1OC4A

Lactate dehydrogenase from plasmodium berghei
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
315
structure length
315
Chain Sequence
b'APKAKIVLVGSGMIGGVMATLIVQKNLGDVVMFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLKDADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIVGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDQELDAIFDRTINTALEIVNLHASPYVAPAAAIIEMAESYIRDLRKVLICSTLLEGQYGHKDIFAGTPLVIGGNGVEQVIELQLNADEKKKFDEAVAETSRMKALI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-LACTATE DEHYDROGENASE
molecule tags Oxidoreductase
source organism Plasmodium berghei
publication title Crystal Structure of Plasmodium Berghei Lactate Dehydrogenase Indicates the Unique Structural Differences of These Enzymes are Shared Across the Plasmodium Genus
pubmed doi rcsb
total genus 104
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1oc4A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1oc4A02
4GVLA 1HTBA 4BKUA 3UCFA 3F4BA 4B3JA 3GZNA 4PG4A 4NPCA 1G0NA 4E2YA 1VLLA 1WDLA 1XLTA 1YRLA 4WECA 4ZQEA 5BT9A 1UZMA 4A73A 2DQ4A 1LSOA 2JAPA 1NWHA 2D1YA 1QP8A 3SJUA 1FDUA 1M76A 2VOJA 4XYMA 2QRJA 1E7RA 5IN4A 3H2ZA 1R0SA 3AK4A 1PIWA 3RJ9A 4JLWA 4DUPA 3EHEA 4ZD6A 2RH8A 5FWNA 1PWZA 4IGEA 3DMTA 4HY3A 5ICMA 4RVUA 1SC6A 3AI1A 3JQFA 2H5LA 2QZ9A 4MOWA 2TMGA 2GN6A 1ZO8A 2LDBA 1IULA 3HSKA 3NJ4A 5ITWA 3HWRA 2A94A 5BSHA 1QYCA 2GASA 3ZU4A 3JQ7B 2GZ3A 5H81A 5L9AA 4GWKA 2OBYA 4YR9A 1ZSVA 3NDRA 4D43A 1IOLA 3WQQA 1U9JA 3EMKA 2UUOA 1RJWA 4DYVA 4GPD1 4UAGA 3HN2A 3C8MA 3RJ5A 3TPCA 5A3JA 3K73O 1OOEA 1TXGA 3ONFA 1Y7TA 4P4LA 3H5NA 2JHFA 2XPCA 1PJ3A 2ZIZA 2VZ9A 2X8LA 2JD1A 4NZ9A 3U4IA 2FR8A 3AY6A 5F5NA 3WDSA 3KLPX 3I5MA 1H2HA 4BKRA 2ZB4A 4YAIA 4XCVA 4NBWA 2ZTMA 3LLSA 3GLQA 4DYDA 3GNQA 1ZVMA 4Z3KA 5T6BA 4YDRA 1JU9A 2RCYA 4IDAA 1PZHA 3AOEC 3DO5A 4AJIA 4RF2A 1NPYA 1HSZA 1SCUA 4YJGB 3RWBA 1YWGO 4HFMA 3KVOA 5DF1A 3C85A 2V7PA 2Q3EA 4M89A 1ENYA 2G0TA 4CMHA 3NRCA 3FHLA 2CF6A 2VHXA 4KTTE 3WXBA 3JSAA 1V0JA 4W7HA 2Y1OA 1GEGA 1DEHA 3E9MA 5JO9A 3RVDA 3PPIA 5T57A 1IPEA 3VOSA 3F5SA 2WYUA 4CMGA 3S55A 4DQVA 3JYPA 1U5AA 3H65A 1HL3A 2ILTA 2DKNA 4IDFA 5G2OA 1Y5MA 3JQAB 2ZTUA 4W82A 2J5QA 4K6CA 3ZWPA 4R68A 3LT4A 1GCOA 3TZKA 3NTOA 1F12A 3ROQA 2B0JA 3DBHB 3E1KA 2JCXA 2NVUA 4OQYA 4CPDA 3GN2A 5L4LA 3ZWBA 3FPCA 4I1IA 3W4JA 1O95A 2DPGA 1NFFA 1R0KA 2Y0DA 3D4OA 2UVDA 1E3SA 2DT5A 2BD0A 1C14A 1P0FA 1EE9A 1DAOA 1Z82A 3PJGA 3LVFO 3PJDA 4NU6A 1U4SA 2D2IA 1DRUA 1GR0A 3H9EO 3JYQA 3EK2A 1C1DB 1P1RA 3CH6A 5IDQA 4P4NA 2WE8A 3HG7A 4NJOA 1MB4A 4L75A 4OKIA 1EBUA 2A92A 3Q2KA 2CMDA 2PY6A 3WJAA 2RIRA 1WVGA 3K92A 1BDBA 3BXXA 3C1OA 5FI3A 1ZFNA 3O26A 5IJZA 3RC7A 2VHYA 3M6IA 1JKJA 4A5OA 3GVHA 4QUKA 1T2FA 1S7CA 2X58A 3DONA 1SBYA 2DM6A 3GGOA 3LC2O 4M54A 4PFJA 4TRJA 3UUWA 1SO8A 4CUJA 5DBFA 2WEKA 1J0XO 3OICA 4NIMA 2GUGA 2O4CA 2ZB7A 1LA2A 4FFMA 3CUKA 3PWSA 4KTVE 2X0IA 2WJPA 5CPFA 4RZIA 5L95A 1JKIA 3ANLA 4IQ8A 3R3SA 3OIGA 4DWVA 2W2LD 1GPDG 4L4RA 1B16A 3GOHA 3KZVA 1U2DA 2ET6A 3QVXA 3MOIA 3I9KA 1GD1O 5L51A 1YDWA 3ZV4A 1ADCA 1VPDA 4J9VA 1EK6A 4WPGA 2VQ3A 1NVMB 3HDYA 3D5TA 1WZIA 3PQEA 4D7AA 5T5QA 5KVQA 5B4UA 1WP4A 3NTRA 1ISMA 1EUCA 4OHUA 2IXAA 4BO0A 1I3LA 1P44A 1ISFA 1HDOA 1UP4A 1UZLA 2CVZA 1E5QA 4ROSA 3PDUA 3TWOA 4NU5A 1MG0A 4MKXA 1BHSA 1LDBA 2NUAA 2H9IA 3PIIA 3AUUA 1HLDA 4YJDA 1PJ4A 4I9UA 4CM9D 1BW9A 1CDOA 5MDHA 1DC3A 3QHAA 3WB9A 1YVEI 4FN4A 4D42A 4J6FA 3OEWA 1BG6A 5KVCA 1MP0A 2PGDA 3GHYA 3GVXA 1Y81A 1I01A 3ROMA 1YGYA 4IDEA 5CDYA 2X5KO 1U3VA 2QQ5A 4IPTA 3D1LA 3QRWA 4WNCA 2YUTA 3A4VA 1X7DA 2GSDA 3KEQA 4XA8A 3H5RA 4YJHA 3WX0A 2YHIB 1N9GA 3FBTA 3TSCA 4BKPA 1VKNA 4BS9A 1PU2A 1PQWA 4PG5A 1AXEA 3UFXA 4LISA 1ZCJA 4PG8A 1U7HA 4KUEA 2JFFA 2BMAA 1JQBA 2OOSA 5DZSA 1R15A 4U6QA 3IP3A 3W8EA 4RVFA 4RZHA 1GL3A 4WOJA 3JQBA 4EUEA 2RHCA 4TQGA 1YL5A 4IDBA 2O3SA 4XJSA 4B4OA 1NQ5A 5TLSA 3KETA 1PGJA 3GEDA 1JKFA 8LDHA 1Y8QA 3BYZA 3IMFA 1C1XA 5A9RA 3RKUA 1GCUA 4DBZA 2PFGA 3GT0A 3MJCA 1NBOA 4R69A 3Q9NA 4EJ6A 1UXJA 2VZ0A 4D46A 1E5LA 4R51A 2V6BA 3DFUA 4GGPA 1LXCA 4ND2A 4S1VA 4E5KA 3NGLA 1BXZA 5DN9A 1U4OA 2AE1A 1E3LA 1PQPA 2NADA 3E5MA 2RBEA 1UDAA 5ER6A 4XKJA 3VHRA 3TF5A 1AHHA 1RM5A 4DBVO 4EEZA 4E2XA 1JA9A 5A9TA 1U5CA 5CEJA 3VPSA 1HWYA 3PFFA 4UUPA 4FDAA 2A4KA 5I7FA 3OP4A 5DOVA 3KV3O 4R16A 4TVBA 3WIEA 4CQMA 3L4SO 3KBOA 3ITDA 3M1LA 4B8WA 3KO8A 3FSRA 3OA2A 4MKZA 4O59O 3WS7A 3VTFA 1CJCA 3F3SA 2BFMA 1CF2O 2BGMA 5BSFA 1PS8A 3VKVA 4IINA 2V6MA 3ZNNA 2NU9A 1Z6ZA 4YWJA 3I3OA 3OBBA 4PCVA 1MA0A 2CDAA 3D5QA 2FWMX 1NPDA 3ZWNA 4EJMA 3DMYA 3QIVA 2WYVA 4OKNA 4R4JA 4UEOA 4GVXA 5JAIA 3RUFA 1A9ZA 4QFCA 3OSUA 1C0KA 4L74A 4NBTA 4BL5A 4XQCA 3KYCA 4Q39A 1VL8A 2I5PO 2OL4A 1O0SA 3HDJA 3MJVA 3TFOA 4Q3NA 1PTJA 3NUGA 2P9GA 3IOYA 4JBHA 3WYBA 4MVJM 4BIIA 2A9FA 2DUWA 3N58A 5KKCA 4ESOA 4Z9FA 3NEPX 4CM3A 3JQGB 4FOOA 2AE2A 3L6DA 4RLSA 5JE8A 3HDQA 1C1DA 3BHJA 3PDJA 3U0BA 1PEDA 2AEFA 3ZWVA 1ZZEA 3MEQA 3DDNA 2G82A 1U2GA 4BB5A 4AVYA 1ISIA 1Q0QA 3JQ8B 4AJ1A 2BHLA 1XYGA 3WMXA 1J4AA 4MP6A 4PLGA 3I4FA 1YONA 3U5TA 1GYRA 4IJKA 1ZJZA 4KP7A 4CM4A 1Q0LA 1HYGA 4TZKA 4MINA 1X0VA 4YB8A 1GPJA 1VC2A 3NV9A 1CQJA 1UXIA 4FFNA 