3OU7A

Dhpi-sam-hep complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
214
structure length
214
Chain Sequence
b'TTSHGLIESQLSYYRARASEYDATFVPYMDSAAPAALERLRAGNIRGDVLELASGTGYWTRHLSGLADRVTALDGSAEMIAEAGRHGLDNVEFRQQDLFDWTPDRQWDAVFFAHWLAHVPDDRFEAFWESVRSAVAPGGVVEFVDVTDHERRLEQQDDSEPEVAVRRTLQDGRSFRIVKVFRSPAELTERLTALGWSCSVDEVHPGFLYATCRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM-dependent methyltransferase
publication title Characterization and structure of DhpI, a phosphonate O-methyltransferase involved in dehydrophos biosynthesis.
pubmed doi rcsb
source organism Streptomyces luridus
molecule tags Transferase
total genus 72
structure length 214
sequence length 214
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ou7A00
3OU6A 3R0QA 3SVZA 3JWGA 4IV0A 3UJ8A 2IDKA 1DCTA 4OX9Y 3T7TA 3QV2A 4R05A 4RTOA 4CTKA 3PFGA 5E1DA 5E9WA 4OQDA 2BM9A 3TRKA 5LQCA 2Q41A 1M6EX 4BLWA 3HP7A 3FRIA 1VP9A 2N47A 4CKBA 4BLVA 5FULA 3V8VA 3PFHA 1G55A 1V39A 3LPMA 3E05A 1JG3A 2FCAA 4GOND 5E2BA 5DX0A 2OXTA 4P7KA 3MTEA 5ICCA 1L9KA 5GIPE 2JHCA 2PWYA 3C3PA 2NXEA 3UJ9A 4KW7A 4YV1A 3EGIA 3HCAA 4GEKA 1P39A 4R8SA 3UJ6A 4C08A 2PX8A 3LCUA 2ADMA 5DM0A 1DUSA 1SKMA 5GP1A 5E9QA 5EMLA 4EQZA 1FBNA 4PYLA 1NW5A 2YUIA 2ZIFA 2PLWA 3PT9A 3JWIA 4PNEA 2ZULA 2IH5A 3RODA 5DTRA 3C6MA 3G5LA 3PB3A 1ZGJA 4M38A 1X1BA 2AS0A 2ERCA 5KYGA 1AQIA 2PT6A 3MB5A 5EKUA 2AZTA 2UYQA 4EK9A 4R6XA 3FPEA 1JTEA 3GDHA 3LX6A 3CVOA 3NW9A 1SQGA 2ZVJA 5DSTA 5HIJA 3RW9A 3BKXA 5BW5A 3HCCA 3LECA 1P1CA 2B25A 3OFJA 4QQNA 4CKEA 3FRHA 4CXMA 1I1NA 1L1EA 4RTQA 4MIKA 1BC5A 2QRVB 1G38A 1KP9A 1Q0SA 1KPGA 3DXYA 3KR1A 3NDIA 2DULA 5T67A 2G70A 4V0QA 4KVZA 4M37A 3SMQA 4YUWA 3BXOA 3BZBA 3QOWA 3B7PA 2ZBQA 5KVAA 3HA5A 2ZLBA 5E9JA 5KQSA 1MHTA 3I5UA 3TKYA 5M5BA 3SGLA 4DA4A 4AZWA 3MHTA 1G8AA 2AN4A 2ZWVA 5DM1A 3IV6A 4FZVA 1M0EA 5K8VA 4IWNA 1FJXA 3UA4A 2PT9A 5DM4A 3BGVA 5HIIA 1L3CA 2O57A 4M7RA 4CWAA 4PWYA 4X60A 3NTVA 5E1OA 3DUWA 1L3IA 3PVCA 3UJAA 3MTIA 4KRGA 4YV0A 1PRYA 5HOQA 5C9ZA 2P3QA 3FTDA 5K0NA 4EKGA 2GS9A 2ZIEA 1VLMA 2YTZA 1YFLA 1RJGA 3FTCA 3CGGA 3FUTA 2HWKA 3KQYA 2EFJA 4KIGA 1WZNA 2AR0A 3OZSA 2EX4A 2BR3A 3BKWA 3SX0A 1EJ6A 3KHKA 5E8RA 2ZW9A 4QPPA 5FHQA 3AWIA 1UWVA 1JSZA 5HILA 2I9KA 3OCJA 4H0NA 3NVMB 4PIMA 3HA3A 3DXXA 4FGZA 2KW5A 3EVZA 2OO3A 2ZZNA 1JSXA 5EQJB 4KDRA 4P7JA 2PXAA 1NE2A 3JWHA 3K6RA 3MCTA 1VE3A 3R3HA 2ZIGA 3OZRA 4R8RA 3UA3A 3GWZA 5ICGA 1X19A 2I7CA 4X61A 3H2BA 5DXAA 2Z6QA 2PVCA 3C6KA 5CVEA 5FCDA 1EAMA 5DX1A 3DLIA 3TM4A 1WG8A 3U81A 3B89A 1KHHA 3M6VA 4RSRA 3IEIA 1QAMA 4DCMA 4Y2HA 2XBMA 4RTLA 3X0DA 5HIKA 5LQKA 2AOTA 3TQSA 1KYZA 2ZBPA 3O7WA 4DQ0A 4XUDA 4PGHA 5K0CA 3KQWA 1AF7A 2CMHA 2F8LA 2PSSA 3EGEA 3AY0A 2BM8A 2IPXA 4XCXA 3ELWA 2H00A 1ZKDA 3KQVA 5EC8A 5EHIA 4HTFB 3SXJA 4C06A 4DKJA 2PX4A 3DH0A 3DTNA 3GRUA 4ER6A 2JJQA 3B5IA 4OQEA 3A4TA 1JG2A 3HCEA 3ORHA 2QYOA 4OBXA 4YUYA 2Y1WA 4PIPA 3FTFA 4U7PB 3D2LA 2ESRA 1RI2A 3GRYA 3EEOA 2K4MA 4KWCA 4E70A 1NKVA 3AXTA 4FP9A 4RTRA 8MHTA 1NV8A 4X41A 2GPYA 1ORIA 1JQ3A 2PV0A 2XVAA 3G88A 3CC8A 2V7EA 3GRVA 3KQPA 5CM2Z 5FQOA 3LDGA 1F3LA 5KQRA 3AXSA 1RJEA 1R18A 3EVDA 2JG3A 5BXYA 1R8YA 3NJRA 1P1BA 4GC9A 4PYIA 4QTTB 5HFJA 1XCLA 1WXWA 1IM8A 3DMGA 3RIEA 1FP2A 3LCCA 2AN5A 1XJ5A 3TMAA 2ZSUA 1X1CA 3VYWA 1FPQA 1N7JA 1RJFA 5HZMA 5D1NA 2OKCA 4MWZA 4PONA 2HTEA 3LBFA 4POOA 5EIWA 2AN3A 5JR3A 4HSGA 4Z2YA 3ME5A 3FTEA 2NYUA 3M6UA 2Y1XA 3AJDA 1I9GA 2G72A 5DX8A 4A6EA 1IXKA 2GAFA 2ONZA 4DM3A 5EIFA 1X1AA 4M36A 3FPGA 2EJTA 3GCZA 1NW7A 1KXZA 4FR0A 5HIMA 3T7RA 4AX8A 1RI5A 2VDVE 3KKZA 2CL5A 3MQ2A 2ZZMA 2C7RA 1BKYA 2ZFUA 2DPMA 3MCZA 2P41A 2ORED 1SUSA 1KIAA 2JHAA 1O9HA 3HCDA 1VQ1A 4RWZA 2HR1A 4BY9E 2OPBA 4PGGA 4RTNA 3UBTA 3G2QA 3G7UA 5GM1A 5GIOE 1AV6A 5EZSA 1QANA 3NDJA 4FS8A 3KR9A 2HMYB 5LQJA 2YQZA 1XDZA 3EEYA 2XYQA 1TPYA 2AOVA 3KU1A 5GINE 3F4KA 1U2ZA 2IFTA 3C3YA 5DPMA 4HG2A 4DZRA 5DTMA 2QM3A 3EVBA 2JHPA 4RVGA 4QDKA 4ZTBA 3UJDA 3B3GA 4DCGA 9MHTA 3BGIA 2FK7A 3LSTA 1RI4A 2B9EA 2WK1A 4YMHA 3LKDA 3A7DA 2OYRA 4DMGA 5K0BA 3KPUA 2C7PA 2PY6A 1JR4A 4HGZA 5DSXA 2H1RA 2PJDA 4C04A 1VL5A 3HTXA 1QAQA 5CVJA 5DRYA 3EVGA 5E8JA 2P3LA 4HRAA 4E2YA 3HNRA 2O07A 1JTFA 3OE5A 2YXDA 3BWYA 2AOUB 1FP1D 3LBYA 2XYVA 5F2KA 4A6DA 1RI3A 2YX1A 5K01A 1VPTA 1F38A 3A25A 2XYRA 2PWPA 4GOMD 4X63A 3GU3A 3IHTA 3A26A 4RVHA 3THSA 3UJ7A 1N2XA 2IH4A 3GGDA 5G02A 4ER7A 3PS9A 4QVGA 4LWOA 1NBHA 3S68A 5K0JA 5FWAA 3LHDA 5CVDA 3VC2A 5E2AA 2NXCA 3KR2A 3OE4A 3VC1A 2GH1A 2PX2A 2JH9A 1ZQ9A 4PYKA 1INLA 4E31A 3V97A 2B78A 4RTKA 3LDFA 2IBTA 3KPVA 1XCJA 1TW2A 5EPEA 5E1BA 2GA9A 4P7FA 5B1SA 2Z6AA 1ORHA 3KQTA 4F85A 3ELDA 1YZ3A 3A7EA 2PX5A 5EMKA 4E2XA 2YR0A 3HA7A 1NT2A 4PYQA 3HCFA 4WVLA 2QRVA 3P9NA 1M6YA 4ISCA 3THRA 4YUXA 4QDJA 5EMMA 3FPJA 1DL5A 4ER5A 3MGGA 2WA1A 4GUAA 2PGXA 2IIPA 2VDWA 2YXEA 1KYWA 4ER0A 2EJUA 1HMYA 3NWBA 2LD4A 3OPNA 3CJQA 5LQNA 3P9IA 2PKWA 3ID6C 2A14A 2XVMA 5EG5A 3SM3A 3SR4A 4E32A 3ELYA 5FTWA 3HM2A 3TM5A 3REOA 3UJCA 4OA5A 1N7IA 2FRXA 1KR5A 3G2OA 3KPJA 1YB2A 3HVKA 2ZBRA 3GXOA 4KIFA 3FUXA 5CVVA 5IH3A 5EHGA 3DMFA 4ER3A 4JXJA 2QY6A 1YZHA 4RVDA 3HVIA 2AOUA 2NXNA 3T7SA 4E2ZA 3NVKI 2ONYA 