1OAAA

Mouse sepiapterin reductase complexed with nadp and oxaloacetate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
259
structure length
259
Chain Sequence
b'ADGLGCAVCVLTGASRGFGRALAPQLARLLSPGSVMLVSARSESMLRQLKEELGAQQPDLKVVLAAADLGTEAGVQRLLSAVRELPRPEGLQRLLLINNAATLGDVSKGFLNVNDLAEVNNYWALNLTSMLCLTSGTLNAFQDSPGLSKTVVNISSLCALQPYKGWGLYCAGKAARDMLYQVLAAEEPSVRVLSYAPGPLDNDMQQLARETSKDPELRSKLQKLKSDGALVDCGTSAQKLLGLLQKDTFQSGAHVDFYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEPIAPTERIN REDUCTASE
publication title The 1.25 A crystal structure of sepiapterin reductase reveals its binding mode to pterins and brain neurotransmitters.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 96
structure length 259
sequence length 259
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 1997-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1oaaA00
1ENPA 4HFMA 4DC0A 4DQVA 1DEHA 3JYPA 3LC7O 4I9NA 3OJLA 5A04A 2X9NA 2Y1GA 4XR4A 1YB5A 4IDCA 4IQ0A 5T67A 4QXMA 5DOZA 2PNFA 2GRAA 3D4PA 1VL8A 4IDBA 1X7GA 5AYVA 5JDCA 1Y7TA 4KDEA 1FMCA 1PJTA 1SBYA 2TMGA 1C1DB 4BO1A 4TZTA 2CSUA 3EMKA 1E0DA 4FJ1A 1NVMB 2PZLA 3UN1A 3SVTA 5CDSA 2JAPA 3HN2A 3E82A 3HB5X 1LDGA 4NJMB 2BHLA 3RUFA 3QSGA 2W90A 3CE6A 1LLQA 4JNKA 4ALIA 1UP7A 2Y67A 2RIRA 4H3VA 2QHXA 4J2OA 4QFDA 1HDXA 4FIZA 1CIVA 4U6QA 1ONOA 5LCXA 5BSFA 3U5TA 1O95A 4MVJH 2SCUA 3U09A 2HDHA 3UAGA 4DXHA 5L53A 2J3JA 5HS4A 3NTRA 1GZ3A 3HUDA 4WUVA 4A10A 3IKTA 3RUHA 4DIOA 1WPQA 4XIYA 3PXXA 4D79A 1GV0A 3VKUA 4DTIA 5B37A 3JYLA 5G2OA 3Q6IA 5F5LA 3TF5A 1FF9A 1UXHA 3DR3A 1DIRA 1U3TA 3PHIA 4K9DA 5HBRA 3ZWAA 3PZBA 5HS6A 1CQJA 3CZMA 3RUAA 2JHFA 1QKIA 4RF2A 1M67A 3QLJA 4PG4A 3FSRA 4BNXA 1C0KA 4D44A 3DTYA 2C7VA 5C3MA 1VRWA 4GI2A 3SLKA 1ENZA 5CEEA 1DC6A 2VHYA 3U4CA 4FR5A 2GASA 1W4ZA 1XWFA 1KYQA 4Q3DA 1YBVA 2YHIA 3PJFA 3HFSA 2WM3A 2VZ8A 2OBYA 4OSPA 2BF7A 5A03A 1E7RA 5JYEA 4I5DA 1E1KA 5HA5A 4DIFA 2FSSA 2Y1DA 1Z73A 5L7YA 1UXJA 3KYCA 3VH1A 1LRLA 4WASA 4PIVA 2AEFA 3NT2A 4WLEA 4RPGA 1PZHA 4AJ4A 5BNIA 4CM4A 2Q45A 3PWKA 2NWQA 4MIOA 4ZQBA 1YOVB 4AJPA 4CMBA 2CDCA 5L4SA 2PR2A 2VWPA 3D4OA 3EY4A 4FN4A 4Q3CA 1YKFA 2ZCVA 1L1FA 2I65A 3VC7A 2E4AA 4ND5A 1B8UA 1ARZA 4FJ2A 2CUKA 4YWJA 5B12A 2WDZA 4M55A 4NH4A 1GYQA 4OJNA 4PN3A 4QTZA 4BO9A 2I3GA 4RV9A 4PLGA 2OMEA 2W2LD 3DMTC 1LLDA 1M75A 4CMEA 3V5NA 4I9HA 1O8CA 4RVSA 1K6XA 5JC8A 2Y05A 4BO6A 4YJHB 1VJTA 4MJLA 4DWVA 1E3IA 2WMDA 1JLLA 4E5YA 4BO4A 1UXGA 1UZNA 4IGFA 1CJCA 1UJMA 5LDHA 1ZK1A 5TX7A 1HDOA 4II3A 3ZV3A 3GNTA 3AM4A 1PGOA 1HE3A 2DUUA 3ENKA 3R6DA 1P0CA 3PJDA 4FJ0A 4HY3A 4YB8A 2NVUB 1WVGA 3JQBA 1C0PA 4IMPA 1HKUA 2ZTUA 3H9QA 4ND4A 1F0YA 4D41A 4J43A 4IIUA 5IDYA 5ADHA 2ZATA 1DXYA 1Y8QB 4BO0A 1JAYA 1T1RA 1YL7A 5IAAA 4J49A 4J6FA 3AU9A 2AG8A 4BO7A 3W1VA 3H4VA 4BO2A 2O48X 4CLDA 2RH4A 2FRDA 1YQDA 2VUSA 2YQ5A 1NVTA 4ALNA 2GGSA 4ZQFA 3BIOA 1Y9EA 5TJ9A 4EGFA 4FOOA 3F3SA 5DT9A 3WMWA 4QECA 4MP8A 5A06A 4ND3A 5JDIA 4CMIB 3KEQA 4NU6A 4LN1A 1QXSA 4BNFA 4UUOA 4YJFA 2DBQA 5T57A 1QYXA 2BFAA 2DBVO 4HWKA 4R3WA 5HWSA 2RCYA 3PQFA 4HFJA 2HKIA 4HNHA 2X5JO 4NBWA 3U62A 3OP4A 4ALMA 3GY0A 1I10A 3INGA 2JCXA 4R68A 3IJPA 4B4UA 2YJZA 2NQ8A 3HDHA 4O59O 1KC1A 1PGJA 3DBHA 1YXMA 2PY6A 1GPDG 3R3JA 1SZJG 2XXJA 3AWDA 1B0AA 1WMBA 2FPGA 1PL7A 4QEDA 1OC4A 4XDZA 3U49A 5ES3A 1HLDA 5CDYA 5JCJD 4FFLA 2Q4BA 3GAZA 3HE3A 2VZ9A 4WCFA 3TZQA 1DPGA 1EVYA 1DRWA 4WPGA 3NJ4A 3OHSX 1E6EA 3WGTA 4N5MA 2C59A 4D3SA 1VKNA 1H6AA 4YEDA 1R4MA 5JO0A 1UZMA 4O1MA 4II2A 4GBJA 1EUZA 1PU2A 1SC6A 5COBA 4B4OA 1AXEA 1XLTA 5IDXA 3NUGA 1W8DA 2X5OA 1SO8A 1Q7GA 5C5IA 2ZB3A 3GUYA 2I9PA 1L7DA 4RVFA 3QWHA 3GPDG 1C1DA 1PJSA 5IG2A 2NVWA 1BDBA 4HXYA 4JP2A 5G0UA 1VM6A 1ZIDA 4PRKA 4BHTA 3L77A 4EEZA 4YRBA 5B4VA 4ZRMA 1EE2A 3A14A 3SLGA 5KIAA 1UAGA 2D8AA 1SEVA 2VTDA 4GVLA 3GGGA 4HUJA 4BNLA 1JKJA 3S2FA 1ISMA 1IUKA 4NK4A 3GG2A 3NRCA 4M49A 5K6AA 3DMYA 5I7VA 1EBUA 1SCUA 4ZQGA 5A3JA 3UCEA 1O94A 2ZKLA 3C3XA 2FHSA 2X9VA 3M1LA 5JFOA 2E49A 4CMHA 4J0EA 4YAEA 4A5OA 2J3KA 3ORFA 1YB4A 2HK8A 4IUYA 3EYWA 4NIMA 3M1AA 3ZDFA 1E3WB 1DC3A 4D45A 3P7MA 1U3VA 4CQMB 3S2IA 4GMFA 3MZ0A 1TEHA 1GUFA 4L4SA 2QRKA 3DOJA 4DLLA 5IFLA 3LLSA 1GUYA 2OORA 2Y66A 3ZV5A 2NV6A 4TQGA 5ENVA 5CDUA 3ZCXA 1P1RA 3PYMA 4J9UE 1PEDA 3GPIA 3AUSA 4ZHSA 4PZEA 3E8XA 2EGGA 2VUUA 1GZ4A 2WD7A 4JJGA 4WKGA 4YT8A 3LU1A 1G0NA 1GD1O 4Q3AA 4HFRA 3QWAA 1S7CA 3BA1A 2B83A 5DCWA 2I99A 4YJGB 1IZ9A 5F1PA 1VPDA 3DZHA 4PVDA 4N5NA 4YCAA 4W7HA 2EKQA 2NTNA 3GEMA 4Y8VA 3WQRA 3BMNB 2WE8A 4UUNA 4E32A 1CDOA 3V1YA 4J7UA 4IZHA 1PWXA 3INRA 2VHVA 3LF2A 5B4TA 3HJAA 3SJ7A 5JYDA 4ZGWA 1LDYA 1RPNA 4MVJG 4YA6A 3RU7A 3X2EA 3PK0A 4E2YA 1KVSA 2XPCA 1KBZA 3DZBA 4RPJA 3GFBA 2EF1A 5IZCA 2FPPA 2X9GA 1D1SA 4P4NA 1YOVA 4YTEA 4NHEA 3E9NA 3TN7A 1YGYA 1YWGO 3K6JA 1Z7BA 4MVJE 2JFHA 1J5PA 3DAFA 2EGHA 3GMSA 2RH8A 4XQGA 3BYZA 3H9GA 3QVXA 3WMXA 3CUKA 3H3FA 3FPCA 1DIGA 1HEUA 3I1JA 4F3YA 4HFNA 1UP6A 3PFWO 5C7OO 2IODA 3AFMA 3KVOA 3NX4A 4FD3A 5I7FA 2PD6A 3D3EA 2BFMA 3OEYA 4YJHA 1B8VA 4BMVA 5F1OA 2XOXA 1TT5A 3BMQB 4RORA 5EJ2A 3WOHA 3UXYA 3UVEA 3H2SA 2GZ2A 3NDRA 1IL0A 1NPTO 1R15A 3GRPA 4XGNA 5HRUA 3GHHA 3DBRB 2VYVD 1AXGA 2Q1WA 1WLYA 