1OC4A

Lactate dehydrogenase from plasmodium berghei
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
315
structure length
315
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVMFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLKDADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIVGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDQELDAIFDRTINTALEIVNLHASPYVAPAAAIIEMAESYIRDLRKVLICSTLLEGQYGHKDIFAGTPLVIGGNGVEQVIELQLNADEKKKFDEAVAETSRMKALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-LACTATE DEHYDROGENASE
publication title Crystal Structure of Plasmodium Berghei Lactate Dehydrogenase Indicates the Unique Structural Differences of These Enzymes are Shared Across the Plasmodium Genus
pubmed doi rcsb
source organism Plasmodium berghei
total genus 104
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1oc4A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1oc4A02
2ZYDA 4OXNA 4OXYA 1ZJYA 4R5HA 2CZCA 3HHPA 1MX3A 1YBAA 4K26A 5C7OO 1DEHA 5T8KA 1DC6A 5EERA 5BNFA 4MDHA 4RPJA 4BO6A 1XG5A 4R1TA 3STHA 1L7EA 1NPTO 2HDHA 4JP3A 4CM3A 2ZJ0A 3P19A 3PYXA 1QXSA 3GPDG 2Z1MA 2DUWA 4RQTA 4FOSA 2W4QA 3UXYA 2GN9A 4GMFA 3BAZA 2RHCA 3KEOA 4XDYA 4BO2A 2UV8A 4W4TA 1F14A 2Y1DA 1E3SA 3IIEA 2ZYAA 4NFSA 1WXDA 3FNFA 3DXFA 2IRWA 4HBGA 3X2FA 4R9SA 3Q9UA 1ADFA 1HSZA 3M1LA 2AQHA 4PGFA 3I9MA 2ZB4A 3JTMA 5G0TA 1ONOA 3JQ9A 3ZWWA 4UEJA 1AUPA 3PLRA 5KJ6A 1DIRA 1ID1A 3DZKA 3U4HA 3CSDA 3ZWOA 1HRDA 5JC1A 2NTJA 4JJFA 4L73A 3G49A 4U7WA 2HSDA 3Q1LA 1T2AA 4K9DA 2QZZA 1ZW1A 4LMPA 3ONEA 3RIHA 3IAHA 1P77A 4R41A 1NPYA 3OECA 3DC2A 1DXYA 5TIIA 4R3WA 3GMSA 5CEFA 4CQMA 3I83A 4EUFA 2C7VA 1EMDA 2IEBA 1YH3A 1ZBQA 2LDBA 3KM0A 2GSDA 1SEPA 1V3UA 1NAHA 1A4UA 1H9AA 4JNKA 1A72A 9LDTA 3U09A 3ITKA 4OOEA 2ZTUA 3KYBA 2I67A 2IZ0A 2RHRA 3O9ZA 3DFZA 3RAJA 4BO0A 1G0NA 5DULA 5CDGA 5KVCA 4K6FA 4YT8A 2WDZA 2O4CA 2WMDA 4HY3A 4P4LA 4BKQA 4BHTA 1DIBA 4OSOA 4D42A 2VNAA 4CR8A 5IXSA 4KMSA 4EW6A 1HETA 4BS9A 3HADA 4PLTA 3V5NA 1S7CA 5KWEA 2GO1A 4OQYA 4XWYA 4MVJI 1ENYA 3DAGA 4J4HA 3V2HA 4FDAA 3VAZA 4EI2A 4BV9A 5L95A 4BIIA 4OKNA 4Q3EA 4R1SA 2ZK7A 4J1TA 4ZGWA 3OQ6A 3EGOA 4P4GA 2PZKA 4Q9NA 4KUEA 1P0CA 2JFHA 4FR5A 4PZDA 1T2EA 3JQAB 5F5NA 4NBTA 1WDMA 3PLNA 1DRWA 1GCUA 3NYWA 1VSVA 4NU5A 1PR3A 5U4QA 3RKRA 3UICA 3GGOA 3Q3CA 1SC6A 3DBLA 2X5KO 1Y8RA 1NAIA 2O3UA 4DBZA 1ZMTA 4A03A 3ADOA 1O89A 1B3RA 1DHRA 4RF5A 3DL2A 4A5OA 5EPOA 1U2DA 4NFHA 4CQMD 3RBXA 4YRBA 1DB3A 4IGFA 5EMHA 3F1LA 1YB1A 3CMMA 3PDUA 3UGKA 2I6TA 1JAXA 4BO5A 2X9GA 3DZJA 2CFCA 4GWGA 5BNTA 3I23A 4LRTB 2ZTVA 1ZMOA 4XD2A 3GLQA 1Z7BA 3I9JA 3T7CA 2W2KB 1HDOA 3GT0A 4ZRMA 5JO9A 1B15A 4DLLA 2NNLD 3HQ4O 5AOVA 4XYGA 4IBOA 1E3JA 3KB6A 4FN4A 1UZNA 4MP6A 4D44A 3U62A 4AJPA 4BKPA 2PWZA 2EWMA 2GERA 4BB6A 4KTTE 5J23A 1I2ZA 4LK3A 3RUEA 4E5PA 4Y9DA 4WJZA 5ENDA 3ETDA 4BGEA 1CQJA 2PD6A 4M49A 2ILTA 3BMQA 3ULKA 2OP0A 3PHJA 4IPTA 3NT4A 3AY7A 4YJGB 3GUCA 3L77A 4NHEA 3DAPA 4GKVA 3GZNA 1HTBA 4OXKA 2ZJ1A 4MIYA 4BGVA 4ZN6A 2HU2A 1B7GO 2XOXA 3VPFA 2O3QA 4ZJUA 2YHUA 4DIFA 2NTNA 1JLLA 2Y0DA 3B1JA 1GYQA 3F5SA 1PZFA 4WPGA 2QYSA 4FW8A 2BF7A 1XQ6A 4YAEA 1D4FA 3CE6A 5JMPA 4ALLA 2W8ZA 2AG5A 3AUUA 4CR6A 2IE0A 4MO2A 1GV0A 5COBA 4J7XA 1HL3A 1ZH8A 2EGHA 1V3TA 4K6CA 4MVJH 3D0OA 5ITVA 1R4MA 2X0IA 1W4ZA 4YEDA 5I7SA 4AJNA 2E82A 4NU6A 1E7YA 1YXMA 3KV3O 2GASA 4YJDA 4PLZA 2C59A 4CM4A 1HDYA 1N1EA 4IDGA 1IPFA 3HB4X 4L4SA 2C0CA 1UDCA 3FNHA 1E3IA 1WZEA 2TMGA 1E0DA 3FNEA 3K92A 3ZGYA 5HM8A 4XKJA 2G76A 1ZFNA 4O6VA 4F6CA 3RASA 2Q2WA 1O6ZA 2I5PO 5DZSA 1T2DA 1Z73A 2J5RA 3ZCXA 2YFHA 3OQBA 1Y81A 1Q7GA 3M2TA 3KSUA 1MFPA 4NK4A 2DPGA 3HDHA 4FIZA 2JD2A 4ALIA 4EUHA 5H83A 1PU2A 2WM3A 3FCOA 2F00A 2BI8A 3GMDA 1GDHA 5KKAA 5TQVA 3TDKA 4GVLA 2NM0A 1YKFA 2P5UA 1NASA 1R16A 3WYBA 3C8MA 2B37A 4UAGA 4GGOA 4ZU3A 4CR7A 3WGQA 3VZQA 3WMXA 2D5AA 4GBJA 3OEYA 1XR3A 2VRCA 2HLPA 2HCTA 4J6FA 3UCEA 4GWKA 4L76A 1A9ZA 3BYZA 3VPSA 4E33A 3L6OO 1PR9A 1UR5A 2VN8A 2J3IA 1FDTA 2F1KA 2VQ3A 1A27A 2FMUA 5IG2A 2VUTA 4QFCA 4CM6A 2UUOA 3DB2A 4IINA 1TLTA 2SCUA 4BMNA 4K28A 3GY0A 1U4OA 3VPHA 5B37A 4CM7A 2OP1A 4GX2A 5A05A 4XR9A 5T8KC 4CL3A 3JQ8A 4RLHA 1PGQA 4XB2A 1LRJA 3N7UA 2JD1A 2GCGA 2CUKA 3IQDB 4A27A 4HFMA 4PRKA 4TRNA 3Q11A 1LJ8A 3WBBA 1SEVA 2UYYA 2X5JO 3KSZO 2PFGA 1YO6A 1H6CA 3KETA 2X5OA 1EVIA 3BMCA 2W2LA 2A35A 1P1IA 4CV2A 1PZHA 1E1MA 3D4PA 4D3SA 2VHXA 2EJVA 3ONDA 1OBFO 1UXGA 3WWZA 2VTEA 1YGYA 2Y93A 5AQ1A 1KEUA 4ESOA 3QVXA 3U4IA 2PKQP 1Q7CA 1TXGA 4G2NA 4JQCA 1NHWA 2JAHA 1VKNA 1T4BA 4FFPA 2VRCD 5I8ZA 2P9GA 4CJXA 1KIFA 2DBZA 1E3EA 2WE8A 5EESA 1R0SA 3JYQA 2I76A 4MPDA 5KJCA 5CDSA 4IS2A 1F8FA 2Q50A 1IYZA 5BNIA 2A9FA 5JY6A 4R69A 4U6QA 3SLGA 4TVOA 5FI3A 3RFVA 4NFYA 3RI3A 1LRKA 3ZWMA 1NYTA 4CQLB 2FSVA 1O94A 3VC7A 3H5AA 1HWYA 4IMPA 3WS7A 5IDXA 1H5QA 2P4QA 4LGVA 2DFVA 4E4YA 3Q2IA 1D3AA 1V0JA 4TROA 1OC4A 1QP8A 1DSSG 4GSLA 1P1JA 4CMIB 2VT3A 1JDJA 4R5MA 4XGKA 1C0LA 2DAPA 3PQFA 4ND2A 3RKUA 4RLSA 1MP0A 3ZHZA 3F5QA 4AJ1A 1K89A 4DQUA 5JDCA 1ZSNA 1JA9A 1AHIA 4RV9A 1PQUA 1YONA 1LLUA 2GZ3A 3AUSA 5F1OA 4CM1A 2Y05A 2W2LD 2X9NA 3KZVA 1UJMA 2O2YA 3G0OA 2QZ9A 4KUHA 4LISA 1KVSA 2EJWA 4MIEA 4YAGA 