4TTRA

Crystal structure of legionella pneumophila dephospho-coa kinase in complex with bu2
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
201
structure length
201
Chain Sequence
MVYSVGLTGNIASGKSTVAEFFSELGINVIYADKIAKELTSKNTPCYQDIISHFGSSVVLNNGELDRKRIRDIIFSNSNERLWLESLLHPVIRKKIEEQLIVCTSPYCLIEIPLLFNKHHYPYLQKVLLVIAPLESQLDRIVKRDHCTKKQALAILATQPNLEQRLEAADDVLINESGLSELKAKVNKLHQKYLREAKIKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Legionella pneumophila dephospho-CoA kinase reveals a non-canonical conformation of P-loop.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Transferase
molecule keywords Dephospho-CoA kinase
total genus 71
structure length 201
sequence length 201
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ttrA00
2C04A 2LCFA 1EXMA 4RD2A 3RSLA 5BXQC 2GBLC 1KI4A 5C4GB 1P9WA 4QFMA 1Z2CA 4GT1A 3FB4A 2WWHA 4Q4AB 2NPFA 3RS3A 1D9XA 3T06B 4AD8A 1NVVQ 1XPUA 2Q3FA 3QIAA 4GMXA 4V0ME 1E2FA 1IN6A 4B6FA 2DFNA 1C1YA 3SFZA 4C2UA 2QBYA 4LJAA 4UNQA 5DH9A 1B0UA 5CB6A 4F4IA 3EPHA 1M8PA 1ZJ6A 4X8MA 2GNOA 2I1QA 3THWA 3K70B 5FPHA 1ZNZA 2XX3A 2IYQA 3DEFA 4V0NA 3SC3A 4DLVA 4JLDA 2QG6A 3NHBA 2D2FA 2JATA 5TARA 2YHSA 1JPNA 3Q85A 3B1YA 5J4YA 2AK2A 2IYZA 2BMDA 1SULA 1XEXB 3IGFA 1BOFA 4DCTA 2KI5A 4IHQA 4NYMQ 5F9HA 2ASEA 4A36A 1P4SA 4HLCA 4I1OA 4P4SB 3RWOA 3MGCA 5JJIA 4JLKA 4AKIA 1DO2A 1N5KA 2IA5A 3CRW1 1C9KA 2PCLA 1KOFA 2MSDB 1XEWX 1HH4A 2O8FA 1F2UB 1E2DA 1HV8A 2ZAMA 4PC2A 1VG1A 4GRAA 2VH5R 2XJ4A 4W5WA 4ZCLA 4Q66C 1YZTA 3QPVA 1NN5A 4PFSA 2EQBA 4TT3D 5AJZA 3R8CA 4E5UA 5LD2C 4MKFA 1M7BA 1EFTA 3REFA 2JLVA 1KK1A 1DG3A 1DAKA 1N6RA 1ZD1A 1XNJA 2VL7A 4M1KA 2OHFA 4I1VA 2R62A 2WMNB 4MUBA 3T34A 1KI3A 1F60A 5L8VA 1E2KA 1JAHA 1GIAA 1VECA 4HATA 4YDHB 5FOXA 4NZYA 4LJ9A 2O0HA 2YC2C 4AKHA 4LBYA 3TSWA 4LY6A 3T1VA 2BM1A 4IOLA 3BERA 2PJZA 4D4MA 2RGNC 2FZ4A 4ZI2A 2XB2A 4N0DA 4P4TA 2PZEA 2REXB 5DI9A 5GJCA 1WBBA 3TR0A 2JLWA 3OEHD 2C9OA 3QY0A 5C2JB 1T3SA 1ZUHA 1Z0DA 1VTKA 1T6NA 4QJ3A 3QE0A 3U6KA 4DCUA 4TQAA 2ZYUX 4HLDA 3VTKA 4XD7D 2OXRA 2ZRDA 2CLCX 1SXJC 1IY2A 1KO1A 1TNDA 3THWB 4M2LA 4DT1B 2QL6A 2ZSBA 3K0EA 4WOPA 5E95A 1U9IC 2VSOA 4HLUC 2OCPA 1E79D 4DWJA 4LBWA 3B78A 2TMKA 4ZIRB 1Z83A 3WNCA 3I32A 1OKKA 1JR3E 2B7CA 1NLYA 1VG8A 1OPXA 4JVNA 4KODA 4G5QA 4QHSA 4ABYA 1S9DA 1RRCA 3ONWA 4LSGA 4A2PA 1F2TB 2XITA 1BMFD 2ZRLA 1OV4A 4OQNA 4D2IA 4LPKA 4DB4A 4Z51A 3U4QA 4A6XA 3OF5A 3DOEA 2CHGA 4JLNA 2NO0A 3TQCA 1FP7A 2W0SA 4LJ5A 5BWMA 1QHXA 4BLQA 2G77B 2GXSA 3B13B 4Q1AA 1YR9A 2A78A 5AUQA 2CHQA 1XCGB 2WOOA 1E2JA 3GJ3A 2HJVA 4ARZA 2WSSA 1GDDA 4NP6A 2A5YB 4WA7A 4Q1FA 5HE9A 4GZLA 3N70A 3CPEA 1GM5A 1LS6A 4U5XA 1KI8A 3ND9A 3QKRB 3EIEA 2FPLA 5FPYA 2ANCA 1G8FA 3B1WA 4TSFD 4MQBA 1VIYA 2YOGA 3LLMA 2QMUA 3KFVA 3SBEA 4CW7A 1N5IA 2VBCA 2CJWA 2FDCA 1LFDB 3LX5A 1XRJA 1OT3A 1T8UA 3R9XA 4GNKA 3PEVA 3A1UA 5GADl 1CJUC 2ZE6A 1YR6A 4OJKA 3ZGXA 1UBEA 1R4AA 4KFUA 4XH9B 3CPJB 4JJZA 2CVHA 2JIZA 3F8TA 5E7MA 1YZNA 3EZ6A 1EK0A 4PSAA 4XD7A 2AK3A 5JMTA 2WWYA 2RB4A 3TMKA 2XOKA 4QM6A 1SVOA 2AFIE 2WJYA 2UVQA 2OLKA 3WYFA 2JJ1A 4B3GA 1MRNA 2HJGA 4JLOA 3AM1A 4LC0A 2O8CA 1A82A 1ZRHA 3C8UA 1JQLB 2VO1A 1R5NA 2C95A 3IEVA 4EFLA 2UZ3A 4TYNA 3I61A 2VRWA 2XEXA 3JVUA 1E4VA 3MD0A 4MYUA 3KFXA 4Q1EA 5JFGA 4PPGA 3L0SA 1BMFA 4HAUA 2HYDA 2KBEA 4GI7A 2YYZA 1YHNA 1R10A 3MWJA 1X8JA 4HZUB 3BB4A 2J59A 1MO3A 5BQ5A 1GNPA 3N2EA 4KYUA 4Z1MA 4HSEA 3DM5A 4ARZB 4FMBB 1G5PA 1TF7A 1XXHA 4B47A 4A4DA 2ZS9A 1IOZA 3AQ4A 2AN9A 3D8BA 1XPRA 3Q3JB 5E7JA 1HE1C 1PLLA 4U02A 1OFHA 1K8RA 1TU3A 3NDBB 1CR0A 2ZQ5A 3VX3A 4A0HA 1CR4A 2Z83A 4US1R 1OIVA 2BC9A 3K53A 3MAAC 4QXAA 4FCWA 4ZIRA 2CDNA 3OHMA 5FTKA 3NC1C 1E9FA 4RZ2A 2DBYA 1TL7C 4KI0A 3R9IA 4BEBA 1H8EA 4Q03A 4AK9A 1TQ4A 5FTJA 2IYLD 4GBMA 1IQPA 4KCGA 4A0GA 1OH7A 5CITA 1WRBA 2K5UA 2NGRA 1KI6B 3LNCA 3FHOA 5EE3A 1ZINA 1FQKA 2O8EB 1WCV1 4DZZA 5DN6A 3GJXC 2F3TA 5JBQA 5BN5A 3U2QA 2CXXA 4GFDA 2PEYA 3WRYC 4YMTA 4ASUD 1P2SA 4QBHA 2C99A 4MYTA 2QSYA 1UBGA 4YMVA 4YLGA 3BRWD 2AX4A 3ASZA 2CCGA 1NL3A 4TT3A 1CJVC 2BMFA 2WAXA 3C5HA 4DC9A 3KXLA 2X1VA 5EXXA 5K8UA 4OQMA 3SQWA 3AVTA 1GKUB 5M04A 1P6XA 1TUIA 5JZVA 4YXWD 1UKVY 1P7CA 2HCJB 3TW4A 5GJBA 2JLQA 1Z29A 2Z4SA 3NBFA 4FMCF 2JA1A 5SZIA 3X1ZA 3I8SA 1N6KA 4JT2A 2V9PA 2BDTA 3VKHA 4ILEA 4NL4H 1MKYA 2OCBA 4ESHA 3UG6A 2QROA 5JS8A 2BKUA 4KLNA 2HT6A 1OIXA 4W7SA 2FFAA 3RS4A 3I1FA 3VHXA 1W36C 3QXCA 3VR1A 1EG7A 2HXYA 4HLQB 3LQQA 2AKAB 1L8QA 4JLBA 4D0LB 4WZ6A 1CS4C 2FG5A 1XZPA 2WJJA 2ONJA 1QHSA 2OXCA 1PZNA 4DT1A 2XJ9A 2J45A 3ZZUA 4D4JA 3B1ZA 2O8CB 2F43B 1VYTA 3TVDA 4D80A 1XD2B 1HYQA 2D4HA 2EYQA 2C9CA 1JXMA 4QGFA 5JEDA 2VP9A 2PT5A 4TSFA 1MRSA 5UKDA 2PZGA 3FOZA 1S96A 2JJ2D 5AUNB 3KJEA 3EC2A 3ZVNA 5JSZB 2W6JD 1F2TA 4QGHA 3EARA 3IPYA 4UKDA 4KFTA 4QGAA 5J40A 4E07A 3NBXX 4H1VA 2D2EA 3KXIA 3U4QB 2WWWA 1CU1A 4G5OA 4G0NA 4S2EA 5D3MB 3RDPA 4HUTA 3A1TA 1IN7A 5J4KA 1GL6A 1N6NA 1KZGB 1CJMA 2JIZD 4DIEA 4ESVA 3NDPA 1Q21A 4NE2A 4LV8B 3CIOA 2NO1A 3C4JA 5FBRB 4HAWA 5E7IA 4AKEA 4CIDA 4RVCA 2XNDA 2QMOA 1UEJA 1SXJE 3U44B 5IK2D 4MYCA 2CK3D 5KNCA 4CEJA 2JAQA 1VCIA 1YRBA 3LA6A 5KYKA 4AI6A 1VPLA 2YC4C 1NBMA 2B92A 4BLPA 2MSEB 