1OAAA

Mouse sepiapterin reductase complexed with nadp and oxaloacetate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
259
structure length
259
Chain Sequence
b'ADGLGCAVCVLTGASRGFGRALAPQLARLLSPGSVMLVSARSESMLRQLKEELGAQQPDLKVVLAAADLGTEAGVQRLLSAVRELPRPEGLQRLLLINNAATLGDVSKGFLNVNDLAEVNNYWALNLTSMLCLTSGTLNAFQDSPGLSKTVVNISSLCALQPYKGWGLYCAGKAARDMLYQVLAAEEPSVRVLSYAPGPLDNDMQQLARETSKDPELRSKLQKLKSDGALVDCGTSAQKLLGLLQKDTFQSGAHVDFYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEPIAPTERIN REDUCTASE
molecule tags Oxidoreductase
source organism Mus musculus
publication title The 1.25 A crystal structure of sepiapterin reductase reveals its binding mode to pterins and brain neurotransmitters.
pubmed doi rcsb
total genus 96
structure length 259
sequence length 259
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 1997-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1oaaA00
1CWUA 1W6UA 2AQ8A 2R00A 4P8RA 4IMPA 1Y81A 1G1AA 1MC5A 5BNTA 5THKA 1KVSA 3V1TC 4DXHA 2XPCA 3G1UA 5JCXA 1V0JA 1U8FO 1XCBA 4L74A 2DBZA 1KC1A 1LX6A 3JQDA 3V2HA 4YTEA 1DJQA 1TT7A 2YDXA 2D2IA 2OBYA 2WE7A 1MUUA 3JYLA 3P7MA 1YS4A 1Y8QB 1T2DA 2VT2A 4YJHB 5HBRA 1XSEA 4O5OA 1E1NA 2EEZA 3MOGA 3PYMA 2AE2A 4CUKA 4M55A 2EV9A 2BI7A 4U0JA 4OGWA 4J1SA 2RBEA 1YOVA 4TROA 4TWRA 2VZ9A 2EG9A 4MINA 3B1JA 3ST7A 5IZCA 4DC1A 3AY3A 2PGDA 3ANNA 4Q3BA 4TRRA 4XDYA 4BKRA 1L7EA 4J91A 4CMHA 4NBVA 2OHXA 1PJCA 2PZJA 4E5KA 3GH3A 1IE3A 4L0QA 1JDJA 1LQTA 3RFXA 2P9GA 3ZI0A 2BD0A 4AJPA 1KY5A 4FSHA 4IIUA 3AJRA 1PS9A 2O7SA 4OQYA 1KC3A 5C3MA 3NT2A 5JO0A 1KERA 1GV1A 3FCOA 4CM5A 3ZU5A 1LSSA 1Q0LA 3DHEA 5IG2A 1EVJA 1GPDG 1PGJA 1RWBA 2VCYA 4UUPA 2X22A 3GOHA 1SBYA 2QRJA 3HWRA 1P0FA 4RF2A 4B79A 1X7HA 3JQAA 3PTZA 4II3A 2X0NA 5EPOA 4NU6A 4NQZA 3VTFA 3KLMX 4CM9D 1X15A 2J6IA 5EQFA 5FFFA 2Y0CA 4AG3A 1IOLA 2AQHA 4BGEA 4ZQGA 2PV7A 1JA9A 4ALKA 3KEOA 2ZIZA 4DIOA 3ANMA 3P19A 4CL3A 2NV6A 1ZKMA 1QYCA 2PGJA 1DPGA 5FF9A 4F45A 4MP3A 1RJWA 2AW5A 5T57A 3INRA 3JQ7A 4YT8A 5F3RA 3H9EO 2EF1A 1XU7A 3NV9A 5JW6A 1DHRA 1EDZA 1DHTA 1P1RA 3V1UA 2B83A 4PLFA 1ONPA 2BRUA 1YVEI 3SVTA 1ML3A 3KBOA 4HP8A 5EMHA 1N2SA 5BNFA 4EEZA 1Z7BA 3N58A 3W4IA 2C2YA 2EGHA 1F8FA 3M6IA 2PWZA 4AJHA 1DIBA 5U9CA 4WLVA 2VHYA 5A04A 2LDBA 3KRTA 1VKOA 4WLFA 3NKLA 3RQSA 4GLOA 1ONOA 4GSKA 3EC7A 3UAGA 4NFSA 6LDHA 1OFGA 2W2KA 3DZKA 1IHYA 3R0IA 1O9BA 2XXBA 3U4HA 3MOIA 1HDZA 3WGOA 3M1LA 1C0KA 3RBXA 5DT9A 4HX5A 4PG4A 4GBJA 4D3SA 5JO9A 2CSUA 1GADO 2X86A 1HL3A 1TEHA 3DAFA 3GZNB 4FJ0A 5A9TA 3PPIA 4Q3AA 3WDSA 2VRBA 2HK9A 4IZHA 3E82A 4P4NA 1CJCA 4WUVA 4G65A 1R0KA 2QZZA 4NG5A 2AMFA 4RPLA 5IDXA 2RHCA 1PL6A 4YRDA 2CDBA 3CIFA 3RBVA 3ZWVA 4I5EA 4BV9A 5IDWA 3ETEA 4FC6A 5TRTA 1T2FA 4ZGWA 4NJMA 3N74A 5I7SA 3ZCXA 1VL0A 2EJVA 4EITA 3GAFA 4PGFA 4XGNA 1Y5RA 4AJKA 4BGIA 1B8VA 5DDIP 4JBIA 1NFRA 2O3SA 3G49A 5JCJD 4BKPA 3WJ7A 4PZDA 4DIFA 2QQ5A 4GWKA 5GZ1A 2D1YA 1ZK2A 3WBFA 1B7GO 2XAAA 3IJRA 4CM4A 4D46A 3KYCA 4XIYA 2C7GA 3GMDA 2QX7A 4URFA 3WGQA 4WOKA 4PLTA 1UZNA 3DBRB 1HSOA 4BO1A 1MG5A 3JD3A 2GF2A 3NRCA 3RCBA 2VYNA 4J4BA 3T4XA 5L53A 3OETA 4NZ9A 5KVVA 4CR6A 2PTGA 3DEYX 1QKIA 5ADHA 1PJ2A 3EAGA 3UH1A 5A4DA 1NFQA 4FOOA 3SLGA 5JMWA 4FFRA 3IP1A 4S1VA 1HYGA 1SNYA 5ES3A 4BO2A 4C4OA 1BDBA 2JCYA 2PH3A 4D42A 4CMCA 5JDIC 4YB8A 3D5TA 1DIAA 1DLIA 3IC5A 2NTJA 2ZQZA 3H4VA 5AXBA 4QUKA 4DREA 4MVJI 1JKFA 1MXFA 2J8ZA 3BAZA 2Y93A 4MVJH 1G0NA 3MZ0A 4I9HA 4U5QA 1DBVO 2HJRA 4CODB 2NUAA 4QECA 5CEJA 3K92A 3L07A 4GL4A 4M87A 1GD1O 3JQ9C 4OM8A 1K5HA 1QXSA 1UZLA 2GCGA 4JXKA 4H16A 2PKQO 1KVUA 4S3MA 3ONEA 3BHJA 4DBVO 2DVMA 3I3OA 4MO2A 5CDSA 1U4SA 4NMHA 4OL9A 4CLOB 3ON5A 2OUIA 4ESOA 1PGOA 1YBMA 3EW7A 1N8KA 3AW9A 3Q2KA 5F1OA 3LC7O 1QSGA 5HTOA 3GT0A 4AL4A 4LMPA 4CUZA 4J6FA 2ZTLA 4O59O 1F06A 1UAGA 4EI2A 1I30A 1DFGA 1EEHA 4E0BA 4IS2A 3TWOA 4OKNA 1NQTA 1W0CA 2VUTA 1DC5A 3U4DA 5DBFA 1P77A 3BMQA 3IAHA 5CAEA 2YV2A 1PJLA 4ZRNA 1YBVA 3HNPA 4JP2A 4UVDA 4Z0PA 3CPSA 4EYEA 2XF8A 5JDCC 3V2GA 2G17A 4CR8A 4FFOA 4JN6B 1UXJA 1I3LA 3GLQA 1R66A 4R1NA 2IEDA 2FPPA 3RSHA 1T2AA 5L40A 4CMGA 1EMDA 2EIHA 3TQHA 2UUOA 4BOYA 5F5LA 2W4QA 3JQBA 5A9SA 2Q1TA 4MP6A 1CQIA 4KWHA 1ZK3A 3PQDA 2D59A 1LSOA 1WMAA 2WD7B 1Z6ZA 2PNFA 1MFPA 2NTVA 1HYEA 4CMEA 3LT0A 2B37A 2DAPA 3C8MA 3KSZO 3RUFA 3I5MA 4IJWA 3T7CA 2EP5A 1HSZA 2XOXA 4WKGA 5F1PA 1YDEA 1VKNA 3WTCA 3K30A 2GLXA 3OECA 5T67A 4CQMB 3ULKA 2J5KA 3JD0A 4K1LA 4KTTE 4R1SA 1U3TA 3S2FA 2Q45A 4RLHA 3KYCB 3JQAD 5A1TA 3TJRA 3ZH2A 4JNKA 2W2LA 4J4HA 3HUDA 2J3JA 4DGSA 1PS0A 2DUUA 1PSDA 3TOXA 4BUCA 3WSVA 3E9QA 3ZV6A 4BO4A 5ICMA 1ARZA 1WZIA 1TI7A 1XLTA 4BNLA 3LYLA 4DRYA 2EXXA 4Z0HO 5TF4A 4BNXA 2ZATA 1GTMA 4ZD6A 2Q4EA 4CMIB 2IXBA 3GNSA 3GVXA 4NU5A 2DQ4A 5L4NA 3OIFA 4U6SA 4D0SA 2VTDA 5TC4A 4HADA 4RVGA 5CPFA 3UUWA 5JE8A 3TZQA 3ZN2A 2PZLA 1Y8RA 4Y6RA 4XIJA 3L4SO 4H3VA 1Z75A 4Y6SA 4BNUA 1PZHA 3VAZA 1GQ2A 3HB5X 3K2BA 5AXDA 2O3QA 2O3RA 2G5CA 1E0DA 3MJCA 4JBHA 5JLAA 3ICPA 2G76A 1LDBA 3JQFA 1GCUA 1AXEA 3W8FA 1M76A 3HDYA 5TNXA 2J5RA 5I7FA 3WS7A 2DPGA 5L9AA 4JJFA 3RUCA 1PWXA 1PZGA 2GDZA 5DCWA 1R6DA 3KXDA 5L7TA 4GMFA 3DR3A 5IDQA 3GGOA 5KJFA 1B26A 1QMGA 4L9RA 2X0RA 2NM0A 2DLDA 2J3IA 