3DBHB 3E6AA 4FFLA 1J0XO 1ZK1A 4H15A 3R0IA 2YV3A 1T4DA 5CFZA 3GRKA 4CMKA 1KC3A 1R4NB 5KCZA 5DN9A 3VVBA 3KRTA 1CETA 4XX0A 3C7CB 3P5SA 3IOYA 4YBZA 2NQTA 2B5WA 1P74A 3RUIA 5ICSA 1GADO 3I52A 4WUVA 3MZ0A 2VUUA 3AI3A 4BNUA 2CNBA 1P31A 1WVGA 3Q9NA 1E3WA 4IGEA 1NQTA 4RPLA 3TJRA 4RZIA 2J5KA 4E30A 5JNLA 1RYDA 3PZRA 4YAKA 1KVRA 1KVTA 4WE3A 5A04A 2CDCA 3TL3A 2NVUB 4JBIA 1XELA 5K0ZA 4CV0A 4FFOA 1P9LA 1EEHA 3RBVA 3D1LA 4B4OA 2O7SA 1IZ9A 1U7TA 5JAIA 3DZHA 4FB5A 4OKIA 3ROQA 3GNTA 4GVXA 1PX0A 5KVVA 1E6WA 1R66A 1SB9A 4RCVA 2CVQA 4ALJA 1Q0HA 2NQ8A 3VHRA 5IDYA 1U2GA 1V9LA 4YQYA 4PLYA 4HX5A 2B36A 2O4UX 1LDGA 5ER6A 3Q0EA 2O3RA 2OGUA 3GOHA 2HMUA 5IJZA 2O3SA 4B7CA 3C3XA 2QG4A 2Z5LA 3PJGA 5DDIP 3O26A 1QLHA 4L74A 3RD5A 2GZ2A 4IDBA 3WICA 4AJKA 1JVBA 5AXAA 2DFDA 4AJIA 2GD1O 3WLFA 4CUJA 3OETA 3UCXA 2GN6A 1H2BA 4B4VA 3HFGA 1T25A 1B8VA 3I1JA 3OA2A 4CMHA 1TA4A 3M1AA 3OEWA 4FBGA 1IULA 3AFNA 1NQOA 3DO5A 5TSDA 4XZ3A 4KQXA 1ADCA 2V65A 1H94A 1LSJA 1H0KA 1GUFA 1MA0A 3BHMA 2VHYA 4CM8B 3GQVA 1E7MA 3CINA 2Y1GA 2AEMA 1J49A 4FFNA 4TWRA 5JAZA 3EVTA 5BSEA 4FGSA 3DOOA 3F4BA 3HE3A 3F9IA 4KP7A 3U0BA 2UVDA 3PWZA 4XGIA 5THQA 2Q49A 1YDWA 5JY1A 4HP8A 2QYTA 3UUWA 1EVYA 4DQXA 4QSMA 4OOFA 5I9NA 3HN7A 2HRZA 3VOSA 1CIVA 4A10A 2ZTLA 2FPIA 2D0IA 4LVUA 3JQCA 3UKOA 3D3WB 3RU9A 1LX6A 3O38A 4NI5A 2OO5A 1LC0A 4YTEA 3ROMA 2Q3EA 5I7EA 1I24A 5TT1A 4WNCA 4BGIA 1E1NA 3BIOA 4L0QA 1MV8A 3GK3A 3QWAA 1X15A 4TZTA 3VH1A 3K9QO 4WLUA 1F8GA 4WKGA 4MVJE 2VWQA 4ALMA 3FTNA 5GZ1A 3NUGA 4CM5A 2R00C 4ND3A 1X1TA 1YVEI 5IZCC 4JROA 3OJEA 1ZEMA 1G0OA 3JQ7A 3I9LA 5CPBA 1JU9A 4BO1A 4Q3DA 1IE3A 3FD8A 3JQGB 3LZ6A 4B7UA 4N5MA 1XLTA 1B16A 4RVGA 5IXYA 4L4RA 2D59A 4WLEA 1X7GA 3O4RA 3D4OA 4WCFB 4AL4A 4CLRB 5ITWA 1VSUA 4IDDA 3ZWCA 3TNLA 2V6MA 2HAEA 4JIGA 3EZLA 1NR1A 2V7PA 5CHEA 2EIHA 3TQHA 1AXGA 3DWFA 4G5HA 4R68A 1QYXA 8ADHA 1Z6ZA 2EKPA 3SXPA 4A73A 3E82A 4KDFA 5HBRA 3QVTA 4JX8A 4YRDA 4PLCA 3OQ1A 4DPKA 3AU9A 3PQDA 4BUCA 3RBZA 4D79A 1XEAA 2E37A 5HTOA 2ZQYA 1DFIA 4XIYA 2EGGA 4D46A 3GVCA 1XYGA 5C7LO 4M55A 1PWXA 2DT5A 2WJPA 4RVFA 3PTZA 4YAIA 1Q2XA 3GVHA 1I30A 1KEVA 3U49A 3KOUA 3HWRA 2WYVA 3GEMA 5ER9A 1SOVA 4XJTA 3PFWO 3EAGA 4XQ9A 4DPMA 4UVEA 2ZATA 1E7QA 2JD0A 1YWGO 5JYDA 4EUEA 2CF6A 4KWIA 3IJPA 4W82A 4H3VA 1CYDA 2Q1UA 3BMOA 3MCVA 4UVDA 4OAQA 2PZLA 3GGGA 4U6SA 3OJLA 4TRJA 1GCOA 4YB8A 2VZ0A 1FK8A 3A14A 4CLEA 4DYVA 5L9AA 1H6DA 4E0BA 2NSDA 2Q4BA 1UAGA 2V6FA 1KEWA 2ET6A 3ASUA 1DFGA 4NNJA 3TL2A 2ZB3A 3HUDA 1JTVA 2G17A 1VM6A 3H2ZA 3LSYA 1BSVA 3ZV6A 1HZJA 1HE5A 3JD4A 5ENVA 1PGJA 1G1AA 4GKBA 5ICMA 4UEKA 3WQRA 2Y67A 3D4NA 1I2CA 3KO8A 1U7HA 3PHGA 1DIGA 2C7GA 1NVMB 1YQGA 4PLVA 4RF3A 1Q1NA 1A7KA 2VZ8A 1GYPA 1N9GA 4D43A 4CUKA 3MJCA 2DVMA 4WCDA 4TRRA 4I9NA 4RPGA 4FJ0A 2LDXA 4Z9YA 3OM9A 1YL6A 3ZWPA 1X7DA 1WNTA 4MINA 2JAPA 1NTOA 1SOWA 3PJFA 3G79A 1L7DA 1U4SA 4BNGA 3HN2A 4WECA 1PTJA 5JDCC 1C1XB 4OO3A 1E1KA 4MVJM 5JO0A 3ENKA 3R3JA 3C7AA 3FN4A 4OHUA 3V1UA 4BO8A 3JV7A 2DTDA 1QR6A 3O8QA 1ZK2A 5A5FA 4BQPA 4TKMA 4NBWA 3SVTA 4Z9FA 1R6DA 2D1YA 5EQFA 3WGHA 3M2PA 1JAYA 5G4LA 3ZI0A 2VT2A 3FR8A 1P44A 4MVJA 3LU1A 4Q3NA 1BDBA 5H82A 1U1IA 1R12A 1ZJZA 1PZEA 2NVWA 4Y6RA 1BGVA 4Z9XA 3OSUA 5HWSA 4QUKA 1L1FA 3E18A 3VTFA 4D3FA 2ZIZA 3EYWA 1QYDA 3EK2A 4I5FA 4PFJA 1UP6A 1PJTA 1H9BA 1QV6A 3GDFA 4Y6PA 3GNQA 3AJRA 2IODA 1WWKA 3DHYA 3NX4A 3ZZNA 3TZHA 5L7YA 3GRPA 1K6IA 3AOEC 4YAJA 5GY7A 3K31A 1CERA 4Z6KA 5GZ6A 2RBEA 1NVTA 3QSGA 1VL0A 2DBQA 1HE3A 4A0SA 5ES3A 5CDTA 4ZQGA 3SJUA 4E2ZA 3UH1A 3ZWYA 1Y8RB 2EW8A 3NRCA 5HS4A 2HRBA 4BNYA 4IIUA 1MC4A 4LMRA 1EVJA 1KVUA 1PGPA 3DMYA 4C7KA 3P2YA 3QE3A 3PJDA 4E2YA 1M2WA 1OI7A 1HEUA 1HT0A 4E13A 1DBVO 4TSKA 2BMAA 3H9QA 5F1KA 5HA5A 5BT9A 4QT0A 3TRIA 4CMGA 1ADGA 4DBVO 2JHFA 3OP4A 3PPIA 1K5HA 1WDLA 1ZK3A 4EZBA 1EDZA 2J6IA 1EK6A 3BXXA 3AM5A 3SC4A 3NTQA 1LA2A 5CPFA 5KVSA 1U5CA 3QRWA 5L4SA 4NG5A 1I2BA 5C3MA 1PL7A 2V6GA 2B35A 2AE2A 3PYLA 4E31A 2X0RA 3W1VA 2E6UX 2IYOA 2PGJA 3L0DA 5TT0A 6LDHA 3S2GA 1Y9EA 3KLMX 4PLFA 4XCVA 4TRMA 4YJFA 2PNFA 4MVJD 2GLXA 4IDCA 3TPCA 4XDZA 2OBNA 3CKYA 1IY8A 1BWSA 2OXIA 5CG2A 2CF5A 3U5TA 2YV1A 3WYCA 4WLOA 3EUWA 1LDBA 3HDYA 3TZKA 5IDWA 3BMQB 3L6DA 5BQFA 2UUPA 1XGKA 4D0RA 2C5AA 1I33A 3OH8A 3ROPA 2AEJA 4IXWA 5IN5A 3W6ZA 3NAQA 5K6AC 2WD8A 3AFMA 4L4XA 1ISHA 1X1EA 3H8VA 1XWFA 3DOJA 4J0EA 2PTGA 1I01A 3WYEA 4MOWA 1NNUA 3I3OA 2POQX 3JQDA 3K6JA 2AG8A 3JQ6A 3N58A 3HG7A 1LU9A 4ZQHA 4B4UA 1YJQA 2RH4A 3AM3A 3OMLA 2J3HA 4WOKA 4BNLA 1VPDA 3WX0A 3MWEB 1EFKA 4MP3A 2BRUA 3JD1A 1I36A 5JE8A 3ZNOA 7MDHA 4BO7A 1LEHA 1YDEA 3RU7A 3RUDA 3CEAA 5L4NA 5EJ2A 3UVEA 5EQDA 5CDYA 2GDZA 3PI7A 3IP1A 3QJ5A 1FF9A 1R4MB 1EFLA 4DXHA 1ZO8A 5B4UA 4EYEA 1GR0A 1F12A 4YQZA 4R1NA 5A9TA 1C1DA 2XXBA 2V6BA 4CM4B 1GEEA 3ST7A 1WMAA 3JQAA 1IL0A 1QSGA 4J90A 3ZHBA 4BNNA 1HDXA 4W9NC 4GGPA 4J49A 2EERA 3KYCB 2O3JA 3UN1A 1LQUA 4J1NA 3S55A 4E5YA 3OHSX 4IQ0A 2ZQZA 5JAQA 3ICCA 4E21A 4D41A 2Y0CA 1DLJA 3FI9A 4E5NA 3ZNPA 2DKNA 3K8ZA 2Y99A 4M89A 4CPDA 4AJ2A 2G5CA 4UUMA 1E92A 4Y8VA 2O48X 4XA8A 1MG5A 3PIDA 3ZU2A 3GUYA 2A92A 1WW8A 4MJLA 3JQEA 3LVFO 2FY8A 2P9CA 1GQYA 1NPDA 1DC3A 2FR0A 3IDSA 1CJCA 2AA3A 2W2KA 1DAOA 3LC2O 1EE9A 