3OU7A

Dhpi-sam-hep complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
214
structure length
214
Chain Sequence
TTSHGLIESQLSYYRARASEYDATFVPYMDSAAPAALERLRAGNIRGDVLELASGTGYWTRHLSGLADRVTALDGSAEMIAEAGRHGLDNVEFRQQDLFDWTPDRQWDAVFFAHWLAHVPDDRFEAFWESVRSAVAPGGVVEFVDVTDHERRLEQQDDSEPEVAVRRTLQDGRSFRIVKVFRSPAELTERLTALGWSCSVDEVHPGFLYATCRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM-dependent methyltransferase
publication title Characterization and structure of DhpI, a phosphonate O-methyltransferase involved in dehydrophos biosynthesis.
pubmed doi rcsb
source organism Streptomyces luridus
molecule tags Transferase
total genus 72
structure length 214
sequence length 214
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ou7A00
5EIFA 1Q0TA 1WXWA 1NBIA 3BT7A 2AOUA 2CKDA 2BR5A 4EMSA 2QYOA 1RJGA 1WZNA 2FRXA 3A7DA 3DMFA 2ZFUA 3LCUA 4E31A 3LPMA 3CJTA 1NW3A 3MTEA 1NE2A 2AOWA 3SM3A 3OZRA 3VC2A 5K01A 1EIZA 1M6YA 3OZTA 5FULA 3O31A 2UYOA 1SKMA 3FTFA 3CCFA 4AZSA 1G8SA 3P9IA 3UA4A 5DM0A 4CKEA 4ER0A 5K0FA 2P35A 4A6DA 2P3OA 5HILA 4BLWA 2PVCA 4OBXA 1YB2A 4PGGA 2NYUA 2H00A 3BUSA 3FPJA 3NWBA 4QDJA 4EQZA 1R74A 1KIAA 3TOSA 3GRYA 1ZG3A 4PYJA 4YV1A 5G02A 1VQ1A 1EQAA 5EC8A 5FQOA 3UFBA 1HMYA 3EVCA 3NW9A 3KQPA 4BP3A 5B1SA 2OYRA 1TPYA 4A6EA 2GPYA 4F86A 3R0QA 3KKZA 4FT2A 5GIPE 1G60A 2ZZMA 3PX2A 2OB2A 3Q7EA 1NKVA 5DM4A 5E9JA 4AZVA 3EVBA 4CXMA 5FTWA 3NDJA 3O4FA 3LDGA 5ICGA 4C03A 2OBFA 3DXXA 4HRAA 4RTSA 2ZLBA 3HNRA 3FUVA 5EQJB 1SUIA 4K6MA 5P8WA 2HWKA 1RJEA 3MCTA 3KPVA 4GC5A 4LWPA 1R18A 4PIPA 2EFJA 4QDKA 2AS0A 5ERGB 3SR4A 4KIGA 1YZ3A 2JJQA 1TW3A 4XUEA 1KP9A 1XCLA 8MHTA 1XDZA 2JHPA 4DMGA 3BKXA 4OQDA 5JUWA 3SSMA 1JTFA 4C07A 1T43A 4P7KA 2Y1XA 2Z6UA 4BP1A 1DL5A 1O54A 3ME5A 5BP7A 4DQ0A 3ELUA 1FBNA 4FR0A 1YUBA 4OA8A 5EPEA 2PV0A 1RI5A 4RTRA 3FPGA 3ANXA 3FYCA 2JHAA 4RTMA 2AVNA 3PX3A 3DR5A 4E30A 2O57A 1N7JA 2IGTA 5E1OA 3P2EA 2GH1A 5K0JA 2QY6A 2CL5A 1PRYA 2JHCA 5E8RA 5FADA 4E2WA 2AOXA 4OQEA 3UJAA 4X1OA 2BM8A 2P8JA 5FA8A 4CKCA 3CGGA 3I53A 1L3BA 4LG1A 4PGHA 4PYNA 5T64A 5LQUA 1FP1D 1FJXA 2XBMA 3PS9A 5K0LA 4M38A 5GM1A 2BZGA 2XVAA 3A26A 1ZGAA 3OU6A 3TLJA 1XTPA 3A27A 5IH3A 4B17A 5F2NA 1XCJA 2LD4A 3KPJA 3KQVA 5K0CA 4Y30A 4DKJA 4PYQA 10MHA 5FHQA 3M4XA 4X60A 2AR0A 1NW5A 4QVGA 3EGIA 4XCXA 3T7SA 3VSEA 5CIYA 4NECA 4HTFA 2G72A 3GIWA 3ER8A 1RJDA 4IV8A 5EKXA 4OX9Y 4YMHA 5DTQA 1EJ0A 4R8SA 5DPMA 5HIJA 4YUXA 3E23A 3NJRA 1QAOA 2NXEA 4PONA 3B7PA 4QVKA 3SMQA 3QV2A 3PTAA 1SVUA 3NTVA 4V0RA 5E1BA 5HZMA 4C05A 3HVKA 1H1DA 2PX8A 2V7EA 3SGLA 2BR3A 1M0EA 4BY9E 2FPOA 2IH5A 2PGXA 3KR0A 2IFTA 3GRRA 3LL7A 4CKBA 4AX8A 1N2XA 5BW4A 5K8VA 2IH4A 3MGGA 3OU7A 4FT4A 4L7VA 5CCXA 4BLVA 4ER6A 4KIFA 5E1DA 4R6XA 2PKWA 3M70A 4X41A 3E7PA 4DCGA 3AY0A 4PINA 3A25A 2YUIA 5K0NA 3FZGA 3I9FA 3VYWA 4GUAA 4CTJA 4ER3A 2AOUB 2OZVA 3KQOA 3UJBA 3FPHA 1NT2A 3CBGA 4RTNA 3FYDA 3UJ7A 1JG3A 3KPYA 2ZWAA 3LGAA 5E1MA 3SSNA 5E2AA 1MHTA 2NP6A 2P3LA 2PLWA 3MTIA 5EHIA 5CCBA 5DM2A 1U2ZA 1I1NA 2HMYB 4GC9A 2GS9A 5EZSA 4RYLA 4PCLA 4C06A 5DTRA 2NXCA 2O07A 3OCJA 3MB5A 3BWMA 4EK9A 4IV0A 1VLMA 3DUWA 3MQ2A 4U7TB 3EEYA 3LBYA 3M33A 4R8RA 3FPFA 4ER7A 3PLAE 3HCBA 4XUDA 3V8VA 2ZIGA 2ZWVA 3BWCA 3FRHA 4MIKA 3G2MA 2BR4A 1X19A 1YZHA 3R9XB 4YMGA 2C7OA 5D1HA 3G89A 2IDKA 3BGDA 5EMJA 5CUQA 5K0BA 3JWIA 3KR2A 2NNWB 3ELWA 5K0EA 2AN4A 3FUWA 2EG5A 3FUTA 4YUYA 4RSRA 2YXEA 3LX6A 4QPNA 1FP2A 5DWQA 3K6RA 5DX0A 3RW9A 5HOQA 4JXJA 3B3JA 3QOXA 3LSTA 2BH2A 3FTDA 3C6MA 4H0NA 5BXYA 1VPTA 2IPXA 5DRYA 2QRVB 4FSDA 2GLUA 2IDJA 2OY0A 3EVDA 1QANA 2ZVJA 2PX5A 3IV6A 2XYQA 5CM2Z 1RI4A 2ONZA 4YV2A 3ER9A 5FA5A 2FK8A 3G5LA 3DMGA 5GP1A 5DLYA 2UYCA 1KYZA 3MERA 3Q87B 1JQEA 5F2OA 3C3PA 4HGYA 5FHRA 4POOA 2IBSA 5LQNA 4Y2HA 4GOOD 4GBED 1QZZA 2B2CA 3HP7A 2QRVA 5HEKA 4RTPA 3JWGA 5K09A 1G38A 2ZW9A 5C9ZA 4CWAA 3ID6C 3KQQA 3SSOA 1V39A 4FSXA 5GIOE 5GWXA 3CJQA 4MTLA 3TFWA 1YFLA 3GJYA 5DM1A 1AF7A 4GQBA 3M6XA 3C6KA 2WA1A 4AZWA 4YUZA 3LDFA 2DULA 2PWPA 2G70A 2C7PA 2A14A 1P1BA 3P9KA 1PJZA 3LCCA 3GXOA 4PYIA 1M6EX 1SQGA 2CMGA 3LCVB 3FPEA 3U81A 3G2PA 3UJCA 2NP7A 1VIDA 1EJ6A 2GB4A 1IY9A 3GRUA 1JG2A 1JQ3A 3PVCA 3EGVA 4MQ4A 5LSAA 5ICEA 2PX4A 2QE6A 5KQSA 2I62A 3D2LA 3IEIA 1AQIA 3AJDA 4WXHA 5DXJA 3UA3A 5H02A 4E2XA 5GINE 3FTCA 1XJ5A 1SUSA 3G2OA 4ATNA 1QYRA 3LKDA 1OR8A 3BZBA 3HTXA 3TRKA 3UJDA 2BM9A 5FWDA 2YQZA 3TKYA 1VP9A 2ZBRA 2OO3A 5LR6A 4OA5A 4HTFB 3VC1A 5KQRA 3UJ6A 4QTTB 1JSZA 4C4AA 4QPPA 2CMHA 1KYWA 1I4WA 2Q41A 3OPNA 4ISCA 3TM5A 4KDRA 2UZ4A 2Y1WA 5FWAA 2AZTA 9MHTA 3PFGA 1ZKDA 2PXAA 4DM3A 5K03A 3WSTA 4E32A 3T7RA 1VP3A 4V0QA 3BWYA 3HCFA 3SVZA 4P7GA 2IIPA 4F84A 4PYLA 1ZQ9A 1UWVA 3BGIA 4RTLA 2ADMA 2WK1A 4PYKA 2VZ9A 2AN3A 3DMHA 3P9NA 5EEGA 4BLUA 2ZCJA 1FPQA 3KR1A 3KPUA 3GRZA 4FS8A 5IKMA 4GOND 4P7JA 4UOEA 3B5IA 1EG2A 1YF3A 5DT2A 4EVIA 2PX2A 3GCZA 4O29A 1BC5A 3AXSA 1ZGJA 1ZHFA 3G2QA 5FQNA 2XYVA 2YX1A 3DTNA 4PCAA 4PWYA 2FCAA 3C0KA 1NV8A 3GNLA 4GEKA 3EVAA 4IKPA 3CKKA 1KR5A 4E70A 3ORHA 5GOZA 2P40A 4YV0A 2FYTA 1BOOA 2OKCA 3DH0A 4RVDA 2XYRA 5C1IA 3UJ8A 1AQJA 1EAMA 2AOTB 2YXLA 3DXYA 5JR3A 5LQJA 2ORED 2FHPA 3NVKI 4C04A 3R3HA 2PT6A 5EKUA 3NVMB 4RVFA 