2A5FA

Cholera toxin a1 subunit bound to its substrate, nad+, and its human protein activator, arf6
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
162
structure length
162
Chain Sequence
KEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the activation of cholera toxin by human ARF6-GTP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/transferase
molecule keywords ADP-ribosylation factor 6
total genus 55
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2a5fA00
2O8FB 1ZRHA 4GMDA 4EPWA 1K5GA 5J5CA 2P65A 3DEFA 2ZRNA 2BJVA 2IYVA 4AC9A 1W0KA 5HKKD 3VQTA 4DLSA 5M04A 1T4GA 5LPNA 4KFSA 3DOFA 1L7VC 4D0LB 3KB2A 1HA3A 4KODA 4D2IA 4GT1A 4GFDA 3SBEA 4X8LA 2ODBA 1P5ZB 2OILA 2WICA 3IKJA 1NY6A 1Z2CA 1LFDB 3ADKA 1VIYA 1OYYA 3B9PA 1IY1A 1VYVA 2Q9AA 3A4MA 4MRPA 4I1VA 5DISB 5CB8A 1U8AA 1DAKA 1KK1A 2G0NA 3FKSD 3Q7QA 4TMXA 3TQFA 1S3GA 221PA 4BLPA 2O8BA 1N5KA 2V4ZA 3TMKA 1G19A 1Q1ZA 3GLIE 1OB2A 1DAIA 1CJKC 5FTNA 2CHQA 5AWFC 3UKDA 2V7QD 4L16A 2R2AA 1Z2AA 4NU0A 4RD6A 4F92B 2QBYA 2OBMA 1SVIA 2ANCA 3B85A 3AVXA 4JMPA 2O8EB 4QGHA 3LVRE 4M1WA 3TE6A 4RCZA 1KSHA 1P75A 2LCFA 1E2MA 5J4LA 3THYB 2Q9BA 1F2TB 3VR3A 3QE0A 4HI0E 5C2JB 3RABA 3A4NA 3EXAA 2J7PA 2Z6VA 3K70B 2GDJA 4IW3B 2JLQA 4JL6A 1OH5A 1J8MF 4TL6A 3UANA 2CEAA 4HZUA 5CIQA 1ZNZA 1TQ6A 5G3YA 5L3VA 3RC8A 4BRUA 2IYUA 2RGEA 5B58C 1E9RA 1GL9B 5DHAA 1W0KD 2OLKA 5CYPA 2BVNA 4D0NA 2HYIC 2BMDA 2E1RA 3GFOA 2Z0MA 3C16C 3KJIA 2ZREA 3CW2A 3MSXA 3NBXX 3AV0B 4GMXA 4NE2A 3ZYCA 1YZQA 3N70A 1DO0A 4I81A 1KI6A 4TTQA 4FXPA 4M1SA 3BGWA 3EZFA 3KFXA 3AKYA 2W83A 1RRCA 1ZU4A 3NWJA 4DCVA 1QZXA 3AB3A 4A6PA 3GJXC 1WBDA 4RZXA 1ZCAA 1E2QA 2DCUA 2ORVA 2O0HA 3WP0A 2P2LA 2VO1A 5GADl 3MG9A 2ZJOA 3DL0A 5KSYA 4JT4A 3AF3A 3BRWD 1MO6A 2PX3A 1ESNA 4TL7A 1E1QD 3WNCA 2V7QA 4FWTA 4UKDA 1CJTC 3RSOA 2NOAA 4PQRA 4QBGB 3QXXA 1X1SA 4QOSA 2CL6X 5UKDA 2J1LA 4PAQA 4YMVA 3THYA 2N42A 1GKIA 1GFIA 1NSFA 3QBTA 5KSPA 5AUOB 4QNRA 3V4RA 3UATA 3QIAA 4M1TA 4B2LA 2GVDC 5E95A 1HV8A 2CJWA 3U2QA 4DJTA 2C78A 1OHHD 2IUUA 2C98A 3FOZA 3LRPA 4Q48A 4LOAA 5GJCA 3B1WA 4UNNA 2JLWA 3GJ4A 1OFIA 1E9EA 1KI9A 4PZYA 5SZKB 3U7HB 5EXPA 2J0SA 4JZKA 1HEIA 1HURA 2GXSA 2NIPA 3HPQA 2ZRPA 2WTUA 4B6EA 4TZ0A 2CNWD 1Q0UA 2L0XA 1II8B 3CWZA 1XTKA 4BFUA 4BWYA 2CHVA 3K0CC 2HXSA 2CDNA 2YHSA 1ZUIA 4Q9JA 1DAMA 2GJSA 1S9DA 1ZNYA 3K0AA 2H5EA 4F4IA 2GESA 2NTYC 4MGZR 5DE3A 1US8B 2FG5A 2ORIA 3W6PA 4DLYA 2JLRA 4A92A 3PJRA 2J7KA 4P4SA 3BFVA 2OUKA 1ZIPA 4GP6A 4MYHA 2JATA 4CEIA 1Q1QA 2ZUDA 2RGAA 1E94E 5JWOA 4LJ6A 4UXHA 4OI0A 2WMNB 1QHIA 2ZRJA 2OBNA 4BFTA 1E2EA 3QKTA 3K8YA 4R2HA 2BKEA 4BFXA 5DYIA 4R98A 5CJPA 5FUWA 1F5NA 2P0EA 4IOKA 5J4HA 4B73A 3FMOB 1QRAA 1ZBDA 1ZCBA 3TAHA 4B6FA 1W5SA 1E4YA 3ND9A 4C2TA 2QZ4A 3KXIA 4TMZA 5SZIA 3QPUA 4HEJA 2QEQA 4ON9A 3C4JA 1JR6A 1W48A 2ZJ2A 1GKYA 2Q9CA 3C8UA 3FMFA 3SI7A 1FFHA 4U5XA 1E2KA 4LV8B 3R7WA 4BZXA 3WHLA 3N2EA 5KDDA 1RIFA 1KK0A 3GFPA 3Q3JB 3C5HA 2B7CA 1Q3TA 3SE0A 4BLRA 4BE7B 4YMTA 2V55B 2AWOA 2I3BA 2AL7A 4H1VA 2QRZA 3L0PA 1ESMA 4P31A 1KDTA 2ZJAA 4ZI2A 3HWSA 1WP9A 4R2IA 4EAQA 4XTCS 5HE8A 3AKDA 2ZI4A 1G3IA 4MRSA 4RSGA 2Z5FA 421PA 1SKYB 3I61A 1HYQA 3CWQA 1E9BA 3LH5A 2RAPA 3QOFA 4TTPA 5JWHA 3VR6A 4AYTA 1JXOA 2NO1A 1SVKA 3A36A 5FBQB 2IA5A 3QPWA 3BD9A 1UEJA 1N3BA 4TLEA 1TQ2A 1R0YA 4LHXA 1II9A 2QUZA 1EX7A 3I4LA 2ZJYA 2OFOA 3EASA 2ZQ5A 1YR6A 1B0UA 2NO7A 4IJMA 3AEZA 1OH6A 1U94A 1RPZA 4Q9KA 3FMIA 1IN5A 1N6RA 4AG6A 8OHMA 2NG1A 3BOSA 5HTKA 3GEEA 5FBVB 3M6AA 4C0QC 1P3JA 3WMFA 4JLOA 3K09C 4I1UA 4KFRA 4BLQA 4AKEA 4B3XA 1G17A 3SJAA 1TNDA 5AR1A 1M2OB 2FPLA 3SJCA 2QA5A 5FR2A 3CH4B 2W6JD 3VFDA 3PG5A 4JL8A 2XSZD 4FINA 3T35A 2GAOA 1RW4A 5KDLA 3DDCA 2ODWA 2XB4A 1N6LA 1M8PA 3RWOA 1NNEA 5CLLA 3AF0A 3NHBA 3OESA 1AZSC 4MYTA 3X1DA 4AY2A 3WBKA 5JSZA 4O0MA 4KV9A 4AWXA 1UF9A 2PZEA 3RANA 2ZSDA 2Q6TA 2JDIA 5CIWA 2XOKA 1D2NA 1A1VA 2GWHA 2ZSEA 1DPFA 3L0IB 4LGMA 3N5CA 1U0LA 2ZU0C 1AGRA 3REGA 2IUTA 2P3SA 3FVQA 3P4XA 1KO5A 2R9VA 2OAQ1 4URUR 1KSFX 2RGBA 2WWFA 2C96A 2WKPA 2J0VA 4ZCIA 5J47A 1TL7C 1NMXA 1LF5A 4LSGA 3RRZA 3MGCA 3W3ZB 1IN4A 4IRUB 2GNOA 1JAHA 2ZVPX 2X2EA 1E9AA 4FMDF 2PCLA 3TW4A 2OCBA 1FQJA 4IDQA 2NZ8A 1UPTA 2UZIR 1FMLA 4LBVA 5EJEA 2O8DA 1LVGA 4KU4A 3L8YA 4KI0A 4NBSA 4WXRA 2B21A 5JWRA 3FFBA 1XJQA 2JLYA 4NYJR 3VNVA 1VG0B 1XX6A 5EE0A 1IXRC 4TMTA 1MH1A 1G4AE 1CR1A 4DSOA 1N6OA 2BM1A 4MUBA 1XRJA 5DH9A 2CLCX 4C30A 4BFZA 2HLDA 2X2FA 1NN0A 3KTAA 2O8BB 2FE4A 3VNUA 2G83A 4ZO4A 3VR1A 2GBLC 3OAAA 1U9IA 1G8GA 1P2SA 1PZNA 1WXQA 2GJ8A 1E32A 2F7SA 2FN4A 4Q7MB 3A37A 3X1XA 1W36D 1SHZA 3BAFA 1P7CA 3GEHA 2J0QA 4DHEA 1I4TD 2ZJZA 3PVSA 5L3RA 4EDHA 3WYGA 3ECCA 4HB4A 5FL7A 5B57C 2QG6A 2XX3A 2JDID 3EIEA 5KUTA 4A2WA 1E2GA 1J2JA 1SVSA 1Z0IA 1KY2A 3CUEF 2YWFA 3I62A 3TVDA 4NDZA 2IYXA 4FD2A 1W4AA 3TW8B 2AHOA 3ONWA 3BB1A 3K0FA 3DZ8A 2ORWA 1U0JA 1WE2A 1SZPA 1SXJE 3HPRA 3WYAA 5JI3E 3TGPA 4A15A 2ZE8A 3AM1A 4EJSA 4WW0A 1R6BX 2WJVA 2WIAA 5KDOA 4IFEA 4M53A 3VKHA 1N25A 3UG6A 5L3QB 1D8TA 4AI6A 2CK3A 2BDTA 2QQ0A 3GJ8A 4JJKA 3HYRA 4M9SA 5IT5A 1N6IA 3BH7A 1WBBA 3H86A 4Q4JA 4DUGA 1CLUA 3SFZA 1KGDA 1IJFA 2WAXA 3NVAA 