2A5FA

Cholera toxin a1 subunit bound to its substrate, nad+, and its human protein activator, arf6
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
162
structure length
162
Chain Sequence
KEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 6
publication title Structural basis for the activation of cholera toxin by human ARF6-GTP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/transferase
total genus 55
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2a5fA00
1N25A 3IUYA 1II8B 4RD4A 4AK9A 2FN4A 4C7OB 1KJZA 5IDVA 4MYTA 4XD7D 4EFLA 1FTSA 4FI3C 2ZJYA 2VPPA 1CRPA 4U7DA 3CH4B 4TYQA 1W36B 2VSOA 3Q7QA 5JSZB 5KHOC 1GRQA 1Q1QA 2QGZA 5BWMA 3DZ8A 5FH9A 4F92B 4BWYA 2X2FA 4M1WA 4Z54A 4LHYA 1DAKA 1AIPA 1V5WA 2BHRA 3X1DA 2F1IA 2VIIA 1US8A 4F4IA 3AVYA 4NMMA 1P3JA 2CCKA 2ZYWX 4R2IA 2IXFA 1BYIA 2OFWA 5BQ5A 3REGA 1COWD 4LOAA 4QC2A 2G6BA 3RS3A 5CITA 5DE3A 2Z83A 1R4AA 3HYTA 3GLGA 5JEEA 1Z2CA 2PT7A 2ZE8A 2P0EA 5B58C 2XXAA 1GTVA 4M9QA 5AJXA 1G6OA 1KY2A 2FWRA 2G77B 3DVLA 4FWIB 3W5IA 2ORIA 2ZU0C 3WYGA 1NF3A 3TW8B 4BECA 1DG1G 4E22A 3P20A 1VYTA 3MG9A 3K9HA 4H1UA 3U44B 1W2GA 1I4LD 3LXXA 2ORWA 3N70A 1HURA 1AQYA 2W6IA 1RJ9B 4PO9A 5UKDA 4EQ6A 1UEJA 2ZI4A 3B1ZA 2W6JA 1MABB 3VR2A 2GCPA 3LXRA 1ESNA 4I1SA 3CR7A 2CK3A 4D4KA 2IS6A 2P3SA 2VP4A 2UZIR 1Z83A 1NBME 4B74A 1OSNA 4G5OA 2ZRAA 3WBKA 1GITA 1XCPA 3QF7A 1QHYA 2YHSA 2RGNC 4HB3A 3U5ZB 3ZQJA 1CU1A 2R6CA 2WIAA 2J41A 2ZYVX 3AVOA 3EZ9A 4NP6A 2B7BA 1Q1EA 3KB1A 2JLSA 2ONJA 3T12A 2B6HA 1TAGA 4XWKA 1RKBA 3D7MA 4TQ9A 1NKSA 3RRYA 3CLVA 1GP2A 1TF7A 4A2WA 3QF4B 2YOHA 3THXB 2IX3A 1NG1A 4LBYA 1W36D 1DVRA 1YE8A 1DS6A 3V4RA 3VR1A 5EQTA 1X8JA 1OXXK 4A6XA 2JJ2A 3M0EA 4M2LA 3KUCA 4V0KA 3THYB 2IYTA 4MRPA 2F43A 3P4YA 2AX4A 5BYKA 1Q57A 2YWGA 2QRZA 1XX6A 4PQYA 4AG6A 3LNCA 3AB3A 1N6KA 3N5CA 1XBTA 2OILA 3A1UA 5FI1B 2IT1A 4Q9LA 2WIBA 2GEVA 2RKOA 3VR3A 2MSEB 4XJXA 4YMUA 4V0NA 3Q85A 1KI7A 4N3NA 3K9GA 4KODA 5J4KA 1AS0A 3EZ6A 4KI0A 4NDZA 5EP3A 3U2QA 1M7BA 4X8LA 5GADl 4DC9A 2YC4C 1GL7A 3SE0A 1XXHE 3KKMA 2GJ9A 1VHLA 3ADKA 1F60A 1G5PA 3PFIA 4FMCB 1KSGA 1S4QA 2FA9A 3OAAA 4A6PA 1L4YA 3MFYA 1FX0A 1P2VA 3RS2A 4P3YA 1RE0A 1ZM9A 2W00A 2O8DB 1BS1A 4LGMA 4ERNA 2ZRIA 3RS4A 3SHFA 2VLIA 1PUJA 1I4TD 1Z8FA 1UKYA 3BERA 3RWMB 4A4DA 3AVUA 2J0UB 3G82C 4G5SA 5BN3A 2XSZA 5E95A 3T1OA 5K8TA 5L8VA 3HJNA 1HQCA 2YNMA 2B92A 1R0ZA 1IAQA 4LI0A 2VQSA 3ZVMA 1E2NA 1SQ5A 1TU4A 1NI3A 1QHXA 3U7EB 2V8OA 4CW7A 3KB2A 4HUQB 3KJGA 2GXSA 4D82A 3HWSA 4DKXA 4B2PA 5JECA 4IDNA 4FMBB 2OAQ1 2C8VA 2Z5FA 2V9PA 2BCGY 3VKHA 3NH9A 1TEVA 5KSPA 4U02A 3K0CC 4RD2A 3B85A 4BEJA 221PA 1J8MF 4Q7JB 5ANRB 4C3ZA 1PLJA 4JS0A 2G3YA 2IYZA 3RSLA 3FMOB 1XJQA 2ZEJA 4TYYA 3OEED 3IBYA 3TUIC 3IQXA 1E9CA 3TH5A 2ZU6A 1JPJA 1IXRC 2OCPA 4NKRA 2X2EA 4QJ5A 4G0NA 3RANA 1PVOA 3AF4A 1NY6A 3H0KA 3UPUA 2ZUBA 3PENA 2EFHB 1K5DA 2AXPA 4DT1B 1QF9A 1KIMA 5FPHA 3SZRA 3BWDD 4HUTA 1IHUA 3NTUA 1KO1A 3RVBA 2QA5A 1R2QA 4BLQA 5EXXA 2HJGA 4A9AA 4EPXA 1E1RA 3R8CA 4HLDA 3CPEA 2R2AA 3GMTA 2CNWD 4LRWA 3CBQA 4J0QA 1GAJA 4NCIA 4W7SA 1NNEA 2HYDA 1UM8A 2FH5B 4TLEA 2E9SA 1JR3D 2IUSA 4L9SA 3ZS9A 3TVTA 1P9NA 2GCNA 4C0KA 4N0DA 1XJCA 1R0XA 3MLEA 1E9RA 4F7WA 1YZUA 2ZRMA 1U2RA 3AF2A 4HZUA 1H8HA 2IF2A 3ECCA 4TT3A 2WWYA 3NBZC 3UMFA 3OHMA 2BMFA 2GTPA 1XDBA 3X1WA 3DM5A 2FZLA 4OHYA 2DY1A 2ZRFA 4A0HA 3SFZA 2QPAA 2FJUA 4NYIQ 1NRJB 1KJYA 4PANA 2A3RA 2VL7A 4KXFB 4QJ4A 5FBLB 4ZKDA 2JIZA 5DO9A 1CKEA 4WXPA 5JHHB 3FFBA 1D8TA 4IKEA 3WXMA 3MWYW 1F2UA 1XD2B 1XEXA 4JL8A 3K0SA 5FL7D 5EXTA 3QIAA 3KKOA 2JAQA 3OE7A 3CRRA 2J7PA 1TMKA 1OKKD 1KNXA 4LPKA 4M0LA 4L8GA 1MT0A 2VHQA 4KJZA 3IQWA 4IXMA 3NKVA 3BS4A 2N46A 2MSCB 1ZM7A 3A4NA 3SQXA 3LVQE 3KUDA 1YZQA 3QXHA 2FPKA 3BH0A 2H1LA 1KSHA 3CR8A 4GI7A 4NU0A 1T8UA 3WHKA 1P6XA 1W4CA 2GJ8A 2RGGA 3L0SA 4KCGA 1FFHA 5AR1A 2AL7A 3TBKA 2GJAA 1U90A 1AK2A 1L4UA 2YZ2A 4JJKA 1NIPA 1T5IA 1MH1A 1U8AA 4LHWA 1DBSA 3R7WA 4O3MA 3NWJA 1ZC4A 3AVTA 1C4OA 2FU5C 3LY5A 2FX3A 4FMDB 1SGWA 2I1QA 4PPQA 1SZPA 3NG1A 4TYWA 4DDWA 2JATA 2QMOA 2A78A 2WKRA 3CNLA 2IWHA 1E0AA 1I4DD 4DCNA 2IUUA 1XB2A 2LKDA 2O52A 3C8UA 3OFND 2GAAA 4DCUA 1N0UA 2J1LA 2QPOA 5J4LA 4JIMA 2RGCA 3B2EA 3AKCA 1D2NA 3FMFA 5JJIA 2FE4A 3LA6A 2AN9A 4WA7A 2GILA 4EKDA 2ODWA 2QQEA 2ZRKA 4RZ2A 4Z8YA 3GLFB 3O8DA 4LHZA 3LRPA 3P32A 4PQRA 3RAPR 4XVRA 1VCMA 2PH1A 4DEXA 2OAP1 4JLVA 3SJAA 1N6NA 2ZI6A 3DDCA 4GBMA 1N6HA 5E7JA 1QVAA 1OYYA 3C4JA 4IXNA 3EC2A 5EE1A 5C2JB 2ZJOA 1F2TA 5TARA 4QGAA 5JWOA 3CPHA 5KSYA 2IYWA 3B1VA 4MH0R 4OHWA 4BPBA 3H84A 1E1QD 4US0R 1DAIA 5CDFE 4LY6A 3SC3A 4NCJA 1JALA 2OE2A 4JLNA 2QROA 5EP4A 3L43A 3W6PA 3DKPA 2XITA 3TLXA 4TLAA 4LPSA 1CJKC 3W5JA 1BMFA 5EE5B 3EA5A 4XWAA 2P6UA 3SOPA 4CEIA 1KMHB 1OXSC 2MMCA 5HR5A 5JJLA 2GF9A 2XB2A 3W3ZB 1NN1A 1IXSB 1VG0B 3GQBA 4A82A 4NYIR 2GJSA 2QT1A 4KU4A 1G8HA 3RS7A 5JMTA 1OH6A 4TL6A 3QKTA 1P5ZB 1E2QA 3QENA 3FGNA 1CJMA 2GEUA 1EFRA 2V4ZA 1WMSA 2D62A 2RCNA 4JVNA 1Z2AA 2XEXA 4HLQB 2QAGA 4OJQA 5P21A 3SBEA 1D9XA 2BC9A 2F9LA 2OXRA 2QBYA 1SHZA 1U94A 2IUTA 1KAGA 4LJ4A 5CYOA 5KOYA 2REXB 4QHSA 2KBFA 3VR6A 2CHQA 2PZFA 2Q3FA 2RGEA 5DH9A 4PC3A 2FEOA 