1OAAA

Mouse sepiapterin reductase complexed with nadp and oxaloacetate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
259
structure length
259
Chain Sequence
ADGLGCAVCVLTGASRGFGRALAPQLARLLSPGSVMLVSARSESMLRQLKEELGAQQPDLKVVLAAADLGTEAGVQRLLSAVRELPRPEGLQRLLLINNAATLGDVSKGFLNVNDLAEVNNYWALNLTSMLCLTSGTLNAFQDSPGLSKTVVNISSLCALQPYKGWGLYCAGKAARDMLYQVLAAEEPSVRVLSYAPGPLDNDMQQLARETSKDPELRSKLQKLKSDGALVDCGTSAQKLLGLLQKDTFQSGAHVDFYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SEPIAPTERIN REDUCTASE
publication title The 1.25 A crystal structure of sepiapterin reductase reveals its binding mode to pterins and brain neurotransmitters.
pubmed doi rcsb
source organism Mus musculus
total genus 96
structure length 259
sequence length 259
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 1997-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1oaaA00
1PWZA 4ID9A 2QRKA 4R1NA 4R16A 5HBRA 1KOLA 3C1AA 2HAEA 1HE4A 3ZWCA 1XU7A 1ZJYA 4HUJA 2PD6A 4DQVA 4NBUA 3D3WA 2ZKLA 2VWQA 1IPEA 4MDHA 1VC2A 4PLPA 5JO9A 9LDBA 2WJPA 4J91A 5ES3A 3LU1A 4D42A 1RKXA 3FWZA 1ZMOA 1AUPA 2Q1SA 2YFHA 1R16A 2XOXA 3PDJA 1CQIA 2PGDA 1Y5MA 3WQQA 2Y1EA 3V1YA 4WCFA 3C8MA 3I4FA 1A27A 4DIFA 2UUPA 1JWBB 1IHYA 4QFCA 1HZZA 2DKNA 4BVAA 5KTKA 4W6ZA 3KRTA 1R12A 1XELA 2J3IA 4JBIA 4BV8A 1KY4A 1RWBA 4KUGA 4YACA 5F5NA 2DT5A 3PGXA 5T8KC 1LUAA 4PLVA 5G4KA 3C7DB 4GMGA 1YO6A 2AEJA 2AQ8A 4U6QA 3MWEB 1PR9A 1VI2A 3ZWWA 1MXFA 2V6BA 1IY8A 5FI5A 2O3TA 4DLLA 4OL9A 5JMWA 1DBVO 2C29D 1NTOA 3BXXA 4WPGA 4DPMA 1QG6A 2EP7A 1HRDA 1VLLA 1KETA 2PZMA 2GGSA 1C0IA 4ND2A 1P31A 4I5DA 4PG8A 2ZYDA 3AM3A 1R0LA 3OSUA 1UH5A 1EVYA 4NBRA 5KVQA 3GUCA 1HKUA 1U2GA 2E37A 5KJ6A 4A03A 4BNZA 3HG7A 5DF1A 4DRYA 3HB5X 3FNGA 4RVGA 4BKOA 4UEOA 5AXCA 4J7CA 4NDNE 1IE3A 4GKBA 1WMAA 3OP4A 3ADPA 2AE1A 2DU8A 3IUSA 3ZHZA 4IDEA 4LW8A 1LDGA 5BNFA 2BF7A 1SNYA 4TKLA 4XR9A 4ZQGA 2X58A 3LF2A 1GZ3A 4FCCA 4G5HA 4DPLA 1PJ3A 1FF9A 2CF6A 5I7FA 3VHRA 2OO5A 5A9SB 1RPNA 4YJGA 4CLOB 4MVJH 5ICSA 1E92A 4HY3A 5B12A 1DHTA 4JBHA 2B83A 1NVMB 1PIWA 1Q0LA 4O59O 5I8ZA 3GNSA 4NFYA 3QWIA 1NFFA 4WNIA 1RJWA 2RHRA 1JKFA 5CG1A 1U8FO 4BIIA 4BNTA 1HSOA 1ZK0A 3JYQA 5GZ3A 3F5QA 3EY4A 4LCEA 4J2HA 1HETA 2YJZA 1ML3A 3MJSA 5DT9A 1B0AA 2EV9A 4GBJA 2NTJA 3B1JA 1A9ZA 1R66A 3VH1A 5L40A 1WDLA 3Q9NA 1KY5A 4R5MA 3RUFA 1UP6A 4L8VA 4BNVA 3WIDA 3DMYA 1E7WA 4Y6PA 2XXJA 4DUPA 4EUEA 5IAAA 1SBYA 1H2BA 2HUNA 3LLVA 4RF3A 1M6WA 2EGHA 4UVEA 3G49A 4NHEA 3BZUA 4EGFA 1LJ8A 1OFGA 4ND1A 3RC1A 4CODB 2PWZA 3P2OA 5ILOA 1GCOA 2GCGA 2W2LD 3DBRB 4NU5A 2NVUA 4CM1A 4Z6KA 5L53A 1F8FA 2H1SA 3LK7A 2NVWA 2VRCA 4TRRA 5EQDA 4DMMA 4K6CA 5I8WA 4FOSA 4BNIA 1I3LA 3DTYA 1P0FA 1UDAA 2X23A 1X1EA 2O4CA 2YUTA 3H9JA 4PVDA 2HJSA 4HV4A 3WNQA 1YL5A 4G2NA 3QLJA 2BFMA 3CEAA 1O89A 2ZB3A 3GFGA 2BGLA 1PS0A 3LVFO 3RUCA 4PG6A 4YTEA 1B26A 3P2YA 4ZJUA 2DTEA 4F46A 4OKNA 1XQ6A 2EWMA 4GI2A 1K6IA 4MO2A 2YFQA 1HDGO 2Y1FA 3F6YA 3R3JA 2PD4A 2O2YA 3H3FA 1O6ZA 2EIHA 4DREA 3EDMA 4AJHA 1B16A 1BSVA 1ZNQO 1E3LA 4DYVA 4E33A 4ALNA 4CPDA 1N9GB 1WMBA 2VHXA 3MJ4A 3JD3A 1C1XA 3X2EA 4PVCA 2DUUA 1P9LA 4PLWA 1GUZA 4YAJA 2AG5A 1KVUA 1EE9A 1LI4A 1KYQA 3DC2A 3TOZA 4RF2A 4W99A 4TRMA 3R6DA 1U4OA 1XHLA 3VKUA 3JQ6A 4CQLA 3QVXA 2AQHA 4RLHA 1JAXA 4GGOA 5KKAA 4Q3AA 3JQ9A 3C85A 3W8DA 3AJRA 2LDXA 4DYDA 4D41A 4BL5A 1YL6A 3U5TA 2HMSA 3RFVA 4BNXA 1QYVA 2C5AA 1YGYA 3L77A 3F4BA 1YDWA 1H6BA 1QLHA 1C0PA 1NPTO 3L6DA 2D1YA 1TI7A 1UXKA 2ZTLA 3HZZA 3NRCA 4GLLA 4YR9A 3WSVA 2ZB8A 2V65A 4J49A 3ETDA 1UZLA 1VKOA 1WDMA 2Q46A 3QJ5A 3RUHA 5DBFA 1GV1A 5EJ2A 3UN1A 4N18A 4WKGA 3JQGA 3WFJA 3GEMA 5L4LA 3BHJA 3MJTA 4KWIA 4M54A 3BTSA 3ENKA 5JY6A 4YPOA 2P5YA 1I8TA 1GTMA 5CFZA 4B3JA 3GHYA 4E5YA 1LLCA 1R0SA 2VYNA 1ZCJA 5TIIA 2H9IA 4IJWA 3TOXA 3PIIA 4PGFA 3F47A 4HWKA 4UVHA 3VOSA 4IDAA 5JAMA 2ZYAA 3H3JA 2IYPA 4GQAA 5A04A 1Z75A 3ZNQA 2OMEA 5TF4A 4E5KA 2DBZA 2NU9A 4NMHA 5I9NA 4HKTA 3GR6A 1KVRA 4Y67A 1NQOA 2PK3A 5CAEA 4P4LA 4RQUA 4WLFA 5TS3A 1E5QA 1UXJA 3JQBA 1ENPA 5CEJA 4E3ZA 3WB9A 4MKXA 3RC9A 2O7QA 3L9WA 3CIFA 4WCFC 3DTTA 5IZCC 1G0NA 3RBZA 1YKFA 1K3TA 3LSYA 3UICA 1E1NA 1HYEA 2Q1UA 4OJNA 2VHYA 2HKIA 1DIGA 4XQ9A 3X2FA 3WIEA 1HDXA 2PKQP 1JKIA 2A92A 3Q9UA 4JN6B 3BMQA 4EITA 5DCWA 4FPXA 3NYWA 4IJUA 2ZYGA 3S2GA 1DOHA 1NM5A 3IP1A 1R6DA 4K26A 5AQ1A 1XSEA 4J1QA 2B5VA 3UKOA 2JL1A 3OBBA 4AVYA 2WMDA 3VPSA 4CV3A 1KVTA 4CLRB 1U8XX 2XPCA 4IMRA 3AUSA 1JW9B 3IIEA 3DAPA 4U0JA 1DLJA 1DJNA 2CY0A 1N8KA 1Z7BA 1ZSNA 2EKPA 5IDWA 3AK4A 4YCAA 1P1HA 4BGUA 3JTMA 4FFLA 4UUOA 1KEUA 4ITUA 1HE2A 3PZBA 2JD1A 4A2CA 3GAFA 3DB2A 5IF3A 3BIOA 2WE8A 3EMKA 2Z5LA 3QQPA 1JVBA 3NDIA 1Z82A 1EMDA 3LF1A 4EUHA 3MOGA 4TROA 4E13A 1Z6ZA 2D5CA 1N1EA 1ZW1A 1XYGA 4ND4A 4BO6A 3GNTA 1GADO 1ZMTA 3CE6A 3ZCXA 2HLPA 1GDHA 4B8WA 3U4CA 2D2IA 2YQ5A 1GEGA 2FR8A 3QP9A 2HMUA 2B4TO 3OH8A 4LK3A 4Q39A 2GZ2A 2FR1A 1I2CA 3L0DA 2C2YA 2AHRA 4BO0A 2EHDA 2GRAA 1GU7A 1QMGA 1ENYA 2NV6A 2GZ1A 1QORA 2WD7B 4ZQHA 3DHEA 1HLPA 4CJXA 4R1UA 1P77A 1ZUD1 1JN0A 4JP2A 4OOEA 4IIVA 1R4MA 1DPGA 2QRLA 1D1SA 1UAGA 4LVCA 3MOIA 2DBQA 1LLUA 3I9OA 1R4NB 3AWDA 3EVNA 3R3SA 4W82A 4RL6A 3M1LA 4WJZA 1PJBA 4XEHA 3WFIA 4AJOA 1I01A 2VCYA 