3OEHD 1VCMA 4II7A 1US8A 2UZ3A 4NH0A 3KQKA 1J8YF 2C9OA 3ZVNA 4CW7A 1OXSC 1IBRA 5FBWB 1C9KA 2H57A 2YVUA 3OFND 2ZTSA 3LLMA 2F43B 1DEKA 2GILA 2UKDA 1UM8A 3K0CA 1S0UA 3IDQA 4LJ7A 1NBME 2DFLA 4NCKA 2GK6A 1KMHB 1G16A 1MR3F 4IEIA 4PHTA 1Y63A 2WM9B 2WWIA 5J4KA 3AKEA 4G5OA 3KUCA 3V4FA 3I72A 4PZZA 3IQWA 3T1OA 1G64A 5EXSA 3T1VA 1G3QA 2G9NA 4MITA 2OXCA 1KKLA 3DHWC 1N5JA 1DE0A 2GXQA 3Q8XB 4ZKEA 2C8VA 1ELOA 2C99A 3ASYA 4F91B 4PC2A 2R6DA 2REXB 4Q7LA 2QBYB 1W2HA 2ZRFA 621PA 4CF7A 3BJIC 1OKKA 2AKYA 1QHNA 1WRBA 2ZETA 2WWYA 2EFGA 2R6AA 1CBUA 1WQ1R 4DSUA 2QMUA 3TNFA 1FX0A 3OEEA 1I4DD 1KZ7B 2CK3D 2XZPA 2ZYUX 4WZBE 3U44B 3EARA 3QKSB 4I1OA 5H68A 1Z8FA 3Q72A 4OHZA 1ZD1A 3MWYW 5ANRB 5E7IA 4AYWA 4DUGD 1Z28A 3RS5A 3U3KA 3TBKA 2BIFA 4GOKA 1OFTA 3MD0A 2KJQA 2QPOA 3UMSA 4TYYA 2KSQA 2OAP1 3AUXA 3BH6A 1E79A 4Y0AA 2O0KA 4JLVA 4HB0A 3BIFA 3X1YA 1W36B 4HATA 2ZI5A 2QSYA 1R5NA 2D2EA 3LW8A 3PUWA 5EE9A 4LDJA 1FUKA 3TH5A 1CKEA 4PFSA 3W8NA 3CPHA 2J9RA 4BLOA 1CJUC 4CVNA 1GL6A 2G1KA 5JEEA 1ZU5A 1GOTA 3LD9A 1QHGA 4C4PA 1IONA 2OV2A 1IJEA 4BEJA 4QM7A 4M9XA 1TADA 1JR3E 1GRNA 3NXSA 4HAZA 4B75A 3CF6R 2R44A 2QI9C 2BCGY 1OB5A 3U7GA 1CRQA 4NYMQ 2EFEB 3H1TA 3UWKA 2FMXA 3CRW1 3DMNA 4JT2A 1KI3A 4U7DA 1DAFA 3WP1B 5CDFE 5FOSA 2XJ9A 3RYTC 3IPYA 5DI9A 2JCSA 3I32A 3D3QA 2Q3HA 3LX5A 3PUVA 4WZ6A 2XGJA 4IOJA 3CRMA 1O87A 1TUEA 4G5GA 3BFXA 2BMFA 4HDQB 4QHTA 1AK2A 5TXGA 5LB4A 3QG1A 3AH8A 2GTPA 5HZKA 1E98A 4Q66C 2QM8A 1T5LA 1W47A 2V1XA 1HE1C 2WSSD 3LX8A 3NH9A 4L4UA 3KXKA 4LYAA 3ZIAD 3AGPA 4EQ6A 4HDOB 4MGIR 3C7KA 1Y3AA 1E79D 1IQPA 2ERXA 3ZDQA 4JIMA 3D8BA 5FFMA 4LPSA 4C0SA 2RGGA 4XOIA 1KSJA 5FPYA 1EFHA 3TUJC 2DFNA 1P73A 2AR7A 3K53A 2J45A 3F5FA 2GJAA 1S2MA 2IYTA 1SULA 2KI5A 3GP8A 2F55A 1BS1A 2P6UA 5AUQA 1LW7A 1PUJA 1OXVA 5IRCD 4QL3A 2XTNA 4DSNA 2FX3A 2OO7A 3EAQA 4UNPA 2A78A 1TTTA 3QF4B 1UKZA 5JHHB 2OM2A 3SOPA 5H8WA 4I1SA 1R8QA 1RZ3A 4N3NA 4DCNA 4E22A 3A4LA 3TSOA 1P62B 2GCNA 3FKSA 1J90A 3RRYA 5HE9A 1E9SA 1G7SA 1CXZA 2F1IA 2YYZA 4Q21A 1G3RA 2LKCA 5BWMA 2ZRLA 4ZDJA 3B82A 3TSWA 4Q4LA 1C4OA 1OF1A 4NZYA 2ZYVX 1CF4A 1BIFA 2HF8A 2ZROA 4PO8A 2RGCA 2GEDA 2FOLA 2FSGA 4JL5A 5E7MA 1BYUA 1P9RA 5E3HA 2FF7A 3ZQJA 5IK2D 5E4FA 4KSBA 1UDXA 2VSXA 3PQCA 3W6NA 4XVRA 1E2NA 5ELXA 4HDCA 1E3MA 3CLVA 2OCPA 1RVDA 2CJWB 3B9QA 2Q3MA 3Q85A 4Q01A 2I4IA 4LC1A 2IYZA 4GRAA 3U7EB 4C0JA 5A4JA 2GF9A 5KHOC 4GSYA 4WIAA 1OLOA 1G7RA 1ODFA 1YU9A 4BFVA 2O5VA 1G291 4PSKA 2VYFA 2P6NA 1T0HB 4L5BA 4EQ6B 1KAOA 2HJGA 4AK9A 3CBQA 4O2LA 3THWB 2YWGA 2JASA 2ONKA 2X77A 4ZCMA 3B1XA 1JEEA 2P67A 1N2CE 1N5LA 1FL9A 2ZSBA 3FGNA 5K8TA 3CX6A 1E0AA 1NVWQ 2DWOA 4HUQA 4QGAA 4JVLA 3SHWA 521PA 1KI2A 3Q9LA 3AF4A 3L2OB 4NYIR 1GG2A 1A2KC 1R0ZA 3MWLA 1AZTA 4Z1MD 3BORA 3G0HA 2FFQA 3LXXA 2D62A 1Q3HA 2IX3A 3EZ9A 3VU9B 2BWJA 3T34A 4HSEA 1T6NA 1E1QA 3QXSA 4ABYA 2JJ1D 2WZQA 1Z0FA 1ZM7A 1HQCA 3CRVA 4OQXA 2SHKA 4ZIRA 4PC6A 3UMRA 2WV9A 3GLGA 2IYSA 1MV5A 2IW3A 3P26A 4PR0A 2QT0A 4Q02A 5LD2C 1KO1A 4R71A 1NVVR 1XXHA 4KVAA 5F9HA 5CK4A 4C0BA 1G3UA 4UXJA 1UBCA 2Q3FA 4LUCA 1T8TA 2REOA 1NMZA 5EZ6B 4HZUB 2GK7A 2ZR0A 1GP2A 1OHHA 3K0FB 1ZW6A 3EPKA 4OK5A 3PCRB 4U02A 2PT5A 5HKKA 1TU3A 4JSTA 4LHYA 5GJWC 3SBDA 2XZLA 3NDBB 3D31A 3J81k 4TT3A 1ANKA 3WMEA 1RJ9A 1K6MA 4CEJB 1GVNB 1KZGB 1EWRA 4EPYA 2X8AA 2RH5A 1XTSA 1JB1A 1KI6B 4JS0A 5TB5A 1S9HA 2I1QA 1T3HA 3AF1A 2NZJA 2ZI6A 4LI0A 3MJHA 5D3MB 4LCBA 3KKOA 3BK7A 3O8BA 3VX3A 1CJMA 2QY9A 1UADA 4P4TA 3H84A 3QG5A 1YR7A 2IS6A 1DADA 2AFHE 4P33A 3ZS8A 2F43A 2FDCA 3RHFA 1U2RA 1XCPA 2PEZA 4DWJA 4DVGA 4A8JB 4B32A 1L4UA 2A5FA 1NJGA 2YINC 4FWIB 4Q1BA 4IDPA 3W8RA 1OH7A 3GLFA 4D25A 4A1FA 4IHQA 2O8CB 2ZRAA 1P72A 5HR5A 1SHKA 1H8ED 4UQOA 3AKCA 3VTKA 1AJEA 1YE8A 2A3RA 4A82A 2A2ZA 4MKGA 1ZP6A 4RKFA 2W2VA 5FBLB 5JS7A 1QG4A 5DNYB 4GPTA 2V6IA 1P2UA 1EK0A 1XCGB 3OE7D 4IDHA 1VMAA 4G5SA 3ZVMA 5F9FA 3OHMA 5L8VA 1NF3A 1TPZA 3O8CA 2WAYA 2ZSFA 1EFRD 1A5TA 1TUIA 2BCJQ 5JSZB 3QXHA 1UBGA 3P4YA 4UNSA 5FOVA 1JJ7A 5JCPA 5BN4A 1CEEA 2PBRA 1W0JA 1RFLA 2D7CA 2QRNA 3H2YA 3U6KA 3FYHA 1W4RA 4E03A 3KL4A 1CJVC 2IYYA 3CNOA 1XMSA 3AVUA 3TAUA 3GQBA 2YC4C 1XPOA 2JLUA 5F98A 3I8XA 1QHSA 2GKSA 4DLXA 4D4JA 2KB0A 4NPHA 5AJXA 4BUJA 2EFHB 4CEHA 4NL4H 1FTSA 1NVXQ 1UFQA 1YR9A 4JKIA 3VR4A 4IDOA 1EESA 2ZANA 3CX7A 1Z5ZA 1E9FA 4MGKR 2IBMA 4C3ZA 4HAVA 4B48A 1G8YA 5AJWA 1KYIA 1G18A 2GJ9A 1P4SA 3QENA 1H8EA 2FFBA 2AD5A 4B3BA 4JVMA 1RRFA 5AJVB 1ONBA 4JYCA 2ZE5A 3AVVA 1PVOA 4KITB 2OFWA 2ZUBA 4L9WA 4D82A 1NG1A 3AVTA 4XD7D 3IBYA 1D6JA 4Y0VA 1AS2A 1SGWA 1HT1E 2WJJA 5J40A 1T5IA 3L0OA 1Z6GA 2NPFA 5BYKA 1TX4B 2D3WA 3ZD6A 5LBIA 4Q00A 3RC3A 4YMWA 2IHBA 3W6OA 5EZ5A 2CCJA 2ZVQX 1TF7A 4NCHA 5A0FA 5BYJA 2PEYA 4KFUA 3CB4A 1JALA 2NQ2C 4HLDA 2AFIE 5EP3A 3KQUA 4A2PA 2G77B 1GRRA 1XF9A 2QGNA 4PAMA 3GPLA 3UK6A 3QKSA 2WPDD 4UJ3A 3TR0A 2RHDA 3SR0A 3A6PC 2C9CA 1G7TA 2OESA 2VP0A 2ZJ5A 1SVWA 1TU4A 4NKRA 2J87A 2WJIA 4W5WA 1U9IC 3QPVA 4EUNA 4RD0A 1UAAA 3NBFA 4ITRC 4QHYA 1W49A 1FQKA 1LNZA 1XWIA 4YMUA 4BZQA 5SZJA 4PC1A 2ZIAA 3QY0A 4WXPA 4D4MA 5AUNB 1R0WA 1LS6A 3L82B 2MSCB 4QRHA 4LJ4A 4XWOA 1KI1A 2NO0A 1F2UA 5DSZA 3QKRA 1BYIA 3PXGA 2D06A 4LC0A 