4IDPA 2FSFA 2O8BB 1TF2A 3LWNA 2ZYTX 5FBLB 1UDWA 2OBLA 1KI6A 1LVGA 2JJ8A 3FPAA 4BRWA 2REBA 5FR1A 2QAGB 4CEHA 3LXRA 4DLUA 4EJSC 5BYJA 1AKEA 1IY0A 1F5NA 2RMKA 4DCVA 4WXPA 2IX3A 3LVRE 4N3NA 3TUIC 4DUGD 4OI2A 3I72A 5HKKD 1ESMA 1ZU5A 2F1JA 1DAHA 2GHIA 3I4LA 3MWKA 4U00A 1T3LA 2QRNA 2DYKA 3W5JA 3N2IA 3SJZA 3T1TA 1T5IA 3Q9LA 3QNUA 4JL6A 2CHVA 4B3FX 3IQXA 5CK4A 4RFSA 3VR6A 1H8HA 1T0JB 4URZR 1W48A 2DCUA 3K09C 1HQYE 1OE0A 3OESA 3KUCA 3TR5A 5D3MA 4B73A 5G41A 2PH1A 3AVPA 3K0SA 2FSGA 2IYVA 2ZETA 1G3MA 2BM0A 2QI9C 3TUJC 5JECA 2X2EA 3MCAA 3R9WA 4IW3B 2OLJA 3PEWA 1GSIA 2GZAA 4OHVA 4WZBE 2CL0X 4V03A 1TTTA 1ZC4A 5EQTA 2GDJA 4MDEA 1I2DA 3KKPA 2CL6X 1NSFA 2RGEA 2IUSA 2FJUA 2YWEA 4L16A 1PV4A 5HTKA 4DSUA 2AR7A 3CH5A 2A5FA 3PQCA 4TL8A 2J5XA 3W8RA 4HUQB 3RLFA 5FOVA 3HYRA 5LBIA 2QTHA 1AZTA 3EIHA 4XTCS 5IHPA 1N6LA 4TMKA 1S0UA 4TLDA 3A4LA 3UWKA 1TQ6A 4BUJA 2I1VB 3AUYA 4A6PA 2OCAA 2N42A 2VSXA 3C7KA 4PZZA 1BH2A 4V0OA 4C0LA 4KAXA 1K5GA 3PUWA 1OF1A 4Q9HA 5A5GA 1J8YF 2W6IA 1W7AA 1B23P 4D4LA 3FVQA 1DS6A 3E2IA 4B74A 2RGGA 2ZRJA 3CZQA 3NBYC 2BBTA 3SJAA 4FI3C 4D26A 1O3YA 1FTSA 2RGNA 2ODEA 4EPVA 1GVNB 1M2OB 2R6DA 2V8OA 4R71A 3IHLA 3NC0C 1WDTA 3CUEF 5CLQA 2ZREA 1COWA 3R8FA 2XTNA 4PPNA 4RZXA 4C0SA 2Q3HA 2H16A 2HXSA 4LZZA 1SVKA 2FN4A 4C3ZA 2GETA 2W2VA 3A1SA 4JVSB 4NYIR 1XMIA 3P1JA 3U44A 3SJCA 3VKWA 4OL0A 5JCPA 4G5RA 4UJ3A 2FA9A 2HV8A 3A58B 1ZUNB 3EXAA 5IT5A 4GSYA 1EX7A 4MKHA 3UMFA 2V4ZA 3DPUA 4B2IA 2HYIC 1ZCAA 2PJRA 1DAGA 1ETUA 1X8KA 3IEUA 5TDHA 1KY2A 2NMVA 2WWFA 1HTWA 3TGPA 3ETLA 1JEEA 1OLOA 3Q7PA 2QM7A 3UWOA 2PT7A 2QEQA 2ZJ8A 3H0KA 2BBOA 2PX3A 1W2HA 4HDQB 1AQYA 4FWIB 5EUQB 5FOTA 5G3ZA 1VCNA 4Q9KA 1S8FA 2ZE8A 1FUUA 3CRRA 3AVVA 5BW8A 2DFTA 4PQRA 1DE0A 5FOSA 1BIFA 1AGPA 5JI3E 1FNNA 4TL7A 4LHVA 4K46A 4A2WA 2ZSDA 2A5JA 5IK2A 4DIDA 5LB2A 1O87A 1ZP6A 4JVMA 1IXRC 4BFSA 3EPJA 1RYHA 1G17A 2F1RA 3B9PA 1W36D 1N5JA 3NBZC 2QPTA 3RWMB 1II0A 2FZLA 2JDIA 2XSZA 5KTYA 2G1JA 3W90A 2VLIA 2GXUA 4BE7B 1UAAA 1N6HA 2J7KA 1Z0IA 1Z5ZA 5JRZA 1SVIA 1S2MA 2D3WA 1YU9A 5G53C 3FMFA 1IN5A 4MYHA 4TYQA 2OESA 4XOIA 4BRUA 2GZDA 1G6HA 3TQFA 1JEDA 4PHTA 1HEIA 2AL7A 4BQSA 4HYYA 2ZVPX 4EIWA 2E87A 4RFVA 2F1IA 1S3GA 4E22A 1J7KA 2GVDC 2IHYA 1RPZA 1OFUX 3CO5A 4RCZA 2VP4A 4RZUA 2WKPA 2MMGA 4OHZA 3D3QA 4Z8XA 2IS6A 2V54A 3NH6A 1MV5A 3LBIA 3W34A 1W0JD 4ZV4A 5DSZA 1ZD9A 1U9IA 3ZYCA 5JCZA 1NNEA 2WV9A 5AJWA 4WBSA 1U8AA 2WVJA 1DO0A 1GNRA 1II8A 4D6PA 1NJGA 1TADA 1VYUA 3IBYA 2GVZC 4I1UA 1ZM4A 2IYUA 4DLYA 2PMKA 2ECKA 4ASUA 3GLGB 1RRFA 2Z6VA 3OEED 4OBEA 4C0KA 4LYFA 4RCYA 721PA 2CEAA 3MFYA 4LJYA 3Q8XB 4PTLA 3ZVRA 2Q6TA 3VMFA 1IJEA 1YRAA 3BH6A 4A82A 2RGAA 5KDLA 3EZ9A 2BJWA 1X8LA 4CRWB 1DG1G 3EG5A 1II9A 4MKIA 4GDFA 5EE9A 3AB3A 4URXR 3EPKA 3CKLA 4UJ5A 3U3OA 1G7RA 4JLVA 1QRAA 5B58C 2J41A 4PC1A 1E0KA 4ACAA 2NO6A 4Q5IA 2R8RA 1BKDR 3RS2A 1HE8B 1L7VC 4JYBA 3S1AA 4IOJA 3BK7A 4BEJA 2YOHA 1OHHD 3WHKA 1EX6A 3A4NA 5EE0A 1FQJA 3SDZA 4QKQA 5B2ZA 3TVTA 1FOEB 4FWTA 1YZLA 1G7TA 1OFIA 2CE7A 3QF4A 2FEOA 2WJVA 3CBQA 4B3BA 4F7WA 5J4VA 3QKSB 2ZRMA 2ZJZA 1YZGA 5LPNA 1G3QA 3B8HA 1IM2A 1AA9A 2XXAA 3JZAA 3QF4B 1N0VC 2CE2X 2LKCA 3QI2A 2V6JA 1W46A 2VHUA 2A3RA 4ACBA 3PEUA 3CRMA 3L8ZA 2N1BA 3QSYA 4BZQA 4AYWA 1OXSC 3R7WA 4EFNA 3HR7A 3ADBA 3IO5A 3KTAB 3H84A 3R20A 1GNQA 2R2AA 3EAQA 3OE7A 3MRSA 1I4TD 1I4DD 3K0AA 5DYIA 3PXGA 5JJKA 3C15C 1UEIA 2LWIA 2C9YA 4DSNA 2HCBA 3GLIB 2A30A 2F55A 4EQ6B 1R0XA 2ZR0A 3KKNA 3LAWA 5HR5A 4IDNA 2G83A 2GCOA 1KYIA 1GOTA 4OHWA 2EFEB 1R8QA 2ZI9A 4NH0A 3GLGA 1AK2A 2HF9A 1R5BA 1XTIA 2IYTA 2IHBA 4FMCB 5TB5A 3DO6A 2DB3A 5JJLA 1NY6A 2FF7A 4OK3A 1N6OA 5EUMA 1SQ5A 3GLHB 3RNLA 1A7JA 2ZS8A 3T5GA 4DLTA 1CKEA 3GEHA 1ANKA 1NJFA 2GZHA 4F38A 3ZD7A 4BLOA 2CK3A 2ONKA 1IONA 3GQBA 4NYJR 4DLWA 4AWXA 1CJTC 3GLIE 2EYUA 5DHFA 3BWDD 3F5FA 2WKRA 1G4UR 1I2MA 2H18A 1XBTA 1GRRA 2OEPA 4TMXA 3AVOA 3LO5A 1DTSA 5EP2A 1MO4A 5TMPA 1NN0A 1U8ZA 1I4LD 4FMDF 4R98A 3G0HA 1VG9B 1ZNWA 3KDSE 3E5HA 1EFRD 2QGNA 3GJ7A 4D81A 4EJSA 3U6BA 1EFRA 1XJQA 4NBSA 4Q4HA 2VF8A 5FUXA 1KAOA 5F3WB 5A0FA 3ZQ6A 4Q48A 2WWIA 2HT1A 3KQLA 4B6EA 3GEIA 1NKSA 1G21E 1ZIOA 3AGQA 1L2TA 4Q4JB 3T35A 1XMSA 4IFEA 1AN0A 2XNSA 4KFSA 1VKJA 1KSJA 3H86A 2JLZA 3QXSA 1OJLA 1XMVA 1S4QA 3IIMA 3R7WB 1QF9A 5E3HA 5FH9A 4URWR 4L9SA 1QBKC 4II7A 3UPUA 2IYSA 4CEIB 4I1SA 3HR8A 4EQ6A 4JL5A 1U8YA 5BYKA 4XWKA 4KYIB 4HAXA 1NKTA 4IDQA 1ZCBA 3Q5DA 3SS8A 5KSZA 1QHIA 3TW8B 3VU9B 1YE8A 3S1AB 1F2UA 4KHZA 5C4MA 3U3RA 2ZUDA 4BFWA 3T1QA 5BN3A 3KQHA 4RKFA 2ZRIA 4XVUA 2JDID 5KU1A 4RY2A 3BFVA 5KSOA 2XZPA 4TZ0A 2RHMA 1YQTA 4Q7JB 2W6JA 1KMHA 2B21A 4BFTA 2G6BA 3TBKA 1QVAA 4C9BA 2MMCA 4QC2A 1CEEA 5HZHA 2RKOA 4OQLA 521PA 3U7EB 1AGRA 1D6JA 3BAFA 4GZMA 3AEZA 4BASA 2QPAA 3VX4A 3K70D 2ZJ2A 3CX7A 1MABA 1DBSA 1Z6GA 3WP1B 1G8PA 1GWNA 5A4JA 1OXXK 2XNDD 4C30A 4N1AA 4LHWA 2DWOA 4PC3A 2GK6A 1JR3A 2VIIA 3KTAA 5JHHB 3GCGA 1NY5A 1JALA 2A5DA 2ATVA 3GPLA 3BOSA 4JBYA 5H8WA 1AIPA 2OSBA 2X8AA 2O5VA 2QTFA 1NIPA 4Q1BA 2P0EA 3I62A 3GLIA 2JLSA 1J90A 5JLJA 1E4YA 2ZANA 3F0TA 1M34E 3OEHA 4IEIA 4Q19A 3UANA 1EWQA 4IOMA 4CF7A 1VCMA 2I3BA 1G8YA 2QQEA 3O8DA 3TAUA 1WE2A 3PJRA 3THXB 3GLFB 3GJ4A 4M0LA 1U0JA 