2OY0A 3MAGA 4ATNA 4EKIA 5K0GA 1L3BA 1VP3A 3HVHA 4E33A 2IH2A 1SG9A 5FWDA 3E7PA 3PLAE 4E30A 4P7GA 4QPNA 5FADA 3M4XA 4PYJA 3K0BA 2Z6UA 3M33A 4R6WA 3A27A 3Q87B 1Q0TA 4OBWA 5EEGA 4IV8A 1BOOA 5ICEA 5F2NA 3NWEA 5K03A 2R6ZA 3GO4A 4RV9A 5P8WA 3KPWA 4MQ4A 3G5TA 5EKXA 1G60A 2UYHA 3FYCA 5U4XA 4DF3A 4YMGA 1P91A 3GIWA 3GRRA 3EVCA 4RTJA 3E8SA 1T43A 3IYLW 3BUSA 4BLUA 3FYDA 5DLYA 1ZHFA 4U7TB 4F84A 2UZ4A 1NBIA 4FSXA 2BZGA 3R6TA 3CBGA 1YF3A 3L8DA 2NXJA 3PX2A 2CMGA 4XUCA 5CCXA 5LQUA 1PJZA 4BP3A 1XXLA 4F86A 1H1DA 5K09A 4C05A 3ER8A 2NNWB 3OU7A 1QZZA 1MJFA 3P97A 4V0RA 5GWXA 2ZZKA 4MHTA 3CKKA 3G89A 2R3SA 5HEKA 1XDSA 3BWMA 1RI1A 2B2CA 3I53A 4K6MA 1AQJA 3TPZA 3KPYA 4G56A 2PXXA 2O05A 1I4WA 4GQBA 2P3OA 4IKPA 1WY7A 2P8JA 3BWCA 5CUQA 3TR6A 3HEMA 3ANXA 3QOXA 2E5WA 5CCBA 4RTMA 1NV9A 5LQAA 1OR8A 1B42A 1EG2A 1RJDA 1VBFA 3FZGA 5KS2A 3OZTA 5DWQA 3CCFA 5FHRA 1NW6A 2G71A 2O0LA 3I58A 4HTFA 3KQQA 2FHPA 7MHTA 3P8ZA 2P7IA 4L7VA 3EMBA 1WXXA 5LR6A 4PINA 4C03A 3P71T 4LWPA 4QVKA 3UFBA 4FT4A 5DXJA 3FPFA 2G8NA 4AZTA 5DTQA 1YFJA 1R74A 2P40A 3B3JA 3OU2A 3PX3A 5CD1A 3TKAA 2YXLA 4E2WA 4YV2A 5C0OE 5LQRA 2OB2A 1UIRA 3BGDA 5EEHA 5IKMA 1YUBA 3G2PA 3G8AA 3DR5A 3TOSA 5ERGB 2UYCA 3P2IA 4HGYA 2OB1A 3EVEA 1EQAA 1QYRA 1UFKA 1NW3A 2AOWA 2AVDA 2FK8A 3HCBA 4FT2A 2IBSA 4GF5A 5FA8A 4RYLA 2QE6A 4WXHA 2H11A 3TFWA 4EMSA 2JH8A 1ZGAA 2EG5A 3T0IA 5GM2A 3UJBA 5C1IA 3SSNA 3DXZA 2HV9A 5EOVA 3MERA 4PCAA 1D2GA 2FPOA 3DMHA 3EPPA 3I9FA 3LL7A 4O29A 5F2OA 3DLCA 3O31A 2G1PA 3ERCA 3KQOA 3FUVA 1XDUA 3WSTA 3DULA 3EVAA 2B3TA 5BP7A 1G6Q1 2YVLA 5EZQA 2AVNA 1BHJA 2IGTA 4PCLA 3SSOA 1XVAA 3R9XB 5K0EA 5FUBA 1D2HA 5CIYA 1R00A 1Y8CA 3B3FA 3EVFA 4GOLD 3ELUA 3EGVA 4HH4A 4MTLA 5T64A 5T6BA 5K0LA 4PYOA 4EVIA 2BR4A 1SQFA 1ZG3A 3TLJA 4UOEA 5BW4A 1D2CA 1KPHA 2AOTB 2HNKA 2ZTHA 1NW8A 2UYOA 2ZWAA 3KR0A 4RX1A 1R8XA 4NECA 2IDJA 4HC4A 4P58A 2BH2A 4QQKA 1JQDA 1O54A 3P9CA 4YUZA 3NMUF 1HNNA 3P2KA 5DRTA 3FUWA 5GOZA 4LG1A 5FA5A 2I6GA 1Z3CA 4RTSA 2VS1A 3VSEA 5E1MA 5CVUA 4XUEA 3M6XA 4CTJA 3CJRA 2IP2A 3LCVB 4AZVA 2PXCA 3GRZA 5EVJA 3PTAA 3M6WA 4GC5A 3EMDA 1JQEA 5ICFA 2C7QA 1X1DA 3SSMA 5DM2A 2P35A 3I64A 3DP7A 2AOXA 4LECA 2OZVA 1WS6A 4AZSA 1TW3A 2VP3A 3FPHA 2O06A 1JG1A 3GJYA 1XTPA 3BT7A 3E23A 2OBFA 2V74B 2VZ9A 3G2MA 4PYMA 5K0FA 4GBED 3O4FA 4C4AA 4RTPA 5EMJA 4Y30A 3DOUA 4KDCA 5D1HA 1JG4A 3LGAA 3UZUA 2PBFA 4X1OA 10MHA 3KQMA 1SVUA 2I62A 1EJ0A 1VIDA 2GLUA 3CJTA 2FYTA 4C07A 5JUWA 5LSAA 2ZCJA 3LDUA 5H02A 3ER9A 2C7OA 2BR5A 3R24A 3UWPA 4CKCA 3HVJA 2P1DA 1O9GA 3KQSA 2P7HA 1SUIA 4RVFA 3G8BA 3JWJA 3BWBA 3C0KA 3GNLA 4AUKA 1G8SA 4B17A 2VDUE 4PYNA 3M70A 1EIZA 5FQNA 4YUVA 4QTUB 2NP7A 2GB4A 1R6AA 3P2EA 5MHTA 3LKZA 1IY9A 1KPIA 2CKDA 5DT2A 4GOOD 2WA2A 4OA8A 5K05A 3FUUA 4FSDA 4BP1A 1QAOA 2NP6A 3Q7EA 2CWWA 5EGSA 3P9KA 3OFKA
chains in the Genus database with same CATH superfamily
4ZI5A 1P3JA 2RG1A 2R8EA 1PFKA 1T15A 1XNGA 3EW7A 2HBYA 3K1YA 3AUFA 4CIBA 1W36C 2KMLA 3DHWC 1CDOA 4JNKA 1VJDA 1CY8A 3KO8A 2D2VA 3MN1A 4GYWA 5I7HA 5CYPA 5GJCA 1GGEA 3KNZA 1ODSA 2VF4X 4TYWA 5FULA 3O73A 1KDVA 2FCAA 2MSKA 4AJLA 4P7KA 4ARBA 2EZ4A 3BMOA 3DHYA 4LN1A 3KWJA 4YPFA 3S28A 2ZSJA 5C18A 4TRRA 2EWWA 1AKWA 1H2XA 2BBSA 2GBGA 3DCNA 5FBRB 5B7NA 2CEAA 2JIBA 3I3SR 4FBMA 3EZXA 4HB2A 4XA8A 4F06A 2IV2X 3PNBA 4YAJA 2Z3ZA 1ONSA 4YAIA 4AJJA 2B4KA 3O4IA 1FBNA 1Y89A 4P3XA 2FMUA 3PT9A 3KCQA 1GPDG 2VP6A 3BZWA 2D7CA 4TZTA 4ZAVA 4NU5A 4DMLA 5KTYA 4LZJA 4IINA 4EHJA 2QBYA 3BORA 5DBOA 3ZE9A 1CUDA 2HQSA 3B1FA 1WPQA 5BSEA 2HIHA 2VXOA 2E87A 5KYGA 1ORVA 2RKOA 4QO7A 5EKUA 4WJZA 3IA7A 2HREA 3ANNA 3H3XA 1MOPA 5FBLB 5FFNA 3NALA 3WB9A 5CIWA 3OQOA 1OAOA 1NFRA 3UXMA 1JFRA 1OXTA 1SUEA 1T91A 1JEDA 4MI3A 1D4ZA 3E8MA 3S7TA 3S8YA 4Y9RA 3R5KA 3BM5A 5JZVA 3WZLA 1L1RA 3GELA 1GTVA 1DWPA 2J0SA 2W4QA 2ZT8A 3V4ZA 2E1PA 2OGUA 1GARA 3CLSC 4G24A 4QSMA 2DR3A 1N2GA 4Z86A 4O4LF 5KYUA 4DA0A 1IEQA 3ZK7A 4AKEA 1M34A 1L4GA 3SGLA 4JJZA 4W5WA 3V3TA 2I80A 1G8AA 4OYLA 4WOPA 1AQ6A 5EXTA 1ZHHA 3DNPA 4IRMA 1QQAA 1Y8AA 1U8TA 1A71A 3CPEA 4K03A 1SBNE 4JQYA 3RHSA 4EY4A 1E1QA 4FC6A 5K3FB 4YJ2B 4P32A 3DPSA 3FH0A 4JKOA 1V8FA 4N5HX 3T9DA 4JYBA 5FEUA 1OFVA 3DG9A 3H9GA 5CLGA 1NQTA 3NAMA 4D4MA 4OLAA 1C0EA 4KRGA 4TYNA 3LT0A 2PUJA 2O0JA 1HY3A 3GFPA 2FG7C 4CR6A 5JJCA 4E5KA 2QTVB 4O4LA 1XKTA 2AA3A 3EG5A 4M0FA 4RPIA 2MYTA 3ESQA 1I6KA 5BUCA 1CRWG 1K66A 4N7MA 3M2PA 2Q62A 1XU9A 2EX4A 4L8VA 4B7UA 1DDGA 4IEFB 4DIFA 3OCWA 3PXCX 1QFJA 4ZODA 1FLVA 2OTCA 3O2NA 2OO3A 3WTCA 1E0KA 2DX7A 1QHHB 5K3AA 4B6QA 2XNDD 1YZVA 3QLJA 3P9PA 4EA9A 4TROA 3LI2A 3VKWA 5SY6A 4N6OA 2WB2A 2UUBB 5KTSA 4GI7A 2WTEA 1NAHA 2VPYA 4MR8B 2XOEA 4QJ3A 3HFJA 4KXMA 1FZQA 4J94A 4LI0A 3UC9A 2Z8XA 3N6VA 5FOUA 3ASVA 3DUFB 3EFOB 3TOZA 4UM8B 3DEAA 3GDFA 2PMWB 3OCXA 1GVHA 2YFQA 4TXMA 4UU8A 1VPWA 2BEKA 1M6VA 4DIUA 2BAGA 1M8JA 3GCGA 4PGHA 4AMUA 5JDIA 1PV4A 3BWVA 4QA9A 4IUBS 2P2DA 3RT9A 1RRMA 1TCUA 3KQVA 5H5JA 2EL9A 2OCAA 2Y0CA 3I34X 4GUDA 2ZOSA 4MGEA 4X8OA 3ODPA 4QGHA 3RKUA 3I2YX 1N2CB 4ZRDA 1V3TA 2Y1CA 4KE8A 1NXWA 4INOA 3PLNA 2R1TB 4B09A 3K6SA 3A3PA 5IJ0B 4YGYA 4HQ0A 4UMDA 4Y6PA 4PIPA 2G4CA 2YUTA 4QBHA 4CM4A 1GQ2A 4ND5A 3ZE1B 2K2WA 5FI1B 3ZQ6A 