4P4SB 2KE5A 3ICQB 2BBTA 4KVGA 4A0GA 4DCTA 4ASUA 3PR1A 1Z6XA 3HYTA 4QBHA 4DT1A 1P2VA 4XD7A 2HUPA 3V00A 2NO9A 1VG1A 4D0GA 4DLVA 1DG1G 4A8JA 4DLTA 4F38A 1XJCA 1AS3A 4NCJA 1JNYA 1XJ0A 4JLJA 4MKIA 2FSHA 1P9NA 4OHVA 1RYHA 3PFIA 2OE2A 2JIZA 3F0TA 2AXPA 2IC5A 5EXTA 3UG7A 4RZ3A 1ZM2A 4DRZA 3AVOA 1Z6YA 2BEKA 3T1QA 3ETLA 3EWSA 1E4VA 3BE4A 2ZRHA 3U6BA 2A30A 5CYOA 1Z07A 2B7BA 3CRRA 1PJRA 4WOPA 2R62A 2GETA 2VQSA 2ZI9A 4PHGA 5C4MA 5EP2A 2P5TB 1D5CA 4US2R 2CVHA 3ZD7A 3RRNA 1W36C 1G20E 1D9XA 1XEFA 4PC3A 4PSVA 4JKYA 3IIMA 1A2BA 1QBKC 4TYWA 1OFUX 1UDWA 3MMPA 3EW9A 3KUDA 2IYWA 3BC1A 4JVSB 1DOAA 4A6XA 2O8DB 2J46A 4RCYA 3QKRB 1R7RA 1JJVA 2O8FA 3KZ1E 2ZAMA 3OEHA 3SQWA 1G4UR 2PT7A 3V9PA 2IHYA 4Q1DA 2QP9X 1P6XA 3K9GA 2IF2A 5JMTA 2UVQA 3O8RA 1KDPA 2W0SA 4A2QA 3P20A 3OFNA 4CEIB 5KNCA 5LDDC 2YOHA 4M1YA 3VU9A 4HYYA 5AK0A 2H92A 4FMBB 1KJYA 1V43A 1Z29A 4IVPA 2YKGA 1ZD9A 1S3SA 3GFTA 2P5SA 4MYUA 1CRPA 1DG3A 5JZVA 4B2IA 2QORA 4OQMA 4KLZA 4QGFA 1MABA 1AN0A 1QHHA 2QAGA 3GLFE 2F3TA 2GZDA 4PSAA 4OI1A 2OCAA 4TLAA 4GZLA 1G9XA 2GAAA 5IHPA 3NH6A 4HUQB 1DVRA 3G82C 3Q7PA 2VSOA 5G3ZA 5D3QA 3I92A 3AP3A 3MJRA 1RC8A 3U7FB 2XSZA 1ZC3A 1KK3A 1R0XA 3WRXC 1D2EA 1P61B 3QKUA 1G5TA 2F1HA 2PCJA 3CO5A 1IXZA 4ESVA 1VKJA 4NMMA 2IXGA 4TYQA 1GWNA 2B8TA 1NBMA 2C03A 3SU8A 1XTJA 1DTSA 2Z83A 3B1VA 1VTKA 2F1RA 3HU2A 4GBMA 4LJ5A 1CIPA 4LRWA 3WMGA 2QGZA 5DGXA 2W2TA 4URVR 2R6GA 2GJKA 1N0UA 4KXFB 3H4MA 3ADBA 1TF5A 2KWIA 821PA 3CNNA 1SKYE 4FMCB 4LYJA 4MYCA 4UXIA 3EZ2A 1NN5A 3QVUA 2IK8A 2HLDD 3PIRA 3GJ7A 4EFNA 4QJ5A 3PEWA 4O2RA 4C2UA 1DS6A 3GLHB 3OAAD 3PENA 3LW7A 4YQFA 2BKUA 3O8DA 1GL7A 2K5UA 4OBEA 1YZTA 1AM4D 5IF9A 3GD7A 4ZPXA 1QHHB 1NG9A 3T5GA 4RKEA 2JEOA 2N1BA 4ZCLA 3TQCA 4BQSA 1TQDA 2QAJA 1YHNA 1HH4A 3CONA 3S1AA 3DVLA 1T9HA 2QP4A 1WB9A 4WZAE 3MUFA 2CLSA 3CPJB 4V0ME 5F2EA 2OXRA 1GM5A 4DDWA 5FTJA 5BXQC 1N6HA 3I8SA 3MFYA 4QGGA 4PHFA 3AF2A 2XXAB 4DZZA 1MO4A 1NBMD 1X8LA 3QJYA 2XZOA 3R9IA 4KHZA 1EX6A 1M6NA 1BO6A 1HE8B 2C9YA 2QQEA 1JQJC 2PZFA 5HCIA 4MH0R 4DDTA 2DFTA 4B43A 1DARA 4LV6A 3D7MA 2XTMA 3A1VA 1G41A 3NEYA 2D2FA 3NHAA 4ERNA 4QBFA 2HT1A 4AIIA 3LFUA 5TDHA 3VHLB 1M7HA 2AWNA 2W58A 3OZXA 4O3MA 4J0QA 4TTRA 3GJ0A 1OH8A 2JLZA 1GNQA 3W5JA 1MOZA 3RSLA 2ANBA 3NEJA 2WSSA 5C18A 4NYMR 2BBOA 5KOYA 2NPIA 4LYHA 3VHXA 2CE7A 2XJ4A 4K46A 4CIDA 3U60B 1UEIA 1MO5A 3FHTA 1QDEA 4EJSC 2WKQA 1UBEA 3EIHA 3NTUA 2PX0A 3THXB 3IEVA 3IILA 1ZM3A 3I3SR 1COWA 1G7CA 4JVNA 2VLIA 4LV5B 4OHXA 4DT1B 2IYLD 4Q9LA 4OHWA 4TQAA 4F4CA 1NLFA 4HLUC 1E1RD 4KYIB 2XITA 3BXZA 5JI2E 5JLJA 3B13B 4C0LA 1L2TA 2Z43A 3ICEA 1G5RA 1FZQA 2A7QA 1JPNA 2CL7X 1Z22A 2QU8A 3TSZA 2RGDA 2RMKA 4RFSB 1E0JA 1NIJA 3AVQA 2GBLA 4P0TA 3W5IA 3FFAA 1NRJB 2FJUA 4FW9A 3B78A 4OI2A 4BGDA 4DLWA 1NY5A 5JRJA 3TUIC 2H1LA 3H0KA 4FI3C 2EU8A 3CRQA 3RS7A 1IOZA 3K70D 4NYJQ 3EC2A 4MKFA 1GUAA 1E6CA 2DWQA 1GNPA 1VHLA 4PAOA 1B23P 1K5DA 1NVUQ 1R5OA 2F1JA 3DM9B 1FP7A 4W5JA 4PPFA 3OF5A 2VIIA 1CR0A 3I73A 4P4UA 4E07A 4DEXA 1ZVQA 4ZV4A 1T8UA 1GITA 1S96A 2FH5B 1FX0B 4M8NE 3UIEA 3M1IA 4B3CA 4GL2A 1GIAA 4TL8A 4ARZB 4GZMA 4MQBA 1TEVA 2XNDD 3NC0C 2ZITA 3LXRA 1Q20A 3ZZTA 3K9LA 1YQTA 1YZGA 4XWKA 1J70A 3EZ7A 4IDNA 2XTZA 5L3SA 2V9PA 5CDFA 1COWD 3AP1A 4CGZA 4TWZA 1OIWA 4Q1EA 3ZLJA 2WOOA 3EC1A 2X19A 2ZYTX 1X3SA 1LF0A 3CH5A 3IEUA 4EKDA 4URXR 1KJZA 1UJ2A 3OIVA 5JCZA 5FBRB 2VP2A 1AGPA 4KYUA 1DO2A 2ZR7A 1Z06A 4NCNA 2VHCA 4BFYA 1OXXK 4FCWA 4R9UC 1KNQA 4Z1MA 4V03A 1VCNA 4IOMA 4OQFA 1R10A 1T91A 4XTRA 5KSZA 2EQBA 1WMSA 3D6TB 3ZH9B 3AUYA 3I5YA 3R20A 1JR3D 1G21E 1EXMA 1FUUA 2GXUA 4LZZA 3QSYA 3P1JA 2F9LA 4PQYA 2PL3A 3WBJA 5TY0A 1XPUA 4ZDIA 4M2LA 3IUYA 1YVDA 4ILEA 1MT0A 4K8OA 5KTYA 2HJVA 2RKOA 2Z4SA 2RGNA 2AK3A 1RRGA 2OHFA 5FOTA 5F3WB 2H16A 4IEEA 4ZI3A 3FHOA 2V54A 2GCOA 2VHJA 4RVCA 1KOFA 2OZEA 2DYKA 2JJ8A 2ZR9A 4F4JA 1W4BA 4OQNA 4GP7A 2F6RA 3ZQ6A 4ZDKA 4X8MA 5BN3A 4KO8A 3QUSA 1M7BA 2VHTA 4GOXA 1A7JA 2ZXUA 5K8UA 2RB4A 1KTVA 1BMFD 2FZ4A 1JEDA 1Z6TA 1YZKA 4WA7A 1BKDR 2W2XA 1YZNA 1XNJA 4Q18A 1II0A 1Q21A 3DPUA 3KQNA 3FE2A 3KJGA 2IYQA 1VCIA 4Z54A 1XTRA 4QKQA 2NGRA 3CKLA 5DYGA 4LHWA 3EZ6A 3RS2A 1HQYE 4OL0A 4GI7A 1OSNA 1T3SA 2QE7D 2ZRMA 2BHRA 2IUSA 5JBQA 3E70C 1S1CA 2JJ2D 4TMVA 3B2EA 2VP9A 2W6IA 3KTAB 3GLFB 3TIFA 4US1R 1I2MA 4YDSA 1JR3A 4TQ9A 2X1VA 1X8KA 2XNSA 3LA6A 1NSTA 1P2TA 2VSFA 3VMFA 3LY5A 1N0VC 1FNMA 2O52A 5CK5A 4TMWA 3TLXA 4AURA 3T1TA 1X1RA 4KSCA 5CM9C 5KO2A 2OSBA 3PV0A 1XEWX 5IK2A 1E9DA 2KBFA 1OJLA 2GZHA 3K9HA 5GVSA 2D74A 5JFGA 4WAUA 4Z8XA 5C1BA 2QENA 1DAHA 3B7GA 4QFMA 4DSTA 4A0FA 2XAUA 1XEXA 4S35A 2ZS7A 4Z8YA 1EFCA 4R7ZA 2CMKA 5DO9A 4XH9B 2VHUA 4OK3A 2VP4A 2DWPA 2J0UB 1JQLB 3IBGA 4QM6A 2FGKA 1BMFA 3GLIA 2OFXA 2WVJA 4V0KA 4HLQB 5SZHB 1E0SA 1G6HA 4V0MA 3REFA 1FTNA 5TV2A 1XU4A 4IKEA 1P9WA 4DCUA 1TAGA 2WIBA 1VECA 4G0NA 2GVZC 1SVOA 3EX7C 4FIDA 1Z0DA 3BH0A 4G1UC 1T3LA 1JXMA 3T15A 2NMVA 3KQLA 4BLTA 3WRYC 3K70C 4E5UA 3K0SA 2AXNA 2JJ2A 4FMCF 4TLBA 2W6ID 3ZZ0A 1OV4A 3SYKA 1J7KA 4DEYA 3U4QA 4RZ2A 1E2DA 1GSIA 1MABB 4N0DA 2ZPTX 1QVAA 2VEDA 4JBYA 2AD1A 4MDFA 3IO5A 2VP5A 3KQHA 1F6BA 3Q5DA 1ZNXA 2DB3A 2FPMA 4OKSA 5J4YA 1KO7A 