2A5FA

Cholera toxin a1 subunit bound to its substrate, nad+, and its human protein activator, arf6
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
162
structure length
162
Chain Sequence
KEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/transferase
molecule keywords ADP-ribosylation factor 6
publication title Structural basis for the activation of cholera toxin by human ARF6-GTP.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2a5fA00
1NLZA 4RKFA 2ZS7A 4EQ6A 1C9KA 5A0FA 1IN5A 4H1UA 3NWJA 3VKGA 1HEIA 2JLRA 5CDFA 4PC2A 4A36A 3H2YA 2XJ4A 3DOFA 4Q19A 3CNNA 4JLKA 3QVUA 5DO9A 4RZUA 3AGPA 4IOJA 2IUTA 4QBIA 3ZYCA 3E70C 5HE8A 1XRJA 1W49A 1JR6A 1O87A 3EG5A 3R7WA 1NY6A 3NTUA 1XXHA 1HH4A 4Z51A 2PZGA 1DAMA 3MWLA 4TYQA 1KO5A 3W8NA 1ESMA 2CNWD 1NIPA 3OF5A 4O0MA 4DJTA 3THXA 2EFEB 3TUJC 2ZVQX 2PJRA 1EFRA 3IKJA 4F92B 2QE7A 5GJWC 4ZDKA 1Q57A 3NEYA 3VR6A 4BFXA 2EFDB 1N6LA 5HCNA 4PSAA 4ERNA 2HF9A 621PA 1W36D 1AQUA 3OIYA 1RJ9A 2BMFA 1OXSC 3QIAA 4IOKA 3U3MA 1W5SA 4TT3D 4EJSC 5BW8A 1XCGB 2FG5A 2V1XA 4ZDJA 1TQ4A 4I1SA 5FL7D 2RGNC 1N5IA 4C0BA 4WW0A 5LD2C 2ERXA 1SVIA 4AD8A 2ZJOA 3U6BA 4A0HA 4BGDA 4HAZA 4DT1A 2QM8A 3KQUA 2ZUDA 2IS4A 1E2MA 5EE9A 1NKSA 2VIIA 2VP0A 4FMBB 4S2EA 1WBDA 1OXXK 1Z63A 3MSXA 5EUMA 2ZYTX 4C7OA 2OCPA 1MT0A 4M1KA 3FOZA 1BOFA 3N2EA 1WCV1 2PLFA 3AM1A 2VHJA 4R2HA 1P9RA 5AJVB 2QBYA 4Q7LA 4BE7B 4ZDIA 1UF9A 5JRJA 1S96A 2PLRA 2CVFA 4IVRA 1U2RA 2RHMA 3ND9A 4X8HA 2O8FB 4AC9A 4JYCA 4B71A 3FE2A 1OFTA 1YZNA 4DLWA 5D3MA 3FDIA 1CRQA 3FMPB 2HXSA 4NONA 4QGFA 3AVQA 4FMDB 1QHXA 5UKDA 4IHQA 3O8CA 5EP4A 1UBEA 3RS7A 4ZCLA 5JWHA 4NPHA 2JLVA 2BBTA 2GTPA 1GWNA 4B2LA 4YMVA 4JLAA 2OHFA 1G20E 4PO1A 4AK9A 1IN8A 1FP6A 2RAPA 1R0YA 4JVLA 2J1LA 3U7EB 1B23P 1Z0AA 4G5OA 4LJYA 1U0JA 3LVRE 4D4MA 