1A5ZA 2AQKA 1GZ3A 3GEGA 2QRKA 5A9SB 2YQ4A 1F17A 2EXXA 3QW2A 5G4KB 1XU9A 5KJEA 1JWAB 4WGGA 4DREA 2VNSA 4W99A 3RJ9A 4PLWA 3MOIA 2GUGA 4D7AA 4FSHA 4EJ0A 1X7HA 2I65A 4HWKA 1DIAA 3LDHA 3DAFA 4ZVVA 4YXFA 1XQ1A 2BH9A 3BZUA 4GAEA 2WYUA 2FSSA 4B3IA 1X0VA 1SAYA 4FFRA 4MKRA 2NADA 1FXSA 3PHLA 2D4AA 5G0UA 1U3VA 5B4VA 2DLDA 3C7DB 3NJ8A 4PN3A 4RF4A 2R00A 3W4IA 2YFQA 2YV2A 3JQAD 5IZCA 3BHJA 5F21A 4D0SA 4CLDA 3KUXA 4XR4A 2YUTA 3WOHA 5I8WA 3OF2A 2VWGA 1J4AA 2GR9A 1PJ3A 1ISGA 5KKCA 3WIDA 4UUPA 2VYVA 5AYVA 2Q45A 4I1IA 1E7SA 1YOVB 3VZSA 3FSRA 3V1YA 4LW8A 4QO8A 2RIRA 1Y5RA 4UULA 3WGGA 4NJMB 4WCFC 3GHYA 1PIWA 4YT4A 2C5EA 1EZ4A 4RVDA 1A4IA 4C4OA 3AI1A 2BFOA 1OMOA 4Q3AA 4FCCA 4Z0HO 2CMDA 4CV3A 4OQZA 1XKQA 1KOLA 5BR7A 2PKQO 1UXIA 2CSUA 4DUPA 3H2SA 4IDAA 4R1UA 1O9BA 3WG9A 1QYCA 1EUCA 2BFMA 3GA0A 1HDRA 2B0JA 3DONA 3M6IA 1QYVA 5ILOA 1Q0LA 1I3NA 1X0XA 3NV9A 1KERA 4NMHA 1BTOA 2HMWA 3Q2KA 3S2IA 3OA0A 1LLDA 4BNKA 1BW9B 4AJOA 3B20A 1VC2A 4S3MA 1GZ4A 3LK7A 1C0IA 1IHXA 4UREA 4PZEA 2VHVA 3KXDA 3GR6A 4IJWA 3BHIA 4MVJG 4Q3BA 1ZZEA 3GN2A 1LDEA 3E9MA 1ZXBA 3PQEA 5JLAA 3B1FA 2JJYA 4AFNA 4CUZA 1RPNA 3ITDA 4ONEA 3W6UA 5A06A 3WIEA 1NBOA 1Y9AA 3QVWA 3PP8A 2C29D 4R9RA 5BSHA 3ON5A 2O23A 2OOSA 3H9EO 4MP8A 3JD2A 2VOJA 2X7HA 3I4FA 5JFOA 2VYVD 4IQGA 2HJRA 3ANLA 4ITUA 1B14A 1HDZA 4ZQBA 3KYDB 3U9LA 1K6XA 1UP4A 1NFRA 1DIHA 1ZK0A 3IC5A 1KBZA 3B6ZA 1LQTA 1I5RA 1ISFA 2I3GA 2YQ5A 2XAAA 3LF1A 1PGOA 3H65A 5G0VA 1JVSA 1P0FA 1PL6A 4ALKA 5CAEA 4P8RA 3ONFA 3H9UA 2HQ1A 1JKIA 3SJ7A 3O03A 4QQRA 4W6ZA 4J9UE 3NDIA 5TGDA 1JKJA 3PGJA 5L7TA 4AVYA 1ZCJA 3MJSA 3GHHA 5U1PA 1PQWA 3TOXA 5LDHA 3D64A 3TZ6A 2X86A 4AICA 3K30A 3VDRA 1ZK4A 3CH6A 4RO0A 2HMVA 1E3WB 4UVGA 4ND5A 2ZYGA 1YQDA 1Z74A 3DMTA 4JN6B 5JAMA 3DHEA 1CDOA 5TNXA 1XU7A 1PEDA 4GMGA 4F46A 1M6WA 5B1YA 1IUKA 4XIJA 3PEFA 2RAFA 4J16A 4QXMA 5T6BA 4DIOA 4XRGA 1YE3A 3TZQA 4DL9A 4ZHSA 1HSOA 4J2HA 3MJVA 1E7RA 2Q4EA 4O1MA 3WFIA 5FYDA 2IEDA 1X13A 1NP3A 5TC4A 5EN4A 3ANNA 3FNGA 3MTJA 2PKRA 3ZH2A 2IZ1A 3W8EA 1U8FO 3I5MA 3AOEA 1DJNA 1E5QA 1PS8A 4B8WA 3QVSA 4IJKA 1LI4A 4P22A 3ZV4A 1VE9A 3HDJA 4GSKA 4PCVA 1LTHR 5TX7A 2GF2A 4CQLA 2EP7A 2J3KA 2BGKA 4E5MA 4UUNA 4YJHA 5BSGA 2HUNA 3H6KA 3T7EA 5G2OA 4W7HA 1E7WA 4OGWA 4E2WA 1GAEO 2EG9A 2IXBA 1A7AA 2X22A 3I9KA 3NDRA 1GUYA 1LLQA 3F1KA 1I3KA 2RH8A 4IMRA 1PJ2A 1RYEA 1DDOA 4XQEA 3PWKA 4E12A 1DRVA 2H1SA 3NEPX 4GX1A 2CDBA 3E8XA 1BG6A 3HB5X 3NT2A 4M54A 3DTTA 7ADHA 1VLLA 4J7UA 2NU7A 2OL4A 2CVOA 3JCZA 3ETGA 2PD4A 1GUZA 1M67A 1ZSYA 3EVNA 3CZMA 1T1RA 4E5KA 1Q0QA 1O95A 3LC1O 2IXAA 1A71A 1PWZA 2Y1FA 5FWNA 3D3EA 3DBHA 4JJIA 1I3LA 1ML3A 3VKUA 3V1TC 4CL8A 4D3DA 3L9XA 3BMNB 4IUYA 3JYNA 4BO4A 3FR7A 5A03A 4J2OA 3ZHYA 4IQ8A 2WWRA 3DDNA 3FPLA 3RUFA 4E3ZA 1GD1O 1M6HA 3IKVA 3H5RA 4R3NA 4BKUA 4MVJP 1PJSA 3WB9A 4AJLA 1CWUA 1Y8QA 3EZYA 2IZZA 4I5GA 3U4DA 2GNAA 4E32A 1N5DA 5K6AA 2YZ7A 1SMKA 4Y98A 5TF4A 1UH5A 3AM4A 3WWYA 3IUPA 3ZWVA 1UAYA 2OFPA 1O5IA 1Y6JA 2NVUA 4L8VA 3DOCA 5A02A 2VCYA 2WYWA 4MKZA 4BB5A 3ASVA 4CV1A 2YHIA 5DBGA 5JDIA 2BGMA 3H4VA 5DCUA 5FEUA 1Z75A 3AUTA 3ENNA 3QV1A 2D8AA 4R01A 4PG7A 4OL9A 2P2SA 5JCXA 4FQ8A 5EL0A 3PDJA 2H6EA 1OOEA 4EITA 4I9UA 4Z3KA 3DQPA 3U3XA 1HDCA 2GGSA 5COAA 3W4KA 4J0FA 4EBFA 3I6QA 2VWHA 5DP1A 1PQPA 3DZBA 4UVIA 5KJFA 4OH1A 1HKUA 3LT0A 4HFNA 2E48A 4RGBA 1NFQA 3DBRB 4S1VA 1GTMA 1EUDA 3GAZA 4KOAA 4XRRA 4W9NA 4HV4A 4Z3DA 1IHYA 4EEXA 3W8FA 3HZZA 2X58A 3GF4A 4DC0A 4IS3A 1ENZA 4QX6A 1LUAA 3FTPA 1ISMA 1QORA 4A26A 1DPGA 1U3WA 3JSAA 4CLOA 1Y7TA 1ISJA 3KLPX 3R1IA 1PJLA 4TQGA 2Q1SA 4R4JA 5KOIA 3WGIA 4ND1A 4XQCA 4I5EA 1E6UA 5DBIA 1MGOA 3WGTA 3I4CA 3HDQA 3I9OA 1RWBA 5G0SA 1LSSA 3TF5A 2G1UA 1P33A 1A9YA 3FPCA 5GMOA 4I8XA 1E3LA 1H6AA 1YBVA 4RVSA 3QP9A 4IZHA 1R15A 2BGLA 4J4TA 1PGNA 4DWVA 2EF1A 2PK3A 3N74A 5LDGA 3FRJA 4LRSB 4DGSA 1CF2O 4NK5A 1OC2A 5A3VA 4CMJA 2HMTA 2B4QA 4R51A 4U0KA 1ZVMA 2YDYA 1HLDA 2EHDA 3R6DA 1N7GA 1DOHA 3D3WA 4GH5A 4XB1A 3D7LA 4TKLA 2CY0A 2J3JA 3OJ0A 5ILGA 2QQ5A 1KY4A 5CDUA 5JS6A 1BXGB 2ZB8A 4OMUA 3RFTA 4YACA 2PY6A 3H9JA 3QQPA 5FI5A 5JMWA 4FPXA 1H2HA 3MOGA 5IDQA 2EP5A 3ZU3A 3KSDO 3V2UA 4AJ4A 3JQBC 4ID9A 3PHIA 1ORRA 2D3TA 1N9GB 3ZWXA 2I3AA 2JCYA 1LC3A 5DT9A 4ZQEA 3QWHA 3JQFC 2G82A 3F3SA 3JQGA 1GZ6A 1B8UA 3JYOA 4E2XA 2NU9A 3INTA 4NJOA 5CEJA 2PV7A 4WCFA 3QWBA 2OORA 4Q39A 4FS3A 3C85A 1NVGA 4BQRA 1AN9A 2HO5A 4KZPA 3GPIA 1HYHA 4BL5A 2XF8A 1R37A 3GDOA 5HS6A 3FBTA 1U5AA 1WMBA 2BHLA 3AK4A 3BTVA 3L4BC 3O8QB 4QO7A 1H6BA 5JC8A 1XDWA 3WQQA 3F46A 2NVBA 5T57A 2D2IA 5A3JA 3D5TA 2FR1A 4JK3A 2DU8A 1LRLA 4W7IA 4BO9A 2DPHA 1TT5A 1VL8A 2PGLA 1P1HA 5TS3A 1LNQA 4NPCA 1V6AA 4P38A 1UXHA 2JKVA 4B7XA 2X0JA 3KTDA 5F1PA 1I10A 4Z0PA 5L40A 4BO3A 2Q1WA 3H3FA 4OYRA 1H93A 3DBVO 4Y6SA 1C3VA 1LBEA 4I5DA 5U9CA 3GVPA 1VJ0A 3LC7O 2NUAA 3RROA 2O2SA 4NBUA 4WNIA 4CQMB 5L51A 4DTIA 5KTKA 3WTCA 4QECA 1F0YA 3VZPA 1CEQA 1UXJA 2EKQA 3DMTC 4F45A 4FD3A 2C54A 3PRJA 4IIVA 3TWOA 1VI2A 3RUCA 2VOEA 1LSOA 3L4SO 3VH4A 4RZHA 3GG2A 1SO8A 3NGXA 4RF2A 3TOZA 4IJVA 4R16A 4YYZA 4DIBA 1W6UA 2EW2A 5EIOA 3DHNA 2GN8A 3G17A 3W8DA 1KC1A 1KETA 4WK6A 4INAA 4U5QA 2EKLA 5EINA 3Q6IA 3S1LA 3ETEA 3K96A 1MXHA 1UP7A 2EV9A 1B26A 