4TTRA

Crystal structure of legionella pneumophila dephospho-coa kinase in complex with bu2
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
201
structure length
201
Chain Sequence
MVYSVGLTGNIASGKSTVAEFFSELGINVIYADKIAKELTSKNTPCYQDIISHFGSSVVLNNGELDRKRIRDIIFSNSNERLWLESLLHPVIRKKIEEQLIVCTSPYCLIEIPLLFNKHHYPYLQKVLLVIAPLESQLDRIVKRDHCTKKQALAILATQPNLEQRLEAADDVLINESGLSELKAKVNKLHQKYLREAKIKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dephospho-CoA kinase
publication title Crystal structure of Legionella pneumophila dephospho-CoA kinase reveals a non-canonical conformation of P-loop.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
total genus 71
structure length 201
sequence length 201
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ttrA00
3KKNA 1AZSC 1CR1A 1TU4A 2QY9A 4B71A 5CITA 3UG6A 1OE0A 3Q7PA 4WZ6A 4IFBA 1N25A 1E2IA 1IN6A 5CDFE 3SJBA 5AJZA 1I4DD 4EKDA 4NYJQ 4YMTA 4M9XA 4ACAA 3A4LA 1US8B 3LX5A 2RGGA 3U5ZB 2ZANA 5A4JA 2W2XA 2XAUA 4TWZA 2ODEA 4TMTA 4MKIA 1FNNA 2VSOA 4B48A 2FE4A 4JLKA 3FFBA 4URYR 2G88A 5KNDA 4M9ZA 5DN6D 4DCTA 2ZR0A 3AUYA 4FCTA 1ZD1A 2PT7A 3LV8A 4PHTA 4TTRA 1W46A 1Z5ZA 4DDUA 3LVRE 2OBLA 1LS1A 3MRSA 2WKPA 1NLYA 3MFYA 4BECA 5DI3A 3ZZUA 4F4CA 2W0MA 1T0HB 1XP8A 2ZETA 2YJTD 3ETLA 1ZUHA 2FFQA 1EXMA 2R8RA 5HE8A 5LDDC 2ERXA 4KVAA 4W5JA 2GK6A 5H68A 3A4MA 4ZCLA 1E1RA 1VG1A 2EQBA 2JLRA 5KNCA 2WWWA 1OV4A 3DVLA 3WNDA 1K5GA 3B78A 4EFMA 4Q02A 2IYWA 1E2PA 1BO6A 2V1UA 2X8AA 1OFUX 1VYUA 3KZ1E 2RGBA 1AQUA 3SZRA 1N6NA 1Z6GA 1YRBA 3RS5A 4B2IA 1XZPA 2ZUCA 1QHNA 1VPLA 2AHOA 4B44A 2BCJQ 3D8BA 3U3OA 3D31A 3MMPA 3FMIA 4AC9A 2DHRA 1OHHA 4X8MA 4D25A 4ZO4A 5DLQC 4X8LA 5JI3E 3EPHA 3NIBA 2CXXA 3UPUA 3B82A 4KBFA 4JVMA 4US1R 3OEHD 3O8BA 3BH0A 2HYDA 4RD2A 3AP3A 4M22A 4ZIRA 1G17A 2FWRA 2UVQA 3LQQA 4HSEA 5EP2A 4RFSB 5DHFA 1U8ZA 4B43A 3RHFA 1XMSA 3TAUA 2J5XA 5IT5A 5BN4A 1CR2A 4LOAA 1Q0UA 1SHKA 2VP5A 3VMFA 3FKSD 1G4AE 1R7RA 3PEVA 2YHSA 3X1WA 4AIIA 1GL7A 1MOZA 2GCNA 4Q47A 3CNNA 2GWHA 5KDLA 3DHWC 1ZMXA 2Y8EA 1K5DA 4ON9A 3CWQA 2UKDA 1ZM9A 4RCYA 3QI2A 5JHHB 4HAYA 4YMVA 5FBQB 2J87A 1KDRA 3HR7A 2FSGA 2O8BB 2XEXA 5TB5A 1ZP6A 1QG2A 1T91A 4V0MA 3I72A 2ZRDA 3VKWA 4LGMA 4KYUA 4LBZA 4MQBA 1YZUA 3MD0A 4Z8XA 1AS3A 3KTAB 1LS6A 2IW3A 1QVAA 1DAIA 1SVWA 4JZKA 4XWAA 5FOVA 3SDZA 1ZU5A 2C8VA 2G6BA 2YC2C 5C2JB 4LI0A 3PUYA 2CJWB 2YWHA 1G9XA 2Q21A 4LUCA 5H8WA 2FEOA 1RFLA 2JIZD 1R8SA 3FVQA 3EPLA 4G01B 1QBKC 1SHZA 2CK3D 1GP2A 3CNOA 3IPYA 2PT5A 2REBA 4TSFD 2JLSA 3NBXX 2NIPA 5C4GB 1FZQA 1NSFA 2CLSA 4FMDF 3UMFA 1Q57A 2VF8A 3OE7A 3THYA 1IQPA 5BYKA 1NL3A 3KXLA 3HPRA 3OIWA 2BIFA 1KKMA 2Z6VA 3QKUA 1E9EA 3EWSA 3EZ7A 3KXIA 4EQ6B 2GJKA 2H17A 1DG1G 4ERNA 3TMKA 3PV0A 1R2QA 1OIWA 4GRAA 4ZV4A 1YZGA 2WWYA 3A1UA 4WA7A 2FZLA 2FSFA 1Q20A 1IN5A 2HCJB 1GRQA 2E87A 1ESMA 1AS0A 2ZYVX 2OFXA 3THWA 5FL7A 1VMAA 1KDTA 2QA5A 2ODBA 2I3BA 1U9IA 3SJZA 4LWZA 4N0EA 4RFVA 3GLFA 2PCLA 3CR7A 5J47A 5JRJA 2AL7A 4TLEA 5FPKA 4CGZA 3F0TA 1TF2A 3LFUA 3WRXC 4GBMA 4OI2A 5IRCD 4Q7MB 3GJ6A 2BM1A 2VF7A 1SZPA 2O8EB 3ZJYA 3CR8A 4IXNA 1BYUA 1CRQA 1EG7A 1W4BA 5FR2A 3B60A 5FTMA 1GTVA 3B8HA 1H8EA 1US8A 5JFGA 3KQHA 1E32A 1OYYA 2QP9X 3HU2A 4C0KA 2L0XA 3LWNA 1NJGA 2J9RA 1JPNA 1XD8A 3NDPA 4RD4A 4UNRA 3K70D 3D7MA 4RSGA 4HB4A 2A78A 1KI7A 1JJ7A 4WAUA 4LYHA 3LLUA 3JZMA 2ZPTX 4NTZA 4BGDA 2E9SA 5KYKA 1OXSC 2ZSEA 2V3CC 3QG1A 1LY1A 1F2UB 2A5JA 3GEEA 4MRSA 3UXMA 4B3FX 1E1RD 2BBWA 1XTJA 2YWFA 3EA0A 3AVPA 3QPVA 4NZYA 4WXRA 3PXGA 3JVUA 3SI7A 4U7DA 3VTKA 2MMGA 2CHQA 4JLVA 3VR5A 1Z2AA 5B64A 2J7PA 1R5NA 1OB2A 1E2LA 3NBYC 4B73A 1VHTA 3QKRA 1OHHD 1GG2A 2HT1A 1UEIA 2RH5A 2WSSA 4GSYA 4DLRA 2W00A 4Q1FA 3REFA 5BN3A 1U8AA 4IDHA 4XSGA 1GDDA 1KO8A 2C04A 2CCKA 1R0YA 5JECA 2FPLA 2Q0HA 1JXMA 1YHNA 1SVLA 3SBEA 4OK6A 4DUGA 3O8CA 1TEVA 5G53C 1X6VA 4JIMA 2UZIR 4KSBA 4PSVA 2DBYA 3NH9A 3UIEA 5DYIA 1PJRA 2NTYC 1KDOA 2VSXA 5FTLA 3KDSE 3QXXA 3SBDA 2OFOA 4LBYA 1P9WA 4YDSA 4ASUA 2WV9A 4B3XA 2W6IA 2GJAA 4P32A 4P31A 4PC2A 4YMSA 3K09C 4OKSA 4D0GA 3JZAA 5FOSA 4MUBA 2GAOA 5E95A 3MSXA 2OV2A 3AF2A 2WMNB 1OT3A 3KKMA 4Q66C 4QGFA 5CIQA 1QHHA 4IKEA 6Q21A 4DDVA 1XCGB 5EJEA 1EX6A 4QXAA 5FL3A 3KUDA 2Z43A 4EPRA 1X86B 3SJCA 1X1RA 1W48A 4EPVA 1TPZA 3D6TB 5CJ2A 2VL7A 2ZI4A 1IY2A 4NH0A 1ETUA 1R0XA 2WJVA 1S8FA 3Q5EA 4OQFA 1UJ2A 1KI4A 1GILA 4Q18A 4LJYA 3ND8A 3W3ZB 2G83A 3KX2A 3ADCA 3NBZC 4A6XA 4BLRA 1EFTA 1Q22A 2A7QA 1IJEA 1KSJA 2BEKA 4P3YA 1SXJC 2BJWA 4QFMA 3AM1A 621PA 3PENA 1E94E 1KI2A 4Q03A 3C16C 3GJ3A 5LD2C 1E1QD 1Z0JA 1GM5A 3DM9B 1OH8A 3IQWA 2CJWA 1NY6A 1EX7A 3K9NA 3OE7D 1EFHA 2NPIA 2QGZA 1W0JA 3BJIC 4DDWA 4KU4A 4I1SA 1E79A 2GVZC 3ZVMA 3JVVA 3PITA 3CLVA 4BASA 4D80A 1G3MA 1N6IA 4KCGA 3NHBA 1CULC 2X19A 4DLSA 4M1TA 4A1FA 4IEEA 1IXZA 1E3MA 1G8PA 1VYTA 2YWGA 3Q9LA 5FUVA 1Z6AA 4YXWA 1FTNA 4EQ6A 1DELA 4IJMA 1E2FA 2QM8A 5JSZB 2ZR9A 4M53A 4P0TA 1IN8A 1E9BA 4NONA 3NHAA 4A6PA 2PLFA 1QRAA 1EFUA 2ZE5A 3BFVA 2F3RA 1RRFA 2F9LA 2QRNA 1L4YA 2FFHA 4RY2A 2K5UA 3NDBB 1D2MA 1DTSA 1D2EA 1T4GA 1EFCA 2KE5A 3AKCA 4Z8YA 4D4LA 1W36B 1ZC3A 2C96A 3A1WA 3TVDA 3QXSA 2I4IA 1EWRA 2GKSA 3O8DA 3C14C 1ZRHA 2FX3A 4I99A 2J46A 3E1SA 4MRNA 