3OU7A

Dhpi-sam-hep complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
214
structure length
214
Chain Sequence
TTSHGLIESQLSYYRARASEYDATFVPYMDSAAPAALERLRAGNIRGDVLELASGTGYWTRHLSGLADRVTALDGSAEMIAEAGRHGLDNVEFRQQDLFDWTPDRQWDAVFFAHWLAHVPDDRFEAFWESVRSAVAPGGVVEFVDVTDHERRLEQQDDSEPEVAVRRTLQDGRSFRIVKVFRSPAELTERLTALGWSCSVDEVHPGFLYATCRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and structure of DhpI, a phosphonate O-methyltransferase involved in dehydrophos biosynthesis.
pubmed doi rcsb
source organism Streptomyces luridus
molecule tags Transferase
molecule keywords SAM-dependent methyltransferase
total genus 72
structure length 214
sequence length 214
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ou7A00
4E33A 3EGEA 1SQGA 2HWKA 3P2EA 1WS6A 1UIRA 2UYQA 3P8ZA 1JSZA 4XUEA 4Z2YA 4ER3A 1AF7A 3BGVA 3NW9A 4DZRA 3UJBA 3K6RA 4EMSA 3PX3A 2OXTA 1M6YA 2OKCA 1ZG3A 3PB3A 4YMHA 5DTQA 3UJAA 3HEMA 1IM8A 3B7PA 4FT2A 4PYKA 2WK1A 5C1IA 1Z3CA 5GP1A 1NW8A 1NW5A 3DTNA 4C08A 4ER6A 4YUYA 1G60A 3G2OA 3BT7A 2YXDA 3A7EA 3SSNA 3Q87B 3HA7A 1ZGJA 1KHHA 1XVAA 2OY0A 3AXTA 2PX5A 5FWAA 1VE3A 3BWBA 1Q0TA 5EOVA 1TPYA 1RI2A 2CL5A 3CVOA 3DUWA 3OFJA 2AOVA 5KYGA 4CKCA 2XYRA 3V97A 3RIEA 3GU3A 4E30A 3DULA 3KR1A 4PNEA 5DM1A 2Z6UA 2ZFUA 2HMYB 1SKMA 2YQZA 5K03A 2PXXA 5E1OA 5DSTA 5GIPE 2I9KA 5DRTA 2V74B 5HIIA 5E9JA 1EAMA 5C0OE 3G5TA 3PTAA 3BGIA 3E23A 1KR5A 3KPYA 3PFGA 1YZ3A 3HA5A 4YUWA 3DR5A 4M37A 1XXLA 10MHA 1FP1D 2AN3A 4QPNA 1JG4A 2P8JA 4PYQA 3SMQA 4DQ0A 3VYWA 3HVJA 5EZSA 2Z6QA 2ESRA 2H00A 4YUZA 4M36A 2EJTA 2BR4A 2VS1A 3OU2A 4KDRA 1NW3A 3UWPA 3JWJA 3TKAA 4ER7A 5LR6A 4OQEA 1G38A 4F84A 3LBFA 3LL7A 3A27A 2QE6A 2EX4A 4DKJA 5E9QA 4PGHA 3P2IA 3O7WA 4DMGA 4GOMD 3CJRA 2ONYA 3DLCA 2IBTA 5MHTA 5E8JA 5DSXA 3GRUA 4Y30A 5HIMA 1PJZA 4YV0A 5DX0A 5KVAA 5DT2A 4BLWA 3UFBA 3CC8A 4RTLA 3B89A 5DRYA 1JQEA 4KW7A 1I4WA 1ZKDA 4QQKA 4MQ4A 3P9IA 1NBHA 1SUIA 3CGGA 4F86A 3HTXA 4EKIA 5HIKA 1DL5A 3D2LA 1NBIA 2WA1A 3C0KA 2JJQA 5K09A 3OCJA 2AOUB 5K01A 3KPUA 1YFJA 3GXOA 3FYDA 3P9CA 1X19A 5GOZA 2AZTA 2DULA 5IH3A 5FULA 3C3YA 3IV6A 3KQYA 2FHPA 4GBED 2IP2A 3T7RA 5ICFA 3DH0A 3S68A 2O0LA 3B3JA 3G8AA 2G70A 3FUUA 5K0NA 3T7TA 5EC8A 4GEKA 4FS8A 4R8RA 5LQAA 5LQNA 1YB2A 4FGZA 4OQDA 8MHTA 4GOND 2E5WA 2AN4A 4F85A 3M6XA 1JG2A 2JHCA 4E31A 3SR4A 1SG9A 2OBFA 3G5LA 2B3TA 5GM2A 2HTEA 4QPPA 1XJ5A 3MTEA 3FTEA 3I64A 3DXXA 2O06A 3NDJA 5DTRA 3SVZA 2VZ9A 1R74A 1N7IA 2AR0A 2OB1A 4K6MA 3TM4A 4AX8A 1KYWA 4DM3A 2P3OA 1OR8A 4RTPA 2YXEA 2I6GA 4O29A 3LDUA 2IBSA 1FJXA 5K0BA 1L3IA 2ONZA 4OA8A 3P9NA 4IV8A 2PWPA 4LWOA 2HNKA 3M6WA 4QTTB 3NJRA 4OA5A 5F2OA 4E2ZA 1JTEA 1QAOA 4X63A 5U4XA 2XVMA 2IPXA 3GRRA 3BGDA 5D1NA 3GRVA 3RODA 4FSXA 2G71A 4U7TB 3T0IA 3TOSA 4YUXA 2IH4A 2NXJA 2ZBPA 2BM9A 2GLUA 4X60A 2OZVA 5HIJA 5KQSA 1JTFA 4JXJA 1YZHA 3NWBA 4PONA 4RTKA 5CM2Z 3GCZA 2PBFA 5DM2A 1KPGA 1KYZA 4LECA 5HFJA 3P97A 4WXHA 1H1DA 2ADMA 2HR1A 3EEOA 2JHAA 3I9FA 4ER0A 5EMJA 3G89A 5GINE 2B2CA 1G8SA 3GJYA 1JG1A 3VSEA 3G2PA 3FTFA 3ID6C 3O31A 3HCAA 3LECA 3FUVA 4H0NA 1N2XA 4LWPA 4BLVA 5HOQA 3HCDA 4PIMA 4PYMA 4X61A 3OZTA 3FUWA 4RYLA 4HTFB 2PSSA 5ICGA 3FYCA 4HGYA 3A4TA 3UBTA 1VP9A 1FPQA 5DWQA 3X0DA 5FA8A 2P40A 3R9XB 3FRIA 2FPOA 5FTWA 1D2GA 3FUXA 3CKKA 2BR3A 3CJQA 4IWNA 1DUSA 3ELUA 3UJDA 4R8SA 2AOUA 4R6XA 2NP6A 1B42A 3QOXA 4HGZA 2P35A 3P71T 2G72A 5BW5A 1MHTA 2O57A 3AXSA 3ELYA 2IH5A 3ERCA 1L1EA 2QY6A 5GWXA 2VDWA 1IY9A 5KQRA 3KQMA 5EIWA 3AY0A 2GB4A 5DXJA 4DCMA 4P58A 4BP1A 4EKGA 5C9ZA 3FTDA 1ORIA 1NT2A 1UFKA 5GIOE 3B5IA 5CCBA 1M0EA 2OB2A 1XDUA 3M70A 3EVCA 4YUVA 2ZCJA 4P7GA 4CTKA 5K0GA 5D1HA 1N7JA 1SQFA 2R6ZA 4GF5A 3M4XA 4X1OA 5ICEA 3DXYA 3TM5A 4V0RA 2A14A 3KR2A 3V8VA 4C07A 4Y2HA 2ZLBA 3HM2A 4UOEA 5DPMA 3UJ9A 4RX1A 1KP9A 3PFHA 1XDZA 3LX6A 4NECA 3P9KA 2ZZKA 2GPYA 3GGDA 4GC5A 3GNLA 2ZZMA 3FUTA 4R05A 3G88A 3R24A 2IDKA 4FSDA 2EG5A 4OX9Y 3FTCA 3R0QA 3FZGA 2GH1A 2V7EA 1L3CA 1VL5A 1F3LA 2B78A 3HCCA 3EVZA 2ZIGA 1TW2A 1G55A 1NW6A 3BKXA 2ZZNA 3K0BA 3KR0A 4RV9A 4ER5A 3C3PA 2BR5A 3HP7A 1YF3A 2R3SA 1AQIA 3KPVA 4MIKA 4QQNA 1F38A 3FPGA 3OZRA 4PCLA 3HCBA 3TMAA 4CTJA 4PYJA 4G56A 4AZTA 2NNWB 5E8RA 3EVAA 1I1NA 3GWZA 1QZZA 1JSXA 1U2ZA 2C7PA 3THSA 3FPHA 2FK7A 4YMGA 2AVDA 2F8LA 2IH2A 5K0LA 2OYRA 3EPPA 3ANXA 1XCLA 1P39A 1RJFA 3GRYA 2N47A 3L8DA 4FR0A 4ISCA 5LQJA 3QOWA 4E2YA 2PKWA 5EHIA 3PT9A 4GQBA 5E2AA 5CIYA 3E05A 5T6BA 2PXAA 4AZSA 1O54A 4RVDA 2CMGA 1M6EX 4QTUB 2BH2A 1KPIA 1XCJA 3UJ8A 1O9GA 3FRHA 5FWDA 2IFTA 5EKXA 4RVHA 1FP2A 2G1PA 4A6DA 4QDKA 5EMMA 2ZULA 5ERGB 3NMUF 3EGVA 2ZIEA 3JWHA 5E1MA 5EMLA 3KHKA 4GC9A 1L9KA 3EMBA 3NVKI 2K4MA 3LBYA 3R6TA 2O07A 3REOA 4RTJA 1P1BA 2P1DA 1BC5A 2FYTA 5CUQA 5E2BA 1O9HA 4RTOA 2YVLA 3TR6A 1BOOA 3AWIA 1D2CA 1YFLA 3ORHA 4BP3A 3ER9A 2Y1WA 3M6VA 2CMHA 1AQJA 4V0QA 5FUBA 2GAFA 3G7UA 3LPMA 4XUCA 5E1BA 3I53A 4KWCA 4PYOA 1RI1A 3LHDA 3E7PA 3SM3A 3NTVA 4ZTBA 5HZMA 1TW3A 5HILA 2ZWAA 2ZBRA 3LDGA 1KIAA 4PCAA 2CKDA 4PGGA 1BKYA 1R18A 3U81A 3KQQA 2G8NA 1PRYA 1INLA 3GRZA 3KQWA 4EVIA 4YV1A 5K8VA 3SSOA 3PS9A 4DCGA 2ERCA 4PYIA 2VDUE 2YXLA 2EFJA 3HA3A 4QVGA 4RTRA 5EKUA 3HVHA 5CVEA 3I5UA 1XDSA 2BZGA 