4PG6A 5A06A 3GDOA 2FY8A 2AA3A 3F1LA 3KXDA 4FC6A 3GFGA 3SJ7A 4UREA 4CLEA 1DRVA 4YT8A 3FBGA 2JCYA 3NJ8A 4IUYA 2BH9A 1EK5A 4WK6A 5I9MA 3OETA 4RVDA 4CLOB 4OJNA 4EITA 1LQTA 5BSEA 3ZU5A 3SVTA 4JP3A 3ZNOA 3AOEA 3FWZA 3ZDFA 4D3FA 3AM3A 4DIFA 5JCJD 5KWEA 2W8ZA 4RVGA 3VTZA 3DZHA 1LSJA 3AUTA 1LNQA 3PGXA 1OBFO 1V9LA 1H5QA 4IJVA 5A5EA 1BXGB 5B1YA 5JCXA 1KVQA 4CV0A 3GH3A 4BNXA 1DOHA 4R9SA 1ZJYA 1XU7A 4RCVA 1WWKA 2VHVA 3UW3A 4A7PA 3E9QA 3FI9A 4KQXA 5EQFA 3VPFA 4DC1A 3B1JA 4JP2A 2ZJ1A 2NVWA 3DZKA 2BI7A 3PQDA 2I65A 1RKXA 3V8BA 4U0JA 2Q2QA 2ZYDA 4IMPA 4RPKA 1BRMA 4TZTA 3ZWWA 1YB5A 3JQ9C 4EJ0A 2AG8A 5JAMA 1NNUA 4WGGA 4BNKA 1VL0A 1LDEA 5DCYA 4NJMA 1A7AA 1KOLA 2XF8A 3UOGA 4BO6A 4FIZA 1P1IA 3BHMA 1PZEA 2NWQA 1WXDA 4M55A 1XU9A 1I2CA 1NAIA 4GKVA 1QSGA 3G49A 4U6SA 4DPLA 3GGGA 4LCJA 4ALJA 3FTNA 4BGIA 4WCDA 4ZGWA 2C82A 1LRJA 5A4DA 2WE7A 4N7RA 5IDXA 3GAZA 4IDDA 5JAQA 3IL2A 2GN4A 1VM6A 3DQPA 1KVUA 2BFPA 4QXMA 2Q1TA 1P45A 2YZ7A 2AQIA 2ZTLA 5BNIA 3OIDA 4MVJG 1AE1A 3DB2A 4J1TA 4UEJA 4BNVA 3QWFA 4HP8A 3E18A 3O8QB 1N8KA 2J3JA 2Z1MA 4Q3CA 4XX0A 3VKUA 2Q45A 4EZBA 3H3FA 5G4KB 3K9QO 3BMQB 4TKMA 5ER9A 3U4DA 4HX5A 3ZV3A 5G0SA 1MG5A 4YQZA 2LDXA 1H0KA 2HQ1A 3FNGA 3HN7A 4J2HA 4AG3A 2FP4A 5DCWA 3T4EA 2HRZA 1ZK2A 4NHEA 3VPXA 4P22A 2BKAA 3F6YA 4O63O 4LMPA 4BV9A 3C1AA 1YQXA 5EINA 4BNHA 2ZKLA 1PGNA 2YY7A 4WEQA 4U7WA 1GDHA 3I9MA 3VAZA 3WICA 4F6LA 1R12A 3QV1A 4NK5A 3AJRA 4E21A 3JYNA 2Q99A 1FDWA 1P1JA 2AEJA 3HDHA 4FFRA 4CLHA 3OQ6A 2EJWA 4BMNA 4M1QA 3Q11A 4E6PA 2C29D 1K6JA 2EF1A 4XD2A 3DBLB 2QX7A 5DBIA 3WGGA 4CM6A 1KEVA 3A9WA 2FPIA 3DOCA 3H2SA 4KQWA 3JD1A 4AL4A 5JS6A 4QO8A 3ZHYA 4W6ZA 3BTSA 4XRRA 1E1NA 2J5RA 2O2YA 2ZTVA 4HFJA 1DIGA 1GFSA 2NQTA 3WMWA 4CODB 2QG4A 2HUNA 3D4NA 3EDMA 2PKQP 4YAEA 4GGOA 4YA6A 1YS4A 2PKQO 3K2EA 5L40A 5DNAA 3JQBC 3GY0A 4MJLA 3AI2A 1IZ9A 3WIDA 2P5YA 4NH4A 4EDFA 3M1AA 1R66A 2FZEA 1MGOA 4YACA 3R6DA 4N5MA 1T4BA 2YJZA 5EIOA 5FI5A 5HS6A 3U3XA 3ZHXA 2JL1A 3B70A 1MXFA 3RUCA 3WG9A 2AW5A 1LX6A 2AQ8A 4L76A 1DLIA 3UH1A 1UP6A 1ZW1A 1PJCA 1ZSNA 1D3AA 1SB9A 5TQVA 2GERA 4IQGA 2VNAA 3KM0A 3ENKA 1H6DA 1AGNA 1Y1PA 1Z7BA 1X15A 7MDHA 1I24A 5C7LO 4NG5A 1ENPA 2YW9A 1KC3A 4PLCA 3S2IA 4WOKA 3S2EA 3QWBA 4IDGA 5KVSA 4GL4A 4B4WA 2FSSA 1QV7A 1DFHA 4CMAA 5I8WA 1OI7A 4FJ0A 3SX2A 4KUGA 3PHIA 4FD3A 1LLDA 3QVSA 4YVFA 3W8FA 4XEHA 3V1YA 4O5OA 2BGLA 3IAHA 4NMHA 5KNLA 1Q1NA 4L0QA 1K2WA 1Z75A 4IIUA 4Z0PA 2Y99A 1IL0A 4IIVA 5JYDA 3RFVA 3OHSX 3F4LA 1Y9EA 1E7WA 4OXNA 4AJJA 4AJLA 3ZWXA 3O8QA 3FNHA 2FN7A 1ONNA 3IUPA 3Q0EA 1HE2A 4WCFB 3ASUA 3DAPA 2WMDA 1HE4A 2Y05A 4E33A 3HFSA 5TF4A 3D64A 2ZJ0A 2CSUA 3F46A 5THKA 1X7GA 4DLLA 1ULUA 5LCXA 3FF4A 2Q46A 2FSVA 1B3RA 2GNAA 4QX6A 5COQA 5K0ZA 1SNYA 3C7CB 2HU2A 2TMDA 3LC7O 4E2ZA 3K31A 1NQOA 4PLHA 4R41A 5A1TA 1YQGA 1LUAA 3ZWAA 3C24A 3UGKA 5CFZA 2HK8A 3V1UA 2I6TA 3RU9A 3DHNA 2B4QA 1J5PA 1MC4A 4ALMA 5AXCA 2JHGA 3ANMA 2OHXA 3ZV6A 5DT9A 3DFZA 4C7KA 1QYWA 2WWRA 3DEYX 2CUKA 2EWMA 3HQ4O 2RHRA 1ZK1A 1SAYA 2FRDA 4R3NA 1W0CA 5F3RA 4R1NA 4O6VA 4WNIA 3GHHA 4MVJP 3P2OA 1U3UA 3X2FA 4YYZA 3D0OA 2DBVO 1AXGA 1A4IA 1CYDA 4PLFA 1X1TA 4CR7A 4LRTB 5ENVA 3O03A 5I7SA 3DZBA 5JYEA 4J9UE 1E7YA 1P31A 1XIVA 1KY5A 2JAHA 1N2SA 1AN9A 3OJOA 3ZCXA 3KEOA 3F47A 1LRLA 5IXYA 5KIAA 2X9GA 3BA1A 3H3JA 3QVWA 4C4OA 5HTOA 4CMEC 5IDWA 2Q50A 4E3ZA 3RFXA 4R3WA 3PWKA 5EQDA 3OECA 1RPNA 1SEPA 2GPTA 4OH1A 4FB5A 1ONOA 4I08A 4WCFC 1YBVA 1HF3A 3DHYA 2QRKA 4QO7A 2IDZA 4WLOA 4JQCA 4YJFA 5BNTA 2ZYGA 4Z9YA 1FJHA 2XAAA 4Y9DA 1FF9A 4AICA 1HDRA 5G4KA 4DIOA 4GX5A 1LDNA 1E1KA 4UUNA 4ZQBA 5B4VA 2D4AA 3QJ5A 1TEHA 4J0EA 3BMCB 3Q1LA 9LDTA 3PYXA 4CL8A 1EVZA 2PZKA 5AXAA 2PV7A 3TNLA 2RH4A 3PHHA 4MVJD 4LVUA 3P2YA 4NDNE 2C2XA 1HYEA 5K6AA 1WMAA 1CETA 1XEAA 4YJGA 4I8XA 2O4UX 5IZ4A 2C2YA 3PK0A 3AM5A 4FFLA 2GCGA 1T26A 5GZ3A 3UF0A 1MX3A 3VPHA 4Z6KA 5KOIA 1SPXA 1GQYA 4OMUA 3MTGA 4ALLA 3HFGA 4QFDA 1PZFA 4DTIA 2W4QA 5JY6A 2VHWA 2HMVA 1DIBA 3PHLA 4L9RA 4TSKA 3IS3A 3TN7A 3UICA 1J6UA 2CVOA 2IODA 1GV1A 5B12A 5A3VA 1Y8RB 1DFGA 2QW8A 4W9NA 1FDTA 4ZA2A 4GX2A 5I8ZA 1EUDA 1F06A 4XIJA 4D41A 3FWNA 3RC1A 3JQAA 4FJ1A 4CM1A 3ABIA 2VT3A 3DBRA 3MTJA 3FNEA 4J49A 3K30A 4WE3A 3BTVA 1D1SA 4DREA 1VL6A 2GD1O 2DAPA 4MIYA 1ADFA 1V6AA 3GUYA 4PLZA 1DIHA 2C7GA 1LSSA 3RSHA 2Q2WA 3I23A 4EUHA 5EERA 5L7YA 4Q3AA 1PJLA 2O2SA 4IXWA 1EEHA 3NT4A 4J1NA 2Y1GA 1GZ6A 3H6KA 1UH5A 3EZYA 4CLRB 5JLAA 5GMOA 4J43A 3ZI0A 4WUVA 1VSUA 4MVJE 1GAEO 3IJRA 3LT0A 4ZRNA 3GVCA 1M66A 4ZQGA 4BNUA 4NK4A 5JY1A 4XDZA 2R2GA 2G17A 1DC5A 1ZKMA 3NT5A 4Y6RA 5U1PA 4PGFA 3DHEA 3GZ4A 4BHTA 4BNJA 2GR9A 1YL6A 2UAGA 4IM7A 4CV2A 3FRJA 1SEVA 1GQQA 3F5QA 1I2ZA 2X0JA 4MVJA 4CV1A 4OXKA 1U7TA 2AG5A 1E7QA 1NAHA 3ITKA 3A06A 3GQVA 5JMWA 2Y1FA 2NVUB 5A9SB 3PZRA 4XR9A 3MWEB 2E49A 2HMSA 3G1UA 3RASA 3BMQA 1A5ZA 3U49A 4OOFA 4DMMA 3EZLA 4ZRMA 3TZQA 5DP2A 1Q7BA 1HE3A 3C3XA 1DPGA 5CDTA 4FJ2A 4H15A 5K9ZA 1P0CA 1VJ0A 3L9WA 1LLCA 5JPIA 1Z74A 4JK3A 4B7UA 2O3UA 3EC7A 3OIFA 1JWAB 1HSOA 3H9UA 1EVJA 1O8CA 1WW8A 1K89A 1XELA 2O3RA 3GEMA 3I9JA 3K96A 4TWRA 5F1OA 3PIDA 1V8BA 1XDWA 1LC0A 2VWQA 3GPIA 1EBFA 4NBRA 1NWCA 2OMEA 2X9NA 1UP7A 4R54A 4CLDA 5T67A 3C7AA 1T1RA 2BELA 1NTOA 4ZICA 