2A5FA

Cholera toxin a1 subunit bound to its substrate, nad+, and its human protein activator, arf6
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
162
structure length
162
Chain Sequence
KEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the activation of cholera toxin by human ARF6-GTP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/transferase
molecule keywords ADP-ribosylation factor 6
total genus 55
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2a5fA00
3CRRA 1E1QD 4TLCA 1ZM4A 2WPDA 2AR7A 3IEVA 3MFYA 3SI7A 3QNUA 1OXTA 1KO8A 4G3XA 1JR3E 4RZXA 2LKCA 2IYWA 4MUAA 4RFSB 3K09A 2GHIA 2P5SA 2HLDA 5G41A 2J0QA 2EW1A 1JBKA 2ZITA 5DGXA 4BEBA 4H9GA 2GF9A 5KSOA 3SNHA 1M7BA 2ZE6A 1Q1QA 4BFTA 3AVUA 2ZU6A 1JEDA 1Z6AA 1RRCA 2IYVA 3B1XA 4IXNA 3AF4A 2FPMA 1Q3TA 3DMNA 2Q21A 1LS1A 1UPTA 3K9LA 1G20E 1X1RA 3RHFA 4NU0A 4C0LA 3SU8A 1NSTA 5E95A 1G4AE 1FMJA 3ZQ6A 1G9XA 2YYZA 2A7QA 3LFUA 1IOZA 1R5BA 2C5LA 2WSSD 4Q19A 1Z0JA 2WJVA 2WJHA 3VKGA 1VG0B 1H8ED 2BCGY 1TQ4A 1KZGB 2GDJA 3M6AA 4PSKA 3GJ7A 1E4YA 3S1AA 3PEVA 3TSOA 4RSGA 4JSTA 5KSZA 3J81k 4XSGA 1E99A 1QBKC 4YDHB 1DOAA 3I3SR 1G3QA 3PV0A 2YC2C 2F3TA 4F91B 2J59A 2ZU0C 2QT0A 5DH9A 2X77A 5B2ZA 5KPJA 1J2JA 3UWOA 4ZV4A 1FNMA 3GJ8A 3T35A 4CW7A 2W2TA 4RD1A 121PA 1OIWA 3T5DA 2NO6A 1OSNA 3ZS8A 4D0NA 5C2JB 4JT4A 4POAA 1KSGA 2YWGA 2HJVA 3QG1A 4D26A 1S8FA 2IBMA 2QGNA 1F6BA 3HJNA 5CIQA 1E2FA 4IDQA 1W4CA 3E70C 3ZZTA 4DLRA 5IK2A 5L3VA 4J0QA 4GSYA 1E2HA 3T1TA 1A2BA 4G01B 4XWOA 2F9MA 1ZBDA 4BFXA 4URVR 3SEAA 3QKUA 3V4RA 2ERXA 3KFVA 1GRQA 3C8UA 1CBUA 4V0NA 1JI0A 3FFBA 4M1MA 2IS2A 1UM8A 1OH7A 2IXFA 2VHUA 3GFTA 4HUQA 2WWHA 3E1SA 2GEVA 1NMXA 3ICEA 1WRBA 2ZRKA 4MYCA 3R20A 1SVWA 3LW7A 4I1SA 4JBYA 4Q18A 4TSFA 4Q03A 3TH5A 2F9LA 3GJ5A 4EKDA 3AF0A 3PUYA 3AP3A 1NN5A 1G7TA 5FTMA 1XTJA 3T61A 2QGZA 5K8IA 2W6JD 5JLJA 1DO2A 2IX3A 1DAMA 1FZQA 4PO1A 4PHGA 4MGIR 2C8VA 2ZRDA 1IONA 2UZ3A 2QE7D 1U99A 1W46A 4OHYA 3RC8A 3RC3A 2WKPA 1FP6A 2I1VB 4M1KA 4GP7A 1N6IA 4B73A 1NKTA 3CRW1 2D3WA 1GWNA 2Q3HA 3WMEA 3HU3A 5JEDA 3EZ9A 2IS6A 2DWPA 1XEXA 1T8UA 1KZ7B 4M9SA 2CVFA 4OJQA 1ZW6A 1NY5A 1P62B 2X2FA 2B7CA 2PEYA 2BC9A 4PPNA 3OAAA 2V4ZA 3W34A 4DHEA 3KJEA 4GBMA 3K70D 2FU5C 2J5XA 1NBMD 4Q4AB 2QMOA 3FMFA 4TLAA 5L3QA 4KFUA 3SFVA 3U6KA 3OFNA 2R6GA 2GCNA 3L0OA 1II8A 5ELXA 2IF0A 3TE6A 1O87A 4AURA 1XJQA 5HPYB 1CJVC 3TMKA 1JB1A 2H7VA 3C5HA 2DY1A 2OXCA 3BB1A 2RCNA 3QKSB 5KSYA 1CXZA 4DWJA 2IUSA 1RRGA 2QTVB 1SGWA 4A82A 2Q3FA 4M8NE 1HH4A 4RFSA 3MUFA 4UQOA 3RVBA 2W58A 3CNNA 1N6PA 3WRYC 2ZAOA 3QKSA 1KI3A 1UBFA 4II7A 2LWIA 3W6PA 4EPVA 3VAAA 4A0RA 1B23P 4TMTA 4IFEA 2JJ1D 2OAP1 3AGPA 1XXHE 1HEIA 4HDQB 5BN3A 1KMHA 4DLZA 2BMDA 2P65A 3PENA 4KYUA 4DJTA 1HUQA 4TYNA 3IIJA 4Q4JA 5CLQA 3K9GA 4TL6A 1YZLA 3QQ5A 3CPJB 4NCHA 4LYHA 2GEDA 4HB2A 3I72A 5CYPA 2AWNA 4AK9A 2JDID 2IHYA 1VCNA 2XZOA 1VYVA 2PLRA 4KHZA 1UFQA 4BUJA 3NVAA 1OXSC 2PBRA 4RKEA 4OHVA 2YJTD 4G5SA 4PSVA 2O8CB 2BBTA 1UKYA 5G40A 3GEEA 3GJ3A 1QG4A 3RAPR 3NIBA 1M1YE 4FINA 3LV8A 2MSEB 2FGKA 1Q57A 1YU9A 1CR4A 1PV4A 2CLSA 1MOZA 2QEQA 2V7QA 5JWOA 1A7JA 1ZM7A 4EFLA 4EJSA 2X19A 1U0JA 3I5XA 1DEKA 1BYUA 1F3OA 2PT5A 1ZAKA 1JXOA 2ZE5A 2C9YA 3RS5A 3T1VA 2P5TB 3TW8B 1W36C 3AM1A 2VQSA 2QPTA 3G5UA 3AVVA 1VG1A 2QE7A 1EWQA 2N42A 4Z8YA 2ATXA 4NL4H 3GJ4A 1PVOA 3SQXA 3H0KA 1WCV1 4TQ9A 1E4VA 2FFQA 5C1BA 4JLPA 3WMGA 1KSHA 3LVRE 1XBTA 3RS3A 4Q00A 5FTLA 3A37A 5LB2A 2QORA 2G6BA 5HCIA 4Q9KA 1G3MA 1TF7A 2BM0A 4QM7A 1G5TA 2D2EA 1FX0B 1Z0AA 1C9KA 2CJWB 2IYRA 2GCPA 5CK5A 2EQBA 5HKKA 2HJGA 5K8LA 1S96A 4GMXA 5AJWA 5E7IA 3R7WA 2QAGB 1FW6A 2NPFA 1R6BX 3KDSE 4RZ3A 1OHHD 1TAGA 2ZSFA 4M1YA 4RCZA 2QAGA 4LBVA 2AX4A 2OCAA 4GOJA 1XD9A 4ILEA 2KSQA 4V0MA 2PH1A 2ZANA 3DDCA 4UNRA 4XVUA 4AKHA 3BK7A 1XD2B 1CJMA 2X8AA 1CJUC 2XZPA 4KV9A 4LYAA 3WNBA 4B3XA 5JFGA 2V6IA 3OEED 5EP3A 1Z3IX 2HF9A 2HT1A 1BOFA 3B5JA 3UG6A 3AVTA 1N0VC 3ASYA 3RS7A 1BS1A 4TL9A 4DDWA 1P2VA 2GA8A 2YZ2A 3P27A 4P0TA 3NBFA 4QHYA 4B48A 5EE9A 3ZIAA 2ZSBA 2FPLA 4B3FX 5G3YA 4F92B 4BECA 1ZNWA 5LDDC 2ZJAA 4C0SA 2IWRA 2OESA 3K9HA 5EXSA 1MKYA 1VKJA 2GZDA 2H17A 4S35A 3T15A 3KZ1E 3B85A 2CK3D 5LB4A 4F4IA 4GMDA 2R6FA 3NC1C 5SZIA 1NN1A 4A8JB 4D0GA 1R8SA 1DAGA 4PC3A 2L0XA 3GQBA 1P6XA 2V3CC 1T3HA 2BJWA 3ZYCA 3C5CA 2Q0HA 1QHNA 4G1UC 4ZI2A 3KQUA 2IYSA 4B74A 3M1IA 1VHLA 4DCSA 3ND9A 4PANA 2O8FB 4GL2A 1ELOA 3W6NA 4Q9LA 4PAMA 2ZIAA 1FL9A 3QKTA 4LHVA 2BWJA 2W6JA 1SVOA 2ORIA 2ZROA 3FVQA 2HLDD 3I5YA 5GVSA 3H1TA 4JZKA 3QF4B 3PQCA 1CIPA 2BMEA 5H8WA 4Z54A 1AS0A 2WOJA 4LBYA 3LVQE 1EFRA 4UXIA 2WKQA 2I3BA 2C04A 2RB4A 4HSEA 2GJSA 4GI7A 4D82A 5J40A 3BJIC 4R2IA 3QXXA 2RGNA 1E96A 1E2IA 2VO1A 2Y8EA 4GRAA 3KJHA 1NG1A 2J7PD 2J1LA 4HAYA 3BGWA 2CHVA 4FWIB 3IBYA 3EPKA 1GNPA 1G8YA 1MO3A 3CM0A 3NKVA 4UXJA 2ZR7A 3TAHA 1KTVA 3EC2A 1XEFA 1XTKA 3WNCA 3THWA 1IN4A 2D7CA 4JKIA 3AUYA 4M1WA 3VFDA 3W3AA 4TMVA 3IBGA 2JASA 1KI1A 1L7VC 2B8WA 5J4LA 1TADA 2ZQ5A 1I4TD 5D3MA 1HY3A 1P9WA 2R2AA 3CF0A 5IDVA 3GLIA 2ZYWX 4N0EA 4JL5A 4MKIA 5FOWA 2CNWA 2JLQA 3TAUA 4I4LA 1T5LA 3U7EB 2MMCA 4IDOA 1XTRA 4Q1FA 1H8HD 1BMFA 2W0SA 1AS2A 1G41A 3A1UA 