2WP8J 1Z0JA 2HT6A 3KS9A 4N5DA 3K20A 1MVOA 3TW8A 4RTRA 3V4FA 3IT3A 3OBIA 4LNUB 5TR9A 4JLDA 4X3PA 2C5AA 3KQPA 5FQOA 1YZUA 2P9CA 3URMA 6AT1A 4B0PA 2YNMD 5J58A 1E2HA 1A5ZA 5F52A 3FW1A 3ZVLA 1Q0QA 4DC0A 1GZ3A 4Y2VA 4LYHA 1SBHA 4LXGA 5HFJA 2I3GA 4GM0A 4QKQA 1FP2A 2G1PA 2XGSA 4ZQFA 1VECA 2D62A 1N1EA 4Q01A 4GECA 4HSGA 4LZOA 4FWTA 2NMVA 1CYEA 2XCQA 2YWJA 4MXDA 3B5JA 3ZIUA 2H4WA 3ZJYA 4C7JA 3G02A 3DKRA 2WWVD 4D9EA 1LLUA 1N92A 3B36A 3MJHA 1JBQA 3F2IA 3VR5A 4Z7QB 3QTTA 1JLLB 1R8SA 4U7WA 4D5EA 5EKSA 1KXZA 4WESB 1DBIA 2COEA 4COKA 4J2TA 4DLAA 3KKZA 1B3RA 1Z07A 1N4AA 4ZAGA 1N2IA 1IUNA 4LOIA 3UBMA 2PGNA 3CNQS 4DR2B 4KVFA 4AKTA 2QTBA 2NO5A 2C2WA 1Z39A 2HH9A 4G8CA 4PGGA 1ISMA 3WLFA 2IUYA 2OWEA 1OYYA 1P1JA 4N5IX 4R5MA 4EG3A 4GLFA 1O6BA 2ATCA 4HPXB 5DGTA 2O8DA 3MMSA 2ZSAA 1IY2A 5GINE 2G9VA 4MVJH 5E6UB 2IFTA 5EI5A 1D1SA 4J8PA 2PFGA 3GEHA 4RBNA 1M6NA 5DTMA 1C4OA 2QM3A 2JHPA 3DVRX 3SF0A 1EHIA 1NONA 3UAYA 1E2NA 3H8SA 1YA6A 1SVNA 2X2FA 4ZYXA 1LWNA 1QHEA 1JDBB 3CB4A 2XNCA 3DEZA 3R0JA 1Y3AA 1ZK1A 1OHHD 3AONB 4Q37A 1BDJA 3P5BA 5EIEA 2EKZA 5EJ7A 1WO8A 5TLSA 3OA2A 4R1NA 4L4SA 5AW7A 4NG4A 3I9V1 4E2YA 4WJKB 1X1SA 4MO9A 1G42A 1LVGA 2VDLB 2JCGA 1ZR2A 2PS1A 5I9SA 2GYVA 3QU5A 3GLRA 3W7AA 3W9BA 2J0UB 1Z34A 1P0QA 2PLAA 2XYVA 4XIYA 5ELLA 4AJKA 5CD9A 1B74A 3NIFB 5ELXA 1W46A 1H6BA 5BW6B 2RGEA 3WIVA 1U7ZA 1YDWA 2PKQO 2ZUWA 5G02A 4V3BA 2JIZA 5KWIA 4KFSA 3S68A 1M6HA 2PGOA 2GEBA 3COWA 1DFHA 4RETA 2H51A 5EIOA 3QI7A 5B30A 2G5CA 4B31A 2KX7A 5CB6A 3P2MA 1QIJA 1AKRA 5D7BA 1NLFA 1B8OA 3S5JA 1N3BA 3FG9A 2JI7A 3MIZA 2AN9A 3VZPA 4FYXA 3ZZUA 4EMTA 3K5HA 3GJRA 3A14A 4NE9A 4F3TA 1OLUB 1C3XA 3ZWMA 2QT1A 3ILSA 3SX4A 5ECDA 1YDGA 5KMGA 1Q7BA 4IIHA 4A10A 3NTQA 4X1IA 1W5EA 4PYQA 5A3SA 1GKUB 1N2CE 3HUUA 4WVLA 1M6YA 4HWRA 5DT9A 4FN5A 4QULA 4BU1A 3ZDXB 2DEUA 4CM9D 4GUAA 2VDWA 4MPJA 3LWBA 5FOSA 2NU9B 3TR5A 4DLRA 3OHPA 3SXPA 1WY5A 1YB5A 4EI8A 3KTAB 3OPNA 4E32A 3IMCA 3A1EA 5JS1A 3L4BC 5CFLA 3NIDB 3IQDB 2O1WA 1KSHA 4YFVA 3I92A 1UJBA 3UAZA 4LK3A 3ZCRA 2EQBA 3KOZA 4Y2TA 3LOUA 3I83A 3NHLA 2YW9A 1PR1A 2CXNA 3IERA 2JJ1D 1FRVA 1D2RA 2OO5C 1E0SA 1DTSA 1EBBA 2H65A 1GEEA 1FFBA 2E4WA 4CF7A 5M34A 2JZNA 4E03A 5FX2A 1Z4IA 3M4XA 1VIVA 1MGOA 3O4VA 3O5AA 4P86A 2V1UA 5HJ7A 3DCJA 3HY3A 4MLDA 3SC3A 4ECAA 2DUWA 2VQSA 4GP9A 4D3FA 1OFUA 3AVVA 1G6HA 1MB9A 2WSLA 3NWEA 1EK2A 2J3LA 2ZATA 1X86B 4Q24A 3RYIB 1YVUA 3SYLA 1H2WA 2ETVA 5LBUA 1CRPA 5B3KA 3MG9A 3FI9A 1BGVA 4G9EA 3BD7A 4J43A 3EVCA 1OWNA 5IVIA 4F3CA 1ZD3A 3KEFA 3C6ZA 3PQCA 1U0TA 5DLYA 1CD5A 3VJMA 2Y1KA 4JJEA 3RU9A 2WW8A 1CB7A 2R5NA 1GUFA 1DOHA 2ZIUB 4Y2RA 4LRTB 1KGSA 1ZQ1A 5AUNB 5AVZA 1CQWA 1GYPA 4MYTA 5K09A 3MYYA 4GQAA 1QPGA 2QIOA 2NYVA 2A1UB 3SHWA 1GZ4A 4Y2YA 3KKEA 1KH3A 1LS6A 1SHJA 5CPFA 3L7OA 4CKEB 1E5DA 4DSOA 4F4FA 3EIHA 1UKBA 4LJ7A 4MYCA 1G63A 1J1IA 3WBBA 1AURA 1FFXA 4P5DA 5CUQA 3FYUC 3LLMA 1YZLA 2GLTA 4UQOA 5DYYA 3UKDA 2JJMA 2I2AA 5JD5A 1YJCA 3C1AA 4H7FA 1VBFA 2JAQA 4KSYA 3LQFA 3LBNA 1NVVR 2HWXA 4MKIA 1UFVA 3UK7A 2AYXA 1Z6GA 4Q0MA 4F6RB 4EJ2A 3RF7A 2JATA 5JMOA 1B0UA 3BRSA 2NUAA 2L69A 1GPBA 3N2ZB 4YRQA 4I4TB 3AZPA 2O8CB 4MRRA 1IXYA 3R6GA 1L5ZA 1UCFA 3KYJB 1BQEA 4TTIA 3TXXA 2YXLA 3L0BA 1ZD2P 3QZUA 4PZ0A 3NIGB 5DTEA 4I1OA 3WYCA 3T1TA 2GTIA 2ZYIA 4Q15A 4WK6A 3O1HB 2RHCA 4XCQA 5ERGB 3RBVA 1OWLA 5TPZD 2XMCA 5LL6P 2Q3HA 2R2GA 3EIFA 3PEEA 4RYLA 3H2GA 2QE6A 3I30X 5HPYB 2H3HA 1W5BA 3FF1A 5EWLA 2NXWA 3GCWA 3X1DA 2BEJA 3DNMA 1KS9A 4G9BA 2VQDA 5KYXA 4W5OA 1F2VA 3UG7A 3RSZA 2G9UA 1USWA 1NN1A 1JILA 1NVEA 1CQJB 1KA9H 3K9BA 4NBTA 4PVDA 2AMFA 3TLGA 3WRXA 5JC1A 4Q1FA 2YOFA 3I9FA 1SD5A 1BDBA 1N2BA 2HAEA 4TKUA 4G63A 4U2EA 1CJSA 1CY1A 2EX1A 4BEBA 3HBLA 4U63A 5BUQA 5CLQA 2AFVA 3ET4A 4YPVA 1XA3A 1CSEE 3I72A 5EE1A 1WVGA 3U3OA 1S9DA 4BB0A 2YVLA 1Q0ZA 3C1OA 3S2YA 1X0XA 2V7GA 4TWRA 3QELB 2FMKA 3RAEC 2CCGA 2Z8YA 4MUIA 5CIYA 1K2WA 2PGIA 2QTAA 4ZREA 5L3SB 3NHAA 2FR8C 1ENZA 1ODCA 4HH4A 3G68A 5AHOA 3HKCB 1Y8RB 5K0LA 4DMRA 3EZ2A 1B26A 4LGVA 3RYFB 3RUHA 3U4CA 3BXHA 2ZWAA 3KR0A 1ONNA 4RX1A 1XZ8A 3ZS8A 3CG4A 3OJEA 4QXAA 1HNNA 3P2KA 1BVYF 1E4YA 1EUDB 2PWZA 4IJWA 5CH8A 2YY6A 1RC8A 1HDGO 1YHYA 4WZBB 4QM6A 2VS1A 4BZXA 4DIOA 4UNSA 3KHSA 1F4LA 2Q0HA 3WK6A 1WCIA 4P0QB 1I2CA 1A96A 5CDSA 2ZRMA 4MW0A 1K88A 1EUQA 1MG0A 1Q83A 5TMEA 2FQQA 1GR1A 1VHTA 1NVDA 3OQNA 3NHRA 4US0R 3WGVA 1FYVA 3UHPA 3QKUA 1FX0B 2ZEJA 1JNXX 1TVKB 4LECA 5BNWA 1W85B 1E6WA 3FPHA 3EG9B 3FPSA 2YHIB 3QE4A 4I50F 1X2EA 3IVGA 4OXXA 5AKLA 2H4YA 3T9EA 3RIXA 4CR7A 5TQ2A 1U0OC 4CM8B 3GZNA 3ZQKA 2QZ9A 3NWOA 3VO1A 1OJ7A 3AR9A 4KQWA 4ZOLF 4DDVA 3FJOA 1FLDA 5DM70 1TC1A 1UPBA 3VKHA 3SZGA 3OQIA 2BTQA 4X1OA 10MHA 3MGKA 1EJ0A 3B1VA 1GQYA 2GLUA 1ONBA 2WBLC 1T0JB 3CJTA 3I6MA 4D74A 3S40A 4RD6A 5H02A 1ZUHA 3A9UA 4OJQA 1G8GA 1V8BA 5LXTA 3QPBA 2QQ0A 1J9GA 4OFZA 2JGKA 1OE0A 2X0NA 3G8BA 2WILA 3FOCA 3C3AA 1C29B 1PR5A 2VYFA 4JOSA 1J00A 3WRYA 1M5UA 2N75A 3DEKA 4I50A 2MT9A 4HFNA 1BVUA 2A1IA 4UHFA 1NLUA 3HBJA 3I61A 5HCUA 5C8ZA 3R1IA 2IC5A 2QG9A 1BA3A 4QOSA 3VM6A 1LX6A 3UFXA 1RZUA 2GM9A 3DZJA 3W06A 2RARA 4FYIA 4OXIA 4NMHA 4QATA 1L8AA 3WWPA 4YCAA 1LSJA 4OLBA 2A6PA 1R4AA 3P4YA 3OIFA 1KMCA 1JFLA 