4TTRA

Crystal structure of legionella pneumophila dephospho-coa kinase in complex with bu2
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
201
structure length
201
Chain Sequence
b'MVYSVGLTGNIASGKSTVAEFFSELGINVIYADKIAKELTSKNTPCYQDIISHFGSSVVLNNGELDRKRIRDIIFSNSNERLWLESLLHPVIRKKIEEQLIVCTSPYCLIEIPLLFNKHHYPYLQKVLLVIAPLESQLDRIVKRDHCTKKQALAILATQPNLEQRLEAADDVLINESGLSELKAKVNKLHQKYLREAKIKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dephospho-CoA kinase
publication title Crystal structure of Legionella pneumophila dephospho-CoA kinase reveals a non-canonical conformation of P-loop.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Transferase
total genus 71
structure length 201
sequence length 201
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ttrA00
1P62B 1WXQA 4EPVA 1ESMA 5JWHA 3CF2A 3K0FA 2BJWA 1ZYUA 3K70B 1DPFA 1TQ4A 1P2VA 2DYKA 2A9KA 3RC8A 4X8HA 3VU9B 2WJJA 4PPQA 3F0TA 2ZJZA 3V9PA 1ZM2A 1QHNA 1R0YA 4DLWA 1Z5ZA 4QJ5A 1N5IA 4URYR 1RPZA 1DVRA 2BM1A 3PV0A 4KYIB 2A3RA 1QRAA 2OSBA 1RYFA 3GEHA 5EZ6B 2WKQA 4HLQB 4YMUA 5FPHA 2MSCB 1ZRHA 2MMCA 3KB1A 1MABA 2J41A 1W0KA 1X6VA 4DEYA 1KMHB 5C2JB 2IWRA 3R20A 1XMJA 4WAUA 1X8KA 3U44B 1F3OA 2X2FA 3PUWA 5FPSA 5LD2B 1ZJ6A 2NO7A 2FSHA 2LKCA 1XPRA 4HEJA 1EFUA 1VCNA 1XMVA 1MOZA 4PAQA 3F3YA 1CTQA 2JASA 4I4LA 4M8NE 4EDHA 2W2XA 4C30A 3KKPA 2O8BA 5LB2A 4Q9JA 4BZPA 1U81A 2QENA 3W6NA 4BQSA 3MFYA 3FDIA 3PENA 4D6PA 4LJAA 3AVXA 1RZ3A 1ZM4A 4KSCA 3TBKA 5CJ2A 5EQTA 2JLSA 5JWRA 2ZVQX 2ZANA 2AD1A 2CL0X 3D6TB 1NMYA 3L0IB 3OE7A 1Z0AA 4P4SA 4M0LA 5KDLA 3KJHA 3FFBA 2IYQA 5C4GB 4AYXA 1QHHB 1ZIOA 2V3CC 3CZPA 2V4ZA 2VP9A 1T3SA 3M4YA 1NN0A 4W7SA 2C8VA 1Z0FA 3AVQA 2C96A 2AKYA 2AWOA 2Z83A 2ZJ8A 4Q1AA 3EX7C 2C98A 3RNLA 3FGNA 3KX2A 5JS7A 1P7CA 4QHTA 3HDTA 3BWDD 4DWJA 1E2IA 4OQXA 4A6XA 2ZUBA 1S4QA 3SJZA 3ZZTA 2NOAA 3IQXA 4F4CA 2P6UA 3N5CA 3H86A 3CWQA 4HDQB 3HPQA 3QI2A 3IPXA 1E2QA 2W6IA 1U8AA 4DDVA 2Q9CA 4OI2A 1J70A 1QVRA 3KQUA 4EJSC 1Y63A 4LHVA 1E9CA 4C9BA 3U7GA 2H5EA 1IN7A 1IN4A 1Z0IA 3PJRA 2NO1A 4Q01A 4HDOB 1NKSA 2R9VA 5DHAA 5AJZA 4JS0A 4RY2A 2QQ0A 5SZHB 2FGKA 1Z07A 4TLDA 3I62A 2NQ2C 1JQLB 1CJMA 2OILA 4LHWA 3U7EB 4Z54A 5KDOA 1AQYA 4KI0A 1FP6A 1KJWA 4XWKA 2QA5A 1SXJC 3CH4B 3DM5A 1SXJD 5KYKA 1N3BA 3SJBA 3DMDA 3MJHA 4BLTA 1VG9B 2XSZD 1D9XA 2I3BA 4RD3A 2J59A 1DAEA 1DTSA 1SVKA 2G0NA 2GXSA 4PPGA 1WB9A 3FHTA 1OPXA 4XVRA 4MKIA 4N3NA 3TAHA 1AIPA 3ASZA 1ZVQA 4TL9A 2EWVA 2QMOA 3RS2A 5M04A 1ELOA 3ZH9B 2CNWD 4ZO4A 2OCBA 1ZUHA 4DCSA 1OH8A 2OBLA 4N0EA 3QEOA 3BXZA 3UKDA 5JI2E 1IM2A 2C9CA 5F98A 1T3HA 5DLQC 4Q1BA 1GL6A 1MKYA 4KXFB 2BV3A 1UDWA 3E2IA 4HYYA 1KI6A 4Q4LA 3FKQA 1BOFA 3GLIA 3QBVA 3SYLA 3KQHA 3MAAC 2QBYA 1TU3A 3TUZC 2QAGC 2B7BA 3RS4A 3VR1A 2JLXA 4M4SA 1AZSC 3GJ6A 1CJVC 4NYMR 4TT3D 4PTLA 2CCKA 3UXMA 4LV8B 5FOXA 4DCVA 4QGFA 1F2TB 1Z0JA 1BKDR 4H1VA 3VX4A 2WPDA 5JBQA 4RZXA 3H84A 4NCNA 1UBEA 2IA5A 3UIEA 2E87A 1GP2A 4XTCS 3NBFA 1N6IA 1XU4A 4X8MA 5CYPA 5G41A 4NYIR 3NDPA 1AJEA 4MRNA 821PA 3ETLA 1UEIA 3CH5A 1EFRD 4BLRA 3LX5A 4B3GA 3TVTA 1P6XA 3P4YA 1KZ7B 3ASYA 4ARZA 1Z6TA 2GK6A 4S2EA 4XWAA 5JS8A 1E96A 4TYNA 2IHYA 1P3JA 4JL5A 3VHLB 2QMEA 4C0QC 5JEDA 4FMCB 5GJVC 3GFPA 4HB4A 1CS4C 4BFWA 1KY2A 2O8CA 1X1SA 1TEVA 4D4KA 4M1YA 3EC2A 1F48A 4M1KA 4OHWA 1Q1ZA 4FXPA 4KJZA 1TL7C 1E79D 5EP3A 3RVBA 3JZMA 5TB5A 3SHFA 3RS5A 1VHTA 4N0DA 3CNLA 3AVPA 1KSGA 4JL6A 3KL4A 2O8EB 1A2BA 4IDQA 3VHXA 1TAGA 5D3QA 2IWHA 1RIFA 3U61B 3SQXA 2D2FA 4RZUA 4C7OB 4EJSB 5CM9C 4MDFA 2BEJA 3MLEA 4HAXA 2FA9A 1E9RA 3P32A 4KHZA 4Q48A 2D2EA 2GETA 4S35A 2WSMA 1DS6A 2V1XA 1VIYA 4PHGA 4UXJA 4Q4HA 4AC9A 3U4QB 1Q21A 1KDOA 4K81B 5HPYB 4Q03A 3RABA 5EXTA 3FOZA 2VHUA 3GPLA 1CR1A 2VO1A 1D2EA 2ODBA 2F3RA 4LYAA 5FOTA 1JPNA 2JIZD 3A4LA 1XCPA 5CB6A 4MYUA 3F8TA 3IGFA 3AGPA 5CLQA 1BS1A 4B34A 3TSWA 1ZUNB 3GLGB 1ZCBA 2ZXUA 3CF0A 3VR5A 4QC2A 5DHFA 1HYQA 1XJCA 3FMFA 3U7HB 4CF7A 2BHRA 5EXPA 1E9BA 2BWJA 4QBGB 5DSZA 4O2RA 4DKXA 3AVYA 1ESNA 3CKLA 2IEZA 3K0AB 2QP9X 2WMOB 2WJGA 2Q3MA 4OQNA 4ABYA 1J2JA 3GJ4A 5FH9A 1ZD8A 1WMSA 4RCZA 3MUFA 3A8TA 1CR2A 3VR4A 3T34A 1E9EA 2QTHA 2VP6A 5DIFA 2AK2A 1W0KD 3T1VA 5K8UA 1IXSB 3FB4A 4YQFA 4DIDA 2R62A 3ZLJA 1EK0A 4M1TA 2GZDA 4M1MA 4WXRA 4UNNA 5CYOA 3CIOA 3GLHA 1VYVA 2QTVB 4DB4A 4Y0AA 4BRWA 5F3WB 3I72A 2C9OA 2FFQA 3I3SR 5EE9A 4NH0A 3PIRA 3BH7A 4PANA 5EE3A 1TNDA 1WCV1 2ZSEA 1TEXA 4JT2A 3GJ7A 1T0HB 1S2MA 2GXUA 3CF6R 5CK5A 2ORIA 3EWAA 4A0GA 1WA5A 1MR3F 4OK5A 2D62A 1E0JA 3KFXA 4EKDA 3P27A 4ZDJA 1AGRA 4GI7A 1K5GA 1P2UA 2ZJBA 3BFVA 4G5OA 3ZVLA 4TL8A 2PJRA 4LYHA 1G3QA 2QORA 2YV5A 2V9PA 5FR1A 2JA1A 4A2QA 3BH0A 1RRGA 2QN6A 4OHVA 1II9A 2UZ3A 2XTZA 3T1OA 4XIGS 4HZIA 4ZI2A 3PG5A 2V54A 1W7AA 1WF3A 2VPPA 1EFTA 1UKEA 3CUEF 5HTKA 3A1WA 3OHMA 4LYJA 1GILA 2PX3A 1GNRA 3QSYA 4P33A 2PZFA 3OAAA 3WBJA 4A8JA 4EFLA 2ERYA 4MDEA 2JLRA 4P0TA 1TF5A 1XMSA 3N2IA 3NG1A 4ACBA 2C99A 4CRWB 3QPUA 4BPBA 4F92B 1EWRA 4Q21A 2FH5B 2W6ID 1OXVA 4LSGA 2OZEA 4XOIA 5FTMA 3IILA 1Z6YA 4GFDA 5A0FA 3WMGA 4A4DA 2AXNA 3NVAA 4MRRA 2CHVA 1E4VA 1G8YA 1UBCA 1B23P 4EAQA 4A6PA 3L82B 5HE8A 4CEJB 2ODNA 1DE0A 4ZDKA 1II0A 3LBHA 4RJLA 5BYKA 1KI8A 2CJWA 