1JQJC 5FBVB 4LX0A 3QPWA 1CULC 1DTSA 4OI2A 4YXWA 2VHCA 3C7KA 4HATA 3GLIE 5F9FA 4NE2A 2GBLA 2BCJQ 1Z28A 4DLVA 4LOAA 4QGAA 2IS1A 5FUVA 4HDCA 4YMTA 2ZI6A 1TQDA 2OCPA 4D6PA 1T5IA 4TYPA 4CVNA 3VTKA 1SVLA 1XZPA 2Q6TA 4US1R 2WTUA 1S1CA 3MWKA 4GZLA 2QA5A 3SBDA 1VYTA 4DLUA 4Z8XA 1R2QA 4JT2A 4R7ZA 2ZTSA 2J0SA 2ZRLA 3NXSA 4O0MA 2IL1A 1KKLA 2F43B 1XEWY 3SBEA 3K0SA 2G0TA 4HAWA 1CR1A 2Z0MA 4UJ3A 1W2HA 3THYB 3PCRB 4TLEA 1CS4C 3NEYA 5TV2A 4IFBA 5BXQC 5HR5A 1UAAA 1VHTA 2QT1A 3DVLA 3U7FB 2AFHE 1T9HA 3MD0A 4CZ2A 2O8CA 2DPXA 1M34E 1DPFA 3ADCA 5E4FA 4NYMR 4EPRA 4D81A 1NLZA 2RMKA 1W49A 4B3DA 5DNYB 4CGZA 3Q7PA 4OKSA 4DC9A 3UPUA 1F5NA 1TEVA 3MWLA 1FOEB 5C4MA 2BMJA 1HQYE 1EFUA 3SJAA 4LWZA 4HLUC 3BH6A 3FE2A 4C2TA 2P2LA 2FFHA 1YR9A 1NLFA 4BPBA 1IN8A 1RIFA 1GKIA 1M8PA 4JSYA 2IUUA 1E1RD 2VP2A 1JQLB 5FOSA 3AVPA 2IW3A 1XMIA 2P0EA 1GNRA 3EWSA 1Y63A 3CIOA 2IYUA 1W4RA 1R0WA 1VIAA 2FPKA 2JGNA 2BHRA 4ZDJA 1E9EA 3L43A 1G17A 1TPZA 3UATA 1YZUA 4P4TA 3IPYA 4YC7A 1AGPA 2VBCA 4LK2A 4AI6A 1P2UA 2F6RA 3U6BA 3A1VA 3ZQJA 2GJAA 1VCIA 4KLNA 5UKDA 4TYWA 1HQCA 4M22A 4HLQB 1G4UR 4B3CA 1W5TA 2BKEA 1MR3F 3CWQA 5FPTA 4C0AC 3CONA 4LYFA 2VSOA 4ZKDA 3K70C 1W0KD 4LBWA 3PIRA 2YWHA 1YR8A 3BB4A 2D4HA 4A2WA 4IW3B 3ICQB 4F93B 4DCUA 3M4YA 4M0LA 1CEEA 2ZJ8A 2B6HA 3WYGA 3AVWA 2IYXA 3OEHD 4CEIA 2ZYVX 4TT3D 2OBNA 2E1RA 2QMEA 1E9FA 1OFTA 3LQRA 1N6NA 3F0TA 4EUNA 2ZREA 3UWKA 2RGCA 2XZLA 3VR4A 2JLRA 1Z8FA 3T12A 4Q7KA 4JVLA 4G5QA 4G5RA 2WZQA 3EX7C 1G7RA 1ZIOA 3L0SA 3PUXA 2D06A 4BZQA 1U9IC 1UEJA 2VHJA 1WQ1R 3DPUA 2HYIC 5BW8A 2H92A 4B44A 1YR7A 3QKRA 1G8GA 2ZRBA 1XXHB 2G77B 1AK2A 2ZSAA 4RD4A 4C0BA 4LJ4A 1ZD9A 2NQ2C 4WZ6A 1LTQA 1XB2A 2BBOA 4C2UA 3CRMA 4LDJA 1M6NA 4A6XA 4D2IA 1FTSA 3NBZC 3Q7QA 4BFSA 3K70B 5AR1A 4B2LA 1WMSA 2A5JA 2YWFA 3SQWA 2CL6X 4TN1A 4FMBB 1PLKA 2V9PA 2JEOA 5FUXA 1GILA 3AEZA 1GUAA 4K8OA 2VRWA 4B6FA 4NCNA 1EGAA 4LHYA 1N6OA 1Z22A 1ODFA 4R2HA 5FR2A 3TVDA 1P4SA 1W4BA 2O8DB 3D7MA 5J47A 1GTVA 1ANKA 1X6VA 1ZYUA 1XDBA 2WWWA 2C99A 4HZUA 4Q66C 4MDEA 4C0KA 4AD8A 1X8JA 1X8LA 1SHKA 1E79A 3THXB 2G83A 4O2RA 1GM5A 1EFRD 2IYZA 2ZE8A 2GVDC 1ZNXA 2HT6A 3ZVNA 1ZMXA 2AFIE 1KYIA 4ARZA 4EDHA 1NG9A 3D3QA 4C30A 3K0CC 4B35A 2J46A 1MO6A 2PJZA 3EASA 3IQWA 4Q4LA 4QG7A 3TR5A 4D4KA 5CB8A 4V0OA 3KQKA 2QPOA 3U7GA 3E2IA 5CIWA 2OT3B 4Y0AA 4B3BA 1E94E 1XFAA 3OE7D 1L2TA 3ZD6A 2H16A 4KXFB 2NMVA 3PXGA 1YZNA 3QIAA 1E2MA 2DB3A 5B30A 1P3JA 3UANA 1OIVA 1FNNA 3W90A 3K0EA 3QE0A 4AYWA 2F3RA 2ZJ2A 2JJ2D 4NYIQ 2NG1A 1TUIA 2PL3A 3Q5EA 3WRXC 3CR7A 3V9PA 1ZUNB 4Q48A 4RCYA 4XVRA 2CCJA 2PMKA 4A2PA 4ZIRB 2FFBA 3U4QB 4CT4B 3ASZA 5EE5B 5AJZA 5C46F 3AGQA 3PITA 3BXZA 3KUDA 4KODA 4DT1A 2Z4RA 2Q9BA 4DSNA 3PUWA 2J45A 1S3SA 3OE7A 3Q3JB 4ZO4A 5LD2C 2QN6A 1VIYA 2ATVA 4TL7A 2ORWA 3KKOA 2DR3A 2P6RA 3ZZUA 3ONWA 1KAGA 2AKYA 3A4LA 3NBYC 2XJ4A 3WBKA 5BYKA 3DO6A 2O52A 4AKGA 3KX2A 1BKDR 1RFLA 2JA1A 1L8QA 1VG9B 5AK0A 1XPUA 4URWR 1UKZA 3L82B 4IHQA 4OQLA 2NO9A 3EAQA 3HR7A 1Z6GA 4U00A 5LBIA 1E0KA 2ZETA 2MSDB 1UDXA 1Q3HA 3PFIA 3VR6A 4DDTA 621PA 5IF9A 3VKHA 2BJVA 5J4HA 4DDUA 4D4LA 2VPPA 4CEIB 1XJ0A 4YQFA 5EUQB 2VSXA 1IXZA 5KDLA 1KI2A 1GOTA 1OLOA 3PG5A 3GLFB 2JATA 1OKKA 3DZ8A 3AVOA 1IM2A 4WXPA 4OI4A 5CDFA 3QF4A 2HYDA 4ASUA 3IO5A 3CH5A 4PAOA 1JXMA 2CHGA 3WYFA 3EPJA 1E9CA 2CVHA 1RPZA 3I92A 1NN3A 1UEIA 2RGDA 1CF4A 3AP1A 1U8AA 3AUXA 4C0QC 4F7WA 1ZCBA 3JZMA 4H1VA 2IXGA 5FBQB 3A6PC 4UNPA 1NIPA 3W6OA 3Q5DA 5D3MB 3MAAC 3L8ZA 5C4GB 1GITA 4FIDA 2FA9A 5DN6A 4EPXA 3I4LA 2QG6A 3FWYA 4WXRA 5DN6D 1G6HA 1R8QA 3AP2A 3K9NA 3PUVA 4KAXA 4NCJA 1NLYA 4FXPA 4QHTA 4U02A 4KBFA 1FTNA 1EX6A 5CDFE 5K8TA 1WA5A 5E7JA 5CYOA 2J3EA 2EFHB 1AKEA 1XJCA 2GJ8A 3QBTA 4ACBA 4NYMQ 1ONBA 2HXYA 1KMHB 4RD3A 3RRZA 1Z6XA 4MGZR 1IY0A 1KNQA 2NZ8A 3ETLA 3M0EA 4OK5A 2YOGA 2A3RA 4EQ6B 4AKEA 1NP6A 2GZAA 4CT5A 3A8TA 2GWHA 5AJXA 5GJCA 3ZDQA 1IXRC 1N25A 4L16A 5EE0A 1SKQA 2DHRA 2O0HA 4BZXA 2JIZD 2NPIA 5GJWC 2ZR9A 3FMPB 5AUOB 2XB4A 1OH6A 1FUUA 1W1WA 2ZUCA 2FE4A 2ZRFA 4Q1CA 3V00A 2GF0A 3QXSA 5SZKB 1TNDA 3GJ0A 3IQXA 4JL8A 1OH5A 1CRQA 5EQTA 3IILA 4MRNA 5EE1A 1F2UA 2ODEA 5L3SA 3AF1A 3FGNA 4WAUA 2WJGA 2ZRAA 1Q1EA 3D31A 1G3UA 4Q4HB 3I73A 5LPNA 1W0JD 1B0UA 4LYJA 2O8FA 2F1JA 1T0HB 3MG9A 1BMFD 1H8HA 1I4DD 1G8FA 3L0PA 3EG5A 3GJ6A 1KJZA 3ND8A 3QPUA 4QJ5A 4EPYA 4JS0A 221PA 4XTRA 4BLOA 4B76A 1ZUHA 4EPWA 4PZZA 5K8UA 1AS3A 4JJKA 4WIAA 4TTPA 2CNWD 2ZJOA 1X8KA 5JCPA 4L9SA 4JIMA 5P21A 1OE0A 4O25A 1P2SA 1U0LA 4HZUB 1L4UA 3NDBB 1XMVA 2RGAA 3CZQA 2DFTA 3AVYA 2ZRGA 1QHHB 2ERYA 1C4OA 1UKVY 4PHFA 2PZEA 4HB0A 2YKGA 3K09C 2OO7A 4ARZB 1DG3A 1JJ7A 4Q7MB 3EWAA 3G0HA 2ZE7A 1NSFA 4PR0A 1BYIA 1NF3A 2IF2A 2V6JA 3P4YA 3TKLA 1PZNA 4CDGA 3O47A 1YZKA 3CO5A 3PJRA 2CEAA 3SE0A 3A36A 2GESA 2GVZC 4Q9JA 4AYTA 2XGJA 2OE2A 1RE0A 4WA7A 3X2SA 3OIUA 2ODNA 3EW9A 4BLRA 4D80A 4M2LA 5J4VA 3ZVLA 4XD7D 3FKSA 3IIMA 4IKEA 4Q9IA 1XU4A 4XD7A 1YQTA 1YZQA 2BIFA 4NCKA 3K1JA 2GRJA 3QBVA 3LAWA 3GEHA 3WYAA 3GLGE 3FOZA 1RRPA 2C78A 3DOFA 5FI1B 4EAQA 1KY2A 2RH5A 4TTRA 3FDIA 1CKEA 4MKGA 3V4FA 3LA6A 1FPMA 2GK7A 4IEIA 3K0FB 1KI4A 1DAEA 3SFZA 1Z2AA 1AIPA 4B3GA 5KO2A 1EXMA 1P60A 2GNOA 2Z43A 