4NCIA 2VHQA 2J7PD 1NI3A 721PA 4B44A 3U44A 1CR2A 3QVVA 3SFVA 4EPVA 2JJ1A 4S2EA 1M7GA 4JBWA 3U3MA 4CT5A 2V1UA 4HAXA 2PH1A 2R6CA 3A1SA 3F8TA 3EA0A 3FWYA 2XB2A 2VPPA 4KBFA 4Q9IA 2ASEA 1Z0KA 3MWKA 4DDVA 1F2TA 2JA1A 1E2LA 2J0UA 3PUXA 2Z4RA 4PANA 5FOXA 1RYFA 2JLVA 1FPMA 1SVMA 4K81B 3KFVA 3MWJA 3AQ4A 2A5YB 3GCGA 4C0AC 2CL0X 5EUQB 1BH2A 4G01B 2IWHA 3I1FA 4XVQA 3X1ZA 4Q7KA 2ZM5A 1FP6A 5LB2A 4DDUA 5L3SB 3KKQA 4DIEA 2HEIA 1S8FA 1SQ5A 1W46A 4B3GA 1KI4A 1YZLA 2GA8A 3K09A 4PPGA 2BEJA 1XXHE 3KKMA 4TT3D 1R2QA 3SYNA 4CEHB 2QTFA 2PJZA 1NN1A 4OQLA 5EUMA 4YXWA 2ZRGA 4QNMA 2PMKA 4H9GA 1VG8A 4N1AA 3G5UA 1UKEA 1TEXA 2QAGB 4TYNA 5FTKA 5FTLA 2FEMA 1IN6A 2HV8A 1LY1A 1SXJD 2A9KA 1LS1A 1VYTA 5AJZA 3ZS9A 3ZGXA 1XTQA 1XB2A 1XD8A 4QBIA 1F2UB 2YWEA 3RNLA 1Z83A 1KO8A 3BS4A 1VDZA 4A0HA 4PC7A 3ND8A 1JECA 1CS4C 1VIAA 3R9XA 2IT1A 3OE7A 4XSGA 3WNBA 2VP6A 3JZAA 5FPSA 2ZU6A 4W9MC 2NO6A 1KDOA 4WVFA 2H17A 5HCNA 4XVUA 1XDBA 1XXHB 4G5RA 4H1UA 1XD9A 2OT3B 2JIZD 3SJBA 2V6JA 4BASA 4Q1AA 1G1MA 3BERA 1W0JD 3ZVRA 1FW6A 2QT1A 1PLJA 4MA4A 1U81A 4AG5A 4PO1A 1NL3A 1ETUA 4UJ5A 3NBZC 1IM2A 2F9MA 5FTMA 4TLDA 1WDTA 3PUZA 3EPJA 1Q22A 4ACAA 2I1VB 3BFKA 5G41A 2FZLA 2J5XA 4QXAA 3THOA 5BQ5A 4A4DA 5JEDA 1W5TA 5KNDA 2CBZA 1EFRA 3KB1A 2YNMA 1YRAA 1F48A 3CR7A 1OW3B 4KBGA 2OBLA 5FL3A 1OIXA 4L9SA 3GLHA 4JSYA 3KJEA 2D4HA 4YXWD 1RJ9B 4CEJA 1DAGA 5DLQC 4EIWA 3R9WA 1AKYA 3FTQA 2WWHA 2DPXA 1SXJA 3LO5A 3TRFA 2GCPA 4AYXA 2QTVB 3LV8A 3KX2A 1E2IA 4JLBA 4IOLA 5AUPB 3AVWA 2DFKB 2B92A 1VG9B 1W44A 4Q7JB 3C41J 2V8OA 1QF9A 1N6NA 1XZQA 1ZUHA 3WXMA 4B71A 4BZPA 2GXAA 1Z47A 3E2IA 2XEXA 1KMQA 2O8EA 2ZI3A 3FPAA 3NC1C 2XXAA 2BJWA 1OXUA 2WWWA 4KJZA 5H1YA 4YONB 1R4AA 1UKVY 2ZRBA 1HT2E 3QI2A 2IYRA 1UKYA 4RD4A 3U5ZB 1IAQA 2PLRA 4BFSA 1E2PA 1E99A 2C77A 4W7SA 2GCOB 3R7WB 1U8YA 2VA8A 4Q5IA 1AKEA 3SN6A 5JJKA 4Q4HB 5DI3A 2H7VA 4AD8A 4HZIA 2RGNC 1FOEB 1XPRA 1U8ZA 1XZPA 3C5CA 5TARA 3RVBA 4AKGA 4URZR 4BRWA 2EVWX 1II8A 3SYLA 1E9CA 5JJIA 4P32A 1GRQA 5JJLA 2P6RA 1PUIA 4BECA 3L43A 4DKXA 1PLKA 1U0HC 2EFCB 2RGXA 4EPXA 3EPLA 1Z0JA 3JVUA 4B34A 5EE3A 2VH5R 4B47A 2H8KA 2WPDA 2PZGA 4RD1A 1SVLA 2ECKA 3KJHA 1NP6A 4ZDWA 1WA5A 5EXXA 2R65A 2DY1A 4URYR 3U3RA 4A9AA 5FPKA 1IHUA 5B64A 3IIJA 2DBYA 1J99A 3AGQA 4QG7A 1Q12A 1JPJA 5JECA 2VF8A 3C15C 2FSFA 2QMOA 2PJRA 3SQXA 2MMCA 4I4LA 4XWAA 4B2PA 1ZC4A 4M21A 3DM5A 2H18A 1KMHA 2C04A 2ERYA 3ZZUA 2O8CA 3OIWA 5H70A 3RS3A 3CR8A 1DELA 4HAWA 4HAYA 3MRSA 1P60A 2EWVA 2ZE7A 3PEVA 4ASUD 3U61B 1V5WA 4M9QA 4YMSA 4Z51A 3LAWA 3QQ5A 2O0JA 2VF7A 1O3YA 1YKSA 3EPHA 5EE1A 3B5JA 1R5BA 1OPXA 4M22A 1GILA 4FCTA 2OLJA 1ZM9A 1U90A 4Q4HA 5DI3B 5CLQA 2R8RA 2ZAOA 1CULC 4JYBA 4TQUS 1KHTA 1KO4A 1Q1BA 3A1TA 3WY9A 2QM7A 2R6FA 4G3XA 3EG5A 3E5HA 3RWMB 2XOKD 1GAJA 1JBKA 2CNWA 5LD2B 5BW8A 1M74A 2JGNA 2FNAA 3FB4A 4M1MA 4Q4AB 2DHRA 4DIDA 2AX4A 4U00A 4YLGA 2JLSA 5EE5B 3GMTA 3VR5A 4D4KA 2OCYC 1CP2A 2ZE6A 3DKPA 3HJNA 4YDHB 5C4GB 3I5XA 1KDRA 1W2GA 2C2HA 2EYUA 2Q0HA 3LWNA 1G8PA 3C14C 4V0LA 2AK2A 1ZIOA 4IFBA 4RD3A 1F3OA 2EYQA 2FWRA 2LWIA 2B8WA 2ZRKA 2W00A 1NJFA 4DC9A 2VBCA 4D4LA 2PLFA 1W7AA 2QMEA 1GDDA 3RLFA 4UNRA 5FUXA 4LBZA 2J3EA 4DCSA 2FEOA 3ZVLA 2QSZA 1W1WA 2ZRDA 3X1WA 4M1KA 3R8CA 5FH9A 3VAAA 4AKHA 4A0RA 4PXAA 3WNDA 3LQQA 3HU1A 1F60A 1G6OA 2LKDA 2HT6A 1HY3A 1U98A 3IHWA 4NYIQ 2DR3A 5FL7D 3IHLA 5GJVC 3DO6A 3SHFA 4Q47A 1HUQA 1OFHA 3Q5EA 5B30A 1ZYUA 3TJZA 1E2FA 2ODEA 4KCGA 1ZD8A 3DMDA 4P3YA 5FI0B 1ZAKA 1CR4A 1XMIA 4DLUA 4OK6A 4QC2A 4RD2A 4IXMA 3GLHE 4OJQA 2QPAA 4FCVA 4RFVA 1QVRA 5FPTA 2IXEA 3JVVA 2CE2X 3QEJA 3IQXA 2CHGA 2IXFA 2WJHA 1NVVQ 2A5JA 1NLZA 3UPUA 3P32A 5FPHA 1UBFA 1VCOA 3MAAC 1DBSA 2KBEA 4FN5A 4I99A 4LJAA 4NONA 3RRMA 3ZJYA 4A8JC 4Q9HA 1KSGA 2BBSA 4LJ9A 1GTVA 3LBHA 3W3AA 4MGYR 4DLRA 2IL1A 5GJBA 4X8OA 121PA 3O47A 4ZKDA 4PZLA 1S4QA 1U99A 3OIUA 5FOWA 1T0JB 1XEXB 3NG1A 4TZ6A 2MSEB 1YRBA 3TK1A 5FOUA 3WHKA 3GEIA 2J59A 1N5IA 4E09A 1RE0A 5FI1B 3KKNA 4C0HA 1X8JA 4MRVA 4L15A 1TMKA 3U3OA 1NKSA 4Q19A 3A1WA 4ACBA 4F93B 3B60A 2FSIA 2ZSAA 1MRSA 2YC2C 4C7OB 4TLCA 3GLGE 1LTQA 4Q4AA 1TQ4A 4ARZA 2MSDB 2IEZA 4TYPA 4LPKA 4PTLA 4LJYA 2XNDA 2AKAB 2FFAA 2QNRA 3SS8A 3ADDA 5TVKA 4QJ3A 2ZJ8A 3LDAA 3K0AB 2EWWA 3MLEA 1ZMXA 2F3RA 4Q4JB 4F7WA 2C5LA 1ZNWA 5KPJA 3IO3A 3QEOA 1SXJC 1ZM4A 4DLZA 4OHYA 3KKPA 4BLSA 3SJZA 2ZS9A 2W6JA 1XBTA 1L4YA 4ESHA 1KK2A 1NKTA 3CZQA 3QF4A 1Q57A 1OYWA 2QPTA 3KDSE 3F3YA 3RDPA 2WJYA 3EIQA 3HDTA 5J4VA 1A4RA 3A1UA 3U3JA 2FU5C 4URWR 2BV3A 2GEUA 5EP1A 4TL9A 5CITA 3LQRA 2ATVA 4QHSA 3CIOA 1Q44A 4OYHA 5AJYA 2RHMA 1I4LD 2WMOB 4Q03A 1IY2A 3NKVA 2ZJBA 1E69A 1M34E 3IIKA 2FV8A 1Z0AA 3OEED 3JZMA 2WWGA 1N6KA 3K0EA 4O25A 4PQFA 5G40A 5IDVA 3UXMA 4G5QA 4MDEA 1Z63A 2BMEA 5DHFA 1D2MA 3QF7A 4JBXA 2CCGA 2HDNB 2QN6A 3HP1A 2VRWA 1OKKD 4HB2A 2E9SA 3NDPA 3UMFA 1E96A 2WHXA 4NHOA 3SDZA 3IPXA 1Z3IX 3FHCB 4MRRA 2FGJA 2HCJB 4LX0A 2IF0A 2IS1A 4IVRA 5GVRA 3AP2A 4XJXA 2BC9A 2BMJA 4D81A 2QP3A 2ZUCA 3MCAA 4CDGA 4BEBA 3THXA 1E0KA 4LBYA 4W5HA 5D3MA 2QTHA 2ZRIA 1OE0A 3GJ5A 2WSMA 4RZUA 3RS4A 1L8QA 3CM0A 3GJ3A 2FA9A 1AIPA 3A58B 4C0KA 2QAGC 3B6EA 5TMPA 2REBA 3P27A 2ZI7A 2G6BA 1N6PA 