1OC4A

Lactate dehydrogenase from plasmodium berghei
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
315
structure length
315
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVMFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLKDADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIVGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDQELDAIFDRTINTALEIVNLHASPYVAPAAAIIEMAESYIRDLRKVLICSTLLEGQYGHKDIFAGTPLVIGGNGVEQVIELQLNADEKKKFDEAVAETSRMKALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Plasmodium Berghei Lactate Dehydrogenase Indicates the Unique Structural Differences of These Enzymes are Shared Across the Plasmodium Genus
pubmed doi rcsb
source organism Plasmodium berghei
molecule tags Oxidoreductase
molecule keywords L-LACTATE DEHYDROGENASE
total genus 104
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1oc4A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1oc4A02
1SB9A 3KSUA 3ST7A 2UUOA 4YDRA 3MTJA 1PWZA 4YJFB 4YT8A 5IDXA 1LSUA 4I5EA 1YBAA 2WDZA 3C8MA 4OSOA 4IGFA 3LLSA 1A7KA 4CMKA 5KJEA 4MVJI 2ZKLA 1A27A 4J1QA 3WNQA 4XRGA 5THKA 1Y1PA 3IUPA 3V1UA 4DC0A 2DUUA 2X4GA 4WCFC 5KTKA 4GLLA 4JP2A 4QQRA 4XIJA 3FNGA 3ZWWA 3KOUA 4MO2A 3RU9A 2I76A 4IZHA 2AQHA 1Z45A 1O8CA 3G0OA 4II3A 3L4BA 2UAGA 3GVIA 4B4UA 1PS0A 2Y1EA 3QVXA 4NDNE 4J7UA 3ZU4A 2V6MA 2AG5A 3JYPA 5HBRA 5U1PA 4F45A 3PWKA 1R6DA 1KOLA 4DREA 1B3RA 1BGVA 1P3DA 3PHJA 4ROSA 2I9PA 1LX6A 3N74A 3GRKA 3LF1A 1BVUA 3IP1A 2EW8A 4B3HA 1F06A 5JAZA 3VVCA 2PD4A 2ZATA 1E0DA 1P1FA 3G1TA 1RM4A 4DLLA 2CF5A 2TMDA 5A9TA 5DBGA 4CL8A 4TSKA 4Q3AA 3WYEA 4CQLA 3JQAA 3S1LA 1LC3A 2J3JA 3G3EA 5EERA 4JJFA 5BSFA 1UJMA 4WEOA 3SLKA 1BWSA 3V2UA 1CIVA 4PLCA 2B36A 4FR5A 1M2WA 1KC3A 5LC1A 1RYEA 2C0CA 1GUFA 3GMSA 2R00C 2HJRA 4MKZA 4PZCA 1P9LA 4PLHA 3GZNB 2Z5LA 3LC2O 3H5NA 3PIIA 3ZU5A 2HMVA 4DLAA 4EI2A 4A03A 2B35A 3OA0A 5COQA 3TWOA 1YS4A 3JQGA 4TVOA 2PV7A 3A4VA 1GYRA 4ITUA 1NQAO 4OOEA 2EIHA 2YV2A 1KVUA 3MEQA 4TRJA 4Y9DA 3OIFA 3R3SA 1H5QA 3F1LA 4PVCA 4W9NA 4D46A 2Z95A 1MXHA 1H6CA 2AE1A 4P38A 1GUYA 4XYEA 3DZJA 1WWKA 2O4CA 3F1KA 4BB6A 2G0TA 2DT5A 1Q2XA 5L3ZA 3VVBA 4R9RA 1ZSNA 2QYTA 4W9NC 1QYWA 3K2EA 1E5LA 2Q1UA 1P77A 2EWMA 3HDHA 4U0KA 2TMGA 3RUHA 4RF4A 2XXJA 1K3TA 1IB6A 3B70A 3PXXA 4J7CA 4M54A 4F46A 4FBGA 3FD8A 4FFOA 3KEQA 4CMEA 3QJ5A 5JCXA 2ZB3A 1TB4A 4DIOA 3DBLB 3MOGA 1HYGA 3WFIA 2POQX 1CQJA 3JD0A 3JYNA 3GN1A 1C3VA 3DZGA 4X54A 1NX6A 1IY8A 5A9SA 1EVJA 1PS9A 4FS3A 5F5LA 1AN9A 1WW8A 2Q1WA 4LSWA 3WLEA 2Z1NA 3LLVA 1ZK0A 2P5UA 3AY6A 4ZU3A 1B8UA 2ZYGA 1UXIA 3F47A 3AM3A 5EMHA 1QMGA 3JQ8B 4NU6A 1Q0LA 2CVOA 3RJ5A 5JSFA 1N9GA 3D64A 1KY5A 1DXYA 3AWDA 2NTNA 1XHLA 4LK3A 2NSDA 4D42A 3KYBA 5ENVA 4BO8A 4QXMA 3BMNA 4AFNA 1TEHA 3N7UA 1SCUA 3ICPA 1XLTA 1LDYA 3PJGA 5T6BA 3LDHA 1C1DB 2WJPA 2XAAA 4AJEA 4XGKA 4AJLA 2Y93A 1ID1A 1YE3A 3MZ0A 4HNHA 4B4VA 1U5CA 3JYOA 1KVTA 1SZJG 3U4HA 4EEZA 1AXEA 2NLOA 5CP8A 5HS4A 2E49A 1JU9A 4YA6A 1AHIA 2VNSA 1DSSG 3U5TA 3WSVA 4E31A 3BAZA 4L4RA 4IGEA 4XCVA 2SCUA 3WLFA 5K6AC 3JQ9C 2PFGA 4MIYA 4GGOA 3PDUA 4BMSA 5K6AA 3ZDFA 5L4NA 4FJ2A 4XKJA 3HHPA 1P1HA 1Z82A 3RU7A 2V6BA 4J91A 1GY8A 2BFOA 1T2EA 1N2SA 2NVBA 3BA1A 3GFGA 4L0QA 2F00A 4WEQA 1TT7A 4IM7A 1JWBB 2FWMX 4OYRA 5KVQA 1I36A 4CMIA 3OBBA 4AJJA 2H9IA 2EKLA 4YVFA 3KVOA 4DVJA 3JD4A 4CL3A 3DFUA 4FJ0A 3WQSB 4RPHA 1Z74A 4GKVA 4H16A 4NJOA 1ZBQA 2C2YA 2PKQO 1S7CA 3DZFA 4QT0A 1M75A 2O3TA 4XRRA 5DULA 1RM3A 3OH8A 3VPHA 5JE8A 1I10A 1B7GO 2GD1O 2BGMA 3WWZA 1EVZA 4ZQGA 2Q99A 2IODA 3ETEA 4BV9A 2R2GA 5ILOA 1HZJA 3DC2A 1XELA 1I0ZA 2BFAA 4ZRMA 3INRA 3ZNOA 4R9SA 3RI3A 1ONOA 1GFSA 3H6KA 4IMPA 5FI5A 3UF0A 4RGBA 4WLFA 1XU7A 2X9GA 5BT9A 1V0JA 4BIIA 2QZ9A 4HV4A 3ZHXA 3ZWBA 3H5AA 2GLXA 1MC5A 5GY7A 5EINA 4QEDA 3JD3A 4YTEA 4FFMA 4NQZA 1N7GA 2B83A 2Q45A 2Z1MA 3O26A 4BNHA 3ONEA 3VDRA 1V3VA 3IAHA 2HU2A 4NHEA 4CMEC 1T25A 1E1NA 1MA0A 1V8BA 5TS3A 1UZLA 5TT1A 1O0SA 4JX8A 2RBEA 2FOIA 4F6CA 4ND2A 5T64A 3IP3A 5CFZA 5L7WA 2DTXA 4BMVA 2YHIB 4A5OA 4CPDA 4CLRB 2OUIA 3TJRA 5A04A 3KETA 1JAXA 2VWGA 2FPIA 1LNQA 3VKUA 3GR6A 3PGJA 5TJHA 1P74A 2J5QA 4BO6A 3OQBA 3DAPA 4CM5A 3OJOA 4J1SA 3BTVA 2FRDA 4RVSA 5L7TA 3JQGB 2HRBA 3TFQA 3EYWA 5EQDA 1FDUA 5G4KA 4R1TA 5L51A 5DNAA 1Q7CA 2W98A 4J43A 1DIRA 1CERA 1BW9B 3I6QA 4PVDA 3T4XA 5JDCA 2RH4A 4ND1A 3TZ6A 2W2LD 1PGJA 1LSJA 1VL6A 2GYYA 2Y66A 1ZXLA 3EW7A 5AXCA 2ZQZA 4OJNA 4BUCA 3BTUA 5BSEA 3GZ4A 4LGVA 2W2LA 4KWIA 1LDBA 2JFGA 1XR3A 2VUUA 4GQAA 3IQDB 3U3XA 2G76A 1NR1A 1FJHA 2DKNA 3H65A 2FZWA 5G0WA 4YJGB 3WGYA 1Y6JA 1QV6A 4I1IA 5CDUA 4CLOA 3TRIA 4L8VA 2A94A 2VQ3A 4ALLA 3WYBA 2BFPA 3EGOA 1ONNA 5HM8A 3JSAA 4E21A 4MVJG 2EKQA 4M89A 3RVDA 1X0XA 3PLNA 4J9UE 4JJIA 3VPFA 1HWYA 3PK0A 3IUSA 5EL0A 3VPSA 1NPYA 1QG6A 1SC6A 2DUWA 3AFNA 3D5TA 3DBHA 5JS6A 4E6PA 1M67A 1PGNA 2VZ0A 4YXFA 4WLNA 3RKRA 3W4JA 3DZHA 2X6TA 4K26A 3GHHA 1YO6A 4RDIA 1SAYA 2NUAA 1HLPA 4U6SA 2PK3A 1U7TA 2PWZA 3ASUA 5BQFA 3B6ZA 4NBUA 3QHAA 5G0UA 2JKVA 1G1AA 3W4IA 1GADO 2DTEA 2BMAA 4BO1A 4DQVA 3NX4A 4WLVA 1PGQA 1O6ZA 5DDIP 3SJ7A 4Z9XA 3KEOA 1JVBA 3QWHA 3ZWPA 1YBVA 1HDGO 3GN2A 3CMCO 2IZ1A 2VRCD 3HDJA 1XG5A 1XIVA 4D3FA 4A10A 1E3WA 3BIOA 