1K8RA 3LY5A 1F2TB 4NPHA 5GJVC 4JLVA 1QHGA 2J87A 2Z6VA 3GLGA 2QENA 3KXIA 2FEOA 3BOSA 4ITRC 4LHWA 4DLTA 2EFEB 2WAXA 2OILA 4P3YA 1SKYB 3SJZA 1AZTA 1SULA 4LV6A 3BORA 2CK3A 3B1VA 2CDNA 3FPAA 1MRNA 1WBBA 3PUZA 3IKJA 5FFMA 3HR8A 1G16A 1YRBA 1CP2A 2QSYA 5DYGA 1KSJA 3K53A 4MRPA 2UKDA 1OFHA 2YV5A 4OYHA 2OG2A 4PZLA 4Q9HA 3T06B 4MYUA 4WBSA 1GL7A 2VP6A 3CRVA 2DFLA 5IK2D 3O8DA 2OFOA 3TR0A 4I1UA 5JS8A 1X3SA 1NJGA 1A82A 4UJ5A 5B64A 5L3QB 1W48A 2H5EA 3A1SA 4CEJA 3I62A 4ZCIA 3NG1A 1FQJA 1NBME 3H84A 1HA3A 4NYIR 2G1JA 1IJFA 2VL7A 3FMIA 3RS2A 1BIFA 3FTQA 4QNMA 4QM6A 3DM9B 3IO3A 2W0MA 3X1WA 2B21A 3DMDA 3WBJA 3ZGXA 4A0FA 1P9NA 1OF1A 1OHHA 2QY9A 4L8GA 4A8JA 5KHOC 2XB2A 2ZYUX 5TB5A 5KDOA 1N5LA 2IYQA 1RZ3A 4AG5A 3DKVA 3B6EA 2KWIA 3AB3A 4FMCB 1OFIA 3LWNA 4PAQA 4PSAA 3E5HA 1Z5ZA 3IUYA 4OJKA 1IN6A 2GXUA 3IIKA 1N2CE 1EFTA 1RC8A 4V0KA 4S2EA 3B8HA 2CL7X 3W8NA 3HYRA 4YXWD 1PLLA 1AN0A 1WDTA 4UXHA 2HDNB 2DCUA 4F4JA 4RVCA 2ZVQX 2JJ8A 4RD6A 3AKEA 2ONJA 3B7GA 1AQYA 2O8BB 5A4JA 1PJRA 1Z07A 2W2XA 1DADA 4IVPA 4LV5B 1TQ6A 3VNUA 1GKYA 3LBNA 1IBRA 1D2NA 2J41A 4Q1BA 4DUGD 1ZU4A 4QBHA 4Q1AA 3EXAA 1OXUA 4OK6A 1ZC3A 2VIIA 1Z47A 1Z0FA 3LX8A 5CM8B 2IWHA 1OW3B 3SHWA 3TIFA 1S4QA 2OBLA 5F98A 2FNAA 2A5FA 2KBFA 5JWHA 1TU3A 4ACAA 3VU9B 1OPXA 3ADDA 5JEEA 1E3MA 2RGXA 4IOMA 1SQ5A 5IHPA 2XXAA 4LI0A 1WP9A 3A1TA 5G53C 1GP2A 1T6NA 6Q21A 4BE7B 1T3LA 1ZM9A 1KKMA 1SXJA 2PZGA 4QFMA 1N5IA 1WB9A 4LJ5A 3BB3A 3GCGA 4KYIB 5FBRB 2Q9AA 3FHTA 3GLHE 1NVUQ 3IGFA 3N5CA 4LC1A 1YVDA 2XTZA 4CYMA 4QGHA 3RANA 2NO0A 3RSLA 1GAJA 2YOFA 2QAJA 4HAVA 3Q8XB 1IY2A 4TQUS 2RGEA 5H70A 1OJLA 4M1OA 5JHGB 3IEUA 1E2DA 3O8BA 2QP9X 3LXRA 2QM7A 1QZXA 1QDEA 2EWWA 1AQUA 4KCGA 1P72A 5KNCA 4PPGA 5F3WB 2A5YB 1W44A 4Q5IA 3BERA 1GVNB 2J0UA 2GZHA 4YLGA 3OIYA 4GNKA 1XMJA 2P67A 1KK1A 4TZ6A 4D25A 2HXSA 3KQHA 5FBLB 3VU9A 2GXSA 3RRYA 1SKYE 3UIEA 1Q12A 2ZM5A 4URZR 5FUYA 3GFPA 3REGA 4PTLA 2VYFA 4WOPA 1NMZA 4A0HA 3LXXA 3CPHA 2HCJB 3SN6A 3GD7A 4DLSA 2C9CA 2F55A 2KBEA 3N2EA 4PPQA 3I32A 3BFKA 1W36B 3I1FA 4QBIA 4OQNA 5DE3A 4F38A 4BLTA 4QBFA 4RFVA 3KL4A 5AUNB 1VECA 2XJ9A 4BGDA 1NBMA 1YJ5A 2C2HA 2W6ID 4FCVA 1KO7A 4DZZA 1Z0IA 3EIEA 3MSXA 4UKDA 4XIGS 4Y0VA 2QTFA 1UADA 2B92A 4PX9A 1K5DA 4IDNA 4MQBA 1DVRA 3G82C 3OEHA 3UXMA 3QENA 4W5JA 2CE2X 2GJKA 3L2OB 1LY1A 2CHQA 5CM9C 4M1SA 3VR2A 3C4JA 1KJWA 2ODBA 4NYJQ 3SJBA 3KKPA 5EXTA 1KI6B 4TMKA 2WWGA 1COWA 4DRZA 3W5IA 4JMPA 4LC0A 4JLNA 2FOLA 4LRWA 4XSHA 1UDWA 3TBKA 1TQ2A 1XCPA 2ZRMA 1YZTA 2W00A 1NJFA 3QF7A 4IOKA 1Z2CA 2O0JA 4ZCLA 1SVMA 2QRNA 2ZI7A 3BH7A 4TQAA 4AYXA 3QXJA 5HKKD 3AVXA 1J8YF 3KKMA 3EZ7A 1QHSA 4TWZA 1W2GA 1QHYA 3NBXX 5FBWB 1M2OB 1QHHA 2QRZA 1Q21A 4HAUA 5A0FA 1HV8A 3EIHA 1K5GA 4AG6A 1LNZA 4JLJA 2YC4C 4QXAA 3R9IA 3NWJA 5EP2A 5DO9A 3CB4A 3TQCA 1G19A 4BASA 5BN4A 3RWMB 3RRNA 2JLXA 2QI9C 1AJEA 4P4SB 4FW9A 2PCLA 3HPRA 3WNDA 3MMPA 4CEHA 4I1VA 3C41J 2R6DA 5GVRA 3ADBA 1LW7A 1T91A 4Q7LA 4Q4HA 3VHLB 3EZ6A 1ZRHA 4JBWA 1KMQA 4MDFA 3RWOA 4P4UA 2FV8A 2BEJA 3TK1A 1Z06A 1QHXA 1DO0A 1R5OA 4PO8A 4Z1MA 2QMHA 3NDPA 2F43A 1IXSB 1N0UA 4HYYA 1N6HA 1D2EA 1NL3A 5JRJA 4PHTA 3PR1A 1WE2A 5FUWA 2G88A 1E9RA 3EA0A 2B8TA 3QEJA 4B43A 1XZQA 2QNRA 3QG5A 3IHWA 2WMOB 2PJRA 4PXAA 4ZDKA 1AKYA 2ZR0A 4OI0A 3TSWA 4DVGA 1XXHA 4JYCA 3EZ2A 1D9ZA 2YHSA 2C03A 2IEZA 1JPNA 1CU1A 1W47A 2JLZA 5DYIA 3SYNA 2G3YA 1NI3A 4YMSA 5SZHB 4LCBA 2CXXA 1QF9A 1VDZA 4X8MA 1J99A 4MRRA 3U3JA 4DLYA 1JR3A 5JSZA 4RKFA 4Q1DA 2IXEA 1BH2A 1Z6TA 1GKUB 3BIFA 2EFGA 1KOFA 4BQSA 2F1HA 4PQRA 4W7SA 3GMTA 1LVGA 3A58B 3GJXC 3U2QA 4D0LB 3JVVA 1RYFA 2ZI5A 1SVIA 3B1WA 2OFXA 4QNRA 5KYKA 1ESMA 4RZUA 5KNBA 1XMSA 4TMXA 1Z83A 3TGPA 1XCMA 1ZINA 4QC2A 2WSMA 4P4SA 5EZ5A 1E9BA 4DSTA 2DBYA 1NMYA 4LJ7A 3OF5A 1T4GA 4XJXA 4B2PA 5J4YA 4AY2A 3THXA 1Q1BA 4TLBA 5DI3B 1BO6A 1U94A 5EE3A 5FOVA 1JAIA 2FJUA 3DEFA 3H2YA 1U90A 2ZRHA 3UMRA 1W5SA 1Z29A 2I4IA 1E2KA 2QZ4A 4DCVA 4PQFA 1EFHA 2YINC 4IXMA 1QRAA 3AF2A 2VLIA 3HP1A 1I4LD 2X1VA 3T5GA 1U8ZA 2VP4A 4O2LA 2OCBA 4JLBA 2FF7A 5D3QA 5G3ZA 3OAAD 1LV7A 4R71A 1KK3A 1NIJA 2NOAA 2XNDA 4DDVA 2NO1A 3NEJA 2J9RA 1ZD8A 3B60A 2ANCA 3KTAB 4IVQA 4M9XA 4A15A 3UK6A 1TF5A 4D4JA 1YE8A 1G18A 4HB3A 4L4UA 4EFMA 3UKDA 2O8BA 1NKSA 4MA4A 4A36A 3QOFA 1Q44A 2JAQA 2GJ9A 4TYQA 1G21E 1JR6A 1ZC4A 2OSBA 2YNMA 2C77A 3I8XA 2WOOA 4YONB 3C16C 1WXQA 3B82A 4K46A 4MRSA 3MJRA 4FMDF 2JLVA 4P32A 3MWYW 1YRAA 4EIWA 2IK8A 2XTNA 1XRJA 3VR3A 5KTYA 4JLAA 4FN5A 2GK6A 5HTKA 3T34A 3THYA 4NZYA 1X86B 2KI5A 5EP1A 2E9SA 2VHTA 5BN5A 1VPLA 3WY9A 1YHNA 3TUZC 1N6RA 4I1OA 1HYQA 3B13B 5DLQC 2ZRIA 4XWAA 2FX3A 4YMWA 1E9AA 5GJBA 3KQLA 4Q02A 3DM5A 4OHXA 4G0NA 4JLMA 2WVJA 2HF8A 4CEJB 2GXAA 3SDZA 1HE1C 1SVSA 1ZD1A 3TLXA 2AHOA 3BS4A 2BVNA 4HDOB 4X8OA 1GFIA 3UMFA 2ZPTX 4KFRA 4OQXA 4LHXA 1KIMA 3SHFA 2KE5A 3ZVRA 1OXVA 2IHBA 4KU4A 1Q20A 4ZPXA 4XTCS 2AL7A 4M1TA 1TEXA 1SXJB 3BC1A 4XVQA 4NHOA 5EP4A 1XD2A 1N5KA 1US8A 2ZEJA 3LBHA 4LJAA 1D2MA 4Q7JB 4QGGA 4Q47A 2XNSA 2W6IA 1JAHA 1UJ2A 1G6OA 1G7SA 3B1ZA 4OHZA 3CW2A 2JLUA 2X2EA 2WSSA 5FPSA 3TNFA 2WIAA 4PZYA 4QOSA 2CLDX 4NDZA 2GXQA 4PFSA 1P73A 4BLQA 5L3SB 3A4MA 1T3SA 1XCGB 3MGCA 5KSPA 