1LDMA 1E7WA 4O63O 1CQIA 1HSOA 3W8FA 2I67A 3P19A 2UUPA 3UOGA 3VVBA 2NVUA 2QYTA 2PH3A 1R4NB 4GVXA 1R6DA 4UEJA 2ZK7A 4PZCA 4E2XA 3OMLA 4QSMA 3Q9UA 3M2PA 1HDZA 3IC5A 3FF4A 1WWKA 1DRVA 3DZFA 1H5QA 1NBOA 1Y8QA 3KOUA 5EL0A 2J5RA 2WSBA 1ZSYA 2OZPA 3ZHXA 4FDAA 2GO1A 5I8WA 1VKOA 2GYYA 2I66A 1MA0A 4FFRA 1DHTA 2C5EA 3RCBA 5L95A 1DJNA 4NFHA 6ADHA 2ZTLA 1OAAA 2PH5A 2Y1CA 1PQWA 3RBVA 1KS9A 3B1JA 2J5QA 4FPXA 4G81A 3B6ZA 4C4OA 3IKVA 5AVOA 1JTVA 3NDIA 3N58A 2CZCA 4CV2A 2BRUA 4RF4A 1HF3A 2YHUA 3SC6A 2CF5A 1Z45A 3HQ4O 3ZU5A 4A27A 2OFPA 5IJZA 4LISA 3ROPA 4Y98A 1U4OA 1VJ0A 1EUDA 3I23A 3MCVA 2H9IA 3ROKA 2J3IA 5G0WA 5CEFA 1AE1A 1TVEA 1QORA 4J1SA 3PGXA 3WFJA 1WZEA 3RSHA 4OIMA 2WYUA 3AUTA 3RFTA 2X0NA 1HE5A 5AXDA 3W4JA 1A5ZA 3KTDA 1XHLA 2VT3A 3NV9A 3VH2A 3K9QO 4Y6SA 1E3LA 4BQPA 4QT0A 2J3HA 3JQ9C 4BMSA 1RM4A 2D2IA 3FBTA 4R01A 2H1SA 4J4BA 1MC4A 1T2EA 5K9ZA 1T2DA 3QE3A 4XQEA 3INTA 5U9CA 2ZTVA 1MXFA 3GN1A 1BRMA 3K5PA 4KWHA 5CP8A 4K1LA 1KEVA 5TT1A 4BQRA 3O03A 1XA0A 1XU9A 3WWZA 2O3SA 1LC3A 1DC5A 1K0UA 2A94A 1HRDA 1LSUA 2I3AA 4WNIA 4A26A 1GAEO 3CMMA 4CM7A 3JQ8B 3ROQA 3GVCA 4PRLA 4XYGA 3VPSA 3KETA 2B5WA 1KETA 4W9NC 2D5AA 1NAHA 4NFYA 5G0SA 3WG9A 1ZSVA 3VZRA 3BMCA 3ON5A 2FR1A 2VUTA 4DYDA 4FGSA 4RPHA 2JKVA 3EHEA 5BSEA 2VNSA 3I9JA 2DTEA 3WGZA 3ZU2A 1LLCA 3AOGA 4GKBA 4HKTA 4E0BA 2LDBA 4DQXA 3EC7A 3F5QA 3A4VA 4DPLA 3Q2IA 2B36A 3JCZA 3LC2O 1NWCA 1W0CA 5TIIA 3FTPA 2Y0DA 3I52A 4AJKA 1SMKA 5TGDA 8LDHA 3JQGA 1PS0A 2AQHA 2FN7A 1T26A 1PJCA 4CQMA 3NT4A 2YY7A 2G5CA 3JQFA 4KMSA 4L73A 3L6DA 4TKLA 5GY7A 4E33A 1X7DA 2Y1EA 2VWGA 2EWMA 2HK7A 3AOEC 4N5LA 4R54A 4CLHA 3F6YA 1YJQA 2BI8A 3CXRA 2JCVA 5ICSA 1BG6A 1I3MA 4GL4A 2J5KA 2P4HX 3S55A 3D0OA 2QW8A 3L6OO 3D5TA 4EI2A 3E5MA 3U4IA 1TXGA 2JL1A 4BNUA 4JLWA 5A3VA 2O3RA 2VOEA 3IUPA 5JMPA 1ZCJA 1NQAO 1ZMOA 3F46A 4GLOA 3JV7A 4P8RA 4AJHA 4OQZA 4LCJA 3WR5A 3V8BA 1RM5A 3BMNA 3QWFA 3OECA 3ZWWA 1MB4A 2Q1TA 2B4TO 1YQGA 1ZKMA 3NAQA 3OF2A 2HMWA 1H6DA 4UVEA 1ZMTA 5ER6A 3T7CA 3T4XA 4ALJA 3BXXA 3ZHYA 4BOYA 3GZNA 1K89A 4FS3A 4GQAA 3ZNNA 1HDCA 1HZZA 1A7AA 3TDKA 4EJMA 4F6CA 4YQZA 2B37A 3DBLB 3ZNPA 4CM3A 4AJNA 1LSOA 5BNTA 1EFLA 1U28A 3FCOA 4EDFA 4RF5A 4BNZA 5A9SA 1BVUA 1M76A 1YQXA 1H2BA 2QIOA 2XXBA 2PD4A 4FFOA 4L0QA 3O26A 3WTCA 4B7UA 4EUHA 3L07A 5GMOA 3MOIA 5U1PA 1P45A 4PG8A 3Q2KA 4YRDA 1BXGB 1Y8RB 3SBOA 4QQRA 3I9OA 4BO3A 5I9LA 4GX5A 5DBFA 5KVVA 4XJSA 3VOSA 1HSZA 2OP0A 2HLPA 1X7HA 5TNXA 1XG5A 1M66A 1ORRA 2B0JA 2NACA 3QP9A 2VCYA 4DUPA 5EN4A 3DBRA 5FI5A 3RIHA 3IP1A 4P4LA 2OO5A 4BS9A 4R51A 1UP4A 5L4LA 1R12A 2JHGA 1B26A 2VWHA 2AA3A 3RROA 3IUSA 2D3TA 3NDJA 1I0ZA 3BTUA 3PP8A 4ZJUA 1R0KA 3QA9A 1N8KA 3ABIA 7MDHA 3BHIA 4CR6A 1O0SA 4DMLA 3IDSA 2G82A 3RC2A 4A73A 3K73O 3GHYA 5LDGA 4Z9FA 3NJ8A 4B4VA 4DLAA 3KV3O 5EMHA 1T2CA 4PLVA 3BHJA 1Z6ZA 4BNWA 2B4QA 4D46A 5IZ4A 2BI7A 3R1IA 1H0KA 4IS2A 1XU7A 1H93A 2DT5A 3NEPX 2PGJA 2CDBA 4WNCA 1E7SA 4BNTA 4RLSA 3ZWPA 2P5UA 5DULA 5DZSA 3UCFA 1ISHA 3RUCA 1NR7A 4GSLA 3QV1A 4FGWA 1JN0A 3K92A 3OJEA 1XR3A 3PVZA 1MFPA 4CLOB 5JMWA 3TNLA 4DA9A 3TJRA 1DIBA 4A0SA 1MX3A 3GVXA 4IS3A 5A5EA 3HB4X 3DONA 1N92A 5KJCA 5EESA 4GWGA 1WNTA 2ZYAA 1D8AA 3HHPA 3FPLA 1VSUA 2EKLA 3AM5A 1HE4A 2C54A 2UUOA 4G5HA 1ZXLA 1HDYA 1DRUA 2DTDA 3GK3A 4UVGA 2HJRA 3KYDB 3BTSA 3V2HA 1NVGA 4NBVA 2DUWA 2OUIA 2GERA 1C0IA 4ZRNA 3DXFA 4U6SA 3TFQA 2GN4A 3LT4A 2PKQP 3W4KA 4RLHA 1HETA 4E3ZA 5L7TA 1ZVMA 4JBGA 3LZ6A 2QRJA 4KDFA 4YT5A 4NJOA 4MPDA 3C7AA 3I9MA 3OIGA 3TZCA 1UZLA 2AMFA 3I9LA 4HP8A 2HRBA 4TROA 1H9AA 1Y5RA 4XEHA 4XQCA 4XQ9A 3ROMA 4H7PA 4M86A 1QYDA 4R3NA 3B70A 3EW7A 4LVUA 4O0LA 1TB4A 2YV2A 3RAJA 4C7KA 2I76A 1YJ8A 1C3VA 3RJ5A 3PGJA 3GEDA 3GQVA 2C07A 2NTJA 1FDTA 1BXKA 1N2SA 1SPXA 5BQFA 4Y6RA 4IJKA 1OOEA 1U2GA 1P0FA 1N7GA 3QY9A 1UDBA 1FXSA 4J2HA 4BKQA 3PJEA 3H2ZA 3G79A 4DMMA 1U8FO 2OHXA 1J6UA 1OBFO 2C5AA 5BSHA 3ZU4A 4RZHA 3GH3A 4Z3DA 2UVDA 4MKRA 2VTEA 5KKAA 5A9RA 4BNMA 4YDRA 1A4IA 1P1KA 1UXKA 1XQ6A 4YVFA 3I4CA 3Q3CA 3EDMA 3ZZNA 3QQPA 4MIEA 5IXSA 4F46A 2RHCA 1J49A 1P9LA 3UCXA 1XEAA 1DLJA 2EIHA 3GAFA 4XRRA 5I7SA 2EEZA 5JSFA 4BNNA 4CV1A 1GCOA 3QHAA 2GN8A 4CV0A 3AOEA 3KLPX 4CM1A 4CODB 4MOWA 4RZIA 4CLRB 4JBHA 4EW6A 2ZB4A 2EJWA 1OC2A 4IQ8A 4BB5A 3KRTA 1B7GO 1SOWA 1BDMA 2AE2A 1A27A 1I24A 3E48A 3DBVO 2VHZA 3FNGA 3O9ZA 5CPBA 2B35A 3GR6A 4BV9A 3TZKA 1EK6A 2IRWA 3JD3A 3AFNA 4OOEA 3ANMA 5BT9A 3DBLA 2I6TA 2J8ZA 3F9IA 9LDTA 3GUCA 2O4CA 1TT7A 4TKMA 2Z95A 2O50A 1ZUD1 4AL4A 1EZ4A 1VL0A 1PJBA 4L4RA 1GDHA 3K31A 4IDEA 5JXWA 3N7UA 3VVCA 3HNPA 3D3WA 3NTQA 2Z1NA 3UUWA 4IDDA 2JCYA 4BNHA 4CMJA 5KVSA 1Y8RA 4WLVA 3ZV6A 1SOVA 4D43A 4Z6KA 5T6BA 2X8LA 2CVZA 1ISJA 4RQUA 5JY1A 5DNAA 3JD0A 1QMGA 1MC5A 1NHGA 2RHRA 3TZHA 4CM9A 4MVJF 3TL3A 5ILOA 1HT0A 3AY3A 5COQA 1Q2XA 4LSWA 1U7TA 1E5QA 2G1UA 1NFQA 4G2NA 3G17A 2NLOA 3PHHA 3L4BC 1Q7BA 3RUIA 3IIEA 4P22A 4NNJA 2O3QA 1CETA 4NQZA 3JQ7B 5IXYA 1RM0A 4CQLB 1JDJA 1M6HA 2Q3EA 3PYXA 4W4TA 3S8MA 3U3XA 1WMAA 1NQ5A 3JYQA 2X1HA 2NU6A 5CG1A 3HADA 2HMVA 1P44A 4IJVA 4JK3A 3OBBA 5THQA 2G0TA 3ADPA 1ZZEA 2ZQZA 1CWUA 3MJSA 5LC1A 4UVHA 1KEUA 3DO5A 4OO3A 4YT4A 1IY8A 4A2CA 2YZ7A 4LCEA 1B3BA 2IEBA 2I5PO 3L9XA 2Z5LA 1NR1A 3MTJA 1PSDA 