2JFYA 4WZAB 4LE0A 4G26A 4AO8A 1E2KA 1VL2A 3A0UA 1JYSA 3S6JA 4B4UA 1TYCA 3UOGA 4WNAB 3W5JA 2D1QA 3PFGA 2VP9A 1RWOA 3TRKA 1KJIA 3UWSA 4IOJA 2XNDA 4NMMA 3NM5A 3UYLA 2V6JA 1KP3A 4RCVA 5DHFA 3JPYA 4B73A 1PWEA 1VIMA 2I3ZA 3NC4A 2V4MA 3HJTA 2R87A 3WGYA 3A6LA 4OHXA 4BZPA 2XMDA 1TL7C 2BRUA 3W3AH 3OTGA 2YN0A 2D74A 3CX7A 4YQYA 1J20A 3FGNA 4W5TA 3C5HA 3C1TA 1T34A 1WQ4A 2GBCA 1ZRMA 4KW7A 3T1QA 3UJ6A 1NVUQ 3TKLA 1SBIA 2B7CA 2YV3A 5HIAA 1N6PA 5DM0A 4Q4HB 3TQQA 5A5EA 2NUTB 2XXBA 3AF6A 1ZMTA 2NU6B 4MVYA 3C4VA 2CNOA 4ND8B 5FUWA 1FFHA 3TINA 2PHZA 1D09A 3IDZA 3ANSA 3GLFA 4KJZA 3ND8A 3LOQA 4E09A 3VPGA 4EGJA 3E70C 2Q5FA 4RWEA 3AG6A 3WK4A 4RJTA 1D0VA 3GZTB 2AZTA 1DBPA 3VZDA 3U4QA 1BJRE 1OV4A 1AHPA 3GDHA 3KAPA 4EG1A 3DOCA 2VAWA 3HY6A 1WLYA 3BKXA 1A7UA 1A7JA 1B6GA 1M33A 2IZOA 3ANYB 2BFMA 3G5MA 2GO7A 1S5PA 1XQ1A 3F97A 2JANA 2XH8A 3CH6A 3JS5A 4F21A 5CITA 4B33A 4B3DA 1AQNA 1XK7A 4XD7D 1HETA 4D99A 2HA6A 2I7VA 2TMYA 3FCEA 4WFIA 1P61B 3DOEA 4RPKA 2YNMA 2VHQA 3VYTB 3QNUA 1XK6A 1U9JA 5D51S 4UBNA 4C4ZA 5T57A 2ZWVA 3IV6A 1IIRA 1KKMA 1U0EA 2AFIB 2VJMA 4TM8A 2PAFA 4V0MA 4YTEA 3NNDA 2YOGA 4MWCA 4X8LA 5EKDA 4CHTA 4HKTA 4IIDA 4KV7A 4LZPA 2ZWOA 4IDNA 3W8NA 4EPVA 3M9LA 1GL3A 1P0MA 2BZ0A 2J46A 3SKYA 3D31A 2I54A 2XMRA 5EPOA 5F9FA 2NM0A 1HE1C 3SFTA 4DDKA 1XJWA 1NY5A 2P3QA 2WFAA 2N1BA 1CVRA 2Q8QA 1SJ9A 2Z2ZA 2BFCB 1MIHA 1TM2A 2OK8A 3D6MA 2F1OA 1E6CA 5DWDA 3W2IA 3VZRA 3Q3CA 6ABPA 1SQSA 3M89A 1PNVA 2DFNA 2VDKB 3T15A 1M1NB 4XDGA 3RS7A 4BO1A 5K3OA 1F1BA 1T5IA 1VDMA 3HCRA 4BWVA 5L9AA 2BR3A 1HT3A 1EJ6A 2MIIA 3IEVA 1JSZA 2XLCA 4OLJA 3HNOA 4MVXA 5HNKA 1EGHA 2ZAOA 4W82A 3VPSA 3L5OA 3DXXA 3ZEIA 2O2IA 1G5QA 5ALPA 4IDOA 5A7GA 1Y37A 5C80A 1JSXA 1JEQB 3WK5A 2YZKA 4TS3A 5JLJA 4EZIA 2G0NA 4ZVSA 2IY9A 1RM0A 2V6BA 1CEYA 3UA3A 1PJ4A 1SUAA 2AMVA 4WZAE 1XTJA 3DF9A 5C8YB 3GLGA 2WR8A 3WFIA 2X0EA 1BEEA 3H2BA 1CNEA 4G1UC 4OPMA 2FMXA 1LKZA 4LDRA 3RLFA 4PQYA 1OHHA 3QUCA 5K3SA 3V2GA 4BNIA 4DVGA 3D8UA 5I7UA 1Y1PA 1CRZA 1FFWA 1ABEA 3RTAA 3SS7X 3THYA 1MDFA 1VCNA 4K46A 4IPTA 1QAMA 1XZIA 1EJ2A 1R12A 2AOTA 3B1WA 3G9QA 3NQ41 3VR4H 4EQ6A 3WMEA 3AHCA 2BHTA 2JD1A 3OZBA 1EFRD 1SHKA 1NI3A 2OSBA 2ZU6A 5IF9A 4KCGA 2CL7X 4O2BF 4YCSA 3HB9A 4HMQA 3E22A 5L3ZA 4HNUA 1IVSA 2JD2A 3SKXA 4RK1A 2FN9A 5FTLA 2ODTX 2EJVA 2PUFA 3L6EA 1PN3A 2P0AA 4ZO7A 1XEXA 1B8VA 2ENWA 3FTFA 2FOXA 1F3OA 2BGNA 4U7PB 1XSEA 1UEIA 4K8OA 4ZYLA 1NVFA 2QGZA 5HRCA 3RYTC 3L7IA 2PUAA 7GPBA 2GSWA 3CZAA 4XH9B 1UFRA 4CM9A 3BF7A 2C4WA 5AI6A 5ITWA 2ZRGA 5T6MA 2JEZA 4IQ4A 4LVNA 4F2GA 1TCAA 4K9OA 3W79A 2PV7A 2HK8A 5C1BA 2OLJA 3HE3A 4V2UA 2OSVA 3HH8A 2AN3A 1RMTA 3H5TA 1QK3A 1V1JA 3AYZB 1WRBA 3LFHA 5DBFA 2DY0A 1E9DA 1RS0A 5F77A 4OP1A 4FQ8A 1I3CA 5AW2A 1O4VA 5BMVB 2VH1A 2VJQA 2JJ1A 1T9AA 4RLSA 1I33A 2Z2KA 3JZMA 4NCIA 3K9NA 3UK2A 1HYHA 2YJ6A 1MTOA 2C7RA 3MRXA 5M3BA 2YVAA 4YCJA 4WKGA 1ECJA 2ORED 1SUSA 1VJRA 2FPGA 2AFHE 2QQEA 1PUIA 4FDAA 5E3IA 4BLOA 4D26A 1XRMA 4MKRA 1SZJG 4ZT7A 3ULKA 4QTYA 1J0BA 2EGGA 1YMVA 4M9QA 1Y9EA 2BN4A 1PFUA 4FEYA 4C3ZA 4DFDA 2VXCA 3ETJA 2DLCX 1XMQB 1REQB 2G40A 4Z9BA 4HRXA 2ZRDA 5BW8A 5JYEA 1L7XA 1O6ZA 2EBWA 3E1SA 2F6RA 3DZKA 5DBIA 1L5NA 4YJ3B 4CM7A 3LUPA 1ZLYA 2QX4A 3B3GA 3L41A 2Q1YA 3NV9A 5J4YA 3AR8A 5I7WA 5CPBA 3E27A 3GYGA 1JT9A 5CNMA 5DLPA 1GLVA 4ZJUA 4A0HA 4BAZA 1IRXA 2ZITA 3OLWA 3WBJA 2XE8A 2O52A 1Z0UA 2F62A 1OJLA 1NOKA 1MV5A 1QB8A 2H5IA 3ONVA 1JR6A 1NG1A 2I6SA 3GVPA 3HNRA 4L4RA 2C2OA 4DYVA 4DLYA 3QPDA 2OHOA 5JAOA 5LZ9A 3C15C 1Q7RA 1RXYA 1ZGGA 3GY0A 3WBKA 1J22A 2W8BB 3RIHA 1JKJA 4D8WA 3D02A 3HB1A 3QVJA 1JXAA 1HWYA 3G13A 3GAAA 4LWOA 4B85A 2W98A 2YV1A 3OQ6A 4MR7B 1SB8A 1ZN9A 3I9JA 4KGZA 4S2EA 4UZSA 5CVDA 5E2AA 4AJ1A 3WHPA 1ZH4A 5EJGA 2GX6A 3CUSA 4TQAA 3TTVA 3V97A 5A5DA 5I7EA 2PUCA 2Z6QA 2Q3JA 5KPDA 4LBYA 5JI3E 1O6GA 1KQOA 1TW2A 3K2IA 4MIYA 5E1BA 1ZNXA 3AJEA 3L0YA 1ZINA 1XQVA 4GVXA 4UAGA 4ZIRB 1VKJA 1YI8A 3LY9A 3ESAA 3Q40A 4C4PA 1IN6A 2HFJA 3HG7A 4E2XA 1XWWA 1NT2A 3H1TA 5C5CA 3GAZA 2P1ZA 3MW8A 3LQYA 3PQ2A 5TPZA 4HVLA 3FPJA 2GK6A 3UHOA 4FI3C 3NFYA 2QLTA 2X0DA 1ZRNA 5JD4A 2ANCA 2FPWA 3PVSA 2XNSA 1LQUA 1NVBA 1NJGA 2A5DA 1FYEA 1QIEA 1Y1SA 2GGSA 2RAFA 2LD4A 2YC4C 3EASA 2WZBA 4NOKA 3GEDA 4DXAA 4FYWA 2EJBA 1R0BA 4UTZA 5D6OA 2A14A 1KEZA 3WLQA 1I6LA 2AKYA 4IJUA 3I5AA 3KJXA 1U0LA 2ZVDA 3G9UA 5AW6A 2YHSA 4BEWA 1CR1A 3A4YA 2XNHA 3DMFA 2WMYA 5EHGA 2JLUA 1IEWA 4NYMQ 4I5EA 1CUUA 2CZCA 5H70A 2R4TA 2ZANA 5FR2A 4Z4EA 3ANMA 1JHPA 3H6KA 2PJUA 4UU1A 2EDCA 2QX6A 2DRIA 2H1CA 1SG9A 5ER6A 4CFSA 4EYSA 1Y6FA 1HFKA 1E2IA 5AOCA 2BZ1A 3GOHA 3NEJA 3SDZA 4FFBB 4R2XA 4IVNA 1LFDB 3NWJA 3QEKA 1B15A 2QUKA 1L7QA 1ACLA 3DFZA 3MTGA 5IC6A 3PHIA 2L2QA 4ARUA 4KIUA 2VZLA 3ZCPA 2HA5A 1E2GA 5GZ6A 4BX2A 5ENZA 4V1CB 4C30A 4H7KA 4BO3A 2O19A 2NW6A 3WE7A 4A8PA 1G21E 1MQ9A 1VYVA 1YR7A 1M2OB 2DBVO 2ZUCA 3AF4A 3FYCA 3G5TA 3CEJA 2HA7A 3I4LA 5CLHA 3N2NA 5DLDA 3BXPA 3ZE6A 3TIGA 3NKVA 2V6MA 1N75A 1JIKA 4TN5A 1M76A 3B7WA 2DGDA 1AN9A 3AIMA 4WZZA 4DJTA 5AXCA 2HLHA 1NU6A 1JALA 4P31A 1VKOA 2J3JA 5B3AA 3IC5A 3GGOA 1JHDA 4PBRA 5KSZA 2V3WA 3NBAA 1KZHA 1T8YA 4DT1B 1XWIA 3AUTA 3ITNA 3IULA 3KUKA 3RBAA 4HN4B 4FMDF 3OD5A 4UHEA 1RI1A 