4TTRA

Crystal structure of legionella pneumophila dephospho-coa kinase in complex with bu2
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
201
structure length
201
Chain Sequence
MVYSVGLTGNIASGKSTVAEFFSELGINVIYADKIAKELTSKNTPCYQDIISHFGSSVVLNNGELDRKRIRDIIFSNSNERLWLESLLHPVIRKKIEEQLIVCTSPYCLIEIPLLFNKHHYPYLQKVLLVIAPLESQLDRIVKRDHCTKKQALAILATQPNLEQRLEAADDVLINESGLSELKAKVNKLHQKYLREAKIKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Legionella pneumophila dephospho-CoA kinase reveals a non-canonical conformation of P-loop.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Transferase
molecule keywords Dephospho-CoA kinase
total genus 71
structure length 201
sequence length 201
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ttrA00
1M7GA 2OSBA 3FDIA 4TSFA 4FMCF 5JBQA 1QF9A 2DFNA 3X1XA 1P9RA 4ZIRA 1AKYA 1KK1A 2GVDC 4LYHA 2Q9BA 1JNYA 3F5FA 2A5DA 4QOSA 2O8FB 3RC8A 2ZRDA 3CLVA 1XMIA 2V8OA 3RSLA 5KPDA 3EPLA 4A82A 2Z0MA 2FDCA 4GOKA 3A4MA 3EZ7A 5JLJA 2AWOA 2G0TA 4FMDF 1T4GA 2IWHA 3H1TA 4JJZA 5BN3A 2JA1A 3EWSA 1ZUNB 1RYHA 2IYYA 2REXB 3Q72A 4LJYA 5CJ2A 2V4ZA 4US0R 2D74A 2F9MA 4UNSA 4YXWD 1W4CA 4L8GA 3QXXA 4HB2A 2B8TA 3UKDA 3ZZ0A 4O2RA 2QT0A 4V02A 2FFQA 4G5OA 4XWOA 2FMXA 3GEHA 5JEDA 2ZSFA 4PC2A 4EPXA 1DARA 1T8UA 3OF5A 3IO5A 1VG1A 4W5WA 1RFLA 1LV7A 2ORIA 1ZCAA 2DFKB 3LLUA 3C5HA 3NHBA 4LHXA 2BEKA 4OJKA 4Q4JA 3TAHA 1OIXA 1CJUC 1MO3A 5JZVA 1P75A 2J9RA 4L9WA 2KB0A 2WPDA 3ZVMA 1I4DD 2MSCB 2J7PD 2VTKA 1H65A 1G9XA 2C99A 1UDWA 5L3QB 5BW8A 5JWOA 1F60A 1XMVA 4LJ5A 3BH0A 2WTUA 1KAOA 3THWA 5FR1A 1L8QA 1KO8A 1X1RA 3Q5EA 4Q4AB 3RABA 4TMTA 5FTLA 2ODWA 3CF2A 3QOFA 1QG4A 2P5SA 3OIUA 3UIEA 4JSTA 3PENA 1Q1ZA 3CZQA 3PXGA 5FFMA 2IEYA 5EE1A 4EJSC 2FFBA 1AS2A 1XJQA 1XFAA 1P3JA 2FFHA 3FMPB 4QGGA 1N5IA 3AV0B 1N5KA 3DOFA 4WA7A 2WWIA 3LBHA 4B34A 4B6FA 2XB2A 2QY9A 1C4OA 2X2EA 2BMFA 3BFVA 3VU9B 4DT1A 3GJ7A 2CEAA 4KV9A 5KNDA 1ZU4A 4D82A 3MG9A 4YC7A 1ZC4A 2WIBA 3DZDA 1KY2A 4C3ZA 1IONA 3LQRA 1JJ7A 1I2MA 1FTSA 2QSYA 1TF2A 1P73A 3ZS9A 4FINA 2MMGA 2QAGC 3WYFA 3U7HB 1FL9A 2ZRPA 2MMCA 4F7WA 1KSJA 1RKBA 1T9HA 5G40A 2OCPA 1TQ6A 1A82A 1TU3A 2VP9A 3MFYA 4II7A 5D3MB 4HEJA 4XSGA 3SFVA 1N25A 5C18A 1Z0JA 4I81A 1E0JA 5EUMA 1QHSA 4X8LA 2HLDA 1CTQA 2YWEA 1VYTA 4BLRA 3CPJB 2O52A 1KNXA 1AZTA 1QDEA 4P3YA 5BWMA 4QXAA 1EFRD 1A1VA 4PTLA 3AVYA 2VL7A 4XTRA 3S1AA 3QVUA 3RRYA 3U3MA 4JKYA 1IN5A 2FN4A 3B1WA 2GCOA 2RGAA 3MUFA 1ZM2A 4L9SA 2GJSA 5DIFA 4TLAA 2ZIAA 3KJIA 2JJ8A 3U61B 2AK3A 3LQQA 4DJTA 1T3LA 1AK2A 1T8TA 1NLYA 3P4XA 3SC3A 3ADDA 3T1QA 4MRSA 4KXFB 2PMKA 1FP7A 1UF9A 3ZVLA 1T0JB 1I2DA 4JIMA 5EXPA 2WSSD 2C77A 4A92A 2ZI9A 3B85A 3K9LA 4B2LA 1U8ZA 4BZQA 4HB0A 5FPKA 1E2JA 5JS7A 4OI4A 3DL0A 3CRMA 4DSUA 2VQSA 3QF7A 2NQ2C 4MA4A 1MO5A 3U44B 1DAEA 2CLSA 2EWWA 1KDTA 5EE0A 3L8YA 5AK0A 4C4PA 621PA 3VHLB 5C2JB 1Q3HA 1GRNA 4LCBA 4CIDA 1OH8A 4FMCB 2QORA 3SS8A 4ARZA 4GFDA 3FHTA 1P2UA 3KQUA 1NMZA 3KQHA 1OW3B 4IRUB 4US1R 2O8BA 2HF8A 1JQLB 1P2VA 3M6AA 1X8KA 2FV8A 4YDSA 1NKTA 4IDQA 1VCMA 1A5TA 2EYQA 1Z2CA 2WWXA 3TQFA 1EXMA 2VP2A 2CCKA 3EIQA 4PQRA 1Q44A 2ZJAA 3SHWA 4DUGD 3R9XA 1Z6GA 3SZRA 2GZHA 3GJ3A 1CJKC 1QBKC 3AEZA 4BE7B 4DLXA 4R9UC 4QC2A 2GHIA 3KQNA 4AKGA 2AKAB 4EFMA 4PC1A 3SU8A 4Z51A 3BH7A 1XTJA 3BRWD 1KDPA 2FG5A 3MWJA 4U02A 3TJZA 3KJGA 1DO0A 1FW6A 2ZPTX 3K9GA 4AG6A 1E98A 4LC1A 3IUYA 1NN3A 1VCIA 4M9ZA 3SBDA 3C8UA 4CGZA 1XTRA 3P26A 2B6HA 2ZSDA 2VSOA 3ETLA 5G53C 4YMWA 4R71A 3K8YA 4A9AA 4DBLC 3BGWA 1S3SA 1CRPA 5AUNB 3VR3A 4LBYA 3VKHA 4D81A 2ATXA 3FPAA 2VH5R 3C14C 4IXNA 1NBMD 3NWJA 4PC6A 4C0JA 1XP8A 1ETUA 1JALA 3IKJA 1PLLA 1ANKA 1DTSA 3QKRA 4KO8A 4PHGA 4UJ3A 4DWJA 3A36A 4NYMR 4AKIA 5JJLA 2IXGA 2QP3A 1VYVA 3A8TA 2F7SA 4M1YA 1ESNA 1CJMA 2C9CA 3BERA 3P32A 4RFSA 1G8PA 3ZYCA 1J90A 3U7FB 4X8MA 2R62A 3BB3A 3WNDA 1GKYA 3CH4B 4GBMA 3FWYA 1NN1A 4OQFA 3A4LA 2IYTA 2ZTSA 4ZV4A 3IIMA 4ZCLA 1D6JA 4D2IA 2ZRMA 3WXMA 2EU8A 2YZ2A 4V0MA 2IWRA 1YQTA 1QVRA 3AGPA 5FL7A 4B35A 4Y0AA 3GLIB 5JSZA 2IXFA 1B23P 3I8SA 2OUKA 3I8XA 4DB2A 4NTZA 3ZLJA 1NF3A 4M1KA 5TMPA 1QHYA 1Z5ZA 5KSPA 2G1KA 2PLRA 1ZAKA 3HU2A 3B5JA 1YRAA 3DEFA 4PSKA 4EQ6B 1SZPA 2CL0X 3FMFA 3LH5A 5TV2A 1ZP6A 4HAZA 4BASA 3GJ6A 4GMDA 2ZXUA 3VAAA 2G6BA 1OKKD 1ZJ6A 4O0MA 5EXSA 3A58B 2O5VA 1N5JA 2RGEA 1W2HA 2QEQA 4UXIA 2QMEA 4R2IA 1O3YA 3L0OA 3W9YA 1SVLA 3B78A 4NCKA 3OE7A 1TPZA 3B82A 4Q1EA 5CYPA 4B3BA 2OO7A 1TAGA 5KDDA 2OLJA 4KYUA 1XDBA 3ICEA 1ZW6A 1Z08A 4LHVA 2J7KA 3SJAA 1NSFA 5HE8A 4Z8YA 2QENA 2V7QD 5HZHA 4B3XA 2YJTD 4HB4A 1RE0A 1FUKA 1RYFA 3GFOA 4OHWA 2ZAMA 4BFXA 1OV4A 3BBPA 2Z83A 3DMDA 4LJ6A 2FGKA 4B47A 3BFKA 4C0SA 4CEHB 5BYJA 3O8CA 3QXJA 4IOKA 3TSZA 2ZRHA 2OCAA 4NYIR 3KXKA 1E2LA 3PEWA 3T12A 2ZE6A 1IXSB 4AYXA 3IBYA 5DHAA 1S9HA 2I4IA 1ZM7A 4KI0A 2AHOA 3EA5A 3B13B 4ESHA 2SHKA 1NG1A 4JVMA 2GNOA 4LC0A 5H68A 1DBSA 5SZHB 1E2HA 1JI0A 1E2FA 2IS2A 2B21A 2IL1A 4F92B 4TMVA 2R6DA 3L82B 1YZLA 1DAHA 2OM2A 2NIPA 2BMEA 3HR7A 3KTAB 3VNVA 4YQFA 3NC0C 2KJQA 4LYAA 4CYMA 3NBFA 2JDID 4PO9A 2REBA 1I4LD 821PA 2YOGA 4A0FA 4ARZB 2IXEA 2A5YB 4JLDA 2VP0A 1KO4A 3L0SA 2GWHA 2ORVA 1MKYA 2HJGA 1U98A 3CONA 1GOTA 2VA8A 2BM1A 4IHQA 