 1EDBA 4CFSA 4BC0A 1J2EA 3V1KA 1W4LA 2Z8XA 3OG9A 1OCEA 4QDOA 1GGVA 3ZPXA 2YASA 1JU4A 2HFJA 3AZQA 2AJBA 3C45A 1LBSA 3FLBA 1ZI8A 4LYDA 1XQYA 3H1BA 1BRTA 2QXTA 5SYMA 4JYPA 5ALXA 3ZLVA 5AOCA 3H18A 4F21A 3E1GA 2QVBA 4TPKA 3WI7A 3HI4A 1HBJA 3IUQA 5HF5A 3WZLA 5JAHA 1TK3A 1TIBA 1G4HA 4G4GA 4YK7A 4XJVA 4PSCA 1LZKA 1SCQA 2WTNA 3C70A 3VISA 5ALOA 3STTA 5D3KA 4FLFA 4PQEA 1R50A 5ALEA 3MGAA 5FPPA 2OXEA 4AB1A 5ALYA 1TCCA 5DLPA 3B12A 3HABA 3R3WA 4CG2A 2VAVA 1KU6A 1F0NA 3IDAA 4OYYA 5HFNA 4Q3OA 2VF2A 2WFLA 3D4LA 5KBYA 2QR5A 4G5XA 2QOEA 1CUHA 5AO9A 3HACA 4XX1A 2XQFA 3H2IA 4UFOA 3JW8A 1ZD4A 4ARBA 4BP8A 2JGEA 2ZVDA 3SK0A 3D2AA 4BBZA 4BB0A 3O4JA 3P2MA 1QIFA 1TQHA 1TKRA 3KSRA 5IVIA 5C8VA 1XKLA 1Q0RA 1CUXA 5CXUA 3RK4A 4EY7A 1EVQA 5K3EA 4IQ4A 4A5SA 1SOMA 5CT4A 4PW0A 2H9YA 3AUKA 1GZ7A 1K5PA 5AI6A 4X3CA 1VKHA 2IITA 3AIMA 1AMNA 3I6ZA 3ZLUA 3PDCA 1XLVA 1CEXA 5HKAA 4GWLA 3AZPA 1DX4A 5FUMA 1JU3A 2HA3A 3DOIA 5K5EA 1A8UA 3ESAA 3WL5A 3WK8A 3WYNA 4EZIA 1LZLA 5JYCA 4KE9A 4WFJA 5E4JA 1BEEA 1GQRA 4UBMA 2XUQA 5AHXA 2H1IA 1UWCA 2B20A 2Z3WA 1C7JA 3WMRA 4FFWA 2QM0A 5HF9A 5ALSA 1PV1A 5K3BA 2R8BA 3IUMA 2WLSA 2JGLA 1J07A 3CCCA 3DQZA 4H7EA 1W6RA 1T2NA 4IH4A 4H77A 3STUA 5ALHA 3IB3A 4DTCA 3IIIA 4UHDA 2HU8A 5CXXA 3R3UA 2RONA 3HRHA 1UKAA 3O4IA 5K3FA 2XUHA 4F5ZA 1XFDA 4HXFB 1QO7A 3C8HA 3WQHA 5AM4A 5FP0A 4C4XA 2WFMA 3LIPA 5E4TA 3C6XA 2G63A 2JF0A 4HXGA 1UZAA 2WHRA 4E46A 3I2GA 5EHQA 2WIJA 4IHAA 1IMJA 4BAGA 2QS9A 3WK4A 5EHNA 1VXRA 1BN6A 1QZ3A 3KWJA 1XZIA 2RIPA 5FDFA 2FJPA 1WB6A 1WB5A 3O95A 2XUPA 5AM5A 3ZV7A 3RLIA 3PICA 5AKIA 1A7UA 1CRLA 4WY8A 4UBLA 1UKBA 3BIXA 4U2CA 4BVJA 3C6YA 3QMMA 2C5FA 2HIHA 2WUGA 4DYHA 1WPXA 1YB6A 3H17A 4FHZA 7YASA 4KJXA 5AKYA 5JZ9A 4LXGA 4BE4A 1ETHA 2B9VA 1K63A 1P0QA 2Y1KA 2OGZA 5HQ3B 2X76A 1QIDA 2VEOA 2OLEA 4KAFA 4BCCA 1N5MA 2WJ3A 5ALGA 1CUIA 1K6EA 2BAGA 4G9EA 1E8MA 3FYUC 3R3YA 5AK4A 1VXOA 2XMDA 1GQSA 2QTBA 1ZGBA 1BU8A 2WHPA 2QMQA 4AO6A 4LHEA 5IH7A 2RAUA 5AI5A 2WIGA 4D9JA 4UPDA 2WG2A 4B82A 1BE0A 4KYVA 2JGFA 3H04A 4JUIA 2QZPA 4B9EA 5BOVA 5AKGA 5FKJA 4C87A 1P0IA 3IA2A 4QNNA 4X92A 3WKAA 4DMHA 5AI8A 1ACJA 3O9MA 4UHFA 5SYNA 5LP1A 3WKEA 2HA4A 3WK9A 3WK7A 3F96A 1CUEA 4KR0A 5IVDA 4H7KA 1QTRA 4HTAA 5FXMA 4ZV7A 1MAHA 1CUDA 1W1IA 2IIVA 5JZBA 3STVA 2VT7A 4MEAA 2Z5GA 4RNCA 5LKRA 4W9RA 5DYWA 1EK1A 4O08A 4FWBA 3ESCA 2HA2A 4I19A 3ED1A
chains in the Genus database with same CATH superfamily
3DSRA 1YVUA 3M6LA 1XP8A 2PEYA 1RJGA 1TJ3A 5KYVA 2ZPTX 4ZGGA 3DE4X 4AN0A 4N9QA 2ZT7A 3B1JA 5DYYA 5A3VA 1HLPA 4AO7A 4IH9A 4YVFA 2GZ2A 2FLWA 2ARKA 3AHFA 3HVKA 4JEHA 5AIAA 1RPJA 3TD9A 4YAUA 2F3QA 1T5TA 5AH0A 2AMFA 3BULA 1U2EA 2QVGA 5A6SA 3LT1A 1GTJ1 5DSZA 2ZSBA 3WGOA 4GI3A 4KBGA 1HQYE 1QS0B 1YE8A 4ZICA 2PQ0A 2OGWA 4RGBA 3JVIA 2EBUA 3GWZA 4CFZA 1USWA 2XVXA 3OBIA 1F8YA 1RBZA 4NG5A 5K8UA 4NH4A 2NP7A 2BFEB 2PK3A 4ZP1A 5FTWA 2I6TA 3JWPA 5KJEA 3ONVA 4C04A 2O7QA 2Y1GA 4EVQA 2ZIGA 2I2DA 5KQGA 2GJAA 2GHQA 3KR0A 1XTRA 1KO1A 2G88A 2RBGA 2HQRA 3NWPA 5AKEA 4QATA 5DBHX 3RADC 4HTFA 2JFNA 2PSDA 3BHJA 5H7XA 2I2WA 3DAGA 3FHJA 3KJEA 4D81A 5IKMA 3GLRA 3A1UA 4LJ5A 2HCRA 4L0MA 3OLYA 4LYGA 4KQJA 2A9VA 2GFHA 3PX3A 4D8WA 4DJJA 4E3WA 2Q3JA 1MJGM 5AVZA 1AUVA 2YJ6A 2BF7A 4L2IA 1OZFA 5FORA 4ZJYA 2AG5A 1QRUA 4JR2A 2XYVA 4Z9FA 2F4NA 2IHJA 4XZ3A 3V9PA 4IDPA 3CU5A 5C51B 3V8QA 3ANMA 5FLYA 3FCAA 1O5OA 1PWXA 1YU9A 2QROA 3SYMA 3FYHA 5ITZB 4WGGA 3QNWA 4WJLA 1JVNA 3ZDRA 1TVMA 2VP6A 1G1MA 1P8JA 4GXQA 1Z08A 1ZBDA 2Q1UA 1N1EA 3PNKA 3PWTA 4ZQHA 4AJOA 4WUTA 3AEKA 3CKMA 1ISJA 1BMTA 2NU7B 2WAOA 3FPEA 2VK1A 3EBPA 3JVEA 1ZQ1A 4IFEA 4DJAA 4MGEA 1U2DA 1PNTA 4UXJA 3DQPA 3V6LA 2C7RA 3DUFB 5KHLB 4CKZA 2CYCA 1AHPA 1YIOA 2H92A 1Q84A 4W7IA 1AQLA 4MI6A 5H83A 4A91A 3I05A 2IOQA 3D3NA 2QRHA 1P18A 4FYHA 5I7RA 5IC4A 1I7DA 5EP2A 1YACA 2BM1A 5L4LA 2ZSFA 1YQUA 4B6PA 2VRCA 3V5NA 4EJ0A 1SKMA 5K0SA 3CUVA 4ABTA 3JD1A 3V8NA 1TU3A 3L7YA 4ZT2A 2WILA 3B7PA 2D1RA 4DR1B 1EDOA 2ZIAA 2QN7A 1E2GA 3CH5A 3DR5A 3FCUB 5AI9A 2O7RA 2X8JA 3I1FA 1ML4A 2PAFA 5F3RA 5GGXA 