1GNQA 1BMFA 1NBME 2JJ8A 4JVSB 3HYRA 2VF8A 4F7WA 2X1VA 1XTRA 2ZRAA 1ODFA 2JJ2D 3MWLA 1RKBA 2GA8A 5SZIA 3ZZUA 3FHCB 2CHGA 2FFAA 3K53A 4JL8A 4E07A 4JMPA 3VQTA 5KHOC 3K0FB 3X2SA 2AFHE 4NCIA 1VG1A 1XTKA 5H68A 2OFXA 5GVRA 4XSHA 1JECA 2OFOA 2J3EA 2KWIA 3AEZA 3TKLA 2F1JA 2GTPA 2FSGA 4C0SA 2IYXA 1R0WA 2QMHA 3CWZA 2YWFA 2Z4SA 1DG1G 1G20E 2WM9B 3N2EA 3UPUA 5G40A 1AA9A 3HU1A 1OXSC 2PT5A 1D2MA 5FBLB 4O3MA 2NTYC 1JALA 2VP4A 3BB3A 5J47A 1EX7A 2GVDC 4PZYA 2H7VA 3O8BA 2KBFA 4IRUB 5LPNA 3TMKA 3W5JA 2OBNA 3KTAB 2ZYVX 1ZW6A 1OYYA 1N0VC 1XTSA 2WTUA 4AKIA 4Q1FA 2W0MA 5KNCA 2BOVA 3FMPB 4GDFA 3HYTA 2GJ8A 2GCNA 4ACAA 3OIUA 3VFDA 3NH6A 3A1UA 1V5WA 2GBLC 4Q4AA 1E32A 1JQJC 3SNHA 3FKSA 4DDWA 1E2EA 4KLNA 5K8IA 5KSOA 2WKPA 5FUVA 3LVQE 3GJ5A 3KKQA 3DO6A 2QI9C 4C4PA 2NZ8A 4I1VA 1C1YA 3JZAA 5EUQB 5H8WA 4BLPA 2D7CA 4RD6A 5GVSA 5EE0A 2QM7A 2ECKA 1EGAA 1N6LA 3CW2A 2OEPA 3H2YA 3MJRA 4WBSA 4DJTA 4XTRA 2G88A 3K09A 4NE2A 1ZUIA 2QE7A 1CF4A 4UQOA 2IXFA 4AG6A 4D80A 4HLCA 3ZGXA 1CEEA 2ZE8A 4JSTA 4C3ZA 4URZR 1GNPA 4PAOA 1COWA 2IYRA 1FMLA 5FI0B 1XEWY 2VYFA 3I4LA 2L0XA 3QKRA 3HU3A 4OL0A 1OYWA 1ANKA 4OK6A 4B2LA 2AN9A 2OUKA 1E9DA 4NONA 1HTWA 2GAOA 1R6BX 4LRWA 3SBEA 1U9IA 1PUJA 2OFWA 1G4AE 4Q1CA 4Q9IA 4A2PA 2DWQA 2CHQA 1L4UA 4TMVA 1WBBA 3QKSA 4JVNA 4JKIA 4FMBB 4JLMA 2A78A 1KSJA 2QL6A 2R6AA 5KDDA 4OI4A 1ZCAA 1FMJA 4NHOA 3TQCA 221PA 3CM0A 4Q7LA 3UMRA 1NY5A 1T3LA 4PC1A 4UNRA 4DT1A 3D3QA 1Z0DA 4MKHA 3CNOA 3N70A 1GM5A 3MRSA 1KDTA 2DCUA 1TU4A 2ONKA 1T91A 3BE4A 1JXOA 3QY0A 2YC4C 3ZZ0A 5BW8A 4NYJR 2NO0A 4D82A 2HCJB 1K5DA 4PR0A 2O52A 4Z1MA 4XVUA 4DLZA 4GOJA 4DCNA 1I4DD 2DWOA 4URVR 4KLZA 1M7HA 3BH6A 3LO5A 3ZVRA 1OW3B 3VKHA 3RC3A 5AWFC 3RAPR 1IY0A 4MYTA 4US0R 2W0SA 1KTVA 4M9ZA 1E2LA 1VHLA 1E0KA 4IKEA 3CNNA 5GJCA 5G3YA 2IS6A 1HUQA 2QSZA 1YJ5A 4IW3B 4A9AA 1I4TD 5AUNB 1KY3A 4HUQA 2JLUA 3ZVMA 1DO0A 3R7WB 3KDSE 3LW8A 1KO7A 5FPKA 1UFQA 2B6HA 3RRZA 4BZQA 2QBYB 4EIWA 3SFVA 4HAVA 3BIFA 1R8QA 1QHSA 2JJ1D 3LFUA 5CK4A 4AKGA 1GL9B 1VKJA 4NL4H 3VR2A 1IJEA 5JSZB 2V1UA 2ZRLA 1NVWQ 3WBKA 2GZHA 2YOHA 4FWIB 1G4UR 4G01B 1OB2A 1Q1BA 2IYYA 5HR5A 1LS6A 3ZIAA 1F2UB 3RS0A 3T5DA 5K8TA 3LQRA 2XGJA 2OESA 2ATVA 1AK2A 3LAWA 2P6RA 3LBIA 1XTQA 4UNQA 2CEAA 2RMKA 3D8BA 1SULA 1A4RA 4M9QA 1T4GA 3RHFA 4IVQA 1G7CA 2EFHB 2QNRA 3ZDQA 2PMKA 4Q9KA 4WIAA 4W9MC 2CVFA 2ZJOA 1GG2A 5G53C 4DB2A 1CJTC 1M74A 3V4RA 2F43A 4ZCMA 4FI3C 2EFCB 4AG5A 1B0UA 1JNYA 1U0JA 2Q3FA 1S3GA 1EG7A 4OJKA 4G0NA 1S96A 3RANA 5FBVB 2GCOA 1PJRA 1P73A 3R9WA 3RYTC 1CXZA 3ZS8A 4M1SA 1ZIPA 1XBTA 3VNUA 2DHRA 4UXHA 2EFGA 2ZE6A 5AJYA 3W9YA 4C0HA 2O0JA 4L9SA 1EFHA 4PQRA 1P61B 1QDEA 3AF4A 3B1VA 1II8B 4PXAA 2QG6A 3LRPA 3G82C 4MUAA 5FTKA 3UK6A 3VR3A 4PSVA 1SVSA 3LY5A 1SKYB 3VKWA 3ADBA 2ZSAA 3TR0A 4LBYA 3LNCA 4TQUS 3AF0A 1JR3A 2RGDA 5B58C 2Z4RA 3B9QA 3HR8A 4WA7A 4QNMA 2A5YB 4FMDF 3VX3A 3C4JA 2G83A 3A36A 2JLQA 2HLDD 1A7JA 1KI3A 1E2NA 3AGQA 4IFBA 5FBQB 1N6RA 2WOJA 5J4YA 1W2GA 1W46A 1NL3A 2RGGA 4LJ8A 3GJ3A 2FZ4A 4HB3A 2FFBA 3FMOB 4CEIB 3L0OA 1E9AA 3EZ9A 4OHXA 3SBDA 3HPRA 5IHPA 3SEAA 1G5RA 4OQMA 4EFNA 2XNSA 3QENA 5DI3B 3EAQA 2FDCA 2ZYTX 1W0JA 3ZQJA 5FPTA 4TYYA 4AKEA 1G3RA 3E5HA 1HQCA 1KK1A 4BFZA 1WP9A 2GJ9A 3WY9A 1ZNZA 3DOFA 2WAXA 1K8RA 1TF7A 4PAMA 2XX3A 3ADDA 2ZYUX 3LXXA 5CLLA 4BEJA 2XZOA 1U2RA 3A1TA 3QPWA 5DI9A 2YWEA 3I61A 3B78A 4KO8A 4V03A 5DE3A 4CT5A 1KAOA 3M6AA 1CP2A 5SZKB 4TWZA 1N0WA 4B6EA 3AKDA 1ZNXA 1GDDA 1GITA 3FKSD 3UG6A 2C03A 2J5XA 4MKGA 3PUVA 3AVVA 1FX0B 1HT1E 1W1WA 4D4MA 3OZXA 1AQUA 1XTIA 2FSFA 3LH5A 3PEYA 3WYAA 2GESA 1Z29A 1OIXA 2IF2A 4M53A 2JDIA 2NPIA 2WZQA 4MITA 3TW4A 1RRFA 2G1JA 2RHDA 2VHJA 1A5TA 2NO9A 1FUKA 3A37A 4QJ4A 3BK7A 2F1HA 3K0SA 3W3AA 3T61A 3BBPA 2FOLA 2YC2C 1O87A 1M7BA 2ZUCA 3K09C 3I73A 5L3SA 2A7QA 1NMZA 1KOFA 4LGMA 4AIIA 1NLFA 4DCTA 2W2VA 1XRJA 5IK2D 4RD0A 1US8A 5FI1B 2JGNA 2VSFA 3LD9A 1T6NA 2DY1A 5KTYA 1GTVA 2ZRGA 4URUR 2IK8A 3T1QA 1COWD 4CEHB 3SE0A 4JIMA 3TJZA 4I99A 4B33A 1XX6A 3RLFA 3REFA 3Q7QA 1D8TA 3QNUA 5EJEA 3KZ1E 2A5GA 4IEIA 3S1AA 3AVOA 5GJBA 1U9IC 4DLVA 1M6NA 4LJ9A 4HAYA 1RE0A 1A1VA 2QZ4A 4EFMA 2ZUDA 3QVVA 3QKTA 3GLFB 2WV9A 2IBMA 3WMEA 4HSEA 3K9HA 3TIFA 3THWB 1M34E 2HYDA 3AVWA 4E03A 1GWNA 1NBMA 2QGNA 1QG2A 5CM8B 2EYUA 2NGRA 4Q66C 4RFSB 3TQFA 1CKEA 1OKKA 5AUOB 4RZ3A 3WRXC 2J1LA 4JLPA 3CPHA 1T8UA 3CRMA 2CLCX 2CK3A 4Q18A 1HQYE 2ONJA 2WMNB 1VG0B 1YVDA 2K5UA 4GT1A 1T0JB 3OFNA 3LLUA 5KNDA 4ILEA 5GJWC 3THXA 2BCGY 2WJYA 2FU5C 2ZS9A 2IYUA 1MO4A 4BUJA 5DN6D 5BWMA 5J4VA 2IYTA 1JEEA 5HE9A 2WAYA 3TVDA 1SVMA 4P32A 3L0SA 3EIHA 1XFAA 3CB4A 4OK3A 1IXRC 1H8HD 1JXMA 4GNKA 2ZU6A 1YR6A 2YWHA 1VYUA 3AVUA 2IW3A 1W4CA 1JJ7A 2YVUA 2CE2X 3B85A 4POAA 5B30A 5KOYA 3SI7A 2FEOA 2BIFA 4OI1A 4FCWA 1OIVA 1I2DA 4DC9A 1XEXA 1UJ2A 2SHKA 5E4FA 1M2OB 5D3MA 3C5HA 2MMGA 1KDRA 4AD8A 1OE0A 1G21E 3W3ZB 2DPXA 2EFDB 4BWYA 1HY3A 5KO2A 1X86B 3U6BA 4TZ6A 3QF4B 1KKLA 1QHYA 4V0NA 3GFOA 1DAHA 2KSQA 4R2HA 2ZSBA 3WYGA 4U7DA 2CE7A 4GZLA 4EPWA 3GLGE 4Q00A 3ZIAD 3HJNA 2GEUA 4GBMA 2OT3B 3I8XA 2BMEA 5KPJA 2Q21A 3DHWC 3NEJA 4HZUB 4Q4JB 2IS1A 2O8FA 2GILA 5HCNA 2IT1A 1W36D 4URWR 3A1SA 1R5NA 2WJVA 2QT0A 3NBYC 3JVVA 3WHKA 1BYUA 4ZIRB 