3EIEA 2HXSA 4JL6A 1LV7A 4LJ8A 3IO3A 1R8QA 3QXHA 1D6JA 1H8ED 2W6JA 3W6PA 3VNUA 2A9KA 3QUSA 4MITA 1Q12A 3QBVA 3ECCA 2OCYC 3GLGB 5EQTA 2AXNA 3RNLA 1XEXA 5KPJA 1VTKA 2JJ1D 1X8JA 2V7QA 1H8HA 4Q1DA 3O47A 4LCBA 5SZIA 2REOA 4Q7KA 4C4PA 2AD1A 2CNWA 3OEEA 2C9YA 5DO9A 4LPSA 5DISB 3EIQA 3CNLA 2GVDC 1OH7A 1HV8A 3GEHA 3WMFA 1F60A 2CL0X 4C0AC 4EPYA 2WWFA 5F2EA 2CE2X 3QEOA 2OE2A 5K8IA 3P27A 1Y63A 1R5BA 4DCSA 1ONBA 2J7PD 3T61A 4UNQA 4G0NA 4JS0A 2DPXA 1GAJA 3B13B 1GKYA 4PR0A 2J0SA 2MSEB 2XZOA 2GEUA 4NCIA 4UQOA 1F3OA 3OFNA 4UXIA 3CO5A 1XMVA 2XB2A 4NCJA 3TR0A 4DUGD 4A2WA 4B74A 4TZ0A 1E2QA 1E9CA 4NCKA 821PA 4DC9A 2OXRA 1NVUQ 4US2R 5JHGB 2QU8A 5J5CA 1P75A 5HKKA 1KZ7B 4OK5A 4WOPA 1AS2A 5IDVA 4ASUD 3WYFA 2W6ID 4Q19A 3OZXA 4Q9LA 3WNBA 2P5TB 5F9HA 2XXAB 4B32A 5ELXA 3LAWA 3KJGA 2ONKA 5JWRA 3OHMA 2YC4C 3AVQA 5H1YA 1NKTA 4Q4HA 4Q4JA 3EASA 3CPEA 4EFLA 1RVDA 2BBTA 2W58A 3QKTA 4XVUA 1XTSA 3B1ZA 4NDZA 1N5IA 2R6GA 4D4MA 2DWOA 3FFAA 4DCVA 5L3QB 3IQXA 1W4AA 2PH1A 1Y3AA 1Q3HA 2J0UB 2QZ4A 4FCVA 3ZQ6A 5GVSA 1Z0IA 2YV5A 3L0SA 4QGGA 2IUUA 4P4UA 2EVWX 3PCRB 4H1UA 4AURA 2VO1A 3VR2A 2IYQA 2FFBA 3UKDA 3ZZ0A 1P5ZB 3RC8A 4R2HA 4QGHA 1OFIA 4TMZA 4NKRA 1XEWX 2GXSA 1SKYB 4MGZR 1TX4B 1MO4A 2D06A 1IHUA 2ZQ5A 1TQDA 3QPWA 4FMCB 2ZSFA 3RYTC 2KI5A 5EP3A 4KFTA 2UZ3A 1E96A 1KJWA 4FI3C 5B57C 2KJQA 1CLUA 2QTHA 4DHEA 2DYKA 5K8UA 1E99A 1N5LA 3W5JA 1OLOA 4UKDA 3QVVA 2FFAA 3G82C 2FH5B 1NMZA 2ZUDA 1W0JD 2FZ4A 1JPJA 4KSCA 1Q44A 5DN6A 2IF2A 2JLWA 1BIFA 1G1MA 4Q1EA 4GDFA 4KLZA 2O8CB 1CF4A 3I3SR 2FOLA 4A2QA 2ORWA 5FH9A 3CBQA 1YKSA 4E09A 3LNCA 2OBNA 4PZLA 2C2HA 4LJ9A 4YXWD 4E07A 5BYJA 2YOFA 2VHQA 3H4MA 1L2TA 4NYMR 3RS0A 2XGJA 5LPNA 1IAQA 4OI4A 4MDFA 4HB0A 3B1YA 3ZVNA 2O5VA 4B75A 2GXQA 5GJCA 3GLIA 3EA5A 4MUAA 3CB4A 1D9ZA 3NEJA 3RS7A 2O0HA 4OHWA 2ZI5A 2GCOA 5D3QA 5JSZA 3QIAA 3WNCA 3ZH9B 3NEYA 4D0NA 4A2PA 3L2OB 1A5TA 1Z83A 4L8GA 5AJWA 1Z0AA 1KI8A 4OHZA 3IPXA 4PHGA 1DVRA 3U4QB 1VYVA 4NP6A 1HYQA 3KQKA 1NVVR 1T3LA 2CDNA 1CKEA 1F48A 1E98A 3Q8XB 3RRYA 2DR3A 4V0ME 2ATXA 1OKKD 4XVRA 5CIWA 3WP0A 4LYJA 4FMBB 4CEIB 2ZEJA 1S4QA 4RKFA 2OHFA 4NYMQ 4I1UA 4I1VA 5DYGA 5FTNA 5J40A 1GIAA 1UDWA 4DLUA 3P20A 1G20E 1QZXA 2V7QD 1H8HD 4TLAA 3TR5A 4DT1B 1D8TA 1S96A 3QPUA 1T3HA 4PO8A 1RRGA 1CXZA 2CNWD 1S9DA 2ZJYA 4D0LB 3GLGA 1GKIA 2HJGA 3GJ8A 1P7CA 2JDIA 4RD1A 4NBSA 1CJKC 2B6HA 4ARZB 2QI9C 3K0CA 5JRZA 1IXRC 1O87A 4M2LA 3AVVA 3H86A 5FBLB 1FQKA 2ZS7A 1KI6B 4DBLC 1DS6A 4ZKDA 1XD2B 1NIPA 4LHWA 5CK5A 1NVVQ 1QDEA 2VP4A 4A0RA 2YOHA 4HZIA 1YZNA 2G1JA 1MABB 2Z83A 2ZJOA 4Z1MD 1QVRA 4F92B 3HPQA 4A0GA 4C30A 5KSOA 1MV5A 3QF4B 1YRAA 2QRZA 3OFND 1KI9A 1TADA 1A1VA 2C95A 4A8JB 4L16A 4M1OA 4I4LA 4HEJA 4JL8A 4C2TA 4BZPA 2YYZA 4HI0E 3EWAA 1S1CA 4KFRA 2QPOA 3GLFE 3CUEF 4HZUB 5FPYA 1EGAA 2Q9AA 1G3UA 3X1DA 3BB3A 5AUNB 4HLUA 2JIZA 1K8RA 1CR0A 1XCPA 4X8HA 4WXPA 2VSFA 5CYPA 4PO1A 4OHVA 2F1IA 5C46F 4TQ9A 4B3BA 3ADBA 1XXHB 1UF9A 2OCPA 2JLQA 3K8YA 1E9SA 4S2EA 4F4JA 4ZDIA 1SULA 1DO2A 1VECA 4V0NA 3R8CA 3MG9A 2V6IA 1BMFD 1XTRA 4JVLA 1VHLA 3MWLA 4YLGA 4YQFA 5BW8A 4XIGS 2A3RA 4QBIA 5F98A 1Z2CA 4MRVA 4Y0VA 1XWIA 5JZVA 3B1XA 3K9LA 4NCHA 1SVSA 2OSBA 3EC1A 4CEJB 3RAPR 2IYRA 2J0UA 1KMHB 4PSAA 1SXJB 3V4RA 3PJRA 3U2QA 4TL7A 3SE0A 3FYHA 4HATA 5LD2B 1MO5A 1HEIA 3MWJA 1P9NA 2ZAMA 3C41J 4ZPXA 4E03A 3C7KA 2ZIAA 3K0FB 5E7JA 2CVHA 3ZIAD 4B3GA 3W6NA 5JJKA 3LBHA 3FKQA 4N1AA 5FUYA 2D2FA 2AFIE 1QHXA 3NC0C 2C78A 2XNDA 4NU0A 3VNVA 4LJ4A 1L8QA 2IS2A 3K1JA 2ODWA 2QGNA 4BLSA 2QBYA 1XB2A 4DLVA 1E4VA 3SHWA 4TYYA 3U7EB 2Z4SA 3MJHA 4OL0A 2PZGA 4LHZA 3HU1A 2ZRGA 3B9QA 1ZD9A 5HZKA 1GVNB 3K0AB 1KY3A 1PLKA 2R65A 2NZ8A 4QBFA 3Q7QA 2OO7A 4V0OA 2PBRA 1VCMA 2RGNC 5C18A 4Q1CA 1S3SA 2G1KA 4A92A 5FOWA 1YZTA 2EYUA 2GEVA 3BERA 1G8GA 3PIRA 1G7RA 4EJSC 4YMUA 4BRUA 2ZJZA 1CJUC 4TMXA 2NMVA 5TMPA 2BHRA 1II9A 3T06B 4Q21A 1NVXQ 1FL9A 4GOJA 4A15A 2OXCA 3AP2A 1EWQA 4JLNA 3RLFA 2C9CA 2QMEA 3P4YA 4A82A 3THXB 5EE1A 1J8MF 1DARA 5A5GA 3DKPA 3DDCA 4XJXA 2RMKA 3UATA 4D6PA 4QBHA 5DNYB 1G21E 2QP3A 5DE3A 1W36D 3SR0A 1R0WA 3AVXA 4DCUA 4R9UC 4Z54A 3M4YA 3V00A 3L8ZA 5KDDA 3ZLJA 1PUJA 4BE7B 1G3QA 4OQXA 3OESA 2I1QA 3GQBA 2A5FA 3M1IA 3WBJA 1KK2A 2JJ8A 2Q3FA 3GJXC 3AKDA 4FD2A 5KSYA 2ZU6A 1AA9A 2QQ0A 4RZ2A 3UWKA 2AFHE 4ZI3A 4JJKA 1M7HA 4Q7LA 1KDPA 2GZDA 5FBRB 1WBDA 4RD6A 3TBKA 2H5EA 2JDID 4DT1A 5DH9A 4C3ZA 1OW3B 3KFXA 3OIYA 4RJLA 3VR3A 2HT6A 5ANRB 1ZNYA 3ZZTA 2YINC 2OESA 4YDHB 2ZRFA 5DSZA 3CH5A 1KSGA 5AUOB 4ZCIA 1E0SA 1G291 2QG6A 3KB1A 1E2EA 1JEDA 4M1MA 3T5GA 4ARZA 4XWOA 1ZNZA 2NOAA 2ZRIA 4QNRA 1JQJC 3CRRA 3AVOA 4UNSA 1G41A 1QHYA 3LQRA 1QHGA 1LFDB 2FMXA 2O0JA 1KJYA 3BBPA 3O8RA 1P2SA 2B21A 2QAGC 1DEKA 3DOEA 4DVGA 1MABA 3U3KA 2BBSA 2JLZA 2PJZA 3RWMB 1SKQA 1R6BX 3CF6R 1KTVA 1RIFA 4DSOA 1OXUA 3QF4A 4CT4B 4KHZA 3AGQA 5CM9C 3KJHA 4A8JA 4CRWB 4QHYA 1I4LD 3I8SA 5IK2D 3R8FA 2IL1A 1Q21A 1W7AA 1FMLA 1E1QA 5H70A 3BH7A 3AF1A 3PR1A 4HZUA 2G0NA 4N3NA 3PUVA 1U90A 1HURA 2R62A 4C9BA 2ZSDA 2CVFA 4RZXA 2D7DA 2LKDA 2WZQA 1ESNA 4F38A 1KK0A 1J7KA 1XTQA 3ZS9A 3RRZA 5CB6A 1N5KA 5DI9A 3K9GA 1VIYA 3I32A 5FBWB 3VHXA 1NG9A 2EU8A 4W5WA 2HUPA 1ZD8A 2HCBA 3U44B 2QENA 4KI0A 2CHGA 1JAIA 