5BR7A 2DFDA 2BI7A 4R41A 1ID1A 1PGNA 2VRBA 4TWRA 3SXPA 2G76A 2NSDA 2BI8A 3TF5A 1U28A 5ILGA 3GQVA 4UREA 2HU2A 4FIZA 3FWNA 1AHIA 1PQWA 3DO5A 4MKRA 1U7HA 4NNJA 1NX6A 3M6IA 3E1KA 1YOVB 4IPTA 2OBNA 3GZNB 3DONA 2WSBA 3KYDB 1NPYA 1RYEA 3ETEA 2DC1A 1HF3A 1RM5A 1XLTA 2O2SA 3E03A 4CQMA 1GD1O 1DC6A 1Y7TA 3WJAA 3JQAA 3OICA 4XYEA 2X8LA 3OJFA 5BSEA 1AXEA 4I8XA 1V0JA 4RLSA 1T1RA 4XYMA 1GR0A 2PH5A 5G0WA 5CPBA 1ZK2A 4P4NA 2E49A 4UUMA 3GDOA 4FB5A 4NJMA 1P3DA 2I76A 2B4RO 4JNKA 4OKIA 2W90A 5K6AA 1QR6A 3DBHB 3PI7A 3U3XA 3UUWA 3QV1A 1JLLA 4D3DA 4DL9A 4KDFA 3H9EO 1BW9B 3TZQA 1ZZEA 3E5MA 4AL4A 1U5CA 3AU8A 4J4BA 4A27A 4WE3A 4GVXA 3RKRA 1SZJG 3U0BA 4PLGA 4A73A 1EBFA 2EJWA 4URFA 4E5MA 1K2WA 1TB4A 2VYVA 2W2KA 1IL0A 2VZ0A 3GAZA 1SCUA 4BUCA 4HADA 1QRRA 2Q45A 3H9UA 1GAEO 5IDYA 3PYLA 4XRRA 2FZWA 1LC3A 3U49A 1U1IA 5JDCA 1UZNA 4IJKA 1X14A 1YB4A 4CLEA 4WLVA 4D46A 4Z9XA 1XIVA 2GN6A 4PG7A 5G0TA 3PXXA 2Q99A 3ROPA 1BMDA 4MINA 3V1UA 3BMCA 1ZFNA 2FSVA 4XB2A 1DIBA 4XA8A 1BVRA 4OYRA 3F46A 4YB8A 3PVZA 3UXYA 3PHIA 1K89A 4MOWA 4EDFA 4CL3A 2BELA 2GN9A 1MLDA 3FPCA 2NU7A 2WTBA 3GLQA 3RWBA 3ZWNA 4HX5A 3H5NA 3JQ9C 4II2A 5JNLA 4MIOA 4XZ3A 2CFCA 3FF4A 3GG2A 2FWMX 5T57A 2AQIA 1C1DB 5DP2A 3IJPA 4Z0HO 3UCEA 5A06A 3GN1A 1EE2A 3LT0A 4KTVE 3MWDB 5JMPA 2UYYA 3TL2A 3A06A 2J5RA 4J3FA 4M89A 1U7TA 4N5MA 4IDBA 2I66A 1JDJA 4KDEA 2X5OA 3W8EA 4XGNA 4PLCA 4RPGA 4OMUA 4PCVA 1Q2XA 1U3UA 1N5DA 1E5LA 2Y05A 2GDZA 3OA2A 3S2EA 2VUSA 1J6UA 3IJRA 3WG9A 3BTUA 1X7HA 4E31A 1A9YA 2I6TA 5TX7A 4BMSA 3WGIA 4YJDA 5HM8A 4D0SA 3BMOA 2NTNA 4GVLA 3KETA 1ULUA 3HFSA 3CMCO 3ZZNA 3K2EA 1NWHA 4U6SA 2GERA 4RVDA 4BO2A 1GUYA 1TEHA 2IXBA 2Y68A 4K1LA 4S1VA 1LQTA 2AQKA 4WK6A 4A0SA 4DXHA 1E1MA 3EW7A 4C7JA 5COAA 3CXRA 4N5NA 2Z95A 1BXKA 4FS3A 1GV0A 4YAIA 1KVSA 2TMDA 4NJOA 3VPHA 4RGBA 5J23A 4E21A 1I3NA 2IDZA 4DA9A 3VPGA 4ZVVA 4FFRA 2B0JA 1KC3A 1DAOA 1YBAA 3MJVA 2RHCA 3I5MA 3OIGA 4L4SA 3HE3A 4GX2A 5KJFA 3JYLA 2B37A 1NQAO 2NNLD 1V9LA 1L1FA 3ZGYA 4EEZA 3K92A 2VZ9A 3AOEA 2EJVA 4R51A 1WNTA 4XKJA 4CM8A 1W4ZA 4PFJA 3ZWXA 2Q4BA 4XQEA 1BXGB 4B8ZA 3SLGA 1YQXA 3F1KA 4RPKA 4CM4A 3E9NA 3GVHA 1MXHA 5TNXA 2C82A 1NFRA 4B4UA 2HK8A 1A7AA 1T4DA 2BGMA 2A9FA 4GSLA 3QRWA 4NK4A 3U4IA 2AA3A 3Q0EA 5I7VA 3M1AA 4FFPA 3PQDA 5I9MA 3QVOA 3PFFA 3FD8A 1BVUA 4XYLA 1DFHA 3GRKA 4B7CA 3W1VA 4MIYA 2JFHA 1ISFA 1IUKA 2QIOA 2ZB7A 4Y98A 5A3JA 3D5TA 4FC7A 2VUTA 4PRKA 5KWEA 1MGOA 2P5UA 5ER6A 5ENDA 4KWHA 4EUFA 1WZEA 5F21A 4AJ2A 1V35A 2HJRA 4ALKA 4BGVA 3PP8A 2BGKA 4Z3KA 3HUDA 1ZEJA 1Y8RB 3R0IA 1E77A 4XCVA 3VC7A 2C7VA 2D59A 1GPDG 2I3GA 5CDUA 4IS2A 4U0KA 2F00A 4O0LA 3GNQA 3K30A 1VPDA 3GZ4A 3UW3A 2HO5A 5IN4A 5DP1A 5DBIA 2PTGA 1CIVA 3BMNB 1YJQA 4TZKA 5TJHA 1J5PA 3IQDB 3VDQA 3UF0A 2G17A 2NACA 4YYZA 3OMLA 5G4LA 5IZCA 3VH3A 3HDJA 3EVTA 3UGKA 5IZ4A 3FTNA 2DLDA 4HXYA 4AICA 4R01A 3DFUA 2JKVA 3OIDA 4IQGA 3WLEA 1DJQA 4WASA 2JAPA 2JFGA 2Z1MA 3GFBA 1NQTA 3OEYA 1AE1A 2V6MA 3ADOA 5JCJD 4MIEA 3JQ8B 3FR7A 4J0FA 1DO8A 3RUIA 1LDMA 4F6CA 3KV3O 2CDAA 4TQGA 5LC1A 1DFGA 3AI3A 1PZHA 4MP6A 3TJRA 4CMKA 1M66A 4IXTA 1PJ2A 2RIRA 3NV9A 4B3IA 3CKYA 1SEPA 4IIUA 3VH4A 4YT8A 4N5LA 4F45A 2NUAA 3ZNNA 1E3SA 3WXBA 1ZO8A 1T24A 4ND5A 3OJEA 3WGYA 5G4KB 1BGVA 3KYBA 3B1KA 3GVCA 4YJFA 5DCUA 4MVJE 3A1NA 2G1UA 3WNVA 3LC1O 1DC3A 1H6CA 1Z7EA 4ALIA 3F3SA 2HCTA 4EI2A 2AG8A 3ST7A 3AY7A 4H15A 3VKVA 5KVCA 1GZ6A 3HNPA 5MGBA 4WEQA 5FF9A 3KSZO 2ZK7A 1LBEA 1XG5A 1PJLA 5ADHA 5K6AC 2EXXA 4B4OA 5CPFA 1OZAA 3I83A 4DPKA 2C59A 1ZVMA 4RF5A 1GEEA 4ZN6A 4D79A 4J0EA 3JYOA 1EUZA 1LSOA 1Y1PA 3D3EA 3JYNA 3M2PA 4RF4A 5A9SA 1KBZA 4RDIA 1T26A 3PZRA 5KNLA 1MC5A 2C0CA 4FFNA 3DZKA 3B1FA 5FFFA 1NVGA 3MEQA 2QYTA 4X54A 4INAA 3TPCA 1PX0A 3H2ZA 4L75A 3E6AA 2EF1A 1OI7A 3QVTA 3RC7A 4GL4A 1T1SA 3BTVA 4IDCA 5JDCC 1V8BA 1T4BA 1UXIA 3OA0A 1G0OA 1U9JA 3H5AA 1SOWA 3K2BA 2EG9A 2PGLA 3JD4A 4PG4A 5L7WA 1MC4A 4JCOA 2DUWA 2JD2A 5KIAA 3OECA 3DHNA 3UH1A 4YJHA 4CMCA 5C7LO 2FR0A 3VVCA 4OXNA 3GMDA 1T2EA 5DNAA 1MFPA 1NAHA 1LRKA 2DVMA 3JQEA 4JX8A 3NJ4A 5KJCA 3KB6A 4DLAA 5H83A 2NLOA 1DEHA 1H5QA 1NP3A 1D4FA 1JWAB 4CUZA 1OC4A 3I3OA 2YDYA 3SJ7A 3ZHXA 4I5FA 2CVOA 3Q2KA 1EK5A 1HSZA 1X0VA 1WVGA 2QW8A 1I30A 5JLAA 1Q7GA 1XKQA 2CVZA 3ANNA 2FPPA 4TKMA 1JKJA 3NT2A 4OQYA 2OUIA 3RIHA 4D3FA 1ISJA 2UUOA 3Q3CA 2GPTA 4UAGA 3RQSA 1L7EA 4E2YA 1EQUA 2FPIA 1F8GA 1O8CA 4FJ0A 2VT3A 3LT4A 3D4OA 4E2XA 2XF8A 3E9QA 1T2DA 4R1SA 3ROKA 1F12A 1KS9A 4BKQA 4CV2A 4FQ8A 5TT0A 1YVEI 1ARZA 5TGDA 1TT5B 1LDNA 3AU9A 4RVFA 5JAQA 4IGFA 3LYLA 4CMAA 1E7MA 1EUCA 2BHLA 2D4AA 5EINA 1C0LA 1VM6A 1ZXLA 2E6UX 2WE7A 3L07A 5B4VA 4EW6A 4JLWA 4B4WA 1EFKA 3O8QB 4RZHA 3WTCA 1LQUA 3ZV4A 2NVUB 1NAIA 4KTTE 3P19A 2VYVD 4C4OA 3CMMA 2O23A 3E48A 5ICMA 1UJMA 1FDSA 3PHJA 2E82A 2V7PA 3H9QA 1YXMA 2QZ9A 4JIGA 4WLNA 3V8BA 1D3AA 2P4QA 2P9EA 8LDHA 1VL0A 5DBGA 2PNFA 3FTPA 1Y9AA 4E12A 3P7MA 3AFMA 1XEAA 1HWYA 2IODA 4J9VA 1LTHR 3PYMA 1U2DA 1Y8QA 3ASVA 4B7UA 3FRJA 4E5PA 1QXSA 4YBZA 4IDGA 3TL3A 1X1TA 3AOEC 3B20A 1D1TA 2Q2VA 3EHEA 4GPD1 4J43A 4L9RA 4MVJD 5EPOA 4D7AA 1ZKMA 3RASA 1N92A 3GA0A 3MZ0A 4WUVA 1UR5A 4RVSA 3F1LA 4JBGA 3D4NA 4J1SA 4ONEA 1LRLA 2WYUA 1PZGA 1LA2A 3OFSA 2HMWA 2BFPA 1DFIA 