4B32A 1E1QA 3EARA 2BDTA 5GADl 4BE7B 4KFUA 1HH4A 1TUIA 4GOKA 4PO8A 1C4OA 1XNJA 2ZITA 5J4HA 3DZDA 1X1RA 1YR8A 3QXJA 5TVKA 1X8LA 4W5WA 2IUUA 2XXAA 1YHNA 3L8ZA 1Z08A 2IYSA 4BASA 2PL3A 1N5LA 1FQKA 4TZ0A 1XXHB 1GKUB 4URXR 4A0HA 1VYTA 2J0SA 1E2FA 3RSOA 3DKVA 1KK0A 3MWYW 2A5JA 3ZD7A 2XJ4A 1G16A 2FGJA 1Z6XA 4A15A 4BRUA 1J90A 3AP3A 3CRQA 1E9FA 3BORA 3ZYCA 2NIPA 4DUGA 2FWRA 3GD7A 1GAJA 2ORWA 3QXCA 1LW7A 3EW9A 3K0CA 1YU9A 2NG1A 4ZKEA 4G5GA 3LX8A 3PUYA 4FCVA 1TUEA 2YOGA 4KFSA 3DM9B 2G3YA 1GVNB 2H8KA 2V7QD 2ZR7A 3FYHA 4KVGA 5FL7D 4TSFA 3EPJA 1N25A 3TSZA 4R9UC 1XPOA 3KKNA 2RAPA 1UM8A 5A4JA 4EPRA 4JLOA 3KUDA 2DB3A 4YMSA 2VP0A 3FPAA 1VDZA 2R6FA 1NSTA 2BVNA 4HB0A 4A0FA 1N6PA 3NIBA 4XJXA 4NCJA 3AH8A 2HJGA 4TLCA 3R9XA 1JR3E 3ADKA 4TYPA 1HT2E 1RJ9A 1AZTA 3X1DA 3K9LA 5FR2A 3RRYA 5DYIA 3U3MA 2OLJA 5KNBA 3SZRA 1SXJB 3VTKA 1F60A 2D3WA 4KODA 4MGKR 1G8GA 2AD5A 2QUZA 2R8RA 3X1YA 1XF9A 3IDQA 2C77A 3B2EA 2GK7A 1W0JD 1OV4A 2V55B 4I81A 5FBWB 4FINA 4C0AC 1AS2A 5CIQA 4EQ6A 2QT1A 3ADCA 3REGA 2WJHA 1R7RA 1UBFA 1NVVQ 3D31A 4HAUA 4UJ5A 5UKDA 5BN5A 3G0HA 2BC9A 1L2TA 5BN4A 3THYA 2O8DA 2ZRHA 3CPEA 1RW4A 1IN5A 4RCYA 2REBA 3CBQA 2AFIE 3NXSA 2Z5FA 3Q5EA 1T8TA 3ND8A 1FFHA 2VIIA 4DLSA 4JLBA 2ZSDA 3X1WA 4OBEA 2P5TB 3R8CA 1NMXA 4QHYA 3TR5A 5JZVA 5FUYA 5FUWA 1G5PA 4HUTA 3ZD6A 1S9HA 2QAGB 5L3RA 3GEIA 1DBSA 5L3QB 3QXXA 3VU9A 2GNOA 2D06A 2OCPA 4KV9A 4TQ9A 2P65A 4FCTA 4M9SA 4LHXA 4E09A 5HZKA 1NN1A 3EPKA 1Q57A 1FP7A 1W4RA 1YQTA 4IOMA 1E69A 2G1KA 3EC1A 2JDID 4V0KA 1IN6A 2PT7A 1G3MA 4KVAA 2B7CA 2XITA 3UWKA 2J0UB 2VA8A 3B60A 1KMHA 1E3MA 3FHOA 5FL3A 1OFUX 4OQLA 4DSNA 4DLRA 3E1SA 4QM6A 2HCBA 1AN0A 2HF9A 2JATA 3OE7D 4JYCA 1XPUA 1N0UA 3B7GA 2ANBA 3PEVA 1GRQA 5TY0A 3QVUA 4QGGA 2HJVA 5TMPA 1VIAA 5FTJA 4DHEA 4L5BA 2OO7A 3T15A 5JMTA 1FTSA 2VHTA 4IXMA 5HCIA 2YNMA 4QFMA 2BM0A 4H1UA 1A2KC 1DEKA 5CITA 1FPMA 2IYWA 2PX0A 1G8PA 1QZXA 2CL7X 3I92A 4C2TA 2WWFA 1V43A 3B6EA 1P2TA 1OJLA 3T12A 5L8VA 3TK1A 2JLYA 1GRRA 1XD2B 2QGZA 3DOEA 4XH9B 2W6JA 1UKVY 1TPZA 2ZR0A 4LJ7A 5AR1A 1IHUA 3KQNA 4B35A 4TMXA 4E22A 1MV5A 1QHHA 2CVHA 2VTKA 1NBMD 3AF3A 4DLUA 5DISB 5BXQC 4HLDA 3WHLA 3BB1A 1J7KA 2O0HA 1OKKD 2VHCA 1Z22A 4Q47A 4ITRC 4QGHA 3VMFA 1QHIA 2BCJQ 3MWJA 4B3DA 1ZD9A 3EZFA 5JCZA 4A36A 1R0XA 2FN4A 5EE5B 3KUCA 4QBHA 4B43A 1CR0A 3Q8XB 3A1VA 2CK3D 1OHHA 1GRNA 2AWNA 2XTNA 4LBZA 1E99A 3TAUA 2WVJA 3OFND 2W83A 2OAQ1 5E7JA 4G5QA 2AR7A 2WICA 2RCNA 2WIBA 1R10A 1E0SA 3W34A 3IIKA 5AJWA 5JHGB 2P6NA 1XTJA 2OCAA 2XEXA 2HEIA 2R2AA 4TLBA 2J87A 1KHTA 1KNXA 3Q3JB 1OXUA 3EIEA 2ANCA 3SYNA 1KJYA 2HDNB 4XSGA 5E7IA 3Q85A 5ANRB 4C0JA 1KSFX 1KI9A 1YRAA 4BFYA 3EPHA 5F9FA 2QMUA 2VH5R 4V0OA 1OFHA 4YMWA 3VAAA 2F6RA 4PQYA 2QROA 1ZNWA 3QIAA 1MABB 3LW7A 4MQBA 3PCRB 4DSOA 2X2EA 2QSYA 1Q20A 2EQBA 1PUIA 3UMSA 4D25A 4L15A 4MRVA 1QHXA 1Z8FA 1XZQA 4LJ6A 4B6FA 1D6JA 1IAQA 2BMFA 5KSYA 2YINC 4HB2A 4JLDA 3H0KA 2A30A 2YZ2A 4UXIA 4MA4A 2O8BB 1U8YA 1LFDB 2IC5A 2WPDD 4DXAA 2WWYA 2CL6X 1R2QA 4BLSA 2NMVA 3AB3A 5E7MA 1E1QD 3P26A 5EXSA 2ZJYA 3QJYA 1PLLA 2UZIR 3OEEA 1U90A 1Q3TA 3B82A 4YLGA 5TV2A 3PUXA 1G17A 1ZM9A 4P4SB 4G3XA 3T1TA 2H18A 2X19A 3THOA 4FW9A 4LJ5A 3IPYA 3SJAA 2OHFA 1F2TA 1QHGA 1X8JA 2ZAOA 1ZAKA 3QPVA 4BFVA 5TARA 4BFXA 4Q9LA 1NG1A 2YYZA 3L43A 3KXLA 4TTPA 3V00A 4PSKA 4DLYA 3KXIA 1RRCA 3IEVA 2QP4A 1J8YF 2RGCA 1UKZA 3DVLA 2W00A 2WIAA 2FX3A 1GFIA 3TGPA 4DUGD 3FWYA 4DIEA 2XNDA 1FW6A 3K0CC 4M22A 2EVWX 3OIWA 1JAHA 3LXRA 5KU1A 4C0BA 1L8QA 1I4LD 1YRBA 1YZGA 3OEHA 4M2LA 3AF1A 5EP4A 4BZXA 2C9YA 2J0VA 2VF7A 1Z63A 1NLYA 3HWSA 3O47A 2QY9A 2ZRMA 2FFHA 3K9NA 4B3FX 1Z2CA 3C5CA 3SJCA 2ZQ5A 1W2HA 1DAMA 1IBRA 1M7GA 3ZJYA 1E1RA 3UATA 5B57C 3I5YA 1KO4A 3BJIC 1E6CA 1BH2A 5C1BA 4TLAA 4NP6A 4C7OA 2H92A 3NBZC 4FMDB 4EJSA 5SZJA 3SYKA 4D2IA 4R98A 2UKDA 2C78A 2VQSA 1G1MA 2KB0A 2ZTSA 4FD2A 4GZMA 2XB2A 2PLFA 1EXMA 1YKSA 3IKJA 2ZI9A 3U4QA 1UKYA 5BYJA 1SKYE 3FTQA 3C7KA 5FFMA 1JR6A 4F91B 2BBOA 1IY1A 2IHBA 4PFSA 1KI6B 4G5SA 2WWGA 1OT3A 1D2NA 2QPAA 2ZETA 3KKOA 3GLIB 4UJ3A 1WBDA 4Q02A 1KNQA 4D81A 1PLKA 3GLGA 3K70C 2ZI7A 3K70D 1N5JA 2HYIC 2AK3A 2G77B 1ZC4A 1G5TA 2P0EA 1NI3A 1RYHA 1YR7A 4XWOA 3IO5A 2GVZC 4MGIR 1TADA 2C5LA 1ZU4A 2Q3HA 3K0AA 1YZTA 3OIYA 4KAXA 3ONWA 4GRAA 4B48A 4EPYA 3K8YA 3U6KA 4BFTA 3MWKA 3IO3A 2QPTA 1CRPA 2H57A 2J7KA 5DH9A 4IDOA 2J9RA 2YHSA 4R7ZA 4B71A 2Q9AA 3ZQ6A 2GF9A 1OXXK 3IBYA 3KKMA 4JBXA 4O0MA 4TL7A 3KQLA 4D4LA 1KI2A 1SVLA 3PR1A 4DCUA 2PZEA 3LLMA 1LV7A 4BLQA 4XD7A 5LD2C 4MRSA 4ARZB 2OAP1 3MD0A 2RKOA 4IXNA 1G9XA 1LF0A 4TT3A 1S1MA 2BEKA 4Z8XA 2MSEB 1E0AA 1KO5A 2O8CB 1XEWX 2WSSA 3W6PA 3RWOA 3U5ZB 3IIJA 4IHQA 3AP1A 2ZJAA 2ZI3A 5AJVB 2ZREA 1CU1A 3DMNA 4A8JC 5HKKA 3OAAD 2W58A 4LPKA 1KK2A 2FEMA 3AKCA 4JJZA 3ECCA 2WJIA 4I1SA 3KXKA 5JI3E 1LTQA 1NP6A 5H1YA 4ZKDA 4TYWA 4LV6A 2W6JD 2G9NA 3WXMA 1NJGA 3AV0B 2C95A 3CPJB 3BFXA 3BS4A 1SZPA 4LJYA 1P72A 3L0PA 5CIWA 4A0RA 4ZI3A 1NLZA 3DPUA 2Z6VA 2Z0MA 4X8LA 1FNNA 3CRVA 3FFAA 3WMFA 3RWMB 2ZAMA 4Q4HB 1R5BA 4OYHA 4UNPA 2OM2A 1TX4B 4OI0A 1P9NA 4YXWA 2ZM5A 4U00A 3IBGA 4CT4B 2F9MA 1BMFD 4LCBA 4JKYA 1OHHD 1WDTA 3TUJC 2A2ZA 4BFSA 1OH7A 2XZPA 5JFGA 3AKYA 3CRW1 2R6CA 5E95A 4HAWA 