3R3HA 3KPWA 3OU7A 2VDVE 4RTNA 4KIGA 3B3GA 2NXNA 4M7RA 5FADA 4E70A 2P7HA 4P7FA 3C6KA 3NDIA 4KIFA 3CJTA 5ICCA 5H02A 5CVVA 4IV0A 1SVUA 5KS2A 2UZ4A 3UA3A 1NV9A 1JR4A 3JWGA 2PGXA 3SGLA 3HVKA 3A26A 2PLWA 3M33A 2YX1A 2P41A 2PT9A 3LDFA 1RI5A 2QM3A 2ZSUA 3KKZA 5EIFA 4CXMA 4MHTA 1WXWA 2I7CA 4WVLA 1QAMA 2P3QA 3RW9A 3THRA 3BKWA 2Y1XA 1FBNA 2Q41A 4HSGA 3BWYA 2C7OA 2DPMA 4PYNA 4QVKA 2PWYA 3DXZA 1KXZA 3HVIA 1D2HA 3E8SA 5M5BA 5JR3A 1AV6A 5EG5A 1WG8A 1EIZA 3HNRA 2QRVB 3KQTA 5DXAA 2C7QA 1EJ6A 2C7RA 3ME5A 4OBWA 5EPEA 5FA5A 3UA4A 2IGTA 4FZVA 2AN5A 3TLJA 3GDHA 2FRXA 4C06A 5LQCA 2FCAA 5E1DA 3OFKA 4HRAA 2XYVA 2KW5A 5CVJA 1I9GA 1NV8A 3ELDA 5G02A 3DP7A 4GUAA 5IKMA 2ZBQA 3UJCA 1VLMA 1KPHA 3EVDA 3DMFA 3G2QA 4AZWA 4E2WA 5DM4A 3LKDA 3MCZA 5BXYA 1P91A 3WSTA 2JH8A 2JHPA 2YR0A 4E32A 1YUBA 2AVNA 3FPJA 2H11A 4OBXA 3G2MA 1R8YA 2FK8A 1QAQA 2PVCA 1HMYA 2NYUA 3EVEA 1JQ3A 5FHQA 1R6AA 3CCFA 4CKEA 1HNNA 1JG3A 3TFWA 7MHTA 1RJDA 2H1RA 1ZGAA 3DLIA 3GO4A 3LSTA 1RI3A 5EMKA 4E2XA 3UZUA 3MHTA 1L3BA 2YTZA 3F4KA 3JWIA 4BLUA 5HEKA 2GA9A 1MJFA 2ZIFA 3UJ6A 3MCTA 5EZQA 2ZW9A 3EVFA 4HTFA 1VBFA 4EK9A 4C04A 3MGGA 2UYCA 1T43A 1WY7A 5BW4A 4PYLA 5LQRA 1JQDA 3LKZA 4YV2A 3M6UA 4DF3A 5EEGA 2IIPA 5FCDA 5P8WA 2B25A 5EEHA 1RJGA 3C6MA 2AOXA 3KQPA 3OPNA 1X1AA 2VP3A 2B9EA 2QRVA 3PVCA 3TQSA 9MHTA 1NKVA 3T7SA 5EQJB 1ZHFA 5K0FA 5GM1A 5K05A 3ER8A 1R00A 2XBMA 3DMGA 2ZTHA 2JH9A 5F2KA 2ZWVA 2PV0A 5DTMA 1G8AA 2ORED 2PT6A 4HG2A 2ZVJA 3HCEA 3KQSA 4RWZA 5LQKA 3H2BA 4CKBA 3BUSA 1RI4A 1QANA 1QYRA 1WZNA 1VP3A 2PX2A 3LCUA 3B3FA 3SX0A 4EQZA 5DLYA 2HV9A 3P2KA 2P3LA 4X41A 2IDJA 4RVFA 4RVGA 3IHTA 1Y8CA 2PX8A 3MTIA 3KR9A 5FQNA 3FPEA 3SSMA 4C4AA 5F2NA 5CVUA 1V39A 2EJUA 2PY6A 3KQVA 1DCTA 2XYQA 3TKYA 4POOA 4XUDA 2AOTB 4XCXA 1VPTA 1EQAA 2O05A 1P1CA 5FHRA 1XTPA 1G6Q1 2GS9A 1NW7A 3LGAA 1Q0SA 3KQOA 4IKPA 4AZVA 2UYHA 4HC4A 4B17A 1VIDA 4P7KA 4ATNA 3AJDA 3OZSA 5BP7A 3BWMA 5CVDA 1IXKA 3EVBA 4DA4A 2XVAA 2Z6AA 2NXCA 3IYLW 3O4FA 3EGIA 4PIPA 3HCFA 3MERA 5FQOA 5DX8A 4RSRA 3VC1A 3IEIA 3TPZA 2CWWA 5T64A 3BZBA 1BHJA 1X1DA 4A6EA 3EMDA 4KRGA 2QYOA 4L7VA 3ELWA 1NE2A 4P7JA 1WXXA 3CBGA 4RTQA 3QV2A 4FT4A 2NXEA 2I62A 2PXCA 3KPJA 4CWAA 4RTSA 3DOUA 3EVGA 5E9WA 5CD1A 2WA2A 2OPBA 3NWEA 5LSAA 2NP7A 3VC2A 4U7PB 5T67A 4MWZA 4M38A 4FP9A 5EGSA 1VQ1A 3BWCA 3EEYA 2AOTA 4QDJA 1ORHA 4HH4A 5K0CA 4BY9E 5K0EA 1X1BA 4AUKA 4C05A 4C03A 3PLAE 3I58A 2PX4A 4PINA 3A7DA 2AOWA 1ZQ9A 3G8BA 4KVZA 2YUIA 1R8XA 4KDCA 4R6WA 3TRKA 2P7IA 3A25A 3LCCA 5B1SA 3KU1A 1X1CA 2PJDA 3LCVB 3PX2A 1RJEA 3Q7EA 5JUWA 5LQUA 4PWYA 4GOLD 3MQ2A 3OU6A 5EVJA 5EHGA 1SUSA 3UJ7A 2BM8A 4GOOD 5DX1A 5K0JA 2LD4A 3OE4A 2OO3A 4RTMA 3OE5A 3BXOA 5DM0A 2JG3A 3NVMB 4MTLA 1EJ0A 5CCXA 3FPFA 1EG2A 2UYOA 1UWVA 3SXJA 3MB5A 3DMHA 3MAGA 2AS0A 4LG1A 3GIWA
chains in the Genus database with same CATH superfamily
1VFPA 5MF6A 4TSKA 4Z2YA 5F12A 1CT9A 3RUDA 2G3YA 5IVIA 4OUDB 1DS6A 3HB7A 5LU9A 3DKIA 4PPYA 3S99A 5GONF 4YMHA 4S0ZA 5C1IA 4J2TA 5KOHA 4DQUA 2XDWA 2W6CX 4HT3B 5JY6A 3Q87B 5BUZA 2OCLA 4IIVA 2BUBA 2I6QA 4RVOA 2G9ZA 1GGHA 3KL4A 1C50A 5IN5A 5DM60 2WIFA 1TPYA 3CVOA 1EUDA 4BBPA 1I7QB 4UOZA 1GGNA 1UKVY 1YCDA 3RS4A 2R7MA 1CNMA 4RC9A 4ZOLF 2G6BA 3G85A 5H5JA 4BCBA 5MN6A 1RSZA 1H2HA 4COOA 4EEZA 2GTIA 1YZFA 1DT3A 1E20A 3ZVRA 4ZOEA 2BGKA 2QTMA 5FWXB 2VF2A 2P2GA 4MP3A 3UOWA 1ETHA 5IF3A 3E23A 2A59A 5KPJA 1A5TA 4ZMSA 2DERA 2KMLA 1T5DX 4OEHA 2ZE6A 4FYKA 4ZC1A 2INGX 1MT0A 3I5XA 2HO4A 1W4LA 1SQ0A 3JQRA 3O0DA 5DDIP 1YTUA 1EXWA 2Z8YA 3WXMA 1G1MA 1PR0A 2GCEA 4E5UA 4Q7KA 2E21A 2Y1EA 4IY1A 1A9XA 3PA8A 2DE0X 4XZ3A 2O4UX 1WABA 3F5SA 3OE1A 4TTIA 2BR4A 5AUNB 2H4JA 1KI1A 3JRXA 3OH8A 4DQKA 4EPTA 4QFCA 5KNCH 3STVA 1C14A 1LS6A 5BUCA 1W0CA 4CCYA 3VC3A 5LOVF 1K6MA 2EDCA 5AK0A 3EXIB 4R9UC 3CM0A 1ULZA 2ZYTX 1S4MA 1W2HA 1U8YA 3NUQA 3OM8A 2FPPA 2CXXA 3U80A 1ZUIA 2AUMA 3HU5A 4Y30A 3SZ3A 3WRWA 2LDXA 5HZHA 2FPRA 1KMQA 3EIHA 5EXPA 3ZCTA 2D7CA 2W6IA 1RKXA 2O14A 4RORA 1P31A 3FJOA 2PR2A 4X93A 2ODWA 3GN2A 1NJFA 3KLNA 1JLMA 2ISQA 3FCCA 3UV3A 4MQ4A 1TUBB 3TLAA 4BFZA 1SUIA 3L8YA 3RT9A 3BXFA 2A0XA 1KO7A 3AW9A 1KQOA 4PFSA 1H2YA 3ZY4A 3DCNA 4IGFA 4JJ6A 2B1QA 1QYWA 3H8JA 2G7ZA 4TMTA 4BU0A 4DCUA 5HRAA 5IT9A 2PS9A 1VGQA 4R2WA 1UXJA 5EWJB 3TXYA 4RQAA 2HPVA 5KVQA 1TT5A 3JYHA 2WMYA 2G9NA 4B83A 1QHSA 4R0NA 5T5QA 3GAZA 5JT1A 3COZA 3G8AA 1XJ0A 4FU0A 2A5DA 2R7KA 4TYPA 4GPD1 2R8ZA 3E9QA 4XIIA 4CKYA 4D9NA 3WIDA 1JJFA 2JBAB 3X1JA 4D26A 2IPOA 4X7BA 1KDVA 1Q11A 2PH5A 4MW5A 5HK9A 4KAJA 5A5DA 2WWYA 1UP6A 3GH1A 3W34A 4E5VA 4ERXA 2RE8A 3GAAA 2GAOA 4AKHA 2GEJA 2IV7A 2X8JA 3K9NA 3FD8A 2OHOA 4TM8A 2GKSA 2HTEA 1Q5PA 1Y8QA 4NULA 4D0LB 2EJWA 3MTEA 3Q85A 3A10A 1GKKA 4II3A 3FI9A 4K03A 4RKYA 5KNCA 1KP2A 3BXEA 3QNWA 1VCMA 4UNSA 3ZC3A 2HPZA 4Z4CA 2AZMA 3A6PC 2J3EA 2PYIA 1J9ZA 4Y9SA 3LMKA 4XEUA 3OF2A 3KYDB 4IJQA 1QX3A 2DXIA 1D6JA 4ES6A 1F8UA 1HDZA 1LC3A 1UMBA 2J4DA 2KE5A 5K0BA 4J94A 1LPNA 1XZHA 3A1TA 4L4ZA 2XJ4A 4QTTB 3ZW9A 1ATIA 1NX6A 5KTSA 2YFHA 3PWKA 2CV1A 621PA 3OZDA 3KSRA 2KX7A 2C5LA 4IG4A 4OP3A 4J0HA 4F9EA 3N05A 5A4IS 2GLUA 6Q21A 3MB8A 1Z4OA 3KYCB 1DWOA 4MV4A 5CDGA 4KXWA 3L46A 1P1IA 2WQ6A 3Q7RA 5B57C 1R5NA 