1NPDA 4PIVA 4YEDA 3TFQA 1KEVA 3GN2A 4BNJA 4BS9A 1C1XB 3FI9A 2XAAA 3CZRA 2NTVA 1A7KA 3TNLA 1GQQA 4A7PA 5TRTA 1Q1NA 4FGSA 1FDTA 4FDAA 4NBVA 3P5SA 5BT9A 3SC6A 1HEUA 4BNKA 1E1LA 3GC6A 3HWRA 1PJSA 3WJ7A 5A1TA 2FSSA 1E3JA 2I67A 4IQ0A 4PLYA 2EERA 1GY8A 3ZV3A 7MDHA 4Z9FA 3WDSA 1PWXA 4BO1A 2I5PO 3NUGA 1P44A 1NASA 2O3SA 3WTBA 3E5RA 3OQBA 2VHZA 5LCXA 1F14A 4E6PA 4E0BA 4WNCA 4QXMA 3DOCA 3H9GA 5JYEA 1V3UA 4MVJG 4Q3CA 2Y1DA 3DZGA 1ONOA 3PJGA 5COQA 4O5OA 3QWFA 2TMGA 4WLEA 7ADHA 4CM9D 1IULA 2Y1GA 4Y8VA 4CLDA 4HFJA 2RH4A 4I9NA 3IC5A 5HS4A 1VJ1A 3I9JA 9LDTA 2PZJA 5CP8A 2OBYA 1R37A 1T2CA 1A5ZA 2D5AA 4RO0A 5T5QA 2JHFA 4O6VA 3TZ6A 3NT4A 3BAZA 1H0KA 3CSDA 5FYDA 5TQVA 1PU2A 1YS4A 4BMNA 1ADFA 5HA5A 4HFNA 3L9XA 1O0SA 4FGWA 4IM7A 4Z0TA 4O1MA 1HXHA 2H63A 1TA4A 3Q11A 2NWQA 1NVTA 3OJLA 3JD2A 4A10A 2VTEA 2OGUA 5F1OA 2Y99A 4L4XA 2H5LA 4MVJP 3FBTA 1BHSA 1PJQA 4LCJA 4EYEA 3A9WA 5AXDA 2X22A 2GASA 4AJNA 1NFQA 2J3HA 2OORA 2OFPA 1QYCA 2GYYA 2VHWA 3RI3A 1B14A 4BO7A 2ZQZA 3DOJA 1SB8A 4RDHA 3AW9A 2B5WA 2YQ4A 1O5IA 4GKVA 1MFZA 3RFTA 2O3JA 3SBOA 3VTZA 1Y5RA 3BMQB 5GZ6A 1FMCA 4NZ9A 4PLTA 4BQRA 1PGOA 1XU9A 3TZHA 5KJ1A 2O3UA 3ANMA 4NBWA 4R3WA 1ZK1A 5JE8A 4CV0A 3DQPA 3FN4A 3SLKA 1OC2A 3GMSA 4CMIA 1IOLA 1BG6A 1D7OA 4G65A 1PEDA 1Q0HA 4ZRMA 2LDBA 1GL3A 1UP7A 5AYVA 5CDGA 3WX0A 1Y81A 4Y6RA 3IMFA 3ZW9A 2R00C 2Z1NA 1MV8A 4QO7A 5L95A 4GLOA 1BXZA 3ZU3A 3GDGA 3HQ4O 1B15A 1FDVA 2WD7A 2IEDA 3HSKA 1NHGA 1S6YA 1HYHA 3JSAA 4D3SA 3PJFA 2X9VA 4L74A 3VH2A 3ZHYA 3JD1A 1U3VA 3FHLA 4LMPA 3IP3A 3JCZA 3K31A 4DQUA 2NQ8A 5L9AA 3Q2IA 4BB6A 2I9PA 2PA3A 4LISA 3GVPA 5JXWA 1Q0QA 2X5JO 3ICCA 3IS3A 3LLSA 3OQ1A 4GH5A 2ILTA 5A3VA 3AM5A 3BTOA 3GOHA 3HB4X 3PEFA 4KQWA 4OH1A 1YH3A 1DDOA 6ADHA 4LN1A 1XDWA 2BFAA 3PQEA 1YB5A 4ZGWA 4J1NA 3D7LA 3WGHA 1IB6A 4M55A 3G17A 3PTZA 1B8VA 4ROSA 2G0TA 1ZBQA 5KOIA 1LDEA 4HBGA 2WWRA 4QO8A 6LDHA 4OXYA 3KM0A 4RORA 3KYDA 4XB1A 4XJTA 3C24A 3QA9A 3WWZA 2QZZA 3U62A 3ZU5A 3SVTA 1QYDA 5G0SA 3DZIA 2HDHA 1U5AA 3KBOA 3I9LA 4DTIA 3COSA 4M1QA 3ZU2A 5CDSA 3D64A 3E9MA 1UDBA 3DBLB 4OGWA 4R69A 1DRWA 3F5SA 1YBMA 4HFRA 1L7DA 1TXGA 3UOGA 3T4XA 4CR8A 2B69A 3CTMA 1N7HA 4QEDA 4OOFA 5L7TA 4KUEA 3IUPA 2YV1A 3ZH2A 3G0OA 3ZU4A 5G0VA 4ZD6A 3I9NA 3GT0A 3PPIA 4Q3BA 1EK6A 5U9CA 5B4UA 3ASUA 2WD8A 3FNEA 1BW9A 4YAKA 1PSDA 2VQ3A 4M87A 3OQ6A 3B6ZA 1IPFA 4LSMA 1LEHA 2W2LA 5DDIP 3RVDA 4FN4A 5B1YA 4DGSA 2OHXA 3S55A 3DL2A 3SX2A 1ADBA 2DTXA 1NHWA 5CEEA 1I10A 3F9IA 1HLDA 2PGJA 3QE3A 3RAJA 1YWGO 3TZCA 3CINA 3K6JA 4BOYA 3SJUA 2ZB4A 4NJMB 4RPHA 1WAMA 1E7QA 2EW8A 1P1KA 2Q50A 4FD3A 4S3MA 2GZ3A 4UVDA 4BO3A 5CDTA 4D0RA 5A4DA 1W8DA 2GLXA 5A5FA 3WGGA 2IZ0A 2DM6A 4LSWA 1I24A 1Y6JA 3EYWA 4BNGA 2JJYA 4DMLA 1I2BA 4CUKA 4N54A 1E1KA 4I9UA 3NTRA 1CWUA 2W2KB 4BO8A 3ONDA 1EDZA 4XIJA 1E3WA 2PD3A 3GHHA 1ONPA 5EL0A 3G1UA 3JQDA 4CMJA 5KVSA 1C1DA 1MX3A 4NU6A 1A71A 5DOVA 4B3HA 3HJAA 1YB1A 2BRUA 2X6TA 2OL4A 4YVFA 4CUJA 3ONFA 1YQGA 2VNAA 3BMCB 2DQ4A 5IXYA 4PRLA 1PGJA 4CV1A 2JD0A 2E48A 3VPFA 1M2WA 2FP4A 5LDHA 4FFOA 1HTBA 4PLFA 1R0KA 4XD2A 3AY3A 4UULA 3QWAA 5JFOA 4L4RA 4FBGA 2VRCD 1XCBA 2I3AA 4FOOA 5THQA 4IDDA 2JFFA 4L73A 1OOEA 4MVJM 1SPXA 2VHVA 3A4VA 1CDOA 4P22A 1Z74A 4BQPA 5IDXA 1PQUA 3W6UA 4J90A 4BO9A 1TVEA 2ZTVA 1LC0A 3PWKA 5C5IA 4JROA 1ORRA 1ISIA 3AUAA 1K0UA 4J4TA 2AW5A 5CEFA 4R9SA 1E7RA 4YDRA 4IDFA 3ANLA 2FMUA 2OP1A 4EBFA 3ABIA 1K6JA 1TT7A 3V1TC 4NIMA 5KCZA 3RJ9A 2X86A 5ITVA 3NGXA 3AI1A 3PLRA 3GPDG 2P4HX 1HDOA 3W4JA 3UFXA 2Q1TA 3BHMA 1V3TA 3BMOB 1E3EA 2C2XA 4YT2A 1B3BA 3I6IA 2VOJA 2Y66A 2CMDA 2FHSA 1SOVA 4CM7A 4LRSB 1PJTA 2PFGA 1SB9A 1QYWA 4NFHA 1PJ4A 5HTOA 2DBVO 1UAYA 3CPSA 3V5NA 2NADA 3GRPA 4IZHA 4OM8A 4ZA2A 4B4VA 2O3RA 3ITKA 4YAEA 4BNWA 5A02A 4DQXA 3TQHA 1A4UA 1GUFA 3KYCA 1CERA 1C14A 1RM0A 1NR1A 4GSKA 3KUXA 3ZWPA 1TLTA 3RUEA 2Q3EA 1PJCA 5IXSA 2B35A 4EJ6A 4RCVA 4UEKA 4W4TA 3OHSX 4XWYA 2YHIB 3DZBA 4WLOA 1JTVA 4FW8A 3DZHA 1VSUA 3WSWA 1JVSA 3H65A 3WOHA 3K73O 2C07A 4KP7A 1G1AA 1LRJA 4BV9A 1YL7A 3S1LA 1ISHA 4CM8B 2CVQA 4H16A 4I5GA 4IBOA 4M86A 5U1PA 5FWNA 4XX0A 3JQ7B 3OIFA 1PL8A 3WGTA 4IZIA 4U5QA 2BMAA 3FNHA 3GGOA 3K96A 3AM4A 5L51A 3H2SA 3RKUA 4TVBA 1I33A 1EDOA 3DXFA 4BNHA 2VYND 4BNUA 1LLDA 3SEFA 5BNIA 3ZN2A 3VVBA 5EERA 1J4AA 1I5RA 2PZLA 4MJLA 2AEMA 3LDHA 3W4IA 4CM5A 4FSHA 1M67A 4JJFA 4A26A 3GGPA 1RYDA 2OOSA 5DN9A 3PRJA 3VPXA 4CMEC 4XGIA 4JGBA 1H94A 3BMNA 1DC4A 3DWFA 3WMXA 3UVEA 4AJPA 1GYRA 3WS7A 1EBUA 3UCXA 3INRA 2FY8A 3TDKA 5A03A 4J16A 1G6KA 2B36A 3V2GA 1ISGA 1B2LA 2YV2A 4BNLA 5HWSA 1P74A 4LVUA 4JXKA 2YZ7A 1FDUA 1NWCA 3D3WB 3ZWOA 3JQ8A 1BWSA 4YA6A 3O4RA 4QTZA 5BSGA 1DIRA 1EZ4A 2J3JA 4MPDA 4MP3A 2OXIA 3ZWAA 4TSKA 2X4GA 1GZ4A 4R4JA 4U8GA 4ZQBA 2IXAA 3PHGA 2J8ZA 2VN8A 4R1TA 1AN9A 1H6DA 4XIYA 4WCFB 1ZK3A 1EVZA 5IN5A 2V6FA 1ZEMA 1B8PA 1BDMA 4NI5A 1KVQA 3HHPA 3KOUA 3LQFA 4GX1A 2IYOA 4TZTA 5K9ZA 1NNUA 3HN7A 2WEKA 1W73A 1GCUA 1Z45A 2BKAA 3MTGA 2Y93A 1ZSYA 4PZCA 4J6FA 5JCXA 2CDCA 1A4IA 3SC4A 3JV7A 4NR0A 4Q3NA 3GH3A 1PZEA 4MVJF 3TN7A 1DLIA 2ZJ1A 2Y0DA 3C3XA 2X7HA 3MJEA 3WBFA 1YRLA 4OAQA 1LLQA 3KZVA 2CZCA 1ENZA 3KTDA 1MA0A 4NFSA 2CDBA 1RM4A 3E18A 4AJIA 4LGVA 2A4KA 5FI3A 3NKLA 1K5HA 2R00A 4E5NA 