1C14A 1D1SA 1FDVA 4IQ0A 1OC4A 1UXIA 4FFLA 4KQWA 5AYVA 3QA9A 3INTA 3ANLA 2E82A 4E2XA 1NVMB 5I8WA 3JQGB 5L7WA 3GG2A 1Q0HA 1XQ6A 1LU9A 1ZIDA 9LDBA 1U4OA 1LDNA 3VKUA 2PKQP 1A9ZA 4Z3KA 4NHEA 2X9NA 1B2LA 3ZNNA 1SOVA 3KM0A 1PQPA 1P0CA 2C59A 3NTOA 1NAIA 3C1OA 4QFCA 3OMLA 5CEEA 5L51A 4RJTA 1P9LA 3CMMA 1X1TA 2PLAA 3MJVA 4NPCA 4FOSA 4J3FA 1DAPA 3OJEA 1HZZA 2HRZA 1GZ4A 2WTBA 1E6UA 3KSUA 3SX2A 3PZRA 1RPNA 2JD1A 1E1LA 2GZ2A 3RC1A 1YGYA 4CM1A 4LSWA 3NJ8A 4YXFA 4LMRA 4GX1A 2X5KO 1NHWA 2IODA 3RKRA 1ISMA 4G5HA 2G82A 3STHA 2X1HA 5ITWA 3NGXA 3L6EA 4MJLA 5TSDA 3L6OO 4ALLA 4M86A 2RH8A 4I5DA 1ZSYA 3KB6A 5LCXA 1ISFA 5COAA 3ASUA 1T26A 3KYDA 1WZEA 1LDMA 1EFKA 2WWRA 2H6EA 1BW9A 2CVOA 3VDRA 4M8SA 3GZNA 4B4UA 1R37A 4XRGA 5BNIA 3MJEA 3O4RA 4FD3A 2NQTA 1B14A 1M67A 1E3SA 2D3TA 2BHLA 4BO8A 3FHLA 4X54A 1U1IA 3KO8A 3OEYA 4LVUA 4CLRB 4WLEA 4B7XA 1P74A 3E5RA 4FR5A 1DRVA 1FDSA 1LJ8A 2HK8A 1SCUA 2GYYA 4J7UA 2ZJ1A 2I76A 4YYZA 1U3VA 1RM0A 2GR9A 4CMBA 4DUPA 1UP4A 4HKTA 3TDKA 3ZHBA 4J7CA 3ZW8A 1C1XB 3RUEA 3MJSA 1QYXA 2DTDA 3ENKA 4XQGA 1HETA 4XYEA 5I7VA 2D4AA 3WG9A 3ITKA 5K9ZA 7MDHA 2ZTVA 4XB1A 1EUCA 2VWQA 3C24A 2X9VA 4KUEA 2YFQA 1H6AA 1BHSA 1Y9EA 2RCYA 1ADCA 3Q3CA 3WGZA 1OOEA 4FW8A 3AI1A 3JQ7B 1JAYA 4J0EA 2RHRA 3UCEA 2H1SA 4A03A 1LEHA 1YWGO 3MTJA 1V3UA 1YB5A 1E3LA 3FR8A 2I67A 2R6JA 1GY8A 2IZ0A 4AJIA 1BDMA 4YRBA 2JD0A 3FNEA 1V3VA 4R5MA 4IXTA 3ZWWA 1N92A 1ZO8A 1YH3A 4PLCA 4E30A 4Y6PA 2EHDA 5DP2A 4F6LA 3JQGA 1ZBQA 2PD3A 4J9UE 4RDHA 3WQQA 2VOEA 1QV7A 4E3ZA 3O8QA 3ZWOA 2G1UA 4DMLA 1IYZA 3D4PA 2Q2VA 4PLGA 2LDXA 1HF3A 3PGXA 4E5PA 1XELA 4CM8B 3HDQA 3I6QA 2CZCA 1E6EA 1I33A 5ER6A 1B0AA 4HFMA 1VL6A 4XX0A 2YW9A 1M75A 2ZB8A 3LQFA 4ZA2A 4LISA 1FDWA 1A9YA 4BNTA 1VJ0A 3UVEA 3L0DA 3L6DA 3JYPA 4N18A 1DC4A 1NAHA 1WXDA 4OXNA 1R0LA 3PDUA 5KTKA 1R4NB 1P3DA 1HT0A 3RUAA 2F1KA 1FMCA 2Y05A 1JKIA 3H3FA 3MCVA 3DTTA 3F4LA 5EJ2A 2IDZA 2G0TA 3BMCB 3BXXA 3D5QA 4K28A 3ASVA 5F21A 3G17A 3GA0A 4BB5A 5KCZA 4YAEA 1D1TA 2YV1A 4NR0A 1Y7TA 3RROA 2JFGA 5BSEA 3GN1A 3LF1A 3U62A 3HADA 3O8QB 3LK7A 4WJZA 3OFSA 4L8VA 2ILTA 3CSDA 4K6FA 1VM6A 2UV8A 1GYRA 4B4WA 3MJ4A 4HWKA 5CDTA 4YQZA 1E1MA 3LT4A 3AOEA 2WE8A 5FYDA 1BRMA 2B4RO 4TZKA 2OZPA 1N7HA 2H63A 3QV1A 1ENYA 2P9CA 4BGVA 3CUKA 3B1KA 4PFJA 5H82A 4D45A 5EESA 4P22A 2JFFA 1PS8A 2W2LD 3Q2IA 3AFNA 1NASA 1DXYA 3TL3A 1K89A 4AJ2A 2R00C 2X0IA 2CUKA 3ZWNA 3WBBA 3A14A 5KOIA 1LTHR 1I5RA 3GN2A 2OORA 2OXIA 2DUWA 2I3AA 2UDPA 3QVOA 1VPDA 2EKLA 1DIGA 1JTVA 4OYRA 4TRMA 4CLHA 4N54A 1BW9B 1O0SA 2Y1EA 1V9LA 5LDGA 3VPHA 2Y1OA 1LLDA 3VH4A 2P2SA 3C3XA 4B4VA 1RM3A 2ZYGA 3QE3A 1PR9A 2I9PA 4BNYA 2GN6A 1HZJA 3OH8A 3GVHA 3P2YA 1GCOA 4XRRA 4E2YA 3GAZA 3FWZA 1GYQA 5U1PA 1TT5A 1WW8A 4N7RA 4TKMA 3W4KA 3PDJA 4XYGA 2VYVD 5L95A 1U7TA 4K26A 1KOLA 2X5JO 4D3DA 3ZU3A 2I99A 1YB1A 3CE6A 3E18A 3PVZA 2BFOA 4E31A 2ZKLA 2FPIA 2ZTUA 4EBFA 4NI5A 5JDCA 1HEUA 2YYYA 3H9JA 2JD2A 4JJGA 1QP8A 4UUNA 1T1RA 1EDOA 2GN4A 3D4OA 1DIRA 3F1KA 1CF2O 3RFVA 4HUJA 1OC2A 2ZB3A 4ND1A 4QO8A 4RVDA 2UVDA 4NBTA 2FOIA 5HM8A 2ZYDA 1YO6A 4PLZA 2B4TO 3N7UA 2GZ1A 2P91A 2HMWA 1UXHA 4HNHA 2FSSA 2X4GA 4DIBA 3H3JA 1F14A 1ZEJA 3GY0A 1A27A 2FMUA 4RVFA 5T64A 1GEGA 5K0ZA 1AHIA 5IDYA 5EN4A 2FSVA 1ISJA 4OO3A 2P5UA 1H9BA 1BVRA 4G81A 1VI2A 5FI5A 1X0XA 4YJFB 1N9GB 1U3WA 3BMCA 2QZ9A 1Y9AA 1NWHA 2GD1O 5ENVA 3I9MA 2RAFA 4E6PA 2W8ZA 4CL8A 3WB9A 2VHZA 4ZVVA 1O94A 2C7VA 3PHGA 1E3WB 1UR5A 4NIMA 3VPSA 3WGTA 5H81A 3U4CA 4FDAA 1PZFA 4JGBA 3RUDA 3WYCA 1YL6A 1O5IA 5JAQA 3S2EA 1M2WA 3PJFA 4BV8A 4ND3A 3L9XA 3H6KA 3NTRA 4KOAA 4NBWA 1WAMA 4Q39A 3TOZA 3PEFA 2WYUA 1I2BA 4GH5A 4FJ2A 2GSDA 3UXYA 3JYOA 1Y8QA 3PK0A 5JYDA 1E7SA 4B3HA 2X58A 1ZSVA 4RF4A 5C7OO 3F46A 3IIEA 1IPEA 3PI7A 1HWYA 1GQQA 1C0LA 4YAKA 3KZVA 1R4MA 3Q11A 3EZLA 1E7WA 4GX5A 3AM5A 4NBUA 4R16A 3FTNA 4YAIA 3VZPA 4R3WA 2BGMA 2GZ3A 3FRJA 3LT2A 3DBLA 3JV7A 4D43A 1D4FA 2V6GA 3BTOA 1P1FA 2V65A 2FHSA 2HRBA 4LCJA 4OHUA 1Y5MA 3QVXA 5JPIA 5JC8A 4AFNA 2YUTA 3OA2A 3ZWXA 1ENOA 2A94A 3FF4A 4TVBA 1KS9A 3S1LA 5B4UA 3F6YA 4JK3A 4NBRA 3RIHA 4NFHA 3DBVO 3BMOA 3KHUA 4MVJD 3EMKA 1A72A 1DSSG 3LDHA 1JKJA 4YT5A 4J43A 1N7GA 3VZQA 4BNHA 1OAAA 1HLDA 1NR7A 1KBZA 1UP6A 1EK5A 3NUGA 4A27A 4B8WA 1MA0A 1ZJYA 3I9OA 3ICCA 2VHWA 4AJNA 2V6MA 3GGPA 3E6AA 4LSMA 3UOGA 4BQRA 1E7YA 1DDOA 4DWVA 4GVLA 3V2UA 3D7LA 3FBGA 1U28A 2CY0A 3H2SA 4KMSA 4OOEA 1H9AA 1H93A 5B37A 3F1LA 3AUUA 4LGVA 5T5QA 3VOSA 3WMWA 2VHXA 4E2WA 1C3VA 2BGKA 3EDMA 3QLJA 1S7CA 1U7HA 4E2ZA 4CM7A 3GVCA 2DBVO 4H7PA 4FJ1A 4CLEA 1PX0A 1EK6A 1W4ZA 2JHGA 5DF1A 3A4VA 2CDCA 2A9FA 5FEUA 1EQUA 1LLQA 4R9RA 3S55A 1A4IA 4I08A 4IZIA 4J2OA 4EUHA 1XWFA 4EJMA 3ZWMA 1ZH8A 3QIVA 4R54A 3ETGA 1YQGA 4YAJA 2GUGA 2UAGA 2I3GA 4YT2A 1KIFA 3H9UA 3OF2A 2AE1A 3X2FA 2DPHA 1XA0A 4WNIA 1BWSA 3OEWA 3R1IA 4U7WA 3CTMA 4RZHA 3H65A 1QV6A 4I5FA 1B3RA 2O2SA 3UHAA 4YRAA 1Q7CA 3K5PA 4TVOA 3ZWBA 5JXWA 5CDGA 3FPLA 3DBRA 3TZCA 5LC1A 1Q7BA 2Z5LA 4DPMA 4II2A 5DBGA 3DC2A 1T2EA 2OBNA 2VUUA 4KUHA 4RPKA 4AJ1A 1DFHA 2Z1NA 3CKYA 1XDWA 3HQ4O 1QR6A 4QEDA 1VRWA 3WWZA 3DXFA 1EVYA 3AUSA 3C1AA 1YQXA 1EBUA 5IN4A 4NK4A 4CMJA 1NBOA 3C7AA 4BNMA 4GGPA 1EVIA 1CEQA 3DL2A 1BXGA 3V5NA 2I5PO 3UICA 3EK2A 1WLYA 