3FR7A 4XB1A 1IPEA 1PZEA 3IP3A 4R16A 1O5IA 1NXQA 1ZK3A 4BNKA 1ZK4A 3KSUA 4KOAA 4XDYA 1PIWA 1H2HA 5JE8A 2VRCA 4OQYA 2HJSA 3EAGA 3WIEA 1HDGO 1IPFA 2Q49A 3MTGA 3F4LA 3VZQA 4WGGA 3VPFA 5I8ZA 2PFGA 3UH1A 1OMOA 1YE3A 2Q2VA 3I83A 1N9GB 5FEUA 4CLOA 4ITUA 1P3DA 4FFNA 4NMHA 2GPTA 1Q0HA 2X22A 4NJMA 4FBGA 2AQKA 1C14A 1SB9A 4E5NA 4J0FA 1U3WA 1KOLA 3B1KA 2CVQA 2JJYA 3VPGA 5JO9A 1GQYA 3JD2A 2YQ4A 3C1AA 1I36A 4J16A 1K2WA 1PS9A 4FC6A 3VZPA 2A4KA 1EDZA 2P4QA 1ZH8A 1NQTA 1XELA 4KWIA 4B3JA 3UF0A 5MGBA 5TSDA 3BZUA 4U0JA 3QJ5A 1PR9A 2E48A 4L8VA 4LVCA 5KTKA 5I9NA 1IOLA 5ENDA 5JAIA 1TI7A 2GD1O 4FFMA 1JVSA 2CY0A 4IIVA 4A03A 2Y68A 4LSMA 3WS7A 4L4XA 3KM0A 3T7EA 4IJWA 5H82A 4CMGA 2NU8A 1Y1PA 2NQTA 4IBOA 3PHLA 2PTGA 2WWRA 2DQ4A 1KEWA 3EVTA 1E7QA 3KSZO 3ZU3A 2WTBA 4FCCA 3ICPA 1LLUA 3DOCA 4Q3BA 3H5RA 5G0VA 3GG9A 5TJHA 3ZWMA 5J23A 5CDGA 2YDXA 3STHA 5TT0A 3TOXA 3C1TA 3WWYA 3PEFA 4CM5A 3PDJA 2W2KB 1LQTA 4X54A 4YACA 3I5MA 1R0LA 3VKVA 5JAQA 1HLPA 1NM5A 1DOHA 2O2YA 3BTOA 4UEKA 5G4KB 4GKVA 2NVBA 1KY5A 2IZZA 1M2WA 3WBBA 3MWDB 2Y1OA 2QRLA 1SAYA 3CTMA 4BB6A 5C7LO 3FBGA 3EZLA 1PJLA 3VDRA 5L9AA 4FC7A 1ONNA 3I4FA 1EQ2A 1I32A 1CF2O 1RWBA 3UHAA 2UAGA 3RWBA 1D3AA 4UEOA 4MDHA 1XSEA 4XYBA 2EW8A 3F1LA 5IDQA 2O7SA 3OQ1A 1LUAA 4CLXA 1XQ1A 1YVEI 3CINA 1JU9A 3PLRA 3W6UA 2PZJA 3JTMA 1YONA 2HK9A 4OHUA 1KVRA 4CUZA 1LI4A 3GVPA 4YPOA 4LMPA 2HMUA 2V6FA 1BVRA 1FDVA 3U9LA 4DLBA 1WAMA 4Z0PA 4NI5A 3DMTA 4CMAA 3ENNA 4UULA 3OM9A 2XF8A 5B1YA 4HBGA 2WYVA 5BNFA 3C8MA 2X0RA 3PFFA 4J91A 4J7XA 4DBZA 5L7WA 4Z9YA 3PZRA 1D1TA 4GPD1 4RVUA 4AJOA 2R00C 1E6WA 1GPJA 2PKQO 3TQHA 2QYSA 1GUZA 4OXYA 1HZJA 3CZRA 4YAJA 4WE3A 4EUFA 1KY4A 1FDUA 4DPMA 4FOSA 3GF4A 4ILKA 3COSA 4R4JA 3MJEA 1IZ0A 1Q0QA 4PVCA 1UXIA 4YYZA 2BGMA 1ZK0A 1YRLA 2P2SA 4J3FA 4RF3A 1ENOA 3AI2A 1WZIA 1LBEA 3MJ4A 3DZIA 2D4AA 2J6IA 1I2BA 3GRKA 5A5FA 4DGSA 4XGIA 2X0JA 1J4AA 1YDWA 2VT2A 2PD3A 3O8QB 4KZPA 5JDCC 2YV3A 4CMIA 4JX8A 3LQFA 2GZ1A 3DFZA 3ONFA 5FYDA 3TFOA 1PQUA 4JROA 4PG5A 3AI1A 1PTJA 2IYPA 3C85A 4BGEA 2OOSA 3MWEB 4OM8A 3JQ7A 3PRJA 4CM8B 4CQLA 3DFUA 2PA3A 4JJIA 1ISFA 1Z75A 5A1TA 2X7HA 1NNUA 4ND1A 4ZICA 2EP5A 1B8PA 3RKRA 4I08A 1F17A 2BH9A 4NBUA 2ZYDA 1E1NA 1EBFA 4TRNA 4BKOA 3ZI0A 3NYWA 3E9MA 3WIDA 3DZKA 3AUAA 3L4BA 2B69A 4BV8A 5FFFA 4NU5A 4GSKA 3IS3A 4YQYA 5AOVA 2DM6A 2AW5A 1KIFA 2FPIA 2VYNA 2X4GA 4J1TA 5BR7A 1B16A 3AM3A 4E31A 3WQSB 5C7IO 1E3EA 1VL6A 4AVYA 1X1TA 2DC1A 2C0CA 4M54A 4CM6A 3D1LA 3PI7A 1L7EA 2FP4A 3GLQA 4DYVA 1QLJA 3E5RA 2EV9A 1XIVA 1Q1NA 1U8XX 4JJFA 1C0LA 4CMCA 1YBMA 1GL3A 4TSKA 4FB5A 2FMUA 1N9GA 1NAIA 2VQ3A 3LF1A 4YAIA 3E6AA 3R0IA 3VPHA 4N7RA 2X6TA 2DPHA 3Q9NA 3B1FA 3RBXA 4EBFA 4CMKA 2VZ0A 1SEPA 3RASA 3NTOA 3V2UA 2E82A 4LW8A 3R3SA 4L75A 4WEQA 1HYGA 2GLXA 3E9QA 1PR3A 3HG7A 5AXAA 3RVDA 2QQ5A 3BMOB 1E3WA 3Q0EA 1K6IA 4INAA 4J4HA 1MXHA 4EZBA 1U7HA 1EFKA 2O4UX 3GNSA 2NADA 2FSVA 2Q2QA 2YHIB 3K2BA 2H6EA 4MP3A 3C1OA 3C7CB 1PGQA 3WB9A 4Q39A 1P31A 3U4HA 4Z0TA 3JQCA 5IDWA 3KZVA 1XKQA 5G0TA 1GFSA 3FI9A 2WEKA 2D59A 2ZQYA 4G65A 4DREA 1MUUA 3JQAB 1PX0A 4AJ2A 3AU8A 1UH5A 2GCGA 4OAQA 2FR0A 1KVUA 3V1TC 3H5AA 3PIIA 3QWIA 4K6CA 4PFJA 3RJ9A 4AJLA 2AEMA 4CM4B 2Q46A 3A28A 2GF2A 1MLDA 5KWEA 3BAZA 2CD9A 1OFGA 4YJGA 4HNGA 3X2FA 2C29D 4XR9A 4YXFA 5DP1A 5DCYA 2AXQA 1LNQA 3KUXA 4LRTB 5T8KC 1KERA 1F12A 2A9FA 3H3JA 2W2KA 1T24A 2IDZA 3VTFA 3WJAA 2Q99A 3CSDA 2AEJA 4R9SA 3OJOA 4E30A 2X86A 3ZWOA 4OGWA 3T4EA 5G4KA 2C7GA 4CUJA 1NTOA 1QYWA 1LRJA 2AQ8A 2H63A 2HQ1A 4IMRA 4XWYA 4KUEA 4E5KA 3ASVA 1KVTA 1LJ8A 4F45A 2D1YA 5JCXA 2D0IA 2B5VA 2X0IA 4RPLA 4XZ3A 5DN9A 3GT0A 4BMNA 2CVOA 1BW9B 2QZ9A 2RBEA 3EZYA 3OQ6A 1YBAA 1EVZA 1MP0A 1KEPA 3FTNA 4MVJA 2P91A 3ETEA 3PLNA 1PQPA 4FSHA 3KLMX 3SX2A 5IF3A 5CDTA 1ZW1A 3K30A 3D64A 2QX7A 2Q1UA 4IZIA 3F47A 4YAGA 1FK8A 1LQUA 1LXCA 3Q11A 4R1TA 5JDIC 3ZWYA 3BMQA 3H6KA 2Y1FA 1T4DA 4JQCA 5JW6A 2GDZA 2PV7A 2W4QA 4E5MA 3OIFA 4LGVA 4Z3KA 3PYLA 3WLFA 5CPFA 1TLTA 1NQOA 4GLLA 4J1NA 1VSVA 3OIDA 2OBNA 1R4NA 3M6IA 1LEHA 5KVQA 4XJTA 5F3RA 3VHRA 2RAFA 3L4SO 3FNEA 4LRSB 4YJFB 4BKPA 3JYOA 4QO7A 4WCFC 3ZV4A 4Z0HO 4TRMA 1E1LA 4O6VA 5TQVA 3KO8A 4P4GA 4BO5A 1DAOA 2BFOA 1E3SA 1ONPA 3WXBA 1A71A 1BWSA 4EYEA 3JQDA 1SB8A 4W6ZA 4RDHA 3S1LA 4P38A 1XDWA 3WGOA 3RFXA 2HUNA 3ZW8A 4KQWA 3AUUA 4OXKA 2YDYA 4QO8A 4RGBA 3DBHB 3WGQA 4B8ZA 1ZFNA 3QWBA 2JD1A 4CV3A 1MGOA 3H9EO 2X58A 1QLHA 5L51A 1PJ3A 3FWZA 5CFZA 1T25A 4LK3A 3O8QA 1IHYA 1GV1A 1ZNQO 4WCFB 3IAHA 3ONDA 4ZD6A 4MINA 4GH5A 4AICA 1T1SA 4CR7A 5A4DA 3DOOA 4IPTA 2BMAA 4KP7A 2PGLA 1G0OA 1R4MB 4CL3A 3RKUA 1E6UA 5KJ1A 1ZEJA 4CM8A 5K6AC 1YDEA 4MKXA 1EVIA 3H9UA 3A06A 4UAGA 4BNYA 5TLSA 4AFNA 3IMFA 1UUFA 4ZN6A 4I5EA 2E37A 1O6ZA 2NSDA 3TSCA 1EMDA 1W6UA 4U8GA 3ZWXA 2AG5A 4UVDA 4RCVA 1RM3A 1GQ2A 1HE2A 1LSSA 4HV4A 2LDXA 2FWMX 1X1EA 2V65A 4CM9D 4DBVO 4R1UA 1P1FA 2IYOA 1ML3A 1Y6JA 3L6EA 4M87A 4CLEA 4EEXA 1I5RA 5JC1A 2GNAA 3IL2A 2AHRA 1Z74A 1R0SA 1DO8A 2DVMA 2W8ZA 3EK2A 3FRJA 4IDGA 1QG6A 2C82A 1Y9AA 5TS3A 4U5QA 2EERA 3QVTA 4TRJA 4W7IA 3K96A 4YR9A 1X0VA 3JQ8A 3JQ9A 3PHGA 3AI3A 2C2YA 3KEOA 1GQQA 3JQ6A 4KUHA 1PGPA 4OXNA 3W6ZA 4R69A 3H7AA 3LT1A 3IOYA 2FOIA 2QG4A 2EHDA 3AK4A 1IYZA 