4LJ5A 3WP1B 2HYDA 3LA6A 3SZRA 3MUFA 4RKEA 4PQRA 3CWQA 4UNPA 2DYKA 3TR0A 2XSZA 3VX3A 3ADCA 4KYUA 3EZ7A 3MFYA 2F3RA 3OAAA 2IS2A 2CVHA 1A7JA 4QC2A 4TTRA 2A5GA 4TLCA 1FFHA 5C4MA 2PJZA 1UM8A 3CF2A 2FNAA 1FUKA 5IHPA 1NNEA 3RRZA 3ICEA 5FTMA 1MABB 4B74A 1P2VA 4IEEA 4JZKA 2V9PA 4OQMA 3UMSA 4BFUA 4O2LA 2Q0HA 1IQPA 5EXSA 2VP5A 1M7GA 1N5KA 3UG7A 3OEHA 1MRNA 4MYHA 4HB4A 1XDBA 2P6RA 4B48A 3NDBB 1KSHA 1GOTA 2WWXA 4L5BA 3CX7A 2WJHA 4LYFA 1EWQA 4A15A 4MH0R 1UPTA 3ZZUA 1MO5A 1M7BA 2KB0A 2ONJA 3I3SR 1Q21A 3GJ6A 1CULC 3BH6A 3GEEA 3TUZC 4HAUA 2B6HA 2ZI4A 3KQKA 2CDNA 1II8B 3GLIE 4ABYA 3WYGA 4XTRA 3OFND 1FZQA 2WJJA 4NHOA 4LHYA 1UEJA 4NBSA 1T0HB 3V9PA 5GVSA 4MKGA 5FPHA 5SZIA 3PV0A 4HSEA 1VKJA 3WNCA 1P75A 1HURA 2OUKA 2P2LA 3Q85A 1KO1A 3SYLA 5DHAA 3N70A 5EJEA 2BKEA 4TL9A 2ZI5A 4KHZA 2ZUCA 4UQOA 5E7JA 2GXSA 3GJ0A 3P26A 1Z6GA 1PUIA 4Q9IA 2OBNA 1OW3B 1T5LA 4DB4A 3Q5EA 1OIXA 2AR7A 4U5XA 4XH9B 1J7KA 3JZAA 5CB8A 3Q3JB 1XCMA 3NHAA 4TL8A 1KKMA 3C16C 4B35A 2FN4A 2QP9X 5BN5A 2ATVA 1LF5A 1G5PA 4RD3A 4OKSA 2J0UA 4TQUS 4XWKA 3FMIA 2ZRKA 3MWJA 4BFTA 5FTJA 1LF0A 2ZRCA 1T5IA 1JNYA 4WOPA 5CB6A 1QRAA 3LVQE 4JSTA 2BDTA 4XVUA 1E1RA 4US1R 2LCFA 3DM5A 3U4QB 2YNMA 2J59A 1P61B 5J4LA 1NVVR 2ZAOA 4QOSA 1VIAA 3ADDA 1FW6A 2RGCA 2WSMA 5CIQA 3SI7A 2RGDA 2R6FA 3VX4A 2OAP1 2WWIA 1OFHA 4QFMA 2ZS9A 1A5TA 1KDOA 4YXWD 1W36B 3WYAA 2F1RA 2V3CC 2Y8EA 4TQ9A 1KAGA 3AUYA 4D4KA 3ETLA 5L3QB 1GSIA 2VHTA 3RS2A 3PJRA 1COWD 1U98A 4N1AA 1Z2AA 2BHRA 2ZRNA 3IQXA 4KVAA 1MO3A 1D2NA 5K8LA 1G291 3CM0A 3IGFA 3M1IA 1N2CE 1Z22A 2QP3A 4GI7A 3I8SA 4XWAA 1Q1ZA 1GITA 2KBEA 3A4NA 1S0UA 4TLDA 1OT3A 4WAUA 2X2EA 1WQ1R 4CGZA 1TX4B 5FL3A 1F6BA 1R6BX 5A5GA 1CR1A 2J7KA 2YYZA 4KITB 1JJ7A 3LX5A 4G3XA 2V1UA 4HI0E 3BFVA 4Q9HA 5KUTA 2JLWA 3JVVA 2J7PD 1MKYA 4XIGS 3I8XA 