4HLCA 5EP4A 4EPRA 2JAQA 3FKQA 1GNRA 2ZS8A 5CB6A 5JRZA 4XSHA 1K8RA 2CXXA 3TR5A 2ZYWX 3SNHA 1X6VA 2HXYA 3LBNA 2OEPA 4D80A 1XEWY 3EA5A 4LBWA 4RFSA 1Z6AA 4LWZA 3W9YA 2QL6A 1RKBA 4IVQA 4PPNA 1XFAA 2VTKA 1NLYA 2D7DA 1FNNA 1IN8A 1MRNA 5JS8A 4GNKA 3W34A 3HU3A 2G88A 4CZ2A 4NP6A 1D9ZA 2YZ2A 5B2ZA 3N2IA 1NIPA 1E1RA 3QNUA 3HR8A 1ZUNB 1HTWA 5E7JA 1Q1EA 2ZEJA 2G3YA 5KSOA 4POAA 3OIYA 5FUVA 1IN7A 4NTZA 1EFTA 4ZIRB 1PV4A 1AQYA 1RRPA 5DN6D 5K8LA 2C95A 1G5PA 1WF3A 2CCKA 1WCV1 2A5DA 4EFMA 3ZIAA 5KYKA 4QJ4A 3ADCA 3WYFA 1G8HA 4US0R 4RY2A 5P21A 3T12A 5A5GA 3AVYA 2Y8EA 1KY3A 2IS2A 4TSFA 1XTIA 4M0LA 2G0TA 3L8ZA 3M4YA 4RJLA 4CT4B 3VX4A 3BB3A 4LHVA 2GRJA 4B35A 4M9ZA 2BOVA 4X8HA 1W4CA 2B6HA 4D6PA 4C7OA 2FFHA 2A5GA 5FR1A 1X86B 1YJ5A 1ZJ6A 1LV7A 5BN5A 1AQUA 4JLPA 4M1OA 2BM0A 2RCNA 1XP8A 2WJGA 4JLNA 3AVPA 4LJ8A 1Z08A 1EFUA 2GZAA 3B1YA 4GOJA 3X2SA 1H65A 1H8HD 3PUYA 2BBWA 2WOJA 2IS4A 4LYFA 4B3FX 2ZRCA 4N0EA 4EPTA 1E2JA 1AA9A 3SEAA 3CPEA 4B3DA 1N0WA 1JI0A 3S1AB 3K9NA 4JJZA 2AN9A 3M0EA 3GLGB 1EG7A 5HZHA 2IEYA 4GDFA 2YOFA 3L0SA 1SKQA 4FMDB 4V0OA 3LVQE 3RAPR 3VKGA 1LB1B 1VPLA 1KKMA 3U4QB 2HF9A 4KAXA 3PEYA 4V02A 2PMDA 3B8HA 3BWDD 5DN6A 3EWAA 5FUYA 1DAEA 1QG2A 4HLUA 4CRWB 3TVTA 1M1YE 1KNXA 3VR2A 3KXLA 2YJTD 4MKHA 1YR8A 3ASZA 2QMHA 4LHZA 4TSFD 2J41A 4V0NA 4YC7A 3IGFA 2ODNA 3B1ZA 4Q1FA 4BPBA 1CTQA 2E87A 4LY6A 4DXAA 1NN3A 5KU1A 3E1SA 2G1JA 4M4SA 4AKIA 3UWOA 3DKVA 3GLIB 4A36A 1VYUA 1XMVA 3W90A 3NIBA 3CZPA 6Q21A 1XCMA 4TMKA 5L3QA 4MUAA 4DB2A 5KPDA 2HCBA 2GF0A 4DBLC 4HUTA 1I2DA 3A8TA 3THWA 4KLNA 3VKWA 1CU1A 1G3MA 1OXTA 1AS0A 3NBYC 1XD2B 3QXJA 4LK2A 3SC3A 1XD2A 4UNQA 1SXJB 3CF0A 3TUZC 5K8IA 4JLMA 3SZRA 4JLKA 1H8HA 1A82A 2W0MA 2Q21A 2QE7A 3QBVA 3T61A 1FMJA 2WWXA 1NMYA 2OG2A 1E2HA 3PEUA 2YV5A 1S1MA 2QROA 1G8FA 2YWHA 1QHXA 3FDIA 1OIVA 3CNLA 3HR7A 4OJKA 5KNBA 1KI7A 2CLDX 4DB4A 2GEVA 1KI8A 2V3CC 4JLAA 4D26A 3DZDA 1IXSB 3LNCA 2TMKA 1KJWA 4HAUA 1KIMA 2JLXA 2FPKA 3CX8A 4XIGS 2EW1A 4L8GA 4MRNA 4HB3A 3RS0A 4B76A 3LBIA 4PPQA 4EFLA 1EWQA 5HPYB 3BB4A 1MKYA 2WKRA 3K1JA 4B74A 2WBLC 3T5DA 5JHGB 4PX9A 1IY0A 1GZSA 1KAGA 1OT3A 4JLDA 1TF2A 1GKUB 3R8FA 4OI4A 1JAIA 3FMPB 3GJ6A 1C1YA 1EGAA 1BOFA 2VL7A 4TN1A 1VHTA 4KFTA 5G53C 2HYDA 3BBPA 3DOEA 2N46A 1XMJA 4Q1CA 2ONJA 2ATXA 4B33A 5CM8B 4CYMA 1PLLA 4PO9A 2GHIA 4WBSA 1ZINA 4PHHA 3TKLA 2EFDB 4IXNA 5C46F 3QXCA 4EJSB 2MMGA 4BFWA 3LLUA 3PITA 3CF2A 2CVFA 1YZUA 5CJ2A 5DIFA 1QHYA 4C9BA 2IWRA 2YOGA 3T06B 5EQTA 1MO3A 1R8SA
chains in the Genus database with same CATH superfamily
2OAGA 1GGJA 3M6IA 3H2GA 4GMDA 3OO1A 4P5DA 3TIVA 1C9DB 5AIBA 1BX0A 2BJVA 3NHKA 4AC9A 1W2WB 3I09A 1FNSA 1F17A 1NKVA 2DFVA 4E2ZA 4UBOA 3ULKA 2WKWA 2PSSA 3DOFA 1L7VC 4BN5A 1BD3A 3OY7A 4PYRA 1FXUA 4YROA 3UAGA 4GKBA 4HX5A 4GT1A 2UVPB 1B15A 2IH2A 1D4ZA 3D1LA 1P1RA 3SVZA 1FJ2A 1IBSA 1RXSA 2OILA 3IOEA 4TKLA 4ZI7B 4Z9AA 3FRHA 1ULTA 3OFKA 1L1FA 3CEPB 5CB4A 3KQSA 5C34B 5T41A 3SBOA 2QGFA 1VYVA 1HL7A 2Q9AA 1U3VA 4QT4A 2IOHA 1GZUA 1A4UA 3H7IA 5I7OA 3FKSD 1D1TA 2LCQA 1NXOA 221PA 4IRXA 2V4ZA 3S99A 4YUWA 1ABEA 4LQCA 3GI1A 3Q7EA 1Q1ZA 4RK1A 3RH0A 5HKOA 2BRUC 1AUPA 4ENPA 2CHQA 3P0EA 4QWWA 2R66A 5AWFC 3ZW9A 4EAAA 2FEKA 2V7QD 1XP5A 1LDMA 1NAIA 5AI9A 3ZXSA 1N5OX 4DUZB 2VAXA 4NU0A 4RD6A 4XIJA 4U9IS 3EW7A 1FQOA 3WWCA 5CFQA 4M1WA 2NVBA 4RCZA 1ESCA 3TE6A 2LW7A 1DKMA 1TDJA 1MUUA 3R3JA 3VR3A 1K4MA 1UAGA 2WU0A 1QFJA 1VGRA 4KDEA 3GEPA 4HI0E 1L3IA 3UZUA 1Q11A 4E4RA 1V7ZA 4HWPA 1XNRB 2J7PA 3OEWA 3F7TA 2VYND 2R00C 2Z95A 4IW3B 4JL6A 1DUIA 5K3FB 4CU5A 2NTJA 3HY4A 3SNKA 3UANA 1M6VB 2CEAA 4F9EA 1BROA 4KE9A 3V8PA 4HZUA 3ZV7A 5L3VA 3RC8A 4MIKA 1N4AA 1VPWA 2IYUA 2UZ1B 4YRPA 4CG3A 2XCSB 1Z0ZA 1W0KD 1XN4A 1GQOA 5JNLA 1G63A 3TBFA 4F72A 5F64A 4EY5A 4E70A 3W9BA 1KFCB 4JI6B 2BMDA 1QCYA 1SBZA 2BFFB 3KJIA 4TKVA 2UDPA 5K3AA 3MSXA 4F21A 5A7FA 1YZQA 4MA5A 1DO0A 4I81A 1KI6A 2G9ZA 4HWGA 4TTQA 5BSGA 2G1AA 1YS6A 5K8CA 3TPCA 3HACA 1Q7TA 3R5SA 5NLLA 3D3NA 1O97D 3URMA 3RIHA 3UGJA 2R751 1UZNA 2DCUA 2O0HA 2CF6A 2P2LA 2QX7A 3AM4A 3QVMA 4G1EB 1UBSB 3KQMA 3G79A 5GADl 4WJLA 2CXHA 1A71A 5A03A 3GFQA 1N8KA 3NHAA 1I2ZA 2CUZA 2X6QA 3BRWD 3GRRA 4B6SA 1NV9A 3EMBA 3ES9A 4V1CA 1A9XA 4FWTA 5DU2A 2OV1A 1A95A 3QLUA 1LJ8A 1J0EA 5K6RA 5J1SB 1DKUA 1BEEA 2F00A 4MHSA 4N7RA 3F74A 2X8LA 5IM5A 7ABPA 3CEMA 3HYLA 1U8EA 3AYXB 2O2EA 3JV7A 1JAYA 3MTGA 4ZOLF 4TMYA 4IUYA 4ZJYA 5AVUA 4XB2A 2YYYA 1QUEA 2X4DA 4QNRA 4AG3A 3QJ5A 2PO5A 4L8WB 1U02A 3UATA 3HA2A 3M34A 5BWOA 3GUUA 4NOMA 4AMYA 3E9MA 4QOGA 1HV8A 3GROA 1NUHA 1H2YA 2I4MA 5LKRA 2C98A 1MVOA 4WESA 2BFDB 4Q48A 1M6HA 5JVDB 5GJCA 3B1WA 1IWBB 5AM4A 1WPXA 3USCS 1TYDE 1QYRA 1HSZA 4QXRA 1KI9A 3H87A 2J0SA 3OKCA 4EB6B 2GXSA 4YJ2A 2ZRPA 1WPRA 1Q2XA 3DLTA 2CNWD 4RY0A 3KR0A 4RESA 5CT4A 3UAOA 1II8B 3WB9A 3CWZA 1XTKA 1ZH0A 4NZ9A 4GS5A 1AMUA 2FK8A 1PQWA 2F67A 2CDNA 1S8AA 2QUHA 2X41A 5IT4A 3OX4A 3VR6D 4N40A 2WUWE 5HKAA 5ALUA 1COZA 1L3BA 2ZZKA 4OAQA 4LXGA 3OOSA 2XE7A 2ZT6A 2FG5A 2P6PA 2H7CA 3Q41A 4MVJF 2FQWA 3L6BA 4BX8A 5J3JA 4QLOA 4TMFA 5BURA 5KYYA 3RFXA 4ZEMA 4M0KA 2Q5JA 1AKVA 2PKYX 4MYHA 3TLKA 3QMVA 2ZUDA 4C6RA 1E94E 4BP9A 5JWOA 3WSWA 