4B44A 2PCJA 1U99A 2ZI4A 421PA 5CB8A 3SC3A 1DAKA 4NYMQ 3U3KA 4TMZA 1XEFA 4O25A 4Q7KA 3H1TA 3EZ7A 4LOAA 2IF0A 3QKUA 3M0EA 1U98A 2VBCA 4GMXA 2OG2A 4WVFA 3NBXX 1EX6A 3LDAA 4WW0A 1L4YA 4LK2A 1S9DA 3GLFE 4CEJA 4QJ3A 1G19A 4MGYR 2F1RA 2ZI6A 4PHTA 1BIFA 1W47A 4NTZA 4NYIQ 2JLVA 4PX9A 4US2R 4AI6A 5TDHA 2FF7A 3NH9A 2JIZA 5IT5A 2BBWA 3NTUA 5BQ5A 4UNSA 4O2LA 2XOKA 3W8RA 1SKQA 2CMKA 1GKIA 2ZSFA 4GL2A 4IVPA 2QEQA 4YDHB 3PQCA 2ZRNA 1G18A 4ERNA 1Q1EA 4RZ2A 4OJQA 4MYCA 1Q1QA 3GLHB 3KJEA 5FPYA 3TLXA 1KO1A 3Q9LA 1TF2A 3U3RA 2BMJA 2FG5A 2ODEA 1DAFA 4GMDA 1SHZA 4LYFA 5ELXA 3A58B 4Y0VA 1BO6A 2WOOA 4G5RA 4CYMA 4DRZA 3RSLA 3D7MA 4NPHA 2ASEA 1JBKA 2JLWA 2WWIA 4TMTA 2D74A 2ZRPA 3KTAA 5JJKA 3OEED 4KCGA 4WZ6A 1CULC 4IJMA 3QBTA 2FE4A 3TUIC 1DADA 4ESHA 3J81k 1KKMA 2QE7D 4RD4A 2I4IA 2OV2A 1G8HA 1Z83A 4US1R 4I1UA 5IRCD 4JLNA 3SHWA 4V02A 3P4XA 1W4AA 4C0KA 2F55A 1HE8B 4P31A 1E2DA 3Q7PA 2AX4A 1NRJB 1FQJA 4FN5A 4Q9HA 1KMQA 4A8JB 2JLZA 1RC8A 1PZNA 2FMXA 2AXPA 2EFEB 3KJIA 4Q19A 4Q5IA 2AHOA 3GFTA 4EPXA 2XNDD 4OQFA 5EZ5A 2HT1A 4AYTA 2Y8EA 1HURA 1KIMA 3BERA 4NDZA 3P20A 3SR0A 3PEWA 3AM1A 1DARA 5IDVA 3OEHD 1CJUC 2W2TA 3KJGA 4P3YA 4EUNA 4DBLC 5JJIA 2OCYC 1YZQA 3CR8A 1U0LA 4QRHA 1Z28A 4PO9A 4LZZA 1QG4A 5JLJA 2BBSA 2IUSA 2CJWB 2ZI5A 3AQ4A 1G3IA 4H9GA 3SN6A 3O8CA 2XAUA 1XXHE 1SVOA 2RH5A 3ZVNA 1M8PA 1CBUA 2DFLA 1JB1A 2NPFA 2JCSA 4A1FA 3NKVA 2OE2A 2E9SA 3HR7A 1E1RD 2CCGA 3UWOA 4CIDA 3L8YA 1UADA 2VL7A 1IQPA 1G41A 2G6BA 2FNAA 1KDPA 2BBTA 1C9KA 4PSAA 1TTTA 2KBEA 4Z1MD 1P9WA 4DVGA 1YZLA 5JWOA 1RFLA 1XD8A 1ZNYA 3C41J 4OHYA 1IONA 4II7A 1SQ5A 3F5FA 1AKEA 2GRJA 3KFVA 1IJFA 3AUXA 1GIAA 1E2GA 1P75A 1PLJA 4IDHA 1Q3HA 1E2JA 1Z47A 4B73A 2F9LA 3Q72A 4MYHA 2JJ2A 2X77A 4FIDA 4LHZA 3SS8A 2Q9BA 3JVUA 2OXRA 5F9HA 4PPFA 4K8OA 4EPTA 3OESA 1U8ZA 4PHHA 5G3ZA 2ZEJA 3NEYA 5AJXA 3A4NA 3WRYC 1AS0A 1CLUA 1P4SA 3LA6A 5JEEA 2IYVA 4NBSA 4RD1A 1ZINA 1R5OA 1Q22A 2DR3A 4Q4AB 3VNVA 2R65A 1S1CA 3K1JA 3IQWA 3G5UA 3UANA 2EYQA 2YOFA 2RGEA 1SXJE 2AL7A 2ZR9A 3PFIA 3V4FA 2IUTA 2VRWA 4AURA 4JYBA 1R4AA 2WWXA 4L9WA 1Z2AA 2VEDA 4F93B 2REOA 1XJQA 3UMFA 4V0ME 4TN1A 4TTQA 4Z51A 1FOEB 2BKEA 1LVGA 3BAFA 4PZZA 5DO9A 1W36C 2DWPA 3R7WA 121PA 2R6GA 4GOXA 1SHKA 3B13B 4XD7D 4FWTA 1ZM3A 4QBIA 1MT0A 3MSXA 3Q5DA 4DDTA 4HLUA 1R0ZA 3RDPA 2QP3A 2GBLA 5JSZA 1EESA 1KYIA 4YMVA 1OIWA 1NY6A 1MH1A 1IN8A 3QXSA 2GXQA 2WSSD 5CJPA 1F2UA 1W49A 4PHFA 4D0NA 1W5SA 2N1BA 3GEEA 3TNFA 3VR6A 4YMTA 2NZJA 3QKRB 4CVNA 3A6PC 4Q1EA 3GQBA 3EA5A 1ZD1A 1LF5A 3I1FA 5HKKD 3LQQA 4KBFA 2O5VA 8OHMA 1Z6AA 4V0LA 1YZUA 3B5JA 1TQ6A 2ZJ2A 4G1UC 3TW8B 1UF9A 3B1ZA 5KSZA 4IDPA 2YKGA 5J4KA 4JVMA 3LBNA 1KK3A 2FZLA 2P5SA 3AKEA 4YONB 1KI1A 2WWHA 3QKSB 3QXHA 4LPSA 5K8LA 2PEZA 4BFUA 2QQEA 3TH5A 1J99A 2VP5A 1NF3A 1NN3A 4LI0A 5FOUA 1GZSA 1ZU5A 2Q6TA 4MKFA 1JR3D 4U5XA 3B8HA 1G6OA 1HV8A 4ZDIA 4DT1B 4DLTA 1CR4A 4YXWD 4A2WA 2H17A 2WWWA 3X1XA 2QAJA 3T06B 1KZGB 3WYFA 2P67A 1R8SA 4X8OA 4NU0A 3MMPA 2QM8A 1E4YA 3CONA 3CX7A 1AS3A 1DAIA 3SOPA 5J4LA 4JT4A 1II8A 1UDXA 4RFVA 1O3YA 1N6KA 4A82A 2ZRCA 2A5FA 1NVXQ 2CDNA 1KI7A 5FUXA 4ON9A 3ICQB 1N2CE 3EXAA 3SQWA 3QF7A 4XVQA 3IHLA 3BGWA 1G7TA 4UKDA 2P2LA 3T35A 1KGDA 1JEDA 5B2ZA 2J7PA 2GXAA 4LC1A 1Z3IX 2A5DA 4HUQB 2BJVA 4CGZA 1PVOA 4M1OA 4ZDWA 3H4MA 1XMIA 2XOKD 3TSOA 4TLEA 1UPTA 2GAAA 2DFNA 2HXSA 3MGCA 4CEIA 5JJLA 3QUSA 3BD9A 3KQKA 3PVSA 2GDJA 3EA0A 4R2IA 4KSBA 2ZRKA 3FE2A 3QEJA 3NHBA 3CR7A 1GL7A 4BGDA 2V6IA 4WXPA 3W6OA 4QNRA 5J40A 5DI3A 5FTLA 2I1VB 3DL0A 3WP0A 2P3SA 3A4MA 4JLAA 3W90A 5HZHA 1KAGA 5TXGA 2VSOA 1OSNA 1OFTA 2B21A 3CRRA 1TQ2A 4MUBA 3SU8A 3RRNA 1YZKA 4F38A 3I32A 1SGWA 1W36B 1P5ZB 2ORVA 3B1YA 1N6HA 3BRWD 4BECA 1MO5A 1OLOA 1W44A 4W5JA 2VSXA 721PA 4OKSA 3C16C 1T5LA 2UVQA 5LDDC 2D4HA 4MRPA 1Y3AA 4QL3A 1GOTA 2JJ1A 4F4IA 4LBWA 4IEEA 2RHMA 3U44A 1DELA 1F5NA 1Q0UA 4QKQA 1G6HA 2ZRFA 5CDFA 2F43B 3HP1A 1NIJA 1QF9A 1OB5A 1FX0A 3SFZA 3BC1A 2GKSA 3QQ5A 2F1IA 2BKUA 2IYLD 3I8SA 4DSTA 1NKTA 3FMIA 2GEDA 1VECA 2HXYA 2PMDA 5KUTA 1MO3A 4ZCIA 4D0GA 1VTKA 1VG8A 3PUZA 1N6NA 6Q21A 4GSYA 3W5IA 4LC0A 2ERXA 4NYJQ 2XJ9A 2GCOB 2FPLA 4FMCF 1VCIA 2TMKA 2VLIA 3ND9A 4ASUA 4DZZA 4B3CA 5JRJA 5EE1A 1H8EA 5JRZA 3EZ2A 5JECA 2J46A 1F6BA 2WHXA 4LUCA 1ZM7A 1XJ0A 4IOJA 2HF8A 2ZU0C 1E2PA 4RVCA 4QHSA 1L7VC 2QTFA 5AUQA 2NO6A 1JI0A 2DBYA 1J8MF 3LWNA 4CEHA 2V8OA 2KE5A 1KI4A 2N46A 3IHWA 2PCLA 3NDBB 2FPMA 1G291 1G7RA 1G7SA 4RKEA 2PJZA 1EFCA 3MCAA 4JLJA 2PH1A 3W8NA 2KI5A 4ESVA 4CZ2A 1TMKA 3ZS9A 4Q1DA 5H70A 3RRMA 1IOZA 5EUMA 1BYIA 4E5UA 1S0UA 2EWWA 2B92A 1EWQA 3GLFA 2ZIAA 4PO1A 4PQFA 1YZNA 2R6DA 3THWA 3VKGA 2ZE7A 1JJVA 4AKHA 2G0TA 2CXXA 3CO5A 4PC6A 3M1IA 2Z43A 521PA 2PBRA 4RFSA 1RVDA 2RGNA 4KFTA 5EP1A 3CZQA 4TMWA 1OH5A 1T9HA 2HLDA 1KSHA 3EASA 2C2HA 1YR9A 1T5IA 3NWJA 4DLXA 4ZPXA 3DZ8A 1W4BA 4QBFA 1TQDA 1SVWA 2B8TA 3AP2A 3C14C 4GP6A 2CLDX 4JBYA 4PC2A 3NC0C 1I2MA 3BB4A 1AKYA 4D0LB 3NC1C 2RGXA 2ZROA 3OF5A 1NN5A 2PZGA 2REXB 3QE0A 4JZKA 4TQAA 1RRPA 4WOPA 4QM7A 1Q12A 5FTNA 4IFEA 3SDZA 3QG1A 3C15C 5KSPA 4JJKA 1ZC3A 5C46F 1WQ1R 5FOVA 4IVRA 3EZ6A 4B47A 3B9PA 1A82A 1XCGB 1CJKC 1N5KA 2PLRA 4LX0A 5BN3A 3MG9A 2CLSA 3P1JA 5FBRB 4TTRA 5LB4A 