1XDDA 5HRAA 4V2IA 3RTBA 1L7MA 2JRLA 4QDTA 1U8ZA 4GX1A 3TNYA 5GINE 4MGKR 1E1DA 1UBFA 1XXLA 3IP7A 5K3DA 3AVTA 1UM9B 4EYEA 3P9SA 4Q39A 3UA4A 1K8ZB 5JFTA 4KXQA 1RYBA 3NBXX 2RBKA 2O59A 3G0DA 3FSGA 4RV4A 4UD6A 3UW1A 1ZNWA 2VHYA 1IOLA 1FNNA 1HFWA 1ZGHA 3QHPA 1DG1G 2ZRFA 3L49A 4OB8A 3RHFA 1C8LA 4QOIA 1IBSA 1LF5A 2QL9A 1EX9A 1Q15A 4NH0A 3UMGA 5IXYA 5K0LA 3RARA 4OGFA 4P98A 3KYCB 4F4FA 1SCUB 4Z1MD 4OHCA 2AFHB 4YT8A 3GGJA 4YHBA 1OBCA 1D5CA 4GOLD 3SC6A 4R1PA 1MRNA 3WLHA 5K05A 2HIGA 5CMLA 4B81A 3N87A 4G81A 2WU8A 3INYA 3U7QA 2NN3C 3NTLA 3WLTA 1PL8A 2NSHA 3KZKA 4BQEA 3KKMA 4B71A 4OKNA 1JDTA 3I9MA 4Z1MA 3UV3A 2GDJA 5CCBA 3THYA 3FTPA 2B82A 1CEYA 2WJWA 4B2IA 4OQYA 1DV2A 1FYWA 3BDIA 3P2IA 4G0PA 1NZFA 1IN6A 1IAVA 2P6NA 2WSSD 4MXDA 1A4IA 1G7CA 2I1VB 3ACCA 4UTPA 2FYTA 3L8HA 1L7NA 5JDCC 2P2YA 3DEFA 5DW0A 5F2KA 5I9IA 2J7PD 2MOKA 5F1YA 5JC8A 4I1OA 1LDYA 1AIPA 3OFKA 1FRNA 1DMSA 1SXJB 4ALJA 3ND9A 4AKTA 5FH9A 3WAKA 3JAWB 2O5EA 2PRZA 1SG6A 3G8BA 4DIBA 1G8SA 4ECEA 5L53A 2HW8A 1FTSA 4QFBA 5CVTA 2B3TA 1KDYA 3K8YA 3RUDA 3KFXA 1EFLA 1TF7A 1JEEA 3DDUA 3HYSA 3BDAA 1U9IC 1JT2A 2XKJE 3ND5A 2FUKA 5AHRA 3WS7A 4Y67A 5FBVB 4ER5A 2OILA 5BW4A 3D8TA 3FPHA 4EW3A 2M6RA 4E1AA 1LLDA 2YOFA 2OGSA 1RIIA 4GM1A 2AG1A 4R8RA 4ZD6A 5KJCA 3PKJA 2ORYA 3DE5X 1JA1A 1A9SA 1FP7A 2AT1A 2E55A 4M8NE 3RT1A 2B2NA 4POAA 1JW9B 4J49A 3IIJA 1A97A 2J3KA 4RMJA 4JJ4A 3T15A 1MENA 4H6VA 3T7SA 4AUEA 1G3QA 2O8EA 3PR2B 4J16C 4LDNA 2QJTA 4GOKA 2Z1NA 5BYJA 2W6PA 2A94A 3BWMA 4OBWA 5A4DA 5IJ0A 5H8WA 5I7OA 1BDIA 1LRLA 3FKJA 1MGPA 2HA0A 3NBYC 4U8GA 4ZVSA 3SJAA 1G3RA 2DBYA 3FF1A 3VNQA 1P5JA 4B3JA 1TM4E 1XTIA 4IMPA 1T3GA 1MIHA 1ATZA 1PVDA 4UVHA 3RE1A 5JAPA 1GWNA 3ZWAA 5T41A 4IZIA 2RK4A 2H9AA 3HGMA 3KL4A 4LQ4A 5K45A 4DV4B 1NSTA 4LJRA 3A1EA 2O2JA 3IRVA 2QGNA 1Z4PX 1ZUWA 3Q7EA 3BTUA 3DOHA 4D46A 4F6RA 1LRJA 3MERA 3QBTA 3TFWA 1HNNA 4YMWA 3QKIA 1I5OA 4HPWA 4D4HA 2PS0A 2QD5A 1HRKA 2PLAA 4CW7A 4HADA 4RVFA 4D0LB 1OI7A 4ZAZA 3BWBA 3RTCA 4P7GA 4BV9A 4O2AA 4DWOA 4C0JA 4YALA 3LUCA 5BWLA 5IARA 2R4UA 4OUDA 3KCNA 5HZHA 2ZZMA 3OO1A 2V7UA 1NASA 5E8JA 4YIHA 2ZKIA 2HEIA 3UFXB 1QFMA 1ECGA 1F4LA 1L6RA 1EJ0A 1XRQA 2QENA 3HCEA 3PXBA 1JPNA 4I1UA 3DV9A 4ZRDA 2G4LA 4XVUA 2A9QA 1XZJA 1MN6A 1OBOA 2R2AA 3R5SA 1L4HA 1Q1NA 4K9LA 4RSGA 1Q91A 1BZYA 1NRWA 1NVVR 2Q8NA 3GJ7A 3QYJA 3IQHX 4D7AA 1KRHA 3RTAA 4O4JA 3MCVA 1DWPA 3JQQA 3OQJA 5JHHB 3BCHA 1JDZA 2JCYA 1N9KA 5F7ZA 4DNPA 3FRHA 1IATA 1KI2A 2YYYA 3N2LA 4P53A 2C2HA 2VP9A 1QBGA 3DDSA 4I4NA 5HPYB 1KE2A 4JUCA 1GUAA 3X1MA 2PL9A 4YMSA 2OQVA 3KKZA 5LA6B 2XZTA 2X8LA 5AHOA 4DS3A 5CBPB 1RBMA 4NICA 4D4JA 4F2PA 1ZR4A 4GBJA 3CTPA 4ZVTA 3ZWWA 1X7HA 3SDBA 1VGRA 3EN0A 5D51S 5HTOA 2DVMA 2LCFA 4E12A 3VVMA 2AHOA 4GWGA 2BHLA 1E9BA 1ONOA 1S2NA 2A6PA 1PK8A 3MWEB 4PYLA 5D7NA 3V1YA 1PUJA 1XZCA 3MB8A 4TYQA 5JV5A 3M4YA 4MKZA 2D2EA 3IULA 3Q7PA 3TSWA 4TWAA 4WASA 4HDSA 1MAWA 3NRBA 1GGJA 3SF8B 4BXOB 1U1GA 2P4UA 3M6IA 3OOYA 4MVJA 4BLTA 4B76A 4PV7A 1GSAA 1VE7A 3AI1A 4DV7B 1XTJA 3WGUA 1JZTA 3OICA 3UJBA 2C20A 2Q4DA 3KLOA 5B5SA 1DGQA 4P5DA 3GFOA 3WQQA 1SHJA 2DWOA 3NTQA 2P8JA 1RPAA 4EG0A 5JRJA 4YRLA 1CQPA 4FT4A 4HI0E 1ID1A 1NUTA 1W96A 1NXWA 1JJVA 2VPQA 2YZKA 3N5KA 2IU0A 1KTIA 1GYQA 1RWPA 3PHHA 4S1TA 3SKVA 1KP3A 5BYAA 2BJWA 3PQ7A 4JJZA 5FUYA 4S1WA 2JC3A 3TDNA 4EY6A 3OJWA 1T4CA 4X1KB 3OWHA 2QD2A 2RGYA 3GBVA 4PGHA 4KMOA 4JI3B 5HQ3A 1KYVA 1YQDA 1TLTA 4E15A 3REQB 1QNLA 5CA0B 4HDMA 3I8XA 1XPJA 1G8FA 1MH9A 5E3JA 3QSYA 2VFAA 4KE6A 3ZY2A 4QPCA 3QFSA 3HB0A 1JKIA 2V59A 2EW1A 5DX8A 2J09A 4MWOA 5ECYA 4UTVA 3WWYA 1NGSA 4AZVA 4QU8A 1EIWA 1T8PA 1VPTA 1QGAA 3A4IA 2ZUWA 1QPGA 3NNNA 4AN4A 4WNCA 2PIAA 1OA0A 1X77A 3HBJA 4AW9A 5CFNA 3IBCA 4RW0A 2FU5C 3F3SA 1YWGO 4PC7A 3M6MD 1PE0A 3EIUA 2JNWA 3EDQA 4MKXA 5G0TA 1RQLA 4M0EA 4D43A 2ZRGA 1QF7A 2OV2A 2YQ5A 4E6PA 3MS7A 4K2HA 4BFUA 3VHRA 1E1QA 1MB0A 1LB1B 2GZSA 4BMYA 1GAQA 4FOOA 5DMHA 2FGJA 3H2ZA 3FGOA 3HXKA 3ZQ6A 3OUTA 3FNEA 3IP6A 4Q37A 3RV4A 3Q1KA 1Z9BA 1QIGA 1K88A 1A9RA 2DFPA 2O7SA 3OZUA 2GRAA 2JS7A 