1AUQA 4U6QA 3WGIA 2QL7A 2WMNB 4ZOLA 2ZRJA 4WXHA 4ZEVA 4M9CA 1E2EA 1V3QE 2FX2A 4R3UC 1T6BY 1ZHFA 4YCJA 2P4UA 4NR0A 1OI2A 1Z73A 3PK0A 2GHTA 2IBTA 2VJAA 2Q4DA 3GFSA 1UT5A 4YMIA 2ZIWB 4RLFA 4PZCA 5KX5F 2MSWA 3DLAA 4CM8A 5EQJB 3WQRA 1W5SA 1Z39A 3ASUA 4TMZA 5SZIA 4P5EA 4QATA 1UBMS 4ON9A 3C4JA 3NW9A 3L4EA 3WIDA 4R7GA 3C8UA 4ESEA 4BHTA 2AZDA 2QK4A 3L6UA 4YJFB 5DZSA 3ZE1B 3TNDA 2X8WA 2YQZA 3N2EA 1K7FB 4GM1A 1CB0A 5TQ2B 1RIFA 1KK0A 3IDZA 2W22A 4YO8A 3H8WA 5GWXA 2VTVA 3SE0A 2I2DA 2X7HA 2P3OA 2V55B 4BLRA 4D02A 1ZAYA 3EN0A 1IWPB 3W3AH 2MOKA 4H1VA 3L0PA 3HU5A 1KDTA 2P1ZA 5LM3A 4FTWA 3HWSA 4HH4A 4TS3A 3GZTB 4N12A 5LIPA 1QCDA 2YN2A 1FFAA 1M6VA 1G8AA 2K2WA 2OG1A 3FRJA 3LCJA 3ZBQA 4D8UA 1HYQA 4MEJA 2RAPA 4AYTA 13PKA 1EA5A 1GA1A 2WMYA 3CA8A 3MQ2A 4V2IA 4EVSA 2NO1A 2HA3A 1M8KA 3WE7A 2ID7A 3CO0S 5CH5A 3HLTA 3QPWA 4UHFA 3WO1A 1R0YA 3S8MA 1II9A 1KZYC 2BI4A 4QT0A 1KEEA 3SKXA 2ZJYA 2OFOA 1UBLS 2PTGA 3IHKA 1O6FA 2I54A 1FUIA 1YR6A 2B2CA 1KP2A 3GT7A 3AEZA 1E5QA 1OH6A 1Z7GA 4OH1A 3IV9A 3PNLA 4MDYA 4P3OA 4HRYA 4Q9KA 4Q9NA 4DV1B 1VA4A 4KUEA 1TT7A 5HGJA 1DX4A 4JFRA 2C5GA 4FFWA 1GNLA 3UW3A 6PFKA 4YCLA 1YDHA 5E2AA 2D5LA 3G2IA 3GEBA 2K7FA 3FBGA 1RWKA 4I1UA 4B4KA 2GBIA 1CNEA 4AKEA 1H5QA 2UXCB 4CF3A 1TNDA 5BNWA 4K9NA 2FPLA 4IJVA 5LQJA 3OU2A 1VM6A 4XYBA 4N41A 1J2EA 2ZYIA 1W7AA 5TMDA 3VFDA 4C87A 1UZLA 2GI4A 3CMCO 5AVVA 4X60A 4HDMB 3LUHA 3TAXA 1NUUA 4WLOA 4YB8A 5KDLA 2XB4A 1S5PA 3LX4A 1N6LA 2A67A 2QNIA 4QYIA 2VOEA 3RYFA 2UUCB 1T5TA 2Z6QA 1UMCB 3NHBA 4FFSA 4CFZA 4MYTA 1CSEE 2EC5A 4O1MA 5JSZA 4ZGBA 1R0BA 5C5EA 1UF9A 4FGLA 3RANA 2ZSDA 1GPH1 2Q6TA 3ZYZA 2R47A 4HPXB 4ALMA 4FQ5A 2NSLA 2GWHA 1GU0A 4E32A 2O8NA 2REQB 5BSFA 2ZU0C 1AGRA 2OHVA 1RIIA 1L4LA 5LSAA 2VPTA 3P4XA 2WB2A 4J9UE 1L9XA 1SOAA 2R4QA 2R9VA 4RMIA 2RGBA 1W88A 2CZGA 3EIXA 1DOZA 3AUAA 4F1JA 4KN6A 5ES3A 1P8JA 3U7JA 3QX3A 4X7RA 2N75A 4D3DA 4CMEA 1U9JA 3BQMB 3STHA 1FSSA 4JEUA 3DE4X 4IRUB 4DM4A 3N0RA 3R5TA 1LRKA 4FMDF 1ORTA 3ZBUA 1FQJA 2XUJA 3AOEC 4B1FA 2NUAA 5JAOA 1L5SA 3PFCA 2XYQA 4PXSA 2X13A 4GDMA 2GR9A 1LBQA 5JWRA 3JY6A 4LFCB 5BO5A 2QYOA 3EBPA 1BNCA 1M6YA 1NU6A 2JLYA 3VNVA 3KU1A 3ET5A 2VSQA 3PI6A 1CR1A 2RAVA 3W05A 5AI8A 2GPJA 1W9HA 4B7AA 1H05A 5IVHA 4RGYA 3IQGX 3JYOA 3VNUA 2DLDA 1U2GC 3H2IA 4OFZA 3VR1A 3Q9UA 1W4LA 2EIHA 2I7VA 2XRMA 1G8GA 1JSRA 1P2SA 4DCCA 3RC1A 1EWVA 1JHZA 4G4IA 3SQDA 3X1XA 5IUJC 3C5WP 1P7CA 3GEHA 1ADJA 1DV2A 2E18A 1WCIB 3JQBA 5L3RA 2XUKA 4BV9A 5B57C 3TI7A 5EJ2A 1F51E 2AOTB 1P74A 3SJ7A 4BNXA 4C20A 1AK1A 4XQ9A 4RL6A 3QUCA 4IIJF 4FIZA 4PX5A 3RIGA 2XIQA 1ZUNA 3HUEA 3C3CA 2IHVA 2AHOA 3KAKA 3NIGB 2GS9A 2XE8A 2H1FA 3BB1A 3R6GA 5EIWA 3PNMA 2RG7A 1GHTA 4JX8A 1Y6RA 4AVYA 1RI5A 1TM3E 2OZKA 1JDZA 4BBZA 4AX4A 1FNCA 3NDIA 3OJWA 3CSUA 4IMIB 3CE6A 4PINA 3U7QA 1CF9A 3RARA 2WIAA 1UJNA 5KDOA 3FPHA 1XVIA 4XYGA 4M53A 4YRTA 3TZQA 4C21A 1N25A 2FB9A 5AFSA 3VKHA 3PXBA 1CRZA 1D8TA 2M6SA 4PRLA 2OHOA 5DRYA 4JJKA 3GJ8A 5JE8A 2FKAA 4OP3A 3WLFA 3ZCRA 1ILEA 2XYRA 4NIMA 4WZAA 1M76A 1VBKA 1YONA 2Q3JA 5DBHX 3TB4A 2AIRA 1YVUA 1AQIA 3H86A 2CJFA 1JIIA 5BN3B 1CLUA 3IAHA 3ZHVA 2WAXA 2BKAA 3TVYA 3OEHD 4YUAA 2HADA 3AZQA 3KJFA 2Z1NA 5I5GA 3L8CA 2UZ3A 3N6VA 1H69A 1J8YF 2AB0A 1R4MB 3ZVNA 1GTSA 1OXSC 1K88A 2JF0A 3H6KA 1NI4A 1O9BA 1PT8A 4MVWA 5FBWB 3TKYA 4F12A 1FDTA 4M3NA 2BEVB 3HJHA 3M6WA 2ZTSA 3WBFA 4G5FA 3SOZA 4TVSA 4K9DA 4PFJA 2VXYA 1I6MA 1NBME 1ZBQA 2DGDA 2PXXA 3FYDA 5CFZA 4R1MA 2G6TA 3UYKA 3DMFA 1KMHB 1UXIA 3CNQS 2HL6A 4J07A 1NJ2A 2WM9B 4KWCA 4PHTA 4CG2A 5HWSA 1JLLB 5J4KA 4FW8A 1CUGA 1OTHA 1QH0A 4OV6B 4P54A 4IQFA 3VTAA 5KZMB 4HXFB 2A33A 4FMPA 1V1JA 3INNA 2O1WA 2D8AA 3I72A 5JAPA 5COQA 3IQWA 4QDXA 4JI0B 1K7SN 3E1KA 4PWZA 2YJGA 1G3QA 4MITA 3ZWOA 1FYDA 2OXCA 1TK9A 4RC9A 4YCNA 2EFJA 2GXQA 5JARA 4HVCA 3PB3A 4CF6A 4II3A 1UJBA 4F91B 3PTLA 2FXVA 1ULSA 3OPQA 2R6DA 2REXB 3PR2B 2OK7A 4JXJA 2XUFA 4Q7LA 621PA 1JDJA 3RYIA 4KH0A 4YAGA 1WIWA 4MTLA 4P98A 4UHBA 1AU9A 3B6KA 1QV7A 1QAQA 1CBUA 1WQ1R 3PXDA 4MUFA 4R0MA 1Z75A 4MR8B 1A98A 3TNFA 1FX0A 4Y2TA 3I04A 2CK3D 2O3UA 2XZPA 5AKGA 2XCRB 3AILA 1XN1A 1ISJA 1J6UA 2UUOA 3IJRA 3QKSB 5CNMA 3Q72A 1P1IA 1NPTO 1NW3A 1WTAA 3DXYA 3JQEA 3KVYA 3G0OA 1O5TA 1Z28A 1X7WB 1BE6A 3PX3A 3H83A 3RUCA 1K8XB 4EKIA 1OFTA 3H1PA 3MD0A 2BJHA 2D0OB 2KJQA 3VA7A 1J1IA 3VO2A 3CE9A 1ATIA 3AYZB 2QX8A 8LDHA 1GLNA 3AUXA 4Y2XA 4Y0AA 2O0KA 4KN8A 2J33A 2QSUA 5CA0A 1GSHA 3VPGA 1R4ZA 4IKPA 5BYAA 1XQ6A 3LCVB 3OCJA 2ZI5A 1EUCB 1XYVA 1R5NA 3LW8A 3PUWA 3TH5A 3C1OA 3W8NA 4PFSA 4BLOA 3UKOA 1YKFA 2VEOA 1O95C 2B5OA 5FNVF 3Q88A 5CLJA 3HXQA 3PFNA 1MAVA 4W1SA 5D7NA 1T9CA 2JLCA 4WZBA 1MJFA 2NZVG 1PN3A 2E1PA 3WRXA 3LD9A 1QHGA 4NOJA 3K30A 3J7TA 1V8OA 2F59A 4XJTA 3RHTA 3BXFA 4HYQA 3QVOA 2GTHA 5DHRA 1JG3A 4EG4A 1GRNA 1HLGA 2PZMA 3CF6R 1MBZA 2C4NA 1ZN9A 3GCXA 2HM7A 4MPRA 4BMCA 1T5BA 1WCIA 2A0XA 1KBQA 2B5VA 2VCEA 1N32B 1AXRA 2CNBA 3PZRA 4UUMA 4AY4A 3GP5A 5LXTF 1LI7A 3KEQA 3AHJA 2EFEB 3H1TA 4RVDA 1UC4B 2CNDA 2HQBA 1X9HA 3JR7A 3MINB 3DMNA 1VBMA 1PFVA 2HDOA 3MUNA 3RRBA 1BA2A 2XMSA 2VUHB 3WP1B 4DGQA 3ERCA 4PRYA 3VH2A 1UK9A 5CDFE 2XJ9A 4AP5A 3V34A 2POQX 3IPYA 1GTJ1 