5E9QA 4DZRA 2WA2A 4KW7A 2FK7A 1RI3A 3CVOA 3ELDA 2IH2A 1X1DA 2PSSA 3SXJA 2E5WA 1YFJA 2VDVE 3S68A 5CVEA 1MJFA 1P91A 2HNKA 4QTUB 1L9KA 4HC4A 4YUWA 1XXLA 2AOTA 2N47A 2P7HA 2UYHA 1KPGA 3HM2A 2ZTHA 4KDCA 2VS1A 2XVMA 4P58A 4AZTA 3MHTA 3DXZA 4E2YA 3R24A 4G56A 5EGSA 4E2ZA 4RWZA 2PT9A 5EEHA 2ZULA 3MAGA 4DCMA 1L1EA 2UYQA 3EPPA 3M6UA 2YTZA 3AXTA 5EG5A 4FZVA 3TQSA 2YVLA 3DOUA 3OZSA 3SX0A 2JG3A 3I64A 3KU1A 1JG1A 3H2BA 1DCTA 3LBFA 4GOLD 5EIWA 3KR9A 3PB3A 3DLCA 1D2GA 2HTEA 3AWIA 3HVHA 5HIMA 1IM8A 5E2BA 3TM4A 2YR0A 3M6WA 2IP2A 2DPMA 7MHTA 3BGVA 1Z3CA 2HV9A 3E05A 1L3CA 3OE5A 3ELYA 4U7PB 2R6ZA 3NMUF 2ERCA 3P2KA 5CVDA 3KQSA 2PJDA 1F3LA 2GA9A 5CVUA 2EJUA 4FP9A 1XVAA 1BKYA 2IBTA 2O0LA 1BHJA 1WG8A 3BWBA 3T7TA 5EVJA 2G1PA 1XDUA 1Y8CA 2F8LA 3RIEA 3THRA 4E33A 4F85A 3KHKA 4OBWA 4R6WA 1IXKA 2NXNA 1KHHA 1RI1A 2P3QA 4WVLA 1XDSA 4C08A 2HR1A 3FTEA 3R6TA 4KVZA 4AUKA 4LECA 3A7EA 1KXZA 2G71A 2I6GA 3HVJA 3L8DA 5EMLA 2AOVA 3I58A 3GWZA 2AVDA 2I7CA 3CJRA 3M6VA 2P41A 3G5TA 3EGEA 2B9EA 1DUSA 3HA5A 5CVJA 4EKIA 2JH9A 3LECA 3X0DA 4IWNA 5LQKA 2P7IA 1O9HA 3OU2A 1VL5A 2OB1A 2ZBQA 1D2HA 3HA7A 3T0IA 5CVVA 5EHGA 1F38A 2ESRA 3HCAA 3UJ9A 3FRIA 5K0GA 3KQTA 5D1NA 3KPWA 1G8AA 3QOWA 5KVAA 2PY6A 3TKAA 1UIRA 3KQYA 1X1CA 4MWZA 4HH4A 5EOVA 3FUUA 1KPHA 1Q0SA 5HIIA 4M7RA 4ER5A 2OPBA 2YXDA 3P2IA 5K05A 3EEOA 1HNNA 3NDIA 4LWOA 5ICCA 4RVGA 3GDHA 2H1RA 3BKWA 3BXOA 2B25A 5DRTA 1WS6A 5DXAA 3E8SA 3IYLW 5T6BA 3GGDA 2B78A 2P1DA 3EMBA 3TPZA 5LQAA 4RTQA 1R8XA 3ERCA 3GU3A 2AN5A 5KYGA 3FUXA 5GM2A 1WXXA 3DLIA 1JR4A 2EJTA 2ZBPA 3C3YA 4DA4A 1NW8A 2PWYA 2V74B 5F2KA 1P1CA 4HSGA 1X1AA 5DTMA 5C0OE 4RVHA 2K4MA 4PNEA 1NW7A 4R05A 2VDWA 5EMMA 1VBFA 1B42A 1UFKA 2OXTA 1SG9A 1N7IA 4GF5A 2C7RA 4PYOA 1SQFA 3KQWA 4HGZA 3OFKA 3UWPA 3DP7A 4P7FA 3EVZA 3KQMA 1QAQA 2JH8A 2VDUE 3PT9A 2QM3A 5HIKA 1ORHA 3DULA 4KWCA 3LHDA 2EX4A 3HCEA 3NWEA 1VE3A 3G88A 3GO4A 4GOMD 5HFJA 4RTOA 1JTEA 1RJFA 5ICFA 1NW6A 3EMDA 1R8YA 4PYMA 3OE4A 3CC8A 3TMAA 4DF3A 4MHTA 1R6AA 3P9CA 5LQCA 3V97A 2PBFA 1TW2A 3EVEA 2G8NA 1R00A 2VP3A 5CD1A 3RODA 3F4KA 3G7UA 3P97A 5KS2A 4PIMA 4YUVA 1NV9A 5EMKA 4RTKA 3LKZA 3OFJA 5DSXA 4RTJA 1JQDA 3PFHA 5LQRA 1NBHA 2C7QA 3UZUA 3JWJA 5E9WA 2B3TA 1L3IA 1WY7A 3G8BA 2Z6QA 3HEMA 2ONYA 3TR6A 1ORIA 5FUBA 3O7WA 3LDUA 4RV9A 4X61A 5FCDA 4CTKA 4EKGA 3HCCA 2PXXA 3MCZA 3EVGA 1D2CA 3REOA 3EVFA 3IHTA 2O05A 4FGZA 5DX1A 1INLA 1JSXA 4QQKA 4QQNA 1G55A 5T67A 2ZIEA 4HG2A 5M5BA 2CWWA 5MHTA 3B3GA 2ZZNA 2NXJA 3B3FA 4ZTBA 3P71T 1I9GA 1JG4A 2H11A 2ZIFA 4M37A 5DX8A 3THSA 2Z6AA 1X1BA 2R3SA 1P39A 3UBTA 2O06A 2KW5A 1O9GA 3B89A 3JWHA 3P8ZA 4X63A 3G8AA 5BW5A 4KRGA 3HCDA 4XUCA 4RX1A 1AV6A 2I9KA 2ZSUA 1KPIA 3HA3A 1RI2A 2PXCA 5EZQA 1QAMA 4M36A 2GAFA 3A4TA 3GRVA 3K0BA 3I5UA 4Z2YA 3HVIA 2ZZKA 1G6Q1 5E8JA 5U4XA 5DSTA
chains in the Genus database with same CATH superfamily
1DC4A 2ZJAA 4KLCA 3ZY3A 3U5TA 1NBIA 5JO0A 5A5FA 1CUVA 2F67A 2IUFA 3A1WA 3T4PA 2P9FA 5JY1A 4WZAA 1C1HA 1FLAA 4ROSA 3E3AA 4N8SA 4C0WA 4DA6A 5KKCA 1MR3F 1N6OA 3NVAA 4C76A 2HA0A 1MGOA 4CIVA 5GQSA 3OA2A 1JBKA 3PF8A 5K01A 4DC9A 1M6YA 1NDUA 1MFPA 4DEXA 1Y4ZA 4WKNA 3LUJA 1GTG1 3BSYA 3FPAA 1J2EA 4AZSA 4C87A 2CJWB 3HO6A 3MCWA 1YCDA 2P6PA 5BSMA 1J90A 2WJJA 1ZJ5A 3I2GA 3NO4A 4PG6A 2IPOA 4DLZA 4AKGA 3A2LA 4DNXA 1QB8A 1SXHA 3Q9NA 2UZ3A 3QKUA 1Z2EA 4LXUA 4UE2A 4D9IA 1JMKC 5HKBA 1EQAA 1J4AA 1K92A 2XI4A 3QUCA 3IOEA 4TXJA 4BNDB 3B78A 1G3UA 5FLKA 3ZDZB 4RMJA 2WIBA 3JPYA 4RLQA 3ZHUA 5I9LA 1R0XA 3CLSC 2UZ1B 3N87A 3WSWA 5B12A 2IZ5A 5B2EA 5IC4A 5K8UA 3F98A 1REQA 3ORSA 3ZVKA 1L4GA 5E9JA 2WG1A 1W0KA 2QB5A 4YJ3F 1RHJA 1LBQA 1E20A 3MTDA 3ESCA 1FYFA 1T4MA 2ACKA 2IE8A 2IYWA 4HRAA 5E4JA 4KK4A 1XKTA 2ZYUX 3FUVA 1N6LA 3JVEA 4HXFB 4DKXA 2IKSA 3WIOA 3EXIB 1Y89A 1KNXA 2RHJA 1T3ZA 4K6GA 4KODA 4GSKA 2R1VB 1J21A 3OCYA 1FU7A 1U31A 2GN6A 2IIVA 2ZXEA 2J85A 1G8KA 1EKXA 3K9HA 3WLIA 5HCNA 2AH5A 1FFYA 3MGKA 4POAA 3NCHA 3ZCRA 3ELUA 3V4FA 1OIXA 4IJVA 1I6MA 5AJYA 4DV6B 3SE0A 1X8LA 2ILVA 4OJTA 1F7VA 3BZWA 1XG5A 2AFIB 3W0LB 2IC5A 1OD6A 3S29A 1SCBA 1PFKA 4JITA 2O57A 5IAKA 4W1QA 2VHUA 3CWQA 4GXQA 5JMOA 4C2TA 3C8ZA 3NT5A 3UY4A 3ICCA 1MBZA 3QYFA 4CU5A 1VBKA 1GCOA 1FLNA 2D54A 1JHRA 1BJTA 2FFBA 3JQBC 1B8UA 2JGMA 2CJFA 4OOFA 2HCRA 4D0RA 3RFVA 1DWPA 3IIMA 2AFRA 1C3OB 1ADJA 4DABA 4JXZA 1FJXA 1F8UA 3O91A 5DGTA 3PQFA 1A4UA 1ZWKA 4TXNA 3LBNA 2EWMA 3NHRA 1J8MF 1QHNA 2XB6A 4ALJA 4HQLA 2EFHB 1DXQA 1XLUA 3FYHA 1D4OA 3BDIA 3DC7A 1OPRA 2P9HA 2XDYA 1LTKA 3BSFA 4EJ0A 3LKBA 3O3OB 3V1NA 2XZLA 4L8LA 4R7ZA 2QM8A 1BQ4A 1PJQA 2Z5VA 4MITA 2R7KA 5J59A 3RGGA 3BWDD 1POXA 1R6XA 2CFOA 2H16A 1RJDA 3Q6MA 4HGPA 4OI0A 3AIOA 4TS4A 3G49A 2OAP1 3DEZA 5G3ZA 3NHZA 1CUJA 2IT1A 3P9PA 1K4YA 4P7BA 1BHSA 1RRKA 4WKOA 3EISA 4V0RA 2XMRA 3AL2A 3E6AA 4XIFA 2TMKA 2A1IA 4KR2A 3VR2A 4YLGA 3MGAA 1PS8A 5LC1A 2ZS7A 1AJEA 2J3JA 3NONA 2C5FA 3R23A 4CTMA 1LTHR 1PEKE 3GL9A 4JEHA 3D4BA 3SQNA 3INGA 5ESXA 4BLVA 2RJ3A 4F96A 4JI2B 3ZKWB 5IJ0B 3O2SB 4DCOA 4D82A 1RHQA 4UD2A 5GJCA 4DLRA 1VYHA 3TUZC 2VJLA 4BGIA 4NBUA 3KUDA 3O83A 4B8ZA 3ZNPA 1KOJA 1DGQA 3U09A 1ZAKA 3R3XA 4WN9A 3CBGA 2ARKA 3N0TA 2I54A 4RTNA 8OHMA 1GGHA 4OHUA 2I2BA 1U3UA 