3AM4A 3CZRA 3A06A 3PJEA 4Z6KA 2VN8A 2B37A 1EVYA 4ND3A 1E7QA 3Q0EA 4UVDA 2X5KO 3GAZA 4NJMA 1B8VA 3DO5A 3I52A 3UHAA 3C85A 4PLGA 2UV8A 3RROA 9LDTA 3ICCA 3DHNA 1ZMOA 1E5QA 3SXPA 4B7CA 4BNKA 4EW6A 3EDMA 4JBGA 4RF3A 3VH1A 9LDBA 4OOFA 2ZB8A 3DBVO 1AHHA 4WPGA 3OEWA 1DFHA 4HX5A 2H6EA 3ROQA 1DAPA 1U4SA 1WMAA 3RFTA 2NACA 3PPIA 3DHEA 4YBZA 2I5PO 2C20A 2EXXA 4NIMA 1PWXA 3D3EA 4E0BA 4U8GA 2G1UA 2QYSA 1KERA 4YB8A 1VKNA 4QX6A 2B4QA 1M66A 3GGOA 1XYGA 1QORA 4EUHA 1ADFA 3ZWCA 5LDHA 4L9RA 1R66A 5ICMA 2W2KA 4IS3A 4IZIA 4UEJA 2IYOA 4U0JA 3D3WB 5GZ6A 4XR9A 1NPDA 4Q39A 1B16A 1YQGA 1K5HA 4L74A 2ZTMA 4PLYA 3H9QA 2UVDA 3DOJA 3WB9A 4Q9NA 4A27A 1RWBA 5G4LA 4CMAA 6ADHA 1C14A 2X0NA 1A4IA 1A71A 1D1TA 5JMWA 4L4SA 1VL0A 1WDLA 4RF2A 4YWJA 4YRBA 1G6KA 1YXMA 1JKJA 3MWDB 4KQXA 4LMPA 4P22A 3VZRA 4DA9A 2X22A 4Z3KA 2D1YA 3VH2A 2O3RA 4N5MA 4HBGA 4LRSB 4R4JA 4F3YA 4BO5A 1DAOA 1R15A 5I7FA 4PLWA 1ADCA 1VSVA 3KZVA 3SBOA 5COAA 3AI1A 4RJTA 1PQPA 4PCVA 3BMOA 3NGXA 4CLHA 2BH9A 4H3VA 2RHCA 3RUFA 2H5LA 1U2GA 1JA9A 1DFIA 2V7PA 2Q4EA 4RDHA 3IMFA 2D3TA 4LISA 4ZQFA 4XGNA 3Q2KA 4YCAA 4WLOA 1R0LA 1D1SA 3FCOA 2CY0A 2DPGA 3K8ZA 1MG0A 4I9HA 5L7YA 3SEFA 5JLAA 4RLHA 1ISGA 5F3RA 4JNKA 4OH1A 4BNMA 4BQPA 2O23A 4BNTA 5KJ6A 1UP4A 1JAYA 3PYMA 3HN7A 8LDHA 1JN0A 2FPGA 3DQPA 1DEHA 3WTCA 1FXSA 4GAEA 1N9GB 2PH5A 2Y68A 4IINA 4KTVE 4N5NA 2C5EA 2BFMA 1IULA 2O3SA 2P9EA 3AW9A 1HE4A 3Q1LA 2YDYA 3JQFC 2WYUA 1HZZA 1O9BA 1A7AA 3MCVA 4XIYA 4KWHA 3MJTA 3LT1A 2CMDA 1L7EA 3P2YA 4LVCA 2CDCA 2O3QA 2FPPA 4OAQA 4UVIA 3TL2A 4CJXA 4EUEA 3I5MA 1KEVA 2C2XA 4ZICA 2V6GA 4K6CA 4S1VA 3PWSA 4D0SA 3HUDA 1JWAB 4CV2A 1TI7A 2J8ZA 1ZW1A 5A9RA 1S6YA 3Q3CA 1NVMB 4YAIA 4Y6RA 5A1TA 2NTJA 4XYLA 1DPGA 5JO0A 1LA2A 1D4FA 3GQVA 1NP3A 4NK4A 3WG9A 4IQGA 2G17A 3RC7A 5IZCC 3ZV4A 1ENYA 2GPTA 2P5YA 3G49A 3WGOA 3RIHA 1UUFA 2ZIZA 1I01A 3VH3A 4BGEA 1Y7TA 3ENKA 2WWRA 1MP0A 2VOEA 2X9NA 1V3TA 1ZKMA 1DLIA 4IUYA 2FY8A 3CSDA 2NTVA 5J23A 5CDTA 4B4WA 4B7UA 5CEJA 3E9QA 1H2HA 2YDXA 3AU8A 4URFA 3KRTA 5JYDA 1IUKA 1DC6A 3DTYA 3CIFA 2NV6A 5L4LA 1E3WB 1ZVMA 3F9IA 1DRUA 1X13A 3H2ZA 4WCFA 3H3FA 1B2LA 2J3HA 2YFHA 4E30A 2AW5A 4NI5A 1HLDA 1UAYA 1ZK4A 2FR8A 3GEGA 2DQ4A 3LT4A 4XYBA 3W6UA 1UDBA 2AMFA 1U1IA 3WOHA 1Z6ZA 2AEFA 3EK2A 4BO7A 4BKOA 3DMYA 4J6FA 1ISIA 4HY3A 2C5AA 4DPKA 3F4LA 5IJZA 4CMJA 1MFZA 5MDHA 2P91A 2YHIA 5A3JA 3JQ8A 1J5PA 3ONFA 3K6JA 3IS3A 1XDWA 3WSWA 2I99A 2UDPA 3C1OA 4YJHA 1VJTA 2Y1DA 1BVRA 1BDBA 2GZ3A 1LXCA 3WGQA 3ZN2A 1GPJA 1D3AA 3E9MA 3JQFA 1ZSYA 4I08A 3T7CA 3WS7A 1NWHA 2B69A 1U3TA 2AG8A 2O50A 4JP3A 3VZSA 4YPOA 1KC1A 2JFHA 2X9VA 3Q9UA 3MJCA 3RD5A 4R68A 1GZ4A 2ET6A 4GLOA 1EE9A 3HDQA 1W73A 2J5KA 3KYDA 5KVSA 1YL6A 2X1HA 4CM9A 5JO9A 1VJ0A 1C0PA 1GQQA 3PHLA 3F6YA 4YACA 1RJWA 4BO3A 1YQXA 4P4GA 1IZ0A 1NQTA 4BNLA 1I2ZA 1GU7A 1LLUA 4IDFA 4IBOA 3C1TA 1NQ5A 4M49A 4PLPA 4NPCA 2NU9A 1M6WA 2RAFA 1PS8A 3L77A 1EDZA 3NV9A 1P33A 1PJTA 3TNLA 1YDEA 2OHXA 3LK7A 4JJGA 1ZFNA 2Y1GA 3PP8A 2PZLA 5JXWA 1DC4A 2C7VA 3M1LA 1I3NA 3PEFA 4B4OA 1EDOA 2JJYA 5JBIA 4ZJUA 4KUGA 4QFDA 1KVQA 1XA0A 4Q3BA 5KVCA 2VRCA 4NJMB 1BXZA 2X5JO 2HAEA 2P68A 2X0IA 5JCJD 1HXHA 3GNSA 4HKTA 5TC4A 4Y6PA 1H9BA 3W8DA 4CQMA 2E6UX 1I33A 1ORRA 2VCYA 2HQ1A 3SJUA 1VE9A 3G1UA 3NT2A 3ZV6A 4TRMA 1W4ZA 3AUTA 1CWUA 2VUSA 4RVFA 1P1JA 1DO8A 3GA0A 3HSKA 3GVXA 4FJ1A 4RZIA 3EAGA 5I7SA 3H2SA 3O8QB 5KJ1A 2PKQP 3VH4A 2DBZA 4MP8A 3D5QA 4RPLA 4TKLA 2VWHA 5H83A 2PR2A 3DONA 2NADA 3NDJA 4PZEA 4CQMB 1P1KA 3ROPA 1X14A 1I8TA 3DOCA 3GLQA 3JQ7B 4MVJH 5I8WA 3PLRA 3ZWOA 4F6LA 5TIIA 3RSHA 4ALJA 1B15A 4LN1A 4GWKA 3DZIA 4UUOA 2VYVA 2D0IA 3ZWYA 1GR0A 4HFMA 1R0KA 1AGNA 4YQZA 2DLDA 3HG7A 4J49A 1BXGB 4E5PA 3D7LA 4IPTA 5JC1A 3QVSA 3MJ4A 3L6EA 3FBTA 4LW8A 1W0CA 1R16A 5ER9A 1O95A 2P4QA 5F1KA 1NHWA 1MFPA 1XWFA 1EQ2A 3R3JA 2FZEA 5ICSA 1DIHA 1H0KA 4YJGA 2O2YA 3ZI0A 1DRWA 3JQAB 4E33A 3JD2A 5IF3A 4ZD6A 4GWGA 5FF9A 2OP0A 2X86A 4YAJA 3HQ4O 1KEPA 5ITWA 4CUZA 5T57A 2Q1TA 3CEAA 4XQGA 3HWRA 1XQ1A 4I5FA 5DOVA 3WR5A 3QWAA 1KEWA 5DBFA 4IIVA 4PGFA 1ISFA 2BF7A 1YJ8A 3SLGA 1L7DA 3PZBA 3DHYA 4G2NA 4RVUA 4W4TA 5DBIA 3L0DA 3OQ1A 4DTIA 3EZLA 2JCVA 2HRZA 3D3WA 5A5EA 4UUPA 3INTA 3S8MA 3BHJA 4YYZA 4MIEA 3KYDB 2DM6A 3BMOB 1PL6A 1LLQA 3S2GA 2AA3A 2FSVA 1WP4A 3I1JA 3X2EA 1QKIA 4QECA 3E18A 3FRJA 3V1YA 3BMQA 5GZ1A 2AQKA 3QIVA 3UICA 1VKOA 4GI2A 4FFLA 2LDXA 4M8SA 3U4DA 4R16A 5F1PA 2HK7A 2EF1A 3MJVA 4EJ0A 1W6UA 1PJ4A 1CRWG 4IQ0A 3AY3A 3AUAA 1PZFA 3NUGA 4WASA 1GCUA 2PZJA 3ZHBA 2WMDA 5H81A 1JKFA 2QQ5A 3GNQA 4R69A 1E6WA 4BNNA 1OBFO 2PLAA 4R5HA 1NVTA 4WK6A 3W6ZA 1Z75A 2OBYA 1H6DA 1GD1O 1RM0A 1KY4A 4PG8A 4CM8B 3GHYA 3WX0A 3DFZA 3RWBA 1R37A 3BTOA 4R1NA 4N18A 2O3JA 4IJVA 5G4KB 3VAZA 5B12A 3QVWA 1AUPA 2XOXA 1NVGA 1PJ3A 3BMCB 3UKOA 3BMQB 4UREA 4BNJA 4J4HA 2ZB7A 3BHMA 1GDHA 2Q2WA 3COSA 2I6TA 1AXGA 1UDCA 3TOZA 5I9LA 1HDXA 3UCEA 3I9JA 2VZ9A 3L9XA 2E48A 1PGOA 4IDDA 4OM8A 3W1VA 1EVIA 1EFKA 1MB4A 2QRKA 2OORA 3V2GA 1E7SA 1HSOA 1BDMA 3JYLA 2VHZA 3M1AA 2W90A 1PQWA 2GASA 4RV9A 3FN4A 5DF1A 4DXHA 5F21A 4DLBA 2B4RO 2AXQA 3DMTA 1QRRA 3IDSA 1YB5A 1F12A 5L40A 3EUWA 5L45A 2DBRA 1R4NA 2BRUA 4HNGA 3FWNA 4I9NA 5AXBA 4AJNA 4RF5A 3CPSA 1DOHA 1IPFA 