1A0OA 3D3QA 3PUVA 2XGJA 2C4VA 4NRDA 5FQOA 3EGIA 3M5PA 2YWXA 3OOJA 2FEPA 8ATCA 3NHFA 3BTVA 2GPSA 3NH9A 1W47A 2KMLA 4G24A 4L4UA 3ZIAD 4BNYA 1Q7BA 4LYAA 2ZUFA 1JR6A 4EQ6A 1IZZA 3AGPA 1NVGA 5BT9A 1X8XA 4DIBA 4DSZA 2WA1A 1UPXA 1UXKA 2HPHA 1IQPA 1G1AA 2ERXA 2QS9A 3V4LA 4WZZA 1IHDA 5AHRA 1VPDA 4GXRA 1Z7YA 3U7IA 4JIMA 4AS2A 2G82A 1TA9A 4DPLA 2EW2A 4Z7NB 1C80A 4OUDA 1RMYA 1FEZA 2WFLA 5FPYA 3SM9A 1TYCA 1Y4DE 5JZOA 2A35A 2AR7A 2QVGA 4J03A 6REQA 2Y92A 5KU7A 2GJAA 1I7LA 2GRUA 2CFSA 3QVTA 4WFQA 2IYTA 5A1JA 4P08A 2I6SA 1BS1A 2P6UA 5AUQA 1IK6A 3R5KA 2F8TA 1P7ZA 2XTNA 2I29A 1SCKA 2IU0A 1S2DA 4AP6A 1TTTA 2Z2KA 1UKZA 2PY6A 1SQSA 3IUEA 3IT3A 3FGPA 1P0MA 3WADA 3HFSA 2J6HA 4P2GA 3AJDA 2QTLA 4DCNA 3UMVA 1IRIA 3LM8A 3PPXA 3HMQA 1J90A 4HEA6 4RY8A 1KPHA 3VYUB 5HBGA 4Q21A 5FADA 2V9CA 2RHCA 1H4QA 1U0BB 4EA8A 5ER6A 4U9HS 4J0FA 5BY2A 2ZYVX 3HCDA 4GX1A 2DETA 2HF8A 4E5PA 4PO8A 4PF1A 1NX9A 1JN0A 5DBIA 3ETJA 5JNTA 4UBIA 1W59A 2E55A 3UV6A 1YL7A 5L4SA 1XPUA 1N4DA 1SU8A 2DH5A 2CFOA 2JH9A 3CZCA 1P9RA 4F5ZA 3IPRA 5BN4B 1JYEA 2HSWA 1HK7A 3AHFA 4BO6A 1UDXA 5C1IA 3PQCA 2QRVA 3STUA 5ELXA 4LJLA 4EGQA 1WABA 1LSOA 3LCUA 3ZUGA 4NG5A 2YW9A 2Q3MA 2BKXA 1RD4A 3BIJA 2I4IA 3F78A 4Q01A 1AHPA 3P97A 4JA0A 4NBRA 3CR3C 4C0JA 1ZQ9A 1CB7A 3GUZA 5A4JA 5KHOC 1FF9A 4WIAA 3FSRA 5ULLA 1G7RA 3ZNOA 1I7NA 3A1NA 3THRA 1TCVA 2VK2A 4QFBA 3RODA 1WKCA 4QDTA 2ZYRA 4IIYA 2O5VA 1W94A 1RM0A 3E3MA 3GRUA 1NVMB 2GH1A 2GFQA 2VYFA 3IXMA 1T0HB 3IUQA 4L51A 2X86A 1KAOA 1BCRB 1P5HA 1T36B 3D8TA 4HQRA 4MAMA 2HJGA 3JYPA 2HW8A 4O2LA 3U5TA 5IN5A 4RS4A 2JASA 1RAIA 2XWJI 1EJBA 2QVBA 1JHUA 3ZU2A 2L2QA 1UDCA 2BZ1A 1XA0A 1FLNA 3RV3A 1UWLA 1ORVA 1OX5A 4EO7A 1DMSA 3AMVA 1AUVA 1FL9A 3NIWA 1H2ZA 3ZCPA 1BHSA 5KNCH 1NVWQ 2AW5A 2O3SA 3SHWA 4KPGA 3Q9LA 2P1RA 5AW9A 4NYIR 1FYEA 3LWBA 1A2KC 1R0ZA 7MDHA 2FFQA 4PLGA 3TLEA 1PSDA 2EF1A 2JI8A 3EZ9A 3S70A 5JOQA 2BWJA 4C3OB 2J9FB 2XB9A 1T6NA 2YDYA 3QXSA 2JJ1D 3CRVA 5JD5A 4OQXA 2J8ZA 1IMJA 2SHKA 1VLHA 2BT4A 2P2YA 4EF4A 3GLGA 4BBJA 1MV5A 2X3UA 4Q02A 4PR0A 4ALNA 5JDIC 3N2YA 5L45A 4F8EA 4WKOA 1AZLA 4C0BA 1M5UA 4YY3B 2RD2A 2R7AA 1IXKA 3CX3A 4N7BA 1E61A 4RFLA 5K0LA 1JKXA 1CDEA 2REOA 1WQ3A 5EZ6B 1JXAA 2GK7A 4XVHA 3V2GA 4G1CA 2XBLA 1EVLA 1OHHA 5COBA 1T2AA 4GWGA 4IJUA 4P36A 1YAHA 3DF9A 3M6XA 4GPAA 3WRVA 5J2UF 4JSTA 4J0CA 4DNPA 3M83A 5AKHA 3ZHRA 3SBDA 4NI5A 5L6MB 1ANKA 1T3TA 3DUFB 2WWRA 4OSEA 1KRXA 1GQQA 1TLFA 1EGHA 3WMEA 3A26A 1RJ9A 1K6MA 3OPXA 3QRWA 2YS7A 3GIDA 4FN4A 4B7XA 3FOFC 1O9GA 1DQYA 1KZGB 1EWRA 1VLQA 2DJIA 2X8AA 3B70A 5MDHA 1JB1A 1VJGA 1M2GA 1NAHA 1S9HA 4PYQA 4XCVA 3KZCA 4FNGA 4J49A 5AQ1A 1R0KA 2WQ7A 2XUDA 4LEIA 1DKLA 3M3HA 1PNTA 4LI0A 3I5UA 1C4XA 4MI3A 4RU1A 4OBBA 4IDEA 5DBGA 1PJCA 5K3OA 2AMFA 1P77A 1X9GA 2A58A 2IZ0A 4MZDA 1A9PA 1IPFA 1E4EA 2QRUA 4TX1A 3DF7A 1IUPA 1O94C 3ZS8A 1LDBA 4JGIA 4OLJA 4FK8A 4DVGA 1SUEA 1L5RA 4JA2A 3SC2B 1NJGA 3DFIA 4I5GA 4LJKA 4IDPA 1RYDA 1YOVB 3HK2A 2JFWA 2JCVA 4ZFNA 2JAOA 2C07A 1NFQA 2QQ5A 2R60A 3U4MA 3GLTA 3D64A 4ZO6A 2SCUB 1B8NA 3AKCA 1AJEA 5DTMA 1YE8A 4NU6A 4B85A 2A2ZA 3AJRA 1X1EA 3DMRA 3WISA 5JQWA 1ZP6A 3E1GA 1RLTA 2Q49A 4WRRA 3FM9A 3NHSA 5FBLB 3L7CA 2V6IA 3JD2A 4CKCB 1Q14A 3N86A 1NXWA 4AXXA 4J1QA 1FFEA 1TO2E 1KRWA 2R7MA 4UBLA 1HLDA 1I5RA 4G5SA 2FPGA 4JY7A 4GP9A 1K7XB 2FSSA 2W6ZA 5L8VA 2VDLB 3TGLA 4ND6A 3O8CA 4RWZA 3C85A 4DA0A 2PH7A 2WAYA 2ZSFA 1A5TA 3LHIA 1GADO 2BCJQ 1J00A 1UBGA 1FDRA 1FFGA 1JJ7A 4IQ0A 4IRMA 4BDSA 1F1BA 2PBRA 3FFWA 5BN4A 1RFLA 4EENA 1A7KA 3H2YA 3U6KA 3RTBA 1PUXA 5B53A 4E5MA 1GZ3A 4EYOA 1K89A 4FYKA 4Q3BA 2CXOA 3RYHB 3O3MB 4TM7A 3RREA 4BEVA 4E03A 3CNOA 1L5OA 1Z7EA 3H5NA 4YJGB 3AVUA 2J3QA 3F1KA 4X84A 2XIJA 3VKUA 1QIDA 3GQBA 2YC4C 4KQFA 4AZ3A 3I8XA 3UB3A 3L1HA 4DLXA 2W6PA 1KMNA 4C4RA 2G67A 2LV8A 3IP9A 3K4QA 5AJXA 1KMMA 2GYYA 3ZHTA 3Q5GA 5KHLB 3QVWA 4CEHA 2BH9A 1CUUA 4NL4H 1Y9EA 4DMHA 4JKIA 5JALA 3KVNA 1Y1TA 1MPXA 1Z5ZA 3P9CA 5GZ1A 2GA9A 4HDMA 1E9FA 4K9QA 1LLQA 4KIGA 4M8IA 2VH1A 4MGKR 1RVV1 4F5WA 4HAVA 3I2JA 2ENWA 3EQZA 4OKNA 4YAOA 1G8YA 1ODJA 2NSDA 5AJWA 1YS7A 2XVZA 3NOOA 3UHOA 2JIPA 3NBAA 1DFHA 3IE0A 3QENA 4U39A 3UXHA 2YN0A 4BCBA 5DNWA 5B37A 2AD5A 2YZ7A 2H1VA 1F38A 4FU0A 3NNDA 5D51S 1ZONA 2I3GA 1RRFA 3A6DA 4FYJA 3MMSA 5CVCA 4CKCA 3AVVA 2Y1DA 1H1LA 2CFTA 4MJ7A 1TW2A 2ZUBA 3E35A 1M34B 1RLIA 2IUEA 3OQNA 2JKZA 1AS2A 3H3FA 4JKOA 5E0OA 4BVEA 1QG0A 3OZGA 4PLFA 1SGWA 4GEGA 1SG6A 3IR6A 3MWDA 5IKMA 4I8DA 4RK6A 5EXEA 2I1LA 2D3WA 2OMKA 5EIFA 3ZD6A 3N8HA 1OI7A 4Q00A 4JGBA 4BU0A 3W6OA 2CCJA 2ZVQX 5A0FA 1QGYA 5BYJA 3RD5A 4DQ0A 2QJTA 1V6AA 4BNTA 1Q1GA 2H2AA 5JADA 3PTAA 5DNCA 1LBTA 2G77B 2YWBA 4WCFC 2H1WA 1FB5A 1OTXA 2AOVA 1OXKB 1B2RA 3F2IA 3LUGA 4JITA 1O94D 1RHQA 2I3DA 2X5XA 5ED0A 4CF5A 2F48A 4DNOA 2WPDD 4JP1A 1T3ZA 3L7YA 3TR0A 2XMDA 2L18A 5U4QA 2C3MA 2P90A 2JIOA 3EMVA 2VUSA 3DP9A 1NI4B 3ZDBA 1FP4A 1Z5PA 1JH9A 3VNRA 1SVWA 1ZXLA 3N59A 4H4DA 4EGJA 4XAQA 4EYSA 3OM8A 4EQZA 1Q19A 4W5WA 5KSWB 4YNBA 3HJGA 3QPVA 2BTEA 5AESA 4M60A 1E3TA 4QU5A 2WJZB 4YHHB 3BUSA 4HQLA 3Q7RA 3K9CA 3BEOA 3EC7A 4MKZA 1Z36A 1FQKA 1CE8A 2NV0A 4QDKA 1XDWA 4D4MA 1AF4A 4WXPA 5AUNB 3ZV6A 