4OI2A 1H8EA 2PH1A 4JS0A 1OJLA 2YV5A 2WOOA 3FB4A 2F3TA 3QF4A 4XVUA 1PVOA 1BMFD 2P65A 3CF6R 3QEOA 4B3FX 4IDPA 4ZCMA 5J4LA 3ASZA 1CS4C 3SJZA 2Q9AA 1RZ3A 3IHLA 4NBSA 1GKIA 2VHJA 1D2MA 5FH9A 3B7GA 1KNQA 5KDLA 1VTKA 3AM1A 1KZ7B 1CR2A 5EP1A 3AVUA 1ZNWA 1G3QA 1WE2A 4JLMA 4BECA 3MWYW 1G8GA 4M1WA 4TYQA 4TL6A 1Q1QA 4IVPA 1ZUHA 4IXMA 4CRWB 5FOXA 2BJVA 5K8IA 2PJRA 1S8FA 1I4TD 2B92A 2NPIA 1GVNB 3GJ5A 4XTCS 2ZSEA 3GQBA 1II8B 1JR6A 5E7IA 1SXJB 3IQXA 4DLZA 4IOMA 4KFRA 1P9WA 5JFGA 1G8YA 1J2JA 1M2OB 4LY6A 5A4JA 2DYKA 4TMKA 3WNCA 1H8HA 2BM0A 2IYQA 2P6RA 2J46A 4NYJQ 1K6MA 1R0ZA 2HF9A 3K9HA 4P0TA 2CMKA 2J7PA 2RKOA 2V6JA 3Q9LA 2BHRA 2O0KA 3FMOB 1Q20A 1CF4A 4RZUA 2LKDA 1YE8A 2PX3A 3U3KA 5M04A 2IYWA 2ZITA 4NKRA 3EAQA 1CU1A 3W34A 3EARA 3L0PA 2E1RA 4M8NE 3H2YA 3P20A 3QXCA 4N0DA 5TVKA 4YONB 2ONJA 3AUYA 1KI1A 3KTAA 1KIMA 5G41A 3W90A 1HUQA 1JR3E 3B8HA 4O2LA 2J3EA 3DPUA 5KSYA 1JB1A 1Z28A 3H84A 1KI9A 1N0UA 2ODEA 3QUSA 4IVQA 2NZ8A 2YOFA 2JLSA 2OBNA 1B0UA 3JVVA 4IOJA 4TWZA 2QGNA 1XB2A 2O8CA 1G20E 1NBME 1J8MF 2MSEB 1R4AA 4JJKA 1X8JA 3MRSA 4ZI3A 1ZBDA 4GMXA 2C96A 1E69A 4LDJA 2C95A 1J99A 2AKYA 4W5HA 2XAUA 1KJYA 1CJVC 1F2TB 4QGHA 2BCJQ 1W0JD 2HLDD 4D0NA 1Z06A 3ADBA 1IXRC 2ZJOA 3AKCA 2DWOA 1ZM3A 2GRJA 1XTIA 1NIPA 4LOAA 3U5ZB 1G6HA 1HY3A 1L7VC 4M1TA 2A78A 3MSXA 1D9ZA 3CR8A 3QNUA 3V4RA 2OXRA 4A36A 1CEEA 1F48A 2Q9CA 1BS1A 3WBJA 1L4YA 4EPYA 4A4DA 4URVR 3LXRA 4OHVA 1CLUA 3K0SA 4A1FA 1LVGA 1S1MA 3TQCA 2ZI5A 4B33A 4WZ6A 3CIOA 1P9NA 3IPYA 1BYIA 4LBZA 1DELA 3HR8A 4JLAA 3PR1A 1OB2A 2QMUA 2H8KA 2ONKA 4EJSB 1GZSA 2FEMA 3K0CC 5HTKA 1MABA 1Y3AA 3RWMB 1W7AA 1UEJA 3D8BA 1E1RA 3W3AA 3CM0A 1PV4A 4I1OA 2GA8A 2VHUA 2Z4RA 3V4FA 2Q3FA 5KDOA 3P1JA 2QAGA 3MWKA 1LB1B 1KK2A 1P5ZB 3QXHA 4TLBA 3TLXA 2ZE7A 1NJFA 3DMNA 4TMZA 1W47A 3OFNA 5AJXA 4UJ5A 3ZIAA 4MDFA 2J0UA 4CEIA 2CXXA 2ZRBA 1U0HC 3H86A 2FH5B 2JATA 2F1IA 3TW4A 1CP2A 1G7CA 2XITA 1X8LA 4FWTA 1E9CA 2QROA 1JR3A 4M4SA 4PC7A 5KNCA 4TLCA 2ZQ5A 1OFHA 4N3NA 2WKPA 4S35A 1II0A 4JLBA 3RVBA 3ZQ6A 3CX7A 2WWYA 2RGCA 3WNBA 3FHOA 4URYR 2GDJA 3W6OA 4D4JA 3HU1A 5CDFE 5LB2A 5F98A 1D5CA 2ODNA 1JPJA 3KKPA 3FKSD 5AUQA 3QJYA 2OFWA 2W00A 3HYRA 5LD2B 2ZVPX 4PSAA 2PL3A 5TB5A 2ZS8A 1W0KD 3ADKA 3UG6A 3BORA 5J4VA 4DLTA 2C9OA 3C15C 3I1FA 5BN4A 2JLUA 2F55A 1W46A 2XOKD 4JLKA 1IN6A 4D25A 3VQTA 1E9DA 4CVNA 1SQ5A 4F4CA 1P61B 2JLWA 3C7KA 5G3YA 3QPVA 2J1LA 3I4LA 1KJZA 1YR7A 4JLOA 1HURA 3BB1A 2YWHA 1GFIA 1ZD8A 5EE3A 1OSNA 3KDSE 3TR0A 4F93B 1AN0A 1P72A 3SN6A 1ZIOA 5G3ZA 2IUUA 2FZ4A 4Z1MD 4D0GA 1KDOA 3EX7C 3NBYC 3QPUA 3BK7A 4LJ4A 2CNWD 5L3SB 3Q7QA 1EX6A 1KSHA 4UXJA 1PZNA 1N3BA 1F6BA 2A9KA 2JJ2D 4N1AA 4DCTA 1CXZA 1N0VC 5GADl 1G5RA 4LV6A 4RCZA 1US8B 2WZQA 2OAQ1 2OG2A 3HJNA 4ZCIA 5K8LA 4IVRA 4JLVA 3QVVA 5AJYA 2HT1A 1XZPA 1R5OA 2OBMA 3ZZTA 2IS1A 3UATA 3AVXA 4NYIQ 2WAXA 1KI6A 4Q47A 3RS5A 5GVRA 2VSFA 3L8ZA 3K0FB 5KNBA 2A5FA 1UM8A 3GLHB 3LV8A 3WMEA 4MRPA 5CB6A 3PEYA 3DM9B 4TN1A 3FE2A 1Z6YA 5B2ZA 4M53A 4N0EA 1SHKA 1VHTA 2VEDA 1ZC3A 2I1VB 1SHZA 1XCGB 4DDTA 4P33A 3RANA 1JECA 1RIFA 1G3RA 1R5NA 1TNDA 1SVSA 2VP5A 1OH5A 1W0KA 3SYNA 4KU4A 4UKDA 2ZYVX 4G5RA 4DHEA 1GNRA 1W36D 3QPWA 5CDFA 1FP6A 2GZAA 4HAVA 5C46F 3KB1A 3L0IB 4EPWA 2BDTA 3ZD7A 3OE7D 1KY3A 3M1IA 1ZNXA 3QIAA 4EJSA 3PUZA 4NE2A 1IY0A 2XOKA 4US2R 4O25A 2XNSA 5FTNA 5GJCA 2ZR9A 4LBVA 4MGZR 2WOJA 2CK3A 2CHGA 1DAMA 4Q48A 4RD6A 4V0ME 4OK3A 4AWXA 1M8PA 4B44A 2XB4A 3A6PC 3OHMA 4Q02A 5FOUA 1OKKA 3FKSA 3SE0A 4V0OA 2ORWA 5JWHA 1RRCA 1UADA 4GSYA 1XEWX 5BN5A 2KSQA 1Z0AA 5J5CA 2C98A 5P21A 3UG7A 4Q9IA 4DLYA 4BRWA 3N5CA 1E0AA 3ASYA 2EFHB 2PEZA 2IA5A 3GLGA 2J45A 4PO1A 4YLGA 2GCNA 4RZ2A 1NMXA 2ZRJA 1M6NA 1AGRA 3O8RA 1N6RA 1SVKA 2JGNA 5FL7D 2GJAA 5EE9A 4P4UA 2QZ4A 2IS6A 1G4AE 4K8OA 1E3MA 2PZEA 3CRVA 4ABYA 1TADA 2QM7A 1AS3A 2EQBA 5CLLA 1V5WA 2OXCA 1S1CA 3CPHA 3RS3A 1MH1A 4Q21A 1HTWA 3ZGXA 1YR6A 3AVTA 3DO6A 1AJEA 2C04A 4A0RA 1T91A 3GLIE 2WV9A 4XWKA 4QBFA 2CVHA 1VKJA 3IEUA 3VKGA 2YOHA 5L3QA 4BFSA 2QTVB 4Q18A 4A2WA 4ZI2A 2PBRA 3NBXX 1V43A 1Z47A 3LA6A 4L16A 521PA 4W7SA 4C30A 2GKSA 1T5IA 2RGNC 1G291 1PLKA 5DH9A 2VHCA 3AQ4A 3K53A 3DKPA 2VIIA 1EFCA 4MGKR 1KI2A 1FPMA 4PHFA 1G1MA 3I62A 1OB5A 1A2KC 2ZUCA 1DVRA 4A15A 2A7QA 2WBLC 3IIKA 4RCYA 1KK0A 3SI7A 4U00A 4DIDA 4RD4A 3LWNA 2JLVA 1NVWQ 1U8AA 3F3YA 1IOZA 5JI2E 2PT5A 1AM4D 1W49A 4PPQA 5JECA 1JAHA 1ZD9A 3F0TA 4TYWA 1AA9A 3RWOA 3DVLA 1JEEA 2V9PA 2D3WA 1FTNA 1XTQA 4G0NA 3TE6A 1Z29A 1G18A 3RS2A 4DCNA 4ZO4A 1K8RA 2O8EB 2NOAA 3GJXC 4LJ7A 4QGFA 4HLUA 4HYYA 4D4KA 5EP2A 5HZKA 5C4GB 4JKIA 4JZKA 2IHYA 1E9SA 4GZMA 4LV8B 1BOFA 4OI1A 3AF2A 1S0UA 3FVQA 4M21A 2EW1A 4WXPA 2N42A 4KITB 5TDHA 3ZZUA 4CT5A 3HPRA 5BYKA 4NMMA 3K70B 2J59A 4G5SA 3PCRB 4K81B 2GXUA 1P62B 2ZS9A 1UEIA 2ZJ2A 1KI7A 2WSMA 4DDUA 4FI3C 1G3IA 4AK9A 1YR8A 3U6KA 2IYLD 2OCYC 4MQBA 3CWQA 2W2XA 3NIBA 3RS4A 1E79D 4PPFA 1Y63A 2FNAA 1KHTA 3QXSA 5DO9A 2F1HA 1E9BA 5L3VA 3BFXA 4AKEA 4XVQA 3VR6A 1N6NA 3E5HA 1P60A 1HE8B 2EYUA 2GJ8A 5HR5A 2AD1A 4PZYA 1R0WA 1E2KA 2YINC 4OQXA 3U44A 4OI0A 3AP3A 1WXQA 3OAAD 2Q3HA 4HUTA 1OH6A 2JLYA 2E9SA 2RGNA 5GJVC 3GEIA 3VHXA 1XF9A 3W6NA 4DB4A 3ZIAD 1YZQA 4G1UC 3FGNA 1E9AA 4X8HA 