1K6JA 3ZNQA 1NNUA 3CXRA 3JD2A 3SBOA 1LLCA 1P33A 1DC6A 3DTYA 1IPFA 1KY4A 2P68A 4RV9A 1P31A 2OFPA 2YHIA 3GDFA 3KOUA 4E5NA 4GQAA 3FNHA 4BO7A 2VN8A 1HRDA 3DMTC 4ZQHA 3DFZA 4BHTA 1QORA 3OJ0A 2JCXA 3VC7A 4AJ4A 4GI2A 5DN9A 1YOVB 2BLLA 3G3EA 1V8BA 1ZK4A 4IGFA 4I9UA 3IUPA 4R4JA 4CQMD 3IKTA 5HWSA 2NNLD 3FR7A 3PIDA 4D41A 1KVRA 2Z95A 4N5NA 4GX2A 4ALIA 3OP4A 9LDTA 5U4QA 4WCFC 1H2BA 1R4MB 4E21A 1W73A 4IJVA 4JBGA 4MIEA 5A5EA 3GEMA 2HKIA 3IUSA 1Q1NA 3PJGA 1K6IA 4AJJA 1B3BA 1FDTA 4R68A 3COSA 2YZ7A 1EE2A 4DPKA 2JJYA 1LDGA 4D79A 1HDYA 1ZMTA 4UREA 2DC1A 3WNVA 1AGNA 4M54A 3D64A 4OXYA 4HY3A 3WQRA 3DWFA 3WXBA 4F46A 3EYWA 2E49A 3BTUA 3WGHA 1SOWA 4YJGB 4J90A 3I1JA 1MFZA 2C54A 1V35A 1PWZA 2HLPA 4L76A 4LN1A 3DZBA 4XR9A 1HXHA 3I9NA 3W4JA 2VT3A 1PGQA 3TSCA 4IM7A 2QRLA 4NJOA 3KSDO 2Y1DA 5AVOA 3K31A 4RPHA 1ENPA 4E13A 1F17A 3L77A 1CIVA 4Z9YA 2DTEA 5KVQA 3ZWCA 2C07A 4BO6A 2P4QA 4XYMA 1P1KA 3HN7A 3PP8A 2PD4A 4NDNE 1ZJZA 4PZEA 4FCCA 2GNAA 2Z1MA 1AUPA 4P4LA 5L4SA 4MOWA 4MKZA 1ZUD1 3ABIA 2AG5A 1BVUA 5DULA 4ZU3A 3AWDA 4TQGA 4BQPA 1SMKA 2AHRA 1LC3A 4IIVA 4RZIA 3ETDA 4W7HA 1PIWA 1YJQA 4PIVA 1WDMA 3VPXA 1KEWA 3L9WA 1K6XA 7ADHA 3RASA 2Q4BA 3VZSA 4CV3A 5A03A 3K9QO 2E37A 1H6BA 4GKVA 3CZMA 1VC2A 3ROQA 4RVSA 4H15A 1M66A 2ZTMA 3CMCO 4J49A 5L3ZA 5IXYA 1NYTA 4CPDA 1I8TA 4IY1A 3INGA 3C7CB 5GY7A 3IMFA 3PFFA 3GVIA 1ZMOA 4XJSA 4ND2A 5TX7A 3S8MA 3GNTA 3JD4A 3K73O 5J23A 1VJTA 4GKBA 4ILKA 4DQVA 4YCAA 5EINA 3ZNOA 1Y8RB 2JAPA 4UEJA 2WYWA 1WWKA 1O8CA 4P38A 4MDHA 4EDFA 1NVTA 3OQ1A 3HFSA 2EW2A 4WCFA 3D3EA 4CM8A 1VJ1A 2OP0A 2PFGA 3WYBA 1BTOA 1NQOA 4J4TA 3WLEA 4B7UA 4CMIA 2VNAA 4LW8A 3PYLA 5K6AA 1SEPA 1YL7A 3NGLA 3NDJA 4A2CA 2HMTA 3I4CA 1LA2A 1MP0A 1U9JA 4R1UA 2XXJA 3DMTA 2FWMX 1H94A 3B70A 4FFPA 1I10A 2HMVA 4QT0A 4I1IA 3VH1A 4FN4A 1ENZA 4Y9DA 3HG7A 1ULSA 3TZ6A 3PHHA 3TFOA 3QQPA 2YV3A 2E4AA 2VNSA 3SXPA 5CDUA 5DCUA 1R15A 1IB6A 2GN9A 2ZCVA 3PQFA 4GPD1 3UCXA 1UP7A 5A3JA 1N5DA 2AEFA 4WEQA 1HE4A 5A06A 4BNVA 1SAYA 2FR8A 4BMSA 3GHYA 2C29D 4BNNA 1QYWA 3BTSA 1QLJA 2A4KA 4C7JA 5AXAA 3MJTA 1BXKA 2ZJ0A 3ZZNA 2DTXA 4GMGA 4IMRA 3RI3A 4U0KA 4TZTA 4UULA 1I3MA 1W8DA 3VHRA 2VYND 1AN9A 2HQ1A 3A1NA 4Z3DA 1ISIA 1HYHA 4QX6A 1Z73A 4KTVE 3V8BA 1DJNA 2GGSA 2VWPA 1ZXLA 1L7DA 2X7HA 3EUWA 5IZCC 1GUZA 1T25A 1YXMA 3BTVA 3LLVA 4HFJA 4GAEA 4CLOA 3JD1A 4M1QA 5JSFA 5KJ6A 2GERA 4WK6A 4DA9A 4XWYA 1BG6A 1ZNQO 1I0ZA 3BMNA 2WJPA 3DOCA 3WIEA 1JQBA 5L45A 3DMYA 4GVXA 3LF2A 2CNBA 1E5LA 1CRWG 3FNGA 2R2GA 5TLSA 1H6DA 4R9SA 4JIGA 5ER9A 3C85A 3ITDA 4FPXA 3ROMA 3DBHA 4O63O 1JVBA 3VDQA 1E5QA 3GUYA 1SZJG 1E3IA 4WPGA 4CM6A 3QWFA 3OA0A 1DC3A 2QYSA 5JAIA 3DOJA 2P5YA 4CJXA 3AUTA 3U0BA 1C1DA 4E33A 1B8UA 4TKLA 2PK3A 3AU9A 3PWSA 1OZAA 4J7XA 4YWJA 2D5AA 4INAA 4XGKA 5THQA 2J3KA 4Q3NA 4E5MA 2CD9A 5A9RA 5FWNA 1XR3A 4W9NC 5G0UA 2JCVA 3WGYA 4Y98A 3OSUA 2NQ8A 1F12A 2WYVA 2O4CA 4BO0A 1KETA 2PD6A 5JY6A 4DC0A 5G4KB 3TZHA 5G4LA 1HLPA 3U3XA 1GAEO 2JFHA 1YKFA 2D8AA 3RFTA 1JN0A 3QHAA 1IL0A 2NACA 4ND4A 3OHSX 5JBIA 4W9NA 1PZEA 1ZXBA 4P4GA 1FF9A 2DKNA 4FBGA 3OBBA 3KLPX 3W1VA 1PTJA 1N1EA 2DBRA 5I9NA 3DO5A 3U4IA 5JAMA 2AXQA 2D0IA 2PKRA 2B36A 4CM3A 4UEKA 3WGGA 3GGGA 2CF5A 3UF0A 3W6ZA 2FP4A 2P9EA 2X0JA 2NWQA 2VZ8A 3JQ6A 3PHIA 2BELA 4W82A 4A5OA 4ZN6A 1I3KA 3BIOA 4NK5A 1R16A 3GR6A 4NNJA 4DYDA 1X14A 2EW8A 4RVHA 1C1XA 1ZCJA 2NADA 3SJ7A 5BQFA 4EUEA 2Q1UA 4Q3DA 3WOHA 1Q0QA 3ORFA 3B20A 4DMMA 4NH4A 3GNQA 3ZV5A 1I2ZA 3ONFA 3RVDA 3GHHA 3DZHA 3AUAA 4DL9A 4JQCA 2PR2A 4RPGA 1RYEA 1I36A 2QRKA 4GWGA 4RF5A 1Q7GA 1NPYA 5KJCA 1PJ3A 5G0WA 2ZB4A 3JQBC 4ID9A 4MVJE 1P1HA 2GASA 4IDCA 3QWBA 3D3WA 3SLKA 3NDIA 4YA6A 1SC6A 4UEOA 3GDGA 3E1KA 3VPGA 2V6BA 4CMEC 4CV1A 1I24A 1RYDA 3L4BC 4WASA 1J5PA 2JHFA 1E7RA 3I9LA 4PN3A 4YDRA 1NPDA 4D7AA 4XEHA 3F47A 3FWNA 1Y1PA 1GFSA 5T8KC 3IDSA 4OKIA 2EWMA 3W6UA 1U2DA 4FGSA 5JY1A 3DONA 3GG9A 4JX8A 1E7QA 1MG0A 3FTPA 1B15A 1BXGB 1T24A 3GRPA 4Q3CA 3VVBA 4BMVA 3VH2A 4Z9XA 1F0YA 2CF6A 3EZYA 4L4XA 2UUPA 1XIVA 2Y1GA 3UCFA 3RWBA 1I2CA 1IULA 3DZGA 1I01A 2NLOA 4E5YA 4XD2A 3QJ5A 1C0IA 3RC9A 4DLLA 2HO5A 4E4YA 5JNLA 1ZW1A 2AEJA 1ISGA 3I9JA 1NX6A 4OOFA 3JQEA 2QYTA 3DHYA 2OP1A 3PWKA 1SB8A 3H5RA 4PRKA 4MVJM 4Z6KA 2NVUA 1CQJA 1C0PA 3GUCA 2QIOA 3I52A 5C7IO 2PY6A 4WCFB 4YT4A 1JWAB 2FZWA 4ROSA 4DQXA 4TSKA 1E3JA 1IHXA 2Q49A 2ZQYA 4AJLA 3FD8A 3S2IA 3QW2A 1J49A 5AOVA 2YHIB 2TMGA 3AFMA 3D0OA 3DOOA 3TL2A 2VRCD 2B4QA 4PG5A 3PQEA 3LU1A 4JROA 1N1GA 3VVCA 1JLLA 2Y67A 4BS9A 4ZQBA 1MC4A 3I23A 4IQGA 4UVGA 4B3JA 4BVAA 3JQ9A 4RVUA 3PLNA 5DNAA 5TJHA 4IUYA 1F8GA 2Q3EA 2YHUA 5C7LO 3K96A 4A73A 4ZQEA 2ZCUA 5BR7A 2SCUA 1P1JA 4IGEA 4R1TA 1YDWA 1G6KA 3PHLA 5IFLA 2FPGA 1ADBA 2Y66A 4FC7A 3SJUA 1HDXA 1TVEA 4OH1A 4BNFA 3QRWA 1LXCA 1JU9A 2I65A 3QWAA 1T1SA 5TT0A 4MIYA 3O26A 2E48A 3OIGA 2BFMA 2WEKA 1DRWA 3RC7A 3QP9A 4MVJG 3H9QA 5KJEA 3EVNA 3H2ZA 2BFAA 2WM3A 3JYNA 5DBIA 1LUAA 1YBAA 5KKCA 4XB2A 5BSHA 3FPCA 4YAGA 3RU7A 2HK7A 1NP3A 4NJMB 4K6CA 1DRUA 1BXZA 2X8LA 1O6ZA 4R41A 3UW3A 1TT5B 1EE9A 3EVTA 3H8VA 2DM6A 3HHPA 3DBLB 2Y0EA 5IF3A 2FY8A 5AQ1A 3Q9NA 3QVWA 3I6IA 4EGFA 4YEDA 1MX3A 5CHEA 1B8PA 1ZEMA 2CVQA 1UUFA 3PYXA 4JLWA 4WEOA 4Z9FA 3WLFA 1IZ0A 4WE3A 1LBEA 