1XD8A 5JJIA 3AKCA 2J0UB 4LBZA 2ZRPA 2BMFA 2YVUA 4PC6A 4BLPA 4N3NA 1XPOA 2QROA 3TW4A 1NRJB 4ESHA 2Z4SA 3HYTA 5CB6A 1AA9A 2ZUDA 4Q4JB 4FMDB 5BYJA 3WP0A 2FMXA 1CR2A 1KDPA 3QXHA 2OLKA 1D6JA 3CNOA 4JLOA 2OCYC 1MT0A 5DHAA 3QPVA 5DISB 1CJTC 2C96A 4RD0A 5EXPA 3BFXA 4U7DA 4LV8B 1G3IA 4M53A 1KY3A 4TSFD 2JLWA 3F5FA 3DHWC 2G1KA 1ZNZA 4NH0A 1KDRA 2YOHA 1Z08A 4F4CA 5JMTA 1NVXQ 8OHMA 4ASUD 2I1QA 3CR8A 4E09A 1E1QA 4CIDA 2FGJA 4K81B 4ESVA 4E5UA 4ZCMA 2FDCA 3WMFA 4A0GA 2R65A 1E9SA 2RKOA 1I2MA 1TL7C 1S9HA 2ZXUA 1WBDA 3ZVMA 2H1LA 5SZJA 3SYKA 2V55B 1DARA 3IHLA 3FB4A 2ZRNA 4JVMA 1LS6A 4LZZA 1E0SA 2LKDA 1IAQA 2SHKA 3LDAA 4PHHA 3QJYA 4C3ZA 1GNQA 3ZD7A 4GT1A 3CRQA 2VP0A 4MH0R 1R5NA 3B9PA 4YDSA 3N70A 3B9QA 4B2IA 1U0HC 1CTQA 4Q01A 5CJPA 2ORVA 2VTKA 4W5WA 5GADl 4WVFA 2FN4A 1G8PA 1II9A 1U8YA 2IYYA 3JVUA 2REOA 5JBQA 1EESA 1NVVQ 5C18A 4V0LA 5DSZA 4LY6A 1VG8A 3DOEA 2NZJA 5FPYA 2AXNA 1EG7A 2R44A 3Q9LA 3LLUA 2QSZA 1IQPA 5FI0B 2CE7A 2VP9A 4KBGA 4PC1A 4TTQA 5KUTA 2BBSA 1KO4A 1U2RA 4V0ME 1MV5A 3K0AB 421PA 4E22A 2PT7A 4LSGA 4OQMA 2OLJA 5JHHB 1G3RA 2ZAMA 4V02A 3ZJYA 4A6PA 4JL6A 2F1IA 2GBLC 5TDHA 4MYHA 1KDTA 3X1YA 1WF3A 3NH6A 3CF6R 2DYKA 1OFUX 1S1MA 1PUIA 4M9QA 4W5HA 1HT1E 2KB0A 3BWDD 3K0AA 1KJYA 2QL6A 2WJIA 4PC7A 3I61A 2PLFA 4Z1MD 3L0IB 2V7QD 1W0KA 1SXJE 4UNNA 3K0FA 5CK4A 3FKSD 1DELA 4FWTA 2WPDD 5H1YA 1J90A 4BFYA 2W83A 4ZDIA 5TMPA 3FYHA 1D5CA 1CLUA 1VYUA 2ZRCA 4ABYA 5M04A 2AK2A 5LD2B 1A5TA 1D9XA 1II0A 3RYTC 4PO9A 3OESA 3F3YA 1Z6YA 4OHWA 2QQ0A 1OB5A 5EJEA 5L3RA 2IYTA 4BFWA 2VP5A 2V54A 1Y3AA 2IC5A 2JDIA 3LBIA 2EYQA 1DAHA 3CWZA 5AWFC 4A4DA 1E0JA 2F7SA 1KHTA 4TMZA 4M4SA 3O8CA 1RKBA 1K6MA 1UBCA 3C14C 4H1UA 1OXXK 3BFVA 4JLDA 4NCIA 1KI8A 5TY0A 2DFKB 5FH9A 3AKYA 2RGBA 1TX4B 3CPEA 3RRMA 5KDDA 1NN0A 4XH9B 3SOPA 1QVAA 1RYHA 2QUZA 3Q72A 1Z63A 4MKHA 4DT1B 4GP6A 2WWFA 1OKKD 1VCMA 5HZKA 3WP1B 4HUQB 4BWYA 3U5ZB 1E2JA 1PUJA 4MYTA 1Q22A 4P33A 3GLFE 4MGYR 1S3GA 1A1VA 2O8EA 4MITA 4DCTA 3NTUA 3VX3A 2O5VA 1FUKA 2AN9A 4EFNA 2YWEA 2NO7A 5HE9A 2E87A 2ZJZA 4FI3C 1FX0A 2CJWA 1TF2A 4ON9A 2IT1A 2HUPA 3CF2A 5FL7D 3EIQA 1MABB 3EARA 1Z0DA 3K8YA 2AXPA 1N5JA 3ZLJA 1HTWA 4UNQA 1TTTA 1MABA 4DCNA 3R7WB 2N46A 2G0NA 2UVQA 4BRUA 5JI2E 2JIZA 5DIFA 5JCZA 3UG7A 3MRSA 2RGGA 1H8EA 3KFXA 4X8HA 4KI0A 5JZVA 2FZ4A 5AJVB 2XTMA 3KKNA 4A9AA 3U44B 4L5BA 5TVKA 1S2MA 4OQFA 4C0JA 2VH5R 2C9OA 5EZ6B 4JJZA 1C1YA 1P5ZB 1U9IA 2FEMA 3H4MA 1XTIA 2ODWA 4NP6A 3SZRA 3CX7A 1XEWX 2PMDA 4Z51A 2BKUA 4X8LA 4BEJA 2KJQA 2FSIA 3CUEF 2JJ2A 3QUSA 1KGDA 3AQ4A 3C15C 4JVSB 4KJZA 3EPLA 5CITA 4PQYA 5FTNA 4KLZA 2GILA 4RD2A 3FKQA 1EWRA 1XWIA 3FFAA 3QVUA 1JALA 3S1AB 1JPJA 2Q3MA 4NBSA 5A5GA 4B6EA 5JSZB 5JWRA 5IT5A 1J70A 1RVDA 2OHFA 1KSFX 3BBPA 3GEIA 2XSZD 3KB1A 1GDDA 3QXCA 4OI1A 3TJZA 2CL0X 2XOKD 1N3BA 3F8TA 1EFCA 1VTKA 2IEYA 4KFSA 4JKYA 3QVVA 1G7CA 3ZS9A 1E2NA 4Q21A 1OIXA 2XITA 2IS4A 5JI3E 2VA8A 2OAQ1 2WM9B 3MJHA 2ZJ5A 1JJVA 3A1WA 3TSZA 3N2IA 2OV2A 3TVTA 4DB4A 1ZUIA 4C7OB 1E2QA 1KI6A 1GL6A 1G1MA 2GKSA 3P26A 2O8EB 1FQKA 2WJYA 4WZAE 1GIAA 1HT2E 1ZM2A 2D74A 2ZI9A 4U5XA 4EJSC 5KU1A 1YZGA 1E9DA 3QKRB 1ETUA 3KB2A 3KKQA 1IHUA 3TQFA 5FOUA 2WBLC 3CBQA 1R7RA 4E07A 2EFCB 1JEEA 2AKAB 3K0CA 5DI9A 4BRWA 1T0JB 1YKSA 4DKXA 2RHDA 1KI9A 4KFTA 1TU4A 1E2EA 4US0R 4GPTA 4DUGA 4FD2A 2XAUA 1I2DA 1MH1A 1NY6A 3RABA 1GSIA 4I99A 1VMAA 4HAXA 4M9ZA 1D8TA 3GFOA 3KTAA 3JZAA 1MO5A 1Q1ZA 1OYYA 5AUPB 3R8CA 4ZI3A 2W2VA 4KITB 3GLFA 2JLSA 3OZXA 2WWXA 2PCJA 2EVWX 4DB2A 4IDPA 3VR5A 3HU1A 4RJLA 2EWVA 1AZSC 2FWRA 5BWMA 2QQEA 4DIEA 1P61B 2JCSA 3U4QA 4DLXA 5HCNA 3T1OA 4JLKA 4R9UC 3CZPA 5JJLA 3R8FA 5BQ5A 4KVGA 4BFZA 1UBGA 2OBMA 2AK3A 1P75A 1A2KC 1E2GA 4IRUB 3PEYA 2K5UA 4NMMA 4A92A 2Z5FA 4RZ2A 4TMWA 3VQTA 2ZI4A 1E0AA 2GAAA 4UNSA 3OHMA 2DWQA 4HAZA 1W0JA 5DI3A 1DG1G 3D6TB 3T1QA 3DL0A 4W9MC 4NTZA 4MKFA 2NTYC 4RY2A 1AM4D 2R62A 1R0XA 4I81A 4HLUA 1NVVR 1ESNA 5KPDA 3ECCA 2XXAB 1R0ZA 3TRFA 3GLHA 4Q1EA 2IYLD 1ZCAA 2ZI3A 3BD9A 3QY0A 2CBZA 3LNCA 2HEIA 4CEHB 2R6AA 4OBEA 3VX4A 4IVRA 3D8BA 1J8MF 2ZJBA 1P2TA 2D2FA 2ZS7A 4G5OA 5FOTA 3TUIC 4QJ3A 3FHCB 2VHQA 5HZHA 4QJ4A 4LGMA 1IJEA 1SXJD 4MUBA 1GL9B 1Z0KA 3X1ZA 4ZIRA 2QPAA 721PA 4E03A 2BBWA 2CMKA 1G64A 1T8TA 2FZLA 1E98A 4N1AA 3QSYA 2WIBA 4KSCA 2XOKA 4LJ6A 1M7HA 1NNEA 2XSZA 4QKQA 1ZIPA 2VF8A 2V1XA 4GZMA 4FCWA 2XEXA 5F9HA 2VEDA 1A4RA 3CX8A 3X1DA 4O3MA 1FMLA 4WW0A 4GFDA 3I8SA 4HLCA 4TZ0A 3VKWA 1OT3A 5HE8A 821PA 2DFNA 1OV4A 5E7MA 1KI7A 5DHFA 3REFA 1YR6A 4A8JC 1TUEA 3GPLA 4AC9A 4MRVA 1KNXA 4B75A 3KXKA 2EYUA 2A78A 1MRSA 3CX6A 2NGRA 1DE0A 2XX3A 3NHBA 5KOYA 1ZNYA 4EJSB 3BRWD 3NH9A 3RS4A 3U7HB 2F1RA 2BM1A 5FOXA 2ZS9A 4YMVA 4BZPA 2NIPA 4PPFA 5TXGA 2MSCB 1QHIA 3AH8A 4FMCF 4B32A 5JRZA 2XNDD 1MO4A 1US8B 1PLJA 2RGNC 2HCBA 4US2R 2ZS8A 2FSFA 3SS8A 3W8RA 2QBYA 1OYWA 1Q0UA 1R10A 2J7KA 1G8HA 1IY1A 3QI2A 4IJMA 4EQ6A 1ZM3A 3KJIA 3MCAA 4KVAA 4OL0A 5TARA 3OEEA 4IDHA 1LB1B 1N6KA 2A5GA 2ZUBA 4DBLC 3THWB 2O8DA 5FTJA 1TMKA 4DXAA 4LPSA 2OM2A 3WXMA 2FG5A 3LO5A 3U3KA 1AGRA 2O0KA 2OXRA 2QBYB 1DS6A 3CLVA 1XEXB 1XX6A 3BE4A 1RJ9B 5FL3A 1CJKC 2CLCX 1JNYA 1U81A 3EA5A 5E3HA 3BAFA 2QM8A 1F2UB 