1CRQA 2CBZA 4PO9A 4BWYA 2FPKA 1RC8A 2G1KA 1Y63A 4KSCA 1RYFA 4D25A 2EFCB 1EFCA 1HT1E 1PJRA 5FUVA 5L3RA 3THYA 4LX0A 1F3OA 2C77A 4DLZA 5JWOA 1G41A 1SVWA 2IW3A 4L5BA 5SZHB 1X1SA 4L4UA 2C96A 2OBMA 2XGJA 2YNMA 1XEXA 1E2LA 1VYVA 1JQJC 1NMZA 5E4FA 2CNWD 4HB2A 2ZJBA 1A4RA 1GP2A 3AF4A 3X2SA 3BIFA 3GLFE 3J81k 3BJIC 2QE7D 5EXTA 1NSTA 3EASA 4EPRA 2QPOA 3U7HB 3IKJA 2QT1A 1EGAA 2H8KA 1IY1A 2ERYA 5DHAA 4BLRA 2JCSA 5DI3B 5DIFA 5CM8B 3IQWA 1YVDA 3D31A 2ZSAA 3SQXA 5CYPA 1Q1EA 4HDCA 3IO3A 3OAAD 3CX8A 1XTSA 1Z0FA 3RC3A 1XB2A 1COWD 3NWJA 1XDBA 1DPFA 1KDRA 2QUZA 1UKEA 1N5LA 3PUXA 1E96A 3BFXA 3QKSA 4HAZA 4YXWA 3BH7A 2EU8A 1Q3TA 4ZPXA 2LKDA 3I3SR 1YR8A 5AUPB 2XXAB 3RC8A 5FR2A 1E2HA 5FPKA 1U99A 3CR7A 4HB4A 2GILA 2RHDA 3C41J 4LPSA 2YWHA 2V3CC 4JLAA 2FE4A 3EA0A 3LW8A 2P65A 3TUZC 4C2TA 3AKEA 2F9MA 2FSIA 4AURA 4NONA 3IPXA 5FTMA 4LWZA 2CMKA 4EPWA 1KJZA 2WWXA 3BC1A 2HEIA 1DAEA 4TTRA 2GF0A 4CVNA 4POAA 4TN1A 5CJPA 1UJ2A 1DOAA 3GFPA 3TNFA 1G3IA 3HJNA 5TVKA 1Q1BA 2OCYC 5J5CA 4EUNA 2CL7X 4ZDIA 3K09A 2G9NA 3T5DA 1GILA 1W4BA 1BYUA 4C4PA 2A5GA 4PPQA 3BORA 4OQFA 4LYHA 1R8SA 2C2HA 4Q1DA 2RGBA 1FTNA 1K5DA 3QOFA 2AWOA 2VP6A 3OIWA 4LGMA 1KK0A 2ZU0C 4DLSA 1MABB 4A8JC 1DAIA 1Z8FA 1GZSA 2ZI7A 3GP8A 1ZM3A 4FINA 1Q3HA 1M7GA 4QHTA 2DPXA 3ZDQA 1HQCA 3HYTA 5DI3A 2ZRPA 5GJVC 3DKPA 2VHCA 3SOPA 1FPMA 3W6PA 5L3QB 1DAMA 2W2XA 4DDWA 1JNYA 3NKVA 3QBVA 4Q01A 4Z1MD 3LLUA 2XOKD 5FTLA 2ZI3A 5FUWA 4CT5A 2ZSFA 3RS0A 2QN6A 4NYIQ 2IYWA 2CVFA 1FUKA 4M9QA 4F93B 2P67A 2ZS7A 4Q4HB 4JMPA 1TPZA 1J70A 1N25A 5J4LA 1D2MA 1ZUIA 1N6IA 4MRPA 4AIIA 3N5CA 5EZ6B 3QENA 3D6TB 2E9SA 1Z06A 1RRGA 3GJ5A 5EP1A 1VDZA 4KFRA 3VKGA 3P4XA 3THXA 4M9SA 2AD5A 2AWNA 1GG2A 2BCJQ 2DHRA 1DARA 1IXSB 2PBRA 2IEYA 3NH9A 4DDTA 4TL9A 5CDFE 2WICA 1GITA 2V55B 2VHJA 2ZRHA 3H2YA 1Z63A 2IS2A 1QHGA 2N46A 2OV2A 2EFGA 3P4YA 1E1QD 3MG9A 4KLZA 3SI7A 1CBUA 2WHXA 2BBWA 4QHYA 1E1QA 5AJVB 3CF0A 2OO7A 3G82C 3VR4A 3HDTA 2JJ2A 3LBHA 1E9DA 4ZO4A 2BHRA 3FMIA 4IXNA 2BV3A 621PA 2OFXA 3VR2A 1E9AA 1R5OA 4FW9A 2ZJOA 1E9EA 4C0AC 4M1MA 2ZJYA 3KKQA 4LJ4A 2VP0A 3X1DA 1T5LA 3RRZA 4PHFA 1NN3A 2O8FB 2ODBA 4D0NA 2J9RA 5EXPA 4PZYA 2CCKA 1BO6A 3EWAA 1T3HA 1XJCA 3CLVA 4PPFA 2VQSA 1XD8A 4G1UC 4X8OA 2QTVB 5P21A 1TQDA 3TJZA 1SHKA 3U3JA 2BEJA 3CX6A 1W0KD 3M0EA 2JLRA 3FHTA 2G88A 4PHGA 3X1YA 3KQKA 1BYIA 4HZUA 3EX7C 5F98A 1P72A 1QHYA 1LF0A 2EFHB 5KOYA 1EFHA 1WA5A 4AG5A 2QP4A 3GLHE 1G19A 3K1JA 3EZFA 1YZKA 5DISB 3AGPA 221PA 1XZQA 2KJQA 3KUDA 5CM9C 4Q21A 3PR1A 3L0OA 4WAUA 1DVRA 4IJMA 1TQ2A 3DM9B 4A1FA 2JLXA 5LB4A 2NZ8A 4HEJA 4PAMA 2W83A 3M4YA 1IBRA 3WYGA 3A8TA 1FNMA 2QU8A 1QHNA 4P3YA 1CF4A 3RS5A 5B64A 1DEKA 1QHHB 3SYKA 2R44A 3B82A 1OH5A 2WSSD 3KKOA 5LD2B 2WZQA 4E09A 3PENA 2PMDA 4KJZA 4TWZA 2ZJ5A 2FWRA 6Q21A 1XMJA 2IWRA 1P2TA 4P0TA 4NYJQ 2NO9A 1GL7A 2J1LA 2GKSA 2IYXA 3GMTA 4WZAE 3Q7QA 1ZVQA 2GESA 3BS4A 4MH0R 4MGZR 4LJ7A 3RAPR 2ZJAA 2GJAA 2QGZA 2PCJA 2QM8A 1XTRA 2OAP1 3I8XA 4XSGA 4HAYA 3BXZA 2ERXA 4UNPA 2KB0A 1G291 4Q4AA 2O52A 2J87A 5HCNA 3WY9A 4M4SA 3QXHA 3TKLA 3VHLB 1C4OA 1OKKD 1MR3F 3QEOA 1Z0JA 2F7SA 4E03A 1N2CE 3WXMA 3RANA 1IJFA 3V00A 2IXFA 2DWPA 2XTMA 2ZRNA 2VPPA 2REOA 5L3VA 4QBIA 1TAGA 1G64A 5KDDA 1Z3IX 3L82B 2D74A 1OFTA 1M74A 3B6EA 5KNDA 1NP6A 2GTPA 4MGKR 2Z43A 1E2PA 4LRWA 2QE7A 1KJWA 2QT0A 1ZNXA 3I5YA 4Q00A 1ZW6A 5DGXA 4HLUA 1GKIA 4QL3A 4OI1A 3W3AA 1KMQA 3K9NA 4P4UA 2WOJA 3FE2A 1R6BX 3MLEA 3FFBA 4RZ3A 1A1VA 5H70A 5BN4A 2ZTSA 2VHQA 3KKMA 3IIJA 4LUCA 3ZZ0A 1WXQA 2Q21A 1FP6A 3VR3A 2ZM5A 2VYFA 4ITRC 3WBJA 5C1BA 3FKQA 4A8JB 1LB1B 2R6CA 3FKSD 3LX8A 1F48A 1AS3A 1E0SA 3OAAA 1QDEA 1ZBDA 2YZ2A 3EZ7A 4P32A 4RD6A 3ICEA 2D62A 2FU5C 2XAUA 2VP5A 1UFQA 3CZPA 1AKYA 2IEZA 3TLXA 1P60A 1Q1QA 1R7RA 2RCNA 4XWOA 2HLDD 1AS0A 4KXFB 2JLYA 3AVUA 3NIBA 1E99A 1AQUA 3W8NA 1NIJA 1E98A 4PR0A 1HY3A 3GJ6A 4W5HA 3IDQA 5SZJA 2ZRBA 1E2QA 1NVVR 4JKIA 2SHKA 4ZKEA 2IS4A 2GRJA 3GD7A 4O3MA 1E69A 2A9KA 3SFVA 4A0FA 2PLRA 3QXXA 4NDZA 1XXHB 2QORA 5DN6D 1EFUA 1F6BA 2F9LA 2IL1A 2BOVA 2IYYA 3EC1A 4RD0A 4QM7A 2PLFA 1TU4A 3NEYA 2NZJA 4BZPA 4JLJA 121PA 4AC9A 4B48A 4B34A 3ZS9A 3KX2A 1MO5A 3U7FB 2AXNA 4GPTA 1WMSA 1ONBA 4R9UC 1XPOA 1T8TA 5CK5A 1T4GA 3PEYA 2F1HA 1KKLA 4OYHA 4ZDWA 4C0BA 1MO6A 2W00A 2YVUA 1N3BA 4C7OA 1NVUQ 1UBFA 4LHYA 1Y3AA 4Q9JA 4YMWA 3W6OA 2O8DB 3MSXA 2O0JA 5JS7A 4BGDA 2WWGA 3NXSA 4LOAA 2H1LA 4IDOA 4KVAA 3ADKA 3ICQB 4M1WA 3BE4A 3L43A 2BWJA 2W6ID 1KHTA 1JJVA 1ZM9A 1G7CA 2OUKA 5FTNA 5FBVB 1KO5A 3L8YA 3HWSA 1PLJA 4IKEA 1FZQA 1ZMXA 5J47A 4P4SA 4DSOA 3PUVA 3Q5EA 2GCPA 2KSQA 1P2UA 3A4MA 2O8EA 4DBLC 2JGNA 1LF5A 1VHTA 5EXSA 3FFAA 4JBWA 3ZS8A 4IFBA 5EE1A 4Q02A 3W3ZB 4TQ9A 2HDNB 2H7VA 4M1YA 1G6OA 4X8LA 1LS1A 1UKZA 4BFYA 2F3RA 1XX6A 5JI2E 1DAFA 2V1UA 3RYTC 1OYYA 3OFND 3UKDA 1CR2A 4LCBA 4WW0A 1E6CA 2ZUBA 4K81B 1Z0KA 4DLXA 4QBFA 4Q7MB 1OB2A 1KGDA 2A2ZA 2G3YA 3MWYW 1IN4A 2ZRKA 3AV0B 4URYR 4CGZA 5FPTA 1GTVA 2OILA 1OB5A 4B76A 3C14C 2GJ8A 1XTJA 4PC6A 4B44A 1MT0A 2G0TA 3GFTA 3K9HA 4KBGA 3UG7A 4GP6A 1W0JA 3NEJA 4OI0A 1YR7A 1GUAA 1H8HD 1VCOA 5AR1A 2V7QD 3ASYA 2X19A 4B3DA 3SYLA 3TIFA 1ZM2A 4Z54A 1SVLA 4TMTA 3PITA 1UM8A 1DELA 2JLUA 3GJ8A 3ZH9B 1S1CA 4NHOA 