1KEEA 2HA3A 2JIMA 4HGRA 4ZVPA 3A06A 3OETA 4ZV7A 3IPXA 4D9JA 2OENG 1TPZA 5KU1A 4J0DA 4X1KA 1BXGA 1RQ7A 3LCJA 4GPEA 4YYZA 1PZGA 2QQGA 4JL8A 1OR8A 2NZWA 4R1QA 1B42A 3NRJA 2FDCA 4Z0TA 3W4JA 4M8KA 1ZA2A 3LLVA 3DE2X 4GYYA 1SKBA 3K2EA 2IXDA 2G71A 3V9AA 4N0DA 1KEUA 2OHJA 1UKVY 5KOIA 2ZR8A 2GBLC 3AI3A 1OCEA 3PQ5A 2VTBB 4L95C 1N78A 1P29A 3RLIA 1FB5A 3C98A 3JPWA 1MIOA 4ARZA 1YI0A 2IF0A 1CF2O 1MU0A 2MSEB 1GHTA 2Z5FA 3D43A 4IDPA 4M1WA 5I9TA 4K9RA 4QTXA 2WY2D 3QVGA 4QM7A 1LFAA 1VGRA 1O8CA 2QENA 3G2PA 5FWYB 4YWHA 1WZEA 4CIDA 4UDXX 3UC5A 1I2ZA 4GVPA 3ER6A 3UMRA 2FK8A 1FTGA 4WCFB 3U80A 3NTOA 3JWPA 2EFYA 4EUFA 4ZDWA 2O3TA 4N48A 2WJVA 1UK6A 2YV2A 3ZCXA 4TUYA 4JGIA 1VCIA 4JA2A 3MD0A 1XQ9A 4A1FA 3E7XA 5JEDA 1F7UA 4DMMA 3T41A 1PFYA 4JB2A 5TPWB 3A6EA 2Q5EA 4BVFA 2J4DA 1D2GA 1NP6A 4FONA 4UUQA 4R1UA 1R6UA 1US8B 5AVJA 1HR0B 3OQJA 4ZAFA 5HKLA 2QMZA 3VOAA 3TWOA 4BO5A 1ZLXA 1XRNA 4GAEA 3LC2O 1OBHA 1HE8B 1FU4A 3BE6A 4H7EA 3THXA 1NUPA 1UOPA 2PYDA 3DM9B 4HFRA 2DXIA 1QOQB 4DXHA 3IAS6 4NEGA 3IIJA 3P9QA 3HV0A 4KQGA 3SG0A 1JLRA 3AL2A 2NV6A 3O4GA 1A2KC 1TAUA 1EVJA 4JR0A 4JVMA 3EGVA 4O2AA 1PE0A 4L2IB 2O7VA 3C8ZA 4IVQA 2VPPA 3WYGA 2C9YA 1FP4B 1KIFA 3PBKA 1KPHA 5BW4A 3GGCA 3B12A 5TMPA 2P2LA 3IB6A 3GCDA 5EJAA 4JDPA 5GOZA 2JBAA 1JKFA 2IXEA 4DABA 5BSWA 4TTSA 1DB3A 4K9PA 3QLUC 4TYMA 2HF8A 3BC1A 3PWTA 3FCXA 5ALZA 4OKIA 2ZIZA 5WRFA 2WVJA 2O2HA 3NBZC 2IP2A 2XB8A 3CBQA 2Q4OA 3K4PA 4GO1A 4HNAB 3D6TB 4ZO6A 2JIQA 5EJMA 5GJWC 1LNQA 4EMUA 1EFVA 1W6RA 2C54A 3A6KA 1E6KA 4UHCA 4YQEA 3OQ1A 4R3NA 4RZ3A 3WB2A 3ZWOA 1UR5A 8GPBA 5KHOC 2ST1A 2E4AA 4PSCA 3I64A 4MR9B 1Q3KA 2R7AA 1IOLA 3DP7A 3N87A 4MYHA 3DAGA 3QWFA 1FNCA 2FN7A 1QYIA 3HZHA 2E6KA 4QU5A 3DO5A 1NPDA 1B41A 1PHRA 1WUYA 1ZRSA 2CXTA 2Q0XA 2V74B 4XD7A 1KMIY 1T3TA 4IHKA 3UO8B 1CKEA 2H52A 1G8HA 2JLRA 4BLQA 4RTPA 1C0IA 3K53A 3S2GA 5UKDA 1G3QA 1Q0HA 3GI1A 5JHHB 4OQLA 2QMUA 2I4OA 3KSBC 4C7MA 1A72A 5TB5A 1PNQA 2DWQA 2G88A 1F17A 4MLZA 4Y9UA 3V2UA 2MWMA 2OFPA 1RC0A 3J7AC 4B3MB 5FYDA 4CNQA 2C3PA 1XTTA 1IUKA 1KWKA 1NJ6A 1Z2CA 1Q44A 3ESCA 1TLFA 4NAHA 4B17A 1UWLA 4J1TA 2B9VA 4CU2A 5KC8A 2P9QA 1KZGB 1N6RA 3AUSA 1PJBA 3PI6A 3VR1A 1H2RS 5MHTA 4B6RA 4WFKA 1VHQA 2IE0A 4DL9A 1LSUA 1Z0FA 2C4HA 1U2TA 5CX1A 3RVMA 1PJTA 2EATA 2YRFA 2NSJA 1RPTA 4DUZB 5L45A 1QV7A 4FTWA 4WV3A 5AOBA 2OCLA 4P82A 3IIMA 2CWWA 1BZYA 1U2SA 1ICIA 4H9GA 1F9AA 5H68A 4YAKA 1THZA 3F3KA 3O93A 4PCVA 1NM5C 1C0LA 1TYAE 4EGFA 1E9CA 1SXQA 2X4GA 3PEFA 3T7TA 5K6TA 4NOMA 3MQFA 4NZNA 4OQDA 1NT4A 2Q41A 4B74A 4BLSA 3K0AA 2Q1WA 1W96A 3Q6MA 4OEHA 4FC7A 4E94A 2G25A 5J2TF 1L8QA 4WERA 3EH2A 2XUPA 2OXTA 4LHXA 4BGEA 4HAYA 1TQ2A 2HSJA 3AF1A 4KE6A 1Q22A 1TZKA 4GMDA 3TX6A 4B4VA 4RMJA 5AI5A 3HKDB 3VA7A 3EGIA 1CVIA 3D64A 1HFWA 3HCAA 4ZVMA 3D0RA 1P5ZB 3G7NA 3PDCA 4N0MA 1FS6A 1GWNA 4M22A 1BDMA 4HYTA 5GP1A 4NV3A 1NL3A 4IUDS 2YUIA 2WYOA 1PJSA 1GG2A 2ZI6A 3F67A 1OPRA 2AXPA 1L4NA 1W4BA 3DJYA 1QIHA 3GLHA 5JXHA 1EFRA 3DONA 1EM8B 3HYNA 1RPJA 2A9FA 4AXXA 4B3IA 4F2WA 1X1BA 5J2TA 1MEJA 3D0QA 1J7KA 3QLTA 4TPKA 4J16C 1KQNA 1TO2E 2C2MA 4B46A 5CB4A 1CVLA 4PQGA 1ULAA 4B9AA 4PHCA 1P6UA 4DAOA 1MAWA 1EUYA 1MX9A 3RS4A 2FP4B 2P5UA 2SNIE 2D5IA 2XRYA 3LW7A 1TF5A 1OFUX 3PTLA 4M7WA 4OU4A 3TRIA 1R64A 4KWHA 1KP9A 1Q0SA 1G38A 4HNSA 1Y8QA 3I2JA 3J7TA 3R41A 4XGIA 3H0EA 4WLFA 1HDRA 4F9TA 4L0DA 3ZHRA 2ZWMA 3GQVA 3F96A 4M6WA 5E9JA 5A0VA 4QYMA 4TQ9A 4BVAA 5KQSA 1CQXA 3KQLA 5J40A 3HYSA 4HQKA 1D03A 5A5VA 3L1HA 2WKQA 1TNDA 2H8KA 3H1EA 5AD1A 1R9NA 3FFAA 3U7FB 4HDMA 1NW4A 3UA4A 1O0SA 1XDGA 1CP3A 4M7RA 4YLGA 3D4LA 5ECGC 2ODAA 1H94A 2FLKA 2QF7A 3HYCA 5JQGF 3VNAA 2V0NA 4RJ2A 3KQHA 1N5RA 2ZJ2A 1OFHA 3FE2A 3V32A 2XB6A 4E5PA 4YV0A 3BH6A 1ISHA 1A9OA 4YLEA 1GZ5A 4XQCA 5K3EA 4FNMA 1PWZA 1RACA 3QFRA 1FRFS 1D3AA 1T8PA 1VLMA 3A3OA 3OJCA 4HNGA 4WK2B 4ZARA 3CGGA 1CF9A 4TGLA 4ZYUA 2WSMA 2FN8A 4YFYA 3ROFA 4UVIA 4IWXA 3BMNA 5ADWA 2EAUA 1MJGM 3H84A 4LHEA 3BMCB 4WY5A 4OB8A 5DNAA 4E7OA 1CZUA 1DXYA 1Z28A 4UREA 3TN7A 4IZIA 4BTEA 2RHBA 1GZVA 3H5AA 3Q6IA 4NYIQ 4FGZA 2OMKA 5HYVA 5JQGA 3T3IA 1R15A 1CR2A 3HACA 2GPNA 5FBKA 1I6WA 1Y42X 3F78A 2XE6A 3UXYA 3AHJA 4JV5B 3PDIB 1QHGA 3V1KA 1EX9A 4I5GA 1M72A 2BMFA 4WOKA 5KKCA 1T9GS 5L6MB 2I03A 1EIWA 1UBUS 3Q3IA 3Q15C 3R2JA 4YRJA 3S27A 4JLWA 1X2BA 2O4UX 1KI7A 1BWSA 1U6IA 3HV2A 2DLDA 2EP8A 1P17A 1GZSA 3N8GA 4AY2A 1K86A 1QYXA 1RWPA 1YS6A 4LX0A 4XQGA 4RABA 3V1TC 3EHEA 2C7GA 1DXQA 4DSZA 3WIDA 4YRBA 5HX7A 1PV1A 1ZYUA 1JPNA 3ADCA 2CSUA 2RHGB 3KQWA 4C89A 2APJA 3TLEA 1HZJA 4ZA2A 2IOFK 2DHCA 3K1AA 3LQ2A 5TT1A 2E4YA 3FKJA 4XB2A 3ZHTA 3NHUA 4AUNA 2PX4A 2JIOA 3DH0A 4BP8A 1IUOA 3UT6A 1RXEA 2FEAA 4RW0A 1DQRA 1S2NA 5FTJA 1XKXA 1XI2A 2X22A 2O2YA 2GKGA 2ZIXA 1OH8A 2UZ1B 3G82C 4DMHA 4IKEA 1ZJ4A 4TV8F 1IPHA 5KNBH 1V6AA 5LZ8A 4DGSA 5U4QA 2AJLI 2K4MA 3IVCA 1NKVA 4BFXA 5D3MA 3HKBB 4DR7B 1ESDA 2XUJA 1CBUA 1Z74A 3FMIA 2WMDA 4FDUA 2OG2A 3P9ZA 4P4GA 2J6HA 3FZNA 2V7EA 3GEEA 1NVWQ 4UCXA 2JJ2D 3E0QA 3K9HA 2D8MA 1RJEA 3OT1A 2J3EA 3KFVA 4AULA 5AHWA 5HGXA 5JSUA 4GC9A 4B8WA 4DKXA 2CMKA 1DQPA 3MVEA 2NZUG 2QSUA 1RKQA 1Z5WA 4RD2A 1RJFA 4PFQA 1KAEA 2CBXA 1Y1LA 5D5PA 1M2FA 2PEZA 3TTUA 2JFUA 3PC8A 3WNDA 