5J4HA 5FPHA 1G17A 4KLZA 3SHFA 4TQ9A 2NO1A 1BMFA 3A4NA 1XCPA 4OHXA 3OEHD 5B57C 4C7OA 2WPDD 3NVAA 3UMRA 1Z6XA 3MGCA 1OPXA 1NSTA 1ZYUA 1KMQA 2XGJA 4RJLA 2NPFA 1XD9A 2ERXA 4BPBA 3AKEA 3NG1A 1EFHA 1KSGA 4RD0A 1W4BA 3I72A 4GOXA 5B64A 3E1SA 2XTZA 3CR7A 5EZ5A 1TMKA 3GFTA 2JDIA 3PG5A 2XTNA 4C0HA 3KKOA 3AKYA 2J0SA 1KI8A 1SXJC 4B71A 5IHPA 2WWHA 5SZKB 1COWD 3OZXA 4JYBA 4DKXA 2VP4A 2R6CA 3BXZA 1AIPA 4GP6A 2QQ0A 4C2TA 1MOZA 3T06B 4GZLA 3KQLA 4G3XA 3DHWC 5DLQC 1E1QD 5H70A 1RPZA 5DI3A 4Q1CA 4KFUA 2IK8A 2CDNA 2N46A 5EP4A 1SXJE 2VBCA 4ERNA 2JEOA 1XXHB 3QY0A 4PAOA 2DR3A 3ADCA 3HYTA 4M1MA 2V55B 1KSFX 4NZYA 4XD7A 1LTQA 2GEUA 3N2EA 1NI3A 4L4UA 4Q00A 1IAQA 2BKEA 5BQ5A 4HZUA 5L3RA 4IEIA 2G1JA 1AQUA 3SR0A 3WP1B 3PJRA 3WHLA 3HDTA 4NCJA 4NDZA 1RRFA 3KQKA 2R6GA 2ZRNA 1Q12A 4HAWA 2YWFA 3UXMA 1HT1E 3VR1A 5DN6D 5JWRA 3THXA 721PA 3QEJA 4DEYA 1IN8A 4JVSB 2JJ1A 4C0BA 3BC1A 4S2EA 5FL3A 5KPJA 4A6XA 4V0KA 3QBTA 4TL7A 1XCMA 1IJEA 5ANRB 221PA 1G7RA 1X6VA 5HPYB 3OEHA 4JLNA 2D62A 3D6TB 1J7KA 1E79A 2VF7A 5FI0B 2ANCA 3RLFA 2ZJ8A 1MR3F 2G83A 4I1VA 4M1SA 1LF5A 1TF7A 1YZNA 4FMDB 4IFBA 3EIHA 2IF0A 2TMKA 3W8NA 4LX0A 2ZROA 3AB3A 4TT3A 5CIQA 1Q1EA 2YC4C 1LS6A 1E2GA 1CR4A 4QHYA 3WYGA 2J0VA 4B6EA 3B1YA 2WICA 4LYFA 1P2TA 2EWVA 4H9GA 4E09A 1HE1C 4YDHB 1ZM4A 5EQTA 3CW2A 2E87A 3QENA 1NVVQ 4RFSB 2PEYA 2ZETA 4LV5B 4RD2A 1ZD1A 3I73A 4XSHA 1IXZA 1XMJA 3EC2A 1P2SA 3LVRE 3EZ2A 1SGWA 4URXR 2MSDB 2OCBA 5EXXA 1CBUA 1R5BA 2O0HA 2ZI4A 3SOPA 1IM2A 4HLCA 2PCJA 3A37A 3AUXA 5KOYA 2R9VA 5GJWC 2QRZA 2DWQA 2JIZA 2C03A 2N1BA 4D0LB 4DLVA 1NNEA 2KE5A 4LJAA 4MKGA 4PX9A 1S9DA 4GNKA 5TARA 3THYA 2ZR0A 4WZAE 2Z5FA 2ZRAA 2DPXA 2OILA 2ZJBA 3OIYA 4PZZA 5CM9C 1ODFA 2GK6A 3LFUA 3VR2A 3QKSB 5K8UA 2AXNA 4NP6A 2RCNA 2R8RA 1QHHB 1SULA 4JMPA 1QHXA 3KX2A 4KBFA 1OXXK 1Z63A 1R2QA 2VLIA 3DZ8A 2F1RA 2O8EA 2CL6X 3WYAA 2NO6A 2EFCB 4ZIRB 1SVOA 3I3SR 4HI0E 4MITA 1R7RA 2BC9A 2FF7A 2GEVA 5JEEA 5CK4A 1XZQA 1AZSC 2CJWA 2GBLA 1E4YA 2AD5A 4HLQB 4CEJA 1BYUA 4MRNA 4LYJA 2ZUDA 4MYCA 3UMFA 3A1UA 2WMOB 3KZ1E 3BH6A 3D31A 1HQYE 1TU4A 1VECA 4U5XA 1IN4A 1NBMA 1M7HA 3N2IA 5HCNA 5H8WA 4V0LA 4A0HA 4MYUA 3I61A 3TBKA 421PA 1YJ5A 5FBRB 2ZAOA 4NU0A 2FSGA 4URWR 4WIAA 5AR1A 4G01B 2P6NA 1JPNA 1LNZA 3FTQA 3OIVA 4FCTA 1S3GA 2VRWA 3C16C 3CF0A 1TEVA 4IW3B 2G88A 2Q3MA 3V9PA 1E2NA 3PV0A 1Z0IA 2G0NA 3RSOA 1XEFA 3T1VA 2BBWA 3KUDA 1KDRA 3QI2A 2GK7A 1OLOA 4OYHA 1CJTC 1G8HA 5EE5B 2JIZD 1NG9A 4TZ6A 1TUEA 2P5TB 2QAGB 2R2AA 5AWFC 1TX4B 1MO6A 4NYMQ 2ATVA 1NP6A 3GLFB 4Q4LA 5F2EA 2J87A 3RRMA 1G3UA 2ASEA 1RVDA 1T3SA 2EVWX 2J5XA 5J4KA 2AL7A 2NO0A 5EXTA 1F2UB 1N2CE 2FGJA 2ZI7A 1W48A 1XU4A 2RH5A 3IILA 3IEVA 1KMHB 1EESA 1G21E 1VG9B 2ZYTX 2O8BB 1DOAA 5CLQA 2P0EA 4QNRA 5JRJA 2H16A 2WHXA 4J0QA 2FE4A 4QNMA 3LRPA 1FUUA 4NPHA 1IN7A 1WBBA 3MCAA 1GNPA 1GM5A 1ZVQA 4ZPXA 4A8JC 4FD2A 1R0YA 1JBKA 2FWRA 2NTYC 4HUQB 1XX6A 3M4YA 1E9EA 5DE3A 1NN0A 3SJCA 1KO5A 3BJIC 2JCSA 3I92A 4C0KA 4PFSA 5FBWB 3GLHE 1YRBA 4BLOA 2B7BA 4DCUA 1J8YF 1E1RD 5TY0A 1W36B 2IYUA 2QRNA 3CNNA 3D3QA 4I1SA 1JJVA 1NMYA 1S96A 3PIRA 5HE9A 3A1WA 1JXMA 5J4YA 2D2EA 3CO5A 1EGAA 4QM6A 1TQ4A 1RW4A 1DE0A 3NH9A 4A2QA 1N5LA 2H18A 2V1UA 4ITRC 1NY6A 2DFLA 1KI3A 4XD7D 3U6BA 2ZE8A 1F2UA 4LGMA 3LVQE 1YKSA 2OAP1 4C0QC 2H17A 2IYZA 2A3RA 1PUIA 4P32A 5DYGA 1FNNA 3T5GA 3GLIA 2QMHA 4DIEA 2ZU6A 4YMUA 1HEIA 2CVFA 1MO4A 4B48A 1IHUA 4JYCA 5A0FA 2Q21A 2XTMA 5C4MA 2IEZA 3E70C 3ZVRA 4DDWA 4RY2A 1II8A 3UWKA 2I1QA 4LHYA 5IRCD 3CRW1 3VX4A 3GLGB 4KVGA 4Q9JA 3B1XA 1W0JA 1CIPA 2HV8A 2B7CA 3SQXA 2JASA 4NYJR 1HA3A 4EQ6A 1ZNYA 3A1VA 4LHWA 1WDTA 1SKYE 4NHOA 1BIFA 2UZ3A 3ICQB 3GLFA 2CHQA 1BKDR 4B73A 4C0LA 4WVFA 1AKEA 2WJIA 3X1WA 2BMJA 4BFUA 4W5JA 1Z6AA 4OK6A 1Z6TA 4BFZA 3QBVA 1SVIA 2RAPA 1ONBA 3QKTA 3CNLA 2GF0A 4PC3A 1Q1BA 5B30A 3V00A 3WP0A 3EXAA 2V6IA 2FPMA 3Q3JB 3RS7A 2CE7A 3BD9A 5DI9A 1OH7A 4AI6A 3O47A 3PEVA 2REOA 2QUZA 3LY5A 2QGZA 3NEJA 3LAWA 1OYYA 3EASA 1R10A 4Q4HB 3EG5A 1ZUIA 2PT7A 4IEEA 2GVZC 4Q5IA 1NVXQ 1OXUA 1P6XA 5CITA 2FSIA 1HQCA 4GDFA 2V1XA 1EK0A 1NVUQ 4QHTA 1GWNA 2VP6A 4Q7JB 3GLHA 1OHHD 2BBSA 1EFUA 4HZIA 2GXSA 2QG6A 4UNRA 3K0AB 2VO1A 2XJ9A 4NCNA 4PPNA 4MH0R 2IUTA 1GUAA 1SVWA 1KZGB 3RHFA 4Q66C 2GBLC 2QE7D 4GI7A 3K0EA 4HB3A 2JLRA 4MYHA 5EJEA 3TGPA 4QBIA 4HLDA 4F4JA 3VR5A 1X1SA 5E95A 5FUVA 5IDVA 1E9FA 2QP4A 1GILA 1GP2A 4C7OB 2WM9B 4JL6A 1YVDA 4IFEA 1UJ2A 2AXPA 4OK5A 3TUIC 2AK2A 4OHYA 1C1YA 4TTRA 2H1LA 2HEIA 4B32A 2O8DB 1OYWA 2UKDA 2KBFA 3U7EB 1NJGA 2WKQA 2WJGA 2DWPA 2W6JD 1TF5A 4M9SA 2QT1A 1FOEB 2IBMA 2JJ1D 4P31A 3Q85A 5KYKA 3U3OA 1E1QA 2QBYB 1VPLA 5JJIA 1DO2A 1OE0A 4G5QA 4B74A 3K70C 4Q4HA 3BWDD 2X19A 3TSWA 2ZE5A 5LDDC 2XXAB 4DZZA 4Q1FA 2EFDB 1P7CA 2CCGA 1MABB 3K0AA 2FZLA 2PX0A 4RVCA 1U9IC 3NEYA 2W0MA 2LCFA 2RGDA 4EPVA 1KTVA 1HYQA 4ASUD 2QN6A 5KHOC 1PJRA 3LO5A 1EWRA 1U9IA 5A5GA 1ZU5A 4QGAA 1YR9A 2GCPA 2QU8A 6Q21A 4JBYA 2Z4SA 5KSOA 3BOSA 2RGGA 3K9NA 2W6JA 3PUVA 3EA0A 4ESVA 4AY2A 2IF2A 2RB4A 2RGXA 4MRRA 2ZREA 4BZXA 1U0LA 3RNLA 2BMDA 1GG2A 3TVTA 4HAUA 4JT4A 4E07A 3TAUA 4A8JA 4DSOA 2XEXA 2FFAA 3C5CA 3CRQA 1G8FA 4M2LA 3UANA 4PQFA 1G19A 2NG1A 1IQPA 4M9QA 1CR0A 3W5JA 2UZIR 2WWFA 