4TTRA

Crystal structure of legionella pneumophila dephospho-coa kinase in complex with bu2
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
201
structure length
201
Chain Sequence
MVYSVGLTGNIASGKSTVAEFFSELGINVIYADKIAKELTSKNTPCYQDIISHFGSSVVLNNGELDRKRIRDIIFSNSNERLWLESLLHPVIRKKIEEQLIVCTSPYCLIEIPLLFNKHHYPYLQKVLLVIAPLESQLDRIVKRDHCTKKQALAILATQPNLEQRLEAADDVLINESGLSELKAKVNKLHQKYLREAKIKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dephospho-CoA kinase
publication title Crystal structure of Legionella pneumophila dephospho-CoA kinase reveals a non-canonical conformation of P-loop.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Transferase
total genus 71
structure length 201
sequence length 201
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ttrA00
4S2EA 1DG3A 2WSSD 3RS3A 1XD2B 1MRSA 5KNDA 4MRPA 1ZW6A 3ZVRA 2ANCA 3B1WA 2WWGA 3MAAC 2N42A 3T1QA 4DC9A 4HAVA 4LBWA 2GXSA 5JCPA 4LJ4A 1YR9A 3K0AA 3CWZA 4YDSA 4YMUA 3U7GA 1IJFA 3TNFA 2QRZA 3UANA 2DY1A 2WJIA 2CL6X 1JALA 1U9IA 2QY9A 1RVDA 1XJ0A 4HAYA 1ZBDA 2ZRLA 4C0KA 821PA 3N5CA 3OAAA 4Q1AA 2O8FA 4HATA 3B8HA 1KI3A 5FPTA 2NZJA 3THYA 3G5UA 3GJ8A 2NIPA 1F2UB 1XCMA 3B82A 3DVLA 3U60B 1N25A 4LHVA 2O5VA 1N6KA 2JLSA 2OSBA 3LBNA 4DB4A 1ZM2A 3ICQB 1VTKA 1RRFA 3QG5A 3SNHA 1I4LD 4C0SA 2I4IA 4HDCA 3U7HB 1AJEA 4PHGA 3VR3A 3BB4A 5HKKA 5EXPA 4F92B 5FL7D 1VG1A 2GKSA 1X8KA 1KI4A 1NF3A 3OIYA 1IAQA 3PFIA 1TL7C 3EIQA 1FP7A 3WHKA 3KB2A 3FE2A 3QXSA 1KMHA 1VHTA 5H70A 1A4RA 3V4FA 4EDHA 2DPXA 2G3YA 2VBCA 1R7RA 2GJSA 2IHYA 5EZ5A 3T5GA 2QP3A 1TF5A 1Z6YA 2JJ8A 5AUNB 2ZREA 4CIDA 4N3NA 2VP4A 4TYQA 2A30A 3FDIA 1KI6A 4POAA 1G16A 3NHBA 5KTYA 1Z6TA 3SE0A 1KAOA 3GFOA 2C78A 5JRZA 1VMAA 1FX0B 2F9LA 2V55B 4C7OB 2YWGA 3UATA 5CB8A 3NVAA 4IXNA 2W6JA 1P4SA 1G291 2VP0A 3EXAA 3G82C 2QPAA 1MO4A 3PIRA 4KVGA 4ZCMA 3RC3A 2A5GA 2F9MA 2C96A 2KSQA 4Q1BA 3ZLJA 1P73A 3FKSA 3KQNA 3NHAA 2RGNA 3RSLA 4TT3D 1E1RA 1W5TA 3PCRB 4GP7A 4A0RA 5JWRA 3VMFA 3QKUA 2O8BA 3P20A 4DZZA 2MSCB 2XITA 3DM5A 3AP2A 3LW8A 1IHUA 2OBMA 5C1BA 1D5CA 2O8EB 5KNCA 3P4XA 4PO1A 1WF3A 1E9SA 2QBYB 3W6OA 4FXPA 4M2LA 4MGZR 2WJGA 2NO9A 3U3OA 1E94E 1KK0A 2CHVA 3OFND 1S3GA 5JS7A 3IKJA 1KO4A 4M53A 4RCYA 3SC3A 2YC2C 1IY2A 1XCGB 4JIMA 4MGKR 2GXQA 4UNSA 4B47A 1XTRA 3OEED 4B2IA 1D9XA 3NC1C 4DCTA 3LLMA 1YZGA 2UKDA 4JKIA 4CYMA 1KJZA 1SVWA 1M74A 4DWJA 2QTFA 3R8CA 1P9NA 1UDWA 4TLEA 2EFHB 2FV8A 4G1UC 2IXEA 4B3CA 4A8JA 4EJSA 4B6EA 3HP1A 4GP6A 3U44B 3D7MA 1DOAA 5KSYA 1P5ZB 2A5JA 4Q1CA 1FUUA 1OW3B 2IUTA 5FUWA 4MDEA 3KKOA 3AGPA 1KI7A 2QU8A 1OH8A 2VHQA 4LPSA 4ESHA 1KKMA 2WJVA 2GBLA 3RS5A 4A82A 1CU1A 5HZKA 1PZNA 2G0NA 2O0KA 1OXSC 5FTKA 1CKEA 4E22A 4C9BA 1E0SA 3CF6R 2PZGA 4PFSA 2HCBA 4KSBA 2XZOA 1E9CA 3KXIA 4PSVA 4EFMA 4A2PA 1E98A 1JXOA 2OV2A 3VKGA 3IGFA 2X1VA 3P27A 4IJMA 3EW9A 4Q9JA 1G18A 4I4LA 5JECA 1R8QA 2H57A 2CCJA 3OZXA 3LX8A 3PUVA 1PVOA 1GP2A 2XNDD 4MGYR 3TUIC 1BMFD 2MMGA 4GPTA 5DNYB 2O8CA 3K0AB 4L8GA 1BOFA 4IFEA 1G3RA 2UZ3A 4AYWA 2QP9X 4ZO4A 2F6RA 3UPUA 3IO3A 1PLJA 1KSHA 2NG1A 1QHNA 3F3YA 3NEJA 4Q4HA 2BIFA 1N5IA 1P75A 2JIZA 2B8TA 2LKDA 2FE4A 1FMJA 3AKCA 3CM0A 1XXHA 1XTKA 4X8OA 2AWOA 4Q18A 4AG5A 2O8FB 4J0QA 4NBSA 4OQMA 5JBQA 2EFEB 3THYB 4B43A 2FSFA 4O2RA 4IOLA 3SJCA 4KBGA 3T61A 1UDXA 4PHHA 3O8DA 2IWRA 1PUJA 2WJYA 3CR7A 1N5KA 1NMYA 3H0KA 2CEAA 2VO1A 4HB4A 3V9PA 5KDLA 4CEJB 3BB3A 4KSCA 2ZJAA 1ZAKA 1SGWA 2ZYVX 3LXRA 4UQOA 1QVRA 3KUDA 1XBTA 4HAUA 4M1WA 2O8DA 3T35A 3MWKA 5CIQA 2OCYC 3SJAA 1AK2A 1KMHB 1NJFA 5FBVB 3GLIA 1G9XA 1C1YA 2P5TB 4YC7A 4BRWA 4LBVA 1KO7A 2BM1A 2ZAMA 4BLSA 2JDID 1MRNA 1E69A 1P9RA 1Q44A 1G3QA 2ECKA 5JSZA 4LJ6A 4UXJA 2R44A 2ZRKA 3EZ6A 3LFUA 4H9GA 1F3OA 2V3CC 1BYIA 3WMGA 5CB6A 1QVAA 2RGCA 4RZUA 2H7VA 2P3SA 4Q7JB 1KI6B 4Q7LA 5A0FA 2QMOA 4L9WA 5FPHA 1SXJC 1Q1QA 2IXGA 1HE1C 2HF8A 2R6AA 4KLZA 5FBWB 1UKYA 2ONKA 1ETUA 5F9HA 3EWAA 4QBIA 3ADCA 1E0KA 2X77A 2VLIA 2VRWA 2ZJ5A 2IUSA 1TTTA 4CEIB 5KSPA 3EZ9A 2YWHA 2IW3A 2GVDC 4PAMA 3EPJA 2Q9BA 1DAHA 1EFTA 4XVUA 4PSAA 2ZE7A 1CEEA 1MV5A 1QBKC 3LBIA 5FBLB 5J40A 1D9ZA 3W9YA 3R7WA 3KDSE 4TLBA 4KFTA 4D2IA 4DLWA 3EIHA 2HYDA 2WJJA 4JL5A 3SN6A 2IYSA 2XSZA 1EWRA 2AK3A 3JVUA 4D0LB 3BE4A 1CJKC 1HEIA 4PC6A 5CYOA 4Q02A 5BN3A 2ZS8A 4B3GA 4HZIA 2RHDA 2O0HA 4I1SA 4PPGA 5DO9A 2EFGA 1ZUNB 2C98A 2D2EA 3VAAA 3Q5DA 2ZRMA 2ZRBA 3D6TB 1G5RA 4M9SA 1E2GA 5K8TA 1G41A 4DCUA 2FZLA 3NDPA 1JECA 4KJZA 4M1MA 3CKLA 3ZDQA 3MJRA 4PC2A 3AVWA 4C3ZA 1NJGA 3RRZA 2PL3A 4YMSA 5EZ6B 4AWXA 1W0KD 4RSGA 3NBFA 4MUAA 1OHHD 2JLZA 1P6XA 4ZI2A 2OXRA 2HLDD 3GFTA 3K09A 4UXIA 2WZQA 3LD9A 3SZRA 1N5LA 3QKSA 1CIPA 4GOKA 4JYBA 4A8JB 4EJSB 1E0AA 4B75A 2FJUA 5BW8A 2A9KA 3B7GA 5SZIA 2CNWA 1GZSA 1MH1A 2YOHA 4URZR 1SKQA 2XAUA 3HJNA 2ZM5A 1NNEA 1EFUA 2W2VA 2GXAA 4I99A 2J7PD 3C4JA 2F1JA 1AN0A 3WMEA 5JWOA 1W48A 3BWDD 4BRUA 4XIGS 4DKXA 2C04A 3MWJA 1HURA 1HT1E 5AK0A 4JT2A 2QQ0A 4XD7A 2ZS7A 1R0WA 1JR3D 2FWRA 4JL6A 3W6NA 1N6NA 3SYKA 1B23P 2V8OA 1YZLA 1RRPA 3RLFA 3T34A 1IM2A 2FH5B 3E70C 2VHUA 1D6JA 2OLKA 2QAGC 1OSNA 3CF0A 1XTSA 3OEHA 1DAEA 1Q57A 1XDBA 2JLRA 2YOGA 3A1SA 4OKSA 4QNRA 3QKTA 4LUCA 1WQ1R 4KVAA 5JS8A 2XGJA 5J4VA 4Q1DA 