1RIIA 3JV7A 4TV8A 1RFLA 4O3FA 1GUDA 1SA0B 2G72A 4HEA6 5TGTA 3CIOA 2IYAA 1E8MA 3QVMA 4XUGB 4DWOA 3LBHA 4TVBA 4DM3A 3Q0TA 1LU9A 1N4DA 1YVRA 4UPEA 1RCUA 1FU7A 1L4UA 2V9ZA 3PVZA 2OXRA 3JSAA 3K5WA 3Q11A 1W36D 1W2WB 4ERNA 4AX8A 4KXWA 1R4NA 2BHLA 3GGPA 2OGWA 4F92B 5KJCA 1I1OA 1VTKA 2QPLA 1BKYA 2VTEA 3WOVA 1BU5A 1ZONA 3HSYA 3UF0A 4M54A 3HN2A 3CX3A 2I1LA 1DCFA 3MMXA 3OPYB 4MI6A 1V96A 4B76A 3GJ7A 2F1HA 4FS8A 4TMKA 2O7NA 1QZXA 4B3RB 2A5LA 3PEWA 5FT9A 1SCJA 1BWQA 3UHAA 3CH4B 1T2VA 4BXOA 4BTVA 5CBPB 3DOJA 4KHZA 4HUQB 3EPLA 2VUUA 1KKLA 4CMEC 3R3WA 4QTZA 3HXQA 2WUWE 4HS9A 1WHSA 3EVBA 5KUTA 4MITA 3OIYA 2R00C 621PA 1VBKA 4QG3A 1V2HE 2FWPA 3KT6A 4I81A 1U1EA 1NNSA 2GJ4A 4IEIA 2Y2UA 2H1RA 4J4HA 4IFTA 4KRYA 3ES9A 5HF5A 4XOUA 5I4BA 2VAPA 3H3FA 5CVJA 3T12A 2E49A 2X77A 2P3LA 1URPA 3O8CA 1X15A 1K7FB 4IX9A 4V24A 1R0CA 1R5NA 5KQMA 3CNBA 2CF5A 3CNOA 3LBYA 4D9MA 2NLOA 1GLNA 1CQZA 1BJTA 1G1AA 4UCWA 4IYJA 1OWMA 4RADA 2QZ4A 4QVGA 2OKGA 4CUJA 1S3IA 3K0SA 3BA6A 1LQ2A 4W7SA 1I9CA 3ZWDA 3IBSA 1VGVA 1W5FA 3ESBA 4L73A 4BNXA 3RNLA 3IUJA 3TI7A 3CLSD 1YC2A 4WSOA 4YX9A 4BCCA 1AKQA 2YV5A 3LDFA 1BS9A 2IBTA 3UEOA 2Q4RA 4LF5B 2CHEA 4KPEC 1UOQA 3EC2A 1N1DA 3RK4A 3MT0A 5B1SA 3VAAA 5AWFC 2A94A 2CB0A 4BFUA 2VATA 2VBFA 1AKYA 2XTNA 3ICVA 4E15A 2YR0A 1GPKA 1QYCA 2J32A 4ZQIA 1RDFA 3A9TA 3PXUA 1EWTA 4B4DA 1HQYE 1DP4A 3OQHA 4LFAB 3B9BA 3OQBA 5C51B 2WA1A 2ZDGA 4DVJA 4WY2A 1YR1A 4PGMA 4P4TA 1GCGA 4ER0A 2ZTLA 3AOEC 3ICQB 2DWUA 4CJXA 4EL0A 3LHFA 1MW8X 1RXCA 2X0KA 4TMYA 1Z0ZA 1E66A 4ED9A 4PGFA 1QO0D 2CJWA 3H83A 3WGJA 2IIVA 4EW2A 4MWSA 3TM5A 1YL5A 4X84A 4YO8A 3ONEA 1GZ6A 1YB2A 3KPJA 3ABQB 4QU9A 5FUXA 3SC2B 1P7YA 5LYJB 5C7YA 1W1IA 4JXJA 3UY4A 2GAAA 4MGHA 3UUEA 5J2UA 2O3RA 1MG5A 4V0LA 4OQQA 2J3IA 2PKYX 2PS0A 4BL5A 4D8YA 4LZZA 5TJ9A 4ZCIA 3OTQA 2I55A 1H5NA 3CUVA 3E7PA 4ZEOA 3S8EA 4KLAA 3IMFA 1ADYA 3UKJA 1HMPA 3O4HA 1J90A 2W2XA 3KM0A 3BE5A 2H1HA 1H6CA 3Q87B 5TF4A 1KOLA 1U9IC 1AGRA 4MVJP 4RLQA 4N39A 3DMPA 4IGEA 1PNTA 3HVUA 2JA1A 4TKVB 1HA3A 2O2JA 1U0NA 1QGOA 3BHIA 4K9KA 5EUMA 5IDWA 4LV6A 5DCUA 3TUJC 1LK5A 4QYSA 2XDYA 4S05A 1GU0A 4C21A 2EU8A 3SF8A 3OQMA 1FDSA 2HXGA 2QUIA 3B2QA 3RV3A 4H4CA 1WCWA 1EPUA 5JAHA 1JIUA 1NVVQ 1GAQA 1N1MA 1RSZA 3ASYA 3HJUA 1H0HA 4ZVLA 1G19A 3LVBA 4ENRA 2ZI9A 3ZYCA 1B93A 1ND5A 1OBFO 2RGNA 2ZYGA 5CW2A 4C05A 1LLQA 2R97A 3PLRA 3LA8A 1XRPA 3QMWA 4NJOA 2IYZA 2ZZKA 1O96B 4NENA 4V0RA 3SI7A 5ICEA 4B3SB 1YRBA 2ID8A 1NPYA 2B82A 2WSBA 2IHYA 4CU5A 5BN4A 2YC2C 1CUFA 2ZXEA 4R98A 3UWOA 4BMPB 5IM4F 1K1EA 3NHKA 1DCMA 3IO3A 3QK7A 4Y1EA 2V5AA 4S1VA 2ZB2A 4BFCA 5AP9A 3KDSE 3QKRB 1OASA 3A2MA 1I4TD 1K6MA 4DCSA 2WYVA 3NM6B 2JAUA 2ZJ3A 3T5GA 1E59A 2B5VA 4EAQA 4YRZA 3NZEA 2D0DA 4HNRA 3L1UA 3BAFA 4J1NA 4JJKA 3AEKB 4QT0A 4YQFA 3ADKA 3U0VA 4ETIA 3H9UA 2FRDC 4H2DA 3H1PA 4X7PA 2B0CA 3HBAA 3QUQA 1E18A 1X8XA 1WXXA 1EFUA 1Y6GA 3KXDA 1WEHA 5IMBA 3FMFA 1LPAB 4EYEA 3MMPA 4PLGA 2G8NA 4Q7EA 1E64A 1Q1NA 2QVXX 4LRSB 3EMVA 4DIBA 3B78A 1ZXXA 3E9MA 1RM3A 4MGIR 4NEQA 4HHEA 4Z3DA 5IM4A 1O6CA 3BGDA 3EDMA 3F49S 4ASUD 1OH6A 3AUYA 5ADVA 4Z3KA 1CP2A 1EQAA 1W94A 2IUTA 2J4CA 2XVZA 1WM1A 2CNLA 3A4VA 3KHTA 5ALSA 3EDQA 1L4MA 3F6PA 1AIPA 2WVHA 2P90A 4X85A 4GDMA 3T8YA 3UMCA 4NBUA 4MVJE 5IJAA 2H11A 2JH8A 1ZGAA 5BORA 4TXHA 1DU4A 1B14A 1D6JA 1LJLA 1MJNA 3B1XA 1SMKA 3L6RA 4J2HA 3R7FA 4DMFA 3IURA 4UHKA 3ZUPA 1NBME 1N9ZA 5B1IA 5IN4A 3P20A 4DIKA 3EWNA 5DULA 1GTSA 3UM9A 4DILA 3EOAI 2OCBA 2H4ZA 3LO8A 3M81A 4RDIA 3U31A 3WSTA 2Y4NA 4QRDA 1U7OA 1U0SY 5JI2E 4M60A 1YT5A 3D3JA 4X45A 5AH0A 4DDHA 4KLRA 4AVYA 2AVNA 4N5MA 5I48A 3TRHA 4ITVA 4AN1A 3VU8A 1IZ9A 3C5EA 4NARA 4OHOA 4MEAA 1RAFA 1CW2B 2QLJA 3KZNA 2VP4A 4W1RA 4PX2A 5CK5A 4IIJB 3B3FA 3QY9A 4IJ6A 5AKHA 4CETA 1FTNA 3GD7A 4NDNE 1LPOA 2QTLA 4GE0A 3WLLA 4CN8A 3BH0A 3VH1A 4BASA 5KSWB 1KBQA 2ISSD 1FMJA 3ZH9B 3AVOA 1U2EA 2FXIA 2BH2A 3HO6A 3TIVA 4B3XA 4PPGA 4ALLA 1YVDA 2JFGA 5KTTA 1C80A 5E3HA 3MWGA 2IXGA 2MMCA 3C24A 4OK3A 3RC2A 3RRYA 5HGJA 2E4XA 2VAVA 4MV7A 3W3AA 2XYGA 4CTJA 1LPMA 1Z8FA 5BT9A 5LOVF 3CT4A 4DR5B 4WZ6A 1I4LD 2JFZA 2QLFA 2UZAA 3HXLA 4GC5A 1LB1B 2GARA 3DL7A 4MH0R 3K3PA 3R9IA 3JQAB 4RZXA 1Z2AA 4Q7JB 1VMIA 3PGA1 3GH3A 5AUQA 1DHRA 3IP5A 3SZUA 3C48A 1IN7A 2VP3A 3JR7A 4Y0NA 2WWYA 2OR3A 4JI7B 3DAHA 2OBFA 4LY9A 1UK9A 4KV9A 3WRVA 1U7TA 5B7GA 2CXXA 3GHYA 3LAWA 5LA6A 4MHSA 3AY6A 4XJVA 3OZGA 3BMOB 2RBGA 4MV3A 1K9VF 1XZEA 3PHBE 4J9VA 4U1RA 4W7IA 1VIDA 4EENA 4HLCA 3DZ8A 4OMCA 4RKFA 3KKQA 1CTQA 4EMBA 1RIFA 3UOAB 3ELBA 2BR5A 3R24A 3UHFA 3KL4A 4AKGA 2OD2A 1RCTE 1XZJA 5JV5A 3SP1A 5AICA 2A35A 3W2TA 5TC4A 1JVSA 1RYEA 5I47A 1RM5A 3A6GA 4UE6A 4QXOA 4AC9A 2LP4Y 4BV9A 4HNVA 2QBYB 2AZ4A 1ZD5A 3HSSA 4G86A 2QV0A 3TMKA 2QM0A 3OJXA 1W4CA 1B6RA 2IS4A 4JVOA 2OFWA 5JSFA 3UAWA 4I5DA 4NH0A 1QAOA 4MRMB 1YBFA 4JOCA 4XSGA 2V8OA 5KYYB 1BEZA 2FUG1 1B4DA 1HLPA 4DJJA 3QLEA 2XR1A 5DLEA 1X94A 2FZVA 4W6QA 4A8JA 4KAFA 4QDZA 4FHFA 3S7ZA 2FFRA 3JYHA 1VHJA 3ETHA 2IDKA 4Q6BA 2MDTA 4AL4A 4F5ZA 1YZQA 1QHXA 2GERA 3H19A 5DISB 1EM6A 2OCGA 3AHEA 1R6BX 1I2DA 1M34B 5C7OO 5MN5A 1E0DA 1MQ8B 3F6RA 3O6VA 3NKFA 1F2DA 2W2OA 3HP1A 4D9GA 4LJSA 4KU4A 3KQUA 1ZM3A 2PR7A 1U8EA 