4TTRA

Crystal structure of legionella pneumophila dephospho-coa kinase in complex with bu2
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
201
structure length
201
Chain Sequence
MVYSVGLTGNIASGKSTVAEFFSELGINVIYADKIAKELTSKNTPCYQDIISHFGSSVVLNNGELDRKRIRDIIFSNSNERLWLESLLHPVIRKKIEEQLIVCTSPYCLIEIPLLFNKHHYPYLQKVLLVIAPLESQLDRIVKRDHCTKKQALAILATQPNLEQRLEAADDVLINESGLSELKAKVNKLHQKYLREAKIKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dephospho-CoA kinase
publication title Crystal structure of Legionella pneumophila dephospho-CoA kinase reveals a non-canonical conformation of P-loop.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Transferase
total genus 71
structure length 201
sequence length 201
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ttrA00
3ZVRA 3GJ4A 2WKRA 1F5NA 2IYWA 4OKSA 1E2PA 1FTSA 1M7GA 4LYAA 2PT5A 1KSGA 1NVWQ 4PANA 2JIZD 5LBIA 2NQ2C 1J70A 3AGQA 4GMXA 3R9IA 2ZU6A 1HUQA 5F9FA 3SHFA 2YOGA 3DVLA 1R0YA 2QQ0A 4IOKA 4FCVA 3WYFA 2P2LA 3B82A 4XWOA 2HT1A 4OHZA 4KFTA 3K0EA 2X8AA 2O0JA 1E79A 3SFVA 1T3HA 4EJSA 1E2FA 2G3YA 3PUVA 4DXAA 2OCAA 1FNMA 4PTLA 2Q6TA 1W36D 3HPRA 1Q21A 1G7CA 5JFGA 2JEOA 4V0LA 1G16A 4ASUD 1WP9A 2WAXA 1G8HA 4AURA 5JHGB 4XVRA 2FSGA 5FOWA 1XXHA 4ZCMA 1FUUA 621PA 1MR3F 3GFPA 2YZ2A 3RWMB 1JECA 5H68A 4A2QA 3FHOA 3R8CA 4A8JA 4MRNA 2IWHA 4URWR 3CNNA 3EC2A 2L0XA 4DLZA 4W7SA 1YVDA 1AJEA 4A8JC 2GVDC 4KXFB 1P61B 3PJRA 3W5IA 1R5NA 2GETA 3P1JA 2R9VA 5LD2B 3HU1A 3LVRE 4DSTA 1QHNA 4JLJA 4QBHA 4W5JA 5J40A 4NCJA 2C95A 3MWJA 2GCOA 4P3YA 3A1VA 5TVKA 3UG7A 1IJEA 4MRPA 1FX0B 2KI5A 1EWQA 4E22A 1Q20A 1IOZA 2VHQA 2ZJZA 3K9NA 3RVBA 4WIAA 4TQAA 4ZPXA 3FB4A 3EAQA 4Q1EA 4EPWA 2JLXA 2XXAB 5GVRA 1E1RA 4EPVA 2H18A 3BD9A 3GLGE 3GFTA 4Q7LA 4W9MC 4KJZA 4M1YA 1DE0A 4JBWA 1UBGA 3K0AB 4GNKA 4XWAA 1VCOA 3QF7A 2VH5R 2NPIA 2IYVA 2VHJA 4JMPA 5FPKA 3U7FB 4MDEA 2HCJB 4DLUA 1GNPA 2REBA 1OIXA 1SHZA 3L8ZA 1JAHA 1JXOA 5JLJA 1F48A 1ESMA 2PZFA 3CRRA 5JJKA 4Q4JB 1VYTA 2GJKA 3QG5A 4TMWA 1TF2A 1T5IA 2HEIA 2Z4RA 4ZI3A 3EA5A 4LDJA 2G6BA 2AFHE 1OV4A 1QHSA 1XTSA 2BJWA 1OIVA 2BBTA 2J0SA 1A4RA 5FBLB 4PC1A 1QDEA 4LBYA 2ZR7A 1SZPA 4HAYA 1DAKA 4FMCF 1AK2A 5G40A 5H8WA 5IK2D 2RGCA 4ZDWA 4M2LA 2UVQA 2FA9A 2RGGA 5LPNA 1S8FA 2J3EA 3MAAC 4L9WA 2ZRIA 3C14C 4RCZA 2GZDA 1YU9A 4XIGS 3KTAB 3OIUA 2FWRA 1X8LA 2ZRBA 2GCPA 1IHUA 4PSAA 3TAHA 5K8LA 3AVUA 1XEXA 2X77A 2N46A 5UKDA 4EPYA 4LBVA 1EESA 1XDBA 2R6DA 3LNCA 4A9AA 3TBKA 4I4LA 1SVWA 2PCJA 4M1OA 1W4CA 1T0HB 2QAJA 1WF3A 4M1SA 4YQFA 3PENA 1OJLA 3LA6A 4P0TA 5CK5A 1KTVA 4AD8A 1GITA 4Q9JA 1KI2A 1XEWX 5IF9A 1XFAA 1ZYUA 2B7BA 1HE1C 2OCPA 3GEHA 2VO1A 2BHRA 1FNNA 4W5WA 1KY2A 2OE2A 1ZU5A 1KDOA 4JVLA 4GMDA 3TKLA 4PZZA 1P62B 2W2TA 2ZUBA 1YZLA 3EZ2A 1T9HA 4F4CA 1XTKA 4BFVA 2GEVA 3ZD7A 3SHWA 1E9AA 1W47A 1MABA 1QHIA 4AKHA 4NHOA 2WJHA 4KFSA 3C16C 1S9DA 3NH6A 1ANKA 4HB4A 1XD8A 3RC8A 3HWSA 3QNUA 4LHWA 1ZJ6A 4QNRA 4QGAA 1XPRA 2OFWA 4M1TA 5EE1A 3UWKA 3VKWA 2J87A 4IJMA 4PHHA 1KY3A 1F2TA 3X1YA 1KSHA 1Z6AA 3OESA 1NL3A 1UKVY 1XJ0A 1VDZA 2ZE7A 4Y0VA 1BMFA 2OESA 3D6TB 2GTPA 1JQLB 4RD2A 2OAQ1 1MO5A 1PUIA 4CT4B 1VYVA 3BS4A 2O8FA 2EFDB 1OYWA 3DO6A 1JR3D 4IHQA 2V1UA 3FE2A 4NCKA 3TUIC 1LS6A 4AK9A 2IYRA 2XEXA 3B6EA 1L8QA 2QGZA 4LJ8A 5EP2A 2HYIC 3K9GA 2MMGA 1PLJA 5G3ZA 4C0HA 3PUWA 4B74A 1D5CA 1E2IA 1BIFA 1M7HA 2O8CA 3OIVA 4KSCA 3VFDA 3R20A 4IRUB 2X19A 1PLKA 1DAIA 1ZUIA 3BFVA 3BB1A 4Q01A 1GOTA 1N0VC 3S1AA 5DH9A 4D4LA 4M8NE 3V4RA 1Y63A 4RKFA 1W36C 2EW1A 3CM0A 2V6IA 4LPSA 1TPZA 2QSZA 3DM5A 4V02A 2ZS9A 4AYTA 3AVYA 5L3VA 2J7KA 1JALA 4EKDA 1JI0A 3VR3A 2WWHA 3SYNA 2GNOA 1YR9A 1VHTA 1E9CA 4QHSA 4C9BA 4RFSA 2YC2C 4E03A 4MGZR 1D9XA 5F98A 2QMEA 1OSNA 4IDNA 2ZVQX 3MCAA 1M34E 2JJ2D 1K5DA 1CR1A 2CEAA 4KLZA 1XZQA 2OSBA 3WHKA 3TRFA 4P4UA 2ZXUA 3IGFA 1VCNA 5TY0A 2LWIA 4Q7JB 4N0DA 1US8B 4WVFA 3NXSA 5CYPA 2IYQA 3C4JA 5LDDC 2ZJ2A 2VSXA 1IN6A 1NKSA 1XD2A 4MRVA 4NE2A 4POAA 5AJVB 3NHAA 4JYCA 4Q1DA 1MH1A 4BFZA 4EFMA 3LXRA 2CCGA 1GIAA 2AWNA 4PSKA 4EQ6A 5G41A 4M0LA 3SJBA 2BKEA 4IXMA 4YONB 3M6AA 2ATVA 2YWHA 2ZI9A 5JS7A 3B1VA 3A4LA 2IYXA 3QKRB 4YMVA 4PPFA 4H1UA 1EGAA 4JT2A 2Z5FA 2A5DA 4ERNA 3T35A 421PA 3LWNA 2YC4C 4Z8XA 2ZUDA 3UATA 3DL0A 5FTNA 2B7CA 3FHCB 2EVWX 3IHWA 1P75A 4M1MA 2PEYA 3M1IA 4NH0A 5CDFA 3AKCA 4YLGA 1V43A 4V0KA 1P2SA 1F3OA 1II8B 2HV8A 2JLSA 4S35A 5HE9A 1YZNA 3FGNA 3VR1A 3ZQ6A 4JLMA 4A0HA 2PLFA 4QBGB 5EXSA 1XNJA 3MG9A 4CEHA 2EWWA 4IDHA 1N6RA 5AWFC 2W6ID 5DYIA 4EPTA 1ZIOA 4NBSA 4Y0AA 3U60B 2RHMA 3QOFA 5CYOA 3VR6A 1SVSA 4TT3D 1KDPA 3CPJB 5CM9C 3BC1A 1SVLA 5CB8A 3MWKA 1IN7A 4JLOA 1PLLA 3L0OA 5GJCA 4C0QC 4URVR 2ZS7A 3WNBA 3QXHA 3BH0A 2I4IA 2KE5A 3R7WB 3UWOA 4B6FA 2IL1A 1R5OA 2QNRA 3JVVA 2AL7A 2BCGY 2G77B 2PEZA 2ZJOA 2GEDA 4YMSA 4M4SA 1OXVA 2FV8A 1WE2A 2E9SA 2ZYTX 1E2QA 5FOTA 4BUJA 4MYHA 3RS7A 3KFVA 2Z6VA 4TMKA 2NTYC 4BLTA 4AKEA 3LD9A 3VR2A 3OAAA 1NSTA 4B2LA 2ZANA 2IS6A 3BK7A 1FL9A 3H84A 3KJIA 5BN5A 5EXPA 1QHXA 4QJ5A 2ZU0C 4BQSA 4GZMA 4B47A 2CVHA 4NYJR 2QBYB 3TE6A 1TAGA 3DZ8A 3G82C 3KL4A 3VAAA 3U7EB 1UDXA 2RGEA 2FEOA 2G0TA 2F1IA 1RW4A 3PFIA 4DT1B 2ZAMA 5HKKD 4Q03A 3WNCA 4BFXA 3GLIA 3LQQA 4ZDIA 