3U61B 3QQ5A 2ZE6A 2QMUA 4OI0A 4OQMA 4OJKA 4CW7A 3AGPA 3UMRA 1M8PA 2GTPA 2P6NA 1JXOA 4BFVA 3VR4A 4GP6A 4M0LA 3P1JA 4TT3D 3B85A 1UKEA 4XOIA 3SS8A 2H8KA 4PFSA 4TYNA 4JLBA 2AX4A 2YWEA 2ASEA 2DWPA 2Z0MA 4CEJA 3KUCA 1AKEA 1P62B 1W0KA 1M7GA 1TL7C 1KMHA 4V02A 1SXJA 1SVIA 3S1AB 1CP2A 4G5GA 4ZDJA 4O2LA 1M1YE 4HDOB 2V9PA 2ZI6A 4UJ5A 4KJZA 1XU4A 2H92A 2XNDD 3CX8A 3K0FA 1W2HA 1U99A 1C4OA 4P4SB 2QQEA 1WF3A 4LJAA 3TSOA 1T5LA 4RCZA 1EFRA 2RKOA 2IYTA 2IUTA 3RANA 1QF9A 4PC1A 2JJ1A 2BKEA 4L9WA 3BXZA 2RHDA 1GUAA 4IXMA 3RS4A 5L3RA 4DJTA 3I61A 3QEJA 3K0AA 2Q9CA 4HUQB 3KQLA 4FMDB 4CIDA 1BH2A 2IA5A 2OILA 221PA 2ZE8A 3THOA 3BORA 3EZFA 1NLZA 1ZJ6A 2XX3A 1HTWA 5LBIA 4AYTA 2VQSA 2XB4A 3SYKA 3T5DA 1XEWY 3RSLA 3L82B 1MRSA 5FFMA 2QM7A 2XTNA 1IOZA 1IXSB 3EXAA 1DBSA 2FN4A 2HV8A 1TNDA 5GJBA 1BYIA 3IKJA 2WICA 3EZ2A 3HU3A 8OHMA 4ZKEA 1G5RA 1T5IA 3PUZA 3CF2A 4NCNA 1CJMA 3U7HB 1PVOA 2EFEB 4PQRA 1X1SA 3LY5A 2DFNA 4IOLA 4MYHA 2GRJA 2ONJA 4L15A 2EYQA 3R9WA 3KFVA 3IIMA 2YZ2A 3ZVRA 4TLBA 1E0JA 2GESA 3FHTA 2WPDD 4HYYA 4RFSA 2RCNA 3NVAA 4LYAA 1Q1QA 4MKGA 4IRUB 2O0KA 1OIVA 1PZNA 2FF7A 4HB3A 3RABA 4PANA 3KB2A 1DAHA 1E9AA 4M4SA 4URUR 4BZXA 2F7SA 1G6HA 4BFTA 5F9FA 1QG4A 4LJ7A 1P4SA 2GF9A 4IDNA 3BB4A 2IWRA 5D3MB 2J3EA 4G1UC 2AXPA 1B23P 4JVSB 1RRPA 3AH8A 4JVNA 4TLDA 2FGKA 3GFPA 1E4YA 3IILA 1S0UA 1F5NA 4WIAA 3RDPA 3CRW1 1FPMA 4AKEA 4Q9IA 5HE9A 2O8BA 1R4AA 1N6LA 2YKGA 3U3JA 2QE7A 3UMSA 3UK6A 1Z06A 2R6DA 2I1VB 2ZITA 3GLIE 1YZQA 5JBQA 2F1HA 1OFTA 2GILA 3EC2A 4GOKA 4IHQA 3KTAA 1JBKA 2NO0A 4JLJA 2V54A 2GXUA 2ZRLA 3CZPA 1D9XA 3DMNA 5FBVB 3T1VA 4MA4A 1KMQA 4PC7A 3RC3A 3KKOA 4KYIB 3VAAA 4G5OA 1U9IC 1Z22A 1TUIA 3TUIC 1FX0B 3A36A 3WRYC 3BC1A 1GWNA 4JYCA 3VU9B 5K8LA 3RSOA 4JBYA 1HQCA 4D4KA 1NN3A 2W2TA 3W90A 1E0KA 3QSYA 1GSIA 3SQXA 2FJUA 3PG5A 1IN7A 4I81A 3FE2A 4C7OB 2IEZA 3PFIA 5TVKA 3B5JA 4DIEA 5L8VA 3U44A 1ZUNB 1YQTA 3GLGE 2AK3A 2VRWA 2WVJA 3REGA 4L5BA 1RZ3A 2G3YA 2VEDA 1GOTA 2PEYA 2BV3A 3X1XA 1AM4D 1WB9A 3IHWA 4TTPA 2ANBA 2DB3A 2PEZA 2JGNA 1ZCBA 3BS4A 5AJVB 4C0SA 2PZEA 2XZPA 3DOFA 3ZVLA 1CS4C 2WWHA 1A7JA 2ZRNA 1OFHA 4DEYA 3U7FB 1BKDR 5TDHA 1W0KD 1E2GA 4LK2A 1SXJD 2PX0A 4TL9A 4FW9A 3U6KA 2ZJ5A 1G3RA 4IEIA 3UG7A 4IVRA 3WBKA 1OIXA 1VCNA 1E2KA 3BIFA 4QRHA 1Q1EA 4IOMA 1OKKA 3S1AA 4BUJA 1M74A 2PJRA 2O8EA 3LLMA 1XMJA 2QSYA 1EFRD 3Q5DA 4YONB 3GLHB 4BFWA 1XNJA 1KY2A 3U3RA 1A2BA 4HLDA 4U00A 4P4SA 2PMKA 2NPFA 2C5LA 3HJNA 1VDZA 2ZR7A 4G3XA 2D3WA 1NF3A 1T3SA 3QE0A 2QSZA 2ZRAA 4O0MA 2WWIA 1G5PA 1XJCA 4QKQA 1E69A 5FOXA 1TAGA 2QT1A 2WBLC 5HZHA 4Q9KA 1G7TA 3FWYA 4V0KA 1F2UA 2EFHB 1E2NA 2QTFA 2VP0A 2ZYUX 2LCFA 1UPTA 4AD8A 3WMGA 1JR6A 2J45A 2GEDA 1E9FA 1GL9B 1II0A 2WSMA 4FWIB 5P21A 1XPOA 2R6AA 1Z28A 3W8NA 4Z1MA 1OJLA 3I5YA 2FGJA 1NJFA 1COWA 2JAQA 3LW8A 3QOFA 5KSPA 5UKDA 5J4LA 2CMKA 1Z0FA 2OCAA 4DWJA 2OLKA 2BCGY 2C77A 1HH4A 3BK7A 1C9KA 3Q85A 4KV9A 2ZM5A 1WQ1R 1KO5A 4M21A 4KFSA 2BM0A 2ZE7A 1NVWQ 3SHFA 3GJ7A 4WW0A 1C1YA 2W83A 4KODA 4GNKA 2ZVQX 1FNMA 3OAAA 4FMCF 1E2MA 1TTTA 1E9DA 2PL3A 5B30A 1S2MA 5JJLA 1ELOA 1P2TA 3M6AA 1RYFA 4E5UA 2X1VA 4R98A 1HQYE 1WRBA 1XEFA 3HYTA 2RGXA 1YJ5A 4W5HA 1QHIA 2Z4RA 5SZHB 3BWDD 4OYHA 3GEIA 2WJGA 1G19A 4L4UA 5EZ6B 2H16A 4LHVA 4HLQB 2GAAA 1BMFA 2NO6A 2VHJA 5GADl 1MT0A 4QNMA 3ICQB 4TYPA 1U8YA 4XD7D 5E7MA 2YOGA 4C2UA 4AY2A 3SN6A 1F6BA 2O52A 2ZS8A 4B6EA 4RKEA 3IEVA 1NIJA 2RGCA 4P33A 4PO9A 4TL6A 5HCIA 3K0SA 4WBSA 1KGDA 4PPGA 3EZ9A 4AYWA 1DE0A 3B6EA 2FSIA 2QPAA 2ZVPX 5BN5A 5E3HA 3L0IB 3TNFA 4DSNA 4CVNA 2QE7D 3SQWA 1YR9A 3QJYA 1NLFA 2Q6TA 1II8B 2BVNA 3HWSA 3TLXA 1JI0A 3LW7A 1Z6TA 4GOXA 1J8YF 5EZ5A 3EG5A 2HLDA 3ZIAA 4DSUA 4P4TA 3DO6A 1OF1A 5HPYB 1UBGA 3D3QA 3TH5A 1MR3F 5SZJA 3DEFA 5KHOC 4JKYA 1JB1A 3N70A 4QBGB 2X77A 1W5TA 4JL5A 2ZS9A 4EDHA 1E0AA 2MMCA 3TSZA 1W1WA 4F4IA 2F43B 2IYYA 2WJIA 2VTKA 2CL7X 3C8UA 2AWOA 2NQ2C 1NBMA 4RZUA 5G40A 2FEMA 5CLLA 2IYVA 4DXAA 3DZ8A 2ZROA 2GBLA 2N46A 1WBBA 3VU9A 3E70C 3NBFA 3MCAA 4MGYR 2O8DB 4XVQA 1AN0A 1UBEA 4NMMA 3A58B 2OZEA 3CWZA 4ITRC 2BMEA 3FMPB 3IHLA 1DG3A 3Q3JB 2IX3A 2WIBA 4GZMA 4C7OA 4IDPA 4BWYA 1HY3A 3SU8A 1UKVY 2QORA 3GFTA 1NSTA 3ONWA 4HB2A 4X8OA 3W3AA 2VYFA 4CDGA 2GDJA 2R44A 1UAAA 3H1TA 4M1YA 3AF3A 2BMJA 4LV8B 3R7WB 3MGCA 2IUSA 1RPZA 1LW7A 4Q5IA 3HP1A 3AEZA 1AZTA 1R5OA 4A4DA 5JS8A 5KSZA 1PUIA 1JQLB 5E7IA 1KNXA 5C1BA 3CZQA 4TMVA 3CX6A 3T34A 3AVUA 3AF0A 3RRNA 2LWIA 1ANKA 4PPFA 2QPTA 4AK9A 5CM8B 5AWFC 1LNZA 3N2IA 2G9NA 1VG8A 1MO6A 1XBTA 5EP1A 5SZKB 4D2IA 3GLHA 2F55A 3LBNA 4QHTA 3GCGA 1TMKA 3NKVA 5B58C 1CTQA 1A2KC 1F2TB 3QXJA 3FOZA 1Z6YA 3NXSA 4PAMA 4QGAA 2XOKA 3LH5A 3RS3A 4IVQA 1HE8B 5G3YA 2XTZA 3HDTA 2ZRPA 5EUMA 2RGEA 1JR3A 5JEDA 5IHPA 2WOOA 1NI3A 1IM2A 1COWD 4CEHB 3GPLA 3FMOB 3NC1C 3IBGA 2FSHA 4M1SA 5GVRA 2ZJAA 2G77B 3GP8A 4IDQA 1LVGA 3CRQA 3KKQA 1KO4A 1TQ6A 1SQ5A 2OG2A 2QMOA 4UJ3A 3OAAD 4JLAA 721PA 1G6OA 2HJVA 3KXKA 2P6UA 4S35A 2B92A 1IN4A 4TTQA 3TKLA 2C03A 4WZBE 5IK2A 4D26A 4MKHA 3EW9A 1KZGB 1SXJE 1NN5A 4I1OA 2ZRCA 4OJQA 5HTKA 5L3SB 3TAHA 2MSCB 4DB4A 3VKGA 3KL4A 3LO5A 1RE0A 1S3GA 2X2EA 2W2VA 4AG6A 1AK2A 2XSZA 2NO7A 2NO9A 2XXAA 4M9QA 1JJVA 1X8LA 3CONA 4LHXA 3AVTA 2C9OA 