4WZBE 2PLFA 3S1AB 3K09C 4JLPA 3NBZC 2ECKA 2BEJA 2ZRLA 4O3MA 1G4UR 2OE2A 1NRJB 3R8FA 3R7WA 1WMSA 1LW7A 2QP9X 4BLTA 2JAQA 3TVDA 1ELOA 5JCZA 4D26A 1W5SA 4C9BA 5LPNA 1N6KA 1OXTA 1GAJA 5JMTA 1F2TA 1GDDA 3C41J 2QQEA 3RRNA 4MYTA 3E2IA 4Q1BA 4UNPA 2X8AA 3TSOA 3SJBA 4BEBA 4PR0A 4QM7A 1F3OA 4RKFA 3THXB 2WIAA 1E2IA 1KKMA 1Z8FA 4DSTA 3KXIA 2O8CB 3LBIA 5JCPA 2J0QA 1OIWA 121PA 2PMDA 4GPTA 1E6CA 2BV3A 4P4TA 3EW9A 2LKCA 2JLQA 2W0SA 3AF3A 4TMWA 3ZH9B 1DS6A 1K5GA 2A2ZA 2EFEB 1UKVY 3C4JA 4LSGA 1N6IA 1QHIA 4LUCA 4B43A 2NMVA 3VNUA 2OFXA 1QRAA 1GTVA 4B3CA 2XXAA 3SEAA 4QG7A 3K70D 2CK3D 5DNYB 3NDBB 3BE4A 4TL8A 2WVJA 2QTFA 4OBEA 2C9YA 3GP8A 2HYIC 2VF8A 4EFLA 1OFUX 2OEPA 1XXHE 3DKVA 4IDNA 3KJEA 1FFHA 1KI6B 2P6UA 4DCVA 4HDQB 2FEOA 1Z0KA 2FJUA 3M0EA 3LW7A 4FMBB 5SZJA 1E2PA 1H8ED 1YZKA 5J47A 3CZPA 4Q1DA 2YC2C 4OKSA 2R44A 3QKUA 4OQMA 3AH8A 4BZPA 1M74A 1FNMA 4ASUA 3AVQA 5ELXA 4PO8A 1T5LA 1TUIA 5JHGB 2ZRIA 4Q4AA 3ZQJA 4Z8XA 4GL2A 2O0JA 2F43A 2R6FA 3OEED 1RRPA 2EFGA 4YXWA 5JI3E 4LPKA 4BGDA 3OESA 4AURA 3EZFA 4GRAA 5JS8A 1E2MA 4Q4JB 1SVMA 2OT3B 3LDAA 1KO1A 4B2IA 1XWIA 4XJXA 4QJ4A 2WJYA 2G9NA 3SBEA 2ZI6A 4LJ8A 4HDOB 4OQNA 4Q19A 5FPYA 4BRUA 1U81A 2HCBA 3ONWA 1KAGA 2ZANA 2PZFA 2F9LA 2F3RA 4KODA 1Q0UA 1W5TA 1Z22A 3EPKA 2J0UB 1IJFA 3KKQA 1JQJC 2OBLA 2ZSBA 4CEJB 4MDEA 1DAFA 1T3HA 1L4UA 4B3GA 4TSFD 3ZS8A 1ZIPA 3QF4B 5JJKA 4M0LA 5FBLB 1TQ2A 2QPAA 1T6NA 5FPSA 3WY9A 3L2OB 2CJWB 4QFMA 5AUOB 4Q7LA 3T1TA 1KO7A 1XRJA 4OL0A 1NIJA 2WWWA 4JL8A 3RS0A 5FOVA 1R0XA 4A0GA 2V7QA 5FOTA 3LXXA 3NDPA 1EG7A 4QBHA 4QKQA 3B1VA 4KSBA 5AJZA 5IT5A 5JHHB 4L15A 2RMKA 4L5BA 2ZYUX 1U99A 3CNOA 2IC5A 3TKLA 1OHHA 3PUXA 3QQ5A 4WBSA 4DRZA 3T35A 1UPTA 1UAAA 3QKSA 2C5LA 3WHKA 2F1JA 1UBCA 2WWGA 4PHTA 1XEXA 1D9XA 1Q3TA 3HWSA 4TTPA 1GL7A 4YMTA 3EZ6A 2GCOB 2XJ4A 2IYVA 4TQUS 1DAKA 1BH2A 3MJHA 3FMIA 5B58C 3B9PA 3ZJYA 3IBGA 3VR4A 2ZJYA 1E96A 2X2FA 3G5UA 4EUNA 4ZDIA 5L3SA 2XNDD 3JVUA 2O8FA 1WA5A 5DISB 4EPTA 5IK2D 2BIFA 4D4LA 2YHSA 4UNQA 1QZXA 5H1YA 4V0NA 2QA5A 2K5UA 1E9RA 1QVAA 1S4QA 4P4SA 2W6IA 4DVGA 3AP2A 2F43B 3Q8XB 5E7JA 3LD9A 4PHHA 3U3JA 1MT0A 1RJ9A 4AKHA 4XVRA 1KOFA 4BFVA 2XSZD 1N6HA 3BS4A 3REFA 4IJMA 5FR2A 1GNQA 3TK1A 1GITA 1G16A 1YZGA 3NXSA 4FCVA 4BWYA 1N6OA 4XIGS 3EWAA 4IKEA 4W9MC 1XNJA 2A30A 4Q9KA 3KKMA 3RDPA 2JLZA 2GJ9A 3AVWA 5GVSA 1NLFA 4IDOA 4DLSA 3AVVA 1WB9A 4PXAA 3ZDQA 3CBQA 1Q21A 2ZJ5A 4UNNA 4DC9A 2BWJA 2A5GA 1RRGA 3TUZC 4ZKDA 1OIVA 3AVOA 4BQSA 3X1YA 2FU5C 4A2PA 4EDHA 4TZ0A 2RGBA 3IO3A 3HPQA 1GRQA 3QE0A 5GJBA 2GTPA 4V03A 1EFTA 3KKNA 5FUYA 4UQOA 4I1UA 4Z1MA 1R8SA 2QNRA 3R20A 4PANA 1K5DA 1GKUB 1MRNA 3GLFE 1A7JA 3THWB 1ZNZA 1WCV1 3A1SA 5CK5A 1OT3A 5CJPA 4TYYA 2G3YA 3CRRA 1DEKA 2JJ2A 4A8JB 3WMGA 1XJ0A 1VG0B 4B75A 5SZIA 1RJ9B 1T0HB 1UDXA 3CUEF 4QRHA 1II9A 2W2TA 1W4AA 3AGQA 4FIDA 3U60B 5K8TA 4HATA 5IK2A 1M1YE 3RRZA 4AD8A 3GMTA 2DFTA 5F9FA 2IS4A 2ZU0C 1WRBA 5CIWA 4LHZA 2NO9A 3R7WB 1D2NA 4IOLA 3KXLA 1E32A 2RHMA 3B1ZA 4MRVA 4KSCA 1NY5A 2PZGA 1ESMA 4BUJA 2BCGY 1UFQA 3ND8A 1KK3A 5HKKD 1SXJA 5DHFA 1XJCA 4ZKEA 3PUYA 1MV5A 3QG1A 4M9XA 3W5IA 3TRFA 1UKZA 4MUBA 4DXAA 3I5XA 2WJJA 2CCJA 1LY1A 4P4SB 5LBIA 3T1OA 1NKSA 5FOWA 4TMXA 1DG1G 2XZPA 4DEXA 2A5JA 1ZINA 1NVVR 5C1BA 2YNMA 4QBGB 1VCOA 1OXVA 1W36C 3MWLA 2WJHA 4FW9A 4ZDKA 3O8DA 4YMSA 1E2DA 1ZM9A 3A1TA 3WRXC 2DB3A 1G41A 1HV8A 1G7SA 2YYZA 4XWAA 4R98A 3B9QA 1JR3D 2OZEA 2O8DA 4PSVA 4RD1A 4BFWA 3J81k 2ZUBA 1E0SA 3TW8B 4KHZA 4Q9HA 4F38A 2H57A 3KL4A 2XZOA 2B8WA 1YHNA 2NZJA 3IHWA 3TIFA 3R9WA 2OV2A 2GZDA 3X2SA 5UKDA 2CLDX 3GD7A 3QKRB 4DLWA 5F3WB 1OFTA 5KTYA 3FHCB 1N6LA 2W58A 3AVPA 1XEWY 3GPLA 1VIYA 2GAOA 2HXSA 1JXOA 2QL6A 4LI0A 4AYWA 3GLGE 5BXQC 4RZXA 5E4FA 1UBFA 2FPLA 2H92A 1JAIA 4TL9A 1Z3IX 3K1JA 2QPOA 1SKYB 3MMPA 1TTTA 4Y0VA 1DPFA 3NKVA 5CB8A 1J70A 1WF3A 4PPGA 2P3SA 4BLSA 5DSZA 1E99A 2WSSA 2ODBA 1UBGA 3DM5A 4XOIA 2BBOA 1EFRA 4FWIB 1XPUA 2VPPA 2OHFA 3ZVNA 1M7BA 1YZTA 2BBTA 1KYIA 3OIWA 1AQYA 4E22A 2P2LA 4E5UA 4R7ZA 4JL5A 1R8QA 2Q6TA 4IDHA 1VG8A 3Q5DA 3BIFA 4JSYA 2DCUA 5LD2C 1KJWA 4E03A 2V3CC 3GJ8A 1P4SA 3IPXA 4B76A 4ZDJA 3KB2A 2WKRA 4OQLA 2DY1A 3UK6A 4KYIB 3SNHA 3WMFA 1ZRHA 1PUJA 3NTUA 2DBYA 4LK2A 2GJKA 5HCIA 3RYTC 3UWOA 4PZLA 3H4MA 4LZZA 2CL7X 1COWA 3AP1A 4H1UA 1OFIA 2YWGA 5FPTA 2AX4A 2FSHA 2VYFA 3JZMA 2C8VA 3CPEA 3BAFA 1YU9A 3GJ0A 4RD3A 3QSYA 4AIIA 1SKQA 4AC9A 3JZAA 2ZRKA 4OJQA 4JBXA 1G5PA 2W2VA 1Q57A 3NC1C 4MGIR 4POAA 5FUXA 1Q22A 3U3RA 3CWZA 3R8CA 4Q7MB 4KFTA 5DYIA 3T61A 3HP1A 4PAQA 3GEEA 4QHSA 4MGYR 2GF9A 1A4RA 3FFAA 1G64A 3KFVA 1TQDA 4NONA 1G6OA 4D80A 2D7CA 2ZS7A 3IDQA 4KVAA 2AFHE 5IF9A 4DLUA 4GT1A 3X1DA 1VHLA 1IY2A 3K0CA 3THYB 2BJWA 4CZ2A 1TL7C 4FN5A 1H8HD 4CW7A 1FQJA 5KO2A 1FX0A 3H0KA 2I3BA 4JT2A 4JVNA 3CH5A 1E94E 4MKIA 5L8VA 4YMVA 4AG5A 3WRYC 2QSZA 2BKUA 4F4IA 2F6RA 2OESA 5EUQB 3R9IA 1E2EA 4BLQA 3IIJA 4LRWA 2RHDA 1QHGA 1KGDA 4ACAA 4CF7A 1FMJA 2D2FA 2D06A 5HKKA 3B6EA 4Q9LA 2C2HA 4DCSA 8OHMA 1IY1A 1XD8A 4JBWA 4K46A 4U7DA 3PVSA 1FMLA 1XTSA 3VKWA 2H7VA 2VSXA 1OF1A 2FSFA 4B2PA 3EPJA 2ZRGA 1X3SA 4TYPA 4DSNA 2LWIA 4BFYA 4TTQA 2YKGA 3THOA 1WQ1R 1XD2A 4WW0A 3ZD6A 1SXJD 1HT2E 1VYUA 1Z83A 2HJVA 1W4RA 2ANBA 