3NDRA 3IKVA 3TZKA 4IUYA 1MB4A 1V6AA 4CM6A 4MVJI 1E7SA 1O95A 4B7XA 1SAYA 1CETA 3I1JA 5CHEA 3ZW8A 2HK7A 4YQYA 1QV7A 4YJFB 3WYEA 4I1IA 2J5KA 1H6AA 4CLOA 3HFGA 3ROQA 3U4HA 5BSFA 3FCOA 4JJGA 1HYGA 1XWFA 2BLLA 2O4UX 2VUUA 4GGPA 4GWKA 1I32A 4FC6A 4XJSA 4Q3DA 1E6EA 3HDYA 4J7XA 4RQTA 5AVOA 3N58A 1ADGA 4I5EA 4R5HA 3VZSA 3KEQA 4XYGA 4PZEA 2Y0CA 2YV3A 4CM3A 1E0DA 2HK9A 2PH3A 1E3IA 4UEJA 1QSGA 3L4BA 1ZXBA 3OETA 3C1TA 5L7YA 1D8AA 3EUWA 2VOEA 5U4QA 4Y9DA 2YW9A 4QECA 3Q1LA 2AMFA 3OEWA 2ZTMA 3I9KA 2AE2A 2GUGA 4YJGB 1ADCA 1T2AA 4IS3A 4DC0A 4II3A 2H6EA 3IKTA 1AXGA 2XXBA 3DOOA 3ZWMA 4EZBA 2ZTUA 1LDBA 1W0CA 4F6LA 2O48X 2C54A 3C7AA 1CRWG 2JCYA 4J2OA 3VDRA 1LSJA 1RM3A 5A5EA 4TMFA 5CDYA 1QKIA 4YT5A 4YQZA 4WLUA 1HDCA 3A14A 4CQMD 4K6FA 3PHLA 3DBRA 4BHTA 2O3QA 2R2GA 4J7UA 4YJHB 2PKRA 3JQAD 5F5LA 3C7CB 4DIBA 4BKPA 1NBOA 3GVXA 4K28A 3VZRA 4CMBA 2CF5A 3DZFA 4PLHA 3H5RA 5I9LA 3RU7A 4PN3A 5C3MA 4R54A 1GYQA 2P9GA 3AFNA 1M6HA 1TT5A 4JJIA 1DHRA 1GFSA 3ICPA 3T4EA 3TFOA 1I3MA 1Q7CA 1B7GO 2DBRA 4TRJA 4RZIA 4HP8A 5AOVA 3O8QA 4ND3A 4R9RA 3T7CA 2GN8A 3RROA 1M76A 3C1OA 1I36A 1WLYA 3L6EA 3N74A 4XRGA 1F06A 1PS9A 1DSSG 4BNNA 3JQCA 5BSHA 2RAFA 3ULKA 4DVJA 4J4HA 4R68A 5ENVA 4ALLA 1N9GA 3D1LA 2X9NA 3ITDA 3PDUA 5EESA 2BFOA 1XR3A 2AEFA 1CEQA 1C0KA 1QYXA 5JY1A 3LC2O 3RD5A 3ZNOA 4WGGA 5T6BA 3DAGA 3CH6A 1ZJZA 1O94A 4QQRA 4BGEA 4BNYA 3QVSA 2VT2A 3DZJA 2NU8A 1E7YA 4WOJA 1WZIA 2EGGA 3DHYA 2IEBA 1FK8A 2FN7A 5B37A 4WCDA 3S2FA 5TC4A 4J1TA 3ZWVA 4NH4A 3VTFA 4XQCA 3U09A 1JA9A 2D3TA 2QYSA 3U4DA 3K9QO 2X0RA 4Z3DA 1EFLA 4UVGA 3MJCA 3DMTC 4KQXA 2WYVA 4KZPA 3NDJA 1WPQA 3IDSA 4E2WA 3STHA 1EQ2A 1HDYA 2X9GA 2C5EA 1PL7A 1OMOA 1Y8QB 1SMKA 1WWKA 3KVOA 2Y67A 5COBA 4ZQFA 1QP8A 3TWOA 3RSHA 3WMWA 5EN4A 4CQLB 3FR8A 1SEVA 3ZV5A 3V2UA 3RUAA 4W9NA 5LDGA 2F1KA 1KC1A 2RCYA 4NPCA 1E6WA 2HSDA 2ZJ0A 1UP4A 3JQFC 3KHUA 1VE9A 4BNFA 4JK3A 2Y1CA 4DBZA 1CF2O 3PJDA 1Z73A 4P4GA 3AOGA 3NX4A 3RU9A 5ITWA 1VJ0A 4AFNA 4ILKA 1B8UA 3D4PA 4RJTA 5L4SA 1E6UA 2C20A 4P38A 2AXQA 4XDYA 5JS6A 3WYBA 5BQFA 1YJ8A 2P9CA 2RH8A 4CMGA 1BRMA 1PL6A 3AUTA 3NTOA 3HDHA 4TVOA 4KOAA 2GN4A 2HQ1A 3JQGB 4AJ1A 3RJ5A 1VSVA 1F17A 5HRUA 4F3YA 1YE3A 4CR7A 4KUHA 4IY1A 2HMVA 1PR3A 4W7HA 4BKUA 1SO8A 2JAHA 1QV6A 1P1FA 3K5PA 4JP3A 1X0XA 4P8RA 5GZ1A 3QW2A 4PG5A 4UVIA 3WGOA 2ZQYA 2R6JA 4CR6A 2Y0EA 2IRWA 5G0UA 4ESOA 4HNHA 4R3NA 5AXAA 4FJ2A 3AY6A 5EIOA 3ROMA 1DRUA 1VKNA 1CJCA 3KLMX 1LX6A 2VWGA 2YHUA 2VTDA 4DBVO 2QG4A 5EQFA 1XA0A 1K6XA 2WYWA 4FJ1A 1N1GA 3PIDA 4DIOA 2E4AA 5THKA 3VAZA 5A9TA 3KO8A 4A5OA 2G5CA 2HRBA 4M49A 3GF4A 3TRIA 2Q2WA 4BO5A 2PY6A 3W6ZA 3G3EA 3PK0A 4CLRA 4YRBA 3NTQA 3I52A 2RBEA 1UUFA 3NAQA 2I65A 5JDIA 4OSPA 1I2ZA 5B4TA 1HZJA 1N2SA 3LT2A 2JHGA 3LT1A 3GGGA 2X0NA 3RCBA 3QSGA 1YQDA 4RV9A 2A94A 3OJ0A 1EVJA 2D8AA 3TSCA 3KSDO 3RFXA 5JCJA 1EEHA 1KIFA 3D5QA 5IG2A 4PZDA 2VNSA 4RPJA 2W98A 4YXFA 3DR3A 3O03A 4ZRNA 2QHXA 1EVIA 3PYXA 2YYYA 2DPHA 5GMOA 1IZ9A 3I6QA 4GMFA 2DAPA 4IGEA 1C3VA 3WGQA 3ZI0A 1LSSA 5JBIA 2YDXA 1GPJA 5BNTA 1UZMA 3UAGA 3QWBA 3ON5A 3UHAA 1R15A 2GSDA 3HDQA 3ZV6A 4DC1A 1DIHA 4ZICA 4I08A 4YAGA 4IMPA 1HE5A 1V3VA 5MDHA 1WXDA 5DOZA 2ZATA 3G79A 2CUKA 1X13A 5JYDA 4CMEA 3H7AA 2ZIZA 4PLZA 3DAFA 4XQGA 5KJEA 4CLHA 2X0JA 4ZHSA 2O7SA 4XDZA 5TT1A 3F4LA 4I9HA 3U9LA 4CMIB 3D0OA 1LSUA 5C37A 1U4SA 1Y9EA 1PQPA 3O9ZA 1P33A 3GPIA 4BB5A 1R4NA 4G81A 5A9RA 5KKCA 2EP5A 4WECA 1JAYA 3ZNPA 3W4KA 1WW8A 5KVVA 2NM0A 3GVIA 3A28A 3L4BC 2OP0A 1CYDA 2VZ8A 1VL8A 5DCYA 2PLAA 1U3TA 4RVUA 2HRZA 1GQYA 2GD1O 2NU6A 3EZLA 3PGJA 5H82A 2G82A 5JC8A 1R4MB 2QQ5A 2WDZA 3PWZA 2X1HA 2W8ZA 4NG5A 3ZDFA 1KERA 1YOVA 2IE0A 2VWHA 3L4SO 3GZNA 3WWYA 2GNAA 1PGQA 4Q3EA 3I4CA 1VL6A 5T8KA 3H6KA 5AXBA 4OHUA 4J9UE 5TLSA 2A35A 2ZCUA 3GY0A 2PKQO 3B70A 3IL2A 5JAZA 3WGZA 4ZQEA 4QUKA 1BDBA 3DBLA 3E82A 4D45A 4Z0PA 1HDRA 1P1IA 4K9DA 2BH9A 3H8VA 4CLXA 1H2HA 1PTJA 3WYCA 2IZ1A 3HN2A 1HT0A 3BHIA 4YWJA 3G1TA 1YDEA 3AUUA 1Q7BA 5EMHA 1UXHA 2UVDA 4GX0A 3I9MA 4OO3A 3DBHA 3GK3A 5JC1A 2CNBA 3KLPX 4ALJA 2PR2A 3PWSA 3RBXA 5I7SA 5C7IO 5FEUA 4RVHA 5JPIA 4AJJA 1S7CA 4OXKA 1PS8A 4CQMB 5F3RA 3O26A 3OF2A 3WICA 3DBVO 3K8ZA 3QIVA 4DWVA 1GQ2A 2CSUA 3JQAB 2GR9A 3PHHA 4CMHA 3ZWBA 4Q9NA 1OAAA 4UUPA 5I7EA 1JU9A 4BGIA 4C7KA 1H93A 4D44A 1ENOA 3GG9A 1ZIDA 3PQFA 3NJ8A 4LRTB 2UDPA 4WOKA 5JSFA 1P0CA 4E30A 4OQZA 4GX5A 3FSRA 1QLJA 5IFLA 1JQBA 1VJTA 2QX7A 3AI2A 2ET6A 3JD0A 1I0ZA 4OIMA 1DIAA 2PZKA 5T64A 3EAGA 1X7GA 2Q4EA 3FPLA 4GAEA 1WDKA 2IZZA 4H3VA 1DAPA 1KEWA 1IHXA 5T67A 4AJEA 5HS6A 3E8XA 2FZEA 1IZ0A 3QWHA 4W7IA 5CG2A 3QY9A 1H9BA 1AHHA 4ZU3A 4HFMA 4AJKA 5F1KA 5C7OO 1CQJA 4TRNA 1DC5A 1ONNA 2ZCVA 3INGA 1EUDA 5ER9A 4OSOA 3WQSB 2X5KO 1OBFO 3WR5A 2D0IA 4L0QA 3DEYX 3ETGA 1MG5A 3O38A 1ZH8A 3RUDA 2PV7A 4YT4A 1HL3A 3INTA 2FRDA 1WP4A 4N7RA 4EJMA 3NGLA 1P45A 4ALMA 4B79A 1IYZA 4H7PA 3ONEA 3PLNA 3WLFA 4QT0A 3MCVA 2JCVA 4MVJA 1P1JA 2NVBA 3T7EA 2W4QA 1M75A 2FPGA 3ENNA 2POQX 3IAHA 2DFVA 4WEOA 4W9NC 1E3WB 2J6IA 4U7WA 4XYBA 2O50A 4RPLA 3VZPA 5A05A 2FOIA 2Q1WA 3I23A 4BO4A 4NK5A 4Z9YA 1DXYA 5JAIA 1KEPA 3GUYA 2DTDA 2SCUA 3GEGA 3EC7A 4E2ZA 5TSDA 1A72A 2WM3A 3VZQA 4FFMA 4AJLA 5IDQA 3S2IA 3GEDA 3LC7O 1BTOA 