1Y1PA 2YW9A 3JD3A 4B8ZA 4UVHA 1GYRA 2PZMA 5DP2A 2H63A 4PZCA 4CMAA 2R6JA 3MEQA 2WD7A 3U4CA 1GV1A 3QIVA 1GU7A 1BXZA 5JYEA 5H81A 1NWHA 3RC2A 4UEOA 3PFFA 4NQZA 1IPEA 4WLFA 3ZNNA 5JBIA 4TVBA 3RUHA 4AJEA 2PA3A 2QRLA 4YJFB 4NH4A 3SLKA 3DBLB 2OMEA 1PS0A 2DTEA 2JFFA 4II2A 4PG4A 1KVQA 1SCUA 3D5QA 4MIOA 4M1QA 3PZBA 4RDIA 1UDAA 3CZRA 2AEFA 3TFQA 1NX6A 1U3TA 2DC1A 1I32A 3BTSA 3WSVA 1W73A 4U8GA 3NGLA 3WFJA 2WSBA 1R0KA 4RL6A 1T1SA 4BNWA 1SZJG 4O59O 2A4KA 1JW9B 1SB8A 4NR0A 1XHLA 4HUJA 1C1XA 5L53A 3LF2A 1QYWA 3NTRA 3OICA 4WASA 1EDOA 2B5VA 1VL6A 4U0JA 3MJTA 4YDRA 4DLBA 2AW5A 3GEDA 4LVCA 1E5LA 2Q99A 1ARZA 3E1KA 3RC9A 1UUFA 2FWMX 1C14A 1YRLA 3FF4A 4J1QA 3ZU5A 3GFBA 8LDHA 3NTOA 3WBFA 3AUAA 3COSA 4LSMA 5L45A 3JYPA 3VH3A 5LCXA 4BNTA 3K2BA 4BNZA 1NXQA 4DVJA 4GX0A 1C1DB 2J8ZA 1F06A 3S8MA 5A4DA 4JCOA 3OIFA 4PLPA 2HKIA 3PXXA 3WGOA 2C07A 1C0PA 4A2CA 1ZSVA 1YL7A 2DM6A 3GZNB 3KHUA 4I9HA 3KBOA 1PJBA 3RFXA 4QFDA 3UW3A 5JCJA 4BKRA 5JDIC 3GAFA 1YJ8A 1U3UA 2HK9A 4HADA 1X14A 2O3TA 3ZDFA 1WDKA 5T64A 4JGBA 4QEDA 4NBVA 2IDZA 4H7PA 4IY1A 4XYEA 3ZW9A 1BVRA 2QW8A 3CXRA 4BNMA 4ZRNA 3IS3A 1WP4A 2OUIA 1P1RA 5FF9A 2Y66A 4OM8A 4CLHA 3EW7A 4J9VA 5L4LA 2I66A 3CIFA 5T5QA 2JFGA 3P7MA 5JSFA 5MGBA 3HSKA 2VTDA 4KUGA 4OIMA 2GN4A 4CODB 3WJAA 3FWNA 3RC1A 3H9GA 4ROSA 2FZWA 1NWCA 1RM5A 3ZU4A 1QKIA 1UZLA 1YB4A 1BVUA 4EDFA 3AOGA 3BTUA 3W4JA 1K0UA 2AE1A 3VH2A 1MFZA 5K9ZA 2H5LA 1G6KA 3A9WA 1TEHA 1K2WA 5DBFA 3X2EA 2I9PA 4AG3A 4DLAA 3LQFA 2Y1EA 4ILKA 4PG6A 1HXHA 4CM9A 3JD0A 9LDBA 2CDAA 2FR8A 4II3A 1ZNQO 4IZIA 3ORFA 1ISIA 3WLEA 4DYDA 4L75A 1T24A 4WLVA 4JP2A 3WTBA 4G81A 4BNJA 5JCJD 4N5NA 3WQSB 2YJZA 1LXCA 4GI2A 4X54A 5TJ9A 4XYLA 5JPIA 1D1SA 1O0SA 5HRUA 4Z0TA 4JLWA 1OAAA 3A28A 5C7IO 2OZPA 2ZCVA 4RDHA 3I6IA 3EMKA 3WJ7A 1RKXA 2NU6A 3MJEA 1LDNA 2PH5A 3I9NA 4N7RA 1ZEJA 4PVDA 4RQUA 4JBHA 1OFGA 5CEEA 5IFLA 4J4BA 4RPKA 4URFA 2QIOA 1EBUA 2A94A 4YJGA 4BNXA 3K2EA 2NACA 3QLJA 4YT2A 2AHRA 3EDMA 2NU8A 4IM7A 5DF1A 1QRRA 3WNVA 3F4LA 4TZKA 4XYBA 1BMDA 3H7AA 1E6EA 3AWDA 3GH3A 2P5YA 3JQ8B 4XJSA 3KYCA 3PHHA 3G1UA 1FDSA 4GX5A 1EVZA 3IUSA 2Z95A 1AE1A 1VJTA 1SBYA 1RM4A 1BHSA 3T4XA 1UZMA 1IZ0A 3NKLA 2AQ8A 2Y1CA 1ADBA 3LT1A 2X6TA 4IJUA 3WGZA 2ZB7A 3IP3A 4CMEA 3H3JA 1EBFA 1TVEA 2HJSA 1XIVA 4B3JA 1KS9A 1D7OA 1HE2A 4FJ1A 3RCBA 3PIIA 2VHWA 3UCFA 3BMCB 3SC6A 2FHSA 4YPOA 4Y67A 3E5MA 4CMBA 2H9IA 2JL1A 3AY6A 3JYLA 4HNHA 4CM9D 4BKOA 4BNFA 5DOZA 2P68A 4YVFA 4N54A 2W98A 1KYQA 2QHXA 1MXFA 1NQ5A 1O8CA 4P4NA 2FOIA 3BTOA 2YDXA 4XGNA 5TJHA 2Q2VA 3B1KA 1EK5A 1E77A 3C1TA 5A1TA 2BLLA 5A9SA 1PJQA 2O7QA 2X8LA 1BDMA 4N18A 5G4KA 2B4RO 1W0CA 3V8BA 4DMMA 3CPSA 1ULSA 1NFFA 4OSPA 3OJFA 3GGPA 3OFSA 3GN1A 5DCWA 2JHGA 3IKTA 3RQSA 3E03A 3KVOA 4K1LA 3AI2A 3PWSA 1RJWA 3QWIA 3SBOA 1Y5MA 3UAGA 4GPD1 5B12A 1OZAA 1M75A 4NZ9A 3GFGA 3JQBA 4EEZA 1WZIA 4BGUA 4O63O 4XYMA 2JCVA 3ZHXA 1QLJA 1UDBA 1GL3A 3JQFA 4BMSA 1B8PA 5IAAA 2DQ4A 4KQWA 1VJ1A 1AHHA 2DUUA 4G65A 3FBGA 4MVJF 1YOVA 2PZJA 3ZV3A 1V35A 1JQBA 1B3BA 3ADPA 4LN1A 4PRLA 3RC7A 1M66A 4NJMA 1Q7BA 4C7JA 1GY8A 1PL8A 3C1AA 3DTYA 4BV8A 5DCYA 5AVOA 3DFUA 2CVZA 3TSCA 1HYGA 2DTXA 4MKXA 4BMVA 2PGDA 3L4BA 3VPXA 1D8AA 3HFSA 1P1KA 4ZA2A 1P45A 3QHAA 4KWHA 4J7CA 3JQ9C 1ZUD1 1GEGA 3LLVA 4Q3CA 2Q1TA 1PSDA 2BD0A 3BA1A 4GLOA 1DO8A 1PS9A 4PIVA 2NWQA 4BNIA 3QVOA 1TT7A 3L6EA 3QY9A 1B2LA 2NLOA 1ZXLA 3OBBA 5I7FA 1S6YA 2AMFA 1V8BA 2YYYA 2D5CA 3WNQA 4HNGA 4RVUA 2VYNA 1BW9A 2RCYA 4M86A 3AW9A 5DOVA 1ONPA 1M76A 1N1GA 3WDSA 1HYEA 2WTBA 4YRAA 3ZWAA 1E1LA 2G0TA 2I99A 4ZD6A 4DPLA 1XA0A 4L9RA 3RSHA 1I8TA 2ZKLA 3ZWBA 4YJHB 5I9LA 1YL5A 2IYPA 3QWFA 3VDQA 2DBRA 1WPQA 3NT5A 1SNYA 3P2OA 5A5EA 2Q46A 2X4GA 1NM5A 3HNPA 3RVDA 4IDFA 4M87A 2YY7A 2B4TO 3LYLA 4RJTA 4OJNA 3EC7A 4WEQA 3KYDA 2FP4A 1B0AA 3GDGA 2VRBA 1N92A 3EY4A 1DLIA 1FDUA 5COQA 3PVZA 4NBRA 2FZEA 3E9QA 3S2FA 1R0LA 4NDNE 4J3FA 5KJ1A 4FGWA 1IB6A 4YA6A 1JWBB 3RWBA 3E48A 3SEFA 2C20A 5KNLA 5THKA 3MJ4A 1EE2A 2TMDA 1UXKA 5B4TA 3UFXA 4IXTA 5IN4A 1FMCA 1YQXA 5LC1A 1PJCA 2X0NA 3WMWA 3R3SA 1ULUA 4JJGA 3ZW8A 4CMIA 2VYND 3T4EA 4RORA 5L7WA 1Y8QB 2NV6A 3IJRA 1ONNA 3GG9A 4QTZA 1FDWA 1XSEA 3ZNQA 4CMCA 4ALNA 4DA9A 2FN7A 1NHGA 2ZCUA 2VWPA 3IMFA 4PLHA 4LCJA 5AXCA 1C0KA 4JBGA 3GC6A 1QMGA 1Z82A 2ZTMA 5IZ4A 3NJ4A 3G3EA 1JN0A 4YWJA 3A06A 1VKOA 1K3TA 2YHIB 1U28A 2C2XA 3L9WA 1P1FA 2QRJA 3GNSA 4HKTA 4DMLA 1R4NA 1FJHA 1WAMA 3AU8A 4J91A 1PJ4A 4RPHA 4KTVE 2VHZA 1FDVA 3F47A 2GRAA 2B83A 2BKAA 4B3HA 2BI7A 2BELA 3GZ4A 1DC5A 2X9VA 1I3MA 5F5LA 4M8SA 3DZFA 2Y68A 1HE4A 4DC1A 3ROKA 2PH3A 3INRA 5G0WA 2AXQA 2C82A 3DZGA 1LDMA 5IF3A 4ZQFA 1DFHA 1N8KA 1DAPA 1MC5A 2HK7A 5KIAA 3B70A 3DEYX 3NDJA 1TB4A 3DR3A 4A7PA 4AJJA 6ADHA 1EQ2A 2GYYA 3JQ7B 3G1TA 4GQAA 5GZ3A 3TFOA 1XCBA 1T2CA 2JCXA 2Q2QA 2PLAA 1HLPA 5T67A 1NQAO 1J6UA 4CLOB 4WEOA 1EUZA 3FHLA 2VZ9A 2AQIA 3VKVA 4GLLA 3MTGA 4XEHA 1MG0A 4D45A 5ADHA 3VVCA 4BNVA 3CUKA 4EJMA 4FC6A 4RVHA 1KEPA 4WLNA 4YCAA 2X23A 4ND4A 2OBYA 1W8DA 2FRDA 1MUUA 2P91A 4H16A 1QV7A 3E5RA 2EEZA 4E6PA 1DRUA 1N7HA 4DRYA 5CP8A 2XPCA 5AXBA 3INGA 5DNAA 2FPGA 3UF0A 3BMNA 3K5PA 3WXBA 5C5IA 4FOOA 1BRMA 1ZIDA 1AXEA 4KDEA 4XQGA 1P3DA 2P9EA 3QA9A 3OJOA 5F3RA 3GVXA 1AGNA 