2Q0HA 4WIAA 5A5GA 4KLNA 5CIWA 5AWFC 4ASUD 4L5BA 2H92A 4IJMA 1ZINA 1G4UR 1AS3A 1QHHB 2VP5A 1ZM2A 1G7TA 1JB1A 2L0XA 1H8ED 2OO7A 1X86B 1G64A 1K8RA 2X8AA 2YV5A 4Q9IA 3SBDA 5GJVC 5JJKA 1X1RA 3MD0A 1QZXA 3BE4A 1E9AA 1NN0A 1NN3A 3MJHA 4QOSA 3BIFA 2BM0A 4NHOA 2RGAA 4RFSB 1GL6A 2FF7A 1OPXA 4HSEA 4PXAA 3BJIC 5JFGA 5KNDA 1GG2A 1UAAA 2KI5A 4GNKA 3D8BA 2C5LA 5J47A 1QHIA 4D81A 4PQFA 2BJVA 2PLRA 4PX9A 1Z5ZA 4ON9A 4LHXA 3RLFA 3ZLJA 3CPJB 2C04A 1YR8A 2CLSA 4OK3A 1RRFA 4NCNA 3CZQA 1EGAA 2ZREA 3QNUA 1ZNXA 2F1RA 4Q9JA 3KKNA 2PMKA 4MRRA 2A7QA 5K8LA 2MMGA 3FKSA 1P4SA 5AK0A 1ANKA 2I4IA 1II0A 4D2IA 3PUXA 2QPTA 1GRNA 4WOPA 4TMZA 1P62B 4LX0A 1SXJC 2GAOA 3PJRA 3NHAA 1KO8A 2KB0A 1CRQA 2BWJA 2GBLC 1XPRA 2FGJA 4WZBE 5JWRA 2ZR7A 1VG9B 2PJRA 2VP6A 5CB6A 2IS1A 2PZEA 1MR3F 1D5CA 3SNHA 5BN4A 2NZJA 1R6BX 4YONB 3SU8A 5JZVA 3B9PA 2IS4A 2JLQA 2ZAOA 3CUEF 1M7HA 3J81k 4KYUA 3R9IA 3T5GA 3UIEA 2D2FA 4EPWA 1OXVA 2WMOB 4BZPA 4LV6A 4PSVA 3FKQA 4EPVA 1OHHA 2DR3A 3IIJA 4GRAA 3QBVA 1Y63A 4GZMA 4HAYA 4OQLA 4TMKA 4DLXA 4RVCA 1P2SA 2GKSA 2RGXA 1DAHA 2VHJA 1KK3A 1LF0A 1UKZA 2E87A 2XOKA 5FBVB 5IT5A 5TVKA 3K0AB 1XTIA 4E09A 2JGNA 1RYFA 1W4RA 2JLUA 3QKSB 5KO2A 1E99A 1KSJA 2OLJA 4S2EA 3ZZTA 4V02A 2ATXA 4I1VA 4ILEA 2PX0A 5J5CA 2D2EA 1X3SA 1Z63A 4MDFA 2GEDA 2DHRA 4YXWA 4RZ3A 4HDQB 4TN1A 5AJYA 4B47A 1SKYE 3K53A 3CM0A 4V0ME 1SVIA 1FPMA 1WA5A 4JT4A 2QE7D 3IPXA 3T15A 4JBYA 3WY9A 1Z6TA 3K09C 5GJCA 4RCZA 5KU1A 1Z6XA 4ESHA 4CEHB 3CF0A 3FMPB 2DPXA 4YDSA 2ANCA 1ZIPA 1SXJB 1U0JA 3DMNA 1ZCBA 3BK7A 4KO8A 3K70C 2CJWB 1NVVQ 1VCIA 3A1TA 3PITA 2ZROA 4B6EA 1CF4A 4LBZA 1XWIA 3PR1A 3TSWA 2Z6VA 3WHLA 2UZ3A 5HE9A 1RRCA 1IY1A 1N6OA 3U6KA 1ZBDA 3JZMA 4B75A 2LCFA 3TGPA 3T5DA 2QQ0A 2GVDC 3Q5EA 1KI8A 4M1MA 3SJCA 1UKEA 3ZD6A 2O8CA 3W9YA 1A5TA 4IFBA 4LJ9A 1M8PA 1JAIA 1WB9A 4TL9A 4HAVA 2FDCA 2V3CC 5G3YA 2R8RA 2EWVA 3B78A 4PZLA 1DAEA 5DIFA 421PA 1W5SA 2G1JA 2GESA 1G5RA 1L8QA 1OLOA 4YLGA 1YRAA 4AYWA 4DUGD 3AVXA 4N0EA 1HQYE 1S1MA 1AGPA 1PLLA 1U9IA 1M34E 4RSGA 2OFOA 4DWJA 2I3BA 4R2HA 3VR5A 1UDXA 2R6AA 2WSSD 2C03A 4GDFA 4D25A 2O8FB 1YR6A 4DIEA 4M1OA 5IK2A 5L3QA 4ABYA 1IOZA 1KAOA 1NBMA 3IO3A 1SKQA 5H68A 4JKYA 4EPTA 1E2HA 4Q4LA 1JJ7A 1W0KA 4ITRC 5EXSA 2F7SA 3O8BA 4K46A 3MUFA 4Q4AB 1RVDA 4C0LA 4L15A 1KI6B 4XD7A 1OF1A 2GA8A 2YC2C 3EA0A 2FZ4A 1YVDA 3FVQA 2CL0X 1S2MA 2WJJA 3OIUA 2BMEA 1VIYA 3Q3JB 1P9WA 2N42A 3V9PA 8OHMA 3SN6A 1OYWA 3K70B 5FR1A 1G8YA 2B7CA 4QNMA 4Q48A 4Q00A 1GZSA 2ZS7A 3OIWA 1RZ3A 2DYKA 5AJZA 1HY3A 2HXSA 4MUBA 5J40A 1U8ZA 1SXJD 1COWA 4WXRA 4O25A 4LC0A 2X77A 2ZRCA 4KV9A 3VR4A 4PAQA 2JLZA 2ZPTX 5DI9A 3THWB 1ZC3A 2GZHA 4M53A 4NCHA 4DIDA 4JVLA 3TR0A 5K8UA 3GLIB 4RZUA 1RRGA 3B60A 5SZHB 3BFKA 2WV9A 4B44A 2OBLA 1N0VC 2DWPA 3LDAA 2W58A 1KK1A 2PL3A 3TIFA 3WMEA 3GLHB 1DO2A 3NBYC 3U4QB 3KKQA 4MKIA 1XXHA 1MV5A 4DSNA 1R10A 4ZDKA 2ODEA 4UNNA 1S3SA 4D6PA 2IBMA 3LBNA 1X8KA 1FL9A 4C0QC 4JLPA 4YC7A 3I5XA 1BO6A 1QHNA 1NVVR 4NONA 2YKGA 2GXAA 4OK5A 4MGKR 3ZIAA 2VHCA 3FDIA 3GEHA 3VHXA 1TQ4A 3H1TA 4D4LA 3MWJA 4IOMA 3TAUA 4BFZA 5LPNA 1G8GA 3LX8A 3KJEA 3I32A 1ONBA 3E5HA 2IF0A 3SQWA 4IVPA 4A8JA 1TQ2A 3BRWD 1XP8A 1II8A 3WMFA 2BVNA 3B1XA 1T4GA 2FSFA 5D3MB 1HEIA 1XPOA 4BE7B 3HPRA 3CF2A 1KJWA 1G17A 1XNJA 2OLKA 2JCSA 5JRJA 4YQFA 4F38A 2IYUA 3A1VA 4Z1MD 2PBRA 1EWQA 4UXJA 4UNPA 4DHEA 3LQQA 4JLMA 3K70D 5M04A 1SXJE 1IM2A 3SYLA 4X8MA 4W5HA 4OHZA 2LKCA 3RNLA 2RMKA 3LX5A 4BFWA 3SFVA 1UF9A 1VPLA 3TJZA 1G19A 2FSGA 1ZVQA 4LYFA 5FUYA 1OH8A 2EFGA 4Q9KA 4ARZB 1OB5A 4BASA 1VYVA 2DB3A 2F1JA 4E03A 2SHKA 2DFNA 4PC7A 4X8HA 4G5GA 1MO3A 2O0JA 2ZIAA 3EIQA 3PEYA 3NC1C 3TK1A 4ZIRB 1DE0A 5G41A 4LDJA 3CH5A 3PV0A 3W6NA 3AUXA 3UXMA 1GUAA 1NP6A 3ZGXA 1RJ9A 4DDUA 5LDDC 2GXUA 1A4RA 2IHYA 3AEZA 4PHGA 4QFMA 1A2KC 4EQ6B 4CVNA 2JEOA 1ELOA 1N5KA 3BB4A 2IYVA 2W2VA 2D74A 4JBWA 3B6EA 2B8TA 2UKDA 4A15A 1TQDA 4Q1CA 1HT1E 621PA 3THOA 3B8HA 3DO6A 3W34A 4DJTA 1SVOA 1TPZA 3WP1B 5JS8A 3OEHD 4EPYA 4XH9B 5JLJA 1IY2A 4CEJB 1G9XA 1ZU4A 2OBMA 3NIBA 2WM9B 4MKGA 4P31A 3THXA 4L9WA 4DRZA 4IOLA 4I1UA 5HCNA 3OEEA 2JLXA 2WJHA 4HATA 4FW9A 1E6CA 2XGJA 1T6NA 1XD9A 2G83A 1YZGA 2F43B 1Z07A 4JYCA 1MKYA 1JPNA 2QEQA 1G7SA 1XEFA 4JVSB 4QL3A 2V7QA 2H17A 2OCBA 4P4UA 4GPTA 1JXMA 1Z6AA 1GWNA 4FD2A 2IEYA 3QKUA 3N2IA 1KDRA 3TUJC 4C0SA 1JQLB 5KDOA 5DI3B 2YWHA 3AF3A 3D3QA 5L3SB 3S1AB 3GJXC 4TMXA 4D0GA 3W8NA 3GLHE 1XD8A 3CONA 2CHGA 2ZRLA 2PCLA 2YVUA 3CNOA 5FPKA 1NLFA 3HU1A 4PPFA 4KFRA 1N5IA 2HLDD 2OG2A 3ND9A 3HDTA 3ASZA 1QG4A 4HB4A 2FGKA 3VX4A 1DPFA 3VU9A 1CLUA 3IPYA 1JAHA 1TUEA 2JJ1D 2G9NA 3FHCB 1A2BA 2C98A 1WF3A 2WWGA 4O2RA 1TUIA 4O0MA 2RGNA 4PAOA 5BXQC 1P7CA 1NIJA 3IKJA 3EASA 3CW2A 4XTRA 4ZKEA 3RYTC 2V1XA 1AZSC 1XTSA 2MSDB 2HYIC 3TQCA 4PR0A 2EU8A 3CKLA 4HUQA 3SHWA 2OCYC 3KQKA 5HKKD 4URUR 1YHNA 4LWZA 3C16C 4JJZA 4KFUA 3QKRA 2ASEA 2GWHA 4C2UA 5KUTA 5BW8A 1ZAKA 4HAZA 2XJ4A 4MKFA 4Q03A 3PEWA 3NDBB 3X2SA 1GNRA 3VX3A 1ZD8A 1ZCAA 2Z4RA 5FL7A 2GXQA 3VNUA 4TWZA 1E9DA 1OKKA 3WNCA 3A4MA 3VTKA 5CDFA 3CRQA 3LV8A 3TMKA 1OXUA 5HCIA 1IJEA 2ZRBA 4MYHA 3HU2A 1P61B 2H16A 3I72A 2ZR9A 4P4TA 3X1YA 2VF7A 4QJ3A 3KQLA 4EFNA 4B3XA 