4PSVA 5KSPA 2QAGA 4CEHB 4QGGA 2R6AA 2F43A 2GJKA 3ND8A 4XVRA 3DZ8A 4GMDA 1AZSC 1G4AE 5JWRA 2VEDA 4Q9IA 1KJYA 3CH4B 2DFKB 1SXJA 3T12A 2V1XA 1A5TA 3BFKA 1ZAKA 4PZLA 2YJTD 3SN6A 3UK6A 4F4JA 3NVAA 5JSZA 3CR8A 3B5JA 1Z28A 2FSHA 3CW2A 3P26A 1SXJB 3P27A 4Q47A 1NG1A 2ZI4A 3EW9A 2XSZD 3KJHA 4RSGA 1U94A 4DDVA 2FMXA 2GWHA 4F91B 4RFSB 3X1XA 4TYWA 3RSOA 2D06A 2XZLA 3RVBA 1R0YA 2QMEA 4YMSA 3LW7A 4GOJA 2FFQA 4GL2A 2A7QA 2QA5A 4Y0VA 2WAYA 4PHHA 3LY5A 1XTQA 3B85A 4AKGA 1KZ7B 3JZMA 2GA8A 3CM0A 3K0CC 3PIRA 2YWGA 3RRMA 1JR6A 2CLDX 5C18A 3VQTA 4IXMA 4IVRA 1W2GA 1WP9A 1XTKA 4RD3A 5DLQC 5FOUA 3ZQJA 2Q9AA 2ZYWX 4XIGS 1G8GA 3KZ1E 2WM9B 4R2IA 3BH0A 3WRXC 4TLCA 3U3KA 2O8BA 1S9HA 4LHXA 3PG5A 5DO9A 4TQUS 2B6HA 4TL6A 3QKRA 1NLFA 5CB8A 1G3RA 3ADCA 2ZRFA 5FBQB 1MOZA 3A1VA 3DMNA 2QAGC 1MH1A 4TLBA 4DDUA 1J2JA 1BS1A 1OHHA 5FOWA 5IDVA 421PA 2FNAA 3PCRB 2WMOB 4FCVA 4EDHA 4J0QA 5C46F 1OXUA 1XFAA 2J0VA 3KJGA 1Z47A 2CJWB 4Q4LA 4MITA 1XEFA 4D82A 3NTUA 1OH8A 1LY1A 1PLKA 4BZXA 4LC1A 2OBNA 3M6AA 4LV6A 1X6VA 4PAQA 4TLEA 1RIFA 5CDFA 3RRNA 1Z6TA 4TMWA 4DRZA 1TUEA 1UADA 4NPHA 3FKSA 1ZC3A 2I4IA 5FI1B 5FUYA 1NN1A 4DHEA 3JVVA 4A8JA 1UKYA 3W5IA 3WNBA 2BBSA 2ODWA 2UZIR 3FMOB 3WHLA 2J0UB 3O8BA 4QOSA 5K8IA 2ZRGA 821PA 4EPYA 3AKDA 5DE3A 1NI3A 2ZROA 3HU1A 2WJHA 4QG7A 4HB3A 1CR1A 4RD4A 3UXMA 4NCKA 2CNWA 4IVPA 3O8CA 1PUIA 3KQNA 1KTVA 4BFVA 4XTRA 2IC5A 3ZIAD 1G18A 5H1YA 1OIWA 3WBKA 2IUTA 1E9SA 3U3MA 4B71A 3PUYA 1U0LA 1W5TA 2WPDD 1G9XA 4YMUA 3BB1A 2W58A 1KK3A 1TMKA 4TLAA 1KDTA 4UNSA 4UXHA 4V0KA 3LD9A 3HU2A 5EJEA 1AS2A 1W47A 2BVNA 1KNQA 1V43A 1N0UA 3BB3A 3LFUA 2GXQA 3EA5A 1J99A 1SGWA 1XCMA 4UXJA 4JYCA 3DVLA 4PO1A 3CNOA 3DDCA 4D4KA 3A36A 2QENA 4LYAA 4DSTA 4ZDJA 3RABA 1G3UA 2OFWA 3AF3A 2VSFA 3OIUA 3QXJA 1JXOA 1ZM7A 4C7OB 2NIPA 4JZKA 5GVRA 2O8DA 1CRPA 1II8B 5CLLA 1R0WA 4B33A 4AYXA 5JEEA 4YDSA 5TY0A 1G7SA 3W9YA 3ZD6A 4O0MA 1KAGA 4JT4A 4TMVA 1HT2E 3I5XA 2OT3B 1NF3A 4HDOB 4ZCMA 3WMEA 2QP3A 3IUYA 1CP2A 4IVQA 3ZIAA 4OKSA 3PVSA 4PQYA 5KNBA 2F6RA 2W2TA 2FFHA 3AP1A 1Q44A 3UMRA 1HA3A 3LBNA 1FL9A 3I92A 4Z8YA 4I81A 4C0QC 1E3MA 4UNRA 3A6PC 5AK0A 4MRSA 1OH6A 1NRJB 1P73A 2ATXA 2J0UA 3DL0A 4WXRA 4DUGA 1OYWA 1X3SA 2G0NA 5HPYB 4V0LA 1KI9A 3QVUA 2PL3A 4RKEA 4D0GA 2J0SA 1FMLA 1CXZA 2FFBA 4MGYR 5FPSA 2AHOA 1P75A 4URUR 2QP9X 2ZVQX 1SHZA 1G20E 3QG5A 3ZVMA 4MKGA 1XWIA 4ON9A 2PZFA 1T91A 2PX0A 1QVRA 4ZCIA 4DKXA 3IILA 4BLSA 4NCIA 2IXEA 1E0JA 2ZI6A 2EFDB 4BPBA 3IBGA 2GCNA 4V0MA 3TE6A 4W5JA 3QVVA 2WTUA 3K70C 4MRNA 4KITB 3FYHA 1E9CA 3AVWA 4Q9LA 1KNXA 2GK7A 4Y0AA 2FPMA 5KSYA 4JIMA 2OAQ1 3K9GA 5GVSA 2IT1A 5KUTA 3WNDA 2ZI5A 3AKCA 1E2MA 3CB4A 4M1TA 2C78A 4MUAA 2XTZA 1D2EA 1KY3A 3KB2A 4BFXA 1GKYA 1FW6A 1SVSA 1GL9B 2W0MA 4WVFA 3EPLA 1XU4A 2WIAA 5FL7D 4WIAA 1HUQA 4KV9A 1LW7A 1VHLA 4OK6A 4MRVA 3QKUA 4DLRA 3V4RA 2HUPA 2IK8A 5AJYA 1VMAA 4XWAA 2J7PA 2FGKA 2Q3MA 4QBGB 1KI7A 3FTQA 2QQ0A 1RKBA 1E9BA 1W0KA 2GCOB 4G01B 2Z5FA 2OM2A 4TMZA 1Q20A 2R6GA 4B75A 3AF0A 3MMPA 2ZYVX 4PX9A 1Z07A 1XD2A 5CIQA 5B30A 3GLGE 1P5ZB 1V5WA 2Q9BA 4L15A 1NMXA 3MWLA 1OSNA 4KVGA 3QG1A 1Z08A 4XSHA 4DCNA 2Z0MA 2IYRA 2D7CA 4B43A 3T1OA 1L4YA 2KE5A 4M9XA 2NTYC 3LXXA 4JJKA 4DEYA 2ZU6A 3QQ5A 4FN5A 2JJ1D 2FEMA 4B3XA 1T0HB 4JSTA 1DADA 1GRQA 2QAJA 1VIAA 4EPTA 1KDPA 1U0HC 4N0EA 3B1XA 2MSCB 2OE2A 3LRPA 3TSOA 1Z22A 3VR5A 5ELXA 4F4CA 3E70C 5TXGA 4W9MC 1NBMD 1LTQA 1HURA 4FD2A 3DZDA 4PSKA 1XJ0A 3SU8A 4CEJB 1CULC 3IHWA 2EVWX 3TH5A 2EWVA 3CF6R 2BJVA 2ZITA 1AM4D 1TF5A 1OW3B 3QPWA 4FMDB 1W44A 4LBZA 3A1WA 2HF8A 1D2NA 3KXKA 1JPJA 2ZIAA 3P32A 3HU3A 1FX0A 4OI4A 3QEJA 5HKKA 2FV8A 1N0WA 1E94E 1GAJA 1NVWQ 4B2PA 4DJTA 4PANA 1G5TA 4NCNA 4B2LA 4M22A 4FXPA 2VP2A 2J7PD 3MUFA 1JI0A 1CLUA 1E1RD 1FX0B 1PVOA 1LV7A 3HPQA 4U7DA 2ODNA 1WF3A 3BBPA 1Z6XA 4OHXA 2WJIA 2YV5A 3SR0A 2GEUA 5HZKA 5J4HA 3KL4A 1SKQA 3P20A 4NU0A 1JR3D 2ZR7A 4O2LA 1KDOA 1KK2A 5LDDC 1ZYUA 3EZ2A 3H4MA 1JB1A 4V02A 4DVGA 2YKGA 1ESNA 4O2RA 4P33A 3QJYA 5KPDA 1M6NA 4TTQA 5FBWB 4M9ZA 3RRYA 2DWQA 4DB2A 1GRNA 4PQFA 2J0QA 4A15A 2ZUCA 1KMHB 3ZLJA 3LV8A 5DNYB 1ODFA 1UPTA 1P2VA 2XZOA 1UBCA 2B8WA 2B8TA 4XJXA 3PFIA 1UF9A 1TEVA 3EIQA 2P2LA 4MRRA 4A2QA 1RJ9A 4OQXA 2VA8A 3FHCB 2FH5B 2R9VA 2NG1A 4YQFA 3AF2A 3MJHA 3TK1A 4EAQA 2E1RA 5TV2A 2C5LA 2GAAA 2RH5A 3AKYA 2WKQA 1RJ9B 3SE0A 1G1MA 3FWYA 4LJ6A 4MDFA 1E1RA 3GFOA 1Z0AA 3L0PA 1S1MA 2DY1A 2JASA 2QMHA 4M1OA 3RHFA 2O0KA 2QRZA 4LHZA 4LYJA 1D8TA 1SZPA 5EE5B 4HUQA 4CEIA 4IEEA 2QY9A 5B57C 4Q1CA 2IWHA 2D7DA 3FDIA 1U2RA 3VAAA 5DYGA 1M1YE 2IUUA 3ZVLA 2UKDA 1NBME 2Y8EA 1G8HA 3GJ0A 4B32A 4MA4A 3SHFA 3DMDA 2J3EA 1KO7A 3VU9A 3U61B 1XD9A 2GAOA 3B7GA 2KWIA 4R2HA 4S35A 3NHAA 3B60A 3SNHA 3GLFA 1U90A 3QUSA 4A9AA 2P6NA 1UDXA 1R2QA 1SVMA 1G16A 5KPJA 4BLTA 4CT4B 2OFOA 3A37A 3AF1A 3LDAA 2ZSEA 4FIDA 4O25A 1CTQA 4JLMA 2R6FA 4L9WA 1XEWY 2AKYA 3AVQA 3K0FA 5SZKB 4HZIA 4CZ2A 1SKYB 4ZI3A 3FMPB 1WBDA 5AWFC 2OZEA 2IS1A 2IF0A 2IBMA 5L3SB 2B7BA 1KSGA 2DR3A 3B9QA 4AYTA 3THOA 2QZ4A 4A92A 3K0FB 1E2NA 2ZRCA 4HI0E 5K8LA 5KDOA 1QG4A 3QBTA 4FCTA 1D5CA 1NLZA 2JEOA 3ZZTA 5L3QA 5FL3A 4ZKDA 5G3YA 4UQOA 5L3SA 3AVYA 1KO4A 3GEEA 3K8YA 2QNRA 4B3CA 4DEXA 2P6UA 2FOLA 1W4CA 1ZD8A 