4EZBA 1ENPA 1M76A 3ITKA 5ES3A 4ALMA 3V1TC 1WZEA 1OFGA 3U0BA 3S2FA 1HDZA 1WXDA 4ZGWA 2X0RA 4FSHA 1HE5A 3GGGA 4DBZA 2EJWA 3E1KA 1PJQA 1A72A 1YJQA 4OMUA 2QZZA 3WNVA 4CM4A 3P5SA 1T4BA 4MKRA 5FYDA 3KSZO 3IIEA 8ADHA 1LSOA 3NJ8A 4MP3A 1C1DA 3RUAA 4AVYA 1ONPA 4XDYA 1RPNA 2Q4BA 2PD3A 1U8FO 1Y9AA 5FI3A 5AXAA 5HTOA 3L4SO 1PZEA 1Z73A 4KDFA 1F8FA 2VYNA 4DWVA 1OC2A 4B8ZA 1IE3A 3L6DA 3OJLA 1NAHA 2GN4A 3HB4X 3RFVA 3ZW9A 1X7HA 5IZCA 1ULUA 4OXKA 5MGBA 3DBHB 3PRJA 3ITDA 4C4OA 1CQIA 1PEDA 3WDSA 1SMKA 1WAMA 4W99A 1XEAA 4I8XA 1MC4A 1BTOA 3AUUA 3EHEA 3H9UA 3EVTA 3LC1O 4RCVA 5JCJA 1Y5RA 4CM4B 3A1NA 5IXYA 1A4UA 3EMKA 1WVGA 4ZQBA 4BKRA 1QXSA 5GMOA 3G17A 1LJ8A 5U4QA 4E12A 2FHSA 5TJ9A 4TKMA 1N5DA 3L6OO 3NDRA 1V6AA 3OP4A 1DIAA 2IZ0A 3VZPA 1JLLA 3ZWAA 2PA3A 2PZMA 2J5RA 1WZIA 4YJFA 1HDCA 5BNTA 3Q9NA 1R4NB 2DU8A 1K6JA 3FPCA 1NQOA 3RUDA 3TDKA 3K2BA 4MVJM 2ZK7A 4OKIA 2R6JA 2YHUA 4YJHB 4TMFA 4R1SA 1QYCA 4L73A 4BNIA 3LT2A 1PX0A 3DB2A 3PTZA 4BGUA 4MJLA 2E37A 3WYCA 5DOZA 3SX2A 4Y67A 4CMHA 5IDWA 4K6FA 2NWQA 1ZEJA 1P44A 2EG9A 2GCGA 3JQBC 3WBFA 4BQRA 4GX5A 7ADHA 5I9NA 2VTDA 3KBOA 2AHRA 3EVNA 5IDYA 2JL1A 4L76A 3GDFA 1BMDA 2FSSA 2VZ8A 3NGLA 4KMSA 4WOJA 1C1XA 1JVSA 4IMRA 3UFXA 4PG4A 1IL0A 3KLPX 1ISHA 1T2FA 1U4OA 1PZHA 4ID9A 4PRLA 1VSUA 4B7XA 4CLDA 1K2WA 4BV8A 3QLJA 3H3JA 3KXDA 3MJEA 4FDAA 1DIBA 1X1TA 2J6IA 1Q0QA 4CM3A 3OICA 3LZ6A 4M1QA 4HWKA 4XD2A 4FCCA 3ON5A 4OO3A 1ZJZA 2I3AA 4AJ4A 1ML3A 1PL7A 4KQWA 1P1RA 3S2EA 3DZBA 2D5AA 4DPLA 1Y81A 4EBFA 1I32A 1IHYA 1ZO8A 2O2SA 3WXBA 2DTDA 1HYEA 3AI3A 4J90A 1I3KA 1RM5A 1YDWA 3B1JA 4PLZA 4R01A 5HA5A 4II2A 3WGTA 1HE3A 2D8AA 1K6XA 1LSSA 1GL3A 3BMNB 4CM6A 3OF2A 2YYYA 2Y05A 1YH3A 3JQEA 5KCZA 2Y0DA 4YRAA 2OGUA 1U7HA 1K0UA 4JIGA 2CSUA 2VTEA 4DMMA 1HYHA 4D43A 1D8AA 5CDYA 2HMTA 1NYTA 3ENNA 1GQ2A 1E3LA 3E48A 4AJ2A 3TZHA 1B8PA 4WUVA 1QSGA 3R1IA 3VPXA 3ZWVA 4BNFA 4E2WA 4BO9A 4CQMD 4ZVVA 1MV8A 2CVQA 2C59A 5JMPA 1U2DA 4FB5A 2BLLA 3D4OA 1LUAA 1XGKA 3ETDA 2NM0A 2O48X 3H8VA 1CETA 2Y0CA 2DC1A 2VHWA 4RZHA 5KOIA 5TGDA 2GN9A 5L95A 4XJTA 3H7AA 2HKIA 4GX2A 2PTGA 1N1EA 4XZ3A 1UXJA 1J0XO 1FF9A 3NTOA 4ALNA 4YAKA 3JQ7A 4UUMA 4HP8A 4FFNA 3WICA 2AQIA 4G65A 3WQRA 4UUNA 3T4EA 3K73O 3EZYA 1JQBA 5IZ4A 1I2BA 1HDYA 2HO5A 3K30A 4FC7A 2BGKA 3PI7A 5KVVA 5JAMA 4J0FA 4R41A 4R51A 1JTVA 5JDIC 1Y8RB 2IEBA 4YAEA 1FK8A 4MOWA 5BNIA 5BSGA 2HK8A 3E6AA 4AICA 5CG1A 2J3KA 5B4UA 5JAQA 2I66A 4XWYA 3NTRA 3AFMA 3CXRA 3WWYA 3BHIA 5I7EA 2ZCUA 1O5IA 1UP6A 2YQ5A 1VI2A 4PLFA 3A14A 1SOVA 4UVGA 5H82A 4ZRNA 2O7SA 1PR9A 4I9UA 4AJKA 1B14A 4MVJE 4BNWA 3ROKA 3WGGA 3K92A 1PJBA 4FOOA 4KUEA 4NH4A 2C7GA 4XYMA 3KLMX 2JAPA 1ISMA 1X1EA 3V8BA 4BNGA 3C7AA 1ADBA 3ZNQA 4M87A 1D7OA 4J16A 1OMOA 1X7GA 1E7YA 2OO5A 2Y1OA 1DHRA 3IJRA 1A9YA 4AJ1A 3QRWA 4U5QA 3ORFA 4O1MA 1E3EA 1I30A 2WD8A 1GCOA 3SC6A 1GZ6A 4QFCA 4W82A 1HRDA 4J0EA 2GN6A 1YL7A 2HK9A 3FPLA 3AOEC 5FWNA 2V6FA 3DAFA 1J4AA 4TZTA 2H1SA 3C1AA 1YWGO 4O0LA 3K5PA 4HFNA 5G0SA 4OHUA 1LRLA 2EV9A 1QR6A 5EIOA 2QHXA 2EP7A 4Q3NA 2HSDA 4NZ9A 4NBWA 4RVDA 2CUKA 1YRLA 2EW2A 5CHEA 3WMWA 1Y8QA 3ROMA 3H9JA 2EGHA 4J4TA 3UH1A 1I5RA 4I5GA 1HTBA 2GGSA 4BNYA 3G79A 4N54A 4JBIA 4ND5A 3GG2A 5I9MA 2ZJ1A 3PVZA 5DP2A 1ARZA 4G81A 2WEKA 3SC4A 4OL9A 4CUJA 3OIGA 3FI9A 3HJAA 1GEEA 1FDTA 4LVUA 2PH3A 1UH5A 1VPDA 2VOJA 3CZMA 2O3UA 3LT0A 5T8KA 4AJPA 1X0VA 5JDCC 2OXIA 3F3SA 2DAPA 2RCYA 1Q0HA 5TX7A 1I2CA 1YVEI 4D79A 1V9LA 2OOSA 3EC7A 4RVHA 3GT0A 4IJUA 4JBHA 1OI7A 5C5IA 4TVBA 1K89A 1LDGA 1VRWA 2PKRA 5A9SB 4QTZA 3TFOA 3IOYA 2JAHA 2E4AA 1QP8A 2NU7A 1C0IA 2CVZA 5TNXA 5KKAA 5F1OA 4RPKA 4WKGA 3TZKA 3OQ6A 3K9QO 3M2PA 3DDNA 2X8LA 3B1FA 5JY1A 4GPD1 4R3NA 4BO4A 4OXNA 1HDOA 2VWPA 1NASA 1WLYA 1TT5A 1XU9A 5IN5A 3V5NA 4YT4A 4FIZA 1ZK2A 2ZTVA 2VYVD 4PZDA 3D4PA 4CM1A 2JFFA 3RKUA 1Y8QB 3AJRA 1MGOA 3PWZA 2VT3A 2GZ1A 3EY4A 2PZKA 4RPJA 4HUJA 2YUTA 4UEOA 1MUUA 1P31A 2OP1A 3BTSA 3FNFA 4O6VA 3S2IA 1UP7A 1NFQA 2CNBA 2GO1A 2XXBA 3VTFA 1UXGA 4E5YA 4BGVA 4OKNA 4OSPA 3I3OA 3TPCA 1PJSA 2NU6A 1CEQA 3PGXA 5ER6A 5T5QA 3O03A 1K6IA 3GH3A 3STHA 4CM9D 1H9AA 4KOAA 5TQVA 2ZQYA 1Y8RA 4GH5A 4OXYA 4TROA 1IZ9A 4XQEA 1R0SA 5IDQA 3LF2A 1NBOA 3UXYA 3ANMA 3CMMA 2FR0A 2NVUB 5JC8A 5C37A 3C3XA 4ZQEA 5ITVA 4TWRA 2V65A 3WIEA 4ZHSA 1YL5A 2OZPA 4EUFA 4CM8A 1FDVA 4RQTA 2IRWA 1VC2A 3P2OA 2WD7A 4L4XA 1HT0A 3KB6A 3OETA 3WGHA 3JQDA 1OC4A 4ONEA 2VT2A 4HFJA 4J2HA 5IAAA 4BKQA 1H2BA 2YZ7A 4A73A 3I4CA 1Q7GA 3PHGA 1B26A 3C7CB 1UZNA 4AJIA 3UN1A 2RIRA 4D44A 1TXGA 3H4VA 4JCOA 1E77A 3GEMA 5A05A 4QUKA 4LMRA 1EK6A 5JW6A 4K9DA 1VM6A 3IKVA 1ZMTA 3QSGA 3P19A 4JN6B 3DTTA 1TLTA 3U9LA 4G5HA 1Q1NA 1HDRA 2I3GA 4PLTA 4A26A 2Y1CA 4MINA 1EQUA 3QQPA 4H15A 5LCXA 1EEHA 2H63A 3OIDA 2DFVA 5JPIA 5KKCA 1A5ZA 5C3MA 1KETA 1ULSA 1WMBA 3GPIA 1ENZA 3SVTA 1GPDG 4CR8A 5B37A 4NFHA 1G0OA 2VNAA 3AM5A 3IKTA 3D1LA 4RPGA 4EJMA 3ANNA 2B0JA 4FN4A 4Z0HO 3WMXA 4BKPA 1E1LA 4J7XA 3QVTA 4CV0A 1BHSA 5IG2A 4BNZA 5B4TA 1EFLA 1LLCA 3M2TA 1DB3A 3IJPA 3RBZA 4QSMA 4P4LA 4BNUA 3UCFA 1IYZA 1I3LA 2O4UX 3JQ6A 1SOWA 4AL4A 2HCTA 3GAFA 2A92A 3LVFO 4E32A 1P45A 1PTJA 2YW9A 3GUCA 4MVJD 3OFSA 4EJ6A 2ZCVA 3BYZA 4S3MA 4E5MA 1YBMA 4FFRA 3AOEA 7MDHA 1WNTA 2EP5A 1LI4A 