3EIEA 1OH5A 1GKUB 1LF5A 1Z29A 1X8LA 4C2TA 1TADA 1GRRA 4KYIB 3U7GA 3RS0A 4FMCF 1CULC 2QAJA 3M6AA 3X1XA 2VSXA 2EFCB 4Q1AA 5G40A 1CR1A 3U60B 5KTYA 1M1YE 4FCTA 4KVGA 1PV4A 3LBIA 1PLKA 4DLZA 4EDHA 2OCAA 5J4VA 3NC0C 4GOKA 1TX4B 4Q4JB 4W5JA 3KQHA 5L3RA 1RFLA 2PCJA 3ADBA 5BN5A 2EVWX 3OIVA 2ZJ2A 2JLVA 2RHMA 3SR0A 3OFNA 4A2PA 1DAMA 1NVUQ 2QNRA 4C4PA 1CBUA 2FEMA 2ZETA 1TF2A 3QE0A 2V1UA 2VH5R 1T91A 1W44A 3HPQA 5KPJA 2KWIA 2GNOA 1LV7A 2OBNA 2VRWA 2Q9BA 4JSTA 4BFXA 1B0UA 4HZUB 4MRVA 4NTZA 1IBRA 1TEXA 4GSYA 3WNDA 4D4MA 2DFLA 1IJFA 1HT2E 3NDPA 5KDDA 1WP9A 1Z6YA 5DISB 2GETA 3CO5A 2PMDA 3EIHA 4AI6A 3GEEA 3K0CA 4C0HA 2NPFA 1E0SA 2CLCX 4RY2A 2OZEA 4B32A 3EC1A 4HB0A 3SDZA 1G7RA 2J5XA 4GMDA 1E1QA 5C4MA 5JI2E 4HYYA 1OB2A 1RC8A 2AKAB 3BB1A 5KPDA 3UMSA 4LV8B 2NG1A 2BBSA 5CB8A 4M22A 3F5FA 3ZDQA 1NMXA 3EZ7A 2R6FA 1OFHA 3X1ZA 4EJSC 3NH6A 1Z06A 3DEFA 3EW9A 2IYYA 4Q1EA 4B3CA 4Q4HB 1KHTA 2CXXA 1YZNA 4MQBA 2ZXUA 2FOLA 3LW7A 1OW3B 5DGXA 721PA 3LWNA 4S35A 3EZ2A 4LJ7A 3GJ3A 2RHDA 2YWEA 3AH8A 2J87A 2GF0A 3MRSA 1E4VA 1YU9A 3A1WA 1JR3E 3KJIA 4G01B 3DMDA 3PUWA 2WJVA 2ZRJA 3R7WB 1MO5A 2V6JA 1L2TA 2XTZA 5SZKB 1E1RD 3U61B 2ZE5A 5SZJA 2P5TB 4HLUA 3HP1A 5JEDA 5EZ6B 4Q19A 3ZZUA 2QAGC 1QHGA 4JBXA 2XZOA 1CIPA 2CDNA 3VNVA 4ASUA 3K8YA 4TMVA 4GZLA 4Q02A 1R0YA 4A1FA 3T34A 1N0WA 1W7AA 1AKEA 2FPLA 2JASA 1H8EA 3AVVA 4GL2A 1AJEA 4JKIA 3EZFA 4U5XA 2JJ8A 3RSOA 5JCPA 2X19A 4OYHA 2VP0A 4M9SA 5JBQA 2NZ8A 5FTKA 4MYCA 3QPUA 1E2MA 5FL3A 5A0FA 1QHSA 1ZNYA 4IDQA 4X8OA 2CE7A 3GFOA 5FTJA 1ZP6A 4XWOA 3AM1A 4AKHA 1G3RA 1ZUNB 2BDTA 2VBCA 1E79D 1ZMXA 3E2IA 5AUPB 2ANBA 1G4AE 3NEJA 3I62A 2F3TA 2HCJB 1F2TB 2ZSFA 6Q21A 2ZJ5A 1W0JD 3R20A 1UKVY 1S0UA 3KXIA 2BBOA 4EJSB 4G3XA 4F4JA 5HZHA 3EPJA 5KYKA 1HV8A 1E0KA 1AN0A 2O8EB 4Q1FA 4RD3A 3R9WA 4BLSA 1R7RA 1ZJ6A 1Z0JA 1KK2A 3C7KA 4JLOA 4V0MA 1OIXA 1EX6A 2R44A 4B6FA 3IBGA 5LD2C 4KAXA 4CT5A 2FPMA 3Q7PA 3GP8A 2P67A 3QY0A 4M8NE 4MGYR 5LBIA 2PT5A 4OI2A 5LB4A 4EAQA 2R62A 2YWFA 4LK2A 3MCAA 2W2TA 2Z4SA 4FMDF 4BFTA 4B48A 4UXIA 3TKLA 3F0TA 3KXKA 3TSOA 4JMPA 3T1TA 5LB2A 2QN6A 4PZZA 1U99A 4AKIA 5J4HA 2W83A 3QXJA 4IHQA 3DOFA 2R9VA 4UNQA 4CT4B 3CRVA 3H86A 1OJLA 4JZKA 5DNYB 3AQ4A 5G53C 2QAGB 3Q8XB 2GZDA 2FFQA 5AUNB 1XJ0A 1J8YF 1WRBA 2AWOA 1R5BA 3RHFA 1YR9A 4B2LA 2FV8A 2O8BB 5FR2A 2AD5A 3IILA 4AY2A 1EFCA 4URVR 4ZPXA 2GDJA 3TAHA 4U00A 4Q18A 2YJTD 3NBXX 4QGFA 1Z3IX 1GKIA 3GJ7A 4B34A 1Q20A 4FCWA 1QHHA 4FINA 3U3JA 3LBHA 2IYRA 4OI0A 1CS4C 1I2MA 2BMJA 5FOXA 3T61A 4DLRA 2QP3A 1CP2A 3DHWC 2CBZA 4HB2A 1P2TA 1W2HA 1Z08A 5KDLA 4PHTA 1IXZA 2CCJA 3TVDA 1GDDA 4G5QA 4TLBA 1W49A 2O0KA 4TMTA 5IRCD 2IEZA 2PLFA 5F2EA 1EESA 3LW8A 4I99A 4OHXA 3NHBA 2EWWA 1NJGA 5LD2B 3VKGA 3WP0A 2HV8A 2BOVA 4US2R 1DOAA 3I5YA 1BH2A 1XEWY 2HUPA 2ZYTX 2UVQA 1FMLA 1SULA 2A9KA 1Q22A 2RGBA 1XPUA 3UATA 2OSBA 1GL9B 1BMFD 2ZS8A 1MRSA 1N2CE 3C5HA 1LB1B 2Q21A 1ZNWA 1FUUA 3CZPA 3KX2A 4MGIR 2ZVPX 1KO5A 2WOJA 3BC1A 2QM8A 3BH7A 821PA 2ZRHA 1ODFA 4PHHA 4K8OA 2AWNA 2D3WA 2CLDX 1HYQA 4K81B 4M9ZA 3TSZA 2BKUA 3UG6A 3WRXC 2J46A 4LCBA 4CDGA 1ZUIA 3K0FA 4ACBA 1AS2A 1ZUHA 1SVSA 1U8YA 3GLFE 2OFXA 4MA4A 2RGDA 3KFXA 4GP7A 4DUGA 1ZM3A 2F1HA 2PZGA 2TMKA 5EJEA 2FNAA 1Q1ZA 1SHKA 1UEIA 3AUYA 1YKSA 1XZQA 1FNNA 3LLUA 5CJ2A 1KOFA 1N6LA 4EIWA 5CJPA 3AVWA 1OE0A 1RYHA 2WSSA 1Z0KA 2ZRGA 4A0RA 2IL1A 3PUYA 3K0AA 4YMSA 4Q01A 2ZSEA 3WYFA 3QKSA 1KO7A 1IN4A 3HYRA 3LQRA 1NVWQ 1EFTA 2HF9A 2ZANA 3MAAC 4BFYA 4NYJQ 1G8FA 1T0JB 2ZAMA 4OJKA 2A5FA 3QVUA 2ZJAA 2IYLD 3A8TA 2QT0A 2DWQA 1XCGB 1G8PA 3IIKA 2ODBA 3FYHA 5F3WB 5CM8B 3CWZA 5E7MA 2QU8A 4OQMA 1S1CA 1DO0A 3F8TA 2QENA 3NEYA 3W90A 4AURA 4BLOA 5KSZA 1KNQA 4P4SB 2HT1A 1M6NA 3TRFA 5IF9A 3AF0A 4DXAA 4F93B 2JLYA 1DG3A 3TE6A 2ZI9A 2AD1A 4M1YA 2BEJA 1E9SA 4CEHA 3IEUA 2DFKB 3M1IA 2HF8A 3WYAA 1E4YA 1SXJA 1YZKA 2ZQ5A 4Q5IA 2CJWA 4WBSA 4OI1A 3IO5A 3FTQA 2GBLA 1VECA 2BMDA 4GOXA 5EP1A 1OIWA 3EPKA 2DCUA 4QBFA 3I8XA 4QHYA 3P27A 4IOJA 1WXQA 4D80A 5F98A 1HE1C 3BH6A 2IS2A 1QBKC 4QHTA 1OV4A 1M74A 2QL6A 3PEVA 5FUWA 2ATVA 3RDPA 1H65A 3AV0B 1NMZA 2BIFA 1TF5A 4P33A 1G18A 1S9HA 2CL7X 2XAUA 1II9A 4QXAA 4JVMA 4RD1A 4ZI3A 3LD9A 3PXGA 1SVKA 4QM7A 4II7A 4PZYA 3FMIA 3KTAB 4DSUA 5DN6D 2R65A 1JEDA 1JI0A 3L0IB 3KQNA 1IN8A 4I1OA 2ZVQX 5B57C 4FCVA 4JLBA 3A1SA 5FOVA 4QG7A 4OHVA 5BYJA 4LJ6A 4Z8XA 1VMAA 1ZD9A 1GM5A 1N5LA 1NG9A 2O8FA 2GCOB 4BZQA 1G5TA 4WAUA 1YRBA 3UKDA 5L3QB 4UJ3A 4PSAA 3AP1A 2HT6A 5K8IA 2KBEA 1UJ2A 3NBFA 1UBEA 2BEKA 4QNRA 3U7HB 1KI2A 2Q3MA 1GFIA 4MRSA 4Q4AA 5FUVA 1TNDA 3FE2A 3Q9LA 2IWRA 5AJWA 1Z47A 4MUAA 2AFIE 4GP6A 4ZCLA 1Z6GA 2WKPA 3AKYA 4PSKA 3CX8A 3GPLA 3K9LA 1KZGB 3K09A 2ZRDA 3QXCA 5C1BA 3QUSA 4PC2A 5TY0A 1E3MA 2A5YB 2D06A 4TYPA 4DSOA 3GJ4A 121PA 1Z0IA 2KJQA 4UKDA 3A6PC 3W8RA 4ZDJA 3JZAA 1W1WA 1P72A 3BB3A 4Q21A 4A2QA 4N1AA 3OF5A 1GNQA 3VMFA 1OIVA 3A4LA 2QUZA 3THWA 2YOGA 1MOZA 1CXZA 2PJZA 1LFDB 2ZSBA 4NYJR 2K5UA 4HDOB 3AP3A 4PPGA 5DHFA 3BXZA 3MWLA 1N6PA 1UPTA 2NQ2C 2D7CA 1MO6A 3D6TB 1E94E 2ERYA 5DYGA 4QBGB 3GLHA 3UWKA 3EPLA 4XIGS 4ZCIA 3U4QA 2G0TA 2EYQA 3EAQA 4URWR 1HH4A 4EUNA 2I1VB 2WAXA 3REFA 2WZQA 4MDEA 4NCKA 3L8YA 4PO8A 