2JLXA 3TNFA 2ZI3A 5DI3B 2R65A 3ECCA 5D3MA 5JRZA 4TYNA 4I99A 2PCLA 1VIAA 3Q7PA 1CRQA 3P4YA 1VCNA 1KKLA 1NN5A 2QM8A 3LX5A 4KAXA 2ZVQX 4TQAA 4CDGA 4R2HA 2QI9C 2ZM5A 1GSIA 4G5GA 2OLKA 1XBTA 1XXHA 4ILEA 2PJZA 5F9HA 1U0JA 4EPRA 4HZUB 3CB4A 5AUPB 2WMNB 2HUPA 4TLEA 3REGA 1G3MA 1UBEA 1WBDA 1C9KA 3PFIA 2IYXA 3U4QB 4PAMA 5EP3A 2KBEA 2ZYWX 3LBNA 4HAXA 1MRSA 4EIWA 1N6PA 3VX3A 4MKFA 1BO6A 1DAGA 2NO7A 1NL3A 1FX0B 2FOLA 3LLMA 2HDNB 1TEXA 4LWZA 2W6ID 4ACBA 2IYRA 5FOSA 5JSZB 2IUSA 1QG2A 1FZQA 2H5EA 4LPSA 3P27A 4LJ9A 5LB4A 1N0WA 3OAAA 4WAUA 5J40A 2WJVA 4M22A 2QE7A 3AF4A 3D7MA 3G82C 3WBKA 3I5YA 3TH5A 2XSZA 2GXAA 5FBVB 1RC8A 2L0XA 1A2BA 1F5NA 1Z0FA 3SQWA 4EKDA 4MKHA 1Z07A 4BFTA 1L2TA 4KBGA 1E4VA 4JVLA 3IQWA 3UPUA 3EPHA 3FFBA 1PLJA 4GP7A 3K0FA 5FBQB 3T15A 4OHZA 3TUJC 4QL3A 1GL6A 2AR7A 1CKEA 4LBWA 2XNDA 4FXPA 1US8A 2GETA 2NGRA 3PEUA 2QAJA 5DGXA 4B3DA 1W1WA 4URUR 3NHAA 4WXRA 3T5DA 1D2EA 3PQCA 1U8YA 3MJRA 1DADA 5FI1B 3W6PA 3GJ4A 3MLEA 3FKQA 1ZCBA 4RKEA 3G0HA 5FTJA 3CX6A 1UKYA 2HXYA 4URZR 1QHHA 1HH4A 5KU1A 3U4QA 3BB4A 3DOEA 5D3QA 3VTKA 2ZRFA 3KUCA 2CLCX 4BLPA 1XD2B 1GL9B 3SYKA 4Z54A 2VHQA 5FUWA 4HAYA 4HLUC 1O87A 1X86B 5AJWA 4CEIB 2HT6A 4A6PA 4NCHA 3U7GA 1U2RA 1Z2AA 3EIEA 2GXQA 1S2MA 4ON9A 3ND9A 2ERYA 4NCIA 4PQYA 4Q01A 1LS1A 2VHTA 4DT1B 3PITA 4KJZA 4UXHA 2ZSAA 3OEEA 2GAAA 2R6AA 4M1OA 3RC3A 3T34A 4EFNA 2CNWA 4C0AC 3AKDA 4HDCA 2G77B 2CHVA 1E2QA 4KFSA 5CYOA 2WAYA 1XTKA 2FA9A 1IBRA 3TMKA 3SYLA 2OFOA 4GOJA 1WP9A 2BVNA 2KWIA 2D7DA 2GILA 4ZDWA 2ZRCA 4NH0A 2XZLA 4NL4H 3B60A 3GFPA 1ZMXA 2DHRA 2FX3A 2IT1A 3KJHA 4HUQA 2IYSA 1UKEA 1DG3A 2Z6VA 1GIAA 3I32A 3O8BA 3FOZA 2AN9A 4D4MA 1Z0DA 1FQKA 3U2QA 5FTMA 1JEDA 3X1ZA 4BEJA 5KUTA 2AWNA 2ZR7A 4DLRA 5FTKA 2BOVA 2HYDA 2C78A 4DUGA 1KI4A 4I4LA 2XX3A 3W3ZB 3TR5A 4C2UA 4RZ3A 4TLDA 3LX8A 5EZ6B 3LW8A 4DDVA 1EX7A 1XPOA 3DDCA 2CE2X 4Q03A 4HSEA 2IX3A 2QMOA 1AGPA 1U90A 2QPTA 1GRRA 1KMHA 4Q1AA 1CR1A 2Q0HA 4RSGA 2IHBA 3EZ9A 3L43A 4TT3D 2W83A 4EAQA 3MD0A 2GEDA 5KSZA 1M34E 4H1VA 5CM8B 3CKLA 3MAAC 4XH9B 1G5TA 4RFVA 1XEXB 5E7MA 2Y8EA 3GCGA 1EWQA 1QHNA 3VMFA 2QBYA 3EC1A 4AYTA 1VMAA 3VU9A 2KI5A 1VDZA 2X1VA 2HCJB 2IW3A 2ZJZA 3HU3A 2CBZA 3UMSA 5TXGA 2Z43A 3FYHA 1LF0A 3IGFA 3KFXA 1XPRA 1D8TA 1R6BX 1G7TA 4JLJA 5AJVB 2GESA 1E0KA 2P67A 5DN6A 3SFZA 3OFND 1NLZA 2UVQA 1AS0A 5E3HA 1LFDB 2J41A 1W2GA 4FCWA 2ZEJA 3RAPR 4QJ3A 3AF0A 4X8OA 3VFDA 3W8RA 4F91B 3CX8A 3AF1A 4MUAA 2AFIE 3QG5A 1DAIA 2YVUA 3F8TA 1CULC 3N70A 3NH6A 4KCGA 2QTHA 3K09A 4CT4B 2D4HA 3B2EA 1OXSC 1XMSA 4CEHA 2FPKA 4D6PA 3PUWA 1W44A 4Q7KA 1YZUA 3LNCA 2X77A 4QJ5A 2V54A 4KLNA 3SDZA 4WOPA 1U94A
chains in the Genus database with same CATH superfamily
1THTA 3FDIA 4BU0A 4F2GA 4H7HA 2WF7A 1GUYA 3MF4A 5JSQA 1P1CA 2Q2NA 5LU9A 4PSDA 3IUEA 1ZOIA 3LHIA 3O94A 3TB6A 1AKYA 2GVDC 1T2UA 1JNYA 1VJGA 5JAHA 2C0CA 1NXWA 1Z5VA 3WMWA 5C8XA 3U4CA 1XFDA 1QQAA 4QU8A 2IPOA 4E51A 4QTZA 7YASA 2WVAA 4ZJYA 4G4SP 2E2WA 4JR0A 1QYXA 2G0TA 4K0KB 1T4GA 2JA1A 1ZUNB 1QP0A 2FPPB 2REXB 3COPA 5BW5A 1JEQA 2VHXA 2C94A 2I87A 2F9MA 3Q2OA 4P53A 4US0R 4UNSA 4XJVA 3USCS 3UWPA 1PJCA 4YCNA 4OSOA 3KV3O 5TQ2A 3QXXA 1D6SA 2B8TA 3UKDA 2P9ZA 3JAMA 1VA4A 3AI7A 4O2RA 4YRCA 3KQSA 3ZDRA 2FFQA 4KDEA 3V8QA 2FMXA 4YN3A 3IO5A 3WQSB 4L6IA 2FCRA 1VG1A 4DJJA 3BA6A 1RFLA 2VWPA 4L8YA 2QRJA 3U4IA 4HT3B 2YUTA 1J1UA 3HO8A 4ZU6X 2JI7A 5ENZA 2GPWA 4LHXA 1X7WB 3CZCA 4IY1A 1B14A 4PWZA 4G1VA 1CJUC 1BE0A 3OURA 3TJRA 1MIOB 3WB9A 4L9WA 2CUTA 5JZVA 2KB0A 2WPDA 3F78A 2BMWA 2JB9A 2MSCB 2J7PD 2VTKA 3CO0S 2J3IA 2OV8A 3FXAA 1M75A 4P5PA 2C99A 3STTA 3IP8A 1PK9A 4J75A 5BW8A 1YMUA 4LJ5A 4Q3OA 3GK3A 5DPMA 1KAOA 3F74A 1L8QA 2C8KA 2R751 2XAAA 3ONNA 2FX2A 1Z4JA 5C5CA 2ETXA 2SCUB 5DCUA 4YRNA 3A70A 1NMSA 5FTLA 3KHUA 1NSYA 1EVYA 3ANLA 3NHJA 2JZOA 1VLLA 1IDN1 4K9NA 3ZY2A 4XJSA 2VS1A 4YASA 4UCXA 4C22A 3F90A 3CZQA 4BQFA 4YAJA 1B8NA 5EE1A 1W30A 2HZBA 2VSYA 3G0BA 3K7EA 3QFTA 1P3JA 3FMPB 4B4OA 2WWIA 3Q3GE 5A1TA 3KYCB 2IH4A 5ESWA 4BMDA 1ABEA 1D7OA 1FJ2A 4MVJF 2APJA 3DL4A 5EUCA 1GSAA 4HDKA 2CEAA 3V80A 5AM3A 3L06A 4TWRA 5KNDA 2HSJA 3A3YA 5YASA 3SHFA 2M98A 6NULA 3ZU3A 3KJXA 4KH0A 4C7VA 2WE7A 2QN9A 4ZVUA 3RUEA 1IONA 4C3ZA 3ZU6A 4HS9A 1I2MA 2QTGA 2MSWA 3MJSA 1JDJA 4ECAA 2CXQA 2QSYA 4C4RA 1P73A 4G24A 4PIVA 1DDOA 3UJNA 4FC6A 3KQHA 3B53X 5HQ3A 1GT6A 3PEFA 2MMGA 3Q7EA 2W6PA 4YMIA 2ZRPA 2WNHA 2EX0A 4BFLA 1QK5A 5JALA 1KSJA 3VH3A 4FHDA 1RKBA 5BN5B 1OPRA 3IURA 3KBOA 2GYUA 4ZN6A 5I8WA 5LFAA 3EPRA 1A82A 1TU3A 2EZ8A 3T4PA 3MFYA 1R6UA 1YB1A 4II7A 1AZWA 4HPJB 1LLUA 3ODGA 3F6CA 4RY8A 3CNBA 3FROA 5T6MA 2Z1MA 2VRCD 2Y3IA 3T3OA 3CPJB 4BB5A 4GPZA 1AZTA 3EE6A 1KMNA 3DDZX 1EZ1A 4FZVA 3SBXA 1BWRA 2CW5A 5BWMA 1WS6A 4XCXA 4TVKA 3HXOA 1X9HA 4Y6LA 4PXSA 1BE6A 1E3WA 1J0BA 2VL7A 4XTRA 4BKUA 4EMBA 4Z6KA 2IOFK 3U3MA 1I4OA 4KE7A 4NENB 3IEXA 1M9NA 3B1WA 2JVJA 3QV2A 4HDKB 4BP3A 4EP1A 1ZM2A 2Z04A 3LXMA 4I6GA 2ZIAA 5E7QA 2AK3A 4J6EA 4DJTA 4YRTA 5IULC 4JR2A 1T5HX 1T3LA 3LGAA 3P4XA 4JI6B 2PKWA 2HNBA 2WU4A 1DC6A 1QFSA 2ZPAA 2GN9A 2G28A 3N8GA 4IUDS 4MRSA 1PKXA 1UF9A 2IDMA 2X2OA 4EB8A 2G25A 3KG2A 4JIMA 4YUZA 3C3YA 5EXPA 2WSSD 2C77A 4BZQA 1OGIA 1V1RA 1U8ZA 4C1NA 