1FL9A 1RYHA 1G1MA 4HI0E 3A1UA 4Q4HB 3ZS8A 1CRQA 2ZSFA 3VR2A 2G1KA 4C4PA 2P5SA 3L0SA 2HYIC 3ONWA 2ZJBA 3GLHE 3PEYA 4C2TA 2ZRHA 5GJWC 1HQYE 2QENA 2NO1A 1YQTA 2W6ID 2LCFA 3H1TA 4HYYA 1L4UA 2J0SA 1U2RA 3QVVA 4UJ3A 2ZI5A 3FGNA 3TKLA 621PA 4IDPA 1FP6A 3ECCA 3K9LA 1RRCA 2LKCA 2BKUA 4B3XA 421PA 1P2UA 2QSZA 1N3BA 5FPSA 3CRMA 5JHGB 1RFLA 4LHZA 4V0LA 1A1VA 4GZLA 4D0GA 4WBSA 4KXFB 1M7BA 4DLSA 2EFCB 2MMCA 1UBGA 2OE2A 2AD5A 1XEXA 1JAHA 3UG6A 4KYIB 5JJIA 2HT1A 1FPMA 3I5XA 1KHTA 4ZDWA 5C4GB 2AXNA 3VR1A 1S9DA 2VA8A 3CLVA 4Q4AB 4N0DA 3F0TA 4P32A 4F4JA 5EP4A 4V0NA 4QBHA 5EXXA 5GJBA 4A0HA 1XF9A 2JLQA 2WKQA 1XEWY 2P65A 1PLLA 3MUFA 1R8SA 1H8ED 3CR8A 3I61A 1VIYA 1T0JB 4MKFA 3KJEA 1G3MA 4JS0A 1P2VA 3WNBA 3EC1A 2WHXA 2ZR0A 1US8B 3EARA 1Z0KA 3TR5A 2J3EA 4LC0A 4ASUD 4PQYA 1JR3E 1E9EA 5JJKA 3SI7A 3R7WB 1GSIA 2C99A 3X2SA 5JJLA 1EK0A 1NLZA 2IYQA 1CR4A 3FVQA 2CK3D 4A36A 2XTZA 4PXAA 3AVQA 5D3MB 4TYPA 3KKNA 2ZXUA 2Y8EA 1XEFA 4TT3A 4WZAE 4Q21A 2ZU6A 5BN4A 3VX3A 4LJ5A 3UK6A 3FHCB 1XPOA 3THXB 4IOJA 1OYYA 3MFYA 5BQ5A 1FTNA 2R6DA 4BFZA 4LOAA 4DUGD 4BFUA 5CITA 2J7KA 2DBYA 2FFQA 4XH9B 3FMFA 4RFVA 2R8RA 3QXXA 2VHTA 1E79D 4ZDKA 3VHXA 4XSHA 1BYUA 5TDHA 1P61B 4D0NA 1OPXA 3OFNA 4OQXA 3KQHA 2VP6A 4UNQA 2GZDA 521PA 3ADBA 1SHKA 1Z6AA 3FYHA 1QHYA 3H4MA 3B1XA 3OEEA 3W8NA 4IVRA 3UIEA 3QKSB 5EE0A 4Q66C 1MO6A 3DMNA 5FTMA 1NVVQ 1D8TA 3T1VA 5EXTA 5HCNA 3SQXA 2QNRA 1QRAA 1RJ9A 3C8UA 3ZYCA 4F7WA 1GKUB 4H1UA 1G7RA 5FI0B 5G40A 5HZHA 1GRNA 1FX0A 1CLUA 2KE5A 4C7OA 2WOJA 2D06A 1Q3HA 3RRYA 5J5CA 2ZRAA 2AFHE 1UBFA 3BGWA 1W0JD 4RJLA 3K70B 1JI0A 2WKPA 1T5IA 3QKRA 2X8AA 3TQCA 2E1RA 3UMSA 1UKZA 2J87A 2P67A 1N0VC 4YDHB 3AV0B 5JLJA 1H8HD 3A8TA 3R20A 4JLAA 3K0EA 2BM0A 3C7KA 3V00A 4I1VA 1G7SA 3I4LA 4NMMA 2J1LA 5FOXA 5IDVA 4JLOA 4U5XA 5E7JA 3GJ5A 1OXUA 2WIAA 1VCIA 5HTKA 4JLNA 5BN5A 1LNZA 1HA3A 1OE0A 4TL7A 3RRMA 5FUXA 2BJWA 4RD6A 2AD1A 3GLGE 3IUYA 2VF8A 5K8LA 2OFWA 3WNDA 3ZVLA 2AL7A 2VIIA 1P7CA 1Q20A 3CIOA 3Q3JB 4QL3A 4NPHA 3W3ZB 2IA5A 2XNDA 1KK2A 1XMIA 1R6BX 2D2FA 2GESA 2PX3A 4AYXA 1BMFA 1N2CE 3K9NA 3QXCA 1R0YA 4PAQA 5HCIA 3WP0A 2J0QA 3DEFA 3I32A 2FGJA 5DYIA 4KV9A 4JBXA 4ARZA 4D4JA 1H65A 3FPAA 4G0NA 5AJYA 4MRNA 2VQSA 3DL0A 3LNCA 4DLZA 1KDOA 3LX5A 1XTIA 3BC1A 4JVSB 4KHZA 5AJWA 5FOVA 3U44A 4B6FA 1II8B 4Q9KA 4PPFA 5FI1B 4BPBA 3FTQA 4ESVA 1OB5A 1ZIOA 2OO7A 2GRJA 1ZC3A 3E2IA 1W5SA 3LDAA 1UADA 4GOJA 5KYKA 1U9IC 4AKHA 221PA 1NMXA 1EWQA 1MO5A 2ZR9A 2ZYWX 2A78A 1W4CA 1UAAA 1FZQA 3VHLB 3CPJB 2GAAA 3QF4B 4MQBA 4Q9IA 2OT3B 2CDNA 3ZIAA 2CMKA 2CJWB 4NZYA 4ZDIA 3TRFA 1KSGA 5IK2D 3X1XA 4KCGA 5KSOA 4B3FX 5E7IA 1A2KC 3CZQA 2A5DA 1IN6A 3PUXA 5CJ2A 4D4LA 2QP4A 3U6BA 4R9UC 2H92A 3IIMA 4TYNA 3AVOA 4N0EA 1DPFA 4BFVA 3KJHA 2EW1A 3BD9A 4HLUA 3PEWA 3I72A 4DLRA 2XEXA 1NSTA 3WRYC 3W8RA 5HR5A 4AKGA 4NCKA 1E2FA 2Q21A 4XWAA 4ZI3A 1V5WA 3T1TA 3RHFA 4JLPA 3BH6A 1Q0UA 3GJ3A 4AD8A 4DLYA 4QG7A 4K81B 2GF0A 1YVDA 1M2OB 2BOVA 2QSYA 3QXJA 4DXAA 4QGAA 1LB1B 2MSDB 3MWYW 4QXAA 4AURA 2OBNA 1QHGA 4QHTA 3RRNA 4M9XA 5K8UA 4FIDA 4B3DA 2JJ1D 4FI3C 1TADA 3BH0A 2XXAB 4JVMA 2FSIA 2J0VA 1GTVA 5BYJA 3SJBA 2ZI7A 2QMUA 3GLHA 3SQWA 1KI1A 2OEPA 5J47A 2QPTA 4CEJA 1IONA 2ZYTX 3ASZA 4URWR 4Z54A 1KI8A 1UEIA 4P33A 4JZKA 3E5HA 2SHKA 1SVKA 1KNXA 3GCGA 1ZU5A 1AQYA 4ZDJA 1R4AA 2CXXA 3AKYA 3JZMA 4LC1A 4DSTA 4BUJA 2RGNC 2ZANA 3A36A 4MH0R 4LJAA 3CRQA 4ACAA 3T12A 2VL7A 4OI0A 1LTQA 4GSYA 4NONA 1GRRA 3K0SA 3JVVA 4L4UA 3RSOA 4XJXA 3IBYA 2NPIA 4JMPA 4EPXA 2WKRA 2DFNA 2F3TA 3ZH9B 2EYUA 1S3SA 1NLFA 4JVNA 4OYHA 3B1ZA 1C9KA 2KBFA 5BYKA 2AN9A 3W34A 2YYZA 4QM6A 4LHWA 3U6KA 1QHHA 1UKVY 4ZCLA 3K53A 4JSYA 3B78A 4A2WA 1W0KA 3L2OB 2GWHA 1OHHA 4QKQA 5AJXA 1AQUA 1OXVA 1A5TA 1RJ9B 2JLYA 2HLDA 3BH7A 5LBIA 2F1RA 4EPYA 1GVNB 1ONBA 2F1HA 1KJYA 4GT1A 4TTQA 4CEIA 4O3MA 1DG1G 1MR3F 4LJ9A 1COWD 1Z0IA 3GQBA 1E2HA 1ODFA 2BBOA 1IN8A 3QKRB 2WWYA 3W5IA 1W7AA 4PQFA 2J7PA 3CW2A 3EZFA 1X6VA 1YR6A 3SR0A 3L82B 2CE7A 1GAJA 2G88A 4A8JC 2ZUCA 4EJSC 3D31A 2AKYA 3CBQA 1JR3A 1G64A 2A5YB 3ADKA 4EFLA 3P26A 5LD2C 1DE0A 2YZ2A 4LBZA 3NBZC 4PX9A 1Z47A 3QOFA 3UWOA 4JLVA 5L3RA 2W58A 2YJTD 1XMVA 1R5OA 3GFPA 2D62A 5KU1A 1KAGA 2D4HA 2GBLC 2R65A 3LY5A 3SHWA 1E99A 5FR2A 2IT1A 1GDDA 2LWIA 5LDDC 1ESMA 2C5LA 2UZIR 4P0TA 1ZM7A 4JSTA 1J7KA 1DS6A 3NG1A 3EWSA 4FWTA 5F9FA 2ZVPX 5IRCD 2ZRPA 3RANA 1A2BA 1T4GA 1CJUC 4ARZB 1NG1A 5CYPA 2FPKA 5E7MA 2OBLA 4C2UA 1VCNA 1IXSB 2HF9A 1HY3A 3AVTA 3K9HA 5KPJA 1RIFA 2G77B 4DCSA 1ZYUA 3EA0A 2IXFA 1EFHA 4YMWA 1NMZA 4Q1FA 2EFDB 2GNOA 4ZKDA 2BKEA 3TBKA 2ASEA 3VKWA 1E4YA 1VCMA 3Q7PA 1TQ2A 1SVIA 2IX3A 5CLQA 2W6IA 1FW6A 4Z8XA 4RY2A 5EP3A 1K8RA 2RGAA 2ZEJA 1ZP6A 4RD0A 4BGDA 1NN5A 4JVLA 1F48A 1IY0A 1R2QA 2C9YA 5P21A 4GL2A 2IYZA 2XJ9A 4NCIA 2FSHA 1C4OA 1Z6GA 1LF5A 1RW4A 4IVPA 4A92A 1XCPA 2WPDA 3WMFA 3M1IA 1UBEA 2H5EA 1VIAA 3RYTC 3B85A 4JLKA 1VCOA 1YZTA 2CCGA 1GILA 3CRW1 5EP1A 1OFTA 2WTUA 3LAWA 4HAZA 5TMPA 2J46A 1NG9A 3I8SA 2ODWA 1B0UA 3MCAA 3PUZA 1CJMA 3RS4A 4DIDA 5FTJA 1GM5A 4OI1A 1VECA 4OL0A 3DDCA 4US2R 4MYHA 2J9RA 1Z8FA 4HSEA 3DM9B 2FU5C 2Q6TA 1YKSA 3TVTA 2IUUA 3PVSA 3TMKA 4HAWA 1FFHA 3VR6A 3KTAA 2V7QD 1RC8A 1M34E 4II7A 4DLVA 3C5HA 