2A5JA 3U6BA 1KK0A 1YQTA 4URXR 1LVGA 2Z43A 3WMGA 2WPDD 3CWQA 4Q9HA 4RJLA 4TSFD 4TMWA 4Q7MB 2VF8A 2GHIA 5G3ZA 3O8CA 4AIIA 1E2PA 1Q1BA 1T3LA 1C9KA 3L8ZA 1YJ5A 3ONWA 2J7KA 1G16A 3W6OA 4Q7LA 1WQ1R 1YR7A 4C7OA 3O8RA 5IK2D 2ZM5A 1Q3HA 4AG5A 1Q12A 1XTQA 5JSZA 2F55A 2ZUCA 2H8KA 2IA5A 3IIMA 1W0KD 2ZR0A 1WDTA 5D3MA 2Q3HA 2QP4A 3ADCA 5GJBA 4M21A 1C1YA 2V54A 2C9CA 2CCGA 3AGQA 4DLUA 4QGHA 4Q7KA 1US8B 4BLTA 1CR0A 2EFDB 1DELA 3I1FA 2WAYA 2JDID 1HE8B 2WTUA 5B64A 3IHLA 1ZYUA 3B1YA 4KFSA 4RKFA 1UFQA 4TQUS 1FQKA 1JXOA 1P60A 2J0QA 5KNCA 3GLGB 3AGPA 2ERXA 3RS5A 2XXAB 3H4MA 2PX3A 5JWHA 1E2FA 1PZNA 3I73A 3P1JA 1VYUA 3CRMA 3QXSA 4JL6A 1DTSA 4ARZA 4Q66C 4QGGA 3ZVRA 3U44A 3O47A 4BGDA 5JCZA 3CX6A 4MITA 3SYKA 1IONA 1S96A 2CVFA 4C9BA 2PEYA 3ZZ0A 3C5CA 5CK4A 3RRZA 3FFAA 3ETLA 4IEEA 2HLDA 1AKYA 2QMUA 2R6DA 2NGRA 4ZIRA 3I61A 1MABA 4B76A 2QG6A 3AF1A 4JLJA 2C95A 3FPAA 4HLCA 3ND8A 5EUQB 4HI0E 4XTCS 1Q3TA 1E0JA 2P2LA 2JJ1A 3A36A 4BUJA 1F48A 5EE3A 1E2EA 1T9HA 2XNDD 3UMRA 1P2UA 3QEOA 2BBTA 2CEAA 3ZH9B 4QBIA 2VP9A 2FSHA 2WJGA 2WOOA 2O5VA 1MO4A 1OH7A 1G20E 3ZIAD 3QBTA 1F3OA 4QBHA 2QSYA 3V4FA 2A2ZA 4M1KA 2VA8A 5HKKA 1Z0AA 3QF4A 5FPTA 4IDHA 1SVMA 3BORA 3C14C 4IVRA 2H5EA 3K1JA 3PUVA 1G3QA 2QSZA 4CEJA 1HUQA 1Y3AA 3MGCA 2C9OA 4URYR 1G7CA 4OQXA 3THYA 3IDQA 1WE2A 5FOTA 2XTMA 1M2OB 1W5TA 2Z0MA 5CK5A 2C77A 1LNZA 4ZV4A 4ACAA 5AJVB 1RRPA 3GEIA 1R5NA 3GLIE 4LBVA 3HR7A 1EG7A 1IQPA 4KBFA 4BLRA 1N3BA 2AK3A 2ZS9A 3ZVLA 1DEKA 2OESA 3SEAA 4HDCA 2G88A 4A0FA 1CR4A 4B3GA 2ZJBA 2WMNB 2CNWA 4NH0A 2ZRPA 5DI3A 3PG5A 3H2YA 3OZXA 5L3SA 5C4GB 1JR3A 3S1AA 3DZDA 1NSTA 3QXXA 2IW3A 2WSMA 4TL7A 3QI2A 2OT3B 2ZTSA 1FX0B 1DARA 1KKMA 2A5DA 2GZAA 2W6ID 3C15C 2O8DA 5CLLA 1Q0UA 1J70A 5FOWA 1AA9A 2W6JD 1XMVA 2J0UA 1XTJA 4TTPA 2QTFA 3U3OA 1LY1A 4V0LA 2CK3D 4UJ5A 2CHVA 4OK6A 4AKEA 3VU9B 1E9FA 4BEBA 2AXNA 4Q1BA 4Q47A 1CJTC 1KDPA 4D0NA 5EE9A 2P6RA 4XVUA 3RC3A 4NPHA 1R0WA 2HEIA 3F3YA 1G3MA 2QRNA 4TYNA 1U98A 2Q6TA 3B9QA 4PFSA 1LS6A 4ZDWA 3BFVA 4PHFA 4TTRA 3UK6A 2KSQA 5ELXA 5EZ5A 1NL3A 2FFAA 1RPZA 5CIQA 2J0VA 2OXCA 1Z22A 1EFHA 1NVXQ 3QKRB 3UG7A 1GVNB 1IN6A 2LWIA 3DPUA 1XTRA 1XMJA 3JVVA 2B21A 3KJHA 4DB2A 3GJ0A 4A36A 1J7KA 2W0SA 4FWTA 2JJ2D 2DBYA 2QM7A 5FUXA 5JI3E 2YINC 2NO6A 3PIRA 2WWIA 3FHOA 4PTLA 5EUMA 4M1SA 3OIYA 3ZJYA 4BLPA 4C0JA 2Q9AA 1T3HA 4DT1A 4L16A 4HZIA 1UBCA 1S8FA 2XTNA 3ASYA 4YMWA 521PA 3MMPA 3GLGE 3ICEA 5FBWB 1EX7A 2QMHA 3U3MA 1TU3A 4AWXA 1IN7A 5F9FA 4B2IA 4URZR 1KI4A 1JJVA 1KTVA 1EXMA 1N6RA 3CRW1 4TTQA 3WRYC 1FOEB 2NIPA 5HZKA 2V7QD 1U0HC 1BOFA 2A5GA 4D26A 5HE8A 2WICA 2CVHA 4NL4H 3LVRE 4AYTA 3E1SA 1NLYA 4LJYA 1S9DA 2RAPA 2ZITA 1OT3A 1VTKA 4KBGA 3IEVA 3AKDA 3OAAD 1CR2A 2WHXA 1PUIA 4MGZR 5CYPA 4Q4JA 1TTTA 1FTNA 3BD9A 3N2EA 2FG5A 1G6HA 3KZ1E 5FTNA 1KO4A 4DLYA 2WWWA 4IFEA 2CMKA 2XSZD 4HLUC 3NXSA 1VG8A 3BGWA 4W5WA 2AK2A 4WW0A 5SZIA 2P65A 1E2KA 5EE0A 3K0EA 1VCNA 2AHOA 2ZI5A 2GK6A 5J4YA 1TL7C 3KQUA 1QRAA 3A58B 5FFMA 3UWOA 4D0LB 1ZD1A 3TR5A 5HPYB 4E5UA 4YDHB 3U3RA 2EFEB 3EPHA 1XD2A 2Y8EA 1F2UB 1QVRA 4WVFA 4BFUA 4F4CA 1XEXB 3CX7A 4TQAA 1E79A 2BKEA 4OKSA 2ORVA 5TV2A 1KDOA 5GVSA 3CNNA 2QGNA 3U3KA 3CB4A 4LV5B 1KDTA 1W0JA 1XU4A 5CLQA 1HA3A 1XFAA 4FXPA 4LBWA 1E98A 1R8QA 3GD7A 1XTKA 4UQOA 4IDOA 3QPVA 2XZPA 2GJKA 4Q4HA 4AD8A 3SYNA 3QEJA 3U7FB 3PVSA 4LC1A 5H8WA 4NE2A 2J45A 3T35A 2B8WA 2XJ9A 4UNSA 1GILA 3EG5A 2HXYA 3KFVA 4DLVA 1D6JA 3GJ6A 2H18A 1XF9A 3A37A 2VEDA 4O2LA 1YZTA 1AZTA 1XEWX 2IYSA 1T8TA 4JYBA 2NOAA 2N1BA 5JRZA 5TXGA 2G0NA 2OV2A 4MRNA 1VG1A 4E07A 1FNMA 2ONKA 4DLWA 2GVZC 1W4BA 1FQJA 2RH5A 2VO1A 3LO5A 2WWFA 1OFUX 3P26A 4I81A 1H8HD 5FPSA 2W2XA 4HAWA 1FP7A 5CM9C 1ZU5A 3GLFA 4TT3D 2D7DA 3MJRA 4M9XA 4EFMA 3I92A 4KITB 2ZI3A 2YYZA 1Z0DA 2QI9C 3PQCA 2J59A 5FTMA 5JHGB 4P0TA 3WNBA 1KI3A 5FBRB 4XSGA 4DDTA 2IK8A 5FI0B 1TQ6A 4PC6A 3ZYCA 4DCSA 1R8SA 5TMPA 2JIZD 1JEEA 1IN5A 3HR8A 3KKPA 3LAWA 4G5RA 1DADA 4NZYA 4Y0AA 4YMVA 1I2DA 4XSHA 4LUCA 4RZXA 2C78A 2H7VA 3BAFA 3OE7D 2J7PD 1KY3A 5E4FA 2REOA 2WKQA 4HEJA 2V55B 2BCJQ 3DM9B 4ZCMA 2OUKA 3T1VA 4EJSA 3NVAA 3QQ5A 4BRUA 3EXAA 4CEIB 2O8EA 2C9YA 2ECKA 1KMHA 1D9ZA 2XZLA 1GNPA 2NO0A 2HCBA 1E2JA 1SKYB 4R98A 5IHPA 2P6NA 2OHFA 4KVAA 4RCYA 1RIFA 2VYFA 3IGFA 4XVQA 1GKYA 1O3YA 1NSFA 4KFTA 2C96A 1KSFX 1AQUA 3E70C 4P32A 3VKWA 2FFHA 3TW4A 3RC8A 5H1YA 2QBYB 4GFDA 4TL8A 1P9RA 4RD0A 4H1VA 4BFVA 3T06B 2REBA 2YOFA 5E3HA 1YZLA 3FB4A 3V00A 2CE2X 2X1VA 4Q1DA 4UNRA 2IYQA 4UXHA 5DHAA 1P73A 4Y0VA 1MRNA 1ZIOA 4EPRA 2O8BA 1KI1A 4W9MC 1K5GA 5L3VA 4JLKA 3FOZA 4RD6A 4CF7A 3EWSA 2WVJA 2XX3A 4QRHA 4IOKA 3I3SR 2FMXA 5DYIA 1AM4D 5GVRA 1WBDA 2NO9A 3QG1A 3QJYA 3QPWA 3MSXA 3IHWA 1DAGA 4RFSA 4CGZA 1GSIA 2C2HA 4V0OA 3EX7C 1KI9A 1XMSA 3GCGA 3QSYA 2ZSAA 4MKHA 2IXEA 2ZYUX 3D31A 5TB5A 1KYIA 4LJ5A 1UDWA 2BV3A 1K6MA 1IY0A 3MWKA 1E2IA 5JS7A 2XB4A 4L4UA 3VHLB 2ZJ8A 4LYJA 4YMTA 5HTKA 3ICQB 5DSZA 1N5JA 1VDZA 4GT1A 5FPYA 3I8SA 1EWRA 2WJIA 4JL5A 1J90A 2ZE7A 5FTLA 3C41J 3OESA 3RABA 2QE7A 3SS8A 3G0HA 1J99A 1N6IA 2H57A 1HTWA 1LTQA 3VAAA 4DB4A 4LYHA 4R71A 1U81A 4JLAA 1JR6A 1NMYA 5B2ZA 1E2GA 5F9HA 1KMQA 2AFHE 4IDPA 2VTKA 5EP2A 2ZE6A 