4JS0A 4PO8A 2WPDA 4C0JA 3WMFA 3U7GA 4JLPA 1JAIA 1E0AA 4ZDKA 2P5TB 2BMEA 3K9LA 5F2EA 2BKEA 3IIKA 4LBVA 1OXTA 1W49A 3UIEA 3AVXA 3O8RA 2ANBA 4NKRA 4NTZA 2GF9A 1YZUA 5EP3A 1OXVA 2C98A 4PC7A 3CF2A 3ZJYA 1P62B 2RAPA 3O47A 3FGNA 3KJIA 2H5EA 1L4UA 3AUXA 1ELOA 3NG1A 5CJ2A 1KI1A 1S3SA 5JWHA 1W4AA 4OJQA 2GJSA 4PAOA 4URVR 5G40A 3K0AB 2FGJA 2ZAOA 2NQ2C 4H1UA 3D7MA 2YINC 1Q22A 2BCGY 1P9NA 1IN8A 3X1WA 2H17A 3K0CA 3RS7A 3KQUA 4JVLA 1E32A 1KKMA 2ZE7A 5EP4A 1EWRA 2V6IA 1AJEA 3TRFA 2Q9CA 4I99A 1XXHE 4OK5A 4IRUB 2NO7A 2EW1A 4KO8A 3UATA 1YJ5A 1E2IA 1CIPA 4LI0A 4LJ8A 5F9FA 5FI0B 3BGWA 4Q7LA 2AXPA 1A2BA 4OHYA 2IXGA 1CJKC 1KIMA 2WBLC 3CNLA 4G5GA 1TX4B 3DKVA 2GBLA 3T15A 4CDGA 3QKTA 4NYMR 1NG9A 1A2KC 1Q12A 1X1RA 4BFUA 2WJGA 2ORWA 4G5SA 1YZQA 3DOFA 1IHUA 3MJRA 3OIVA 2EWWA 4HAVA 3B1VA 2R65A 3OFNA 1Z6YA 4RD1A 5HCIA 3V9PA 1R0ZA 2RGXA 5IRCD 4F92B 1RRPA 3L0IB 1YKSA 3LH5A 4IOKA 2ZRAA 2XB4A 1SXJD 1KO8A 4M21A 3SYNA 4GP7A 4UXIA 2H57A 1W36B 2P6RA 4TZ6A 3EWSA 4EJSB 3F3YA 2WIBA 2L0XA 2GXAA 4KSBA 1KSFX 2C8VA 3Q72A 3I73A 4M8NE 3CRVA 3VFDA 1X86B 3LQRA 1QZXA 3CWQA 5IF9A 2VHTA 4MGIR 1JECA 2ZR9A 1P9RA 4G3XA 3B2EA 4EFMA 4M1SA 4R7ZA 4US2R 4NCJA 1W1WA 4Q4JA 5D3QA 4LV5B 3SBDA 2V7QA 1SKYE 1W5SA 3CWZA 1KI2A 3OEEA 1GFIA 2ORVA 1EESA 3TSZA 1N6PA 1IXZA 3U5ZB 3GLHA 4CYMA 1W4RA 3U60B 1P3JA 1T9HA 2AD1A 1M7HA 4TYYA 2GJ9A 3ECCA 2X2FA 2J46A 3AP2A 4K8OA 4QNRA 2ZE5A 5HE8A 3SEAA 1KSHA 1D9ZA 1ZNYA 1FMJA 1XF9A 4QJ5A 2GEDA 2VF7A 1E2EA 2HLDA 4DXAA 4GOXA 4NCHA 2Z4RA 3AP3A 2CCJA 4PXAA 3OIYA 2C03A 2ZXUA 2Q0HA 1US8A 3HPRA 4TTPA 3WP0A 2PEZA 3PV0A 1JBKA 2P3SA 2YWFA 1Q1ZA 3OE7D 4C0HA 4YONB 1E2GA 1U81A 4IDHA 3T61A 5CIWA 3W6NA 5KO2A 2DFLA 5AJXA 1FFHA 4ERNA 1US8B 2NPIA 5JHGB 5FFMA 4LK2A 4JBXA 3OZXA 1LNZA 4QNMA 3C5CA 4JSYA 3SJBA 1J8MF 1RE0A 2BIFA 3M1IA 3KB1A 4YC7A 4B35A 4BECA 2OG2A 2IF2A 4QRHA 3CNNA 3AH8A 4XVQA 3UMSA 3CRQA 3LVQE 4H9GA 2QSZA 2QBYB 4NMMA 2ZPTX 2CLSA 1ZIPA 4I4LA 4AY2A 4KU4A 4AG6A 3C16C 4JKYA 4EPXA 1VG0B 5GJWC 1WB9A 1Z2AA 1WQ1R 8OHMA 1K6MA 3CPHA 1TEXA 2X77A 3REGA 3TAHA 1G5RA 4US0R 2BMJA 4P31A 3VNUA 3CONA 2RGDA 3BD9A 4X8HA 1QG2A 3QF7A 4RJLA 3WYAA 1ZU4A 2P5SA 3H1TA 2ORIA 3PUZA 3SZRA 1RVDA 2H92A 4TYPA 1RW4A 2AFHE 1NMYA 4KBFA 1IAQA 3HP1A 4UNNA 3WMGA 4Q7KA 4GOKA 1XCPA 4L8GA 5EZ5A 3VNVA 4EKDA 4M53A 5CYOA 4LDJA 2BEKA 2NOAA 5AUOB 5JRJA 2RGCA 1U98A 1E79A 1JJ7A 4Q18A 5KHOC 3ADDA 1Z6AA 1QHHA 1Q57A 1RFLA 5FL7A 5H68A 3THYB 1Q0UA 3L2OB 1RZ3A 5K8TA 2KBFA 3DHWC 2VTKA 1E9RA 2ZEJA 3V4FA 1XP8A 1H65A 4DCSA 4BFZA 4QJ4A 2YOFA 4HB0A 2WSMA 1P61B 3QPUA 2FX3A 4JL8A 1H8ED 3G5UA 1NVXQ 5ANRB 3SHWA 1PUJA 2GEVA 4A0RA 3E1SA
chains in the Genus database with same CATH superfamily
2C04A 4L6CA 3DOOA 1RXIA 1Z4OA 3GCDA 3IB6A 3FNEA 1EWKA 3LZCA 5J1SB 1Z2CA 1TVKB 3FB4A 1FPQA 2NPFA 1QVWA 1R9MA 2Q1YA 4UVDA 4F8JA 3ADPA 4L4YA 3LOPA 5ERYA 1P44A 2EJVA 1IN6A 3OPVA 1OXMA 5DWQA 5DNCA 2VAXA 3PL5A 1DRWA 4WN9A 1HYHA 2G7MC 3A6KA 3PP8A 3VU0A 4AN4A 4C2UA 5DH9A 5DM1A 3NTLA 5CB6A 3WQHA 4Z4CA 1EWTA 4R8KA 1ZJ6A 4OU5A 4MO9A 4X8MA 5EIFA 3WO1A 1VJ1A 5FWDA 2VCHA 4G84A 4EBBA 1DINA 2WF8A 4TX1A 1UZNA 2O0MA 1ZMBA 1U2PA 1ZNZA 2KLBA 4P53A 2JFGA 3AV3A 3SHVA 5MN6A 3NT5A 1K9VF 3SC3A 2R2GA 4ROSA 4Z4GA 3UJDA 2VSNA 1NZFA 1K3FA 2OOKA 3KUXA 3L0CA 4JJ6A 4JLDA 2BHSA 2D2FA 5EWLA 3HDVA 1SU8A 2BTOA 2QNIA 3TD6A 2GTHA 3RAGA 2W4IA 1JPNA 3F2VA 5DHQA 9LDTA 2AK2A 2MINA 1W2WB 1NW3A 2IYZA 1KYVA 3KAJA 1EWQA 1BJKA 3N8HA 3PA6A 4NOLA 5FUMA 5F9HA 3NANA 4FDUA 4A36A 4AKIA 3JQEA 4GECA 1OFUA 4OGGA 5JJIA 3CLUD 4TRRA 3W9SA 4CIXA 1DO2A 3HC7A 4JGGA 1ZGGA 4I3GA 4J75A 4DG5A 1YVUA 3TXXA 1I7SB 4G5XA 3FCSB 3D3EA 1HH4A 1UUFA 2ZFUA 3UEOA 3OPQA 1Y3CE 4CIVA 1HV8A 5I8ZA 4ADSG 2FXVA 2ZAMA 2C0CA 1SELA 4PC2A 5T64A 4W5WA 1ORTA 2GRUA 4Q66C 3QEMA 4ZCLA 1NN5A 1RQLA 4PFSA 2P11A 5AJZA 4DE5A 4MKFA 4N5LA 5FNZA 2ZJ4A 4TMYA 2MDTA 2X42A 3L8GA 3IEIA 3KSRA 1DAKA 3WV4A 1Z7EA 1XNJA 2VL7A 2QN7A 4L3OA 3D54D 4KI7A 1E2KA 3DMFA 5J2UA 1JAHA 1K4KA 3G7NA 4LJ9A 2O0HA 4DLNA 4A2CA 3P0FA 1NSYA 1ZL2A 3AW8A 3DD1A 2J33A 2Y93A 4O8ZA 5DGCA 4MWZA 1YGYA 2OWDA 4LY6A 3TSWA 1A5AB 2PJZA 2R8YA 5F3RA 4B81A 2PWYA 3Q12A 3NLLA 2PUWA 4P4TA 3R9XB 1RM4A 2REXB 1M1UA 1NJ8A 3PR3A 4UD2A 2VF4X 5GV8A 4MWTA 4GBED 2VDMB 3OEHD 2C9OA 3EHEA 3QY0A 5C2JB 3RVSA 3OTOB 1IK6A 1FRZA 1T6NA 4UPEA 1Y6FA 3IFSA 1IOLA 3DFFA 1E20A 1DX6A 3G2JA 4HLDA 4BV3A 2ZRDA 3N39C 1BKSB 2HADA 4LE0A 4YCAA 1TNDA 4FX5A 5E2AA 1WSWA 4DT1B 2FQXA 3UK2A 4HLUC 3R3YA 3S1LA 2PUAA 1JEAA 3JVIA 1TZMA 1E79D 3U3DA 1JDJA 1GCIA 4HGZA 3WGZA 2CJPA 4TN5A 2XMGA 4QUAA 1MW9X 1SUBA 4UU7A 3DBOB 3NCHA 3WNCA 1ISSA 5AP9A 4DW8A 2ROQA 4JHXA 1VG8A 3RB8A 2WW8A 3USCS 1OPXA 2H1RA 3VO9A 1XNRB 1TO1E 3RW9A 1JXQA 4KQ2A 3TTUA 4UTNA 2PMFA 1YQEA 3GNTA 3X3HA 2C31A 1XQXA 2O57A 3MBOA 3ONWA 5HQJA 4BMSA 3I2YX 4A2PA 2XITA 5LCXA 2H4JA 2ZRLA 1P1CA 4OQNA 5F2OA 1W87A 2WMYA 4M7PA 1H2RS 4Q7EA 4LPKA 4BN4A 4EECA 3NVKI 1QANA 2E85A 4Z51A 1YQWA 4A6XA 3BM5A 3A2NA 5ALPA 1PZXA 1ECFA 3SP1A 4LEIA 4D45A 2NO0A 3D8UA 3Q15C 2JI7A 4R6WA 4EVIA 3QX8A 3NFYA 1JLSA 4BLQA 2VZ8A 5AUQA 4E1BA 3MOSA 3O2NA 2GHQA 5DVZA 4CMCA 5IT4A 3G9QA 1OR8A 2R7KA 4YAGA 1AZLA 1DV2A 2J4FA 1C9YA 1QR2A 2HJVA 4D9FA 