2YCBA 1Y6FA 4Q4DA 1BNCA 3SEFA 4UU1A 5LP6B 2V6JA 4TYNA 4GRDA 4KX5A 3HXMA 2JAQA 4EPXA 4F11A 4C89A 4OCZA 1JT9A 1SBZA 2R66A 3IMKA 3PNMA 1UWKA 2FMUA 2PZGA 4KSBA 4F96A 4J75A 4PVCA 1GKLA 2ZBDA 2NQ8A 5EHGA 4YXWA 3H86A 4KXVA 1XF9A 1HXHA 2H2GA 5AKHA 1HTBA 3OPVA 5FLKA 5TS3A 4B7CA 2ZWOA 1AY0A 1GLVA 2NU9B 4P7KA 4W9NC 4JY7A 4GDMA 4O4JF 1G6Q1 2XMGA 3KPUA 3LFTA 3O8OA 4P08A 2X4DA 2GJSA 2IBMA 3OIYA 3UAVA 3WRVA 5J4VA 1QGED 3EA0A 3OQIB 5SY9A 4U3JA 1VL5A 2ECPA 5BNIA 1JR3E 1VCIA 1N2IA 1O97C 3L1IA 4OQNA 5TC4A 1R16A 3D2LA 3U3XA 2QN3A 4L5JA 4LDAA 2QQ0A 3OVMA 2CXRA 4WJZA 2HSZA 4HD8A 4V0RA 1EUDB 1WTAA 5DCUA 3E4CA 3KVYA 1FTYA 4IIVA 4ZGWA 4FJ0A 2P40A 2H16A 4M9RA 4FMPA 2B83A 4A8TA 5F12A 1FFCA 4JVNA 3DWGA 3FMVA 1FRVA 1RS0A 3KK0A 1T34A 6NULA 4P0QB 1UXGA 4NFHA 4OJMX 5D84A 5CYOA 1T25A 5AHKA 3L7KA 1YDEA 1C1XA 1QHHA 3OIDA 1BHSA 1N7HA 3MQFA 4KQXA 3WLLA 4PQRA 1TC1A 5E95A 5KSYA 5CB0A 1ORWA 1TEVA 2YC2C 2NIPA 4MYHA 2ODTX 3CSSA 3NPAA 2QTTA 3JQ9C 3ENKA 1KDTA 3ILXA 3IAS6 1RRVA 3NNDA 3R5XA 1GD1O 2WSLA 4BZWA 4EGAA 4LMRA 4G0QA 1XQVA 4FDVA 1NE7A 2ET6A 2QR2A 4J03A 1DAKA 1Z07A 3UAGA 1XD2B 1RR6A 3ASYA 4OATA 4GBMA 1K92A 3H1AA 1V7PC 5LC1A 4D3SA 4R9VA 2OOKA 4NCJA 5JLJA 3K0SA 1XT6A 1Y42X 4E2WA 1Q7GA 5KJFA 3IQGX 3LXMA 2FRDC 3EODA 3FWHA 1X9GA 1H9BA 1K98A 2J9ZB 3OTIA 4UNNA 1R4NA 4S12A 4XM2A 4OKSA 3S4YA 3PFWO 4MWEA 4CV1A 2ZYTX 1PL6A 1ZGZA 2DHRA 2EDAA 1NMEA 2QJFA 4ENSA 4OB6A 1LLQA 4B80A 1QIHA 2P2LA 5TGDA 1ENYA 3NWBA 3JU3A 1KO7A 3S7ZA 3TCNA 4WCFA 3SQLA 1N7JA 1Z4IA 3NOVA 5AHWA 9LDTA 1JZQA 2P78A 5IHXA 4GL4A 3K5WA 4WMLA 4Z1OA 4HV4A 1ISRA 1XD9A 4D4LA 4EPRA 4HAOA 2BY4A 3B70A 2HPVA 1E7MA 1XU9A 1M1XB 5J5VA 3VDRA 5I4BA 4ZI7A 3IQFA 3V80A 1YT5A 1V6AA 1YBHA 3I1IA 2WSMA 3NBUA 4ALKA 3GGPA 1THZA 1T3LA 1U0EA 2CZCA 2ZT5A 3FGNA 4MUNA 4FZ3A 3MRSA 4AJLA 2HSGA 3EF1A 4Q00A 4JWKA 3PQFA 1DRWA 1YL7A 1JG6A 1YGYA 4QX6A 4OP1A 1E1YA 4O4IF 1GYRA 3QU5A 3ID6C 4AIRA 4HB0A 2AFIA 2ZYIA 3ISVA 3IUYA 3JWHA 2HU5A 2OSBA 2XD4A 3DV2A 3RRJA 3C7AA 3RSZA 1FFAA 4JYMA 1ZL0A 1QGDA 4D82A 4DNOA 3GLFA 5GJBA 5K0JA 4Q9NA 1A77A 5A3RA 3LLVA 2RHGB 2JK1A 1TPZA 1X3SA 2TECE 3QQPA 4RAQA 2FW8A 3HZOA 1PDWA 3E61A 3TQTA 1EP9A 2OESA 2RGAA 1X7WA 3HBLA 4AXBA 3WO0A 4WZAB 1CR6A 5JMTA 4H6WA 4LF4B 3EGIA 3SZUA 3I0ZA 5CTAA 4EB8A 4B6SA 4PZAA 5ALJA 4TYMA 1ZXBA 1LU9A 2DPHA 3EGVA 2YS6A 3GJSA 3HUDA 2FW1A 4MRVA 4KVAA 3KYDA 4RZHA 2ZBQA 4N8SA 4CFYA 3PKIA 3GFRA 3RROA 3ZV3A 2ZWAA 3V6MA 4HQRA 1OLOA 1F38A 2HWXA 4XUCA 2ODEA 3M81A 2XH8A 1VRVA 4H7IA 3JQGB 3QPCA 3U40A 5HILA 4FHFA 5L95A 5IT0A 2WF6A 2CL6X 3K9HA 4KAXA 1U2SA 1WXDA 4TMVA 5H59A 5H4HA 3ROQA 5FV4A 4G1VA 1PJ2A 1UMDB 1XQ9A 3A6FA 4KH1A 3DKRA 2GTPA 5YASA 5LA6F 4C0BA 1F4VA 4X45A 2IHTA 3QP9A 3GLGB 5FLXA 4DDKA 2C5BA 4A1FA 3IGFA 4INJA 2WG0A 3TNDA 3DF9A 4C2UA 2WAXA 1KFCB 4FFBB 1ODTC 1QBKC 1Z5VA 1BKSB 2BDEA 5CNMA 5J2TF 1X92A 3LV8A 5UKDA 1E0DA 4JOSA 3UMMA 1H4SA 2Q5LA 4JYAB 3BMNB 2CCGA 3HKEA 1NNEA 1F7VA 1RAEA 1XCLA 2F3TA 3F74A 2I33A 3HA3A 3K4HA 4U2DA 1IHPA 3OESA 4TLMB 5ENZA 2ZI3A 4MJ3A 5FOXA 3U17A 4KWTA 3G0BA 3VA7A 1E0JA 1TYDE 1GG5A 3ANYB 4PAQA 5JSZA 3EVCA 3GH3A 1GPJA 3BH7A 4TLDA 2XB4A 4EUKA 1D07A 3B2EA 3JQBC 1A0OA 5FNVA 1QSGA 3QKRB 2ID8A 4MCHA 1H66A 1QIKA 3OOSA 2AYYA 3PFCA 4ND5A 1U0FA 3EY4A 1KC3A 2JJ1A 5EIWA 3ZJUA 1CJUC 4N41A 4DBVO 1G17A 5FEMA 1N2GA 4HUQB 3ZJYA 3UWDA 1R6UA 2COKA 1WABA 3KTDA 3LWNA 5T4FA 3B2NA 3KBOA 3DLAA 1JAHA 1NVMB 1HE8B 1D2EA 1S7GA 1RWXA 3ASUA 3NVMB 2REOA 3QOYA 2JANA 1NVBA 5A9TA 3FDZA 5FJIA 1WXEA 1MG0A 4J0FA 1E1NA 3E3NA 2QU7A 4A92A 4HBZA 3VPXA 2AYXA 2EFJA 4PC2A 3EEIA 1VDZA 2JA2A 5AW0A 2CLMB 1QAOA 1V47A 4FOTA 5AVXA 4MUEA 1Z0KA 3KLPX 1K4YA 5IWCA 1E2PA 1PGPA 3N5CA 3G5TA 4R51A 2V65A 4AL4A 5BV0A 2G70A 2JK0A 2OHFA 4RTSA 1JV2B 5B1EA 2IC5A 1LLFA 2PKEA 2P9TA 4PAGA 5F1KA 2H2FA 5EERA 3CRW1 4D96A 1I0LA 4TV9B 3QVGB 2A0WA 2Y93A 4WZBA 3VH3A 1HSOA 2OE2A 3ZNNA 2CL7X 3BH6A 2R8XA 1I80A 4M1WA 2POQX 4IJVA 4K0RA 2J3QA 4CLEA 2XTNA 4UFNA 1G8HA 1UJBA 1IUNA 1GZVA 1ZD9A 2FMHA 2NTEA 3THYB 1VHLA 3COZA 4FEGA 2Q3BA 2HMSA 2V6IA 