1CP2A 2ZRKA 3LW7A 3ONWA 1U8YA 1G3MA 3WRYC 4PZYA 3CO5A 1RJ9A 4C0AC 2AD1A 2XZOA 5EUMA 2QG6A 5A4JA 1JPJA 2ECKA 2P6NA 1EX7A 1KYIA 2MMCA 2PLRA 1DG3A 3AM1A 3CBQA 2ZJ8A 4WW0A 5L3SA 2VSFA 4F91B 3THWB 2YVUA 1EFRA 1EXMA 4PC3A 2QSYA 3T06B 3K70D 4LBWA 5AUQA 3D7MA 2RGNA 3K0FA 4U7DA 2W6JA 4FMCB 1NIJA 4OBEA 1S3GA 4DCNA 2D62A 2J0UA 4A82A 4DLWA 1R5BA 1Z0DA 2RGNC 3KZ1E 5FBRB 4EPXA 1ZM4A 521PA 3ZVMA 3TK1A 1T4GA 4XD7A 2NMVA 4CEIA 1JJVA 3AUYA 1U9IA 5J4LA 2OFXA 2ZSBA 2F7SA 2JLUA 1UEIA 1KI1A 2R2AA 1NMZA 1XEFA 2VHCA 1AGPA 2YWFA 2H8KA 2ZJ5A 4PQYA 5EE0A 2P67A 3VX3A 4UNRA 2KSQA 5TB5A 4IOJA 4A0FA 1IAQA 3U6KA 3Q3JB 1NVVR 3RS0A 5BQ5A 3RC3A 3MFYA 1DO2A 1BS1A 2BKUA 4JS0A 4LOAA 1Z06A 5JWHA 1H8HA 2FGKA 2YOFA 1AM4D 2ZTSA 3W6NA 2VF7A 4RZ2A 4LC0A 4H1VA 1H8ED 2J7PD 1SKYB 1HYQA 1NMYA 5AUNB 5HCNA 5KSOA 1HT2E 3EZ7A 3HP1A 3RAPR 3N2IA 5JBQA 5E7JA 3NIBA 5DSZA 5F3WB 1NLZA 3KQKA 2QPAA 1XMSA 1U98A 4JLVA 4QJ3A 2REXB 1SVIA 3F8TA 2CDNA 2FH5B 4ZO4A 1MO3A 4LHYA 4JKYA 2ANCA 4Q19A 4JLAA 3OEED 2GJ9A 5H70A 2CHGA 4MDFA 3WMEA 3IO3A 1WBBA 4C0KA 2I3BA 2X2EA 4US1R 1TF5A 2RH5A 4II7A 2JJ2A 4NU0A 3P20A 3I3SR 4PC7A 2FSFA 2KJQA 4KYUA 3UIEA 4Q4HA 3ZIAD 4C7OA 1WCV1 2JLZA 1W0JD 2EFHB 3H86A 1NJGA 3EWSA 5FL3A 3W5JA 3WRXC 1F6BA 1QG2A 1SKQA 1XF9A 1XB2A 2QE7D 4DLSA 4TTRA 2ONJA 5DI3A 3SS8A 1ZAKA 2FZLA 2ZRDA 3MRSA 4R9UC 4HZUA 2PZEA 1GKIA 2VP2A 4OK3A 4RJLA 5A5GA 1ZC3A 4B3CA 1ZUNB 2DBYA 1AS0A 3CRW1 5BYKA 2EYQA 1NN3A 4RD6A 4TYQA 1CJKC 3U3KA 4LYFA 3QXXA 4EUNA 1G3UA 5FTMA 3K8YA 3FMFA 1OXSC 3U3OA 3VX4A 2H1LA 3ADDA 1N6PA 1O87A 3ZS9A 1U94A 1I4TD 1JEEA 5HCIA 5HTKA 4A0GA 3IQWA 2J0QA 5E3HA 2FNAA 1Z22A 4R71A 5C1BA 2XSZD 1W0KD 2V7QD 1IXSB 2IEZA 4AC9A 4CIDA 1CULC 3GJ5A 4Q66C 1I2MA 3KUDA 1TQ6A 2CL7X 2OEPA 3A1TA 4C30A 2PCLA 3WYGA 2VQSA 1G17A 3T34A 3RABA 3GEIA 1F2UB 4A2WA 3FTQA 2QZ4A 3CB4A 4GL2A 2I1VB 3V00A 4NYJQ 3I62A 2WM9B 1ZM2A 1GUAA 3FFAA 2ZVPX 1FOEB 3AVOA 1VIAA 4HUQA 4Z1MD 3IBYA 4LHVA 2KBFA 5JEDA 1TUIA 3KKMA 1E9RA 2WWIA 2QMOA 1H65A 4L4UA 4LYHA 3OEHA 4Q1BA 3VKGA 5SZKB 1M74A 3P32A 1GNRA 4U02A 1Z0FA 2QROA 3U3RA 2QM8A 4AG5A 4DDUA 1RFLA 1EFHA 1KK3A 1CR2A 3AVPA 1FTNA 3GJ3A 1KK1A 3O8BA 3OIYA 4PAQA 3GLGB 3ICEA 4PHGA 4OI2A 1Z0JA 1P9WA 5IDVA 3CPHA 4M1WA 5JMTA 2BBOA 2NPFA 5JRJA 2XNDD 4BLPA 3QF4B 4B75A 1N6OA 1CS4C 2ZRJA 3BRWD 3E2IA 2GCNA 3BIFA 4L5BA 2D2EA 1I4LD 1KSJA 2OLKA 2QY9A 3U61B 1KGDA 1N6NA 2J59A 2KBEA 1P7CA 2QI9C 4B33A 1TF7A 2HCBA 3K1JA 5K8TA 2ZRFA 4G1UC 3WBKA 3I73A 2BVNA 4F4JA 4CZ2A 3NDPA 5KNDA 4F92B 4PPNA 2C9CA 1AGRA 3DMNA 4GSYA 4FWTA 2MSDB 1CF4A 2CMKA 3K70C 1FZQA 1SKYE 3TSWA 3W9YA 4L16A 4JSYA 3CLVA 5E7IA 4Q5IA 4JSTA 2CHVA 1DTSA 4HLQB 4PC2A 4AY2A 4TYWA 3FPAA 2FOLA 1E2GA 2B92A 3ZD6A 4JL5A 5L3RA 1WRBA 8OHMA 3MGCA 4C2TA 1KKLA 4OQFA 1XPUA 4DLXA 1ZBDA 3CX6A 4D6PA 2X2FA 4Q1FA 1Z08A 5HZKA 1JJ7A 4H9GA 3FFBA 2AK2A 1P73A 1KZ7B 4BRWA 2IK8A 2LKCA 4Q9IA 1KHTA 1KI6B 2AX4A 2GJSA 1G4AE 4IVRA 2DCUA 1UF9A 1FP7A 4NTZA 3RYTC 4YMTA 3CRQA 2FZ4A 3QVUA 2J7PA 3ZH9B 4B2PA 4QG7A 1E2KA 4KFRA 1JQJC 2C2HA 4YMWA 1U8AA 3UANA 2IT1A 4WAUA 5EE9A 5K8IA 1DADA 5D3MA 2A5YB 4F93B 5DNYB 2WPDA 2GA8A 4IW3B 3AVWA 4ARZA 1LW7A 3VR4A 3TIFA 2QPTA 4ZKDA 2O8BA 2QAGA 2GDJA 3D3QA 3QKSA 4NDZA 3R9WA 4HI0E 4EJSB 3I5YA 3OEEA 2V3CC 1R0WA 1ZNYA 2QAGC 3MJHA 5CJPA 3QBTA 5HZHA 1YRAA 2C99A 3NC1C 1F60A 4QXAA 2ZRPA 3RRYA 1DAMA 2OBMA 2IBMA 3QPWA 1EFUA 1OLOA 2WWXA 3VMFA 4DJTA 3AH8A 3ZIAA 4G01B 1OIWA 2IC5A 5BN4A 2BCJQ 5EP4A 4A8JB 2YNMA 4AYXA 5TXGA 2B8TA 2F9LA 1DAGA 4G5QA 1RE0A 3ICQB 4YMUA 5FPSA 3B13B 3W8NA 5HR5A 4FMDB 1QVAA 3I92A 4JYBA 4HUTA 1FFHA 3EZ9A 2BOVA 1YJ5A 4URZR 2AXNA 1P3JA 4LBZA 2H92A 2VHTA 4DLYA 2GCOB 2AR7A 1DELA 3KX2A 1D2MA 1VCMA 2PX3A 1S0UA 3KXIA 3A4MA 1KI8A 5JWRA 4LV5B 4G5SA 2QT1A 4NCIA 1X1SA 4TWZA 1SVMA 3A1SA 2BV3A 2QM7A 3G0HA 1W5TA 2NZJA 4A6XA 1ZP6A 3NHBA 721PA 4PPGA 2IEYA 1GM5A 2O0KA 4EAQA 1G9XA 4BASA 4HAZA 3SQWA 1IN5A 1GAJA 2VA8A 3E5HA 1ZD1A 3FMIA 1E2JA 2QTFA 2JDIA 1W0KA 4JBXA 4LGMA 3SC3A 4XTRA 2VRWA 1TMKA 4UQOA 1UBCA 5KUTA 3DHWC 2ZRMA 2WJGA 4D82A 4LJ6A 4S2EA 1JAIA 2WOJA 2Q0HA 2ZITA 2P5SA 3L0PA 3IDQA 1RYHA 2ZE5A 2JA1A 3NBZC 4OHWA 2A5FA 3SBEA 1DVRA 2EQBA 1KO4A 1DOAA 2OLJA 1CJUC 3A8TA 1ZM7A 3KJHA 1OHHA 2OG2A 4ACAA 2ASEA 2VBCA 1WBDA 1GG2A 2IS2A 3PEWA 2WWWA 5CIQA 1IY0A 2GK6A 1TEVA 1CR4A 4IDQA 2ZYVX 3CUEF 1NRJB 4CDGA 2WMOB 1P9NA 3FYHA 4Z1MA 2KB0A 1L4UA 3RS3A 4O2RA 5J5CA 1G7SA 1N5IA 4M9SA 5JS8A 4GOKA 2F1JA 3KKQA 4XSHA 2XZLA 3DOEA 4TSFD 4QKQA 3CF0A 4HB2A 5FL7A 5FOUA 3CF6R 3UKDA 2AXPA 4KBFA 1XEXB 4DSUA 4P4SB 2QORA 3RNLA 1AQYA 5IHPA 4D25A 1TEXA 1G4UR 1RRGA 4XSGA 3RRMA 1HA3A 1G7TA 2HJGA 2BM0A 3SYKA 4URUR 1W49A 2F6RA 5KU1A 3LLMA 1G8PA 5LD2C 1KO1A 3X1XA 2WKQA 4IXNA 1E3MA 1YQTA 1G8GA 2C96A 3CWZA 5DIFA 1FX0A 1XMIA 1N6IA 3BB4A 3DDCA 4LYJA 4M9QA 4JBYA 1W7AA 2Q3MA 4L9SA 5JI3E 2DFLA 2IYYA 1MRSA 1XWIA 2XXAA 3QY0A 4PC6A 4KVAA 2A3RA 4EPRA 1WDTA 3NEJA 4DC9A 1WMSA 4PAMA 3GJ8A 3SR0A 4GFDA 5C2JB 3QG1A 1FW6A 2JLWA 3DEFA 3SJZA 2RGDA 2DWQA 2ZE8A 2AFIE 4JZKA 4TLCA 2IYTA 5EXTA 4LV6A 2CCKA 4A2PA 1G64A 1Z8FA 3V9PA 2BBSA 1A2KC 1GSIA 1OE0A 4UNNA 3OIWA 1MABB 3DKPA 3H1TA 1E0SA 4Q4JA 1AS2A 1YZGA 3KKNA 1C9KA 4HYYA 1NY6A 3MWYW 3NBFA 