2BEKA 3CH4B 4BFVA 2RAPA 2JJ1A 2WAYA 3SR0A 2ONKA 1F2TA 2ZSDA 2OFWA 4XWKA 2JLYA 4MGKR 4EPTA 4ZDWA 1FP7A 2ZSEA 2ZYTX 2ANBA 1S0UA 3VNVA 3HDTA 1ZJ6A 1LF0A 3NC0C 1NVWQ 4NKRA 4KSBA 1JR3D 4NONA 4C9BA 3U61B 2P6UA 3LW8A 2WICA 2H57A 1OH8A 4L9WA 1II8B 3DKPA 4P31A 1E2PA 4TL8A 1ZU5A 3GP8A 2FH5B 1M7GA 1ZP6A 2ZRJA 3B78A 3FHOA 5CJ2A 4LPKA 2H8KA 1E69A 2GCOA 2R6CA 5FTKA 2EU8A 2R9VA 4IOLA 3THOA 1UF9A 4V03A 2V8OA 2Z83A 4HI0E 4TT3A 2Q9CA 3U3MA 4IEEA 2BV3A 5JECA 3CKLA 4URYR 4GOXA 2HV8A 3OIWA 1H65A 4YMUA 1V5WA 4HUTA 4L15A 4NYJR 1R0YA 3Q85A 4CF7A 2P3SA 4Q4AA 4TLDA 5J5CA 3W9YA 2WWYA 3P32A 2MMGA 3U60B 1IN7A 1E79D 3PEUA 2G9NA 3KXLA 5ANRB 1RW4A 4LJ8A 2AD5A 3OIVA 3P4XA 1DAFA 2D62A 2CCKA 2QMUA 2CCGA 2QAGC 1XTSA 2WKRA 1F48A 1P9RA 4OK3A 3KQNA 2AD1A 2PX3A 3U3RA 4HLDA 2ZVPX 4LJ9A 5J4KA 1G291 1CR0A 5CLLA 2WMNB 4G5GA 2VSFA 1FFHA 2LCFA 5AUQA 1R4AA 1XTQA 1KDOA 4D4MA 2A5DA 4N0DA 1LF5A 2QP4A 4B34A 4QRHA 3LQQA 3EPHA 2ZJYA 2OUKA 1XNJA 3VR1A 3W5JA 2FSHA 3ZZ0A 1HE8B 1SHZA 2AWOA 3L8YA 3O8RA 1GRRA 5FR1A 4JBXA 4B47A 3VHXA 5B57C 4DSUA 1KO1A 2RHMA 4TYYA 1N6LA 2A30A 3X1XA 1KK2A 5EXXA 3HWSA 4CRWB 3SC3A 1P7CA 3ZIAD 4B71A 2TMKA 2WV9A 1O3YA 2N1BA 4DEYA 2GEUA 4AKIA 3EC1A 3AVQA 4GOKA 4HEJA 5H68A 4AIIA 3A4NA 3DZDA 2FSGA 4ERNA 3U3OA 3QEOA 1E2LA 1VCOA 2GTPA 1JECA 3MWJA 4C0HA 3R9WA 2EFDB 2P6NA 1W4AA 3P20A 4QBGB 1E6CA 3UMSA 3GLIB 4QL3A 1QG2A 1J7KA 3CNLA 3OFND 3P1JA 1EX7A 2IA5A 2A2ZA 2PX0A 3KJGA 3GLHB 1XP8A 4IOJA 1V43A 3SYLA 4URUR 4URXR 4A2QA 3LX5A 1F60A 1GRNA 2C98A 3PVSA 2PEZA 5FPKA 1UKEA 2QTHA 3RSOA 3MLEA 3LH5A 1N0WA 2FFAA 3ADKA 4PC2A 1XF9A 4LHZA 3RS0A 3LRPA 2D7DA 2WHXA 4C7OA 2GETA 1KO5A 2UZIR 4KO8A 5FL7A 3B1YA 1GG2A 1M74A 2QP3A 4HB4A 3RLFA 4BLSA 1HURA 1G5RA 2GAOA 3AF3A 2WJJA 3LLMA 1DBSA 1RJ9A 4DLWA 4JYBA 1RRFA 2C95A 1W7AA 3TUJC 2BDTA 1E32A 3LD9A 5JJKA 1QVRA 2A9KA 1EK0A 3VMFA 1GZSA 1DAIA 4HZIA 5KNDA 2DWOA 2ECKA 3ZH9B 2ASEA 5EUMA 3WHLA 4B33A 2BOVA 3BH0A 3IPXA 3KUCA 2V1UA 4A1FA 1KK0A 1S9DA 1ZVQA 1G5PA 1E1RA 3RDPA 3EZFA 4WZBE 4DEXA 1CRPA 5IRCD 3PEWA 1LFDB 1SZPA 1UBEA 5F2EA 4M21A 1W36D 2WWIA 4XOIA 2B7BA 1DAKA 2H18A 2REXB 4BFUA 4LUCA 4GDFA 2OZEA 3AKDA 1U98A 5AJYA 2REBA 4ZKEA 3NHAA 3IDQA 3R9XA 4DIDA 2R8RA 1SXJC 1XPRA 4C4PA 2IUTA 5JS7A 4QGFA 3AV0B 4DSOA 3W3ZB 3GLGB 5L8VA 2PZFA 2QU8A 4R98A 3HU2A 521PA 4QHSA 4AWXA 3FMOB 2J7PA 3H86A 3HPQA 5B58C 4LJYA 1IN5A 1X1SA 3U44A 3RNLA 4JVNA 2GCOB 3WHKA 1COWD 1L4YA 2OEPA 3B2EA 1KAOA 5FPHA 1OB2A 2VF7A 3SJCA 2J0VA 4FCTA 1SVKA
chains in the Genus database with same CATH superfamily
2Q9UA 4TUYA 1E1QD 2BISA 1V3UA 3VU1A 1BCSA 2GPBA 3LDUA 4ZTUB 1TTHA 3KTFA 5FWAA 2FRDA 1YZ3A 1IBMB 2Q0QA 1PBNA 3Q12A 3CUTA 3DZCA 3K09A 5COAA 1VL6A 3S70A 5AVYA 4UNIA 2J0QA 2HLDA 3M6IA 2EW1A 1JBKA 3H3JA 2P9GA 3RFXA 4YMHA 2C7GA 1WXGA 4F1WA 2GF9A 3DMPA 1RVV1 3LUKA 3AW8A 1E6LA 1JRLA 1Q1QA 2J09A 2ZLBA 4CUZA 5A9SA 3AVUA 1F0NA 3AUUA 1TVKB 3P4UA 1WEHA 1Z6AA 4LVNA 3OT4A 2IYVA 1RRCA 3DMNA 2P9BA 2Q21A 3T3DA 3OQIA 4TS3A 3QRWA 5CB4A 1ZIDA 1M54A 1UPTA 3K9LA 1G20E 4GI3A 4NU0A 1DWQA 2Q3BA 4HF7A 1GRVA 1TT5B 3QVMA 5E95A 1TCVA 4ZVUA 1G4AE 3ZQ6A 1RABA 3OCWA 2W70A 5B55A 2GNPA 2W2NA 3ZWQA 3D8NA 3RS8A 3FLAA 2R8EA 2WSSD 2Z9BA 1Z0JA 2KMLA 2WJVA 4MINA 2KPOA 3VKGA 1H8ED 1R0LA 2BCGY 5DLEA 3UJ6A 4PSKA 3GJ7A 5KSZA 3PEVA 3NQ41 2HSZA 3PR3A 4GYYA 4AB1A 2NO5A 5ED0A 1E99A 3COZA 2Q6VA 4YDHB 4A6DA 5CFLA 5I4BA 1NUPA 2ILVA 4LRUA 1G3QA 2OV8A 3PV0A 3Q3IA 4EECA 4MVYA 2J3MA 3EFBA 1KP9A 5LIPA 3IB3A 4YB8A 2WP8J 1N1DA 3LHFA 4TRJA 3AESA 3I64A 5DH9A 2QD4A 1J2JA 4JXZA 4OHPA 5G1PA 1RXYA 121PA 1OIWA 1KFKB 4JT4A 4POAA 4WY8A 3KLMX 1KSGA 3TG2A 2YWGA 1GYRA 1IJKA 5K45A 4KO2S 3QVWA 2FW1A 3G8CA 3HJNA 1E2FA 3JWIA 4OHUA 2YYSA 4CMKA 4IDQA 1H42A 1BXRA 3TXYA 4HDAA 4DLRA 2XB8A 1B6RA 4J0QA 5HRUA 4I0WB 4ZVPA 4CMIB 4E5KA 2QRPA 1H22A 5AM4A 2F9MA 2IY7A 3NBMA 4B82A 1ZBDA 5AO9A 4URVR 3HCDA 1N8KA 2ERXA 1BMQA 4PFJA 3C8UA 3LT1A 1D1QA 4O8ZA 1UC5B 4RL4A 1JI0A 4V0NA 3MQ2A 4YT5A 1UM8A 2VQ3A 3L7OA 2AZXA 3C5WP 3E1SA 2HBYA 3MMXA 3L6CA 3BF8A 4RJJA 2R6ZA 3OOEA 2IPOA 2ZRKA 4MYCA 3R20A 4TUYB 3LW7A 4EQ6A 4TSFA 5EEHA 3GJ5A 5K3FB 3FYUA 1YDFA 1QIGA 2FETA 3RTCA 1G7TA 4DHWA 2PRSA 4WK2B 3SZLA 3W5CA 3ETDA 5JLJA 4C76A 4J94A 4B4UA 4PGGA 3R9KA 5REQB 1DAMA 1FZQA 1L9KA 2JFZA 4PHGA 2OGSA 4RY9A 4GRIA 2RAUA 1RLJA 5CTJA 1UZAA 4YCNA 4YPFA 4DDKA 2QE7D 5FDFA 2VC2B 3RC8A 1BC5A 4KUGA 3X43A 2DC1A 4AZ0A 4KKXB 2HTFA 2LCQA 2BY4A 2BKLA 1N6IA 2O8NA 3CQ9A 1W35A 3BIOA 2F8MA 4HXYA 1F06A 2NLOA 2D3WA 1NNUA 2V7UA 1QQ7A 2CNKA 1C0EA 2D1RA 4PSCA 4CM1A 1HYBA 3M49A 3VJRA 3GP3A 1XEXA 4MS3A 4MR9A 1P17A 4M9SA 1MD9A 4BYMA 4WLEA 3S40A 4DMHA 1F9AA 1NY5A 3RU9A 5EYPB 3DW1X 3IRVA 1V3QE 2ON6A 2QRKA 3L8EA 2BC9A 2A94A 1WVMA 2OSVA 2R79A 1XK7A 4F9GA 3JQPA 4D9HA 2RGWA 4L07A 1RWOA 5B7GA 2F8TA 3R6DA 1PKEA 3EBPA 2PRKA 3KELA 2O2JA 4J2OA 3OD5A 2NVOA 3ONFA 4QOIA 4UOQA 2QVCA 1VPDA 1QS0A 2VCHA 3CA8A 1OBVA 5EUBA 2FU5C 2J5XA 2X7XA 1NBMD 2G28A 4Q4AB 1LH0A 1P1CA 1Z68A 3R0XA 1Y9DA 1I3CA 1R4NA 4KFUA 2YV4A 2EV9A 2XCUA 4QXPA 3RC9A 3VDQA 4HVCA 5JAMA 3DD5A 3P2KA 5WRFA 2EKZA 2RAVA 5JIBA 1Q0PA 2I2CA 3RSGA 5HPYB 5D3ZA 2WQZA 3G88A 1T29A 1DMSA 