3EW9A 4JT2A 4LMRA 5B3AA 5TB5A 2ZUDA 1XDDA 4YRQA 1RP1A 1CF4A 1ZYUA 3OKAA 2C97A 1T2CA 1OA1A 4HUTA 4KYIB 3H0CA 4F7DA 4KMSA 2V7BA 5A9SB 1CQXA 3UJ3X 3CA8A 3PQ8A 1ISIA 3VKHA 2WD8A 2WF5A 1G7CA 1AKYA 3VSBA 4ENRA 5JYBA 4B3FX 4ER7A 2V65A 3B3AA 4D5GA 1HBJA 3KZNA 1Q20A 4IDHA 4JC8A 1FMLA 2B7BA 1BEUB 1GDDA 4RH0A 2WLSA 1M1YA 4MIKA 4TMTA 3ODGA 2HJGA 3A4NA 1CTQA 3G2MA 4GM0A 3RADC 1X19A 1WBJB 5F7JA 3R9XB 4IV5A 3VKUA 2AN9A 3LG2A 1P5ZB 4I55A 4DOMA 1F2UB 2P0YA 2JBHA 2C1EA 5FUVA 2Y71A 3AEUB 1E1NA 1E66A 2HF7A 3CLKA 3DMYA 3GWGA 3MPOA 3EJ6A 4EHBA 2NNWB 3GG2A 5G4KB 4UM7A 5GJWC 1HH4A 2EG5A 2ZTUA 4CNBA 3IAS6 3M7IA 5U4QA 2D1YA 2QQGA 1HUQA 2VJQA 4J2HA 1V7CA 2NOAA 2VJMB 5JAQA 3E3LA 2P4EA 3C6MA 2BT4A 3FLMA 3LXMA 1FFBA 2O3TA 2QRVB 5IM5A 4ZYXA 3IV6A 2GF2A 2ZVJA 1JH8A 3EUFA 1I2CA 1RI4A 3FCYA 3K30A 4JQOA 2JC3A 3ESXA 3KO8A 5EI5A 2O7QA 3VJMA 4RCYA 4CG0A 1LDEA 5F1OA 3QGMA 4QGAA 1GR0A 2NT3A 2X5JO 1UBGA 4TRRA 4BWFB 1AN9A 1PT8A 3SPXA 1JFRA 3R5TA 3RVKA 2D4AA 4FD2A 3N8NA 4MX8A 2EGUA 1BCSB 4KIUA 2YWEA 3TSYA 1Q0QA 2Q5QA 5A5GA 4N3GA 5K09A 5ALXA 1TEVA 5EE0A 4O0MA 4S1NA 2CFTA 5FB3A 1Y6ZA 2CFRA 3AF1A 1XVTA 2OUIA 3K4PA 2PH1A 4MTLA 1YFLA 2QU7A 3BFPA 2HX1A 4AZ3B 5KTOA 1Z6GA 4D8YA 1CETA 1IIRA 2GNAA 4US1R 2VNKA 3NP9A 1JZSA 1RQNA 3OLYA 3SIRA 3FWYA 1CKEA 3M6AA 1T1GA 2G9RA 3B6EA 1VCOA 3IQFA 5IAAA 1ABFA 4QELA 5CIWA 4CHGA 2SECE 3E27A 1AHPA 1PJCA 3PX7A 2JNWA 1UAGA 1WQ1R 3A04A 1MRNA 3O8LA 3BL8A 1FNNA 1HQCA 4E2XA 1PUXA 1WSDA 4PC3A 2W6CX 4BLQA 1ZIPA 1XJ5A 3R6DA 3UK7A 2K2QB 2PX3A 2ZJ2A 2C9BA 1OR8A 2VSYA 4Q1CA 5FUXA 1KDZA 3MBIA 4F4UA 3F4BA 4CQLA 4LHVA 1Y8AA 4GYJA 4MEAA 5KSYA 1ZVVA 1ISMA 4LDRA 3KJGA 5J5AA 3ROZA 1N6RA 4RZ2A 2E2WA 5CB4F 1K9SA 4J4BA 5I7FA 3QVVA 4ZVRA 5BRAA 1AZTA 1E2HA 2X22A 1G20A 3G8DA 4DJJA 3QVMA 3KOYA 1KQPA 3SAJA 1OASA 1W85A 3HKEB 5KDOA 1ZIXA 2P9ZA 4K9OA 1RAEA 3P0HA 3QIVA 1TEXA 2Q27A 4EI8A 4QG3A 3C39A 1A8IA 2GXAA 1QG0A 3AMVA 3GRKA 3ZBPA 4KKXB 4FBMA 5EEGA 4DDMA 1S2DA 2ZCJA 4H3KB 1G21E 3PZRA 1G1MA 5E6RB 3VKWA 3FMVA 1O89A 2RGEA 4EY6A 5LYYA 1QHGA 2M1ZA 2Q21A 4RV4A 3WL5A 3WO1A 1F7UA 1NF3A 5KYTA 1KMHB 4YA6A 5HBRA 2EDCA 3UFXB 2PGLA 1AMOA 1A2QA 3GDFA 4ZMSA 4UHBA 1KR5A 1TF2A 3GJQA 2WFZA 4F72A 3EGWA 4RVDA 2CXSA 1G8MA 4RQUA 4DWOA 2ZATA 3GDWA 1ZNZA 2PL3A 5HNKA 1A9XA 3NZEA 3PRKE 4YRDA 3JQ9A 5HW0A 1FFWA 1KY5A 2E6UX 5I4KA 1L5RA 1HE4A 2QAGB 1PW5A 2RK4A 4S1WA 5K1ZA 1R3DA 3MWYW 3Q5GA 1VE6A 2QTVB 5HCUA 3CVVA 4XARA 3GZJA 3DNFA 2IVFA 4HC4A 1XXLA 2N47A 2PHZA 2QD5A 4LJ5A 4X8LA 3HM2A 4XM0A 3SFZA 4AMGA 4KDCA 4MVCA 3AYZB 3UMRA 4P58A 3JV7A 1QE0A 5B1DA 3WYEA 1NQ5A 2JJ8A 1L7AA 1ZINA 4WLNA 2IDMA 1Z5PA 3PXDA 4OM8A 4PZAA 5ICMA 3JSAA 5EEHA 3IL2A 1L4YA 2GZRA 2JBAB 2QL7A 4WY8A 3C1AA 3D8HA 1PYOA 4XGKA 1Q1ZA 2HKIA 3CE9A 2X6RA 3KAPA 3IP5A 1F2DA 1DLJA 1VE9A 1E8DA 3DOUA 1AGNA 3C3MA 4FX2A 3C6ZA 3RUAA 3DBRB 1BFKA 1JG1A 2CBGA 3CX8A 3EAFA 3NHLA 1B6RA 4CDNA 3QWHA 4DHEA 1TT5A 1LDMA 3KOXA 4WOPA 1L5NA 1IM8A 3EEBA 5K3FB 4HGRA 4Q3BA 4US0R 4O33A 4W8HA 3GZTB 4TN5A 5KSWB 3NJ4A 1PE0A 5DMHA 4B47A 4RHTA 4BKQA 3AKCA 5H68A 5I7EA 4H7EA 5F1PA 3FMPB 4LVNA 3WLHA 1Y3CE 2ID8A 2LW7A 4JI3B 1ACMA 3W1WA 3WX0A 1XZJA 1J49A 4Q1VA 1DJLA 2PJDA 2VRCA 3WXMA 5JYDA 1FSZA 2NO4A 3GJ0A 4W5TA 1ZNXA 1UPFA 3HY3A 3LWBA 1TAUA 1OYYA 2ZB4A 3BWBA 4FGUA 3T5BA 2OBLA 4BUJA 1VJGA 5FLYA 2G1PA 4RTRA 1KAEA 3DV2A 1O5IA 3AETA 4ND5A 4OBWA 2NXNA 5ALUA 5ENDA 3KYCA 3QBEA 1P2BA 3UJHA 1KZ7B 3WL6A 1YMVA 1O08A 2BGLA 4YQEA 2O3QA 3JQQA 2AOVA 3A1SA 4IF6A 1EA5A 2GZMA 2Q8PA 4RD2A 3HU3A 4I50F 1IEQA 4Y6QA 3ZE1B 2VPXA 4IWNA 4PGAA 4GPZA 3H9JA 1PNRA 3QBVA 1L4EA 1P9WA 1VL5A 2WKPA 3V3TA 2OB1A 3G9TA 3URKA 3BMNA 2QZZA 2AXEA 3M6IA 2QTNA 2E55A 5HG0A 5EHGA 1U04A 4OHXA 3DVQX 4JLKA 1XQ1A 1TEHA 2M32A 4MWGA 1GTL1 3T3HA 1Q6ZA 1B0AA 4Q7JB 4Y6LA 2O8EA 3KTAA 4C43A 5CHYA 4NCIA 2XA9A 4O2BF 4LPKA 5C5CA 4QX6A 3WL4A 2VYFA 1Q0SA 4Q21A 4L4UA 4RVSA 5J4VA 3HADA 4MVWA 4IIYA 1K6EA 2QUKA 3IAUA 5ICCA 4ZIRA 4ZOCA 4WNCA 4BZWA 5HKLA 4ES6A 1SHZA 4OFWA 1AGYA 2OEPA 2WU4A 3DAGA 4JB8A 1TFUA 4NQRA 3AL3A 1CUBA 3O0TA 3CR8A 3CVJA 2CHUA 4MKRA 2PMEA 3IR7A 3FUXA 3L5OA 4JDPA 4LWQA 4A6PA 4A03A 3OLXA 5CJ2A 1KJJA 1F8FA 4BHTA 1W87A 2JA1A 4GSYA 5IAGA 2YV4A 4LKRA 3I62A 2FPWA 2K4MA 2JFYA 3QK7A 4ZXPA 4PNEA 1RWXA 1CU1A 2AI3A 1JA9A 221PA 5PGMA 4AX4A 2FZWA 3WKBA 5FH9A 1AMUA 1RXIA 2PFGA 2Y77A 4PYOA 4W5RA 1PI3A 4JV5B 1NVXQ 1YB7A 3FMOB 3HQ4O 4XGNA 4DJAA 3D8NA 2XCSB 4BMOB 1CJKC 2FDCA 4L6IA 4QOSA 2AQIA 4I1VA 1FTNA 3G88A 4GOMD 4RKFA 5KVCA 1DRJA 1US8A 1XLTC 2QMQA 3U56A 2QVLA 4M98A 4PYMA 4I4TA 1P45A 5K7SA 3PCTA 2PBFA 1T2DA 3H75A 3R6WA 5AUNB 5C3MA 4BJ5A 4H18A 1IIBA 3ZGNA 3ZHZA 3Q15C 1Z15A 1I3CA 3KAJA 4OI1A 3ZQJA 4PWZA 3RC2A 3LY8A 1B15A 4PSAA 2LV8A 4BMXA 3QWBA 3VR3D 4YCNA 1HE2A 2VT2A 4EELA 1ZZGA 4Q9JA 3B85A 3LRPA 4IHQA 3EDYA 5TVGA 3WWCA 2HA6A 1RYHA 3R9IA 3U39A 3ZV3A 1A7UA 4FYVA 2O8FB 4BXOB 1B6TA 4PFSA 4EKGA 1MH1A 1SUEA 2BFDB 2FGKA 2YMMA 4LFBB 2ZTMA 2V45A 5IHPA 3EVFA 3O8QA 2IEDA 1JKIA 3QVLA 3VNUA 1T8UA 3ZEIA 2FG5A 4QQNA 5MHTA 1U3GA 2CWWA 2P69A 4RAOA 2D1SA 1MEEA 2GASA 4MP3A 1RU3A 3B3FA 4JVOA 1I9GA 4ZI5A 1EFTA 4AJ1A 2ZZNA 4M0LA 2QBYA 3UHPA 1TYDE 2O2CA 4U6SA 4UULA 1SCQA 2Q7OE 4GGPA 4F3KA 