4ARZA 2DUJA 3QHPA 3ZGZA 2WSSA 1PEYA 1RQGA 4NP6A 4PXYA 1RM0A 1PFVA 2VUIB 1SHJA 1T8PA 1KYTA 2AN1A 2C0QA 3M82A 4G8DA 4KZKA 3N70A 1L5ZA 3WK4A 2FJPA 3CPEA 4TWBA 2PMBA 1GM5A 5EIEA 2YIJA 3AUKA 3CG4A 1FP2A 3ND9A 3QKRB 1W93A 2J32A 3G85A 1RP1A 2OTCA 1N1MA 4RSRA 2FPLA 1QIKA 2ANCA 1BE0A 1G8FA 4UBOA 1F8GA 3B1WA 4RHCA 4MQBA 3ROGA 3BQ9A 1VIYA 1OGYA 2YOGA 1KYWA 3LLMA 1NVEA 4O33A 1NYTA 4BVEA 2OSVA 3G5TA 3SBEA 3ZWBA 1IH8A 1XQ9A 2IEIA 1N5IA 1VQ1A 2CJWA 3VNAA 3R9XA 4RPLA 1IQRA 5JE8A 4B4OA 2ZE6A 3PJFA 2VT7A 3PFWO 3ZGXA 3JX9A 4BGIA 1R4AA 1EBBA 1LSJA 3BXPA 7YASA 3GFFA 4JJIA 4L8WB 1NVDA 5ELLA 3ZY4A 3ACDA 4JUCA 1SG6A 2R84A 3CE6A 2JIZA 2ECOA 1RQ2A 2Q9UA 1YZ3A 4OGWA 3DBLB 3M34A 1EK0A 2ASVA 1MEOA 1Y5MA 3LHIA 4QICA 5THXA 1XJWA 1EXNA 1HTBA 2AK3A 2VHXA 3U13A 5JMTA 3LKVA 3K9CA 3QP9A 1GFZA 1HL7A 2RB4A 3OZ7A 4G86A 1I10A 2XHEA 5BN4B 4MQUA 2AFIE 2PR7A 4MHOA 2OLKA 1RZVA 2ATIA 4NVRA 4U7GA 4UTZA 4F6LA 3G8BA 4MV1A 4ZV7A 3S28A 3UWDA 2JLCA 2HJGA 5CLGA 4LC0A 4AZ3B 4V0RA 1A82A 1JQLB 4ZAYA 1R64A 4ZOEA 5FLYA 3GP5A 4NLLA 1P1RA 3TRHA 2D5IA 1HG0A 3ZDBA 1FA9A 3KZMA 2AOWA 4HDMA 4QDKA 2X9QA 4TYNA 3I61A 3BGOS 3IXQA 4MEAA 2JFPA 1QO0D 1GV0A 3ZW7A 1PR9A 3F3SA 5AVWA 4XUCA 2WVHA 1X1BA 1RWVA 3KSUA 1I32A 2UV8A 3DEZA 3PNPA 3VH4A 3BXFA 2B4TO 2YYZA 3DFZA 3EPPA 1F6DA 1L5FA 4JR0A 1X8JA 1P9LA 3BB4A 3LUHA 3PHJA 2VDJA 3LXMA 3N2EA 1M73E 3AR8A 4OFBA 3LLSA 3VSBA 4QOGA 3DM5A 3KXDA 3UGTA 1TF7A 1XXHA 2EHDA 3VR6H 4A4DA 2VTBB 4DR1B 1YDWA 4KYVA 1OZAA 2HIAA 3HNRA 4L5AA 1R9NA 1I36A 6AT1A 3T5PA 5FD8A 3VNRA 2JGMA 3Q3JB 2IYOA 2OB2A 4BCBA 4CQMA 5JU6A 1WMBA 1OYVA 1PEDA 2FN7A 3CT4A 4L0QA 1EK1A 4FS3A 1GAQA 3GW8A 3AF6A 2AV6A 2BC9A 1D2CA 4HNRA 2GYWA 4M8SA 4N0QA 4FCWA 1YS2X 3OHMA 1NVGA 2EL7A 1N4AA 1TPYA 2V5AA 2DBYA 3DKIA 1QE3A 2NN3C 4WOKA 3R9IA 4BNDA 1P5HA 4L0MA 4AK9A 1WB6A 3QEKA 4EEZA 2FR8C 5EINA 3KM0A 3O4FA 4Q05A 2NGRA 3MRVA 1KI6B 4GLBA 4RJJA 5TE9A 1MPXA 4Q4DA 4ZYZA 5EE3A 4E30A 3GC6A 4ZJPA 2O8EB 2ALJA 1XQ6A 2FVXA 1QUEA 1GUZA 3KR2A 5DN6A 2B5VA 1P1IA 2P1DA 5JBQA 4UATA 2NNLD 4GFDA 3WDSA 3V8PA 1QGZA 4OXRA 1C30A 3MOGA 4V0QA 2G9VA 2QSYA 3FY4A 4G56A 1FQOA 1EUQA 1A4IA 1I3CA 1L7NA 3Q87B 3TTVA 3CEHA 2EHJA 4TT3A 2I1WA 3OETA 1CJVC 3QMWA 2BMFA 2V0NA 4DC9A 4PM4A 1MX5A 3AUFA 5EXXA 1Z8DA 4E09A 5A3RA 3BRSA 3BK2A 1E58A 4OQMA 2QK4A 4ZEOA 4IP0A 2CLMB 1JBEA 3SD7A 1P6QA 1MB4A 4UOQA 5G0SA 2JK1A 2WSLA 4XYLA 5T4HA 4YXWD 6ADHA 5CMLA 2HCJB 3WNZA 2OECA 3R6LA 5CVEA 3ENQA 5GJBA 4WNAA 2ON6A 5COQA 4WOBA 1BH6A 3OT4A 3PTZA 2DBVO 1BX3A 3D7RA 1N6KA 1XZLA 1CW2B 3AUJB 2RJNA 3UGQA 3ED5A 3VGPA 1MFZA 1EBUA 2OCBA 2QROA 4INJA 3M6XA 3NZEA 3WDMA 1LSOA 3F1LA 2BKLA 1AX9A 3I04M 4ZO8A 1W6RA 2PRYA 2YHIA 3I1FA 1RJFA 3VHXA 2DECA 3QXCA 1UQUA 3AL3A 3TEMA 1KAMA 2XNJA 2NV2B 4JLBA 1SKUA 3OZGA 1EDZA 1ISHA 3OCXA 4NJMA 3VI3B 2QVLA 4D0LB 2FG5A 3DOCA 4H3KB 1BX1A 4PS0A 1HXHA 2OXCA 4K6KA 4OTZA 4H0FA 3RU3A 4MVJG 2XJ9A 2QRMA 1ORVA 1YI1A 2WI8A 2I67A 4G4SP 3ZZUA 3MYYA 1KYYA 3B1ZA 2O8CB 1RJGA 1O54A 2GERA 3PC8C 5KBYA 2RC5A 2ZVJA 2NZYA 4EI2A 1XD2B 1HYQA 2QYTA 1V6SA 1DCTA 1V7CA 2F9FA 2B8EA 1HNZB 4RVUA 2PT5A 4Y2UA 4TSFA 1DEAA 1XTUA 3VSDA 3ZKWA 1MRSA 3VKFA 2DHDA 2PZGA 1E3TA 3A6HA 1PYGA 3PTLA 5TT1A 3N2ZB 3WLNA 2JJ2D 4CODB 3WSWA 4BNGA 5AUNB 3EC2A 1A88A 5CDHA 3ZVNA 2HUNA 3NDRA 4QAJA 1XL1A 4WKGA 4UKDA 5J40A 2YUIA 2QZSA 5G1PA 4CF6A 2AMFA 1YJBA 4E07A 1UXKA 3UQZA 1Z7YA 1ULAA 3KXIA 3U4QB 1B0PA 4BNHA 1SH7A 1T8RA 2IP4A 4HUTA 3FJYA 4DCPA 2CV1A 4JIGA 2JIZD 3AJAA 3W4JA 1QTIA 3BMOA 2P75A 3BF8A 3E81A 3QLVA 1INLA 1J09A 3C4JA 2WIFA 4HAWA 2BMAA 3FDFA 3HZRA 2ZSKA 2XQIA 2Q7DA 1RLIA 5LFAA 3DH0A 1AC5A 3O84A 2PFKA 4EHHA 1SXJE 4HWKA 2OHXA 1KR5A 5KNCA 3DHVA 3JVDA 1DCMA 3KK0A 3UV7A 2YC4C 1NBMA 1PTJC 5BV1A 2HBQA 1KQFA 5BV2P 3NAGA 1IXYA 5ESRA 2K87A 1UWCA 3A6FA 4AMZA 4CUKA 4I1IA 2OMEA 2CYBA 2YXLA 1C2TA 1TF2A 2QMYA 2X4LA 1Z3CA 1ZJZA 4DVJA 4KR0A 2A9OA 2H2GA 3WK7A 1NFQA 2OBLA 3WFIA 1VE1A 4H15A 3FPAA 5FWYB 4NHEA 2D8AA 2P4EA 3BD6A 3QU9A 1B8UA 3PNQA 1P7YA 4CEHA 3LXRA 5CVJA 4C2AA 3OUZA 1JU9A 2NTJA 1YV9A 2BRUC 1AKEA 3HI4A 3KE9A 3QKIA 1QH8A 1RZUA 3KQVA 3D2BA 3P0HA 4R9SA 4DCVA 4FDTA 1Q14A 4Y7DA 4X91A 3NOVA 4JUAA 4N3NA 4OI2A 3H9BA 4OKNA 5E6SA 1ZU5A 2F1JA 2QLTA 3HCWA 5EMJA 4KQIA 2OCLA 5K0BA 2QW1A 2JHAA 2WFLA 1GGMA 3S0JA 2I71A 4B40A 1QH8B 1VSUA 1ZSYA 2FFRA 5HKKD 1JTFA 1DBVO 3MPOA 4S3MA 2DYKA 3SPXA 3W5JA 2OPBA 3TAXA 2LVBA 1Z2PX 2OB1A 4AX8A 4F5DA 2H7YA 5DW0A 1T5IA 1JGTA 3ZJUA 4C7MA 1BW9A 2XUZA 4U7JA 2EF0A 2J85A 4OU4A 2WTBA 3IIIA 1ZH6A 3IQXA 3LT4A 4KQ6A 3VR6A 2P79A 1FDOA 2M1XA 3JATB 1I3NA 1M34A 1TO2E 1W48A 3K09C 3OESA 1AV7A 5IVIA 1CE8B 1U7DA 2PKQO 3WK6A 4JWTA 2Z2JA 4B73A 1G8SA 3AVPA 1JE0A 2BM0A 3EIFA 1FFBA 1GUBA 3WIBA 5JECA 3QE9Y 2B5WA 1VMDA 1KFJB 3L4BC 3GLUA 5JXJA 5B1EA 4OLFA 4V03A 1VOTA 4XX0A 1I2CA 1Y3FE 3DV0B 1ZC4A 3EBPA 4NPAA 2D5BA 1GU0A 1WO8A 3AUUA 4M54A 5KNBD 2RGEA 2JFHA 4RAQA 5E6UB 3QWBA 3WGYA 5E3IA 3O31A 2AR7A 2Z4TA 3H1GA 4PZEA 4XX0B 3EFBA 3Q98A 4Y7CA 3W8RA 4HUQB 5LBIA 1J2TA 2QTHA 2VYNA 4RKWA 3WNVA 4Y3UA 4O4JA 1L7AA 4TS3A 4YJ2F 3LUFA 3TLCA 1S0UA 1ZD3A 1O5IA 3KELA 3U49A 3UWKA 4HP8A 2EERA 3EHDA 5I8WA 3C98A 3CTPA 4L50A 3JALB 5AVRA 1DMRA 4IYRA 3C3YA 