2EGHA 3GNTA 3KSUA 4N54A 1D4FA 2OBNA 4KWHA 1Z45A 4DQUA 5A04A 4BO1A 4PIVA 3ZWYA 3GC6A 4RDIA 5TX7A 2ZCUA 3KSDO 3NX4A 3K5PA 4DL9A 3MJTA 4IZHA 1DO8A 4OOEA 6LDHA 1JW9B 3PFWO 1NX6A 4BNYA 1TB4A 1KEWA 4J4HA 5FEUA 3GA0A 3PHJA 3L9XA 4MP3A 4A26A 3KRTA 5HA5A 2ZQZA 2J6IA 3AI3A 1OZAA 4YBZA 1UXHA 3RC2A 4BNGA 4CQMD 1WLYA 1HDCA 4J7CA 3PJFA 1E77A 1LJ8A 5GY7A 4D0SA 1T1SA 1V3TA 3MJ4A 4ND3A 5AYVA 3E82A 4GLLA 2XXJA 1HETA 2Y67A 1YB1A 1UDBA 2C7VA 4DRYA 3ASVA 3PHGA 3ZW9A 1E3WA 1PGOA 2PD4A 1QG6A 1O94A 3WGOA 4KUHA 2EW2A 1CRWG 5HBRA 1CEQA 1Q2XA 3E03A 5LDHA 1JLLA 4J1SA 5H83A 1N1EA 1ZK4A 4FQ8A 2CF5A 4LN1A 4U5QA 4WLVA 3ICCA 2HMWA 2PH3A 2SCUA 3JQ9A 1BDMA 3SC6A 2W2LA 2W90A 3WSWA 5C5IA 4J2OA 3CZMA 3SLGA 1PJQA 2EKLA 3KB6A 3O38A 5KTKA 2HJSA 1DIAA 2OZPA 2PZLA 1NVTA 4YT2A 3JYLA 1DIRA 4PVDA 2JCVA 1I3NA 3BIOA 1ADBA 2VYNA 5ICSA 3QLJA 5CP8A 1NP3A 4OAQA 4P4GA 1TT5B 4Q3BA 3FNFA 3MOGA 5A05A 4MDHA 1PSDA 1A72A 1IZ0A 2B36A 2J8ZA 4UUMA 3WJ7A 1E6UA 1HKUA 1QXSA 3R0IA 1TVEA 2OGUA 3QY9A 3F1KA 4EGFA 1TA4A 2Y0EA 2OORA 1EE2A 2Y0CA 5JDCA 1Y8RA 3GN1A 5EESA 1P74A 1ZSYA 2UDPA 2D8AA 4I5DA 1B26A 1QYXA 1LQUA 3EVNA 3DBRB 4JJFA 4R1SA 4WEOA 5L7WA 2PD6A 2YV2A 1Y8QB 3SLKA 1YDEA 3QWAA 1IE3A 2X22A 4I9HA 3S1LA 3FR7A 3LQFA 1Y9AA 1M2WA 4UVHA 4R1TA 3VDRA 1ZIDA 4YRDA 4XQ9A 1WNTA 3RC9A 4BMVA 4DLAA 3GUCA 4PLTA 1IYZA 2QZZA 1HDGO 3P7MA 3QVOA 4KWIA 4YPOA 4J1QA 3DTTA 5HS4A 1FDSA 4OIMA 4LSWA 2EV9A 4WCFA 3ZNPA 4IDCA 4CMJA 5A9SA 1SB8A 1I33A 4JNKA 1O5IA 4KDFA 1PGPA 1N1GA 4BB6A 3UAGA 2OXIA 3DAGA 4CQMB 1DRWA 3GK3A 3PTZA 3Q6IA 4XJTA 3OM9A 3GG2A 2V65A 1RM0A 1UJMA 1GQ2A 4XR4A 3PI7A 1KYQA 2O48X 3G0OA 1T2AA 4L8VA 5B37A 1QYDA 2VRCA 4L73A 3LC1O 3W4KA 5BR7A 3EY4A 5JC8A 4FBGA 1LLQA 1ZUD1 4B4VA 1CWUA 2R00A 3ONEA 1HE5A 2NTVA 1ZK0A 3EGOA 3NGXA 4YT4A 2JFGA 3DOJA 4GLOA 3O4RA 1ADGA 2DTEA 3DZJA 2PKRA 4CM8A 5G0WA 1ZXBA 2XXBA 5F1KA 2YDXA 3DTYA 5JCJA 4BGUA 2P4HX 5JNLA 2EW8A 2DFVA 2VN8A 1JAXA 1LI4A 3JTMA 3ZGYA 1NVGA 3H7AA 3IJPA 1QORA 5JMPA 4M49A 4Z3DA 2Q1UA 3I9LA 1N7HA 4RPLA 4Z0HO 4BNMA 2EXXA 2ZB8A 4HFNA 2DVMA 4RVSA 4E0BA 3GZNB 5IXSA 1N5DA 1AHIA 4DGSA 4J4BA 2VYND 1UDCA 1V3UA 1R4NB 3W8DA 1KVRA 3WGTA 1DXYA 1KEPA 1ZEJA 2POQX 2Y1CA 3GEGA 3S2FA 1GZ4A 3IKVA 4BO3A 5TS3A 2HLPA 4TROA 3PJEA 1PX0A 2JFHA 4B79A 2JD2A 2V6GA 3IUSA 2ZATA 1H6CA 3RKRA 4J4TA 3DMTC 4DIBA 2Z95A 4JBGA 3OFSA 2B37A 5TC4A 1PZGA 1O9BA 2YV1A 1B8UA 1A7KA 5EL0A 2DTDA 3V2GA 2P91A 5A02A 4HNGA 1ORRA 4E31A 4D3SA 5GZ1A 4YRAA 5K6AC 3ANNA 4HKTA 1LLUA 4IXTA 2Z5LA 1PJTA 3GVPA 4AJOA 1PL7A 2HO5A 1VRWA 4GWGA 1UAYA 1MV8A 4HADA 4FFPA 3AOGA 3MJEA 4PLVA 3ZWMA 3WGIA 1U8XX 3INTA 4AJ2A 1ONPA 1OC4A 2DLDA 4ND5A 4JROA 5KJCA 2GN9A 2YYYA 3INRA 2PK3A 1X0XA 4H7PA 4RVHA 3HADA 4XYLA 4I5GA 3H9JA 4D44A 4GX1A 1T2CA 3UCEA 3QE3A 1FXSA 1RYDA 3W6UA 4MVJH 2QIOA 1S6YA 1E3EA 3WTBA 3KYDB 2Q2VA 4FSHA 1T24A 2IEDA 2VWGA 4R5HA 1YB4A 5ITVA 4FOSA 4HBGA 4NBVA 1XKQA 3ONDA 4ZU3A 2J3HA 3LSYA 1LSUA 3FN4A 4PLWA 1JVSA 3AFNA 4I5FA 3HZZA 3RROA 5IDYA 4ND1A 1XQ1A 1YE3A 2C54A 2FPPA 4E5PA 4E5YA 2O3TA 4LMRA 1F17A 3JQAD 3STHA 4IQ0A 2WD7B 1E6WA 4Z0TA 5FYDA 3ZH2A 1R4MA 1B8VA 1I8TA 2IEBA 2GDZA 3OQBA 1LTHR 2D0IA 2Y1EA 4K26A 4E2WA 2RAFA 4NBUA 4L4XA 5EN4A 4PRLA 1LDMA 3JD0A 4FR5A 1XA0A 4FGSA 2O3JA 3ULKA 5F1PA 1XHLA 2NU6A 3RCBA 3BMNA 4HV4A 2B4RO 3VC7A 4BKQA 3L07A 4RF3A 1KVTA 1NR1A 4MP8A 4RJTA 5HRUA 2X9VA 4PLYA 1EQ2A 2VRCD 3OF2A 3G1TA 3AM4A 3RUDA 3WLFA 1TT7A 5TT1A 2JJYA 1LDYA 3V5NA 5C7OO 4JN6B 2EIHA 3M2PA 3TQHA 5IN5A 4UVEA 1LDGA 3NT2A 3VH1A 2PZJA 4KZPA 1TLTA 1W8DA 2I67A 3QVTA 4BQRA 1YXMA 3AY7A 4XRGA 3GNSA 3JCZA 2H6EA 5G0VA 1NHGA 5CDUA 3JQCA 2OFPA 3KTDA 3ON5A 1B0AA 3RU7A 1XGKA 1H9BA 1I3MA 5HM8A 2EG9A 3MCVA 1E3IA 3GAFA 4R5MA 4CR6A 1GUYA 4UVGA 3KLMX 1NFQA 1R4NA 3PGJA 3PQFA 4XGIA 6ADHA 1R6DA 2X23A 4X54A 1ZMOA 3LK7A 3K6JA 4O0LA 1WZEA 2NQ8A 4LVCA 3NDJA 1DBVO 1BTOA 3TL2A 1WDKA 4LK3A 1YBAA 4AJEA 3PYMA 3RQSA 4AJ4A 4M86A 4YAKA 5AXDA 5C37A 1MC5A 5U4QA 3LLVA 2NV6A 3VH4A 1NYTA 3B1KA 1E0DA 2HMUA 1X14A 2VWPA 1WAMA 5L3ZA 1HZJA 3CZRA 1YJ8A 1UUFA 4TVOA 4BUCA 1ULSA 3UVEA 1OMOA 1QRRA 2B5VA 4N5LA 2R00C 1OFGA 5EMHA 4OO3A 1D7OA 3MZ0A 1DC6A 3HJAA 3ADPA 3DBLA 3VZSA 4CLXA 3X2EA 4TRRA 1E1MA 3BTOA 4PRKA 3S2GA 2DC1A 2W2KA 5ILOA 4OYRA 1QR6A 2BF7A 2IYOA 3AUAA 3LZ6A 2FOIA 2WD8A 2DBZA 1ZH8A 1NASA 2A35A 3F9IA 3B20A 1UAGA 1P9LA 4UEKA 1IHYA 3AWDA 2GO1A 1NHWA 1WMBA 4WLFA 1A71A 1YL7A 2X5JO 3JV7A 4Y98A 4BOYA 1HZZA 3WR5A 3UHAA 4GAEA 2HCTA 4UVDA 4BMSA 2VYVA 4EYEA 1BWSA 2NTJA 4U8GA 5AQ1A 4CUKA 3E48A 1ISHA 2HDHA 2E6UX 2VOEA 3FD8A 3ZWCA 3JD2A 5EPOA 4IS3A 3PRJA 4GQAA 1MFZA 2Q4EA 2IZZA 1E3JA 3TL3A 2E4AA 1KEUA 1NPTO 1P33A 3ZU2A 3AUSA 2YFHA 1DDOA 1I2BA 2Z1NA 1YO6A 3GF4A 4ND4A 4A27A 5J23A 1YQDA 4RO0A 1BW9B 1Q7GA 2GGSA 4EUFA 5KJFA 3AW9A 4ALIA 2FR1A 3DZIA 5ENDA 1K0UA 4F6CA 5T64A 1GYQA 3C1TA 4BV8A 3L6OO 4NR0A 1DFIA 4RV9A 2X7HA 3HB5X 3TOXA 2I9PA 2X0NA 3I9NA 2VUSA 2ZK7A 1DJQA 3EAGA 3KHUA 3EUWA 4CMBA 5TJ9A 2VRBA 1PR9A 1H93A 2NU8A 3HE3A 2P68A 1EUZA 1UR5A 4CL3A 4R1UA 5CDSA 3JD3A 2AQKA 2EGGA 4ALKA 5I9LA 3QA9A 2Q1SA 2PGJA 1DB3A 5TRTA 5L4SA 1RWBA 2YV3A 4XGNA 1ENOA 4RF4A 5TJHA 4UVIA 3EW7A 1PQUA 3A28A 1SOWA 3GFBA 4AJNA 2P9CA 3WFIA 3QP9A 4YAJA 1C0LA 