5J5CA 1FUUA 2RB4A 1K6MA 4PC7A 4PZLA 5F2EA 2GJKA 4LHYA 1E2KA 3RS7A 2OBMA 4AK9A 1LY1A 5DGXA 4YDSA 5L3SB 1LB1B 2ZS8A 4HLUC 4L4UA 4BEBA 1YE8A 1DG3A 5AK0A 1ZMXA 3GJXC 3QF4A 3IUYA 4ZV4A 1AM4D 4K46A 2CBZA 2H16A 4M21A 3AUYA 5P21A 1US8B 2B8WA 3GLIE 2GWHA 4WZAE 5KPDA 4GPTA 1G64A 2GF0A 4IOKA 4QG7A 3RS3A 4HZUA 4Q4JA 2E1RA 4M1WA 1P60A 4B75A 1ETUA 3TE6A 4QGAA 2IL1A 2R44A 4P4UA 4B74A 5L3VA 1NNEA 3DDCA 4F4JA 1NVVR 4ZIRA 1NVUQ 2LCFA 1HE1C 3GCGA 4LDJA 2YWGA 4B76A 1M1YE 1MRSA 3S1AB 1GKYA 4RSGA 2HT6A 4C2UA 1UBGA 2VHQA 4RKFA 3PITA 1KO8A 1D5CA 4J0QA 3LVRE 5IK2A 1XD9A 1OXTA 5DNYB 3T5GA 3WNCA 2JEOA 3WNDA 2FPKA 3C8UA 4I1OA 3IEUA 3WNBA 1XXHA 2XB4A 1DAGA 3O8RA 1AGPA 4IOLA 1DO2A 4TSFD 3ICEA 1Q44A 3X1ZA 2QPOA 4DEXA 3U3JA 4Q7JB 4YC7A 4BLOA 2EU8A 4JBWA 2BMDA 1E2HA 2GJAA 2LKDA 3EWSA 4B2PA 4AY2A 1XWIA 2ZVPX 1E94E 3QOFA 3LV8A 2F7SA 4JVLA 4R71A 4C0LA 1H65A 1UAAA 3THXB 4KU4A 2MSDB 4LV5B 2O8EA 3U3OA 4PC3A 4D4JA 1PV4A 2RGBA 3PEUA 2F3TA 3AF2A 5A5GA 2GZAA 2IX3A 2C04A 4M9XA 1CIPA 1XDBA 1FNMA 2QRNA 5JCPA 2DFTA 4KITB 3OIVA 3NHAA 1WRBA 1D9ZA 4TYQA 2J7PD 3WP1B 4DDUA 4CDGA 1QBKC 2O0KA 1GUAA 4QXAA 1XEXB 3BOSA 5LBIA 2ZRBA 3R8FA 5D3MB 5E3HA 3GJ0A 2ODWA 2ZRDA 1MRNA 1VCOA 4U02A 1SXJA 2JAQA 3IIMA 1G3UA 5DN6A 5IF9A 2ZPTX 1HA3A 1XCMA 2XSZA 2XZLA 4V0MA 1Z6GA 2IEYA 3TRFA 3EIQA 2IXGA 3U2QA 3U60B 4KYUA 4N1AA 1H8HA 1UEJA 4RD2A 4MH0R 1Z06A 1XZPA 2CNWA 4MGZR 2XTMA 2DFKB 2O8FB 3R9IA 1XP8A 1W5TA 5EP2A 2IS4A 1S3SA 2ZRIA 3K0EA 2N42A 3KB2A 2I1QA 2X8AA 4W5HA 2GCPA 4JSYA 5EXXA 4LY6A 4B3XA 3DEFA 2EW1A 5DYGA 1ZBDA 5JHHB 1ZP6A 1N6OA 1FL9A 2QAGA 1P9RA 4DSUA 1Z0KA 3GP8A 2XXAB 4B3BA 1VCMA 1S8FA 2OXCA 621PA 5L3QA 4D26A 3EG5A 4CW7A 5C4MA 1U94A 2WBLC 4QOSA 4Q7MB 3HU2A 1IXZA 4GP7A 4L8GA 4NKRA 4HAZA 3GLHE 1LNZA 4KFRA 1VMAA 2IXEA 5CDFE 3B1XA 2ATXA 4HI0E 1ONBA 3EPLA 4NMMA 2IYZA 1FTNA 4NZYA 1KJZA 2AKAB 2FJUA 2VP2A 4ASUD 1JAIA 1E98A 4OHZA 2J0UA 4TMKA 3CX8A 3UG7A 1H8ED 1XB2A 2FV8A 4WZBE 2V6JA 4P4TA 1EFRA 2Q0HA 1OH6A 2ZYWX 3AVTA 2LWIA 4HATA 1CRQA 4AYWA 3K9GA 2IS2A 3GMTA 4LJ4A 2RGAA 2J0QA 5FOSA 2HUPA 4L16A 1FZQA 2J45A 2WKRA 2KJQA 3O8DA 1IY2A 2YJTD 3DKPA 2D7DA 1E79A 4TL6A 2GJSA 1NG9A 4JLVA 1U0HC 1QVAA 2FSIA 1OFIA 4B2IA 1RJ9B 5B64A 5FOWA 1SVIA 1NSFA 2ZJ5A 4NCKA 3QG5A 2ZE5A 1X3SA 1HEIA 1NJFA 2OLKA 1W48A 1JPJA 1XD2A 3B1WA 3E70C 4KBGA 4PPNA 2ZS7A 2V7QA 4HDCA 3GJ8A 4AWXA 2GHIA 5FL7A 2HV8A 5AUPB 2CCJA 4EQ6B 2RGNC 1VPLA 1LS1A 1NIPA 1OF1A 3BFKA 4IDNA 4A92A 3U7FB 1G8FA 4ZCLA 1E2MA 3L2OB 1GSIA 2QRZA 1DOAA 2ZRJA 3CX6A 1WE2A 1P2SA 1E9SA 5C18A 2H1LA 3CLVA 3I5XA 3THYB 2O8DB 3PXGA 3FVQA 4JLKA 1MO6A 4Z8YA 2QU8A 4LBVA 4LWZA 4NCHA 2PEYA 2GEVA
chains in the Genus database with same CATH superfamily
3RTDA 1EYZA 3R24A 4B3SB 4KQHA 3SZLA 1CZUA 1UK6A 5JWHA 2FSPA 2BJWA 4DAEA 3GH1A 1CQWA 3LKVA 5LMCA 1T1GA 4PRZA 3ZXIA 3E3MA 1K7CA 1ICIA 5AM0A 2IZOA 5SICE 2AB0A 2WAAA 3VU9B 1PO7A 3W5AA 3UK0A 2C5HA 4HK4A 1WSBA 2R8YA 2WE7A 3V9PA 1KEEA 2V6BA 3C39A 3L1KA 1R0YA 4QA9A 4DLWA 2I9KA 1CEYA 5GV8A 1FSZA 1N4DA 5AOVA 1RPZA 2BM1A 4K6HA 1UMDB 2VP3A 4ZT5A 3IIIA 1N2GA 4AJ2A 1Z6QA 2I80A 4I5IA 4K26A 4QULA 1Y8ZA 4A36A 5KVCA 4YMUA 5D84A 3LRTA 5DN9A 5FPHA 1E9VA 2RK4A 1MABA 2J41A 1W0KA 2GN4A 4CKEB 2IOHA 5BNTA 2BH9A 3D2CA 8ATCA 5C2JB 5HUQA 2DLDA 1H4VB 3LCMA 4TV8F 5AI4A 1F3OA 2X2FA 5FPSA 4AX4A 1ZJ6A 2H5LA 3T0IA 2FSHA 3ABIA 4QPCA 2Q3EA 1E5DA 1IMOA 4DQVA 4HEJA 1VCNA 1D5WA 1XMVA 3QJGA 4HYQA 1JSRA 1OR8A 4BV3A 2P4QA 5CVEA 1ZJZA 4Z5XA 2JASA 3H05A 1BG6A 4DR4B 3GLVA 3H5OA 2CXQA 4DOMA 5LB2A 4IX9A 3RVNA 4FONA 4KJXA 4Q9JA 1JHOA 1VKRA 3GVXA 5D6NA 2PZMA 2QENA 1JVBA 1TGYA 5LA6B 2EGGA 3AVXA 4RPJA 2CY0A 4GC5A 2XWBF 2ZULA 2O3TA 3PC3A 1JZQA 4A8TA 2H7YA 1NMYA 4KXLA 4ITUA 1WNFA 1I0ZA 1MJFA 5FJJA 4E1BA 4RE6A 1Y5LA 5C1PA 3W78A 4ZODA 1FVXA 2ZUEA 2BFEA 2A9RA 1UKAA 3CZPA 5K45A 1I4WA 7YASA 2B1JA 4IS3A 4WLNA 3W77A 3M4YA 3VDMA 2RFLA 3TPCA 2C8VA 4OUKX 3PF8A 3CF4G 1HX7A 4XEHA 3EX7C 3CXRA 1P7CA 2CYCA 3BWDD 1M54A 4DWJA 2HMAA 4PVCA 1Z0ZA 4A6XA 4OBWA 2XNKA 3SJZA 4NQZA 3PXBA 2NOAA 4WY5A 1A9YA 4F4CA 1OLSB 1Z68A 3HB7A 5EJ9A 2Z04A 1QZZA 2O3SA 3BMCA 3N5CA 4WDQA 3CWQA 3HPQA 3QI2A 4OA5A 3QK7A 3IPXA 2BGUA 3QV2A 4M54A 5DK6A 3ZWNA 3OD1A 4DDVA 3VH3A 4OI2A 4AL4A 3TI9A 4BQPA 3FOEC 1REQA 1RACA 1YJBA 4MVJH 4BFLA 4EJSC 1V5GA 3T7IA 3KQUA 1YB5A 2H5EA 5G02A 3PDWA 1SQGA 1QUEA 2NO1A 3I1JA 2Q5LA 3DEHA 1JG2A 4FOOA 3RU3A 5L95A 1NKSA 1AX9A 1U04A 1YS1X 4I50B 1ULTA 4JS0A 3MHTA 4W9RA 5EZYA 2C4KA 4E14A 2PRYA 4RTJA 3KUXA 4O2AF 3C5WP 4KI0A 1KYXA 2VZ0A 2WHRA 4ILKA 4E21A 1EH5A 5DGTA 5MGBA 4KQ6A 3KJFA 4U3JA 3LYAA 4ZVUA 1VG9B 2XSZD 3JQDA 3MTEA 4KTTE 4NAUA 2G0NA 1SVKA 2GXSA 2IOFK 3WXBA 1OPXA 3OOEA 4HO1X 4MKIA 2RIRA 1AIPA 3T99A 5BXYA 4N65A 5M04A 2E4AA 3RS2A 2CNWD 1SC1A 4PN7A 3JVIA 1Y9ZA 4GO1A 1BEZA 3QU9A 3UGKA 4MTCA 1LSOA 5CURA 3A2LA 2JIMA 2OBLA 1LQ2A 4LJSA 3UKDA 4DCSA 4DXHA 4J6EA 2DP4E 3KPUA 3IL2A 3RYFA 5DLQC 4Q1BA 3OHPA 1RLUA 2IPMA 1E6UA 3P9SA 3SS7X 1OGIA 3E2IA 4B4WA 5ALWA 2IZ5A 3PVCA 5BV1A 3GRUA 3QBVA 2CZCA 2O4CA 2XDQB 5EFZA 2QAGC 4HWKA 3WLRA 1SC4A 1B2RA 5BWOA 4QE3A 3QVXA 1C30B 2EV9A 3JQEA 1Q74A 4EI2A 3ZHRA 4PTLA 5CFRA 4DCVA 1E3IA 5KTOA 4J1QA 5G0VA 2ROQA 2L17A 