4BMVA 1NR7A 3KSUA 3FBGA 4AJ4A 5L4NA 2EEZA 1UXGA 1LNQA 4CL8A 3UCFA 4E32A 1PGPA 4HNGA 1DB3A 4FR5A 3Q6IA 3OJOA 1YONA 5JO0A 4YRAA 1YBVA 1O9BA 4Y6SA 4LMRA 3WBBA 3WQRA 1P1RA 1FDWA 4NBTA 4BKRA 2GO1A 2UV8A 2P2SA 2X0IA 4XGKA 4IXWA 1ISMA 5TJ9A 4QSMA 5G2OA 3LZ6A 4EJ0A 1T2FA 3IOYA 3ZWYA 1ZSVA 2BD0A 5DULA 3NEPX 3W8FA 1FJHA 3CUKA 3MTJA 4KMSA 1NYTA 4CM9A 1B3RA 4GWGA 2I99A 1BXGA 1AGNA 5K0ZA 4L76A 1H9AA 2V6GA 4MP8A 3EGOA 2J3KA 4E4YA 3OM9A 1J49A 3H4VA 3HADA 4QFDA 3FNFA 3S8MA 4IINA 3DMTA 3JQBC 3V2HA 2QRJA 1LU9A 1J0XO 4M8SA 2YHIA 3EZYA 4XR4A 3BA1A 2UAGA 4IQ8A 2JCXA 2CD9A 5H81A 2P68A 5JDIC 3L6OO 3RBVA 1XGKA 5L3ZA 2J5QA 3QVWA 5GY7A 3GDFA 4O63O 4DLBA 4EEXA 1LDYA 4JQCA 3ORFA 1XQ1A 4UUNA 1ZK4A 3JQ7A 1HDZA 3KYCB 8ADHA 4D43A 3JQFA 4BNMA 4CM4B 1X7DA 2Q49A 1UDCA 3KEOA 5DZSA 2EKQA 2EKLA 1NQ5A 3PFWO 3RC2A 2GF2A 4IJVA 3ZHBA 1N7GA 3DDNA 1SC6A 2OZPA 5L45A 2VWPA 1U3WA 1DRVA 5IJZA 2B4QA 1MP0A 2Q2QA 1Y8RA 3N7UA 2P91A 2HMTA 1X15A 2YY7A 1F0YA 4NQZA 4AG3A 1W6UA 1I3KA 4QX6A 2NQTA 1LXCA 2EW2A 1ULSA 3BYZA 2DPGA 3PJEA 1VRWA 3KXDA 1HE3A 3CZMA 3NT5A 3M2TA 2Y1OA 5JW6A 3DFZA 1FXSA 4YRDA 1T25A 3JYPA 5F1PA 1GYPA 4MKZA 1PZFA 3EK2A 3R1IA 3QHAA 2C7GA 1MG0A 1NXQA 1MUUA
chains in the Genus database with same CATH superfamily
2A30A 3C3PA 2C8KA 4HG2A 4G5XA 1KI6B 4E5SA 4R16A 3GIDA 4E2YA 3EPHA 5HBRA 1A5TA 1KOLA 1IQ0A 2HAEA 4ESHA 3C3CA 3ESYA 2QN2A 1SUDA 4TTAA 3ZWCA 4ZI7B 3HCBA 2W9XA 1XU7A 1ZJYA 3MJFA 1NYLA 4HUJA 3NDBB 3KIPA 3U16A 1UIMA 2IP2A 2PD6A 1M2VA 1QTRA 3D3WA 4WA7A 1PNTA 1G8PA 1YA8A 2HMAA 4J91A 3JR3A 2I2FA 1RKXA 3IVAA 4LJ5A 3DB1A 1Y37A 1EWVA 1YKSA 4R1QA 3G2OA 5DWDA 3V8PA 1DOZA 1AUPA 1Q19A 2Q5EA 4WRRA 1NN1A 2Q1SA 3RS9A 2YFHA 4NAHA 1OCEA 5G1OA 3ELDA 3OZDA 4YMSA 2FCRA 4KPYA 2Y1EA 1GGHA 3V1YA 3ZDEA 5JANA 1U63A 3T7IA 5GQSA 3EVAA 1JWBB 4Y1RB 1OU4A 4BVAA 1SR8A 4DCUA 1MNAA 2XWBF 3L7AA 4DCVA 1EDEA 1EH5A 1RWWA 1CFJA 1SELA 2AXPA 2QRHA 1XELA 5IU6A 1L4KA 1T13A 1SULA 2WMNB 2YMLA 2W0MA 3GJ6A 3K05A 3KVNA 2QVLA 2AVNA 3N8DA 3GLIB 2I3BA 2JLSA 3HYTA 5F5NA 3UHFA 3PGXA 4L5BA 1CJBA 2RAPA 3EQ7A 3K9FC 4PLVA 3OG9A 1TIBA 3C7DB 4DIDA 3U60B 1H2WA 4X61A 1WE2A 1FQOA 3T5GA 1XBTA 1ORHA 3DE4X 3G5TA 3L7YA 4F8YA 1PR9A 3AUJB 3ANTA 4KBGA 3EBOA 3O0DA 2JGLA 1MXFA 1GTVA 2AC2A 2EYUA 3P9SA 2IHUA 3ODGA 5MFZA 4P3XA 3KXIA 4DF3A 5BW8A 1UWCA 4V38A 1CUZA 1Y1LA 1M83A 3LWDA 4EAQA 1IZYA 1YJXA 1SCJA 1DIOB 3BXXA 1SQGA 5LPNA 5D51S 1MHPA 3HA2A 4OUDB 3AO0B 4N49A 4NNOA 3KJGA 2PBRA 1XVAA 1XLTC 2GGSA 3B8EA 4YCBA 3DL7A 5IJ0A 2BI4A 2CNDA 2OVFA 3DQQA 4UCWA 5JFGA 1P2BA 4I5DA 2ZAOA 1TE2A 3D8HA 4ZJZA 5AKIA 1DEAA 3DFIA 1UQTA 4NTZA 2AWNA 1TQDA 3F3YA 4NBRA 1M1YB 3D8UA 3GUCA 1R0RE 1UFKA 4FM9A 1ZD5A 2G25A 2E37A 3NXSA 4A03A 1F9AA 1VHDA 3HG7A 2ON6A 2XRFA 3MT9A 1XZQA 2CMHA 2SNIE 3FNGA 521PA 2IYZA 3E7WA 1VB3A 3SEAA 2XZTA 3ES9A 3GT4A 4AWBA 4UEOA 2MSDB 4K9QA 4LOLA 4UKDA 2ORWA 4GKBA 2WMOB 2W6PA 3OO0A 3ADPA 2AE1A 2DU8A 1CZRA 3B7GA 2A0XA 2NG1A 1LDGA 3E7XA 2WB2A 4MI6A 1SNYA 3N6VA 2BE9A 4XR9A 4BJ5A 5I48A 1CNMA 3LF2A 4G9EA 4BCBA 3PQ4A 4G5HA 3PHBE 1PJ3A 1FF9A 2QVCA 2J4DA 1TZKA 1D2GA 3EXHC 4YJGA 3SZOA 4CLOB 4N0MA 4M1KA 4C3UA 2NSLA 1E0SA 1XEWY 5B12A 4OB8A 4JBHA 1NMYA 2DG2A 2PSDA 5C1PA 1P8AA 2D06A 1N3LA 4M1TA 1N5JA 1HTWA 3OAAD 1BCRA 4N9WA 2O5VA 4YRRA 1NFFA 2RHRA 3ZWQA 2FPRA 4DIMA 1JMYA 4OHMA 1WSAA 1X1SA 4BIIA 4K3VA 2JEZA 3SM3A 3V8NA 1ZK0A 3JYQA 2OG1A 1YIAA 2DCMA 3F5QA 4P3NA 1ML3A 1N0VC 4Y6LA 4WACA 1ULHA 2EV9A 1IFXA 1Z39A 3BCUA 2NTJA 3KALA 2HDNB 4ODIA 4G25A 4S24A 3GFQA 1WDLA 3T5TA 3DVRX 3EF1A 4D96A 4IG9A 2PBFA 2GJ9A 1UP6A 1E1DA 3A0UA 4LNHA 1E96A 5CA0F 4EUEA 4Y6PA 2XXJA 5B5SA 5EQJB 1YZHA 1ZD8A 2Q9UA 2BFFA 1JB1A 2DH6A 2FG6C 5NLLA 1RZUA 5JAHA 1M9NA 2GEVA 3NEYA 4DJ5X 5J4HA 4RF3A 2EGHA 3H4IA 4MHSA 3RYIB 4NHEA 3B53X 3LXRA 2N1BA 1OYWA 3CX4A 4EGFA 2F64A 4ND1A 3RC1A 4NS4A 3ADBA 2QMHA 4L8WB 2P65A 4NDZA 2QLMA 4NU5A 2M6SA 4OEHA 3AEZA 3Q0TA 4CM1A 5ARBA 3DFKA 3PNVA 2O9JA 4ZCSA 3ZCSA 3VU9A 1Q1AA 2D00A 4TRRA 1K7XB 2BPOA 4RJLA 1CT9A 1W5AA 4I1YA 2WSMA 4TT8A 3HCAA 1GZDA 1X1EA 1ESDA 1YU9A 1EIZA 2HOQA 2YUTA 2ZSBA 3H9JA 3P0JA 3RGWS 4V1CB 3IAM1 4O4LF 2EP8A 2NO9A 3SF0A 3WNQA 4G2NA 3QLJA 4I14A 2PH7A 3OOHA 3W5DA 4X93A 3LIIA 1LPSA 2ZB3A 4YV0A 1ZD3A 1MOQA 3LVFO 5LMUB 4YTEA 2WTMA 2N1MA 4F46A 4IFTA 3UXMA 1AQUA 3ZGOA 3GOQA 4OKNA 1CUUA 3C16C 3QKTA 3OBIA 3B1YA 4GI2A 5IBPA 1HDGO 2WJJA 2Y1FA 3F6YA 4O1IA 4DR5B 3HKDA 4DUZB 2OBLA 2GEDA 3FKSA 3OPVA 4C4AA 4DREA 4AJHA 4X3OA 1B16A 1BSVA 1ZNQO 3RF7A 2YBEA 1QHIA 4CL0A 2X4IA 4M8IA 4F85A 2VHXA 4PNEA 2ACVA 3B3FA 3F0TA 1GKYA 2VA8A 4G63A 2P9YA 3FY4A 2DETA 4A36A 4PZYA 4EG1A 1C1XA 4PC2A 4PVCA 3IIMA 3M5DA 4YAJA 2QAGC 4CKZA 5JFTA 2AG5A 4F5EA 4DLUA 3L0ZA 1DKPA 1EE9A 4MUEA 2NXWA 1BEUB 4RC9A 2B82A 3BPSA 3TOZA 4RF2A 4W99A 3F74A 3IP5A 3K9BA 4NJEB 4US0R 3FTEA 1E59A 3DWEX 4O4IA 3VKUA 3EE6A 1YVUA 3JZMA 4OHKA 3DVQX 3HKEA 1RHKA 4ZVRA 1JXMA 1TYBE 2WB4A 4X44A 1DQPA 2PUWA 4GGOA 3W6NA 5FAKA 5JO0A 3VAYA 2ATCA 3AJRA 4BLTA 1YB2A 1SVLA 2CYBA 5HMLA 3RFVA 4OSEA 4BNXA 1X7YA 3L77A 4KXVA 4ZAYA 3IESA 2OFOA 5KX5B 4TYWA 4PRYA 3L6DA 1MKYA 4P7GA 2N47A 2CMFA 1U1FA 5AIAA 1TI7A 1OXUA 1UXKA 2ZTLA 3IQHX 3MNFA 3QE9Y 3QBJA 4GLLA 1ZRSA 4G8CA 