2JD0A 1E3WB 2D5AA 5TIIA 1DJNA 1BXGA 1GUFA 1W73A 2ZB3A 2C07A 2C20A 4RGBA 5L45A 4NFHA 4GMFA 3VDQA 1E92A 1KY4A 1NQAO 1VKOA 3ENNA 4M87A 4XGKA 5IZCC 2E48A 1F14A 1QMGA 2ZYAA 4II3A 4A10A 3BMNB 1GV0A 1A27A 3RAJA 4CLOA 3ZU3A 2YFQA 2I76A 3VVCA 1EFKA 1NXQA 3AU9A 3GDFA 2HMTA 2CNBA 3NAQA 4PLPA 1O89A 3RFTA 3LT2A 4NJMB 4D79A 3TZHA 2AEMA 2Y68A 3PZBA 1E1LA 2Q4BA 3W6ZA 3C7DB 1ZMTA 5CPBA 5H82A 1Z7EA 3V2UA 2AQHA 2I99A 1L7DA 3G17A 4KDEA 3VZQA 2IZ0A 3N7UA 1HRDA 2NVBA 1U8FO 2DU8A 3WOHA 2XOXA 4Q9NA 4D3DA 2NM0A 5A03A 3RUHA 1MLDA 3CE6A 1F8FA 2FHSA 3BAZA 2BFAA 3IP1A 2IRWA 1J49A 1P1KA 3FR8A 3GG9A 2O23A 2IZ1A 3IQDB 1KVSA 3DAFA 2DFDA 7ADHA 3ADOA 2FPGA 4CMIB 4BNWA 3IKTA 4B7CA 4CM5A 2HJRA 4B3IA 4JGBA 4CQLA 2EKPA 3A14A 8ADHA 2VNSA 2HAEA 4Y67A 4LW8A 1D8AA 1W4ZA 4RLHA 4IS2A 1X7HA 1NM5A 2WYWA 1GEEA 1XWFA 1M67A 2VTDA 3NDIA 4Q3DA 1P1FA 4K6FA 3ETGA 3RUEA 2DBRA 2D59A 5L4NA 2CD9A 2BLLA 5ES3A 1HYHA 4XYGA 5GZ6A 3I6IA 4RPJA 5JDCC 4BKOA 4G2NA 3SC4A 4B8ZA 1KIFA 4NQZA 4BVAA 3O9ZA 2ZCVA 5KJ6A 5B4TA 4XQEA 1VSVA 3B6ZA 2VTEA 4WLUA 3WWYA 2Y93A 4LGVA 4AJPA 1CQIA 1CERA 3OJLA 1HDXA 2H1SA 3WBFA 3D3WA 2DBQA 2UYYA 1A9YA 1Z73A 5DP1A 3L4BC 3JD4A 2W98A 1F8GA 4ILKA 1QKIA 3ROPA 2C59A 1H6BA 3I83A 5DDIP 3WTCA 1GADO 5KKAA 4XZ3A 1I5RA 3BMCA 1U3WA 5C3MA 4CV3A 4CR8A 4A0SA 2GZ2A 5CG1A 4DPKA 4RL6A 4HWKA 3GPDG 1N9GB 1PGQA 1G0OA 2OP0A 4RQUA 2IXBA 5DBGA 5AVOA 5ILGA 2DPHA 1NQTA 1VJTA 1YH3A 1XR3A 1QV6A 2PR2A 1R16A 1M6WA 2PD3A 4FPXA 3KYDA 2G76A 1V35A 3WGHA 3EVTA 5F21A 2BGKA 2GLXA 3LDHA 3JYOA 3RBXA 4GX0A 1I36A 4IY1A 4E32A 5KJ1A 2R6JA 1B7GO 1KC1A 1DLJA 4K28A 4TRNA 3ZV5A 2CDCA 5HWSA 3FCOA 3G79A 2VCYA 3MWDB 4L4SA 2PZMA 2P5UA 5T8KA 4BNZA 4LRSB 3IC5A 1IHXA 1YJQA 5JDIC 1BXKA 3NYWA 5A5FA 3T7EA 3OEYA 1MUUA 1K3TA 1P1HA 5COAA 2VUUA 1ID1A 1EZ4A 1OAAA 2OP1A 3WWZA 1UXGA 3OH8A 3SXPA 1DC4A 1FK8A 5U9CA 3Q9UA 1LBEA 4F45A 4AJHA 5THQA 4ZJUA 4BQPA 4BO8A 5BQFA 1I0ZA 1K6IA 4E30A 4R01A 3D3WB 2GYYA 1DSSG 2NLOA 1Y6JA 2GF2A 3NTQA 2F00A 2DTXA 1JAYA 1BSVA 4BO9A 2G1UA 3CSDA 2EEZA 1PWXA 2I3AA 3QW2A 1PS9A 5LDGA 4Z9XA 4CJXA 5TGDA 2YHIA 2QYTA 4MPDA 3VVBA 3TZCA 4DLBA 4F46A 3PP8A 4K9DA 1DAPA 2J3IA 2OO5A 1IY8A 4MKRA 1WPQA 1R37A 1K5HA 3GRKA 3INGA 4JJGA 3ZN2A 3I6QA 1EMDA 1OC2A 4IGFA 4ZQHA 3RIHA 3JQEA 4KOAA 3LT1A 4WKGA 3K2BA 4BO5A 4DXHA 4GI2A 4PVCA 4JJIA 4FFOA 5MGBA 4RPHA 4DQXA 3VH3A 4OXYA 1FDVA 1EDZA 3L6EA 4MVJF 1C0PA 4Y6SA 4O1MA 4BGEA 2D3TA 1GYPA 1LC3A 1VJ1A 1BVUA 1C3VA 1G1AA 1Y5RA 1I32A 3OJEA 4P38A 3ZWOA 1UZNA 1C1XB 1HDZA 3JQGA 1M75A 3SBOA 4YXFA 1P3DA 4FW8A 2CVQA 4BNIA 3ZNQA 5I7VA 3CIFA 4ID9A 4RQTA 4B7XA 4I5EA 2BFOA 2D5CA 3BTUA 2WD7A 1H94A 3GDGA 5LC1A 2B5WA 2VT2A 4EW6A 3E8XA 1IUKA 1XCBA 4OSOA 4CM7A 3A1NA 2CY0A 2P4QA 4W9NC 1TT5A 3FTPA 4TRMA 3JQ8A 1Q7CA 1WDMA 1JN0A 2EJVA 2NU7A 3BHIA 3K8ZA 4QTZA 1QLJA 4YT5A 1MFPA 2BI8A 1GY8A 3G3EA 3D4PA 3PLNA 3L4BA 3RUIA 3VZPA 2FZWA 1JTVA 2GRAA 4AJKA 2HRBA 3HNPA 1RYEA 1SMKA 1N7GA 4FGWA 1ZK3A 3WGZA 1PR3A 2H63A 4IBOA 5CHEA 2X4GA 5JBIA 1L7EA 5BSGA 1KBZA 5JAZA 2B83A 1LEHA 3ZZNA 3ZHZA 2P2SA 3P5SA 1AUPA 3WBBA 4ZVVA 4J3FA 3PLRA 3UXYA 2X5OA 3RBZA 3D7LA 2HK9A 2EERA 4UULA 3COSA 4JIGA 4UUOA 4GH5A 4ZQFA 3JQFC 4ZN6A 1O6ZA 1I10A 2IE0A 4ONEA 4AFNA 3RI3A 4JBIA 4E5MA 1ZXLA 4RDHA 3QWIA 3QSGA 4WASA 2B69A 1X13A 2Y66A 3R1IA 3KYCB 2O50A 5FF9A 5CEFA 3GVIA 3WNQA 3I1JA 4YRBA 4DVJA 1ZEMA 5C7IO 4XB2A 4CM4B 3LF2A 1D1TA 4DMLA 4ITUA 4OM8A 4JCOA 1KETA 2W2KB 5DULA 3WLEA 1HEUA 3ORFA 4E13A 1EDOA 3V1TC 4B4UA 3L77A 1KERA 1T25A 3JQDA 1C0IA 1L1FA 5L7TA 3CXRA 2O3QA 3TDKA 4E5NA 2X1HA 2UV8A 3KYBA 4WJZA 1X1EA 1BVRA 3ZHBA 4EBFA 2I66A 2PWZA 5JXWA 2J3KA 2YHUA 3BMOA 1H2BA 4IJUA 1VI2A 3P19A 1F0YA 4TKLA 1CIVA 4J91A 1KS9A 1B3BA 1RM4A 4DPMA 1B2LA 1E7SA 2CDBA 4URFA 3CKYA 3DZFA 4MVJI 2BRUA 5CDGA 2C5AA 3NKLA 3M2TA 4W7IA 3I52A 5COBA 1DHRA 5KCZA 5KJEA 4K1LA 4HFRA 2PTGA 4QEDA 3EYWA 2P9EA 5TNXA 2VYVD 1T4DA 4Q3EA 1U1IA 1YKFA 1Q0HA 1YOVA 5TT0A 2X86A 3H5AA 2Q49A 1ZBQA 4GBJA 2B4TO 4R9RA 1PL8A 1R0LA 4JX8A 4XYEA 1HDYA 2PNFA 3U09A 3W4IA 1MXHA 1N92A 3PWZA 4CLRA 1ENZA 4QQRA 2WSBA 1TI7A 3QWHA 4B3HA 1PJ2A 3WSVA 2IYPA 4FS3A 4S3MA 4CM8B 3OJ0A 3GR6A 3WFJA 1G6KA 1B8PA 2JKVA 4OGWA 4MO2A 5G0TA 4YAGA 5BNFA 2GZ1A 3T4XA 4D0RA 9LDBA 3N74A 3KUXA 4J16A 1XQ6A 3ZW8A 4ALNA 1BMDA 3LYLA 4G65A 3H9GA 4HNHA 3W1VA 3ETEA 5I7EA 1IPFA 4NNJA 4N18A 3IDSA 2YQ4A 4QECA 4U0KA 1H6AA 4MIOA 5TSDA 3ST7A 3GMDA 2G5CA 3DBVO 3VZRA 4E12A 3I4CA 4GKBA 1PS0A 3SEFA 3VPGA 4XQGA 4CMKA 3DOOA 1H9AA 4XWYA 1XG5A 2HK7A 3WQSB 2DUUA 3R3JA 1BGVA 2AHRA 3MJSA 4DA9A 2X6TA 4LSMA 5IAAA 1A4UA 3D3EA 3DC2A 4PN3A 2WDZA 3V2HA 4OSPA 1NFRA 4YJFB 4ZHSA 1ISGA 1YBMA 3DWFA 4N5NA 3GGPA 4J90A 2WM3A 4RF5A 1IB6A 4F3YA 2E82A 1E6EA 4CUZA 3Q2IA 3E9NA 1FMCA 5FFFA 3BMOB 4BGVA 3TRIA 2EP7A 4WLNA 1GZ3A 3H9QA 3HUDA 4C7JA 3T7CA 4CMEA 4CMCA 1EVYA 1ISJA 5I9NA 4BNLA 1K6XA 2QRLA 4I9NA 4NFSA 1JVBA 3TFQA 3JQ7A 3KSZO 4EEXA 3FPLA 4IJWA 2QYSA 4FC7A 1EFLA 4PG7A 5DCUA 4HUJA 4M8SA 3DXFA 1E7MA 5G4LA 3U4CA 4D45A 5IZCA 2VUTA 3TJRA 3I9OA 4NI5A 2VHZA 3ETDA 4QSMA 4W99A 2V6FA 3RBVA 4Y8VA 5ADHA 3PXXA 3L0DA 2QHXA 1RM3A 3RD5A 4KMSA 4P8RA 1JWBB 2VZ8A 3TOZA 1DHTA 2PA3A 1P77A 4RPGA 5IG2A 3WYEA 5CEEA 5JSFA 1SOVA 4IMRA 1HT0A 