4QRHA 4ZCIA 1Z2CA 3RWOA 1KMHB 3W90A 1IBRA 2QUZA 1ZNZA 4KFUA 4TL7A 3Q85A 1QZXA 1XJQA 3O47A 2GK7A 5CLLA 3UMSA 5JHHB 1NVUQ 1F2TB 2JATA 1AS3A 4KV9A 4NCHA 2OZEA 3OFNA 4D81A 1RKBA 4DCTA 2FFQA 1FUKA 3GJ0A 2XB4A 4IKEA 1UM8A 5DO9A 5EE5B 5FPTA 5BXQC 3LV8A 4X8MA 4CEJA 2R6AA 3KTAA 2P0EA 2V4ZA 1S1CA 4WOPA 3THYA 2DR3A 3C5HA 4O2LA 4GOXA 2NO9A 2AK3A 2CVFA 2W58A 2A2ZA 4YXWD 4V0MA 3DOFA 2ZEJA 4IVPA 3REGA 3K9HA 3OHMA 2Q9AA 5K8UA 2MSCB 3WMGA 3THXA 4N1AA 2O8CB 2CJWB 1OXUA 1QRAA 2J45A 1RRFA 5FOVA 2JIZA 3H4MA 3S1AB 4FN5A 1E96A 2Q9CA 1NBME 2NO7A 1KJYA 3BFKA 4C0SA 2BIFA 3P4XA 1W46A 3ZVLA 2W83A 4R98A 1Y3AA 2WBLC 4O0MA 5FH9A 2PMDA 4N3NA 4FWIB 4LSGA 4G3XA 3H2YA 5KHOC 1COWD 2ZRLA 3BE4A 4CW7A 1WB9A 3B78A 3BORA 1XD9A 1Z6XA 4YC7A 1LNZA 4DSNA 2QMHA 2VIIA 1AKEA 1R4AA 4C2UA 1DARA 1VMAA 3EWAA 3W6PA 4ASUA 3U44A 4BWYA 4B35A 1G3IA 4QM7A 1YKSA 4AKGA 2IF2A 1NN5A 1N3BA 2GVZC 1G3RA 2HXYA 3UXMA 5KSPA 1RVDA 2ZSAA 1E2NA 5FI1B 1EFTA 4BFWA 3CNLA 4EQ6B 1E9FA 1L4YA 4IEEA 3SNHA 4DLTA 3CZPA 4BECA 2GXQA 2O52A 5KDDA 2BMFA 2C8VA 4KVGA 2JLQA 2HYDA 3GJ7A 1A2BA 3Q72A 3KQLA 2ODBA 1OYYA 4OYHA 3RS4A 1MRNA 2YV5A 1P4SA 1IXZA 2NZ8A 4DLVA 4P33A 2QRNA 2CXXA 1P2UA 4TZ6A 1DG1G 4YDHB 3U4QA 2D7DA 2ZR9A 5DISB 2BDTA 4TLBA 4HLCA 3KXKA 2XTMA 4JJZA 121PA 4FCTA 1NP6A 2D2FA 1S2MA 1LF0A 2F1RA 2FN4A 2JGNA 3U2QA 4CEHB 2O8EA 4RZUA 3TUJC 4DZZA 3OF5A 3IILA 4R2IA 4QM6A 3QKUA 2VHUA 5HPYB 1GFIA 1VKJA 1Z29A 2WJVA 4ZKEA 1BH2A 4TSFA 3AKYA 4TYYA 3ZZTA 1XJCA 4TL9A 4PQRA 2FEMA 4QJ4A 3B2EA 4ZV4A 3MMPA 2JJ8A 3WP0A 4FIDA 3TVTA 3QPVA 2EFEB 4ACBA 5FR2A 1OXTA 1GKUB 4MKIA 5DYGA 4B71A 3L8YA 4K81B 4HAUA 2FE4A 2V55B 1IONA 3Q9LA 4FW9A 1G20E 1L2TA 1Q12A 2NGRA 5FOSA 5IK2A 4RSGA 2R6GA 1ONBA 2ZS8A 1ZU4A 2B8WA 5J47A 1W48A 1N6KA 3QQ5A 2XTNA 1US8A 3U6BA 1NMXA 4QL3A 4B3XA 3W3ZB 1D9ZA 1E1QD 4RKEA 1BOFA 3W6OA 4A6PA 5EZ6B 2VYFA 3MSXA 5DHFA 4D0GA 1UKYA 1GRRA 2WJIA 3QKRA 1E94E 5H1YA 2QA5A 4DDWA 2IHYA 2QENA 4QGFA 3GLIB 1LFDB 3R8FA 3KB2A 2BMDA 2CNWD 2OT3B 3LQRA 4GI7A 4NYIR 2P5TB 2CBZA 4B48A 2DHRA 4R2HA 2ONKA 1IQPA 1RJ9B 2LKDA 3CF2A 2YWEA 3OZXA 4DVGA 1CJTC 1YHNA 3NH9A 4BLRA 2F1HA 3RSOA 5JECA 2K5UA 4LUCA 4PPQA 1II8A 4KU4A 5L3SB 2ZI3A 3M4YA 2X1VA 3N2EA 4MKHA 3GLFB 3UMRA 1W44A 2V54A 3K0FB 4RZXA 3A4NA 1II0A 4A15A 1ZINA 4BE7B 3T1TA 5IRCD 2XX3A 1KDRA 2N42A 4GP7A 2DWPA 2EFCB 4CEIB 2R6FA 5LB2A 3P26A 1ZRHA 3IIKA 2ERXA 2ATXA 1S1MA 2D4HA 5AJXA 4JVMA 4B2IA 2RAPA 1OFTA 4M9ZA 4MGYR 3ZQJA 4BFSA 4URYR 1MKYA 3SZRA 2GF0A 4NYMR 2GBLA 1XEWY 3R7WA 1G7RA 4KYIB 5KYKA 3KKOA 4UJ3A 2C9YA 5GJBA 2GBLC 2J9RA 2TMKA 2VP0A 1HE8B 1VG8A 2GZAA 1C1YA 2V9PA 4JLPA 3G5UA 2J46A 4FINA 2QQEA 3VU9A 2ZETA 1NLFA 4Q21A 3B1WA 1J2JA 2QEQA 1KNQA 4Q18A 4EFNA 2GAAA 3SE0A 3AVVA 2G1JA 3PCRB 4NKRA 3TR0A 1JR3A 1T3LA 1SVKA 2WKPA 2QBYA 3PEUA 4BLOA 1XZPA 3RSLA 2N1BA 1CLUA 3IQXA 2UKDA 2H5EA 4C4PA 1CTQA 3PITA 2IYZA 4YDSA 4ESHA 1XP8A 1G5RA 4MYCA 2CLSA 3VTKA 5SZIA 4LHXA 1SQ5A 1COWA 2F9MA 1KI9A 3ZGXA 1Z3IX 1QHHA 3QJYA 3EPKA 5LB4A 1LB1B 5JZVA 1VG9B 4PXAA 5DN6D 2IW3A 4Q1CA 4DUGD 1KO8A 5EP3A 2V8OA 4PQFA 3T1OA 1M6NA 1AIPA 5CDFE 4ILEA 3L0SA 3I1FA 4WXPA 4X8OA 1SGWA 4KAXA 1W2GA 4MUBA 3NWJA 1KO5A 1ODFA 2IX3A 4C0BA 3KJEA 3GJ6A 3PG5A 4D4JA 2C98A 4XWKA 1D2NA 2UZIR 2YOHA 4HZUB 4LRWA 2A5GA 4GZLA 4NMMA 4OHXA 3BWDD 2WSSD 4PFSA 3ASZA 2FPMA 4D26A 1FP6A 3AP1A 3GCGA 3I32A 3HPQA 4M9XA 4DEYA 5P21A 3CH5A 1XX6A 1SXJB 1JPNA 3I72A 1HQCA 4ZDJA 2XNSA 2HJVA 1A82A 2J41A 4LJAA 4BFTA 2IXEA 5EP1A 5FTJA 2FPLA 2BJVA 2CHQA 3Q5DA 1RC8A 3M0EA 3WP1B 1P60A 2VL7A 3LBNA 4GBMA 5KDLA 4U5XA 5DE3A 3NTUA 1VPLA 4LZZA 1G8YA 4JKIA 1BYIA 3ASYA 2RMKA 2D74A 5GADl 4HAWA 3CNOA 4BZPA 5FUXA 4M21A 4HATA 4HB0A 1G41A 1TADA 5CB6A 2IHBA 2NO1A 2GXUA 5FTKA 1HV8A 4IDPA 5SZHB 1XPOA 4L15A 4LK2A 5F9HA 3BAFA 2IS4A 1IY1A 3GLIE 2BC9A 2C04A 2IYUA 4ZDKA 4QHYA 3GP8A 1P5ZB 3HYRA 4QGGA 1ZD8A 1NY5A 1RRPA 2J5XA 4HUQB 3B8HA 3C8UA 3B1YA 2WV9A 1Q3HA 2W6IA 1A1VA 2QPOA 2OXCA 2O8DB 1N5LA 1V5WA 2ANBA 2Q3HA 3ZZUA 4XJXA 3GLFE 1TQ4A 4TT3A 5FUYA 1RRCA 1Q1EA 2FFHA 3PUZA 3BOSA 5FBVB 4DRZA 3CPEA 4QBIA 3B60A 1Z6GA 2DY1A 2R65A 4XVUA 1BKDR 1GKYA 1WQ1R 4PX9A 1HY3A 1YE8A 3EZFA 3T5GA 2ZI5A 5G3YA 2IXFA 5KPJA 4CT5A 3GLHB 4GDFA 2ZYWX 4TL8A 3WHLA 2ZPTX 4Q4AB 1NBMD 1R8QA 2BM1A 1T6NA 4E07A 3UK6A 4C0JA 1KKMA 1A5TA 1KK0A 1KMQA 1KI3A 4PO9A 1VCIA 2JLRA 2A5JA 3KUCA 4MKGA 4BLQA 2W00A 1CKEA 3RHFA 1S4QA 5JI2E 4MGIR 3X1DA 4DIEA 1OB5A 3A1WA 5AK0A 3GMTA 2GESA 2WICA 2GKSA 3WYAA 4F38A 4DLRA 4RVCA 1NI3A 1NSFA 3T1QA 3TSOA 2GXAA 2GHIA 3C41J 4G5OA 2ZJBA 5HKKA 1XTIA 3EASA 1KIMA 5CITA 1QHGA 1J90A 1Z6YA 2RGBA 1KAOA 2WWGA 4BZXA 3TMKA 2OO7A 1Z6TA 5FR1A 3LLUA 2XB2A 4MGKR 3L82B 2ZIAA 2WIBA 4M1KA 4Q00A 3U3JA 2VLIA 3EW9A 1C4OA 2V1XA 3IEVA 3DPUA 4IFEA 2BEKA 3AF4A 4XVQA 1T8TA 3JVUA 2XOKD 5FPYA 2VP6A 3ECCA 2GJ8A 3SU8A 1JR6A 1NVVQ 5FBWB 2H16A 3KFXA 4ZIRA 2FJUA 2W0MA 4CF7A 1NLYA 1TX4B 1DAFA 3AP3A 5J4YA 2JASA 2WSMA 2IA5A 4PHTA 5FOXA 3TR5A 3CH4B 2EYUA 2DFNA 2J1LA 2HF9A 3J81k 3IUYA 3UG6A 3GLGA 1VYUA 1P2VA 4ARZB 3E70C 5L3QB 2O8BB 3BH6A 1OKKD 3DM9B 3IPXA 3SDZA 3K0SA 4DBLC 821PA 1DBSA 2ZREA 4BZQA 1E69A 2GRJA 4B3BA 1SXJE 5EUQB 4TN1A 2Y8EA 2FU5C 4DIDA 5KOYA 1H8EA 4HB3A 1R0XA 