3JS5A 5BY2A 2VYQA 4DZTA 1A69A 3D2CA 2LBPA 1WMEA 4JLMA 1UZLA 1WDMA 2GWRA 2IZ5A 4B85A 5HJ2A 4Q47A 4URHA 5DBFA 1GV1A 3MBKA 4B31A 4N18A 1QRUA 1EVKA 3G9XA 3AF5A 1O58A 1YQ9A 2VAPA 1SU6A 2PBLA 3MJTA 3QGMA 1IEVA 5CDFA 4UM9D 3MD9A 3A58B 3ENKA 3RFUA 5T4HA 1ONSA 2P5YA 1P7PA 3WRYC 2X42A 1JFVA 3UAZA 2VFAA 3G5LA 3IT3A 3C8ZA 4Q01A 3MW8A 4RTJA 3QJGA 5FADA 1URPA 4IL5A 3W1WA 1R4ZA 1OZFA 2VSFA 3EUAA 3LPMA 3SQDA 5JRJA 3H5LA 2H9IA 2QDKA 3TOXA 4NCKA 4HXEB 3PIIA 1A1SA 1TTPB 4PGFA 1MQ9A 2PWPA 3Q3EA 5AICA 1CHNA 4IDAA 4UFNA 4IEFB 4WHMA 4X1IB 2B1JA 3UMJA 4EZIA 5JNUA 4MGKR 1Z75A 3ZNQA 2Y0PA 3BN3A 4EELA 5K51A 4EYKA 2XUKA 3IX7A 1A8SA 1QHNA 1RBZA 1TMYA 1NE7A 4JUAA 4UBOA 5I9NA 3DP9A 4IZOA 1KVRA 3D81A 1D0SA 3OX1A 1L2TA 1EJ6A 5TS3A 3UXHA 1NN0A 4LXIA 5KYKA 2DY1A 1UXJA 4MLDA 5CEJA 4E3ZA 2OPBA 3L7JA 3RC9A 2H18A 1TECE 1TQHA 5K3DA 3CIFA 2BR3A 3TZLA 5JVDF 3QX7A 5D7BA 2JJ2A 4QULA 5K3AA 2VQSA 4NYIR 1HZZC 3LSYA 1CX9B 1HYEA 1WUJS 4ITRC 3HJTA 5CB4A 1NUQA 2HKIA 1DIGA 3X2FA 1DO0A 3WIEA 4WXPA 3Q7IA 1WHTB 4JN6B 4QRDA 2EZTA 3GRAA 4MDFA 4IJUA 3HJCA 5GOTA 3TBKA 2ZYVX 4TUYB 1NM5A 1Z5ZA 3A6EA 2F17A 4M76B 3CKMA 3L02A 1KI9A 5AW0A 5FL7D 2ZJ2A 3HLKA 2WAMA 3EPJA 4N12A 3IDQA 3OBBA 5BV2P 4PIMA 3N0WA 3C3YA 2GFHA 3NGMA 4LPSA 1U8XX 4IMRA 1J1IA 1EFPA 1HY3A 3AUSA 5ALXA 5C81A 4S2UA 3KQQA 5FLKA 1HFEL 1DLJA 2VPQA 2ZRMA 1GPUA 2C61A 4RV5A 4D1YA 4AC9A 1I6WA 2NNWB 2V9CA 4DKXA 4HVLA 4YCAA 1P1HA 3TLEA 1RPTA 3G6KA 3UAOA 2WSYB 3HUTA 2VO1A 2XOEA 4XQ0A 2HA7A 3UJAA 4JI8B 1VMAA 4WY5A 5E6SB 2XSZD 1WMDA 4LXHA 8AT1A 5EZSA 3AFHA 2F1IA 1WD7A 4Q7QA 3K1AB 2ENUA 2ZYWX 1JPJA 4MW2A 1E5VA 1FMLA 1PJRA 1CVLA 4HTFA 5CXSA 3TLXA 4YAUA 3AVWA 4ZOBA 2D5CA 4IVRA 5LU9A 1P4RA 5AVJA 3UUEA 1NLYA 1RHRA 4Q1EA 5EYPB 4EHFA 1UBMS 1L1QA 1HQKA 5BORA 1GDHA 3Q9LA 4EJSA 1IOWA 2GK4A 2AKAB 3DZ8A 4JLBA 3ZLTA 5JR3A 3OE5A 1C3EA 1Q21A 4M1YA 5JZMA 3KQMA 2FR1A 3IUMA 1I2CA 1W34A 4PWYA 2C2YA 2FFAA 3H4MA 1PE0A 4WJKB 3WYFA 4EL5A 2DPXA 2AN1A 3KJIA 4IHQA 3AVYA 2HF8A 3L6RA 4DNXA 1Z62A 5JRZA 1WCIB 1TIPA 3C8DA 5A0TA 1U6JA 1SVKA 1U6KA 1DBWA 1MX1A 1R4MA 3D3KA 4A23A 5IKPA 1D1SA 1FX0A 1G291 2QMEA 2OHHA 3AKEA 1DCMA 3NS7A 1PDOA 4FFVA 4LVCA 3TJZA 1YZUA 2UVQA 1VA4A 3I3SR 3FBWA 5ERXA 3S5JA 4I0WB 1LLUA 4QXAA 3UK7A 4DV0B 1MOSA 3PXEA 4F4IA 3WFIA 3M1LA 2QNRA 2CKDA 5D01A 4AJOA 3BS4A 5B2EA 2BJWA 3QEJA 1J5XA 1QJCA 5BR7A 1KYIA 2DFDA 4R41A 4RXMA 3V1LA 2VRBA 3ZZUA 3X1MA 4U1RA 3AI7A 4NWIA 2BI8A 3TF5A 2IYTA 2Y27A 3KKNA 4UREA 1YTLA 2SHKA 1AHIA 2YWCA 3DO5A 4B40A 2EFDB 1OHHA 1J2UA 2NSYA 4NNJA 1GPWB 5LZ5A 3T0IA 2QTVB 3LKZA 4BFLA 5BVHA 5FA8A 1HYBA 1MN6A 5CVCA 5ALPA 5EGNA 4YMGA 3E1KA 4UAJA 1KWKA 1YOVB 4ARIA 4MH0R 1YR9A 2CUNA 4HSGA 3P2IA 4UU0A 3DONA 2MSCB 5LYJB 1LNSA 1ZI8A 2AOUA 3TRJA 4JT8A 3UBTA 3R0ZA 2D3WA 3THXB 4EHJA 4XJVA 1XLTA 1RM5A 2O2SA 4TLMB 3T7JA 4KK4A 5B7QA 3EDCA 2ZU0C 3W90A 2XZOA 2AJBA 1PR5A 2MINA 3KKKA 4PINA 3WJAA 2BYTA 2B6NA 2H2HA 3X1XA 5IVDA 2GXQA 1AXEA 1JR4A 1L5KA 5H4GA 3PV0A 3BRWA 2ZAIA 2PH5A 4IIJF 1Y1RA 4Q7EA 4TS4A 1ZK2A 3DZCA 5G0WA 4A0FA 4B46A 5EJ6A 1M2OA 2OKCA 3EXAA 2HF9A 4FQ7A 1K8RA 4NJMA 3G2JA 5CVVA 1JSCA 3BWCA 4L2IB 3MWGA 3DBHB 4R9UC 2XX3A 4RHYA 4G4SO 3W2IA 2FE4A 5GONB 1GG5A 3QVUA 1WMFA 2O05A 5CIQA 4CF6A 1CDDA 2A5DA 1XEWX 3H9CA 3TZQA 3T7DA 1MT3A 3E5MA 3HU1A 4AL4A 2V4ZA 3AU8A 3FI0A 3NWOA 4ZTZB 4D25A 4GVXA 4EF6A 2I7TA 2I1WA 2JRCA 3IERA 3OLVA 1N9ZA 4GPIB 4PLGA 3EXHA 5C1IA 2EZ9A 1S96A 3QOFA 4E5MA 1K2WA 4EABA 1P18A 2VYVA 2W2KA 1IL0A 1KS2A 1SK9A 3GAZA 1ND5A 2GNPA 3MA0A 4ND8B 4BUCA 3G0HA 4CT5A 1Y4ZA 3B78A 3TTSA 4XRRA 3OT4A 4IIBA 1V45E 5EMKA 4UNQA 2IX3A 5JDCA 4CLEA 2R6DA 3AVOA 2I3ZA 3M49A 4E22A 4WLVA 3SNHA 1KH1A 2WHPA 1D5CA 3BSYA 3C3EA 2J67A 2GN6A 4HYEA 3TTVA 4COKA 3IAM6 1T4MA 3HXTA 3PXXA 1BMDA 4NZMA 3FYUB 3ROPA 1ZFNA 4EPWA 1J56A 1Z16A 4TMTA 1GGJA 3N0TA 4XA8A 1U2DC 3RV3A 4EHIA 1NBAA 2GZDA 4OYRA 5E2AA 3VJRA 3F46A 2WIJA 3NHMA 3RRZA 3R0VA 1GG9A 4MWEA 4QVGA 1T5SA 3IUEA 5EHNA 5EGSA 3UAXA 4BQSA 1UANA 2PEZA 3NYIA 2GI4A 2V6JA 3RVMA 1BWPA 4G0OA 2JFYA 1ZKDA 3FPCA 4ZYTA 1UDRA 3GLQA 1XEXB 3H5NA 3JQ9C 3MFYA 4OY3A 3K2IA 5FWXA 2J0UA 4MIOA 4XZ3A 5JSYA 1ZGCA 5JNLA 3EF0A 1AS2A 4FYXA 1CE8A 1ZW6A 5T57A 2K7FA 1LPBB 5DP2A 4EKIA 3UCEA 1UC5B 3TW6A 5I4KA 4ANFA 2PCJA 2P9ZA 3GP5A 1EE2A 1U98A 4HQNA 4F1KA 2GZHA 4X8LA 4EHDA 1OGIA 3A06A 4J3FA 4MWTA 4R2KA 4Y0AA 3R7WB 3LCCA 1OW3B 3REOA 4YY3B 3TECE 3OCVA 1P8JA 3GLFE 2Q6IA 4PLCA 4G1CA 4RPGA 3UQYS 3RVBA 1MOPA 4XTCS 4AF6A 1AT1A 1R6AA 1JG3A 3A3KA 2GXUA 1J42A 1T6BY 1IN8A 3C1UA 4IX9A 1U3UA 5ELLA 1E5LA 4UMDA 4B9EA 4AY6A 5IVHA 3PVCA 3ZHSA 4E31A 3WG9A 3BTUA 1UC4B 3W2HA 1WF6A 1A9YA 3IQZA 1O6GA 2VAXA 3L0PA 5GPBA 1QQAA 2FETA 1YFKA 2E4WA 2Z56A 1W59A 1UOQA 3LV8A 4ZV4A 2YW2A 3Q3JB 4A8JC 4DKJA 2R8RA 4B2YA 3O8OA 3CMCO 3H04A 3IH5A 3CVVA 3JVDA 1CTQA 2YL2A 3I5YA 1AHNA 2GERA 4RVDA 1BH2A 4EA7A 1EM6A 2CHVA 4OA5A 1C41A 4WK6A 4EW2A 3R7BA 5KWIA 3H75A 4L4ZA 1GKUB 2WT4A 1K8QA 3VNRA 3ZCRA 3JALA 1SKMA 1BXKA 1LI7A 2NSJA 2UYOA 4UM9B 4N6NA 4C7OA 2TMDA 1PF7E 4JLUA 3VM6A 4DAEA 4E21A 5HJEA 5AKGA 3QY0A 3VPGA 1WW2A 2PLNA 4FONA 4U2KA 4WI1A 4X24A 2P9TA 2RHCA 3ZTYA 1OROA 4TWIA 3TLJA 3HE3A 5A4KA 1RLIA 5KJFA 3JYLA 5C4IA 1RTKA 1E64A 1NQAO 