2WE7A 1Z7EA 1IOLA 5JXWA 3UHAA 1GPJA 3A4VA 4NIMA 3OIGA 5CG1A 4CMEC 2DBVO 1V3VA 2QX7A 3ZN2A 5MDHA 3F6YA 3LLSA 2XXJA 4CM8A 1N2SA 2R2GA 3IL2A 4PVCA 1ZKMA 2PD3A 4CLXA 2E4AA 2WEKA 2B69A 3BMOB 4EGFA 3RUAA 3H5NA 3ABIA 3PJEA 5FFFA 4WOJA 3ICPA 4O0LA 2J5QA 4B4WA 1J5PA 3VPGA 5BSFA 2UDPA 4J1SA 1NR7A 1HF3A 1I0ZA 1HDGO 4N5LA 4PG8A 3KEQA 3ZWNA 1YS4A 3PYMA 1CRWG 4HXYA 1CQIA 2PR2A 1DHTA 1MB4A 3V2GA 3WR5A 3PGXA 4LCEA 1QG6A 1RM3A 4EJ6A 1RM0A 1T2FA 3C1OA 5I9MA 2BFPA 3WGYA 2C2YA 3E9NA 2HK8A 4F3YA 1T26A 3EHEA 3MWDB 1LDYA 4YR9A 1SPXA 1HZZA 3TN7A 4BNHA 4B79A 5KVQA 3DBRA 1KY5A 1BXKA 1GQQA 4UUOA 3HJAA 1TT5B 5I7VA 1D1TA 1VRWA 3TZCA 2UAGA 1DC4A 4LSWA 3CMCO 4J43A 3VZRA 1GFSA 3ZV5A 1ENOA 2W90A 4PG5A 5AXDA 4BVAA 4FFMA 4DQVA 2Y0EA 5TRTA 4I08A 1LSUA 4O5OA 4CLRA 2Y1OA 3RJ5A 5JW6A 2VUSA 4HFJA 1U9JA 2E49A 3S2EA 1LLCA 4PLGA 3A1NA 1MLDA 1YB5A 3L07A 1WLYA 2Z1NA 3UOGA 5C37A 3DZIA 1EQUA 2P4HX 1U8XX 2CD9A 1K6JA 3VTZA 3C24A 2GZ1A 3CTMA 4FJ2A 1GPDG 1PZGA 1YBMA 3AY3A 2NTVA 1TI7A 4IDEA 4BOYA 1GQ2A 2HMSA 5A9RA 3ANMA 4FC7A 4R54A 3PK0A 2O50A 2FPPA 4HFRA 3K73O 4TMFA 4F6LA 1DJQA 4GL4A 5L3ZA 3LT2A 2OHXA 4AJHA 3FWZA 4JXKA 3SX2A 2GPTA 3OIDA 1ENPA 2BFAA 4YT5A 1Z45A 1JKFA 4ZICA 1BXGA 2X1HA 3GVIA 2WD7B 5TLSA 3LT4A 3WSWA
chains in the Genus database with same CATH superfamily
1CJUC 3T7KA 3CH7A 2BV3A 2VPYA 5IKOA 5IASA 3PUZA 1NNI1 1XWIA 5EPUA 1DC6A 5BNFA 4EK9A 4OBWA 4MDHA 1GXSA 3IT1A 3VBCA 4V39A 2FSVC 3W6OA 4Q7LA 3VKGA 1OFVA 1NPTO 3M7IA 2BP7B 4FFWA 4UHCA 3MUNA 3PYXA 3GLHA 4MV1A 2Z1MA 2ZZKA 2IX3A 2GK6A 4RQTA 4AUMA 1KWGA 5EJGA 4JXXA 4GMFA 5HQJA 3WK9A 1P5FA 1EFAA 3PQ7A 4XDYA 1PFQA 4W4TA 1F14A 4ND8A 2Y1DA 5DGIA 4KPEC 3DDUA 4UTZA 3H2BA 1Z2CA 2ZYAA 3L1IA 4ZAXA 1OXSC 2YX1A 3UO8B 4B8YA 4YRQA 3VR6D 3W3AH 4BNDB 1D5WA 4YIHA 1EGMB 1M1NA 5FNZA 1L3BA 4DCTA 1ADFA 1HSZA 3M83A 5KTMA 4JB2A 4PGFA 3VJRA 3KXKA 3Q5GA 1S3FA 3JAMA 1JDZA 1K8ZB 2W4MA 1W19A 3R5HA 3ZWWA 1PP4A 4AUEA 4RTKA 2GBLA 2EVWX 2QSYA 3KR9A 5E6RA 1ID1A 2HLDA 1DTSA 3AESA 2UZ3A 1NXSA 5HFJA 3VNAA 3T1HB 3DZKA 3IUQA 4TL6A 4BVHA 2RDMA 3DTVB 3S2SA 5C5CA 2NTJA 5A4IS 3N53A 4PXAA 3LBHA 1G55A 3G49A 2VAPA 2C7RA 2ZAMA 3GJ4A 4LXIA 3FYUB 4U7WA 3FFXA 1VECA 3T06B 1T2AA 3W6PA 3P2EA 1RRCA 4H7FA 2GCOB 1BH6A 1ZW1A 4MA4A 3RTAA 5ANRB 5H59A 1NPYA 4ZANA 2AXPA 2O8NA 3OCXA 1G20A 1DXYA 1K5GA 3GMSA 1JKMA 5CEFA 3I83A 3ZTTA 3IPXA 2VPQA 2C7VA 1YH3A 4OI1A 1ZBQA 1SD2A 2LDBA 3KM0A 5D01A 5I4KA 3UATA 4BQEA 2GSDA 1JYSA 2O0KA 4UXJA 3QX3A 2FFAA 1L1EA 1A4UA 1GLVA 1H9AA 1MRNA 1NAHA 4UAJA 1T6BY 4JNKA 4MQFB 3TECE 4P35A 3U09A 3BE5A 1M1XB 3LRTA 3T15A 3BXOA 1L4EA 2PS9A 2I67A 4LIPD 3ROXA 2GHTA 4HEJA 3HR7A 4FCWA 5ABPA 5C4IA 1XMSA 5CDGA 1GKIA 2CCGA 3OE7A 1FMJA 3ZDXB 3TCXB 4Q9LA 4BMDA 4OSOA 4BHTA 1UQTA 1Z4QA 2VR1A 3QHPA 3NBMA 2C95A 3FF1A 3V5NA 4PLTA 1H5NA 3N2YA 4OQYA 2O2HA 3DAGA 2YHAA 3EH2A 2ZI4A 3T5BA 3VKFA 4D97A 5EMNA 4EI2A 4BIIA 5L95A 4U9IS 3EODA 1V95A 4M0FA 4QBKA 4R1SA 1T1GA 3NEAA 4J1TA 4KQ9A 4ZV9A 1BE6A 4MJXA 4EW2A 4IXNA 4YV1A 1QWSA 3ZHSA 4CHTA 3JQAB 4ED9A 1CX9B 4KVAA 1WDMA 5LMZA 3VR6H 1VHQA 4L02A 1PR3A 3GMTA 4X61A 1NBIA 2VFAA 2XUJA 5FH9A 3DBLA 1EM8A 5I7UA 4DR2B 4ND7A 3PU6A 4AW9A 2O3UA 4PFSA 5EUBA 4A03A 2XDQA 2NV2B 1RRMA 4F5YA 1VE7A 1SHLA 1MW9X 1R0YA 4YUWA 4DLPA 1FSGA 4Z4GA 1NBMD 3CVOA 2Z4RA 3UK7A 5TVGA 1YR8A 4E88A 4V0QA 4F4DA 2J30A 3RBXA 1RHUA 3TKLA 1DB3A 3KVNA 1QG0A 5EMHA 1I1QB 3IRUA 3CMMA 2JGRA 3N0WA 3HSYA 3DL0A 2WW8A 4Q00A 1B93A 2F3RA 3SHTA 2QN8A 4LRTB 3PI6A 3BXEA 4HLCA 4EYQA 3HKEA 4OQDA 2P67A 4XD2A 3RU3A 1Z7BA 2QOEA 2NUPA 3UXEA 1GPH1 3NEJA 4MCJA 2HMAA 1HDOA 3GT0A 5IHXA 1K4YA 5AOCA 4EQ6B 1PDVA 2NNLD 2WFLA 2N1MA 5AOVA 5AK5A 1GT6A 4IBOA 3F71A 4Z9BA 4FN4A 1H22A 1M5RA 4MR7B 1ZCBA 2BTQA 1T3ZA 3ELYA 3U5ZB 3KT3A 2PZFA 4RABA 4O4IB 1HC7A 4BB6A 2J7KA 4BVJA 5JSZA 5IT9A 1I2ZA 1OAOC 3FPAA 2P1ZA 4LK3A 3V8VA 4ILEA 2CV1A 1NURA 1Y7PA 4Y2YA 5EE9A 2KE5A 5E38A 1U9CA 4BGEA 4ENWA 2PD6A 4M49A 3ULKA 2VJQA 3AVUA 4ARCA 1CG6A 1IBKB 5UKDA 4C7BA 4FFVA 4FONA 4PZLA 3DFFA 3WLJA 2O2ZA 4BFLA 4P0QB 3L77A 4NHEA 2VHUA 4Q18A 2WNSA 1UKVY 2WUVA 4HD8A 4GKVA 3TLKA 1EU1A 5ALKA 1M8KA 1X3SA 3ND8A 1GKUB 5BV7A 4MIYA 3W9UA 5HZHA 5HHTA 2EZTA 4MUNA 4X5OA 5C8YB 1SXIA 1PK8A 1URPA 2QTFA 1W5FA 2VEOA 1ZA1A 2YJTD 1JHAA 1M6YA 4YMSA 1UEJA 3RS9A 2O3QA 3HCWA 3S6JA 2YHUA 1FJ2A 2NTNA 3ZX5A 3TINA 2P2GA 1DBIA 2Y0DA 3BILA 1X9IA 2V9ZA 1LW6E 3IDQA 1FTYA 1P0QA 2BF7A 3DM9B 3OT1B 3PG5A 4PS1A 4L4ZA 4MEBA 4EJ2A 3EWNA 1P9OA 2W8ZA 4AKIA 2FMKA 5COBA 1GV0A 5FP0A 4J7XA 1YTUA 1HL3A 1ZH8A 1V3TA 3VR5H 3CRW1 1EFRA 1HX7A 2DERA 2GAJA 3EAQA 4L27A 4Q1EA 1W4ZA 3BWCA 1M8GA 4GVPA 2E82A 1G7CA 1PDOA 4NU6A 4PZPA 2WIJA 4NTZA 5AKEA 3ETJA 2IW3A 4YJDA 5I9BA 1LLFA 2F17A 3N39C 2AMLA 1BKDR 5GONA 5AESA 1KYTA 4CM4A 2HBQA 4GYJA 1RLIA 5FOTA 1IPFA 3IVXA 2AOUA 5K4AA 1TYEB 2C0CA 5LP6B 2VA8A 1UDCA 4Y0VA 1WZEA 4ZYZA 2QVBA 3ICOA 3K92A 1TM4E 3PPVA 3TH5A 2H08A 4M0LA 4XKJA 421PA 1AF4A 1M2GA 3AR6A 1L4GA 1SIUA 3D2CA 4F6CA 1DVRA 3H4TA 3JRNA 4NAVA 5TMPA 1NMXA 3EPKA 4UHJA 2QXTA 2I5PO 1Z73A 2XUOA 1IRIA 3LKDA 5IHPA 2YFHA 3OQBA 1Q7GA 3KSUA 4PNEA 5DN6A 3TCKA 2CNWA 1M6VB 4FIZA 4G23A 2PO7A 1Q5PA 3MC1A 3PFCA 5CD9A 4V0OA 5HCIA 3FCOA 2BI8A 