3M0EA 1H8EA 1CTQA 2IEYA 3NH6A 2JGNA 1G7TA 2RGXA 5H8WA 2ODNA 2ZJOA 4W5HA 3TUZC 1MKYA 5SZKB 3UXMA 3PUWA 4M1OA 5DHAA 4ASUA 2EWWA 4TZ0A 3MMPA 2ZJYA 2HV8A 4FINA 1G8HA 3BXZA 2GJ9A 2NO0A 4CZ2A 1E3MA 3KKMA 4RZXA 1S9HA 2PEZA 3WHLA 1SKYE 1E2NA 3GP8A 1E2KA 3GLHB 3BFKA 1IOZA 2EWVA 5K8IA 2PBRA 1E1QD 2CK3A 1R0XA 1E2EA 3U3RA 1G3UA 4Q4LA 3LO5A 5GVRA 4O0MA 1KMQA 2FX3A 3QE0A 4ZPXA 5KPDA 2H16A 2FF7A 1S1CA 4FN5A 1S1MA 2CHQA 4MUBA 4JBWA 1W36D 3O8RA 1Z22A 3EA5A 1KO5A 4OBEA 4M22A 1DAGA 2GK7A 2FG5A 2AHOA 4Q19A 3TR0A 1Q21A 1QDEA 1U94A 1T5LA 5J4LA 4DJTA 1FUKA 1RKBA 4Q4AA 2BCJQ 1SVOA 1U0LA 1G4UR 2YWFA 4RVCA 1E79A 2KWIA 3VTKA 4CVNA 3KKPA 2H8KA 2CLCX 3IBGA 1JJ7A 1QHHB 4PC1A 2QTVB 2EU8A 3HU2A 4LBYA 1GITA 2DB3A 1M1YE 2ZSDA 2DYKA 1DAMA 2ZU0C 2BMJA 2ZETA 4HUTA 3WYGA 1E2IA 4FD2A 4GOXA 2QQEA 2W0MA 1XP8A 1YZQA 4N1AA 1US8A 3SU8A 1JNYA 1Q12A 3CRRA 3FHOA 2P6RA 1XWIA 2R6FA 3BOSA 3NH9A 3SS8A 4E07A 4RD1A 2XX3A 5G41A 3CRVA 3DO6A 2Z6VA 1NSFA 2CBZA 2K5UA 2TMKA 4URVR 3K09C 1XB2A 3FMIA 4Y0VA 5LB2A 4U7DA 3QPVA 1E9DA 1UEJA 3KX2A 4HB2A 5C18A 3AF3A 3BJIC 5L3QA 1KZGB 3SBDA 2XTNA 2ZRFA 5D3MA 1N6PA 2JLUA 2ZJZA 2RH5A 1H8HA 1GL7A 3SFZA 2E9SA 4WXRA 4R71A 2VSXA 1E2MA 3RS0A 3S1AA 4AYTA 3K70C 3WRXC 3THXA 1XJQA 2VSFA 4LY6A 4PZYA 3HWSA 1JXMA 1U8YA 1ZCAA 4NYJQ 4FMCF 3BAFA 1ESNA 2FFAA 3GEIA 4Q48A 4BZPA 5FPYA 4V0OA 1MABB 3ZJYA 3B9PA 5SZHB 1F5NA 3OESA 1AM4D 1U0JA 4GFDA 3WXMA 2GF9A 4EUNA 1X86B 4IOMA 2B21A 1CF4A 2F1IA 2WVJA 1MO3A 4DDTA 4R2IA 1ZNYA 2W00A 1OH5A 1JBKA 2ZITA 1SZPA 1G5TA 3BFXA 4C0HA 4ZCIA 1SVLA 1LF0A 2WWHA 4P4UA 4LHYA 4IFBA 3KL4A 4DSOA 3OIVA 3I62A 2KJQA 4AIIA 1YJ5A 1E0JA 1W4BA 4LJ8A 1VYVA 1ZM9A 3BB1A 5TXGA 3PXGA 4MDFA 2CE2X 3IPYA 4TWZA 4MRVA 5EQTA 3PEVA 4LJYA 4UXHA 3Q8XB 1XPUA 1XFAA 3W6PA 5AUOB 1OIWA 2ZSBA 4LPKA 2AXPA 4M1KA 5GADl 2N1BA 2JJ2D 3L43A 1D2MA 5TV2A 2D7DA 2JLVA 1A82A 1QHXA 1TQ4A 2REOA 2ZI3A 4W7SA 2DFTA 1AZSC 4NYJR 2BBTA 2XOKD 4NE2A 1ZUHA 3TJZA 4BLOA 1NN0A 3EX7C 3N2IA 2WWXA 2ZI6A 4BFTA 1N6RA 2P6UA 2PT5A 4HLCA 2QM8A 3PENA 4D80A 4KITB 1YR8A 2QM7A 5IK2A 2IYLD 1WMSA 1XTJA 3NBXX 2ZE5A 3AKEA 5B64A 2O52A 3VR4A 2Z4RA 4XVRA 5D3QA 3CPEA 3AGQA 4TL8A 1S4QA 1UFQA 2GDJA 2WSSA 4BFSA 2V4ZA 4PHTA 3K9GA 1FMLA 2PMDA 4FMDF 4XTRA 1G20E 3KTAB 3C5CA 3CONA 4IKEA 4O25A 1G4AE 4QFMA 4BEBA 3QPUA 4URXR 1XRJA 3ZD7A 1UPTA 3GLGB 2WMNB 3IHLA 4OQLA 4IDOA 1FNNA 1KI9A 2D3WA 2HDNB 1WB9A 2ZE8A 3PUYA 5HE8A 2QMHA 5H68A 1OFIA 3RVBA 1KOFA 4HLQB 3SDZA 1DELA 3TGPA 4JL8A 2JEOA 2YKGA 4P3YA 4MYCA 2IYTA 2WBLC 3GJXC 4M1YA 2J0UB 3HU3A 3AVUA 2RKOA 3CX7A 4UNPA 3VR5A 3LQRA 3X1DA 1XEWX 2JATA 3R9XA 1Z3IX 3C41J 4CF7A 4Q1EA 1DO0A 3CH4B 3X1ZA 2ODBA 1II8A 1Z6XA 2JJ1A 1Z29A 4OK6A 2IS4A 1N5JA 4LSGA 4EAQA 4TYWA 5EP2A 2OZEA 5FL3A 1W4RA 2JCSA 3L0IB 2C95A 1M7GA 4KU4A 3NDBB 1J70A 4AKEA 4M1SA 4IEEA 4UJ5A 4G5QA 1P62B 1T0HB 3A4NA 1U99A 4HUQB 1JEEA 3HU1A 3QF4A 1K5GA 3Q5EA 2CVHA 5FL7A 1P3JA 4AKIA 4BQSA 4BECA 2CJWA 2GEDA 2GTPA 1ZNXA 1KK3A 4LDJA 5CJPA 4C0QC 4F4IA 1E9AA 4F91B 1TF2A 1TAGA 3L0OA 4JJZA 5C2JB 2IYXA 3HDTA 4LWZA 1VHLA 5KHOC 1F60A 1E2LA 4QHSA 1IN5A 3MGCA 5TB5A 4DT1A 2N46A 1MOZA 5G3YA 1T8TA 4HEJA 3BIFA 3CPHA 2ZR7A 1XMJA 3REGA 1GNPA 1RPZA 3A6PC 4YONB 3SOPA 2KB0A 4TQUS 1VYTA 4OK5A 4URUR 2H17A 1E96A 3CX6A 2E87A 3O8BA 4K8OA 3T15A 3WBKA 3FHTA 1GL9B 1NI3A 1XD9A 4C30A 1ZM3A 3NTUA 2C2HA 2WIBA 4GBMA 3UMRA 2UVQA 2QG6A 4BLQA 3P4YA 4QGFA 3IIKA 4X8HA 4CEHB 3KUCA 3LH5A 4IDNA 1DAKA 1COWA 2FEMA 2IYWA 3KJIA 3K0CA 3MRSA 4TLDA 2VH5R 4YXWD 5L3QB 2XXAA 5L8VA 1G3IA 1RRGA 1TEXA 3AQ4A 4DLTA 3D8BA 5G53C 3Q85A 2FFHA 2JIZD 4X8MA 4E5UA 1NP6A 4HZUB 4BLRA 3S1AB 3QG1A 3G0HA 1QZXA 2H18A 3KXKA 3PITA 4S35A 4GMDA 3V4RA 4OHWA 2PCJA 3TW4A 2PZFA 5CM9C 4Q7KA 3HR7A 1ANKA 4ZKEA 4F38A 3R9WA 2ZROA 4LV8B 4TN1A 4V0ME 1S0UA 3THOA 2OCAA 3OIWA 5LB4A 3BS4A 5KSZA 2OFOA 4P4SA 4PPQA 1G5PA 1XTQA 3THWA 1KY2A 4DLUA 5CLLA 1TQ6A 2YWEA 3GD7A 5L3VA 3KQUA 1E9RA 3NC0C 4NHOA 4EKDA 1GRQA 4XWKA 2ORIA 4XOIA 1NLYA 1ZCBA 4QBGB 1JJVA 5GVSA 2QT1A 4M21A 2YNMA 4HAXA 5C46F 1WBBA 3IEVA 1XPRA 5G3ZA 1R10A 4JT4A 2VEDA 1NY5A 2ZQ5A 5FOWA 4GRAA 2QA5A 4A6XA 1JPNA 4RZ2A 8OHMA 2IS1A 3ZQ6A 5ELXA 4NYIQ 1NBMD 4IW3B 1NN3A 4JLBA 3GMTA 4QM7A 3RDPA 3UKDA 3M4YA 4WA7A 3TK1A 5BXQC 4FCVA 3IO5A 3FMPB 4JJKA 3GEHA 3TSOA 4TMVA 1KDRA 2VPPA 1BS1A 2ZUDA 4NL4H 3C14C 5FTLA 2QPOA 2R9VA 4DHEA 1VDZA 4G5GA 2ZRDA 4Q47A 1OH6A 2OAQ1 3C16C 2HT6A 3AP1A 1NIJA 1NVUQ 1YRBA 2QEQA 4KFRA 2CCKA 1EG7A 1LS1A 3IPXA 4TTRA 3EASA 5E3HA 3LWNA 2HJVA 3TSZA 2Z4SA 2IYVA 2Q3FA 4KO8A 1OB2A 3DOEA 2RHMA 3A1WA 3TW8B 1Q1EA 1NVXQ 1AS2A 2CLDX 2V6IA 1KGDA 1PJRA 3CX8A 4YLGA 3NKVA 4Q5IA 5TY0A 2B6HA 3NBYC 1P2TA 4G5OA 2RAPA 4PAOA 1A7JA 2RGGA 3AB3A 4A2QA 2V7QA 3QBVA 3QY0A 3H2YA 4B73A 1Z08A 4A4DA 4BEJA 2QT0A 2VHJA 4CDGA 1DVRA 1SXJD 2FN4A 1SULA 4HLUC 1GKIA 1M6NA 4P4TA 1N6IA 5AR1A 4NYIR 1YZNA 2BHRA 3GJ7A 2GVZC 3LV8A 4BFYA 3BK7A 1XXHE 4DEYA 5JFGA 1R5NA 1OLOA 1ZJ6A 3DHWC 1S8FA 2KBEA 2QL6A 1G7CA 2ONJA 4D81A 1U81A 2HJGA 3W5JA 2QTHA 3FB4A 4NCHA 2FNAA 5FBQB 1CP2A 1E1QA 5F3WB 5BWMA 4RCZA 4MYUA 2ZI9A 3I92A 3ND8A 4ZV4A 2DCUA 4Z8YA 3VFDA 5JRJA 1Z0AA 3PJRA 2V1UA 1HQCA 2VTKA 4LK2A 4G5RA 3AVVA 2QAGB 2RGBA 4JLDA 3AVXA 3MD0A 