2HAEA 1E2JA 2WFLA 3H4TA 3NOVA 1JA9A 1R3DA 4EF6A 5JS7A 4TKMA 1RFGE 4BO3A 1IG3A 4IZ6A 4XEHA 5I3CA 1C8BA 3OQHA 3ZCQA 1O08A 1BXKA 4PLVA 1MO5A 1SY7A 2WPNA 1DAEA 4MW7A 1JX6A 1R27A 2YS7A 3DLPX 3AHHA 5M7EA 5FFFA 1W87A 4EHBA 2C92A 5KCZA 3VHLB 5SYMA 2IEDA 3QH4A 4DIBA 3D6JA 2ZIVB 2XUOA 4FMCB 2V5VA 2DU8A 2HSDA 3U19A 1HNZB 1H2YA 4GFDA 4ARZA 2GCIA 3BL8A 1T3ZA 4TXLA 5FNVB 3FJOA 1NMZA 4C2AA 2BN4A 4AJJA 4RVUA 1OW3B 1OVMA 4US1R 4CXMA 3KOYA 1UZNA 2HF8A 1P2VA 2O8BA 3IJPA 3GZNA 1I3CA 1JN0A 2FV8A 4DM4A 4ZOLA 3G5TA 2RARA 4ZPJA 4MLZA 3CIFA 5EJ9A 1EJ6A 3VO2A 2EYQA 3UQZA 2EV9A 2FPIB 2X8JB 1ORWA 1EXMA 3VZRA 3G2QA 2J33A 3CVVA 4PQRA 3KSBC 1C3XA 1U7DA 3A14A 1EM6A 1CCWA 2EAUA 2GZ3A 3HCOA 1U0NA 3DV2A 5THXA 3L8FA 3SZRA 5BWCA 1AGXA 1PKEA 1PQPA 1XN1A 2B0CA 4BE7B 4AMBA 3U26A 4QC2A 1M1ZA 3KOMA 4GC9A 4ID9A 1YBFA 3SU8A 2Y1KA 3V8RA 1KDPA 3BG5A 1XXLA 4B3TB 3KJGA 1DO0A 1FW6A 5CBPA 3E0QA 2ZPTX 2BKLA 3K9GA 3IHKA 1PNTA 1E98A 2DKOA 4R8LA 3SF8B 1K1EA 3VJKA 2HGZA 3I0ZA 2M6SA 5JTTA 4UTVA 2ZZKA 3SBDA 3BXFA 2ZSHA 1SD2A 3FWKA 1PIWA 1VE6A 2JL1A 2VSOA 3MYYA 4YDRA 4QATA 2Z95A 4F5EA 4HNTA 4KQIA 4UM8B 1CETA 3DTYA 4G1EB 2C4NA 3BGWA 3EIWA 3R76A 4DBLC 1E77A 1M5TA 1DRKA 1ISPA 4DCPA 2H1SA 2IBTA 2OCKA 3HGQA 4JASB 1GTJ1 1KFKB 1QTRA 4L73A 4PFJA 1T29A 3N0XA 3RJ5A 2QQ5A 4PC6A 3NWJA 4CDMA 3OY2A 4GYYA 2VJMA 5JYBA 3RVKA 2RSLA 1P17A 3VKFA 4NYMR 4HQRA 4AKIA 2Z9CA 4I55A 5E6UB 3Q98A 4HNUA 1VYVA 3MQFA 3EULA 1ESNA 1O8CA 4H08A 4FFSA 3P32A 2MWMA 2C5EA 1QLHA 1G8PA 4RFSA 3ZYCA 4CL0A 4JV5B 1OC4A 2J32A 3CJRA 5TGZA 5IUJC 4YVFA 1GKYA 2ONYA 4EL0A 1NPYA 4OQFA 3SSOA 1NN1A 3VPHA 3TCNA 1V5IA 1XMQB 1GRCA 1HR0B 1V7CA 2IYTA 4HHEA 1L5GB 3FHJA 2TS1A 1WUYA 3RGGA 4ZV4A 2FYTA 4XYBA 1DWPA 3JXEA 1DL5A 1GZ7A 4DGSA 3EQ7A 3WXMA 1F8XA 1RYMA 2C4TA 3TZ6A 3L40A 3WLQA 4I8IA 2PD3A 1QFYA 2IWRA 4B8ZA 2IXFA 1IMOA 3FNFA 4IUCS 4B34A 3UCEA 3ZHQA 2CV0A 2Q29A 3JYOA 3RUPA 1JRLA 5EERA 5K0NA 3PC4A 1M73E 1NF3A 5CDTA 2FEPA 4A2CA 2XYQA 2VDQB 3BJMA 2PLRA 3FOWA 3HU2A 1AKMA 4HNAB 1YRAA 4KUEA 1Z37A 4D3ZA 1C80A 4EQ6B 3IUNA 3UA3A 2CL0X 2MR6A 2W90A 2W4IA 3A3PA 3HZZA 4TT8A 5K3FB 3FPEA 1ZP6A 2V5UA 4HGZA 4Q24A 4RZHA 4TXNA 3TFQA 4GL4A 4LQCA 3JQGA 2G6BA 5JY1A 2J3HA 5LZ7A 3VYTB 3TIGA 3C98A 2O5VA 1N5JA 2RGEA 4MHTA 3X2EA 3V2UA 4PNZA 5HSGA 3O8QB 1NRXA 5CW1A 4RETA 2FPGB 1HC7A 2QMEA 1ODTC 1P81A 4R2IA 1FNSA 1UK9A 1XRRA 2X6TA 3L0OA 3W9YA 2WR8A 1VI2A 2Y93A 1UZAA 4QSHA 2R4QA 4NCKA 5HJ2A 4KRXA 5TS2A 4HBGA 1EDZA 2GZRA 4KK4A 4MLCA 4HMOA 3G9TA 4MQ5A 4FB4A 1Z17A 1XZFA 4ZQIA 5AQEA 3STVA 5IH7A 4ZCQA 3OZGA 4N47A 1W35A 1XHLA 1Z08A 3Q9SA 4Z8YA 4QWWA 1TOAA 4FKBA 4B3XA 2TYSB 1U1EA 3BN3A 4O33A 4BFXA 3O74A 1QYDA 1POXA 2FGKA 4LCJA 4C0SA 3F5MA 3FFXA 2CMFA 3JQAD 4MW2A 5HF6A 3QXJA 3U80A 2OCAA 4NYIR 3KXKA 1J09A 2XOXA 2Q46A 2ZE6A 2I2XB 4AY5A 1XEAA 3IQDB 2BE9A 4XEUA 1KC1A 1IXSB 3R6DA 3K05A 3BSYA 3QLVA 4AYXA 3BZUA 1S9HA 1QTNA 3EFHA 4WNIA 4ZALA 2R00C 2Q45A 3K92A 2BHNA 4OBXA 1ATIA 3O95A 2SHKA 1NG1A 2XE6A 4KXWA 2NQ8A 1JHYA 3F6YA 4LKRA 5CFPA 4MMZB 2CXOA 1D8AA 5SZHB 2B21A 1QNLA 2R6DA 5K5EA 4G23A 3C0KA 2OOSA 1ORDA 1YZLA 1DAHA 2OM2A 2QLJA 3C7TA 4RDXA 3GAZA 2XUHA 3GNQA 5LUBA 3AIMA 2KJQA 1IUNA 2FUCA 4DWVA 1DNPA 4CYMA 1JUDA 1TYEB 2WFMA 3JW8A 1TFRA 1I4LD 1JNXX 1CZNA 4PLFA 4ARZB 2A0FA 5B58T 2A5YB 2WM2A 3G89A 3OD5A 4QAQA 2I6UA 1KO4A 2C3OA 2V0NA 3NAMA 3OWXA 4IEFB 2GWHA 4RL6A 4V24A 4YNBA 1HT0A 4A1OA 1GOTA 2P5YA 4FYHA 2VA8A 4G5YA 4FZJA 4J49A 1BD3A 3AOEC 4AF8A 2PH1A 4JS0A 1HETA 1H0SA 1H23A 3IMGA 2BAGA 1OJLA 2YV5A 2WOOA 3E2MA 3H7AA 1LI4A 1J9ZA 2F3TA 3D6FA 3QF4A 4YRDA 4R8SA 2P6MA 3PHCA 2CUZA 2XT0A 5HMLA 4BKMA 4DYVA 2MR5A 3QEOA 2GDZA 4IDPA 2B1JA 2BFCB 5J4LA 3UB4A 2RHWA 1A27A 5DKFA 3SJZA 5ILGA 1MA3A 2O5EA 4IIUA 4Q3CA 2BI8A 3E48A 5FH9A 1XDSA 2AJDA 2NAPA 2OPHA 3WLNA 1H9AA 5EP1A 1ZK1A 2R7KA 4UULA 3IAS1 4ZFNA 1XZBA 1B0PA 2OD7A 3A3KA 3HEBA 4H7JA 3PHLA 2ID9A 4O0LA 4JLMA 1FNCA 1TM3E 1KGSA 1U7WA 2JPDA 1BAPA 4XX1A 4CUJA 3WGTA 4TL6A 1Q1QA 3CVOA 4LY3A 1CQZA 4YXFA 4HWPA 1R4ZA 4MB2A 3AR9A 5K8IA 5KOIA 2PJRA 5JZOA 2DUNA 1DV1A 2NPIA 2B92A 2IHNA 2O2CA 4MWDA 1II8B 2P0YA 2OV1A 2ZCUA 1JR6A 2IY8A 5E7IA 4CF6A 1U2GC 4ABTA 1OLSB 3KELA 2Y1WA 1XHFA 4HTFB 4J0HA 3ACDA 3QW2A 1VLHA 4PCUA 1H2ZA 2JIPA 2XMQA 3PPWA 4O2AA 2RH4A 2RBGA 4LOIA 2BM0A 2IIPA 5BSTA 3WNCA 2ZM6B 1K6MA 2HF9A 3C5WP 2Y6UA 2W2KA 3BSFA 3E5NA 3HJAA 3HKDA 3P2OA 4P0TA 2V6JA 4ARVA 4F97A 2B4YA 3DL7A 4JX9A 4RZUA 5JDCC 1YDWA 4UUBA 3GFVA 2EDAA 2VXBA 1CU1A 2WG0A 2ZUWA 3H2BA 3W34A 1QPGA 3L0PA 4NJEB 4YGXB 1JKJA 3AR6A 4RADA 4JLWA 1JMVA 4DCMA 4ITVA 3AUYA 1KI1A 1VIMA 3KTAA 3OPQA 3PDUA 3W90A 1JG4A 5LP1A 2IU4A 5KSYA 3P9KA 1E92A 4AAYA 3N53A 4XWYA 1N0UA 3E22B 4RQAA 4UATA 5JH7A 2NZ8A 2OXFA 3WWEA 1K75A 1ZGAA 2OBNA 1V2HE 1B0UA 1M66A 2V3VA 4MQFA 1T6BY 1BEZA 2QGNA 3LVBA 5ALOA 2O6HA 2L19A 4E15A 1JHMA 3NV9A 1V7PC 1J8MF 2WUGA 5E4TA 1CZRA 2WQ6A 3MGGA 4M99A 4IIHA 1UEXC 3CZ5A 4Q3LA 4RH1A 3TX2A 4ZI3A 5D3KA 1E69A 2W8BB 2Z2YA 4GI5A 1QE5A 1XVAA 3SM3A 5KX5F 1QX3A 2QQGA 5K3CA 4ENRA 4BAGA 1TUGA 4LNAA 2ATEA 1NP7A 4AROA 2QSUA 4CKCA 1CJBA 1OTHA 4HH0A 1J8DA 3ANMA 1W29A 1W0JD 2D1TA 3ISJA 3PD0A 1Z06A 1WX1A 5CVCA 1FSZA 1IXRC 1J97A 4Y18A 3NS7A 