1M1ZA 4Q4JA 1AKVA 2V5UA 2JAWA 5KKAA 3KWLA 2W6PA 3AHEA 5JAOA 2QORA 2NM0A 3AEQA 3GGCA 2GPAA 2QUZA 1R16A 4GOXA 1NRWA 4QU0A 4UM9B 4KAFA 4ZI2A 1C7ZA 4WBXC 2VDMB 2FKAA 1G3RA 2OV8A 1XCLA 2JLZA 4FFSA 1CZHA 1DT5A 4A0GA 1XZBA 4HGOA 2AEEA 3Q3VA 4ND6A 1PFVA 2XV1A 1A7UA 3Q3JB 1XLUA 3GAAA 2FAXA 3E7FA 4Q05A 4TTRA 5FLEX 4EW3A 2HCTA 3WAKA 4BMOB 3SDSA 1SWVA 4BIMA 4DR7B 3HHEA 3I6MA 3ZVLA 4DBLC 2UUBB 1A9ZA 3BYZA 3ER6A 4C4AA 3EPLA 3CPHA 1FOEB 1PR9A 1RWVA 1UKZA 1R27A 2J3IA 2JNWA 3G2JA 3HL4A 1UFQA 1V9SA 2VK1A 2P79A 2W9XA 3MQFA 2P2NA 3DLPX 1FQKA 4CM6A 2PUAA 3VXKA 3DB2A 4GUDA 3CUWA 1IVYA 2B4AA 2SCUA 4MI6A 4DMCA 2SKCA 1U4OA 4TT8A 3VPHA 4GRAA 3O73A 4RLQA 5JZ9A 4IJ5A 4JXJA 2LIPA 2VG8A 2W43A 2WHRA 2NO1A 3KJGA 4XR9A 2VF4X 1GGFA 4XM2A 3VYVA 4ZOQI 4YUAA 5HOEA 3V8QA 1XRSB 4HX2A 3H1GA 1PGQA 3ETHA 3O3CA 1CU1A 3RC8A 3A36A 4EYGA 2GCGA 3HY4A 4U2FA 3KKKA 2DECA 2V0NA 2FEAA 1OH8A 5EWLA 2QW1A 3PGVA 3AUYA 4TM7A 3WBBA 2H1WA 2NZJA 1D09A 3PDIA 3B2NA 1JLRA 2Q3BA 1U94A 2BM0A 4F2PA 4FZ3A 3DD5A 1EVIA 3FGNA 1XZIA 5HRCA 3ZI4A 2CJWB 1P1IA 3IUMA 4BFXA 3IBFA 3AL2A 3D4PA 2H4JA 4V0KA 2Q28A 2VHXA 2HT1A 1XQ9A 2ZXFA 5GGXA 4G1MB 1E0SA 1DKNA 2JI6A 3WWZA 3UYLA 4OLBA 3QX7A 2Y93A 2DHCA 1KEUA 1AV7A 3WL3A 4EHFA 2VDRB 5IARA 5BV8A 2GVNA 4A92A 4GI5A 2JF0A 3EPHA 1R50A 5L3SA 4Q7KA 1TXGA 4YRKA 4IIJF 2ARKA 4GKAA 1AGYA 3P0RA 1JA0A 5I8ZA 2P9GA 4JYCA 1A2BA 1RRFA 2OBLA 2QAGB 5DV9A 1X1SA 3JYQA 3DH0A 3R0ZA 2X8BA 4LGCA 1T3LA 2FJUA 1Z12A 3T9BA 5CDSA 2A5JA 1F8FA 2Q3DA 3G85A 5BNIA 4EG0A 3ZEIA 2ZFUA 1Q44A 4R69A 3VSDA 1QUEA 2YFKA 4U6QA 4XUCA 2DBYA 1QPGA 4WCVA 3ZWMA 1Y3IA 4JJZA 2FQWA 2I2FA 2FVXA 4G5YA 2XUHA 4K9QA 4TX1A 5ERYA 1YF3A 3WIBA 2BFCA 2PGIA 4YIKA 1O94A 1QNFA 2HTFA 2GXAA 3VU9A 1HORA 4NJEA 5FO0A 3CF4G 1KR5A 4LGVA 4KN6A 4LJ6A 4D9HA 3PEYA 2AKYA 1EVKA 2UXCB 2J87A 3Q2IA 1AUOA 4NV0A 1ULHA 4OK5A 3IP9A 3FVWA 5IJ9B 4EHKA 1OC4A 3DTNA 3NBKA 4CMIB 5BR8B 2Z8XA 5AHOA 4QUEA 4AQYB 1P9RA 4EGJA 5EIEA 1EJ2A 1HV8A 1L4HA 4GR4A 2R1UA 3UQYS 1R9NA 3ZHZA 1IXSB 4AJ1A 5HM6A 1M74A 1Z5GA 1ZSNA 1BJKA 2QK4A 1RJ9A 5IBRA 4J2TA 1PQUA 3W9BA 1YONA 2GZ3A 4JLNA 5F1OA 5IFKA 4LNHA 2Y05A 1Z07A 4RETA 1KDYA 2H65A 3R5XA 3EEYA 4G86A 5FEMA 4IUBS 4KUHA 3HWX1 4LISA 1KVSA 1Q74A 4DJDC 4YAGA 1QVAA 1PYGA 3E6AA 1GFZA 2LE0A 4FFLA 3T94A 4HG2A 2YV3A 1T4DA 4NYIQ 2P3OA 1WXWA 2M1ZA 1KC3A 3P2JA 4P36A 3BKXA 3UGTA 2O5CA 2AIRA 1CETA 1IZZA 4KIJA 1P19A 4MCHA 3P5SA 2WJAA 4X64B 4YBZA 1UOQA 1H2YA 2B5WA 3ONVA 3WBJA 5I4BA 5DH9A 1V7QA 2DUNA 4ETWA 5EZYB 3UJDA 3A31A 3I52A 2GHIA 2QGNA 2PU7A 3I01M 4WKPA 3ICQB 2FFJA 3L6RA 1VJGA 2VUUA 2WWIA 4C0AC 4FMBB 1V8DA 1P31A 1WVGA 3MB5A 1Z4PX 2FK8A 2XNKA 3IAS1 4AULA 4FHEA 4ESHA 2BEWB 2DSNA 2OG2A 6REQA 1KVTA 3NFYA 5LR6A 4JLSA 2QT9A 3QF4B 1DCFA 2NVUB 4JBIA 2HYIC 1UODA 3OZAA 2VI5A 4B6EA 2QTLA 3IMCA 4FOPA 5DXJA 3TOVA 3TQCA 3BRWD 2CLSA 5CBPA 1K7SN 2X40A 2B98A 3MRTA 4U7GA 1C2TA 5EYPA 4ZIRA 5JV5A 2DFNA 3CRVA 1P9LA 5JIBA 1W9HA 4B4OA 3KJFA 1U7TA 2DZDA 3CLRC 3DZHA 3PUWA 1MV5A 5E7IA 2YH2A 5EZQA 5G40A 2W6ZA 3RJMA 6ABPA 3NTLA 1P80A 4CEIA 3OUUA 4F06A 4V0ME 1TYZA 1E6WA 3O3OB 3PD0A 4LRQA 1MT3A 1MTZA 1Q0HA 7YASA 4C7OB 3OY2A 1VI6A 4YQEA 3PNLA 5CK5A 3EVBA 2O9JA 3F7TA 2FETA 4PLYA 4PE5B 2O4UX 2NXEA 2X41A 4AKTA 2IX9A 2PRKA 3GOHA 2WMYA 3BE6A 1ID8A 5IJZA 3DCNA 1YR6A 2RHWA 5T4BA 1Z3CA 2IWRA 3OCWA 5K09A 1Y8CA 1IY0A 2HU7A 4LY0A 2XCIA 1CD5A 3LE8A 4UJ5A 5DDIP 1LK7A 2ZRGA 5DIFA 2FPGB 2QX4A 4MQEA 2GPWA 2Q0XA 4RVNA 1BHO1 4EO7A 2NYAA 4DR1B 4MMYB 1JVBA 1Z6YA 5AXAA 4PEVA 4CUJA 3WKDA 3OETA 3SU8A 4UUAA 2GM3A 1WBJB 2IU0A 1II0A 4B4VA 3HFGA 1B8VA 4OK3A 5B2ZA 2XMQA 1BGXT 2ZRPA 1IULA 2C2KA 1DWOA 3DO5A 5F2EA 4LZJA 4XUEA 3SP1A 4LZLA 4EB6B 4KQXA 5H8WA 3QFHA 2H54A 4G0PA 1MA0A 2HBRA 4EJSC 3TKYA 5HNKA 2IBSA 4O4IF 4UBOA 2POCA 1J49A 4TWRA 5JAZA 1JPUA 5IEBA 4MTLA 3CB2A 4RK4A 2H5IA 4FGSA 4LJKA 3KEMA 5BSEA 5ITSA 1M6NA 2RK3A 3F9IA 3U0BA 5GJCA 2CLMB 2PIDA 3OPYB 4XGIA 3SZLA 2XCTB 4QHYA 4A8JB 5THQA 1U2PA 1N2CA 2ODNA 1RXYA 2C3PA 4MKHA 5L8VA 3LNTA 4QVIA 1SQSA 1RP1A 2F9MA 1EVYA 4DQXA 3IT3A 4IRUB 4ZARA 3V33A 1KI6A 3HN7A 3NHBA 3VOSA 1WULS 4ZI7B 3IALA 2CB0A 2ZTLA 2FPIA 2D0IA 1F2DA 2AW3A 3JQCA 3QEAZ 5C8YF 2GMWA 2P4EA 2N9UA 1J42A 3F4KA 1ZM2A 3AF1A 1QDEA 3UK0A 2BMJA 5KWVA 2ZCJA 1W4AA 1EVQA 4AWXA 4ETNA 1IATA 4HHEA 3SBEA 1ZOLA 3BWMA 4YTEA 4ZJYA 1CW2B 3C41J 1ZRMA 4WNCA 3WAGA 3PB3A 1RXUA 3BIOA 4S35A 3O2QB 4JYAB 3QYAA 4JGGA 3QWAA 1X15A 4I5IA 3VH1A 3HUTA 4DEXA 4WKGA 1F8GA 2IH2A 4H1WA 3T3HA 4C0JA 1YNOA 2VWQA 4G89A 2C03A 3FTNA 1ECLA 1ZGCA 2AFIE 2CFRA 3JQPA 4FYXA 1VFNA 3PEEA 1T8UA 1FYXA 4R8VA 2V54A 4ND3A 3W2IA 3FRIA 4CHGA 1ZEMA 1RI2A 1G0OA 3FPHA 4FBMA 5CPBA 3I9LA 2EEPA 3UUGA 4DV4B 4RQAA 5K0NA 4B7UA 2ZBGA 4N5MA 1B16A 3GNLA 3JARB 3L6CA 4L4RA 4ZKEA 2OFFA 3V46A 4CT4B 3C15C 5LP6F 3D4OA 3VR3A 1KRXA 3Q7RA 1VSUA 3TLAA 4IDDA 3ZWCA 3N28A 2N0SA 2HAEA 1Z06A 4BFSA 5ALSA 1KYIA 2J3EA 4TQ9A 2JC3A 2V7PA 2QSUA 2EIHA 3C2QA 3SF8B 3TQHA 1RAIA 3GFPA 1AD2A 2PX6A 4R68A 3V7WA 2X5XA 1K3UB 1TZMA 4LOHA 4DCMA 4QODA 4U02A 1DDIA 3TR5A 3O75A 4DM4A 3UMSA 2JIPA 4G63A 3UMYA 4IHJA 3CZ9A 3GWZA 3QVTA 2V98A 5CH5A 4DM7A 4OX9Y 3OQ1A 2QMYA 2HLHA 3B5JA 4G1EB 4K2AA 3RBZA 2B1JA 2VHCA 3SHFA 4D79A 1PV4A 