4KHZA 2YYZA 2AKYA 2H7VA 3AF1A 1E4VA 4Q4LA 5KSYA 1ZVQA 2CK3D 3SEAA 3DKVA 2DYKA 1XCGB 4LJ4A 4Q9LA 3A6PC 4HLDA 3TSZA 1VHLA 4MUAA 3X1ZA 1NNEA 5DI9A 1QF9A 2CL0X 4NPHA 2FMXA 1E2DA 5SZJA 4TQUS 2ZRNA 4TMTA 4HAXA 5A0FA 3PV0A 1HT1E 4RCYA 1R7RA 4WBSA 2RKOA 4A92A 3KXLA 1GNQA 2FSHA 3LBIA 4XH9B 4R7ZA 4QHTA 1NIPA 1GDDA 1XXHB 3WY9A 3AF2A 3EA0A 3KJGA 4O3MA 2G1KA 3TH5A 1W0JA 1GZSA 1P6XA 5AJWA 1KJWA 2ZUCA 3QXSA 1EK0A 1TL7C 5HE8A 1ZW6A 4OL0A 2QE7A 3HU2A 4MRSA 5J4VA 4OHVA 5E4FA 4KITB 1BMFD 2QT0A 3LY5A 1KI6A 2C77A 3BERA 3T1VA 3TQFA 3IBGA 2F43A 3CW2A 4MYTA 4QFMA 4RZ3A 5EXXA 2A78A 3EC1A 5JSZA 3F0TA 3FOZA 1CIPA 1KI7A 4G5GA 2ZI6A 3QXCA 5G53C 1BO6A 4X8LA 4KODA 5CJ2A 4B6EA 3W34A 1KAGA 4FCWA 1WXQA 4OQMA 3ZS8A 1ZNWA 1XCMA 5TV2A 3SI7A 1IN4A 2QTHA 3ADKA 3AKEA 3Q8XB 4UNSA 1R10A 3MLEA 3RLFA 1KSFX 3FMPB 2OHFA 2WJYA 3QEOA 3VR5A 3U7GA 2GF9A 1LS1A 1JBKA 1E2MA 5AR1A 1Q1BA 3GLHE 1NN1A 2XSZA 3QI2A 4EJSC 2V7QA 3LAWA 5EJEA 1U0HC 2P6UA 4NP6A 3CR8A 3CONA 2RCNA 3NEYA 4GP6A 1FQKA 1N6LA 1CEEA 3PUXA 3C15C 2OXRA 2P65A 4RD4A 3TNFA 3RRZA 5DLQC 2HF8A 2ZRHA 4D4KA 4OHYA 1U81A 3BJIC 1DEKA 3CZQA 4OI0A 2A30A 5AJZA 4A36A 2ODEA 4OI1A 1XTJA 2VF8A 3NKVA 3FDIA 2QTVB 1AKYA 2YJTD 4ITRC 5E95A 3RS2A 3LH5A 4Z54A 4AKIA 1XCPA 4F4IA 2SHKA 4DWJA 5BW8A 2P3SA 1QBKC 4WA7A 5DHAA 4NL4H 1E0AA 4MRRA 3QE0A 4M53A 1NBMA 2OCBA 2ZQ5A 5FUVA 1Z5ZA 3CX8A 2GILA 2QP3A 3PIRA 4PO8A 1VG1A 2QP9X 3NC0C 3UMFA 1ZCAA 5BYJA 4OI4A 1G5PA 1TQDA 1D6JA 4IDOA 4TYPA 2ODWA 4BFUA 1UKEA 5FI0B 2ZI4A 3IHLA 1E2LA 4E09A 2PL3A 4B76A 1CU1A 2OM2A 2G88A 1G19A 221PA 2VEDA 1Q0UA 2OUKA 1ETUA 1MO6A 1KO7A 2XNDA 2Z4SA 2QU8A 2WWYA 3BBPA 4RD3A 4LHZA 1GTVA 2QN6A 2IXGA 3X2SA 2PZGA 2IUUA 1CJMA 3KQHA 1Q1ZA 2AD5A 1E98A 3L2OB 1IY2A 4OK5A 2I1QA 4DB4A 3QUSA 3U5ZB 4V03A 3K0AA 2XOKA 2F3TA 4X8HA 3UPUA 2PBRA 2JCSA 1AN0A 3CWQA 3TVDA 4XTCS 4D0LB 4F7WA 3QIAA 1MT0A 5JJLA 3SJAA 2EWVA 4TLAA 1RIFA 2XAUA 4CEJB 4RD1A 3T61A 3ZDQA 4ABYA 1J8YF 3MJRA 3THYB 3AVQA 2E87A 3AQ4A 4P4SA 3ZJYA 1Z28A 5DGXA 1E0JA 1KI4A 4I99A 2WAYA 4B32A 2BMEA 2OILA 3QPUA 4DDVA 5C46F 1G21E 4MYUA 2ZR0A 1NG1A 3L0IB 3FKQA 3MWLA 2FX3A 1X86B 1OKKA 2CE7A 2FF7A 2P6RA 4FI3C 3THXB 2Z83A 3SYLA 2ZRAA 6Q21A 3W3AA 1XXHE 2IYLD 3B1XA 5GJVC 3OAAD 4I1OA 2BEJA 4LI0A 2IS1A 3ADBA 2HT6A 2O8FB 2AKAB 3LW8A 2PX0A 2W0SA 3B85A 2CK3A 2R6CA 1JB1A 1RZ3A 1Q1QA 1ESNA 3WXMA 1G8FA 1QHYA 1XBTA 5KSZA 1CRPA 2BBWA 3IKJA 4G0NA 1XU4A 2J0VA 2YWGA 2XZPA 4JT4A 1P9RA 2W2XA 4LJYA 1DAEA 2QRZA 2OBNA 1R6BX 4HEJA 2GJAA 3ZYCA 3JZAA 1W36B 2NO0A 4XOIA 1K8RA 4HDOB 1GVNB 1N25A 1D8TA 2DFKB 4JVNA 1CXZA 2PJZA 3U44B 1E0KA 1MOZA 1E9EA 1KMHA 1YZTA 2DPXA 3FWYA 4ON9A 4TTPA 1EWRA 5AUOB 1EFRD 1QG4A 3CRMA 4DSOA 1AZSC 2E1RA 2C9OA 4IOLA 3MD0A 4EIWA 1XMVA 2QMUA 2W6JD 4MA4A 4TLDA 4UNPA 3QSYA 4RFSB 1GWNA 2V6JA 3AUXA 4XD7D 3V4FA 5KPDA 1ZMXA 4UXHA 1UPTA 1Q22A 2RGXA 3LXXA 4A4DA 5KTYA 1XTQA 2ZE6A 4Q02A 2R62A 4AIIA 3GJXC 2D7CA 4Z8YA 1LY1A 3IIJA 4FMBB 4BLSA 4BEBA 4KO8A 2VP9A 3BGWA 1GL9B 2HXSA 2JLVA 1ZNXA 1DPFA 2RHDA 1WA5A 1XD2B 4QNMA 4WZ6A 2PT7A 5J4HA 3U4QB 3AF3A 5FFMA 1H8HD 4QGHA 1OH8A 2CJWA 3TLXA 3F3YA 1X6VA 2ODNA 4KCGA 4MKFA 4MQBA 4CYMA 3B9PA 4JLDA 3NBYC 2IF0A 4D80A 1Z2AA 2IUTA 4DCSA 1SVOA 2QP4A 2VP4A 2O8EB 1ZCBA 4BEJA 3AF0A 2ORVA 3BB3A 1E9BA 3LVQE 4BFYA 4PR0A 4Q7MB 3FVQA 5KO2A 5JEEA 3CX7A 1IM2A 4M22A 3VNVA 2Z43A 4AYWA 3DMDA 4PSVA 4JIMA 4HZIA 3SBDA 1W4RA 1ZM9A 4OJKA 4US2R 2HLDD 5L8VA 3EPLA 1JXMA 2KWIA 4GOJA 1OFIA 3SOPA 3SFZA 1FMLA 3I5XA 1U0JA 1U99A 2O5VA 2GWHA 5E7MA 3R9XA 4V0OA 1N0UA 1S96A 1OW3B 1E6CA 4BGDA 4AG6A 3AB3A 1EX6A 3X1WA 3SN6A 5KDOA 2JLYA 1G1MA 2F55A 3QKTA 2GXSA 1N5KA 2D06A 5TARA 5JJIA 1JEDA 4TL6A 3LDAA 5F2EA 1TQ2A 1UEJA 3HU3A 1A7JA 4IVQA 1OH6A 4AI6A 3LBHA 3NDBB 2AHOA 5C4MA 5EQTA 2G83A 1II9A 2CLCX 1J8MF 1TUEA 1SXJD 3EPJA 3L43A 3EZ6A 4V0ME 4P4TA 3Q7QA 4HLUA 1XTRA 3TGPA 5IT5A 1FMJA 3HR7A 3OE7D 4HLUC 3LX8A 4A1FA 5JCPA 3O8CA 2ZRGA 3PUYA 1UFQA 3AVXA 3PEYA 1R2QA 4JVSB 3FKSD 1X8KA 3PVSA 3Q7PA 1Z47A 2IYSA 2NG1A 4D4MA 1RYFA 1N6HA 2AWOA 4TTQA 1IXRC 2R8RA 3KKPA 4KLNA 2ZAOA 1UBFA 1TNDA 1PV4A 1YZQA 3AP2A 1XRJA 3CIOA 1UADA 4Q48A 1EG7A 1YRBA 2YINC 3NG1A 3QBVA 1LTQA 3QXJA 2C03A 1GL6A 4I1UA 1M7BA 4KI0A 1W4AA 5C4GB 1TU4A 4P31A 2Z0MA 4PAOA 1S9HA 4OQNA 2LCFA 1P2TA 1G6OA 5B58C 3P27A 1GP2A 4NZYA 2J0UB 3C5CA 1X8JA 3IO5A 1ZIPA 4OK6A 5FPHA 1RPZA 1Q57A 2XJ9A 3CRVA 3VU9B 1M2OB 2AN9A 2IWRA 4LX0A 3OEHD 1UDWA 3KB1A 3ZZ0A 1E2EA 4JL6A 2GEUA 1GRNA 1ZM3A 3AEZA 3QENA 3REFA 3PEVA 4MITA 5B64A 4NONA 3IEUA 4GT1A 4YXWA 1AQUA 1E32A 4MH0R 2B6HA 3KQUA 4E5UA 3TW8B 4BPBA 2CL6X 1OT3A 1GILA 4NCNA 1DO0A 1M8PA 1E9SA 1UBEA 2ORWA 3LRPA 4PO1A 2RB4A 1CR0A 1QHHB 3GEEA 1P72A 5ELXA 3B5JA 2NIPA 1HEIA 1OF1A 2OCYC 4LCBA 4CRWB 1DS6A 1Z0IA 2FFAA 3GQBA 3BH7A 1D2EA 2XTZA 2G9NA 2ORIA 1KJZA 2BMJA 3HYTA 4JJKA 3K09A 2ZSEA 5CM8B 1X1RA 1YR7A 4Q47A 4QOSA 4TLEA 3HR8A 2GZHA 1CRQA 1UKZA 5AUPB 1U0LA 3K09C 4ZCLA 3GLFA 1I2DA 3TUZC 4C0LA 4UJ5A 3FHTA 2ZROA 4DT1A 4W5HA 1OB2A 1FQJA 2NOAA 4FMDF 4TMVA 5FBQB 1PJRA 3K53A 3BFXA 4B3GA 4DCVA 4Z51A 3CKLA 2JJ1D 2ZYUX 3I8SA 4D0NA 4I81A 2PMKA 3ADCA 1NVXQ 1LVGA 1U9IC 3NVAA 4Q7KA 4Q4HB 4C7OB 1KDTA 5M04A 4RFVA 5D3QA 3TW4A 3THWA 2F3RA 