5J5AA 2VXCA 4B2YA 3BILA 4YY3B 5LYJB 4H1VA 2ZWVA 4DDMA 3VDXA 3H84A 1UBEA 3EGVA 1GP2A 4XTCS 2ZXEA 1QQAA 2ECPA 4XARA 2VOJA 4LSZA 4NYIR 1M34B 4HRYA 1FYVA 1UEIA 3LX5A 4I8XA 1I01A 1KMNA 4NC9A 1HNWB 4CLOB 2HADA 4RE5A 2VTBB 1Z9BA 3PFFA 4NV0A 5LQCA 2J9GA 4XWAA 1P19A 1EVIA 3OQ6A 5JS8A 2PGOA 5TJ9A 4JL5A 1X7WB 2QMEA 3VHLB 2DOKA 3HUFA 1E62A 2J6IA 1PK9A 4HB4A 1N2BA 1ST2A 4MWOA 3K30A 4QQKA 2XUAA 5EWLA 5F21A 5KNLA 1X1SA 1TEVA 4XJVA 1U0BB 3HEBA 4MS1B 3I9MA 4KPUB 1F48A 3ICWA 4EABA 3EVCA 3L84A 4D97A 4ERXA 4RKQA 1T36B 2AUNA 1EFVB 3HY3A 1I2ZA 1FPQA 3LT1A 1SBTA 2A59A 2HZ7A 1CC1S 3FYUC 5K51A 2NZVG 4H18A 3SHFA 4P82A 3FI9A 7REQB 4PIMA 1XHFA 4DJFC 4NJMA 3JQ7A 4W4TA 2GTIA 2RHGB 1A2BA 4QUJA 3VHXA 2GRAA 1TAGA 4KMSA 3U61B 1RIFA 1SD1A 5BMVB 2J6BA 4R84A 3WL3A 4XCXA 5LU9A 4MDFA 2BEJA 2XYGA 3MLEA 1E9RA 3P32A 4JLWA 4BXOB 3HCRA 1D2AA 4S35A 2PQ6A 3OZTA 1PEAA 4G65A 4QODA 1DS6A 1FTQA 3KLBA 3FUVA 2H06A 3NUZA 4FYXA 4PHGA 4ZVKA 5AM2A 5HKAA 4IIXA 3ENZA 1Q21A 5EIFA 3LUFA 2Q6VA 2QN7A 3W2EA 4RYLA 1L4HA 5EXTA 4C2AA 2IEBA 1BN6A 1W19A 3F6RA 2ODBA 1TYEB 5LLSA 3NRJA 4HRAA 1VKOA 5J63A 5GGXA 1XCPA 1K27A 4EVIA 4LWPA 3B3AA 2C0PA 2QU7A 3AGPA 3FPCA 3UXYA 1UWCA 1ZUNB 3TSWA 5LJLA 3IVAA 4QC2A 1XJCA 3O4HA 1K0UA 1KYWA 1QLWA 4CF7A 2BHRA 2P27A 3EDRA 2BWJA 2V03A 5EPEA 1HO3A 4PFKA 1RYNA 4O2RA 4QBGB 5DSZA 4KUHA 4DKXA 3UMMA 3Q0IA 5EINA 2SBTA 4OHUA 3GRYA 4EKIA 3WYDA 3CKLA 1CQIB 1CUXA 3K0AB 2QP9X 3K6JA 3C87A 5JADA 2O5CA 3V3TA 2Q3MA 4AO6A 4ABYA 1CZRA 1J2JA 1JWLA 1WMSA 4PQEA 4I3HA 3NASA 1CR2A 5EJ4A 3SZ3A 5LUBA 4C14A 4AQYB 3T34A 3DFKA 4MUGA 5JIBA 3FNHA 2VP6A 3PFGA 3PTAA 3FB4A 4YQFA 1GN9A 5LBTA 4PNHA 1L4LA 4M1TA 4DV4B 2O57A 4DM3A 2Z2ZA 4M1MA 3NPMA 3QBEA 5KYYB 3EE6A 1C7ZA 3W79A 5CYOA 2Z95A 2CGEA 3T3DA 2GCGA 3LUHA 2B9EA 3GHHA 3OJWA 1MGPA 4JXXA 3G5MA 2CLEB 3M83A 4KQ9A 1A9ZA 4ZT2A 5F3WB 4IZIA 1NZDA 4DANA 4CGYA 1Z38A 3EXEA 3OCVA 1GAEO 2ZSEA 1PNQA 4LVOA 5EE3A 3FSJX 4B8WA 1YTUA 2CFTA 1ZGBA 4EB3A 1T0HB 4CLHA 2AG0A 2EATA 2IZ1A 4UHFA 1WG8A 1MR3F 2D62A 1E0JA 1LZLA 4BMNA 1IJKA 1U4NA 5A4AA 1AQIA 3N5KA 3VZPA 3I09A 2O0LA 1PE0A 2WEKA 3BFVA 2ZJBA 3HXTA 3OBBA 3P2EA 3E82A 2BHLA 4QO8A 3FM9A 4X71A 4LYHA 1G3QA 3TNLA 1MTZA 2QORA 2YV5A 4W5RA 1WBJB 3L5KA 2JA1A 4NICA 1RRGA 1NHWA 2D13A 2QN6A 5T67A 3JWGA 3B1JA 3KVVA 2FZWA 3K32A 1WKCA 1QIDA 1Y98A 2VHVA 2GJ4A 1U1DA 3FZEA 4HZIA 4FFWA 1HDCA 4KO1S 3PG5A 4JXJA 3RQSA 2PGNA 5CFLA 1LV8A 4NQRA 3LSYA 4XUGB 5IC4A 4DR5B 1H42A 4LYJA 2QRUA 2PX3A 2R7KA 2IEGA 2V5UA 4P33A 2ZUSA 2PQ0A 4AJEA 1CE8A 5JNUA 1SVUA 2RK3A 1V16A 4AT1A 1XU9A 3KEFA 4P0TA 4WN3A 3NG1A 5E6UB 1L5LA 1TRKA 3AOEA 1O95A 1EWRA 3T5CA 4Q21A 4BC1A 2FH5B 2XA1A 1R0BA 3ND5A 2IPXA 4I14A 3W8DA 4LJRA 3ORHA 5A0FA 5FTMA 3IILA 4GFDA 1AKQA 2FSSA 1RC1A 3KQSA 5TQ0B 1K66A 2BGTA 3NOOA 4IGFA 1TO1E 3G2IA 4MRRA 4UU0A 1G0OA 1UBCA 3WKEA 3IR7A 4IF6A 5AKIA 4EAQA 4GE0A 3UUFA 4MVCA 2W2NA 3L7MA 4A6PA 4Q39A 3Q9NA 1SU4A 2OK8A 5IJ0B 4MP3A 1JHDA 3PT5A 1PJZA 2PUVA 5CHYA 4WNYA 4RJLA 1XUOA 1G5FA 1FIUA 3D5EA 3B5EA 3G9XA 1NV8A 4X44A 1NBME 1FXWA 2OPHA 1VKNA 2JJ8A 4W8HA 1A7AA 3HRIA 5KS2A 3C3BA 3L7LA 4OHRA 1QC5A 1VCHA 2VF8A 3ZZUA 1K6IA 1XTRA 2QSJA 4UC0A 4CM1A 2GA8A 2ICAA 4FS8A 4ZI7F 2XCSB 4F5ZA 1CZHA 4WLVA 2QRVA 1VBFA 1WEKA 1E5XA 1NFRA 1PUXA 3OPYI 1JECA 1Q83A 2C2GA 3GU3A 4FVTA 5GVRA 3A14A 4UMFA 3JATB 4N3AA 1YDFA 1PNOA 3AHEA 3PD7A 3RTCA 3TKLA 4CQMB 4F56A 4C0SA 4R41A 4FDMA 3ON5A 2Z4SA 4Y1EA 3C8DA 2K87A 5KVQA 2X4GA 4B7XA 1CFZA 1R1DA 3K6SA 1GZUA 2JFUA 2WIFA 3LP5A 1QOQB 3WYBA 5LQRA 1YTLA 1QRSA 2YQZA 4OLAA 1Y4DE 1OXSC 4O3MA 2CFCA 2WHYA 1BVHA 5HRCA 1T9GS 1EX7A 1ZESA 2GX6A 2YXEA 4PZYA 5ADUS 1QRRA 4RNCA 5CDYA 3TMKA 3KTAB 1KDVA 4TUYB 2AI1A 3LLSA 4L73A 4Q1FA 5KNCA 2R00A 3CMCO 3CSDA 3FMPB 3KQTA 4P3KA 3RUIA 3E9RA 1J5XA 4YK7A 3D6UA 3UCEA 5I9TA 3VFDA 1WVIA 1AUVA 3N3BC 1N8TA 1V5WA 3PFNA 3SNHA 1QCCA 1E32A 4K6CA 4BX0A 3FKSA 5FJIA 3HXKA 1NAHA 3EOAI 4IV5A 4KLNA 4DDWA 3AVUA 5K8IA 1GEEA 1Z4PX 2I87A 2JF0A 4BZZA 2POCA 1CVRA 3GJ5A 1T6ZA 3DO6A 4MW9A 3VV2A 4LTNA 1GTJ1 1C1YA 2GO1A 5KEIA 3E7XA 2B4TO 5KJCA 1JLLB 3IKTA 4PSDA 2RHWA 1P5RA 1V5IA 4G5FA 1EQUA 1VHQA 3LHFA 4H6XA 5EE0A 1I9CA 2ECKA 4FHZA 2UYGA 3HKCB 3ZWOA 3P9RA 4BYMA 5HZMA 4GX0A 2VLBA 3DWIA 4EG7A 4WBSA 2JI9A 4DLLA 3WA6A 3MMSA 3ZHZA 1KBZA 2JPDA 3L77A 3LUBA 4NE2A 2WE8A 1ZUIA 4W6ZA 2QE7A 1NXSA 3RRBA 2JH3A 3UXHA 4DKJA 4AG6A 4CLRA 3AOGA 4IX1A 4ZYUA 3MT0A 3NM4A 3ESYA 3IELA 4C3ZA 4D44A 1AXEA 4URZR 1I1HA 2HBZA 4PAOA 1FMFA 1JXQA 2BEVA 1WP4A 3C6BA 2ISCA 4N3GA 1XMOB 1CRZA 3G5LA 2IPAB 2L0XA 4GLBA 4K6GA 2H2GA 1H0SA 4OK6A 2B8JA 2ZB8A 3DUFB 3GHYA 4EY7A 1C7RA 2P41A 1IQUA 1VLZA 1H66A 3BMCB 2E4UA 2YZKA 4BNZA 4NONA 2AQ8A 5BVGB 4FGZA 5FV4A 3HA2A 4JC8A 2BE7A 3STTA 4DADA 5FQNA 5FBHA 2AGVA 2A35A 1G4AE 4Q1CA 4IFIA 1P3DA 4TTJA 2DWQA 2CHQA 1L4UA 3ZJUA 4LF6B 2P8SA 3AU8A 2F17A 1WBBA 5L7TA 1TKAA 2EHDA 2D7JA 4FMBB 4N5HX 1KSJA 2WM3A 1PR2A 3P9YA 4FW8A 1ZCAA 4H7HA 3O31A 3CM0A 1W0CA 3QWBA 2CXOA 3UMRA 1YDMA 4PXSA 3UY4A 2XMRA 3JSXA 1NFQA 1DKQA 2W2OA 3D3QA 4FILA 5E7QA 3CNOA 3N70A 1GM5A 3MRSA 3NAQA 4EGJA 4DV0B 2A1UA 4C76A 3PC2A 2BH2A 1JR2A 1A8PA 1HRKA 2VR1A 3QY0A 3U17A 3ZZ0A 3GZ4A 2PUBA 1JSZA 4KIJA 2XF8A 5CFOA 