5HTOA 1HA3A 3T41A 2R6HA 2MMCA 1GQSA 2W5UA 2X8JB 3VU3A 1DBWA 1WD5A 1FBTA 1P2SA 2EGGA 2H0AA 3BOSA 3GVCA 2FPPB 3HCBA 3KZ1E 1SUFA 1PWXA 1T9CA 2DT5A 4J0KA 4LHVA 3H4MA 4M55A 5LBUA 2BEKA 4MX8A 3SYMA 2EBHX 3A8TA 4YAIA 2CXOA 2QE7A 3OEHD 1KEVA 3KOUA 1USVA 2WYVA 2W11A 1SU4A 3QIAA 5K0GA 3WK8A 5TE9A 5CT8A 5BO5A 3ELWA 1OIXA 4DZZA 3MSCA 3H11A 2PG3A 3N2NA 3IPCA 3JAKB 5KHLB 1BC5A 2J33A 1CY6A 1KK1A 1NZJA 5JYDA 4N9QA 2Q4DA 1TPYA 4GOOD 4KWIA 1GXSB 1TKRA 3EIOA 2Q1UA 1UOOA 2GXUA 3BMOA 2Q8PA 1YB7A 5DCLA 2QD2A 4IG9A 4HVTA 3GLHB 1GCOA 4YB8A 4D2IA 3A14A 4DYVA 3R3YA 5L9AA 1H6DA 1ZJJA 4BN4A 5I5EA 3W2HA 3F6CA 4URYR 1JJAA 3C6BA 1J9ZA 4EI8A 1UAGA 2V6FA 3A3OA 3KJIA 4ND8B 3R24A 4QGAA 1SXJC 3LQ2A 3ZBQA 2HV8A 3ASUA 4NNJA 1YE8A 1RPTA 2VXCA 2QRVA 4FFBA 3RJZA 1JTVA 2C3UA 3R3WA 4F4CA 3T1YB 3W0LB 4HUQA 4WA8A 2FWBA 3THWA 1HZJA 4MUAA 4QYXA 3H05A 4G0YA 5F7ZA 3F2VA 1HE5A 1QHIA 1UPXA 1PGJA 1G1AA 1ZN8A 4PTLA 5EQJB 1GPAA 3NOVA 1W1WA 1N4DA 4UEKA 1F2VA 2GBGA 4YCLA 3SX4A 1FU4A 3DPSA 1KZ1A 2IUFA 3OWHA 3G0CA 5DGDA 3I6BA 5K45A 4D82A 5E6RB 1JDPA 1XFDA 3AESB 1LB1B 3L2OB 3VNVA 1GSOA 1NDQA 1DIGA 1C5KA 4S1TA 1ZISA 2KBFA 1NVMB 4RK0A 4PLVA 3WK6A 3TW0A 4RF3A 1Q1NA 1UMDA 3VNBA 4H3SA 2VZ8A 1K8YB 4KQFA 3TIGA 3MJCA 4MGZR 2YVLA 3T9EA 1MRSA 2XKAA 1V45E 1W5BA 1J0BA 1FC0A 5BNWA 2LDXA 3OLWA 4RXTA 4F8EA 5JNSA 5FTJA 2NGRA 2KB0A 3BFVA 1JH9A 3LX6A 2Q2NA 5KSYA 3NGMA 2B6NA 3WA6A 2IH4A 3KU1A 3A9UA 4YMLA 1FRQA 4QUAA 5DO9A 1I7NA 3QPUA 3BRQA 4IWXA 4EZEA 3Q40A 1NYLA 4Q6BA 4FSXA 1C1XB 1XYVA 1P2GA 1E1KA 5AJVB 4UAVA 1MMFB 5IAKA 2GKSA 1YS7A 3R3JA 4H59A 3FN4A 4DG9A 4HQKA 4B75A 2RD2A 1QR6A 3O8QA 3O7WA 2GPNA 4LX8A 3BX1A 3I45A 3KOWA 2EFJA 3DYVA 4R84A 1R6DA 2D1YA 2Q9AA 1T5LA 3A4MA 3GZJA 4Z9FA 2ON6A 3LWDA 1JAYA 5G4LA 4UOZA 3M33A 2JPDA 3NS7A 1UKAA 3CRRA 2VT2A 1K7YA 4MVJA 4N4AA 3LU1A 2V1UA 4P32A 3L01A 1IRXA 5H82A 2VHJA 3O8RA 3D5EA 1ZJZA 3IAEA 3MCZA 2ONCA 3NHWA 1NR5A 2NVWA 2XUKA 4Y6RA 4Z9XA 1TLFA 2DUJA 2EARA 2GTHA 3OSUA 1GZ5A 2AJBA 4HCJA 1OZHA 4RMGA 3U3KA 2ZIZA 3AETA 5FWYB 5HK8A 1QYDA 2ERCA 4I5FA 4A3SA 3QKWA 1Y7LA 2BH2A 5DWVA 5AJXA 3D1VA 3ZE1B 1H2EA 1PJTA 3UWPA 2QSJA 1DZIA 1ZD4A 2IIBA 2XMRA 2ZI9A 1AXRA 3DOIA 3GDFA 1K7CA 3LPNA 4IV0A 5FUQA 1IVSA 4Z53A 3DHYA 1C3OA 5LKAA 3ECCA 3NX4A 4TTAA 3TZHA 2B8EA 5L7YA 4YRGA 3GRPA 1Y8AA 1ZQ1A 1GG5A 3D2BA 3F5DA 1YI0A 3GLGA 2GB4A 2IOYA 3Q7SA 1G63A 1P7WA 4ZZ0A 1VL0A 2SKEA 2HRRA 3T3EA 3N8KA 5D7NA 4ZQGA 2R1TB 4LPKA 4DNQA 3ROTA 3NRCA 5HS4A 3LC0A 3R40A 4GE3A 1MC4A 1IJKA 3PQ3A 4IIUA 2XDQB 3LVBA 4PO3X 1PGPA 3HZHA 3FMGA 3N8GA 4R2KA 5FOVA 3DMYA 4KOEC 4A5SA 5KSZA 3TSOA 4ER3A 2FG6C 1AGRA 3PJDA 2ORYA 1M2WA 4XD7A 1HT0A 4E13A 1Q19A 4TSKA 5F1KA 1J7KA 3CRNA 4IF6A 4U39A 4W5RA 3G7UA 2JHFA 4M3NA 4C3OB 1ZK3A 1K5HA 1O6BA 2JLSA 2YWEA 3QI7A 4XIIA 3SE0A 4AS3A 4D57A 3Q1KA 3C6QA 4ISBA 4DA4A 3BXXA 3SC4A 4TMYA 1LA2A 2P0AA 1S3SA 5AFSA 4GL2A 2D5IA 3QRWA 4FQ5A 3RC3A 3L46A 1KSFX 2H1LA 3DCJA 2ZAOA 5HJ7A 1T36A 4FW9A 1TRKA 4LQ4A 4E1AA 3HKEB 5C3MA 5CA1B 3VBEA 1S4MA 4JSRA 2X0RA 1QZTA 3G9UA 2O1EA 4MUKA 3E1GA 2G7ZA 4H35A 5I4IA 2HD4A 1S89A 5M7EA 3PC8A 2NTYC 3K9BA 3QEKA 3HUUA 3LOUA 3ZE6A 1A97A 2PX8A 4QBFA 4IDCA 3TPCA 1U7OA 1M1YE 2JLWA 3HLTA 1KFEB 4R1MA 4XDZA 4ZCRA 3UJPA 4QEKA 2OBNA 3CKYA 1YD7A 3GBPA 5JSZB 5J2TA 2NSHA 3KT0A 5AI8A 1GZ7A 5FJIA 4YPOA 1X8JA 2J5BA 4WD3A 1OA0A 2YV1A 3I1IA 5AKIA 3ILSA 1O9GA 1LDBA 1JE0A 3LNCA 3PKIA 4MW4A 3TZKA 2FDRA 1WPXA 2I4RA 1JMKC 3UUFA 5ED4A 1TM3E 2UUPA 4D0RA 2GA8A 4QLBA 4PPQA 4IXWA 1XEWY 1MB9A 3PIRA 4FK8A 3A1TA 1NVVR 5HKOA 2IOQA 5JT1A 5WRFA 2Q8QA 3L49A 3AV0B 3EIUA 3AFMA 3BDVA 3AO0B 2QT1A 1NVKA 2R3SA 4ESVA 2X0KA 1I01A 1YR2A 3CN9A 5IC5A 5TR9A 3JQDA 3UB3A 8AT1A 1TGYA 1QC5B 4DCCA 5HQ3A 5IW8A 4DKJA 1YJQA 3HCAA 1LY1A 2GN0A 3BJRA 4B6SA 4BNLA 2D0PB 3EY9A 3OPQA 5JCOA 2NPFA 1IB0A 3DMFA 2IIQA 1E4EA 3AUFA 1SXQA 5FTNA 5JE8A 2LZ0A 4UBKA 3MCTA 4CBVA 4UMFA 1E2DA 1X19A 3RTBA 4BO7A 7MDHA 2RFLA 2JGJA 2PUBA 1RHKA 1XDSA 4G4SP 1Y5IA 2O59A 3A3KA 2NU6B 1DJLA 4IMJB 4DLXA 3BFJA 1DJPA 1R6TA 3GT4A 5CDYA 2GDZA 1K7EB 2F90A 4G37A 5C4GB 2XQKA 3UAYA 2R47A 1FF9A 1EFLA 4LYYA 2E85A 3OKPA 4DJAA 4O29A 3ZD8A 1S2IA 1F12A 1KGDA 1XP5A 4JHLA 4KPUA 4YQZA 2IYEA 3K4QA 2PZEA 1QIIA 4CF5A 4B43A 4ZVSA 1HQYE 4CM4B 4JYZA 4K86A 1SXJE 3ST7A 3CFYA 5DBEX 5TXGA 4Y2SA 1P0PA 3PT9A 3I9FA 4DA0A 1P4RA 5JTUA 1QSGA 1N6LA 4J90A 4BXOB 2VYCA 3LPLA 4W9NC 5CGQB 4G6ZA 4J49A 3WK5A 1PJRA 1ZG3A 4JH0A 3A9RA 4AO8A 2O3JA 4IVNA 2PXHA 3KJZA 2E7ZA 4PYRA 1QHGA 2Q6TA 2NOAA 2YJ4A 2Z3WA 1JAHA 2WM2A 3JQRA 3OHSX 4IQ0A 5CXQA 4KLZA 4NARA 5E1DA 2B9VA 4OFWA 4OYHA 3HB0A 2XZLA 1VP9A 4ZI7F 1XZKA 1XRNA 2BHTA 2CJPA 4X9XA 3ZNPA 4K9KA 2Y99A 3KQWA 1EP3B 1MAWA 2BM8A 3JWHA 2C2WA 3QU5A 4LE2A 2G5CA 3UQZA 3VU8A 4IG4A 4IUDS 3QKTA 3G0BA 4Q4JB 1ZOOA 4C2UA 2DHRA 3EGIA 1P5ZB 4U7TB 3LYUA 4FE7A 4XA8A 4BJHB 3DAYA 4MJLA 3LX4A 1OXKB 3RG2A 3FHJA 3QVGB 1IY1A 4FKMA 1QCCA 5JS8A 1N6KA 2QLBA 2ZRHA 4JI7B 1DC3A 2AJLI 1Z7GA 2FW8A 3IDSA 4NFLA 2AA3A 2W2KA 1DAOA 1NP6A 3LC2O 3PT5A 4HNQA 3BFXA 1JUDA 4HRYA 5EEHA 2OCKA 4RJLA 3M3PA 4B84A 2QRKA 3CLRD 5A9SB 1YNSA 3BQMB 4RY0A 4S1WA 5FBHA 1FVFA 2V7XA 1T34A 2EXXA 1G5IA 2ILVA 3QW2A 1NTRA 5A7HA 2NX2A 3ZXYA 4DREA 2YMQA 