3TMKA 1DV1A 2NUBA 2DY1A 2UAGA 3D6MA 2ZZMA 3DLIA 2OXCA 3BB1A 2RCNA 1N8SA 4D9FA 4EI7A 5I7OA 4BKMA 1RRGA 1X7GA 1HYEA 1SGWA 5CA1F 4UQOA 1W4ZA 2YXLA 3BE5A 3MUFA 4RFSA 3RVBA 3O03A 4KWHA 4NI5A 2ZAOA 3FWKA 3QKSA 2PWYA 3A27A 1UBFA 4PCLA 3ZE0B 3C6ZA 5AKHA 4ZMRA 3VAAA 3R0IA 3MK31 3UICA 4JXJA 3BEDA 4IFEA 3TTYA 3AGPA 4BVBA 1H1LA 1I5RA 1LPMA 4RANA 2F1KA 2NP6A 4JBHA 3AHDA 4P7BA 3NV7A 1PGQA 3WGJA 3SEQA 5BN3A 4G1MB 2PO5A 2I1WA 5EL0A 3Q9SA 2X1LA 3PENA 1O9HA 4TYNA 1HUQA 5C9ZA 5CLQA 3HYSA 4Q4JA 1NQTA 3SHTA 2MSWA 4TL6A 1YZLA 1SWWA 2P35A 3ZDCA 1RPJA 1XWFA 1XKLA 2M1ZA 4HEA6 3EFHA 4IHJB 2GF2A 4KXYA 3E53A 5ARCA 4AK9A 3NPAA 2JHFA 4QUAA 1JX6A 2V0NA 3H2KA 4ZCQA 2XZOA 2PLRA 4ZANA 4IG4A 4C0XA 1UFQA 1VB3A 3NM4A 2AZMA 1VL2A 4OHMA 5HS6A 1DEHA 5DSXA 4Q34A 2W6NA 2YJTD 3IUMA 3PGVA 1TFRA 2O8CB 3RNOA 1X80A 2EW2A 3EFOB 3IP7A 5I9MA 1VSTA 1ZK0A 1UKYA 1W88B 1CDZA 1E5TA 2XGOA 3DBLB 3EF1A 4K86A 4L5IA 1CQWA 3LG2A 3GEEA 4P5PA 4CQJA 4B3TB 3BHIA 1I3OA 1QG4A 4J29A 3NIBA 5D8DA 3PNMA 4K9QA 4JD5A 2MSEB 2FGKA 4COOA 1BVYF 2QEQA 2V7QA 2Y2VA 2EGGA 1ZM7A 5JWOA 4LXQA 1H85A 2IYAA 3X2EA 1ZK1A 2Q4BA 1FP4A 2O2CA 4ZMSA 4ZMBA 1WU7A 3LF1A 1F3OA 2A9OA 3AR3A 1PR5A 1M0TA 4TKUA 1E8DA 2JAXA 4RVHA 4XW2A 5C35A 2P5TB 1R0BA 4WQMA 2VQSA 2QPTA 3G5UA 3O0DA 1B6SA 1GPH1 2WG2A 4W6ZA 5TEWA 1KU6A 1ZGBA 4FYVA 1R64A 3S44A 3ZE6A 4U5QA 1EWQA 1ES9A 1RAIA 2H0RA 4PV7A 1ZGZA 3UC9A 1PVOA 2EERA 2V6MA 3FUXA 4AZ0B 1S6YA 3SQXA 4C0BA 4EUFA 2G76A 3OOJA 4DCGA 3JASA 3WGMA 4F8JA 5AI6A 3TW8A 3MINA 4CTMA 4MW5A 5C1BA 4UEWA 1GPJA 4G25A 1RWQA 2XZDA 1I9GA 2I2WA 1XBTA 3Q5GA 4DDHA 2ONYA 3TW0A 3A37A 2FFRA 1PWHA 3DT9A 5HCIA 5LB2A 3WYNA 5CEFA 4BP3A 3GNQA 5CA1B 5JR3A 4EO4A 1C9KA 4OIFA 3MTDA 1O6CA 4J3NA 4B4OA 3HNOA 1NX9A 1RLMA 3GBSA 2PMFA 2XRYA 2HJGA 1UBUS 3AEKA 3VO1A 1B15A 1HRDA 5ELMA 2HJRA 2QAGB 1FW6A 2JFQA 1F0KA 1NU6A 2NPFA 5ALWA 1Z39A 3VI3B 5K0JA 4RZ3A 1TAGA 2ZSFA 3T3EA 3DEZA 1IBKB 1UBKS 1W6UA 1ZA1A 4KWTA 3T7CA 1PYDA 3OY7A 1FVOA 5DVZA 3BMNB 4IJKA 3NT2A 2OCAA 4ILEA 4ENRA 4XVUA 2PH1A 4IHJF 3SMQA 3TIGA 4CQLA 4UNRA 4LF4B 4F46A 3BK7A 3MHPA 1ADJA 1CJUC 2O3RA 2DT5A 4XIYA 3LP6A 3FG9A 1N34B 4LYAA 3RVDA 1NR5A 2W43A 4UDOA 4RPCA 3B53X 3WNBA 3GUZA 4Z49A 3SHVA 3ZV5A 2R3SA 2HWYA 2J33A 3FYTA 1ZXLA 3V48A 3DB2A 5HIKA 3SQLA 3I6QA 4U9HS 1K86A 1OTHA 1N0VC 5CIYA 3WL8A 4JUBA 4TL9A 1TLTA 1P2VA 3P27A 4DDMA 4BXOA 3VZPA 1U3TA 1SKMA 4WXMA 2JGAA 2PGNA 4O5AA 4F92B 4BECA 3AHEA 3EZXA 5LDDC 2ZJAA 3MYRA 1EFLA 4DBLE 1O94C 1NOIA 3JTMA 2FUCA 1VKJA 2H17A 4LWPA 4WWHA 1HFKA 3FBWA 1X1QA 2AOUA 3GEGA 4WXYB 1L1RA 4A8JB 1YB4A 2XMCA 1WXWA 4PC3A 3GQBA 1SUPA 5D00A 3CN7A 4NZZA 1U7PA 4OGWA 1U3GA 4RPIA 4YP5A 4ZI2A 4A03A 2IYSA 5F3DA 1VMDA 4B74A 5DNUA 4Q0MA 3VUEA 1WOYA 1G98A 3ND9A 2EP8A 5IASA 1YFLA 3PHJA 4XWWA 4RXUA 1RI2A 5I9LA 2OQRA 4MKZA 4KZPA 1BH6A 2PKYX 3W6NA 4GL2A 1Z73A 3IEXA 3QA3E 2X7JA 2ZIAA 3MT9A 1KY5A 3DE6X 4YCBA 4ETWA 3FTEA 2C5SA 3U4DA 3QKTA 4LHVA 4ER6A 1PHPA 2W6JA 1MV8A 2QZSA 2ZROA 4Z3OA 3IV9A 3G8YA 2ZKLA 4MULA 2J30A 2XEDA 1CIPA 3A11A 5DOZA 5H8WA 1VLJA 1NFQA 4Z54A 2WOJA 3KOZA 3PXDA 4HDRB 1QGYA 2N47A 4YP1A 1EFRA 5HOEA 2AYYA 2WKQA 2I3BA 2DLDA 2C04A 2FUNB 3L4SO 2YS7A 5AW5A 3E5RA 2HADA 5IAGA 3C3DA 2HM7A 2W2OA 5J40A 1ISMA 3ROEA 1Z2EA 1E2IA 2VO1A 2Y8EA 3L5KA 1NG1A 4B40A 4Z7JA 2J1LA 2X3UA 3KPVA 2CHVA 3HKCB 4U6QA 3IBYA 4AZSA 1YDWA 1GNPA 4QUEA 4CN8A 1MB4A 3CM0A 1ZAYA 2EL7A 2XUPA 1U7DA 2HSDA 1T9ZA 1NM5A 1EEHA 2XUZA 4BVHA 3WNCA 1XEFA 1VGVA 1RRKA 2D7CA 3I1YA 4JKIA 3TO5A 4BNXA 1PQ4A 3IBGA 1FY2A 2GN8A 4OOFA 3FJYA 3NAQA 3HZOA 5AHKA 4DMFA 3AHJA 5FAXA 4QEDA 5HUJA 5D3MA 2R2AA 1P2FA 3IXMA 1MX9A 2PJDA 4N0EA 4ZHSA 4JL5A 1WHSA 2J07A 5BORA 3TG8A 2D8MA 4MIKA 3JSAA 3ZK8A 3JQ8B 1EM6A 3EXHB 4JDUA 4Z99A 3RF6A 3VXKA 1O5OA 4ARIA 2ZIGA 1T5LA 5J58A 4UEOA 5CR9A 5IUJC 4Q05A 3TOZA 4AQYB 2W0SA 2XDQA 1G41A 3G13A 1JQJC 3NJ8A 4MPTA 3WSWA 2WU3A 3NT5A 3SIXA 4LX0A 3QPWA 3PGJA 3EDQA 1QO9A 5DTQA 5EIBC 2E4YA 3PICA 1XQ9A 2VHCA 4MW6A 2A6PA 3K9CA 3GLIE 5F9FA 2KW5A 1NW4A 3PC8A 3GGSA 5DM2A 4D3SA 4V1CI 4DLVA 3V8EA 2GGSA 3COWA 5JQGF 1PL6A 2IS1A 5FUVA 3RIEA 3EH1A 2YNMD 3IXQA 5EEGA 5ALYA 1C9YA 1GDHA 1OI4A 4R1MA 4HDCA 1HQDA 2OCPA 3AINA 3VV3A 3GBPA 4FHEA 2ID9A 2WUEA 4O29A 4PYLA 4NSNA 1YDEA 1L6IA 3HLTA 4QRIA 5IC5A 1X74A 2WUVA 1YBFA 3COSA 4DABA 3JALB 3TWOA 3PF9A 3LDGA 4Z8XA 2NP7A 1R2QA 1F4PA 3TOSA 2IYPA 1ZY2A 2WMDA 2J0SA 1IQRA 3NXSA 1QG6A 5FNZA 2RHLA 3BCUA 1RP1A 3PFGA 2HIMA 3IDFA 4GI2A 3WLMA 2Z0MA 1T1IA 2PQMA 3NEYA 5TV2A 4IFBA 1S02A 4JI3B 1OREA 3U7FB 4IZHA 5ALJA 4E2XA 2O8CA 4HGZA 1K8ZB 3FX2A 5F1PA 2MYNA 1CEXA 3KB8A 4EG3A 5K20A 4RTJA 1SUEA 4NYMR 4EPRA 2ZBEA 2J67A 4J4BA 1NLZA 3TL3A 4CGZA 2YCLA 3Q7PA 4OKSA 4UBKA 3TTVA 4CJXA 3KT6A 3NM6B 2WQ7A 1NMSA 2X6RA 5IN4A 3I58A 4WFIA 1V3VA 1AKNA 4LWZA 3BH6A 3FE2A 1ZITA 5JMWA 1QGZA 4U1RA 1PJ8A 3PJEA 4EG6A 4RF3A 1RIFA 1RI3A 5JO0A 4BPBA 1GKIA 3IESA 4C89A 3DNFA 4H7PA 5IJ0A 1YT5A 1CB7A 1ZMRA 3AVPA 1V9LA 2P0EA 3FAZA 3EWSA 2Y71A 1CUAA 3B6ZA 3EGDB 3AR5A 4RETA 2WTBA 4RMNA 1A5AB 1ORVA 1V7QA 3U31A 1TPZA 4DUPA 2QIPA 2WF8A 4MR7A 3S5UA 4DUZB 1U3VA 3GEPA 2IZ7A 2X8BA 4J6EA 4XX1A 5E9WA 4FR2A 1V48A 2NADA 1FMTA 