1KSJA 1KNXA 2NTYC 2G9NA 1DAEA 1YZKA 1VCIA 3WXMA 3TR5A 5GVRA 5C1BA 2R8RA 1Y63A 4HDCA 2Q21A 4POAA 5BN4A 2XX3A 1E9DA 2Z83A 4PSVA 4UJ5A 3GLGE 5B2ZA 421PA 2VQSA 2EQBA 2WTUA 2FSFA 2C9YA 2QE7D 2NGRA 4C0KA 3A4LA 1KI2A 1KI6A 2BBSA 3TSZA 5FPSA 3QG1A 1V43A 2YJTD 3NKVA 4JYBA 1NVUQ 1YR6A 2IS1A 1VMAA 1G18A 4QXAA 4XD7D 5HKKD 3W8RA 3QQ5A 4JLDA 2BWJA 4Q1CA 2ZI6A 1IM2A 3ZVMA 4DCUA 3VR2A 3O8DA 1N3BA 1E94E 2XJ9A 1WA5A 2EFHB 1KY3A 1NIJA 4JLMA 2BCJQ 4EDHA 2RGBA 1G5TA 3X1YA 4CEIB 2H7VA 3S1AA 1OXTA 3K0EA 2FGKA 2GESA 4PC3A 3IHLA 2JGNA 5JCPA 1FTNA 2YHSA 3J81k 1US8B 2N46A 3R20A 2HT6A 3B5JA 2D62A 2GJ8A 4OK6A 2EYQA 2QENA 4D6PA 2AWOA 2X2FA 5J4VA 2WBLC 2ZJYA 1AKEA 4Q21A 2IYQA 4P33A 4EJSB 5CLQA 2WZQA 4ESVA 2PT5A 5JS8A 721PA 4M2LA 2FSGA 1IHUA 4D4LA 4AYTA 1M34E 3DMNA 3L43A 4PR0A 3K0FB 5AJYA 2OILA 4XVRA 2VF7A 4RZXA 4F7WA 5LD2B 2D7DA 1VYVA 3KKQA 2VP4A 3NBFA 3BC1A 5KHOC 2ZJZA 3LLMA 4OI0A 4E5UA 2L0XA 1IY2A 1A2BA 1YZLA 3PVSA 4KVGA 2YVUA 5FBLB 4FMCF 4A0FA 3CR7A 4DVGA 3GPLA 1RKBA 1AK2A 1X6VA 1MABA 5FFMA 4E09A 1NVVQ 3UG6A 1H65A 1TNDA 1H8HD 2F1IA 3BB1A 1Z2CA 3CF0A 4OI4A 1E2EA 1DBSA 1N25A 2K5UA 4L9WA 5EP2A 5HCIA 2VP2A 4U02A 5G53C 4L16A 5SZJA 3A1SA 3TNFA 1EK0A 2X8AA 3TSWA 3DM9B 4E03A 3K0SA 4NCHA 2XTZA 2P3SA 3P20A 3ZQJA 1XD8A 4DLRA 2NO0A 4P4UA 3CRVA 1JPJA 3BORA 4JT2A 2IXEA 4JLBA 4LX0A 5CK4A 4BFWA 3PUXA 3KKOA 2A2ZA 3G0HA 1RZ3A 1E2QA 1ZM2A 1E0AA 2ODEA 1YZGA 4MA4A 2Q3MA 2ZAMA 2O8EA 2FA9A 1KMQA 2YZ2A 1LV7A 4XWOA 1P60A 2QAGC 3LQRA 3KJEA 5KYKA 4D0GA 3RRYA 2IYYA 3BIFA 4X8LA 3MD0A 3QXCA 1HQYE 3QXSA 3OEHD 3EC1A 5AUPB 1P6XA 1W0KD 3H84A 4G5SA 2YOHA 1XTIA 1JQLB 3TAHA 1OXUA 2JA1A 1E2HA 2QM7A 2JLQA 4FIDA 1IY1A 2WMOB 5E95A 5CDFE 4TMTA 1U81A 3IPXA 1TQ6A 4R71A 2A5FA 1JR3A 4DLVA 2GJSA 1F48A 1WF3A 2CXXA 3MJHA 4XTCS 2Z43A 5KSOA 2WV9A 