2I99A 4O4IA 1VMKA 2MSCB 1QFMA 4LJ4A 4XWOA 1KI1A 1ODLA 1F2UA 2E5LB 3PXGA 4G4SO 2MYTA 4IZ6A 5KYYB 4G5YA 2C2YA 5T3YA 2PR2A 1N2JA 3ESQA 3HYTA 5AYVA 2GNPA 4QBHA 4NZPA 4OJNA 3ZGZA 4CG0A 4KWIA 1PQ4A 4ZHSA 4Q82A 3R5FA 4A8JA 2WFAA 3OFSA 4JROA 4F38A 1QIJA 1XJCA 4J3FA 3U9SA 4NCJA 1LUAA 2FDXA 1FVFA 4PSUA 4CL3A 4LRXA 4JLJA 1KARA 4NBKA 4CI0B 4W5QA 4QVGA 2Y9PB 1XRRA 3JYHA 2OE2A 2BTOA 3F0TA 1YI8A 2AXPA 1A7UA 3R1IA 2IHNA 2IE0A 2QM0A 2DSTA 4UDOA 5CNIA 2BEKA 4N5HX 1J8QA 3EEIA 3ETLA 4PZAA 1LWNA 2C7GA 2NQTA 2PXHA 4J1NA 1IVYA 4FYWA 1VI5A 4B82A 3CJQA 4JI4B 3ENZA 3C98A 4J9VA 5HEKA 3CRRA 3LC0A 2QB5A 2GETA 2AMYA 4D9KA 3LECA 4OLBA 2RAUA 2DBVO 4US2R 1H66A 2AV6A 3EYWA 3ZD7A 1D0IA 2PRJA 4WFKA 2WF7A 1DAOA 3TSAA 3BJEA 3SQNA 3NHLA 1XZDA 1XEFA 1YRYE 4PC3A 4UVEA 3J81A 2WDZA 1LTKA 3IYLW 4TYWA 1OFUX 1UDWA 1OFUA 3MMPA 1E0DA 4KXUA 3PUHA 4BTVA 5HIMA 1E3QA 3RI3A 1ONSA 4JVSB 1DOAA 5B6JA 2O8DB 2B4YA 2GN6A 2AVDA 5FULA 2OCIA 3Q7SA 3ZI0A 1JJVA 1P4RA 4H3VA 3P5BA 3OKAA 2PT7A 1DXOA 3NFYA 1WSAA 4A6EA 1VFNA 3L6RA 4Q1DA 1A9OA 5ALQA 1QH8A 2C20A 1P6XA 3K9GA 1JIJA 2IF2A 1BEZA 5HBRA 2PGIA 1N75A 4RTOA 4G0OA 3JTEA 1I14A 3M2PA 1ZY2A 2YOHA 3VU9A 2VP3A 4ZVTA 2CT8A 2OWEA 4BQPA 1V43A 3LBFA 2YKGA 2V65A 1K4YA 4UOQA 4HRXA 3AIMA 1S3SA 1YOVA 1DG3A 1SQFA 3GDGA 5B12A 1YJ8A 2QORA 3R3VA 2FAXA 3I5MA 4QTZA 2F3TA 2GZDA 2F3SA 2V7GA 2EG5A 2GWRA 4OI1A 5HQ3A 2NU8A 4ZAVA 4HUQB 3CGGA 3G82C 3MJEA 2VSOA 5G3ZA 1QF6A 3AP3A 2Q7XA 4ZA2A 3ZCSA 1Y6FA 3PYXA 4RPKA 1A8PA 3U7FB 5G1OA 4YI5A 3B9BA 2AE2A 3WRXC 1D2EA 1P61B 3O73A 3MF4A 2PCJA 4MX8A 4E5KA 1YE3A 1T2UA 1IPEA 1VKJA 4QTTB 4NMMA 4RBNA 2QNBA 1BDMA 3F3KA 5TNXA 4EGCB 1XZFA 2DCMA 3JRXA 3KR2A 2C03A 1QGZA 9LDTA 1XTJA 1DTSA 2VJNA 2OO3A 3AJ8A 3D6NB 5KCZA 1FQWA 5L53A 2HGZA 3WFZA 4Q7EA 4JYMA 4G65A 1HOXA 2F1RA 1YCDA 2RGWA 2ECPA 3D6HA 3AERA 5G4LA 1JSCA 1M0WA 4R40A 1HNNA 1NMQA 4OXYA 4LRWA 2H3EA 1WU8A 2DUUA 4AJOA 2QGZA 5DGXA 2HNKA 2GJKA 2ZTLA 4Q15A 6REQB 3MCTA 1D4OA 1M0TA 3E3OA 3RUIA 1FXWA 3ADBA 2BHSA 2IXAA 3OWHA 4D3SA 2P1DA 3GZNB 4JSRA 4MYCA 1DEXA 4UXIA 4FP9A 3VNAA 5A4DA 5JS2A 1KP9A 2QMYA 3VISA 1U7HA 2GPAA 3DE7X 3OHSX 4EFNA 2R1UA 3LDGA 1U8TA 4QJ5A 3PEWA 1POXA 2BSAA 4WY5A 1ORHA 1Z88A 1NR7A 4YQFA 5ABPA 2BKUA 3O8DA 1BCSB 3OJCA 1GL7A 2K5UA 4JOCA 3UGKA 4F85A 3NHPA 4M55A 2OAEA 2WQZA 4EB3A 1AM4D 2FYTA 5IF9A 1AMNA 2VHVA 1OAOC 3GU3A 3LBAA 3Q3EA 2LIPA 3WBBA 3VAYA 4WLEA 4ES6A 3CG0A 1DQNA 1TQDA 1ORWA 2RGUA 3SX0A 3VRHA 2HBRA 3DEJA 3CONA 3NVMB 3S1AA 3ZJ5A 1WW2A 2QD3A 3DVLA 3TGWA 1N3IA 1YRLA 4QOHA 1Q0HA 1OWLA 4XFDA 3MUFA 3B89A 2EKPA 1ZK1A 4V0ME 4DC1A 2OXRA 5LYJB 1PNOA 3FOCA 4W9RA 4DCMA 1N6HA 1W8IA 3H8VA 4C88A 5BXQC 2HWXA 4DJEC 2Q2VA 5H16A 3IOCA 1NBMD 3QJYA 4IYRA 4L27A 2XZOA 4KTTE 2PZFA 5HCIA 1HE8B 3U40A 2QQEA 1JQJC 2QD2A 1HFEL 4DDTA 2EQ5A 1FU7A 2B1IA 4N01A 3LHDA 2NACA 4RVHA 3FNHA 2XTMA 1IE3A 1KIFA 1GPWB 2JKVA 3A1VA 1VXRA 2NYAA 3AEKB 1XKLA 3NEYA 3GA0A 4L9RA 4W8GA 5LBTA 4A91A 4AIIA 3LFUA 4JZYA 1UOEA 2AWNA 2W58A 4O3MA 2CV1A 3ILYA 1RLJA 5BSTA 3H6HA 1E60A 1XGKA 2XY4A 1OH8A 3DLBA 1QXSA 4F6RA 3K6KA 3W5JA 2OD9A 4UQLA 1MOZA 3NEJA 4X63A 2A57A 1DIHA 2VH2A 5C18A 4NYMR 5HS6A 3HFGA 1W85B 2F8MA 1J24A 1JSLA 2NPIA 1X0VA 3NUGA 4LYHA 1P9LA 5H3HA 3VHXA 3ZDEA 4S1PA 2Q07A 4TOIA 2XHZA 3T3MB 3VKVA 1F2DA 3HWX1 3ROZA 1CUFA 1X7XB 2BEUA 2BFEA 2ZWAA 1Y5RA 4NOLA 4K6MA 3I9OA 2QJFA 3LZ6A 3O2NA 4FB4A 3PNPA 4ZHQF 1P5RA 4LF5B 3DD1A 1NYQA 1LPMA 3DUWA 1KS9A 3T9BA 4BNUA 2IJGX 1R4MA 1DC5A 1ZM3A 3GEGA 5AKJA 2ECOA 3V4SA 2VLIA 4LV5B 3E3LA 4QXMA 4DT1B 5GINE 1JZTA 1KEZA 3OMWA 4OHWA 3LT4A 2Q99A 1H9CA 3GGCA 2MWMA 4F3YA 3R3UA 4KYIB 3RUEA 2DF8A 3L0ZA 3U4CA 3BIXA 3V8NA 4C0LA 5EJ8A 5ESWA 2FMHA 2DHDA 1JAXA 4WOBA 4UPDA 3IB3A 2X4LA 5SYNA 4LRUA 1QGAA 2AJDA 2RGDA 4UUPA 4W6ZA 5C5CA 3HXKA 5IJZA 1RPNA 3M4ZA 4INZA 3ZE2B 1S3IA 4DV3B 2BUBA 4MV0A 3OFVA 1NIJA 1TYEB 2P9HA 4CLOA 2I5PO 3SZUA 1DIRA 1BDIA 1E5VA 2FJUA 5EJGA 2W93A 3B78A 5J1TB 1TYAE 1AO3A 3H0KA 1KVTA 4FLFA 3RTEA 3AZPA 1E62A 4B3IA 1ECPA 4Z7JA 3L1UA 4DOMA 2XWPA 1CQZA 4P86A 3QYAA 1GUAA 2DWQA 3CLSD 4BMNA 1B23P 3H1GA 1YFJA 1SHJA 2WUEA 1K5DA 2F1JA 4Y0NA 3K8QA 3OF5A 4FT4A 4DNFA 2UYCA 2J4CA 2V7TA 4P4UA 5CYGA 1ABBA 3QBJA 1DTWB 4OY3A 2C7RA 1WAMA 1W5FA 1BRTA 3MTBA 1CJCA 2FH5B 4PW0A 1I32A 1FX0B 3ORHA 1USUA 4BMOB 4EEKA 2JGIA 2IYFA 3QE2A 1RDFA 4GZMA 4CMAA 1GN9A 1TEVA 1K3UB 2SKEA 2ZITA 2CHFA 2A94A 1A4IA 4JB3A 5JFOA 1NE7A 2VJCA 2DR2A 2XTZA 4FEYA 5L3SA 2QJRA 4ND4A 4B80A 3AP1A 4TWZA 4N9WA 4JR1A 4Z3OA 3NONA 4Q1EA 2PWPA 3T95A 4BATA 3EC1A 2QRQA 3WRWA 5E9WA 5BMVF 3NM4A 3IEUA 3L79A 3TSYA 4OAOA 4B3JA 1KJZA 3OIVA 2DVMA 3UHFA 4W7IA 5FBRB 2B83A 4RE6A 1A77A 5B58C 1UP4A 1RI4A 3GJQA 4NCNA 4B6RA 4LXIA 3ZK7A 4POOA 4FCWA 3KQVA 1CQWA 3PTZA 2JLAA 1MB3A 3K0BA 4JQSA 4OHOA 4QUGA 4UCQA 1FJHA 3QLVC 1SWVA 5C32A 4FDTA 1ONPA 2I9KA 3ZH9B 3VGPA 1P6QA 1SQ6A 1UOQA 2YHUA 3AI3A 3AX6A 1EXMA 5DSTA 2GXUA 5SYMA 3NX4A 1H0RA 1QAMA 3ORRA 1NBIA 3P1JA 4INOA 4D9JA 3G17A 3K1AA 1U0OC 2O2DA 3N2KB 3B7PA 2ZB3A 1FFWA 2Z8YA 3KZKA 4M2LA 3TFQA 2DLNA 1JZSA 3IAS1 3OCUA 4M7WA 4XIFA 3VSDA 1MT0A 2WLTA 5KTYA 5LYYA 1P0CA 1OLUA 2W6OA 3IJPA 4F1WA 5IKOA 1RRGA 4CR7A <