2IK8A 3WYGA 2C99A 4LC1A 3B7GA 3N5CA 4URWR 1G8HA 3CKLA 1ZUIA 1DOAA 1YR7A 4XH9B 3TE6A 5L3QA 2GCPA 2GA8A 2NGRA 5EE3A 1WXQA 2NZJA 1YE8A 2GJSA 4O25A 1AQYA 1TF5A 4TT3A 3EPJA 3NTUA 1NN1A 3K9HA 3R9XA 3I73A 3Q72A 4B76A 3P26A 2CLCX 3ZDQA 3U7GA 1DAMA 1N0UA 3TVTA 4GZLA 3BH6A 3W8RA 1YU9A 5JWHA 2HLDD 2QUZA 1IONA 1I2DA 1WDTA 2B7CA 1KK1A 2NO1A 2OT3B 3G5UA 5EP4A 2QEQA 3T12A 4AG5A 5BXQC 1Z0DA 3VHLB 1GFIA 1II8A 3A4NA 1U2RA 4O2RA 4DLTA 4BRWA 4ZDKA 2IXGA 3FGNA 1KSHA 2IYZA 3B9PA 1XJQA 4EPXA 5L3VA 4IDOA 1RJ9B 1YR8A 1Z8FA 3C5HA 2KBEA 4JYBA 1NBMD 2OBMA 2GZHA 4DB2A 5J4KA 2VPPA 4B3CA 4W9MC 1DAKA 1G7SA 3QNUA 4DEXA 1XTIA 5JWOA 2F43A 4D4JA 1FP7A 3AV0B 1E6CA 5FPHA 2O8CA 4PQYA 4KVGA 4ESVA 1GKUB 2OEPA 2ZI9A 3MJRA 3M0EA 2Q3HA 2IS6A 3P4XA 1W49A 2J1LA 4PPNA 4LBVA 4B47A 1W36C 4TL8A 5TARA 4URZR 1XX6A 4MYUA 2Q3MA 1FUUA 2JCSA 4G5QA 1VKJA 1X8KA 1UBFA 5IF9A 3KQUA 4F7WA 1KYIA 2IHYA 1SVOA 2J59A 5CJPA 2O8DA 2DFKB 2WOJA 1XD9A 1SVMA 3UANA 1U0LA 5LB2A 4K8OA 2Q9BA 1GNQA 1P73A 3VX3A 3TQFA 3SJAA 1MH1A 3RS2A 4GP7A 5AJYA 3OIUA 1M34E 3TUJC 5FTJA 3BRWD 1FTSA 1XPRA 1J2JA 3HR8A 1W4RA 4B6FA 2CEAA 3CM0A 4LRWA 4QOSA 3K0EA 2IYXA 3BGWA 3IO5A 2VP9A 3K0CC 1DADA 3QKRB 2F3TA 3IGFA 1SGWA 2BKUA 2ZRHA 3R7WA 3U4QA 1XFAA 4TMKA 4AKHA 1NN0A 4HDQB 2MSDB 2ANCA 2GHIA 5EXSA 4AWXA 3A37A 4A36A 4ACBA 3CX7A 4RVCA 4CEIA 3TSWA 2WPDA 1G16A 3X1YA 4KITB 1S1MA 1GNPA 1T8UA 1OXTA 3VR1A 2EFGA 3HYRA 3FHCB 1G64A 1XPUA 3FHOA 2LKCA 1GRRA 4PC3A 3QBTA 1N0WA 1P2UA 1P2VA 4BFYA 5TXGA 1U94A 2BDTA 2YNMA 4MGIR 4EUNA 2WKQA 2QTVB 2ZXUA 1UM8A 2XOKD 2AN9A 2RGDA 1Q1BA 2ZTSA 1XF9A 2J0VA 3C5CA 4NL4H 4GMDA 1OB5A 1P72A 1F2TA 2CHVA 1JR3D 4HLUC 4OQNA 4LDJA 2ZYWX 1W47A 4EPTA 2DFLA 3MUFA 1KI6A 1MKYA 1XD2A 1XZQA 3TK1A 1QHHB 3ASZA 4J0QA 1L7VC 2WWGA 5CK4A 5BWMA 2ZYTX 2AKAB 5KOYA 3SFZA 1TU3A 3IIKA 3PUXA 4BFUA 4CEHA 2OCBA 1JECA 4ZCMA 2VA8A 2ZUBA 2F9MA 4FWTA 1P61B 1AGPA 5JEEA 2H7VA 3PEWA 2J41A 1Z47A 2ZI3A 4NE2A 3VX4A 1AJEA 2P5SA 1KKLA 4TQUS 1KI1A 2VP2A 2Z5FA 3MLEA 4MDEA 5EUQB 1FW6A 4MH0R 3CF0A 1VCOA 1G7CA 1A82A 2EWWA 5EXPA 3K09A 4IOJA 1I4TD 4M1KA 4LV6A 2P67A 3GMTA 3ZD6A 1RC8A 5K8TA 2GJ9A 2ATVA 2WMOB 2XSZD 4PAOA 4QJ4A 4BZQA 3KKPA 3B2EA 4GT1A 2AKYA 1TF7A 3ADKA 5L3SA 5KU1A 5G41A 1XXHA 4C0HA 1FMJA 2WHXA 4L9SA 2ERYA 1P6XA 2F6RA 1VIAA 2BMDA 1ZW6A 4LV5B 3GD7A 1P9RA 2ZREA 2RHMA 3MAAC 4FCWA 5CB8A 3P32A 2KB0A 3SC3A 1KJZA 1VG0B 4JLPA 4HDCA 4TMWA 2R2AA 5J4VA 5KPDA 2ZI7A 3U6BA 2RGAA 4BFXA 2CE7A 4DDTA 5FOTA 4MYCA 4MRPA 2OAP1 5TY0A 3LXRA 5KO2A 3K70C 1YVDA 5EXXA 4BEBA 3CPHA 4Q7JB 4R7ZA 1B0UA 3L8YA 4R71A 1RYHA 1KO1A 4JKIA 2A5GA 4NYIR 4Q1BA 2NG1A 3WHLA 2P3SA 4B3DA 2ZRKA 4XWKA 3L43A 2N1BA 3RWOA 4AYXA 3IEUA 4QJ5A 5JLJA 5F3WB 1ZU4A 1ZM2A 1UDXA 2IYUA 4AKGA 3BAFA 3F3YA 1EESA 3U3MA 1L4UA 4FXPA 1P3JA 1KAOA 1FFHA 1UBCA 2GETA 2ZRJA 4K81B 5FOUA 2VBCA 1EK0A 1RJ9A 4JLOA 3N2EA 5JS7A 2BEJA 3BOSA 4JT4A 1KSFX 4LZZA 2O8FB 5C4MA 4GL2A 1XEXB 3CW2A 3QXCA 2IBMA 1OH5A 3WP1B 4NYIQ 1W2GA 2V55B 1N6KA 1ZINA 4GMXA 5FUWA 3OIVA 4HAWA 1OH6A 1Q1ZA 3AKEA 3AKYA 4JT2A 2WTUA 4NHOA 4DIDA 4ZDWA 2DCUA 3SYLA 3LD9A 2ODNA 3RRMA 2AD5A 2N42A 4YC7A 1OXXK 4OQLA 4C0BA 2JJ2A 2VHCA 5JCPA 4OK3A 4UNNA 2D7CA 3THXA 4M9SA 1CEEA 2FNAA 3PVSA 4II7A 5CDFA 1NG1A 1IBRA 2H57A 1BOFA 2IC5A 2IYLD 3LXXA 3V4FA 5A0FA 2V1XA 2FU5C 4UNPA 2DFTA 1W4CA 4DLXA 3ICEA 4G5SA 3W34A 3KQNA 4EIWA 2ZSAA 5EE0A 1AIPA 3QKSB 1KO7A 4EFNA 1TEXA 3LBIA 3EARA 4B33A 1CJTC 3LX8A 1ZAKA 2ORVA 3LRPA 2QL6A 1DAEA 2V8OA 3GJ0A 1DAGA 4TN1A 3A6PC 1HUQA 1KIMA 2E1RA 1S9HA 3ADDA 4WVFA 1T6NA 4FINA 2PCJA 5CYOA 1N5JA 4A8JC 1NMYA 1WA5A 1U81A 1VG9B 3FTQA 3QF7A 4JJZA 1NBME 1RW4A 3BE4A 4XD7A 5EXTA 3T1OA 4DLWA 4Q4HB 4DSTA 1GITA 4Q4JB 4B2LA 2P65A 1KAGA 3SFVA 2IXFA 1XCMA 3KJEA 1G3IA 1UADA 5B2ZA 3TRFA 1CBUA 5AUQA 4HAVA 4PTLA 2PMDA 4KXFB 2DWQA 1WE2A 2SHKA 3OF5A 2JATA 2ORIA 4EPWA 4QJ3A 3AVWA 3UWOA 4JBWA 3QENA 4MGKR 2IHBA 4GPTA 5J4YA 1NMXA 3F5FA 1HE1C 1J99A 3VR6A 3RVBA 1JAHA 4G5RA 1MO3A 4BFSA 4DLYA 1H65A 5FPTA 2JLYA 1U98A 1TQ2A 3MWKA 4ILEA 4M8NE 3G0HA 1IY0A 1WCV1 4PSKA 2XITA 3AB3A 4JSTA 1M7BA 4DZZA 2QMHA 4QL3A 1RRCA 2WAYA 2ZAOA 2XJ4A 1V5WA 3ZS8A 4QM6A 5CLQA 5JI2E 2EW1A 2XNSA 3EIHA 4B34A 1W44A 4B35A 1LB1B 2CBZA 4A9AA 1N6HA 2HDNB 3X1ZA 4JBXA 1N2CE 2B7BA 4PZYA 3GLHE 3WYAA 2V6JA 4KO8A 1WP9A 3SNHA 5AUPB 1A4RA 3C4JA 4CYMA 3PEYA 3CPJB 4XTCS 4HAUA 1UFQA 4BLPA 2PX3A 1AKYA 2ZSBA 2R6CA 3T1QA 4QHSA 4OHYA 3ZQJA 5DIFA 1D2NA 1G8YA 3CRMA 4JLMA 4D81A 3CH4B 4LYFA 1I2MA 2REXB 3GLIB 4AKIA 3BB1A 2D62A 1JR3E 2FG5A 4W7SA 2AWNA 2CCGA 1FOEB 3AQ4A 2FPKA 5FL7D 2GCOB 4MKFA 4PHFA 3AVYA 1ZM3A 2C98A 4Q9JA 3DM5A 2EFCB 2IF0A 3GFOA 3DKVA 121PA 4FN5A 1G18A 4V0LA 1Z07A 1RKBA 1ZIPA 2WJHA 4Y0AA 4BLTA 1Z63A 4Q4LA 1OSNA 5FTKA 4EJSB 3MWYW 3DMDA 4U5XA 4Q48A 4RZ3A 4XTRA 4F93B 3T15A 4URVR 1UKYA 2VH5R 5LB4A 2BC9A 4E22A 1U0HC 1M2OB 3J81k 2KWIA 4LBWA 2W0SA 3FMFA 3QY0A 2O8FA 5AK0A 5FUXA 421PA 1T9HA 3I5XA 4YMWA 4HUQA 4TLCA 1ZBDA 3C15C 4RD0A 1ODFA 2J0QA 4KAXA 3W5IA 2GZAA 3ZGXA 2QN6A 2H1LA 2WWXA 3A1SA 1Z0KA 1ZM4A 3E5HA 4BFZA 1O3YA 3ND9A 3VKHA 4K46A 3TIFA 3DPUA 1CJVC 2JJ2D 2TMKA 4Q9HA 3GJ5A 1KHTA 1PLLA 2GXAA 4OI1A 5BQ5A 1XDBA 3FB4A 1U0JA 3WXMA 1N6OA 4POAA 2V4ZA 