3PHJA 4J2HA 3B1FA 3AU8A 3ZWAA 1LNQA 5JYEA 5GZ6A 3KYBA 1NVGA 2HCTA 1Z74A 1ULUA 3JQ8B 3IJPA 3IP3A 4RO0A 5A9SB 2YY7A 1D3AA 3K8ZA 5ENDA 4BKUA 1PGNA 4KP7A 2ZK7A 4ZQFA 1ONNA 3BYZA 3FI9A 4TMFA 3GEDA 3B6ZA 5F1KA 4HV4A 3TNLA 1U8XX 3RJ9A 1TB4A 5KJ1A 2WSBA 1Z82A 3E8XA 3VTZA 1WDKA 2Q99A 3Q0EA 2DFVA 4CQMA 3KTDA 3ONDA 4IQ8A 1NQ5A 4GGOA 3AY6A 1JVSA 1T4BA 2HU2A 4L4SA 1OI7A 1NR1A 1XHLA 2J5QA 3PXXA 3QWIA 2Q1WA 1GEEA 4R01A 1FK8A 4WLOA 4J9VA 1NQAO 1PL7A 2A92A 1N9GA 1ZVMA 3MWEB 4CR7A 3VH3A 2C0CA 1UZMA 3GC6A 2JL1A 4I8XA 4OQZA 4XJTA 1QYDA 2Y0DA 3BMQB 3ZHZA 4HFRA 3QSGA 3GFBA 1E3WA 5H83A 4QTZA 4BNWA 3I4FA 5JCJA 1X7GA 3GVPA 3PLRA 4IDEA 2A35A 2IZZA 2JKVA 4BKQA 4IDFA 1RM4A 1ZK0A 2Y1CA 3HJAA 1GU7A 3OIDA 1YL5A 4ZRMA 1MXHA 1HDGO 5GZ3A 1EQ2A 2H9IA 1GL3A 3ZWYA 2VZ0A 3O03A 3EGOA 2CDAA 1Q2XA 3AI2A 5L4LA 1D8AA 3WGIA 3GK3A 2YQ5A 4ONEA 4PVDA 3JQ8A 2YDYA 1R0SA 1NM5A 2ET6A 5BSGA 3GFGA 4IDGA 2VHVA 2Y99A 4YR9A 3Q6IA 3TFQA 5B1YA 1KEVA 5I7EA 2IZ1A 3BMNB 3G1TA 4QO7A 5CEFA 2P4HX 2AA3A 4M49A 3Q9UA 5G4KA 3TPCA 2J3HA 1SB9A 2EKQA 4J1NA 1ID1A 1YRLA 3W8DA 3AM4A 4UAGA 1RM5A 3HN2A 1B16A 3BZUA 3JQAB 5COQA 3U09A 3HB4X 1LLUA 3QY9A 3WX0A 4BIIA 4UUMA 1UDCA 1X13A 2C82A 2O2YA 1SPXA 3CEAA 4IXWA 4RORA 4UVIA 2IXAA 2C2XA 5DOZA 1HDRA 4MKXA 2QW8A 5JMPA 2QG4A 2RH4A 2FRDA 4JCOA 4ITUA 3NJ4A 1FDUA 1E92A 1PR3A 3K2EA 4LRTB 4WCDA 3JSAA 2AEMA 3DAPA 4R51A 2HMSA 2VTEA 1UXKA 5C37A 1M6HA 4GSLA 3GMSA 4KWIA 1O95A 2EERA 3NX4A 5KVCA 2HJSA 4W7IA 3OJOA 4XA8A 1PJBA 3SC4A 4PVCA 3UKOA 1EFLA 2B35A 1KEUA 1DB3A 1Z45A 3LVFO 5TT1A 1A7AA 2BGLA 5K6AC 2X9GA 2PZKA 4U8GA 4YQYA 3BMOB 4GLLA 5F5NA 4OSOA 2O7QA 1ADFA 2O3TA 5C5IA 4BB6A 2VUSA 4AJOA 1KEPA 2FZEA 1X1EA 3ZW9A 2IEBA 3NT4A 1P1IA 2H5LA 3G79A 4PLVA 5B12A 2OMEA 4R69A 1SEVA 1LRKA 5T6BA 4KQXA 3C1TA 3T4EA 3OICA 2PGLA 3DDNA 4YVFA 5G2OA 1IUKA 1YE3A 1PL8A 2WD7A 5DZSA 4B3IA 5ITVA 5ICSA 3MEQA 4WLUA 5KWEA 3DQPA 2HSDA 4XZ3A 5BSFA 4BNGA 3IQDB 4PLPA 4RF3A 4QSMA 1WPQA 1J6UA 3KUXA 5COBA 4DLAA 4D0RA 3RBZA 3L4BA 1G0OA 5L7YA 5ILOA 2Q1SA 3CH6A 4L75A 3TRIA 1U3UA 1UXGA 4FQ8A 1I3NA 2NU6A 4BNJA 3F4BA 4WNCA 3TZKA 3LC2O 4TRJA 3P2OA 3EY4A 1XGKA 2O3JA 4CQLB 1AXGA 4Z0TA 4DLBA 1FJHA 3FSRA 3GEGA 5I9LA 5B4VA 2B5WA 1P45A 5B4TA 3ZGYA 3UFXA 3SEFA 4QFDA 3U49A 4IINA 8ADHA 1E6WA 2DT5A 1E1KA 1HE3A 1VE9A 1V3TA 1WP4A 4IPTA 3ROKA 3GPIA 4MKRA 1YONA 3WYEA 3A28A 4CLDA 4BO9A 2EJWA 4QQRA 5IAAA 1E77A 1A71A 1R12A 3H7AA 3RU9A 4BKOA 4W4TA 1TA4A 4UVEA 4Y8VA 1SO8A 4CMAA 4MVJA 4PRLA 4WGGA 3WR5A 3R3SA 5TGDA 2IE0A 1K3TA 3CINA 2BH9A 1A4UA 1PJSA 3AK4A 1QRRA 3GRKA 4J16A 5EL0A 5KNLA 4L73A 4LVCA 4IDDA 3IS3A 4EEXA 3R3JA 4TRNA 2O23A 4MVJP 1R4NA 1NHGA 3WMXA 1CYDA 2I66A 1HTBA 2WD8A 2AQKA 3V1YA 3HDJA 1E7MA 4I9NA 1MV8A 3AM3A 4RDIA 4BNIA 4AICA 2NVBA 3M2TA 3WWYA 3LT1A 4E12A 4D44A 2D5CA 5TQVA 3H5AA 3Q1LA 1EZ4A 1EUDA 2Q2WA 4RQTA 5CG1A 1GUFA 3CZRA 1BMDA 3HE3A 4OAQA 5CP8A 1LC0A 1GQYA 5HA5A 1M6WA 1YB4A 2C5EA 4J1QA 2GO1A 3X2EA 2TMDA 2B5VA 2CFCA 1WNTA 3A06A 1P44A 4UUOA 4HBGA 1ZFNA 3ZWPA 1UDAA 2RIRA 4LCEA 4B8ZA 5HS4A 1NWCA 1QLHA 4O6VA 5IZ4A 3DZIA 3PRJA 4IDBA 4WECA 3GQVA 1BGVA 3TF5A 2VYVA 5FI3A 1GDHA 2NU7A 4CUJA 2Y1FA 5HRUA 1GZ6A 1ISHA 4NFYA 1X0VA 4GX0A 5A05A 3WTBA 8LDHA 4G2NA 4PLYA 1XEAA 2OO5A 1LI4A 1T2CA 3RD5A 2Q46A 4I5GA 4BMNA 3OJLA 4AVYA 2BFPA 2I6TA 5I8ZA 3ZU2A 4XGIA 3BA1A 3EHEA 4J0FA 2HAEA 4EJ0A 1HE5A 4LRSB 3MTGA 4PLHA 4BNZA 4CLRA 5EERA 4BGUA 2B69A 4KDFA 1J0XO 2E6UX 3AOEC 4F3YA 3DZJA 5MDHA 4FGWA 4LK3A 4IBOA 4KZPA 4YJDA 5JS6A 1YJ8A 1D7OA 5A3VA 3GZ4A 1H6CA 3LC1O 1DIHA 1I32A 2NVWA 3FNFA 4XYLA 3KETA 4ZJUA 5DP1A 1XG5A 3QVSA 4Q9NA 4DYVA 2VRCA 4J1TA 4MP8A 4A10A 1ZK1A 1K0UA 3WSWA 1S6YA 4RL6A 4BL5A 1XQ1A 4OIMA 4BNKA 4FFNA 3ZDFA 3NTQA 4FS3A 3LLSA 4OMUA 3A9WA 2Q2QA 3DB2A 3H9GA 3PIIA 1VL8A 3BHMA 1GZ3A 3OQBA 2NSDA 1ORRA 5JDIA 1QYVA 1GV0A 1UJMA 1PJTA 1Z7EA 3UN1A 4ND5A 3ADPA 4YACA 4UVHA 4IS3A 4O1MA 3HFGA 3ADOA 4HFNA 2VWHA 4M89A 1CETA 4OSPA 4WLNA 1IY8A 2CVZA 3UGKA 5BT9A 3RKUA 4ALNA 4FIZA 5A02A 3LZ6A 2VQ3A 4K9DA 4XKJA 2GPTA 4FFMA 4IJKA 1NTOA 4DVJA 5LDHA 5ILGA 2YQ4A 3F9IA 3P5SA 1C1DB 5KKAA 1XU9A 4ZHSA 3ZV3A 5EIOA 5G0VA 4R5HA 2AQIA 4A26A 4PLWA 4DTIA 3GDOA 1AE1A 1DEHA 2NVUB 3O9ZA 4EW6A 3NAQA 1K2WA 1GUYA 2YJZA 1L1FA 1E3EA 1H0KA 4W99A 3HZZA 2BKAA 4PG7A 1NFFA 3E48A 4CQLA 2VOJA 2WDZA 2POQX 2CMDA 2Y68A 1DOHA 4YPOA 3WJAA 3AOGA 4AJEA 3JQFC 3KEQA 5MGBA 3GPDG 1PQUA 5CG2A 1QG6A 2X5OA 4EJ6A 1KVTA 3DBHB 3KV3O 4IJUA 1RKXA 3MWDB 4DQUA 3M2PA 4PG8A 1LQUA 2NU8A 2FR1A 4XR4A 3GF4A 4OJNA 4BO3A 4ALMA 4YJHA 1FXSA 4L4RA 2NU9A 1A7KA 2FR0A 3RC2A 4RLSA 4RCVA 2O50A 4CV0A 3DHNA 1DFIA 3BHIA 5I9MA 3W8EA 4YJGA 3KYDB 3QVTA 2BI8A 4CLXA 5KVSA 3KVOA 2ZYAA 3D3WB 3HSKA 1TXGA 3AI3A 5IXSA 5HS6A 5IN5A 3OM9A 2QHXA 4O0LA 5A5FA 1XKQA 2O4UX 4ZICA 1HDOA 4RQUA 3IL2A 1UH5A 1MB4A 5DOVA 4XYBA 3S2GA 3ZNPA 1VSVA 3JYQA 2OOSA 1UAYA 1UDBA 3H5NA 2X6TA 1ADGA 3E5MA 1O89A 3DAGA 1TLTA 2PH5A 3U9LA 2UYYA 2W2KB 2W98A 1DO8A 3ENNA 3I9KA 1NPTO 4KDEA 3PJEA 2FN7A 1PGPA 4XQ9A 4EZBA 2HMUA 3PGJA 3PZBA 2Q50A 3F3SA 1H5QA 2EKPA 1U2GA 2EP7A 3ZV4A 1PU2A 3JTMA 2OL4A 1PJQA 3RUIA 5TIIA 3G0OA 2DBQA 1Y6JA 4MVJF 4Y67A 5T8KA 1PQWA 3F5QA 1V6AA 2HDHA 2PZMA 3DZFA 2O3UA 2B0JA 2O48X 4JP3A 