1M83A 4RMGA 3GCZA 4N1AA 4BC1A 3H1EA 2FJPA 4JB3A 1U5BA 3RAPR 1KY3A 4BE4A 1BWRA 1NKTA 2WC1A 2WF7A 1I2AA 3P97A 1VL0A 4WXHA 3WO1A 3T0FA 4K6KA 3JR7A 3SLGA 2J9YB 3T41A 2C9CA 3FI0A 3RS7A 1USUA 3D3NA 4LHEA 2PT7A 4ENTA 3PJDA 4AECA 1A8PA 1JZTA 1KQFA 4BO9A 4Q16A 1TQDA 2IYVA 2J0QA 1KI2A 4IJKA 1WBDA 4ZREA 3RSOA 3OJXA 5DSZA 1XNQB 1H4TA 3D81A 3Q3IA 3LHSA 4B8YA 4BJ6A 4Z8XA 4KFCA 1L7EA 3ZU6A 1A27A 4AJOA 4KH1A 1U7PA 2XB9A 2F3UA 2Y6VA 4LDAA 3VBCA 4D6XA 1LB1B 3L7IA 4MVJE 5KTPA 1N2HA 2YN0A 2RGRA 4XIFA 3RIHA 3RBZA 3WIBA 2ILVA 4IGAA 3MWJA 3ZE0B 2VYQA 3E70C 4QXOA 3TSWA 4C5AA 5CDSA 5JJKA 1CE8A 1QHFA 2P9TA 5L7TA 1PHRA 2GR9A 1DP4A 2QRKA 3AFHA 3D7NA 3KZVA 4MUIA 4XM1A 1MHTA 2G09A 2BFWA 4N7MA 4UPVA 1IATA 2O3UA 5GWXA 3KQMA 3Q72A 4MHOA 5EIWA 5BSFA 1YDHA 1AUOA 3B1VA 4H7IA 4OM8A 5TE9A 4YACA 2FX3A 3HDQA 4RLSA 4BVLA 4V1CI 3JTMA 1MOQA 4FYVA 1N1EA 2FZKA 2GSWA 1Z06A 1PW7A 2DM6A 1ZGGA 3OOYA 5FBKA 3CVUA 4REOA 1RVV1 1VLZA 4HUQA 1RM5A 3L8MA 3ZVLA 3B48A 4JBHA 2VQEB 2ALJA 4QLAA 1EVYA 4MEJA 2LGJA 1K86A 5DWVA 1L1FA 2K6GA 4NPCA 4V0RA 3AHJA 4DMUB 3IDQA 1XTJA 5JPIA 2WWHA 1T8SA 1IPFA 4Y1RA 3M5CA 4UVIA 5DPMA 4G0YA 4PZZA 1E8DA 1P1HA 5FNVF 3KXKA 1SQ6A 1YMVA 2Z9BA 1JT9A 1RMTA 4PG6A 1VFNA 3KVNA 1TF5A 3FUTA 5C2JB 3G88A 3LUHA 1T9HA 1KU0A 3R1IA 3KWJA 4A1OA 1TFUA 2QVCA 1MAHA 4US0R 2HK8A 2I7DA 4WOBA 1L5NA 3RG2A 1PR2A 4AJ9A 1VRCA 1F9EA 4G9GA 3QF7A 4O4JF 1IDOA 2V7EA 3TQIA 2X6QA 1XYYA 3GZNA 3PI6A 4HAUA 2ZZNA 3P0RA 1PR4A 4DTCA 2I9PA 1B0UA 4QQNA 4PLFA 2NSDA 2YC4C 4GP7A 4I3FA 3NXSA 3R75A 3W5DA 4B7UA 2IW1A 4Z1OA 4LF9B 2A35A 1KSFX 3BIJA 3IPXA 4PYJA 2CLHB 1NBME 2Q62A 4JC5A 4LTDA 2V9PA 3JQ7A 1KO4A 4F5WA 1JSXA 3ZWMA 2NZUG 1FU4A 4I2VA 4B84A 4WLNA 3O8CA 4ZJUA 4FLEA 5FV4A 1AOXA 4RTNA 4F0JA 1PP4A 1Q1ZA 2XZLA 1D1PA 2X2OA 4WOKA 3EFEA 1M6EX 2OORA 4UPEA 2FWJA 3EVNA 5EKXA 1DAPA 5DK4A 5AJVB 5BOSA 3ECAA 1II9A 2HMUA 2ZULA 2B92A 3I61A 3S3TA 4H6XA 4FOTA 4XDYA 4I6EA 4NY1A 3KJNA 1F7UA 3JQAD 1X38A 3GDOA 4IRUB 1GNVA 5DI3B 4JNCA 4QGSA 2P2ZA 1HY3A 1Y80A 2WG1A 4KXXA 3I1YA 1SXJD 1K75A 4P4TA 4RPCA 5LD2C 2AC7A 1FYEA 3SKYA 1G8JA 2IZZA 1O4WA 3DBVO 1Z08A 3TRDA 2QLLA 3GFTA 3R0JA 1TVCA 4RF5A 1GZ5A 2C9YA 4M9RA 3O91A 4NJMB 2GBFA 4F12A 5EQDA 2FPGA 1XN4A 2Q3MA 521PA 3KQQA 4MYHA 5JBIA 4BATA 2QKYA 2GK7A 2YVKA 3MLAA 3V5NA 1N3IA 4ZZ3A 4QWMA 2EKPA 4CEHA 3K71B 1QPBA 2W6JD 3BHNA 4DR3B 1G5QA 1G3IA 4OIFA 3EFOB 1SVNA 2XMRA 3I5UA 4RDXA 2VDVE 1FTQA 2C4NA 3ZWNA 4M7RA 4O4JA 3NDIA 2LXNA 4NR0A 4OQNA 4KSBA 4AS2A 1QR2A 5HJ5A 3FR7A 3GRPA 2RH4A 2V4MA 3OCZA 1NUTA 1LLCA 5FBQB 2B35A 1W49A 2PT5A 4K8OA 2EGHA 1UK6A 4KQ6A 3HXLA 1EDEA 4XD7A 4WFKA 3BFXA 3DW1X 3LYAA 3I04A 1OC4A 3ROQA 1QH1B 3VZBA 4QL3A 3QLUC 3DKKA 4EAAA 2I7CA 2W00A 4LXHA 2P3QA 2QUZA 2IS6A 1CEQA 1FUKA 2ZUFA 1XEWY 2QYHA 1FBNA 4XQGA 1A5ZA 1XYGA 2Q29A 3THOA 2DPMA 3GJTA 3LRXA 3PU6A 1IN1A 1FMJA 5GONA 1NFQA 1R0KA 1ZRSA 3B5EA 1U6IA 1V4BA 3W2HA 4WZ6A 2O8CA 2IGTA 4URHA 1FSPA 4FDUA 1I24A 3PSAA 4NZOA 4AYTA 3QI7A 2VP0A 2FRXA 4R1OA 5H80A 5BQXA 1VLHA 3TRIA 2A4KA 2CNDA 3AFIA 3NO4A 4WXEA 3KHSA 2GTHA 2PZFA 4BFWA 1WPXA 1IZ7A 4H27A 1ZW1A 5HS4A 3Q98A 2DT5A 3ETGA 4R84A 3TLEA 3WLJA 3A1FA 4X62B 1XCMA 3WSTA 4L28A 2WAAA 4OHZA 1IAQA 1Q1EA 3QKWA 3T5DA 4P0QB 3G2MA 4G0UA 1WA5A 1YB6A 2AYXA 5JS7A 3TLZA 4BNTA 3ZYZA 3C1AA 4QU0A 4ARZB 4EJ0A 2Z2IA 4QBTA 3U2QA 2P67A 4LJ6A 5EMKA 4N5MA 3H5IA 4X0EA 3JQBC 3W6OA 2R11A 3GCGA 4DJEC 4EJSB 3WNZA 4LMPA 3JWIA 4X1IB 4F11A 3EZGA 4BOYA 2R2GA 4PX2A 2Q21A 4W63A 4H6PA 4I50B 4LW8A 3U1VA 1PEYA 5J58A 3HY6A 4NZNA 4B6GA 1LQTA 1SRRA 2IHYA 3HZRA 4YWHA 5SZJA 4CQLB 1JH9A 3KUUA 2C54A 1ENPA 2WIDA 3QWFA 2XKJE 3E7DA 1UXIA 1T3TA 4Q6BA 4Q4JA 1WXHA 3EW9A 1WOYA 2ENWA 2PMBA 3OEEA 3MT7A 3IBSA 1EP1B 1IEVA 2X2EA 4YC7A 3W90A 1GWNA 3MUOA 4MITA 5KYYA 2AJBA 3LYHA 5EEHA 4EMUA 4MA5A 1FNNA 3BPSA 2C29D 1TZCA 4MQBA 1QYVA 4AIRA 2V4UA 4GX2A 2NUBA 5IEBA 4ABTA 5BV0A 1QYIA 4U7HA 1J20A 2BGIA 2ZB4A 4IMIB 1P9NA 3IEVA 3D3JA 1OXVA 1BMDA 1CR0A 1H2ZA 3CEAA 4M98A 4LY9A 2HU5A 1Y63A 4A1FA 1WZNA 2QT1A 1Q0UA 3M9XA 4CT0A 3RSHA 5KMGB 3X1DA 4BHTA 1G42A 3PE6A 5FWYA 5FP0A 2VI5A 2YJ5A 5CVUA 2YRXA 2B8TA 3B53X 2GA8A 3NORA 4D41A 1FRFS 4DR1B 2AQHA 1JI0A 3OQOA 3ZGZA 1P2UA 3IIJA 3CU5A 1JAHA 4HVCA 4YMUA 2EBUA 1P1CA 2PLAA 2XGMA 1P2FA 3AGPA 1P4SA 2Y1GA 3BQMB 3UAZA 1C9YA 4EHHA 2AI2A 4JZKA 5A5VA 3AVQA 2HB6A 5AVZA 1MJGA 3BCHA 4LYYA 2N0SA 3B1XA 4PQEA 5EP1A 2P4EA 1R37A 2XF8A 3KOWA 4DR2B 3R9KA 1NW4A 4PIPA 1L5WA 3HLYA 4XDHA 2NU9B 4OOFA 1S2IA 1QPZA 3DZHA 4LTMA 3ABOB 2OSVA 4D4MA 5IZCA 3ZDDA 1X14A 1XL1A 3VPFA 1KGSA 1RQXA 1V3QE 1PQPA 2J5QA 1VG1A 2VN8A 5DULA 5A5GA 5A6SA 4C2BA 3W9UA 4W5OA 1GPKA 1T36B 1UJMA 2ZI5A 1L7AA 3CHYA 2D1QA 3I23A 4LUCA 1GZ7A 1U3GA 4PXAA 5L40A 1JAZA 1RNLA 2FN4A 3OT1B 1NJSA 1SQSA 2PU7A 1TK3A 4GE0A 1UDWA 1N2JA 1NQ5A 4RGVA 3WTBA 1PQWA 4I99A 2ZUEA 4D3XA 4I3GA 4DV4B 1C0IA 2BELA 3WA6A 4TM7A 3DZGA 2FRDC 4O2AA 3WYEA 4DOMA 2X5XA 4OI1A 1TTPB 4MGHA 2BCEA 3FBTA 1NMZA 3AM5A 3IVGA 2PX4A 1VCHA 5J2TA 4JC4A 4WKNA 1KQ3A 3AUAA 3EXFB 1C7IA 3RVOA 1E0KA 1NNLA 3F6RA 1D2RA 1USWA 1YS2X 2IHTA 5HF9A 2VSOA 4WBNB 1ODFA 3GT3A 5IULC 2ZI3A 3Q7EA 3ZY3A 2ZRKA 2FZ5A 4EHIA 3HMQA 2B99A 5AVQA 1EI9A 4GOOD 4HEA6 