4MVJA 3NYWA 2ZYAA 3E9NA 4EGFA 6LDHA 3GDOA 5G2OA 1CJCA 2OL4A 4KTTE 3KO8A 3RAJA 4DIFA 1NTOA 1I3MA 2RHRA 3ZWMA 2DPHA 3ZV5A 2HDHA 4U7WA 4E2YA 4NBRA 1H6AA 4B3JA 1T24A 2RH8A 1GYPA 1L1FA 2WYWA 1T2CA 3ABIA 3GG9A 2HUNA 1EUCA 2CD9A 2QIOA 2CFCA 4K28A 1HL3A 4TQGA 5EN4A 1YB4A 3WQQA 4ALIA 2FMUA 3Q6IA 5BNFA 3Q2IA 5LDGA 4K1LA 1HEUA 2VRBA 3DWFA 2DVMA 4YQYA 4IS2A 1KBZA 3RFXA 3GK3A 2Q2QA 3JQCA 1EK5A 4Q3CA 1X15A 2YJZA 4BS9A 3UOGA 3WTBA 4DQXA 2GUGA 1E1KA 3QP9A 1E3SA 4BO2A 3GVHA 3H9EO 1PJ2A 4XA8A 5L53A 4J1TA 3I6IA 2NQTA 5DZSA 1HETA 3ANLA 3W8EA 2P2SA 4PIVA 4BKUA 3L9WA 2A35A 4PG6A 1N1GA 1HSZA 4J3FA 3E5MA 3S55A 5A5FA 3JQ9A 1ZK1A 4WGGA 2W2KB 1Z7BA 4BGIA 2EKPA 4NG5A 5DCYA 4D45A 1EBFA 2GRAA 3FTPA 3RBVA 3ZU3A 4NU5A 4XR4A 4DYDA 3CH6A 4XQCA 4A2CA 3RC9A 4YT5A 4BNVA 3CTMA 1FMCA 1ADGA 2BHLA 3ETGA 5A3VA 1JW9B 5G0TA 3JQBA 3C24A 3FR7A 1Y9EA 3FR8A 4OQZA 1GTMA 1KS9A 4ZA2A 5T8KC 3T7EA 1KYQA 2OMEA 3DL2A 4E2XA 1NHGA 1U3WA 3RUEA 3RQSA 1IPEA 3GNTA 4Z9FA 2IXBA 3ZWNA 4WCFB 4YT2A 1XKQA 2EJVA 1NM5A 3UVEA 4BOYA 5B1YA 3VTZA 2X0JA 1BRMA 4PLVA 4ZQHA 4UVEA 4D0RA 2O7QA 2Q1SA 3ASVA 3OECA 3Q11A 2YFQA 3HB5X 5G0VA 1U8XX 4MDHA 2DBQA 4C7KA 3KYCB 5JNLA 2OBNA 4CMBA 4JK3A 1NFFA 2BGLA 4Z0TA 2C54A 3WJAA 3O4RA 2FP4A 3QWIA 1GAEO 1DJQA 3WJ7A 1UR5A 4D3DA 2X5OA 1DLJA 2UYYA 1ZUD1 3U49A 4RORA 1H93A 5DCUA 4NMHA 3GUYA 3H9GA 2QX7A 3DBLA 4PFJA 3INGA 3TF5A 1OAAA 2D2IA 2QW8A 2FR1A 1H6BA 1ZJYA 2DFDA 3ZWXA 1BW9A 1LDEA 3DZKA 1OZAA 1VJ1A 4QO8A 1YOVB 3U4IA 4XDZA 4QO7A 1T26A 4P4NA 2B5WA 4CR7A 1BXKA 1E3IA 3GRPA 1KVSA 5HS6A 2HMWA 3NRCA 3NTQA 1R4MB 1PR3A 3QWFA 4R3WA 1W8DA 3WBBA 1BG6A 3I4FA 5F5NA 4LCEA 4J1NA 1WDKA 2VYND 1UXHA 1QYVA 1UZMA 3KV3O 4FC6A 2PD6A 4YEDA 2HMUA 4OIMA 4CQLB 5U9CA 1TT5B 2BD0A 3UAGA 1NFRA 2JD2A 4OQYA 1NR7A 4CR6A 1YKFA 1LRJA 3OMLA 3RC1A 5JAIA 1DJNA 1ZK3A 1YQDA 3I83A 4MP6A 3NDIA 2EEZA 3QA9A 4JXKA 4UEKA 5AQ1A 3OJEA 1HKUA 1PSDA 3PYLA 4LRTB 4AJOA 2I67A 5HWSA 4Z3DA 4BVAA 3BMCA 4M55A 2PGJA 2WE7A 5CDGA 1B0AA 3PHHA 1N8KA 4WCDA 1O94A 2E82A 3KYCA 2LDBA 3KUXA 4Z9YA 3UCXA 3VOSA 1PIWA 3LU1A 1PL8A 2NNLD 4WOKA 4BHTA 4D41A 1HE2A 1U3UA 5CG2A 1XCBA 1T1SA 4GX1A 1NWCA 1SO8A 5CDSA 4C7JA 5L4SA 3JYQA 3D4NA 4RL6A 4WNCA 3WGIA 4W7HA 5JY6A 1N92A 1PU2A 1C1XB 5T67A 3D0OA 3DEYX 3TN7A 4RVGA 2Y1FA 3VDQA 3HFGA 3ZU2A 3ZHZA 4BL5A 3DXFA 4NBVA 4CUKA 3W4KA 4W7IA 1DDOA 3BZUA 3L4BC 3OJFA 3JQAD 4CLRA 5CPFA 3MOIA 4NR0A 1U5AA 4CODB 4DYVA 3PFWO 4GMFA 5IN4A 4WLEA 3KHUA 3BXXA 4Q3EA 4W6ZA 4DMLA 3VC7A 1R4MA 4CLXA 3K31A 3CUKA 2W8ZA 1PJLA 1H94A 3FTNA 4M86A 1MLDA 3FF4A 3W8FA 1JDJA 1GZ3A 1NNUA 1T1RA 2CDAA 3AU9A 3DBRA 4JLWA 1HF3A 4DPMA 4IQ8A 4NNJA 3OM9A 3AK4A 4GX0A 4CLOB 4AG3A 5ADHA 4PRKA 5KJFA 1O89A 1QLHA 1V3UA 3QW2A 4CMCA 5K0ZA 3E8XA 4ILKA 2AQ8A 4AJHA 1ZIDA 4L75A 4GGPA 1SBYA 4EDFA 3PIDA 5DP1A 4BNXA 2PY6A 4KZPA 4IXTA 2HLPA 4YRDA 4BB5A 4H7PA 1U9JA 4U6QA 1DFGA 5EPOA 5JFOA 2CDBA 4LSMA 3ZZNA 4INAA 2BKAA 1LC0A 3KSDO 4YR9A 1GEGA 1QLJA 2JCYA 2IEDA 3VKVA 4JQCA 5IXSA 1J6UA 1SNYA 2XF8A 1CF2O 3GDGA 1GV1A 1OOEA 2CF6A 5C7OO 1P0FA 3NJ4A 2GERA 3DAGA 4NK5A 3GGPA 1V35A 2Q50A 4NFYA 5EESA 1QYXA 3LQFA 1KIFA 3HDYA 3U62A 3DR3A 4XEHA 1T2DA 1EE2A 3GPDG 4GKBA 3L07A 3F5SA 4KP7A 4GSKA 2VHVA 3LYLA 2IZZA 3FHLA 3NKLA 2ILTA 2GF2A 3GF4A 4CMGA 3PQEA 4WE3A 2Q2VA 1IOLA 2YQ4A 1TA4A 5FFFA 3HFSA 2QRLA 4RLSA 4CMIB 1UXKA 4WECA 1GUZA 3OHSX 1G0NA 3GMDA 3PZRA 1LU9A 1GQYA 4WLUA 2XPCA 4I5DA 4DBVO 1E7WA 1X7DA 1FDSA 5JDIA 3NAQA 4E4YA 3AY7A 5K9ZA 3GC6A 2PGLA 3IC5A 3GEDA 1P0CA 5CEFA 4MPDA 4FW8A 4FFPA 3TSCA 2R00A 2HJSA 3ZNPA 3I9NA 1EUDA 4KDEA 1PJCA 1LLDA 1P1IA 4O5OA 2NQ8A 3I9KA 4N7RA 3VZQA 3ZHYA 3OA2A 4MKXA 1KEUA 2IXAA 1F0YA 4NBTA 1NAIA 4J2OA 1RYDA 2WSBA 4IDEA 1KVRA 3C7DB 3I9MA 2CZCA 3UGKA 5A4DA 4CV3A 3FSRA 2ZJ0A 5BSHA 1NPTO 3ZH2A 2X58A 4MVJP 1YB1A 4GMGA 2B4TO 1WDMA 2GN8A 3M6IA 2WYVA 1YONA 1Q7BA 4J4BA 1E3JA 4E5NA 1DBVO 2NVUA 4Y98A 4DC1A 4IIUA 1LQUA 5I8ZA 5CEEA 3GY0A 3R0IA 4E5KA 4ESOA 5DT9A 1LDMA 3RUIA 4IDBA 2FN7A 2Y67A 3QWBA 2WD7B 1ENOA 1IHXA 2P4HX 2BI7A 1PGPA 4IDCA 3B1KA 1ZSVA 4R54A 2YY7A 3A9WA 5TLSA 4DIBA 3NT5A 3ZW8A 5I7VA 2C82A 3LC7O 3DBRB 1T2AA 2P9CA 4Q3DA 3TOXA 4TZKA 3HADA 3KM0A 2D5CA 3E03A 2P9GA 4GVLA 5BR7A 5GZ3A 1UDAA 4FQ8A 3WGZA 4TRNA 1SB8A 4IDAA 1SEVA 3O38A 4Y8VA 4GVXA 1XSEA 2VHYA 4OGWA 3RASA 4IDGA 2ZB4A 3P7MA 5KWEA 1LRKA 3NT4A 2VWQA 1I24A 3CINA 2G82A 2VUTA 3AI2A 3JD1A 5TF4A 3RC2A 1VL8A 3ZNNA 1DIGA 1QYDA 3WIDA 2AE2A 2BELA 2D4AA 3TL3A 4D3SA 4E13A 3GVCA 4IXWA 3E82A 1CDOA 2JCXA 4J9VA 3QY9A 1WPQA 2EGGA 3OJ0A 5A02A 4EITA 5TSDA 4R5MA 4DUPA 2BI8A 3HN2A 4FGSA 4PG5A 1ISJA 3DOOA 3F5QA 2G5CA 4FGWA 1C0KA 2D59A 5A03A 5ILGA 4IJWA 5C7IO 4FPXA 1GYQA 3MJSA 1PZGA 3F4BA 3UUWA 1CYDA 4NFSA 2I65A 2JD0A 2WM3A 5C7LO 5AVOA 4JGBA 2WTBA 1MXFA 1A9ZA 1LTHR 5DN9A 1GV0A 3FNEA 1NXQA 2IDZA 1BXGA 2JD1A 4RO0A 1DHTA 2WE8A 4XQ9A 3VPGA 4A7PA 1XQ6A 1E92A 2EHDA 2OFPA 5EJ2A 3ULKA 3E5RA 1MG5A 4KUHA 3GVPA 5EQFA 4WJZA 3R6DA 3IL2A 3I9LA 3O9ZA 1EBUA 2VHXA 3PYXA 4DRYA 1FDWA 1E6UA 2IE0A 5JYEA 4YAGA 2W4QA 5FEUA 4DQUA 1E6EA 5DCWA 3QVOA 2DBVO 4E2ZA 1T4DA 1EMDA 2Y0EA 1B3BA 1N7HA 2YV1A 1U28A 4HXYA 4Z0PA 4XX0A 4GSLA 3RBXA 3V2HA 1BSVA 4MIOA 1YOVA 3OSUA 5COBA 2A4KA 3LSYA 3RUCA 