1NBOA 2CFIA 3C3PA 2EIXA 3ZQ4A 1RBQA 4ZAZA 1HQCA 4RIFA 1JHXA 1FU8A 1M8PA 2R8XA 3T5MA 1TF7A 3PD7A 2JH3A 5C8DA 3D6VA 3Q1KA 2CDBA 4MWEA 4OD0A 3EIUA 3P2JA 1HL3A 3KXKA 4OY3A 2ZCUA 1G3UA 3ST7A 2X8BA 3C6MA 4E46A 3PB3A 4O4LB 3WYDA 2O14A 4M38A 1GDDA 2AS0A 3EUAA 4BJ6A 3MB5A 4U5XA 2XT0A 4WQMA 5JBNA 2VNHA 1AKNA 1UMBB 1E7WA 2VHZA 1BMTA 4JLBA 2W48A 3DVAA 1XEAA 2CVQA 2E48A 2PD3A 1GCOA 4EJSC 2W9XA 4ABTA 4ANFA 1YVPA 4HWTA 4RHTA 4E08A 4DQVA 2G5PA 2HSZA 1JFFA 1K8RA 3H9JA 5ALWA 5F3RA 5HSGA 4LBWA 2DH6A 1GYRA 1P8JA 4X1YA 2EERA 4QOEA 4BNUA 4HEHA 3CH7A 3ISTA 3Q8MA 4J0HA 4RULA 1UBTS 4Y7DA 1M2VA 1OZHA 4Y1RA 1BE6A 2G4LA 2GCGA 3A1WA 4U2FA 5EAIA 5BUZA 2JJ2A 1TD1A 4X54A 4ZTZB 3CLRC 3Q5EA 3DAOA 1U04A 4OQXA 1Q2UA 1WB6A 1XLTC 4PGAA 3LQ4A 5DTIA 3VKFA 4EJ0A 4ILKA 3A9CA 1CXZA 1OA0A 2Y0DA 3LT4A 1W29A 4IHJF 1ILWA 4JLNA 4DS3A 3DMTC 3WIEA 3IA2A 5FBZA 1M6VB 2AI1A 3EGCA 4OXRA 1BKSB 3QUTA 1R0LA 2P6OA 1G20A 5GVSA 2ODNA 3WQRA 3MJCA 4U3JB 4ZVUA 3BJRA 4ZQGA 1ZVMA 5CVTA 1Z8HA 3ITDA 2VOEA 5JADA 2OILA 1GRCA 2CFOA 2PEYA 4RJIA 1NRXA 3G8DA 3UMFA 2EP7A 2AIRA 2EFJA 4AQYB 4K9NA 3BAZA 1DWUA 2OMEA 2WM8A 4L72A 5AM4A 5HCIA 2I71A 4YMLA 4IHJA 4HR7A 4CM4B 4JVLA 3PQFA 4OREX 4AF6A 2G63A 3EODA 3N0VA 4KDFA 5KWSA 2GEKA 2I34A 1IXSB 4YRRA 2OZLB 1NQ5A 1TYDE 2C3OA 4Y3UA 1MB4A 2ZCVA 1JKXA 3EZFA 3C87A 4DR6B 2F1IA 1HTWA 2FGJA 2G08A 3GYBA 3GWZA 2DKOA 1GG5A 2NSDA 1V7PC 2QOEA 2HZ7A 5IT5A 1QE5A 1UP6A 3THWA 2QMQA 4ZOCA 5F7JA 2VHJA 4H6PA 2GSDA 2Y1OA 4ZP1A 3ZVRA 1B23P 5CA0B 2JD0A 1PQYA 3E35A 3IQZA 2Q0QA 2FB9A 3GHHA 1J0XO 1PT8A 1BFUA 3OC0A 1T5BA 4OHZA 2QXYA 3DDSA 4RTLA 5JJLA 2FJUA 5AT1A 2POCA 4Y2SA 1QVZA 3TQSA 3O7WA 1NN0A 1A8UA 4GS5A 5D01A 4D8UA 2QRPA 4GEGA 1X9GA 2Z6VA 4LNHA 2M98A 2FV8A 2AUNA 4NKRA 4TXNA 1SK8A 4MYDA 4ADSG 3J81k 2DKNA 3EZLA 1U9CA 3FNGA 2I2BA 1T6BY 2CNNA 3GRPA 2P30A 3F9RA 5DN9A 1Y5RA 4KWTA 3SZMA 3VPBA 1ZVVA 2GD0A 1YBHA 2X6RA 3DE5X 3DWEX 3T3MB 2QYOA 4DBLE 5KWEA 3NT2A 3KCNA 1QPBA 1WDLA 4PAGA 4UBMA 3QVXA 3NUQA 1KI4A 1YZFA 1LXCA 2OM2A 4FFPA 4REQA 3WLKX 4D80A 2PZFA 2VT3A 2XKBA 4KWCA 1P2DA 1RLJA 1FDWA 3QITA 4PLCA 4AYWA 2JAPA 3ZNPA 4E70A 4GPIB 5ESRA 1NV8A 2GPYA 1JT2A 2RHJA 3W5HA 1EGMB 2QD5A 3NATA 1M8FA 4PG7A 1GEGA 3INTA 1B8PA 1L7VC 4YDQA 1R37A 2WU1A 1XTRA 1FUUA 2X19A 2YIJA 2ZS8A 3LCCA 3MYRA 3RT7A 4AZVA 4P81A 1X1CA 3H6HA 1QO0A 1WSAA 4BTLA 3ESZA 2HSEA 2OO7A 2DT5A 1RQRA 2WPNA 1DMSA 1KRHA 3H9EO 4Q4DA 3AI1A 1UXGA 2ON6A 4XLZA 4KPUA 3TRFA 3PGMA 2JNWA 2VC2B 5L7WA 2V5UA 4M3NA 3D0KA 4NDZA 5GGYA 2Z08A 2H9AA 4MCHA 4ZT2A 4KAJA 3ZBQA 4BO4A 1DC6A 1M5RA 3HN7A 1TDJA 3H2YA 1KFKB 3KKOA 4MQUA 2Q6LA 2FSPA 3FLEA 1RI5A 1OSNA 2W2KA 1UINA 1UODA 1E4VA 2B8EA 2UYGA 5SYMA 3DL2A 4WXYB 2ZJYA 1DJNA 3W8EA 3OMWA 2I4TA 4UTVA 3IPYA 3RS3A 4ILEA 1UJNA 4LE2A 4Q7KA 4JBGA 4QUKA 2B2NA 1RYYA 2F17A 2Q2VA 1ZMOA 1QANA 3CS3A 4WD3A 4BNTA 4JCCA 1IQ0A 2RCNA 3E48A 4JCOA 4WASA 4WN9A 4XZ3A 1IFXA 4XFJA 4XIGS 1FXUA 2A9VA 2WIJA 3ZN2A 1QGAA 2P6PA 1I1HA 3IAS1 5A62A 3CVJA 1Z6XA 4RXMA 3RIGA 3SQLA 3ZU5A 5C5EA 5KJFA 4EUEA 3W2GA 1NXXA 1MXFA 1DX6A 2G0TA 2Q7XA 3R3ZA 4DZRA 2WF7A 3DE6X 4QUBA 1AO0A 4JGGA 1MO5A 1RQ2A 3IS3A 1H0RA 4B1FA 4BNNA 3AR5A 3EC7A 3LSTA 4WBNF 2OOSA 1C81A 3HR4A 1EE1A 2PLFA 3JCZA 4P84A 4ZAXA 3TPFA 1F8UA 4AT1A 3C74A 3VU1A 1A1SA 1X14A 1UZLA 3TD2A 1U3TA 4FVTA 3SQDA 2BI8A 1VL5A 4HNHA 3AUJB 2F8MA 2P9TA 4P3KA 2IPLA 2LXNA 3PXEA 4B2PA 3CE6A 4X63A 1NAIA 4FZJA 2AD5A 3ZGNA 3A26A 4D82A 3DCYA 1N2XA 2RGGA 2W83A 1XRQA 3V1LA 1NBHA 1TKAA 2QG4A 3EOZA 5CFNA 3I5MA 2QN2A 4QECA 2G9RA 1Y3DE 3ZLBA 5BN5A 3GNQA 2PX2A 4WBNA 4PYKA 3KUUA 4EJMA 4IJMA 5ADUS 4OBBA 4JC0A 3KPVA 3L43A 4XPIB 4L15A 3VI3B 1T36A 1ZCJA 2AK3A 2FQ1A 2YW2A 4R1LA 1E96A 4RL6A 2O23A 2W6ID 5H1YA 4BX8A 3NHWA 1Y5NA 4XE5A 1HEYA 1SQ0A 2BFFA 4TTJA 3I2GA 4ASUA 5JAIA 3FXAA 5CP8A 1EUCA 4NU0A 5JFTA 3OWOA 3ZDQA 4YUXA 4KO8A 1K8XB 1C3EA 3TL2A 2XI4A 1UAYA 3R5HA 1Y81A 3WLIA 1C3LA 2XQFA 1G5PA 1ZI6A 3T5DA 1SVMA 2XUHA 2J5KA 3UV3A 4PFKA 2G8LA 1Y80A 3IEXA 4ZYYA 5BSHA 2X6QA 4PCUA 4BPRA 3Q9LA 1KAMA 5KX5A 3FNQA 4ZVTA 2NPOA 3MXTA 2ZIVB 5KYWB 4F6LA 3GLIE 2O2CA 5F98A 3IEPA 4BNKA 4GH5A 1N57A 1W4ZA 1J23A 1SBYA 4KIFA 4YMSA 3W7VA 4AG3A 2WWGA 1W8DA 1MNQA 5DEIA 1D2NA 3IHLA 3TNLA 2I3AA 2QRUA 1PR2A 2MSWA 4RF5A 4L27A 2HSGA 5AJHA 1ADJA 2ONYA 3MAGA 5GPBA 3SZLA 4F1JA 1QDEA 4LOJA 4ZGBA 3DQPA 3MQ4A 3SZOA 2KE5A 4N0PA 1FFSA 2CYAA 2IZ7A 3CWCA 4E4YA 4DMUB 4IR7A 4R6WA 1OUMA 2AK2A 2IEDA 3NEAA 5B1HA 1ZC4A 2NUAB 4EYQA 1HQKA 4QBGB 3IP6A 3CPHA 1E7MA 1Z8DA 5F51A 2IEBA 3JD1A 4D2IA 3BGSA 4ZCRA 4W7HA 4G5SA 4MIEA 1WXGA 2Q1TA 6LDHA 5ICMA 1G7RA 2WTNA 1HNXB 4DQDA 4BMNA 1Z35A 2B35A 1ETHA 4QNNA 5FFFA 4NBSA 4WW0A 1IWOA 2YJTD 3GPBA 4UNNA 5EMNA 3VO2A 4HDKA 3UW3A 3U7QA 1P4GA 3F6BX 3DV2A 5F9MA 4OM8A 1KZYC 4LRWA 3SM9A 2GPTA 3RC3A 1U6JA 4JBXA 3L6CA 3G59A 2V7TA 2WABA 3EEFA 2B7BA 3R3UA 1T1IA 4L6IA 5C52B 4BBPA 1J0DA 4W5JA 1MZPA 1USVA 4JJ8A 4LY3A 5FNVB 4ZDKA 4R2LA 2PKXA 4XPZA 1YDEA 1Z29A 3FY4A 1R5JA 3GBPA 3JYPA 4CCYB 5JRZA 2QXUA 3LWDA 1SHLA 2BHSA 3QUSA 3R8XA 2A3NA 4NE2A 1VIYA 1Y63A 1LBIA 2J0EA 2EFGA 2PXXA 3GPIA 4K0RA 1NATA 4CKXA 4EI7A 2AC7A 1KVRA 1XZGA 2G06A 2P3OA 3B6JA 3P1JA 5ESDA 2YIMA 2NYRA 1DAEA 1TUBA 