1CUWA 4YUAA 1JE1A 5LP1A 2MSCB 4X63A 5BWMA 4O25A 4NNPA 1Z45A 1JR3A 3C97A 3LTNC 1BNCA 4N0MA 3T5PA 1QBGA 1VSQA 1YQTA 1R4MB 2QP9X 1T0IA 4QOJA 2Q45A 1HDIA 4ZZ1A 1BX3A 1QH8A 4EHAA 5AHWA 2GAFA 4JAVC 2BEUB 2N75A 1GCAA 4ERNA 4W63A 1B43A 5WRFA 2ZZKA 4CUKA 3IEUA 2IQIA 2AG0A 4R9SA 3QJ5A 1DKRA 3B8EA 1UT8A 3KV1A 4BEBA 2C2ZA 4MW2A 5A4FS 1M1XB 2WIFA 1EDOA 5DHAA 2QRUA 3KHUA 5ERYA 3KVRA 3VNBA 2MYNA 1D1TA 3I9NA 3QMVA 1BMQA 4BZXA 4YP9A 4JLAA 4NY1A 1XMJA 4GD3Q 3ZWVA 1V3QE 1XTJA 3MSXA 4QQRA 4V0LA 1TTPB 5KSPA 2ZYWX 3KELA 4E5UA 5CNMA 3OJ0A 2WHEA 4G26A 4OU4A 2AKEA 1CIPA 4LCEA 4PU0A 4Y9UA 4YV7A 2NAFA 1NX9A 4RMIA 4A6DA 4O4IB 3NV9A 5JH7B 2QZ4A 5KQPA 2YY6A 2QRJA 2A9VA 2Z2KA 3ZVNA 3GBSA 5CLFA 1YIAA 3JZDA 5I7OA 1I6LA 2B21A 2MYTA 3CLRD 3DOEA 1U4SA 3KQPA 2HSWA 2X4GA 1X7ZA 1FMFA 4KBGA 2OYRA 4A6EA 4FT2A 1NTRA 5JD5A 1X1TA 3SX4A 3A32A 5GTDA 4OXIA 2ZSBA 1RLIA 1CR0A 3W05A 1A9RA 3MUOA 3QG5A 4OEHA 3AB8A 1J0XO 1ZD3A 4P3OA 4C3VA 3H4TA 3JYPA 5GOTA 3V1YA 2B98A 2GM5A 3L02A 5FPHA 4TTAA 1EJBA 1EGMB 1O95D 3QVWA 4KLAA 1CJBA 2OESA 4BNUA 5AVQA 1U02A 2DAPA 1YZTA 3IVCA 4WGGA 5ISMA 3QEMB 3SSMA 2QGNA 5FBLB 5T7BA 4ZAGA 4ZHQB 4BP1A 3G8CA 3EGOA 1Z0KA 2BFNA 2DUNA 5KMGB 4JEUA 2DM6A 2N42A 2VLIA 4LHEA 2ZETA 1FS6A 1NF8A 1UDXA 2W43A 2XQKA 3DBHB 4G4SO 2G88A 2IYLD 2Q1SA 2IEGA 3HEAA 1A9ZA 5TMBA 3W04A 4EMBA 3OZGA 5TPZA 2W58A 1N7JA 1E1LA 1N2CE 1EFVB 3WHLA 4EMUA 1ULZA 5CXXA 1CJTC 4X8HA 4ALIA 4ZJUA 4I4CA 3WOVA 4F92B 4XPIB 3A1NA 2QTMA 1JIIA 4L74A 2QPOA 4RLHA 2V5UA 4Y9TA 4D8TA 2E18A 3BDVA 3FDXA 3OFVA 2FMKA 4DQDA 1GPNA 3OEEA 3EXHB 4UM5A 2WAMA 4ZANA 4BGVA 1RMTA 2IF0A 3BB4A 1XPJA 5LQUA 5AVVA 1RWQA 2GTPA 5JNVA 5K0LA 5B7QA 1PG0A 1K06A 3H1FA 4EO7A 4O2RA 2PGNA 4QT4A 1A1SA 1Z3IX 4S2UA 3F74A 5HZHA 1N3BA 4U2GA 1X2BA 2WPDD 2BPOA 2YW9A 2CF5A 3VSEA 1VGQA 3TBKA 4B4OA 2G72A 4UOZA 5B7GA 4L85A 4AJ2A 3LY9A 1Q11A 3A3KA 4NCBA 1V8ZA 1X77A 2O8BB 1WXIA 1SIWA 5DI3A 5DTQA 1TF5A 1NONA 4R8SA 2IWRA 3H2KA 4GWKA 4E7OA 2Q3EA 3PNKA 2Z3WA 3STYA 3HVKA 1NE7A 1QJCA 2JVIA 2X9VA 3TQTA 1QSGA 2VHCA 1EX7A 5TQ2A 2XT9A 4X1KB 3DAFA 4WJLA 2D00A 4RADA 2QOEA 3ZZ1A 1N2EA 3KB1A 4EJMA 4QAJA 5FPSA 1FNCA 1GZ6A 1QZTA 1ZK3A 1BJKA 2C03A 4EY4A 4GMFA 1ONSA 5GGXA 3ZY6A 4UTVA 3S8EA 2I2FA 3CR7A 1W1IA 3FA2A 4CV0A 1OZHA 1R50A 4H15A 1MABA 5EZ5A 3TLBA 1HMPA 2BTQA 1Z82A 1NVUQ 4IIHA 1Y7TA 3IRVA 2M1XA 5IAJA 4CTJA 1IZZA 5BOSA 4AKIA 2AOUB 4G0UA 4Q05A 4CIDA 1D5WA 2GJ9A 2FW8A 3VGJA 4B9AA 5L95A 1UMDA 2CMDA 1P8AA 3CISA 4QYWA 5JFTA 3AYXB 2HQBA 2YOGA 1VA5A 4RXUA 4BWYA 5I9NA 2I5PO 3ENNA 1TJNA 1U3CA 4ZOBA 5CB0A 3PXEA 4RJTA 4CUJA 1ZVQA 3TW8B 4CIBA 4IHJB 3IKMB 3HJUA 3QVGB 2JPDA 1PTJA 4R2KA 2VT7A 2FV8A 1ORRA 1I4LD 3PE3A 1KBZA 5AK5A 2YVQA 3EEYA 4OXYA 1YZVA 4C9BA 1CVRA 4CM8B 3B60A 3MD9A 4EHJA 4CLRB 5KOHA 4CG1A 1YQUA 3RSLA 2BR4A 1P5JA 4V0ME 3ZH2A 1NT4A 1KERA 2JEZA 1PQWA 3JPWA 3PJDA 2H4YA 2LIVA 4JGIA 2GM4A 4JP5A 4EO9A 2FDRA 3OM1A 5JI2E 5L45A 5CK4A 1IZ0A 4ZRDA 4U0KA 3F3SA 1CUFA 2PS1A 2Q3BA 3BM5A 1RAFA 2C92A 4JYCA 5DJ5A 2OFWA 3FR7A 3KZOA 5DWQA 5C7LO 3FCUB 4AY2A 3QOXA 3N5KA 1EWKA 4MHSA 3S4YA 1H42A 3KD3A 1L5HA 3OOHA 1AK1A 5LKRA 4EUSA 2HLHA 5BXYA 1KSGA 2EKZA 4M60A 3PI7A 1UXJA 3TIXB 2ONZA 2RCYA 3TGWA 1LD3A 4FK8A 4C3OB 4LBVA 2BGWA 1OFUX 1GQSA 2C4TA 2O3UA 1V7PC 2ZDHA 3GNSA 2GPNA 3O3MB 4U2EA 1W0CA 3MERA 3MFYA 1QGDA 1ZBQA 4AZ0A 1WBBA 4URYR 3H9UA 4UUAA 1G8HA 4Y7CA 1ZJ4A 3U9TA 1QRDA 4CQJA 4D9JA 3IP6A 3JVDA 1G38A 1GCUA 4J3FA 1AURA 5ALRA 4LHSA 4BRWA 3NBFA 4AFNA 5GWXA 3TVDA 3RCBA 1D2AA 1OWOA 1QO9A 3GFRA 4ND3A 1P2GA 3GP8A 3EIQA 4GQBA 5DCYA 3AVOA 4DA0A 4YUZA 2WT9A 1JHPA 5KOJB 2YWXA 2HM7A 3RROA 4QHSA 1KJWA 1N0HA 4PYIA 3SQXA 3HWRA 5G3YA 4N5IX 4M9CA 2A35A 1S96A 5CLQA 1QK5A 2BW0A 3DE0X 3ZZNA 4JLPA 4QM7A 4OHYA 1WP9A 4AWXA 4A0FA 4G09A 2ZB8A 5AH0A 1VYVA 2MDTA 5JJBA 3IDOA 4KE9A 2RKBA 3BH6A 1YJBA 1NSTA 1PR9A 1QC5B 1ZA1A 2O1WA 3A4VA 3EYWA 4MW7A 4OL0A 5FAXA 1L7QA 3E22A 3GI1A 3AR4A 1L7BA 1XMIA 4BQPA 4F9GA 1U4OA 2IVZA 1YK1A 3CF4A 2A9JA 3AUTA 2QSYA 1WEKA 2QSZA 3A1TA 1VP9A 2VF7A 4DWJA 2BTEA 2LTAA 5KQRA 4P8RA 4WTOA 3A2KA 2GZAA 3UMYA 2OLJA 2QLMA 4PAQA 4BMCA 2NUPA 4CG3A 5I7SA 2B3DA 4I3FA 1U3TA 3WGNA 3WK6A 3HXPA 4OYLA 3S1AA 4E2FA 3EEFA 1BDJA 3KXPA 1NVVQ 3P4UA 1AE1A 1TA4A 1VL1A 2PU7A 2W5UA 3T7RA 1EZ1A 2OGSA 3OE7A 4X00A 1GCIA 1O96B 1A7JA 1OAAA 2JASA 4ZO8A 1DS6A 4GZ6A 2UYGA 5IK2D 3KR1A 2H1WA 3CO0S 2E4WA 2Q6VA 3B3QA 3TVTA 3V32A 2HW8A 1WAMA 1IL0A 2QX9A 1JSLA 4AS3A 3VR5D 4YI5A 3A10A 3BMQA 4MYSA 4H17A 2FCAA 3R5FA 4H60A 4QUKA 4W5WA 2IHTA 1ZRSA 3NIBA 4R8LA 1Y5MA 3WXBA 3QFFA 4LMAA 1CS0B 2NU8B 2B4QA 2QTBA 2CVZA 2OV3A 3FNEA 3FROA 5KNCH 3IVMA 4RANA 4X9XA 1J00A 1D4FA 3IXQA 3MMSA 3Q8WA 2X4LA 2I4LA 3IILA 3NVMB 3CVOA 2YJZA 1K3FA 3DT8A 3ELDA 4HB3A 4MJ7A 3VNVA 3QVTA 4MA4A 1ID8A 2F7SA 3AOEC 4CV2A 3SE7A 2IEAA 5C8YF 1RXCA 7GPBA 1DKPA 3W5AA 4MLDA 1RJ9A 4D46A 4DQLA 3QBDA 1ZR2A 1YUNA 2IXAA 2BRUC 2EBFX 3IPAA 3K09C 3KYBA 3OIVA 4X1IB 2HBRA 1PG2A 2ZTHA 4UVDA 4H1WA 4J1TC 5EJ8A 5AKIA 1LTQA 3G23A 4FOLA 3RRBA 5FOWA 4UFOA 3R24A 2YN0A 1ZMXA 4LN1A 2YJ5A 3PC8A 5GJVC 3ITEA 4C4SA 1E89A 3AM4A 4Q4DA 1H2AS 2YHIB 3BILA 1J8DA 2CLKB 1P1IA 3GPCA 4NKRA 4AG3A 2IPLA 5BSUA 1XCMA 4GKBA 2MHCA 