1K5GA 3PXGA 3RS5A 1Q44A 4IEIA 1ELOA 1YR8A 5BWMA 2R44A 2A7QA 5B30A 2PH1A 3K9LA 3N70A 3C7KA 3I4LA 5DI3B 3NBXX 2CLDX 3ETLA 2XITA 2REOA 4QC2A 4C3ZA 4N0EA 5CK4A 1J99A 2G0NA 3F5FA 1KK2A 2ZRCA 1G18A 2B21A 4JLKA 3E1SA 4V0NA 2WVJA 2WPDD 4ZI2A 2ZSFA 2OV2A 4UKDA 2FPKA 4TZ0A 1LF5A 4DHEA 1NF3A 1N0WA 3GPLA 2YKGA 4US0R 4KBGA 3T12A 4B43A 4J0QA 4Q9HA 5JWOA 3CR7A 2HLDA 1BYUA 1B0UA 5JCZA 2WOOA 2VPPA 3D8BA 3IIMA 4I1VA 2ZJYA 4HSEA 3T5DA 1FPMA 2FG5A 2VSOA 4CGZA 4Q9KA 1AZTA 4B44A 2FSIA 3B1ZA 2C78A 2CE2X 2QL6A 2RGAA 3GD7A 5GVSA 3ZVNA 1E79D 3DZDA 5GJWC 4K8OA 4OQLA 1Q3TA 2HUPA 1IN8A 1M1YE 4K46A 1YR6A 4JLBA 1YZUA 4A0RA 3EX7C 3AVTA 3EPHA 4PZLA 4JLNA 3SJCA 3RDPA 1E99A 5FTLA 4UNQA 1W4BA 3W8RA 3EIHA 5JRZA 2PJRA 1U2RA 1NJFA 1GL7A 4WZBE 1SXJA 4FD2A 4B73A 2DB3A 1G6HA 1NG9A 5J4KA 2FDCA 3A37A 2Q9BA 2JAQA 1NKTA 1SXJC 4NYIQ 1OPXA 1W5SA 4ESVA 2NO6A 2EU8A 2WZQA 1E1QA 2DFTA 4WXRA 3OE7A 4CVNA 1E2HA 2WJJA 2ZI7A 3O8DA 1TU3A 3FKSA 1S3SA 2JDID 5AJYA 3EARA 2H17A 1R0ZA 2OBLA 2ZJAA 3RANA 4EDHA 4B3FX 4DEXA 1SULA 3VHXA 1GRQA 4TQ9A 1HTWA 1E4YA 3B7GA 2OFOA 2CNWA 2VTKA 3A36A 3VHLB 1JR3E 4EFLA 4WZAE 4OQXA 1UAAA 2FGJA 1E1RD 3ND9A 5TDHA 3TAUA 5KNCA 1E9DA 1KNXA 3H0KA 3KQNA 2DWOA 1OHHD 3O8RA 3AKDA 1OH7A 2A9KA 2WWFA 1VTKA 3TQCA 3K70B 1PZNA 4NYMQ 5EZ5A 1T91A 4B3DA 3LX5A 3THOA 3TJZA 1ZD9A 4L8GA 3QVVA 4Q1AA 1T5LA 2H57A 4ZIRB 4FXPA 1OXXK 4RD0A 3VNUA 1N5JA 1YZKA 2O8DA 4GPTA 3MUFA 4UXIA 5FL7D 4DCUA 2CCJA 3EG5A 1X3SA 3EXAA 4GRAA 4JL8A 3WNDA 1KOFA 1Z63A 4D2IA 1F2UA 1VIYA 3AGPA 4HDQB 5B2ZA 5TMPA 4BRUA 5ANRB 4LWZA 4U00A 2FFBA 3A58B 1Z0AA 3K0CA 2XGJA 1PUJA 4LJ7A 3HDTA 5BN3A 1U8ZA 2IUSA 2EFGA 3EIQA 2QGNA 4LPKA 2WHXA 4URXR 1T3SA 2XJ4A 1I4DD 3A1UA 3K0CC 3GLHA 4KSBA 1UJ2A 2ZSDA 4Q4AA 2Q21A 1G3QA 5C18A 3PQCA 4LJ9A 3BXZA 4RY2A 3LO5A 1HURA 4TMZA 3SQXA 4OJQA 1CBUA 4IFBA 1PVOA 2C5LA 3VKHA 4B34A 1OFHA 2D3WA 5D3MB 3B9QA 1XMJA 1Z83A 4PHFA 1K6MA 1R8SA 1W2HA 3D31A 1MO4A 3I8XA 1HQYE 1O3YA 2HDNB 2QAGB 2W2VA 2WIAA 1N2CE 3IPYA 3ND8A 3QKSB 1VECA 1W1WA 2ERYA 1KZGB 4TMXA 4DKXA 1ZUHA 4LY6A 3QF4A 3FMOB 1U90A 3ZLJA 2JJ1A 1LV7A 5DN6A 4HAVA 2GAOA 4G5RA 5CIWA 1QVRA 4P32A 1T0JB 3HJNA 2MSEB 4IOMA 3T15A 4DUGA 1DAHA 3VQTA 2ZM5A 3U3MA 1IJFA 1T8UA 2Q3FA 2WTUA 3JZMA 1JNYA 1NN0A 4LV8B 5B57C 4DDTA 1MV5A 2O0HA 2WMNB 3OFND 1HH4A 3RRNA 1VG0B 3GFOA 4HDCA 1AA9A 1L7VC 4QBFA 1J7KA 4I1SA 2F43B 4O25A 4AWXA 3QEJA 3U7HB 5KNBA 5JSZB 3LFUA 1OFUX 2WSSA 3KDSE 3WMFA 1B23P 4LJ5A 1G5TA 3AV0B 3WBJA 3EIEA 1CJVC 1TTTA 1G291 1OH5A 2OAP1 1Z07A 2YHSA 5EE3A 2BWJA 4DB2A 3Q5EA 3PR1A 4LC1A 3P4YA 4UXJA 2UZ3A 1EFCA 5FUWA 2VP5A 5CLQA 3I61A 4TYNA 5L3QA 1ZC4A 1SHKA 3N5CA 1Z0KA
chains in the Genus database with same CATH superfamily
3LK7A 5IKOA 3ZVRA 4U8HA 2ZBQA 4DN6A 1F5NA 1QVVA 2IYWA 3C3EA 1FTSA 1M7GA 1ONSA 3PYXA 2NQ2C 1SQGA 2WRZA 1VJDA 3HP4A 4C76A 1XA0A 4BDSA 3AGQA 2MCFA 4CQMA 4DR3B 1UBKS 3F5DA 2ZU6A 2FFRA 4RV9A 2IYFA 3ES9A 3MB8A 1R0YA 4CXMA 2AOWA 4FCVA 4XUGB 3Q9SA 4ARUA 2O54A 2P2LA 1PJ4A 3NT5A 5K8CA 2HT1A 4KFTA 4OKNA 5JCOC 2G25A 2I4RA 4HQRA 4ZAFA 5BSFA 5COBA 2O0JA 1E79A 1ATIA 1MZVA 1L7BA 2BDEA 3IH5A 4Y9RA 4AVYA 2OCAA 1F0NA 3KLMX 3RGWS 1NR5A 4MR8B 4TKVA 4BO0A 1KQPA 1G5IA 3A27A 3DWFA 1MQAA 3HSSA 3R1IA 4MCIA 4XCQA 5K3CA 2BEVA 1AXRA 2O3RA 4J7XA 3EF3A 4ASUD 4E3ZA 1Z5OA 1JN0A 2AN4A 4TWIA 5JHGB 1QPZA 1GFZA 4Z4EA 2PH5A 4KMMA 5AW5A 1MR3F 3GFPA 2OHVA 2FI1A 3E23A 5LZ9A 1JHMA 3NBAA 3R8CA 2YN4A 2F1OA 1RBQA 3DTVA 1PFWA 1AF7A 3P2IA 2IQ5A 1PL8A 3WLOA 3GF4A 3I0ZA 5I7FA 4KXFB 3T9EA 2D1RA 4A7PA 5LD2B 4TS4A 2CLHB 1T9GR 3OU2A 1QHNA 5J40A 4QBHA 4W5JA 2RK3A 4FM9A 2PVSA 3A7DA 4H59A 2FUG6 4I08A 4NCJA 5CT6A 4EDHA 2GCOA 1C1HA 3A1VA 3CLSD 1IJEA 4CLOB 1TT7A 1Q20A 4ZODA 4WIAA 4UD6A 4TQAA 3U3XA 5C1PA 3GUHA 1M1NA 3RKSA 1ZI8A 2WHPA 5BVHA 1KVRA 1MNAA 1S01A 2H18A 4EPVA 1WVMA 4J9VA 4K9LA 3GFTA 1M67A 3LQKA 2XDQA 3OX4A 1UFRA 2FOXA 2KLHA 2NZYA 2WU0A 4ENWA 3LY9A 4W9MC 4KJZA 4NMHA 4JBWA 1DC6A 1TT5A 3K0AB 4N9WA 4IGFA 2FAXA 3E2PA 2VH5R 2R1UA 1CUBA 1EVKA 2HCJB 3VYRB 1R9NA 4O59O 4IYJA 4OB7A 1CWUA 3ZEAA 4QFBA 5IHXA 4EI9A 4CM8B 1W581 3I28A 3QMWA 5JLJA 4TPKA 4DABA 2BI8A 2OV6A 1XRSB 4EMTA 2IIQA 3BGSA 2VXYA 4FKBA 3UT5B 2FPPA 3IAFA 1EUQA 3OTQA 3N86A 1MN6A 5DYYA 1FA9A 4KXNA 2XBUA 1R9JA 4ZEMA 4C7MA 3I1IA 3D1LA 4NFLA 1XTSA 5A3SA 1IOLA 2OHJA 5NLLA 2EC5A 3TZLA 1MH9A 4N6GA 3TL2A 1KFEB 2ZR7A 4LDRA 2FSSA 1F7VA 3V6MA 2HLHA 4AO6A 1QFZA 5IK2D 1DINA 2CV1A 5IWAB 4M2LA 3NHSA 3A9SA 5BT9A 1WAMA 1S8FA 4L9WA 1VJCA 4LSMA 4DZTA 1VJ1A 3VC2A 4EYQA 5B36A 4KREA 4OAOA 2BFPA 3TAHA 1G5QA 4DLZA 4GC5A 5EI5A 1CUGA 3IUNA 1ZI6A 3NX4A 4R1UA 3WLQA 8ATCA 1VMEA 1NU8A 2C97A 1Z88A 5GQSA 2X3UA 4BUZA 4NG4A 1SVWA 4A73A 4M1OA 1XE3A 4GZ6A 4G4GA 2XUFA 1G38A 3ZWDA 3MD9A 4XQCA 1NVAA 3KCQA 3S1SA 4AD8A 4ETMA 4FVTA 2G8LA 1XFAA 2B7BA 3PPVA 1GR0A 2DBZA 2Q07A 4FNAA 4MP8A 5K3BA 1SC1A 2F48A 4MIOA 3HCOA 2GSWA 2C07A 2QNIA 3CN9A 2J4CA 3MJ4A 1DC3A 1P0IA 2PUTA 3PUHA 1BKSB 3Q12A 5I3CA 1KDOA 2HPVA 2FSVA 3GHYA 1O5TA 3H0CA 4JVLA 2PWZA 1YI1A 4GL2A 4M60A 1RYBA 4FEGA 5EJAA 2FSVC 5LZ7A 4XUEA 1JUDA 3BZWA 2ZBFA 3UUEA 1QHIA 2H3HA 1CPYA 2ZUEA 1KXZA 1OJ7A 3HZHA 3OT1B 1ZUD1 2IY9A 3C16C 2DRIA 1ANKA 1Y5IA 4HB4A 