4AWXA 1NP3A 3C8HA 4TKVA 1IXSB 3C3WA 1BSVA 2DPLA 2XZTA 4DCNA 3TKLA 3CRW1 3ZHYA 2F55A 2TS1A 3VPHA 3SXJA 4LC1A 3QX3A 4DIUA 2Q1XA 2HCJB 1CUGA 3KOYA 5CLQA 5HYVA 1YA6A 1I7DA 1I4OA 1L7QA 3AOGA 2HMTA 1QIHA 4LV8B 3ZIAD 3EIXA 4UVDA 5DHUA 4EL0A 2ZIVB 1WS6A 1UIRA 4K6GA 5YASA 3NW9A 1T0JB 4YIKA 1MMFB 4DZRA 2BDEA 1I2ZA 3V4ZA 4YCJA 4Z51A 3RREA 2D5CA 3GFSA 4WJZA 4YRBA 3OOEA 3TUIC 5F9FA 2XWJI 1N1GA 4ER6A 4YRDA 1ADJA 3ND6A 1VMKA 3MTJA 4M0MA 4CKEB 1B6TA 1RT9A 2OM6A 2OV6A 3WLLA 1YBAA 1JMVA 1W85B 4JAVC 2WZCA 4P31A 5ER6A 4OXKA 1GRCA 2E55A 4IP0A 4KIWA 1AA9A 5DM1A 2Z6UA 1DADA 2O6HA 3OUZA 2UUPA 1LJLA 2E6KA 1XGKA 2YC2C 3OC6A 1NL3A 4LY3A 4Y0AA 4Z99A 5JAQA 3DEJA 1HDRA 3AJAA 4MJXA 3GC6A 3HWSA 3AQIA 4WNAA 4PVCA 5UKDA 3N6VA 1Z2PX 3PNLA 2V96A 4AQDA 3L4BC 2BWJA 1X7XB 4L0MA 2OKGA 2VBCA 1UOPA 3OLXA 1A76A 2PBZA 1NXXA 3ETCA 2PSEA 4N8DA 2V7BA 4R2JA 3SYRA 1UZNA 3G2IA 1NR1A 3KZOA 3PFGA 3H1PA 4GM0A 4Q93A 4BKMA 2HHHB 1PK8A 4EEKA 4W82A 1JG4A 1H0HA 2DFNA 2P8JA 2XOKD 4U2DA 5IDYA 3DAHA 1UOEA 3HDVA 3NHYA 1Q14A 3JXEA 1V3VA 2QGZA 4BLRA 4M36A 2VHYA 4DMCA 2GEFA 4NG4A 3VMMA 4URXR 5K0TA 3U3XA 2AI1A 1X39A 2PQ2A 5K8LA 2ZVPX 3WNBA 1ECPA 2QUIA 1A50B 4BRUA 3LX8A 1QFSA 2OCDA 1N0UA 3U9TA 1P4GA 1JHDA 1QCDA 4GOMD 3D2CA 4HQNA 2BJWA 4CU5A 1RQRA 3WHPA 2B9VA 5KVAA 1R5BA 1T1JA 2Y66A 1FLAA 3G7NA 5LBTA 4RTLA 2OGTA 4GI2A 5LNK6 1AKYA 4TMXA 3RC7A 3RJZA 4B6SA 4HJXA 1WB9A 5A0FA 1B43A 2QGFA 4MLDA 1JT2A 1XUOA 5DYIA 5BYJA 1N92A 3L49A 3KUXA 4EKIA 3WQHA 2FETA 3OCJA 4P34A 3MCUA 1SD5A 2RI1A 3SJ7A 1X19A 2ZJZA 1TQ4A 1NDUA 4QOIA 4BE9A 5DN6D 1M54A 2CNKA 1M34B 3KZ1E 3T7RA 1HQDA 4DVGA 2QTVA 1Y3CE 4OHVA 1QG6A 3A2LA 3B1YA 1GN8A 5C4IA 4KRYA 4O4JB 4RU1A 4PRYA 5C4GB 1E9BA 5EXSA 2WIKA 1AKEA 1YDGA 3NHPA 4M9QA 3B7GA 4BCCA 3GLFB 4F4UA 2WKQA 1ABFA 1AB6A 3JZIA 1YDEA 2BDTA 1OXUA 1P2GA 4XWWA 2OBFA 4OQ4A 4YDRA 1FVXA 2B6NA 5F1PA 4NBUA 3FDIA 1I4TD 4IS2A 3CVYA 4QQ8A 4YJFA 1XQXA 3L1JA 2Q1YA 3OQIB 4MI3A 3UXHA 3FPAA 3DEFA 4Y9UA 4XQ0A 2XT6A 3TM4A 4R81A 1YL5A 3ZKWA 4NTZA 5JECA 1WD5A 1K2WA 3H5NA 2GN6A 2IV3A 2FE1A 5JLAA 3RH0A 4BYMA 5KX5B 2Y77A 4FFVA 1L3IA 3DD1A 3NRCA 2P9HA 4I2NA 4JP1A 5BQPA 1K6XA 1VXOA 2H54A 4F6RA 5KNBD 4CZ2A 4YJDA 1GGKA 4LXQA 4RHFA 1XKTA 4D92A 4MHSA 2IPXA 4M1MA 4XA8A 5BW8A 3ABIA 5D1NA 5LQUA 3T0IA 1Z5OA 3K9HA 4TS4A 4AIIA 3DTVA 1A2QA 3U49A 4G36A 4X60A 2IXDA 1NLMA 1Z0AA 5EE0A 3ZNPA 4FMDB 5JAIA 3W7AA 4ETWA 4A0QA 1EUCA 5IDXA 4F2DA 5ANRB 3MS7A 1JKFA 1NC3A 4B75A 3JQBA 1HEIA 1Q3TA 1TZKA 2RC5A 3AILA 2R1VA 5JNTA 1ZQ1A 5EZ5A 1FYDA 3WLAA 2DPXA 4HWOA 3TW8A 3ZCVA 1N75A 1WLSA 3VKUA 2WNSA 3K5WA 4QGAA 1E2IA 3BWXA 3I5MA 2DBYA 3KCNA 3LQFA 4I14A 1HFJA 4LWPA 1N2XA 4OO3A 3HYTA 4EFKA 1ZJWA 2JJ2D 2VH2A 2B4YA 4JZYA 3AVPA 5G0SA 2PSSA 3LP5A 2PL1A 2NYRA 4TUYF 3O8NA 1VP9A 5LB2A 1MLDA 4FWBA 4WZZA 4EJFA 5L95A 2UUBB 4WGGA 1PS9A 3FUXA 2C2XA 5F23A 5FTMA 1PCXA 3ICVA 4DDUA 1BE6A 2RI6A 1J21A 2ZWMA 2Q1SA 5ELMA 3BD7A 1K7CA 3RVQA 1MOSA 2ZUTA 2WI8A 2ACKA 3NT2A 1SB9A 2ECOA 2X86A 4LKOA 1NZFA 4D9FA 2MIIA 3O93A 2R68A 4AXBA 1UJ6A 3D5EA 1C2YA 1GV0A 3CRVA 3F67A 3Q7SA 5LA6A 4EOGA 1IMJA 2XWSA 4ZVKA 4FJ2A 2ZIUB 4LJ8A 3AY0A 4ESEA 2EWVA 2FGKA 4NAVA 4RMHA 3BRQA 2GJ8A 1FJ2A 5HGXA 2W6ZA 9ATCA 1E1NA 1BNCA 3NC0C 2FWPA 3VR6A 4YRSA 3RS3A 3FYHA 4AZ3B 3CZ5A 2XVYA 1NF8A 3IQDB 4P4SA 3DHYA 2VDMB 2GHRA 1NT2A 3F6SA 3PGXA 4YALA 4ZXPA 3RKUA 1KI4A 3B5IA 4EG7A 3QFCA 1PK7A 3AHHA 3FCUB 3Q7QA 4ZOLB 4YUVA 4DDHA 4YUAA 1R5OA 4P4GA 2ODQA 2R6ZA 3QJGA 4M8KA 3ANMA 4LSZA 1II8A 2V3WA 4X1OA 4A7PA 1CVLA 2I2XB 2QD5A 4AYWA 1JBQA 4N5DA 4CQMA 5IANA 4FMPA 1P8AA 3MWKA 2YFKA 4DY4A 5D8DA 5CT9A 3G0HA 3HNPA 1XDZA 3GLHA 3QUTA 4NECA 4P8RA 1ZRNA 4ZVNA 2CJWA 3BHIA 4AM8A 3N2YA 3IIEA 3T54A 1GR1A 4JI1B 4B7AA 3NBMA 1TKAA 1SG6A 3QX9A 4MVJA 3ZD8A 4B80A 1EXVA 3ZGVA 3AR8A 4GR5A 3TH5A 3KSBC 2ZBEA 4RD0A 2WUEA 3UGKA 2F3SA 4RFLA 3JD1A 1QKIA 3WGNA 4DADA 4F4IA 2IYPA 4QUIA 4UDXX 3TPFA 4YJ2A 3C3PA 3T95A 2NUAB 3BMXA 1DBIA 1P75A 2OLKA 2Q0SA 1AQYA 3ND7A 4DLSA 1EXMA 3OBIA 3L7DA 3OJOA 2OHJA 2DKOA 3W9BA 4WJLA 4P98A 3A6JA 4LTNA 3RSFA 3M6LA 4CF3A 2Z8YM 2MMCA 3NU1A 5CFPA 2AVDA 2FFJA 1SFRA 1YB1A 3IAAA 3SJUA 3T61A 2V6IA 2Q2NA 1YZTA 4INAA 2JD1A 4TRMA 5ALKA 1VJDA 7YASA 4I1SA 3BSSA 2VK1A 3FRJA 3NHLA 4RZXA 3IIMA 2M98A 3SVTA 2D2FA 2GK4A 3BE6A 3EHEA 3SF8B 3LH5A 1Z0FA 3QOYA 4ZRDA 4CLRB 1MX1A 4WLVA 3QJ5A 1ESEA 2IHBA 5K51A 2JI7A 3H11B 4X54A 4DLTA 2ZQZA 3P2YA 2SBTA 2W5UA 2ZIEA 4BAGA 4C7BA 3GLQA 1PF7E 3OPVA 2C5SA 1XQ9A 1SC3A 2ZGVA 1ZK0A 1KJWA 5IUJC 2FJ0A 1L4GA 2VOJA 2NGRA 1MJHA 2XMDA 1N9GA 2FYTA 3LUCA 3IURA 4E09A 4QGFA 1AX9A 1MCZA 1XLTC 4QVIA 1BWQA 3ENVA 2OV8A 2ZJ1A 2IOHA 3HN7A 4P22A 1OXSC 4TMYA 2VTKA 5D3KA 1I10A 1HK7A 2GAFA 2OP1A 3G7UA 4CN9A 1XSEA 5BR4A 2Z4SA 3QKIA 4HD8A 4Y2SA 3VAYA 4X8OA 1I3OA 4XYMA 2XUHA 3VU9A 5JNVA 2XUDA 3FY4A 1JHRA 3AFGA 1XDDA 4EYSA 1FQJA 1NVUQ 4OMCA 1E66A 1CF2O 3HB0A 5DE3A 4YV1A 4BFCA 4Z4IA 2IEIA 3L7JA 4MB2A 4BRZA 2O7SA 4W8HA 4QG7A 1CRWG 5D87A 3ZH9B 1C7EA 3EZNA 4UNIA 1UXHA 2BZGA 2EKDA 3R4VA 4XWAA 2IW3A 4DUZB 5FWNA 1Z0ZA 2RB5A 3GT0A 1I13A 3T9EA 1F9AA 4J4HA 1SC4A 1G7TA 3K4PA 5IJZA 1U9ZA 2OTCA 5SY6A 1BFDA 2VZ8A 2WYWA 4YNBA 1P1RA 2C5GA 2ZDGA 4CM8B 3UKJA 2C83A 