1VYUA 4PSKA 1ELOA 2QROA 4XD7D 3GLIE 4U00A 4DVGA 4Y0AA 4FCTA 1KY3A 2JDIA 4DCNA 1U0HC 4DT1B 5DLQC 1G8PA 2AK2A 3M6AA 3LLUA 3EPKA 4FMCB 1DAFA 1X1SA 3ZQJA 3VNVA 2OCBA 1UJ2A 1VG0B 2D74A 5E95A 5JZVA 2YV5A 3A58B 1X1RA 2DWQA 1IJEA 1WE2A 1VKJA 2CLSA 2ZUBA 3GJ0A 5EXSA 3U3KA 4A15A 1EX6A 4GNKA 2XB2A 3KKQA 1OH7A 3QQ5A 2WAYA 1AGRA 1NBME 3BFVA 4HB3A 3A4LA 4LGMA 2VP2A 3JZAA 5FFMA 4B2PA 3GLFE 1Z83A 4LV6A 3GJ4A 1UBCA 3EPLA 4JBYA 4QRHA 5JCZA 3BORA 3T06B 1LFDB 1TNDA 4FW9A 1NL3A 3WYAA 1KSFX 2ZPTX 3OF5A 2BBSA 3UWKA 1EFRD 2ZJ2A 3I8XA 4RD3A 3LBHA 1Z0FA 3F8TA 2GCNA 4CT4B 2BMDA 3QIAA 1FQKA 3B1YA 3WYFA 1WRBA 4EFNA 4OHZA 3AEZA 4G5SA 1YE8A 4US0R 5DI3B 1SKYB 4C0BA 5ANRB 4AC9A 2IF0A 4M9ZA 3PG5A 2ZJ8A 5HE9A 4MYTA 4BFXA 2B7CA 2I1QA 5DN6D 4JLJA 5L3SA 4P4SB 3SBEA 2GK6A 2IWHA 4CRWB 3THWB 1V43A 1J2JA 3CNNA 1DAIA 2OHFA 4G3XA 4PANA 2FGKA 4W5WA 3UG7A 4A6PA 2IBMA 4A1FA 3ZZ0A 1EX7A 1SXJE 2CHGA 2FMXA 1AZTA 1R5BA 4URYR 3WNCA 1JEDA 2FA9A 1JAIA 1YR7A 4BWYA 3EPHA 2WAXA 3AUXA 1HYQA 3WBJA 1BH2A 1E4VA 1U8AA 4B74A 4FMDB 2BMFA 5IF9A 1F6BA 5DE3A 2QE7D 4UNNA 2O0JA 4IDQA 5B30A 4MRSA 4LYAA 2GJ8A 1LV7A 4BFWA 1TUEA 3C15C 1KIMA 1RE0A 1XX6A 1W2GA 3AH8A 3QEJA 2Q3HA 4LV5B 3KFVA 1J8MF 3SEAA 3T5DA 2OLJA 4Q9HA 1U98A 1T3HA 2VHCA 3VQTA 1XMSA 4LJ7A 5F2EA 5TVKA 2GXUA 4BZXA 2JJ2A 3Q72A 1IXZA 3ZVNA 2Q0HA 4NH0A 2ZVQX 1ZINA 2ODEA 1OFHA 2GEUA 2FZ4A 2XOKA 5DIFA 1EGAA 1M7HA 4B48A 2W0SA 2OG2A 3CO5A 4ABYA 3IIJA 3AF0A 1Z63A 2YOFA 1U8ZA 5GJVC 1YU9A 2H1LA 3DZDA 3VX4A 3F5FA 4R2HA 3B5JA 4DCVA 4C0LA 1N6HA 1FQJA 1MABA 1AA9A 1KZ7B 1OIVA 1E9BA 3U2QA 721PA 3PR1A 2XNSA 2ZI4A 2GA8A 4GI7A 4V0MA 5FUVA 4C0JA 3LXXA 4KLNA 4NYMQ 4I1OA 2OFXA 3EIEA 3TAHA 3DKVA 4PC7A 3RWMB 4H1VA 4NTZA 4B33A 1T8UA 2XTMA 3LQQA 5M04A 3X1WA 1F2TA 2C77A 1WBDA 3QNUA 4MA4A 5EJEA 2NQ2C 3EC2A 3CNOA 4TLAA 1QG4A 3VU9B 2DWPA 2QAJA 2AKAB 3J81k 1OXTA 3U4QA 5JWHA 4Z1MD 1IN7A 2AR7A 2W2TA 4LYJA 2OUKA 2GJAA 3REFA 2ORVA 4M1TA 2J45A 1P60A 1KO1A 4QOSA 1LY1A 2BEKA 1E2PA 4UKDA 5B2ZA 3DZ8A 1N6LA 4PHFA 2REXB 4C0AC 1CBUA 1Z0JA 3HR8A 1OYWA 2IC5A 1EXMA 2RGEA 1D2EA 1TX4B 2FPMA 3HYTA 1DBSA 4OJQA 3EZ7A 1W36B 5FR1A 4B44A 4L9SA 3U7EB 2X2FA 1J8YF 4TQ9A 2WJHA 4LYFA 3AF1A 4US1R 1TF7A 1ZMXA 3P32A 1GNRA 4XWOA 1NVWQ 2BDTA 4LYHA 3OE7D 1FOEB 4D82A 5J4HA 2HXYA 4OJKA 1W46A 4YMTA 4NYMR 4TMTA 3H84A 1KI2A 4MKIA 1SVSA 2DFLA 2JLWA 2OESA 3VKHA 4TSFD 2IL1A 1RYFA 1X3SA 4WOPA 3GLGA 1HUQA 2GHIA 1X8LA 4E09A 3PV0A 3RC8A 2CL0X 2BV3A 5DISB 1TU4A 4D4KA 1W44A 1TPZA 2J0UA 2ZAOA 5TARA 2A2ZA 3QUSA 4QBFA 4BASA 5J4YA 1UM8A 1G6OA 1E6CA 2ANBA 2OM2A 5FH9A 2OXCA 2NPFA 1XD8A 4AK9A 1Q3TA 1EFCA 4JKYA 4TYYA 1JR6A 5FOSA 1XJCA 4TMZA 121PA 4YXWA 2W2XA 2R62A 3CWQA 1NRJB 2GILA 1OKKD 2HXSA 1KKLA 2VP9A 3A1VA 5EUQB 1XZQA 3K8YA 5DGXA 2X2EA 4OQFA 2FEOA 2PZEA 2WICA 4HUQA 5L3SB 1WP9A 5UKDA 2C03A 1SVMA 3EG5A 1Z2AA 4DUGA 2EYQA 3I73A 3Q7QA 1OJLA 1CRPA 1CR0A 1NKTA 4HDOB 4DDUA 2XZLA 1II0A 2GETA 4B34A 1GL6A 1OF1A 1Q22A 1SQ5A 4W9MC 4FWIB 4TLCA 2P2LA 4Q4JA 2I3BA 1KTVA 1CXZA 3K1JA 2PH1A 4BLTA 3ZIAD 3OHMA 4DIEA 2V6JA 5CDFE 5GJCA 2F7SA 1Y3AA 5AUQA 4WZBE 1QHSA 1T91A 3TIFA 4KFSA 2HUPA 2IYUA 3RNLA 3B1VA 2QN6A 4YMVA 3MWLA 2GCPA 2ZRIA 4NCJA 4DDWA 4KI0A 4PR0A 3TQFA 1ZNZA 4RKEA 3KQKA 2CVFA 3GEEA 1TEVA 1WA5A 4BLPA 5IT5A 1OFUX 3DOFA 4NKRA 2Z43A 1AS0A 2GJKA 1W0JA 4XSGA 4CEHA 5A4JA 4F4CA 1AIPA 1GUAA 3SFVA 4RFSA 3SYLA 2HCJB 1NBMA 4KAXA 2BWJA 2IYRA 2QGZA 2PJZA 4NU0A 2GZAA 1W2HA 3ZS9A 2ZRCA 2A5FA 3DKPA 3FMOB 3GLFA 1CJVC 1W49A 3ZGXA 2QORA 2IS2A 1SHZA 4HZUA 2Z5FA 2QGNA 3OAAD 4OHXA 5EUMA 4PO8A 2GCOA 1KDTA 2KI5A 4B35A 2AWNA 2IEZA 1G6HA 3HYRA 2DHRA 3ND9A 2AX4A 2PLRA 4OQNA 5C4MA 2O8BB 3DPUA 1O3YA 2PMKA 4OI2A 4OI4A 4XTCS 4WZ6A 2WM9B 1P9WA 2MSEB 3RS2A 1L7VC 2BMEA 4M4SA 5HKKD 4Q00A 1N0UA 2NZ8A 2FOLA 3KQLA 1KK1A 4QGHA 1OV4A 3W90A 3TH5A 1T3LA 5AUPB 4L16A 4BE7B 3NEYA 3AM1A 1ZC4A 1NKSA 2DWOA 4LI0A 3N70A 4GZMA 4QJ5A 1F2TB 1G17A 1E9FA 2ATXA 3W3AA 1P72A 5FUYA 1SXJA 1CR2A 3TVDA 4OHYA 2OCPA 4AY2A 1WXQA 3ADDA 1BO6A 2P6NA 5EE3A 3I1FA 2VF7A 4OK3A 3U4QB 4Q01A 2WWFA 2QRNA 2VP5A 1OXXK 3QJYA 4MKGA 1QG2A 1CR1A 5AWFC 3QVUA 4YQFA 3LVQE 4KODA 1Z06A 1U90A 2ZIAA 2ZRNA 4PZLA 3B9QA 3QXHA 4EPVA 1HTWA 4PQRA 1YZKA 3P1JA 1T9HA 1WDTA 2PEYA 3A4MA 1J90A 3CB4A 2Q3MA 3AF2A 3R9IA 4G01B 1JQJC 3BBPA 2W6JD 5FBRB 1KDPA 4B32A 2J41A 5LPNA 1QF9A 2Q9CA 5LD2B 1Y63A 2REBA 1E32A 1ZD8A 4KBFA 1VPLA 4DDVA 3FKSD 4Q03A 1S96A 4EQ6A 1E1RD 4MGIR 3EZ2A 1XZPA 2VSOA 3AF4A 3O8CA 4LX0A 4WW0A 2GEVA 3AKDA 1ZNWA 2C9OA 5J4KA 2Z0MA 1GOTA 1ZIPA 4PC3A 4M9QA 2RMKA 1LW7A 2QI9C 4I1UA 1PUIA 2QZ4A 3B60A 4WXPA 3RABA 2ZTSA 1G8GA 4TL6A 1G19A 4EIWA 4EPTA 3SHFA 4I81A 6Q21A 3EAQA 1E2JA 1S2MA 2OILA 4WIAA 5JI2E 1GIAA 1HT2E 3AP3A 1EESA 3O47A 4BZQA 2EVWX 2R6CA 3OIUA 2XZPA 3A1TA 1MT0A 2B92A 1IN4A 5H1YA 1ZU4A 3TLXA 4M8NE 2O8CB 4A0GA 5JI3E 4XVQA 1Q1ZA 3IEUA 4JLMA 1E2QA 3NXSA 3MLEA 2PJRA 1K6MA 5FPKA 2BBWA 2IK8A 3ETLA 2G9NA 5KO2A 4GDFA 4QJ4A 3U61B 3U5ZB 1EFRA 2X19A 4IXMA 2WSMA 1ZD9A 5IHPA 3QPWA 1XXHB 4EPRA 1CULC 4L15A 1AKYA 4DSUA 5AJVB 1QHIA 2ZS9A 3QI2A 3NWJA 4GMXA 2C9CA 3K0CC 1ZRHA 2R2AA 4TTPA 1VG9B 4F93B 4IOKA 3CUEF 4R7ZA 3A37A 2F55A 2JAQA 2ERXA 4JYCA 4AG6A 3E1SA 5DN6A 