4WZAE 3TJZA 4Z51A 3WHKA 1OXVA 5HR5A 1ZIOA 1NNEA 3AP1A 2OM2A 2BMFA 4AI6A 2IXEA 2WSSD 1DAFA 1GZSA 4QG7A 4RD3A 1GRNA 1ZVQA 3LDAA 1SKYE 1ZCAA 4JLDA 1HT1E 1UKZA 2CLDX 1DPFA 3QKSA 1N6RA 1CIPA 4R2IA 2H18A 2VIIA 3ZYCA 4LY6A 1CRPA 3AUXA 3EZ6A 4NPHA 1CR4A 4US0R 2HXYA 1FUKA 1G5TA 1T8TA 2GK7A 2R9VA 4IW3B 2XJ9A 4DLZA 3CIOA 2QAGB 3DZDA 4JSYA 5KTYA 4TZ6A 3TUZC 3X2SA 3A1VA 4Q4AB 4TQAA 2PLRA 4M1WA 2J7KA 3TW4A 3NWJA 5JCZA 2R6FA 2GF0A 3B1WA 3DL0A 5GJWC 3U60B 3L0OA 1WMSA 5D3MA 3TW8B 4BEJA 1QHSA 3IBYA 3AF4A 4F91B 3H84A 4PQFA 2OFWA 5M04A 2YVUA 5GJVC 2XTMA 5TV2A 3LVQE 1LF5A 1TQ4A 3NG1A 1ZYUA 2VLIA 2AR7A 1N6PA 3V9PA 2A5YB 2RB4A 1Z6XA 4Q01A 1ZM7A 3BD9A 1PV4A 2KSQA 5JMTA 1HT2E 2F1JA 1Q3TA 2VHTA 3IUYA 1IY1A 1YZKA 1NY5A 4LJ6A 5E4FA 2PZFA 5G3ZA 2BOVA 1YR6A 4KFUA 2ZU0C 2ZJ2A 3ASYA 4FIDA 5EE9A 4PHHA 2ECKA 1P60A 3EX7C 1IJFA 1W5SA 2EWVA 1FX0A 2WM9B 2D2EA 5KDOA 4BLOA 4PPQA 1TUEA 1LF0A 3R20A 4HLCA 4CF7A 2QBYB 3FDIA 2DY1A 2KBFA 3K70B 3IIJA 1GNRA 1K6MA 1NRJB 5DI3B 2JLXA 2CL6X 4HAXA 3PQCA 2A5DA 3QG5A 1E79D 2IWHA 1UEJA 4QM7A 3GJ4A 1KNQA 1J70A 4C0JA 4LHYA 2HF9A 1XJ0A 3H0KA 3A1TA 2EFDB 5FPSA 2B8WA 1T0JB 4BQSA 4QC2A 5EE5B 2HF8A 2WAXA 3IDQA 4GI7A 2ZJBA 4OBEA 2HEIA 1XTKA 3ZD7A 2QT0A 1D5CA 1KK3A 4MRRA 4UXHA 4H9GA 3VFDA 1LTQA 2AK2A 4KLNA 4IFEA 2ZJ8A 5KUTA 4O3MA 4LSGA 2OUKA 1OYWA 2G0TA 4DCNA 4H1VA 4C0QC 1FQJA 3SYNA 1ZNXA 2FPMA 3FPAA 3I8XA 4A0HA 1E2DA 1JNYA 2IEYA 3T1TA 1X3SA 2BWJA 5FR1A 4B2PA 1GL6A 2RGNA 4ZIRB 521PA 4ESHA 2IS4A 4ZI2A 3KJIA 1ZC4A 4D82A 2GNOA 1VCIA 5FI1B 1E2JA 3BFKA 3OEHA 1NKSA 2W6JD 3H2YA 1MRNA 4EJSA 4LX0A 3I92A 2D74A 4PXAA 4Q1AA 5DHAA 4PX9A 1AGRA 2A30A 4UXJA 3LA6A 2RAPA 3QVUA 2FA9A 3A8TA 5DGXA 1XXHE 2VP6A 2ZRMA 2BBOA 2VHUA 1DO0A 3FKSA 2QROA 4KBGA 2JLVA 3OEED 3BFXA 4OHXA 2IYSA 2BJVA 3R9IA 3W6OA 1V43A 2GJ8A 2QP4A 3TGPA 4Q00A 1NP6A 1XRJA 4URXR 3VQTA 1XMIA 4LC0A 2JEOA 4DRZA 2FV8A 1M6NA 2JA1A 1FP6A 1N3BA 3F8TA 4IVPA 2WIAA 2B8TA 2JLUA 2JASA 1Z3IX 2P6RA 1R0ZA 4LJ5A 3PUWA 3K53A 2P2LA 3I4LA 2F1RA 2WKRA 3EPKA 2CCJA 4LPKA 1R10A 1Z08A 4BPBA 3T35A 4PZZA 3EAQA 4JMPA 1BS1A 1HA3A 4GFDA 4MYTA 4U02A 5AR1A 4EAQA 3I62A 2XZLA 5KNBA 2HYIC 4TYQA 1SVKA 4IOKA 4HUTA 2A2ZA 1E9RA 1PLJA 4V03A 5HKKD 2D4HA 3CRVA 1OPXA 3THYB 5FI0B 3WY9A 3B1VA 1G4UR 1JALA 1KOFA 2CK3A 5JJIA 4CT5A 2QAJA 4TSFA 4XSHA 3L0PA 4BLQA 2QAGA 1YZLA 2OLJA 1ZNWA 4CZ2A 4NYJR 2X2FA 4HAZA 4C0LA 3W9YA 4Q4AA 5J4HA 3WMEA 3SOPA 4ABYA 1KI3A 1J90A 1E2HA 2WJYA 1JEEA 2OAQ1 2ZRBA 4TYWA 4DKXA 2P0EA 3THWB 1N0VC 5AJXA 5HCNA 3E2IA 4PAQA 2IT1A 4N0DA 2GBLC 3I1FA 3SEAA 1G8FA 3PEUA 3GLFB 1CU1A 2IS1A 4A0FA 1Z29A 2QNRA 3NH6A 2FDCA 3TQCA 4PC6A 2WJJA
chains in the Genus database with same CATH superfamily
4BO3A 3FMVA 3Q7SA 2VUSA 5CITA 1HI9A 4N03A 2XZDA 1K4KA 5EHNA 3UG6A 1X9HA 4DMRA 1G5QA 1QP4A 1MZPA 4IFBA 1E0DA 3VO2A 2IELA 5KWEA 4B83A 1BW9A 1G2OA 3OT5A 2B2CA 4O2AB 2Z1NA 2A5LA 3G3EA 3HN6A 3WLLA 2JI7A 3WGQA 1XDZA 5AI6A 4WEQA 4TV9A 3VTFA 3X2EA 1XZLA 1T3TA 2ZANA 3EVDA 5A4JA 3U7QB 1NRXA 2VUHB 2RI0A 2XAUA 3CVOA 1GY8A 1NNI1 1MJGA 3LZDA 4TWZA 4WNYA 4D92A 4B48A 5I45A 3OPYA 1WW8A 4I55B 3AEUA 4IIYA 4URYR 1RQLA 1MT3A 3K2EA 2QRHA 4M9ZA 1XKQA 3W78A 3FI0A 3AUYA 4YPVA 2B82A 3P9SA 4YJ2F 4FCTA 1SIUA 1H22A 1UUFA 3LV8A 2RG1A 1FMFA 1Z5ZA 4DDUA 2XF2A 3TSYA 3Q7EA 1NLYA 3DLBA 1C80A 1E18A 4NPAA 3ZZUA 1U0FA 4RULA 4I50B 3V7UA 1NMQA 1VKRA 1ZUHA 2PSHA 2XYPA 3TS1A 3ZHRA 5KJ1A 4GMHA 4UNIA 2ERXA 4KVAA 1BXKA 5JSQA 1ZMOA 2FX5A 4JN6B 4GM0A 4MW1A 2YBDA 4ZAYA 3S28A 4MO2A 1NT4A 2WWWA 2R6ZA 3WNDA 3DVLA 1K5GA 3B78A 3GV0A 5BUZA 3EJWA 1MQSA 2M1ZA 4Q02A 1QQAA 1HX7A 1PQ4A 1E2PA 3A9VA 1BO6A 2V1UA 4JJ6A 1VYUA 1RDFA 1WXEA 3RU2A 1NQUA 3ZNQA 1NUTA 3SZRA 4CKYA 3TTUA 5BN3B 3H4TA 3RS5A 4BVLA 4B44A 4PN7A 5IJ0B 4AJEA 4IL5A 3U3OA 3RVSA 4ML3A 4QOJA 5LN1A 1WU7A 4E4TA 3SS9X 1OHHA 5EJGA 4D25A 5DLQC 1OBHA 1BJRE 3OLZA 4PTYA 4QU9A 3NIBA 5IN5A 4YQZA 1Z6PA 4MRMA 2Q1YA 3GNLA 3HSYA 3OEHD 3BH0A 4R2MA 5T4FA 4DCOA 3DBRA 4XPIA 2XVAA 1HL7A 4MVJG 1DX4A 2E48A 4RPIA 3PA6A 4V38A 3G2QA 4K3VA 5DHFA 1U8ZA 3I3OA 4B43A 3RHFA 2AI2A 3TAUA 4CTNA 2JCYA 4OHBA 5LYYA 3A11A 2OCLA 4OM7A 1ZSNA 2YDXA 2V8BA 3TLGA 3TVYA 1Q0UA 3U3XA 1K27A 1G0OA 2YHIB 2J9XB 4W1PA 3PEVA 2YHSA 3W8DA 1GL7A 4Q47A 1KZHA 3CNNA 1JDPA 3QH4A 4Z9YA 3ZE8A 1RBMA 5AXCA 2PWZA 4FR2A 4MVXA 1ZXXA 4ON9A 1GD1O 4C87A 4FTWA 1NM5A 3W8EA 3ABZA 2PFKA 4RK0A 1G21B 1N9GA 3C1TA 3DE1X 3EHEA 3OCZA 4XDZA 3VNQA 3SEZA 3QI2A 3MRVA 5JHHB 1F8YA 1MV8A 3DO8A 1WNFA 5K1ZA 4RPJA 2IHUA 3I34X 4G0ZA 3R3VA 2H63A 3QW2A 4BUZA 2FSGA 3UXYA 3N75A 1JQDA 2G67A 3PFCA 3T0FA 3WIVA 2WNHA 4KIWA 1EM8A 4V0MA 2ZRDA 2BKXA 2ZUWA 3GA5A 1V7QA 1B0ZA 4LGMA 3WK8A 4YIHA 4Z53A 3F98A 2DU8A 1AURA 2DH6A 4OUDA 1E77A 1XKXA 1Z82A 5J5AA 3KTAB 1HR0B 5BRAA 1R9MA 3A6GA 1DAIA 2WF5A 2ZUUA 3EK2A 1FP1D 2H4WA 4MVJM 3KE9A 3I6ZA 1QFJA 4E4YA 5C2JB 4OHFA 4C04A 3VV3A 2FQYA 3BRQA 2QX4A 2YWHA 1G9XA 3SBXA 3CLUD 3ZWWA 2HK6A 3DZFA 3KKEA 4OHPA 1X2EA 4HO1X 4R8LA 4WFKA 3GO4A 3P9CA 2OGTA 1R8SA 1Z25A 4ZODA 3ZD8A 1E1KA 3SPXA 1LD3A 1C1HA 5TQ0B 4TSFD 3WHPA 3WGIA 1A5SB 3NBXX 1QGYA 2UYYA 2Z3VA 3GDOA 1GAEO 4OXXA 3SOZA 3UMFA 4BS9A 4YRBA 1Q57A 1Z7EA 2WSYB 2XYQA 4QELA 4WCFB 5AP9A 3THYA 