3EARA 4NYMQ 3M4YA 4C0AC 3QG5A 3ZD7A 3TQFA 2QZ4A 3B7GA 4ESVA 4JT2A 4PO1A 1P75A 3ZS8A 1EFRD 3SI7A 3CF6R 4Z51A 1OXTA 4R9UC 4PAMA 1WBBA 1W46A 3PEUA 1GOTA 4BZXA 5A4JA 4G1UC 2D4HA 4IRUB 4NBSA 2ZJZA 3B13B 3B1WA 2W0MA 4C30A 4CYMA 2V6IA 1NN5A 3JVUA 1ZW6A 4RKEA 1GIAA 2VP2A 2CL6X 2HJVA 2RB4A 2VSFA 5GJWC 1A82A 1LW7A 1VKJA 2F9MA 3K0FB 1CJUC 3BOSA 3TNFA 4GOJA 1OFTA 5DN6A 2DFTA 4B3DA 2GRJA 2EW1A 4MYUA 1QDEA 2E1RA 5C46F 3RRMA 1U9IC 2F3RA 3L2OB 1BIFA 3K9NA 3AKEA 2DWOA 1OFIA 1DAFA 1FW6A 1UADA 5FBQB 3GFPA 2IXGA 4LZZA 4RFVA 4IEIA 3SJBA 4AC9A 4JSYA 3I4LA 4I4LA 2OEPA 1EFUA 1Z28A 4A0GA 4AYXA 2ODNA 2VHUA 4ZDIA 5KSOA 1FZQA 5TDHA 4LYAA 4TZ0A 1FP6A 2J0SA 1XRJA 2QP9X 4PPNA 2FSIA 4KLZA 2PEZA 3W3AA 4BRWA 4R7ZA 2IC5A 1F6BA 4B43A 3DKVA 5D3QA 3BBPA 3PUZA 4V03A 4CIDA 4ZI2A 5AUOB 2EQBA 4BFSA 3Q72A 4FN5A 2NMVA 2FFBA 1ZRHA 1XZPA 4DSTA 1UBGA 3VQTA 1NLZA 1NJFA 4IVQA 4P4SA 3CIOA 1AGRA 3FKSD 1S3GA 1G21E 4DZZA 1CEEA 1CJVC 1T5LA 2EYUA 3B5JA 2NO1A 1NKTA 4KSBA 4B71A 2KE5A 4GMXA 4HAXA 4JLDA 3DL0A 3P4XA 4OQFA 2QY9A 1D2MA 4DBLC 1B23P 3Q5DA 2ZUDA 2O8CB 3LLMA 4LSGA 1G41A 1XMIA 1ESMA 1G3UA 1KZ7B 1L7VC 1M7GA 2C99A 1X1SA 3HU3A 4OBEA 1A1VA 4F91B 1SVWA 3QVVA 4ZO4A 2J9RA 3EWAA 2Q9CA 3QOFA 4DCVA 1G291 2P5SA 1ZM4A 2A30A 4CZ2A 4B3BA 4C0BA 1WCV1 1OHHD 4DLTA 2BJWA 1BKDR 1FMJA 4OQNA 2GK7A 1E9EA 3KTAA 5DLQC 3ZVNA 2AR7A 3ZQ6A 2QTVB 1G1MA 2XOKD 4NYMR 2WPDA 2WWXA 1U0LA 4TSFA 4DEYA 3KXLA 2OM2A 3R8FA 3PCRB 1A7JA 4DDVA 3GJ5A 4B33A 2WJYA 4OL0A 3BFXA 3AVPA 2GCOA 3AVQA 3LH5A 1KI6A 4AKGA 3GJ8A 1F5NA 1UBFA 2ZSDA 5EXPA 1W4AA 4A8JC 3FWYA 1VCOA 1QG2A 5H70A 4TLCA 4YXWD 5FOSA 2WWHA 1VHTA 2AKYA 1JECA 3G5UA 4POAA 1RW4A 2G1KA 4QM6A 3LFUA 1ZNZA 4Z1MA 1JNYA 4A92A 1CTQA 2XNSA 1E2DA 1W48A 4OI4A 5B30A 5C18A 3GFTA 1W36C 1X6VA 3KDSE 4TZ6A 1KKLA 2F6RA 5E7IA 2IHBA 3B82A 1R5OA 1XCMA 1JBKA 3TUZC 4XOIA 1E32A 4PC1A 3WBJA 1BYUA 2JDIA 1W47A 4FIDA 4D4JA 5KNBA 4WZAE 4LJ8A 1T3SA 1VIAA 4LHVA 4M4SA 4TLDA 1SVLA 4HAUA 4B3FX 3GLIA 3ADDA 2ZRNA 3T1QA 1V43A 3AP2A 3FHTA 4M1TA 1JQJC 1Z0FA 2HDNB 2J3EA 3KL4A 4IW3B 4DCTA 4WZ6A 4B35A 3R9XA 1O87A 1E2LA 2JLRA 3DOEA 2IYXA 3UANA 1Q44A 5FOUA 4B73A 2QORA 2WBLC 1XXHB 2NTYC 3L82B 2R6GA 3RWOA 4DLSA 1EK0A 1NY5A 1D2EA 3L0OA 2BBWA 2BM1A 1KGDA 3L0PA 3VFDA 4DVGA 5AUQA 3RRNA 2QMEA 2NPIA 1G3IA 1PJRA 1E69A 1ETUA 1J2JA 1LS1A 1E96A 2XNDA 2JLWA 2JA1A 3SJZA 1T0HB 4CRWB 2O0HA 2VHTA 1Q21A 1FUKA 4QKQA 1E9BA 2ZI7A 4H9GA 1NBMD 3OEHA 4US1R 2NO7A 4KHZA 4BQSA 4KSCA 4A8JB 4LJAA 2QTHA
chains in the Genus database with same CATH superfamily
2WU4A 1BU8A 4RD4A 3L1KA 4OKIA 3LHSA 2GR9A 3HGMA 4HNAA 4RZIA 4C7OB 1IN1A 5IDVA 4BX2A 4F3YA 4FI3C 1WD5A 2ZJYA 1T34A 2BISA 2VPPA 2Z8YM 3HUEA 1E3SA 5DM1A 2LCQA 3CH4B 4ETNA 3OT4A 1W36B 1E6WA 1K3UB 2WIFA 3ZHXA 1PEKE 1Q1QA 2DBQA 1JPUA 3R6LA 2C83A 4DG5A 1KJJA 5BWMA 3ENNA 5CBKA 3QWHA 2XLBA 4BWYA 4E5NA 4F92B 1X92A 2QZPA 4LHYA 4U9IS 1Y1TA 3MIIA 3JD3A 1Q0HA 1A5ZA 3NASA 4M36A 2DM6A 2IV7A 3TQRA 4N9QA 3WIBA 1VE3A 1JLKA 4F4IA 1P3JA 4M98A 2GO7A 1C3EA 4QU8A 1PZGA 4BP3A 1MJ5A 3KYDA 4GU5A 2IXFA 1BYIA 4R2IA 2PNFA 1GQQA 2XQKA 1COWD 3LMKA 4LOAA 4AU1A 4F2HA 5LP6A 3PFCA 5IAKA 3VR4D 2G6BA 4DMRA 1Y5IA 3SX0A 1R4AA 1L1RA 3HYTA 1U2GC 3W2GA 1PS9A 4P4NA 2I03A 4PSCA 4AUMA 4XJSA 5IBQA 4RMIA 1U1FA 5AJXA 1DLIA 3TRHA 3FPSA 4FWIB 4Q3DA 4KE7A 1FS5A 2GN2A 1XLVA 1GPNA 3N2GA 2CLIB 5D6OA 1L4NA 4WKPA 4QNNA 2AN3A 3EXEA 3LXXA 2AJTA 1CPYA 1ILWA 3GFQA 2JFBA 4KXYA 3PKJA 3QLVA 5F23A 1I4WA 4N54A 3KS9A 2W6JA 1WS6A 4HKTA 2Z1MA 3I2IA 3QYFA 4MQ6A 1LBQA 3OZDA 5JD5A 2WKWA 1JDTA 2CK3A 3G68A 4GMKA 1OGJA 2IS6A 2OUIA 2WB4A 2PKQO 2ZB3A 4WBXC 1JHDA 3V8VA 3CSUA 4F4HA 1TM3E 2RJ3A 3JSAA 4G5OA 4B74A 3ZE2B 2VATA 1XZEA 3ZQJA 2PQMA 1U7TA 2Y1WA 4KAJA 3VPGA 3ZE6A 4ZEVA 4MPDA 1XHFA 1I3CA 2ZYVX 3EZ9A 3UY4A 1MAUA 2CFOA 3II6X 4DUZB 1Q1EA 2AMJA 1V5GA 1GHTA 3T3HA 1DJNA 2ONJA 4HMOA 1QIEA 4TQ9A 1MENA 2GRUA 1EA7A 3PRJA 5D5HA 5CHYA 1NYQA 2D5AA 3GEGA 4A2WA 2YOHA 4O4LB 3HSSA 5BRAA 1DVRA 1UZLA 1SUWA 4BX8A 3MOGA 1OXXK 2ZPAA 3M0EA 3UBTA 4LX8A 1CUUA 5EQDA 2IYTA 1EXDA 1J1ZA 4MRPA 1KJ9A 1TZMA 1M0WA 2AX4A 1KJNA 4UNIA 5B6JA 2QRZA 4L72A 3RYHB 5F52A 4BIIA 1V48A 1B6RA 1ZJJA 1SQ6A 2HRDA 2P77A 1I9GA 3EIUA 5G0VA 3T5BA 2IT1A 1SCUB 2BMAA 2GEVA 3IPAA 2DVMA 2ZUTA 4YALA 1NXSA 1NOJA 3VR3A 4BO3A 3Q85A 1JX6A 1Q2XA 4G8BA 4P0PB 3QH4A 2X0JA 2FMHA 1CUHA 4KI0A 2I9PA 4NDZA 2X9GA 5HQJA 5EP3A 3UZUA 3F5QA 1DDGA 2C3YA 2PSEA 4UVDA 4DC9A 1YJQA 4K3UA 1P2FA 1EM8B 2MYPA 2YXBA 3DXZA 1GT6A 4QQFA 2GJ9A 3PWTA 1FXSA 1NPYA 4LFCB 4FMCB 3GN1A 4PLWA 1I32A 5IAAA 4A6PA 3MFYA 4Y6GB 3RNOA 1Z8HA 3WDKA 4G4SP 4LYYA 4IX9A 4P3YA 3UB4A 1FXUA 1BS1A 4ERNA 2WHPB 2BH9A 2C5HA 1P1FA 1YZHA 2VLIA 3EXG2 3PI7A 3G79A 3LK7A 4YX9A 5IJ9A 3RWMB 3COJA 1VHWA 3DB2A 4G5SA 5E95A 2PUCA 2MYNA 4D9GA 2EQ5A 2R97A 1MZVA 3CZCA 1K2VN 4M88A 4ENTA 2YNMA 3BIWA 1UBTS 1IAQA 5EJ5A 4EW3A 1JLHA 2CZGA 2ZXEA 3CLUC 3ZGYA 4IZIA 4CKXA 1NI3A 4FFNA 1DDOA 2V8OA 5J23A 2CN1A 3KJGA 1TAUA 1U2SA 4IRMA 3QPAA 1SOVA 1SCAA 2RKWA 4DKXA 5L3ZA 3A26A 3CN9A 3ZNPA 4QU5A 4PNEA 2JKYA 2IY9A 3NT4A 3SZLA 3PUHA 3HCCA 4JH0A 5K3AA 3RHTA 2BCGY 4ZJUA 2IEAA 3LJKA 5DNEA 2VDRB 1A5SB 3L7CA 