2P68A 5AQ1A 1XYGA 2QZZA 1GR0A 2ET6A 4Z9XA 2Q4EA 5EIOA 3FD8A 3QVWA 4WLUA 1YS4A 4MVJM 4Y6PA 3ZHZA 5KOIA 2WD8A 4OKNA 2WD7B 2BELA 3LSYA 2VRCD 4ROSA 3WDSA 4W9NA 1RYEA 3BMOA 5IZCC 3WYBA 3DC2A 1GEEA 3DEYX 4C7JA 3G1TA 4RO0A 8ADHA 2IE0A 3UKOA 1QR6A 5AXCA 1V9LA 1V35A 2Y0EA 3D5QA 2CNBA 2O3TA 3DAGA 3G0OA 1X14A 4ZQHA 1R37A 4RJTA 4I9UA 3JQAA 3NKLA 4CL8A 3JSAA 3VDQA 4DVJA 1P77A 3ONEA 3RFVA 3DWFA 3U0BA 3ZWVA 1WW8A 3RQSA 3TL2A 1P1IA 2W98A 1EK5A 2BLLA 3VH4A 5DF1A 3RU9A 2HCTA 1N7HA 4FFPA 3RBZA 1IHXA 3DHEA 5I9MA 3L9WA 2NU9A 3GGOA 2PZKA 1WDLA 3S2GA 4E4YA 1GCUA 2VHXA 4AJIA 1W73A 2V6MA 1D4FA 5EQDA 1JA9A 4ALKA 3CPSA 4UUMA 1I3NA 1JQBA 4L76A 3HN7A 4LMRA 1PWZA 2WYWA 2UV8A 3CEAA 4TMFA 2VRBA 1X13A 3HFGA 1OZAA 2O23A 3WSWA 1ID1A 3N74A 4NK5A 3GOHA 4M89A 4NG5A 1HDRA 4IY1A 1TT5B 3RC7A 2YFHA 1BGVA 1CYDA 1NWHA 4Q3NA 4XX0A 1ULSA 4PCVA 5EQFA 1N1GA 4A7PA 3PWSA 4PLTA 1BW9A 5T8KA 1H6BA 5KJFA 1P33A 3JD4A 3SJUA 3UICA 3I9KA 5EPOA 3ADOA 4WECA 1GYPA 1NFFA 2DTXA 4J1QA 1BXGA 3PIDA 4K26A 3VTZA 4OOFA 4BKUA 2VHWA 3CH6A 4XYLA 3AW9A 3WBFA 2HSDA 1U5AA 4OL9A 5F1KA 4BO8A 2PZMA 3M2TA 3DDNA 3LK7A 1FDWA 2V6GA 2DKNA 3GN2A 4D3DA 1HL3A 5TC4A 3ZN2A 4AG3A 3VZSA 3CMCO 2D5CA 1LSJA 4GAEA 3LVFO 3NGLA 3UFXA 3LC1O 4OKIA 3KYBA 3WICA 2P9GA 1P74A 2DFVA 3ULKA 3ZNOA 4B4WA 1AHHA 5EINA 3JD1A 4NBRA 4DL9A 1IE3A 2C2XA 4GX2A 4TWRA 2IEDA 1A9YA 2POQX 3AY6A 5JPIA 1T4BA 1N1EA 3ETDA 1PL6A 3EVNA 3GGPA 1X0XA 4MP6A 1YH3A 3GNQA 4L74A 2NTVA 3HDJA 1H94A 4J7CA 1KC3A 5DOVA 1ISIA 1KVQA 1K6JA 1DB3A 2H5LA 5CG2A 4PGFA 1Y81A 1WP4A 3VAZA 4F6LA 1T2FA 5IN4A 2HMSA 3GVHA 3S2EA 2NU7A 3OA2A 2CFCA 3U4DA 3PQDA 3QIVA 4JXKA 5DP2A 3WNVA 1GZ6A 3GMDA 1QYCA 3KXDA 4BNJA 4PLPA 1UDAA 3WSVA 3H9JA 1EE9A 1ZO8A 1QRRA 4FW8A 3WJ7A 3IQDB 4DRYA 2BKAA 1ZJYA 4DC1A 1C1XB 1K5HA 2DFDA 5KJEA 1EVJA 2G76A 4WK6A 3O4RA 1F06A 4HADA 4MO2A 4D42A 3ZHBA 5DCUA 1P1HA 4UVIA 3HDQA 1WDKA 1UR5A 1LC0A 1JW9B 1PL8A 1DBVO 1EQUA 4W99A 1G6KA 2YUTA 3L0DA 3LYLA 1DAPA 4NFSA 3UW3A 1EUCA 4IDFA 3NGXA 1ZBQA 4I5GA 4U0KA 4ALLA 2DPGA 1DLIA 5A02A 4UREA 1EEHA 3ZH2A 4W82A 4GMGA 4E12A 4M8SA 1RJWA 1HYEA 2ZB8A 2AE1A 4WOKA 3FNFA 3DHYA 3G3EA 4D7AA 5JBIA 3KYDA 1V3TA 1ZXBA 3PTZA 4JN6B 3OETA 2P9CA 3BMCB 3OEWA 3TPCA 2EG9A 2P9EA 4GWKA 1FJHA 4PLHA 3JQFC 4CUKA 4R41A 1EDOA 3GC6A 4BVAA 1B2LA 1I3LA 1NPYA 2W2LA 3ZWBA 1ZEMA 3G49A 3GEGA 4PLYA 4EUEA 1ISGA 1I2ZA 3JQGB 4ZVVA 1YB1A 3LT0A 3K2EA 4IGEA 2V6BA 2IZ0A 5F5NA 2G17A 3ETGA 3WYCA 4Y67A 1LRKA 2GUGA 1XCBA 4TVBA 4DPKA 4PG7A 4RDIA 4GX0A 4Q9NA 1I33A 2YFQA 2OGUA 4TZKA 4YT2A 1J0XO 1O89A 4JBIA 4OSOA 2VYND 4QUKA 4ONEA 1SNYA 3F1KA 2BFPA 3DTTA 3GA0A 1JKIA 1PJ2A 9LDBA 1YL5A 2VOJA 2Q1SA 3F5SA 1V8BA 1MG0A 5L3ZA 4NDNE 2P5YA 4Q3EA 1DSSG 4H15A 2AQIA 2BD0A 4GGOA 1PJQA 5KCZA 1PZGA 3RC9A 1V3VA 2Z1MA 5H81A 3ANLA 1GYRA 2Y99A 1DJQA 4JCOA 4QX6A 4XCVA 3I6IA 1DIAA 4N18A 2YV1A 4BIIA 3GZNB 4ESOA 1LU9A 2ZB7A 2HMTA 2TMDA 4D3FA 5ITWA 4CJXA 4KTTE 3AJRA 1GY8A 4I5FA 1S6YA 2HO5A 1WXDA 2GR9A 5A9SB 4WLNA 1MV8A 2DBZA 3ZGYA 4CQMD 3PPIA 2HU2A 2B4RO 1Q0LA 4PLCA 4TRRA 1DHRA 3DZGA 1U1IA 4YRAA 3A1NA 1B3RA 4CLRA 5JS6A 2A92A 1TA4A 1IULA 3CKYA 5ER9A 4M1QA 5H83A 4BNVA 3GDFA 3RI3A 5JCJA 2C20A 3KB6A 2YYYA 2FZEA 4H16A 3P2YA 2ZYGA 3Q1LA 5DDIP 3I6QA 2HAEA 3V1UA 3KBOA 2O3UA 3DL2A 4R1NA 4R5MA 1RKXA 3P2OA 3B20A 4PZDA 1AHIA 1ADGA 1JAXA 3K8ZA 4NPCA 5FI3A 4CR8A 1IB6A 3DZJA 4IXWA 3ITDA 4E21A 1I01A 2WJPA 2EKPA 4XYEA 3SEFA 3LLVA 4WLOA 3MOGA 3ICCA 3W8DA 5T64A 4IJUA 1NX6A 4XD2A 3FN4A 4B8WA 3G1UA 2BGKA 1CRWG 2ZIZA 2CMDA 1QP8A 5JLAA 4B3IA 1H9BA 2PWZA 1WDMA 4R9RA 4ZU3A 2UYYA 1GEGA 1QV7A 2R2GA 3BHMA 3AY7A 3WX0A 4GX1A 4B3HA 3OSUA 5FF9A 3WGYA 1R16A 5L4NA 3QW2A 1DFHA 2OP1A 1B15A 4S1VA 5TF4A 1PJ4A 1BHSA 3P5SA 1E1MA 2ZJ0A 2VWQA 3FWNA 2R6JA 3WLEA 3F4BA 1I2CA 2EP7A 1PS8A 4MVJD 5THKA 3ASUA 4RQTA 3D4NA 1JVBA 1ZSNA 3GFGA 3MEQA 2F1KA 1V6AA 2PGDA 3FHLA 4NZ9A 3HZZA 1I30A 5U4QA 3OQBA 4AJEA 3OFSA 4J9VA 4E5PA 3KHUA 5TRTA 4WEOA 4B79A 3H5NA 4J90A 5JAZA 3PQEA 7ADHA 5FWNA 3TZ6A 1DFIA 5HM8A 5JNLA 4XGKA 4KQXA 3ZW9A 4IDAA 5GZ1A 1E7YA 1BTOA 4E2WA 4BL5A 6LDHA 2XAAA 5A05A 3GZ4A 4D0SA 4E13A 1UDCA 3WNQA 5DBGA 3I9NA 2JD0A 3QRWA 1PGNA 4EITA 3DHNA 1G1AA 3A9WA 3DB2A 3TRIA 4RL6A 2OL4A 3WTBA 1U4SA 3MJTA 3QVSA 4AJJA 2ZTMA 3OJFA 1Z82A 3OA0A 1HXHA 1AGNA 1E77A 1JWAB 1QV6A 4O5OA 1OI7A 1CEQA 3HWRA 2PK3A 1XGKA 4XKJA 4B7CA 4RPKA 5IN5A 1C1XA 1NHWA 2UDPA 4KUGA 1HTBA 2GN9A 1GU7A 3H8VA 1LDEA 3KSDO 1A72A 4NR0A 2FY8A 1Z7EA 5G4LA 2PKRA 4J4TA 3ZNQA 1N5DA 1P1JA 4I1IA 3OICA 3PHJA 2DLDA 1U2DA 4OMUA 4BNGA 2Y0CA 5BSGA 2E6UX 4YBZA 1K3TA 3E18A 3JYNA 4DIBA 4RVHA 4WCDA 3PJGA 1QSGA 1YO6A 2FZWA 4MIYA 4YJDA 5CEJA 3V2GA 4TVOA 1F8FA 4MVJP 3DAPA 4AJ1A 4N54A 2BGLA 1VE9A 2DAPA 2EJVA 4XB2A 3GDGA 3O38A 1F14A 5DBIA 4UUPA 4JIGA 1ENYA 1I8TA 4MKZA 1E7MA 4JP3A 1LTHR 1O9BA 3PWZA 2FR8A 3SC4A 3TOZA 1NPDA 1A9ZA 4XA8A 2ILTA 2HRZA 2DBRA 4BGUA 3ANNA 4WJZA 5EERA 3VPXA 4CPDA 4GGPA 1ZK2A 3KYCB 4BNIA 4E2ZA 1VJ1A 4PLFA 2JFGA 3UGKA 3MJCA 1ADFA 4IQGA 5I7EA 3E03A 1U3UA 3RUDA 1PZFA 1A7KA 1DFGA 3SXPA 4QFCA 5L40A 2V7PA 4ZQEA 2WE7A 3D7LA 4CMEC 5ITVA 4JGBA 4K28A 3W8EA 5CHEA 1GADO 4L9RA 4XYMA 3ZWCA 1NASA 2GSDA 2VYVA 4WLFA 4XIJA 3WGGA 3LT2A 5ILGA 3C7DB 