3L0PA 2IK8A 3K9GA 1DAIA 1Z8FA 1YRBA 2FPLA 3KXKA 5AJXA 1OHHA 1SVMA 3GJ8A 3I61A 3QPUA 5HTKA 1W4BA 1XXHE 4FN5A 1Z0KA 3DEFA 2GCOA 1VG0B 4JIMA 4DCVA 4OBEA 6Q21A 4NU0A 1OFUX 3QXHA 2NO7A 1DVRA 3HR8A 3CX8A 4V0OA 1E2JA 3FVQA 1KIMA 4Q9KA 3RVBA 3VNUA 1CJVC 4NMMA 3IIJA 5ELXA 1OYWA 1PZNA 3PEUA 1UFQA 4ON9A 1LS6A 4IVPA 3EAQA 3AVXA 1ZD8A 3QUSA 1JI0A 1E0SA 2RGEA 3BJIC 4OQXA 3SFZA 1Z08A 4DLXA 2GZAA 4QHYA 4RCZA 4DSNA 5GJBA 1OLOA 1GL7A 4B73A 5BN3A 2XXAA 4OHYA 5AUQA 3WRYC 3OE7D 4KBGA 4Z1MA 3ZD7A 1VYTA 2YV5A 2BM0A 4Q4AB 4R98A 3NDPA 1TL7C 4BLRA 5F98A 3PQCA 5J5CA 2WWYA 1FMLA 4OQNA 2AK2A 4B2IA 1RYFA 1S2MA 1W47A 1TMKA 3PITA 4V0LA 4PC6A 4F91B 2BJVA 3HYTA 1TU4A 2V54A 2XNDD 1E32A 1GZSA 2PH1A 1A4RA 3QKUA 2ZPTX 2WSSD 2G77B 1E98A 1K5DA 1IBRA 4Z8XA 3TIFA 3RANA 3P1JA 1IAQA 4WBSA 2DHRA 1KK0A 5CITA 3T35A 4WZAE 1FQKA 3CIOA 3AP3A 4LSGA 3T15A 3VR4A 3LAWA 5BXQC 1W2HA 3LW8A 3U3JA 4QJ5A 3ZLJA 2HF8A 1AKYA 3NVAA 5EE3A 4OQFA 3QE0A 1M2OB 4TYNA 1KMHA 2AD1A 4KSBA 2O8DB 2IW3A 3QKSA 5CK5A 3TUIC 4DLTA 3QJYA 2GVDC 4G5QA 4LHXA 3TQFA 3ZGXA 4DEYA 1YR9A 2WKQA 3F0TA 3RNLA 2WJYA 1ZNWA 4LV8B 3EPLA 3FKSA 1KY2A 4TMXA 2IEYA 1FX0B 5FH9A 4Y0VA 4C4PA 4UXIA 3W6PA 2PCLA 2X19A 3I5XA 3FGNA 1G3MA 2VBCA 2P0EA 3CLVA 4Q1DA 2DCUA 4JL8A 2H18A 1M7HA 4DKXA 3TKLA 2J41A 5JS7A 3REGA 4W9MC 1Z83A 5BQ5A 1AZTA 3KQLA 4MDEA 2X1VA 1S9HA 2FF7A 3GP8A 4BLQA 1JAHA 2CMKA 2YWHA 2ZQ5A 4MGKR 3TMKA 4ZKDA 1EGAA 3EZFA 3MG9A 3VU9B 1E1QA 4P4TA 5H70A 4G5RA 1SVLA 4QNMA 1G9XA 1VIYA 3CPEA 3PG5A 5TB5A 1Q44A 1XTSA 4TMWA 1T9HA 1QHHB 3UATA 1VHTA 3TBKA 5H68A 1ZYUA 4R2IA 2FPMA 4ZI2A 2O5VA 2ORVA 2FDCA 5AUOB 1PJRA 1DAFA 4DSOA 4TQAA 1KKLA 2ZETA 1CJUC 3B1VA 4TLBA 4M1OA 4C0LA 5JHHB 3R8FA 1EESA 5JI3E 4RD4A 5JJIA 3CX6A 3K0AA 2BV3A 5FBRB 4KYIB 5KNCA 2N42A 1BIFA 2ZRFA 3ZJYA 4CYMA 4M9ZA 