3WSVA 5BYKA 5B53A 3KXLA 2GTIA 3OIWA 3UA4A 1KKMA 1KL7A 1VCHA 3BL8A 3I6YA 2BDEA 4EQ6B 2GJKA 4AJ1A 4ERNA 1Q6YA 3AETA 4FE7A 5BYBA 5A5DA 2G9QA 1R2QA 3L8MA 3P96A 5TQVA 4QAJA 1U7XA 1HBJA 1YZGA 1ZOLA 4JUAA 1QZUA 1YC2A 4RGQA 4WA7A 4GKKB 4YP6A 1Q20A 2CFTA 3QEKA 4LCEA 4UBKA 2NZ2A 2HCJB 4E13A 4O8CA 3T9BA 4GE0A 5C52B 3FZGA 4K6FA 1GRQA 1OBOA 5BMVA 3LTNC 2OFXA 1YQDA 3G6WA 4O1MA 1NVBA 4XRRA 3THWA 1VMAA 3MWGA 1ZN7A 1DINA 2QA5A 4OG2A 1B73A 1GLVA 3MB5A 1JHQA 5DM4A 2CJPA 2Q5HA 4LWZA 3DTVB 3F9RA 1PR9A 2I3AA 2PCLA 3QVWA 3C5EA 3H9JA 4FFDA 2E5LB 5A9SB 4IS3A 3WYCA 1Z56C 2XDWA 4LTNA 4TLEA 5FPKA 3F0TA 4HTAA 1TF2A 5TR9A 3LFUA 4KLCA 3A14A 4GBMA 4TS3A 5DTRA 3OOYA 2QN7A 1U80A 3EIUA 4JX9A 3TIIA 4RIEA 3UGQA 2AOTB 1NBAA 2IHKA 1W4BA 2FHPA 3S29A 3C3AA 2H07A 2Y1KA 1C4KA 4MW0A 5FTMA 5BSHA 1M6WA 1GTVA 2MYNA 1H8EA 1US8A 2PKRA 3B8HA 1I7LA 4AZ0B 2P4HX 1OILA 4KPFC 1AZLA 4DRXB 1JH8A 1K08A 3D7RA 2YWJA 1Y5NA 4OQYA 1NJGA 2J9RA 2GBFA 4TVSA 4RD4A 2VDJA 1DC8A 4HB4A 2A78A 3B5EA 3TTYA 1JJ7A 4EA6A 4E08A 1FNBA 1R0KA 4WAUA 5HHTA 3JZMA 4ANFA 3JD0A 1RLTA 4BGDA 1KFKB 2BGWA 1OXSC 4ZT6A 3QG1A 1LY1A 1F2UB 1DQSA 1E1RD 1GV0A 3AVPA 1TB4A 1RKQA 2B2NA 3JVUA 4BB6A 4LQ4A 4G41A 4HXGA 4HFMA 2D5BA 2YNMC 4H77A 2CHQA 2I1WA 1I24A 3PJGA 4PX2A 5HF6A 1Z2AA 5C81A 4WLFA 4QUEA 2J7PA 3MT9A 1N77A 3HU5A 4PYKA 3NBYC 1L5GB 1NGSA 2B1QA 4YCNA 4KFCA 2NT4A 1VHTA 1AXRA 1YQGA 1IIRA 1GG2A 5D5PA 4IMPA 3T3PB 1UEIA 2R8OA 4LTDA 2XDQB 3FUCA 2W00A 1YONA 3KEGA 3FJOA 3V4VB 4IDHA 4KQGA 2VJCA 4XSGA 5EWLB 2XKKA 1KO8A 1VXOA 4L72A 4RJKA 2C04A 5IARA 5JNSA 2AKEA 2CGEA 4AJOA 4X92A 2JAXA 2Q0HA 4BKOA 3D0OA 4UHBA 1U3WA 2JBHA 5ESRA 3MQ2A 4DUGA 4E14A 4C03A 4JIMA 1MAWA 4DLAA 1B76A 4JXXA 2NO5A 3UIEA 2UXDB 1Y4DE 1PJRA 1J06A 1KDOA 2CFSA 1CC1S 2NTYC 2VDUE 2JFPA 2VSXA 4LQLA 5K0LA 1VBMA 3LY7A 3DH0A 4ASUA 4B3XA 3TKYA 2ZTVA 5HZGA 2PUGA 4HS9A 4PC2A 2X3FA 4F4DA 1PW7A 3K09C 4NATA 4D0GA 2RAUA 4BRZA 1VKOA 2RKBA 4FZVA 4UCQA 3PD0A 5FX2A 1N7HA 1NR5A 2PM8A 3DB1A 3FNEA 1FBTA 1XDGA 3GDFA 1SJ9A 3D7NA 2ZTUA 3KYCB 3PX2A 3RODA 1XLTC 3RYFB 2JAOA 1PBNA 1QHHA 1YA4A 3RADC 4ZZ2A 1Z68A 2R6HA 4XD2A 4DDVA 3KOYA 1EX6A 2PZKA 1RIIA 1L7OA 4QU8A 1V3VA 4EPRA 5HZHA 4Y0NA 1RSZA 1V11B 5KREA 3DBOB 2G9VA 1CY7A 2WK1A 3ETDA 2R66A 1TPZA 3ELUA 3HL4A 2VL7A 2Q7XA 1GPLA 1KIFA 4GI3A 5TE9A 1QM5A 1IY2A 4G8CA 3Q8KA 1A7AA 1IBCA 1CYEA 3RSFA 5CDSA 2F48A 1YCDA 3Q5EA 4OQFA 5CA0F 2FLKA 4DBVO 2JZNA 1NQWA 4LJYA 3ND8A 3PBKA 2B2XA 2G83A 2GN9A 4KN6A 3KX2A 4WN9A 4ZO8A 5ETJA 3WL5A 4BLRA 4EJ0A 3ADCA 3II6X 3PX7A 4CL0A 1UWVA 5I6DA 1KSJA 4I9HA 1GQSA 2V45A 1E2UA 4K6OA 1SXJC 3WO1A 4QFMA 3ZDEA 1UFKA 4Q03A 4YRDA 2FSVC 4MQFB 1E1QD 1P33A 3Q6MA 4NULA 3PR3A 3L77A 4JT8A 4OB7A 5SICE 3ZV5A 3RAFC 3K9NA 3AERA 4JR0A 1EFHA 2C5GA 1J09A 1W0JA 3DLTA 1LBQA 4KU4A 1HG0A 4I1SA 2GVZC 2KHZA 1JF8A 2VPIA 5KC9A 1N1MA 4FDMA 3PI7A 2IUUA 4AJKA 3MB8A 4HWKA 4PYQA 4D80A 4HDNB 3IP9A 3HEMA 1RJWA 2X19A 3NHBA 2PJUA 2H65A 1P1BA 1JU9A 2MHCA 2GGSA 2GFIA 4H60A 4ME6A 4MO9A 5TF4A 3TKAA 1VYTA 3Q9LA 4B6RA 3P19A 1Z6AA 3QU2A 3FIUA 4LZAA 3ZOKA 3ET4A 5C1OA 1DELA 4IJMA 1FLNA 2OL4A 1VJDA 1VM6A 4GWLA 4QQRA 4CTOA 4ZJYA 5A1TA 2QM8A 4G4SO 3MCTA 2ZR9A 4Q3BA 2YXBA 1ZI8A 1IN8A 2HWKA 4NONA 4P0TA 2CLOB 1TI7A 4ZAXA 2C2KA 5IAJA 4A6PA 2H59A 3BFVA 2LD4A 2F3RA 4AJPA 4RKWA 2C3YA 3OJOA 2F9LA 4Z9XA 5C37A 2EP8A 2QRNA 1V37A 5KNBH 2ACVA 1UDCA 1OZHA 2D5LA 4FIZA 2I7XA 4YACA 3AKCA 3JYOA 4Z8YA 1UWCA 4ZYXA 1K75A 3E5RA 3PE3A 3FSEA 1WBJB 4M76B 4EM6A 2Z08A 1TZ2A 1EWRA 2WG1A 2GKSA 4A3SA 3ZE2B 2PK3A 4GC9A 4I99A 3CLSC 1N5DA 3RM3A 1G4HA 1NVKA 2PAFA 3EIEA 3K7EA 3RUAA 1U2SA 2QTNA 3DNPA 3CT4A 4JIGA 4IJ5A 3W6PA 4D9CA 1UT5A 1VRCA 1CY8A 2NVBA 1NW6A 2X3UA 4BVBA 1P8AA 1PYGA 2C4WA 4JJEA 2PSSA 4ZYUA 4KO2S 5KCMA 3RBXA 5EQTA 3AY6A 3SZOA 3GLGB 1GPJA 1U04A 3JX9A 5DVZA 5AM4A 1X8JA 1H8HA 1KP3A 2FR8C 1UJMA 2OM6A 5KYUA 3UWMA 2KM1A 3O47A 4OMUA 5JQGB 2AMJA 3EXIB 5SZIA 1QONA 1JPVA 1L1QA 1V3UA 1PZEA 3UOGA 4UVDA 5DO9A 5LVAA 4LPSA 1L5MA 1GQFA 2GVDC 2X14A 3MZ0A 4JQSA 4Y1GA 1HV8A 2CUTA 5LMZA 3S4YA 1QVVA 1ZRMA 2HO4A 4ZVTA 2FK7A 3T9DA 3V2IA 4DA7A 2BGJA 4C0AC 4D3DA 1GZ3A 5F2EA 3TQOA 4JC5A 1HFJA 2Z58A 1VIDA 1ZICA 3C4QA 1YFZA 1MBZA 2Y9MB 4LRUA 4DCSA 1ONBA 1GGVA 3RVPA 4BAGA 3B3GA 4EG7A 1ZJ5A 2OQVA 3DA8A 2DPXA 2GBCA 3GPCA 2I8AA 1M1YA 3HDYA 4Y2QA 4FDTA 2FMFA 1IG3A 4NABA 1AV6A 4WKGA 2G5GX 1FSZA 1WV0A 1DIAA 4ZMSA 1RCUA 2X8BA 5KNDH 4MTLA 4FBLA 2OCIA 3CO5A 1XMVA 4KPUA 5TJHA 3GRPA 4AJNA 3OCWA 4WXMA 4NCJA 3K9BA 2P5UA 3ZDDA 4A2WA 1TCCA 4TZ0A 4JQCA 1L4FA 2GCIA 3D0QA 3NALA 3S40A 1NVUQ 2PKXA 2VFAA 4U6QA 3T0GA 2QU8A 4US2R 2J9YB 4J1TA 1AV7A 2WIJA 1KZ7B 4OK5A 2JGMA 2WZDA 1E1CA 3BD8A 3D7KA 3HUFA 3EEBA 1RI4A 1GCIA 1Z4KA 2A1UA 3X1MA 4B6PA 3KPJA 5ADVA 1AK1A 3HM2A 5I7SA 4EYGA 1D1PA 3D1JA 3OZXA 3OT4A 2P5TB 1AE1A 3WNBA 4B32A 2Y0PA 4QFCA 4X90A 2XXAB 4C5CA 5J2UF 1P39A 3G8YA 1UMKA 3OHMA 2YC4C 1NC1A 4Q4JA 1JA9A 4NH4A 2W58A 1RWBA 4MV3A 4R3UC 4XVUA 1PL7A 1TZMA 1I33A 2V7GA 1CJBA 1AKRA 1H3FA 2DWOA 4ZALA 3FPEA 5C1DA 2QYSA 1L8OA 3BMNA 4CF5A 4DM4A 3D0RA 5A3VA 1VJ5A 4LRXA 3PGLA 3ZQ6A 2GPYA 3G2IA 3R3ZA 2PX5A 4QGGA 3DF7A 4RF5A 1ZHHA 2A6PA 1JPUA 2VO1A 3ZZ0A 2BUCA 1M2EA 5FAXA 4BVJA 3KVRA 