1QDLB 2CVFA 2I1LA 3EDQA 4FR2A 4RL4A 4EEZA 2ZRIA 3AOEA 4I8IA 7MHTA 4R51A 3QU4A 3ZWXA 3E61A 1ZU4A 4XQEA 1BXGB 5L8VA 1G5HA 4QU0A 2W6CX 4D9BA 4K7JA 4CM4A 3E9NA 2IK8A 3GVHA 3ZS9A 3QG1A 4TXMA 5TNXA 1S2MA 2HK8A 1T4DA 2A9FA 1G4HA 2D7CA 3R3UA 4GSLA 3T1OA 5DGCA 3R75A 1TMKA 1A9QA 1EDDA 1KDTA 2PUFA 1KO5A 3CT6A 1MW9X 3E27A 3GRCA 1U99A 1ZESA 4CHGA 3PQDA 5I9MA 3QVOA 2BFDA 3PFFA 3PC6A 5GTDA 1QZTA 4C20A 2DCUA 1DFHA 4B7CA 4C9BA 4XYLA 4HATA 1OA1A 4R2IA 4LJSA 2Q8NA 4FHEA 4N7MA 1NW4A 2QIOA 3X1YA 5BXQC 1EXVA 4M9CA 3AKCA 2H4HA 3EIWA 3H42B 3ZCVA 2HR1A 1CLEA 1T15A 2ZJOA 1UT5A 2JBHA 3DCYA 3L05A 4OJMX 1S3SA 1CQXA 2O57A 3TEFA 3SZRA 3GV0A 4KWHA 3O3MB 4B71A 4DT1B 4B4KA 3N75A 4TV8B 1F6DA 2QLNA 3PTLA 5F21A 3SEZA 2C5BA 5TQ2B 1QFXA 1KI6A 4AJ2A 3LOUA 4DA8A 2BGKA 3K0KA 5KU7A 1BD4A 1COWD 5EWJB 5EE3A 1Y8RB 1BVYF 3R0IA 4WK4B 1MX9A 4ZAXA 4DLVA 4F60A 1KGDA 5I9IA 3RG8A 4ZI7A 1E2BA 1K86A 3T7KA 2QVGA 3HGMA 4IS2A 1IAQA 4U0KA 4O0LA 4GOND 3GNQA 3K30A 4AAYA 5IN4A 2JI7A 3D59A 1Z17A 1VIYA 5TY0A 3TRKA 5JLJA 2Q1XA 3QPBA 1Z83A 2GAIA 5DBIA 3WLKX 4KIWA 3VYSB 4NFLA 3BMNB 4TZKA 2Z58A 2CUZA 4UBNA 4H6XA 3O5AA 3IQDB 3WA6A 3UF0A 3QXXA 4Z4HA 2MYTA 3CLSD 3U7IA 4EIWA 2GPJA 4YYZA 1TVKA 1DQRA 1GNPA 1ESNA 1HPLA 2BKEA 4Y1RA 3VH3A 5BUQA 3QTTA 2I71A 3RH0A 2GQ0A 3HDJA 1T8YA 2O2JA 5I51A 5IZ4A 4DC9A 3FTNA 4IGKA 1N2OA 4AICA 4R01A 1ZOOA 3N0VA 4EKNB 4IQGA 3GLIA 3U4MA 4H35A 4K9SA 4FLFA 1GN9A 2HD4A 2JAPA 4HAWA 4EVSA 1XEFA 2VK1A 3GFBA 3HBLA 3FJYA 4MJ7A 1AE1A 2V6MA 4N3NA 4S05A 1E9EA 5JCJD 3JQ8B 1TK2A 4J0FA 3M9XA 1FU7A 4COOA 1LPNA 4OKSA 1LDMA 3G13A 2J85A 2JBAB 5LQSA 4Q9KA 4PYIA 1U28C 1X87A 1Z2CA 2JFUA 1PZHA 3AI3A 4I4NA 4CMKA 4I9NA 1GLNA 2FQ1A 4CKCB 5LQNA 4UD6A 4XUDA 3LK6A 1U4NA 1MAVA 4JIMA 5EZ6B 2ZSKA 1HE8B 2VDOB 3VKGA 5CB8A 3KOWA 3ZE0B 3EEYA 2WWVD 3V8EA 4NCAA 3VNBA 1LD3A 3BDIA 3F3KA 4B74A 3SVZA 4RETA 2I87A 3OJEA 1KIMA 1M2JA 2WYIA 4V2UA 1GTZA 3WGYA 5FWAA 3KYBA 3B1KA 3MC1A 1NUTA 4IFIA 4CEIB 2JPDA 1YJAA 2HFJA 3K6RA 3OIVA 1M1YA 4QUEA 3LC1O 2XWSA 4EI2A 5REQB 1WDTA 3AY7A 4H15A 4ENQA 1R0CA 3AVTA 2ZYHA 1GZ6A 1PYGA 4LI3X 4UMVA 1Z12A 3KSZO 5KQGA 2ZK7A 2GOYA 3IBSA 2L18A 2A2ZA 2QLFA 2IPXA 4MIKA 1RAAA 3RB8A 4ARSA 5C18A 2ZXUA 2DLNA 2CWDA 2A0WA 4URZR 4BXOB 1E9AA 1GEEA 2FW7A 3LUCA 4J0EA 2HDOA 3RQIA 1LSOA 4OMCA 1Y1PA 5DLDA 5EXTA 2YASA 3L0YA 3M2PA 3PF9A 4EVQA 3NQ41 4NG4A 1JXQA 3TG8A 2PXXA 1AA9A 2YZKA 1T26A 5ALNA 3PZRA 1H8EA 3G0BA 4FFNA 2XCLA 2OR3A 2AFHE 2DF8A 5FFFA 4B9AA 2FEWB 4X54A 2XZDA 4FE4A 4D9CA 4TV9B 4WMLA 4XCQA 1PX0A 2WFLB 3ZDRA 1E2UA 3OMXA 2EF1A 5LD2B 4QOSA 1L5YA 2W22A 1APBA 2Z9BA 1UJCA 3RTDA 1C1HA 1P9WA 4IFBA 4KG7A 3O84A 3P96A 4BJ3A 5J43A 1SOWA 3VHQA 5JNTA 2PGLA 2PO7A 5L7WA 2H9AA 5K0GA 3RABA 1JIVA 2DUWA 2Z2ZA 3ICVA 2JD2A 4RHXA 3SHQA 4CCYB 4M9SA 4CGZA 2QGFA 4CMCA 3ZZ1A 1KAEA 1ZQ1A 1TK9A 2H2FA 3LKBA 5KI6A 1F2UB 2HCRA 3NVMB 3QKSA 4P4SB 4KJZA 2C8JA 1LRKA 4FW9A 5ICFA 1TO6A 3KYJB 3V8VA 1JEQB 4DLAA 4C0WA 1C30B 3K4PA 1IPHA 3SLRA 2C0PA 4WBNB 2ZWAA 1A8PA 1Q91A 1BWRA 1NP3A 3NH6A 5FUVA 4DWJA 2OXCA 1D4FA 1JWAB 3FTCA 3LECA 2VEOA 3GJXC 1E4EB 1PEYA 1ZH6A 3I3OA 4IEIA 4LGMA 4XB6B 3RYIA 4V0MA 5IS2A 2PGIA 1EK5A 1M2GA 2D8MA 1JDVA 1HSZA 2R5WA 2AG6A 3RREA 2QW8A 3CF0A 3ANNA 1DEXA 2FPPA 3VKFA 4TKMA 1WEKA 3NT2A 2OUIA 2R87A 4X95A 4C4YA 4D3FA 5FXMA 4W8HA 2Y4OA 5FPYA 4BZXA 3Q3CA 4KXWA 3W5CA 1W2GA 1G8KA 2RG1A 4RELA 4MQ5A 1L7EA 1KE1A 5HKBA 2H1WA 2QR3A 2ZJ8A 4UCQA 2RARA 3E9QA 2OHVA 2BC9A 1M73E 2JBWA 4JBYA 5BN4A 1CCWA 4ENWA 5KYYB 2CFOA 4XLZA 4RY8A 1M8PA 3R5KA 4V1CA 1F4VA 1YV9A 2HJGA 1X39A 3PE4A 1QS0A 1A9TA 2J31A 2IYVA 4TN1A 4B44A 2GBPA 3TLBA 5JAQA 2Q6VA 4IGFA 3VC2A 1H05A 4JFRA 1SIOA 2BISA 2D4AA 1GAWA 2R25B 2VPWA 1JT2A 1VM6A 1ZGZA 2WE7A 3HR7A 4KJXA 5EIBD 3KAQA 3Q72A 4HNAB 1WSWA 4LZNA 2NVUB 3SSOA 2P5SA 1E61A 4R6WA 4YC7A 4KTTE 2IUSA 2PMDA 3P19A 4H31A 3TTXA 4C4OA 4CE6A 3CMMA 4CCAA 4Z7OB 2O23A 3E48A 4Q9DA 5ICMA 1CUHA 4HN4B 3UYLA 3H9QA 8LDHA 2QW0X 1MJNA 4WLNA 1D3AA 2P9EA 4H1WA 3AHFA 4HGPA 4QASA 1XLUA 2AMYA 2PNFA 3T4PA 5AK5A 2GPNA 5P21A 3UV6A 4C0QC 3K0SA 1RRMA 1LBTA 5A7GA 1GSOA 3E5NA 4KRFA 1NUHA 1QTNA 1XRPA 2XADA 3OEHD 2W0SA 1L4NA 1P19A 1UFOA 1U2DA 3PICA 5I9TA 2WZBA 1F1BA 2PQMA 3O1HB 4CKBB 4IDGA 3ELWA 2BKVA 2BMDA 1X1TA 4PSCA 2NU8B 4QOIA 1D1TA 3OU2A 1I0LA 3AZPA 5DTRA 1VXRA 1FTNA 4D7AA 4E5DA 4ERNA 3HJFA 1QZ3A 2P0AA 3AZOA 4R1PA 3GA0A 3RASA 1R8JA 4FX5A 2DY0A 2UU9B 3RV4A 1Q12A 4JBGA 1ANKA 1R9JA 2G1KA 2OV4A 1LRLA 2WYUA 4IWNA 5EHGA 5KX5A 2I7VA 4YHHB 2OLEA 3Q2OA 5LQUA 1NPDA 3AIOA 4PIVA 3WQHA 3COYA 4YEDA 3U80A 3TFQA 4BS9A 4R98A 3EIEA 3WLHA 3NHWA 1N3BA 3EG9A 1NF2A 2XAAA 4UPVA 1A7KA 1TIKA 2IELA 4P32A 1GQQA 2I4MA 3FZEA 3TNLA 4A7PA 5JSHA 1FDTA 5T4FA 1S5PA 4AYTA 4NBVA 3P5SA 3FGOA 3AR8A 3L4JA 3PNSA 2WFAA 2BN4A 2Z30A 1PJSA 3PI6A 4LVNA 3T9FA 1X1RA 4Y0VA 3PQCA 5AW6A 4I81A 3UFBA 1QMPA 2IDJA 4IQ0A 5HRAA 1NLZA 1D6NA 3B1XA 5H9WA 4LBWA 4ZOCA 5HNKA 3W3ZB 4Z9FA 3RTCA 4KR2A 4Y2TA 2CW5A 2I5PO 3NUGA 4DCJA 4KRXA 3ZJYA 3ZX4A 4A8JA 1KEKA 1Z4OA 5CTAA 3GRFA 2R8OA 5LCXA 3G2QA 2ORVA 3TSZA 1UT8A 4WNCA 2O1SA 3DOCA 2R96A 1B76A 4LJ8A 1CZUA 1HG0A 2ZT5A 2LXNA 1NGSA 1YR3A 4IIEA 2NXEA 2RJNA 4IG4A 1KRXA 4DCOA 2GK6A 4X1IA 5BYJA 1JQLB 