3C7DB 2YFHA 6ADHA 4CV2A 5CFZA 4YJFA 3OQ6A 4PZCA 1OMOA 1GPJA 3LSYA 3RUHA 2C5AA 5G0SA 4D3FA 5CDYA 4XCVA 4HNGA 1HE2A 3IOYA 3ZHYA 1OBFO 1EVZA 2W90A 3OJFA 4KUGA 4W6ZA 3PFWO 3JCZA 3K6JA 4PG6A 3O38A 3D1LA 3RAJA 1LSJA 5TS3A 1U5AA 2BF7A 4N5LA 4RGBA 4DBZA 2GRAA 4MPDA 4BO5A 1GYPA 4B4OA 5JFOA 1IZ9A 4F6CA 4Q3EA 4YBZA 1J4AA 1AHHA 3IKVA 3R6DA 3ROPA 3VPFA 1KVQA 1EUZA 1JWBB 3F5SA 2F00A 4XQCA 2EGGA 3WICA 1XYGA 2V6FA 1GR0A 2IRWA 1EBFA 1ZZEA 3WNQA 4OXKA 3HDHA 3ZHXA 5G0TA 4RPJA 3T7EA 5DCYA 3NDRA 1VLLA 3E9NA 3NYWA 2GN8A 2VWGA 3DFUA 1T4DA 4MIOA 3FBTA 4XDZA 3PWZA 2AG8A 5CPBA 1U5CA 2ZB7A 5AXCA 3VZRA 5JAZA 4C7KA 1X7DA 3M1AA 3QWHA 4XQEA 1LRJA 2WMDA 4CM9A 5JC1A 4N5MA 2OGUA 4CM4B 3PJDA 2NTNA 3U5TA 3I83A 4QXMA 3AY7A 4WOJA 4U6QA 1WMBA 1YQDA 2X23A 1PJ4A 3E03A 1BSVA 5GMOA 3RJ5A 1LDYA 2IYPA 1VSUA 4A7PA 3WIDA 4CMKA 3E9MA 2DU8A 3TN7A 3D4NA 2JAHA 1PEDA 4DPLA 1LSUA 3FN4A 5KIAA 3WFJA 1HDCA 2IYOA 2V7PA 4IDAA 4ALJA 1ZSNA 1JAXA 3ZU4A 4EUFA 1HKUA 5TJ9A 4FB5A 3JQCA 2PA3A 4A0SA 2HUNA 4B7CA 3NEPX 4R3NA 3WFIA 1CDOA 1WDLA 2C20A 1CERA 4HXYA 1LRLA 1NXQA 5IJZA 1JW9B 3VKVA 4PCVA 2DFDA 3NT5A 1DAOA 1KYQA 3SC6A 1A5ZA 4JJIA 4E32A 1MGOA 1WVGA 5EQDA 1MLDA 3WQSB 2BMAA 1LDEA 1H2HA 1DLJA
chains in the Genus database with same CATH superfamily
5KAMA 2VNHA 3GRUA 3CVOA 5DGHA 4JDUA 3OZAA 1P5JA 1YNOA 2F8MA 3FGOA 1Z3CA 4OFXA 2VYFA 4KSYA 4A3SA 5HMLA 1G1AA 1XAJA 2QUIA 1AKYA 3NKVA 1KVSA 3NHYA 1V0JA 2AUTA 3V33A 2ERCA 4UU8A 3C45A 1Z12A 4D6XA 2HBYA 1LX6A 2YCLA 3OHPA 3JQDA 1QH9A 1XZDA 2W2NA 3GLFE 5DISB 2CXOA 2Q29A 4OAOA 4YTEA 5DW0A 4TM7A 4J2TA 1POWA 2J0UA 3FH0A 1LPSA 2OBYA 3FIJA 4BP3A 5JZVA 1MUUA 3M7IA 4XWAA 1IHUA 1Y8QB 2VT2A 5LOVB 2YW2A 2W2VA 4JJKA 4YMGA 1UZUA 4ESHA 1RJGA 3LVBA 4ZO4A 5IUNC 5K03A 3DDCA 3MOGA 4EKYA 1K8RA 3CVVA 4UZFA 4M55A 4IIHA 5EP3A 1FXWA 4OGWA 5FPTA 2RBEA 2XA2A 4IIJB 4R8LA 4TROA 2ONJA 4MINA 2O5CA 5AVYA 1G4UR 5IZCA 3T15A 4R1OA 1RBYA 3AY3A 4W8OA 4BLQA 2IC5A 1NSTA 3ANNA 1T5DX 2EFYA 4Q3BA 3WP1B 4DCCA 5ISMA 1AKQA 5L6MB 5ECYA 2AR7A 2E4VA 1L7EA 2GX6A 4JI2B 4EFDA 2RJNA 1G63A 2OG2A 3LHDA 4NBVA 2OHXA 4UMFA 3SEAA 2PZJA 3NLLA 5EKSA 3QKSA 4PWZA 3TQTA 2NU9B 2AVDA 3GH3A 5KSYA 4GNRA 3TLMA 4UBOA 2REXB 1K2VN 2JLRA 5CDFA 3AILA 1KY5A 4MUAA 4FSHA 2O8EA 2ETXA 3HKBB 1E69A 4IIUA 8MHTA 3AJRA 1KC3A 3AHJA 2B82A 2N9UA 2VKQA 5JO0A 3AIKA 5MGNA 1AKWA 1GV1A 1I3CA 4G0VA 3EFOB 1RC8A 1PV4A 3WWCA 5JS7A 3L01A 1ESCA 1UZAA 1P80A 3HL4A 2SCUB 4G8BA 4QBKA 1EVJA 5IG2A 2VZLA 4UUPA 2VXCA 2AGVA 5LXTF 1KNXA 4X0EA 2BL4A 3HWRA 2N0SA 3S1AB 2EBWA 3DWEX 4Y7DA 4LHXA 5IJAA 4LYFA 3WLLA 4GKJB 4GMDA 1UKVY 2C4NA 2PBRA 2VG8A 1RS0A 1G8KA 1XJ5A 3F6RA 3N05A 4II3A 3EOBI 1I6LA 1R8XA 4NQZA 3SNHA 4X84A 7MHTA 3Q5EA 4CM9D 5I9TA 2K7ZA 3HV2A 3L7BA 3OCYA 3L5OA 2ZBEA 2J6IA 5DHFA 2PIAA 4MEAA 5EQFA 2QN1A 1I3OA 3CX4A 4IIXA 4OQMA 1IOLA 2AQHA 1IB0A 3L18A 5AHOA 5JAHA 5BMVB 2ZIZA 4L3OA 3RV3A 5A4FS 3MLAA 2BTOA 3O47A 4C78A 2QLLA 1M2FA 1J7KA 1QYCA 2BFFB 5CJJA 3O4IA 3VGJA 4AJJA 4F45A 1VECA 1T1GA 5K0LA 3OCJA 4YT8A 3MA0A 2XNCA 1Y3HA 1AA9A 3L8EA 3HFJA 2VH2A 1XU7A 4RWZA 4YV2A 1QTNA 3HVRA 1PUIA 1DHRA 1EDZA 3K71B 2V97A 3RYIA 4QTUB 1P1RA 1NMXA 3F9RA 3E22B 3LXRA 2PX6A 3N86A 3BREA 3I04A 5FADA 3L8ZA 4HR7A 1THZA 3WLNA 5BWCA 5ELLA 1ONPA 2BRUA 4US2R 2QI9C 1WVMA 4HP8A 2YZMA 4TWBA 1N2SA 5AKXA 5AH0A 5BNFA 3TTWA 3N58A 4HJXA 4IJQA 2DHQA 2C2YA 4EEZA 2A5JA 2EGHA 1C30A 2YHSA 4OAPA 5LA6B 2Q4RA 3FZEA 3GBVA 1DIBA 1SURA 2GS9A 3EMBA 2LDBA 3C97A 4YFVA 4DWJA 2Q3FA 1VKOA 1E3TA 4X3PA 3A9TA 4FXPA 1SKAA 3EIEA 3PGKA 3LBFA 3M81A 3QQ5A 5IAJA 3EF0A 5AD1A 1V11B 5JNTA 2ZAIA 4AT1A 1GXSB 2Y9PB 1USIA 3BSSA 5CA1A 1CB7A 2DHRA 1MX5A 1QYIA 3ABRB 4MUBA 4PR0A 4ZYXA 1NE2A 2XZTA 5JEEA 1T2VA 3K9HA 3WGOA 1HDZA 1UWKA 4FFDA 3AFHA 3K8QA 1EM8B 1C0KA 4LY9A 4RJKA 4UBIA 4KH1A 1WUYA 4HX5A 5LQSA 4Q3KA 1U7DA 4RELA 4JLDA 5JO9A 4B43A 4E08A 2I33A 2XYGA 2CFRA 3L7IA 2X86A 2B8TA 1HL3A 1I7NA 3GZNB 2MJLA 3GLHB 3NWEA 4WZAB 5KTSA 2C7QA 3E82A 4WUVA 2ZRDA 3FOZA 4PPNA 1FL9A 1H5UA 3O4JA 4RPLA 2AMFA 5IDXA 1M2EA 4RVOA 1PQYA 1FU4A 4IX1A 4FM9A 3GFRA 3RBVA 2ZSJA 5IDWA 1KMHA 1L4EA 3ETEA 3NWJA 5JJKA 3NBYC 1KO7A 4B3RB 4NJMA 4DIKA 1Z22A 1XRLA 1G4HA 4HNQA 4I2VA 4KKXB 4WVLA 1TLFA 2AJBA 2RK4A 4ER3A 1WBJB 1F2TB 1W47A 1Y3FE 1Y5RA 2IIVA 4XGNA 1RI4A 4EFLA 1BS1A 2VP9A 1NFRA 3G49A 3U80A 4EJSB 3VR1A 3E2IA 1YR3A 2Y71A 2QYHA 3CR3C 4BKPA 1WY7A 4GWKA 5CVEA 1ZK2A 4D4JA 1M2HA 1CY6A 4W5RA 4XIYA 5EPEA 3PNOA 4NDAA 2XTMA 3S5UA 4MW5A 1T5BA 1UZNA 3DBRB 1P0IA 4BO1A 1OX4A 4LJ8A 4K0KB 1Q15A 4J29A 3JD3A 3MOSA 5AKHA 2Q21A 2VYNA 4FMBB 2HXSA 2VPZA 3T4XA 3OETA 3T9AA 4F84A 5KVVA 2WSIA 1UJ6A 1W96A 2C2BA 3MWDA 2PFSA 3CY6A 3EAGA 4JR1A 2XT9A 3WLPA 1W7AA 4MS4A 4MEJA 2ZRMA 4C20A 5ES3A 2FDRA 2R8XA 4D42A 5BMOA 3HO1A 5JDIC 4YB8A 4JYZA 2VPXA 1DIAA 1KYZA 1KMQA 1PJZA 3E7PA 2YVQA 2ZQZA 3H4VA 5T4FA 5J2UF 1FYWA 1JKFA 2CMFA 5LZ9A 4AMVA 2AN5A 4MVJH 4CDRA 5DYNA 1VCMA 1CUVA 3ER9A 2WNSA 1T4CB 2YV4A 3MZ0A 4I9HA 2CJYA 3IVRA 4U5QA 4WOPA 4HWTA 4ON9A 3ZGNA 3HN6A 5JNVA 4RIHA 1CE8A 3V55A 2IP1A 2W11A 1JEOA 1TQ2A 4GL4A 1JSRA 3JQ9C 2GCGA 1M54A 1QXSA 2QJOA 4L8FA 5EEHA 4EHBA 1U94A 2AYYA 4A8JB 4S3MA 3RSCA 2XUFA 2R6HA 4S2UA 2CZQA 1I4OA 2AG6A 4WERA 3V4OA 