3GAZA 3K0CC 4U02A 2FN8A 4YRAA 3BHIA 5ARCA 3ZWYA 4Q7JB 4C3ZA 5LQUA 4JS0A 1YAJA 2NZ2A 5B7QA 3KZOA 2DP4E 5HXAA 2YIJA 4ID3A 1Q17A 1KMCA 1SIUA 3JYPA 4KO1S 5HWSA 2WM2A 3TH5A 4J49A 4IIFA 3DGEC 3EZLA 1URPA 4IGFA 4NKRA 3T7IA 2A9FA 3HO6A 3ICVA 3K6SA 2O7RA 3H0KA 5ICMA 2YHIA 5HIAA 2ZUBA 2EFHB 4QWMA 4DT1B 1IWOA 5DLYA 3SICE 1KIMA 3AF5A 4UZEA 1DTWB 2FSSA 4G23A 3H7IA 1U7ZA 4L7QA 1TCBA 4N5DA 3NTOA 1KY5A 1Z3CA 3SVZA 5JXJA 3RW9A 1X80B 4JJ7A 3ZE8A 2PRYA 4KNYA 1BVUA 3PT9A 5IPFA 3R8CA 4DV0B 1O95A 2BEUA 4CNBA 3KSBC 2PWPA 2R2AA 5TQ0A 3RK4A 4U7JA 2EZUA 5FB3A 2CNWD 5FWDA 3UJHA 2YV2A 3M6XA 4J0QA 4NCIA 1DIHA 4RVNA 2HYDA 4X61A 4Z9XA 4CKBB 1X15A 4TLEA 3ZQ4A 3F3SA 4D8UA 1F4LA 4HGQA 2VPZA 3TVTA 9GPBA 4HS4A 1T6BY 1P9NA 1TVCA 4C0KA 3EF1A 2I6TA 1XJCA 3AFGA 3KD2A 3MLEA 4N0DA 4F7WA 5DM70 3K05A 4XLLA 2CSXA 3ABSB 4YTEA 1DMRA 3KAKA 1JTEA 4G0QA 3ECCA 1ESCA 4D3SA 5EHXA 4EHDA 5IX8A 2O14A 3QEMA 4JYMA 4KIJA 1Z6QA 3JRNA 2V7VA 3NBZC 3MWFA 3K2EA 2BMFA 2YZGA 1UUFA 1ZJ4A 1VIMA 3COZA 4H6PA 4OHYA 2G9ZA 2ZRFA 5AKEA 2WYHA 1V1MA 2XTAA 4NYIQ 3RD5A 3Q9SA 4N76A 4PANA 3NORA 1DFGA 3FFTA 4Z7JA 2F8LA 3HI6A 5FBLB 4ZKDA 2JIZA 1EVQA 2YZMA 3L41A 4I55B 5ALPA 5SV2A 3ZUPA 3DL7A 2OYCA 5F5LA 3WXMA 3I6YA 5JHHB 5J2TA 3QX3A 2OTCA 1F2UA 5HIIA 1UOQA 1XEXA 2O06A 2BKXA 4JL8A 3EVDA 4NOMA 4ZGGA 9LDTA 5IANA 1XVLA 2JAQA 4NXMB 4NFHA 1TMKA 3D2BA 1EK6A 4LPKA 1A71A 1ZMTA 4K6GA 4M0LA 3RSFA 4ETWA 2RJOA 2VHQA 3D6JA 1K63A 4IAOA 1KE1A 5CLFA 2I7CA 1DTEA 2AX3A 2B3DA 1DJLA 1VCHA 3SQXA 1RP1A 3V42A 4X41A 1MA0A 2OCDA 3O75A 4MW0A 4B9AA 2DXIA 4MQ5A 1UBHS 1P6XA 2GFIA 4KCGA 1AUXA 1RI4A 5LIPA 4RVGA 3ZKAA 2B34A 3TBKA 2WE8A 1ISPA 1GZVA 1XZHA 1NRIA 3ITDA 4TWRA 2WYVA 4GNRA 1G8MA 1KH1A 2YZ2A 2ZYAA 2OQ2A 2G9UA 1U8AA 4X3OA 2R7MA 3OVMA 1ZC4A 4QECA 3AVTA 1C4OA 4L5CA 4BCCA 1EVKA 5ERGB 3A4TA 5MGNA 5H9WA 3NG1A 3OOWA 4Y2SA 2C0CA 1FY2A 3CSSA 1ZICA 2JATA 3RWBA 3ZHTA 5DM2A 2WKRA 2Y4NA 3Q6IA 4ZEOA 3ME5A 5ECWA 2C4UA 4HEA6 4PPYA 2IWHA 1DHTA 4ENQA 1ORVA 1E0AA 4DCNA 1C41A 1XB2A 4UM5A 3ESXA 2O52A 3OFND 3TW0A 2PYDA 2GAAA 2IHNA 1B74A 3TXAA 3VISA 2GD1O 2CHEA 4YVFA 3I23A 2DUUA 2HMSA 1WXXA 1J8DA 3H17A 3FMFA 1YC2A 1FSFA 1NE7A 1UDBA 5JJIA 4P34A 2AN9A 2RBGA 2DWCA 1H94A 2PJUA 2QTCA 4H18A 3GLFB 1GVHA 2B8NA 3KQQA 5BMVF 2ZJ3A 4JROA 4LHZA 5FWXB 3P32A 3PVCA 3B5EA 3RAPR 4C3UA 3KLNA 2GTHA 2OBYA 5HFAA 1P18A 1M6HA 2J3JA 4V1CB 4KUHA 2ZI6A 4GBMA 1V45E 4LOIA 5B37A 5E7JA 2C5EA 3NVKI 4HQOA 3W77A 3C4JA 2FYTA 4DR6B 3EC2A 1YB5A 1R00A 2VNAA 3TTYA 2EIXA 1RPTA 4IUBS 3CPHA 3M4NA 3MJTA 5KQPA 4U9HS 2Q3JA 2J5QA 3H84A 1XNHA 3EJWA 1DAIA 3NT2A 4US0R 1JHPA 4YBRA 5CDFE 3V2UA 1FMCA 2QXTA 4X1YA 4IIEA 4A0QA 5EQFA 2VH2A 5BOVA 1WUKS 4XX0A 4FHFA 3W6PA 4YQZA 3PYXA 1OFVA 3DKPA 3FM9A 3GEMA 3U37A 3WDMA 1ES9A 2Y0BA 3WWEA 1D1QA 1PR4A 1GGEA 1T5TA 1UP4A 1ZXLA 4FQ5A 1LLUA 3GRRA 2EKBA 2VAXA 4RZQA 2Q50A 5ERXA 2QL5A 3O1LA 3SOPA 4NNJA 5ES4B 1KMHB 1OXSC 4BVJA 3IUMA 1VG0B 2RHOA 3TG2A 3DE5X 4GIBA 1JSXA 5LL6P 1I5OA 1GA6A 4G0OA 1JKIA 1QIHA 2DTEA 1ISRA 1CUSA 1UT5A 2VYNA 4K3VA 4YT5A 1G21A 3QU7A 1OH6A 4TL6A 3DW3X 3QKTA 5CNIA 1E2QA 1NV9A 2J85A 5AHOA 2ID4A 3HKCA 4OJTA 1KVTA 2D62A 2RCNA 4HDAA 4RJJA 1CSEE 3P9XA 1JE0A 4HLQB 2QAGA 3GLQA 2FEAA 3H1BA 4OJQA 1HZZA 2F9LA 4WERA 4P5DA 2IUTA 2XGMA 3WC4A 4LJ4A 2DGDA 5E9QA 5KOYA 5ALIA 3QE3A 4KDRA 5H83A 3P9KA 4O3FA 2Q3BA 2PZFA 3NIFB 4YA6A 5DH9A 1DEXA 3HC7A 4UHCA 4RTQA 2GBIA 2WQZA 3VOAA 4G8CA 2FEOA 1RLOA 4FX5A 3O4GA 1O9BA 1ZJ5A 4KKVA 3UB3A 5C8YF 2EKPA 3EXHC 2H92A 4L5BA 5ITZB 1HE4A 2OHJA 2JBAA 5DHPA 1Y33E 2L0XA 3VU3A 2X8AA 3ZXYA 2YV5A 1ITZA 1J1UA 1J09A 5IXSA 1KZ4A 2B4AA 3DZFA 5LA6B 2OXFA 3BE4A 3Q11A 1E9AA 4WFQA 1U8EA 3IX7A 3RK1A 4H7JA 2C42A 1K92A 4FYWA 2R8XA 2RGAA 4AAYA 1GGMA 4XKJA 2FF7A 3GQVA 3L7JA 4H4DA 4WNIA 5ECGC 5JH7F 1P9OA 3DAFA 3MJCA 3R0ZA 4PXAA 4CM8B 1BMQA 3AEUB 5IW8A 5AM1A 1ENPA 2XI4A 5ITWA 4EY3A 2AZTA 2B30A 2H9IA 3D8BA 1QHIA 2P78A 2O05A 2VWGA 4OHPA 1WKCA 1T3ZA 2O4CA 1PFVA 1ZIYA 4PX9A 3FYTA 3ZN2A 2ROQA 1FMTA 1XMQB 3CPJB 1JYFA 1YR8A 2VHXA 2JS7A 1RRFA 4D99A 2OV4A 1ORIA 5E1OA 1P91A 4QT4A 2FEWB 3ZLVA 3QNUA 1U02A 1MJGM 1OD6A 3I0MA 4RENA 4OQEA 4Q9JA 3KKNA 4KQHA 4MRRA 3TO5A 2C4HA 5EGNA 1DO8A 3MRVA 1NV8A 4R1UA 1ANKA 3HJBA 1A5AB 4KO2S 5KHLB 1ZO8A 1BE0A 3PUXA 2PXAA 3A4IA 4WOPA 4Q1VA 4TMZA 4WZAA 2OXEA 4C7BA 1P62B 1ODLA 4BO5A 2PUDA 2O7SA 3ANTA 3QKWA 4C1NA 3PJRA 2QN8A 3NB0A 4W5QA 2DH6A 3JVEA 3AR6A 3HKDB 3OCJA 3LRTA 5ALQA 5DT2A 4CM9A 5JWRA 1QIFA 5KYTA 3JASA 4GXQA 4EFDA 2IS1A 4IH4A 1D5CA 1H6DA 3BMCB 2YIDA 3S8YA 1O5IA 1R6BX 2ZBUA 4YONB 4C6TA 4CF6A 2GYVA 1R1DA 2PS3A 3KSAC 2RHTA 1JNXX 3T5GA 1PGJA 3H5TA 3UIEA 4OMCA 1X7YB 3SX4A 3CZMA 5FQNA 1XVVA 2OK8A 3EFOA 4L4YA 4RY8A 3FKQA 3ZXXA 4EPVA 4NCBA 4BQPA 1Q14A 4MPRA 5BWLA 1J0AA 4GRAA 4GZMA 1H05A 1L8XA 1P2BA 1WX1A 4RPJA 3LZ6A 4W8OA 4DLXA 1Q0QA 2VHJA 3L8EA 3P45A 4A1OA 1GFWA 1S89A 2RAFA 4M7OA 3TRJA 3UV3A 2FCRA 3SEZA 2PUFA 2RG7A 2A1UA 3FAZA 3N8GA 4FKMA 3HO8A 4PO3X 5DCLA 4EYGA 4EGJA 3QE9Y 3TZKA 5DNWA 2DJ5A 3Q1KA 4W9NC 4UAJA 4TXJA 5IJ9B 1Q50A 5KO2A 4JODA 1KSJA 2OLJA 2PL5A 1GTMA 3ZZTA 4QOJA 4V02A 1REQA 4RIFA 4I1VA 4ILEA 5LLDA 3H2ZA 2PX0A 5JNSA 3AZOA 