4KL8S 2GN6A 4HQLA 2C4KA 4DG9A 1ISPA 1JYFA 4OG2A 3U4MA 3OZSA 2ZQZA 2ZVJA 1T0JB 4Z4EA 3GLHB 4FR2A 5C80A 1XNRB 4C6SA 4DQKA 3ERCA 4LJ9A 3F5SA 4WXHA 1LUAA 2OO3A 3OZEA 1M72A 3NQ41 4PYMA 1J5XA 3DT9A 4QARA 4MV1A 4X7BA 4WXPA 2EJUA 3VAZA 3W5CA 3KT0A 3W8EA 2WJAA 3O4RA 1FFSA 4I6JA 2Y4NA 4EHAA 3DL4A 4OHFA 1A95A 1E98A 3LL7A 4PWYA 3GRVA 2AD5A 2FTKE 1GZUA 3A9CA 1KEEB 2FCAA 2C2XA 1XVAA 2EJWA 4AS1A 5M5BA 2FN4A 4Q6WA 3Q6MA 4MGIR 1UXOA 3PGLA 4WDQA 3AM3A 3HB1A 3ZWYA 1XDBA 1B14A 4Q47A 5AXDA 2ST1A 1KIFA 4M1EA 2GNOA 2OCAA 3WTBA 5EJ6A 2FHPA 1LFAA 3N58A 3S0JA 1ODFA 1GQOA 1KFJB 1NJFA 3IVMA 2FLVA 4FE7A 3K31A 3PQ5A 2H5LA 3MS4A 3JX9A 2JEYA 2PRJA 2WIBA 4EHBA 3ER9A 3CF0A 1VKZA 3ADKA 3DMYA 4PICA 2XQGA 5EJGA 1XPOA 5IUKC 3G85A 1YA6A 3IPXA 3JARA 5AK0A 3LD9A 4KOEC 4KCGA 3TBFA 3WGVA 1H4QA 3PFHA 1LNSA 1J97A 1XRMA 3PGJA 2BCEA 3TLAA 4C88A 2FPIA 4DR2B 1CR0A 3SWWA 1VBMA 3W7BA 3E81A 3IR5A 4KPYA 4XX0A 2CV0A 3IDZA 2VHXA 3KT3A 1G7TA 3T3GA 5CLQA 4Y6RA 3GUVA 1ZA1A 1LK5A 1H2WA 3BMQA 4ASUD 3ZHXA 5CLLA 2C7VA 2O2XA 5T67A 1EK2A 4E2FA 1NW3A 1BWQA 2WF5A 3DLPX 3PPWA 1W0JA 3A4VA 1Q0SA 2VJQA 3PVCA 1NJSA 3A11A 4BZQA 5FPYA 1EA5A 4M8IA 5TX7A 1DAMA 1NSYA 3NB0A 3L4KA 1E9AA 3NGMA 1TD1A 1P4SA 1ZM4A 1S01A 2L42A 2VYNA 4MOWA 4XSVA 2ZI6A 3V32A 5JXHA 1RRCA 3EMKA 3ZGYA 1L5MA 4RPLA 4K5QA 3RBXA 3AKEA 2WKRA 3BBLA 4U02A 2BEKA 1S2GA 5B2FA 3VR6H 1XE3A 3L82B 3WGKA 5CAEA 1Q2UA 2NTVA 5KTPA 4QBIA 1U90A 1RYHA 4N47A 3ZTTA 1R4NB 1TM2A 1W46A 2CKDA 3F6BX 2FPPB 4B09A 1I0IA 3BDVA 3DVSX 5CJJA 3ZWNA 4Z7NB 3WJ7A 5M2QA 1ZWLA 5KWSA 5A02A 3Q6NA 3AF6A 1UBUS 1VKOA 4C4AA 2YBEA 2IZ0A 5DKFA 1OXVA 2RK3A 2M2IA 2IOFK 1NU8A 1G63A 3LGAA 1Z0UA 1NVVQ 2CB0A 4FSHA 5T4EA 5ESWA 4EJ2A 1QGOA 1D3AA 1QH0A 2FWRA 1G8YA 2A2ZA 2PGAA 5JS6A 2OAEA 3DGEC 4NP6A 5E4FA 3OIFA 4YJGA 5BVGB 2H0AA 1EXWA 3DVLA 1AZWA 2BFDA 4U5XA 4ZMSA 3PE6A 3F3KA 5AM0A 1SG0A 3G89A 3DCNA 2IPMA 1AU9A 3O90A 4V0QA 4AULA 4CKEB 1OREA 3H7AA 4JJKA 2P6MA 3O6VA 4ARAA 1NQVA 4ILKA 3ZDFA 3M1LA 3ZK8A 4E5KA 1TQ4A 2RIRA 4QGHA 3THXB 1OWNA 5BUQA 3EULA 4HH0A 4UQLA 1QRDA 421PA 4X41A 4TWRA 1T13A 5JAMA 1E5TA 1K3TA 3BWEA 2Q2QA 1KQOA 3KM0A 5KREA 1W49A 1BKYA 2PJUA 3LF2A 3OZTA 3TXXA 1WE2A 1WP4A 2R1VA 5C4GB 2B1QA 3UK2A 2Q9BA 5AVYA 5JSQA 3A1FA 1FZTA 5TVKA 4ALMA 1MAAA 2R7KA 5IDXA 1SIWA 3W8RA 4KRFA 4BMSA 3DKVA 3T8YA 2HK9A 3U4HA 1XELA 1LVGA 3LXUX 2X0FA 1AV6A 5JDIA 4G85A 2ZB7A 3MCZA 2JAWA 5F2NA 2CGEA 4RLSA 4B3TB 1HDZA 1UC9A 4WOJA 1ZOIA 1CZKA 1HPLA 3GEIA 3TOCA 2PRIA 3JAKA 4XLTA 5LJIA 4Q4AA 1WRBA 1UKZA 1JE1A 1JFSA 2J67A 1V39A 2F43B 3OKFA 2CHQA 5IXSA 1B41A 1FYVA 1Y7PA 2Q1TA 5LXTB 5BV1A 3ICEA 3K32A 1DCKA 3HSKA 5CA1A 1BCSA 5TGZA 5JARA 5K3OA 3PP8A 3FCSB 3OUUA 2CHGA 3M6FA 5DZSA 2NPIA 3BK7A 1EDDA 5CIQA 3O1JC 3B51X 5GTDA 3IAEA 4BKUA 1NW7A 3D0KA 4O3FA 1C9YA 2FW7A 1TMOA 4Q9DA 3QBJA 5DRYA 4HCJA 4D92A 1A9YA 3QU4A 1NMQA 2CLIB 4GPBA 1O8BA 1U0TA 2DT5A 4ZYVA 5CX1A 5AW2A 4NQZA 1AS3A 1FNCA 3BFPA 1N8TA 4MO2A 1I2DA 3CNOA 5CXQA 1MJGA 5B30A 2FQXA 3U44A 2D5CA 3ZHZA 4RHYA 3W3ZB 4TMKA 4A0SA 4BB9A 2VPWA 3U4QB 1OGJA 3TX6A 1W2WB 2VNJA 5DGHA 2HLNA 4UTZA 4YCAA 3EVNA 4G9GA 2OQIA 3RC3A 4M9XA 3F7TA 3ZDXB 4QUGA 4C7XA 3RYIA 3VZRA 4NOKA 4JT8A 3G0IA 3S2YA 1B00A 4MQMA 1GDDA 3HHEA 3OZDA 2I1WA 2L69A 2VOEA 4BMZA 3EVFA 1A82A 3FAKA 5ICMA 1ZMOA 4MS3B 2ZRQA 5AVWA 4KPUB 4J90A 4M2LA 4P9NA 4RCYA 3PX2A 4CI0B 2C97A 3QV2A 4Z86A 4C5AA 5FR1A 5F52A 3OHPA 1NVGA 4U9HS 4UXIA 1YB4A 1Y82A 1SB9A 1A8SA 2KJQA 3RWBA 4KDCA 4NULA 2VP5A 5BN3B 2PJDA 1DOAA 1RJWA 1H69A 2Y27A 1Y1KE 2C83A 5E9JA 1PYDA 3NYRA 4RDHA 1ZRMA 5HKKD 3B1WA 3E3AA 2BFPA 3LWDA 3FWZA 4GMFA 4K6CA 3ZKAA 2VDOB 2X0EA 4CG3A 5LP6F 4B87A 3OCZA 3DDHA 1RYEA 5I5GA 2DECA 3A4YA 4IKPA 1NP6A 4KO3S 3CZ5A 3FN4A 2GD2A 1R4MA 1SVSA 5B3JA 5E6UB 3U80A 1SVWA 1OGIA 2FUCA 3ADDA 4PLTA 3UWSA 4KEAA 4JC4A 4I5GA 1XMJA 3DHYA 4G36A 4C4ZA 3OCCA 4F1JA 4FINA 1M6EX 3V3TA 4PX9A 3RW9A 1UOQA 2NYVA 3K92A 2LKCA 2WMDA 3HZRA 2Y1DA 1MEJA 3HEBA 4C7OB 4RK0A 2VCEA 2ZJFA 3ADCA 3OEHD 3P71T 3DM9B 2CUNA 2NZXA 4KODA 1JHZA 1J70A 3L4EA 3L7IA 5E9WA 