3CMMA 5CAEA 4CQLB 2C0CA 4J7XA 3WNVA 3CINA 3WYCA 3CEAA 3KOUA 3DR3A 3WGYA 3VH2A 2ZQYA 4PZDA 4YJHB 4PZCA 1VE9A 1T2EA 3DZGA 4G81A 2UUPA 2E37A 4II2A 3B1FA 1GUZA 4YEDA 3CPSA 1I30A 3LF1A 4HXYA 4BNFA 4QT0A 4EI2A 2HKIA 3OA0A 5EJ2A 3OJFA 2NTNA 3DBHA 4G5HA 1U28A 2FMUA 4OQZA 4XDYA 3AFMA 2PH5A 5JW6A 2NNLD 4YCAA 4CMIA 3CMCO 2B35A 5AXBA 2NSDA 1LRKA 2NACA 4NFYA 3TZ6A 3WQRA 3IIEA 1PL6A 5CG2A 2FR0A 5F5LA 4TMFA 4YQYA 4W4TA 4CM9A 5IF3A 4WLEA 4H16A 3BZUA 3E6AA 2PLAA 1EQUA 3GRPA 4XIYA 1T2DA 3H8VA 4GSLA 2GN8A 3H4VA 4FCCA 5KVVA 3QQPA 4GMGA 4J7UA 3S8MA 1PJBA 3U9LA 2Q1WA 5IFLA 3UN1A 2VWHA 3Q3CA 4OL9A 1ML3A 2AXQA 3HHPA 4DC0A 4BO4A 1LU9A 2C5EA 4Y6PA 3PEFA 4RORA 1SZJG 2CZCA 3AU8A 4MIEA 1W6UA 1UXKA 4PZEA 5JO0A 4JXKA 4BNNA 2OUIA 1GTMA 1PJSA 4IZIA 4BO7A 1EVIA 2CFCA 1B14A 4A2CA 3ROKA 4E4YA 4LCEA 3LU1A 4H3VA 2F1KA 1XSEA 3HB4X 2WTBA 1QLHA 2YDYA 2I3GA 2HSDA 5JC1A 1V3VA 4INAA 3PYLA 4BNTA 1M6HA 2X0RA 3E5RA 3AY3A 1HXHA 2J5KA 3WGQA 5T8KC 3OMLA 4J0FA 1JDJA 2EKQA 3ICPA 3JQ6A 3PVZA 3CTMA 4A03A 1GU7A 2O7QA 3GMSA 5JDIA 2PGLA 5AOVA 1R4MB 2Y1DA 2EHDA 2O7SA 1QYVA 1I3KA 4XB1A 5DOZA 1B15A 5L53A 5G0UA 1HLPA 5JFOA 3UCXA 4XYBA 3RUAA 1ZNQO 4GSKA 2AMFA 3UKOA 3U62A 1U3TA 1ARZA 2EP5A 4YTEA 3U4HA 1NR7A 4BO2A 3DL2A 2YQ5A 3OQ1A 1YOVB
chains in the Genus database with same CATH superfamily
4GVLA 1DO2A 1FNMA 2HREA 3ZI7A 1VBKA 3B2QA 3F67A 2VXOA 1JZTA 1VP9A 3R7SA 3FPBA 3COJA 4C4ZA 1T0JB 3KYJB 5CM8B 4E2YA 2CLMB 1AX9A 4O2RA 2OD2A 1HFEL 4A4DA 4ZQEA 5C52B 4ZT4A 4DMGA 4X41A 1W2WB 4A73A 2F55A 4QOGA 4EB0A 1CY2A 4NARA 2BSQA 3D4LA 4RJJA 3SJUA 2VZEA 2C3OA 5JI2E 2DF8A 2WU0A 1ZH2A 3DEAA 3S29A 4XD7A 2EX4A 4KRXA 3P9NA 5HCNA 1E7RA 2QLBA 1DKUA 2DXIA 4V1CI 1TJ4A 3GLUA 2EZ4A 2A9OA 4QDXA 1JGTA 3SMQA 3AK4A 1CR0A 3L8EA 4MK4A 5I7AA 1HOXA 1Q1BA 1S2IA 2OO5C 2W11A 1B76A 4AX8A 3CVOA 5J9FA 4JKYA 3OPYA 1BAPA 1M7BA 4HGOA 3IQXA 3ZKWA 4KACA 4UTNA 1KFBB 4DQLA 5C53B 3DO8A 1PWZA 4F5WA 3NORA 5GP1A 4MAMA 1YVDA 3V8QA 2RGUA 1BIFA 4RVUA 4C2AA 5ICMA 5KOJB 4TS9A 4MOWA 2TMGA 2GN6A 4MAAA 1I3CA 1ZO8A 4WOPA 1W94A 1KA9H 4WXPA 3EE6A 3QBEA 3U4QA 1ZHHA 3SZUA 4MRPA 3STUA 3D6FA 5K8CA 2GEFA 2ZR8A 3NCTA 4YDHB 5J2UA 2GZ3A 5FTKA 5L9AA 1PT8A 1IOVA 2OBYA 4YR9A 2XNKA 2ADOA 4DJ5X 3FFBA 1MOZA 5ESXA 5IC4A 2JLZA 4DYVA 2RJOA 4LF6B 5EWMA 3RJ5A 1YJBA 4DSOA 3QEJA 4CETA 3R5JA 2IYNA 3EZGA 4YQEA 3QPCA 2ZAYA 1E2FA 2AFVA 3ELDA 1Y7TA 4JYCA 2EBHX 4P4LA 2JHFA 1XZCA 3RYIA 3HJTA 1RKQA 2ZIZA 5CB4B 4M9RA 1LW7A 1V71A 3PQ6A 3QVLA 4TMKA 1FUEA 2IOFA 3UAYA 2F6RA 2QRUA 3I5MA 4KSCA 1Q92A 4WJKB 5E6SB 4BKRA 2CCJA 1RI5A 1N2GA 4M8NE 4YAIA 2GHRA 1COZA 3GH1A 4W8OA 3RGGA 4V1CA 3GLQA 5FR2A 5KNCH 4PR0A 1UM8A 1MPXA 5CJPA 1JU9A 4GZ5A 1EI9A 3ZEAA 1J42A 1ZMXA 3DO5A 1JHDA 1LWOA 1GLVA 4I4TF 5CTJA 1G2OA 2B82A 2WJWA 3K9NA 3KIPA 4NE9A 3GCDA 4RFSA 3SR4A 3STVA 4AJIA 1JDUA 3OOWA 5EG5A 3IJEB 1B93A 3UMRA 1IXSB 2A0YA 1G8GA 3LVRE 1P0IA 5DF1A 3C85A 4OPMA 2Q3EA 3RRFA 5JWHA 2PZ8A 3SF8B 1EFCA 3FG9A 3NM4A 1JJVA 4TT3A 3NRCA 3GRRA 5JCOA 3FHLA 4OB7A 3FOWA 3CZAA 3GFFA 1NKSA 2BTOA 2F3PA 2CF6A 5F52A 1ZAYA 4URHA 4G0XA 5B6PA 2KX7A 4D6YA 2GH1A 2DPXA 1YU9A 1MPTA 2PRYA 2XDQB 3LUHA 1RZUA 4KBFA 5T57A 4ZO9A 1GVHA 5IKOA 2GN2A 2JGDB 1WB5A 3WO0A 4DQVA 3MGCA 3S55A 3FZYA 1Y0BA 2IPOA 1V8OA 3ES9A 1CZNA 4KO2S 1A9PA 4F4FA 4RNCA 4KNVA 5H02A 4GOLD 2W8BA 4RTKA 3JQAB 3GW8A 1H0HA 4U2CA 2BGNA 3EARA 2Q41A 3IAAA 4K6CA 3SNKA 2GM9A 2JIDA 1AKTA 1GCOA 1NVXQ 4YREA 3DBHB 3EW9A 1I0LA 3KALA 1DBSA 1BYUA 3ZWBA 4K0KB 4GDFA 2J0SA 2MT9A 1QAMA 1U9ZA 3OF3A 4GGMX 2DPGA 3A05A 1NFFA 3OCZA 1L5HA 1R0KA 1EFVB 3D4OA 4HLDA 4QGGA 2A0UA 3KP1A 4PX5A 3WQBA 2BD0A 1NE7A 1C14A 1EE9A 5F2OA 4CDMA 4IEIA 2R1VA 1BEZA 3GYGA 3IP6A 4NBSA 3KLBA 4C2TA 3JYQA 3EK2A 3B13B 4OBEA 2VJBA 3VGPA 1RZRA 5IDQA 2CB9A 5FTWA 4ZO6A 2HT6A 3HY4A 3FVVA 3NC1C 4H3KB 2GJ9A 4QXAA 1VI6A 3OX1A 4O2BF 1EBUA 1R6UA 1CZRA 2A92A 4CZ2A 2VBIA 1Q16A 1UPTA 1WVGA 1M7GA 3UK7A 3UEOA 1PUJA 5INTA 3AVUA 2O1XA 1ZFNA 2HWKA 3VOAA 1ZR4A 4Y30A 1DT3A 2VJAA 1GO2A 1Q1EA 3OQJA 3OPMA 2OYRA 2OGSA 5IKMA 4DM3A 1XI2A 2ZSBA 5IM5A 1KKLA 3P96A 2VPQA 3LC2O 4LSZA 3PUXA 4PFJA 2BJWA 2WBLC 5JYCA 1U1DA 2RHBA 4FM9A 3CSSA 1Z28A 1JBKA 1RI3A 5J5VA 4B6EA 4KNYA 2IPNA 1ZIYA 4NIMA 3IESA 1EFAA 3IKJA 5CLLA 3DLHA 5GZ1A 4PIMA 2LD4A 4FFMA 4R8LA 1CP2A 2XA2A 1SUCA 3LVBA 3PWSA 2BZ0A 4D8VA 4DIEA 1QVAA 1SG6A 3PX3A 5CPFA 5TGTA 1M6VB 2ORVA 4NAUA 3SHWA 3UHPA 4BN4A 3ORYA 2WB2A 1DGQA 1CDDA 1W1WA 5L95A 1FVXA 3BGIA 1BMFA 2Z09A 5FPPA 2H57A 3BFPA 1SQ5A 3R3SA 4MR8A 5HFAA 4HHEA 3O31A 2ZROA 3O2NA 3V4FA 5JMTA 1G291 1GPDG 3GB9A 4MNTA 4X7PA 3VV2A 4DS3A 2I2XB 4S12A 2YYZA 3DTNA 3PNYA 2DHCA 4BQEA 1MO3A 2JLCA 3E7FA 3FF1A 1U2DA 3QVXA 4Q4HA 2QTRA 5AHOA 1GD1O 4OGFA 3BD8A 5C9ZA 3CNBA 1Y89A 1DAHA 5KUTA 2FG7C 3DUWA 4WPGA 2P2LA 2VQ3A 3A1SA 2IY7A 1IUOA 1QDEA 2QLNA 4KQIA 4XM0A 1YTLA 2KQUA 5FBQB 1SQFA 4PQGA 4D7AA 4MS4B 5B4UA 2QD5A 1EGAA 1V16B 3BSWA 4BO0A 2I6XA 1I3LA 4DSAA 1YSCA 4ARZA 3D6NB 4YIHA 1DCMA 4DR7B 3EXFA 1YZTA 2AFHE 4EW2A 4F46A 5FQNA 1KXZA 4TLEA 2H0QA 3TWOA 3ZHUA 5IABA 4RXUA 3OCUA 5IWCA 2O8BA 1MG0A 2YY6A 3UJ6A 3VO8A 4FEAA 1W5AA 3W0LB 1K08A 3H5WA 1K0FA 2XOEA 3CUEF 3OTIA 221PA 3PIIA 5CX4A 4BTEA 4GMXA 2AZ4A 5A5VA 