4XGQA 3RADC 1T3LA 4C78A 2AXEA 4HDNB 4FZRA 1QORA 2D2EA 4F3KA 1Z7GA 1NMEA 3NPAA 2P2YA 2VH5R 5C5IA 1H4QA 1C9KA 1CDEA 2VIIA 2XRFA 3P0RA 4P3NA 4C6HA 3CCFA 1D8TA 1UBNA 1QFMA 5IUJC 5EE0A 4Z1MD 3N9IA 1OMOA 3ZCVA 2P79A 1UJMA 1DQSA 2RH4A 2YWHA 5TRTA 3WIOA 2B5OA 4II2A 1D0IA 3HJCA 4HUJA 2WB4A 3T7KA 1R3UA 4FSHA 2ZUTA 4CL2A 4LVOA 5K0TA 3NKLA 3TKAA 5K8UA 2HA4A 1Z16A 3U9LA 1PDOA 1IEVA 1TKRA 1YUBA 4OJTA 5GJVC 5IKMA 1U7PA 1THTA 2H2AA 1NMXA 2GNOA 2Q50A 1OBCA 3DE7X 3LL4A 3NOVA 2M2IA 4PPNA 3RUAA 5ALIA 4CT4B 4PZ9A 3WLEA 5KC9A 3D1JA 4UM9D 3HJBA 1EFLA 2OO5A 2R86A 3TF5A 3KVRA 3KT8A 5MF6A 1T3SA 1Z5UA 3PTZA 4F4DA 4YAUA 2VHVA 3X1MA 3H7AA 3K35A 1EFPA 3F7NA 1V2GA 4WINA 2V8BA 1SFRA 5CURA 4HOYA 4RD0A 4RA9B 3HK2A 2Q21A 4MRPA 1JQBA 3A58B 4TTRA 3ETCA 1NURA 5TQ2B 5CR9A 3QKTA 3VU9A 2RAUA 1E2QA 1ZGBA 2C42A 4UCQA 3UYKA 3X1JA 5HWSA 1IBCA 1VMAA 3HDVA 1ZR4A 2BTQB 4PLHA 3D4IA 4Q12A 2QAIA 3C70A 2C99A 4QUAA 5L4SA 4KRXA 5JE8A 2J3KA 1SHZA 5REQA 2GZDA 2WJYA 5K0EA 3TDKA 4MUYA 1SXJB 3TUZC 3KEOA 5T3YA 3M0EA 5LQDA 1Z75A 2RGXA 3HHEA 1AA9A 2WTBA 3BSFA 5D6NA 1UDAA 1FYXA 4BKUA 2XQIA 4K1XA 4I50B 2IOQA 3ZOZA 1A4UA 3CZ4A 3DBLB 3ODGA 2HRZA 1ZM2A 3HJGA 5EXEA 3IVXA 2R6DA 1N2EA 3K5PA 5DRTA 5HE9A 3V00A 4FPXA 4ME6A 4I8XA 4RHYA 3KJGA 2ZTVA 4GI1A 1TTPB 4ZOLB 3UFXB 2I67A 4M9ZA 1WUJS 2N9UA 4OLFA 3UICA 5KPJA 1HG0A 3AM3A 4CF4A 3FYUA 2GI4A 2HDNB 2ZQ5A 4N82A 4RKQA 4XUEA 3H8JA 3TUIC 1YB4A 1ZJ6A 4UDYX 4ZI7B 1SC3A 4EHKA 2O0KA 1DKPA 4L8WB 1JQEA 2BP7A 1WULS 3NYIA 2JI6A 1XBTA 1Y3CE 2AKAB 2OXEA 3A05A 1MNAA 1KYVA 4I9UA 1PT6A 2H4HA 1USUA 1O97C 4Z49A 2R62A 1N2HA 1Y6ZA 3WISA 5JECA 1L5HA 4ZMSA 3ZJVA 2HF2A 1J8FA 3CMCO 3RVQA 1SK9A 3BCRA 2CLKB 1XQWA 4QDOA 4I1VA 1TIKA 3PHCA 3GEIA 4PYMA 3O21A 4YPOA 2O2GA 5L3QB 5ED4A 1RPZA 3PI7A 5EMJA 2VTKA 2J08A 2VRNA 1T8SA 2FPKA 5AYVA 1PKEA 1SIUA 1NVGA 2BKLA 3FNEA 3RC1A 3WMFA 1C8BA 3QWBA 1WTAA 1EQUA 4YREA 1OH7A 4Y6QA 2IU6A 4PYRA 3B1ZA 3DDOA 1FTYA 1Y9AA 2OXCA 3SNKA 1Z8NA 5J4LA 5CG2A 4KK3A 4CUKA 5ALKA 3IUSA 1VI2A 3OE7D 3O8LA 1E3TA 5EQTA 2BGTA 4BX0A 1W93A 3BSWA 4Q4AA 1B00A 1PLLA 3ZWBA 4QTUB 4J29A 3GLFB 2J59A 3BZUA 2JEOA 2OUKA 3P2EA 3INRA 3KB6A 2AYZA 2BPOA 3BERA 1R66A 3QU9A 4RHUA 4C76A 1VL6A 1Z2DA 5FPHA 5IWAB 2W6ZA 1ZHOA 1CR6A 4JYCA 1MRSA 5AJZA 2WA2A 4ZDJA 3U4QB 1HT2E 4I0WB 2VHUA 4EUNA 1KNXA 4G0NA 1CC1S 3KFXA 3Q7EA 3JZFA 4HEA1 1E79A 1N33B 2WNHA 2B6NA 2VF5X 4LZNA 4C0AC 1NXTA 5A2GA 2WYWA 3OU6A 2HC9A 1UH5A 4XVHA 4TTVA 3UJ8A 1L4KA 1M67A 4MDHA 1ZCZA 5DH9A 2FR8A 3QA3E 1TUGA 5A05A 1THGA 3WGTA 2Q5HA 1U0BB 2ZYVX 1R8QA 3HRKA 4LX8A 1U02A 4XDHA 1G59A 3HP7A 4UU0A 5JNVA 2MSLA 3ZHUA 1JNYA 1V39A 4GQIA 1MAAA 4GOND 4R9SA 4S0ZA 1AT1A 4BKPA 4BGUA 2YYSA 2QN6A 2Y2VA 5GIPE 1JJBA 1ZW6A 3SIPA 5I4KA 4C7OA 4YROA 2GHTA 1WXIA 2D3TA 1JWAB 1MR3F 2GHQA 1E20A 3B1YA 3LCUA 1J24A 1ML3A 3GN1A 3M5DA 1Q0UA 4G81A 3I9NA 1ZM7A 3ZZTA 4EQZA 4RCYA 3C3DA 3UXEA 2PLWA 2HUNA 1I80A 4LV8B 4J0CA 5JS7A 2IH5A 5D85A 1X7GA 1SXJE 1JJAA 2R47A 2XA1A 3GEBA 5BV8A 1V6SA 1X9HA 4LZAA 1AZTA 1ZGJA 2W0MA 5A7HA 2GHRA 4LQLA 2P2NA 3ZWYA 1AQIA 4FX5A 4M0EA 1JBKA 2KM1A 4R6XA 4B4KA 4C0KA 4OJNA 2XA2A 2QRZA 3RW9A 4NFHA 2NTEA 5JZMA 4WXMA 1NSTA 2AYYA 3ZGZA 1XMPA 4BNDA 4R2KA 1TIPA 3ILHA 3DA8A 4Q3DA 1MBZA 2EJCA 2FW0A 3KXIA 1UPAA 3N7TA 1VYUA 1X0VA 1QLWA 3DXYA 5CIQA 1QIFA 2DKFA 3PENA 3EZ6A 3RUPA 3VU3A 1A27A 4WDRA 1PCXA 1Q3HA 2H0AA 4FGWA 1DADA 3W1EA 2OCYC 3PNQA 3P9XA 5AKKA 3QVUA 4AZWA 2C9OA 3GPCA 1LK0A 1LW6E 1P72A 1QH0A 1M0EA 5EP2A 2HQOA 1PGOA 3THYB 3RS8A 4OAQA 5HTOA 1AKEA 2XD9A 1A7AA 5MN4A 4ESVA 4R0MA 4KXUA 3B9QA 1SEPA 5BRNA 4KH1A 2H59A 1ZL0A 4DV6B 3TPCA 3IPCA 1RTTA 1ACJA 4IIGA 3HFRA 4CZ2A 1DVRA 4K81B 5AK0A 1G4HA 2ZAGA 1QTIA 3KQYA 1Z4JA 1AX9A 1G64A 4CHGA 4DLKA 3DE1X 3IKTA 1VJCA 4BJHB 1Z6YA 2GPAA 1F4VA 3GC6A 1XEXB 3LUFA 3SX0A 8ATCA 3AF2A 1KWGA 2C2HA 3OTOB 1E32A 4Y1FA 3QWIA 2PBZA 1XDDA 2GWHA 3X1YA 3PGLA 3ONFA 4YT5A 3N0TA 2FSFA 4BFVA 2Y05A 1MKYA 1Z4QA 3GMTA 2PBRA 2VT2A 2H5JA 1T9GR 3P0EA 2PXAA 4BX3A 4LHVA 1ZWLA 1OXXK 3E3LA 1ECGA 3AEXA 3ZDEA 3O2JA 3IAEA 4EY5A 4O2BB 3HZZA 4DUGD 3JQ8B 1PHPA 1R9GA 1P2GA 1E2PA 1CJBA 3CLUC 5IAJA 3WB1A 3FBWA 2IGBA 1G3RA 2BDUA 3A4MA 1EAMA 2JB9A 1CHDA 3K73O 3ONDA 2D0PB 3PD1A 3HXMA 3Q8LA 4GMHA 1VIAA 2EVWX 3A1UA 4Z99A 5HCNA 3A32A 4BPBA 2PL5A 1JWLA 4YA6A 2D3WA 1ULSA 2WT8A 2H16A 8ADHA 5AKEA 1ZVKA 2XQKA 4IUCS 4NK5A 1GD1O 3DYVA 3UB4A 1EB9A 1WPGA 2DE0X 4M9RA 4YECA 1X7WA 1XTKA 1ZVJA 2FFBA 4XCXA 3L82B 4XJXA 1KY5A 3ELWA 3R7LA 5KB3A 1XRRA 2GAJA 1VG9B 2WJHA 2AFRA 4LF4B 2FPGB 3GDWA 5FO1A 5K6RA 4G1FA 4O08A 1IHXA 3LG2A 3A4TA 4ZCMA 4LJYA 1TRHA 2O7SA 5DHUA 2VLBA 3GGJA 4I08A 2HBRA 2W6IA 1OXSC 3VDRA 5IYZF 3WP0A 2AN1A 3I8OA 1BXZA 5AXDA 3VBCA 1IRIA 2QZSA 3BB3A 3IXMA 2PH7A 5JDCA 4NPCA 2X0FA 4AJEA 5EJ4A 4I1SA 4LVUA 1U2PA 3N05A 2A7QA 4MGYR 3NMUF 4DEYA 1L8OA 4XLTA 1H22A 5DHRA 2YJZA 3SZRA 5FP0A 2QZPA 4FE4A 1OVMA 1WXWA 2G1KA 2BVNA 2IUSA 5B36A 2NAFA 2ZSUA 3OIGA 2R1VB 1N7JA 4KXNA 4NFSA 3OIUA 5AQEA 3I52A 4ID9A 4O5AA 5E95A 5M04A 1GN9A 3FTEA 2Y1XA 5G0SA 3Q7TA 2A0XA 2COKA 1K8ZB 2H06A 3E84A 1YUMA 1SD2A 4JU9A 4M89A 4S1PA 5DNDA 4NONA 1S2IA 3BHMA 3CA8A 2GZHA 1F8FA 1RADA 2C03A 3ASZA 1PQ4A 3MWYW 3CINA 3GA0A