4ITRC 5EE9A 4Z51A 4Q9LA 2QAGA 2QMEA 4Q4JB 1K5DA 3K0FA 4MRRA 1GNQA 1I4TD 2F43A 5KUTA 3QSYA 2WPDD 4DB2A 1ZD1A 3LVRE 1BIFA 2DFKB 2NO6A 2O8DB 4B2LA 1DO2A 3MG9A 3HPQA 4CT5A 4TQAA 3RS7A 4ZIRA 3GLIB 3QBTA 1KYIA 3AUYA 1GKYA 3N2EA 3ZD6A 2V1XA 1YZUA 1IXRC 1UF9A 4IVQA 3AVPA 2BVNA 2BC9A 5JSZB 4Q7MB 2BEJA 2QE7A 4LRWA 1XD2A 4HLDA 4IDHA 3FKQA 4AI6A 1AGPA 2YINC 1Z2CA 1GG2A 4RFSB 3IQXA 2NGRA 1N6OA 4RKFA 1OIXA 2A7QA 4A0FA 1IQPA 2PT7A 3T1OA 3GPLA 3IHWA 1CJTC 3U7FB 3R8FA 2B7BA 4R98A 3GLFB 3PEUA 4HDQB 1L4YA 4OHVA 3L0PA 4KFUA 3SYNA 4B71A 4D25A 1LS6A 3KFXA 3QEOA 2R6GA 2GAOA 2WWIA 4ILEA 5DH9A 2GCOB 5DI3A 1HH4A 2NTYC 2ZRJA 4TMXA 1ZM4A 4RZ3A 4A9AA 2RB4A 2ERYA 3KXLA 1JPJA 4D26A 1Z07A 2DR3A 3D3QA 2YVUA 3ZZTA 2FFBA 4RD2A 1FTSA 1YHNA 1OT3A 2ZSAA 4MITA 3HPRA 3QF7A 1O87A 1HV8A 2A3RA 1L8QA 4QHYA 2OAP1 2JLXA 2JASA 1D2NA 1F2UA 2XJ4A 1KJWA 1Z0DA 1HE8B 1RZ3A 3B2EA 3LW7A 5CK4A 5HPYB 5JEDA 2NMVA 2ORWA 1TUIA 1NN1A 3WP1B 4D4MA 5B58C 4ERNA 4DEXA 2V54A 2Q9AA 3PQCA 5E4FA 3U3JA 3IILA 5EE5B 4U02A 4B76A 2L0XA 4V0KA 1PLKA 3MSXA 3WY9A 4DBLC 1TMKA 1SXJB 4LCBA 3CNLA 2EQBA 4QC2A 3FWYA 4CGZA 2IS6A 1FNMA 1NY6A 2Z83A 5DHFA 4QNMA 3VNUA 5CK5A 4MKHA 5CDFA 2WOOA 1DTSA 1ZUIA 1GFIA 3KB1A 2GZHA 4WVFA 1TQDA 2CL7X 2WWWA 5EE1A 5B57C 4TL9A 5FOTA 4Z1MA 1N0WA 2ZRGA 3AVYA 1BKDR 1CS4C 3CF2A 2ZE6A 1ZVQA 1I2MA 2C8VA 1T6NA 4TMWA 1II9A 3SJZA 4EPWA 4V02A 3NIBA 4HB0A 1R0ZA 2F3RA 1JQLB 5SZJA 2G6BA 3IQWA 2WV9A 4EQ6B 2G1JA 4ACBA 1UKEA 1IY1A 4PO9A 1P2SA 1AKEA 3CZPA 2IYYA 2YHSA 1WCV1 4IEIA 4IHQA 2B8WA 1IBRA 3LA6A 3RAPR 3I3SR 4DLXA 2NOAA 2RCNA 5A5GA 2XSZD 2PX0A 3FFAA 4TZ6A 3ICEA 2W83A 3OE7A 4IRUB 4PZZA 1W4AA 4LZZA 3L8ZA 4WAUA 5DSZA 4K46A 2PCLA 1W36C 4NDZA 1I2DA 2D7CA 2ATVA 4RD4A 3I5YA 3QENA 4TSFA 4P31A 4FCWA 4L5BA 4UNRA 3CH5A 3ZVMA 2O8EA 2IHBA 1E2DA 3L8YA 3LRPA 2AFIE 3RWOA 4X8LA 4W5JA 5AJZA 2QBYA 2FDCA 1T3SA 3U3MA 4NCNA 4V03A 2ZYUX 5F98A 4ON9A 2RGDA 1I4DD 2IF2A 3TE6A 2G0TA 4PPNA 2P0EA 1NVVR 1DEKA 1XU4A 3VU9A 2BCGY 4TMKA 5FOUA 4DSNA 3Q9LA 5DI9A 4CW7A 3DMDA 5CIWA 3B6EA 1G21E 2JA1A 4O2LA 2VYFA 2WMOB 5KDOA 1TU3A 2V9PA 4KYUA 2CNWD 3ZZUA 4NP6A 1KNQA 1OKKA 2J5XA 5KDDA 1Q1BA 2XB4A 3UMFA 3FOZA 5CM8B 3B13B 4LHXA 1AS3A 4DRZA 3KJGA 4QJ3A 1G8FA 1L2TA 1YRAA 2BJVA 3X1YA 3TAUA 5KOYA 3K70D 1XNJA 1KO8A 1W47A 1M8PA 3K0FB 5JEEA 3KZ1E 2F43B 1VG8A 2QUZA 4D6PA 3H86A 1Z5ZA 2J59A 1JB1A 1X8JA 1Z28A 1G8YA 3ASYA 2ZSEA 3IDQA 5KNBA 3TUJC 5JHHB 1XEXB 3BERA 1J99A 4M0LA 4PTLA 5FTNA 4ZIRB 1PV4A 1DADA 1W1WA 1GWNA 2PLFA 4QGGA 5DYGA 3TSWA 2NO7A 2G83A 1NIPA 2HEIA 3GJ6A 3OEHD 1LVGA 3FFBA 4FMBB 1DARA 2FSGA 4E03A 3BRWD 3MJHA 2I1VB 4B3BA 1KSJA 2FPLA 5JMTA 2YC4C
chains in the Genus database with same CATH superfamily
5HUJA 5CGZA 4BFLA 1M2GA 4PPYA 4XM0A 4B17A 2V6FA 4MRPA 4LZNA 1ZXLA 3GYBA 2ZW9A 2HTEA 3DMRA 3B1WA 5MGNA 2WWGA 2IOFK 3EF0A 4JI3B 3G2NA 1ESZA 4V3CA 1Y89A 3DOHA 4NOMA 5EPEA 3W5HA 4CKCA 1NPDA 4KXLA 1YR9A 5REQA 1C3LA 2W42A 1TPYA 4RA6B 3CWZA 4YDSA 1M6YA 4YMUA 1YJQA 1GTJ1 1I2AA 4HGZA 3PD0A 3T9EA 3U7GA 1AUVA 1QO0D 3FLMA 2QJWA 4ZN6A 1RAFA 2CL6X 1JALA 5KVQA 2CHEA 2Q50A 4EVIA 1I94B 5J23A 2ZRLA 3UA3A 2FKAA 3PQ7A 4E3ZA 5A6VA 5JRDS 5IAJA 5AFSA 4M3NA 5DXFA 3FWHA 2O8FA 1EFKA 1KI3A 1KP9A 3LPDA 3ZYZA 3VYUB 1C0EA 3DOJA 1CZNA 1QJ4A 3K94A 4AKSA 3C85A 1X1QA 1Y3CE 4B8WA 1A9OA 3B82A 3G2LA 3GIWA 3IHTA 1UOPA 2JLSA 4ZARA 3E7PA 1ZM2A 2Q6IA 2IU0A 4BAZA 4AP9A 3SNHA 3RU9A 1UT5A 4B4UA 3U7HB 2CVPA 1Y6GA 4NZNA 3VR3A 1LTHR 3BB4A 3U4IA 2JHFA 1X8KA 4L0DA 5BNWA 5ALSA 4JDPA 1UMBA 1I7QB 4TPKA 3WRYA 1WQ3A 3ERCA 2DY0A 3SPXA 1ADCA 3FRJA 3GL9A 4G8JA 1KMHA 2BAGA 4J7CA 1XNGA 3MTJA 2FZVA 2XOXA 3GGOA 1VHTA 2OCIA 5H70A 1N57A 1QUFA 2MYPA 3TRHA 1E1CA 4EDHA 4E1AA 2G3YA 1KQFA 1W8DA 1P80A 4WZBB 2QP3A 1XMQB 4E4RA 3R40A 1ESDA 1PK8A 1DX6A 3ZXIA 1IQ0A 3RK4A 3V7UA 2QJTA 5EMJA 2B1QA 4FHGA 4CIDA 1JVSA 4RNCA 3RVLA 1XG5A 2FLWA 3FYDA 3RG2A 3T8YA 2B61A 4YMHA 4JXXA 1KZ4A 3F6YA 1FBTA 4PN3A 1CWUA 1D8AA 3GFOA 2C78A 3H3XA 4I9FA 2XOEA 4QDOA 1KVRA 1KYTA 1YBVA 2OUIA 2ZGVA 1EINA 2F9LA 3JQEA 4LDAA 3AW9A 3IDFA 5LNK1 2UU9B 1Y5IA 5CB8A 4C7OB 2CSUA 4IXNA 2EHDA 2W6JA 4RPHA 3G82C 4ZCMA 4JFRA 3WLTA 4TVKA 3DFFA 2FUG1 3PPVA 4TV9B 1U2DC 1K2WA 2KSQA 4Q1BA 4IDDA 2NXNA 2DSTA 4Q3NA 3KQNA 1R00A 1ZO8A 3MT8A 1P7YA 2A0KA 3IVMA 1E1RA 1W5TA 3MOGA 2WUWE 4CI0B 3R44A 5JWRA 2YRWA 2VJOA 1V8PA 2W4MA 5CDGA 1TM1E 2MSCB 2XE4A 1SKAA 4MAMA 1Z2EA 2XQKA 3D0OA 4BKOA 2P0YA 5KOJB 5C53B 2YY5A 3JQ8A 5DV9A 3WQRA 4PCUA 5EVJA 1PVDA 2O8EB 1G8MA 5FLXA 1V47A 4PO1A 3ZPXA 4E4TA 3DXFA 5I7SA 1GQSA 1R3DA 1E9SA 1Z9BA 4GL4A 4BN5A 4CLEA 1NVKA 2WYOA 2Z3WA 4M2LA 4IG9A 4H7PA 5AI0A 2OHGA 2B3DA 4ZVKA 5FHRA 1E94E 4UTPA 2O2JA 1S3GA 1AQ6A 1KJ9A 5JS7A 1NP3A 3IKJA 1TYZA 1AB5A 2E4WA 3SC3A 1GCIA 3V8QA 2BI8A 4JIMA 3UTDA 4XYMA 5KTOA 3WG9A 3K15A 3ILXA 1OZHA 3OEED 4B2IA 2IVZA 3BWVA 2PMBA 4L5IA 4LE1A 4KH0A 5BYBA 4YYZA 1ADBA 1P0CA 3W77A 3GMIA 3K6KA 3U7QB 1KJZA 4L74A 3ZDFA 4DWJA 1TJNA 2QTFA 1P9NA 4DQDA 1JQKA 4TLEA 1JEQB 1PJAA 6CHYA 2FV8A 2H2HA 4QYSA 2O7NA 1JQBA 2YIDA 3BQ9A 1NJSA 2GDZA 3HP1A 3EOBI 1KEWA 2AEEA 4XCXA 4JX9A 4J0FA 5E1BA 5JNSA 2FZGA 4RIEA 1P5ZB 2A5JA 4Q1CA 4UEJA 1OW3B 2IUTA 1MPXA 2CNDA 1JHMA 4ENWA 