4GLBA 4XR9A 2JARA 3WGYA 1T1IA 3J80A 3LHFA 4AUNA 4MO2A 2HPZA 4FEGA 4MUXA 5B7PA 3K0AB 2YUTA 4I9HA 3HI6A 3TB6A 1JFFA 4EUFA 5DVZA 2QZSA 4DV5B 2J41A 2IZZA 5EMHA 3LDAA 3SZUA 1JEYB 1KO1A 2C8VA 1Q17A 2G36A 2EFCB 2OV1A 4OQYA 1T34A 4JUIA 4DG9A 3TGPA 3QUBA 1LQ2A 4YACA 3V9AA 5HZGA 3QNWA 1EEHA 2INGX 1U1EA 3N9IA 5IT9A 1II9A 3PWTA 2FSPA 5AXCA 2EJUA 5A1TA 1IPFA 2IBTA 3GJRA 2R96A 2J6CA 5EVJA 1Y8CA 1IHYA 2BGRA 1Z0FA 2WNSA 2X77A 3FGOA 1XXHE 2D7CA 2G40A 3HSSA 3IPRA 3AUKA 3MWGA 4TLLB 2HPVA 1HURA 4IQFA 4HDRA 1DUVG 3F2VA 4IFTA 2B8NA 1E94E 1P75A 4WK4B 5AKEA 1J2UA 3N2GA 4NIMA 4A26A 4WBNA 1RYYA 2R79A 1J70A 1U2GA 3GBVA 3LECA 4BC0A 2GVZC 2C2OA 1G3MA 3KYIB 4OMDA 5HF6A 1UZAA 3ON5A 2G4VA 3DE3X 2MSLA 4ZQBA 4E5SA 4G84A 1FLVA 3U3RA 2OC9A 4AY3A 3TI9A 3ZHRA 4IICA 5JT1A 4LV6A 2H5IA 3DE6X 2ESRA 3QRWA 5LPNA 4LGCA 2NLOA 4C0LA 1PFUA 2GMWA 1OROA 1G8AA 4MS3A 5E7QA 3I2JA 5KVAA 2XCTB 1RZUA 3PNBA 1U9JA 3OESA 4BPRA 2CHGA 1ZP6A 2WOJA 5KVQA 3FUUA 3M6LA 3MOSA 5K2OA 4N7BA 3S8MA 3EEOA 3EQ6A 4CIAA 2W6JD 3A1UA 1SEPA 4DDHA 3NTLA 4E46A 5DP1A 1BWPA 1K5DA 1ZIOA 3AM1A 1A2OA 1G5IA 1LRKA 3K3PA 4O3FA 3KFLA 3I83A 4CKZA 4BZPA 1R8XA 521PA 5M2QA 2PTGA 3ABZA 2XGJA 3ND9A 1R9MA 2ZBPA 4TZ6A 3B51X 5AKZA 5CFLA 1OJLA 2DFVA 3VH3A 3AY3A 3HS3A 4OHRA 4G0QA 2A7QA 5B58C 2BYTA 1QK4A 5B64A 1XU4A 4X6XA 2VDWA 2R00A 1SQSA 5KX5A 1N5MA 2FG6C 3FWZA 1YRHA 1TYBE 1ZN2A 2E4ZA 1CJUC 1CD5A 1QKKA 1ZD2P 3R7NA 3WP1B 3QY0A 4H6PA 3LT1A 1N36B 3VI3B 2D2FA 2JBWA 3KQMA 2JH8A 2ZUTA 4PICA 1DVRA 2QT9A 4WL0A 5JDCA 3A3PA 1W75A 3SLRA 1NPYA 3PPIA 3LHDA 4YCBA 1I10A 3RSFA 4RTOA 4Q3DA 2YWJA 4FE4A 3REQA 4DGQA 4DF3A 4BP9A 3NS7A 5D5QA 2G8NA 4H59A 4QTZA 1THMA 4QGHA 4NCJA 3VSCA 2E4YA 3WZLA 4XTRA 3UJNA 2E37A 2AZMA 3WLRA 5C8XA 3HP1A 2MMGA 3C87A 2MT9A 1KNQA 1ZSYA 5E7JA 1QFXA 4DC1A 1M67A 5AM1A 1UM9B 1EVYA 1TOAA 4J2OA 2RKWA 4TWZA 2XT6A 4ZVTA 4BVJA 4ALMA 2VA9A 1LBSA 2NX2A 2WMOB 2F64A 3E82A 2J8ZA 2RG7A 4J0KA 4L9WA 1AHIA 2GCOB 2K5UA 4MGEA 4TM7A 5EJGA 4E07A 4AKHA 4WNYA 3HB1A 3CSDA 4PHTA 1IJFA 2D1QA 1Z9BA 1CJVC 1OWPA 3OQ6A 1AQ6A 3AUYA 3Q10A 4CM3A 4Z5XA 3MF4A 2X3UA 1BXZA 3EY9A 3I9KA 4GOJA 4M46A 1VKHA 4OD0A 4QDZA 4R3UC 2HEGA 2X15A 2QYHA 3DSRA 4TVKA 5HXAA 4U6NA 4DFDA 2P6UA 4EJ2A 3DEIA 3B89A 3FVVA 4LHZA 3ROQA 2P6MA 3RF6A 1CY4A 4L57A 4FYYA 4IXNA 2YY5A 3W4JA 3I28A 3W7BA 4F8YA 3TQRA 1YL6A 1T36B 4KV7A 2Z98A 4HR7A 1VSBA 4ENWA 1AV6A 5CH3A 5HF5A 1E2LA 4B3DA 1D8AA 2PXCA 3CZQA 4LZAA 4NICA 5JMPA 2XSZD 5JHGB 4TUYB 3IEKA 4GZMA 1U0GA 4QUDA 2WUFA 4DNOA 3H9BA 3I5UA 4Y6GB 1H6DA 4PE5B 2PSFA 2ADOA 2Y0CA 3HN6A 3P2MA 5DSTA 1QGAA 1R4NB 3VNAA 1E6WA 3BWEA 1V1MA 3O95A 1LF5A 2C2BA 4BZZA 4ILEA 4EG0A 2FMUA 3CLSD 2OA0A 5TMEA 1AO0A 5I8WA 4DUPA 3FF4A 4ZT6A 2FRXA 2OSVA 3U3DA 2ZFUA 3NGMA 1FFEA 1MAHA 4F71A 4HNVA 1XZBA 2IZOA 3M8KA 3VC2A 2P9YA 1O4VA 6Q21A 4ZKEA 3RRJA 2JGEA 5ALMA 3NIDB 1XEWY 5I9BA 1I9CA 4HDOB 3W7VA 3NHKA 4HQ0A 5FORA 5EMNA 1YB2A 4JGGA 4UM9B 3BUSA 4GPTA 1HL7A 1ZQ1A 5L7TA 3GRYA 1WCYA 1K0UA 1R0LA 3ZN2A 4UMVA 1EG7A 1EGQA 3DDUA 1SU7A 3LX4A 4I8DA 5CVCA 4E5YA 2DPHA 4D44A 4XLTA 2JI8A 4CMHA 1LPSA 1IRXA 2FPPB 4MW5A 4LNHA 2TYSB 2ZRKA 4BO7A 3WMRA 1LVHA 1MIOA 2FWPA 2P9GA 3AEQB 1HSZA 3NM5A 3D5EA 4QNRA 4R3WA 3PE4A 5FTWA 3ST7A 3PUJA 4WNAB 3U7JA 4Q9DA 1I3OA 1E3JA 3DHYA 2ZLBA 3ACBA 4LY0A 3NIFB 3H9CA 3IALA 4FEYA 1KJ8A 1OV6A 1UL1X 2CXOA 3CN7A 5G40A 1YJAA 2RHGB 5ANRB 3DOCA 2HXGA 5LA6B 2O7RA 3OWHA 2WINI 3ORFA 4E88A 2RHDA 4S05A 5JUWA 1VKNA 1JECA 5BN4B 3T0FA 4P7KA 3VTKA 3B12A 4A36A 1FSSA 1RWOA 4KH0A 5BP7A 3MLAA 3VQTA 4RIIA 3HV0A 5KOIA 4FR0A 4S04A 1A4IA 1FP6A 3P9QA 3S2IA 1WKBA 3L0CA 4CKCB 1ENOA 2JCYA 4EZEA 4DR1B 2AVNA 4U7GA 1OAOC 2O2EA 4XEUA 1S01A 4HF7A 5ALQA 3TOCA 6AT1A 2LZ0A 3RWBA 5E1OA 3R4CA 1M54A 3K05A 3ZE0B 5K0JA 2QY6A 3KAQA 2WIAA 4R8MA 4H6XA 4CF6A 4FFBB 5J2UA 2ATVA 3HB9A 3RG8A 2VPWA 1Y1LA 1V45E 4P34A 5JZVA 2HRRA 4CR7A 1OFTA 1ZUNA 1W59A 1YOVA 2DBYA 3L84A 4LHYA 3G59A 1T8SA 4LXQA 3W9BA 2PZMA 3D1VA 4RGYA 1FP1D 2WJYA 4H31A 3RU7A 1UC4B 1TQDA 3RF7A 1E3QA 2QIOA 3BMOB 1TYZA 4P4UA 3AU8A 1K8RA 2FN9A 2IOQA 4BFYA 4WKBA 5BSHA 1MKYA 4RA9A 1RZ3A 2FOIA 1TUBA 4YJGB 4Y30A 5H4GA 3I5YA 1XMXA 5CFZA 4BEVA 1DCFA 1H2ZA 2FE4A 1V16B 5K8JB 2YC4C 1KI6A 4BJHB 4BCDA 3TJRA 3NDRA 2PR2A 4W7HA 4UHCA 2GZSA 3OZBA 1RLJA 5DT9A 4J0CA 5GONA 3UAGA 1OU0A 4S3MA 5KSOA 3MOGA 3CU5A 4RSGA 1DADA 3CFYA 2I3GA 1EJ0A 1ZL0A 5HIJA 3S3TA 3STVA 2QN1A 2ZM5A 5AW3A 3ABSB 4KXMA 3SMQA 4LJSA 2EKDA 1U4NA 5FTMA 4G8BA 4DSAA 1V37A 4ZREA 1EX9A 1T0UA 3T3PB 3NLLA 4JENA 1ABEA 1BO6A 1NSYA 5F23A 2IH4A 5AO9A 5GZ1A 3HRHA 1X7WA 2BDEA 1J2JA 2C94A 4AS1A 4TKMA 1G9TA 4L51A 2IY8A 3PI6A 4QU8A 4BJ3A 2JIQA 4UDYX 2OCPA 3G82C 5AXDA 5BVGA 3GFBA 3GUCA 1A50B 1NASA 1ID1A 4YMTA 4ME6A 1JTVA 4HPJB 4IILA 4ZYUA 1GXSB 1BVRA 1IHUA 4B8WA 3ZDYB 3KQOA 2GN2A 3QITA 2B4KA 3IXLA 3VZSA 4E15A 1NVWQ 1XWFA 2PAFA 3DUFB 3WWOA 5K6TA 1MHTA 1U1CA 2BI8A 5ESDA 4KR7A 5KC8A 2SNIE 5FYDA 1ODSA 1HE1C 4YR9A 4KSBA 3TQIA 1IRIA 1R6BX 3LUGA 3N8KA 1YCGA 4MQUA 4GM4A 5DI9A 3FPKA 3OCJA 3BK7A 1ONBA 2A30A 3L1KA 4GXNA 1I7SB 2ZSIA 4R54A 4ZWNA 5FO1A 3EMVA 2IHZA 4KQ2A 4UDXX 3MQFA 1O5OA 1SZJG 3S2FA 5DLDA 1Y5NA 3V8VA 3BWCA 1W5EA 2CXRA 2MINB 3N0VA 3H4IA 