3SEFA 1RYYA 4RZSA 4N5DA 2PGXA 3C7KA 3PKZA 3WGKA 2A0KA 5ESDA 4C0LA 4EF4A 1MXFA 5LBUA 3B6ZA 5BQXA 4FOLA 4IJUA 1XAJA 1OWNA 5B1HA 4D4LA 2JGAA 3ZOKA 2YV1A 4WLNA 4HT3B 3AY0A 1DS6A 1VLHA 2Y1KA 2ZRJA 5F35A 4GGPA 4ZVUA 5IYZB 4HWTA 3G59A 1O3YA 3DBRB 1Z25A 4JLWA 2XAAA 2ZYSA 3V42A 2FG6C 5HJ2A 1K7CA 4WBNB 1EVJA 5THKA 1WDTA 3CUEF 5CLQA 1J97A 5EMHA 5HS6A 2XTNA 4XD2A 4B5KA 2YZKA 5ESXA 5ALYA 5IYZA 4X7MA 1E60A 1JEJA 4C0SA 2NUAA 1KZ6A 1Y8AA 2H16A 2IY7A 5B2EA 4LZZA 2QE6A 1VIDA 2OBFA 5PGMA 3MGGA 5K6TA 4ARCA 4N4AA 3A1SA 4Q93A 1BEEA 1G2IA 1ZI9A 3SF8B 4RPCA 3SJCA 4DQKA 5IH3A 3EK2A 2OVFA 5JO9A 3CLSC 2CVZA 4G5RA 4IMJB 2FA9A 2HV8A 3A58B 4YDRA 1U8EA 4IXWA 3RIHA 3ZWAA 4M0FA 4IR7A 1J9GA 2V4ZA 1FUYB 2VP3A 2XZTA 3BMCA 4G85A 3UMFA 4B2IA 5BV8A 2R60A 3ILXA 4ZAFA 1ETUA 2CFRA 2QYOA 4GXQA 3SMVA 4DIMA 4CM6A 4HFMA 2R48A 3Q7EA 1R00A 3UBTA 1L9KA 3UWOA 2J08A 1E3QA 5IXSA 5JMOA 4DDMA 2O4CA 4WE3A 1CDOA 4HDQB 1AQYA 3DPSA 4KR6A 5EUQB 4Q9KA 2HA3A 2ZWOA 3RHTA 2R79A 5IUKC 1U3DA 1SZDA 3CRRA 3TKAA 1FW8A 1D0SA 1QCCA 1XZMA 4HDKB 4IDBA 4JYAB 2HHHB 2B83A 3LT0A 4DRXA 1Y7LA 1AGPA 3ZCPA 3SHOA 5B7QA 5K0EA 4ENPA 1EFPA 4DIDA 5LB2A 3LKBA 1ZP6A 4QAQA 3CIFA 3DBVO 3R1IA 3OCCA 1H66A 4M0PA 1E6WA 2RH4A 3EVEA 4BFSA 4NF2A 2VQFB 3T95A 2F1RA 3B9PA 3C5EA 1N5JA 3N87A 4I7EA 4YRTA 2GX6A 4YRAA 4XYBA 1II0A 2H08A 2XSZA 4N0PA 2GD0A 3IBSA 5GP1A 5EHZA 3LTNC 4FYHA 5AW3A 4O63O 3HXPA 1V11B 4I9HA 1OU4A 1SVIA 1XL0A 1S2MA 3D6FA 3DOUA 4M7OA 4GDFA 1YU9A 2RE8A 3FMFA 4XOIA 4BRUA 2I03A 2ZSJA 4KKVA 3TLZA 1X7DA 2M6RA 4DQVA 4MICA 1M0WA 4KRYA 4QQFA 1ACJA 4L3VA 4EIWA 1NX6A 3BPSA 4E22A 1WXHA 3OEWA 2FSUA 2A6PA 3B48A 3CO5A 4W8GA 1EP1B 1KU6A 1P19A 2DH5A 2G76A 4H4CA 3BFJA 4ER7A 4RVSA 4R3NA 3LPCA 5EIBD 4ALKA 4LXUA 5EJ9A 4BYMA 4WZZA 4RC9A 3UUFA 3FETA 4LJKA 3BWXA 3DE2X 4MS1B 5D6NA 2JZOA 3OTGA 1PCXA 3OZIA 4LG1A 3QVMA 1VE7A 2B1IA 4NK5A 3NMUF 1UMBA 1W0JD 3MBIA 4ZV4A 3ZYCA 1ZD9A 1U9IA 1EUYA 2PSDA 3H1BA 2HBYA 4K6CA 2Y67A 5KYUB 2EJBA 2OHHA 3A11A 5A04A 1MAWA 2WV9A 3PXAA 5AJWA 1NNEA 2BSQA 1VA5A 2WVJA 1K89A 3ETGA 5HZMA 1VYUA 2D2VA 5ERGB 4P58A 1U0SY 3H9UA 1A77A 1AG9A 1RKUA 2IYUA 4BB5A 5C7LO 5LLSA 5LZ2A 4RWEA 4KE7A 2NWQA 1RRFA 4XQ9A 3OEED 3GLGB 2IQIA 2UYQA 2V6BA 3UJCA 5ICEA 2JAUA 3ICCA 3VV2A 3ZVRA 3VMFA 1KJ9A 4Z9XA 1MC1A 4NULA 5DBFA 5AVOA 3PUKA 3HMKA 1DIBA 3EZ9A 1Z2OX 2A0YA 1RTKA 2G06A 1C9DB 3NP9A 4J0IA 3TLBA 4PGFA 3EG5A 1U9ZA 2EKQA 5JPCA 4CG1A 2Q27A 4RETA 1W52X 2QL9A 3K0BA 3AB3A 4KXVA 3PGJA 4MW7A 4OPMA 4UJ5A 2ZJ0A 5EE9A 3U3OA 4JLVA 4I8XA 3GVCA 4LA4A 1YS7A 5JDCA 2E7ZA 4AN1A 2NO6A 4OM8A 3C7AA 2WJZB 3IVMA 3OZFA 3RADC 4MCIA 3GCXA 1O5TA 4UDOA 1HE8B 5KNLA 1I4EB 3LMKA 2PAFA 2WK1A 4IQ0A 2YOHA 4BEJA 1EX6A 4NFLA 3A4NA 2ZIUB 1SD5A 2OCKA 1PQPA 1RD4A 3DE3X 5AM1A 3WSVA 4AQYB 1LJUA 2NO4A 3DV2A 2K6GA 1CEYA 4BVBA 3CLKA 1FOEB 3ML1A 3SQNA 2EFYA 2ZGVA 3ABIA 4S0XA 3RGGA 1W73A 1YZLA 4YLYA 5LXTB 3AEUB 1YD7A 2ZTHA 3DE7X 3QF4A 3HG7A 5G4LA 4B3BA 1RWXA 3UHAA 3PDIB 1FXUA 1H69A 3FR7A 4GEKA 2ACVA 3FSGD 2ID9A 1K8XB 2ZJZA 1YZGA 3KHTA 4K3UA 4BGUA 4Z2AA 1G3QA 4RMHA 5FA6A 4FR2A 1IM2A 3JZAA 1KPGA 3IRUA 3QF4B 1C1DA 4KQCA 2CE2X 1IYZA 3QI2A 1Q95A 2D2XA 4CGYA 3L8EA 3FG9A 1QRRA 3L79A 3PC3A 4XFJA 4BGEA 4ACBA 3PEUA 2PT9A 4MIYA 2P78A 1EJ0A 3UUWA 3ZU2A 3VH3A 3WLFA 1NZDA 3KTAB 4K6HA 3UH1A 4RLHA 1CZRA 2GN6A 3PC7A 4BNNA 1I4TD 3SIWA 1OAOC 3ANSA 4RK5A 1UEIA 4DM4A 1JJIA 3GFVA 3OMWA 4EQ6B 3KOXA 2ACKA 4YV0A 1U5CA 3PQ8A 4B84A 1KYIA 4BWVA 2EFEB 2ZI9A 3DA8A 2DBRA 3LGAA 4NH0A 4WMLA 1AK2A 3W5UA 3WZMA 3ITEA 4JCCA 3DO6A 3GZ4A 1HE5A 4CLRA 1HR0B 2FF7A 2PNFA 4OK3A 1P4JA 1N6OA 2Z5VA 4H0CA 1SQ5A 3JQ8B 3N75A 2FOXA 4LRQA 3GLHB 5HJEA 1A7JA 2I6TA 3VSCA 1AMOA 3MZ0A 4LXHA 1ANKA 5DXJA 1NJFA 1XDGA 2WTXA 5JG7A 4R5MA 2HA4A 3SC2A 3K5IA 5BW4A 4RORA 2P3LA 4NYJR 4RV4A 5CNJA 3KSMA 5D6OA 2WQ7A 3B6MA 4DR3B 5B37A 2XUPA 2WKRA 4YJFB 3SC2B 1K0UA 4QDTA 3AVOA 5IDWA 2GO1A 3O94A 4OHBA 4YJGA 4JODA 4YMIA 1V1JA 2Z95A 3BJRA 4RULA 1MO4A 3SG0A 2HWYA 1HQDA 1I4LD 4C3UA 2PGOA 5FA8A 5FV4A 4ZA2A 3SZOA 1EUCB 4KPUB 3VTZA 4U5QA 4GYKA 1VG9B 3KDSE 2P62A 1EFRD 1NBOA 3GJ7A 2I4TA 1TUGA 3LKZA 5C7YA 5LU9A 4UVEA 3KB6A 2FEKA 3U6BA 1EFRA 2ZYHA 1KEEA 2WFZA 2FK7A 4MK4A 4I36A 2QD3A 5F3WB 4TSRA 2HFKA 1NZJA 3N7TA 1RWMA 2G82A 2GEJA 2YCBA 4ZV9A 4GX1A 3KQLA 4B6EA 3FCXA 3GEIA 1NKSA 3AGQA 1PJ2A 1L2TA 3OVMA 4Q4JB 3AIKA 2FR8A 3IJPA 4WLVA 1AN0A 2XNSA 1WUTA 3EMKA 4U2CA 1KSJA 3ONDA 3PU6A 1PU2A 4ZZ3A 3BZUA 5AW1A 1OJLA 3IIMA 1S4QA 3R7WB 1QF9A 5BW5A 5FH9A 4L9SA 5E2IA 4YJ3B 1HZZA 1A8IA 4JWKA 3UPUA 3C6YA 2Q62A 2XRZA 3WRVA 2FPGA 4XVHA 3FRIA 5CDSA 2D1RA 4EQ6A 3M3HA 4JL5A 5EJ4A 2DQYA 1AD2A 2Y77A 4XWKA 4HAXA 4N7MA 4G5YA 1H05A 5KSZA 1VP9A 3BK1A 1R9JA 4FOOA 3O9MA 1F2UA 5IBRA 5G4KB 2C8KA 2ZUDA 3BJEA 3E3AA 3EQ9A 4JC5A 2HDWA 4IDDA 4B0OA 2IVZA 4MTLA 4PCVA 5IASA 3V4SA 5TIIA 4J0KA 4IWNA 3VHQA 1ZN7A 5KU1A 2JDID 3ERCA 5EUBA 3BFVA 1TYCA 1F8UA 2VK8A 6REQB 3PNKA 4UARA 1NXOA 2JANA 3EG9A 5IN5A 4ZTUB 3IV9A 1YQTA 1I8TA 2W6JA 4DSZA 3TBKA 1QVAA 4PLZA 3UVEA 2B1JA 3MC1A 2X9VA 2NAPA 2QTGA 521PA 1Y1KE 1D6JA 4H17A 3U31A 4MOWA 2GPNA 5BSTA 3AEZA 5D87A 4BASA 3FOZA 3FUWA 2L42A 3CX7A 1Z6GA 3EJWA 2RKBA 5E9JA 3GK3A 1XZCA 4ED9A 5MGNA 