4W5OA 3PHHA 2C7PA 3KKOA 4KVZA 1NJ2A 4KYVA 2H3EA 4KC0A 2QU8A 4UE3S 3K73O 1M2HA 1A9YA 1E7QA 2ZBEA 3GT0A 3RS5A 5HZKA 1CU1A 1PZNA 4GKKB 4QUJA 1XQVA 5FTKA 4YRKA 4TKUA 3Q6MA 5HMLA 4X3OA 2VHXA 1DPGA 4E22A 5CNJA 1NHGA 5F21A 1E0SA 2H51A 2W6NA 3MT7A 1U65A 1ABFA 2VAPA 1TKRA 3GXBA 1BE6A 2SNIE 1O4VA 1TQHA 4KQWA 4XEHA 4CM3A 3WA7A 2P6OA 3ZZNA 5BNIA 5HQ3B 1QZTA 4G9BA 4KIFA 4NJEA 3P27A 2RHTA 4IJMA 1N2JA 3M81A 2X22A 1R8QA 1QQ6A 2IUFA 5DK4A 3T41A 2H57A 1DP4A 3E2MA 1GP2A 5I4CA 1ZKDA 3FOFC 3IOYA 1KVTA 2OWEA 5CCXA 2ZXFA 4RVOA 3TRDA 3EHDA 4D57A 3RC9A 1Z25A 1IZZA 1SXIA 3SY8A 3FF4A 3FCXA 2QXYA 4J9UE 5ILQA 2O8CA 1J4AA 3P9IA 2YYYA 4HYQA 4AYWA 1YSCA 4LRUA 1K6XA 2QP9X 2GASA 4ZO4A 2QKYA 4MZXA 1P1JA 2Y4OA 3NEJA 1SUIA 1NVGA 2BIFA 2YX1A 1L5HA 4AP6A 3DO8A 4AZSA 4EMSA 4PF1A 4DZZA 3CM0A 1UDAA 3H5AA 3P96A 3FDJA 5TGZA 1XTKA 2FOXA 3W06A 2AWOA 4BS9A 3OG9A 4NV0A 3EGXB 2XUHA 1VOTA 2IU3A 2HTFA 4J0QA 1UMDA 4JJIA 4NBSA 2EFEB 5JBQA 4QFDA 4L02A 4QSMA 4PYKA 4HN2A 3TLKA 5JNRA 4FFBB 3G0IA 1N5KA 3ZE9A 3ZWWA 2BKLA 4C3UA 3LO8A 1IMOA 3IVCA 2CEAA 3OA0A 5C52B 1QIKA 4LJRA 3TI9A 3GJTA 4QLOA 4XDZA 5CCBA 2VI5A 2ZYVX 4QTUB 5CT5A 3RT9A 3P2EA 4RJKA 1RZRD 1JLMA 4O4IF 1ZVVA 1YHZA 1YQQA 3EXIA 1XBTA 4M1WA 2ZJ4A 3FNGA 5CIQA 4DPKA 3SJAA 5LMCA 5FO0A 1U5BA 1NJFA 3FGPA 3CCCA 4S24A 4X64B 1KEZA 1H2HA 3ROXA 3PLNA 1J97A 1KEKA 2WUDA 3C6KA 1EWVA 1YO6A 3U37A 2GEKA 1G9XA 1SVNA 4YC7A 5DTIA 4FQ5A 4LBVA 2VATA 2ZAMA 1V4BA 4BRWA 3WGUA 5KIAA 3VZSA 4OLBA 1E69A 1P9RA 1Q44A 2OHJA 3BJEA 4IS2A 4XOUA 5T67A 1ISHA 5JSZA 4OFXA 1I7PA 4FU0A 2PM8A 2R44A 2WG1A 3P19A 5AKYA 3T0IA 1OGIA 1XL1A 4L50A 1ZJ5A 1QOZA 2BEVB 1BYIA 5CB6A 1QVAA 2H7VA 2QUBA 1K9SA 3L7AA 4N40A 1O96B 2WY2D 4WWHA 3KBBA 3PNSA 1V9LA 4G4SP 4ZAFA 4FS8A 4AJHA 2R6AA 3P9RA 3BL6A 1RRMA 1UKYA 4CGYA 1DEHA 1JEAA 1ETUA 1L6RA 2GEFA 4PONA 5F9HA 1ZX1A 5DNWA 3ADCA 3EJWA 3OZCA 3GOQA 2X77A 4JR1A 2ZJ5A 3I3OA 2IUSA 3LY8A 5CLIA 5KSPA 3PPXA 2IW3A 3WMXA 3EPJA 1GV1A 1GG5A 1KVUA 1DAHA 4XVUA 1PSDA 1TKBA 1UBJS 4PSAA 1U1EA 4UD2A 1QBKC 3LBIA 3F6CA 1BX1A 1CEEA 5BSVA 2IV3A 1D9ZA 2CJYA 1ZH0A 1YRHA 2HMVA 1Z0SA 2JZOA 2M6SA 3FFTA 3IJEB 3HKCA 2P2YA 3P2MA 1GZ3A 5ALOA 1YS4A 2NM0A 3EIHA 4D2IA 3SN6A 4BNDB 4UBNA 3ROEA 1XMOB 1BKSB 1KFEB 3OPYI 3NP7A 2H52A 3G9ZA 4FHDA 2XSZA 1GUYA 4TTVA 1EWRA 2ABWA 4IUDS 1KC3A 1VE5A 1VJ5A 2AK3A 2HDOA 1YNOA 1P8JA 3D3WB 4D0LB 3DAOA 4KQ9A 1CJKC 1KP2A 1ZJZA 1HEIA 1WUHS 2I99A 4PC6A 2F3UA 3AR8A 4Q02A 3DHNA 3KZNA 2ZS8A 5BN3A 4B3GA 4JCOA 4JNKA 2EC5A 3KB6A 4I1SA 3JQAA 1SD1A 5DO9A 5IX8A 2OGZA 1Q14A 2AMJA 5EMMA 1Y3BE 3PFBA 2D2EA 4NZOA 2BLNA 4OP2A 5TQ2A 4M9SA 1C1XA 4IXWA 3I05A 4O4LA 2GHRA 3KJNA 1G41A 4KDCA 3EXFB 2FZLA 1W35A 5THQA 4BKUA 3VJRA 5L9AA 3HVIA 3D2BA 3L7CA 1JECA 3KZKA 3NDPA 4KJZA 4M1MA 4YYEA 4DJFC 5FAKA 3GCZA 4H4EA 5I4IA 5MFPA 3MJRA 4PC2A 3I2JA 3U49A 2O1EA 3Q87B 5JH7A 3L7JA 4DFDA 2PGAA 4MZDA 16PKA 2ID9A 2PL3A 2WI8A 1A50B 4ND1A 1WEKA 3KQQA 2C57A 3GH1A 4XIYA 4K9LA 3BXFA 5CA1B 4M99A 2DVMA 1L4EA 4ZI2A 2O5CA 2HLDD 3I0MA 3GFTA 5ALYA 5E1DA 3LD9A 1Y9JA 1CIPA 1H66A 4GOKA 2R3SA 4MCHA 1SXGA 4R2KA 2JFBA 4EJSB 3OE5A 2XKKA 3M5CA 2FJUA 3HJUA 3AEKA 2VKQA 3IUSA 3N0XA 3I9V1 4AECA 3E9RA 5CBPA 1GZSA 1XQ6A 4B4WA 1VSQA 1M66A 2F3PA 3F7MA 1SKQA 1JHOA 2XAUA 4URZR 4EFKA 4KREA 1M2EA 1RAEA 3HJNA 4IJQA 1P6UA 3VPAA 1BEEA 4F9EA 1RCUA 1J2UA 5JWOA 1NNEA 3C4JA 1AN0A 3I4FA 1PD0A 4HGQA 3HMKA 3BWDD 3E05A 1NW7A 4X6UA 2C04A 1YDHA 4B4DA 3X44A 2PBFA 3OQVA 1HURA 2CWDA 2VN8A 4GVLA 4MNTA 4XD7A 2Q07A 2FW7A 2TYSB 2O2HA 3KJZA 4GPIB 4JL6A 2Q27A 1ULHA 3VTAA 2D2XA 3W6NA 1B23P 4K05A 1H5NA 2QX7A 2HSEA 3I09A 1E6LA 3GLKA 1TA0A 4XDHA 1KMMA 5E9JA 3MRXA 1QQ7A 3E70C 2QX9A 3I2FA 4Y7CA 1BJTA 4G36A 4IIDA 1WCWA 3CFYA 5KJCA 4LRYA 3CF0A 2G40A 1V45E 5GV8A 4DMRA 3ENQA 2DLCX 1Q57A 4H0NA 1V35A 1R8JA 1YZVA 2BFNA 2PN1A 3VUEA 4OKSA 3KE9A 4QNRA 3SVLA 4OHKA 3WO1A 2IPLA 4FONA 4G1BA 1H2BA 4W63A 4KVAA 3CVVA 4MVJM 2XGJA 3V3KA 4RXMA 4BO7A 3EZYA 4Q1DA 2NV0A 1ZRSA 3DAHA 4LY3A 1RYHA 1O4WA 4HI0E 3DDZX 5T57A 4QWMA 3AEQA 1I5EA 3JU3A 4IWXA 3Q10A 2ZSFA 3ZQKA 8LDHA 1ONNA 1UAYA 4F3NA 1OC2A 4K8RB 1LSOA 1IULA 2D1RA 1M8KA 3L0SA 5GMOA 3RRXA 2HYIC 4G0UA 2BCEA 3DVAB 3GLHE 2Q2VA 4YCNA 2FZCA 1E1NA 3GHYA 1Z35A 4OM8A 4PTYA 5B7PA 6NULA 5GJWC 2I6XA 1XKLA 2QENA 4R1TA 2YASA 2W6ID 3OFVA 3O3OB 4HYYA 2J0SA 1G21B 2VDRB 3QVVA 4IIXA 3EDYA 3A14A 3FGNA 3IMCA 4UJ3A 3TKLA 1SM4A 4ZCRA 5C1DA 4NOJA 3AV3A 2DJ5A 4ZT3A 1E7WA 2UYGA 1HL7A 2QSZA 3FPSA 2AI2A 2HA3A 2P9CA 4NK5A 4V0LA 3GFSA 1MVNA 1GGVA 4L95C 3X2FA 1IVSA 4MQFA 3RVJA 1C4XA 1FLDA 5IJ0B 4Z86A 3O75A 2EFCB 4EQZA 4F06A 2EKBA 4P4LA 3M3DA 4IDAA 1XEXA 1GAWA 3GRAA 4HRVA 4JUFA 5HGJA 4BNIA 3KUUA 1P31A 3ZZ1A 1C3VA 1X19A 5SY6A 2P5UA 5BWLA 2AXNA 4WXEA 1ZMRA 3VJLA 1LPOA 1F5SA 1Q1GA 4LEIA 1XRNA 4Z1OA 3ROFA 3DL4A 5JG7A 5CG1A 1U11A 4OU4A 1Y6RA 4KO4S 5GJBA 1NOJA 2MHCA 2EEZA 2FG7C 2VC2B 2WKQA 4MQ5A 1K7FB 2P65A 1QYDA 5JCXA 5HDBB 3PXDA 1HNXB 1RXIA 1V9CA 2RBKA 3M6IA 2G1UA 1T0JB 3KT0A 1GJRA 2BGMA 2V7PA 4QVGA 4JS0A 1P2VA 1GCAA 3R75A 1MNQA 4EGAA 3EC1A 4RHFA 5PNTA 4NAHA 3TZQA 1PR6A 2VK2A 1D2AA 2FP3A 1Z4PX 3T4UA 1MTZA 3EARA 2RGWA 4KE8A 4C7BA 5BMOA 2CBGA 4PQYA 5EKXA 2FMKA 4XIJA 1E9EA 4BVHA 