4DGSA 4TRRA 3F46A 1ZH8A 1E7RA 3B20A 3H5RA 4MVJF 5ENDA 2C29D 4XJSA 4BO0A 3ONDA 2Q46A 2Q3EA 5KIAA 3GZNA 4B79A 4XB2A 3CE6A 1J49A 1VLLA 4PN3A 4A0SA 1M6HA 1DC3A 4GBJA 5CAEA 4XGIA 3KTDA 3PFFA 4O63O 2EERA 3FBGA 4BMNA 1UAGA 3AOGA 2PGDA 2YV3A 3HNPA 1DC5A 2ZTUA 4ND4A 2NVWA 1JKIA 3JV7A 2A9FA 2F1KA 4XYGA 4LCJA 1E7MA 4R1UA 5AYVA 3RJ9A 4P8RA 4UAGA 1ZZEA 1AE1A 3PQFA 4PG7A 3MWEB 3QV1A 4B8WA 1PQUA 4CM7A 4DL9A 3RCBA 4EYEA 4N5LA 4WNIA 4D7AA 2GR9A 3PJDA 3PDJA 4RQUA 4YJDA 2QRJA 2B5VA 1EUZA 4ALKA 3X2FA 1SEPA 2HMSA 3PJFA 4CV1A 2GNAA 2IYPA 1SPXA 3HZZA 3NEPX 2GZ2A 5THQA 5TT0A 3MTGA 4IJKA 1DRVA 4Y6SA 1F14A 5TRTA 3JTMA 3ZV3A 2AEJA 3ZGYA 5HRUA 1Y5MA 2J3IA 3I9OA 1EZ4A 3A28A 3PHIA 5KNLA 4GL4A 4FOSA 3ADPA 3VHRA 3O8QA 5AOVA 4HFRA 4E3ZA 1ZNQO 2JHGA 4EEXA 4ZN6A 1F17A 2X7HA 2GDZA 5L9AA 3TZCA 4B3IA 1ZCJA 3OEYA 3N58A 2Q49A 3FWZA 2QG4A 3HE3A 2C07A 3ZCXA 1LDNA 1E1MA 1RKXA 2JHFA 3FNHA 5A06A 2ZYDA 1QV7A 4HADA 5B4VA 5AXDA 3TQHA 3GOHA 3JCZA 3AUSA 1MX3A 5IFLA 2NU8A 3K96A 4UVHA 3U4CA 2AEMA 1Z7EA 1R12A 1F8GA 3CKYA 4O59O 5CPBA 2GSDA 1ZXBA 1LBEA 4JROA 3GFBA 2ZTLA 1YGYA 3I23A 1TVEA 5KJCA 1LQTA 3UW3A 4XB1A 4CLEA 2X23A 3DMTC 2UUPA 1LEHA 1C0LA 3PQDA 4FD3A 3TZQA 4IY1A 3ADOA 3QE3A 3U09A 4UULA 3WFJA 1U3VA 2PNFA 1ZEMA 2Y99A
chains in the Genus database with same CATH superfamily
3B1XA 1B74A 1SB9A 3FRHA 3TM5A 4CDNA 4BZPA 3FUVA 4RKWA 1EX6A 5AM4A 1XALA 1WO8A 1AA9A 2XRFA 5CBPB 3T7IA 1RTKA 2YXNA 3FOBA 3HVUA 1TM3E 4Q6WA 3P0EA 4BX9A 1A7KA 1QPBA 3KQWA 2PQ0A 3V3TA 1M2OB 2MYPA 3KZXA 3ZHRA 1CDEA 1KGSA 3G7SA 3RGGA 3E9YA 4XRGA 1SELA 5F7OA 3I2GA 4DC0A 4WCFC 2ZFUA 4LJ5A 1XO1A 1WTCA 2QTMA 1KZYC 1CFJA 2WK1A 1UM9A 2WU4A 3NWJA 4GLLA 4BDTA 2DUJA 5FAKA 3EISA 5I45A 2HSJA 3CUEF 3K70C 2I76A 2FWJA 2OGTA 2AQHA 3H4TA 4A2PA 1JG4A 2JZNA 2NZVG 1Z45A 3GJYA 4H0FA 4JXJA 5EIWA 3RRJA 3TYXA 3UJ3X 3LPMA 2DG2A 2Q27A 4QUEA 3L4BA 1XCOA 2OYRA 1H66A 1TJYA 1JXQA 3AW8A 3LC0A 4V3CA 1DEOA 1TUEA 2B3TA 5A4MS 4HPWA 3VZBA 4DCNA 1I7DA 4N48A 4GG1A 3BJEA 2ZIXA 1QFSA 1KOFA 3VFDA 2J07A 2RBGA 5HBRA 1YR3A 2Z4SA 1B6SA 4XXHA 5F7ZA 1H4VB 2XTNA 1KOLA 1I13A 4MPRA 2XYRA 4UZFA 4QRDA 3NBAA 1W76A 4DCJA 3PHJA 2DT8A 1XZFA 1KZ9A 3OZCA 4ROSA 5CDFA 5ALUA 1JX6A 3N74A 3PENA 4JUFA 4C7OB 2VR1A 1KDZA 2XQIA 3ROXA 1FRNA 1M2GA 1QMPA 5AI5A 2EW8A 2VJNA 4S0ZA 4TXHA 1CIPA 2YVUA 3B9PA 4XASA 1GU0A 2V8OA 3NBUA 1H42A 1NW5A 2F3PA 2OESA 3IQWA 4GP9A 2PD4A 3VVCA 5AVVA 5IHPA 3TW8A 4X1OA 5ELMA 1EQAA 2HMYB 1U0OC 1CR6A 2CF5A 5CU7A 5CLHA 1WJGA 4CL8A 4UPDA 1C7JA 4Q3AA 2V4MA 1Y6GA 4M3NA 1NXTA 3TCKA 4DLXA 2J3JA 3G3EA 5EERA 4JJFA 3A6JA 1JHQA 2ZT7A 4WEOA 3SLKA 4EKNB 2VLBA 1T1IA 3V2UA 1ZUNB 5JH7A 2VT6A 2C1ZA 4G1MB 2CFIA 1TCVA 2PKCA 4GT1A 3K70B 2WU3A 3I05A 4FR5A 3GEPA 2C2KA 3HY6A 3NCHA 4QHYA 3BD7A 1L4UA 4HGPA 4Z2YA 3QKRB 1HX7A 4ZT7A 5BYKA 2XW6A 3GOQA 1GUFA 4PZCA 1P9LA 1JGTA 4C22A 3GZNB 4QUJA 4L8GA 1QGDA 2AUTA 2H7XA 5JJ5A 3PIIA 4DLAA 4IIJA 1YS4A 1JLHA 3ELYA 3JQGA 2PV7A 3N2KB 1GYRA 2GBPA 4ITUA 4G0QA 4ZCTA 5DBOA 4YUXA 4LBZA 1TJNA 3IE2A 2DLNA 4NAUA 4RWZA 5KNDA 1ZZGA 3HRIA 4AUMA 1NI4B 3U7QA 3OIFA 2ALJA 2BDTA 2VHCA 3ZZUA 4W9NA 1NDHA 1U7DA 2YX1A 3FHJA 1CRZA 1D7AA 3PNLA 3N1UA 4J0JA 4TM8A 1Z15A 1NMZA 4L3WA 4P38A 1U7XA 3DEHA 4BVHA 1WWKA 2GPNA 4J0IA 2CNWD 4BB6A 1ZRMA 4BAUA 4IGAA 2G0TA 5HZMA 1Q2XA 4F9FA 4Q9LA 2O2CA 2HTEA 2ZBPA 4X1YA 4WX2B 2QYTA 2GF0A 1QYWA 2XVYA 5ALJA 2ODWA 2P2NA 2MMGA 521PA 2ZGVA 3E0XA 3N86A 3ELUA 4LDPA 4BVJA 1ZM2A 3G2KA 3SEQA 2EBFX 2RGWA 2JLRA 2WJWA 2HIGA 2YN0A 1K3TA 2J59A 4QYXA 4F46A 2FP3A 4JT2A 4RGVA 3KEQA 3P32A 5KTMA 1V5WA 4LF7B 3BORA 1UKZA 3QJ5A 1YTUA 2MSLA 4I4IA 2DEUA 2YRXA 2ZG6A 4ME6A 1TB4A 3L7DA 4JR2A 5A6SB 1C3LA 4AYTA 4O2BA 4A6XA 2POQX 4ARVA 4OLJA 2UVQA 4EB8A 1C3VA 5G1PA 1NX6A 1IY8A 2R1ZA 3FZEA 1EVJA 1E1QD 4BLTA 3EFOA 4R2XA 1WW8A 2O8EA 2ZREA 4FCVA 1U8EA 2Q1WA 4L9SA 1BH2A 4LSWA 3R6TA 3RAFC 4R3UC 2P5UA 3F97A 5JANA 4KO4S 2VP3A 2PT9A 4PR0A 4RKYA 1JEYA 1CQIB 4Q1AA 2QXYA 3VJKA 2DP4E 3MB5A 5KCZA 1YCGA 1IPHA 1ESDA 4IMIB 3TKAA 2FFBA 2CXRA 4NV0A 2J33A 2B25A 2QAGB 2YWJA 1MZPA 2WW8A 1XHLA 4RK5A 2NSDA 4D42A 5ENVA 3LLUA 4R1QA 1W36B 1Z5WA 2WWFA 3BMNA 1TEHA 4AFNA 5FUYA 3ICPA 1XLTA 2GZMA 1LDYA 1YJCA 1Y6RA 4IYJA 5T6BA 4YMUA 2V9PA 3IJ5A 4PX2A 3GLHA 2WJPA 3TOCA 4FHCA 4AJEA 4KRFA 1XD2B 2CL5A 2Y93A 1ID1A 1XI2A 3W90A 2XT0A 2IELA 3DAOA 3GGDA 3JYOA 1KVTA 1SZJG 1K97A 2R8EA 1VPTA 4EEZA 2NLOA 2VF8A 3DP9A 2F8TA 3C43A 1WPGA 4FFDA 1YZNA 3KV1A 3CH7A 4YA6A 5I4CA 1E66A 3M3HA 4B48A 1PK7A 4IFIA 1DSSG 2XYPA 4OQDA 4EA6A 2JGFA 3LCCA 3WSVA 2XWPA 5BUQA 2XKJE 3JASA 3BAZA 4LJ8A 4OP2A 3T5AA 4IGEA 4HN9A 3OQOA 3I64A 4DCSA 4LOLA 4B7AA 2JGMA 2V7QA 5HZGA 4O33A 1T36A 1YT5A 3PDUA 3PV0A 3VU0A 5K6AA 4KGVA 4XKJA 1X7YB 4RC9A 5L4NA 4I66A 1YMUA 1YR2A 3D59A 1B8NA 2RK4A 3BCUA 2EX1A 3HHPA 4I8DA 1P1HA 1Z82A 3CZ9A 4XJVA 4XJXA 5DYYA 4ABTA 2V6BA 4J91A 4IO1A 2YYAA 3N75A 2ATXA 1DUSA 1N2SA 3GFGA 4FX5A 2MINB 4JBWA 3F7TA 5HJEA 4OQMA 4NXNB 1NN5A 4MMYB 2JLAA 2J9RA 3U3RA 3R41A 1XQVA 5K3AA 3QMWA 2D6FA 1E3MA 2ISQA 3DVRX 4QFMA 4DANA 3A2KA 2H9IA 2JI4A 2XITA 4GXTA 1H2XA 1U2ZA 2AMLA 3VVLA 2X77A 1Z2OX 3KVOA 3JD4A 4JYPA 2ODBA 3VV3A 2O0LA 1F8YA 4DF3A 3UMGA 2L17A 5GJBA 5AH0A 4A0GA 1Z33A 