2VBCA 2MJLA 4LK2A 4AI6A 4H17A 1M2EA 2P9EA 1NAHA 3GG9A 3CEMA 1YUBA 1YMQA 3B6MA 10MHA 3QVKA 4I9UA 5UKDA 2GB4A 4B3SB 3OIDA 1NQXA 3W7VA 5E6SA 1M67A 1WP4A 1ZH0A 3OT1B 2I6FA 4C01A 1EUCB 3T94A 5JQGB 5JV5A 3BAZA 1U2ZA 2I2DA 3HDHA 5KYUB 1Y33E 4LYFA 1KFCB 2PXXA 3SS7X 4LBWA 2YWHA 2I03A 3H6KA 4NK5A 5AJHA 2WHEA 3RR2A 2OHOA 4D57A 3M4YA 2JGIA 4GOND 4DCUA 1A8SA 1ZLXA 2GCIA 1ZEJA 3HA7A 3OM9A 4XYLA 2DUNA 1WZNA 4BEWA 1UM9B 2XCSB 3KHTA 4EI2A 1OTXA 3N07A 2WTEA 1IN1A 2PSHA 4N40A 1NT2A 2DF8A 5AIBA 1QX3A 1IUOA 1BQ3A 4DSZA 3W9BA 5FA5A 4I1YA 2H51A 3MCWA 5IARA 1Y6JA 2AE1A 2DFDA 1YIAA 2ZREA 3UWKA 3V5NA 3BZBA 2WQ6A 4NV0A 3VR4A 1UPXA 5KOHA 2XT0A 2Y27A 4YK7A 4CG1A 4Q7KA 5CVVA 4OJNA 3EX7C 3L0SA 2O2SA 2D06A 3F74A 4BZQA 3VC2A 1RXWA 3D6VA 4P83A 4F5YA 2AVNA 1F8XA 4BQOA 2O0LA 3QOYA 1OZHA 3MC1A 4B44A 4ZJYA 5BW8A 3GNTA 4DKJA 1J9ZA 3C87A 1LGYA 2X9VA 4OQEA 4Y2JA 1XXHB 3L4BC 3QP9A 4ETMA 5DEIA 4LJ4A 1KORA 3HH8A 4WZ6A 2TECE 2G6TA 1V45E 2BBOA 4C2UA 4LNHA 5H9VA 3ANSA 4XX0B 1BN6A 1YMVA 3CRMA 3PFCA 3ZHOA 4OU4A 1M6NA 1MX5A 1OZFA 3C8HA 4A6XA 3Q7QA 3TLMA 4BFSA 3GBVA 4Y9UA 2O1XA 4F4DA 3E48A 4X90A 4C5AA 4MMZB 4MUGA 3VSDA 5JUWA 3SQWA 1E7SA 2CL6X 4FMBB 4TN1A 2NNLD 4R3WA 4YJ2B 2GO1A 5CNMA 3TSCA 3AEZA 2IDMA 3A6LA 3CSSA 1Q15A 1O58A 4HO1X 5L3ZA 4JLUA 1Z22A 2RCYA 3U1VA 2Q5CA 2RH8A 4JIGA 1QIIA 3U7IA 3RO7A 2GBGA 3B9BA 3WLTA 2X4DA 3GUUA 1N2HA 3IVRA 2BZ1A 2P4SA 4U7WA 5ALRA 4AD8A 1X8JA 2HZBA 4C0KA 4W1SA 1G5QA 4AJ2A 1XNRB 4ZC8A 4D9MA 2ZE8A 4F72A 1N2EA 2GVDC 1P6UA 3V2UA 4ER5A 1U7OA 1EGMB 1NG9A 2G36A 3K0CC 4YJDA 2I78A 1YQQA 2J46A 1F0PA 3IQWA 1PWYE 1QNFA 2XZTA 3LP8A 3IAHA 1WXEA 5G0UA 3U7GA 2VJDA 5CIWA 2OT3B 4P34A 4MWOA 2W9XA 4B3BA 2C88A 3BULA 3EFOA 1Q19A 1C7JA 2Q6IA 5B30A 1X14A 3L9XA 3MGGA 1MT3A 2AF3C 2AMFA 1JG6A 4AROA 1XEAA 4R1OA 3DJFA 4AYWA 4E33A 4JCOA 2NG1A 1Z13A 1Y1QA 5CG2A 3FN4A 1U2GA 3Q5EA 4FFWA 1NULA 1S2NA 2QD2A 2Y66A 3DQPA 2HWKA 2ZWVA 1BXGB 1CQJA 4GNRA 4EG1A 3W5HA 4I5DA 4IJUA 1EVQA 4I7EA 4ZIRB 5FLYA 1CNEA 2SNIE 4MVJM 3ASZA 4O4JF 3LU1A 1WULS 5C46F 2QW0X 3IEPA 2AOTA 5EINA 4KXXA 3QE2A 4BJ1A 2PQ0A 4KODA 3G89A 5DTJA 4ARSA 1FSSA 1OWOA 5LN1A 1EWVA 2YHIB 2Z4RA 1PJCA 3RYIA 3OE7A 1XVUA 4ZO4A 1WETA 2ALJA 2BGLA 3CG4A 2QN6A 5AOCA 3UZUA 3RREA 2XT9A 2P6RA 1R8XA 1X1CA 2W22A 2WAMA 1ECLA 1PR0A 3C3XA 1FXSA 3DZKA 3F9IA 3MLBA 3ONWA 5AM2A 1WXIA 3PP8A 3WBKA 3DO6A 1WY5A 2BUCA 4AZWA 3C5EA 3KX2A 2UZ1A 4BS9A 1BKDR 4LZPA 5AIAA 5T7BA 3P0IA 1RFLA 4CKZA 1EEXB 5AK0A 1VG9B 2OB1A 2XCQA 4FOLA 4V0KA 3W1WA 4FGJA 1RJDA 3WWYA 4CEHB 3HR7A 4KVFA 1ULUA 1UDXA 1JAXA 3PFIA 2XE4A 3TR6A 621PA 5IF9A 1IXKA 1I4WA 1SXHA 1B74A 2LBPA 3FF4A 4ZFNA 3NGMA 2ACEA 2J5RA 5J4HA 1NVTA 3MAJA 4DDUA 1VHDA 4FLFA 4U2DA 4M9CA 3F7MA 4YDQA 4YQFA 5KDLA 1E3DA 2PKQP 3I2YX 4RA6B 3W7BA 4LC9A 3ECAA 1A5SB 2BFFA 1TDJA 3PG5A 4CV3A 3DZ8A 3TEMA 1W5BA 1O4VA 1ZX1A 2QLTA 2C8LA 1G2IA 4LGYA 3LBYA 5CDFA 3QF4A 1Y5MA 3T3OA 1KERA 3IO5A 2C2MA 4ZREA 3H9JA 4YRSA 3EPJA 1ODCA 3B5IA 3WLSA 1FU8A 5GGYA 2PIDA 1C3OA 2XA9A 4ZYVA 3MT0A 3ZHSA 3M2TA 4MR9B 4UREA 1U8AA 1PYOA 4F7WA 1ZCBA 2BFDB 3RAJA 1S01A 2IXGA 4HKTA 5AVWA 4UNPA 1NIPA 3Q5DA 5D3MB 1VSQA 3PXAA 4JROA 3MJCA 3N2YA 2FA9A 5DN6A 4EPXA 1S4MA 4L9RA 4WFQA 2ISCA 4I4CA 5FNVA 1E6WA 3ZY6A 3VBCA 1E8MA 2OO3A 4HPXB 1ADFA 2XWBF 3P2OA 1IHPA 2GI4A 1P80A 3RBZA 1A8UA 4EHFA 4NZMA 1FTNA 2YZMA 1XZHA 1CSEE 3DGEC 2I4OA 1MPTA 4P3NA 5FOQA 1LI5A 3QMWA 1PFVA 3RYHA 1OBFO 2NU6A 1XJCA 4MQMA 2I1LA 3QBTA 4NYMQ 3GFQA 3WL5A 3N86A 4OK5A 1WABA 4EQ6B 4AKEA 2Z2ZA 2CVQA 1M10A 5K3SA 2ID8A 3A8TA 3QYAA 4BVEA 1KAMA 4OXKA 1IXRC 3DFZA 1U80A 5JVDA 1GN9A 3FCCA 4PZPA 3IDSA 2V59A 1W8DA 2QX8A 2VWPA 4MWSA 2XKBA 4E4TA 1KFJB 1FUUA 4HDRA 2OGTA 2ZRFA 4Q1CA 1JLLB 3V00A 1BVUA 4CU5A 4FHFA 4TUYF 5CXXA 4P38A 4ZGGA 1VMEA 2CUNA 1R0SA 4OMFG 4AL4A 4N5DA 5JSYA 5AP9A 1TUBA 1M0EA 4ZJZA 2GZMA 3NHSA 1U0EA 1Y7HA 2VWGA 4KR7A 2NW6A 1YA6A 2E6UX 2GUGA 5COQA 3WKBA 3DMYA 3P9KA 3HJBA 1JR4A 3RARA 2EKPA 4GMHA 3D31A 3I6ZA 4GZ6A 2P1DA 3E3NA 3PS9A 4Q4HB 4RVNA 4EG5A 5LPNA 3K6RA 3DH0A 1Z7EA 1B0UA 5CBPB 5KTTA 1ABEA 2F1JA 1T0HB 2ZPAA 1UMBB 4R31A 4X5OA 5C1IA 4KOEC 3TNLA 1ZVVA 3WL3A 4YUYA 1G8FA 3L0PA 1OB5A 3ND8A 3FSGA 4EPYA 3WKCA 1V7PC 3ICQB 2CFOA 1R6TA 2A58A 5L7WA 4JI5B 5FQNA 3UFXA 1ZUHA 2UV8A 5K8UA 3SG0A 3PIIA 5LZ2A 4UEQA 5BQOA 1AUXA 1X8KA 1UBLS 4ZAXA 3OQJA 4JIMA 5P21A 2V96A 5LXTF 3RFFA 2VJMA 4UVGA 2OGZA 1K8QA 4W9NC 4BZZA 4QDJA 4HZUB 4MUKA 1O08A 4WH0A 3UFXB 3OWHA 3NDBB 2RGAA 2DFTA 2CLHB 2ZRGA 3M1YA 3AVYA 1SBTA 3EVAA 2WIJA 1WD7A 2JAOA 1H93A 3W5VA 1Z7BA 1TZMA 2J5KA 2PZEA 4PHFA 5HQ3A 4GIBA 5I3ZA 2YKGA 1VRWA 1KQPA 1BD3A 1I51A 1YHYA 3ED5A 3LDHA 5F52A 1NW3A 4QQNA 5T4BA 2PUBA 3CVVA 4HH4A 2I33A 4HXGA 5FLKA 5KMGB 2ZE7A 3H5TA 5LA6A 3FOFC 4AQ7A 1NSFA 3A6EA 3G0HA 1BYIA 1QIHA 2NUTA 2IF2A 2V6JA 1D03A 1EQAA 2K2QB 3WL6A 3C43A 3ZLVA 4CDGA 4OX9B 1P1RA 4CKYA 1DZIA 5K0NA 4ENTA 2Y1WA 4MO2A 1RHMA 5H4HA 2MYUA 2CZQA 3SE0A 3N74A 2J9ZB 4Q9JA 2OE2A 1RE0A 3X2SA 2XGJA 1FTGA 4KXQA 3EZYA 1JLLA 2Z1MA 2ODNA 4F4FA 1NBOA 1GPMA 3UA4A 4BLRA 5ALVA 5J4VA 1RSZA 1X13A 1Y89A 5M29A 1AV6A 3EC7A 4QO7A 5IM5A 3FKSA 3IIMA 5AKIA 3TPFA 4DQVA 4XD7A 3LY8A 2BIFA 