1IOLA 2HJSA 3K9CA 4YUXA 1OUMA 3ZWXA 2WYIA 4X6YA 1VJTA 3I01A 5CDTA 2OO5A 1QVVA 4A03A 4DIFA 4AICA 2CFCA 4AO7A 2O0MA 4PXAA 3CC8A 1C8VB 3HHPA 2VCEA 4IICA 4TKLA 1X87A 4PRZA 5D3MB 5GONA 4COOA 3MN1A 4NDAA 4TT3A 5G2OA 1KPIA 5A4IS 4D0RA 3UK6A 3UOWA 1QOQB 3KKKA 1YFLA 3JASA 3GZNA 3RPEA 3WGMA 5AVZA 3SDSA 3HN6A 1GVHA 4JBLA 2I29A 4WXYB 5KAPA 1CZLA 3SS9X 4LFAB 1KJ8A 4Z4GA 2HFJA 4BFUA 5CITA 4L9AA 5J2TF 2DBYA 5LDGA 4WJLA 3ABIA 1ORRA 3FMFA 5AXDA 4RFVA 1A71A 2JI7A 3QXXA 3OCUA 4LDQA 2VHTA 4Q3KA 4B80A 4EKIA 5LIPA 1IC6A 4IV0A 4ZDKA 1V71A 4JI7B 3ISVA 1Y1RA 3BJZA 5B4UA 1DJOA 1S01A 1YUMA 4OMCA 4NRDA 4CMEA 2GM4A 3IURA 5LMNB 5IDWA 4B6PA 3WISA 2VP6A 3TTSA 4UNQA 4WZBA 1R5JA 3G68A 2ZJFA 3HJRA 1QHYA 2W4QA 2IY7A 3LCUA 3B1XA 4INZA 4L57A 1PGJA 2H07A 3PLRA 3A28A 1JG6A 4GI1A 5EE0A 2FPOA 4WK6A 3WQQA 1K6EA 1NVVQ 1D8TA 3AEYA 3A9TA 1SHTX 5EXTA 2DKNA 2RHOA 1BXGB 3E82A 1QRAA 2GYWA 1AV6A 4GD3Q 3RYCB 4QNNA 2HZBA 5G40A 5KYXB 1V25A 5HZHA 5AOBA 4C7OA 3AHDA 1QVZA 2H2GA 3JSAA 3RRYA 2BD0A 2G06A 2J9ZB 2ZRAA 3OX2A 4RJLA 5HW0A 2FSSA 4EY5A 2WTXA 3OLWA 3FJYA 3OOEA 4TV9A 2X8AA 4LRTB 4RXTA 3OZ7A 2AX3A 1TQ8A 1ZMTA 1Z8DA 2GD0A 3C3PA 3MJCA 2J87A 4MYDA 5DU2A 3AYXB 4DZRA 3INYA 4YDHB 3WFJA 1H8HD 1ZL2A 1GPH1 1OPRA 3K0EA 2BM0A 4JLAA 2SKEA 4MEBA 1AKWA 3OZAA 3I4LA 4X91A 2CY0A 2J1LA 5IDVA 7YASA 2XYQA 1KR2A 1RJWA 3CPSA 5DNVA 3ZWKA 1LRLA 4MLPA 1VCIA 3L46A 5BN5A 3W5CA 3QVKA 4CG3A 4TL7A 2BJWA 2FUNB 4LOKA 5A4AA 1Y37A 2HQOA 5F2KA 1COZA 2CXUA 2VF8A 3OKAA 1ZY2A 5K8LA 2Q5EA 4MA0A 4M8SA 2G0AA 1UJ4A 5JQWA 3NNDA 1XKTA 1J0CA 2AL7A 3CIOA 1PWEA 2PAAA 3N87A 1PO7A 3NASA 1J0BA 3QK7A 5BSMA 2IPXA 1QF7A 2W70A 1KK2A 4MINA 1EVEA 1XMIA 2D2FA 4H15A 4R1UA 4Y30A 4ZXPA 4BGIA 3EQ8A 4PAQA 3D4PA 4O3FA 3QMPA 1QQ5A 1V3UA 3PLAE 5ECDA 1S2LA 1MMFB 4KV9A 6LDHA 2X8LA 1ZCJA 4P0QB 4D4JA 1TM7E 3PZRA 1TCBA 3FPAA 1B8VA 3RYHB 2HB6A 1Z12A 2VQSA 4JSRA 4L76A 3M2PA 3SNKA 3T7RA 3ENKA 3HXPA 2JZNA 1BE0A 3PUIA 2C83A 1KDOA 4KSYA 2BGWA 1VI2A 4MVJA 3PC2A 1HWYA 1NBHA 5FOVA 4X94A 4QGSA 1ZAYA 4F6CA 5CR9A 4BPBA 4DV0B 1BDJA 1E4OA 4FFSA 3E2IA 2OO7A 1LK5A 3TPCA 4NOLA 4J6FA 2WJPA 1VLQA 1LC3A 3LC2O 2ZT7A 3HFJA 221PA 4R0MA 4NJMA 2J09A 3V42A 1EWQA 1U7DA 1W4CA 4KGDA 2IOFA 1L0BA 3FI0A 2ZBFA 4MW0A 4OSEA 8MHTA 2G6TA 3QF4B 3N6XA 4MQBA 4CT0A 2ZDQA 4CDNA 1E5XA 5K05A 4C1NA 2ZAIA 3ON5A 4J3FA 1E20A 3ZIAA 3T6KA 4FDVA 3JVEA 1RQRA 3TRFA 3UJAA 1RKQA 4YT4A 3ZWQA 5E7IA 2V0NA 1IN6A 3NEAA 4MUMA 2BYTA 2QP4A 3OOSA 2Q2OA 3PKJA 1CRZA 5HQ3A 2IIPA 2H92A 4ZVUA 4GPZA 3O9ZA 4HDKB 1C8LA 2DKFA 3UFXA 1C41A 3AVOA 1FX1A 1KH1A 1DPFA 2ZB2A 5WRFA 4BFVA 1A0OA 3NAQA 5FFFA 3CVUA 1M2KA 4UBJA 5LA6B 3GH3A 3TRJA 3CF4A 2I3GA 3G2PA 2H2FA 1BTOA 1PJ4A 3IPRA 3OZFA 1NSTA 4IKOA 4RH0A 2HKIA 4X44A 5G0TA 3W8RA 3WRYC 4N7RA 4BJHB 2ZJ1A 4BWGA 4D46A 4J3NA 3L05A 1YTLA 1OY1A 2PJUA 3LY9A 1LQ2A 3RHFA 3ZTWA 3I45A 1Q0UA 2QTGA 3GJ3A 1A7KA 1JZQA 3WGVA 1NYTA 4ECAA 1WF6A 3LBYA 3P9YA 1SK8A 4XQ0A 1ZLXA 4DM4A 1ULSA 1M2OB 2ZJ3A 5TC4A 2ISCA 3E61A 4P84A 5K20A 1CVLA 2ZSHA 1QHGA 2ZQZA 4GWLA 4QJIA 5LYJF 1VHQA 2GZ3A 3AY6A 4JVMA 3JARB 5TJHA 2DH5A 3PA8A 1USVA 4JYAB 1QIEA 4FFBA 4C3OB 2E55A 4A0SA 2QMUA 2VDWB 2MSWA 1YB5A 1J56A 1WG8A 3GLHA 4BVFA 1Z6QA 4RGQA 5HSGA 1B4DA 2OEPA 1ZGCA 4EUSA 5KREA 1SCUB 2Q5FA 1CY2A 2QPTA 3AR9A 1GQRA 5J1TB 5J47A 1KI8A 4Q3AA 1TUGA 5KYWB 3E5HA 2SHKA 1KNXA 2W2OA 5T3UA 4AKTA 4ZDJA 5BQXA 1ZR2A 4LC1A 3CLHA 4BUJA 3JRNA 2ZANA 3A36A 4MH0R 5JY6A 3F4LA 1VL2A 3T12A 1JRLA 1LTQA 5G1PA 1L1FA 4GSYA 4NONA 3OOHA 1C14A 4D45A 2GTHA 1MGPA 5HZGA 5CFMA 4NBTA 1SHUX 5C0OE 1J2RA 3ZDRA 4EPXA 3H3JA 1D03A 4KQFA 4YRZA 2WIKA 1NNSA 1S3SA 3DZHA 3OP4A 3WK6A 3OPXA 2Y67A 1HYBA 2KBFA 5E4TA 2AZ4A 5B4TA 3NHSA 4LHWA 3H11B 4JXJA 1CUDA 2BEVA 2XVMA 1QHHA 2IKQA 2QN8A 4A2WA 2FHPA 1W0KA 2ENUA 4YMLA 1BA2A 1P2GA 1H9BA 5BSKA 1RJ9B 3Q5GA 2GSDA 4F45A 1LKZA 4QU9A 1D07A 3BH7A 3OCXA 4XGIA 3NOQA 1MDBA 3ZX5A 4MEJA 2LR0A 3DVQX 5ALGA 1ONBA 2VWQA 3HADA 3UAWA 3MMNA 4KNWA 1Z0IA 1E2HA 3QKRB 2PBZA 2R8BA 4TUYA 3UAGA 3DOUA 5I7HA 3W5IA 3H19A 3NHPA 3EZFA 4LFCB 4RQUA 5FEMA 3SR0A 4QUKA 2ZCVA 3ZNPA 1WVIA 2Y1KA 3D31A 1FC0A 2AKYA 4DWWA 4JDUA 2HFKA 2GFIA 3UK2A 4BFCA 2YZ2A 2V4UA 3HMQA 2J6IA 3KFLA 3NOOA 1QVWA 2C00A 1KEEB 2GPTA 3EDCA 3QOFA 5K7SA 3UWOA 1J1UA 2WP0A 5B1IA 3IA7A 2W58A 2YJTD 2AOUB 1XMVA 3EEIA 5KU1A 1SXHA 1JQAA 2O2YA 2ISQA 3LY7A 4BTVA 3NBMA 4LF7B 2EP8A 3OCJA 1DBQA 2B4KA 1GDDA 5D00A 2Y99A 4KQKA 3HXQA 4Q1VA 4W6QA 2AMYA 4FFWA 3EXFA 4G1EB 4P0TA 1XK6A 4YRRA 4ZQFA 3TRKA 1J7KA 3QVMA 5CH3A 3NG1A 5BP7A 1JWAB 3JV7A 3TDKA 5F9FA 1FFCA 1B74A 2HIGA 2O8NA 5C37A 5EHZA 4EKNB 3RANA 2GERA 2YNMD 3K2EA 1BEUB 4ARZB 3R8XA 5E7MA 2OBLA 4WUVA 1IXSB 2HF9A 4HVTA 5TMDA 4PZ0A 3ORHA 3AVTA 5CA1A 5KPJA 1RIFA 3L1JA 1U31A 2IXFA 3WGOA 1EFHA 4YMWA 3OJEA 2FLKA 3KEOA 3VHRA 1TVKA 1U8UA 2PD3A 2VT6A 4Y3UA 5B37A 4WASA 2EP5A 2WVHA 1BWSA 1L7QA 2JBHA 2JCXA 3T52A 4CMHA 4E21A 1SVIA 1TLLA 2Q6LA 3CX3A 4HSGA 5JNWA 5KSWB 4Z8XA 2IX3A 3AUUA 5EP3A 5ICFA 5CPBA 3ZE1B 1OWMA 1Y5LA 3R7FA 3WL4A 2C9YA 5P21A 5AHRA 1NYLA 4GL2A 1XK7A 2IYZA 2PAFA 5EXDA 4X7RA 5F7JA 4YN3A 5GZ1A 3EEOA 3BWMA 1Z6GA 2RK4A 2A9OA 1LF5A 1IEVA 1RW4A 1Z26A 3ILSA 3NWOA 5J5VA 2PL9A 3IS3A 4HNSA 5CDUA 