4MGZR 5J4HA 2OEPA 3NBXX 1XJCA 3WNBA 3RHFA 3H86A 1UADA 4NCJA 2ZRMA 3P4XA 2QU8A 4NYIR 1G4AE 2ZXUA 4M1YA 1KNQA 1MV5A 1UBFA 3L0OA 4RJLA 2IWRA 4EPRA 4KO8A 2CJWB 2HCJB 3U3OA 2GJAA 2PL3A 5DYGA 4C9BA 2FV8A 2PEZA 5JHGB 5C18A 1JQJC 4F4IA 3EIQA 3I1FA 3OIUA 3CBQA 4EAQA 1W5TA 3NC1C 1GM5A 1T3LA 4OK5A 3B1XA 3WNDA 2HJVA 2HXYA 3ADBA 3I73A 5JFGA 1F2UB 1LTQA 3MLEA 3SQXA 5DSZA 4KV9A 1XPUA 4EUNA 1VG1A 2Q6TA 5ANRB 3A1VA 4YDHB 4BLPA 1DG3A 2MMCA 1KOFA 1S1CA 1T91A 4DIEA 2BBOA 2ODNA 1LB1B 2BM1A 2OV2A 1J99A 2C96A 1A82A 2PZEA 1H8EA 2IUUA 1N6RA 2XZOA 4LPSA 3DL0A 5J40A 3EPKA 4BWYA 1J8YF 3GLFB 3BFXA 2ZYUX 4HLQB 1MO4A 4YMUA 1IXSB 1XNJA 1IN6A 1FL9A 4DDWA 5CYPA 1N0UA 1OKKD 1XP8A 2FGJA 4YLGA 2CCGA 4IDHA 1D9ZA 4BLTA 3GFPA 1NN3A 3LXXA 5TARA 2O0HA 2Z0MA 4YDSA 4DIDA 1ZNYA 1Z6TA 2XZPA 5L3RA 1D2MA 5KDOA 1JEDA 5LB2A 1JPNA 4ASUA 1E9BA 4JVSB 1ESNA 5DI9A 3W3AA 2O8BB 4DDUA 1GRQA 1SXJD 4DSUA 3CZQA 3X2SA 3HU3A 4QG7A 2DB3A 4Q02A 3U3KA 2ZE5A 1G7CA 4FW9A 1KSFX 4M0LA 4C2TA 5DN6D 3M0EA 4I81A 4BLOA 1F2TB 4BFSA 2AFIE 2IEZA 3CRQA 2RCNA 2ZUBA 5C46F 1XEXA 4B6EA 4CEHB 4A82A 4P31A 2OFWA 4CT5A 1AZSC 2FJUA 2EU8A 1ODFA 4HDOB 5FPYA 2R2AA 3GLHA 1IXZA 3CR8A 4K46A 2GAOA 4P32A 1LVGA 2WIBA 3EIHA 1K6MA 1E2IA 3EXAA 2XITA 4BUJA 2FOLA 2J3EA 1G3QA 1T8UA 3VAAA 3QEOA 1OHHD 4DB2A 5F2EA 2IYZA 3BRWD 1CP2A 2QAGB 5EZ5A 1W2GA 4OJKA 2UZ3A 1X86B 2V4ZA 1UKVY 4ZPXA 1HA3A 2ZU0C 4C2UA 2C99A 1EG7A 3FFAA 2AK3A 3AKYA 2F43A 4Q5IA 4C3ZA 821PA 5DE3A 3LV8A 3NBYC 2V55B 2RGXA 4BRWA 4IEIA 4TSFD 1WE2A 1GRNA 4XSGA 2UKDA 1ZM7A 1V5WA 3BWDD 1FP7A 4ITRC 3B6EA 4W5WA 5F9HA 2G1KA 4LZZA 1CKEA 2RGAA 1XPOA 4NYIQ 3R9IA 3E5HA 1IOZA 3P32A 4M1WA 2GBLC 5JJKA 2UVQA 1LW7A 2YWFA 1EX6A 1NBMA 4JVMA 2O8DA 1GNRA 4V0KA 2VTKA 2XGJA 3TH5A 4HLUC 1FOEB 2REXB 1ZIPA 3DKPA 4IVQA 4Q4HA 3CW2A 1JXMA 