4GYYA 2FW8A 4KBYA 4YJ3A 5J5CA 3GXOA 4DAOA 1H93A 1UP6A 5TS2A 4F97A 1A88A 2CWWA 4J1QA 4JI0B 4RZ3A 7GPBA 3FLBA 3IOEA 3H2HA 4HDRA 4TN1A 4B5LA 2J0EA 2A59A 1VGQA 2AE1A 2FEXA 3CM0A 3G8DA 3LYLA 3QSGA 4ITUA 2H1VA 1ATIA 1Z4OA 2QNBA 3ED5A 4H6XA 2QE7D 2HKIA 2V9CA 3EGDB 3WY9A 1VI5A 5MFPA 1EGVB 2H7CA 2QUHA 3BGOS 4RCZA 5GJCA 1O96A 5JD6A 1P39A 1Z6XA 2JB9A 3BXXA 3CF0A 2C54A 4B4UA 2DPXA 4DA8A 3KXDA 3V5NA 2R25B 2XWJI 4REQB 2Q4EA 3A1TA 2DSNA 3OM9A 4I50B 2Z5GA 2Z6VA 5KX5B 1SBNE 4YJ2F 2Q0QA 3PXBA 3NFYA 4NU5A 1PYDA 4PF1A 4S3MA 4D4HA 3ENZA 5IKEA 2V74B 4KN9S 3T5DA 2GVDC 3C4VA 5D6NA 3Q8WA 5K2MA 1UKEA 1CY8A 1T8YA 2IZ5A 2OOSA 2X8JB 2OYSA 4LJ9A 1EUCA 5AJHA 1JAIA 1WB9A 4GO1A 4FMPA 4HAVA 1SRQA 2FDCA 3PJDA 1W9MA 3OCYA 1ECFA 4FYKA 3UPTA 4LRSB 1PR9A 2OECA 1QLHA 4BVFA 3H0EA 3KWJA 1X38A 1B26A 4MQFB 1EVEA 4MVYA 3D2LA 2VT7A 1OLOA 4UHFA 3PT5A 4FOLA 1ZEMA 5D7NA 1RHJA 4GLBA 4NBUA 1S1MA 1L6RA 4Z4QA 2DPYA 4KPEC 3JAKA 1U9IA 3PIDA 1S2DA 1SVUA 1M34E 4RSGA 4CCSA 2OFOA 4PYLA 2WIKA 1V6CA 1VL0A 3DNFA 3IJ5A 4G67A 2I3BA 4BMCA 1QONA 1PKEA 3P0IA 2WSSD 5SICE 5U4QA 2O8FB 2WMDA 4DIEA 4FPXA 4K40A 5IK2A 3AR4A 5DP1A 4Z4CA 3IO3A 1ULAA 3AL2A 1SKQA 3FROA 5H68A 4BNWA 4ZCTA 4LF5B 3PC8A 2H2GA 4JCOA 4C14A 5BMOA 4MR7B 3EFEA 4AJ9A 1YZFA 3IP1A 4C0LA 5ED4A 4YHHB 1OF1A 2PXXA 4LW8A 4MV1A 3GYBA 1SY7A 1YVDA 2PTGA 2PQ2A 4HQFA 4R1LA 1R4ZA 2WJJA 2Y4OA 3AYZB 4Z2YA 4GZ3A 4KH0A 3B89A 1VBNA 4IUDS 4EAAA 2N42A 1BMTA 4EG3A 5CDHA 3L0BA 3SN6A 4IJQA 1M0TA 2FPPB 3GWGA 1GZHB 3AL3A 4KXNA 4WASA 4JI3B 2WQ6A 2FPUA 2ZJ4A 3H19A 1I33A 2OD9A 1EK1A 3EAFA 4ZALA 1COWA 1LQUA 2VBGA 3VR4A 1RXIA 1MG5A 4PAQA 2Y1GA 5DI9A 1IB6A 3ZU4A 5CA1F 4UM9B 3EVTA 4NCHA 1XELA 4CFYA 2X8BA 1NGSA 1F8FA 1RAHA 4JOBA 1WWKA 3B60A 3OZRA 3S1LA 5SZHB 1BHQ1 4LRXA 5CVVA 4ZAZA 3OHPA 3HJGA 1PFKA 2PH7A 3FETA 3GLHB 4X1IB 2IIPA 3U4QB 2NZYA 2Z6QA 3KKQA 1GG9A 1XXHA 3HH8A 4KH1A 4QGBA 4MJXA 2O8BA 2ECPA 1CFJA 2FMKA 4UNNA 4D6PA 5KMGA 2QE6A 4N7MA 5EWMA 1GV1A 4R9NA 3OC6A 4HSGA 3JYOA 3OWOA 4YEDA 3P2KA 4F3RA 5LDHA 1FL9A 3SYMA 4JLPA 3E9RA 4F11A 3QLVC 2BY4A 4DABA 1YE3A 1S8NA 3F1KA 2GXAA 2PGLA 1CWUA 3ZIAA 3PNPA 3I2YX 2QUAA 1TQ4A 5TVGA 3G8AA 4W5TA 4D4LA 5A6SA 1Y37A 1PX0A 1G8GA 4RPIA 3I32A 1N7IA 2NZXA 4RPKA 4MV0A 1PR6A 5AKYA 3BSSA 2C07A 5BR7A 4CQLB 4NF2A 2C3OA 1L7EA 4DQDA 5JSYA 1II8A 5T6BA 3WMFA 3FH0A 1N36B 4RH1A 1YDFA 2Y0CA 3AM3A 3HDQA 4UREA 3L7DA 3CF2A 1KJWA 4JGIA 4RSMA 4YV0A 5HIJA 1YZVA 3IMFA 3R7FA 2JCSA 2YWCA 3EVCA 5F1YA 3T7KA 1P7WA 4MHTA 5FUQA 4RJIA 1PD1A 3SR4A 3KYBA 1K66A 1HLGA 4RDIA 4U2DA 1RABA 5IWCA 1MVNA 1L8OA 1OWMA 4C4PA 3GFFA 4ZYXA 1JAZA 2FXIA 4UXJA 2X4DA 4DHEA 1Y4SA 4JLMA 4ER6A 1Q7EA 1YNOA 4ZP1A 4QG3A 4MW6A 4BNDB 5L51A 1XZKA 4R2KA 2Y0PA 3SM9A 4W5HA 1RBZA 1ZGBA 3HZRA 4OOFA 2FR1A 2RMKA 1WOYA 4BE9A 3SFVA 1UF9A 1LK5A 1NDQA 1Z4JA 2D0IA 2ZQZA 3ABQB 2LR0A 2JGIA 3L4BA 3IAXA 1DWOA 5A4AA 1W1IA 5DHRA 1NBOA 2UZAA 1L4MA 2WP0A 2V0GA 1PJQA 2EFGA 1E1YA 4Q9KA 4ARZB 1DKLA 4RDXA 1NKVA 2TECE 4N39A 2F1JA 2JCBA 4F9FA 3PB3A 5IG2A 4QEDA 4X8HA 2PXHA 2D5LA 3D5EA 5D7BA 5EXDA 5SY6A 5DASA 2WDZA 2I34A 1M1YB 3TW8A 3EIQA 3IDOA 3NC1C 4IIDA 2PA3A 1B76A 3UGKA 5E2BA 4Z99A 4OLBA 1NBEA 1JBQA 3GPDG 3CH5A 4EMTA 3GMDA 5EUBA 1ESZA 4YBZA 1GUAA 1Y9JA 4HWPA 1E3IA 4P08A 3SHVA 2N47A 4G5XA 5LDDC 3LUAA 4UU1A 3HA2A 3AEZA 2I0FA 3AINA 4R3UC 4F6CA 1U3DA 1QE3A 1CYEA 1VJTA 4ER7A 3F47A 1GTSA 2YN0A 2D74A 1W19A 4JBWA 3B6EA 3MT8A 1JQEA 3JRXA 3JRWA 4KVZA 3T95A 4A15A 3DVAA 1OTYA 1SB8A 2UUPA 2X8LA 1TJNA 4EY8A 2OGWA 1JEOA 2AOUA 4ZCRA 3B8HA 4JYZA 1JFSA 4Z53A 5F4BA 4DJTA 4IMPA 5COBA 3BIJA 1YBHA 4I1YA 4XM2A 3IJRA 3PWZA 3U80A 1JUDA 1WXIA 3D1JA 3NNNA 1IY2A 4FGWA 1SIOA 2QD5A 2L69A 1SG9A 1ZU4A 3W04A 5A5FA 3NIBA 4KFCA 1MC1A 4I9HA 1H2FA 1HLPA 4MKGA 4P31A 1EWKA 2F62A 4L9WA 4HTFA 3RROA 3THXA 5E9AA 3L6EA 1JEYA 5ALTA 2PKRA 1QS0A 5IJ0B 1MQ9A 2QIPA 4B4DA 5P8WA 5EIXA 4INAA 3PDUA 2ISCA 4FW9A 4HHEA 3KZNA 4F84A 1QDLB 4E2FA 1AO3A 1T6NA 1XD9A 3T0FA 1UZMA 2F43B 4P3PA 4MSUA 4ZYTA 5JADA 3IVXA 3FPLA 1T5DX 2Q1UA 4JYCA 1MKYA 4JUBA 1V8FA 3D0OA 4HJRA 5JAUA 1JPNA 3IVMA 2QEQA 1XEFA 4NV0A 4QL3A 2V7QA 2H4FA 4ND7A 4YRJA 3OWHA 5CEFA 2H17A 2OCBA 4XR4A 5DZSA 4CLRA 1K97A 2WLSA 1B0ZA 4XLZA 2IEYA 4YJFA 5IARA 2IX9A 2CXRA 1WKVA 3ROFA 5CA1B 2WLTA 3LKVA 2YWHA 3ILHA 5B1IA 3H97A 3K5PA 1PFWA 1DEHA 1EDZA 3HB0A 2P1DA 3TRDA 2PCLA 2YVUA 5A9RA 1NLFA 1THMA 3HU1A 3OZBA 4PPFA 4YLEA 5B3AA 4I7EA 4K05A 3LTEA 2UYCA 1RBQA 2AZMA 2QRPA 4S0ZA 3AXTA 3U4AA 3ASZA 3EGXB 4RPGA 1R74A 4ZEWA 3WLTA 4AZ0B 3VX4A 4NI5A 1EBUA 3GVCA 4BVGA 1E77A 1BDMA 5EPOA 1TUEA 2C2ZA 5J3JA 1C3VA 2IYNA 1A2BA 2NV2B 3FHCB 3BXFA 4TZTA 3WL7A 4EA7A 4HYTA 5U4XA 1KP9A 4FI3F 1GA1A 3P9NA 5C8VA 3OE1A 4PAOA 5BXQC 5EMMA 2XMBA 2R5FA 1NI4A 3IDSA 2B1IA 2CVOA 2V1XA 4JBNA 1U0NA 3RYTC 3JQGA 3TTWA 3TX2A 1LJUA 1VJRA 4QEZA 2HYIC 2CLHB 4QUBA 4S04A 3CKLA 3A6GA 3OCWA 2VJPA 1SBYA 1EVJA 2OCYC 2PS0A 1YHNA 1ZX1A 4KTTE 4LWZA 3TRKA 2X23A 1N8SA 4KFUA 4BMXA 2GWHA 3O31A 3DLAA 4XVHA 4B3IA 1E1CA 1FTWA 2XJ4A 4Q03A 3PEWA 3LHFA 3NDBB 3NTQA 4PTYA 5EA2A 3PKZA 1GNRA 1U5BB 3ELYA 3EUAA 4MUIA 1ZD8A 4UW9A 3X2SA 4YT4A 3U0VA 4BBPA 1XLUA 4E31A 3VNUA 3L8HA 2H4WA 