5AW2A 2VPXA 4O2BB 4OOFA 4RDCA 4FEYA 1K06A 4ZEWA 1QDLB 5J63A 3SOZA 3FFWA 1VHDA 1GSAA 4F7DA 4IBOA 4JLKA 3SICE 5K2OA 1YQ9A 3JYPA 3N0VA 3TSAA 4LCEA 4RW0A 2I7XA 4HAZA 5TMPA 2J46A 1V4NA 1JIUA 1B0UA 3RS4A 4ID9A 1OILA 1QE5A 3RV3A 4CMGA 1U6JA 2QVGA 1CZUA 5FTJA 3RROA 2C4WA 3VH4A 1SUAA 1OAKA 2FU5C 3L7MA 2IUUA 3LJKA 3OTGA 3PVSA 2CYCA 3NV7A 3TMKA 1UKBA 2V7QD 4GX2A 4CR6A 3P9CA 4G67A 5ER6A 1NYRA 4FSHA 1YC2A 1A8UA 1VE9A 3URMA 2JGNA 1T9DA 1H1LA 3LCJA 4WACA 1SQFA 2ODNA 1VPWA 1ZUWA 2W43A 4IYJA 2LDBA 1IRIA 3DVAA 3GP5A 3IC5A 3ENVA 3L49A 3L7NA 1MAUA 3UXMA 3ZZMA 4M1OA 4ASUA 1L3CA 3U26A 2WAAA 4HDRB 1YAJA 4OO3A 1YU6A 3DEHA 2GJ9A 3MAJA 1TCVA 4NICA 4CZ2A 1E3MA 1T5HX 3H2KA 3HUUA 3LG2A 3PFHA 4X1YA 2YFKA 2XKAA 4FDLA 3U5TA 4FGLA 4DJ5X 2CK3A 2HMUA 1G3UA 1CIVA 1IAVA 2BGKA 3EXHA 1BHQ1 1I2ZA 1JDUA 3DAFA 1EPUA 1ZK1A 2B35A 1L5ZA 3D64A 3OKCA 3R4VA 1M83A 3C1TA 4GYWA 2H16A 4IIBA 4LMPA 5IJ0A 1L7PA 1S1MA 2CHQA 4MUBA 2R1VB 5F1YA 4JBWA 5ALMA 3RRBA 1Z22A 2VPZA 3EA5A 1KO5A 1W36D 4X66B 4L28A 4NY1A 2FG5A 5ICSA 1L6IA 4DA8A 3L6OO 1U8FO 4WDRA 3TZCA 1Q21A 1C7FA 1ISJA 1T5LA 1VC2A 1FUKA 2WHYA 3BHJA 3HL4A 4R84A 1KPGA 3FH0A 5DCWA 3N2NA 4CVNA 5C9ZA 2OQVA 2H8KA 2I22A 4ER5A 3N8DA 3L4JA 1SCAA 3IBGA 1EVZA 4XYBA 3EUEA 3ROTA 1WXGA 5AK6A 4DILA 4KDFA 1DBPA 1FTYA 3JWGA 1BHJA 4PC1A 4X0EA 2B5WA 3R3VA 4QVIA 1C1DB 1P7WA 2J3QA 4UPVA 5CB4F 2D1FA 2HPAA 1M1YE 3EG9B 4ZJZA 4BE9A 4JYZA 2OBFA 3NDJA 1CDDA 2VSNA 1MB9A 2C5GA 5IJZA 4J03A 3UT5B 2CWWA 3MJFA 2BMJA 4HUTA 2XUZA 1PU2A 2AG1A 1DBVO 1QR6A 4PINA 2OV8A 4AMUA 1YZQA 1VSUA 5ALDA 3V97A 2BY4A 1Y9DA 4ZAVA 1HX7A 2NZVG 2R6FA 3NH9A 3SS8A 1SEPA 2FEPA 4HNQA 2D1QA 4N0MA 2COUA 5GIPE 4R6WA 5EMNA 1M5TA 1NSFA 2YN4A 2GBGA 4G37A 3WWPA 4NEGA 2EJVA 1AMOA 4K6FA 1A27A 3FMIA 4NNOA 4NXMB 5LB2A 3B3FA 3E9NA 3QOXA 2QI9F 1SBTA 1E9DA 1UEJA 3QPVA 1I9CA 5C18A 3I1JA 3M4JA 3SC2A 2LE0A 1K4YA 1EFPB 5D3MA 1ZR4A 2I7DA 4PLGA 3O5AA 4G0YA 5AVUA 2JLUA 1EK1A 2XBUA 4I55B 4Z0NA 2UUOA 3SFZA 5G0UA 2B0CA 3CG4A 2WHPB 3DXZA 3DDHA 1UPXA 1E2MA 2G8NA 3WLIA 5SY9A 4AYTA 2XA2A 3IQEA 2VSFA 1J33A 3PB3A 2PRYA 1YDFA 1H69A 4YUWA 1ESNA 1I2CA 3V55A 1CNFA 3F6RA 2ZUVA 3O8OB 4P2GA 1WUYA 2JK1A 5SZHB 3LTNC 1BQEA 1AM4D 5BMVF 2LZ0A 1VL1A 3KR2A 3L6EA 5B1DA 5G02A 5D7NA 1OX5A 2DX7A 1TB4A 2E4VA 2LDXA 4FE7A 4FKMA 4PVDA 3TD2A 4IOMA 4UDXX 3O8LA 4EEKA 2OZLB 2HNAA 4JHLA 4R2IA 2W00A 3V4LA 1HMPA 1OH5A 4IR7A 1JBKA 1SZPA 3M6UA 3QYJA 4H7DA 4WNAB 2IU4A 4Z6KA 1XQXA 2ZDGA 3F3SA 2BGRA 3JX9A 4G2TA 1Z5UA 4ENUA 3IXLA 2DM6A 3OIVA 4DSOA 1P0IA 1WZCA 4CL3A 5ADUS 4AIIA 5HQTA 4DA7A 1YJ5A 5TIIA 4R3NA 3RYCA 3LP5A 5TXGA 3PXGA 3GJYA 5GV7A 1NURA 3E8XA 2QRUA 4TWZA 3Q41A 5C8VA 4MRVA 2FDRA 4RZIA 3TOCA 3WK4A 2ZBUA 2PS3A 2OENG 5DNDA 1T4BA 5AUOB 2ZSBA 4BNGA 5DMXA 3MJDA 4N7MA 4BC0A 1U0OC 3L43A 2R79A 3K35A 3FGOA 1H2XA 1R9JA 4Y1EA 3G23A 4KQIA 1KEUA 3ZI0A 1TQ4A 2ZI3A 4W7SA 3HWRA 2DFTA 1TJYA 4NYJR 4XUEA 2ZUFA 5CYFA 3KIPA 1NUQA 4NE2A 4BLOA 1RWMA 1Z7EA 3MBIA 1NN0A 3R3SA 3N2IA 1V16A 1EU1A 5KYUA 5PGMA 3EX7C 1QTQA 4TS3A 4EY6A 1CVRA 4HLCA 2NU8A 3PEFA 4QUIA 4D80A 4FR0A 1Z6PA 4C7XA 5BNZA 3CE9A 2PSJA 3I2HA 2JL1A 2IYLD 4W6ZA 4FDTA 4IHJA 1PWYE 3ZCQA 3WGIA 1T9AA 3P52A 2Z4RA 5D3QA 2DHQA 3G9UA 4I0WB 3CPEA 4FQ8A 1QIGA 3NTQA 3AR3A 2G63A 4J94A 5EJFA 4D4IA 3HFSA 4XTRA 4YCBA 3OETA 1G20E 3KTAB 1ZESA 2X8BA 4IKEA 4J0CA 5FWXA 3TW8A 4CKEB 3NHRA 3ZD7A 2P79A 2I4OA 4PGAA 1A5SB 2JBAA 1RJDA 3IHLA 3JYNA 1Y1LA 4JB2A 3MTDA 1YZ3A 2AJ8A 3KEGA 3F73A 3EGVA 1ONPA 5LWHA 5H68A 4GMKA 3BZWA 1J21A 4HLQB 4IYRA 3TGPA 4JL8A 4QU8A 1DC4A 2AR9A 3ZWAA 2WBLC 4BNLA 5EFOA 4M1YA 3HU3A 3G6WA 3RYHA 4ER7A 3AVUA 5CX1B 5B3LA 3CX7A 1ZCZA 2NT4A 3W05A 2NV6A 4I4TB 1N5RA 1XEWX 2JATA 2XMDA 1FF9A 5H81A 1NNUA 2PGNA 3BL5A 4Q1EA 1L5SA 3O92A 3BTUA 2ODBA 4DR1B 2JJ1A 3LGAA 1JLHA 1N5JA 3N6VA 3KPWA 5DK6A 4RTRA 2UXDB 5A2QA 1W4RA 1QZ3A 4X6LA 3CLUC 1QFYA 2OD2A 1XZKA 1HDOA 2PO7A 1AE1A 1Z5WA 2OO5C 4X3PA 1P62B 1T0HB 1UK7A 2QL5A 3A4NA 4W9RA 5ERXA 3V2HA 1UEXC 3BL8A 3N76A 3QF4A 1HDRA 1T2EA 2H1SA 2VJMB 1P3JA 1JHUA 3G85A 5GGYA 1RI5A 3HB1A 3H97A 2AZMA 1BROA 2BEWB 3KNZA 3NAMA 4IPTA 5E38A 4Z2AA 4HJRA 2GEDA 2GFHA 3OH8A 4UEQA 3BCSA 4JJZA 3D7RA 4FW8A 4HDKA 5DULA 5C2JB 4J0DA 3DL2A 4QYWA 4LMAA 2ONYA 2P9QA 3PT9A 4U6SA 5KHOC 1EE9A 2IITA 2HQ1A 1E2LA 2VYVD 3JQ9A 4PX3A 3MGCA 4EABA 2N46A 4XVCA 2R6R1 4EUHA 3PC8A 5I4KA 3HXMA 3BIFA 4AUEA 1SIBE 3REGA 1GNPA 1XIVA 1R0RE 2YVKA 4D9FA 1Z5OA 4GBGA 3BPSA 4Q6WA 2AQHA 2RHGB 4AXBA 4UE6A 4HN4B 1XAIA 4OK5A 4BCDA 1ZGJA 4CMEC 1SB8A 4FR2A 2PRKA 2GLUA 2E87A 4HRYA 3CURA 4YP0A 3T15A 5E0KB 1V5GA 3RR2A 5BNTA 3NTVA 1ZM3A 4LNAA 1M2OA 4JJEA 1OASA 1T9KA 2C2HA 3N7AA 4XSVA 3UMRA 2UVQA 3BMCB 4OGFA 4QGFA 4RHCA 4IIEA 3E84A 3EY4A 3R3XA 4IDNA 1RWKA 3DBRB 3HV0A 3H5OA 3MRSA 4TLDA 3K0CA 4WSOA 5JYBA 1PKEA 2VH5R 5L3QB 3JARA 6ABPA 2J3JA 3ZE2B 1TEXA 4DLTA 2YZMA 1N77A 3KXDA 2JH3A 3G7NA 2VDWA 2Z5GA 4UM9B 4E5UA 1PRYA 1K7XB 1M2VB 3WA6A 1KOGA 1SCUA 2AS0A 2DRIA 7REQA 2FVXA 1C7RA 1SQ6A 3LRXA 4KIGA 4RLHA 1D4OA 4AN0A 4S35A 5KYWA 5KWIA 1S6YA 2PCJA 4MI9A 3F6SA 5CM9C 2B5OA 1M1XB 4ZKEA 2PMEA 2ZROA 4LV8B 4TN1A 4IV5A 4Z7NB 2OCAA 4YMIA 4OH1A 3BS4A 4P4SA 1IVNA 1Z4MA 1RQGA 2A57A 4IX9A 1E59A 1XTQA