2B3DA 1GRVA 5AHWA 1BCRA 2WSSA 4QRHA 3TR0A 4URXR 4YC7A 4HWKA 2GYWA 4L0DA 3JAWB 1DIAA 3LDHA 3PFIA 1EFDN 3QPDA 1MVNA 4IXDA 4PANA 5CLQA 5DRTA 4GR5A 1XQ1A 5E6SA 4ZVVA 1RKUA 3BD9A 3IAM1 3ABSB 4GAEA 1S2GA 5DW3A 2CXHA 1X0VA 2SCUB 4B3IA 1JFFA 2V03A 4DJEC 1WMDA 3KKQA 4JT8A 2WG2A 5G0UA 3CJQA 5B4VA 4Q9HA 4DLTA 1C7JA 1O03A 3HABA 4GBED 4X0EA 4EY8A 2YV2A 4KW7A 1PFKA 2Q6VA 2WJYA 4OUKX 4CLDA 4D0SA 4ROTA 2FN4A 3SQNA 4DNOA 4DDTA 2EQBA 4KR0A 2GR9A 3ZZUA 3L7CA 5KKCA 1MB2A 2ADMA 2BCEA 1P7VA 5BN3A 1E63A 3V1YA 3NG1A 1Y5RA 2XSZA 3T38A 3WGGA 3N8NA 1RS0A 1VJDA 3RPEA 3ASZA 1ORDA 1ZOPA 1EZ4A 1OZFA 4L9AA 2GCNA 2JH9A 4YRSA 1VLQA 4C4OA 3AI1A 4Q3AA 1OMOA 4RD2A 3NBYC 1KI2A 1KJ8A 1T1JA 4CV3A 3AT1A 1AMOA 4OQZA 1I6LA 2PSDA 3DAHA 3EEQA 3CWZA 4UEQA 1KOLA 4L0CA 3H6GA 3QU7A 1UXIA 1VB3A 4KQMA 4HWOA 3H2SA 1R9GA 3DS8A 2XZDA 1MIHA 3GT7A 5CLHA 1TM7E 2VRNA 5CLGA 3WHIA 2CXXA 4NCXA 1L8QA 3H1TA 2WWVD 4YUZA 1JXMA 2BFMA 2HNBA 3A26A 3GA0A 4RS4A 1Z5PA 1ZVVA 5L3SB 1E9SA 2B9EA 1QYVA 1X92A 2WDPA 1QQBA 2JCBA 3RRBA 1U8ZA 1X0XA 2IYAA 3VAYA 4KQ2A 4MWOA 2G3YA 1BTOA 1WEKA 1ZBDA 2D1RA 2FW6A 2HMWA 3E3AA 3HUEA 4KE9A 4X7BA 4BNKA 3N2LA 2C7BA 4QTYA 1GZ4A 5IYZA 3LK7A 5EWJA 1I4OA 1JV2B 2BHNA 4HAZA 4IIHA 5B1IA 1U99A 4RZ3A 1CUJA 1Q1BA 2G6BA 3SVZA 1U0RA 2VHVA 1KS2A 4IJWA 4LJAA 4DLWA 1XAHA 1EWVA 1QGUA 2IS2A 4V0NA 1PTJC 4AD8A 3E9MA 4L9WA 5TGZA 3V9AA 4YRZA 5JLAA 2XRZA 2AJ8A 2DWUA 2JJYA 2KWIA 1UC9A 3BXGA 4NJEB 4RE6A 4XFKA 4AFNA 2DPMA 4CUZA 1SKYB 1E99A 1V26A 4AJ9A 4HDCA 3V34A 1P6XA 1E6MA 4KQ6A 2VTVA 3QVWA 2UVPA 1CEYA 1Y34E 3FOEC 2PMWB 1TU0A 3JD2A 4RTMA 3I4FA 1XP8A 3TQTA 2FLWA 4TYYA 3CR8A 3ZI7A 1QPBA 1XVTA 3AHGA 4WXHA 1JEOA 3T6KA 1JS1X 3BERA 4S1NA 2QTTA 3HM9A 1QH9A 1LD3A 1V48A 2O52A 1W5TA 3ZE2B 4BLPA 1D2EA 1UP4A 2V1XA 5CFQA 1HNWB 4MW0A 2VBIA 2FYTA 5BSRA 3T7JA 1TAGA 1DKRA 4F4UA 4Y3UA 4OEHA 2CT8A 3GUHA 3IC5A 3B6ZA 4I3FA 1FYFA 1IC6A 3ME5A 2WLSA 3PNMA 1CRLA 4KYTA 1WKVA 2EJUA 4X62B 1SK9A 2OD9A 1JVSA 2X4IA 9ATCA 4P8RA 4XGRA 1R8YA 1RQXA 4Z54A 1LV8A 3VKWA 1MZVA 2X76A 2VDKB 3IDFA 1E1DA 3PPXA 5CX1A 2YHBA 2I8LA 2JEZA 5BW6B 2ZWOA 3D64A 3TZ6A 10MHA 4DQDA 5B58C 3AXSA 4LTMA 1SU8A 3IXLA 4RO0A 2QPLA 1ST2A 5JNRA 3GJ8A 1CFJA 3NOQA 1QH8B 4MJ3A 3AVQA 1N0VC 5ALRA 4AZ3A 1T8SA 3BL5A 5JAHA 5JAMA 4O3MA 4TWIA 6REQB 5TNXA 1PCXA 3D81A 4NDZA 4WXPA 1UT6A 2BGIA 5M3BA 2WPDD 3DKIA 3FDZB 5MN4A 1S8OA 5ULLA 2FWNA 2VK4A 3VKHA 3PEFA 4RSRA 1LK0A 3I1YA 1RVV1 1CT9A 3B3JA 4GOLD 1W0KD 5KTOA 1YE3A 3WOVA 5K3OA 3QLEA 1BEEA 2BSXA 1Z0JA 2XCUA 3IV6A 1XEFA 4LYHA 2FWPA 3RLFA 3DF7A 3QEJA 4O1MA 2WWGA 4XAQA 4OP1A 3LH5A 5KQMA 1NP3A 1RYYA 2X1MA 3FYUC 1OZ0A 5KYYA 3OAAD 5A62A 3ANNA 4HYEA 1EWTA 5BN5B 3FNGA 3JX9A 4IF4A 4RHEA 4DDHA 3MTJA 4IVPA 2ROQA 3VNUA 2JIQA 2PKRA 4LHXA 3LXRA 4U7PB 5FUWA 2UUCB 4AY6A 2IZ1A 3BIFA 4X93A 4RSMA 5AVQA 4KE6A 2I62A 4OVKA 5HGJA 3I5MA 4CCSA 3AOEA 3EA4A 1PS8A 2GK3A 3CEJA 4WV3A 2AOVA 4MQEB 1UKCA 4IJKA 3U56A 2HN9A 5TX7A 2IPOA 2OHFA 4GSKA 4PCVA 4X20A 2EP7A 2WAYA 2J3KA 2ZIAA 4L9SA 3T3PB 1L8AA 5B7PA 4RDCA 1SKBA 3H6KA 1KYYA 3AKCA 4JNCA 3QUCA 5G2OA 3QQ5A 4OGWA 1AZTA 3DLIA 4W7HA 3VPCA 3WMEA 2NP6A 2IXBA 1AKYA 1RI4A 1A7AA 2X22A 3NDRA 4UM8B 3W8RA 4I99A 2ASEA 4IMRA 4HDRB 1PJ2A 3IUYA 3PFHA 5FA5A 3TEJA 3UK2A 2XWBF 3AG6A 4Q7JB 3P45A 4HDMA 4WNAB 2ZXUA 3UJ6A 4B73A 3NEPX 4I4IA 5FORA 3U17A 4HB2A 1VFPA 1T8PA 1WOMA 3NT2A 4COOA 2YY5A 1EBBA 3DTTA 2D1TA 2PEZA 1OLUB 2AZ4A 4J7UA 4PO8A 3HFRA 4C05A 5BR4A 2CV0A 3ETGA 3TM5A 1ZSYA 3PXUA 2COUA 2JFOA 3EARA 1T1RA 5IUNC 2P4SA 2PKWA 1O95A 2OPHA 3U0VA 3TUJC 1NZFA 1PWZA 2Y1FA 3IQIX 4YECA 4QDZA 2AN4A 1N2CB 1F0NA 5D86A 3TE7A 1ORHA 3FM9A 4ZCSA 1FX1A 3OLYA 3DBHA 3WE7A 2PUDA 1ECPA 3VKUA 4D3DA 4E6EA 1KI6B 3BMNB 3L84A 5JHGB 3ZJ4A 1Y3DE 5SY4A 5BOSB 2FCAA 2WP0A 1Q7EA 1WSDA 2PANA 2QWXA 2C98A 3ZHYA 1NC3A 3FNRA 2WWRA 4OFBA 5HDQA 3R5KA 3TZEA 3TS1A 3H8WA 5AKZA 3RNLA 4UDNA 1JQJC 2E4WA 3KZNA 2AH5A 4DY6A 1M6HA 2H1CA 2Y6VA 1X8KA 1GCGA 2JCSA 3JRWA 2AUTA 3A9VA 3OPVA 3NO4A 3UTCA 2XB6A 4EM6A 5DK4A 1ZXXA 3WB9A 3MTBA 3DHWC 1W75A 1QO0A 3MN1A 3OOYA 2Z3ZA 3Q0IA 5H02A 3U4DA 2E5LB 3QUSA 1FDRA 3WL6A 4Y2JA 1HNZB 1H66A 1BX3A 2YZ7A 5TF4A 4IQFA 4JLAA 4F86A 4DLNA 3G0DA 4UBIA 5IC4A 2A59A 5EKSA 4AZWA 3CNBA 2FR8C 1O5IA 2CYCA 2F8LA 2FN8A 2P5SA 2Q3JA 3DOCA 2VCYA 2WYWA 4MKZA 4TXMA 3ASVA 1OHHD 2BGMA 1GA6A 16PKA 1AQNA 4L28A 4K9OA 4KFCA 1Z75A 3AUTA 2ZRNA 5AVWA 2NMVA 4Z1OA 3QV1A 2I9KA 2AKAB 2HQRA 3JYHA 3OLXA 4R01A 1GPMA 2BGNA 3IOEA 2IEIA 2P2SA 1WCXA 2Z6AA 1CULC 3OE1A 4M8KA 3KK0A 3PDJA 3FFAA 1OYYA 2P1DA 4G0ZA 4EITA 4TMVA 4DJFC 1CQXA 3GA7A 3DQPA 3O92A 4S1PA 5I6DA 1I6KA 1HDCA 1G21E 2HMYB 3AEXA 1Y9JA 4B83A 4EBFA 2MCFA 1TUEA 2BF4A 4DCNA 4UVIA 1P5HA 3HK2A 4Y1RB 1AOXA 3X0DA 2F9LA 3ZYCA 5D5QA 4RGBA 5ARCA 3IUJA 4MCIA 1NFQA 3DBRB 4S1VA 3GB9A 4FYJA 3CV3A 4Q48A 1JI0A 3NHUA 3D4LA 3U7HB 3GGDA 4US2R 3MCUA 4PSKA 2IWHA 5JSYA 1YCGA 3NXKA 4NS4A 1C41A 2H16A 2IELA 4A8HA 3O2JA 1V9CA 4NE2A 1QX4A 3RIMA 3W8FA 3HJFA 4IS3A 1ENZA 3TB4A 3OZBA 3P52A 3U80A 1ORTA 3QX8A 1QVVA 2LVBA 1P7PA 1L5YA 1KO5A 3O47A 4CDMA 3U44A 1ISJA 3KLPX 2PEYA 5C7YA 1PNQA 3DD1A 1Z26A 4HEHA 5FWAA 4R4JA 1ZWLA 5KOIA 5LP1A 7REQA 4ER0A 2RIPA 4I5EA 3OMWA 5HF6A 1JQ3A 2HPHA 4