5IX8A 4W5OA 5ELLA 4B84A 1XXHA 1BW9A 1JV2B 2Y71A 3HM2A 2APJA 4OX9Y 3FDZA 1DC3A 3IKMB 1YVEI 4FP9A 1JEQB 1GGJA 3F3KA 4Q02A 4RNDB 3GLHE 1VHTA 4V0RA 1U8YA 4RWEA 4EG1A 2OAP1 3LBAA 5KVCA 1MP0A 1JSZA 1NNLA 3L0SA 5I4KA 3E9RA 5LBUA 1Y81A 4KC0A 1DZIA 2JRCA 4LBZA 2PLWA 5EXEA 4I0WB 2DLNA 2X5KO 2F9FA 2QQ5A 5JG7A 3HYNA 3T5TA 2ZT5A 3B78A 4IPTA 4MVXA 2QRHA 1KI8A 2HK6A 3QRWA 3GIWA 4HNAA 5D2CA 1DBPA 3TQOA 4OLBA 4P0PB 1JI3A 3A6EA 4XA8A 3U26A 4K9RA 4CIXA 4Q7QA 1YZKA 3IPLA 1SVUA 1GCIA 3FBTA 3TSCA 4BJ5A 2JG3A 4BS9A 4G2TA 3KUUA 4QVIA 4P3PA 2ZDHA 5CM9C 1WEHA 1Z6QA 3UFXA 3N86A 1KNQA 3VJMA 4C0QC 3FVQA 2QR2A 4HXFB 1HK7A 4KYTA 3MC1A 1TGVA 5DSZA 2BMAA 1JQBA 1X87A 2OOSA 1SCNE 4Q12A 1L4BA 5DZSA 4CKBB 4B3RB 1WMEA 5JSQA 1NUAA 1Z34A 1VG9B 4NYJQ 4TQGA 4OL0A 3ZI4A 2I34A 4IDBA 3KETA 4XJSA 4YCCA 1NQ5A 3CR3C 3FCEA 3MTIA 5AD1A 2XRYA 1AQNA 3K0AB 3M34A 3AESB 3CPJB 5EP1A 4NL4H 1QOPB 4KPGA 2Y8EA 4BV2A 3HEAA 4RHCA 2NZ2A 3I04A 3NONA 3ZDYB 4JC0A 1M83A 1GCUA 1QG2A 2HMAA 4NOMA 2PFGA 3PUYA 4CKWA 1T3TA 2OBFA 1E8NA 3DC7A 5FLKA 3WP1B 1NBOA 3GAAA 1U2PA 4R69A 4ZI7A 3Q9NA 2J33A 3Q3IA 4XQ0A 1UXJA 4IW3B 3VX4A 4Y2RA 4D46A 2XW6A 2WFLA 1KMMA 2QQFA 3W5CA 3RS8A 4WK2B 1DEAA 4Z9AA 4GGPA 3SDZA 1H23A 4ND2A 4S1VA 3KZXA 4TT3D 2SHKA 1E3LA 3LXRA 2NADA 3ROEA 4M0LA 3TF5A 2WILA 3AL2A 1RM5A 3T7AA 1QU3A 4NU8X 3HP1A 1JA9A 2G70A 5CEJA 1DARA 1UIMA 1HWYA 1ULHA 1W48A 4L7VA 5E38A 2VJNA 2A4KA 4OQFA 1NV9A 1ULBA 4RK0A 2P4SA 3UXMA 2C8KA 3K9LA 4HDAA 4R16A 4TS4A 4YP6A 4A1FA 2PKEA 1TZJA 2GSWA 2PGXA 2ODWA 3D8NA 4V24A 1J5XA 1MQSA 2QN1A 4AN0A 2GFQA 5CBPA 3KO8A 3FSRA 1HT1E 2FN8A 2HU7A 2QL6A 2XGOA 3P52A 4MKZA 4LOJA 1NMYA 4P4UA 3F3SA 4I1YA 4LPKA 3TW0A 3LHDA 2DEUA 4FEGA 1SZCA 2BW0A 3QX9A 4L02A 2NTEA 3GDHA 4LF5B 1GGFA 3EGDB 1Z6ZA 3D8HA 1R2QA 3PT9A 5KCMA 3OBBA 3TD6A 2DECA 3D5QA 1S5PA 2FWMX 1G9XA 1Y82A 3DMYA 1G41A 2OBLA 3NBXX 1Q57A 2WYVA 3NM5A 4CNQA 3GX1A 3M33A 5J4VA 1J8QA 1P4JA 1QHIA 5ELXA 2GPJA 2PH1A 4GVXA 5JAIA 1XTTA 1Z63A 1BMQA 3G2PA 4QFCA 4QU9A 4F4HA 8AT1A 2O5CA 4DEXA 1NN0A 2DLCX 4P2GA 1MABA 5HZGA 3WAJA 1FP4B 2QN3A 4GICA 4JZKA 4Q39A 1TYBE 2J32A 4EY7A 4AUKA 2QU7A 3TFOA 1A77A 2P9GA 4UZFA 4F4IA 4W5NA 3THYB 1XXHB 4BIIA 4X1KA 1CKEA 1FEZA 4LQ4A 4ESOA 2PSEA 3PF8A 4CM3A 5BSWA 1N36B 4FOOA 3KSRA 4J07A 4F96A 2WV7A 1FA9A 2G63A 5KQMA 2AJ8A 2FZ5A 2AN5A 4GC9A 1Q44A 2GYVA 3GL9A 4GZ6A 5EQTA 1C1DA 3BQMB 3BHJA 1XRRA 4N7BA 3SQLA 4I4NA 2AEFA 4YP5A 3ZWVA 4QUAA 1ZZEA 4WHMA 1RP7A 3HU2A 4PQFA 3C4JA 4RWZA 1LPMA 1UKEA 1ZINA 4O4JA 3ZE9A 5IPFA 1SCAA 2F9LA 3GWGA 2WQ7A 1R00A 1LKZA 2BHLA 2C9ZA 1PFGA 1XYGA 1ZZGA 2YWHA 3WMXA 1J4AA 2Q3BA 4MP6A 4PLGA 5LQDA 3GPBA 4LSGA 4IJKA 2XMBA 2W0SA 1ZJZA 3KEMA 4JP8A 1Q0LA 1R9MA 1U1GA 2W7TA 1KMNA 3N2GB 3A9UA 4G5OA 1GPJA 2H8GA 4IXDA 4ER0A 5JOQA 1K7XB 3NV9A 3PC3A 4X20B 3E3AA 5DI9A 4PG6A 4FFNA 5LN1A 5JH7F 2CK3A 4K9KA 5C8DA 5AM4A 2AA3A 3C3WA 5E6SA 1XHEA 4YRNA 4R0NA 4BWFB 5IARA 4Z1MD 3AEUA 3C43A 3FBGA 4CIYA 1DDIA 2H29A 4GOND 1EK5A 4PO1A 1GZ5A 2DT8A 3EZXA 5H4HA 4YUYA 3D8RA 4HJXA 1JEAA 4EITA 1SQGA 4RIIA 4JP3A 3ZNOA 3EFEA 4HWGA 5EZQA 3ZX4A 3AOEA 1O9GA 4KQHA 2RONA 3X1WA 3AM3A 4DIFA 4RMHA 3M82A 1E58A 1ZU5A 1FNNA 2XGSA 3C7KA 4X6LA 4YI5A 3W6PA 2W8ZA 3ECCA 1N2BA 3KLNA 2QT9A 4X93A 1LSJA 1TAHA 5ALOA 3VUFA 1NGSA 1OBFO 2JA1A 2XHEA 5LA6B 5JCXA 5LQKA 2D2FA 4Y9SA 1JG1A 3R7FA 1XU7A 5HBGA 4RX1A 2FMHA 1QOZA 3WA6A 2VYFA 3E9QA 4YJ2F 5EQFA 3VPFA 4DC1A 5DV9A 4HN9A 1OTYA 2BI7A 2BYTA 1JSRA 2FI1A 1RI2A 3V8BA 1DEKA 2Q2QA 4MUKA 1IZ7A 2VP0A 3SGLA 3T5AA 5CT8A 1DRJA 3F78A 4TWIA 4EJ0A 1NSYA 3VI4B 1Y3HA 2DE0X 3OZ7A 5FD8A 1VL0A 5AM5A 3PFCA 3T99A 4JXXA 4B8YA 5I7RA 1A98A 1A7AA 2JKZA 4AMYA 2YXPX 4CEIA 2GYUA 4AAYA 2ZYUX 3I12A 1PZEA 3PG5A 1N9ZA 5MN5A 2FG5A 1GA1A 2XA1A 4HTAA 2P9YA 3BL8A 2ONCA 4JT9A 3T4UA 3QMVA 1KL7A 1ZXXA 4ALJA 2I2BA 4KHPB 2W2QA 3FAKA 4ZT5A 2WE7A 4N7RA 5SV2A 3HB1A 4NABA 1UM9B 4IDDA 3IL2A 4DCPA 4S05A 2GN4A 3H2YA 5EWMB 3NIDB 3LV8A 1DEOA 4S04A 3DD5A 4QXMA 1SKYB 5JJ5A 2LPMA 2YZ7A 1EWKA 4GMHA 1SBHA 2AQIA 2ZTLA 4D1YA 3R8FA 1G19A 4MVJG 4H7KA 4UEJA 3VR0A 3ANTA 1RHJA 3LOQA 3E18A 5NLLA 1JQDA 1DWOA 1USUA 1FS4A 2J3JA 3DWEX 3NR2A 4M36A 4D3ZA 3M6MD 1G8AA 5C7YA 3VKUA 1SH7A 3TJZA 2Q45A 5EZYB 4FMDF 4CKYA 2CV0A 5C4GB 3ZV3A 3DE7X 5G0SA 1MG5A 2HWYA 1OZHA 4P83A 4YQZA 3TTWA 3UJ3X 2A6PA 2Y6VA 5E3HA 1Z0KA 1M9NA 4KW7A 2B0CA 2LDXA 5GM2A 3RVSA 1H0KA 1N3YA 2HQ1A 3FNGA 3PR1A 4I1SA 4J2HA 1D2CA 3NPMA 4N39A 1ZK2A 2QPAA 4P22A 1OH5A 3ASYA 3RADC 3COVA 3ET5A 3CF2A 4HXGA 3CO0S 1J39A 3F6YA 4YV7A 3CVYA 4O63O 1QWSA 5HKLA 5IJ9B 3C1AA 4L9WA 2V7TA 2XTNA 5EINA 1GAWA 4B74A 4WEQA 1GDHA 3LNCA 3P0EA 2OCBA 1VMEA 2X0DA 4RVCA 3EPPA 4ML3A 1UC8A 2B7LA 3CEHA 2J7PA 2OPHA 4E21A 1T9ZA 1Z38A 1GNSA 5IF9A 1X9IA 3HDHA 4LPSA 3KQHA 4NYJR 5C8VA 4EHHA 2EJWA 5H1YA 3K0FA 3T5DA 2CVHA 4M1QA 4BMNA 4BMZA 1L5NA 1K6JA 1CUIA 2EF1A 1OJLA 2NNWB 4Z9BA 1RKBA 4D74A 3QU4A 4MPPA 3WGGA 1PX2A 2VPTA 4LNUB 2FPIA 5FL3A 2DR3A 3H2SA 5B2EA 5FWXA 4BWGA 4P92A 4W6ZA 2VS1A 1YMQA 4XRRA 1E1NA 2O2YA 4HFJA 4QBKA 2ISSD 1FX0A 1XZBA 1GFSA 1M2FA 2NQTA 1X77A 5A3QA 1SC1A 1D09A 2N9UA 3EDMA 1ZN9A 3T0GA 4QULA 1SC3A 4QUIA 5CVEA 3O8OB 3AVQA 3GLKA 4H77A 2PKQO 4NYMR 1PR4A 4LK2A 4X8OA 3GY0A 1M6YA 