3RYIB 4FD2A 1ZK3A 4ZYUA 2PT7A 2O8BB 3A2LA 6REQB 1M67A 2R8YA 1O95C 1SEPA 2IIQA 1PEAA 3QKSB 4TM8A 1EXDA 3SC2A 1T2CA 1V16A 3WWCA 5CT9A 3RVOA 2RGCA 1SH7A 4CF3A 3P9NA 4CIDA 2O1SA 1MB2A 2JDIA 3AKYA 2P8SA 4YJ2A 1XTPA 1FU8A 2RB4A 2WJGA 5EP4A 3N53A 1C2TA 1CE8B 1A5SB 3KPVA 4FYYA 3TUJC 2B69A 3FLEA 1G291 4Q9HA 1G5PA 4XB2A 1JILA 1UK9A 2W8BA 1DB3A 5HOEA 2WM2A 1O3YA 2VNKA 3WLAA 1U80A 4QNRA 3SBDA 1TC2A 2A1TS 4C5BA 3OQOA 3CNHA 1YQTA 2XVAA 3AI7A 1F7UA 3KKOA 1MIOB 4QEZA 2CSUA 1ZGAA 3D8NA 1PSZA 4IEEA 2ZXFA 4G4SP 3BGDA 4MCIA 1IUKA 3R6GA 1P9RA 2DSTA 3L18A 5B4UA 3CH4B 1GGKA 3HS3A 4LYHA 4EDHA 4DKXA 5TQ2B 3I9NA 3Q6IA 1DJQA 1DG3A 4DG8A 4KNWA 1PQPA 1U9CA 1TVKA 3WP0A 5K3AA 3LOPA 2EAUA 1PGQA 2Y0EA 3NU1A 4G4SO 4R1NA 3U81A 4YRBA 5JH7A 4DMGA 4IV5A 4C2TA 4RGVA 1NI5A 3H6KA 4MR8A 1E32A 2YN0A 4X44A 2ECQA 3THRA 1QDUA 4M1OA 5KCMA 3LXXA 1YR8A 2GT1A 5KPJA 2O8FA 2VZ0A 1L4LA 2DR3A 4MUYA 1IN4A 4CV0A 3IJEB 4BUJA 2AS0A 2Z43A 3FIUA 5HJEA 3BE4A 4LHVA 4PZEA 3NDJA 1C1XB 1QHHB 5BXQC 1P4AA 3HYRA 4LHZA 4AUKA 5FUXA 1OU0A 3T52A 5HUHA 2GKSA 1N6NA 1JFFA 4F1KA 2H4XA 3KOZA 3I52A 1BHQ1 3M82A 4Z0HO 5KSPA 4MW4A 4EEZA 3UHFA 1NATA 1TKCA 4W8OA 5IRCD 4LFBB 1Z36A 1PNOA 3B6IA 1C3JA 3BICA 1PYGA 3VVBA 1ZUD1 4L08A 4X8HA 3GEHA 2LV8A 3GLFB 4H1TA 4DLXA 1QTNA 3QMWA 2L19A 4KZPA 3TINA 3NC0C 2GEFA 4ZOCA 4RSHA 2W2OA 2R85A 3AWIA 3C5WP 3LQ4A 4AF7A 2C2YA 4JQZA 5CVUA 1JPJA 1K6JA 2BFBB 1Q1AA 2PH5A 5J1TB 5A9SB 2PYIA 3NIBA 4X84A 1P4JA 3SNHA 3DMRA 3V8PA 3KDPA 2YVLA 2O2IA 2X58A 3BRCA 1O2DA 1BJKA 1TAQA 1AN9A 3P97A 5AUNB 2HK6A 3G68A 4KUGA 5KYTA 5HRUA 2FN7A 3AOEC 4GPIB 5IKEA 4FP9A 2GASA 1V1MB 5B1IA 3J81A 1IRXA 3RFFA 1W87A 3AC0A 4KQKA 4URZR 2G9QA 5AKXA 2XZOA 1Z8FA 3TTWA 1N0VC 4AJIA 3F5MA 1BOOA 1QHNA 5AVUA 1TZJA 4JNCA 5JCJD 1MTZA 2VJBA 3A8TA 3QA9A 1REQB 4CL0A 1CS4C 2XA9A 3MTQA 2OAGA 4Y3UA 2E49A 4ZPJA 4QJ5A 1BDHA 4NVRA 3H9JA 3L1JA 5TMBA 3PLRA 4CE6A 4CLHA 5KS2A 1SVLA 1WUJS 1KO8A 4C4RA 5LQCA 2YIJA 2P7HA 4F38A 1Y4AE 2ZTLA 2GKGA 5FI5A 3WA7A 4HDNB 4JLDA 4G0VA 2XMZA 2AKEA 1QHSA 1U2DC 2UYCA 4L72A 5FBHA 2HF2A 3VJKA 1AB5A 2GNAA 3DPIA 2ZR8A 3KZMA 4L4ZA 4LJ7A 3ZHQA 4BJHB 3ZH9B 4DMUB 3HFSA 4JI7B 5CU7A 3AB3A 1L8LA 3EA5A 3GDHA 2Q0QA 3CNEA 4XUEA 1S7CA 4AJ2A 3JQAD 3AETB 4YT4A 1DQSA 1HETA 3H0CA 3Q5GA 1T8UA 5I7EA 1BD3A 3R3VA 1YZ3A 3RU2A 5BQOA 1WSBA 2IP1A 3DMGA 5A03A 3IIMA 3PHCA 3R0JA 4DMRA 1ZNYA 2PUHA 2RHHA 3MUNA 3LOQA 3OQNA 2P91A 3TTYA 4GBGA 3GDOA 1GNRA 1D8AA 1JQDA 2QG4A 3A2MA 3BPSA 5J2UB 3RC2A 5HZKA 3UB3A 3L8CA 1QGYA 2BOVA 3KS9A 1MB9A 1VMEA 4IV8A 1FB5A 1G0NA 3DHVA 1H2YA 1F6DA 4RABA 1QC5A 4NNJA 3X1ZA 3MJCA 2J5BA 1G55A 1TK2A 2EEPA 2YY6A 4JT2A 3N6RA 2H5JA 1H2BA 3I53A 4BQNA 1H6BA 3JWGA 2GESA 3O0TA 3LKVA 4HNRA 4QOFA 3HU5A 4OP2A 2H6EA 2E0IA 3UAWA 3ER8A 1Q0ZA 1SOUA 5F4BA 3DE6X 4PO9A 1C8VB 1DXHA 4KK4A 1FQWA 5U4QA 1TCVA 2ATCA 4PO8A 3TLXA 5L6MB 2ISSD 1GKUB 1X1QA 4MA5A 2QW1A 4COOA 2Q1WA 2HBRA 5F4ZA 2VP0A 4OI1A 4BLRA 3BD7A 2WLTA 4OHRA 4WLNA 2PUVA 2Q5FA 1X14A 1I9CA 4G5SA 2A0XA 4FGZA 1LWOA 4PCUA 4TV8F 4Y9SA 4YJDA 3VPSA 1R0LA 3SFVA 4FB4A 2YVKA 4EI9A 2FE4A 4F0JA 3O8CA 4HN4B 2XAUA 5AM2A 2G9VA 4BDTA 2PX6A 1UIMA 4D97A 3MXTA 1Z6GA 5ADVA 1AMOA 4FZRA 3GDWA 3KDAA 2JA1A 3IMGA 3PIDA 5J2TA 3EIHA 2X3UA 1PTKA 3OAAD 3OZXA 2XD9A 1VMKA 1L5FA 3FZEA 4CEIA 2P3LA 2GPWA 5TT0A 4YROA 4ETWA 5JADA 5FUWA 1PFUA 2CWDA 1S8OA 2H7YA 2A9JA 2DQSA 1RXVA 1EGAA 3GZNB 1KQPA 4J0EA 2IUYA 3QLUC 3P0FA 4RTKA 1GJRA 4P4UA 1KDVA 2H1LA 3NEPX 2CEAA 3LUKA 1PFVA 1NAIA 2PSSA 4OI0A 1JKXA 5GADl 2HA7A 2RG7A 4M1YA 3ZCVA 2EP7A 4NCBA 2WP0A 1A71A 1KVQA 3NEAA 4RLFA 3MJSA 1E1KA 1BFDA 1CUZA 1G6KA 1V5WA 2SECE 3Q0TA 2P6UA 4JDPA 4PLHA 2C0QA 4XM0A 5KVQA 1WPRA 3OCVA 1I6WA 1JKJA 4CUJA 2AZXA 4RDCA 2R47A 3O4FA 1QP4A 3GRUA 1NRIA 4M0KA 4WT7A 3RG2A 1R10A 3RKUA 2QTWB 4YFVA 4UEKA 3V1UA 4BU0A 5I3CA 1LD3A 4AMBA 3A32A 2I2AA 1YDFA 3WHIA 2AJCA 4GU5A 1JFRA 3R7FA 1C30B 1SA0B 2OCIA 2G5GX 4QEDA 1A5AB 4RH3A 1Y5LA 4Z51A 5EVJA 3RYTC 1V4VA 4TS9A 4PNEA 2VWPA 3MWFA 4JJEA 1CY7A 1P2DA 3M7IA 2YC4C 4PE5B 3WYDA 4L4YA 4CDNA 5KPDA 