1JDJA 3HGTA 1OFIA 1Y81A 2IE8A 2F00A 5KX5B 1N1DA 1SU7A 1V5IA 4KXWA 1EIWA 1J0EA 3OEWA 1R88A 1MEOA 4LDQA 5K05A 1TX4B 5LYJB 4EG6A 2WJ6A 2ZSFA 1CUSA 4YWHA 4ZO6A 5EP3A 3OIDA 5AW0A 3HXMA 1QB8A 1GTSA 2KJQA 2QTHA 3DL2A 2Y27A 7GPBA 3EG9A 2Q1WA 5K8UA 3O1IC 1ZVJA 1XU7A 2QGFA 1N5LA 3B52X 1OLOA 3IA2A 3CPSA 3TJMA 3VNSA 3G82C 5KYWB 2AA3A 1YB7A 1SCAA 1WMAA 1NMZA 2ZUDA 1EZ1A 4TKVB 1O6GA 1MVLA 4EF6A 4EO9A 2VATA 3M7IA 4KI7A 4RHEA 2OD9A 2F3QA 3DBIA 3CJTA 4G81A 4F93B 4GDFA 1WDLA 2DUJA 3FYUA 4RHFA 2I80A 3EXFA 4NEHB 4PNHA 1CF4A 4FYVA 4MVJF 2O3JA 1JHMA 2WDPA 3AI1A 3H4VA 4A2QA 3QWHA 6ABPA 2X9QA 1AQ6A 5G0VA 2GM9A 2C2HA 4YXWD 4REQA 5C7LO 1V5FA 5EJAA 3H4MA 5IFKA 1U4OA 4NYMR 1ZMRA 4OI4A 3HNPA 4MDFA 5DNVA 3ZVNA 3LL4A 4HRXA 4B75A 3L1IA 2GXQA 5HJ2A 1F14A 1E7RA 1Z18A 2ESRA 3BJMA 1QP0A 1M8GA 4FJ2A 2O7RA 1NONA 5FLXA 1W1IA 2VOJA 4FS3A 4OHWA 1HT3A 3AJEA 3CMCO 3KP1A 3HWX1 3NEYA 3FSGD 3QIAA 5EWMA 2ECFA 4D0NA 3L2OB 2JIBA 4RFLA 1P5FA 3DTVD 1EVIA 5MHTA 1E3QA 3NETA 5HBRA 1M5UA 4ZQGA 5JISA 4JY7A 2WNIA 1KI8A 1RP1A 4H18A 1WABA 4GZ5A 1DVRA 2DTDA 4S1WA 1Q19A 3VC1A 5DNAA 2ZIXB 4QOHA 2DUNA 3FUUA 4GX2A 3SYTA 2QRUA 3UQYS 5HF9A 2DR3A 3OMLA 5BUSA 1OKKD 5CIWA 4FMBB 1WB4A 5E3JA 3EXG2 1XI2A 1V8OA 4RKFA 2J6IA 2OHFA 4NYMQ 1E9VA 3BZBA 5E2BA 1UDWA 1ZA2A 5FTNA 5J40A 1QZXA 2HQBA 2V7QD 2DM6A 2R84A 3DVAA 1MENA 1IQ0A 4NARA 3L05A 1DKPA 1M33A 3OOJA 1Q17A 5F5LA 1KF0A 1OAOA 5JXWA 2WT4A 2FJPA 3V48A 1S9DA 3O82A 4BWVA 1GKIA 4MIKA 4X7MA 1YFLA 3FOBA 1PQYA 1Y98A 2Y6UA 1ZN2A 4WLEA 3F9CA 2AOUB 3UCFA 4NBSA 2AEFA 4ARZB 3GGOA 1GPNA 4ZA2A 2QI9C 3C4VA 3ZCQA 2O1SA 1GZVA 2WAAA 3K0CA 1IE3A 3H86A 1N0IA 2ZS7A 1GCOA 1HE3A 2JGRA 1NIPA 3S2SA 3H7IA 4LHWA 3NPMA 4XDGA 2YOHA 3LY9A 4KQKA 1MABB 3TOXA 1L5LA 1UIRA 1JWAB 3BWYA 3U1BA 4RDXA 3BSYA 4C30A 1K9VF 2XUFA 3DZJA 3FFXA 1C9YA 2QRZA 1QWSA 2BGKA 2NV2B 3OFND 3PPYA 2J0EA 1TADA 3A32A 2ZUSA 5AK4A 2ZFUA 1O5IA 4TKZA 3CTMA 3DVQX 3N2KB 4JL8A 3CLRC 2YYZA 4IUCS 2GHTA 4O4IF 4KFRA 2BFFA 1T15A 2YMMA 3PKIA 3CUEF 3CTPA 1GTJ1 1M1XB 3L1HA 1U0TA 1YQEA 1L4EA 2DQZA 2R5FA 3QLUA 5AW7A 5BMOA 1BXGA 1THGA 3PIIA 3AR8A 4HLUA 2JIZA 3IBSA 4KN5A 3N8KA 4EGFA 5BT8A 1QNFA 4KDEA 5LQNA 2JLCA 2VSFA 2WU3A 5LKRA 5CYPA 3GROA 4NZZA 4PO1A 4UPVA 4EABA 5C46F 1XXHB 1UF9A 1YRQA 1I36A 1RWPA 2AJ8A 2DJ5A 3CMMA 2R5WA 2AUTA 1ULSA 1E9SA 4F4JA 4ZDIA 3AU9A 5J2TF 3FLMA 1P2DA 4QPCA 1N2BA 1IM8A 1XTRA 2V6IA 3D1LA 3GUUA 1BE1A 5D1HA 1GQ2A 4DSAA 5IZCC 3ETHA 1A95A 1QANA 1ZBQA 2NACA 4XIGS 1HE2A 1IEXA 3JARA 1SUEA 1UC5B 4QBIA 1NBOA 2X7XA 1LZKA 1R6TA 3MJCA 1YXMA 3WISA 3DLHA 4E2FA 3I2IA 2HDOA 2YHAA 2Y92A 1W87A 4RK5A 4BGIA 4RE6A 3K9WA 4R51A 5AVYA 3TEJA 1P9OA 3HKDA 2Q41A 3WGUA 1NURA 1WPQA 3LYAA 2OSBA 1GJRA 3EC1A 3O4HA 4WZBB 2GZMA 1Y82A 3IX7A 5B7NA 4PW0A 4ZHQF 3DE6X 2ZJ3A 4AF7A 2JANA 1KMHB 3PJRA 1SXJB 2F8LA 3M2TA 3V4RA 1SU8A 1EK6A 4HNTA 4X93A 4GMFA 3R24A 4HR7A 4HNSA 4TTJA 1FFCA 3C7KA 3LHFA 4QODA 1F9EA 4XYBA 2CVHA 4NZNA 3ZIAD 3W6NA 1FDRA 4RS4A 2XQJA 1G0NA 2OB1A 3FKQA 2AFIE 3NC0C 4ZI7B 3D6JA 5ALZA 1EB9A 1EEXB 3AIKA 4C1NA 3L7MA 4Y2GA 4L6IA 2QVZX 1QTRA 3S81A 4BLSA 1E4OA 3UICA 1AT1A 1QO0D 4TV8A 4BLWA 5IYZA 1E4VA 1IZYA 4ENSA 3U7EB 3DXZA 2UDPA 3TSCA 2PZGA 4G9EA 3L8CA 2J30A 3HU1A 4JWKA 3VR6H 1T0UA 3B70A 2I5PO 3RLIA 1KY3A 3U1VA 1KEUA 1PLKA 3IEXA 3SLRA 2NZ8A 4EGSA 2WTBA 5GV7A 2H6EA 1RWOA 2MINA 5C18A 2ZPAA 4LVNA 4OGKA 4Q1CA 4YRGA 1K4YA 2G9ZA 1J8QA 3MJFA 3VAZA 4EL5A 1YZTA 1JG7A 1NTOA 2EYUA 4R54A 2L2QA 1G8GA 3ZU3A 5K03A 3FZEA 4EJSC 4FDVA 2ZJZA 4PEVA 4UBIA 2ZULA 2NMVA 2I6XA 2C4MA 3DL7A 3R5FA 3W4IA 2C59A 2BHRA 3T06B 4YDQA 3T9CA 4YA6A 4G0VA 1NQXA 2OXCA 3AP2A 2G1PA 1EWQA 4JLNA 1IXKA 3O5AA 3RS8A 4RMJA 4FFPA 2OV3A 5EVJA 5C51B 3THXB 2X6TA 5EE1A 5BUQA 5HRAA 2EX1A 5A5GA 3USZA 1VHQA 4WNAB 3I2FA 1L5ZA 4XJXA 3UATA 3KOOA 2P3OA 3A1NA 3IP3A 3BMQA 2DJIA 2QP3A 1KJ9A 5DE3A 2G76A 5DGDA 4HXEB 1XF1A 5CVDA 3VKVA 5D2CA 4A03A 1T3GA 2GH1A 2Q5FA 4R9UC 5F3DA 1RPTA 3N87A 3T0IA 4YAGA 4Z54A 2RJOA 1RXYA 4P3NA 1L5KA 3SZGA 4JGGA 5EZYB 1PUJA 3LT2A 3AYXB 1G3QA 1SBYA 4EI9A 1I5OA 2A5FA 5JAMA 4X71A 1H69A 3K35A 3AI2A 1D04A 4X54A 2OV1A 3CLTC 2YZNA 4E46A 1RRVA 1HL3A 1B4DA 2IYAA 2WU4A 4FE4A 4S1NA 5AOBA 5FA6A 2FX2A 4FX2A 3Q0IA 5AHWA 4CG3A 3KM0A 4ZI3A 1M7HA 3GMDA 3EGEA 3ZJTA 3ME5A 2H5EA 3O38A 1FDSA 3AO0B 3H42B 4BV8A 4U2BA 5ANRB 3E0XA 2YINC 1VFNA 1YT5A 1PJAA 2A8YA 2H9AA 2OHOA 2R96A 3GG2A 2Q62A 1XZBA 2ZQYA 4FKZA 2QNBA 4NESA 5D6OA 3K0BA 1LX6A 1EA7A 4ABTA 1UBKS 1JEDA 1SD5A 1UBHS 5LQAA 3S1SA 1ZNZA 3VGPA 1W85A 4QNRA 4JGBA 3AVOA 4UNSA 1BU8A 3G2OA 2WUDA 3R0VA 1UANA 4R0NA 5L51A 3RKSA 4RF4A 2J5KA 3BBPA 5FADA 3O8RA 2QAGC 1EA5A 3MPUA 1DEKA 1SXPA 3HQ4O 1ML4A 4KPEC 3T1HB 4D9IA 3Q8WA 3I4FA 4QVKA 1SKQA 1RWVA 4WV3A 3AR9A 3KSRA 3UJ8A 1WQ4A 3B3AA 1D8AA 1VDMA 3LECA 3QF4A 3WL3A 4CM8B 1PZHA 3IAHA 4OBBA 4RELA 3E7DA 3AGQA 2WTXA 1YS7A 3KJHA 3D0KA 3VH3A 4A8JA 4CRWB 3WDMA 4DUYB 4AVYA 4QHYA 4D9BA 3KJZA 3V33A 2BMWA 3I8SA 1YV9A 4EG0A 4Q7QA 5IK2D 4BO8A 3IAEA 5H70A 1KVQA 1Q0PA 1MP0A 4HZUA 3CVXA 1STOA 1GADO 4M7OA 2WQ7A 1I4WA 5T57A 4YHHB 1VE7A 2WZQA 3O94A 2Y67A 3JPYA 1W94A 1N1EA 5A3SA 2NUPB 5F12A 2V0CA 3ZS9A 4ZOLB 4FHFA 3S68A 4QVGA 4KUEA 3K9GA 1EJ2A 5HTOA 