1JPUA 1K2VN 2PKQO 1UMCA 3EUEA 3TLYA 2FE4A 4U0KA 1GSAA 4C88A 3R7LA 1OXTA 3BWYA 3O92A 1T25A 2L42A 3O8RA 1ZM3A 3EBOA 5C8ZA 3I9V1 1KXZA 3ROXA 1UPFA 2AR7A 4A5SA 1NMSA 5JR3A 2HA3A 2C7QA 3IR5A 3B6KA 3D64A 4K9RA 3JARA 1BN7A 1S8OA 3BXGA 2HTFA 2QX7A 2VAWA 2VH1A 4A92A 5M29A 3BRWD 5KAPA 4IJUA 4YP6A 2W6ID 4I1OA 2FCAA 2FPIB 3OX1A 4IEIA 2O2ZA 4HLUA 3ESCA 4DBVO 4EGAA 1OGIA 1CG6A 2W4IA 4GU5A 3PXEA 3HUDA 1SBTA 4RV5A 1JAXA 2RIRA 3TNDA 3NM6B 1UPBA 1V7ZA 5F3DA 4FW8A 3H87A 4KR7A 2K2QB 5C7YA 5IWAB 4PO8A 1E60A 2AVNA 2HA4A 2GJAA 5IKPA 4OBXA 4GLJA 3ZY5A 2QTLA 4HXGA 1JAIA 1CY8A 1JQ3A 2KM1A 2JIZD 2ZTLA 4YO7A 3WV4A 5JFGA 5K45A 4F92B 1HNNA 2ABWA 1PLLA 3QVLA 2M6LA 1X7WA 4GZMA 2PMCA 4CCSA 4IF4A 5IMBA 2IUEA 3U1BA 3EC2A 1FNBA 1S1CA 4X92A 5HEKA 2ERYA 3KQUA 2N1MA 4XLTA 3B1KA 3HB5X 1S02A 2FOXA 1ZUHA 1XRNA 1YI8A 2PS1A 2ZW9A 4M89A 4WHMA 4F2WA 1DX4A 5H70A 3F71A 3MGGA 4E3WA 3HDTA 4QUDA 4EIWA 4FE4A 5J1TB 2NU8A 5LQRA 3LKZA 5ALZA 1PEAA 2FDCA 4ZMBA 1E6MA 4G8DA 5FCDA 5P8WA 2ANBA 4NMHA 3RVLA 4MZDA 1Z2DA 3WGMA 3GRCA 1GTMA 1S2OA 1TC2A 3D5QA 4IHQA 4JSRA 1CY7A 2JVJA 5B2ZA 3GRKA 1M0TA 4NK4A 1LDYA 5T8KC 4NARA 3DL7A 1JUDA 3RYTC 1GT6A 2JJ1A 4O0MA 2P11A 2F1OA 3RNLA 3N59A 1J25A 1TT7A 3R6DA 4UFOA 3Q3HA 2WOJA 3KELA 1KY4A 1AKUA 4G4SO 4L9AA 3UMMA 3H4VA 2Q5CA 3NPMA 4HXEB 5DYWA 2JLWA 3J81k 3NBQA 3RHTA 2IUSA 3RT1A 4KLAA 3ZS9A 4LXGA 2XEDA 2ZRJA 4RVFA 1AZTA 1REQA 5SYMA 3ZQ4A 2ZM6B 2JH3A 4E1BA 5KX5A 5EIAA 4DLAA 1YQDA 4GKAA 3W5CA 2ZS8A 5E6RB 3QSYA 3ZWDA 3H97A 2A9KA 3H19A 4PCUA 4G1EB 1U7WA 4RKRA 4POOA 4ZOBA 1N3BA 1P61B 2PLFA 3ZVMA 4NBWA 3CTMA 3AU8A 1F8YA 3E81A 3HN2A 4BO6A 3MINA 5HXAA 2C4MA 3I0ZA 4CMGA 3M2TA 4KO1S 3WL5A 2YRFA 1P62B 3LLVA 1DVRA 1FTWA 3JD4A 2VHEA 2BEVB 1EUYA 2UZIR 5DGHA 3TLGA 2NAFA 5BP7A 2FI1A 4YB8A 5KDOA 3ADBA 1O87A 1JVSA 4ZAWA 4CTNA 3O4FA 5FQOA 2I6XA 3EDQA 4HBGA 1KS2A 4K2HA 3UUWA 2PUEA 4IJ5A 3I42A 3JV7A 2XNDD 1LSJA 3L1IA 4Z7NB 5GPBA 1GNRA 3RRBA 1K8YB 2BI4A 3SBOA 3H6HA 3LVFO 4QPZA 2ZRNA 3S2GA 4JQZA 2AN9A 3ISVA 4CWAA 1M2VA 3W5SA 4BECA 1Y1SA 1J2EA 5E9WA 1VPDA 3CB2A 5HF8A 1ZEJA 5KNLA 4ZTZB 1W5BA 1Z2CA 2NWQA 4ZT5A 3UK1A 1VQ1A 2O2HA 5MGBA 1EFHA 2UZ3A 1QP0A 1C1DB 3SXUA 4IQ0A 5FH9A 1AUPA 1A88A 4OQXA 1YMQA 1E1RD 1HKHA 1CFZA 3IE0A 4O25A 1VDZA 4DIMA 1EA5A 1TZJA 3WKEA 4KMRA 1RBMA 4IJ6A 3RIXA 4IUBS 3I9NA 4JLWA 2GCGA 2ODAA 2AEFA 3W0LB 3WV5A 3NPAA 4G1BA 1P5JA 1QZUA 2D0DA 3CH6A 3ZWPA 5JSQA 2A7XA 1V4NA 3GEHA 4ZXFA 3OU6A 3NUZA 5EHGA 5A0TA 4MR9A 3LX5A 3HSKA 3ILXA 1P0PA 4Q4CA 3DMRA 2NU7A 4BV3A 4P9NA 2WD7A 4YQYA 1QQ5A 3E0QA 4P4SB 3R6LA 4B3IA 2PNFA 1JDUA 3K72B 1C9KA 3TNFA 5EQFA 4NOJA 3LPDA 2H1VA 2AKEA 5DNCA 2J0EA 3ZBTA 5JZSA 4P1ZA 1B93A 4RXTA 4ZAVA 1N2BA 2DWUA 2FN8A 4BVAA 4BCDA 2GHIA 5IFKA 1MX9A 3U39A 1M6YA 2Y4NA 2X9VA 1B6SA 4GEGA 2BEWA 4H31A 4Y6SA 5EE3A 1J9GA 1N2CB 3RK0A 4E51A 2HC9A 4LIPD 4O2BA 4C08A 3QQPA 4DNOA 1NW8A 2ZAGA 4G1MB 3TIVA 3I72A 4MWCA 4PC1A 4IPTA 3KVRA 1CJUC 3RU2A 1TU3A 3W1EA 4EENA 1N8NA 5F4BA 3F5DA 2ZKIA 3AXTA 2SCUA 4TZ6A 4WY8A 1S7GA 3VPDA 2Q9CA 2R1ZA 3T7KA 3W4JA 2CLOB 2VUHB 1MXHA 2OBLA 3HFSA 2JFYA 1DI0A 2JIOA 3NHMA 2A5FA 3B1JA 4KO4S 2YASA 2Z98A 3OM1A 3V7FA 3T38A 4AURA 1I8TA 2ZROA 3RIGA 1AXGA 1YACA 1JJVA 3TL2A 3C4JA 4B40A 1O95C 2FEAA 4QXQA 1ZHHA 2EQBA 2RHHA 4L16A 4IH4A 4IOLA 5JYEA 3JQPA 4UE2A 2B5WA 2GETA 3N2GA 4DAEA 4E6EA 1MGPA 3EC7A 3PTAA 2C07A 1NP6A 1D1QA 2I8AA 1GV1A 2VDWB 3D8RA 3EMVA 3HA5A 4IZOA 1QYDA 2HQRA 1T15A 4AB1A 4W5RA 1YCFA 3L06A 2PPVA 3IUEA 5ES3A 5KYXA 4DQ0A 2BFCB 5DFAA 3RYHB 2PFGA 3H6GA 3VYWA 2Z2JA 5EZSA 4PHFA 2Z6QA 4HB0A 3FROA 4EARA 2R6CA 4HAVA 3VOAA 1QLWA 4FIZA 3PFIA 1PTJC 1AT1A 1K5DA 5CTAA 3FFTA 3F9RA 3LBFA 5KINB 4U2GA 1U5CA 4K0RA 1IL0A 1E2HA 2YXPX 2O0JA 3AY3A 4M1KA 2CLKB 2DQ4A 5EFZA 1IY2A 3CLTD 3GWGA 1MAAA 3CJRA 3P2IA 5BSEA 4M76B 2IRWA 1D03A 3NYIA 4QYWA 2MOKA 1Y89A 3HY4A 3KJEA 1Z83A 5ISMA 4OBBA 4C7XA 2ORWA 1Q0QA 2NSYA 2EZ4A 1C4KA 1LPPA 1VG8A 4JLVA 4MYUA 3KTAB 2YDYA 1L8XA 2OEPA 3JVDA 5IDQA 1G3UA 3RAFC 4DQXA 3EIEA 1QX4A 1VYUA 4OHFA 5FORA 3I32A 3DFKA 5JQGA 4AJHA 3E58A 4JC8A 3CNOA 5K01A 2N9UA 5BSKA 1AF4A 1CE8B 2Q6TA 1TQ8A 3DQPA 5IH3A 1OFGA 3PQ7A 4EB3A 3UW1A 4PO9A 1J33A 4GBED 4U7FA 4DLVA 3RYCB 3L4JA 2UZAA 4WCFB 4CM8A 3OIDA 1WDMA 4GKVA 5K0NA 4Q3AA 3AL2A 1TVKA 2Q3DA 2WTAA 4LDQA 4G4GA 1WZCA 4FS8A 5BN3A 1OAKA 1W87A 2QUKA 4JUDX 5CFOA 3KT0A 1T0UA 2A0WA 3AT1A 2IYWA 2JKYA 4E0BA 3OQVA 5I7AA 1LI4A 2R87A 3PFFA 4E6PA 4YRAA 1RACA 2POQX 1XNRB 3DXFA 4EW2A 3EW7A 1SG9A 2VHUA 1KJZA 1ZCAA 3I9V6 3SBDA 3CPEA 4MJ3A 3VTFA 3HDJA 1EBFA 3CUTA 3B20A 4I9NA 5KYTA 3WNVA 3WYGA 1V5WA 3WB0A 4TXMA 1MOPA 1YVDA 3SVZA 4BMYA 2OK7A 2XAUA 4Y0NA 3HEAA 2FVYA 4RZIA 1MB4A 4HLUC 1Z0SA 1X80A 3URMA 3VR4H 4J0DA 4YVFA 3R5TA 3OKPA 4IOMA 1UC8A 3N39C 4IV8A 1XB2A 1BCRA 1TT5B 1CIVA 4G6ZA 1NULA 3ANYB 3DOEA 3Q0EA 3BVPA 4GH5A 5HUJA 3IBTA 2V5AA 3WL3A 1MJGM 1UOQA 3L92A 5JMPA 4AZ0B 4DFDA 2HHLA 4ML3A 1U94A 4FSXA 5LL6P 3Q88A 1RZVA 3H1FA 4NOKA 4F9TA 2HT1A 2IHJA 2ZBPA 1WPQA 4G65A 3S2YA 2CKMA 4E94A 3JVIA 3NHFA 4MUAA 5DMHA 2CD7A 1GG9A 2XLCA 3ZQJA 1WMBA 4X6XA 2GDJA 3GXBA 4BLQA 3C3BA 4MS3B 2AW5A 3HK2A 3DT8A 4H9GA 4AL4A 2P30A 3H8WA 3HYRA 5C8DA 3VHQA 3W5AA 2JAOA 1J22A 