2IKQA 2AJDA 2NO0A 3NBKA 1Q92A 2HCJB 1TOAA 2DT8A 2FCAA 3FPGA 2P6MA 3KLOA 1SBQA 1ZX1A 4P93A 1L8AA 1WD7A 4HWRA 5HDQA 3VR5D 1TJ5A 1TCBA 4RVOA 1QONA 2OXTA 5CVTA 3F49S 3EDCA 4B3TB 5K0LA 3L4JA 1M7HA 5K20A 3BH6A 3LO5A 5J1TB 2P1ZA 2P91A 1RVV1 4L6CA 1O8BA 4WA8A 5AWFC 1IY0A 4US0R 5D5HA 3RYCA 3A6FA 3DMYA 4N39A 1EP2B 2XYPA 3CNNA 3DVAB 2EKLA 3ELWA 4RL6A 5G3YA 3UFXA 1YJ5A 3VGJA 5AUNB 2VXYA 3DEKA 3C7DB 1ZK3A 2J3HA 4M0UA 3ZU6A 2QJFA 3W06A 1VPDA 5T6MA 4EEXA 1DO0A 3H3XA 1V47A 2M6SA 1C2TA 3NDIA 2WC1A 2W2KB 4BZQA 4HNGA 4DF3A 3PGVA 3D2LA 4BFWA 3SR4A 1IATA 1LTKA 4HAVA 4H59A 4KX3A 4X7MA 3IE2A 1X14A 2GPWA 1QHSA 3GPIA 2NXNA 4L3OA 1FJHA 2JJ1D 3TZCA 2PJUA 3DXFA 5CK4A 1A9QA 5FFNA 5CDTA 5JSZB 4AKGA 1OI4A 2NYUA 1P91A 1EJ0A 3L8FA 3E84A 4DA4A 4YT5A 2V45A 1G4UR 4G01B 1V96A 4AXBA 3DCNA 2G0AA 3GNSA 1LS6A 4YRTA 5DASA 1ODJA 1X42A 2H11A 4GVXA 1R0RE 2PXAA 4Z7JA 5K8TA 4AJIA 3D0OA 4XWTA 5FWYA 1AK2A 1P1BA 3LAWA 1UOOA 4D9BA 1XRLA 1XTQA 4JUDX 5JYEA 1NYRA 3TXXA 1J24A 3UHFA 2PSDA 2C20A 4XAQA 4DNFA 4TX1A 2DUJA 1GYPA 4P36A 2QS9A 1SULA 3KE8A 1A4RA 4EEZA 4KXUA 5E6SB 3RHFA 1JQDA 4HH4A 1Y5RA 4GPAA 1FDWA 4YFYA 3DE0X 4BOYA 5HUJA 4JI0B 4R7TA 2XNHA 4W9MC 2CVFA 5ED4A 4RVUA 2D8MA 5D6OA 1BDMA 4ZO7A 4FI3C 4X3CA 5EWLB 1JNYA 4YCAA 1S3GA 2OBBA 3WO1A 3U16A 1L5VA 4GGPA 4FR2A 4BIMA 3E9YA 2R7MA 1TQHA 1S96A 3NJ4A 2QTNA 3MRVA 1KRHA 4WNIA 5ALEA 3I05A 3AO0B 1NW7A 2F9FA 2JLBA 4PBSA 2DUUA 4MARA 1FDVA 5JLAA 2FMTA 3NKFA 1WUJS 4GWGA 3RYTC 1ZIPA 3CVVA 1WX1A 1XBTA 2PRKA 3HLKA 4C4ZA 2BKAA 3W9YA 3FVRA 4IF4A 3TCNA 3R6TA 4C0HA 2FLKA 1YSCA 3B1KA 4MRAA 1II8B 4R1LA 4H77A 4HDSB 1TZKA 1XLTC 2BSAA 4MUAA 5DNWA 3UK6A 3QEMB 2F64A 2EW2A 1DT5A 1AZLA 1JMKC 1SVSA 2J9FA 2O2CA 3R0IA 4ZAGA 4B9AA 2F90A 3TR0A 1MQSA 2FG7C 4WI1A 4LMPA 3AJEA 2Z4RA 3B9QA 4WINA 1GVHA 1ESCA 5I7UA 1J0EA 3ZG6A 1RJGA 3A0UA 3GWZA 5CNJA 3VX3A 3ZIUA 1AV7A 1PCXA 2G83A 2JLQA 5K0SA 1A7JA 5DCUA 1E2NA 2X0DA 2WOJA 1E1LA 4DG9A 1W2GA 1UBTS 1W46A 1NL3A 2BZ1A 2RGGA 3GJ3A 4LJ8A 4YVFA 1IJBA 1AKUA 1KZ9A 2OHVA 2FUKA 2VHXA 3KAJA 3H87A 4ZOLA 3L0OA 1K8XB 3S70A 1USWA 2YR0A 3NRBA 1QWOA 3EZ9A 3SBDA 3T4EA 9LDTA 1L1EA 1JMYA 3SEAA 3U26A 5LUAA 2WI8A 3QENA 5I7VA 4KGZA 2XTAA 1SCIA 2BPOA 4MVJP 1DX6A 2G5TA 4C89A 5DI3B 1I14A 2M1ZA 1F8GA 3EAQA 2GUGA 3K72B 1I6KA 1W0JA 3PHCA 2O2XA 1Y34E 4AKEA 3OLZA 4M49A 3MW8A 1RCTE 1TA4A 1HQCA 4FOTA 4BP9A 1KK1A 1CUHA 4XX0A 4V1CI 1FP4B 2GJ9A 5KJFA 1NVTA 1MA0A 1OI7A 1FFCA 1K8RA 4EMSA 4BPRA 4A03A 5IFKA 1BC5A 4RGBA 4D0SA 4U2CA 1TF7A 3ACCA 3AXTA 2XZOA 4ETWA 4OHPA 3G9ZA 2RBEA 5DI9A 1XZJA 4I1IA 4EH1A 1Z73A 2CNBA 3CLUC 1LPAB 3IUMA 5HYVA 1Z5OA 1XKTA 2AI2A 1Y8QB 2DHEA 3M6AA 2BFDB 3F4BA 3H5NA 3MFQA 4IINA 4O6VA 2X0FA 2BEUB 1SWWA 3BL6A 3KCNA 3I04M 4TWZA 1W34A 4B87A 5F5NA 4HNVA 5KX5F 1ZNXA 2O2GA 1Q6ZA 1GITA 5KTNA 1GA4A 1UCFA 2PDAA 2EG9A 1MOQA 2QN3A 4YA6A 4TXJA 5T6BA 1FX0B 2B7LA 4K9QA 3MXOA 1CUSA 2VDRB 1W1WA 2WM2A 3DBLB 4HDNB 2VAMA 3EXEB 3OZXA 2HWXA 2BFBA 3LH5A 1SUBA 3MN1A 4BNGA 4GQIA 2MINA 3WYAA 2WF8A 3HL0A 1GPDG 1Z29A 1JU4A 3ZWQA 1XL0A 4MITA 2PZJA 3N8KA 1EE2A 3RRXA 4QVIA 3QHQA 3VDRA 2XUHA 3JQBC 4LQ4A 2NO9A 4EG3A 3LC2O 1JG4A 1WO8A 3I6QA 4HF7A 3KU4A 5LDHA 3JZFA 2Y1OA 3WK9A 4LDQA 2FOLA 4QQ8A 4GYJA 1M7BA 4Q4CA 3K09C 4GGMX 1ZLYA 1NMZA 1PL8A 1KOFA 1XK7A 1GCUA 4LGMA 4RQUA 2W2VA 5CEJA 3O3NB 3JYPA 4RD0A 5IK2D 3GWGA 2OZVA 4YT4A 1WXIA 5CPBA 1US8A 4MR7A 2JGNA 2J33A 2W2LA 3R44A 5CCEA 2X9NA 1PFUA 3GRKA 1T6NA 3LD9A 4OJTA 4Y2GA 3RC9A 1GTVA 2GUWA 3N0RA 4REOA 3F5QA 3LYLA 3S44A 5KTYA 4URUR 2WJWA 5A3QA 3T1QA 1COWD 3IBTA 5DX8A 4JIMA 4NCBA 3TJZA 5CVDA 3HBFA 1UC4B 1D8TA 2LW7A 3KOMA 2B1IA 1DSSG 2OC9A 3QBDA 2OBXA 2XBLA 3PJDA 1SB8A 2H5IA 3G5AA 4PGMA 5AICA 3M70A 1YC5A 3AVOA 3OE4A 1U9IC 4DLVA 3KT0A 1W75A 3LX6A 2B83A 1K8ZB 4I5FA 4XYMA 5CT9A 1CFJA 3S1SA 2C4MA 5IAAA 4G4GA 3EB9A 4HSEA 3KL2A 4JBLA 3THWB 3DUWA 2HYDA 5IEBA 4NBVA 2QRQA 2QZJA 3QLJA 2R6ZA 1GWNA 1ZFNA 2HA2A 2AV6A 2ATEA 2BFCB 3Q5GA 1SR8A 3BHJA 4YS6A 1QQ7A 5AUOB 2ZPUA 1M83A 4NEQA 1X1CA 2O19A 2J1LA 4XX1A 2WLTA 5JSHA 4ZVPA 1K4YA 2AFHA 3T7CA 1R15A 3V6MA 3K1ZA 5HWSA 1NGSA 5L9AA 1P2DA 2HX1A 3ANLA 2CXUA 1S7CA 4LNUB 1QH9A 2ONJA 2WMNB 3D4BA 4MTLA 1YVDA 2K5UA 1QX3A 4GT1A 4CFYA 2HDHA 2OFFA 4YR9A 4ILEA 5EOVA 4ZARA 4GOND 4DA7A 3I30X 3V1YA 5CA0F 4UHCA 5TQJA 2ZS9A 2GBFA 2IYUA 1CP3A 2GYYA 1KYTA 3O92A 2FTKE 3OZGA 4GS5A 4LGCA 4BUJA 1D07A 4L7QA 3ROPA 3LG2A 1JEEA 2Q8QA 2WAYA 4ZYWA 3L6BA 4P32A 2YIJA 1OC2A 5LQJA 3EIHA 3WFIA 1HG0A 3E3AA 4L85A 1IXRC 1H8HD 4GNKA 1DWQA 1I36A 2ZU6A 1YR6A 5U1PA 4EY5A 2YWHA 5D00A 3L6UA 2Y1GA 5FLXA 2YVUA 2QD1A 2CWWA 5KOYA 2FEOA 4ZGWA 2RGYA 3GB9A 5JD6A 3DA8A 4FCWA 1Q1AA 2NXEA 5A7HA 1OIVA 5ENDA 1EE9A 3R6DA 3V46A 5E4FA 3I6MA 4KNYA 2G71A 1DIHA 3QPAA 1JJAA 3K1AB 4GH5A 5AKYA 3EJWA 1XQWA 2A6PA 3HCBA 1P3Y1 2GWRA 3W3ZB 2DPXA 3MS2A 2PRIA 3QF4B 1VB5A 3VR2D 1HDEA 5ES3A 3LK6A 2QM0A 1D6NA 3VSBA 1UDBA 3GUYA 5HBRA 4HNHA 5F52A 3BHNA 2JIPA 3FJYA 3WYGA 4CMHA 3I2YX 3DJYA 5ABPA 4WTOA 3GLGE 3WK7A 3HJNA 1T0UA 3JWJA 5EKXA 3AR8A 2SCUA 2BTOA 4MEBA 3STHA 3UH1A 4M7PA 3WL6A 5M7EA 3ESCA 4WPGA 4C0WA 5KPJA 1KS9A 4FS3A 2HWYA 4Q4JB 1GGVA 2RHOA 3PWZA 3C3KA 4CIYA 3WB9A 5JAZA 5KYWB 1QGAA 2PWZA 2IT1A 