2Q9AA 1GCIA 4LC0A 3HBMA 3E84A 2ILVA 1LFDB 5AVYA 1NULA 4GHWA 3VPHA 2O59A 2HPHA 1USVA 1EVZA 3FCYA 3SOPA 2H4YA 3EXFA 3ELBA 4LRWA 4C0QC 3QITA 4CRWB 1GZSA 2I71A 3OJCA 3DFMA 5EUCA 4BMDA 5DKFA 3CUTA 3I9V6 1GSHA 2BFAA 3I61A 2DHRA 5ARDA 2HDNB 2JHPA 4TMKA 4RA9B 3DG9A 3HGMA 3OC0A 4B17A 1MV5A 3E1GA 3H1GA 1OH8A 3KJXA 1CZNA 4KPUB 3H97A 2X9GA 2WIAA 2P0AA 1VE7A 3QF4B 4MXDA 5EXEA 5BT9A 1Q0RA 2YZKA 4KE8A 2XMCA 4HV4A 1KARA 1HDEA 2O9JA 5GY7A 5EINA 4TT3A 2HF8A 4TTPA 3JZDA 4FFMA 1HNZB 2B83A 4R1MA 1G64A 2Q45A 1BYUA 2J0UA 2V9ZA 2X15A 2Y4NA 3E0QA 3FETA 1RXCA 3HCEA 3ONEA 1QC5B 4F21A 2HU2A 2OM6A 1T25A 1MA0A 5BW4A 2PSJA 3UW1A 3HWSA 2HR1A 4V24A 4PTLA 4JX8A 5HGJA 2XMBA 4NCKA 4OPMA 4X7RA 3HI4A 1U2SA 2P6PA 1N6PA 1PJ8A 2OUIA 2PXCA 5A04A 1V11B 3KETA 4HMQA 2EFJA 2FPIA 4LF9B 2XSZA 1LNQA 3VKUA 621PA 2Y3IA 1LNZA 2PXXA 3NANA 4BO6A 3DAPA 1IJFA 2AFHE 4RVCA 1Z5GA 3CB4A 3FX2A 2F55A 4KQJA 3COYA 3DZCA 3IP7A 2XCOA 1D09A 5FFNA 1J5XA 1J2RA 1ESEA 3OFKA 4UPEA 4CIBA 5LQRA 4UHJA 5KWSA 2G04A 4O25A 3AR2A 3QX3A 4Y18A 5L51A 4W8OA 4ZI2A 1EGQA 3BXZA 5DNAA 1U0EA 1DIRA 4ZCRA 4M1ZA 1FY2A 1CERA 3OOSA 1BW9B 2IPNA 3CIOA 3KQTA 4G0XA 3L8FA 3P2EA 3P97A 2X7JA 2RH4A 5FBQB 4WTOA 4Y6LA 2Q41A 2QN3A 2OV1A 4LPKA 3AEQA 4PICA 5AOCA 1A4XA 1QIGA 3C4JA 5LP1A 1NW8A 1KFKB 1W2WB 2REQB 4R2HA 4EJ2A 1Z8HA 4HLQB 5AKXA 3Q5GA 1IQRA 1NLUA 1K5PA 5M3BA 4ETMA 4C2AA 2IS6A 4WXYB 1RJ9A 5K8IA 3IUJA 1XRLA 4F91B 2DKNA 4IH4A 1G2QA 4Z8XA 2VQ6A 3NYRA 4MR7A 2XZOA 5HKBA 1G6Q1 1YRAA 1KAHA 1MZVA 4HJXA 4OP3A 5G0WA 3RABA 3S8EA 2H5JA 2EJBA 4ZAZA 4KO1S 2IS1A 2VHEA 4BPBA 2MYNA 4DADA 4E46A 4OAOA 3SYTA 2YN2A 2JFOA 3LWBA 1HQYE 1Q1GA 3WYBA 4E1AA 4KGDA 1BOFA 4TLCA 2ZIXB 4M9QA 1DG9A 4S1WA 1YACA 1CZLA 3OE1A 4AT1A 5JD3A 1SU8A 4RTPA 3Q8MA 5I3ZA 4D6PA 1FFGA 2QR3A 4J6EA 1SPBS 4J9UE 4GYWA 4ZANA 3V32A 3VSDA 1H9CA 4F56A 3PK0A 2ZAMA 4FS8A 5CX1A 2O2EA 2VPQA 5EL0A 3VPSA 2DUWA 2B7CA 3AFNA 4RQBA 1E96A 3JVDA 4CIXA 2BZ1A 2AFHA 2CVPA 2OHOA 1IMJA 1CR2A 4M0LA 3RKRA 2PEZA 3W4JA 4CU5A 4X1IB 4CIDA 4EI7A 1N2BA 1ILWA 1W4BA 2W00A 2AZ4A 3MM4A 1XZQA 2VI5A 3W2IA 5DM1A 2G40A 2HGZA 4KW7A 4U6SA 2ENWA 2VJOA 2VYFA 3QHAA 2FUG1 1G1AA 2F48A 2JKVA 3STUA 1CZOA 3W4IA 2DTEA 4IVRA 4Z7QB 1OX6A 1PV1A 3AEZA 1GSAA 3GELA 1UBHS 3LY9A 2EDCA 1IVYA 3KZCA 1C3JA 3GEBA 3M1YA 3H2KA 5GINE 1JVBA 3QWHA 2QORA 1RAHA 2XB2A 1J7KA 1YBVA 1GWNA 2ERXA 1GXSA 4P4SA 1TECE 2HU8A 5CDHA 3T54A 4DHEA 4HI0E 1L2TA 3AF2A 2OOKA 3M3DA 2A58A 4CEHB 2ERYA 3MOSA 4EJSB 1AZWA 3EGCA 2JGKA 1GLGA 2ZROA 3A06A 4Z6KA 1PT6A 3UV6A 1EVYA 1Y3AA 4BVBA 1J0DA 4AUNA 5EJ4A 2XBMA 1E7QA 4ZYUA 1EXMA 3SM3A 2IIBA 3GLTA 1PDWA 2DUNA 3I52A 2HRRA 4BCDA 3LGAA 4G5RA 2R68A 3BX1A 3ICCA 3MGGA 1ZMOA 1E5QA 3P27A 3R5SA 1URPA 4JLDA 3SXPA 4JBGA 4B7CA 4EW6A 5JBNA 3EXHB 1KY3A 4K46A 2ZB8A 5LP6A 5CR9A 2VJAA 3BB1A 2AT1A 4KI7A 3OEWA 2X3UA 2X1MA 3MILA 4JLAA 1VG1A 3E2MA 4BVEA 2H6EA 1U4SA 5T3UA 1WMAA 2B1JA 4FZ3A 1FX1A 2CUNA 2NACA 1MO3A 3HA3A 4H31A 4ZPXA 4DJAA 4QZVA 1VMEA 1LNSA 2VNKA 4FYIA 2EXXA 4TV9F 4WZAA 1IHDA 3MT7A 1CUBA 3B8HA 3D3EA 5FULA 1W581 2QVCA 3ABOB 4IMJB 3RARA 2YWFA 2ZR0A 3EMBA 4HXGA 4YB8A 3CLVA 2B4QA 1UJBA 5GM1A 1XYGA 3DPIA 1QORA 4KYIB 3ZI4A 3ZWCA 3TMYA 4L9RA 5ICMA 1HA3A 2J08A 3K32A 3MAGA 1XTTA 2M9MA 2DRIA 1B16A 1NX9A 2P7IA 4QL3A 5D85A 2XQKA 3T5TA 4L2IB 2FG5A 4NWIA 4CT0A 2V7UA 4KQKA 3C6MA 4FWBA 4JWKA 5J5VA 2QKYA 5H5JA 1TM7E 4EHBA 3DOJA 1GAQA 2BW0A 3OF5A 1SA0B 2A86A 4QTTB 3TD9A 3IQEA 3R3ZA 4CDGA 2OXEA 3WE7A 4C78A 1C14A 3L0PA 5IS2A 1U7WA 2VPPA 3VJRA 2IXDA 1OTYA 2XTAA 4L4SA 3BWBA 1W4CA 4TT8A 3ZBPA 1R8JA 2WMYA 3MTBA 4RF2A 5K0LA 1K8QA 4HYTA 4YRBA 2H1OA 1JKJA 2XDYA 3BRSA 3SZMA 1E8DA 2X22A 3BPSA 5AK3A 2X0FA 5I6DA 3OFNA 2I2DA 3PD1A 2N1BA 2YMQA 2B82A 3E3OA 4HBGA 3LDUA 1MIHA 3B38A 1XYYA 1XKTA 1DAOA 1XZEA 5I7FA 4QNMA 3TEJA 1ADCA 5TMBA 5COAA 1XRQA 1Z2CA 4IV5A 4QGAA 4I36A 2XUHA 2ZWPA 3CWQA 3NGXA 4H3VA 1P2FA 1SA0A 2PAAA 2RHCA 4QOIA 5E38A 1I4TD 2AFIB 5E6SA 3UY4A 4CG1A 4DV3B 3EEYA 1FYWA 1DFIA 2QG6A 2W6QA 4NOKA 1SXGA 4EG4A 1R9MA 4QARA 4YMTA 3FTQA 3DDCA 4GZLA 4Z8YA 4O2BB 1T5SA 2D3TA 1XZKA 3V46A 1EG2A 3ND6A 3HPRA 3PR3A 4XGNA 4LUCA 4WLOA 4YCAA 1BEUB 2ONKA 3ROTA 2CY0A 5DLQC 1WCYA 1XXHB 3EB9A 4Y3UA 3AP2A 3WYGA 4BLRA 1ISGA 4TV8A 2V55B 5F3RA 2P11A 4K1XA 1J5EB 2DKFA 2YTZA 1JHOA 3ZUGA 3ZX4A 7REQA 4BRWA 3VRHA 4D96A 3KQYA 4EFKA 2A2ZA 3FOAA 5CNIA 1CB0A 2FPGA 1HT1E 2QU8A 1C3OA 2VP6A 3SHFA 3WTCA 1JZTA 2X41A 1ECLA 1VCMA 1D2RA 2Y68A 3UT6A 2RC5A 3R7NA 4N5NA 2C5EA 4C07A 5JS8A 1IULA 2P9EA 4EGAA 2JIPA 2ZYSA 3JQFC 5LA6A 4F3RA 2WYUA 1Z0UA 3S2YA 5I5GA 3MCVA 4XIYA 3OCZA 4XCXA 4QOJA 2CMDA 4QDXA 3NO4A 1TGVA 1RWQA 2GJSA 2JCSA 4CCWA 1KJ9A 2QU7A 4OAQA 3TL2A 4EUEA 4MQEB 1N6NA 2WWXA 3R5KA 2V7EA 2QD4A 4S1VA 5F51A 4EK9A 3QOWA 1IONA 4R2MA 4D0SA 2XT6A 4ZDWA 1DKQA 1ZW1A 2J8ZA 1S6YA 5A9RA 3KSAC 4BYGA 3AKDA 1EP1B 2WA1A 4LJAA 3CEMA 4Y6RA 4XYLA 3AF4A 4N8EA 4YQEA 1DPGA 5JO0A 3COJA 1U7OA 1FTGA 1YC2A 2WSIA 3L7JA 1OH7A 4JLSA 3B5IA 4F1WA 2ID7A 2JFQA 1S9DA 3BH6A 5IYZB 2DFNA 3L0YA 2A9JA 4CG2A 4OD0A 3ZV4A 5LLSA 3C70A 1R0CA 4MYCA 1OLUA 4F4FA 4I55F 3VH3A 2OQRA 5D84A 2QZPA 3ENKA 3A6DA 3RG8A 4E1BA 2VOEA 4EYSA 4H7JA 1R7RA 4BJ3A 5J4LA 3O8NA 1ZKMA 5DHSA 4IUYA 2D2EA 