3C87A 2GK3A 1GCAA 1ISIA 2PUCA 2RHWA 1WCV1 5DCYA 1RSZA 2W9XA 5T6BA 2EERA 3VR6A 1ORTA 5DEOA 3LY7A 2YFQA 5FOUA 2WIDA 3OWOA 2D2FA 1I2MA 5E1BA 4ZCTA 3R7AA 3OT1B 4KQ1A 4Q1FA 1IYZA 4TZ6A 4Z4QA 3GZJA 1WTCA 4MVWA 1YFKA 1JEAA 4DG5A 4QYIB 1TADA 5KAPA 2PLNA 5ALMA 1G8GA 1GG8A 2BMFA 4B2LA 1GUFA 2VF4X 3T9BA 2DF8A 1EE1A 2FG6C 2JCSA 4MJ7A 4A8JA 4ER7A 4ZALA 4DZRA 5EWLB 5F7XA 4WFIA 4S24A 2XB6A 2WG1A 4NCAA 1IQ0A 3HKBA 5AP9A 2W6ZA 3FFXA 4ZEWA 1MHTA 2IQIA 2NU6A 1VRWA 1SG9A 1ZK0A 1W85A 2DCMA 3KU1A 1FX1A 2YNMA 4PLCA 3D6JA 2BTOA 3AINA 5JD4A 2OYSA 2YUIA 2ONZA 3WLPA 6GPBA 4XQGA 4DUGA 5KNDH 2ZDGA 3HV0A 5G4LA 2Q5HA 4ITVA 3AEUB 3ANLA 3I39X 2NYUA 2QUKA 2Y0DA 2V7TA 4W63A 1JPUA 4NAVA 4FJ2A 1AA9A 3KPWA 4CM8A 2Y0PA 3IXQA 4D9IA 4MZXA 1EM8A 4MW6A 5B64A 2G4CA 3IUEA 1K0UA 2C3MA 1ZI6A 2B7BA 4ZHQF 3ZV4A 4CCSA 5EQFA 1HEUA 4YJ2B 4QDUA 5H3HA 3C2QA 2P2SA 1UDCA 2WBLC 4H7HA 1US8A 1WD5A 3RS3A 3FDFA 3ROPA 1UBJS 1QCDA 4BUZA 3ET4A 2BW0A 4G0WA 3DZHA 5CVCA 1DI0A 3I5UA 4CM3A 1M7HA 4ZCPA 4OXYA 4DRYA 1D2GA 4KZKA 1CUCA 1KZ9A 4GI1A 4ZGBA 2PGLA 3PUYA 1QJ4A 4GR5A 7REQB 4BWVA 3AR8A 3KXPA 3OTHA 3LQ2A 2CEKA 4UARA 3I6IA 1UDBA 3I9LA 5EIEA 3C43A 3NHYA 4IVPA 2MSWA 2NO7A 1FW8A 2D5IA 2PLFA 3N3BC 2D1YA 4MLDA 3TQSA 1G1AA 3QEKA 3O26A 4JVMA 1EGMB 2MSEB 1RWNA 2NUTB 5ELMA 5EJAA 1XCGB 4PG7A 4O33A 3VR3A 2GAAA 5LLSA 4IHJB 2XGOA 3AB7A 1S3IA 2ZOSA 3EWIA 3B1VA 4YI3A 4L75A 4QASA 1OVMA 1KH3A 1L7RA 4OU5A 3WGIA 2W6NA 3BWXA 4EGJA 5BV7A 3EMBA 4ETMA 1VCMA 1JG4A 1BH2A 2Z4TA 4R2JA 4Q9JA 2C7BA 3BA1A 5EY5B 4MMYB 4WCFC 1TYEB 4F2GA 4I5FA 4JUAA 2GAIA 1SCDA 1TRKA 4UZSA 1JR6A 3M4XA 3KO8A 1UPFA 4CM9D 2A9PA 3VO1A 2C4HA 4EF5A 4YEDA 3ETGA 4LC9A 1XTTA 3BIOA 5JR3A 2RGDA 2F8SA 1A2BA 1SU8A 5KNCD 4PQFA 2FSIA 1D2HA 1T91A 5FPQA 2FP4A 2CMGA 3UANA 3QPDA 3OA0A 1KYTA 1CUAA 1W73A 2QTGA 4IW3B 4DJ5X 1UWVA 4DGSA 2X4LA 1QK4A 3LQKA 3FOBA 4UBKA 5TR9A 3FCEA 3QWFA 3W9BA 1PJAA 4E2XA 2ZYRA 2HIAA 1M2OA 2FX5A 1JVSA 2FG5A 4LN1A 3NDBB 3LF1A 2YHAA 5L9AA 4I4TB 3UKOA 3S2UA 5K03A 3R09A 4LXXA 2RGNA 1GGFA 2YICA 3NJ8A 4X1YA 4RD2A 1XQWA 3G79A 3ITDA 5TQJA 1CR4A 1GSHA 3P5BA 3TE6A 2ZYVX 3NVDA 2UVPA 1TTTA 1D4AA 4KBFA 5D6OA 1G21B 1Z17A 1R0YA 3Q11A 4R2WA 2IYVA 1T6XA 4NABA 3OMWA 2AMLA 4X6YA 5K0ZA 3IOCA 1HWYA 2ZDQA 1W52X 4FWIB 5EWJA 1X2BA 2NXNA 2V6FA 2ZYAA 3F9IA 4OSOA 3TSYA 1VA5A 4DMKA 5IANA 1WW8A 2XXAB 3U62A 1SUIA 1JNYA 1Z83A 5ALQA 4M0UA 1C0LA 1Y8AA 1ZOSA 4PFKA 4IO1A 1A5ZA 4KQEA 3TVDA 2I55A 3JAKB 3A6DA 4W5OA 1VQ1A 4LF9B 4AX8A 1GFWA 2M6SA 1JUDA 1Q0UA 4JMPA 5EIXA 2VP4A 3EG9A 5J9FA 3I0NA 3S2ZA 1TO6A 5JEEA 2REQB 1FUEA 2HK8A 2FW0A 5TQ0B 5A4JA 3K9FC 5CBPA 4NTZA 3ZU2A 5ICEA 4UCWA 4AX4A 4TKVA 2N3ZA 2OV4A 2RHBA 4XJTA 1KZ4A 2ERCA 2W2PA 3OCWA 2IZ5A 2P1DA 2NO6A 2R3SA 3QFHA 5LZ5A 2OFFA 1V5EA 3Q98A 2SKDA 3DTYA 4RJJA 3T95A 4DQVA 2JLQA 4U0KA 4YCNA 3PHJA 5CB4F 4BB5A 3L93A 5KQRA 1F3OA 2YYZA 3KC2A 1N6OA 1FVOA 1YJ5A 3A7DA 4P7FA 2G28A 1VIYA 4B3XA 1FYFA 4CM4A 3HB9A 1K7CA 1TKBA 1B0AA 2CVQA 1X1TA 2I29A 2P30A 2VYFA 4W7SA 5EZ5A 2A5LA 1HE5A 1P0CA 1Y81A 3DMTC 4YP6A 5H3CA 3RS2A 3V8VA 3VV3A 4E30A 1KZHA 4EYSA 1D2RA 1MX3A 2G67A 4LOLA 2YV3A 3E9MA 1E9EA 4R98A 2H1VA 2F9LA 4DXDA 1RWWA 3HJTA 4S0XA 4U7WA 5K0BA 2BGGA 3G0CA 4OI2A 2IWRA 4PLWA 2FSPA 2R79A 1CJMA 3BCSA 1AKNA 2RC5A 3D8HA 4L28A 4OH7A 2FPUA 2ZT6A 2AGVA 3M3PA 1N4AA 3ZLBA 3PIRA 3GQBA 1Z35A 3P9QA 4K28A 3MB5A 4RPKA 5DYTA 5GONF 2C2MA 2ZBRA 1XZNA 3W90A 1KEUA 5LCXA 5KIAA 4X6UA 1QG2A 3PE4A 3HK2A 1E0KA 1ID8A 1PT7A 4GMHA 4LPSA 1JQLB 2LTAA 2OD7A 2XAAA 3H6HA 4IRMA 5DHTA 4JI8B 3B6EA 1PW5A 3EVDA 2PMKA 4LA4A 4MS1B 3V48A 4QGGA 5TRTA 4JC8A 3C14C 1WG8A 1Z22A 1XJ5A 2PX3A 2I4NA 3PNOA 4IICA 1XHLA 3GZNA 5EQDA 4F9GA 5BVHB 3NMUF 2NP6A 1QQ6A 4NBWA 4Q0MA 4H1VA 2QHXA 4PZ9A 5ALNA 3BJRA 3U4AA 1N0WA 4DR6B 4CKEA 1KDPA 2AVNA 2ZBPA 4BV3A 4K6OA 2QRLA 2B6NA 1U7HA 3MWGA 1V2HE 1AXGA 2COEA 3Q3EA 3W5AA 4ND4A 1V8BA 4G0ZA 4CV2A 2C3OA 3S1LA 3UQZA 4GOND 1UBEA 2VUSA 2JAUA 1DS6A 3ZWXA 3GVXA 4G0NA 1V8FA 4M1MA 1NVKA 1EDEA 3K0CA 3K96A 1YC2A 5C3UA 3R9KA 3QEBZ 4IS3A 2F1OA 1YCGA 2QN2A 