3K8OE 4JX9A 4DYDA 1UPTA 4YMGA 5JH7F 2C7OA 2EOAA 4URHA 5JAHA 2FPGB 2WYOA 5M29A 2VDQB 1KDPA 3D8SA 4WZBA 3DQPA 2OOSA 4NDNE 4DA8A 1PQ4A 1XCGB 1KSFX 5KYKA 1JDZA 3NWJA 4PLFA 2D8MA 4QHTA 1MDFA 4YTEA 2YL2A 2NPOA 3AM3A 3CEPB 5TVKA 2YZNA 4LJRA 4FZ3A 5EA2A 5BORA 3MZ0A 2W2XA 3G9UA 4G25A 2ZJBA 4L4XA 4DLAA 2QR3A 2EP8A 4KSCA 1HC7A 3FTDA 5IF3A 1A76A 2A2ZA 1DX4A 3OC6A 4I1IA 2DT5A 2QR5A 2OY0A 4RD1A 3HDTA 3L7IA 4B5LA 5FOUA 2XB2A 1XZGA 3WLQA 4HVAA 4HDSB 1UT6A 3A9VA 1C9KA 4HVCA 4PTYA 5JCJD 2JGJA 2OBYA 1U0SY 3WLEA 3RU2A 3DS8A 1B0UA 4QSHA 3ONFA 4LE2A 3EG9A 4KFTA 2LNDA 4LF4B 1QZZA 1M66A 3TFQA 1EXWA 2QJOA 4ND4A 1MG5A 1D0SA 4UHEA 3U4QA 2PL5A 2QNRA 5DTJA 5EQDA 3SSOA 3GLKA 3DM5A 1E2JA 2AMFA 1R10A 1O1YA 2JJ1D 3DZFA 5CYFA 5IFKA 2REBA 2B4RO 1T6ZA 3M6XA 3KL4A 1VC2A 2OGZA 2FZ5A 1YKFA 2P8SA 3GUUA 3O8NA 3DTVA 4F4DA 1MEJA 3VPDA 4F4FA 5G0TA 4E22A 2E49A 3FDIA 1G7RA 1JIQA 1Z5NA 2BMDA 2C98A 2QLFA 1EJ6A 1LI4A 3C7KA 3G2PA 3PGKA 4O4LB 3NYRA 1JQ3A 2PTHA 1AU9A 2CVPA 1QLJA 1Z08A 1CY1A 1F20A 2D2XA 2J9GA 3D7RA 3JQGA 1CX9B 4KV9A 5JS7A 5JWRA 2XMZA 3V55A 5D01A 2PZLA 1QCCA 3FPLA 5J4HA 3R74A 2OHOA 2FN7A 3BZBA 1Z7EA 3IT0A 4P81A 3H2JA 4HL6A 3QTTA 3R3ZA 4RZ3A 5FI1B 2D1RA 3SIWA 4FB4A 1F12A 5JNRA 4U9IS 2EL7A 2MIIA 4HAOA 2FPIA 5KEIA 3L5KA 1K4MA 4XQ9A 3VJKA 1F4PA 1QUEA 2MSDB 5REQB 1QZUA 2V9CA 4IF4A 3E9ZA 1P9RA 3OZIA 1D2RA 1W6RA 1DAPA 1L5VA 2CFSA 1QOQB 1WD7A 1OY1A 3E3OA 3L1UA 1SAYA 2AZTA 2R5NA 3LOUA 4J16C 4P22A 1NPDA 3I2KA 5DGDA 2XX3A 1TC2A 5FLEX 2JLYA 4ID3A 2OD7A 1N33B 4FOTA 4EPWA 4NU6A 3RUEA 4YJFB 2W4MA 2XWPA 3D31A 4YCJA 3SEFA 8ABPA 3CVWA 2X2PA 1EWVA 5DGIA 3UMMA 3GRZA 1GT6A 3PUYA 3LLSA 4FGWA 3W6OA 1T13A 3EHDA 4INOA 2Y2UA 3LQFA 2ETVA 3LK6A 5DT2A 5EUMA 3KEQA 1P6XA 1K86A 4EA8A 1S8AA 4O2LA 3WK9A 5GJBA 2F43B 1DFIA 1CQWA 3G2QA 3LD9A 4TKLA 1Z17A 5DASA 1G3QA 3MWDA 4PVCA 1XLVA 1P6UA 2ZJYA 3DVAB 1EFRA 4UZSA 4B45A 2XF8A 1ABBA 2I03A 5AXAA 4IKPA 3CKKA 1Y5LA 1IATA 2X5XA 1UJ5A 1AZLA 4QBKA 3UWOA 4YV0A 3GP5A 3HG7A 4JQSA 5EZ6B 4B2IA 5BXQC 2Z4RA 3KJZA 4DV1B 5LMCA 4P4NA 1OZGA 3QU7A 3J7AC 4REMA 3N0XA 1QF6A 4GDMA 1VZ2A 3UCEA 1DBSA 3ZDEA 4DMCA 1NQVA 4KRFA 5BMVA 4IIFA 3X2EA 1SVMA 2XE4A 2YRXA 3HM9A 2DH6A 4LRYA 1QFSA 4BQRA 2I7TA 4J0QA 1EQ2A 1L4BA 2PSHA 3C3EA 4IHJF 3SZMA 1B7GO 4C29A 2XVMA 1WXDA 2HDHA 4G0YA 5LBTA 3WAGA 1YO6A 4TYNA 1E3TA 1ICEA 4OHPA 5K3CA 2QSJA 3GG9A 3P96A 2W8BA 5AVOA 1A9XB 4HQRA 3RI3A 1WB9A 2ZBGA 4JJAA 3BA1A 1XQWA 1UODA 4DSZA 3LIIA 4W9NA 3UENA 3WGZA 3E0XA 2R85A 3A05A 1DLIA 1LXCA 1K97A 1OVGA 3EIFA 4RDXA 1BZYA 4LZJA 5FIUA 4EG6A 2PMBA 1Y8RA 4Q47A 1OB5A 1NIJA 3CW8X 3DBOB 4UEKA 3ILSA 4HDNA 3E5MA 2W6ID 3KR9A 3N86A 3DLCA 3FSGD 3OO0A 1VDMA 4V2IA 3U7RA 3ZHCA 3AY6A 1B6GA 4L72A 1FFXA 4FYXA 3WK8A 1XNJA 3P0EA 1NMQA 5AK4A 1MV5A 1QFJA 3QKSB 1WZIA 1RYNA 2WAAA 3E35A 3K32A 3N2EA 4L27A 3REFA 1BFUA 4OATA 3ZNQA 4R71A 2RD2A 4Z1MA 1Q16A 4HK4A 1P3JA 2R97A 1Q0LA 2AUNA 3DO8A 3RJMA 3WKDA 4DM7A 1QIFA 4GNKA 4ZAXA 1ECFA 2F1OA 2VL7A 1Q0HA 1DDOA 2NUAA 3FD8A 2IHKA 4G1VA 4OKNA 3C15C 2O0LA 4FONA 3WQQA 3T7TA 4ZZ2A 1GTJ1 2X19A 4E08A 3FOCA 3ZYCA 3CR3C 4GECA 4R1MA 4EO4A 1E32A 1QQ5A 5EUQB 5JISA 3MTJA 2F3UA 3R6TA 4KX5A 3JQ8A 2F00A 1Q57A 1U90A 2X1MA 4WA8A 1QTIA 4MVJE 1JX6A 1QGYA 3DFFA 3HNPA 4FN5A 4HT3B 2X9QA 3PDJA 2WIKA 3AQIA 3G5TA 5ECGC 5KYYB 3AGQA 1MB2A 1GR1A 2NO0A 4PN7A 4Y7DA 1OX5A 3DAHA 3WRXA 2GF0A 2X2EA 1O87A 3AIKA 4UTZA 1P72A 2I2AA 1XROA 2HJWA 3O1HB 4Q3OA 3RRNA 2JIDA 1IU9A 1N2CB 2WTEA 1Z5OA 4JI6B 5J4YA 4PX9A 4TT3A 4WA7A 2HJVA 4V38A 1NMSA 4ZCTA 4LTDA 4Z86A 3GLIB 2BUCA 3O8OA 2DWQA 4HXEB 4DPMA 4JX8A 1TIKA 2DR0A 5SV2A 2HJHA 4BKMA 1E63A 1N57A 4MQ5A 1KMCA 2CZCA 4RCZA 3TQOA 3DOFA 5AVZA 3IQGX 2IYNA 1Y1TA 4KB5A 4XAQA 1KGDA 5K8CA 1U0TA 3HLKA 3VU3A 5KTKA 3OQMA 2PRSA 3RIGA 2P65A 1AGRA 3HHEA 4GMXA 1HGXA 4X7BA 5I7RA 1P7ZA 3C16C 4YJ3A 1VRVA 3AF2A 1Z8DA 3OP1A 1Z18A 1R9JA 3ZS9A 4ZZIA 1SELA 2ILTA 4CQMB 2N9UA 1P61B 1XAGA 2X58A 4K2HA 1N9ZA 1GNLA 2GJ8A 3I6QA 3IA2A 3NTOA 4OUDA 5D7BA 1QIIA 2XA2A 3H1BA 3CPJB 4GR5A 2PAAA 1YS1X 4ZEOA 2O14A 1K89A 1PV4A 3GLTA 2OXTA 5BQPA 1QKJA 1P9OA 3QSGA 5BPFA 1Z13A 1EK2A 4GMKA 4TSFD 4FCWA 1MA0A 5E4TA 3F3KA 1OBVA 4CL3A 4DLNA 4WW0A 4UMFA 4UCXA 4QWMA 1Y3AA 3LQ1A 1DELA 4Z2AA 2EX4A 1ZI9A 1UCFA 3WWDA 2HIGA 5IKPA 3CPEA 2D0IA 4L0QA 2QT1A 6LDHA 2E1RA 4HAYA 3EMDA 3RHTA 3M5DA 1CY2A 4Q7MB 4F7WA 2J6BA 3EC2A 1KAOA 3MHPA 1AB5A 1JKMA 2ZIXA 3KP1A 1MC4A 2Q99A 1GNQA 5CD9A 1LC0A 4WCVA 5A7FA 5JMWA 3JQAA 4HAWA 1IK6A 1SHUX 2FVYA 2ID4A 3N59A 2GYVA 3NBKA 3H5AA 4ESOA 1W88B 2AZXA 2A84A 2R11A 1OHHD 4KGZA 2VVTA 4Z8XA 3F49S 1E2MA 1KFJB 2JCVA 4ASUD 3OKCA 5LU8A 2XTNA 1NF2A 2O2YA 2WR8A 3QX9A 4OGGA 4OREX 4RPLA 2VG8A 4H4EA 5DNUA 4MAMA 4R9NA 1KK2A 1JDBB 1NP7A 2AG1A 3BERA 2H4JA 4IJKA 1OYOA 5TSDA 5KTNA 4JYBA 4ND8A 3OTOB 1WHTA 2WWYA 4QC2A 1ODIA 2NO1A 1XX6A 3L6EA 1Y9ZA 2CYBA 4HNAB 5FBQB 1JPNA 3JZFA 3MS7A 2BSXA 3AEYA 1KK3A 1UZLA 3WZ2A 2C1ZA 4OXQA 2FB9A 1JLLA 2AX4A 2HQ1A 2FPLA 4BLSA 6CHYA 2O06A 4JMLA 2C2XA 1O9GA 1RZRA 1E1CA 1U8TA 3Q6NA 3WDSA 5TQ0A 3QYJA 3KQHA 1AS2A 1M83A 2PANA 4XRGA 2TMGA 2GESA 3E0QA 3DBIA 4JL5A 4QIHA 5K4HA 2AC4A 2WU3A 4C22A 4OLFA 2Z5GA 2PIDA 2QTCA 4ZJPA 5KINB 4TXMA 2WFMA 