5M7EA 3D43A 1CUZA 1RCUA 2IKQA 3QNUA 1FW8A 1VPEA 3A2LA 1CB0A 1Q0TA 1ZKMA 4JR1A 4RTPA 3NHMA 4KK3A 1XZEA 1IUKA 5EIBD 2GLUA 3WNQA 2I9KA 1F2TA 4KGXA 5ALHA 1M6VB 1U9ZA 4KPUA 2I80A 1SCJA 3OY2A 3DEAA 3GGSA 1VDZA 5HIIA 3ENVA 3SICE 3NR2A 2QAIA 1KORA 3JR7A 2VF2A 1SBCA 2XD9A 3NT4A 4MICA 4XFDA 5C1DA 5KYXB 3AFGA 4G24A 4CTOA 1LUAA 1QBGA 1MO5A 4OHKA 4ZT7A 3AFNA 3HNPA 3G17A 2YR0A 2B30A 1YULA 3BS4A 5DIZA 3QVGA 4BKMA 1G60A 1U9JA 5E6RA 1OYWA 2B5WA 2ZT8A 4G37A 1S3IA 4IHQA 1GN8A 4WL0A 1H9AA 2Q5EA 1K2WA 4NCKA 2QB5A 3TUIC 3KR9A 3TX2A 4M7RA 4JLSA 4F86A 5LQUA 1WB4A 3QVTA 4LJ8A 2QGZA 2P9HA 4GGOA 3K9GA 2J32A 4PLVA 2UV8A 1QF6A 1E2IA 4BEWA 5ITZA 2O8CA 3DVAA 3OIVA 3EHDA 3V2HA 5ECDA 4AJNA 1V8FA 4G5FA 3R20A 1U0NA 4FFVA 4QU8A 3S5UA 3USES 5KKNB 1PLKA 2FOIA 2CWWA 1A5ZA 1O0BA 4XGNA 1F0YA 5JS2A 4D4LA 4I66A 5DH9A 5BRNA 2PV0A 2V8BA 3DE0X 1CE8A 2EW1A 1E3LA 4RC9A 3D7NA 4FDAA 4CL8A 3TN7A 5C8XA 3VYSB 5LBUA 4GECA 1NATA 4CMJA 5BNFA 5L3VA 3DLIA 3S4YA 3IBFA 2GO7A 1JALA 5DMXA 3ZY6A 4UTRA 4XSVA 5LQAA 1DAOA 1UXJA 1JI0A 4AZ3B 2XI4A 4CF3A 4YUYA 3PHIA 5H5JA 4OX9B 3GVHA 1E9CA 4QHSA 5CRIA 5C8YB 1U2EA 1KPIA 3CUTA 3R7LA 4C9BA 1JDTA 1EK6A 2VNHA 2VTDA 4FR0A 3D2LA 2WTXA 3TR6A 1ZOPA 1SUDA 4XQ0A 3QELB 1OSNA 3ZCVA 4J16A 4MCAA 1K5DA 4DY4A 2CEAA 3L8HA 2IYOA 5I4IA 3ZNOA 4J16C 3U37A 2CZCA 1O6FA 4P4UA 3TRFA 2ZXUA 5JYBA 2IEIA 3PXDA 4WBNF 1FE8A 5K45A 3W7AA 3O26A 4WVFA 5JNRA 4LKRA 5EAIA 2DY0A 3F2VA 2IYQA 3WK7A 1M6WA 4NE2A 5AJVB 3IAM1 4KO3S 3V7FA 4JYCA 1SRRA 1QB7A 3QVSA 4QBKA 4RSRA 1O7JA 5TQ0B 2LDXA 4FQ8A 1ECCA 1LPOA 3LLSA 3NGXA 4IXMA 4MWGA 1OD6A 4EBFA 3A4LA 3GG9A 1GQYA 1FLAA 1U9CA 3DNMA 4MV5A 1EGAA 3N0VA 2C2OA 2A5DA 3NETA 4V38A 1P5FA 3L1HA 3LWNA 4KTTE 3NAZA 3SX0A 3UAWA 3Q2IA 3UATA 1MIOB 5FTNA 4Z3KA 3FHCB 4MAAA 5D7NA 3ZN2A 1BGVA 3F78A 2DM6A 1PZFA 1VE6A 3OPXA 3OZSA 5ALVA 2IXDA 1X1CA 4NECA 3E3AA 2HV8A 3NGLA 4S35A 5IBQA 1YZNA 1QGUA 4UDXX 3MTQA 1Y6JA 3QFHA 2VCEA 4OY3A 3RWBA 4AJPA 1O9HA 4QBGB 3OJEA 4A0HA 4PRZA 3H8SA 2CHEA 2O8FA 1YS9A 2NV2B 2VG8A 4TMYA 5DYIA 4YHBA 1V4VA 5GTDA 5HUHA 4YJFB 1LDBA 4M86A 4NBSA 2RHMA 3U1VA 1XC7A 2GH1A 4PAWA 5CYOA 3VR6A 3CPJB 5CM9C 5L4LA 3MWKA 4ZK2A 4JLOA 1PLLA 4RXMA 4C0QC 4URVR 3T38A 4F6CA 3WNBA 2ESRA 1FS6A 4PFQA 3ZWOA 1T36B 4ZYLA 3DBIA 3BH0A 3QXHA 3GFVA 1PWZA 1ZZGA 2OA0A 2QNRA 3JVVA 3MMXA 3RC9A 1P45A 4BO2A 2CJPA 2ZJOA 4CKCB 4NWIA 1DAPA 2FV8A 1DU4A 2ZIZA 3FLEA 2ZYTX 4L5CA 4MYHA 1FFGA 4FLEA 2Z6VA 4TMKA 2NTYC 3CLUC 2YXDA 4UASA 1NR1A 1NSTA 1UDRA 2JFWA 3GQBB 4PYKA 3BK7A 3KJIA 3H84A 4TROA 2RI0A 5DHTA 2OBBA 4ECEA 4QJ5A 2X5JO 3RE1A 1Q19A 5DULA 3ETHA 3GJTA 1WP4A 3HMKA 4BQSA 2XBMA 3TE6A 3IOBA 3VAAA 4P58A 3U7EB 1TUGA 3LUPA 3USZA 1M5RA 1ZUWA 4QU0A 2FEOA 5CLJA 5KWIA 2H9AA 1RW4A 2UVDA 2NUAA 3UFXA 4Z7OB 5I8WA 3RBXA 4Q03A 2ZTUA 3GLIA 5TPZD 1YUBA 3R6WA 3H4VA 3UH0A 1CP2A 1D1PA 1XXLA 3U4HA 4NPAA 4ZOLF 4YRTA 1U8YA 3HBFA 4B6GA 3G2JA 4ND1A 4C0WA 3QPCA 5CEJA 2YFHA 1JH9A 1QQBA 4WZBA 2I4NA 3TLJA 2PLRA 4OLHA 3WGZA 5AW8A 2B34A 3HVKA 5CXSA 2QLJA 2EGUA 3CBQA 3QHQA 1ZCZA 4F91B 2YY7A 3BMQA 2YVUA 1EFRA 3K70D 1BJKA 3THWB 5J2TF 5KZMB 5AUQA 2RGNA 5KHAA 5I7SA 1R8XA 2FUG1 1M2FA 2BN4A 4FMCB 4YRQA 1S3GA 4DCNA 1JYSA 2J0UA 1A9RA 2KW5A 1ARZA 3NJ8A 3TQRA 1Z0DA 2RGNC 3KZ1E 5FBRB 4BQQA 3U4MA 4Y2YA 4C3OB 3TK1A 1T4GA 3UHOA 4H6PA 4HDRA 1LK7A 3L7AA 5J4LA 2Y1DA 3WTBA 1J0DA 1KI1A 3ELDA 3L84A 3VX3A 4DWWA 2YWFA 5EE0A 4NXNB 1C7RA 2WLTA 3UH1A 4HYQA 3VKUA 4UE2A 4WOJA 1XWFA 2J3MA 4A0FA 2Q5OA 1EQ2A 4LQ4A 2OPBA 3Q3JB 2Z08A 4J1TA 1SOAA 1XR3A 2DTEA 2OCXA 3RC3A 1XPJA 3RS0A 4DXHA 5MN4A 3K9WA 3L7YA 2OBFA 1U3GA 4OL9A 1FJXA 4IM7A 2BKUA 3A6ZA 4J1TC 4CM9D 1JBEA 3LQYA 3O21A 1T1IA 3PRYA 4FP9A 2FGKA 5GAJA 3FN4A 5HSGA 1WJGA 2P4HX 3BE5A 5B37A 2M32A 3HDHA 4BNDB 4LC0A 1NJ1A 4CR8A 1K8QA 5IJ9A 4BQNA 5AUNB 1HYQA 5HCNA 5KSOA 4Y18A 3EAFA 4YAGA 3NHUA 3EZ7A 1H93A 3U81A 4B9AA 3JSXA 1NLZA 1XMSA 2XKBA 3GRYA 4GLLA 4JLVA 1WXEA 1SVIA 5CR9A 4NAUA 3F8TA 5ARDA 5F35A 4EWLA 1FYXA 3WQHA 3AHCA 3VDRA 4BX2A 4LHYA 2ZJ4A 2VP3A 5JVDF 4BFLA 2RD2A 3A32A 4JLAA 3OEED 2DAPA 4Z1OA 3ZHQA 5H70A 1U7OA 3KKKA 2AS0A 4OFWA 2Z95A 4DA0A 3DAOA 3ZTWA 1E1MA 1GGKA 3T5CA 1TO6A 3VU8A 3E84A 4FFBA 4US1R 1Z4JA 3N76A 2RH5A 3P20A 4IICA 3I3SR 4BCBA 2KJQA 3D4NA 4KYUA 5AOCA 4C7OA 3WRXA 4MI9A 5BQ3A 1PD1A 2H4XA 1CZHA 5CPFA 4Y7DA 1D0SA 2EFHB 3H86A 3EWSA 5FL3A 1X7YB 1XA4A 3WRXC 3WGUA 4ZHQF 3F7MA 2GEBA 1MJGA 1WU8A 4BJ6A 2QE7D 4X20B 4TTRA 1S3FA 2X8JB 3FYUA 3THRA 1U6IA 3BX1A 2VJNA 3RUHA 1BE0A 1IUNA 4C03A 3JQCA 3S5JA 2W5UA 3NS7A 4HZUA 2DP4E 3E9YA 3VDNB 4P92A 3E9NA 3FYUC 2XUQA 4WX2B 5A5GA 1XUOA 3NXKA 4AWBA 4B3CA 4K28A 4GQAA 4E31A 5IU6A 2DF8A 3MRTA 2CDRA 5TMDA 5T4HA 3CRW1 2R79A 1MFZA 2O6HA 4RJJA 2XNJA 1CJKC 3AINA 2YBDA 4X1KB 4INAA 1CERA 1HKHA 5BPFA 3AEYA 1J0BA 4B17A 4LJLA 3ZHYA 4IKOA 1JS1X 3BWVA 1H22A 3K8YA 4IIJB 3U3OA 1QRSA 1GCIA 5EERA 3Q9NA 3ADDA 3FUTA 3R7FA 4BKOA 3OFVA 4S1NA 4CHGA 2GPJA 1U94A 2JGDA 3ZWNA 3IR5A 5TE9A 2DPGA 1HRKA 2FNAA 2G1UA 5FV4A 2LD4A 5C1BA 2XSZD 1W0KD 4F9FA 1IXSB 2IEZA 1CULC 2YS6A 4Q66C 3T9BA 2FPGA 1T43A 3P52A 5GZ1A 3M3HA 4YIHA 4H6WA 3KUDA 2Z30A 1TQ6A 4ZQFA 1MFPA 5DEIA 4MW9A 4QEDA 1W96A 1SBYA 3WYGA 2I5PO 4HCJA 3LC7O 2PO7A 