1BQ4A 4MJLA 3E8SA 3H4MA 5ESWA 4EDFA 2JIOA 4EQZA 4J0HA 4A23A 3BMXA 1B2RA 3DLBA 1R66A 2E4ZA 4N5MA 1T4BA 2AV6A 3CH5A 5FI5A 4DLVA 3O93A 3L18A 1VHLA 5KYXB 3TO5A 1DG1G 3EIQA 4B31A 5G1OA 3U3KA 1MC1A 2AW5A 2ZQ5A 2BBSA 4TVKA 1UP6A 2FFJA 4KRFA 2Q7OE 3UWPA 1PJCA 3PNVA 4H6VA 4UJ5A 4ZOCA 3RIMA 3PQ8A 2JZCA 4Q4DA 3UPTA 3HJFA 1JZQA 3LOUA 1G9TA 2SBTA 3A7EA 3ZWKA 5C4IA 1GSHA 2BGUA 1AGNA 3VR4H 3LQQA 3U5ZB 4X63A 3ITEA 4Y2JA 5IU6A 5K3AA 2F4NA 2WZBA 4LJKA 3S2IA 1KEKA 1DXOA 1FJGB 1RP1A 4GL4A 4AC9A 5C8YF 4H7HA 4G5QA 2RGCA 4UFOA 4YMTA 5ALVA 4CN8A 1J97A 1YS1X 1ZD9A 1F5NA 3G2JA 4TUYA 1UC4B 2BKLA 5ED0A 1LLDA 3QVSA 3WGJA 4P54A 1NW6A 1JMVA 3VC3A 2YYAA 1TCBA 1XL0A 3LCVB 3M8KA 1IVSA 4NMHA 2IYZA 4EABA 4UNQA 2DPMA 3ZXIA 5KNLA 3OPQA 4L0QA 2QLTA 4R6WA 1GG8A 1K2WA 1U2RA 3EVGA 4IIUA 4LVOA 2LP4Y 5CYPA 4JA0A 5AKXA 5AWFC 4ACAA 1NVVQ 2BUCA 3OHSX 2GAJA 2EJUA 4TMXA 5FPTA 4DBLE 3PEEA 2NP7A 4LDNA 1E7WA 1UWKA 1T6ZA 3IUYA 4AJJA 3ZWXA 1NG9A 4ESHA 3FUTA 1K92A 3FNHA 3QY0A 3IUPA 1AGXA 3H1BA 3M49A 3O3MB 2ZBQA 2JJMA 1LBQA 2XKKA 3UFXB 4Z7QB 1A95A 2WMDA 1HE4A 3P8ZA 4AZ3A 1RJEA 1XVUA 3HFSA 2AZMA 3U61B 5LL6P 2BY4A 3COZA 5THKA 3PNPA 2FPXA 4GMKA 5LCXA 4HWRA 5JCZA 1BD3A 1CRQA 2CNWD 4P7JA 3D8UA 4C06A 5COQA 4JYAB 4ZREA 4KN9S 3OOHA 2P5SA 2BFCA 2TMDA 5TMPA 4E2ZA 4YUXA 2ZIWB 1NXXA 1NQOA 2ADMA 2B78A 2OAGA 3K31A 1E6KA 3B9PA 4R7ZA 4R41A 4EHIA 5EKXA 2XX3A 1GRQA 3GJTA 4HH3C 1Z6XA 4B6RA 2GF0A 2C8JA 4Y2VA 2FK7A 2BSAA 2GPWA 4NV1A 3RHFA 3TI7A 2WT4A 3V1UA 5JQGF 2FMTA 2VTBB 1CVIA 1MA3A 3RU9A 1GT6A 4UBIA 1PR0A 2HSGA 3QHQA 1EG2A 1ZLXA 4ALMA 3OX2A 2Q4OA 2WIAA 1WD7A 4WDQA 1I9CA 5AXCA 2F3TA 5DT9A 3QI2A 1WUIS 2JAOA 3BBPA 3QUCA 4WZAE 2HDWA 1ZUHA 2AG0A 2AOTB 3EEBA 2WWRA 3OM8A 4GEKA 4DCSA 1L2TA 2WQZA 1YZVA 2EWMA 3KPYA 5KIAA 2OZLA 3EISA 1L5WA 1OPXA 3MXTA 4DG5A 2XI4A 3ABZA 1BWQA 4O6VA 2GEDA 2D1QA 4MVJP 1HMPA 3OF5A 5DTJA 4MUHA 3X2FA 1PKEA 4PHHA 5PGMA 2DBVO 1A4IA 3GROA 5I7SA 1GN9A 1MABB 5ENVA 2LIVA 3T94A 3QVGA 4J9UE 2D06A 3E1GA 3ZHQA 3TD9A 1Q74A 5J2UF 2JAHA 5TR9A 4DV3B 3AKDA 4YROA 1HY3A 2RKOA 3GMIA 3I5UA 1LRLA 1XNHA 1C3OA 1UBFA 3K32A 5D5PA 5TARA 2VVTA 1C41A 1RNLA 1YR7A 2QLJA 1E9EA 4DUGA 4IHJF 3I30X 1ZM2A 2QZ4A 4CMEC 5KSPA 4IRMA 2XVYA 2Q50A 4LZPA 4MQ6A 3AERA 1GSIA 4C88A 1I13A 4EPTA 3LUPA 4B71A 2RE8A 3A2MA 1SEPA 1TYEB 5KTYA 1Z22A 1PK8A 2EDCA 2X77A 3MT7A 1PD0A 4YAGA 4WCFC 1RLOA 1XZKA 1HF3A 2X41A 3QPUA 4IZ6A 3N6VA 4JC8A 4AYWA 4JQCA 1BJRE 4EO9A 2BR4A 4MGHA 1FF9A 5CM2Z 3CWCA 2NSYA 1CK4A 4M22A 4PFSA 2QJWA 2VCEA 4KR6A 2VTKA 1E2MA 2X8BA 2XMGA 3I1FA 4GX5A 4NKRA 4UUNA 4ZQBA 3T41A 4DIOA 2J30A 5JSYA 5B4VA 2ZVDA 3HA2A 1JXAA 1QRUA 4O25A 4CL8A 1ZVJA 4X8LA 3FCXA 4E15A 2BT4A 2PZKA 1WZ2A 3MGGA 4V0OA 2PV7A 2W6PA 5JWRA 5LD2C 4KVGA 1XPOA 3TNLA 1ICEA 4QM6A 1CEEA 1UKAA 4N8SA 3ADCA 1BH2A 1UPUA 3AKYA 3CZ9A 5EHXA 2PU5A 4ENSA 5K6AA 2LW7A 3Q8WA 2WTNA 2O4UX 2VXBA 4Q37A 5BSRA 3OI7A 2J6BA 2RI1A 4FFLA 3EIWA 4NF2A 2QT0A 2YVQA 5GZ3A 3NGMA 1OLSB 2PL9A 2FW6A 5KOIA 4RCZA 4NV0A 4ALLA 2I78A 3SJZA 4XOUA 3EULA 1V26A 2BFFB 4HL6A 5FORA 3AXTA 3U37A 1RSZA 2D0OB 2WUFA 2HMVA 1DIBA 1KAOA 4GM0A 2GB4A 2QAGA 1HYBA 1UMBB 3CT6A 1Y8RB 5REQA 3TLBA 4GOJA 4Q9DA 1DG3A 5I8ZA 1SU4A 3A0UA 2NAFA 1F2TA 3CKLA 3NYRA 4GKKB 5L6MB 5HFNA 1Z8NA 3JQAA 1QP4A 4FJ1A 2Z9BA 2KPOA 2NP6A 3KKKA 3TPZA 1T9GS 5CVTA 2NV0A 2WM2A 1HKHA 1SD2A 3FNEA 2XJ9A 3MTJA 1TVKB 3UHOA 1XOIA 2WUDA 3TKLA 1JFLA 4AN1A 3SSMA 1VL6A 3TRHA 1VYUA 1CUFA 1Z0IA 2C7GA 1WU8A 4Q1AA 5J2TB 2EFDB 1LSSA 1W1UA 2A86A 2Q2WA 2YVAA 4OLHA 1UDRA 5EERA 3EQ2A 2WU1A 3HBNA 5FULA 4ZZ0A 1BCSB 1PJLA 3R09A 2YXDA 1EEHA 4L5CA 4HLNA 3MNFA 4YJKA 1N34B 1V7ZA 2Y1GA 3P45A 1GZ6A 1IMOA 1GPKA 1UH5A 2J45A 4Q3LA 4GKJB 4G0UA 4J43A 3ZY6A 1CR6A 4WUVA 1JDPA 1VSUA 1Y9JA 1MB2A 5ICCA 4ZRNA 2VF5X 4ZV7A 5BYBA 3T54A 1NOIA 2ECFA 3IQIX 4XDZA 1JFRA 2Z3WA 2R2GA 2CCKA 2G17A 3LGAA 1DC5A 1JMYA 5M3BA 3WK4A 1E2JA 1APBA 5U1PA 3ERCA 3D54D 4UEWA 1YL6A 4CV2A 5BMVF 3C4QA 1SEVA 1U7OA 1VCMA 4MRAA 4OXKA 3VSCA 2G6TA 1U7TA 4RHYA 3RRYA 4D9BA 1H3FA 1TM1E 2WYHA 4P86A 2HBRA 2QU8A 1PTJC 1R8QA 1ZICA 2Y1FA 4WXHA 2NVUB 5A9SB 3MWEB 2E49A 2XE8A 1MZPA 5HPYB 2ZETA 3GJ3A 5CFMA 4DMMA 2ID8A 2YZNA 3QV2A 1THZA 3HFRA 5A7HA 2R62A 2Q7DA 3TZQA 3DLTA 4G8BA 2F43A 3R7BA 1HE3A 1R88A 2FXIA 2VLIA 3C3XA 2N75A 3CF4G 3M5DA 4WL0A 3B85A 5CDTA 4BFUA 3UGJA 4H1HA 2JFOA 1LLCA 4NZYA 5JPIA 1RD4A 3L1HA 5GQSA 4YCMA 3OIFA 1JWAB 1U1FA 1QZXA 3FB1A 5TQ2B 1C4XA 3Q3HA 3H9UA 5DLYA 3U16A 1WW8A 1K89A 3GEMA 1FVFA 3LUBA 3NXSA 3IVAA 4L0CA 1US8B 2NV2B 2FN9A 1K27A 1V8BA 1XDWA 1RAHA 3A25A 4ZT7A 5AW3A 2VWQA 4MI9A 3B52X 3C5HA 1EBFA 3GPIA 4MV9A 4PYRA 4XARA 5CNJA 4JJ6A 4OA8A 4G07A 4FS8A 4PF1A 4CLDA 3ONNA 4MUEA 1T1RA 2BELA 1NTOA 2YS6A 3G0IA 3O8RA 3AVYA 2MYNA 3KSUA 1F4VA 3BDVA 1NU8A 2IGTA 3EVZA 1ZH0A 2I1WA 3KU1A 4N54A 1P1BA 4Q1VA 2FXVA 2OBNA 4MWZA 2HF8A 1E5XA 3TSYA 2G4LA 4MQEA 1VBFA 5A04A 4PIVA 3KR2A 4ZMSA 3GC6A 5L3SB 4FXPA 4YJ2A 4U1RA 2XMCA 3KSDO 5I7WA 3MJTA 4D80A 3QELA 1PYDA 3C6BA 3HY3A 4CF3A 3ZQ4A 4R84A 6LDHA 2PKYX 3EHDA 2RGRA 2ZIGA 4M1ZA 5CT5A 3GA0A 4JLOA 4QDTA 3HBMA 4BZXA 1FZTA 3N7AA 1DQRA 3G85A 5HA5A 3C6MA 2J6IA 4YBZA 3X1XA 1BE0A 1HDCA 4OIFA 3R5XA 4BNDB 2PM8A 1T1SA 1UBMS 1V3TA 4ND3A 