3LCRA 2VUSA 4QLAA 3FFXA 1ETHA 1GU0A 2I7XA 2BGMA 4QA9A 3K0KA 1Z62A 3R40A 5AQ1A 1HKHA 4ZAFA 3N2ZB 4LV8B 2OZEA 1JJ7A 4LK2A 4PC2A 5AR1A 4P4SA 4NYJR 3RG2A 3CSUA 3IHLA 3LCUA 1YI1A 4BEWA 1WB5A 1KWKA 4WJZA 3GLGB 1SKYE 1U2RA 3P27A 2C0QA 2QN3A 1JLMA 1BOFA 4JCOA 1EWYA 4J0FA 3V4PB 3FRJA 3GZNB 3BEOA 4M4SA 4BO2A 5C7IO 5DNDA 1RYEA 4IDBA 2HWXA 3ANLA 1SQ5A 4P2GA 4NNOA 1S6YA 3V7WA 1C2TA 2J9FB 4NJEA 2H00A 1YR9A 1X3LA 3TNLA 2QTRA 3DTYA 1XF9A 1J8VA 2PL9A 4NRDA 3IERA 3GCWA 1Z0SA 421PA 3GT0A 3DWEX 1Z6YA 3CF2A 2IZ1A 4UUNA 4IDOA 5DBIA 3UFBA 3JQ7B 4ENVA 5BN5A 4YWHA 2MU1A 5AOAA 3NHBA 3NH6A 1M2KA 5JVDB 1JDNA 4CODB 4DIMA 1XELA 4F4CA 3IE2A 3RTCA 3H5TA 4OYHA 5AKYA 1UM8A 2B4YA 2RGYA 1GO2A 3RKUA 2B1GA 4XCVA 1OLXB 2PUAA 1W30A 3M83A 3TLMA 4LYEA 1C0EA 2XNDA 5AVUA 3ZE6A 2D1FA 3LDGA 5B4VA 1ESEA 2XB9A 3R20A 5ICGA 5L3VA 3IBYA 2YH2A 4O1HA 5EQJB 2IEZA 1IXZA 1U6JA 4K6MA 4DARA 2HWKA 1RJEA 2RH4A 1PLKA 1E5QA 2MMCA 3C5WP 3LPDA 3TIVA 3QXGA 2IY9A 1YVDA 2VPTA 1VHQA 1YBHA 3K0FB 4HQ6A 3BJIC 4LWZA 1XI2A 4MV6A 1L5WA 1U8XX 4NFHA 3SEQA 4CQMD 4B3MB 1UJ6A 5KHLB 4U7WA 1HDXA 2PD6A 3AVYA 4OGLA 2QWXA 3F78A 1LBEA 1J42A 1NQOA 4G0ZA 4QXMA 4I9NA 3MJTA 4DQ0A 1FX0A 1KZ6A 1FBNA 1EBBA 3MUEA 3R77A 5IEBA 5EPEA 1QHYA 3RFFA 1T1EA 1N7HA 2Q2VA 3F7MA 3JD1A 3PQ5A 5K8TA 4WV3A 1S3IA 2Y1CA 3M9XA 3OT5A 3PUKA 1L5LA 3PEWA 2GXQA 3QG1A 3PFBA 1JMYA 2P2CA 3DR5A 3K8ZA 3R76A 1RHRA 3W2HA 3NYWA 5JSKA 5HUJA 2DU8A 1EDBA 2C82A 2XUJA 4DCSA 2C54A 4HQOA 1L5FA 5ALHA 2VF4X 3P20A 4EEKA 1J8YF 3SFTA 2ETXA 4TWJA 2Z4SA 5J63A 4I9FA 1Y4SA 1GGEA 5CAEB 2EERA 2ZSFA 1F8GA 1ESMA 1Q6YA 2QV0A 5BWBA 1PCXA 4B6PA 4MKXA 3A6JA 1XTPA 4PQYA 3GJ6A 4UAJA 2RB4A 1W7AA 1I3MA 4BLRA 3C4VA 1QOZA 1VG9B 1XCJA 3I6MA 2QMUA 5A04A 4P3PA 2E89A 3C3CA 1Z68A 4K0RA 3FNQA 4K46A 5EXTA 1M34A 1NW5A 3EGIA 3M0EA 1Z4IA 3SLGA 4C1BA 4DR4B 3L9WA 3OQJA 4HTFA 3QXHA 2VHYA 5A0FA 1Z4NA 2YV1A 4V1CB 4L08A 2NVUA 5DPMA 5CB4A 1E2EA 3F1LA 4MW1A 2FKAA 3JAWA 3NR2A 3WLKX 2O3JA 3MJHA 4RFSA 1DQNA 2DF8A 2LXNA 3DL0A 3Q6IA 4C05A 3U7HB 5TJ9A 5AHOA 2BR3A 3LXXA 2UZAA 1YDWA 3H8JA 5DTEA 3T7DA 3VDNB 4WK6A 1QS0B 2Q9AA 3L0ZA 3KSRA 3LL7A 4B79A 1ZPDA 5TQJA 1L5YA 4J43A 2W2KB 1SPBS 2AE2A 4M9ZA 4KIFA 4TXHA 3UGTA 3UMGA 4K5QA 1H1LA 3O9VA 5H70A 5C34B 5FUMA 4Q6BA 3M70A 1FTWA 2C2GA 2BBSA 2J0EA 3K20A 3EAQA 4JJ7A 4YHHB 4QAQA 4JFAA 4TUYF 5C5EA 5TT1A 3ANTA 4P53A 5IUKC 2P5TB 1AXRA 2YBDA 4MRSA 4E09A 3AIIA 1CZOA 4INAA 4YJDA 3HYCA 3ANYB 3HKDB 3UO8B 4EG7A 4ZQEA 1FRNA 3SQMA 3GLHE 4G1BA 3WGHA 1I1NA 4J0EA 4V1CI 3A1EA 1QQ6A 3UWKA 3NNSA 1SCNE 1TD9A 2VF2A 1DV1A 4TN1A 1KI1A 5HA5A 1YGPA 5AI5A 1V1RB 1SM4A 2C2YA 2VNIA 3QLUC 4FUQA 4D02A 3U7QA 3Q40A 4BFZA 1U1FA 1JV2B 1UKZA 4PQFA 1YQQA 2I29A 3OOWA 4FFRA 4ZRMA 1XXHB 1ZCFA 3CS3A 2OP0A 1E7RA 3QXJA 1SIBE 1SURA 2VF5X 3Q3HA 2CL7X 4I8IA 5G4LA 1RR6A 4IINA 2Q7DA 3DJFA 2IDKA 2WWXA 1ITZA 5AK0A 5BR1A 2F62A 5K0BA 2EFYA 1HDEA 3K4HA 1S2GA 3N58A 1LU9A 3QMMA 1TU4A 4XYMA 5DM60 3ECAA 4KITB 1KP2A 4LF9B 1FUYB 3V7UA 3DFZA 1I8TA 4XX0B 1IEVA 1HLFA 2HB6A 3H1EA 4GP7A 2GAIA 1X7XA 4BASA 4B40A 1EP2B 1WUIS 1FJ2A 3EFOB 3IIEA 1NM5C 4TQAA 1VBNA 1VPTA 1L1RA 2ZI5A 4P1ZA 1I33A 1LSOA 1FDWA 1HEUA 2NNLD 1JDVA 1GIAA 5LM3A 1VIYA 4TV9B 5GP1A 4L4YA 4ETNA 1OC2A 3ZKAA 5K2MA 1OGJA 3HYLA 4NU5A 4HGYA 5ALKA 2TMYA 3DOJA 4Q1BA 5LA6F 4L5AA 4C4ZA 3UGJA 2QE7D 1E9DA 2YDYA 4GBED 4YAOA 1Y6JA 3DCIA 3ZD6A 3OKFA 4RTPA 4LNUA 4ZN6A 3QPWA 2Z3ZA 3PDIA 2A4MA 2IUSA 2XJ4A 2YYAA 2H2GA 3OETA 3R2JA 4UAUA 5DIZA 3V8NA 4EJSA 1LPMA 3KQQA 5ALEA 2JIMA 5F3WB 6ADHA 2VRWA 4QNNA 4JIMA 2PUVA 3NDPA 3NCTA 4NMHA 4PX3A 2MSKA 2OQVA 4C6RA 3GJYA 4IOJA 2OFFA 1JWBB 4JXKA 2Y1LA 3IBSA 1E6LA 3P4YA 4MRPA 5EJ2A 1Q3TA 3O90A 4RVCA 2IYEA 5FBKA 1M8FA 4JBIA 4ICIA 3FPEA 1SVWA 3RC7A 3U81A 3FAKA 3WC4A 3BTUA 3O84A 3IO3A 2PMKA 4LSGA 2QA5A 3NM4A 4XQGA 1E9AA 3R3WA 4QDOA 3NPMA 5DXJA 4IVPA 5SYAA 5IXJA 1HX7A 3ZWQA 4F97A 3UMCA 2NZWA 1N3YA 4MCHA 5EJEA 4KPUB 3UJDA 2XKAA 1XE3A 4GSLA 3G1TA 3TFOA 4RIHA 2XWQA 3CGWA 4XKJA 3SC4A 4ARBA 2Q5FA 3F1KA 2IODA 1KEEB 1NP6A 2XDAA 3GJ3A 3NP7A 2YIVX 2PFKA 4CGYA 1QZXA 3UK0A 2G0AA 3RIXA 4DCVA 1XA4A 5JEDA 2RONA 2AFHE 3U61B 3KLOA 3MJSA 1TMOA 3RIYA 1X9GA 4YCLA 3U7FB 3UT5B 4O2BA 1V4BA 3ZCVA 4P3YA 5TXGA 4DM3A 4JB2A 3HCFA 2C5SA 1YB5A 1ZQ9A 1ZSVA 3BGIA 3GFSA 3PP8A 1LDYA 1JAYA 4I99A 4MUBA 3DMHA 4ODIA 4XEHA 5AJXA 4KBYA 1W5AA 2PNJA 1L7RA 4LTMA 4XB2A 2Z08A 4NS4A 4C7XA 5LB2A 3JW8A 3BQMB 4M76B 3NH9A 4OH1A 1MNQA 4NH0A 1QYWA 5KJEA 4AN1A 4BNTA 3A1DA 4LPSA 3DEYX 4D9CA 3GCZA 4RE5A 4ZJZA 4WRRA 2PUDA 2C0PA 1UBJS 1K4KA 2QM0A 2W6NA 3X1JA 1P2FA 4RQAA 1I01A 4PWYA 4RKWA 4O59O 2J45A 3BD7A 3W2GA 1D0VA 4Y3UA 4IZIA 4CEHA 1W4RA 1E69A 5DM70 2NSLA 1I6WA 4RZUA 4CKWB 4EFMA 1Z4KA 2Q6LA 2XYRA 3WB1A 3X3HA 4RABA 1KEKA 1KF0A 2ORED 2W00A 4A8JC 4UW9A 5D51S 3FFBA 1BKDR 3KM0A 3VR0A 3CBQA 5BNIA 1USKA 4ZQGA 2E5WA 4DAOA 1YFJA 1Y34E 1TJ5A 5B2ZA 1MJFA 4XDGA 4BBZA 4F2HA 3HUEA 3PC3A 3K9CA 2PGIA 2DUUA 1JJAA 4YUWA 1OXUA 1JLSA 2VCYA 1KPGA 3ESDA 3F0TA 4MI6A 1OFHA 4AF7A 2A1UA 1BW9A 3BREA 5JLJA 1G66A 2ZR7A 3U17A 1I2AA 3AZQA 3WIEA 5KYWB 4YREA 4NXNB 1PHRA 1U2TA 2GAAA 2XOXA 4RFLA 2PZAA 4B5KA 2H06A 3E9QA 3SJ7A 2XGGA 3A14A 3PQ4A 3REGA 3RQIA 3UICA 