3SC4A 2IYUA 5LXTF 2YIVX 1DKRA 1HZZA 3FFBA 4CI9A 2F62A 4RD1A 3MT8A 2O20A 1JJIA 3LXRA 3M6WA 1P44A 5DTRA 4ROTA 3IEPA 3MRVA 1SKYE 3R0IA 3DYBA 1GTRA 1Z62A 3KEOA 3VSBA 4LJ4A 1WW3A 1LKZA 1OLXB 1OPXA 4Q82A 3G9ZA 4U8HA 1KAQA 1TTHA 5LMZA 3WRWA 1YR1A 2JHAA 3QBEA 4HRXA 3FWNA 4IILA 1F9AA 5JVDA 5JZSA 1Q0PA 4L02A 4OB7A 2W7TA 2QBYB 3P9RA 3X3HA 2QLMA 3LY9A 1E60A 4KDFA 4KOAA 1CP2A 1JBEA 5JYDA 2Q5QA 3GROA 1MG5A 4GE3A 1C81A 1XLTA 3QK7A 5GPBA 4V0SA 4QWMA 2O8FB 1KY4A 3HWX1 4AD8A 1CJBA 5BSRA 2JGDA 1SK9A 4ZTUB 4L5BA 1U7DA 4MGYR 3EDYA 4WI1A 2C07A 3SR0A 3W5SA 4WESB 1P1KA 2ZSJA 3PUVA 1U3VA 3RNLA 1ANKA 2NZYA 2G36A 3NANA 1MUUA 5CEFA 3DEAA 1P1IA 1B76A 3L8MA 2J41A 3PUIA 4AJEA 3LH5A 4ONEA 4OUDB 3ONDA 3LX6A 4EL0A 4C7VA 2MSLA 5HBRA 3R1IA 3LYLA 4DCSA 2H57A 1C1HA 1Q0QA 4TN5A 1Z13A 4B31A 4E13A 2EL7A 4EQZA 1F2DA 1YS1X 3KJZA 4FYJA 2KM1A 3OSUA 2XUOA 3IDFA 2O57A 4MR7A 3WK6A 3N7UA 4BWYA 4X00A 4PNHA 4X7RA 1LVHA 1JQJC 2Q5EA 2Z2KA 2F1IA 3HGQA 5FV7A 2W00A 4NV3A 3WIBA 3HKCA 3FETA 2AXQA 3FPKA 3VPAA 5A62A 4F3TA 3BXZA 4Q3DA 5ISMA 5EHIA 1OE0A 1RD4A 1ZJ4A 5HEKA 1BDMA 1A69A 2DWPA 4GGMX 1J90A 3JYPA 3QE9Y 3HV2A 2ZT8A 1XV5A 3IPCA 3OTWA 4FFVA 4X95A 1TAUA 3NFRA 3MRXA 4DDMA 4UUMA 1M83A 3IP3A 1XZGA 4A2WA 5A4KA 4FW8A 4B6QA 3EQ8A 3GBPA 1EHYA 2ZWVA 3E5HA 4KQWA 1NLZA 3WXMA 2IS4A 2GBGA 3WBBA 1J9EA 2IHBA 4BNJA 2UZ3A 4BYGA 4WOBA 1RXIA 2WF8A 1CJKC 5D7BA 4ESEA 1XXHB 3EGXB 2EZUA 3Q4GA 4S0ZA 5HGJA 1GZSA 1EP2B 1LTKA 4CG1A 2VSOA 1E3DA 1Z2OX 2Y77A 1QIIA 1AQYA 3N0WA 3IT0A 5EJMA 4JLMA 2G08A 3E2IA 3PZRA 5AXAA 5G0VA 5IM5A 2R5FA 4CFSA 4BC0A 4ETNA 2AWNA 4ZI3A 1N8NA 1AV7A 5DM1A 5AT1A 3FF4A 1W4LA 5LB4A 2DJ5A 2UZ1B 3U56A 1XC7A 1OCEA 3LPMA 1CR2A 1P45A 2JD2A 2NZ8A 3F90A 3VSCA 4JELA 3OZAA 1W44A 4WBSA 2JJMA 2ZB3A 1U3DA 4YXFA 4JSRA 1JDBB 2R2GA 1PAUA 2CW5A 3DBHB 2F90A 4U00A 5F3DA 1YQGA 5CTJA 1SUFA 1RKXA 1U0HC 3DCYA 3Q0IA 2Z04A 4F2HA 4OL0A 3LP6A 2C9OA 1WKCA 1REQA 2Z9BA 4JVSB 4F93B 3FKSA 3AR7A 1ZI8A 2VXYA 3KUCA 3M4JA 3NM4A 4GBED 4TVOA 6AT1A 1XQYA 3BYZA 3C24A 4Z54A 2QXTA 4XPZA 1M1YB 3AOGA 3RHTA 3EPKA 1K97A 2B30A 4JYPA 5DHAA 4YP9A 1S6YA 2PPVA 2R1UA 3QJYA 5F2OA 1PU2A 5ALXA 3X1DA 3ZLVA 4L76A 1YZGA 3H18A 2AMJA 3E1GA 4RS4A 1YH3A 2VJPA 3H11A 1M76A 3UM9A 1LSSA 4HQNA 2XKKA 1CS0A 3BM5A 4QTYA 3WI7A 3WHLA 1RC0A 1LBIA 1HBJA 1UBLS 1L7BA 2CMKA 3IUQA 5LLDA 1IWOA 3H4MA 4OXNA 4JA0A 4XGKA 2IPAB 1N2JA 2ZVPX 3L1UA 1TIBA 3FPFA 3NVKI 1KJWA 1OASA 1RI3A 5J4LA 3QXJA 1MZVA 3GT0A 1RZRD 3PX7A 1L8AA 1QWSA 1E4OA 4XJVA 4EPWA 3ROZA 3G8AA 1Q7EA 1SCQA 4IDCA 4YJ2F 2ZIFA 3TRIA 3C70A 3WYBA 4TZ0A 1DO8A 3L4BC 3SQXA 1V6CA 1ZPDA 2UVQA 3PDUA 1U11A 1L7XA 5PNTA 1MABA 3USZA 3KQYA 4CTKA 2P90A 4QOJA 1C7QA 3STTA 5KU1A 4EFDA 1NXTA 1X8KA 4FLFA 5DBGA 5JEDA 5ALEA 1W2GA 1JSXA 1BIFA 4LHWA 4MI3A 3DE0X 1OFTA 1VLJA 2WYWA 1NWHA 3IVCA 1J56A 4FKZA 3SSMA 2DLNA 3FZQA 4AB1A 4RPJA 1IULA 3ZCTA 3PEVA 4X5OA 3GLIB 3B12A 2W93A 3OZRA 5F78A 4DHEA 1E5LA 4DABA 2VAVA 3AF1A 3GEMA 3IDAA 5HS4A 1Q0HA 4LF5B 4AJ4A 1R5BA 2VF2A 3H9EO 1DZ3A 4MVJI 5KKCA 1HR0B 5DM2A 5JSHA 4URFA 2VL7A 4RK7A 1QE5A 1OI2A 2BCGY 4EW6A 1TUGA 5LXTA 5K6TA 3PJRA 3HACA 1I4WA 4ZVNA 1DAFA 2AZTA 1MKYA 2Z9DA 5I6DA 5LFAA 3F49S 2WB2A 4CODB 2JHCA 1QF9A 4WKCA 2HLDA 1Z4JA 4B3BA 1YZVA 3HBMA 3JW8A 1H6DA 5BT9A 3PR3A 4UNSA 2J07A 5DNAA 5EIOA 3UMBA 2PX8A 3WSVA 4DDWA 2ZVDA 1J22A 4GZLA 1USGA 3B6KA 3PK0A 3SK0A 4D9EA 3LFHA 4W5TA 3M1AA 1R6VA 3RUFA 4BBZA 4BB0A 4ZOQI 3IPYA 5CVDA 3U5TA 3O4JA 1QIFA 1C9EA 1TQHA 3DBHA 1TEHA 3DQQA 3H2YA 3GEBA 3INRA 2EF1A 4O4IA 5HCIA 3GUCA 1VJ1A 3CSUA 3VV2A 1M66A 4JBYA 4HHEA 4R6XA 5K3EA 3GOQA 2CT8A 4FHGA 3OPYA 3NCTA 4R1OA 3WRXA 2ZP1A 3OM1A 1EX7A 3CRVA 2RG1A 5CT4A 4Z9YA 3IP5A 4Y0VA 1R00A 4DMMA 3F6CA 3THXA 3G5AA 3AUKA 1QU3A 3O3CA 5DW3A 3CQ9A 1K5PA 1KI4A 3E5NA 3HR7A 1H0KA 3AIMA 3JRWA 4U1RA 4U7DA 1KBQA 3HXTA 4G1BA 4NDZA 1GPWB 2PWYA 4WNAB 3LHDA 4XUGB 1AMNA 2MSKA 3PDCA 2WWFA 2G4VA 1CEXA 4RTOA 2Z2IA 5HKAA 1RU3A 3KZCA 3QELA 3BN3A 4BEVA 2GSDA 1VB5A 3H5VA 4LV6A 4TMWA 3RVBA 4BQRA 3AUFA 3T38A 4ZI7B 3WGHA 5M04A 3D43A 4FZJA 