1QDEA 2ZRPA 2FEOA 3LO5A 3IO5A 4X8MA 1Z6YA 2A5JA 4BECA 4FWIB 4HB3A 4OQLA 3ZIAA 3ZS8A 3SJAA 2ZI3A 1G7SA 2HV8A 2ASEA 3OESA 1N6HA 5TVKA 2WJVA 1AGRA 5FUVA 1NL3A 3U44B 3MRSA 4L4UA 1Q22A 1IN4A 3FB4A 1S1MA 2MSCB 2WAXA 3RSOA 3IEVA 2ZRIA 2G1JA 1Q3HA 2O52A 4PTLA 1EFCA 3D8BA 3OZXA 1Q12A 2JLSA 2XTMA 3MWKA 4L9SA 4US0R 1ZU5A 1R4AA 2GF0A 2BC9A 3EWSA 4K81B 4UNQA 1TPZA 3IBYA 4JS0A 4NP6A 3QXXA 2H1LA 2QNRA 1KZGB 5EXPA 3VKWA 3FKSD 5L3SB 1X8LA 2BEKA 4FXPA 5FBWB 3MGCA 5GADl 3Q5DA 3ZD6A 3K0CA 4N0EA 3KXLA 4F38A 1R2QA 2KE5A 3KUDA 5B30A 2H5EA 3GFOA 2IT1A 4FD2A 2VF8A 3NC0C 1XD2B 2IHYA 1PLLA 2QA5A 4PPFA 1WDTA 4DLUA 4YMSA 3RWMB 2ZIAA 1CU1A 3B2EA 4PZYA 2F9LA 5H1YA 1NLYA 2HDNB 2BKUA 2DY1A 2QTFA 3LDAA 3KJIA 2NZJA 2VEDA 1K8RA 2FFBA 1FPMA 4AYWA 2OXCA 4I99A 3PENA 5E4FA 1JJVA 1SKYE 3WYFA 3RRMA 1OJLA 3MJRA 4HZUA 4V03A 4KLNA 3SN6A 1W4RA 4M9QA 1YR7A 2DFLA 3CB4A 3K9LA 2D74A 3K09A 3SOPA 1N6IA 1TUEA 3HJNA 2GEUA 4AI6A 5DGXA 5FUXA 1SXJE 4WXPA 4B3XA 2JCSA 5KO2A 2ZITA 1EXMA 4AY2A 121PA 1BYUA 4Y0AA 4D82A 3LWNA 4RZ2A 3UMFA 4KCGA 5D3QA 3THWB 1XTRA 2P6UA 4OHVA 2LKDA 3FTQA 3L2OB 4RVCA 1UJ2A 1E2NA 3FHOA 3TGPA 3TLXA 1ZMXA 4V0ME 4HUQB 1D2EA 1LFDB 3KDSE 3SHFA 4IJMA 1JR3E 5DI3A 4A4DA 3RAPR 2N1BA 3KJGA 3QXJA 1W7AA 4ILEA 5FUWA 3BH0A 5FTKA 3OIVA 2QTHA 2W6JD 2GJ9A 1ZINA 5JZVA 1RC8A 1P3JA 5H8WA 1Z6AA 2G83A 3K53A 1RRPA 2EW1A 4KFUA 4LJ6A 3PUVA 3GQBA 4D81A 1W48A 3L0SA 3KTAA 2KI5A 3H0KA 1RW4A 2O0KA 4PZZA 1AA9A 1AJEA 4NCNA 2A30A 4RZ3A 3DZ8A 2GNOA 4HEJA 5AUNB 2WHXA 2ZANA 2O8CB 4NH0A 4LBWA 1GNPA 1R5BA 1T4GA 2P5TB 1T3HA 2ODBA 5EE0A 1ZU4A 3CO5A 1E69A 2QORA 3QI2A 3IIKA 2GKSA 4PFSA 3GLIB 4AKHA 2C98A 3AKCA 2FFQA 2D7CA 1ZIOA 2NO6A 1E3MA 1ZBDA 1U9IC 1H8ED 1XEWX 4V0NA 2G6BA 4AURA 2ZJ5A 4UKDA 3G82C 1CEEA 4LBYA 3AVPA 1XPRA 4OHXA 3B7GA 1XB2A 2C5LA 