3PX3A 5D3MB 4DB2A 3P5BA 3I4LA 3N1UA 4YRJA 5HKAA 1IQRA 1U2SA 4I9FA 2XUAA 5TEWA 3TDNA 4DMKA 1Y6QA 2B7BA 2CLMB 3RYCB 4RO0A 5T5QA 2W2VA 3AMVA 5KQRA 3NT4A 3QVGB 1MJ5A 4MPRA 3PGLA 4MULA 1W1UA 3RTAA 2BMFA 1X42A 2Y3IA 4X7BA 4C04A 3A70A 3EQ9A 1GFZA 3GT3A 3KLBA 4ZEWA 821PA 5EJ9A 4RADA 3N2EA 5DHFA 3PUKA 3KJQA 4FGWA 3WGKA 1XZBA 3I8OA 3OX2A 5GGXA 4B43A 1WHTA 3AERB 1O08A 1SC9A 4MQ6A 5JMOA 4X1YA 4I3GA 3W5JA 2G9UA 2QX8A 4TUYA 2HW8A 3DEKA 3U6KA 4JOSA 1L4MA 2WIKA 5AM4A 3OVMA 4LCJA 3CLHA 4NCNA 5EA2A 2OFFA 5K03A 1XZKA 3ZVMA 1N2GA 3PC7A 5F7OA 1GZ5A 2V9PA 1TAHA 4CDNA 2GPSA 1N3IA 5IJ0B 3L7MA 3I01M 4ZIRB 2H1OA 3A37A 2R8ZA 2VHWA 1AZTA 2CXQA 3W78A 3RI3A 1WB9A 1NG9A 1IRXA 4CEJB 4MITA 3S70A 3SZ3A 4GR5A 5K7SA 1GTRA 3UZUA 3H83A 3W9BA 5JJLA 2PMWB 3VR0A 1WO8A 2HPAA 3N53A 1MFZA 3RFTA 4P1ZA 1R5JA 3ZCQA 3HM9A 4F5ZA 8OHMA 1XF1A 2BDTA 3M6WA 3IDFA 3BIJA 1O0BA 1QPGA 2OE2A 4NZ9A 1MEOA 4EGQA 1S2DA 2BFWA 3A3NA 4MMZB 3FUVA 1Y1QA 5C53B 3ANMA 2I6FA 3K1AA 3USCS 3V7FA 1VG8A 2XKJE 2V54A 3BZBA 2IIPA 3O1JC 4CMIA 3ELUA 1PEDA 4I66A 1Q0HA 1X94A 3L84A 1TKBA 2NUBA 1GA4A 5DWVA 1P80A 4G4SP 5EYPA 2X5XA 2C1XA 1JIJA 5AYVA 1KK0A 5CDGA 1QP0A 2Q3FA 1OXSC 1EJ0A 4ZANA 4Y6RA 3A6ZA 3WP1B 3LRTA 1L7MA 2R00C 3IMCA 4QO7A 1MV8A 1F4LA 5L95A 1L3CA 1U8EA 3WK6A 1Z6XA 4GLOA 1UKVY 4DDVA 3ZU3A 3ZD7A 3GDGA 3HQ4O 2VG8A 3UK6A 2AMLA 2ZIEA 4QU8A 5K3SA 2IEDA 4D3SA 2X9VA 1AQNA 1WCIA 3DE2X 2Q6KA 1PJAA 2R3SA 1Q0SA 2MIIA 3VNAA 4D4MA 4BB6A 4I99A 4EB8A 2R6AA 4BLPA 1HKHA 3RIEA 1GNQA 4BN0A 3NIBA 3IS3A 3KHSA 2JAOA 2UYQA 3LLSA 5EXXA 4ZREA 1G3IA 3NG1A 4GH5A 4EO4A 2ILTA 4HWTA 5HE8A 3QLUC 4OLAA 2EW1A 4IRXA 3GOHA 5J63A 3IEMA 3PEEA 2C9YA 1P0IA 2RGXA 4YMVA 3HR8A 2P40A 4GPEA 3F5MA 1DDOA 3SP1A 1VMIA 2RBKA 3V4VB 6ADHA 3A9CA 2XH8A 5K4AA 1UF9A 2QY9A 1EFHA 4P0QB 2OGTA 5B36A 3QEBZ 3G17A 2G0TA 2H07A 1Q3TA 1PT6A 1LDEA 2PL5A 2DR3A 4GR9A 4Q05A 4C4PA 4LYYA 1JYEA 3OAAA 3HMQA 1EVLA 4P36A 1MB3A 4PO8A 4PONA 3M3DA 2DLCX 2BMVA 3ECAA 5LYJA 4B3FX 2G9ZA 4V0QA 3WWZA 4CT4B 1M1NB 1XVLA 3QA9A 3U62A 2BMJA 3THXA 4PZPA 3I2GA 1ZL2A 3H1BA 2E87A 4FNMA 3DZIA 3KHTA 2R751 4CQJA 721PA 1O5TA 2PSEA 3O4IA 1A9XB 1U81A 4J3JA 5JIBA 1JXAA 3E8SA 4QUJA 1VBMA 1IEXA 2I8AA 5CDSA 3D64A 4MGYR 4OGWA 3WC4A 1YUNA 2C31A 3F5SA 2PFSA 1E1QD 3MMSA 2O8BB 2B69A 3LXUX 5F9FA 3EGDB 4QEDA 1Z4JA 4KUEA 3O3OB 4RD2A 1JILA 4L2IA 1LTKA 3CVUA 3DKKA 3SVLA 5KYVA 4ETWA 2H31A 4Q3BA 4L9SA 4ARAA 3CH4B 1JQ5A 3FNEA 4K6GA 1DV1A 1RXYA 5SY4A 3Q8KA 4H1UA 1RZRD 2B9EA 4LJLA 4OK6A 4CG0A 3EOZA 3OX4A 5CFMA 1XJ5A 4JA0A 4ZU6X 2WFMA 1BROA 4LSMA 5IUKC 1R8YA 2OHXA 2APJA 4N5DA 3DL2A 3SX2A 2YZNA 4GPZA 2DTXA 2QTFA 3RTEA 3F9IA 1HLDA 2ZUUA 1IVYA 5DJ5A 3TZCA 1YACA 1C4OA 4QPJC 5DPMA 3H6HA 5TR9A 4JP1A 1U90A 4P3OA 2EW8A 2WWYA 1P1KA 2C8LA 2RGBA 2ZIVB 1T1EA 1ZA2A 3ECCA 4D9MA 5FI0B 2GZ3A 1JLLB 4Q18A 3NHKA 2X9LA 4HWRA 3CF6R 5FOQA 3ZE9A 3FYUA 1VHQA 1PLKA 3WGGA 4BB0A 5F78A 3GMTA 1A9OA 3PS9A 5JNRA 1G7CA 3ESZA 4EGSA 4DMLA 3QF4A 3WJ2A 3VNUA 2MMCA 2O5CA 4CUKA 1QYIA 3A6LA 4I9UA 4M9RA 2VHCA 1RI3A 5HW0A 2Q5HA 2W2MA 4E11A 4BO8A 4ISCA 3BUSA 1XEXA 1F5NA 3WRXA 1CQJB 2KJQA 4M0MA 1ZPDA 1E3WA 2PD3A 3LCJA 1ONPA 1V9CA 5DTEA 5EIFA 3AEUB 5H3HA 5KCMA 3G1UA 1TMOA 1JU4A 1XCOA 5KVSA 1DCFA 4NU6A 1PLLA 1EDBA 1WNFA 2P3OA 1TVMA 2GLUA 4GPTA 1F0NA 1IY2A 2H11A 2OKGA 3IELA 4U4AA 1I5OA 1QG2A 3DOEA 4RMJA 5KC8A 1Y4SA 1BMFD 1E2KA 4YVFA 4CUJA 4DB4A 4Y1EA 1YQGA 2R4UA 1K5DA 1Z25A 3QYPA 4PRLA 2YOFA 3PFGA 2HXGA 4WW0A 1XMIA 4HJRA 2DHCA 5GIOE 4GZLA 3MS7A 2PCLA 1SD5A 3P20A 4OQPA 3DLPX 1JFFA 1HTBA 1OX5A 1R0KA 3K4HA 2PRIA 4PLFA 4DZRA 2WFZA 2JIZD 3RVNA 4RTLA 5EP1A 4FBGA 2VRCD 5FV7A 2FF5A 1K9SA 1GZ7A 4L73A 4IRMA 4LE0A 2R6HA 4MVJM 1NDQA 5H70A 4ETIA 3WB2A 1FFEA 2VHVA 3HP1A 3LQ1A 1RJGA 4P22A 1LCIA 2E89A 4Q1CA 2JARA 3NZEA 3REQA 5C8ZA 5JJBA 3N5CA 1NQXA 4J90A 4BO9A 2ZTVA 1LC0A 5C5IA 1UINA 3EIUA 1VE5A 2Z3WA 1B00A 2FZ4A 2BMWA 1NW8A 5TS2A 3JVIA 4JSYA 2X41A 3IOBA 2AW5A 1KGSA 3ASZA 3OEED 4J4TA 4YDRA 3TM4A 3ANLA 1RRCA 3PDWA 4QLOA 4HRXA 1SVWA 3BK1A 3FPBA 1TT7A 1HURA 2ZWPA 1E89A 3TH5A 2FPLA 3AP2A 1SHJA 4NIMA 2AFHB 1PG0A 1QKJA 5T41A 3RJ9A 2J4CA 5KHAA 1NKVA 2P4HX 1PFGA 1WKCA 3W4JA 4O3MA 2JA2A 4WN9B 3SIPA 1ODKA 2Q1TA 2CJYA 1V3TA 3BMOB 4TLCA 4F5DA 1N57A 2QJOA 2C2XA 4YT2A 1H69A 1QHFA 4B32A 3UJDA 5AWFC 3WMEA 2P6PA 3ZLJA 1G98A 3L1UA 2C4HA 3U3MA 5IULC 4CM7A 3OPYB 2G67A 4AO7A 4UUBA 5BW5A 1SB9A 1QYWA 1FRNA 3BXGA 1T5HX 3BGOS 2ZBRA 1SUIA 1T9AA 4HS4A 4OM8A 4QYWA 4Y30A 5T3UA 2FZ5A 2LWIA 3CSSA 4K9PA 4BNWA 2GJ8A 3E58A 4IO1A 4MA4A 1A4UA 3F7OA 4RK6A 1C14A 3IRUA 4PC6A 5E6UB 2A1TS 3CBGA 5LUAA 2PU5A 2BFEA 4N8EA 4B3DA 1JNXX 5I47A 1OTXA 3CLSC 4LBZA 3ZWPA 5IK2D 1YR1A 1GAXA 4UBLA 4EJ6A 5I8PA 1RYHA 1YRYE 2I6XA 3MGKA 4HAOA 4UEKA 1RAGA 1S2GA 1GPNA 2XVMA 4I4TB 4EMUA 3DZBA 2I4IA 3HWX1 4RKQA 4WLOA 4FW8A 4XXHA 1CS0A 1XTTA 2ETXA 5HPYB 1Y89A 2VPTA 3F2IA 2ZJZA 2GNOA 1G1AA 3E9YA 1SVUA 3PEWA 4YAWA 4TKUB 1Z07A 3ECSA 2ZRHA 3NFRA 3DEZA 2VXCA 3GJYA 3IO5A 1PNVA 3KTAA 3M82A 3PPXA 1SHLA 4GIBA 2ZYUX 3SFTA 1R88A 1VECA 5EWMB 5FL7A 1E2GA 4FDLA 2PKCA 3JQ7B 4GZ6A 5ULLA 5BWOA 1BA3A 2JCBA 2QP4A 4IEEA 4O4LA 5IJ9A 2IIBA 5CM2Z 2ZSDA 5H0IA 3SY8A 2QRNA 5TQ2A 4AN1A 3H18A 4Q4HB 2XVXA 3JTEA