3RSHA 4URWR 2QG4A 5AI0A 4DLAA 3JVVA 4X6XA 3GV0A 3WHKA 2ZATA 1U8EA 4ZIRB 4QICA 5DYYA 2W6MA 1N9GB 2FDXA 4KFUA 4ZJYA 4N76A 1SELA 1F4LA 5BV7A 4PO8A 1JDPA 1C4OA 3QFTA 3DZDA 1CIJA 5EQFA 3QXJA 1X8LA 4W5WA 3ONDA 2DY0A 3DZJA 4W1SA 2JEZA 2A0WA 1YHNA 3MRXA 3L8ZA 4TZ0A 2XKKA 1TT7A 2OZLA 3HA3A 4QQNA 2F1KA 5AXCA 2QZZA 3UO8B 1PX0A 2I55A 1L7XA 3R76A 4AFNA 1VYTA 3TLBA 2OLEA 1TD9A 1K97A 3A25A 1E2FA 4GXTA 2F67A 4BO0A 1F0PA 3DL7A 4WFJA 2OCKA 1KK0A 2YWRA 3MWYW 1J22A 3KLMX 2O3RA 1KOJA 1G16A 1XMQB 2FWBA 2FYTA 1ZZGA 3AUJB 1YUMA 4ZWNA 3BORA 3SK0A 1B8UA 1DC5A 3BGOS 1Z4IA 3ZYCA 4DUGA 1EIZA 2FWRA 3WIOA 4UTPA 1O94D 1ULBA 2ORWA 2PH5A 2A0UA 4QUKA 5FYQA 4X65B 1M8FA 1Z15A 1S8OA 1XAJA 1YU9A 2GLXA 2NG1A 3K0CA 3WIBA 4RL4A 3UJNA 3PUYA 1SPBS 5DM0A 5HK9A 4CIVA 1GVNB 4D4GA 5HS4A 3FYHA 2IP1A 3K0KA 4KK4A 2JVKA 2OSVA 1PT6A 5EG5A 3TSZA 5LP6F 1RZRA 1TE2A 1NC1A 3KKNA 3HV0A 4GAEA 3CF4A 5G0TA 4JLOA 4OFWA 3TM4A 2GK4A 1NSTA 3VO8A 3KP1A 3VYRB 3AEUA 4HX5A 4LAFA 3RARA 4EO9A 4K0KB 2ZBRA 3NIBA 4HD8A 4UEWA 4B0OA 4NCJA 2JB9A 2QUAA 3ADKA 4ZAYA 4GUDA 1AZTA 2BDUA 3K9LA 3RRYA 2PKXA 5DYIA 3C3JA 4E3ZA 2PNFA 3Q8KA 4DMKA 2O2EA 5A06A 3BD6A 4Z0NA 3H3JA 2R7LA 2GK7A 1CZLA 2V55B 4J6FA 4C0AC 5BOSA 1AS2A 1NI5A 2QT1A 3TEMA 3JQGB 2V7VA 3DOJA 1WL8A 1ZZEA 3ZNQA 1R7RA 5TS2A 1EHYA 1NVVQ 3OURA 4RFLA 1TM1E 1PQWA 2ZDGA 4TV9A 1SCJA 3FHJA 1Q7RA 4BJ1A 4MI6A 2HIGA 5DSTA 2O8DA 2HLPA 4KXXA 1K3TA 1YXMA 1JJIA 2REBA 3C1AA 3ETDA 3Q5EA 4II3A 4MI1A 1FFHA 3B70A 4O4JA 2ZSDA 4M38A 4W7IA 3KSZO 3F7NA 3F74A 1G5PA 1OREA 3C6QA 3DTVA 5FBZA 5CBPB 2QAGB 4WKBA 4OJNA 4MLPA 5C8YF 4F7WA 4PLYA 3BUSA 4P58A 3C3YA 2FW6A 2GNOA 3G1WA 3QXXA 3IUBA 5AK4A 3WSTA 1QORA 4FCTA 1MEEA 3RE1A 2V0CA 2DPHA 4E09A 1SXHA 2O6HA 1FP7A 4KO2S 4RQBA 3U9TA 3WAGA 1H93A 2HN9A 1YQTA 2ZIXB 3DMFA 1YASA 4B46A 4PM4A 5FWYB 5DHTA 1T34A 1JQKA 1VI2A 3R7DA 3WIEA 2YFQA 2PT7A 1U0FA 2XMSA 1Z35A 4EKNB 3L7YA 2A88A 2XITA 1VL6A 3AYXB 1JHYA 3G02A 7ABPA 3BHMA 3SVTA 2VA8A 3B60A 3AJDA 4FSXA 5CVUA 1A9OA 4Z86A 1H4QA 3NVDA 1Y48E 4DLRA 2I2CA 3E1SA 2VJNA 4GPIB 4RDIA 4MUHA 2LV8A 3CEPB 5FWXA 2JATA 2NXWA 1PZHA 3OE7D 4ZT4A 1BJRE 5C7OO 4GM0A 2A0FA 3IDOA 4D3FA 3VOSA 3HNOA 2ANBA 3PEVA 4AB1A 5TMPA 1ENOA 4EB6B 4DCCA 2QLNA 3T15A 4AZ0B 1C0IA 1YMVA 3SEQA 5DM1A 1BOOA 4QFMA 4MVJI 4UAGA 3TLZA 5HBGA 3BL5A 4PYIA 1RP1A 4H1UA 4FDUA 1RLJA 4IIVA 3P19A 3FYUB 5K0EA 2G9VA 3A32A 2CL7X 1DRUA 1JHPA 1UT6A 2H1IA 1DQSA 2H51A 2ORYA 2CMFA 3B6EA 2VYND 4WJKB 3RSZA 3VI4B 3BMNA 3TLAA 2FWIA 1G6KA 3AIIA 3OOHA 4UUMA 4X1OA 5DMXA 4FDVA 3DOEA 1DCTA 4XH9B 3PE3A 1R9NA 2HC9A 2W6JA 2QR2A 2XCOA 5HQ3A 1FFXA 4EOGA 3RVSA 2CLKB 4KXNA 1ONPA 2CXRA 2VDWB 3A6JA 5F2KA 1S6YA 4E22A 2PPVA 2R2GA 5C5CA 1XXLA 3IRVA 3WHLA 1PGNA 3BB1A 2GFQA 2HREA 3ONVA 5DU2A 1HQKA 2ZJ4A 1J7KA 2O0HA 4Q47A 4TKUB 2HY7A 4E0BA 3VMFA 1I5EA 3ZGVA 5TPZD 3EZFA 5JCZA 1J0BA 1U4OA 2FN4A 1KTIA 5EE5B 4QBHA 4YPFA 4AJJA 1L7PA 4FYKA 2QX9A 2NO4A 2B82A 2HO4A 3TQQA 2AWNA 2XTNA 4I08A 4RULA 1E99A 5K3SA 1HK7A 1KZ6A 2W83A 2WUDA 3MTGA 5E7JA 1A9XA 1U2EA 2WICA 2UV8A 1R10A 2JFHA 1E0SA 3IDAA 1X9GA 3GK3A 4YRNA 5EIAA 4HH0A 3IDSA 1XTJA 2XEXA 1PQUA 3EIXA 4N4AA 3B38A 2BFPA 5AOCA 3T6KA 2P6OA 1M3SA 1JJFA 2VPIA 1FF9A 3E4DA 3I45A 1BJKA 3MELA 1C3XA 1ONSA 4F4HA 1VSQA 2ANCA 3DO8A 3X1KA 4KQFA 3OCUA 1KJYA 2PT6A 4ZHSA 1CY7A 5DOZA 3STWA 4KKXB 1ZWKA 1LUAA 3GO4A 3Q85A 4W6QA 5ANRB 4BLVA 3NHJA 1FDRA 1KI9A 4DIOA 1PI3A 2ZM6B 3EPHA 2QMUA 4QJIA 3UCFA 1K2VN 2HXGA 2NV2B 4YMWA 3MIIA 4JBHA 4M0EA 3GDOA 4OAQA 5LIPA 1T5TA 2FW9A 3PCRB 3O7MA 1ISRA 4TMFA 1C5KA 1U6IA 1LSJA 1X13A 3UMVA 4ZVQA 4BV9A 1P4AA 4L4ZA 1XJ5A 4LE1A 4I4TF 5JXJA 4FEEA 5JCOA 3FAKA 3PPIA 4GWKA 4MQ6A 2NT3A 3CT6A 2NADA 1L6IA 5DLPA 4D25A 4MRVA 4L02A 4RA6B 1VHWA 1YS9A 2D1FA 5BPFA 1DMSA 1LU9A 3GAMA 4IDEA 5AHRA 3PUHA 4TWJA 1AG9A 5KSYA 3VISA 1V8FA 2JG3A 2R87A 3H0KA 2OP0A 3MNFA 2NACA 2O8BB 3WWYA 2W8ZA 3PA8A 3G6WA 4DG8A 1RPTA 2WWYA 2WPDD 1J9ZA 2SNIE 2IDKA 1D7AA 2IPNA 2V97A 3AB3A 3MYRA 5E7MA 3ITDA 3WB1A 4BLSA 2NMVA 1CJSA 3O73A 1V8ZA 2A1TR 4ONEA 1HQDA 1OC4A 2UZIR 4KSYA 1BWPA 4A3SA 4D02A 3NI2A 5BORA 3B82A 4YLGA 2VJMB 4JY7A 4BAUA 2RHTA 1IZZA 1XLWA 1G17A 2VUIB 1T6BY 3L92A 4MEAA 2H0AA 3CLRD 3DMTA 3TDKA 1FFEA 1RMYA 2IIPA 1Y6ZA 2SICE 4NBWA 3IPYA 2PVSA 5KNCH 2C82A 2Y1FA 5J59A 3SJAA 4INPA 4YO8A 3U0BA 2IZ6A 3AFNA 1SFRA 3UFBA 4BGIA 4L6AA 1GCGA 3PR2B 3LPNA 3QPVA 4PSCA 5F35A 1OFGA 1K88A 4CTOA 3TFOA 2FP4B 1V3UA 4TTPA 2JK0A 1RRCA 3KXLA 5K3FA 2VYVD 4PSKA 2PZLA 4X63A 2FQWA 1J8YF 5ALPA 5C1DA 3DVLA 4MJ3A 3VR0A 1N3YA 2G70A 4PVDA 3FWYA 3M7IA 4EHKA 4OB6A 1NMEA 4Q3OA 3TW8A 2DEUA 5IM5A 2ODTX 3P0JA 4F3CA 3MGGA 1YZGA 4ZEXA 1I10A 4BZXA 3G1TA 2C9YA 3TE7A 4UBNA 1YFLA 1JDBB 3FPEA 1ZR2A 1M0SA 2E5FA 1L3BA 1FLAA 3IA7A 2GN9A 4GM4A 4MV3A 2B4QA 2NQ8A 2WNSA 1GQFA 4G09A 3OUTA 2G06A 2Z9BA 3ZBUA 1IBRA 3MJ4A 3V4SA 2HTEA 5T4EA 1G20B 3ZD9A 4YWHA 2PWAA 1E1RA 5KTKA 5KNBD 3I5YA 2AX3A 4ND4A 2MU1A 1BH2A 2C1XA 2R8EA 2GOYA 3GCXA 5TPWA 3RCBA 4J0GA 3UJDA 3OZBA 5C1BA 2H92A 3DZHA 2IXDA 4Y2PA 5FBKA 3IMGA 4OVKA 3L4BA 1QIMA 2UKDA 2C78A 2WHQA 3BMQB 4DNPA 4X62B 2QTZA 4F3RA 1O08A 5MHTA 1G1MA 1Y9DA 2ES4A 1RLOA 2KB0A 3IJEB 1BGWA 4X97A 5C34B 2XB2A 2X42A 1YKSA 3IKJA