1OI7A 4IKEA 2WSLA 2ZSIA 1QV6A 2FF7A 2FR8C 3KTOA 3OO0A 2OSBA 4MGKR 5BNFA 5KUTA 2DR2A 1JDJA 2J31A 1R9JA 2Y92A 3EULA 3IEPA 4PTYA 2BEUB 2ZAIA 2CFSA 1KDPA 1OBVA 2ZR7A 4DUGD 1PJRA 3AEXA 4PHGA 5FOXA 3AIIA 3E8XA 1FVOA 5K99A 3RYIA 3OHMA 4Q01A 1GLVA 3COSA 3ZNNA 3VM6A 1FFBA 3PIIA 1E5QA 1ZBDA 4J1QA 2AL7A 3S1LA 2I3ZA 5EHZA 2CXRA 1DQRA 1C7FA 1WV1A 3U40A 4B9EA 4RYDA 2E4ZA 5DBFA 5FB3A 2X42A 1M2WA 1P74A 4IDGA 5DBGA 4I1UA 4LGVA 2JLQA 3SDBA 1XHLA 1GFIA 4MP6A 3O1IC 3H18A 3HRHA 1IUKA 2IIVA 1D2NA 2GYYA 4ARCA 3K1YA 1X70A 1ZXXA 2RHWA 3EOBI 1X3SA 1N6LA 2HJHA 3WLEA 3VPAA 3HJTA 4TLMB 4L2IA 1OPXA 1E79A 2XB8A 3RUHA 4DDWA 1CIPA 4UHKA 3GMSA 2R7LA 1ZUNB 2YMPA 4GX5A 1IUNA 2Z1NA 1QOPB 2JCGA 1E3LA 1ONOA 2VNHA 3OAAD 1YB4A 4YJ3A 2RK3A 3RS8A 3SZLA 3SZMA 4D9JA 3K0AA 3LY8A 1RQGA 4KHZA 1QK3A 4MI6A 1JIQA 4NBLA 2VNAA 5ICEA 2XKKA 1EFRA 3IQEA 3TM5A 1ULTA 5K9ZA 1OOEA 4I9FA 3SHFA 4Q00A 3P5SA 1KP9A 4QNNA 1E79D 4ENWA 3WGLA 4DANA 3RAGA 4YRNA 4ZT4A 1SOAA 2GPYA 2GRAA 3GLKA 3BXXA 4ZANA 1R8JA 3HS3A 1LJ8A 1V47A 3VVCA 4GECA 1NSYA 2A7QA 1FYXA 3TLBA 4OP1A 2GZ3A 2R8PA 3DBHA 3IAS6 1W46A 4ZT2A 1E3EA 3A3OA 3PHJA 4KSYA 4MNTA 4ASUA 2RGCA 3X3HA 4GPIB 2VH5R 1Z6ZA 3F9CA 5CH8A 1C9EA 3OX2A 2FSHA 1CSEE 3CLHA 1WO8A 1FS4A 2HI0A 3SWWA 5J5VA 3P2OA 3C5WP 3HCBA 3MWGA 3O1JC 1QDEA 4DE5A 1H85A 3IEUA 2GZ1A 3JASB 1I1NA 3ZCQA 3CF4G 1IRXA 2EZUA 4JX8A 4KTTE 2ZTUA 3DKRA 5HQ3B 4Z4QA 2M6SA 2ZRDA 3NTQA 3NNDA 1DRUA 2E4YA 3K1JA 5HHTA 1OIXA 3WGQA 4G5SA 1WXQA 4FR0A 4E2YA 4ZDKA 2XEXA 2XH8A 1VLQA 3HJUA 3PT9A 5ALGA 2KPOA 4FEAA 5B6JA 5BWOA 4ZK6A 4OBEA 1SVOA 2V7GA 2A94A 2GSDA 1KK1A 4MRSA 4TL9A 4AJ2A 1GPNA 2Q2OA 2ZEJA 1BXGB 4NQZA 3ZIAA 2RJOA 3L7OA 4JVSB 3B12A 1NZJA 1A1VA 3KALA 1OYVA 2ZYAA 5HUHA 4IDAA 5AHKA 4CF5A 4KUEA 3L8HA 4CGYA 4EJSA 1C9NA 1SXGA 2D13A 2QI9C 2XDQA 1NT4A 5E3HA 4RTJA 4MCHA 5E2BA 4YA6A 5F9MA 2ZBDA 3NM5A 1ML4A 1DC3A 3ZN2A 3PQ5A 4M87A 2IUTA 3ER9A 3SEAA 5CHEA 2W11A 2CMHA 5CH5A 3A8TA 4BNFA 5FBHA 1PJCA 1BWPA 3PD0A 3JQ7B 4OU5A 5KCMA 4DDVA 4QHTA 3L77A 1RWBA 4F8JA 3PD1A 2WQ7A 3ZGNA 5JD6A 4R1SA 4B76A 3K6SB 1G0OA 1Y34E 2CLFB 1OWPA 4IIDA 3PGLA 3TWOA 3G5AA 1KQGA 1INLA 3ZHBA 3N70A 3C48A 5FEMA 5A1TA 1YA4A 1RYFA 2OD2A 1B8NA 3HA3A 3UHFA 1E3WB 3D6JA 4LJ4A 5CDFE 2ZJAA 2TRSB 4MCIA 1WEHA 2WTBA 4WK2B 1LRKA 4YRIA 3QWBA 1Z25A 3CE6A 5AKHA 1OH5A 1QUFA 1GCIA 1AHHA 1SMKA 1LNZA 1R6VA 1UOOA 3ASUA 3FLEA 4DLZA 3IXMA 4ZFNA 3LTEA 5B53A 4FGKA 2MTBA 5ICCA 2BONA 2AF4C 4R9NA 2XA2A 3LSYA 1Z7BA 2ZR9A 5TQ0A 2UVPA 4Q4AB 3LTNC 4JR1A 4S0XA 1Y3AA 3TE6A 2Q4RA 5TIIA 3M83A 5TMBA 2YDXA 5JVDA 2IU4A 4UJ3A 5H83A 1DC7A 3OETA 2EW8A 5I9MA 4ICIA 2QM3A 2ZSUA 1U2TA 3G9ZA 3PITA 1O0BA 4PRKA 2AKAB 3T3PB 5M7EA 2D7DA 1ZU5A 1FFEA 1HTBA 4X45A 4QVKA 1JZQA 2QZPA 3HVIA 3HNRA 4RJIA 3KQTA 4LZZA 2PANA 2H8KA 1W52X 5KJCA 4G86A 2WEKA 1MNAA 4FZVA 2OT3B 3DMDA 4WLEA 4FE7A 3CLTC 3UHAA 2GAIA 3MUFA 3IHLA 3EFOA 1U5BB 1ZIDA 1KI7A 2BGUA 1XALA 2F9FA 3WYNA 4ESHA 2ZYVX 3MC1A 1VKOA 3L0YA 4MPJA 5C46F 4RK4A 5A6SB 1GNPA 1PGQA 2W2TA 3K94A 1TTTA 2V6MA 4Q9NA 1KIFA 1MD9A 3NZEA 3GLFE 1J07A 3KG2A 2HZBA 4U9IS 1ULUA 1IYZA 4MRMB 5FLEX 4DM7A 4HP8A 2A9RA 2Y71A 1QH1A 3EVEA 1VG0B 5FI1B 1N77A 2QN7A 1CUAA 1E3TA 3SYLA 1DDIA 4CNQA 1JS1X 1JDZA 2C00A 4F38A 1FDOA 2YUTA 4J1SA 3TVTA 4EKYA 3WRXC 3JYNA 3UZUA 1ISGA 1JR3D 4U9UA 3AERA 1F06A 1ZOSA 3JPWA 2GA9A 3MM4A 4NH4A 2OBYA 2JIQA 1MQSA 1T2CA 5K8CA 4HTFA 4GDFA 3N0WA 4B8WA 1WY7A 2AZDA 4ZU1X 2WW8A 3H5LA 3UUEA 1F48A 1MIOA 1XAHA 1NBWB 3M7IA 3ZCPA 5FPKA 5IK2A 1T4DA 1NXPA 4ZVRA 1P0QA 4U5XA 2PJUA 4OFBA 5CEEA 3VR2A 2V58A 4ND6A 3KB1A 1TUIA 3N75A 1YZKA 2B9EA 3H5AA 3O2QB 3JAWA 5K0FA 5EP2A 4HCJA 1JFRA 2B4QA 4PFJA 2XE6A 3SP1A 4EVQA 2ICAA 1TAQA 1LK5A 1K4KA 1MB3A 2WHXA 2A5GA 3O8OA 3G0GA 4HWRA 2GLTA 3JW8A 1E7WA 4KYUA 3CVJA 3HCEA 2EBFX 2C95A 2WT9A 1RI4A 1RU3A 3B38A 2PX2A 3KKOA 3PHBE 4N7JA 2IP1A 3L40A 3QVOA 2O1EA 4PG8A 1FMCA 1LK0A 4ND8A 4UTPA 4FMDF 4RFSA 5JJIA 3CLKA 421PA 3FN4A 3HFGA 3WK4A 1VPVA 2GPTA 3MLBA 3T9DA 2EJUA 2PY6A 4ECAA 3TKYA 3JD3A 5ELXA 4XUDA 1Z37A 1BHO1 2AFIA 1OBCA 4G0PA 4MUXA 3V7UA 4B4DA 1FNMA 1U2QA 3KEQA 3ZZUA 3EXG2 3KWLA 4C3UA 5BRJA 4ZICA 5DHFA 2VRNA 3ONDA 1BE1A 2OLJA 2ZP1A 4HC4A 1VJCA 3QG1A 4P7KA 3REFA 4F7WA 4PAOA 3PXBA 1M6VB 5CVDA 3EVBA 3PUJA 1GZHB 2XWPA 1GCUA 4GZ6A 1BD4A 5ALYA 1CRQA 1KYQA 1G5FA 4NBSA 3SJZA 3QU5A 3CH4B 2H2AA 2R6DA 4H1TA 1LJUA 1PZEA 1P80A 4PTZA 5HF6A 2VYNA 2Q5FA 3KV1A 4JQYA 1Z9BA 1GRRA 3FKSA 2QL6A 3ZD6A 2P2LA 4OQYA 4XIYA 4RESA 1NAHA 2NXEA 1UKBA 1D2EA 1LDEA 1E2KA 1K9SA 1T3ZA 2QD2A 3QLUA 5F1OA 5KYUB 4F93B 5EJ5A 1HE1C 4A2CA 3IP8A 3HP1A 2DF8A 2I6TA 1TKRA 4UQLA 1FCJA 2Z2XA 4R2LA 4A26A 5JNRA 1GXSB 2I4IA 2PGLA 4C5CA 3ILHA 4R3UC 3IUQA 1PVOA 1GQQA 2J6BA 1BEEA 2QT0A 5KKAA 1NUSA 3RJ5A 5FR1A 4EHFA 2CD9A 3CH7A 3H7IA 1CY1A 4QPJC 3S1AB 3VNRA 2EP5A 4M8SA 5SZHB 3LCVB 4NXMB 5FKJA 1CYEA 1H1LA 3B8HA 3SPXA 3VDMA 3W2IA 2IX3A 2X7HA 3JALA 4C3VA 2WU8A 4WAUA 5DX1A 4ZHQB 1R4NA 4I5EA 1CUSA 1EBUA 3NHRA 5CXQA 3PSHA 1EBBA 1EWKA 1XDWA 1PYOA 4IX1A 4RBNA 4IHKA 1KC1A 4Y2GA 1KOLA 1YXMA 5L3SA 2J5RA 5D7BA 3ICPA 4BNNA 2AJDA 3DGEC 4OYLA 2I9KA 1C4OA 1Z17A 1R0XA 1M34A 1U3FA 3TR5A 2C9ZA 3PI7A 3D6TB 3BD6A 1YR9A 3P8ZA 