2ID4A 3CSDA 2SECE 2EG5A 5J23A 4ER0A 3G2JA 5CEJA 3E15A 5SYAA 4TQAA 3WMGA 1XK6A 3TSWA 4AX4A 1WCIB 3N2NA 4CFZA 3KRTA 3DMRA 2G25A 5FWDA 3NHMA 4X93A 3EBPA 3CIFA 5IP5A 3TQOA 3CWCA 3LUDA 5L4LA 1K68A 1JIJA 3A31A 1DRUA 5I7HA 3FCSB 1ORDA 5HCUA 3MN1A 1ZM4A 3H3FA 4TUYF 4ZKDA 4WESB 1OLXA 3IR7A 4TMWA 1DO0A 1U0FA 4L4YA 3QKSA 3C8ZA 4C6TA 1UAYA 2FR8A 3GEGA 2WU8A 4TS3A 4HMPA 3THRA 4DJ5X 4ENTA 4YFYA 3G5AA 5FRDA 5CCEA 1PWEA 2AMFA 3UH0A 3WOHA 1DRKA 1HO3A 1Z6ZA 2W8BB 2WFMA 1QYIA 5E9QA 3TE6A 3WIOA 3I5XA 3IAUA 4R8VA 2QMQA 5AVRA 1DPFA 1T29A 4MEAA 5C7YA 1HNNA 3DMHA 1U1EA 3B5EA 3F4LA 2AMYA 5MDHA 1T8RA 5HF6A 1J22A 5JWOA 2P91A 2W11A 3CKMA 4IILA 1FVXA 4MGEA 1J5PA 4BEJA 1NQVA 3K6JA 3AESA 1LVUA 3IS3A 1XDWA 3LIPA 3FZQA 3G0IA 2OQ2A 3LPLA 3WSWA 3C1OA 2WQ6A 3GLKA 1BVRA 1X1RA 4QU5A 3WC4A 4IH9A 3WK8A 3WLJA 1WB5A 4XWWA 2QSUA 2JDID 2WIGA 3NM4A 3FMIA 3TNJA 3D2CA 4ACBA 1NWHA 4RD2A 1U3TA 2AG8A 4JP3A 3VZSA 4YPOA 3F0TA 5DI9A 2JFHA 3VKGA 4MTLA 3LL4A 5EIEA 5DW3A 1CHNA 3MJCA 4IZ6A 1JXMA 4GLOA 4R68A 3W8RA 5B7NA 1MB9A 4GPIB 4MRMA 3WQBA 2J5KA 3HU5A 4NDZA 1R2QA 3KYDA 4TQ9A 4OY3A 2X1HA 5AW4A 2W22A 4CM9A 5AW5A 5CH3A 3IAS6 2H1FA 3L0OA 1VJ0A 1C0PA 1NKVA 3FSEA 3PHLA 1TZJA 4P3KA 2V4ZA 2C7BA 2EFGA 3VR4H 3WA7A 1YNSA 2PUDA 4JC4A 1T9KA 3U4GA 1P2UA 2BCEA 2DULA 3SFTA 5JCZA 4RAQA 2NGRA 1NQ5A 1U04A 4M49A 4PLPA 1YK0A 3IDFA 1M6WA 4BC1A 1EDZA 3NV9A 1QTIA 3OZTA 1PJTA 2OHXA 2BOVA 3SNKA 4PQRA 2WSSD 2Y1GA 3R20A 3GJ5A 3ISTA 4MLPA 2HCJB 4RV5A 2G6BA 1I3NA 2CNOA 1HG0A 4JJKA 5FOUA 1NU8A 4D8TA 3R5TA 1EDOA 3ZXYA 3OBIA 4QFDA 1KVQA 5KVCA 1NVXQ 3ZBUA 3UHPA 2C5HA 4Q7EA 3GB9A 2X0IA 1BN7A 5JCJD 1HXHA 1OJ7A 2VHQA 4HKTA 2YXBA 1H9BA 2IHYA 4DN6A 4ENPA 5B7PA 1TYAE 4LDRA 4N39A 2E6UX 3CNEA 1OF1A 4QUAA 2G5GX 3QQ5A 2NYUA 2BM1A 4FNMA 1RNLA 3ZV6A 4B0PA 2ZJ5A 1RQNA 2LKDA 4C43A 4X24A 2HA4A 4PPGA 5DJ5A 3AQ4A 4Z54A 3ASYA 1V7QA 3DFFA 4PTYA 4FJ1A 3IPAA 4LRUA 4RMGA 5KINB 1HFKA 1MRSA 1RABA 2NUTB 3IP8A 4JITA 4HX2A 3SDZA 4EYOA 1R3DA 2AYYA 2PMWB 1TCUA 4MP8A 1PVDA 3D5QA 4RPLA 4TKLA 1R6VA 2VP0A 3KQLA 1GQFA 1NOJA 5ALKA 2NXCA 3IE0A 4ILEA 1QANA 4FX2A 1HRKA 4K3VA 2L18A 2XTZA 2IU0A 1SIUA 2EOAA 3DOCA 1TK2A 3GLQA 4UATA 3HTXA 2G6TA 5KQGA 4OX9B 4LG1A 3JWHA 3ZOKA 4G0PA 3O73A 4GR4A 5JVDA 3RSHA 4G0MA 5TIIA 3K0EA 1AKVA 2R87A 1F4PA 2BFEB 2WUFA 4GWKA 1GL7A 1NJGA 3REQA 3KLOA 2VYVA 4KNVA 3T35A 3KTOA 4HF7A 4K6KA 2PANA 1NJ2A 2DFKB 1MO5A 5HPYB 1QAMA 4RY9A 3VR3D 3D7LA 5JQGF 1VPWA 3EJWA 3BMXA 5BOSB 5JC1A 4OB6A 3W78A 1ZP6A 4B5LA 1RJDA 2JLUA 3HUTA 3L6EA 1VBKA 4LW8A 4OBEA 1R16A 3BH0A 1O95A 2P4QA 3OT4A 1KBQA 3P94A 5HUQA 2I62A 3C3JA 1U81A 3HM2A 2XNDA 1C8LA 5FR1A 1YB6A 4IZOA 2NZYA 3UUEA 1HT3A 3R3JA 4DMKA 1AO0A 1RQ2A 3UB2A 2AMVA 2C7PA 2J0VA 5C8ZA 2HL6A 2QF7A 4YJGA 1UKVY 2O6HA 3BXOA 2YR0A 3JD2A 3NGMA 4ZD6A 1B0UA 2WJYA 2AC2A 1S89A 4NOLA 5FF9A 1L4KA 1E9SA 1EZZA 2H2FA 4PAGA 4L28A 1T13A 1FS6A 5ERGB 1YHNA 1KA9H 5FH9A 2A6PA 3GFQA 3CEAA 1V7CA 4XQGA 4DRZA 1Z8DA 4LYAA 4H0NA 4LZAA 5CUQA 1MOSA 5K8VA 1SVNA 1XXHA 2IYSA 2Q62A 2PKEA 2ZI9A 2ZULA 1GAJA 3H4IA 3PE3A 1IK4A 1ISFA 2FCAA 2ONJA 2BF7A 1YJ8A 2W6OA 3N8IA 4V2UA 5JZBA 4ZO8A 3VOAA 2BMWA 3DHYA 2V97A 2ZUBA 3PZBA 4RVUA 1Y82A 4XTCS 4A92A 1A7JA 2Q7DA 1V7PC 2JCVA 1C4KA 2DYKA 3BWEA 2HRZA 3HKCB 3T5BA 2P67A 3A4IA 3MELA 3S8MA 2BM0A 4EJFA 4Q4AA 1HL7A 2QQFA 3GFSA 3OQJA 2P2GA 5K4GA 4JC8A 2AA3A 3ZKAA 4BPRA 4A36A 4FXOA 3X2EA 1Y34E 2LR0A 5GOTA 4A16A 4BWVA 4QODA 4F8JA 4HVCA 4PINA 3ECSA 1WMFA 4JB3A 4DCUA 1CQJB 1X1SA 2Q4TA 3HMKA 2XGOA 4O3FA 3RTDA 1V1RA 3S1AA 3SJZA 3LBFA 3UICA 1VKOA 4GI2A 1MB0A 4FFLA 2LDXA 3U4DA 4MW9A 2GXQA 2XECA 3MAAC 2H11A 4OLBA 2JGLA 2RKWA 1UBKS 1W6UA 3HUEA 4PAOA 5IAGA 2R6GA 3AB8A 2FV8A 4L27A 4N0QA 3GLVA 4IQ0A 5A4IS 4YO8A 1PZFA 3H04A 3ZHBA 3NYIA 1NF9A 1W88B 3DMNA 3H8SA 2WMDA 2LCIA 4LZZA 5D1NA 5DGHA 2QQ5A 4O4HF 4U9IS 5H81A 4R69A 3ZBTA 4L5AA 4CKEA 1A5TA 4UQOA 1XZCA 1IM8A 1A9PA 1FW8A 1NVFA 2MYUA 2PLAA 5B1IA 3A6HA 2PWBA 3UJPA 3I9FA 1DIOB 2HHJA 5AMXA 3OOWA 3QFHA 3FTEA 2PA0A 1Z75A 2OBYA 3KWJA 1HE8B 1OXKB 1I4WA 4JKIA 4MCJA 2HT1A 4GDMA 1N33B 1XTUA 3WX0A 1E99A 4IHKA 4JYBA 1R37A 5MGNA 2EKZA 1FYVA 4FILA 4NG4A 4R1NA 4CNQA 1RW4A 1N77A 2PLWA 2P6OA 3QVWA 4PHHA 2XOXA 1NVGA 1T0HB 2JIMA 1VLZA 2Q8NA 3PE4A 1ORIA 4MV8A 1JVNA 3T5GA 3UKOA 1QWSA 2ISCA 2L69A 3LXXA 4HDSA 4MCHA 1HYBA 1CU1A 4UREA 3BHMA 3SQDA 3TTVA 2Q2WA 4KJZA 5KQMA 2PWPA 1HDXA 4YFVA 3BCSA 3EIXA 1F3LA 3FVRA 1ABEA 4O4LA 4GLJA 3HB0A 1EFKA 4FDTA 2QRQA 4MW1A 3KUCA 1CZKA 5B7QA 4MRSA 3TQRA 2BMEA 1JT2A 4K86A 3V2GA 3BB4A 1CLUA 1E7SA 5F78A 4BN5A 3TECE 1BDMA 1RRCA 1UPUA 3W1WA 4GMKA 2OPHA 4YRNA 2ECKA 3LRPA 4ZYZA 3R9IA 2I7TA 5AJUA 1AOXA 1UMDB 3HJUA 1GARA 1KQ3A 5IUKC 2B4RO 2IQIA 1PNOA 4FOTA 3UMBA 3DCYA 1EBBA 2CFTA 1G8MA 1R4NA 3GP5A 4I9NA 5LA6B 4RF5A 1AH2A 3H8WA 3CPSA 1KQPA 1D4AA 1TYBE 2VAXA 2E1PA 2ZJBA 1IPFA 2EKDA 4LGYA 1ENPA 4R2JA 4ALMA 4EY6A 1I9GA 3BE5A 4QBIA 3V1TC 1WZEA 3NUZA 3LCVB 1OFGA 4MUEA 3ZGXA 3CKKA 1L6RA 3PR2B 3U0BA 4RESA 2BEJA 5C8VA 4JGGA 2BBOA 2JFZA 2X0RA 1HE5A 4MI9A 4DBZA 3WWDA 2GXUA 2GMWA 1UK6A 2QTWB 1PJQA 3IIKA 3PC2A 4MUGA 3RF7A 5IVHA 3IPYA 2QZZA 4KC0A 2G5TA 3DD5A 4RDCA 4UNRA 1T4BA 3EF0A 3W1EA 1DI0A 2GZRA 3VHLB 4B6SA 1EINA 