2CDAA 4ND2A 1ADBA 5B4UA 4ID9A 1BSVA 4PLWA 1A4UA 4RVDA 4U7WA 3C24A 5KVCA 1JKFA 1X15A 4IINA 4PG6A 5AXBA 5GZ3A 2ZJ1A 1LDBA 2CF6A 1FDSA 1NYTA 2X23A 3CIFA 1AUPA 1E92A 2YW9A 3I3OA 2Q2WA 4FQ8A 1VI2A 4D0RA 1UAYA 1ULUA 1U5CA 4R1SA 4XRGA 3JQBC 4S3MA 2NNLD 4OH1A 5KJ6A 2GZ3A 3H65A 2X5KO 4BUCA 2GN6A 1RYDA 1JWBB 3HDYA 4BKRA 2NUAA 2F00A 4I8XA 5JAMA 5KKCA 2NM0A 3ZWNA 4E6PA 1E3JA 3JQEA 1M6WA 3PDUA 2IXBA 1Q7CA 1ZJZA 1VLLA 1LX6A 1MG5A 2EW2A 5A9TA 3W4IA 4BGIA 1B14A 4OYRA 2O2SA 4DQUA 5JY6A 1DDOA 3MJVA 4PLZA 1E5LA 1R66A 1LDNA 5COAA 4K6FA 3DQPA 4R5HA 3IJRA 1F8GA 1QYVA 4IM7A 5F21A 3WGIA 1LA2A 4B7XA 2JFFA 3WFIA 3OH8A 2A35A 1DC4A 1BMDA 3D3WB 3GVIA 1DIHA 2ZCUA 5C37A 1D7OA 1Y5MA 3HSKA 5HTOA 3JQAD 4EJ6A 3LDHA 2VNAA 2OXIA 1V0JA 2JAHA 1BXZA 3EUWA 1NFRA 3E1KA 4URFA 1H6CA 3VH3A 3BTVA 3TWOA 3FNHA 2Q50A 5KNLA 1I3KA 3ITKA 5ICMA 2EXXA 4Y9DA 2O3JA 1HWYA 5L45A 3NT5A 1ADCA 2IZ1A 1U9JA 5GZ6A 2DU8A 3RD5A 3WGHA 2VN8A 2O7QA 3QVOA 3WQQA 2PLAA 1GTMA 1AN9A 5T5QA 3RC1A 3WYEA 4YAKA 5CAEA 1YL6A 1HYHA 3ST7A 1NP3A 4MVJI 4HX5A 4KTVE 4IXTA 5K0ZA 5MDHA 4WOJA 2R00A 3EGOA 4BGVA 1VC2A 4EJ0A 1T2AA 3FR8A 2IXAA 1CERA 1V3UA 2JD2A 4ZA2A 3RUEA 3GDOA 4RVGA 2Y93A 4NBTA 1MFZA 3OJ0A
chains in the Genus database with same CATH superfamily
3VO2A 3JAKA 3QTLA 4M1MA 4W63A 2W6OA 1QIKA 3NM5A 3TXXA 3H13A 3LC7O 4Q5IA 3U7IA 3OJLA 4B6FA 4C4ZA 4HYQA 5A04A 1H0SA 1CD5A 1W44A 1YB5A 4IQ0A 1S96A 4CBVA 3FM9A 4J3JA 2Z3VA 2ZE7A 1J2UA 1Q15A 4QXMA 2GRAA 3AV0B 1UFKA 4I4IA 4DDTA 2FMKA 1X7GA 5AYVA 2V1XA 1Y7TA 5TGTA 4WINA 2PX5A 4D96A 5ENZA 4ZYUA 1J8DA 2BMEA 4ZREA 2ZCJA 1P4RA 1T0IA 2PUWA 3EMKA 4IHJF 5CDSA 5HIJA 1VXRA 1T5SA 1OKKA 1S01A 5DCLA 1E96A 3VR1A 1LDGA 2VDKB 1Q84A 1W52X 4CL2A 1SOMA 1ZWKA 3EVDA 3EBPA 4OQNA 4XWOA 5HZKA 2WF9A 2D1FA 2YY5A 3NP7A 1LLQA 1F6BA 1RCFA 5EHGA 3ND5A 4JNKA 4AD8A 4E09A 2AFHE 4QFDA 1IRIA 3QELA 1VE3A 2WG1A 4PRZA 1ONOA 4TYPA 3DEAA 5BSFA 3U5TA 1O95A 1DARA 4AAYA 3K32A 3U09A 5IWCA 2W70A 1F1JA 2I3BA 2WHPB 3D7SA 4LC0A 5HS4A 1TTPB 2I1WA 4WUVA 4MWDA 2VPTA 3E9CA 3WYAA 1M9NA 1OAOC 3KJHA 1US8A 1DAIA 4C7XA 1LK7A 1OZGA 2A0FA 2X14A 4JX9A 4U4AA 2IEIA 1Z18A 5E6UA 4XIYA 4ZMBA 3K70B 2BDUA 4CTNA 2OAGA 5LQAA 3UW1A 1C8LA 2YOGA 4YGXB 4UBMA 3TF5A 1XZFA 2R60A 1RE1A 3DR3A 2F4NA 2XF2A 4RHYA 3RIMA 3S81A 2AS0A 5HBRA 3PZBA 4FWIB 4ZCRA 3CZMA 3T99A 4XOIA 2VS1A 4CKWA 1NSYA 3ESBA 3FSRA 4PG4A 4BNXA 1EFCA 5AVSA 2AOTA 2FAXA 5TR9A 1N6LA 1V25A 3DDWA 4QARA 4W6QA 1XDZA 2VHYA 3UMSA 4FR5A 4G1EB 2Q07A 2ZAOA 4QDXA 5HQ3B 5C80A 3ND6A 2XNJA 3PJFA 1ZCAA 1OXTA 1T34A 1YV9A 3S1AA 5J58A 5A03A 5JYEA 1EA5A 1E1KA 4KAAA 1J21A 5HA5A 5FPYA 5L7YA 4DARA 2GYWA 10MHA 3FCEA 3K15A 3QI7A 3QKRA 2WRZA 3DQZA 1CTQA 2AMJA 5EZQA 4GZ6A 3RARA 3A3PA 1LK0A 4WASA 1OILA 1QHEA 3U3DA 3NT2A 3ZOKA 1PZHA 1O57A 1X38A 2HQRA 1JF8A 2PEYA 4KI0A 5AICA 5BNIA 4ZEVA 4JVOA 4HNUA 4L7QA 2C7BA 2NWQA 3H4MA 1NNEA 4CMBA 1WXIA 4W8OA 2Z2ZA 4LSGA 3OU2A 2FXIA 2BBOA 3OLYA 5L4SA 3KSAC 3FTCA 1U8CB 2WVJA 2ES4A 1YKFA 2ZCVA 3VC7A 2E4AA 1KYYA 4OKSA 5MGNA 2D2VA 2M1ZA 4DNFA 2GXAA 2WDZA 3AEKB 3RS2A 1FNNA 1KKLA 4NH4A 3PCTA 1GYQA 3PRKE 5FXMA 3BFJA 3CA8A 4JB0A 4QTZA 4BO9A 2ZUUA 4PN3A 3FSEA 3V3KA 1EH5A 3L7YA 1YUBA 2C3OA 4GD3Q 1K6XA 3QJGA 5DH9A 3QGMA 1J8YF 1K06A 1OX4B 5ADWA 2LW7A 2WMDA 1G9XA 2JLUA 1E9EA 3UJ9A 3ET4A 3AL0C 5F1YA 3C6QA 1PLLA 3HVUA 3RYCA 3MN1A 2I7XA 3VR2A 3LLUA 4A1FA 3IP6A 4NDAA 1RJEA 2ZDQA 5EG5A 1KRWA 3RQIA 4MVXA 3RREA 4JJ4A 3AVXA 1J97A 4II3A 1VL5A 3H42B 1AUQA 4KK4A 3UJBA 5HZMA 3OTQA 2PGIA 1SHZA 2X0KA 3R6DA 1XRPA 2ZSIA 2VXBA 5ESWA 5BWLA 4U7DA 4HY3A 5IVDA 3SBEA 2OV1A 1WVGA 3C5WP 1A8QA 3C6ZA 3PA6A 3WXMA 4F9FA 1FFHA 2ONJA 1POXA 3D0RA 1WZUA 4KVFA 2FUCA 5H5JA 1X7ZB 2J0VA 1H1DA 4J43A 4TV9F 5K8UA 1G4AE 4MQFA 5CH8A 3WQBA 5ADHA 3I05A 1DXYA 2IPXA 4QREA 1Y8QB 3OQIB 3U4QA 3FIUA 4QLOA 4D26A 1TYZA 1YL7A 4J49A 5IAAA 1AUXA 3K0FA 4R98A 1I7NA 1ZNYA 2C04A 2QTVB 2ZREA 4WKNA 5FQOA 4CN8A 5BOSB 2W6NA 2YN2A 2QSZA 3UPTA 4LFBB 1TIBA 3SYNA 2CJFA 2UUCB 2GRUA 3OLXA 1KNQA 1NVXQ 2V6JA 3C5VA 2FRDA 3CCCA 4B3GA 1WV1A 1ZVQA 3C3WA 4V0OA 2DGDA 2PANA 3N8NA 4C87A 5BPHA 2XMBA 4NAHA 4ZQFA 2Q62A 4HWTA 1SVLA 1CUFA 3TOCA 5KYWA 5AW4A 4IDOA 4Y6GB 1WF3A 1S2DA 2GHRA 4ND3A 5JMOA 3U3OA 1N75A 1X7YA 3ZJ5A 1ZAYA 3FA2A 5DW0A 4BNFA 2JDIA 3CLRD 4YJFA 1O6CA 1PJZA 4TMYA 4PSAA 2DBVO 2ANBA 4K9RA 3LV8A 5JCOC 2PT6A 4OX9Y 2HKIA 1MNQA 4HNHA 3IQFA 4O4IF 1F60A 5AK0A 1E2QA 1Z6TA 3G5LA 1A82A 4A1OA 2OQRA 3DV0A 3AR7A 3WK9A 2IL1A 3DM9B 1RQGA 2NQ8A 3G88A 2FZ4A 2XRMA 1XF1A 2PY6A 4OFBA 5K8VA 3N6RA 3AWDA 1B0AA 1UK7A 1ZH0A 1AKVA 2OENG 2C5FA 3LKBA 3OZXA 4GUDA 4I50A 3STVA 4KH1A 1E1CB 1GILA 1N2GA 2BKEA 2XB4A 5MN6A 4FINA 5AT1A 5IS2A 4KR6A 5KCMA 1MB2A 2YJ6A 3JARA 1Z6YA 2JIZD 2VZ9A 3A6FA 4KODA 4KREA 1DPGA 1Y4ZA 1CY1A 3WMEA 4WPGA 3GT3A 4ZV4A 1E6EA 3V8EA 2P69A 3A8TA 2C4TA 1KHHA 3B60A 4D3SA 3O4JA 2VF7A 4LJ4A 1VKNA 3DCJA 5JNRA 3W9UA 1T36B 1T8PA 4FEAA 4QATA 5JR3A 3TSYA 1OIVA 1SBHA 4AKEA 4WZZA 1GRRA 1XNGA 1KFEB 1UZMA 4V24A 5TPWB 3RT1A 2AUNA 3EPPA 2BEJA 4TLEA 1ODTC 2CJXA 2OFOA 5CCDA 1UBJS 2GA8A 1EB8A 1FNBA 1W8DA 2VQ6A 2PGOA 2X5OA 2ZWPA 3JWIA 1XP8A 3K1JA 1TYEB 3M9XA 3GUYA 2CLMB 3OURA 3QI2A 3HO8A 5C5IA 2I9PA 3RT9A 1F1BA 2FZGA 3QWHA 