3TIFA 1E4EB 3UJAA 2ZU6A 4F5YA 2R6ZA 3E82A 5KSWB 2P6RA 4B46A 5IKEA 4IGIA 1UDBA 4DRYA 4CF7A 3OQIA 1KXJA 3ASVA 1W5BA 4ECEA 3W3AH 4P53A 2OCLA 2OK8A 1S3IA 3WK5A 4OFWA 3MQ4A 3WGOA 4KUHA 2XNDD 3LL7A 4TPKA 4RTJA 4KFUA 5ICEA 1YOBA 2JB9A 1J2TA 3R24A 5HBRA 1JLLA 3R4CA 5DHQA 2PUBA 3MHTA 4LN1A 3AJEA 3S44A 3TB6A 4OQEA 3ICCA 3UT0A 1JFFB 2PH3A 4DDWA 2OAQ1 3BIWA 4GZMA 2PWPA 1BDMA 1VJCA 4Q4CA 2KWIA 3HDGA 4Q3OA 1G6HA 3HL0A 5DGHA 4F2WA 2CXSA 1N2HA 3FRIA 3IDZA 1P80A 4EHAA 1LNZA 1PJQA 2HY7A 1X94A 3TH5A 5KTKA 5EZSA 1IZYA 1Q1AA 2NYAA 1JQ5A 1NVTA 2NU8B 4BN5A 3C70A 2OSVA 3IO3A 2ZSHA 3SS7X 4LHZA 5K0LA 2WYOA 3ZXUB 1UDWA 4Q7EA 5C1OA 3TJMA 1ADBA 1F60A 1WUJS 2R8RA 4AULA 4HEQA 5FEMA 2IYYA 3BFKA 3MWKA 2IX3A 1TT5B 1TMOA 3QZUA 2RBKA 2GBGA 3TZLA 1AK9A 4MDHA 2WNHA 1PSDA 5AJXA 4PICA 1A72A 1IZ0A 2B36A 4UUMA 3I45A 3WJ7A 4L4ZA 5ERXA 4HDKB 2EARA 1MKYA 1GGEA 2Q7XA 2BUBA 3R0IA 3QY9A 5AJUA 2VP4A 4QHYA 3IE1A 4HQ0A 1GT91 2J85A 3DA8A 4E1BA 1ORIA 3S2UA 4RE6A 1Y8RA 2C57A 3GN1A 4FGZA 5GPBA 3WOVA 3CRW1 4EB8A 1QB7A 3ZDXB 1GP2A 2VEOA 2C2ZA 4FDUA 4I5DA 3FMFA 1PNVA 2FWIA 2R6AA 3ORHA 1K4MA 4KFTA 4DM4A 2CFRA 4ON9A 2PUDA 1W75A 2PD6A 4B44A 1ATZA 3MOSA 1BS9A 2ISCA 3LLCA 3SLKA 4MKHA 1YDEA 4CKEB 4F2HA 3N2YA 5JJKA 4LCBA 4CKWB 2AXNA 2BFCB 3M9WA 2BWJA 1B0PA 3WLJA 3HYSA 1Z88A 5FBRB 3FNIA 3GGJA 4X6YA 3N8NA 2XDAA 5ILQA 3TLKA 1XRPA 5ADHA 1ZIDA 4YRDA 4BMVA 4K2AA 3GUCA 4IQFA 3E0XA 3QVOA 1HDGO 3F6EX 3QF7A 3PNBA 1YGPA 3RYIB 2XZLA 4AY2A 1QB8A 3WADA 5HS4A 4PGGA 3TNJA 1FDSA 4OIMA 4ZT6A 1MQ9A 3COWA 4OBBA 1CLUA 4CMJA 3HVRA 2XBLA 1ZISA 2G25A 3FWPA 2QE7D 4JNKA 1VSQA 4P3YA 4C3UA 3HCCA 1IBSA 3CPEA 3PGVA 1N1GA 5LYYA 3VZDA 4IVPA 1YVPA 2E1RA 1W5TA 1EJ0A 3BSYA 5DU2A 1QQ7A 1S01A 3AHHA 1KEZA 3Q6IA 4BB6A 4XJTA 5LZ7A 3R8XA 2BMJA 1KO7A 1RM0A 5LQCA 2H1VA 1UJMA 4OM7A 1T13A 3E3OA 5EE9A 5KOHB 1T2AA 5B37A 2MIIA 2HX1A 1X9HA 4ZYWA 1QYDA 5BSTA 2WWIA 4L73A 4KXWA 4MW2A 3LC1O 3BWEA 5AVSA 3PHBE 1ZNYA 5BR7A 2GN0A 2QORA 3DE6X 4NH0A 2IGBA 3L41A 4B4VA 4XCQA 1CWUA 5AR1A 2EAUA 4AP6A 4RGYA 3A9CA 3B5JA 3EGOA 1FFEA 3JY6A 5IVIA 4YT4A 1ECBA 2JFNA 2DTEA 2AFHB 3DZJA 2UVQA 4F3RA 2IYAA 4D4KA 5G0WA 5K0EA 1RJ9B 2Q6OA 1DU4A 5JCJA 2P4HX 4F12A 2R4UA 1AMNA 4FFBB 3LUKA 3U3MA 3AEQA 3TSAA 4UOZA 1KP9A 2PJRA 3IHKA 3JTMA 1W5FA 4KQJA 1TO2E 1TX4B 4Q9JA 2ZM5A 1QKJA 4L51A 1G2IA 1N7HA 4A15A 2ZB8A 4R2HA 2XRZA 2G1JA 4QUGA 4YCJA 3VU9A 5DHTA 3PE3A 3OZIA 1V48A 4J4BA 4ZIRB 1RBYA 1RYMA 2AWOA 2CJWB 1KVRA 3FNBA 1CZLA 1PWHA 4R2XA 5JANA 3WGTA 4IF6A 1DXYA 4UDYX 2W58A 4FEEA 1IBLB 1ZEJA 3EDOA 5LLDA 1USWA 1AUOA 2O7VA 1XVLA 1GZ4A 5CVVA 5DFAA 5JEEA 5TS3A 2Y1WA 2DUMA 1A96A 2HLPA 3PLAE 1DG9A 1E5DA 4TTQA 1KRXA 2V6GA 3LXXA 2F1HA 4QUHA 5F9FA 5E9WA 2ZATA 2HF7A 1BROA 2QM0A 1IG0A 3LLMA 1F3OA 4HAYA 4JC4A 4DIBA 4RDXA 2Z95A 4JBGA 4IMIB 2BCEA 1IY0A 2LBPA 1PZGA 2V7BA 4QGAA 1NZFA 3VU8A 3W9YA 2NO7A 2ZWAA 4U00A 3OTWA 2P91A 4LQLA 1HORA 4J0QA 3WJ2A 3SS8A 5A02A 4E31A 4E88A 2V58A 4D3SA 4YRAA 6AT1A 1J1UA 1U3FA 3ANNA 1WBDA 1LLUA 3AX6A 1XRSB 1PJTA 3GVPA 4AJOA 4MUAA 1JR2A 2D5BA 4NECA 2A59A 2HO5A 1F0KA 4OK5A 1CUXA 2X0FA 2GS9A 4MV0A 4KDCA 3PGLA 3THOA 1K7CA 4IRXA 5BQ3A 5GJBA 3RIYA 3AOGA 2GN1A 3MJEA 2VSYA 4PLVA 5D3ZA 3WGIA 2ZM6B 1U8XX 1UCFA 3HCPA 3UB4A 2IZ5A 4ARAA 1ZJ4A 1U9YA 2CE7A 3EQ6A 3FOAA 1VCIA 1X0XA 3DXZA 3QKSA 4PPFA 5E7MA 1OTHA 3MWGA 4EZIA 2REQA 1ZC4A 4PWZA 5IH3A 1SOAA 4NCBA 3AF4A 4Z4QA 3EXFB 3LHFA 2Z2YA 3L5KA 4XSVA 2XVMA 1FXSA 1J20A 2C3MA 5K0NA 1JR3A 3EG9B 2HV9A 3QFTA 4HH4A 4OK6A 5ITVA 4N5IX 1YASA 3NVAA 4M99A 4R5HA 1X2BA 2BLNA 1S2LA 4HBGA 1XKQA 2P79A 3DSRA 4V0MA 1G2PA 4ZU3A 4KITB 6REQA 1LSUA 1ZOPA 3HCEA 1JVSA 2CLDX 1NUQA 2YJ3A 2VDOB 3AFNA 4I5FA 5DBEX 5ELMA 3UH0A 3GBVA 3HBAA 2AF3C 3FFWA 5IDYA 4B85A 3R9WA 3FKQA 4NYIQ 1XQ1A 2FPPA 2VDNB 4E5YA 4FZRA 2VJLA 4EFLA 1F17A 1XLWA 1RPAA 3JQAD 2PKXA 4BUJA 4LG1A 4S1OA 1VMKA 5LA6A 2DH6A 1NN3A 1V5IA 1VA4A 2FG6C 5FYDA 2EBWA 4JJKA 5E4FA 1SA0B 4V0ME 3OCJA 3VR6H 3OU2A 2NO6A 1FYDA 2GDZA 1UOPA 1G20E 3BCUA 4GD3Q 5FPKA 1COWD 4MYCA 3OX4A 3D2CA 4LX8A 4MHTA 1YIOA 5EN4A 3CW2A 1K6MA 4YRLA 1XTJA 4M6WA 5F98A 2OBBA 1XA0A 1JKXA 2O3JA 4FGSA 1OR8A 4MQLA 3G8BA 4LXQA 1KFKB 5F1PA 5FH9A 1NI4B 2RMKA 5HJ7A 4G41A 4R2JA 1H69A 1ZH6A 4IWNA 1E3MA 2E85A 4CFSA 3T8YA 2ZYWX 1XZIA 3H5OA 1IOWA 5K8TA 2XDWA 2OO3A 3OD1A 1EQ2A 5JNWA 4LY6A 4L22A 4N01A 1AHNA 2MR5A 4E09A 4R9UC 3RUDA 1ESNA 1IJFA 2I87A 3T1OA 4E5DA 4EHFA 3BF7A 4WMLA 4ZYUA 1LDYA 5LD2B 2BV3A 2B4AA 3NBUA 1XLVA 3DD1A 2YWRA 3TQHA 3M2PA 1PVOA 1N5LA 1VHQA 5AFSA 2GEKA 3QLUC 3VH1A 3L40A 2PZJA 3B9RA 4XAQA 5IKPA 4EQ6B 4YMIA 3OC6A 5KYYB 4NENA 2WIGA 2R6HA 3QVMA 3FPEA 3TEFA 2OKCA 3KTAB 4EM6A 3I2IA 4UHDA 4F56A 3KWMA 1NHGA 3LI2A 2OFPA 1U0HC 2J1LA 2QX6A 1JIJA 5CUQA 1H2ZA 3ROXA 1PFYA 3C7TA 2MYPA 2IF0A 1H9BA 2WJVA 2ZT8A 3THWB 1L5HB 4ND8A 1XZPA 2XUHA 4EL5A 1WUYA 3U7QA 3MCVA 5K8JB 4KFRA 1XEWX 2MTBA 4BFVA 4XX0B 1NE2A 1VSTA 1LBHA 4LXHA 3PX7A 4UCWA 1YI1A 4MQMA 3HKBA 1V41E 3H11B 3TUZC 1Q95A 1UWCA 4PINA 2HRRA 3L8FA 1M8FA 1R6DA 1VLHA 4KQGA 4ZYLA 4KR0A 3WLAA 2G7MC 4Q1BA 4CF5A 2X9QA 4LVCA 3NDJA 3QE4A 5ULLA 4G9EA 3SYNA 2WG2A 3I2YX 3LBIA 1YBAA 4PC3A 4UBKA 5EMLA 3RQSA 5C37A 4M86A 3Q3GE 4MEBA 1O5TA 4D9IA 10MHA 4W8G