4H7DA 4C7KA 3BGVA 1FLDA 1Z0IA 1FFDA 1Z6PA 3V1NA 1WSWA 3D0QA 3C74A 5LDDC 2ASEA 4CI0B 4YN3A 2H29A 1TEVA 1RAHA 1L5HA 3SQWA 2VJLA 1T1IA 4PYKA 2WK1A 5AW1A 3H8SA 2CE7A 3A7EA 3M4YA 4RABA 1DRVA 2ZJFA 4JBGA 3W1VA 3ZBUA 4D9GA 2D5LA 1ATZA 3L18A 4REQA 3PUWA 3C1UA 4C7OB 2O1SA 3UXEA 2OYSA 1YZQA 2NLOA 1HA3A 2OHHA 3UIEA 1C9MA 4FQ7A 3OEHA 2ZFUA 3VNAA 2G1UA 3AIOA 4ZEWA 1E94E 1N2IA 3O26A 2QRMA 1ENZA 1D2AA 1RLUA 2UU9B 1OLOA 1TMKA 2HUNA 4RMIA 3P1JA 4UEJA 2YXBA 5C0OE 4ZQFA 2HQOA 4YUWA 1TM3E 2AC2A 3DR5A 3SHTA 3WRYC 2NIPA 5IC4A 2MR5A 3BMOA 5F5NA 4JJAA 1HRDA 4G3XA 3A4MA 1I5OA 3TCXB 1Z5PA 821PA 1GHTA 2BSAA 3BM5A 3GYGA 1X74A 2YRWA 4RF4A 3OTOB 4WSOA 1GCAA 2BHNA 3N6RA 4HDKA 4N0QA 5KQMA 1N5RA 5EHXA 2I67A 1I7SB 3GEBA 1NXQA 2PZLA 2VK4A 3A27A 5I8ZA 1YK1A 3E7FA 5T3UA 5JCXA 2W2MA 4IO1A 5HR5A 3ZDAA 2IIBA 1DO0A 1MJNA 1O96A 1SHJA 2M1XA 2PGNA 4FNMA 3FGPA 4GI3A 1G1AA 1SULA 1DE0A 1V6CA 3TQOA 5JSZA 3PF8A 5HIMA 3RAEC 2PSHA 4XTCS 3DP9A 4WKPA 1XTKA 3CC8A 3LNTA 1RYDA 3Q8XB 5JD3A 4X20B 2IZOA 5DCLA 2IU0A 4F7DA 4S05A 3RE1A 3O8BA 1PD1A 1ZJYA 2HMSA 1II0A 1KFCB 2FUG6 3MAAC 4CL2A 5HTKA 1P2DA 5A05A 4GZ3A 2CVPA 3DBOB 1CEXA 2DHQA 3G6KA 4NX2A 4EA7A 4B31A 2F59A 3ZV4A 2CMKA 4MUJA 4HX9A 4LSGA 4BNVA 1NQWA 4A10A 5AHRA 2WJ4A 4B45A 4NMWA 5KO2A 4B1FA 1DJPA 1C29B 3PTLA 1BDHA 1H8ED 4Z7OB 3AB3A 4ZYVA 5KOYA 1KRXA 2C2ZA 2I5PO 2OAQ1 2Y1FA 2NV0A 2PUCA 5TT0A 5I01A 2J3LA 1Z4KA 2ATVA 4GEKA 1O6CA 3PLRA 4R8RA 2A1TS 2AXPA 3OY7A 3LQYA 1NTRA 5AQEA 2LIVA 2RH5A 3ILSA 2XCSB 3BSYA 4BWFB 1TFRA 3QA3E 4S24A 2WM8A 3LFHA 5BSMA 2FW0A 1H6AA 1R0RE 1NN0A 1NDHA 2PCLA 2XHEA 5JLJA 3O95A 2IIQA 4FI3C 4OOEA 1RJ9A 3WZ2A 4FZRA 1ZN9A 1XVIA 2QTCA 4IZHA 4N0PA 1KDTA 1D9ZA 1QP8A 3BFPA 1Q74A 2P5TB 2WFAA 3FTNA 5IYZB 2GD6A 1QORA 2FSFA 2LCIA 3N7AA 3OMLA 5AKLA 3RYFA 4AJIA 1Z4QA 1H2WA 1NZDA 2XQVA 4OL9A 3GX1A 3PG5A 3K0KA 1X8XA 4O29A 3CWZA 4XM0A 3VZDA 1WBJB 4XASA 1CB0A 1EE1A 2GBLC 2IEAA 3E1GA 4IH1A 3EA0A 3OD5A 1NN3A 2IOYA 1PVDA 2R62A 2ZATA 5LYYA 4JASB 3BEOA 2NUAA 4Q6WA 1T5TA 5EKTA 1YZGA 2BP7A 2PIDA 4KXUA 121PA 4KQHA 1YBFA 2J6IA 3CUWA 2WAMA 5KQSA 3H5VA 2X0IA 5D5HA 4DL9A 5C5EA 3AVVA 2ZI6A 3RSCA 4MRMA 2VP4A 4QM6A 3W1WA 4LPKA 3HXTA 3GCXA 5KAMA 5CBPB 5ADVA 4NE9A 4WBXC 4YJFB 2AFHB 1B14A 4DSAA 3R8FA 4KE9A 3N6XA 2ADMA 2NZVG 1I1OA 1DARA 2E18A 2JHAA 1XU4A 3HRKA 1R50A 5ALTA 3IODA 5GINE 5A4AA 1X92A 2F43B 5FNVA 3G2PA 4OH7A 4F8YA 1HFWA 2EX0A 1M8JA 3H2ZA 2YNMC 4HTFB 3WLIA 2CVQA 3HBAA 3DOCA 4IMRA 3AVWA 1ZNXA 4JLKA 4FGWA 1FPQA 4WBNA 1XP5A 1FP4A 1S6YA 3THWB 3Q11A 5T4HA 1PT6A 5BMVF 4ACAA 3FF4A 2Q4BA 1U3CA 4QOHA 4NV0A 1ZIYA 4DIBA 3WB2A 1HT2E 2D3TA 3CA8A 2AOUA 5LLTA 3P32A 4MVJG 2ZYDA 2CLMB 2FN9A 3B6ZA 2JLZA 4JJIA 4Z49A 2J3JA 4TWBA 1EGHA 2QTBA 4YP9A 4Z3DA 4G2TA 1JR2A 3BH0A 1CLUA 1OVMA 5KC8A 4BFVA 4HNSA 4ZVTA 1IC6A 4HR7A 4KLNA 1QQBA 4A0HA 4BP1A 2XTMA 1JJBA 1LWOA 3OBBA 1PWYE 3NIBA 3HL4A 2NQ8A 4GKBA 3C7AA 3IHKA 1SXJB 2WJJA 2W4MA 3AV3A 1EXNA 3AM4A 1K63A 3FMIA 2RARA 3SR0A 1HT0A 1QRRA 1Z2AA 2OB2A 3D4LA 5J5CA 1AQNA 1DJNA 1A9PA 4GP6A 4TUYB 5AVSA 3R5XA 3BGSA 1E69A 2X1HA 1SGWA 3AM1A 1DHRA 2OO5A 2EJCA 3L0DA 1WKCA 1FXSA 2RH8A 4L85A 1XPUA 3RT7A 2CFTA 1E4YA 4LVNA 4E1AA 1JYSA 4D9BA 2J9GA 4UOEA 4KFTA 3RRZA 2NQ2C 5AM5A 3OCUA 3CNBA 1L4BA 1PYDA 4OHYA 4ZAGA 3DHNA 4IXDA 2A8YA 3UJPA 5HNKA 2Y0EA 3LQ1A 4JIMA 1DT5A 1T3GA 4IJWA 5FA6A 5KCZA 5DHSA 1ADFA 1Q50A 3CISA 4M88A 4NJEB 3C8MA 1MRNA 3JQEA 3P9XA 3K0BA 4ZVSA 1FDTA 4J16C 1K7SN 1PZGA 1JU9A 1IOVA 4O1MA 4UZEA 5DT9A 2CMDA 3U17A 5MGNA 3MFQA 2FEOA 4AMYA 1SEVA 3TOVA 2Q3FA 4DC9A 3BB3A 2OCPA 4DJJA 4BQQA 5B30A 4B82A 1QZZA 1C3OA 4HEA1 4B3GA 1PN3A 3FPLA 1BU8A 1PBTA 2J3MA 1EFDN 1RWKA 4AMZA 2F8LA 3U5TA 2TMDA 3EEQA 3LVQE 2QN6A 1L8AA 1DTWB 5EHIA 4TPKA 5K8JB 1GKLA 4KOEC 1GPWB 2VIIA 1O54A 2JLRA 4CKWA 4YFVA 2H4HA 4ARAA 1WP9A 1PJ2A 4JY7A 4D9CA 2DEUA 3ELBA 3O4GA 3MWYW 2FEPA 1F1JA 4M1EA 1SVWA 4GYWA 1LEHA 1Y5IA 1ZMBA 4KQJA 4C0XA 3A6KA 2Z9CA 5KB3A 5DW3A 1QIKA 3BL8A 5IKXA 2NSJA 3VXKA 1ZMXA 1IJKA 4QOJA 1CNFA 3SYMA 1U8ZA 2IYSA 4LBZA 4J0IA 3UO8B 2YOHA 3ZQ6A 4K0KB 3PFWO 2FSGA 2XUOA 2C42A 2P1DA 3B2NA 3ROMA 1NVVQ 1O9HA 2ZU6A 2LKCA 3DAGA 4JDUA 3TR6A 4D79A 5L3SB 4P5EA 4F3RA 2GUGA 5ETJA 3H4TA 3OTQA 4LOLA 3SKXA 5DHRA 4G4JA 3X1WA 1SVIA 1G2PA 3I0NA 1DXYA 1U98A 1CY4A 1TM2A 3AG5A 3I53A 4NK5A 1ULSA 3SM3A 1EGAA 1DCMA 2PWBA 2QAGC 2GEVA 3K2EA 3TRFA 2OOKA 5E4FA 3WJAA 1LW6E 4MAFA 1PZXA 4OG2A 4XWGA 4JBIA 2ZR8A 4O63O 2CNBA 3VKFA 1HDGO 1DBRA 3JWPA 3TW8B 1SIUA 1N4DA 3F2IA 2VZEA 4C7JA 1O97D 4EVIA 5FTJA 1Y9EA 3SF8A 2Q27A 2EKQA 4CLEA 2DPGA 3X1ZA 1PV4A 2DH5A 1UXGA 1Z0DA 1RP1A 1OLXB 4TSFD 5FADA 3B2EA 3EGXA 1RZRA 4E5PA 1Z63A 3WKAA 4JI0B 2FFBA 5CVVA 4P86A 3UA3A 2Z8ZA 5I7EA 2HW8A 4FYIA 1AK9A 2EFEB 4HEJA 3GLGA 4ILKA 2QV7A 5D00A 2PGXA 1J5EB 5KTTA 1AKTA 2IYFA 3NBKA 3LPCA 4XFKA 2XV1A 4YO8A 1F14A 1GOTA 1M2NA 2FSVA 4YRQA 3RM3A 5FI0B 4D4HA 3EWSA 3IT0A 4MW0A 2MSWA 4RDIA 5EVCA 5FFNA 2IXGA 3BKWA 1XZGA 1PUXA 3A6HA 2OP0A 2ROQA 3IB3A 2HIAA 3M4ZA 2BAGA 4HWSA 2HA5A 4OHUA 2H7XA 3O73A 5B1YA 3DXZA 3Q9UA 5NULA 1TXGA 3E8SA 1YGPA 3OOSA 3IESA 1ODJA 1AS0A 4NYIR 1H8EA 4G9EA 1WETA 2GI4A 4HQOA 2VBFA 3DC2A 3FMPB 4FMBB 4HQ6A 1DFGA 1V26A 1I01A 