2FE1A 4I1VA 2RHTA 2V55B 5TQJA 1PJSA 1UFRA 1VJ5A 1YTLA 2GT1A 3M1YA 2NVWA 1BDBA 2DX7A 4Y6OA 1KOJA 2IYRA 3WADA 3OC0A 3QFRA 4KLRA 2QQGA 4PRKA 3LLMA 4B9AA 4YRBA 4OI1A 3D7MA 1U2ZA 3A14A 4F4UA 3ZE0B 1I2DA 1UAGA 2VTDA 4HUJA 2G28A 2P1DA 4UDNA 4L07A 4BNLA 3S2FA 4G5FA 4NK4A 1M33A 3K0CC 4XUEA 2BBWA 4KOEC 4Q66C 1KRXA 2I71A 5AKIA 2OCDA 2D2EA 1GZ5A 4E07A 4E5SA 4Q7MB 2AZXA 3HYCA 2XMQA 3AF2A 3RJZA 3FKSD 1CW2B 3ZQ6A 1PSZA 1HFJA 3AHFA 3ZIAA 1K68A 1H3EA 1K2VN 1L8QA 1YAJA 2QLLA 4G0PA 1E2GA 1QNLA 4BY9E 2JLSA 1DBPA 1V39A 4IUYA 3VHXB 2QE7D 2W93A 1E3WB 3A11A 3ID6C 3ZDFA 1G4UR 2WDPA 4CEIA 3VHLB 1PEAA 4TUYF 4IH9A 2ISQA 1P8JA 4GMFA 3MZ0A 3WK8A 4IQ4A 2BE9A 4EYQA 4ZVSA 1VIVA 2A57A 1FBTA 4KKVA 3SOPA 3ZJYA 3LTEA 2RC6A 3PUJA 3LLSA 4PFSA 4EG1A 1GUYA 1PK9A 2X7JA 3DTVB 3OCUA 2NV6A 4TS3A 4A8JA 1W36B 3EFEA 3ZCXA 4RV5A 4AZ3B 2AKYA 2FETA 2IF2A 1PEDA 1ZLYA 4J9UE 4JC8A 4LWQA 5AKEA 5KQLA 3LFTA 3U1TA 2GJ9A 5L3QB 1MTOA 2EGGA 3VAYA 5T4EA 1B42A 1GZ4A 3TIGA 3EW9A 2JFYA 4JJGA 4YT8A 4EELA 3RFFA 1ODJA 1G0NA 4DA8A 4O25A 3WB0A 3TLJA 4HFRA 7GPBA 4KHZA 1YIAA 3O8LA 4EPWA 2KYRA 3D7RA 4B87A 3LCJA 3GXBA 5C35A 1MJHA 2O5VA 3BD8A 4UAJA 5C1DA 2PX2A 1XDBA 1Q50A 1EZ1A 3I92A 2AN9A 4UUNA 2CLKB 4MRNA 1M1UA 1O0BA 3FI0A 1PWXA 5FBWB 1D07A 2VXOA 1UFOA 3KDSE 4LY6A 4N0PA 5K3FB 3B12A 3PDHA 1RPNA 4YA6A 3RU7A 3UXEA 3TNFA 1V2HE 5MF6A 4B3MB 3PK0A 2HREA 5DMHA 2XPCA 4FYVA 2GEUA 1Z4QA 3DZBA 3L8MA 2OA0A 1RXSA 2QN7A 3VJRA 1ZRHA 3IH5A 2FPPA 5HFAA 4P4NA 2XEXA 1YOVA 1E1DA 4L8GA 4EFDA 2HZ7A 3ZE6A 1UJ5A 3TN7A 1DJLA 2YXPX 1R8YA 3VR6D 1ORDA 4HNVA 2JFHA 3ORYA 3D4LA 2XWSA 4HO1X 2OQ2A 1X9IA 2QX8A 5KO2A 1TUIA 3RYFB 2D1RA 1CCWA 2RH8A 2QA5A 2Z98A 3NOOA 1CHNA 1SC1A 3CUKA 3H3FA 2VBGA 2PRSA 2XUQA 5F52A 5LBUA 2PVPA 4UD6A 3GCXA 2P78A 4DCCA 5C7OO 1XYVA 1Z0AA 2R97A 3AFMA 3JATB 1SXJD 3DUWA 3KR2A 3ZDAA 3FTFA 1G20E 3OEYA 3AVYA 2GXSA 2PUVA 1XX6A 2Q6OA 1K7EB 1B6RA 3HEBA 2LGJA 3EXFA 1G20B 4BMVA 5F1OA 1A7UA 3AT1A 3NB0A 5AI8A 5KYVA 5CVEA 4YCNA 1RCTE 4CEJA 1IL0A 1DG3A 4LXYA 3GRPA 3MS4A 4XGNA 5HRUA 3K0HA 3WL8A 2VYVD 4H2DA 3WV4A 1LWOA 2B1IA 1QVVA 5K4AA 5IU6A 2NPFA 2PLNA 3LKVA 4MNTA 2F1OA 3W8FA 1CQIA 3PFHA 2ZT8A 4YCMA 3AERB 2OCAA 3LLCA 1OF1A 2Q5EA 1ST3A 4J94A 4FE4A 3ZYZA 4ENQA 2YN0A 3K1AA 4AIRA 1OA1A 2QYTA 4EYGA 1F8XA 1G2OA 1R6DA 2XNKA 3COYA 2JANA 3NW9A 3S2YA 3F6RA 2ZVDA 3JVIA 2DCMA 3RSLA 2XLBA 4EY5A 2QSJA 1TCAA 3FF4A 3IC5A 1WWKA 4I4CA 1BU8A 1DRVA 4OP2A 4IDNA 3HA7A 2O2ZA 3NHYA 1H5QA 3KOUA 5JADA 4KXFB 1Q1AA 1NUSA 2BMJA 4HTFA 4IGKA 1XMXA 2BTQB 3ZHXA 1WCYA 4MYUA 1VKOA 1UQTA 4MQLA 2BGGA 1GPKA 1JLHA 1RJFA 1QE3A 4QPNA 5AJHA 1EVKA 3JU3A 1JE0A 2IEYA 4IHJA 3TG2A 4PU0A 1I1OA 2WTEA 5KAPA 5L95A 1ETHA 5DGXA 3L5OA 2PH5A 1PQWA 3RBVA 1L5WA 1PNQA 2WSSA 1VYTA 2JAOA 1I4OA 4QQ8A 3TQSA 2BMDA 2GD6A 3W04A 4C3VA 2OD7A 5AOCA 5KDDA 1DTWA 1FS6A 1E99A 2CZCA 2RHWA 3NDIA 2IPMA 4RF4A 2YHUA 4CV2A 4A27A 2V3CC 3WDLA 3WK5A 2X2OA 3HRIA 2C4KA 5EJ5A 2VVTA 2OFPA 3O74A 5IJZA 1S1CA 1UEIA 2W6JD 1N5LA 3IA2A 1TX4B 4ZO6A 4Y98A 1NXVA 1EUDA 4MH0R 4BZZA 1NZJA 1WB6A 2R8OA 4QA9A 5G0WA 3W5HA 5CEFA 5B5SA 3OUUA 2HU5A 1TVEA 3DLCA 1N25A 5DHPA 2H2HA 4H31A 2BUAA 5JWHA 4ARAA 1V1JA 4DG5A 1UKVY 2HMAA 1P2GA 4F2PA 4C0QC 2Z43A 4V2IA 1A5ZA 5CITA 3KTDA 4HVCA 5EIHA 2VT3A 1SCNE 3DMNA 1A1SA 3LSTA 2ZWAA 4WL0A 4Y6SA 3R3YA 3DLIA 4Y9RA 3DE2X 5AJTA 3DE6X 3CZPA 4BMSA 4MB2A 5E1DA 4ZAXA 3A0UA 4GI3A 4N8EA 1Q0ZA 2GMWA 1MC4A 1GNVA 1E2DA 1T2EA 2RMKA 3CGGA 5EP2A 3QE3A 4XQEA 1DMSA 4RFSB 1PW5A 1N5IA 4ZDJA 4X3PA 1FJGB 1HT2E 4BRSA 1OT3A 1I2MA 5TT1A 5ALUA 3NIBA 5D8DA 1XA0A 1XU9A 1U6KA 3CXUA 3H2GA 3LHKA 3OZWA 4D4LA 2C7RA 1DC5A 1K0UA 3MOSA 3WP0A 4WDQA 4WNIA 4GQBA 4WFKA 1GAEO 4GZ3A 2X42A 2O0LA 3KJXA 3ROQA 1HEYA 3PA8A 4KPGA 4TT8A 5IAGA 4H7KA 3VPSA 5F2EA 2ZVPX 3HGMA 2B5WA 2YXBA 1SD1A 3NASA 2P41A 4F4HA 4NFYA 1DBIA 4QDZA 1ZSVA 3UJ8A 3CBGA 1FYVA 1WHSB 1TUBB 2VUTA 4MYSA 4R2WA 2WQ7A 4RPHA 1BHQ1 2JKVA 3ILSA 1SCQA 5F3DA 1N6NA 4F5DA 6Q21A 3I9JA 4ZAZA 1LLCA 4HKTA 2LDBA 3O8DA 1MDBA 4LRYA 2B36A 4RPCA 3LC2O 4RXMA 4NMMA 3VNRA 1BVYF 2Y0DA 1QJ4A 3I52A 3SSOA 1YQUA 2CW5A 4GKAA 8LDHA 1JG1A 1PS0A 4URUR 2XCQA 4RSRA 1T26A 2X5NA 1LK5A 3B7WA 1U3CA 4WKOA 2NSLA 4J3NA 5B1HA 3GPLA 1IC6A 3T9FA 2HIAA 3ZTTA 5JS8A 4MICA 2G5CA 2O52A 2QUJA 1OKKD 4AY2A 4U6NA 5EHIA 4ZVTA 1XLUA 4PONA 4TKLA 5JD6A 3E27A 1L5GB 3QNUA 5KTTA 2OCYC 3E58A 1ZM7A 1M74A 2EWMA 4GR9A 4X95A 2ZUEA 1GU0A 1Z8HA 2DH6A 4M8NE 4AIIA 4CF5A 1BWRA 3EHDA 4Y3UA 1MO3A 1W4RA 2W43A 1M6VB 1CVLA 1QP0A 1V8DA 2J5KA 2H8KA 4XEUA 1EWRA 2G06A 2QW1A 3L6RA 3MGGA 1R8JA 1O95D 3D0OA 2QW8A 4JGIA 3S55A 1VKRA 1YQ9A 1J42A 2J33A 4EI2A 4U2KA 4XIFA 3U4IA 1TXGA 2IOFK 4QAJA 5DEOA 2XGGA 3L8EA 3STYA 3C45A 3SICE 3UT5A 4JLWA 4NSNA 3W3AH 2O3RA 2VOEA 3CIOA 3IUPA 3UKDA 5EIEA 1U31A 2C2WA 3JV7A 2EFYA 4TV9A 4LCJA 3V8BA 1RM5A 2A3RA 3NJRA 1XXLA 3OECA 1KEEA 4GUAA 3P2JA 3N7TA 2B4TO 2BEUB 4GP7A 1R5BA 4DA6A 1CRLA 1T91A 3OF2A 4X7MA 4UVEA 2ZSJA 2O5CA 2PSEA 1FTGA 3T7CA 1IM5A 3LYAA 4W8GA 4FCVA 3ZBPA 2B6NA 1SQFA 1GNTA 3G9UA 3EVEA 1KE1A 2A8YA 3GPCA 3UG6A 3DVSX 1UPTA 2OOKA 4FS3A 4GQAA 1RJGA 3TDKA 3UANA 2PPLA 4F6CA 2B37A 4IVQA 1LSOA 1NY6A 3IAXA 3QLEA 1NVDA 2GEFA 2IXTA 1RI2A 3NHFA 5CDFA 1U28A 