1NN1A 1JQJC 2R62A 4QOEA 5FTKA 2CT8A 4LC1A 4HLCA 1G21A 1QFXA 3WLOA 5CFLA 3AF0A 4W5QA 2RJ3A 4A8PA 3VPBA 3AEQB 1N4DA 3HI4A 1PGOA 4FIDA 5F1OA 1N8KA 3IOCA 3LC7O 3ICQB 4EVIA 2BKEA 3NOXA 4XOUA 1KP9A 3GT0A 4J8PA 5F2EA 5FUWA 1G8FA 3UJHA 3TUJC 4ABTA 1S0UA 1ZL0A 1I30A 4ZCTA 4XWWA 4E0BA 1YZNA 2HF7A 3U7FB 3NXSA 4EA7A 1QS0A 4RLFA 1U2RA 1RACA 1TMYA 5A7FA 2BY4A 3OOSA 4KN9S 5C3UA 1FP1D 5DBFA 4CKEA 5EJ4A 3E5NA 2R8BA 2DWOA 4WKOA 2YV2A 4ZRNA 5TPZD 2WOOA 3H9CA 1GTL1 4Z0PA 3ZW7A 2C78A 1FSPA 4CR8A 1KJNA 4MR9B 4NAUA 1KKLA 1UXJA 1I3LA 4OQLA 4FNAA 4Q01A 5EP4A 4CEIB 4M38A 2ACEA 1R66A 4I50B 3L40A 3NAGA 3C6ZA 4R1NA 2IEDA 2QLJA 3UW1A 3W34A 3OP1A 1WKBA 4G0WA 3KQTA 2ATEA 1EMDA 1H3NA 4WBNB 3TQHA 5AJYA 1WZNA 3LE8A 1IN6A 2W4QA 1FQOA 2Q1TA 2ZIXA 4PO8A 4MP6A 1SXJB 3N5KA 2W6ZA 3PQDA 4M0EA 5EHZA 4JBYA 1TJ3A 1KZ6A 1N0WA 3G2IA 4Q82A 5I3ZA 4JLPA 3GNLA 3KJNA 5GJVC 1TQ4A 2VDPB 1QK3A 3DE6X 3P9CA 2DAPA 3KSZO 3N6VA 2BHTA 4ATNA 4YMUA 1EIZA 1UBNA 4WKGA 3C6BA 2G7ZA 4HVLA 4RTQA 4OBBA 3K30A 1Z88A 3OCUA 3SHOA 1XZQA 3A3OA 3FOAA 3ULKA 1CR1A 4K1LA 2QBYB 3YASA 5ALNA 3AP2A 4LVNA 1U3TA 2BHRA 1P2VA 2BCGY 3C3CA 3PVCA 4Y2PA 1O57A 4QICA 3TJRA 4JNKA 4ZDKA 4L4ZA 4BIMA 2R4TA 3LDAA 1D2CA 1PS0A 2YWCA 1NVBA 1PSDA 3H5LA 3B2EA 4OI4A 3E9QA 4OHOA 3IMCA 3WSVA 3ZV6A 5CFNA 3GLHA 5JR3A 4L0DA 1VB3A 3IT1A 4BNLA 4DRYA 3LYLA 3RS9A 3BRQA 3G13A 2EXXA 1CS0A 2XVYA 1VJCA 4JI1B 3WMRA 3QNWA 1GTMA 2PT9A 4ZD6A 4DA7A 2Q4EA 1ZOIA 1OHHA 2QTTA 4RPCA 3G88A 1NT4A 2VXBA 4JI6B 3GCXA 4G5SA 4AWXA 2CJWA 1WMFA 2JAXA 1KMHB 3OIFA 3OU6A 4U6SA 3UV3A 4D0SA 2J30A 3O75A 4EELA 3UUWA 1WY5A 5JE8A 3AVTA 5FL7A 3L2OB 2PZLA 3UJ6A 5CCEA 4Y6RA 4JYPA 5FI1B 1UBKS 3L4SO 1IUPA 1CJVC 3LCUA 2H7CA 3Q12A 3WB0A 2R1TA 3AUKA 3VAZA 5LLDA 4RCYA 3DMGA 3JWPA 3ZX5A 1OB2A 5BY2A 3HB5X 3KZXA 1E1RA 5EE5B 2VBGA 2O3QA 4DV7B 1HLFA 2NV2B 3MJCA 3OQPA 4JBHA 4P93A 1WKVA 3LNCA 2NO4A 3QH4A 2YWJA 1FUKA 3FPFA 1AXEA 3KQWA 2D62A 2P75A 3LC0A 3HDYA 3HSYA 1TIKA 4Z7OB 3CUSA 4KMRA 4F4UA 5I7FA 2W6OA 3ZUGA 4B32A 1Y6ZA 5L9AA 2IUFA 2HPAA 1PZGA 1RMYA 2WAMA 3DGEC 3GB9A 3KZ1E 4D8UA 1F8XA 2XZOA 7YASA 2ATCA 4R8MA 4UHEA 3HCPA 1YJAA 2FFAA 4EA8A 2ACKA 1QMGA 2NM0A 2WVHA 2GM5A 3FWPA 2JLQA 4ENUA 4MPRA 1D1SA 5DLDA 1Z6XA 4MMYB 2W8BB 3QEKA 3QA9A 1UMBA 3INTA 3EA0A 3LHSA 2E82A 3UPDA 3BH7A 2XLCA 3JQGB 1IMJA 5EHGA 1NXTA 5E7IA 5FBZA 2QN2A 1Q0HA 1TM5E 2J9XB 1LU9A 1LJLA 9LDBA 1IN1A 2AOTA 2JGKA 4NX2A 1XO1A 3LRXA 3IO3A 4P98A 1FQWA 1WHSA 1XLTC 1RBQA 2AHOA 4PINA 2ZGVA 3ZNNA 4RHEA 2C59A 3C1OA 4DR2B 2Z8YM 1SD2A 2H3EA 3TW8A 5L51A 1P9LA 1TEXA 4MQLA 4D0GA 1PZXA 1JXQA 2CYBA 4DLNA 1XK6A 2ZM6B 4DJEC 1DAEA 4I4IA 1IRIA 2HRZA 3FY4A 2PKCA 1GZ4A 1GVNB 3ILYA 4NJEB 3BE6A 1JA0A 1RIIA 3V6LA 4V03A 3ACCA 4JL6A 1OBCA 1QOPB 1RJ9B 3SX2A 4DMGA 2JD1A 4ZEMA 3RSFA 2GPBA 3FHOA 1LWOA 4M9RA 1LX7A 1RMTA 1VP9A 1W1WA 4M1YA 4ND7A 4CI0B 4LSWA 3RYCB 1RQ7A 1E1DA 4GX1A 4I4CA 1FVHA 4M9QA 5IARA 5H9WA 1JG1A 2IYFA 4KU4A 3ZLJA 1ISMA 4QOFA 2VP2A 4GU5A 4YCDA 5G3ZA 3AKDA 3CIOA 3ONWA 2FEWB 3IB6A 1EUCB 3O8OA 4EMBA 4MJLA 3PR2B 3BF7A 1XNHA 4B40A 4CG0A 2JI4A 3QVLA 4C0HA 4I5DA 2WAOA 4W7SA 5D87A 2CL7X 2O52A 2ZSFA 2WWRA 3VDRA 5JADA 4B4UA 3AEUB 1CUWA 4KQIA 4FD3A 2NQTA 3OKFA 3DD1A 4MVYA 2BHLA 1COZA 1N2ZA 4FQ7A 3QKRA 1M1YB 4HNRA 3IQHX 2QVBA 3TW4A 3LIIA 4LVUA 4WLEA 1SXJA 2Z5VA 4TS9A 3E5RA 4MV4A 1DRVA 1FDSA 1XEWY 2GA8A 3E8SA 3OE7D 4GZMA 4MGEA 4V0RA 3KLOA 1SCUA 2GYYA 4FEGA 5D3KA 5JV5A 3HM9A 3IPLA 1BX1A 1U3VA 3A1EA 1R5OA 4DCGA 1S9HA 4YASA 2KE5A 4GECA 5CJ2A 1CJTC 2PJDA 4Y2HA 3W6NA 2MYNA 3OZDA 1HYBA 4R1PA 4LE0A 2OBLA 1IPHA 4EG8A 3PT9A 2J6HA 4EB6A 2GCNA 4AMZA 2DWQA 1OD6A 1SU8A 2X9VA 3QUSA 2QTWB 1E99A 3O8NA 4KUEA 2WHPA 2VRNA 1H6AA 3GZTB 4W5JA 5HFJA 4CW7A 4EJ2A 4NMWA 1ADCA 4U7FA 4LRQA 1OOEA 4OGGA 4TQ9A 3GP8A 3A2LA 3QEMB 1NMYA 2J46A 3OFJA 3LZDA 1JAYA 5ESXA 1D4ZA 1FVOA 2RHRA 1LEHA 1FS4A 3IEKA 1V3UA 1DWUA 5LD2C 1KO4A 3TPFA 3LA8A 4AJIA 1OT5A 4CWAA 3LI2A 2KI5A 1SY7A 3ACBA 3D81A 3DEZA 4R7ZA 4LV8B 4YP6A 1JJIA 2J5XA 1YH3A 4Y6PA 1QZUA 1P4GA 2X9LA 1PYDA 2YIJA 1ILWA 3QUAA 3JQGA 3LKBA 3M4ZA 4J9UE 1Y63A 4YPVA 4LJ5A 4RDHA 3WQQA 5AQEA 4X1YA 5IKMA 4E3ZA 1YZTA 4H35A 4DM7A 5LQUA 4AKHA 4FFSA 1ZN9A 4MQMA 5F7JA 1X1QA 3CUVA 3KOMA 2GZSA 2NZJA 3CGWA 4DMLA 1N77A 1CQZA 2I7TA 1HF3A 2LDXA 3HCOA 2FJUA 3ZY4A 3RT1A 1Q0PA 5B55A 2ENUA 4S05A 5ER6A 3LPCA 4K1XA 4BBJA 1B0AA 2WJ4A 3DDSA 2JZNA 1VL6A 5LB4A 3S27A 4B48A 2YW9A 1ORDA 5K0GA 4LXQA 4HCJA 2ECOA 3LQFA 5P21A 5F7OA 5LQMA 3TLKA 4BNTA 1PFVA 1VJ0A 1M1NA 4BPRA 4N18A 4DEXA 1R0LA 2O8NA 1JG6A 5IMBA 1PUXA 1Q20A 1ZITA 4QBTA 4ANFA 4ARZA 2L82A 1R4NB 4ZVSA 3D31A 2F1KA 4ZVQA 4K8RB 3TO5A 2AMYA 2Y05A 5K3FB 3KKNA 5EJ2A 2V3WA 1VLVA 4WQMA 4NYMQ 3H75A 5TQJA 5LBUA 4MQ5A 2DLCX 4CIVA 2JAUA 3ASVA 3DDZX 1XFDA 4Z2YA 3L46A 4YAEA 1ZI9A 3AP3A 1Z6PA 2IPMA 4NR0A 4O2BB 1FFXB 1L3IA 4DEVA 1RRKA 1XXLA 4RJJA 3U62A 3UT0A 4N12A 3PXEA 4C5BA 3HADA 3P0FA 4RGYA 2RHGB 4MKIA 3FG9A 3LK7A 1HFJA 3IV9A 1E9EA 4TM8A 2X15A 1RMQA 1ORVA 4DJ5X 4M22A 4MW1A 1WBBA 1CS4C 4PIPA 1GYRA 4B4WA 1KPGA 1GKKA 3MJ4A 1E2UA 4Q5IA 5AJZA 5FOWA 2XCOA 5BSRA 4BUJA 4DABA 4YQZA 5A4MS 4UOZA 3LT4A 5E2AA 3VR4H 5CDTA 4GEKA 2IU4A 3OZXA 2ZROA 4BFYA 3PHCA 4LCBA 1M8GA 1N8SA 1EFVB 