4LN1A 1V1MB 2DWOA 1PWEA 1TZJA 1V16A 3GT3A 5DYYA 1NIPA 4C1BA 1HY3A 4LZWA 1V5EA 4M1TA 4J7CA 5CTJA 5JO0A 3A6ZA 2A78A 1T4CB 1ZMTA 1K66A 2HX1A 4H4EA 4GI2A 4ZJUA 1WU7A 4J1QA 2BW0A 2WQZA 2OXRA 3OOWA 2GEJA 1F48A 4I1RA 3VNQA 4D79A 3NYRA 1K86A 1CY1A 3V1MA 1BS1A 4WADA 4IR7A 1JHPA 1PL0A 3U3DA 2NUPA 3EF0A 3W1WA 2C4KA 4XA8A 5K2OA 4A1FA 2I3GA 3K0SA 1VLMA 2YKGA 1Y3BE 3LY9A 5CHYA 3CH6A 1Z5PA 3IXQA 1P9NA 4JBHA 3U7IA 4MO2A 3J80A 4JB0A 1DELA 3HR8A 4JOBA 4XGRA 1PJZA 3EQ9A 4QG3A 2Q3EA 5JIBA 2W2LD 1FTQA 2QMUA 3HBFA 1DKQA 2FEMA 1YBVA 1MABA 1Y3AA 2EKPA 3CVWA 5L45A 1W7AA 2ZIGA 3CM0A 4ZT4A 3EGWA 4I1OA 3RM3A 5ITWA 3V4FA 4MQUA 1N33B 1W4ZA 3MWKA 1LB1B 2ZIXB 4HNAA 3MM4A 1KE1A 1Y4AE 1K0UA 2Q3JA 4BO1A 4OB7A 3ZIAA 2FF5A 2X6QA 2J0UA 2FKAA 2XYRA 1ILWA 2YJ4A 2ZRBA 2WHRA 3ENKA 5ALYA 3D7NA 1IVSA 4CMCA 2M9MA 1XVUA 2JATA 4TRJA 5IW8A 2WIJA 3BAZA 1G7CA 2D13A 2XITA 3Q0EA 1UQRA 5F1PA 4BQNA 4CL2A 5JUWA 2WHPB 1JG2A 4X24A 3CE6A 5KYTA 4BBAA 5K3EA 4RF3A 2WYWA 3WRXA 4G2TA 3LX4A 1ADCA 3RFTA 1OLUA 1TYAE 3A0RB 5IABA 5ALQA 3ZQ6A 4JUDX 2RGCA 5AH0A 2X2PA 3PGMA 2GDJA 2NZ2A 1GV1A 3BK2A 4BWFB 3PNMA 5LB2A 5F98A 3KKPA 3HXMA 1JPJA 3FKSD 3ANTA 3QQPA 2W00A 3HYRA 3JWGA 5LD2B 1NQXA 4YP1A 3NIDB 4PSAA 4S1OA 2PL3A 4DR2B 5HF5A 3OM0A 3GXBA 3ADKA 3G23A 3KLNA 4MW9A 4JBIA 3UAYA 5JCOC 2F55A 5BN4A 1L8AA 5B1HA 2ZYGA 3IMFA 4JLKA 2PUJA 2ADFA 2JFNA 3R2JA 4O3FA 5CBKA 4CG2A 3DT9A 1DQNA 1E9DA 1KAHA 1SQ5A 4JEUA 1P61B 4M86A 4J0DA 3RYHB 4IS2A 1EH5A 3H5NA 3STYA 4B85A 2PQ2A 4CQJA 1KJZA 3S7ZA 3WADA 1VKRA 2FR8A 4A27A 2F2TA 2QXYA 1I80A 3P97A 2HRQA 2YYAA 1FRZA 4OA5A 1XQ6A 1WXXA 1AN0A 3F7NA 1TYZA 3G1TA 3ORYA 1AHHA 1Y4ZA 2ETVA 3D6AA 3FCXA 3O4RA 3ZR4B 4LJ4A 1WHSA 3UJAA 1EX6A 1JQBA 2WD9A 2V97A 4NH4A 3T3GA 1PZNA 3K2IA 3GPCA 5K0BA 2G9ZA 1SWWA 4X44A 4IX1A 5B3LA 3AY3A 3FY4A 1N0VC 1G5RA 3WA7A 4LV6A 4BNTA 1ISSA 1US8B 3KS9A 4OOEA 2OG2A 4EGJA 3N8NA 2D00A 4EVQA 1XZPA 3T5MA 2FUNB 2HT1A 4CR8A 1R5OA 1RACA 5CPBA 1CDZA 1UKBA 3Q6IA 4H6PA 3WLPA 3WKBA 2OY0A 1A69A 3D7KA 4I46A 4B7UA 2VPWA 2WAXA 1KI6A 4Q47A 4AMZA 1LQTA 3NEPX 1LSSA 2VSFA 1XC7A 3L8ZA 4ZGBA 1PDVA 2I4TA 2BHSA 3LV8A 2QY6A 3GVCA 5F5LA 2VTDA 4ER0A 5KZMB 3PEYA 4I8DA 3FETA 1Z6YA 1UPUA 1DRJA 4M53A 4WY2A 1SHKA 4G2NA 4U6NA 2J9FB 5DSTA 2E5WA 3BD8A 1XCGB 3KKLA 3RANA 1JECA 1RIFA 1FU4A 1W6RA 2MDTA 2PZJA 4ZEOA 2NN3C 3NTOA 3HWRA 1OILA 4UKDA 4ARBA 2R5FA 3GY0A 4G5RA 1XTBA 4D9KA 3I2FA 6CHYA 4PRKA 1F12A 2ENWA 3LC0A 2X0NA 1W36D 3QPWA 1NUSA 1PJ2A 2XUQA 4I66A 3AEUB 2GZAA 2D54A 5DBGA 5I51A 1J20A 2OBXA 2IV3A 4BZWA 5JNTA 2PUGA 1ML3A 1LRKA 2FQQA 2IP2A 1M1NA 3KB1A 4R2JA 3C7CB 2VQ6A 1ODKA 4EPWA 1KY3A 1MMFB 4MUJA 2X1LA 5IAGA 3QIAA 4MZXA 4EJSA 1I10A 4NE2A 1UBNA 1IY0A 1JS1X 2WF9A 2XOKA 1BRMA 4I14A 2XNSA 4O25A 5KWJA 2XADA 4LBVA 1E8MA 2WOJA 4B4UA 1SZJG 4EKIA 3EEIA 4D4GA 4Q6BA 4OK3A 1KEUA 3NDRA 1LZKA 3A6PC 5NULA 2VBFA 1H5UA 3QX8A 4Q02A 5FOUA 2E48A 3EQ8A 1OKKA 5H59A 3DCJA 2KMLA 4V0OA 2AVDA 1JJAA 1VMIA 1YUNA 2DHEA 2W6CX 2CWWA 3RS9A 4LYDA 3JV7A 5LOVB 3HY3A 1XU7A 1XEWX 3K3PA 5BN5A 1YB6A 3UG7A 2C98A 2EL7A 3GN2A 1X1BA 5ED0A 5P21A 4DLYA 5JANA 2I78A 4U8GA 3TW0A 1KEEB 2EFHB 2C8LA 5EEHA 5KTRA 4ND5A 3M49A 3MQ4A 3EVGA 1PR4A 3PJDA 1VBKA 4E7OA 1H5QA 2P6OA 2VK1A 4ETNA 1PNVA 3HDJA 3IEPA 4OXIA 4CM8B 1M6NA 4KIFA 1XZAA 1N6RA 5EWLA 3BCUA 2GJAA 2X7JA 1KZ9A 4B9EA 4BGIA 5IS2A 4WD3A 2PZEA 1N5OX 3NFYA 3DMGA 2XYPA 3PJEA 5AVYA 1K5HA 1YH3A 4DA7A 1AS3A 2EQBA 2D1RA 1K98A 5LBTA 3O9VA 1OLXB 4KPFC 3OLVA 1NA5A 1UJNA 2GLXA 5BURA 4RXMA 1W25A 5T64A 3LMKA 2REQA 5JARA 1B42A 4L1KA 3ZTYA 5SICE 1T91A 2C9DA 2VNJA 3JD2A 4GC5A 1HL3A 1WPQA 2WV9A 3AG6A 1D6NA 4K6MA 1I8TA 4BQQA 3DAOA 4XWKA 3IEUA 1I32A 1NUQA 4P7KA 4PINA 1CZKA 3FAKA 4Y67A 3URMA 4LVCA 5LZ9A 2YXDA 4MNTA 1CD5A 2GBPA 4BVAA 3HLTA 1GTMA 3DWIA 4BNFA 3L1HA 4BS9A 3LA6A 2XTJA 4GSLA 5ALSA 3UCXA 4KGXA 4W7SA 1NU8A 5E1DA 3W9BA 1XV5A 3NWOA 4J0GA 3EVTA 4OD0A 2RGNC 1YQGA 4RABA 1G291 4FEEA 5IM4F 2D0IA 1AHIA 2VJOA 2W2MA 3GOQA 3PT5A 5DH9A 5I7HA 3K53A 3R0QA 1VIVA 1EFCA 2H63A 3G68A 4AJPA 3QX7A 1KI2A 1Z4LA 1QB8A 1UXIA 3EVFA 3PHGA 4G1FA 4WINA 1OB5A 4PN3A 1DVRA 3DTVB 4BMCA 3S2UA 2DWUA 3L5OA 4RCYA 2FI1A 2VQFB 1CLEA 2CF5A 2HWWA 3OMLA 3BFPA 4M88A 1NQOA 2NNWB 4RD4A 4Z4CA 1AV6A 2EZTA 2F48A 1QGDA 1IOZA 4K87A 2GRAA 2X0RA 2EJTA 4HQ6A 1AM4D 3JASB 5IJXA 3F3SA 1Y0BA 3OPNA 5K0GA 1E62A 6ABPA 4ZZ0A 2X0KA 3SOZA 2HIMA 5K0EA 1CY0A 1W49A 2H4YA 3O1HB 5AP9A 5JECA 4FKMA 3BWXA 1GKLA 2JFXA 2BT4A 2N9UA 2ZWMA 3D0OA 3F0TA 4UU8A 1GZUA 4NAHA 4FYXA 3AMVA 3RWOA 3W8DA 4D46A 1K0FA 1UMCB 4O8CA 3HRKA 5A9SB 5FWYA 1G18A 1RXIA 2EP8A 2EBFX 2GRUA 3VSBA 1XKXA 1K8RA 2NOAA 4QGFA 5CAEB 4R6XA 4HLUA 3LHDA 5C4GB 3B7PA 4NMLA 3R5XA 4JZKA 3H1BA 3VVBA 3TNDA 1VE1A 3NTRA 1RWOA 3QU4A 3RBZA 3AF2A 4M21A 1C30B 2ZVDA 2QN7A 4WXPA 4KITB 2FW7A 3QUQA 1IRXA 3ZZUA 4NMMA 4AT1A 2Y9MB 3DE1X 4ZEXA 1E1DA 3GUZA 4G5SA 5I4CA 5AJUA 5B6PA 3RFVA 2GAFA 2ZS9A 3KSUA 3P5SA 3TQRA 1HDCA 2H1RA 1ZRMA 4C3OB 2NP7A 3QVWA 1N3IA 4KRGA 2XMGA 1XLTA 3LVFO 5K3FA 3UJDA 1V7ZA 3CZRA 3RS4A 2EX4A 2EC5A 4L0CA 4EJ6A 5DO9A 3SDBA 1ZUNA 5DNDA 4EKYA 2R8XA 2HFJA 1NXSA 1YQEA 2I33A 3E5HA 4O4IA 2Q3CA 1P60A 2EYUA 2Q1YA 3OIGA 3W1VA 3TTYA 2BE7A 1E2KA 