3B6MA 3VPCA 4W5TA 3VTAA 1GZDA 5BN4B 5JH7F 2I2BA 3QFTA 2E85A 3I6MA 4FTWA 4JA2A 4FFOA 4L0QA 4MQUA 3RVPA 4B7UA 2B82A 1C7IA 1C3OB 5GMOA 2GJSA 3ZK8A 1B6TA 1OGJA 1YJXA 3MRSA 5H02A 3Q2KA 3NC0C 5KYUB 4DIDA 3VR3A 3KLOA 4MUEA 4O4IA 1EK0A 4BO3A 2RK4A 5I9LA 4F72A 2HRQA 3BHNA 1M0SA 4M46A 1QX4A 3WV5A 4C4YA 5CLFA 2BCEA 4TTQA 4DJFC 3S7ZA 1SBIA 3ER8A 1XTIA 1X7HA 2SBTA 4AMYA 5TNXA 1XG5A 2DXIA 1GKUB 1QB7A 2B0JA 1G5PA 1M6NA 4HGPA 2BI4A 4C03A 3UFXB 3EXIA 1Z2OX 2H9AA 2ZT5A 3A10A 3ESQA 5EN4A 5A62A 3DBRA 5ECDA 4B2IA 4P4LA 3LBIA 3DZ8A 5L4LA 2NP6A 1B26A 1TFRA 1D2MA 3OZUA 4FHEA 1YZTA 1XF9A 3RROA 1ISRA 3EAQA 3IUSA 2F3RA 5BP7A 1A04A 1FUIA 4Q01A 3P8ZA 2XWPA 3FW1A 3BTUA 3PP8A 3HEMA 1DWOA 1WMEA 3LX8A 4W7SA 1MEEA 1ZMBA 3ABIA 3U9SA 1BCRA 1NT4A 3LPCA 3RC2A 4MWSA 1PCXA 2JI7A 4L51A 5FP0A 5EZYA 4ZI7F 3NJ8A 4DLAA 1HC7A 1ZN9A 4EJFA 1R3UA 4Q3LA 4WT7A 1TOAA 2B8TA 3L6BA 3BHJA 1Z6ZA 1T5BA 2WKRA 5G1OA 2X0DA 3SS9X 3CONA 3VR2D 1Z15A 1Z2AA 2Q6IA 3L5KA 3R1IA 4IS2A 2J9YB 1XU7A 2XYHA 1BCSB 1YNOA 4OMDA 3RWOA 1FFCA 2CBXA 2NU7B 1WSBA 2CVHA 3NBXX 1OWOA 2RD2A 4JYMA 4ZPJA 3ZWPA 2P5UA 5DULA 4LNHA 4NOJA 2R47A 3W2HA 3DFKA 2VDQB 5DNEA 4MWEA 8GPBA 2GEBA 1E9CA 1ISHA 1ZP6A 3C15C 4HWPA 3RUCA 1SUSA 3AMVA 4HGYA 4GSLA 3A05A 5D00A 1IIRA 3QV1A 4HVAA 4UU1A 4YHBA 3UA3A 3O4GA 4D1YA 1GLNA 4Y2SA 4TYYA 5DT2A 2J3MA 1MFPA 1WTCA 4J0HA 4CLOB 1D2NA 3EFOA 4WX2B 1MAAA 2P1ZA 4FI3C 1DIBA 4LWOA 1MX3A 4IS3A 3V4VB 4A0SA 4C1BA 1H4QA 4TUYA 3DONA 1YZUA 1N92A 2PRYA 2VJMA 1HOTA 1P73A 1KAHA 2VPXA 4RK6A 4BJ5A 1RC1A 4N6OA 1KI3A 5EESA 4GF5A 2R48A 4FFBB 4FE7A 2Z2XA 4M53A 2FMTA 1D8AA 2HSGA 4C7OA 1VSUA 3D6UA 4P53A 4DCGA 1NLUA 2UUOA 4UUBA 5TDHA 1KU0A 1M10A 3AIIA 4G86A 3O2QB 1IHPA 1NDQA 1ZXLA 2CLIB 3QPCA 3E2IA 4JEHA 3AKYA 4UVGA 4IILA 9GPBA 4CTJA 3P0IA 3BTSA 1JJBA 3KOWA 5IRCD 2FXVA 2JDID 3KFXA 1OZ0A 2REOA 3HYSA 4K9MA 4MPPA 4NBVA 5FKJA 3TM5A 4IQFA 1C0IA 3TLMA 4JC0A 5EZ5A 3ZCPA 3DXFA 5BUCA 5K0TA 1PWEA 4WFIA 1Z38A 3DEJA 3WMFA 2O8CB 4OU5A 1G9SA 4ZWNA 4HXFB 3E3NA 1LV8A 5BQ5A 5JNVA 1SQGA 4E3ZA 2PQ0A 5L7TA 5AKLA 2ZE6A 3TE6A 1MNAA 3F49S 3QUTA 2J0QA 3AWIA 3HPRA 4CF4A 3I2HA 3JZIA 2P9YA 3VVLA 2VCEA 3FOEC 1KO4A 3HSSA 2CNDA 2IF0A 3PXAA 3P2IA 4TROA 1JYEA 2QL5A 2YWDA 3CF6R 4XQ9A 4JR0A 2OLJA 4LE0A 1C7ZA 4Z86A 1BEUB 1YA8A 3FVWA 3CJQA 5B36A 5JAHA 3HB1A 2JVKA 3DTNA 4O0LA 1FYEA 1N7JA 3GRCA 2CE2X 4CCYA 1S4MA 4XCQA 4NY1A 1Q19A 4WCVA 1CJVC 1YJ8A 3RJ5A 3GROA 3F6SA 1J0CA 4XCXA 1MVLA 1V16B 2NTJA 1BXKA 1XAJA 3DKVA 1T1EA 3VYSB 1ZHFA 5L3SB 2JGJA 1IONA 4NV3A 3NCHA 5LLSA 1P7CA 2H85A 3RRMA 1KDYA 1QQAA 3ERCA 1P0FA 2Q8PA 3T5CA 3DG9A 3HRHA 2COEA 2RI0A 1ECFA 3D8SA 3FVTA 3JAWA 3MLAA 4G5QA 3QY9A 2B7CA 1FXSA 2CBGA 4A23A 1YF3A 1VLMA 3KEMA 3RVJA 3PJEA 3TSOA 5CH5A 3TCKA 5BN5A 1WOYA 5LVAA 1GL6A 3HGTA 4K9NA 1QWOA 2ATIA 3KOMA 4KNVA 3ZU4A 4RZHA 4D9FA 3UJHA 4EYOA 1Q6ZA 1S2OA 4DV4B 4NOMA 3E22B 1WV0A 2BKLA 3N2KB 3FPSA 1P1CA 2FG6C 1X6VA 1A4IA 3WB2A 1IN5A 2O5RA 3I8SA 1XQ6A 2VJCA 4D80A 1O9GA 2QUIA 2FGJA 3V1MA 2EZ8A 4YUYA 1AJEA 5HOQA 2Z1DA 2XB2A 4MIEA 2R1UA 2WWIA 3ZIAD 3CLUC 4O4HB 1X8XA 2RHCA 1J49A 2WZDA 4MMXB 4Q4HA 3TQTA 4E6EA 1XEAA 3F0TA 3OLQA 3GAFA 4XRRA 2QN6A 1MZPA 3QPAA 5JS2A 5JSFA 2WTAA 3PUIA 4BNNA 4OQEA 2NT4A 3OQJA 1TZBA 3LUFA 3P5BA 3KOZA 3BJRA 4FOPA 2VDPB 3KLPX 1DOZA 2CJWA 3ZU6A 4C0LA 2GBCA 2PRZA 4MOWA 4FFSA 4JBHA 4CLRB 5FWXA 2ZB4A 1CZRA 4DSOA 4EW6A 1YFJA 2HNAA 1QBGA 1GNQA 3BEOA 4B6QA 3IT1A 1QWSA 2O6HA 1B7GO 1IVNA 3N0TA 4G84A 1ZVKA 3CEMA 4L78A 4YFVA 5DK4A 3CO5A 1I24A 3SJAA 3DBVO 2PRIA 4QHSA 1FUEA 5CPBA 2B35A 2IW1A 1T8WA 1EK6A 3TZKA 2G3YA 2JGDA 2WOOA 4OOEA 3TRFA 1P72A 2VJPA 4OK3A 5BT9A 4D3ZA 4U5XA 4BQIA 3NH6A 4CFYA 4IYJA 2F1JA 1G8GA 2RE8A 1PBTA 1Q91A 2VDMB 4C2BA 4AL4A 2R25B 5BXYA 3H0KA 1PJBA 4L4RA 4TVSA 3A3NA 3K31A 3GWZA 3L8DA 1MRZA 1NUHA 2WYHA 3A2MA 4K0KB 1NSTA 4HPXB 4DRXA 3ZHOA 1YHZA 3X2SA 1G38A 3UJAA 5KVSA 1X80A 4RD4A 1EGVB 2VJOA 2VK1A 4MUFA 4NG4A 3T1OA 5C46F 1YU9A 4IVPA 4RQUA 3RRJA 1MAWA 3PCXA 3I9V6 5JY1A 1N9ZA 2ICAA 4R1LA 1K4MA 4QRHA 3LO5A 3PD0A 3TL3A 4QAQA 5COQA 3TD6A 3WA6A 3IE2A 2QI9F 1GCAA 2WD9A 4QSHA 3S6JA 4IZ6A 2NZVG 4Y2QA 1N8SA 2P9FA 1YHYA 1KTVA 4H7EA 4S35A 1NFQA 2ZJ2A 1L1RA 5KPJA 4PYIA 1FBNA 3PHHA 4ZYLA 1Q7BA 4TL7A 3RUIA 2ZJ3A 3IIEA 5H9VA 4NENA 1NYLA 3OZSA 3WWEA 2A2ZA 3PHCA 4RTPA 5IXYA 4OI0A 1RM0A 2XZPA 4XJXA 3ENWA 1T4CA 1M6HA 5K45A 3PYXA 4I8IA 4W4TA 3U3XA 1P17A 2VF5X 3LY9A 4GP6A 2E18A 3JYQA 1KYTA 1BS1A 2NU6A 1N2CA 3G68A 1YS6A 4MKHA 3SFTA 2A1UB 2HMVA 1FDRA 4I5IA 3ODGA 4L3WA 3T4UA 2RGEA 4MUJA 4JK3A 3T3DA 1EIWA 2ODTX 5THQA 4QOSA 5HKAA 3L0YA 3JASB 5ESXA 2BR5A 4UVHA 1VCMA 4ZXFA 3KZOA 1IY8A 1FU7A 1VXOA 4ZO4A 3G89A 3Q72A 1UIMA 2IEBA 3F74A 2JIPA 2Z5LA 5D1HA 1PWHA 1DAMA 1PSDA 4PM4A 3BXGA 3FR7A 3D1VA 5F78A 4NE9A 4JENA 2HXGA 4R16A 5JZVA 2FEWB 3RJMA 1NXQA 4L4UA 5HCNA 3KSUA 4IUBS 5C1PA 4YUVA 4RENA 1D0SA 1H2HA 2GX6A 2R6CA 1UM8A 2X8WA 4MRVA 4EZIA 3WIEA 2YY6A 4R2KA 1EGHA 3WO1A 1JR6A 2GKSA 2Q49A 2IHKA 4ZYXA 3C48A 1PZMA 2Z56A 1SULA 4IDPA 1PW7A 2XCUA 5I8ZA 1YE3A 2OO3A 1SBCA 1O1YA 1QUEA 3VFDA 5FEUA 1AMUA 1CZNA 4K3VA 2FFAA 2QUZA 2SKEA 4UCWA 3P45A 4DQLA 4FBGA 4XM1A 1KJNA 2B8WA 3AP3A 2Q3JA 3B9RA 4WBXC 3O2JA 5IVPA 4J0FA 