3T34A 2JRLA 4FQ7A 4W1PA 3DBVO 4WASA 1U31A 3KB6A 3PHCA 3GEIA 1F2UB 3GAFA 1XP5A 3AJAA 1R0CA 4Y6RA 3SXJA 1I4OA 1TOAA 2HWWA 1ORDA 3LUJA 3QPBA 2B6NA 3R3SA 4AJ2A 1PKXA 1B4DA 3ZWQA 3ZWCA 5JXHA 2R0QC 1V11A 4GSLA 5DP2A 1GUAA 1VIAA 4HUQA 4LZAA 4WFQA 2OC4A 1U2GA 2GDZA 2GTHA 3IBYA 4LHVA 4BMSA 4CKBA 4ENTA 2X23A 4DR1B 5CFMA 1GEGA 2Q1XA 1NE2A 3S81A 2VK1A 4W6QA 5C34B 3WOHA 3WR5A 1M72A 5HQ3A 4LYHA 4U0JA 3OEHA 2PLAA 2VR1A 1DX4A 2I1LA 5SZKB 3WWDA 1M74A 4DYHA 4MX8A 4U02A 2J67A 4LFCB 3U3RA 3DDHA 3GRUA 3WKCA 2QM8A 4WN3A 3U4IA 4AG5A 4N6NA 4DDUA 1Z6QA 2XUGA 1EFHA 2I0FA 3L18A 1CX9B 4HNAB 4RA9B 1E3WB 2C4UA 2DHQA 4CUKA 2MDTA 2J9ZB 3E1KA 1JDSA 3DW3X 3LOPA 3Q7EA 1Z0JA 4IDCA 4MDHA 3ZVKA 4JJ7A 5CVVA 2H07A 4FWBA 4MZDA 3CPHA 4QTXA 2HQOA 3A6FA 5JRJA 1MHPA 4MEAA 3QF4B 3Q6MA 2ZRJA 3TD9A 1NQOA 2G80A 1NJ2A 2Z4TA 4L5BA 3S44A 1KSJA 3B3AA 1OWMA 1P7CA 3MZ0A 1TF7A 2HCBA 2SKEA 4K3VA 3C8HA 2L19A 3HVHA 4G1UC 3UJ3X 3H04A 1Z62A 1JFFA 4M0DA 4XDZA 1CY0A 2WVGA 4GSYA 5AHRA 5K20A 1CF4A 2CMKA 1ZIYA 4P34A 1DJMA 2NWQA 5EKXA 1YO6A 2Z1MA 5KWEA 1AKVA 2X9QA 5E7IA 4Q5IA 4NOKA 1SY7A 1QHEA 1YBVA 4UQPA 4KTVE 4EW6A 5GINE 4X7MA 4ZZ1A 2C4WA 1JU3A 3ZHTA 2AGVA 1KQOA 1E2GA 4YB8A 2AQKA 4E7OA 1IBMB 4JBGA 1JJBA 1UT6A 4XLLA 4EQZA 5JSUA 2W2LA 1VI5A 1N75A 2I4OA 1KKLA 3P0JA 3VI3B 1A72A 3GUYA 4DLXA 1TFRA 3BWYA 2L42A 3CLTC 2DBQA 2X2FA 3IELA 1LJUA 4Q1FA 4WI1A 1JRLA 5LP6B 5HJ7A 5HZKA 1PJLA 1J8DA 2AK2A 2EZUA 2Y1KA 3FFBA 3PDHA 2A9RA 4EW2A 3J80A 1QIFA 5FNVB 2VDWA 3VR4H 4ER0A 1GQ2A 2W22A 4ZEOA 3C6KA 1YA8A 1KHTA 2IEGA 3W3AD 4YK7A 3V4ZA 4CCYA 2Q7XA 1V9SA 1MB4A 2XUHA 3EMKA 1UF9A 1FP7A 4HDMB 4ZVMA 3RYTC 3O4IA 3PQ6A 3CRQA 4JFRA 3R0JA 3ZD9A 3SQMA 3CEHA 2BR5A 3NTLA 3ZH9B 4Q4CA 3B3JA 3X1MA 1JQJC 4EFKA 1THZA 2C00A 5CCDA 3ZX4A 3L05A 1R4NA 1Z4MA 5TVGA 2QRLA 2BAGA 1AQ6A 3SEFA 3WWPA 2WPDA 3C97A 1YZVA 1J5EB 3R3WA 3AVWA 1JH8A 1W5AA 2BKLA 5LLSA 5K3EA 1E7RA 3MJTA 1AUXA 2LPMA 2PGOA 3GCWA 2HD4A 3IUSA 3GAMA 3QKSA 4R40A 2XNKA 4UMFA 2ZIWB 4EJSB 1PP4A 2NTVA 2V3CC 5AKGA 1TB4A 3FY4A 1OMOA 4U39A 2VDPB 1ZNYA 1WLSA 2COKA 4QUBA 5CJPA 2IH2A 3QI7A 1JDBC 2E6KA 1UAYA 3NV7A 3NC1C 4O08A 3VH4A 3SFTA 3PWSA 3ITDA 5KJ1A 1CUHA 1LQ2A 1Z2NX 2WWXA 5FWXA 1ISIA 1WKBA 3O9MA 3OU6A 4YJHA 3WJAA 3P9CA 1DJLA 4I4IA 1HNWB 1HORA 1D4ZA 1TLTA 3ZHBA 3TPZA 1W52X 2R1TB 3BICA 1I1NA 4AYXA 4M88A 2YHUA 3C1OA 1B6SA 1CP3A 1P3Y1 2B8TA 3MBIA 1RE0A 4PIPA 2AV6A 3DLHA 3VVLA 3ZWWA 1YQGA 4CKEB 1J2EA 4C4AA 1C1XB 1LBSA 3SF8A 1FFHA 3EZ9A 3WGJA 2BOVA 2BI7A 4URZR 3STTA 2DUWA 2LR0A 1YOVA 2VHTA 3FCOA 4FB4A 4F06A 3O8OB 5JPIA 2BW0A 4YXFA 5T6MA 2PO5A 4GX2A 1IC6A 1NXVA 2A94A 1RTTA 4HWGA 1X77A 1RHUA 1BRTA 3T9CA 3WGKA 4DV2B 5C31A 4ZT3A 3M2TA 4LV5B 2AOUB 5JNVA 4ND7A 3A1SA 3UUFA 2QM7A 5FPPA 3RT1A 2PPLA 1VGRA 4BLWA 4DQUA 4FYWA 1IEQA 1NW4A 1QUFA 2C20A 2CVOA 4JXJA 3R8XA 2WP8J 4EAQA 2QVLA 2AVNA 3NHZA 4HAZA 4C89A 2O7NA 1IN5A 2G5GX 4MV1A 3DD1A 1RZRD 2PXXA 5TQ2A 2VPWA 4XTRA 5H83A 1PL6A 5ER6A 3NWOA 1G42A 4XR9A 5KX5B 1P0MA 2FVXA 4WBXC 3I2JA 1QGED 1JAIA 2ZB3A 2VJMB 1NVMB 2Q0HA 2O9JA 2P5SA 4R5MA 4EH1A 1LV8A 4TKLA 4WKCA 2QYSA 3IDQA 4P7FA 2JA1A 3SBEA 2NAFA 2W8BA 4X7PA 2EQBA 4JR0A 2P9TA 5LYJF 4NMLA 4ZGGA 1VKOA 4ALNA 4IH1A 5LA6A 3Q7IA 3OPYI 1T8RA 2H48A 3IDZA 2I4LA 4I50F 5K3FA 2IS2A 2N9UA 3T4XA 2JZNA 3P9YA 2Q0SA 4IDQA 2ZYVX 3I04M 3NJ4A 4FOLA 3TLCA 4D43A 2WMOB 3H1PA 4Z1MA 2KB0A 5DNUA 1SPBS 3EISA 3P9IA 4LS3A 4MUMA 3DJFA 4O2RA 2IV2X 5J5CA 4NNJA 3ZCPA 3NHFA 5JS8A 1KHHA 2G72A 2X4IA 1RWWA 3JY6A 4GOKA 5E2BA 1RDFA 3KKQA 4AN0A 2XZLA 3G1WA 5FL7A 3W4JA 4KN8A 4M3NA 5ALIA 3STYA 4KBFA 3UKDA 5FXMA 3MUOA 4D25A 4P4SB 1PWEA 4IUYA 1FDWA 5AI4A 4HY3A 1YFLA 3IOCA 1G4UR 4XSGA 5IJZA 1G7TA 3K30A 1T1JA 3FMVA 3W0LB 3UV7A 2X42A 3RKUA 2FETA 2OZLB 1BSVA 2XCLA 1NW9B 3C1AA 2WKQA 3CNHA 4H7EA 1YQTA 1G8GA 1H5UA 3QU5A 1B93A 4TLLB 5IAOA 1N6IA 4M87A 4LYJA 3ETGA 3EOAI 4FHCA 4JBYA 6CHYA 1W7AA 4OA5A 2DFLA 5L95A 4QEZA 3DNFA 3MYRA 4W82A 4PC6A 3UJCA 2A3RA 1JZTA 3M4NA 1JHXA 3KSRA 4UU7A 4DC9A 1AO0A 4W8HA 1WMSA 2I6FA 3GJ8A 4OHRA 4PAMA 2X1HA 3F74A 5C2JB 1KVQA 3OT4A 2ZWIA 3DEFA 3N39C 4NJMA 1R3DA 2RGDA 1KFCB 1SEPA 2DWQA 2VDVE 3IX7A 4LEIA 4LISA 3SJZA 3E48A 1JLLB 1QP8A 3F6CA 2BMWA 3BG5A 4LV6A 4TLCA 4F96A 3TLMA 1G64A 2BBSA 1A2KC 1SKUA 1LDMA 1KEUA 4TRMA 2OCKA 4MNTA 1BMQA 4ZV7A 1EM8B 2Y0PA 4UNNA 3DOHA 5ICSA 3JYQA 1A9OA 4P0QB 2G9VA 1EDBA 4X3CA 4ZU3A 5BV0A 4UBMA 1P3DA 2HH9A 3ZDEA 5IC4A 1INLA 1FLVA 1WVIA 4O4JB 3RU2A 3WADA 1Z2CA 1F6WA 2JBAB 1KMHB 3RWOA 2BUBA 5T4EA 1TDJA 2NYRA 4ALMA 5KWJA 1P7PA 3TAXA 4MR7B 2YFKA 1Y8RA 4WK4B 5CLLA 5JHHB 2QZSA 4JASB 4R01A 1HTBA 2Y71A 3MJSA 3SQLA 3V46A 2ZUUA 3H05A 3MMNA 5TEWA 3ZLBA 3OFNA 4QXRA 4IUBS 1LWNA 4EGQA 2B98A 1KZ9A 2DC1A 2J6HA 1CQXA 2HA7A 3N6VA 2XMPA 4AUEA 4PGMA 1BDBA 1EUCB 3PJEA 4WOPA 3C5HA 4BWGA 3V8BA 3ZZMA 4JH0A 1UIRA 2EBHX 1YB5A 2X14A 1CB7A 2W58A 1N3IA 2A2ZA 4JHXA 2QM0A 4N03A 3TYXA 2RHJA 3DH0A 2EZ4A 4IVPA 4EYSA 1VPTA 4RQAA 4YXWD 5HRUA 3F97A 4MPTA 1OLXB 2OTCA 3FGPA 3AT1A 1NMSA 2PXCA 1MNQA 4UAGA 3CF4G 4PU0A 1QM5A 1R8JA 1KH3A 3VC3A 1J0CA 2P27A 4N1AA 4MGHA 4YTEA 3QV2A 4RJ2A 1QRAA 9GPBA 1PX2A 2QW0X 3H0EA 5FOVA 4FFLA 1P1JA 3N8GA 3MS7A 3UHAA 1EAMA 1U6KA 2WHEA 3TKYA 