5JCOA 3WYAA 3GLGE 2Z57A 1N1EA 4W7HA 5FI1B 5BSFA 1GGEA 1KY2A 4IS2A 1XZBA 3DNPA 1CUIA 1THTA 4ABTA 3FHJA 2IDZA 1X8XA 8ATCA 5JW6A 2Y99A 1K9SA 1T2UA 2Z8YM 3R41A 4KXMA 3D6HA 3TQHA 1DAEA 5CDTA 4W5OA 2H3HA 4GSLA 3HSKA 1PUXA 4RPLA 4EVSA 1RLIA 2X14A 5G4KB 1CUCA 5KO2A 3D3NA 1ABFA 1IUPA 4X3OA 1AO3A 2GNOA 2Z43A 4FFBB 4HDSB 5F51A 1K8RA 3FUVA 1F2TB 1ZN8A 2BW0A 2CL5A 2NAPA 2LRHA 2WINI 4YEDA 2Z6VA 5F7JA 4KFCA 4OQZA 4H7EA 1V0JA 2GDZA 4LHWA 2Y93A 1KH1A 4ITRC 4N47A 5AW2A 2J3IA 5DP1A 2EFEB 2COUA 5E3IA 5IZ4A 3SJZA 1AZTA 2AXQA 4RMHA 1I2AA 3N87A 4XARA 3AL3A 3IDOA 3MXTA 1MRNA 3WQQA 2Q1YA 1WBBA 5CFRA 1SQ6A 3HR8A 3UUFA 1TMGE 1G16A 2JGDB 3L6BA 5FUQA 2VWQA 4J0CA 2YCBA 2QSYA 4M6WA 4BVAA 2HSWA 4RVGA 1BD4A 1OFHA 2YV5A 2AG1A 2YFQA 4OYHA 3UK7A 3PC6A 3UENA 3WYEA 2P2ZA 4AMBA 2WEKA 2VP6A 2P6PA 4D8WA 1GAQA 5T41A 2NTEA 3HXKA 1TYDE 5JS8A 3A7EA 2E89A 1K4YA 2ZTVA 4C05A 1EVIA 3R3WA 2XCIA 2JGFA 3D1LA 4NX2A 5FWDA 1BNCA 2HA0A 4INJA 2FG7C 3MTGA 3KUUA 4A5SA 4NAUA 3IH5A 5KSWB 3IFSA 3VJMA 1RCFA 4EO7A 3OU2A 2GZ2A 1BIFA 2HOQA 5CLFA 3L7DA 3TGLA 1RM0A 3CE6A 4Z4HA 3LT0A 4QPZA 1EHYA 1F5SA 3DMDA 1JILA 1J56A 4BN5A 3N2GB 3CV3A 1OHHA 2QY9A 4L8GA 4EHIA 2ZUEA 3ZWNA 3RBAA 2ZYUX 4KB5A 4ZVOA 4OQPA 4PCAA 1ZZEA 4L22A 2IYQA 4UFNA 2VZEA 3DKVA 3WG9A 4FMCB 1HDIA 4QWWA 4PAQA 1XOIA 2VF2A 3C7TA 1YDMA 4PHCA 3ZN2A 4LSWA 1Z37A 1OGYA 3IUYA 3ZWPA 1BWRA 5BN3B 3BF7A 4M86A 3GZJA 1IN6A 2GXUA 4C20A 5FKJA 1N2CE 4BU1A 3PQ8A 3B8HA 2CL7X 3RLIA 1H2YA 3HYRA 3W8NA 4ALIA 1AN0A 4YXWD 1UK8A 1H2FA 4O2AF 3U7QA 1Q0RA 3B7GA 2PUHA 3F3MA 3JRWA 2PUGA 4W5RA 1PJRA 1CY7A 4HADA 1DADA 4MGHA 1WWKA 5TPWA 3VAYA 4PG8A 3NTXA 1MU0A 3SX4A 2BGTA 1IBRA 3KR2A 2J41A 2V3WA 1MA3A 3R5SA 3FM9A 4QDKA 4QBHA 4Q1AA 3RIGA 3VZQA 4BNWA 2GPWA 3FB1A 3ZE7A 4OK6A 3JQFC 1ZC3A 2IXDA 2F3QA 2VIIA 3OQMA 1JEYA 5TLSA 3LA8A 3MW8A 1PQYA 1JEQB 1MVNA 1S4QA 2YUIA 4O4HA 5H3LA 5DZSA 5LMUB 4Q16A 4F2WA 1QLWA 4FFRA 3N2KB 3U19A 3VU9B 1HQKA 4PVDA 4B7AA 1SMKA 2RGXA 2V9CA 1DBPA 1E3MA 2XXAA 4LI0A 3ISJA 3A1TA 5G53C 3II6X 5AJUA 4P7KA 1GP2A 2JFBA 2ZYIA 1EG2A 3L49A 3TCXB 2AZDA 2I8LA 1WB9A 1M73E 1MEEA 3BB3A 5IP5A 1TQ8A 3KWLA 3DZBA 4PYKA 4Q39A 1NVUQ 3IGFA 4F2GA 4RPHA 1JN0A 1P33A 2ZT5A 1ZGGA 5ES4B 5JZSA 1E7QA 3VNRA 1WV0A 1Y3IA 2NO0A 4Y2YA 4N5LA 1MNQA 1HTBA 3UN1A 2YOFA 4EUHA 2X15A 2Z6AA 1AA6A 4HAVA 3I9FA 2X0KA 3IC5A 3OMWA 5BV7A 1L5RA 1L7NA 1NM5C 1PYGA 4LRXA 1T8WA 5JHGB 3FVRA 4RTOA 1CDEA 1QAOA 4WLUA 3T6KA 5CVCA 5B4TA 2P7IA 1AQUA 4WBNA 2FJ0A 3JAWB 4EB6B 3Q6MA 4DRXB 5F3WB 2Y92A 4K9NA 4LXTA 1JMYA 1UWLA 4GNKA 1SBQA 3GFBA 2JHAA 3I1JA 1T25A 2Q8NA 4BNLA 4EY3A 2VDMB 3W5DA 2HXSA 4NBTA 2ZJ7A 2F64A 3IMFA 1M75A 3RVSA 3UIEA 1Q12A 2ZSUA 4J16A 1EP2B 1AO0A 4X3CA 3IP5A 3REGA 3KJNA 5AW3A 1YVEI 3HM2A 4NENA 4P7GA 4WOPA 4BO6A 1NMZA 2A67A 1ZGJA 2XMSA 4IGAA 5KYVA 3GD7A 4DLSA 3NEPX 1DB3A 3SOZA 2GOYA 3SS9X 1PZGA 2NU7B 3QY9A 1KQNA 4PPQA 1FIUA 4IM7A 4ENQA 3SNKA 4O8CA 3RTGA 2AMJA 1XDWA 1ADYA 1USWA 2QVXX 3L6DA 2H1OA 3SZMA 3KJFA 2XJ9A 1D6MA 1DIGA 1YJ5A 2C2HA 2W6ID 4PX3A 5KTPA 1E6EA 3T5AA 1Q1NA 3WISA 3AF5A 3PDWA 3T1NA 1XGKA 5L3QA 5FO1A 1Z2NX 2WSIA 4KSYA 4F85A 5IKOA 1K5DA 4OXRA 4HNAA 4IDNA 4EHAA 2WKWA 4MQBA 1DVRA 3G82C 2ZYGA 4LY0A 1SKAA 1ITZA 2OWEA 4UBNA 3DBHA 5LCXA 4N76A 4BJ3A 1MNAA 2P40A 3ZK7A 2BI7A 1EDOA 2GJKA 1DJNA 1LY1A 4U2EA 3Q8LA 1S7CA 4QGBA 2ODBA 5HJEA 1GNTA 5DHTA 1RWXA 4NYJQ 2OYSA 4PZUA 4M0DA 1P3Y1 4EDFA 3GGJA 1IBLB 1YJAA 1FS6A 1ID1A 1V8FA 2DVMA 3F6PA 1M8KA 2XHEA 4OVKA 2M6KA 2XNCA 4BNVA 4DNXA 4DRZA 1LSOA 4K6OA 5E6SB 2QAIA 4JMPA 5KYYB 2Z3ZA 4JLNA 1B0PA 1RM4A 3EEBA 1OASA 4LRWA 1UDWA 1TQ2A 2R2GA 4H1TA 1M5TA 2F9FA 1YZTA 2ZRMA 2PSEA 4X1IA 1R6DA 1Z2CA 2O0JA 5ILGA 1I3LA 5LYJB 2A7XA 2ZI7A 1VCHA 4R0VA 4CKWA 4KR3A 1ZH4A 2J0EA 3DMTC 2O20A 1QHSA 1VI6A 5EPOA 4NCBA 2BFNA 1NMEA 3LHSA 1FVHA 1KHHA 4MUFA 4XFDA 1GUYA 1SN7A 1W2GA 4E4RA 3C2QA 1G2PA 3C98A 1DEXA 3BXHA 3U81A 5BNWA 3WGLA 1E66A 4Z9BA 1FZTA 1QOZA 3SC2B 3RHZA 1NVEA 4XPIB 1BN7A 2XNJA 2ZDHA 4JLJA 3L5OA 4UMFA 4C3VA 4EHNA 1ACJA 4X54A 4QXAA 1O8BA 3R9IA 4YRZA 3R3SA 5EP2A 4Q1VA 3DFIA 3DGFC 4Q3AA 1YI8A 4RAOA 2W11A 1JAZA 1CY6A 3K94A 3T7AA 1T35A 2HF2A 2XIJA 3TRKA 5J23A 4YJKA 2BR5A 3HJAA 4X84A 3AFMA 2PCLA 3U48A 4JOQA 1H4QA 2ZR8A 4HNAB 1ZRNA 4I1VA 3C41J 1EDDA 3NTVA 3ADBA 3DP7A 4Q4HA 1ACMA 1I0IA 2X1HA 3EZ6A 3FPFA 2DRIA 1G59A 2C1EA 2ROQA 1K06A 1RQRA 4P4UA 4I1PA 3OPQA 3K1AA 2Y1OA 4L0DA 1WSBA 2Z09A 2BFBB 4H7DA 1WB5A 4IV0A 4PO8A 1C8VB 4Z1MA 5FUBA 4LXUA 4DMRA 1KZ9A 1N0UA 1Z25A 4GBJA 4P93A 2VBFA 1NL3A 4L3OA 2NTJA 1GNSA 1WE2A 5FUWA 3TTSA 5IUNC 4B43A 1WF6A 1XZQA 2J6IA 5KYGA 1F51E 5ABPA 2R68A 1PW7A 1HEYA 3GGGA 3DONA 3IHWA 5LQJA 3FR8A 3I2HA 4W5QA 1EIZA 1AKYA 5DRTA 3ZJTA 4DVGA 2Z8XA 1KYZA 4XCQA 3EZ2A 3U40A 2IEZA 1CU1A 2GN6A 3CUWA 3SYNA 2OECA 2ZUFA 2G3YA 5AI5A 2H1CA 1O5IA 3Q0IA 3CTMA 1PDOA 3CGGA 3P9RA 4FBGA 2ZCJA 1VDZA 2AG6A 1J99A 2O3JA 5HKBA 4JYZA 2IXEA 2HDWA 2VRCD 3DWIA 3L8CA 1I0ZA 1SIWA 3E27A 3PPXA 4IZIA 1M6HA 2F1HA 4FOTA 5EHNA 1KXZA 2PYZA 1LVGA 2X9QA 3C70A 3TLKA 3MOGA 3D7SA 1XVVA 1Z16A 5A3VA 1RYFA 2OHXA 1SVIA 1WDKA 4RPJA 1EWKA 2V7VA 3D4LA 2ILTA 1U63A 1Z83A 1G5FA 3L4BA 1XCMA 4Z4FA 1ZINA <