1ZZGA 4X94A 3BGIA 5L6LB 1U3WA 2JJYA 2V8OA 4OV6B 1GKYA 1GQYA 2C95A 2VP6A 2YQ4A 3BE4A 4RACA 5EXEA 2JIDA 2VP2A 1I36A 4AX8A 4ES6A 2WIKA 2AFHA 2WSSD 4X90A 3R74A 5IKEA 2ZJAA 3TTTA 3F2IA 3MJFA 1PS9A 3QU4A 1RLTA 4YJ2B 5GAJA 4WSOA 1C30B 1U0RA 2ZI3A 1TC2A 1NQTA 4D9HA 4GR4A 5MGBA 3BZUA 1MF7A 4U0JA 1H3FA 2IGTA 4HWRA 5DLDA 3UJ7A 3M5CA 2W6PA 3U9TA 2E48A 3AKCA 2QS9A 2VEDA 2E4UA 1ESCA 1UBTS 5BV1A 2JLBA 4MWOA 4X1IB 5ENDA 1TI7A 3LS2A 1F20A 2PUGA 1NJ8A 1QP7A 4POAA 3WS7A 2WWTA 3CNLA 4JC4A 2DFKB 2I3DA 1RWKA 4PCUA 3IPLA 4IJWA 5H82A 1TO1E 2Y9MB 2NU8A 4OD0A 4RZQA 4ML3A 2WNHA 2BFFA 2NQTA 3PHLA 1R4AA 1D2GA 4MW1A 2WWRA 2UVPB 3IO5A 4GIBA 4WDRA 2CWDA 2DQ4A 2I4IA 3R6LA 4L9WA 3EIEA 1UPUA 3LKDA 2CXHA 1KEWA 1WDTA 3DA8A 1W34A 3OU6A 3PQ5A 1E7QA 1ZS9A 3AL3A 3N8DA 4XSGA 5CHYA 2PYZA 4RL4A 1EDEA 5CMLA 1E9VA 4ZZIA 1Z0KA 3DOCA 4Q3BA 3H5RA 4G5RA 4OY3A 5J23A 3D6JA 3STHA 3D7NA 1QIFA 3I09A 1FLVA 5J40A 1AK2A 1MQ9A 5SZKB 1TQ2A 4B43A 2IDKA 3TLCA 1MIHA 5JH7A 3Q8LA 2FE4A 3U7RA 1YZLA 2Y1KA 4YACA 5E9AA 1E2HA 1QMPA 2IYQA 3I5MA 2Q4DA 3KSMA 4ZI5A 2K5UA 1R5OA 1VP3A 1G5RA 4Y2RA 1IMOA 1JQJC 1NM5A 1XTVA 3O9VA 3O8OB 1DOHA 2BWJA 4TLAA 2SKDA 4HQRA 5KSWB 4I8DA 4J0QA 1JA0A 3KIPA 1OH6A 1YU6A 3WBBA 1GLVA 1NW3A 4MRPA 2PUTA 4KXVA 4BB6A 3VSDA 4MLDA 5C7LO 5MN4A 3QMMA 4LV5B 4PZ0A 1XD2A 4AXXA 3IAUA 4Q4DA 3VDRA 2QMYA 2YWJA 4QYTA 3TBKA 5HQTA 5L9AA 1VSBA 3U81A 1KO5A 1NJSA 3ZVLA 2Q9CA 3MBOA 1I32A 3QVMA 1CF2O 4G1CA 4OUKX 1Y63A 2UAGA 4OLFA 4WY8A 3RWBA 2WKWA 3FX2A 1QPBA 2AFIE 5KEIA 1R7RA 2HQBA 1EBBA 4O4JB 4MDHA 4TKZA 1CB0A 3DDSA 3T7SA 2CYCA 1U0OC 4L5BA 7ABPA 4XYBA 1VCHA 3DKIA 3K2QA 2O7SA 2Z6VA 3S7TA 5CCEA 2HIGA 1LUAA 4LJSA 1OX4A 1JJAA 4NCHA 3ZCQA 4EKDA 4NCBA 1WNFA 1XQ1A 1YNSA 4I6JA 4RELA 1XZJA 4NF2A 1XAIA 1U0BB 3AC0A 4GECA 5ETJA 1U02A 5DISB 3TW8B 3FYCA 1BVRA 3NYIA 3WKDA 3H17A 5ICGA 1T1JA 4DMFA 4ZI7A 1IZZA 5HPYB 1ZPDA 2Y1LA 5AKYA 1L5NA 3CUUA 2OCKA 1IBRA 4YP1A 5C8XA 3W5DA 4S24A 1HNNA 1T6YA 1A8SA 2GWHA 2NIPA 4QJ3A 2WYVA 2VH2A 4DJ5X 3W7AA 3ZWDA 2J9FB 3D2LA 3T52A 3W9YA 4DBZA 3HCBA 3A04A 2DHRA 4Z9YA 3PZRA 2RH5A 4DY4A 5CTAA 4EHFA 4LHEA 1Z4OA 3KUDA 1E6WA 3KHSA 1J22A 3OQIA 2QYSA 1PEKE 1HZJA 1VL2A 3RRFA 4BP8A 5HCIA 3BH6A 3LECA 1KP2A 2QTVA 5BOSA 2GXQA 4R4JA 4KQIA 4LOIA 2IHTA 3GDWA 3WWCA 3K6SB 1P0PA 1UXIA 2BGMA 3ETNA 2RHBA 3AI2A 2I6SA 2ZDGA 4WNAB 4DAOA 2D4AA 2J6IA 2GBLC 2QRPA 3GRKA 4DGSA 3MSCA 2Q6TA 3JW8A 2X0JA 4N01A 1SUWA 2V0CA 1II0A 2VA8A 5K4HA 1R4ZA 3PQ4A 3O8QB 2RJOA 5JDCC 2YV3A 4BPBA 1SR8A 2EQAA 2GHTA 1SURA 3FZGA 2WSYB 2O8NA 1FYXA 1XCGB 5CA0F 2GZ1A 2B98A 3ZDRA 3IESA 2P90A 4JROA 3GFSA 1MEJA 3FYDA 4PG5A 5TS2A 3AI1A 5DNDA 1CY7A 1QHIA 4JLVA 2IYPA 2O05A 3C85A 4TPKA 4BGEA 1GU1A 4OM8A 4CM8B 1JXQA 2YJ4A 4CQLA 5ALZA 2Q3FA 5DTMA 3H05A 3PPXA 3FOWA 4ARZA 4KO8A 1ISFA 4PBRA 1JEDA 3OVMA 1Z75A 4XM2A 1ODFA 5GV7A 5A1TA 2X7HA 4MV5A 1KJIA 4UTZA 3EIXA 3HYNA 1P3Y1 1TECE 3F6PA 2C8KA 4O2BB 2ZEJA 3IVRA 4Q1AA 2ZYDA 3SLRA 2HYIC 4TRNA 2XUZA 2V6IA 1ISPA 4IKOA 2PKYX 3RK4A 2AUTA 4GYYA 3WIDA 3KELA 3VPAA 3ZDDA 3D2CA 5DYGA 4KI7A 1O5TA 1VYHA 2VSXA 4M7PA 5AMXA 1LD3A 4INJA 1OJLA 1IOZA 1BD4A 1C8VB 4BX9A 1T36A 2BCGY 3SZGA 3NEAA 4GHWA 1V1RB 3EZNA 2F8LA 1EWVA 1FUUA 5TPWA 4HNTA 3TOSA 1YACA 1Z22A 2AW5A 2X4GA 3AF3A 3Q85A 1VMEA 4J1TA 1T29A 4PAWA 4UM8B 3AM3A 4UMVA 2W2XA 2BR4A 4QPZA 1ODIA 1BX1A 2HQOA 2FOLA 3HCWA 5C7IO 1E3EA 2NUTA 3RSCA 1UJCA 3UAWA 2Q5CA 1JIQA 3I42A 3NAGA 4G4IA 2FP4A 4CU2A 1DBSA 1U94A 3E5RA 3IIKA 1XIVA 4V3CA 1E89A 1UOEA 2QD1A 3MTDA 4DQDA 2QRHA 1GL3A 3UWOA 4CKBB 2FMUA 1J7KA 2VAVA 3MUNA 4INOA 1E1QD 1N9GA 1Q1EA 3V7WA 2H7CA 3I8OA 3BC1A 5K8LA 2QVXX 1QCCA 3RC8A 4FVTA 4YAIA 4URVR 4TTRA 4GXQA 1SBTA 2GVZC 4N7RA 4EY7A 3VDXA 5JJIA 2X6TA 2COKA 2X9LA 3H4IA 3IV6A 5AVUA 2VZ0A 4GXTA 3FCAA 2W4MA 5IP5A 2BZ1A 2OC4A 4WQMA 4AKHA 4HYYA 4GEGA 4ER3A 4GOLD 1MAVA 5K03A 2E82A 3A4YA 1WZCA 3SIRA 4L75A 1XEXB 2QP3A 3MS2A 3AGPA 1U0NA 2A1TS 3DE4X 3ETLA 4JMPA 1YJCA 2EU8A 2QTHA 4JLAA 5DU2A 3VHXA 1E3WA 1N3LA 3GCZA 3IEIA 1JECA 3AHIA 3AESB 4B2LA 4FMCF 4G25A 2V3WA 1U7HA 2O4UX 3OT5A 2CDRA 2NUPB 5EKTA 1WF6A 3CVWA 2ADOA 2VF2A 4KYUA 4BN4A 3O0DA 3HXLA 2APJA 1M8FA 2PZGA 3OMWA 4TVKA 4WXEA 3WY9A 1S8AA 1VHTA 4NYMR 4QHYA 2ZQYA 3HYTA 1DV1A 4DV5B 1RBQA 3A9TA 4FCWA 2Q0XA 3QNWA 5DHSA 4GR5A 4KVAA 2GO7A 3S2ZA 4OAQA 2FR0A 2HGZA 2HPHA 2MOKA 3LRPA 4KFCA 3ELUA 4HNAA 3DHWC 5DWQA 1K27A 2AEMA 2VDVE 2D3WA 2WWXA 3EXEB 4G1FA 4MPRA 4R0MA 1AMNA 3FUXA 3A28A 3I5AA 3C8HA 3KPVA 4G26A 2Y9PB 3D59A 2EFHB 2EYQA 3EF3A 3UK1A 1M0TA 3BAZA 2CD9A 1DQYA 1OFGA 2H9YA 2C29D 4XR9A 5DP1A 4YQFA 3Q0TA 3BL5A 2OFXA 5DCYA 2H4WA 5A71A 1LNQA 1SRQA 3B7GA 3L49A 3DR5A 1KMMA 3L7IA 4PGGA 4I3HA 3ICEA 1KERA 1R9GA 3ZI4A 3H3JA 4C0XA 3GBVA 1QC5A 1T24A 4RTSA 1ZGBA 4I99A 3FF1A 4NZNA 3VTFA 1DKLA 4GXRA 2CXNA 3WMGA 1KIMA 2AWNA 4NZMA 3L1VA 1OLUA 2CZGA 4XD7D 1FE8A 2XYRA 4OGWA 1ZJ4A 4HMQA 1SOUA 4IMRA 1LRJA 3VR4A 5F2KA 4BLRA 4E5KA 1QH1B 2A9KA 3SS7X 5GOTA 1YVPA 2EJCA 2B3TA 1IN4A 5E3JA 4F45A 1IHDA 5JCXA 2B5VA 4RPLA 3GRVA 1OXUA 3IALA 1PNVA 3I34X 4KFRA 4W5WA 4QDKA 1IATA 2QZ9A 2RBEA 3QBEA 2IYNA 5HUJA 1LQ2A 2O06A 8AT1A 2HBQA 2EKDA 2QJTA 3RYFA 2I33A 4EQ6A 3HM9A 1VMIA 5IVHA 2JLXA 4ACBA 2GS9A 1CT9A 3COVA