4LHWA 1ODIA 2DWOA 4ZEMA 3ZDAA 1LDEA 4RK7A 4KPYA 3K4HA 3BL8A 2WU3A 2CXNA 3BSSA 4DLLA 2G5PA 5K6AA 1SCUB 1QK5A 1Z74A 4L6IA 4K6MA 4WNIA 4G0VA 2G1AA 3GPLA 5H8WA 1T1SA 4CDMA 2OSBA 4UHJA 2O5VA 1NIPA 2H4ZA 3GLIA 3Q40A 2JFZA 4PZ0A 2ILTA 1D6MA 4N6OA 1WTAA 1J90A 4TWAA 4L5CA 5C5DA 3F0TA 1JQ3A 4KUEA 1L4LA 2A0UA 1NBEA 1J5EB 4JEMA 4BLWA 2P3QA 3K32A 3OEHA 1TCBA 2ID4A 2X9LA 3RUDA 1Q1AA 1K5HA 2P90A 3OD1A 2I3BA 4RE5A 5JNSA 2ZR8A 1G8YA 4H27A 4D9IA 1ID8A 4BO1A 1Y1QA 1YDGA 1IC6A 3LUKA 1W19A 4GC9A 4H7IA 1RAEA 4DJ5X 1U0JA 2CBZA 4K6GA 2ZTVA 1CUWA 2FPKA 2ONCA 4KIJA 1Y63A 2IJGX 2J6BA 1REQB 3DTNA 4QRDA 3HV2A 4YALA 2WYUA 3TL2A 1RYFA 5ENVA 4HNHA 3IMKA 1ZVKA 3THYA 1V2HE 2I62A 3OCVA 4CV0A 5FYQA 1M67A 5JWOA 5LA6B 3RBAA 1SVWA 3VVLA 2YJGA 4LAFA 1LTKA 3KQHA 3P45A 2XGJA 4ZK2A 3KPJA 2CNWD 3AU9A 3FWHA 4JH0A 4S1TA 2H85A 1GP2A 1IAVA 3F6PA 5EOVA 5AJHA 3X2SA 2ZPAA 1X19A 1CV2A 1TB4A 2QE7D 4Q6BA 3EASA 3I2IA 1YTUA 3IKJA 4YAIA 5LKAA 1MOSA 4WKNA 2WF9A 5DIFA 2PL5A 2VBIA 4IV0A 1L5MA 1PSWA 1MMFB 3IQWA 2ERCA 1YVDA 3D31A 2PZAA 2O2HA 4CFYA 5CYPA 1EDDA 2H4HA 2XOXA 3EAFA 4N6GA 1XB2A 3L6DA 3JPYA 3SR3A 5FJIA 3CTMA 1KDRA 1M83A 1WEHA 2QVCA 2ZDHA 3FD8A 1GQFA 1N5LA 4V2IA 4R8SA 1J2UA 1OXBB 3BFXA 1E1MA 2VZEA 2G4LA 4HQRA 3W8EA 3MNFA 1XROA 4RH3A 2HA6A 4WRRA 3UAXA 5AUPB 2GO7A 5FR2A 4E4RA 2IODA 2E4UA 4HB4A 1ID1A 4MIKA 4MS3A 1G42A 1VHDA 2P27A 2Q3DA 3ZWYA 5EIAA 1TYAE 1FJ2A 3C41J 3RO7A 3NETA 4MHSA 4MHTA 4ZAGA 5LP6A 2YWHA 4MW0A 1AQLA 4WDRA 5KTRA 4WCVA 3THXB 1RIIA 2YN4A 3ORHA 3UJAA 2NLOA 2GEFA 1MEJA 3OMLA 4AMUA 4AURA 4HXYA 4N3CA 2HSDA 1GHTA 3LDHA 4UEWA 1KJZA 2WWXA 3E0QA 5KTMA 4P5PA 3PZRA 5KX5A 4TN1A 5CJPA 1RCFA 1UJ2A 1NDUA 3NQ41 3HB7A 3EAGA 3UKJA 3C3JA 1I14A 1PZFA 1G9SA 2AVDA 1XPJA 2LE0A 2OCYC 3IHKA 2Q4DA 4ZDIA 4GQIA 1GILA 2J30A 2XI4A 4HFRA 2P91A 1SHTX 4CLXA 4O6VA 1KYXA 1D1QA 1HC7A 3LSTA 4OQFA 4LYHA 3SAJA 2C2HA 3RVNA 2AWOA 3L4BA 2VP6A 3OIWA 1G55A 4DA4A 2YZMA 4M6WB 2PZKA 1KK0A 1N1EA 2ZU0C 1YOVA 4DLSA 3TF5A 3GP8A 1DAIA 2C58A 1ZM3A 3TG8A 4O4LA 3NKFA 2I29A 4QHTA 3ZWOA 1HLGA 3ZDQA 4QPJC 3T3EA 5KWVA 3Q8MA 4G6ZA 1QDLB 5FAXA 1PSZA 2FLVA 2QQFA 3HWX1 3KO8A 3SOPA 2WJPA 5L3QB 4DDWA 3HA2A 2O2EA 3FBTA 3QBVA 3LLUA 4Q01A 3KPVA 1DWUA 2H9AA 4NYIQ 1YA8A 1OC4A 1RAIA 5MDHA 2ORYA 1UJ6A 4Q4HB 4RELA 1JEQB 3IC5A 3UH0A 1J70A 1N25A 4LQ4A 1ZUIA 3I37X 4AJKA 1KARA 4Y1RA 1WDMA 3QENA 3U3XA 1WSAA 2E9SA 2OENG 2AS0A 3LX6A 1DFGA 3G2KA 4JJEA 1LUAA 1BN7A 1RRGA 1GQYA 5DMHA 2B4YA 1XZIA 4W63A 4K87A 4M9SA 3LL7A 2P9YA 1IXSB 3U9TA 4D97A 4IS2A 2AFIA 3A4TA 2VKQA 4MI3A 3VNQA 1U31A 4E2WA 4ER5A 4TL9A 2FOIA 2WICA 4ZGWA 2PS3A 1CWUA 1GCUA 1Z39A 5F12A 3ZQUA 4C9BA 1Z63A 3ABQB 3TNJA 3P4YA 1E1QD 2AB0A 4WEOA 4F6CA 4HL6A 3MG9A 2P1ZA 3SI7A 1CBUA 1FUIA 5J1TB 1LBHA 2NU8A 3HDTA 3KSDO 3LBHA 3PF9A 3H8VA 4FM9A 4LFBB 4M37A 3OE1A 3L05A 1UWKA 4M9CA 2OVBA 5HBRA 3TZQA 3C4VA 1R5OA 2JIOA 3L4KA 2ZJOA 1ESCA 5TJ9A 4ZVSA 2ZJYA 3C45A 5KVQA 3QV1A 3TD2A 1BD3A 2UUAB 2FZEA 3TB6A 1O9BA 1U80A 4CMIA 1NN3A 2ZATA 4BUJA 1ZEMA 5KTSA 3OOYA 3OX1A 3S8EA 3QXGA 2ODBA 3S99A 3M1YA 1XHFA 4JP8A 3STXA 4WINA 3IR7A 2APJA 1E1NA 1I7LA 1T9KA 2IZ7A 4E2XA 5BWBA 1C8VB 2DPGA 3ED1A 3CLVA 3CKMA 3QVWA 4XYMA 2WJ3A 4GC5A 1PNRA 1R6XA 4NZ9A 5F52A 4GI5A 2HPHA 2GCIA 1XNGA 4UHCA 3HDGA 3FHTA 1CCWA 4NOJA 3KQKA 3WKAA 3DVAB 3EGCA 2PGLA 5IU6A 4TGLA 3CF4A 2II6A 4P6VF 3AWIA 5TQ0B 4PGAA 4EA6A 5KYXB 2WTMA 3L6BA 4R2LA 4AG5A 3GLHE 3K1JA 1G19A 3QE4A 3EQ6A 3N2KB 3NAZA 5FQNA 4X3PA 4WZBB 4FHDA 5CFQA 2FX2A 3OPXA 3AGPA 2W2QA 1Q74A 1XZQA 7MDHA 2BUCA 1E4EA 3OIGA 5CM9C 4Q21A 4PYNA 3WKDA 2WTAA 2H65A 4PFJA 3HO8A 2BEVB 2IIBA 1M2GA 3DM9B 3QSGA 5JNRA 1GZVA 2IHVA 2FJ0A 3M6LA 2JLXA 4MI9A 3EXIA 5IMBA 2NZ8A 4HEJA 3V2HA 4QIHA 4EB6B 2GT1A 3W2FA 5AVUA 1FNMA 2EW8A 2QU8A 2X41A 3F7OA 5CVVA 5IJAA 1QHNA 4HNAB 1MVOA 4P3YA 1ZOPA 2D0PB 3FOCA 3I9KA 5B64A 3HYLA 1QHHB 1SR8A 1YULA 3P0IA 4TXLA 5AXBA 3EZLA 1BMTA 1IL0A 2ZUEA 2P9TA 3ZHTA 1A98A 4PWYA 2MOKA 5LD2B 2DQ4A 1DJLA 2BFEB 3CLHA 3H7IA 4L5YA 5F9MA 3CNQS 4U2KA 4YRBA 3LCRA 2FWRA 4IJ5A 4OYYA 5T3UA 3K05A 4NAUA 4PRLA 1P2TA 4P0TA 4TWIA 4ICIA 5D51S 3Q9SA 1Z38A 1AE1A 2WG2A 2RH9B 1H6CA 4C7XA 3HEMA 2XQGA 2B99A 1HLPA 2IUEA 1SUAA 4MH0R 4MGZR 2BFCA 2YTZA 2ZJAA 4BO8A 2QGZA 4HS4A 1W9MA 3I8XA 1YA6A 3HVUA 1GSHA 4Z0HO 2ERXA 5B2FA 1CT9A 2IUFA 3G7UA 3HCRA 3HBAA 2J87A 1UWLA 2QX7A 1T8YA 1G21A 3ZW8A 4EHDA 5CX4A 3JQ7B 2YN2A 5E2BA 3K8ZA 3OT5A 3ZR4B 1T4CA 4JI6B 4R84A 3BF7A 4Y30A 3ILSA 3COSA 1MC5A 1F9EA 3QEOA 4MQLA 2AH5A 3NOQA 2BM9A 4GG1A 2XH8A 5AOAA 2J67A 2I2DA 2WYHA 2IXFA 5JAOA 3HHPA 5J5AA 3FF4A 5EIOA 2XBMA 2REOA 2HA0A 1YQ9A 2VPTA 3I9LA 3RBVA 4CDRA 5IEJA 5L3VA 5KDDA 2VSQA 3OHPA 3B6EA 5KNDA 2HNAA 4HS9A 2QNBA 2VBGA 1L7OA 4TRNA 1UJBA 1ZNXA 5EERA 2A1TR 4Q00A 1WMDA 1GKIA 3WB0A 5B6JA 2WD8A 3PWTA 3K9NA 4P4UA 3NI2A 2Z08A 4DUYB 1QIJA 2WOJA 3FE2A 3U7QB 3MLEA 1W85A 4RZ3A 1JFSA 4MJLA 3JZIA 1JLHA 4RMJA 3E82A 3HSYA 4UEOA 2EKZA 2YWCA 1N2OA 4JB3A 3ZUGA 5FORA 3IIJA 1LD3A 1WXQA 2VS1A 1FP6A 3ZCVA 2ZM5A 2HU7A 3TB4A 3OLYA 3EYAA 3WBJA 2B2NA 1LB1B 1XZAA 2R6CA 3LX8A 3PKJA 4GQAA 5DFAA 5ESWA 4X95A 2J3KA 1WLSA 2VJYA 4YPOA 1WPQA 2FU5C 3GLQA 2OM6A 3UICA 1P17A 1S2OA 2NYUA 3AXSA 1N2BA 3CG0A