4FYXA 3VTKA 3RU2A 1N34B 2CBXA 1GZUA 3TXXA 3CRQA 4PX5A 1OXUA 2AMLA 2P5YA 1IJEA 5K3OA 3UCXA 5A3VA 2Q7XA 1CZOA 3HN2A 4MVWA 3X1YA 1F12A 1PQPA 2N0SA 3RVOA 3KQLA 2V6BA 3HNOA 4EFNA 1SXGA 4BMNA 3OECA 1RSZA 1WF6A 3MCUA 5AHRA 1XA0A 1VKRA 1YRYE 2IY7A 1YB2A 4WY8A 4Z4FA 4Y2XA 3EULA 2VF5X 4LE2A 4EO7A 3X1JA 4EQZA 3NBUA 3QU9A 1SVNA 4RV5A 4EP1A 4I4TF 1ODSA 3IA2A 3WAGA 3FIUA 3JQ9A 3EA4A 2HA0A 2VSXA 4Q1AA 1N75A 3C3JA 4FCTA 4KVGA 1F4PA 3LL4A 1KOJA 1PV4A 3RU7A 2VBFA 1PLKA 4MVJI 4DLZA 2OCAA 3HXLA 5J4VA 3WKAA 5L4NA 1JT9A 1FFBA 2Z2IA 4GVLA 5L3RA 1H2WA 3VVMA 3ADBA 3TNLA 3FN4A 3HCAA 4UTNA 2EVWX 1VLZA 3O0TA 2JLVA 4KX3A 2XDYA 5JFTA 3OFNA 1EYZA 2BN4A 2QNRA 3MGAA 4I19A 3HCBA 2J9FA 3TM5A 3DE2X 2VH5R 2HMVA 2Q45A 4HADA 3RTGA 4BFXA 2PKWA 2Q9BA 1B0UA 2SKCA 3I5AA 3DJYA 3R3XA 4FGKA 4NTZA 5B5SA 1LI7A 4QOFA 5AI8A 5JD4A 3WNDA 1UJ6A 2DFLA 2XNHA 3NDPA 2LCIA 1PFYA 5CB4B 4M9CA 3GPBA 5K3SA 4L0MA 2BFCB 1E6MA 2WW8A 3O90A 3P2IA 4N12A 2HTFA 5DISB 5A4KA 4P4LA 2PMDA 5IYZA 3ZK9A 3EIHA 3FJ1A 4MVJM 5D51S 5LYYA 4AI6A 4JR0A 2R8ZA 3N2YA 1E0SA 4DJAA 3VA7A 3LKDA 4QICA 3SDZA 5F7OA 3AUUA 1FFCA 1WPXA 1OB2A 2CT8A 4HYYA 5I9NA 5LM3A 2AKAB 3BB1A 3M4ZA 2Q49A 4NX2A 3RFCA 3TLGB 5ESXA 3TLYA 1BU5A 2ZIXA 5G4LA 1FP1D 1X7ZA 3UJNA 3I0NA 1NXOA 1C9DB 4IDEA 4LV8B 4M89A 2J6IA 3D4OA 1BC5A 3LC7O 3OURA 1NMXA 4M22A 4AJIA 4FB5A 3KVRA 2IYYA 4IV5A 1DJMA 1UPAA 3R0JA 3HBNA 4O2AA 4MQBA 4YNBA 4XJTA 1T0PA 2Z5LA 1OW3B 1WDLA 4OJNA 1UWLA 2HBYA 5DGXA 1C30A 4HXYA 1O6GA 4RVOA 1F9EA 1KJ8A 2BCEA 3B3JA 3GJ3A 4TN5A 1C9YA 1RC0A 2Y9PB 2Y93A 4HGPA 5HJ7A 1V39A 4G09A 5CTJA 3T3DA 1H22A 3GLKA 1T4DA 1E4VA 3LX6A 1BJTA 1JR3E 1C3JA 1THTA 4MS4B 3UJDA 5IXJA 5JT1A 2XUAA 3DMDA 3OZAA 5CVJA 2ABWA 3PUWA 4JBGA 4Y2UA 1GLGA 2OVBA 1F8XA 2WJVA 3GUCA 4PLVA 4KLRA 3FVTA 4RH3A 1EJ0A 2JGLA 2IBSA 1KC1A 1E1RD 1TM2A 4IYRA 4JENA 2ZE5A 5SZJA 3U61B 1EFVB 2P5TB 5JTTA 3FA2A 2P3OA 4DLKA 3O4JA 4CL3A 2O5CA 1E3WA 3ITKA 1OUMA 3OA0A 4Y7DA 4RUKA 2QAGC 1KQNA 1EBFA 2I2WA 3OX3A 1HZZC 3FYUC 4ECEA 1EUQA 3MCWA 4FQ7A 2CDNA 4B85A 4KXVA 4RLFA 4TMVA 3FMGA 1KBQA 4GZLA 2D1YA 3C6XA 3NYQA 3SLKA 1HBJA 4BKOA 1W7AA 5CDGA 1JZSA 1RFGE 4LSMA 1EP2B 4HWOA 3Q9UA 4ZQCB 1SHLA 4FOSA 3ZDRA 3LC1O 3QYPA 3OHSX 3N0WA 4R4JA 1X7WA 3IDFA 4OYHA 4RLHA 1WZNA 5DGHA 2HL6A 3H11B 1Y9DA 1ZNYA 4IDQA 3ANYB 4MVCA 4EENA 4X8OA 2Y76A 4IF6A 4R8SA 3RC7A 4NR0A 3M9WA 5FTJA 1ZP6A 4JI6B 1Y1LA 1ZMXA 4KR9A 4IXWA 4X45A 3U48A 2ANBA 4FYYA 4CQJA 4EEXA 3HS3A 5ALGA 5GIPE 1YIAA 4RGQA 3AHIA 2IZOA 3LDGA 2HCJB 3T7AA 4AVYA 5JYDA 2ZJ5A 4QDOA 2H52A 3KXIA 1XTBA 2BBOA 4JEUA 4H4CA 2AEJA 1HV8A 2V3VA 3MBIA 5KYKA 3IEIA 3DYBA 4J4TA 3U9SA 3UT0A 4PZAA 3OPQA 2HH9A 1OIXA 2VJAA 1ZGAA 3JQFC 3MWDA 4DWVA 2XHEA 3ETEA 5KOHB 2ZCJA 2X4GA 4GZ6A 4B6SA 3S99A 1C4KA 3Q7PA 4DMGA 2V3WA 3BQ9A 1P44A 3CW9A 4PRZA 3AI7A 2PT5A 1NF2A 3PNBA 4FMDF 1YDEA 2W2TA 3A6KA 4B48A 4UXIA 2HU8A 3TKLA 4F8JA 4F2WA 1HNWB 2CUZA 3OT1B 1N8TA 2OV3A 3G0DA 2QU7A 4ZGWA 4V24A 2FB9A 5LB2A 3I64A 3KQMA 3A1CA 1WU7A 3V4PB 3VKUA 4AKIA 2VHZA 3SQLA 4IHQA 1B41A 1GQYA 1LI4A 3B53X 2NPOA 3L8CA 2BDEA 1YNSA 3B6MA 4AULA 5BN1A 3KXPA 3P52A 4JZKA 4L0CA 4N6NA 4HLNA 3AQ4A 1K1EA 3GP3A 5G53C 3DUFA 4J8PA 1BDHA 3Q8MA 3DW1X 5IVIA 5DLDA 2FFQA 3BD6A 2NQTA 4NMLA 1BXGA 4BNHA 1R6TA 5AUNB 5ILGA 4JI4B 3G2HA 4MARA 4OA8A 3R6TA 3WJ1A 4NMHA 3I01M 1PL7A 3RHFA 1L8AA 1CS0B 4CKEB 5FR2A 4ENVA 3IILA 3EOBI 5I7WA 4AY2A 4NJMB 1ZH4A 3BK1A 3N74A 4I3HA 1ORDA 4U00A 1U3GA 4I9NA 3NBXX 4PGFA 4Q18A 1F2VA 1QH1A 1GKIA 1O77A 3FGOA 3QM1A 4FP9A 3FCSB 4BXOA 3KLPX 1ZNQO 4LE1A 4F1JA 2YJ4A 2IYRA 4OI0A 2KX7A 1CY0A 1NNUA 1X1QA 4UASA 5T41A 1M2EA 3UHAA 1EK2A 4BBAA 2RG1A 3COYA 1N1EA 5JR3A 1TECE 2QP3A 4YIHA 1FP4B 2KM1A 2GH1A 5FPPA 1CQIA 4N8DA 5BNIA 1P2TA 1W2HA 3DWFA 3GOQA 1U1GA 5BYBA 1TAHA 3L6RA 4R9RA 5AM2A 4Z4GA 1IXZA 3TINA 3HYSA 1COZA 1WM1A 2CCJA 1GDDA 1H2BA 1E58A 2HSZA 3FYCA 1W49A 4HN4B 4BAGA 2VUIB 4QYSA 5IRCD 4JUIA 4PZUA 2WF6A 5I7RA 2IEZA 3IYLW 3QPBA 1JT2A 1ZVMA 2YASA 1K4MA 3DWIA 4I99A 5MN4A 1BE8A 3FLEA 1AHIA 3S2ZA 4MVJE 3VH4A 3L7LA 1NJGA 2Y6VA 3CX4A 2J3IA 3MCTA 5T5QA 4PBRA 5ARBA 4RHXA 2TRSB 3IR6A 4CU5A 2HV8A 1TVEA 1W96A 1NWHA 4KZPA 3I5YA 2XPCA 4UVGA 2ZYTX 4CUZA 2UVQA 1TGVA 4RIIA 1NASA 2PN1A 2YJGA 3EEBA 3L4SO 4RW0A 3O3OB 5AHKA 4ZI7F 3FWPA 4MQUA 1GL9B 2Q41A 1BMFD 4ZQBA 2PT6A 1GPYA 1M3SA 1CF9A 4UU8A 2H3EA 2C7VA 3C5HA 1U3UA 3DMRA 2Q21A 2R8EA 3H5WA 3KX2A 4MGIR 3MYRA 2OL4A 3QW2A 4PXSA 2H11A 1RPNA 4HR7A 4M87A 2VHWA 4EELA 821PA 5AVRA 4S0XA 3ZHBA 3I2KA 1RPAA 1G2OA 4ZVVA 1RACA 3JVIA 2AWNA 4DM7A 1HYQA 4Y1FA 2GTIA 2QUJA 3K6JA 4RY0A 2WD7A 2BKUA 1BDBA 3WRXC 4QU0A 3KZMA 4D74A 1SC9A 1ENYA 3D2AA 4JD5A 5BN4B 4WNAA 2DF8A 4X3CA 4ACBA 1GCIA 3PTLA 5HEKA 1MMFB 1V6AA 1R27A 2XYQA 3GJYA 3DFKA 2QUKA 4KR0A 1NPDA 4FUTA 1LPOA 3KFXA 3N8IA 1MAHA 3G13A 1M2NA 3AW8A 5LSAA 1P1KA 3LIPA 1Q1ZA 1SHKA 3AUYA 3G5TA 3GAMA 4QUJA 1AQNA 2FF5A 3GW8A 1KA9H 5CJ2A 5BSHA 1KOFA 1N6LA 2I3AA 3A1DA 1KKUA 3NGMA 3AVWA 2W9XA 4B46A 4O6VA 4V0SA 1GGHA 4CV1A 2WSSA 3B20A 5BQ3A 3G0GA 3RAJA 2C5BA 2IL1A 2IHUA 3E9EA 1A9ZA 3WKCA 1N2BA 2WA1A 4Q01A 4BMZA 4NBNA 4EA9A 1ZBQA 3WV5A 1RQNA 3LQRA 3U4IA 3DCYA 4MEBA 1EFTA 3EYAA