2IXBA 3FKJA 4ZAZA 3ZDZB 1ZD8A 4AZWA 5BQ3A 2HIGA 3U44B 2QENA 1NPDA 1LUAA 3I64A 2BR3A 2CL5A 2ZE6A 3PA8A 3ZWKA 1AKTA 2BFDA 1CF2O 5BOSB 1EHCA 1OQAA 1R0LA 2CXNA 2V7BA 2Z1DA 3PTLA 4OJKA 3UMRA 4CW7A 4EZEA 4YMHA 2G8LA 2P6NA 4MW2A 1O96A 3PR2B 3UY4A 1T9GR 4QDOA 3V3TA 4A2CA 5LKAA 1WD7A 1KBOA 3AUAA 3DBHA 3L41A 3P1JA 1W0CA 4F4UA 1UKEA 4XOIA 3TZLA 2OV6A 1NF8A 4RJIA 3SZMA 2HSWA 3O2JA 4EG5A 1RYEA 1QCYA 4PFSA 4OFWA 3RYIB 5DU2A 2GN4A 4CEJA 2H2AA 2OPHA 4TN5A 2PS0A 3G59A 3GLRA 3KUCA 1AKEA 4MMXB 4WDQA 5BVGA 1UJ4A 2QTGA 1GAXA 1SVIA 3J81A 3K9FC 1CP2A 1QHEA 4G5GA 1V45E 3BJRA 1EUDB 3KXDA 1PU2A 1H4SA 3KU4A 4HDOB 4Q16A 2ZBEA 4TXNA 4KJZA 5BV7A 3HVIA 2XNDD 3IEKA 4ID9A 2YJ6A 3I1IA 4YK7A 4AJIA 1J7JA 2PGAA 2VYND 2Q07A 4P4SB 5EHIA 5CT6A 2VJNA 3ELBA 1GQOA 4OJNA 5D85A 5GPBA 1C9JA 1DP4A 2BONA 1PD1A 1T5LA 1EFRA 1DQNA 1SMKA 1ZXBA 3AEKA 4Y2HA 3TRKA 3RYCB 1U7TA 1OX6A 3NGXA 4DAEA 1B16A 4CL2A 2JJ1A 2A57A 2M32A 3EDCA 4L9WA 1NJSA 2D1FA 2Y1LA 1B6TA 3TD2A 1ZA1A 3U17A 4JJIA 4YT8A 4EYSA 1WPGA 1WM1A 3VUFA 3EVZA 5L3RA 2R00A 2GMWA 3PYLA 4KQCA 4DJTA 4E12A 3I61A 3I0MA 1PSZA 1KA9H 3KQLA 1VJTA 2RHJA 5AW5A 4LKOA 1FRZA 1FX1A 5CVVA 4BO9A 1EAYA 1VB3A 4ZAVA 5L95A 4MWSA 4A91A 4KE7A 3G5LA 4GECA 3ZKWB 4IJVA 3QLTA 4I4TF 5FNVB 2YWXA 3BORA 1ZJ6A 5KYYB 4EQZA 4AYTA 4DAOA 2VQ6A 1XZ8A 3T5DA 4H2DA 3IE1A 2XKJE 3AG6A 4JB3A 1J8DA 1DUIA 3V6LA 2QM7A 5C34B 3ED5A 3ETEA 1E61A 3DAGA 3MUEA 3QYFA 1FDWA 5D6NA 1VJRA 4IMRA 2B4KA 3IKJA 3QWIA 4B76A 5A7HA 3N86A 3O4RA 3HU3A 8OHMA 1AF4A 1JHVA 4ZKEA 1T5IA 3LIPA 3CF2A 2YTZA 1CJMA 1NM5C 3PVZA 4OKIA 2H0AA 2EFEB 3I0ZA 4UVIA 1V3QE 1T29A 4M8KA 1X1SA 4RF3A 4Q9NA 2DFNA 4C4SA 2DHEA 2GRJA 1ADCA 4MYHA 2ONJA 4DZTA 2PUHA 1Z12A 3GG9A 2PL9A 3IIMA 4PTZA 3ZYZA 3RFUA 3Q9UA 3VMMA 3IMKA 5LCXA 2ZTMA 4FKBA 2IPOA 5K0SA 2PA0A 3N6VA 4GAEA 5ISMA 3AQIA 3FHTA 4AY3A 4ES6A 2YQ4A 1FS6A 4IZIA 4RFSA 2VN8A 1EE9A 2O3SA 3CN9A 4LYAA 1TD9A 2RC6A 4MDHA 2ROQA 2GSDA 2O0KA 4L3WA 2V3VA 1PFYA 1DLIA 2WABA 4HB3A 2F8SA 1PWZA 4AP9A 1DAHA 3ACCA 4M4SA 2JBAB 3CZ4A 4URUR 4CKWA 4HQLA 2YNMD 1TT5B 2PRKA 3M81A 1AHIA 1MW8X 4BFTA 1D09A 3TG2A 3C87A 1EUQA 1GLGA 1HDEA 2B78A 1UKAA 2YJ3A 3QKIA 5H9VA 1VXRA 5HNKA 3WZLA 3WGVA 1P4SA 4PGHA 3WLEA 1ZJWA 5G4KA 3QUTA 1UBMS 3G1WA 3UFBA 1LFAA 3DHNA 2BFCA 3MGBA 3GCXA 3Q7IA 3IVMA 4PLPA 4RM2A 5ECWA 1E4YA 2IYPA 1M34A 1R6XA 3VC2A 3MT7A 1AHPA 3GC6A 1U2EA 1ZIXA 2VYVD 5FXMA 4KHPB 5A2GA 2WZBA 5JS1A 5CLJA 3E3NA 3CRW1 2J3LA 2JVKA 2O8BA 3Q2IA 5L9AA 1N6LA 2YKGA 3DZCA 2WV7A 3UMSA 1Z45A 2R11A 4NY1A 2ZITA 1NF9A 3PKJA 4HDMB 2H7CA 4KMRA 3RHTA 1EDBA 1OFTA 3JR3A 1D7OA 3Q1KA 3JVIA 1C4WA 2P9ZA 1JBKA 2NO0A 3BWXA 3C48A 4DWWA 2PKEA 5FBVB 2PQ6A 3NNNA 4W5OA 2QM0A 2P7IA 1LSOA 4UTPA 4KYIB 2O2JA 2FLVA 4G1CA 4G5OA 1D0SA 5I51A 4I6GA 4OQEA 4NVRA 2AZXA 4X9XA 1E5XA 2I2FA 3MS7A 3DE7X 3KYDB 3VU3A 3ZY6A 1WXGA 1F4VA 1U0GA 3RT9A 2JIQA 4QOIA 1O0SA 1U2QA 3D3WB 5FI3A 3W90A 4U2KA 3RW9A 3VYUB 3SQXA 3PG5A 4MUXA 4UC0A 5AD1A 4JXJA 3UJ3X 1SOMA 4C7OB 2IEZA 3PFIA 5JW6A 1AY0A 4GKVA 5BWCA 2F17A 4WRRA 1AMOA 1GFWA 2VPXA 2VNIA 2MU1A 4UOZA 1FDOA 1RZ3A 2G3YA 1C1XA 3KR9A 1UMBA 2Y1EA 4EBFA 1W93A 4I8XA 3UW3A 3PC6A 1VRWA 2JGNA 2PEZA 2OLEA 4C0SA 4ZEWA 2PZEA 2XZPA 4DJFC 5JFGA 1QH1B 3U4DA 2WWHA 4DIBA 3HJRA 5DHPA 1A5BB 5CHYA 3ODPA 2GHRA 3KR2A 2Z3ZA 4LF7B 1SXJD 3INTA 2B94A 3U6KA 4X5OA 2ZJ5A 1P8JA 3IUQA 2VJPA 3WBKA 5ARBA 2XBMA 2AZ4A 1E2KA 1R6VA 4LJKA 2PV0A 1VL6A 1JTFA 4PG7A 4UM5A 4PZ9A 4OF4A 1QAOA 4ND8B 2PJRA 2A33A 3B1FA 5T64A 4QJIA 4B4OA 5HM8A 2O8EA 1XMJA 2QSYA 4A1OA 2ENUA 3A27A 2WG0A 1XNJA 1NJ5A 1YNSA 3M2PA 2G80A 3ZX5A 4ZCTA 3HP4A 3HBLA 1A2BA 2AQ8A 4HLDA 4C2AA 1SB9A 1A9SA 2PMKA 2H54A 1YIDA 2C5LA 2BSXA 2VJKA 5T5QA 5BWOA 1CF9A 2ZQZA 1T8WA 1X74A 4G3XA 4JYPA 4PXYA 4R1UA 5CAEB 3UEOA 3VOTA 5IDWA 3CISA 1NF3A 5HRCA 2QSZA 1Z4OA 1Q0SA 1SK9A 2A0FA 4J7AA 4A0QA 2I7CA 3L0BA 1XRQA 3AR7A 4R1MA 3W5CA 2VT2A 4ZWNA 5H9WA 1MVNA 3EXHB 1ZGCA 3A6LA 4IF4A 1AKUA 1ORWA 1XVUA 2WC1A 2VJMB 1E2NA 2ZYUX 3DMFA 5DRYA 4UU8A 3UH0A 3M5CA 3EBOA 1FRNA 1JT9A 4FWIB 4XJSA 3P0RA 1JEOA 1X42A 3ZWBA 4MUJA 2X0KA 5DX1A 4V2UA 1OJLA 2YW9A 2EGGA 1JJFA 1QUFA 1COWA 1WXIA 3LW8A 3QOFA 1VKNA 3CLSD 5DXJA 2BCGY 5AVQA 1HH4A 4S1PA 2I4NA 1FJ2A 3Q85A 1V48A 5A6SB 3HCNA 4CG0A 2JGLA 4M21A 1XNGA 2RK3A 1Z38A 4F9FA 4ZREA 2BM0A 2I22A 2VWPA 2ZBFA 3Q12A 4OB8A 1LTKA 5ITWA 1LXCA 4Q6BA 1C7EA 1C1YA 3JXEA 2W83A 3ZIDA 4FMCF 2Q4DA 4QXQA 1DT5A 4LY9A 4D6XA 3NASA 1IPEA 5I7VA 4KWEA 1TTTA 1I2AA 1Y8QA 1ZZGA 1LBHA 2IHJA 5CRIA 1L5HB 3BJEA 1QAQA 3GRZA 4MKRA 4O29A 2IZ1A 3CYFA 4JI2B 4EY8A 3B3FA 4JI0B 2ONCA 4QTZA 4R98A 2BFBB 3TOCA 1PDVA 2BF7A 2GB4A 4BAUA 3ASUA 1YJ5A 3M4JA 2RGYA 2NZUG 4GX1A 1U7ZA 1QHIA 4IIJA 4W5HA 4RZQA 1N2OA 4BDSA 4J0HA 5JYEA 3QU7A 3IJPA 4LHVA 5CNJA 2NO6A 1BMFA 4OB6A 2WT9A 5CNMA 5T8KA 4UM7A 1OD6A 4A5OA 3J7TA 2AHRA 1U8YA 4QICA 4AY2A 1F8UA 3EDYA 3T9AA 2ZATA 4FR5A 4DV1B 4Z4GA 3AU8A 4YUWA 2IHVA 2W2LA 2O52A 1C8BA 4YBZA 1Y9EA 5CFLA 3I45A 1NIJA 2Y4NA 4NBWA 3P9KA 4PO9A 4TL6A 3L0DA 1U02A 5HQTA 3WAGA 2C9DA 4I14A 2H1SA 4BB5A 4PPGA 4EA7A 2QPAA 2ZVPX 3TYXA 4MPJA 4LYYA 5BN5A 2D1TA 3E35A 3KDPA 1R50A 3PXAA 4FEAA 3MYYA 4CG1A 4UAJA 1ZEJA 2IDMA 2QSJA 4B87A 1WXDA 3TLXA 5G4L<