4WKPA 1ECLA 1SGWA 3ZR4B 4CN8A 2OZPA 1ODTC 1G3MA 2NYRA 3P20A 1WCYA 1C9EA 2P9CA 4BGVA 1XXHB 1FFDA 2IELA 3K70D 4QLBA 2JFFA 2ZR8A 3DV2A 2Y4OA 4HEA6 1E4YA 1MOPA 1JWLA 4NSNA 1DXYA 1ZMXA 1K89A 5KNBH 1RLIA 3BFKA 3BK2A 4EVSA 2H65A 5EYPA 3OQIA 3UATA 4F21A 4IH1A 2ZRNA 3NPAA 1RLUA 3N0XA 3O1IC 4IOLA 5DM60 3QVGA 2AZXA 1JDTA 2I3AA 3T1HB 3T7KA 3VYTB 1P4AA 2JVKA 2KPOA 4YRAA 4BVEA 3OZTA 5A02A 1VPDA 2A7XA 1DIGA 1JTVA 2CBXA 2CK3D 4R2MA 3G2MA 3RS2A 4EI9A 4CLHA 3TBFA 1Q17A 5BXYA 3IEMA 2B99A 5GONF 4EHHA 1LLDA 1X70A 2OAEA 3AVUA 4B82A 4KBGA 1RM3A 5D01A 3CR8A 4BLPA 1MZPA 5CM8B 2QMZA 5C80A 3C87A 4X1IB 1Q19A 4NMXB 4WESA 1V43A 4OGLA 1HZJA 3RSSA 1B8OA 5KMGB 2GXSA 3DEAA 2ZUDA 3P2YA 1OBHA 5F5XA 1N1DA 1NV9A 4XRRA 4P86A 3S40A 4E2YA 5HJEA 5AW1A 3S8EA 1A04A 2VBIA 4NNOA 2OZLB 3KVRA 4MYHA 1QZXA 3PDJA 5FX2A 5L95A 4YAWA 1U7TA 4K26A 4OQ4A 5EG5A 1KOLA 9GPBA 4C06A 2X5JO 1DMRA 4D3DA 2I99A 1VIMA 1MU0A 1ISPA 1I6MA 2XMZA 1UPBA 2ZTUA 2NO0A 1CRLA 4YCMA 3U3MA 3FYTA 4NI5A 4XD7D 1TCUA 4J0DA 2IYVA 3HB0A 2YYYA 4PQRA 5F64A 5JDCA 3ZCTA 4Z8YA 3O7WA 1EDOA 2GN4A 3TXYA 1ACMA 3HEMA 3UJNA 1DIRA 3RFVA 5JQGF 2ZB3A 1N6IA 1QVWA 5L3QA 4Q7KA 2FOIA 3U17A 3PNPA 1BXRA 2F1JA 1UK8A 2PGOA 2OV3A 2C04A 3ZN2A 2NZYA 1UXHA 1ZWLA 3SD7A 4FGUA 2B20A 4D98A 5BR4A 4DIBA 1X1RA 4RVFA 1A27A 5T64A 4TYQA 2RI6A 2I1QA 4LJ7A 3CU5A 1SCJA 1ZYUA 3KR2A 4MAFA 5EIHA 3EFBA 2M6KA 3C1UA 3DF7A 3VR6H 1ICIA 1MIOB 1M3SA 2BTQA 2NTYC 2Q9AA 3KWLA 1G2OA 5HE8A 1ISJA 3U31A 1R1DA 4H9GA 2G9RA 3TUIC 2INGX 4RIIA 2BR3A 4ZGBA 1H2AS 3SZLA 1X0XA 4YJFB 1E61A 1N9GB 3BMCA 2PSEA 1Y9AA 2GD1O 2HJWA 1SKYE 1Z5OA 5ENVA 3I9MA 4HPWA 2XSZA 4V39A 4BVFA 2W8ZA 3HM2A 3ESXA 3UYLA 3WB9A 1GTRA 4G1VA 3KDPA 1RXCA 4CQNA 3KVVA 2C7VA 4HTFB 3MBKA 4NBLA 1BU5A 1F60A 6YASA 1GZ5A 1XTZA 2C94A 3QJGA 2W70A 2VK2A 3U4CA 1GU1A 5BR8B 3OPNA 5KWVA 5BYJA 3WYCA 1YFJA 2FLWA 4MQ4A 2ZB2A 5F12A 3IYLW 3PJFA 1ZVVA 3L9XA 3H6KA 4OP3A 4KOAA 1UC8A 4JT2A 4LV6A 1SM4A 1I2BA 1KTVA 2ZJOA 3TZEA 2PUGA 1UEXC 3AO0B 3HJFA 1K4MA 4XD7A 5I48A 3TTVA 3DWIA 5A6SA 1ZNWA 4B3HA 4K9RA 4N47A 1FFGA 1SQGA 1E5VA 3CG0A 4FX2A 4PBSA 1GUAA 4RNCA 3TMAA 1RP7A 2WSMA 3HXMA 5AW4A 1E2JA 4L51A 4FHCA 1JDSA 2FWNA 3V3KA 4BAGA 2GXUA 4MCIA 1C0LA 3PUIA 1Q77A 4D4MA 1X2BA 1R4MA 2H7XA 5JFGA 3Q11A 1VG9B 4FMDB 2IXGA 3C8UA 3T61A 4NBUA 4R16A 4LVOA 4YAIA 2H2DA 4PZ9A 4P81A 3OZCA 2B1GA 4QYTA 1GGEA 3DCJA 3TRJA 3DMFA 4Q7EA 3MAJA 4OXIA 4WZAA 3JV7A 2IYNA 4D43A 1KI8A 1KJYA 3BTOA 4MUXA 3K53A 2FEPA 5GADl 2VJOA 1E58A 2PGAA 1GVHA 2MMCA 1NE7A 3NBQA 2HDNB 4OHUA 4RW0A 3NHKA 5JC8A 3FPGA 4BAZA 4V0OA 4NNPA 2I71A 4C04A 3ZWXA 5ESRA 5EHQA 3FF4A 3KB8A 4EO9A 4UARA 1U5BA 4ZAYA 4NE2A 5B4UA 4KXLA 3F6YA 3OKCA 4FGLA 4NBRA 3RIHA 4ENVA 4CIWA 4NFHA 3LJKA 1LPMA 3LYAA 1MAVA 1FSFA 2I4RA 4MVJD 1AKUA 2ZZKA 1DSSG 3EMKA 1VE1A 3IUEA 4UM5A 3BN3A 1C3LA 1N7GA 2ADOA 3UTDA 3VZQA 4EKIA 4OVKA 3RIMA 1UT6A 4YIHA 2Z8XA 1HLDA 4Y1FA 3AB3A 1KBZA 4NOLA 5JPCA 1D6NA 2F1RA 1CHDA 3NUGA 3KE8A 1CRPA 1MA0A 3KZOA 2VHWA 3RTCA 3KQHA 5KBYA 3PUXA 3GGPA 3UOGA 4NULA 1M7BA 3OE4A 3DO8A 1ZCBA 4A8JC 3O3CA 1L4FA 1E94E 3IA2A 4ZO7A 2A57A 2PUTA 3H2SA 4Z9AA 4BRZA 2POCA 2OBBA 4G0PA 1SZCA 2QRUA 3FM9A 3VOSA 4OV6B 1W35A 3WMWA 1E2MA 1KHHA 1Q95A 3BXOA 3Q9SA 2BGGA 3RYCA 5DWDA 1EGHA 4QVGA 3STWA 2QIPA 3CZCA 3DXXA 3SKYA 5ES4B 3T3HA 3GVCA 4CM7A 5C1DA 4FJ1A 3MQ2A 2VPWA 2JVJA 4O0MA 4NLLA 2IGTA 1W4ZA 1MORA 2JHGA 1PG5A 3I01A 3MWKA 4L0MA 1QB7A 3SZGA 5I4KA 2YL2A 3FPEA 2AD1A 1CZRA 4J2OA 5C7YA 1JFRA 1N8NA 2L2QA 3EBOA 3RYHB 5JTTA 5EZ6B 1Y37A 4WXRA 5I7WA 4CEJB 1ZH8A 2AOVA 4HGOA 1DKPA 2WTUA 5KX5F 2WNIA 4B44A 2UAGA 2I3GA 2FMTA 1H8EA 1PZNA 2B2CA 2XGMA 4Z4EA 1JDNA 3X2FA 4JT8A 3AJAA 2VF7A 2VDMB 1BWSA 1I4EB 3EGXB 2CLKB 2DCMA 4NOKA 3DZ8A 4G1EB 1G291 3GGSA 4OHBA 2DUMA 5L3QB 5EWJB 2WI8A 2XD4A 1Q7CA 5ALJA 3S1AA 5JPDA 3BPSA 1WU8A 5CDGA 4PR3A 1SC4A 2WFLB 5E1BA 4F71A 1O03A 1ZVKA 2FJPA 2PLRA 5FWXB 5LC1A 3UMCA 3EFOA 3KTAB 1QCCA 2G5PA 1ZRNA 3PIRA 3EARA 3QPUA 3DC2A 5EIFA 2OBNA 4RPKA 3LQYA 1KQ3A 3VSBA 1DFHA 1KFCB 4UE6A 4G67A 4FZVA 1C7FA 4JDPA 2IWRA 4M0LA 4XPIB 2BFBB 4D8VA 3EJWA 3RTGA 1B0ZA 4KX3A 4LX0A 3DXFA 4EVRA 2DFLA 3AUSA 2V3VA 5E9JA 2V6IA 5AK4A 1EJ0A 3UT6A 4AKTA 3PXCX 5TQ2B 2Y92A 1Y1LA 1NQWA 2QPAA 3MUFA 4BP9A 4URUR 4URWR 2HWUA 2C61A 4BNMA 4GHWA 4AO6A 4XVHA 4EHDA 4G37A 3ZNQA 1B6SA 3CKKA 1ETHA 3NYQA 1W85B 3GYBA 3JD2A 4QC2A 2XQKA 5E1DA 3WRXC 5IULC 4KFCA 1IPFA 1KY4A 1QQ5A 1RI5A 4FMCB 3V42A 3GDFA 4MUJA 2XDQB 5BOVA 5ALLA 4YUYA 2DUNA 3TTTA 1Y1KE 1XROA 3VZBA 4JI7B 4U7DA 2GSWA 2GKGA 3MPUA 1KYXA 4U7TB 3TIVA 5F98A 2HL6A 4UD2A 5IYZA 4FILA 4QFBA 5A7HA 5DN9A 3HMQA 3G2LA 3VR3A 2E9SA 1YOVB 1JG7A 2E1RA 3GLIA 1RRFA 3L7OA 5HWSA 1E0SA 2H5JA 3I6BA 3V4SA 3QE0A 3SQDA 1B2RA 3FR7A 4FYVA 4X60A 1I1QB 3KKKA 1O6FA 1YVRA 4N5NA 3ZY5A 4TL8A 5IM5A 4TV8F 2I55A 1HNXB 4ALIA 5BWNA 2WWHA 2A1IA 1W0KA 1Q1QA 5D6NA 2BFEB 1R4MB 4K6OA 3ELDA 3ZDAA 2R1ZA 2C97A 3IEVA 2AH5A 1YF3A 2E7ZA 5H80A 4F3TA 1GTSA 3GEMA 3GL9A 4ZIRB 1DBSA 1JEAA 1GN9A 4HTAA 1EM8A 2QL5A 2WICA 3EYAA 3P96A 3PJGA 1COWA 2G72A 4TXJA 5LYYA 4ECAA 1FDTA 2XUQA 3KCQA 4R68A 1R3DA 2RHHA 2JJYA 3HUEA 1ZUIA 4MQFA 4D79A 3SQMA 2A78A 4Y18A 1AUXA 1N9KA 1RFGE 3C7TA 4EQZA 2JFXA 3WXBA 4ENQA 