2H48A 2XTMA 3AI2A 5KOJA 3T06B 3C3WA 3L43A 1ZVJA 3WYNA 1QPBA 1XVTA 2WMNB 1KK2A 2NVOA 1RRMA 5JWOA 4FM9A 3CA8A 2R4TA 1T1EA 4ZHQB 2QB5A 4KE9A 4WFJA 2EFYA 5CA1F 6Q21A 3EUFA 3HEMA 1Q14A 1QHEA 4IUDS 4HWOA 2XBUA 4QULA 5E3HA 4HQOA 3VR4D 2V1UA 1A2QA 2BGIA 2EVWX 2H1IA 2JFZA 4K9QA 4BLVA 5KTSA 3B5IA 3NBMA 2B20A 2A5GA 3DAYA 4M0DA 5JXWA 4D56A 2QRVA 4HDKA 3U0BA 2WWXA 4ZEOA 4JI0B 1TJPB 3QWIA 3VPFA 5BSHA 3EXFB 3EOBI 3L6UA 4G23A 3FJ1A 1UXJA 2X0NA 3IRUA 2XKBA 4GKKB 2DPXA 3G9QA 1JHDA 4EUFA 1LEHA 2JGLA 1S3SA 2BEWA 4Z3KA 3ZDDA 3I4LA 3ETEA 4IX1A 4DB4A 5EMMA 5BNWA 1TFRA 1UIRA 2ZBFA 2D13A 4WKNA 3T7IA 1PBNA 3EDCA 3GPBA 4IH4A 5L6LB 2R6AA 3I72A 4G67A 4H77A 5H80A 5JJKA 5I7WA 5MFZA 3IB3A 4KWCA 3U19A 1TO2E 4QG7A 4B7AA 1EA7A 2HU8A 4NLLA 4BNVA 1QHGA 2YVUA 2RONA 3HRHA 4XIGS 1L1EA 5JJLA 1E6MA 4D44A 1UKAA 3WGGA 1OIXA 1BVUA 1IZ9A 3HDVA 2B4TO 4U4AA 2H4JA 4DILA 4DNXA 4IDGA 4D6XA 4YYZA 2BTEA 4DDVA 4BO5A 5K3FA 2A57A 1B8VA 2CNDA 2ISQA 2H3HA 1OZGA 1ULZA 2ID4A 2VDKB 1XFDA 1EFHA 1KI6A 2FB9A 3OX2A 1N3IA 1NF8A 1QO7A 2X0RA 3E1SA 4HYQA 4L1KA 3LSTA 2H1FA 2DQ4A 4IP0A 2O1EA 5CR9A 3UJDA 3VO9A 5JCOC 3IP1A 4HS4A 4BQQA 4XM1A 4V2UA 2Y68A 3PC2A 1YDGA 3ZZNA 4X8LA 2J8ZA 3W77A 4BJ5A 1OV4A 2G63A 1R0KA 3PRHA 3SF0A 1YQEA 3QSGA 2O8EB 5CM2Z 3CLVA 3PC7A 4HXYA 4HXGA 4A2CA 1ZUHA 1ODLA 1UZAA 4HNAB 3AJEA 4M4SA 3TR0A 3QKWA 1P2FA 2WIJA 3DCIA 3AGPA 3EOAI 3C98A 2A58A 4BAGA 5FULA 2QS9A 5GP1A 4QUHA 4RY8A 1OU4A 2CLFB 5EHNA 3ZX4A 1BN6A 1J25A 2IGBA 4M21A 2XF8A 5CG1A 1FSPA 5FDFA 3PQDA 3PT5A 4YAJA 3EXIA 3A1VA 2B0CA 3K9WA 2PX5A 3F6RA 1CBUA 1LJ8A 1ZLXA 3N28A 1F14A 2ZRNA 3JD2A 3O95A 5AM5A 3RVJA 4BUCA 2DTDA 4PRZA 3TE7A 1U7PA 2NSJA 3FSEA 4I4TA 3PXCX 4L78A 1NR1A 3OOWA 1JG1A 1Z74A 3BD9A 2V6MA 4L3VA 1IG3A 2GB4A 4CMIA 2G7MC 4UBLA 4KTVE 2FUNB 2P9YA 4BVJA 4G0OA 4DR5B 3RGWS 1U3GA 4Q4LA 1GQQA 4UJ3A 1YRBA 2JL1A 3O8QB 2HIHA 3LDFA 5C8YF 1Q16A 2UUOA 3V46A 5IJ0B 3LTEA 4DYHA 4R3WA 4KQIA 3T1YB 1UP6A 2D1FA 2DY1A 3SF8A 4DJDC 1Y48E 3DDCA 5EXPA 3FZGA 3BGWA 4YS6A 3CH7A 3VC7A 1WOYA 2OB2A 5E2AA 2HTFA 1ETHA 3VNAA 3W6PA 1YZUA 3TQIA 4H2DA 5JHGB 4URUR 3KQLA 1KYQA 2ZM5A 4G89A 3FFAA 3S2EA 3KYBA 4DCOA 4JP8A 5CFZA 4IBOA 3FUXA 4HLUC 2XB2A 5HQ3B 3O4VA 3CT6A 4P54A 1OKKD 3MD9A 1VDMA 1PS9A 1IK4A 1VIAA 3GU3A 1N5KA 1M6YA 3N2IA 3KYCA 4I2VA 4L8VA 4BN0A 5HYVA 3H5OA 3WGNA 4J07A 3EAGA 4BMPB 2P1ZA 4KGXA 3ZBTA 4Z2AA 1B15A 5FBWB 1JAZA 3QKRA 2REQA 4BCCA 1J99A 3BQNB 2FZGA 3PG5A 3GN1A 4QPJC 5LJLA 1XPUA 3G59A 1CUIA 4BX9A 4Z4CA 1OFIA 1UDAA 4YUAA 5C4MA 4KPEC 5IAKA 1K6EA 2OFPA 1CLUA 4PXYA 2BAGA 4F86A 2Z2XA 1ESDA 1ND5A 5AUPB 5IJ9A 4D74A 3CTMA 3MYRA 4EUEA 1TL7C 3E9EA 1T36A 1UJMA 2QTBA 1ZGBA 3BMNA 3HKEB 1GU1A 2WHPA 3BSYA 1M8KA 1GG2A 5FPTA 2LZ0A 1U2ZA 3D3KA 1KMQA 3AEQB 4CQMD 3LU1A 2C82A 4QTXA 2EIHA 5JXIA 1YVPA 2G9UA 2AFVA 4DR7B 1L1FA 4LHEA 4EEXA 3QVWA 1NI4B 4BX3A 5IH7A 1VPDA 3B1KA 5AI5A 1P61B 2WIGA 3EVBA 4UPDA 4WKPA 4Y6SA 4CF7A 5TIIA 3H3FA 1IEQA 2ETXA 1BE0A 4YMUA 4Y6GB 4ZVOA 4EKNB 2JGFA 5HKOA 5ESDA 4RANA 1S8AA 3GV0A 4XWYA 5ARBA 2A5JA 4R5MA 3ZZ0A 1M1ZA 3DE2X 2CFCA 3LWBA 1K9SA 2X9LA 1UPBA 4RL4A 1FBTA 2ERYA 5FKJA 2WM9B 5FYQA 4C87A 3K72B 3CB2A 3CR8A 3L40A 1BFKA 5DLEA 3PI7A 4PYKA 5KOHA 1BFUA 3IAUA 1YHZA 2ATEA 4FFRA 4R69A 3Q8MA 4MQEA 4TLBA 3RC1A 4S1VA 5LNK1 3ZDCA 3DPSA 5AI8A 3AUXA 4DMHA 3PITA 4UQPA 5JUWA 1B0ZA 3OHSX 1RJFA 4UHFA 4C2AA 3WDMA 5KQMA 5LP1A 2MINA 3PFFA 3E18A 4KLNA 2YJTD 3WK9A 1HE4A 3D6UA 3VNBA 3TZCA 4C7KA 5LQMA 1NFRA 3EC1A 1P4RA 5EC8A 4L8FA 1JHMA 3OBBA 5I01A 2QRKA 5I7AA 5C5DA 1UPTA 2UAGA 3M5DA 3OZBA 3LZCA 2QX9A 3VR4A 5D3MB 5JPDA 3WLOA 2XOEA 2FN8A 4KR0A 5A05A 3W6NA 4BBAA 1E3IA 2ORED 4HDCA 3KWMA 4RIEA 2R8ZA 1Y89A 2WJYA 2IODA 5TLSA 4R1SA 5FXMA 5LBUA 3B38A 3BERA 4C06A 5COAA 1FNDA 2ZK7A 3R7WA 1YQWA 1C3VA 1RM3A 5CFRA 5KMGA 2NV6A 1MVOA 1IOWA 1NUPA 2Q29A 3K5PA 4L0QA 4NARA 3KZ1E 2RCYA 3NAZA 1JLKA 2ZKLA 4V0LA 3GJ0A 4JD5A 3HCRA 1T15A 2IZ1A 5BNTA 2ECKA 1FP4A 3Q3IA 4R54A 1N2OA 4G56A 3H05A 5EPUA 2AN4A 4Y0NA 4ZZIA 4HB2A 4N3NA 3JYLA 4PU0A 3MWLA 5KX5F 4ZJZA 2V0GA 3PNPA