3I2YX 1T0PA 3TLJA 4DCCA 3G49A 2ZANA 3WWDA 1AN0A 2WVGA 1IN6A 1AMOA 1W36C 5TNXA 5HOEA 3PEWA 3ELDA 5G02A 1YAHA 1WHTB 3UJCA 1D0SA 1Y42X 1BXKA 2FAXA 1YR8A 2Z04A 3MF4A 3RUAA 1IFXA 6ADHA 2I66A 5AKGA 1O8BA 4NU5A 3NRBA 4BMZA 1E7RA 1UBLS 2QAGB 1QGUA 2A9PA 3PC8C 2XQIA 3AHCA 3I09A 4G5HA 3WISA 4HYEA 4ZI2A 4KXLA 1GPJA 3ODPA 4XQ9A 3E9NA 3MBOA 2E5LB 4JI4B 4JLPA 1J99A 3FIUA 4D4LA 4MICA 2BD0A 1C7ZA 1A2OA 4BMNA 4JJGA 1UMKA 1RPTA 1L5QA 1R8QA 3FLBA 3K0CC 1JBKA 4JT8A 4TRRA 5JIBA 5INTA 1WW3A 4M8NE 2ZIFA 1CQPA 1JL3A 1O0SA 3IQXA 2J08A 3DHEA 4I9GA 2PFSA 1SUPA 4PG5A 3ZHRA 2O8DA 4CFYA 7REQA 3OY2A 5HDBB 5IT4A 3PX7A 2VCHA 3IKVA 2WB4A 4TVSA 3KSDO 1HO3A 3OZFA 4I55A 4RD2A 2QM7A 1ZPDA 5LA6B 1AH2A 1V41E 4OXYA 1EFPB 1W94A 3CMMA 5CIQA 1D7OA 2FB9A 4Z4EA 2QZ4A 5JE8A 3C1OA 3OPNA 3PVCA 1JR3E 2VP3A 3PWTA 2ISSD 3T7SA 3KJXA 1BQ4A 1JWBB 1ZHFA 2NXWA 4IFTA 3ER8A 2G0TA 4IHJA 2ZTHA 1QGAA 1SBNE 4I55F 3G68A 1NVBA 3E61A 4ED9A 4GSLA 1UT6A 1EHCA 5E6SA 3RHFA 1KMCA 4V3CA 1C8LA 1T1RA 1T5OA 4F5YA 4GFDA 2C4VA 2QM0A 1AMNA 4H7PA 3B3FA 1G20A 2CUTA 3IAHA 4V24A 3H0KA 3SQNA 4KKXB 2IDJA 3NUGA 5TR9A 4BQRA 721PA 2YZKA 1LPAB 1GARA 1V11B 1XRPA 2D4AA 1HYHA 1TB4A 4PAWA 2OFXA 1OTYA 5CITA 1RWWA 2XYQA 2OHGA 4RKQA 1MAUA 2IXTA 3R7NA 8LDHA 3F46A 3ANTA 4F8EA 2AOTB 2ACWA 2J1LA 4ZOQI 4HYTA 1CKEA 3MJHA 3PPWA 2QBYA 3F78A 2RGAA 4MMXB 2W6PA 1QH8B 4OTZA 4JXZA 1Q0SA 4IKPA 4N76A 1UDBA 4M8IA 1ORVA 4TKUA 3SI7A 5LP6B 3KJHA 1C4WA 1DFIA 3E22A 4KO8A 5BYBA 4MSUA 4UTRA 2V1XA 2NXCA 3EGIA 1ISJA 3ESAA 3C8DA 1HQCA 2X4IA 4NATA 3GHYA 4JEIA 4RCZA 4Y6GB 4YHBA 4L7VA 3RHSA 5CB4B 3ELWA 3CLRC 5CBKA 2VDKB 4M0CA 3TE7A 5CA0B 2H4ZA 1X7YA 2RGNA 3CX4A 2BFCA 4G5RA 1R4ZA 1J6UA 1Q0RA 3ZLUA 4DV3B 1TL7C 3KPJA 4EA6A 2C88A 1M2OA 3EVGA 4NG5A 2Z4TA 2I33A 1SU7A 3PRKE 1OXMA 2FFQA 5AHWA 2XPCA 4J49A 4FDLA 3VI3B 4D4IA 4WXPA 2CNWA 4MAAA 2GWHA 1ZCFA 3IQFA 1ZU4A 1KK2A 1OAAA 3H9GA 3MQ4A 4JVOA 5C7OO 3THWA 1FUUA 1FFGA 2EC5A 3O47A 1TDJA 2EBWA 4JCOA 5GJWC 1FMLA 3N9IA 3OTIA 4D8TA 2V7TA 1MABA 2FSIA 3F4BA 2XNKA 4KVZA 2PXHA 4LOJA 1UPXA 1M72A 4KYTA 1RMQA 2R65A 4KDCA 2XA1A 5ARBA 3WSWA 5B1SA 3FOEC 2C2OA 2VF5X 1BN6A 4BAUA 4LQDA 1NDQA 4GOLD 1YDMA 3KEOA 3KCQA 3V48A 1E89A 4KQIA 4B79A 1SUSA 2BM8A 1J0BA 4NC9A 4HPWA 2TMKA 1VTKA 1OGYA 2XECA 5IYZF 1ZC4A 1POWA 3ZWVA 3AYXB 1PD0A 1UKEA 4UM9D 1RLMA 3FPFA 2W7TA 2UYOA 4KN6A 4RHUA 3V3TA 5BNWA 1GYQA 4BLSA 3MRTA 1MU0A 4BEWA 1NVVR 4WESB 5K8UA 3MSXA 3QY9A 1DEOA 3BEDA 3PUKA 3RSGA 4LDPA 1F4LA 3DZJA 3FB4A 4PZAA 3NHKA 4QARA 2H3HA 1Z36A 1J06A 4HAWA 4A8TA 4DEVA 2R7AA 3K6RA 3TIIA 5DV9A 3HXQA 1SIOA 3EXHB 3HKCA 4GI7A 5AICA 1GGMA 2ZUDA 4NFLA 1IE3A 1AD2A 1IJBA 3WR5A 3DL2A 1V48A 4ZV7A 1Z3CA 1NW5A 3DTNA 2AN1A 2P9EA 4RD1A 3U4QA 4U6NA 3UB4A 4DB4A 2FR0A 1ULBA 1XVAA 4ECEA 5KVSA 2LCFA 3IS3A 2BGRA 2QSZA 3J80A 1GZSA 3BB1A 2ZXUA 2AOVA 2FSSA 3Q8KA 3DNFA 3LT1A 4LF6B 5LUAA 5TQ2A 1X80B 3V80A 1W47A 2XT0A 1AKMA 2XCIA 2YQZA 1NIJA 2VPQA 3BA6A 5ALQA 4AP6A 3GUCA 5CDTA 2W71A 4UBNA 4BTEA 2IS4A 4MVJI 4N5IX 1BKSB 5HIIA 3PUYA 3X2FA 2WJPA 1KI9A 1W5EA 1O08A 3A1NA 4I6JA 3BGIA 3IKMB 4MXDA 3LUDA 4I1VA 1GNSA 2W2PA 4E7PA 1AKNA 3UHOA 1QV9A 4M37A 4CEIB 3QWHA 2WV7A 4QOFA 3KKKA 4KCGA 4KPFC 2C82A 2C1XA 3INNA 3P0IA 2G1AA 1I30A 4RKWA 5HKOA 4Y9TA 3D1VA 4L72A 3RFXA 3ZJ4A 4IDFA 4Q0MA 4EJSC 3DF9A 2EJTA 4H6WA 4ZT3A 3LUBA 1O58A 4KDRA 1NW3A 5DH9A 7MDHA 4DR5B 1F2UA 1IK4A 1XTSA 3WMWA 3HO1A 2O50A 4D25A 4NNOA 4BEBA 3GDWA 1BE8A 1QHEA 3CTPA 3K31A 4LOIA 4HDSA 3C41J 1PS8A 3LK7A 2QRUA 1KYVA 1E9RA 2WU0A 2CL0X 3O7WA 4PSUA 4YAOA 3ZKWB 4BNJA 3EWNA 1K0UA 3PE4A 4AJ1A 1HT3A 5GQSA 4HNAB 4YV0A 3C39A 3KYDA 4KDFA 1BXRB 1N3LA 2F48A 4M0FA 1Z4JA 3IQIX 5HF5A 4XPIA 4KW7A 3F6EX 1EFKA 1CK4A 4DQDA 4H08A 3FVWA 4WPGA 2R25B 3I2HA 1Z74A 3TTXA 4RFVA 1RHJA 1W44A 3ADOA 2PBRA 4PXSA 4CLXA 4YRRA 3EB9A 4R8VA 4TLLB 2AFVA 2OO5C 2P9YA 1QP4A 2WHYA 3P9CA 3QEOA 5B2FA 1ZA1A 4J3JA 4II2A 2PVPA 2EARA 4L78A 3LLUA 1Y48E 2IP2A 2HSGA 1XU9A 1U3DA 2OM2A 5ICFA 3NHBA 1DAFA 3ONVA 3Q5DA 5K6TA 2VAMA 1WHSB 4D56A 2CSXA 3NC4A 5EJ8A 2I8CA 3NNSA 3LY9A 4QU9A 2QWXA 2PZ8A 4X3OA 2Z2ZA 5FX2A 1DC4A 1DV1A 2XUGA 1G5HA 1QE3A 2WINI 1AM4D 1YJ5A 3E48A 5DLDA 1W29A 2F4VB 4ZVUA 3GNQA 2HX1A 3V8BA 2HSDA 2BZ0A 2EERA 4EJMA 4EGCB 3M1IA 3ZYCA 6CHYA 1WXDA 3D9QX 3R76A 2XVZA 1MVOA 1T9AA 1YQXA 3GDFA 3GT4A 4RKFA 2NZWA 5BRAA 4HEQA 5KSPA 1SZCA 3GMTA 3MINB 4IHJF 4CL3A 1CDDA 2VZ9A 4QYTA 5K6RA 5AOAA 3EG9A 4QPDA 3IO3A 2P3OA 3EZXA 3O5AA 4L4XA 1B1AA 4YI5A 2PUAA 1I7PA 1I7LA 2BEVA 2J46A 3PJEA 2GD2A 1T5IA 5FBRB 4R1NA 4M1YA 2CV0A 1SC9A 5F2OA 1IIRA 1FFCA 1G59A 5HCNA 2JFUA 2CLDX 5REQB 2FW8A 1P5ZB 1UWLA 3MJFA 1ECLA 1WDKA 1U0GA 1PNTA 5EJMA 3E4CA 2HBZA 3QKSA 3QPVA 4OJYA 3QHPA 4QFDA 4C7VA 3HCNA 2OC9A 4NESA 4QSHA 1ESDA 1U3TA 4AKEA 3K0CA 4JL8A 2LDBA 2NU6A 3RABA 1NG9A 2P6RA 1QWOA 2KB0A 1DOHA 1RPAA 3PEVA 4IQFA 3SZOA 1WCXA 3V1TC 3STHA 4NEHB 1SU6A 4WT7A 3MD0A 3WTCA 3IP7A 3IBFA 3E6AA 1I2MA 3LBNA 3WMGA 4QUBA 4YTEA 1MB2A 4D43A 2Y0BA 4EFNA 8ABPA 3LECA 4LGMA 1L5OA 2QAJA 3RIYA 1R66A 3ROTA 1M1UA 1ONNA 3FUWA 3KTFA 4NCXA 5BT8A 1MENA 4S1PA 3TGPA 2O2JA 5J2UB 2W2NA 1ISRA 2WB2A 1RLTA 2REQA 4O4HA 4I8XA 3N2IA 3WLFA 4E3ZA 3WAGA 4YJ2B 2VLBA 2J5KA