4S1NA 1CJUC 2NV0A 4B5KA 3RUAA 1RACA 4U8HA 3WL4A 3QENA 2DQYA 1HFEL 4I14A 4I19A 3DS8A 1YZ3A 3EBLA 3IUYA 2WP8J 1NYQA 4EY4A 1MC1A 2XOKA 1WXGA 3L6DA 5IAJA 4AURA 1AKQA 3OJLA 4HRAA 1QTNA 1NAHA 1GTJ1 1UC5B 4N5HX 3RFVA 3HM9A 2VJLA 3OT1A 1BMQA 1UBJS 1XEWY 4DR6B 2HFKA 2KJQA 1WL8A 4RULA 1Y5LA 5CM8B 2RHHA 4OHKA 1M8JA 3D8UA 3DBHB 1MOQA 3MXTA 2P2ZA 3N6RA 1PL0A 3PRJA 3QE9Y 4C4OA 1SM4A 5DM4A 4F9TA 3T5CA 3UMYA 1PEDA 3WDSA 1JH8A 2XYHA 3E3LA 1EP3B 1SMKA 1P29A 1SULA 1WAMA 1BVYF 3B85A 3FSGD 3R2JA 1OIWA 4KB5A 4PCLA 1MC4A 3EHEA 4REQB 2Q2NA 4B6GA 1VKRA 4JC0A 1Y5RA 1T4GA 3H0KA 1YRWA 2FLKA 3ZVLA 3NWBA 1LW7A 4UM9D 4BKRA 2VXOA 1M74A 5GMOA 4RFVA 2A9KA 5ELXA 2FHSA 4JQSA 5IW8A 5TJ9A 4IIFA 3H87A 3C7KA 3MD0A 4FLEA 4EJSA 5B57C 3OP4A 1DIAA 2IZ0A 3QKTA 3A1EA 3EASA 3ZWAA 2PA3A 4XWGA 5FUMA 5J4HA 2CXSA 4LQDA 3AETB 1R8QA 1HDCA 2REOA 4O2AF 5BNTA 3I3SR 5D3KA 1CUVA 1ZH0A 2FWBA 3NTVA 4NPHA 5HRAA 2FPUA 4OKIA 4FUQA 4LDNA 4HB0A 2YHUA 4MX8A 4TMFA 4YJHB 4BLSA 1QYCA 3KTFA 3LT2A 3I2FA 3MSCA 1T1GA 4Y2GA 1NATA 1ZMXA 4L02A 3WYCA 4OL0A 4Y67A 1CX9B 2IW1A 2EG9A 1NLYA 3WBFA 3U4QB 4EQZA 2DSTA 3K16A 3HEMA 3EVAA 3GGJA 3K4QA 1YMQA 3QUQA 5I9NA 3PKZA 1M6YA 1B0ZA 2OHFA 3L7BA 3C5CA 3OCYA 4P33A 3MIIA 4ZAVA 1AN0A 4L76A 5TMEA 1BMDA 2FSSA 2X19A 3NGLA 4AN4A 4W5TA 1W75A 5D2CA 4P08A 4IMRA 2JHCA 4XD7D 4C0LA 1P2TA 1IL0A 4JUCA 5LBUA 4PIPA 1U4OA 3WL5A 1M7GA 4YJ3B 4WY2A 2ZUDA 3CCBA 4EFMA 1K2WA 1YMVA 4EPTA 4M0EA 3I1FA 3QLJA 1WTAA 1XRRA 3H3JA 3L3BA 4L8LA 1Z5UA 4LOHA 3SZGA 5HR5A 3WKDA 2J6IA 2NP6A 3CH5A 5I47A 1IVSA 4ZZ3A 3OICA 1YK1A 4KBYA 5C1DA 1T0PA 4V0OA 1NRJB 4HZIA 3VR6D 1THMA 2FOXA 3AC0A 4C88A 2X5NA 3ABSB 3L40A 1ML3A 3IKMB 4DPLA 2JJ2D 4LSGA 3LSTA 3R5JA 3TOVA 2XDAA 3PS9A 3TNYA 1DZIA 1J8YF 3BK2A 3TBKA 1SKBA 3F78A 3H1AA 4J90A 2ZU0C 1RM5A 1C8BA 1YDWA 4GSYA 1UJ5A 4P80A 1FXWA 1QE5A 3ZY6A 1SURA 4YCDA 3HB7A 3UJDA 2AYXA 4MW6A 1ZUIA 4J29A 2CJFA 4ZT3A 2I4MA 2YYYA 4COOA 3NDBB 2DSNA 1N8SA 3L8CA 4KU4A 1E5VA 1VP9A 1UPXA 1ZUNA 4OH7A 2ZYHA 5HE8A 4XWKA 2C88A 3D1VA 1E69A 3K2IA 1CY1A 2X1LA 1QH0A 3CM0A 4R7TA 4D43A 3FMVA 2PX2A 3ZZ1A 1NYTA 4G67A 1GQ2A 4YUZA 5CYOA 1PZNA 2EDAA 2ZIGA 5IABA 1DAEA 1RQGA 4F4JA 3NWPA 1OR8A 3IXQA 5EHNA 1ZC4A 4NECA 4TS9A 4WN3A 4YRTA 1VDZA 5CVJA 1Z7WA 3CWZA 3LGXA 4PSKA 3V6LA 4QPNA 4C5BA 4C7BA 4E2WA 2ZUCA 1Z3IX 1USWA 4I4TA 1MV8A 2C59A 2JANA 3QEAZ 4Z99A 1DWUA 3HVIA 5K4AA 5M04A 2ABWA 3QFSA 5I9SA 4AN1A 3LKZA 1XJQA 2YHAA 2QX8A 3FDFA 4B9EA 3K0CC 1WX1A 3EC1A 3LWNA 4XJTA 1YQTA 4N5IX 3H7AA 2JLVA 3PDIA 2VDRB 2Z3ZA 2OENG 5JAOA 3FPJA 3TM4A 1V4BA 3TNDA 4ALNA 1TGYA 4PBSA 5JNTA 2QI9F 4UMFA 3RM3A 3L82B 4FDMA 4UUMA 3WRXC 1Z36A 3DH0A 3EZYA 4CKWB 1AMUA 1E60A 1FFHA 1MO6A 4UEWA 5IZ4A 2BGGA 3GD7A 3K30A 1HDYA 4BFZA 2NUBA 1GSIA 1TK9A 1OZ0A 2RHMA 4I4TB 1MHTA 2BGKA 1U94A 1UBFA 4PXAA 1F2TB 2QTFA 1QFYA 2FFHA 4CKXA 3BF8A 3V3KA 5C1PA 4R41A 1T9DA 2HA6A 3GUVA 1JTVA 2J30A 4ZODA 1U1DA 2MSNA 2VA9A 1JIXA 1Y8RB 2J5BA 4LBWA 1FK8A 4M37A 1NJ1A 4X44A 4YAEA 5BNIA 4NZYA 5BSGA 5CG1A 2WWYA 5B4UA 3THYB 2I66A 3NTRA 2X8BA 3AFMA 2ATEA 2G77B 4K2HA 3DT8A 3BHIA 4MUBA 4MMXB 3OMWA 2QTVB 1T9CA 4OFXA 2F8LA 1EVEA 3AHGA 5H82A 5IDVA 5KDLA 3LUAA 4LHZA 3AG6A 1GHTA 1WB6A 1B14A 4UE2A 1XD2A 3ROKA 1RLOA 1PJBA 4FOOA 1P5ZB 4KUEA 2FPPB 3G9XA 3U7GA 2FLVA 4M2LA 4XYMA 2F1HA 2QE7A 4G0YA 3GARA 4WN9A 3FBWA 4KSYA 1OBVA 1G8FA 1X1EA 1BQEA 2K6GA 4MAAA 1ADBA 2QMYA 2I78A 4M87A 3IOCA 1D7OA 2NNWB 3CVYA 1JR3D 2OO5A 2HM7A 2VSOA 1IM5A 1RFLA 1WVIA 1I3OA 2ZIEA 3IJRA 3AINA 3K0KA 3M4YA 4IH1A 3OTGA 4IG4A 3VC3A 3AYZB 2E21A 4GXRA 5BV1A 3T3OA 1P7WA 1KDVA 2WD8A 2KLHA 2IBMA 2VPIA 3BHNA 3B9BA 2CXQA 1JSXA 1H1LB 2JGDB 2D2VA 2OKGA 3P9XA 4PWYA 4QFCA 3RRXA 4DEXA 2D62A 4EHNA 3E5HA 4AY3A 1A69A 1L5RA 2SICE 2WG2A 5DWVA 1F1BA 4M76B 2OXFA 1D07A 2WZBA 1F3OA 1YCDA 3E7XA 1IAQA 1KQNA 4ZHQB 1OFUX 2GZSA 3RYIA 2J3LA 2IPMA 2WHPB 4U7FA 1SGWA 1LRLA 4DABA 3P9NA 1EVKA 4TYPA 5CCXA 2QTCA 4ZIRB 1EAMA 2HSDA 4RVDA 4MLDA 3PEUA 5E4TA 2HI0A 3DF9A 4OHYA 2VJBA 3LT5A 3H9JA 3FLAA 3QHQA 3PGVA 1KS2A 4GOJA 1F6DA 4N54A 3O2QB 4ND5A 5I9MA 4GKJB 2HLHA 3PVZA 4JA2A 3WYAA 1W34A 2WEKA 1XAIA 5EJIA 2QJTA 1YE8A 5A0FA 1E3TA 1G8AA 1HOTA 3P9ZA 3CZMA 1UH5A 1YIAA 3LZDA 3TLAA 4F2GA 3GLSA 3QBVA 5JDCC 3U3OA 5JFGA 4JLMA 2O8BB 4RIHA 2IXTA 5CFMA 3DMDA 2RCYA 4Q0MA 5TX7A 1VLMA 3Q7RA 5CXXA 1I2CA 1YVEI 5ALIA 1BXRB 3PFBA 3K0HA 2F3UA 3EC7A 2F9MA 1GDDA 3A1TA 3B1VA 5F9MA 3V7NA 3BJRA 5J5AA 4NJEA 5EJ8A 1H2FA 2FJPA 3QJYA 4TVBA 4A8TA 4R0NA 4RSHA 1I7NA 3B60A 1LPSA 5HHTA 3AKCA 2X3FA 3TFOA 1MABA 3IOYA 4QBFA 2JAHA 4CI0B 4TL6A 3AUXA 3V42A 1FFXA 2PWYA 1ISSA 2CVZA 1GSOA 2HXSA 2Z3WA 4RMJA 4GKKB 5KKAA 4REQA 3I92A 1DBWA 4Z1OA 1RHRA 2FQ1A 3OFND 5FUQA 2P9TA 5JD6A 3TZKA 3K9QO 1OT5A 3DVAA 3LKDA 3MJFA 1QQ5A 3S28A 1QZXA 3B1FA 4GPD1 4D82A 5JY1A 1DC8A 1ZOIA 2AK3A 4BO4A 4OXNA 1HDOA 1NV8A 4UU0A 5BMVB 1WLYA 1WKVA 4Q7QA 5FBKA 1L5WA 5A4KA 2LP4Y 2IX9A 4TKUA 5FHQA 4A23A 1QK3A 1X7ZB 2VYVD 3DO8A 4PZDA 5EHZA 5CA0A 3RT7A 4GZ5A 2C3OA 3KT3A 3AR4A 3GLFE 1X39A 4MWBA 5B2ZA 1VCIA 4HTFB 4LI3X 4ZOLA 3UKJA 2FWAA 2C9ZA 2FSVC 2VT3A 4WL0A 2PZKA 1MUUA 4HBZA 3R77A 5EKUA 1ZN7A 2WWVD 5D7BA 3FNFA 3VU9A 2VQEB 4UFPA 3EGDA 2ZANA 4H6WA 4ZREA 3BD6A 3VTFA 3C39A