3U56A 5BQXA 4FT4A 4C0SA 3FDZA 3LT5A 3P4XA 5AK5A 4G36A 5EJ6A 1W46A 2FFJA 4HDSB 3ZVLA 1PVDA 1CUCA 2PSJA 1HDGO 2VJBA 2PUBA 5KYYB 2PMDA 4K9KA 2CDAA 1QYWA 4FWIB 1FSZA 1KYZA 3UPTA 4CQLA 1OWLA 3TTVA 1ZH6A 1I4WA 2BZ1A 1XD9A 4YC7A 2ZYHA 5EGSA 3ENWA 2SNIE 1GLGA 1XVTA 2GGSA 4RBNA 5EWMA 4NHEA 1YK0A 2B5OA 1DARA 2CGEA 2O7SA 2VNAA 3EWAA 3EYAA 3FXAA 4DAOA 3E2MA 2VDQB 3MINB 3U44A 3GB9A 2EKBA 2IELA 4B35A 2I67A 3RSZA 1YKSA 3I23A 4AKGA 2FDRA 3H3XA 3QMPA 1N3BA 2XUJA 3O82A 2C58A 4INPA 4TSKA 9MHTA 2FX5A 2VAWA 1NRWA 2QYTA 3Q3IA 4N7MA 4JUBA 3UXMA 1N9KA 1RVDA 1BN6A 5KSPA 3RO7A 4RTNA 1PR5A 3CUWA 5FI1B 2ZGVA 3IP9A 4QOGA 1B8PA 1P1KA 2HB6A 2BFNA 1CIVA 3CNLA 3KKZA 1RXEA 5CFNA 4EMUA 1DT5A 4PZCA 3SNHA 3CZPA 3QLVA 3Q0EA 5IM4A 3TDKA 2PSSA 4BECA 2B37A 3L4BC 1PRYA 4LTNA 3QLVC 5EHNA 2HYDA 3GJ7A 4AX4A 2ODBA 1OYYA 2Q4RA 2XE7A 2Z98A 1NQVA 2M2IA 1VBNA 4OYHA 2WB4A 3ZTYA 4EAAA 2WF9A 2NZ8A 3ZE0B 2C4TA 3ROTA 5LFAA 4EG8A 4U2KA 3B53X 3FPLA 4U4AA 1OAKA 2D7DA 4D5EA 5A4KA 3ZUGA 4IJUA 3I76A 4H77A 3NBUA 2BDTA 4B0PA 3IUPA 4XIFA 3KXKA 3ELUA 3ZDZB 1WUIS 2KYRA 3QNWA 4C07A 2VWGA 3P9KA 1LF0A 2HJHA 4LJSA 4RZUA 1E1NA 4C4XA 1DJQA 3KYDA 1SBZA 2QVZX 4D4IA 4DZZA 1ADJA 4PHCA 3G0DA 4X84A 4QM6A 4I55A 4RAOA 1GFIA 4YRIA 1RPAA 1VKJA 2GPYA 4KXVA 4RVFA 3G2KA 3AKYA 2RHCA 4TSFA 3VMMA 3FWHA 2IODA 3N2KB 1U5CA 3PZRA 3UXHA 4HXEB 5B2FA 4MULA 1JHRA 4ROTA 4REQB 3QPVA 2EFEB 5KYTA 5EJ7A 2H1HA 4BBZA 5IH7A 4XYMA 4B71A 5KJCA 2YMPA 3L8YA 4K87A 4K81B 1N7IA 1UMDB 2CFCA 2H1VA 3G0CA 4ROSA 4AT1A 3QFFA 5JAOA 2AG0A 4S1OA 5F64A 2YXLA 4FW9A 4ZQCB 5GY7A 4PYQA 2VPIA 1JI3A 4HFMA 1UZNA 1QLHA 5FOSA 2XCRB 1UPBA 3U9SA 1DMRA 1UOEA 2RONA 2BFBB 2R6GA 3A6DA 3IPCA 1ZU4A 4NMWA 2HC9A 4H31A 4P7KA 1PF7E 3EMDA 5I9MA 1DWUA 1Z8DA 4QUDA 3H5LA 5HJ2A 1F0KA 1YXMA 1B6GA 4G1MB 3H18A 3WYCA 1HFJA 4RIGA 3WFIA 6ABPA 3L9WA 3OU7A 4WNAA 5KQPA 3HXTA 2Q1YA 3BD6A 3MSXA 3EBLA 4I9HA 1REQB 1GRRA 2WJIA 2PZBA 4H16A 4JT8A 5AM3A 1SG6A 1MAVA 1I5RA 4C6TA 2EERA 2IHYA 1ZLYA 4Z3DA 3AWIA 3KB2A 3PEFA 2OT3B 3LQRA 5BN1A 3RC7A 5AJTA 4B48A 4PTZA 2DHRA 4L85A 1C7IA 2XMBA 1WZ2A 2CKMA 3TTXA 1T2VA 2YWEA 1QQ7A 3V7WA 5BXYA 5CXQA 4CKWA 1BTOA 4PPQA 5AVOA 1A8IA 5ADHA 4FGKA 3KQWA 3N2NA 4MW7A 4KU4A 2ZI3A 2X1VA 4R41A 3FCCA 2Z8YA 3WGNA 1H4TA 3TXAA 3UMRA 1W44A 1Q16A 2ZJ3A 5FJJA 4BKQA 1FDIA 4RZXA 2BTQA 1RXVA 4TXHA 1YH3A 1V4BA 1ZINA 1CZRA 2PD6A 3N74A 4ZQIA 3LQ4A 2PDAA 2CFIA 5GONA 2YJGA 3VOAA 2ZIXB 2MR5A 5FFNA 4Y6SA 3NHPA 2NU7B 4ZICA 5LZ4A 5LB2A 1EJ0A 2W9XA 1XAIA 2AN5A 3PUKA 3DC2A 1YJXA 3SZ3A 1J2UA 2ATXA 2ERXA 1YS7A 2D4HA 5IC5A 1YZFA 4BFSA 1OFTA 4FBLA 3TL3A 3CV3A 5AW4A 4JQCA 2ZYIA 3M5PA 2Y05A 1N9ZA 4N8SA 1ZH2A 1DT3A 4RLHA 5P8WA 3RASA 3VC7A 2O14A 2XIQA 5DBGA 2YVAA 5BMOA 3UT0A 3KKOA 1EBFA 3AERB 3K20A 4CG1A 3JW8A 3ZK7A 1ENYA 2P90A 2VP0A 1VG8A 3BGDA 5JAQA 2V9PA 3TJMA 2B83A 4IH4A 3KAKA 2XGOA 2VQFB 4JUIA 4B6RA 1QTQA 2B3TA 2Q3BA 1NLFA 3VV3A 1MJFA 5CA1B 1J2JA 1Q0LA 5ALQA 4YCSA 1KNQA 4P7GA 2OQVA 5E1DA 2WKPA 2NYAA 1SVKA 5E6UA 5T8KA 4BLOA 1XZPA 1BFKA 2FE1A 4LXHA 2N1BA 1CLUA 1GGHA 5HA5A 3V6LA 1L7MA 5BSRA 4DR5B 1CTQA 1AA6A 2E6UX 2IYZA 3C4QA 1XP8A 4Q3LA 5HF8A 5T8KC 4BNFA 3DT9A 4OXXA 2NXEA 4GNRA 5DXJA 4U2DA 5E4YA 4LHXA 1OGIA 1S6YA 2VJYA 2B2XA 2X9VA 3BHIA 1COWA 4JWKA 1WSAA 5IYZA 1UZUA 4E11A 3ZGXA 1SFRA 4I9FA 3QJYA 1DBVO 2GKOA 5LB4A 1ZG3A 4XUDA 4GYYA 1CY8A 3CJTA 2IW3A 1T9KA 5BQOA 3GOHA 3JRNA 5TC4A 1SOMA 1EMDA 2FPWA 4I2VA 3NT2A 1OWPA 4PQFA 2RSLA 4C22A 2NYVA 1NTOA 2AJCA 4GEKA 1QHFA 4QYTA 4ILEA 4UTPA 1T2EA 4GW3A 2QNBA 4EGSA 1YIAA 5HNKA 4ALKA 1PL7A 2G28A 3EY4A 3MT9A 5FBZA 1LK0A 2I7XA 1W2GA 3FDJA 1L9KA 1ZBQA 2PXAA 4MI6A 3PGXA 3RSSA 4UVDA 4M99A 3EJ6A 4YJ2A 5BQPA 4C0BA 4PLWA 1RYEA 4NU6A 3DE5X 3TLGA 4D4JA 5BSHA 5K5EA 2YOHA 2QTNA 4LWQA 1AHPA 2IRWA 4GZLA 4OHXA 3LKBA 3BWDD 1E64A 5KNBD 5EA2A 1WV0A 2H2FA 2IXAA 4MTLA 4AZVA 4PFSA 1JDUA 3ASZA 4S0XA 4B7ZA 1ABEA 2DUUA 3GCGA 4YPFA 4D57A 5BQFA 1PNQA 4DMFA 3MMZA 1UBMS 5FADA 1JPNA 2WU1A 2QF7A 5TGDA 4MEJA 3WLNA 4CMGA 5LOVB 3RJ5A 1XT6A 1F8YA 1SRQA 3Q15C 4FOSA 4X3OA 2JAPA 2N3ZA 5EP1A 5FTJA 2BJVA 3SC2A 4UZSA 3M0EA 3COVA 1P60A 1ZRSA 3BD7A 5CEEA 1R4MB 1UR5A 3HCEA 3KSUA 4R3WA 4IJVA 4U5XA 1F9EA 5DE3A 1L3IA 3PRJA 5AM4A 2QTLA 1DOHA 2AEJA 3L0BA 4LZZA 1VHDA 2J6BA 1XVAA 4L27A 5A1TA 3ASYA 1ADYA 4QWWA 1BX3A 3HB0A 5E1OA 2D74A 1IQ0A 4XD2A 2QRQA 2ZJ0A 2CUTA 2W71A 1BDIA 1QZTA 1NUAA 3ND7A 5FO1A 3TOSA 1C3OB 3QIVA 3CXRA 4HAWA 2P78A 3ACCA 3IBCA 3A0RB 4KQJA 3RIXA 5TJ9A 1VKRA 5LQMA 1OQAA 2GN2A 3M70A 3DWIA 3N5KA 1ONPA 4FFDA 1TADA 4HB0A 2V6BA 1UJ6A 3G7UA 4OHFA 1Y9AA 2GXUA 2QVGA 3K6SA 2I22A 1XPOA 3BAFA 3BMCB 1U1GA 2IOFA 5EWLA 1GKLA 3O8QA 3DBOB 1TXGA 1YB1A 4E21A 1H42A 3H5WA 2BC9A 2IYUA 1EINA 4GM0A 1K6IA 5AJHA 5IXYA 3GP8A 1MC8A 1K6XA 1P5ZB 2XWSA 3EXIA 4MB2A 3ROZA 3K31A 5K8JB 2BM8A 1EWKA 1DRJA 1NY5A 3U4GA 2J5XA 5E38A 4YGXB 2CD7A 1NW6A 5IKPA 5KKAA 3B1YA 2OO5A 3K96A 3I0MA 5HBRA 1Q3HA 4ZHSA 1GDTA 1EFKA 1N5RA 3CVVA 1F4LA 1UBOS 2QPOA 1A1VA 4OIFA 2O8DB 4U7JA 1HSZA 2OO5C 1ZN8A 4D9HA 2HHHB 3FPGA 2CXQA 5GOTA 5FUYA 3RYFB 1DFGA 3OCJA 3HEBA 1TAQA 1T2UA 4KYTA 3EFBA 4NABA 3ZV3A 2DPLA 2FFHA 4BX9A 1ID8A 3OM8A 1O77A 1PGPA 3LP5A 2YASA 1Z6GA 1POWA 4D3FA 3COPA