5I5GA 4PPFA 3DWFA 4Q66C 5L3RA 2PMBA 4JOCA 4KREA 1RWMA 3DL7A 3LKDA 5CK5A 3ZJVA 3A9CA 4P0QB 1EGMB 1JIVA 1U3GA 1KY3A 2LP4Y 4YJGB 4RTMA 4OP1A 3R7SA 2C54A 1V35A 2IS1A 1XZHA 1PWZA 2YWGA 3G7NA 2BEUB 1BJTA 2Q3DA 2RH5A 3DZBA 3ICOA 4HDNB 4NV3A 4XR9A 5KUTA 1G16A 2G0NA 3I9NA 4JKIA 4IWXA 1CP2A 4M1ZA 3VUEA 2IYQA 3M5PA 3DKPA 1SC1A 4OXQA 4PZZA 4RANA 2YVAA 3KSDO 4TTIA 2Y1DA 5AVOA 3PJRA 4DJDC 2YXEA 1R8QA 2ODTX 5KVQA 1NW6A 3BDAA 4RESA 4YALA 5ALZA 2G40A 2VSXA 4NDNE 1QVAA 5IANA 4CKEB 1GILA 4PZEA 4BBPA 1SCIA 3QYFA 4FDVA 2Z1MA 3OEHD 4WFQA 4MOWA 3WLQA 1G7CA 1ZVQA 2I8LA 3CJQA 4B6PA 1ZUD1 2CXXA 3ABIA 4H0FA 3SIXA 4TLEA 3PUZA 5B3AA 4TQGA 2M32A 4BQPA 2JARA 3DE5X 4U9HS 1LC3A 2IS4A 1OYYA 4LTDA 3ETDA 3LCVB 1Z4LA 1KWKA 2EBFX 1IQRA 1KU0A 1JH8A 3NHMA 4KXVA 4PIVA 3VPXA 1K3FA 4AYWA 1U0OC 4ZPJA 3SYKA 4EY6A 2JBAA 3UMMA 1TAHA 5F51A 1BA3A 1R4AA 5ALIA 4M8LA 3K9QO 2FVXA 2E37A 1RJEA 1MVLA 2FUEA 5IFKA 1M66A 3CMCO 5HSGA 5EE1A 5L3ZA 4RWEA 3N7TA 3ZS8A 1J07A 1O4WA 1WV1A 3LLMA 4CPDA 3SYMA 5GY7A 2Q2OA 3IMFA 3SEQA 1QC5B 1P2TA 2G09A 3BZBA 3GVIA 5T41A 1ZMOA 3KS9A 2HRCA 4OFWA 3S8MA 3MTAA 3GNTA 4IWYA 4AP6A 1C9KA 2V4MA 4YRFA 1CSEE 2W93A 1KI4A 5REQB 4BMOB 1RQXA 5EINA 2J09A 3G23A 1Y8RB 5E3IA 4YO8A 4F11A 3MT7A 3JRXA 2Q3CA 1O8CA 2Z2KA 1Q1EA 1U0BB 2HBQA 5IAOA 4KL8S 4KQMA 1ES9A 1VQ1A 1N4AA 3JPWA 4WCFA 4BVLA 4LJ6A 2V8OA 1VJ1A 5JRJA 2PFGA 2WAAA 4XASA 4QJIA 3WYBA 4ZVRA 1Z15A 1A88A 4UUQA 2VI5A 3LY5A 4J4TA 4YMSA 5E95A 3TR6A 4B7UA 1MD9A 2NZUG 4DG5A 3PYLA 1T13A 5JH7A 1M0TA 5KMGA 5LSAA 1K4YA 1SEPA 1YL7A 3NGLA 3CJTA 1E64A 5CYFA 4BYMA 3E9DA 2B1JA 4YJ3A 3IURA 1S8NA 4NAHA 1PR4A 3FSJX 1QZTA 3M3PA 3K35A 3THXA 3SXUA 3K1ZA 1QIDA 3WZMA 4A1OA 2FWMX 1H94A 2G8LA 2WU0A 3RWOA 3T7DA 4YUXA 4KN8A 4LNUB 1I10A 2XZDA 3QNUA 2QPTA 3OZGA 3W5HA 5TPWA 4EQ6A 4TXHA 1ENZA 1JHUA 1J0BA 5JIBA 3HG7A 1ULSA 1D8TA 4E3WA 1YCGA 1C2TA 2NT3A 2E4AA 4LY0A 3SXPA 1L7AA 3O3NB 5D85A 1IB6A 3G5UA 4GPD1 4LC0A 1UP7A 1KAQA 3MSCA 2A4MA 2PUEA 5A3JA 2SNIE 2VJBA 2O8VA 1HE4A 5FYQA 3F5MA 3VR6A 4BNVA 1SAYA 4Z1MA 4E22A 3RGWS 2C29D 2XD9A 1S3IA 1RKBA 2VJQA 2XCQA 3BTSA 4QG7A 4C7JA 4Z2AA 5AXAA 2HV8A 3NHZA 3CHYA 4RMHA 1QRUA 1Y3DE 3URMA 3O2SB 4KXNA 1IIRA 3QBDA 4UULA 2TMYA 3VHRA 2HHAA 1AN9A 1Q7TA 3ZK9A 4GBGA 1HYHA 3OU7A 1OFVA 1Z73A 2O7NA 3R9IA 4DADA 4DE5A 3U61B 2N75A 2PS3A 4B6RA 3CNHA 5AM3A 3PQ5A 3WNZA 1E2BA 2HU8A 1YU9A 1GUZA 3O8DA 1R9JA 1YXMA 2NPFA 1KAOA 3PKIA 4GAEA 1EVKA 2CMHA 4CLOA 3PWTA 3ZVMA 1SC3A 4CKWA 5ETJA 1T29A 4JU9A 4BCDA 5CITA 5KJ6A 2GERA 4X24A 1NUUA 4DA9A 4XWYA 3VO8A 4KFRA 2JAWA 1KMMA 4PPYA 1JQBA 2H0AA 4ZXFA 3MLEA 3IDFA 4YRLA 1G2QA 2XGSA 2PSFA 3AI7A 3EZNA 1KZGB 3LF2A 3ZBQA 4EHNA 4GI3A 3T1OA 2R2GA 5CXQA 3CH5A 3GJ6A 1H85A 3MELA 3AESB 4TS3A 5DLEA 4R9SA 3T4UA 3VR5D 4ZYUA 2D5BA 2DZDA 2B4AA 5EJEA 1NI3A 3FHJA 2C4WA 1JVBA 1DWOA 2Y2VA 4MB6A 4PO9A 5DNDA 1A9PA 4GLBA 1FOEB 3FZNA 4DV5B 3FYUA 1E3IA 3QEJA 4HWGA 3L1VA 4OEHA 4WPGA 5KTPA 1GGNA 1WS6A 4O2RA 1DC3A 4O1HA 1KXJA 1RI3A 1SR8A 1JR3A 1SHLA 4GMXA 1XZEA 4FI3C 4CKBB 2JA1A 2OYSA 1R5BA 4C87A 1B8UA 3OHMA 1H8HD 4Y2JA 5TMDA 2VSQA 4QRIA 3HBLA 3RS5A 1DBQA 4E5MA 1JFFA 3JAWA 3IFSA 4Q9HA 4A1FA 3DKVA 4DB2A 1RT9A 1WPRA 1XVIA 3ID6C 3A4MA 3ZLVA 4WKNA 1VGQA 4UHKA 1S7GA 1UJCA 3ESBA 3OSUA 3E70C 1B74A 3C6MA 5SYAA 4HK4A 3GJ4A 4TV8A 1V1RA 1KETA 1UPTA 1Z35A 2GYUA 3O3OB 3L02A 2VQDA 4DC0A 2R66A 2FU5C 4QXOA 3U3XA 3W2FA 1P2GA 5JCZA 3EMVA 1YKFA 2PUCA 1EDDA 1JN0A 2NSHA 3QHAA 4KE6A 3JAKA 3SJBA 3JSXA 1XOIA 5DTQA 5JBIA 3C8DA 3L6RA 3LFHA 4DUZB 4LY3A 1XX6A 1ZUHA 1ZXBA 3KB1A 4WRRA 3USES 2QM8A 3OBBA 3W1VA 1MO4A 3V6MA 5LJIA 2GEBA 5FKJA 1DEOA 1XMSA 3MINB 4QGHA 1LVHA 4IDOA 3FCEA 3NUQA 2ESRA 4R8VA 1AXRA 3OFNA 5DXJA 2AXQA 3EVCA 2PKRA 2FFHA 3Q7EA 3KOYA 2D4HA 1RQPA 4LPKA 3OG9A 1UBLS 4KPGA 2WJJA 2IOHA 3I76A 4DCPA 3VBEA 4A4DA 2BMVA 2GBFA 2PT6A 2VAXA 4IP0A 2ZJ5A 3ETLA 5HFNA 1TQHA 2HLDD 2HMYB 1F7UA 3K70B 1C1XA 2BZ1A 1ZCJA 3HBNA 4B8YA 4D9IA 5BQFA 2WFAA 4F92B 5KQRA 3BULA 4Q3DA 3ZKWB 5BYBA 3O73A 4U2CA 1D0IA 4X63A 5LFAA 3B20A 1OFIA 3GNQA 3QELA 1I2ZA 3HXQA 3GHHA 2IIPA 1X8JA 2PHZA 3IAAA 2HWYA 2QMHA 3AUAA 4LYEA 4BV9A 5ALWA 4OBWA 4RPGA 4NRDA 1I36A 3O8RA 2QT1A 2HPHA 5KWJA 5KJCA 4OX9B 3EGIA 1Y6FA 1PAUA 2IHYA 2KWIA 4MROA 5G0WA 2ODWA 1YULA 3ISVA 3JQBC 3RW9A 4HNTA 2IP2A 3QK7A 4MVJE 3HJNA 4H6PA 4MGZR 4IDCA 5CXSA 4DMFA 5K5EA 2XB4A 4FCTA 1Z2DA 2GAOA 4UPDA 4ZT4A 1L1RA 2NGRA 5BWLA 1N5KA 4Q4HB 4V0NA 3HU2A 4YUVA 3GDGA 3E1KA 4RY9A 2PBZA 4KO4S 4FWTA 2V6BA 2BEKA 2XMQA 5PGMA 4CV1A 3EVEA 4DT1B 5CB4B 2WP8J 3L4BC 1TF7A 3L7LA 4JI8B 4WASA 3I9LA 1M6YA 2ZPUA 3NC0C 4HJRA 5KNBA 1NPDA 4MLZA 3JAMA 1KGSA 4IYRA 1LS6A 2HA0A 1CDEA 3F47A 3FWNA 3Q3EA 1SBQA 1GFSA 5AM2A 2PAAA 4H18A 1XKTA 2CXHA 4YC7A 1ACJA 4HLUA 1HMPA 1U2DA 1IN7A 3QG1A 4FGSA 5JY1A 4J76A 4I9FA 1XQYA 3FTPA 1B15A 1BXGB 1T24A 3GRPA 4Q3CA 3UJAA 1A9XA 3VH2A 4UNQA 3AB8A 2CF6A 3M6AA 2OTCA 1OV4A 2PX2A 1U0LA 4Q16A 4QPZA 1O9GA 3RVSA 3UMSA 3EPHA 1I2CA 1IULA 2C9DA 1I01A 3K0AA 2BGJA 3PR3A 3QJ5A 4XD2A 5B7QA 2Q27A 4COOA 2HO5A 5JNLA 3KAKA 1GCGA 1ZW1A 2AEJA 1NBAA 4YDSA 1ISGA 5DO9A 3VJMA 1O97C 3TE6A 2PQ0A 4LHSA 2QYTA 3DHYA 3MRVA 2OP1A 3JVDA 2J4FA 2RHTA 5CNJA 4Z6KA 2NVUA 4Y1GA 2WC1A 2LR0A 4O4LA