3F5FA 2VHZA 3EN0A 3MAGA 4ARZB 1L1EA 2YFHA 5LMNB 1XZIA 3PNSA 1CE8B 5AD1A 2JEYA 4LJ8A 1FW6A 4W82A 2GX6A 4WT7A 1XRSB 2FLVA 3TO5A 3GHHA 1KJIA 3U3ZA 3ROXA 4M1OA 2NZ8A 3KSDO 1JKJA 1ZMRA 3NOOA 4J3JA 4CVNA 2WMYA 1FOEB 4L02A 1YHYA 3SQLA 5DISB 4C7BA 2EP5A 3NKLA 3GP3A 4WZAE 1QRSA 3C8MA 3PVZA 2EIHA 1V35A 2BI4A 1IWOA 3FNGA 2E9SA 4MUYA 2DPMA 4K81B 4PXYA 1H66A 3C14C 1NWCA 4XD7D 4QJ3A 5L40A 1E2KA 4FMBB 1EX6A 2C4MA 3FPCA 3LXUX 1ODCA 1FL9A 4GPEA 4RZHA 4I3GA 5I45A 1GPWB 3LH5A 1A5AB 4NYIR 2QAJA 4P2BA 4URWR 4YAIA 2G3YA 4U8GA 4ZEWA 1GN9A 1UMCA 1H85A 1BXGB 2FX5A 4ARSA 4BB9A 1E7QA 3DAOA 1JEEA 3O93A 5ARCA 1PP4A 5J47A 4JU9A 3BXPA 2VOEA 4KC0A 1G8FA 4N7RA 4IEIA 1E6CA 1RI1A 1GSOA 3V4OA 4P3NA 3FDJA 4KVZA 2QJFA 2ZE6A 1C7RA 1TGYA 3DFMA 4KQCA 1R7RA 4U6QA 3W5CA 1IN1A 2G71A 1A8HA 2F4VB 1W2HA 2GCPA 4LC0A 2EF1A 1VI6A 2JAPA 4TMVA 4YO8A 5F5XA 2JH9A 1LRJA 2OZLA 1KZ4A 1CSEE 5M3BA 5DNEA 2R1ZA 2ODAA 3A37A 3N76A 2FN4A 2FXVA 1GAJA 4RHXA 2F17A 3OU2A 1DIAA 2WTAA 3IBGA 1RTKA 3IVGA 1BGVA 2IEIA 1VSTA 2XXAB 2O8DA 1PKXA 1OH5A 2QX6A 1N5LA 5IAEA 3W06A 5CT9A 4HX9A 2J3LA 5JCXA 1H2FA 4N5NA 5IDXA 4Y2TA 1WVGA 4L3VA 1O6CA 4GUDA 3RNOA 2C8LA 4EAAA 2OHVA 3HMKA 3EDCA 3W5JA 5A5DA 2NACA 4HS4A 4PO9A 3K6JA 5FNVF 1MX1A 1NURA 4YAJA 2ZYGA 3KEGA 5TF0A 3QX3A 3OJEA 5FWYB 1T6BY 2NZVG 1M1NB 2A5JA 1EMDA 2G07A 3BD6A 3MQ4A 4TX1A 2BFFA 2P1DA 2C61A 3MM4A 1L4MA 2KPOA 1RQ2A 2V58A 4J76A 4DPLA 3G02A 3GU3A 4RTQA 2RJNA 5JZSA 1JXOA 4EPXA 3NM6B 4J90A 1QX4A 1DZIA 5AM0A 4D3ZA 1F6BA 1MOZA 1U11A 1ONOA 1O03A 1MO5A 1NXVA 1YI8A 1YVUA 2ZAMA 4X8MA 4M1KA 3TIGA 1Z5WA 1FSPA 4J03A 4JQCA 1KA9H 1TJYA 3JCZA 2OILA 3LZDA 3EXAA 4D0NA 1UFKA 2O6LA 1QIGA 2O2SA 4UATA 3VV3A 1L8OA 1RHKA 4IVQA 3STUA 1E8MA 2FTKE 4F91B 3ED1A 1G7TA 1KYXA 3KD2A 2PH5A 1N3IA 2A1TS 3V8MA 4D0LB 4ZVVA 3NRJA 1YD7A 3OQIB 4JELA 5DLEA 4Z9BA 1R27A 2GD0A 2XWJI 5TC4A 3NRCA 1ECLA 4DDTA 1R6AA 3H83A 3RVPA 1V8PA 3VXKA 1G0OA 2Z2IA 5AVTA 5I7AA 1PEAA 1XNHA 4PSVA 4IEEA 1DEKA 2H1SA 4MDFA 3MD0A 4FHDA 3RTBA 2XUDA 3BA6A 3QPAA 4U2FA 3PFHA 2WJPA 2G6TA 4HWSA 1NVKA 1RLMA 3IBTA 2OG2A 3JWJA 1VBMA 1NUTA 1L3IA 3GYGA 4J29A 2CT8A 2PJRA 4UBNA 1GSIA 3H5IA 3M1YA 4L9RA 4MB6A 4BQEA 4KFCA 3O3NB 5AI4A 2L17A 3K35A 1RLTA 3DQZA 3FDFA 4YASA 5TF4A 5JSHA 2ZTVA 3HBLA 3RSHA 3EVGA 3KKKA 2AQHA 4ZVQA 3REOA 2XTMA 4CFSA 5IJ9A 1B16A 1VMIA 4QQKA 1X8KA 2JGFA 4RA6A 1M1UA 1O58A 4M87A 4DR2B 3T0GA 4P5DA 2ZIFA 4UNSA 3ZTTA 2P0EA 3TCNA 2FOLA 1NZJA 1A3CA 2ZT8A 4YMWA 5CA0B 5AW2A 1ZJ6A 2WJVA 4ZV4A 5LNK6 2R1TA 3FCEA 4EEXA 3EHEA 1PWXA 4FYHA 2G1JA 4RKRA 2X4DA 3Q72A 5GZ6A 4CLXA 2FUG6 4BMDA 2I9KA 3IMGA 4CEJB 1RI2A 2FWIA 2JLRA 1NYQA 1XA0A 3I12A 2CVOA 4NJMB 4Q6WA 3K0BA 2CXXA 5TY0A 2XDQA 5DW3A 3SR4A 5EYPB 4DADA 1T10A 4OLAA 1U80A 4XH9B 4YI3A 1K7SN 3W2TA 5GV7A 3MAAC 1Q0TA 4BMSA 1J2YA 1RW4A 2RI0A 4QQ8A 2GN0A 1SRRA 3AUUA 4HI0E 3W5UA 3AEKB 4XOUA 3IEPA 1H4VB 3U0BA 2RJOA 1IBCA 5DKFA 5I9TA 1VI2A 2ZPAA 4CT5A 4AY4A 2P5UA 2I4RA 3FVWA 3K6SA 2J32A 1XNRB 1J8QA 1B3BA 1EUDA 4ZVOA 1S0UA 1P2UA 2V3CC 1CQZA 2PRZA 3NKVA 3B2EA 4BRSA 4CKEA 1ZD8A 3LFTA 3SR3A 1LVUA 2GA8A 4EQZA 1XZNA 5BW8A 3UOWA 3AHGA 3EA5A 4PYJA 3DOHA 3CRQA 3EIHA 2H3EA 3OIFA 4I6GA 4DJDC 5BUSA 1C7JA 1N0UA 2EEZA 1WCWA 3SZLA 4CR6A 1VJDA 1GZ4A 1TPYA 1TZ2A 3FN4A 3E3MA 4R2XA 2DR2A 1GRCA 4BOYA 2DPYA 2WD9A 1UJBA 2PM8A 4PSDA 4ZZ0A 3E9MA 3VUFA 1XTBA 4CXMA 4R1TA 4JT4A 5FPPA 3TNDA 2FAXA 4EPYA 1SXJC 3NG1A 1EQUA 3PIIA 3UB2A 4II2A 4JJGA 3F5SA 4E21A 4F1KA 5H3CA 3T12A 4BNGA 2JAXA 3VZQA 3Q8MA 4G1MB 2XF2A 5ERGB 1HQDA 1VMKA 5LBIA 4JCCA 3LUDA 2IJGX 4OQZA 3ROGA 4DMFA 1XCLA 1ZC4A 4XOIA 2AR9A 2F48A 3FSJX 4DMGA 3TMYA 3EBOA 3LNCA 4HN2A 4OQDA 5JATA 5FPTA 1PFQA 1N5RA 4QRHA 1L4FA 3S55A 2G77B 2ODTX 4MYDA 1DC7A 2BLNA 3M1LA 2XMGA 1FUIA 1RI5A 3EXIA 3VX4A 4BNYA 4MUNA 2EX1A 3IP7A 2NU9B 4LGVA 1P5FA 3CIOA 3V34A 2R1VA 3VHQA 1KGSA 4UARA 3IB6A 5ITWA 5I6DA 1A95A 1DARA 4TQUS 2JATA 3L0PA 4B6JA 2OCLA 4QJBA 1EIWA 4KEAA 3CEJA 4X1OA 3CONA 4AYXA 4UNPA 2Q5EA 3TNJA 3ZJUA 3B2NA 4ZVPA 2O8CB 1L7EA 1UQTA 2AFIA 3DAYA 4MW9A 3RLFA 4X93A 1M5UA 4BB5A 3PR2B 1G20E 4OGWA 4LY3A 4TLAA 4N7MA 4UQPA 3ZCUA 4B3IA 4TWBA 1DKMA 4RETA 5BWNA 3PK0A 1U7HA 1WY5A 2ZIUB 3YASA 1NLYA 1E5DA 5J2TB 2VJNA 3FHTA 2FW6A 1WQ4A 2BH9A 4R2IA 1KAHA 4YP0A 2XE8A 5IH3A 5K5EA 2LD4A 1FTYA 3DE7X 3UUFA 1PDVA 4PYQA 3T3MB 4DVJA 2YVKA 4X60A 5IZ4A 2AR0A 3ZXYA 3MJRA 4KQHA 1EVQA 9LDBA 1KRHA 2WFLB 1P0IA 3OJOA 4MW4A 1OGYA 3RU3A 3NALA 3ZGVA 2ODNA 5FKJA 1BVYF 1UC5B 1OPXA 1GNPA 4CT0A 4Z6KA 5DN6D 4QZVA 5JOQA 3O8RA 1R5OA 1GKIA 4Y0VA 3SYNA 4A82A 3IURA 5TLSA 3QLTA 1ZXXA 2ZI4A 4BE7B 5A4DA 1ADGA 2NXEA 5ECWA 1EXNA 5H3LA 3JS5A 2H8GA 5JC8A 5J5VA 5HZMA 4L4SA 2J7PD 2O0MA 2YVUA 3V4VB 2FX3A 1FTSA 2XEXA 2EW2A 4J0GA 3SGLA 1M0EA 3I72A 2IH5A 2WJHA 4A73A 2C20A 3GRRA 4J7CA 2VUHB 1HV8A 1L7DA 3DMPA 4EITA 2VXYA 4PF1A 2DFPA 5H3HA 1CUGA 1V9LA 1IBSA 4HPXB 1FB5A 1RKVA 2GXSA 1QONA 1WVMA 2RHCA 4TOIA 5JS8A 2OXCA 4HN4B 3ZWOA 3QF4A 3EGCA 2YUIA 4LRWA 2QL6A 4M0UA 3H2GA 2VRNA 3I9FA 2HZBA 4LSZA 3BICA 2RGCA 4BMYA 2GEJA 2Y67A 4FKZA 4QGFA 4YHBA 3FPHA 3V9PA 4H4DA 4C89A 5JJ5A 1H65A 4N5LA 2IDZA 2V7QD 3WB9A 1OXTA 2OLKA 2H4ZA 2P3LA 5F64A 1LUAA 1WXFA 5HDQA 2VHTA 2W6MA