2ZJ1A 5J23A 1JBEA 5J2TA 2GERA 5EHIA 4A7PA 2MINB 2AE1A 2JLYA 1ITZA 4YBZA 1JZTA 2X4DA 3GVPA 2YTZA 1F38A 3EHEA 4XOUA 1YJCA 3ZIAD 5IT9A 4DB4A 1SXQA 4G1UC 3SZUA 2R7AA 5J4HA 4F6CA 4KLZA 3KZNA 4CFYA 5KVSA 3A4NA 4MR8A 1PWZA 3MWGA 4Q16A 4WASA 2FLVA 2F3PA 3NPMA 3A10A 3ZXXA 4EHHA 3DDWA 4C7OA 3C3DA 1L4EA 4QYWA 3DKKA 4D4IA 2W98A 1J0XO 1XIVA 3E9MA 1PL6A 1MB4A 1ZYUA 1KFCB 2ISSD 2JKZA 3GRZA 3TBHA 3UH0A 4TRNA 3W4JA 1N2HA 3FIJA 3L0YA 2NPFA 1R9GA 1O8BA 3AKEA 3SCZA 1O7JA 3ZGLA 5LZ5A 5LKRA 4I36A 3CR7A 4H7FA 1K2WA 1TMKA 3QU7A 5EZYA 3BWMA 1Y9JA 4HEA1 4C0HA 1I9CA 2PWPA 3HJUA 1KI8A 4KXVA 4UMFA 2R60A 4JYZA 2K7ZA 3LC7O 3HVJA 2WWHA 3P9QA 5SZKB 1COWD 3OZXA 4JYBA 4OX9Y 5KTPA 3G59A 2VP4A 3T5PA 1CZHA 3M4NA 4ENWA 3QE3A 3PHJA 1MOZA 4HRYA 4M7PA 1EM8A 3T06B 3E5RA 2NP6A 4G3XA 2J09A 2FRDA 4WI1A 1RZVA 5DLQC 3PYLA 3KL2A 3GMIA 2X15A 1RPZA 4K6HA 1ZK0A 4IP0A 2I55A 4IDFA 1IJKA 3S0JA 3MHPA 3BE5A 1ZESA 3QY0A 4BMZA 2DR3A 4ZVKA 3ADCA 1JWLA 4M1MA 5LDGA 2ZWPA 5AI8A 3IRVA 4MYSA 3LIIA 3N2EA 1NI3A 1UXHA 4L4UA 1ZXBA 3I42A 5GZ6A 3R8XA 4C7XA 1ONPA 3P96A 4JYPA 4HZUA 2OYSA 4DA6A 1GZ3A 1AQUA 2G1JA 3SR0A 3B8EA 3WHLA 3HDTA 4LG1A 4NDZA 2HM7A 1RS0A 2C5AA 2NVBA 1Q12A 4EX6A 2M1XA 5ERYA 3ZWMA 5C51B 2CV1A 3DZGA 3QEJA 721PA 1IN8A 3DT8A 3ZW8A 1T1RA 3BM5A 4ZT2A 4S2EA 1EGQA 4V0QA 1TVKA 4A6XA 2Q0SA 2R00A 3AUFA 3K6JA 4O4JA 1VXOA 3MGKA 1X3LA 1IL0A 2PAFA 3JQCA 2J8ZA 4F5ZA 5KQLA 3AWDA 4RDIA 1E59A 3RTEA 1G7RA 1ECBA 1X6VA 5U4QA 1H85A 1TJ5A 3EQ6A 2D62A 3EFBA 4YPVA 4YP9A 5KTSA 5AVSA 4D9IA 4N5IX 4P7GA 2VF7A 3F7OA 4ZHQF 2Q5LA 1U8UA 4CIWA 2ZJ8A 2G83A 1IG0A 3JR7A 5FV4A 2AQ8A 4UCWA 4U2EA 1LF5A 2PVCA 1BX1A 1YZNA 3EIHA 4L8FA 2ZT6A 2I2AA 2TMKA 3K4HA 5FKJA 3W8NA 2ZBVA 2ZROA 3AB3A 1RD4A 2H52A 2R3SA 2WWTA 5AOCA 1U7OA 2I4OA 2A88A 1G2QA 3L1VA 4Q12A 4TOIA 3WLLA 3CT6A 5B3AA 1E2GA 5BSFA 3D2LA 3A4YA 2JCYA 4IDDA 3TQTA 4B6EA 2DPHA 2O7SA 4ZMSA 1I3KA 3M3DA 3H9JA 2IXTA 2WI8A 2Z8XA 4YDHB 2IZZA 4AXXA 4ZEMA 1YC2A 2F3QA 5DX0A 5KYYB 4RFSB 3FOCA 3QWBA 3O4JA 3E58A 4LV5B 2HBRA 3UFBA 3VYSB 4A5SA 2I6XA 4RD2A 3B3QA 4FBMA 2JAOA 2IX9A 5GINE 1PZMA 1XMJA 2QTCA 1GV0A 2BI7A 4FJ2A 1OFGA 4JHXA 4B4WA 3DLHA 2O19A 5ADVA 1VBFA 3DAFA 4QUHA 3O75A 2H0QA 3KCNA 3SOPA 3GZTB 2AI2A 1RPNA 4J1TC 5F4ZA 3UJPA 1BVUA 2A94A 2QRZA 1Z2PX 4BX2A 3SC4A 3OZBA 2DX7A 5A6SB 3RU2A 5D3ZA 4BNWA 3HN6A 4D0LB 4ALIA 1WW2A 5LXTF 4EKEA 2AH5A 2W2PA 1DCFA 2ZR0A 4ZV7A 3S99A 1X87A 2ZTVA 1YJQA 3L6BA 3UW1A 4DTCA 1T9GS 2Z5FA 3ZXYA 1RR6A 3ZU2A 1CQJB 1I51A 1CEXA 4PZZA 1ODFA 2GK6A 3DXFA 1K92A 3IS3A 4MHOA 4YGYA 5BSKA 3R5SA 3VR2A 2CDCA 4TUYA 4QUDA 5GZ3A 2PLNA 1O0SA 2AXNA 3OOEA 5ALVA 2XIJA 2ZBEA 1QIEA 3LCJA 2YIMA 4Q34A 1Y7LA 4IH9A 1UMBA 4R1MA 1KAMA 4KBFA 4DNOA 2OCXA 4F3KA 2F1RA 4MUFA 1TUBB 4DWOA 3PEEA 4FOSA 1FYFA 1QGUA 1Y6RA 4CM4B 2EFCB 2IOYA 3NX4A 4HN2A 5AM5A 3LXUX 4CKWA 5BRNA 4UBNA 1R7RA 3FRJA 4UM9D 1YAJA 4XXHA 1AZSC 1A7AA 5INTA 3F1KA 1JFRA 4AP6A 2W48A 3UWDA 2ZUDA 3UMFA 5JJ5A 3A1UA 4GDMA 3HSYA 4TLLB 3BH6A 2Y0DA 2CLLB 4GS5A 1LUAA 1PSDA 4YR7A 4MYUA 4YI5A 4ZA2A 4Z2AA 421PA 1VZ3A 2LDBA 1NXQA 3D64A 3FUXA 2EWMA 2Q49A 8LDHA 2B83A 3RFFA 3L0CA 2P6NA 1W8DA 3AL2A 3GZNB 3RGWS 3TW8A 4PTYA 4BYGA 4CCYB 1CUCA 3RU3A 3QEAZ 5AXCA 3OIVA 3R0VA 2VRWA 3C16C 4QXQA 3MC1A 3M1AA 1LPPA 4F4DA 4IW3B 5I7SA 1UBKS 3C3XA 2EGGA 3MIZA 4I19A 4NFYA 1EWVA 4WE3A 1E2NA 5LYJA 3V9PA 4UM9B 2G0NA 1ORHA 3WLRA 8ABPA 2ILTA 2O7QA 5KYUB 4TTSA 1GPKA 4RKRA 1USKA 4AG3A 3CXUA 4ZVLA 4DREA 4P0PB 3KPUA 4OYHA 2XVAA 1CJTC 3Q0TA 4RHYA 2EJUA 3T7EA 2E49A 2O4UX 5EE5B 3CN9A 4HDMA 3GNTA 1KTIA 1TUEA 3MJCA 4ER5A 1B6SA 1AY0A 4BNDA 4CF5A 4F4UA 5AWFC 2MSLA 3WIDA 2Q7OE 2WP8J 2WYOA 2ATVA 4C08A 3HBAA 3UHOA 2I6GA 3C4VA 3IE1A 3DEJA 3KPWA 1SJ9A 3TWOA 1SD5A 1T3SA 2EVWX 5FJIA 1ZEMA 2BEVA 3G1WA 3DA8A 1X7XA 2ZI7A 2PL9A 5AKHA 4EF5A 1XU4A 1CUDA 2RH5A 3N58A 5AW3A 3TOXA 2A9QA 1DG9A 1FPQA 1K3UB 1NM5A 4FOLA 5HYVA 4L5AA 3GHHA 4WCFB 4TKUB 2TMGA 2HR1A 3W5UA 4C14A 3DVAA 2P0EA 4QNRA 1F4VA 5CRIA 5EWLB 3W2FA 1XZKA 2CL5A 5AHKA 1WKBA 2ATIA 2X5OA 3O26A 4MB6A 1R50A 1IXKA 2QZ9A 1UAYA 3S3TA 2JGDB 1EB9A 1HQKA 4QU5A 2OO5A 5TMBA 5AFSA 3ZEAA 1V6SA 3QKIA 4HPWA 2IEGA 4IQ8A 4WKNA 2OXTA 2XCSB 1PBTA 4FW8A 4OAPA 3I9OA 1NVEA 2JCSA 3I92A 4C0KA 5FBWB 1YCDA 1DIHA 3SAJA 3K0BA 4BKRA 4LDZA 3W3AD 1W36B 2ZT7A 3U13A 2PDAA 1HSOA 1KBOA 3HY4A 4LF9B 1R18A 3H4IA 2XCOA 1S96A 2VWQA 4GYJA 1XMOB 5HE9A 2RJOA 2VT2A 3CS3A 5H5JA 3CO5A 4H17A 2Y1DA 4NWIA 3RVLA 4Z4EA 3ZWQA 4QM6A 2FEXA 4PYJA 4MS4A 4LIPD 1N5LA 1PR3A 5L4SA 4ITRC 3PSHA 5C1PA 3HRIA 4DR7B 4LSMA 4I50F 3D6VA 1KI3A 4DM7A 2F1OA 1PJSA 3WQQA 4DILA 2HSGA 5HIJA 3KQPA 4LGMA 4YK7A 3LVQE 2GN2A 2H17A 3EXEA 4X1OA 2NZUG 2VHVA 5EI5A 1PUIA 1N92A 3GLIA 3Q12A 3FNIA 1Q84A 3ZD9A 2FLWA 4ZCPA 4F1JA 4QJIA 1MO4A 5TPZA 3A32A 1PGOA 4YROA 3ZJ4A 3AJ9A 1HEUA 4CTKA 1M2WA 2BUCA 1SC9A 4OQ4A 3SQDA 1ZR2A 1FUEA 2WW8A 3E70C 4EO9A 5IASA 4DDWA 1GG8A 3DAGA 2Z6AA 1L5SA 3UWKA 4GKKB 2I1QA 5IRCD 2G82A 3B12A 1WTCA 2G08A 4Z7JA 2IYEA 1UDCA 5ITZA 3G6WA 3R41A 1ZGZA 5IN4A 2BYTA 3AOGA 4PNPA 1TM7E 2WUFA 2JASA 4G81A 3S8MA 3WISA 1NBWB 3Q5GA 4UM7A 1LBSA 1SU4A 5JCOA 1F8UA 4QWMA 3G7NA 4K26A 4DNQA 4RVSA 3SYTA 4K9LA 3AZPA 1BJRE 2WJIA 4BFUA 4KB5A 3MCZA