4ZCMA 1JB1A 2JJ2A 1P7CA 1VTKA 3F5FA 1XJQA 4OHWA 3T34A 3OIWA 1QHYA 4DBLC 4GL2A 4O25A 3LLUA 5B57C 5CYOA 1XX6A 3SS8A 4BPBA 2GILA 3B13B 4X8OA 1NN5A 2NIPA 2OG2A 3HU1A 1FQJA 3GEHA 1E9AA 1OIWA 1Z0IA 4M4SA 3PEYA 2MSEB 3AF0A 3L82B 3AVTA 3LY5A 4P0TA 2HEIA 5C2JB 1ZRHA 2FU5C 4FWTA 3SJZA 1OF1A 2QAGA 4HDQB 5L8VA 2F9MA 1W0JA 2A5YB 4MQBA 1A2KC 1GL6A 2JEOA 2C9CA 3OEEA 1E9CA 3V00A 1DAKA 2QSYA 3RDPA 5FPTA 2Q9CA 4GZMA 2OAQ1 1HE8B 1F60A 1XD9A 2IX3A 2FSIA 2FZLA 4Q9JA 2ZSDA 3X1ZA 1GTVA 5IF9A 4TTPA 5AJZA 1UDXA 1G17A 3EIEA 3VR3A 3C5CA 1SZPA 2QP4A 4NTZA 4IW3B 4YMTA 3IQWA 4ZI3A 1S3GA 1EFRD 5CM8B 2ZSBA 3QBVA 1IXRC 5E7MA 1N6NA 1XMJA 2VHQA 4JLOA 4C0HA 5J4KA 4MYCA 4MKIA 3EX7C 1WB9A 1Q0UA 2BMDA 1ONBA 3KQHA 4HLCA 2C9OA 4HAWA 3AVYA 1HUQA 1ZAKA 3Q7QA 4AG6A 5TV2A 4FCVA 4JSYA 1OFIA 3JVUA 2DR3A 3KZ1E 3BXZA 4FMCB 4ARZB 2XTNA 2PZFA 1GVNB 2O8FA 2KSQA 1Z0DA 1P2SA 4OI2A 4A6PA 3GCGA 1P2TA 1VCNA 3W5IA 5AK0A 1KZ7B 2AXPA 2CL0X 1NMZA 1Z28A 4DUGA 1GIAA 1NBMD 2ERYA 3A1WA 5EUQB 5JLJA 3BK7A 2B7CA 1VCMA 3TSOA 3GLGB 1RRCA 3W5JA 1GDDA 3WP0A 3ZS9A 1W44A 4CT4B 3U3RA 1NRJB 2CCKA 1HE1C 1TAGA 3CNOA 2CK3A 1E2DA 1KGDA 4KODA 5IK2A 2ODWA 2GK7A 1ANKA 4Q1BA 2VSOA 1DTSA 3P27A 2QT0A 4BZPA 4ACAA 1Q1EA 3EA5A 1SHZA 2GETA 2FWRA 3IIMA 4JBYA 4BASA 1Z06A 5JWRA 4KI0A 1S3SA 4M1MA 4PSKA 1SVOA 4B47A 1E2PA 1VDZA 5JBQA 2ZU6A 2WPDA 1NVWQ 3GFTA 4Q7KA 3RSLA 1KYIA 4QKQA 1W4CA 1P9NA 2CHQA 5J47A 3NBZC 3UWKA 3HPQA 1NLFA 1BO6A 1VECA 1ZD9A 4PPQA 4URUR 3QENA 4LPKA 2Q3HA 4MKFA 1ZC4A 1UKYA 4B44A 2QMHA 2GK6A 3LBHA 1U90A 3SHWA 2XOKA 3KJHA 4PHGA 1GKUB 2WWHA 2ZRBA 4FI3C 5DYIA 3BS4A 1W46A 2OLJA 3U7HB 4A6XA 1G19A 3EZ9A 2XSZD 2ZI9A 5JSZB 2REBA 2FPKA 2WJIA 1TEXA 3OAAD 1R0ZA 2FEMA 3NIBA 5C4GB 4H1VA 2IYSA 4BEJA 3FFBA 1E99A 2BBWA 2VL7A 4MRSA 3HP1A 5LB4A 3CPJB 5BYJA 1I4DD 2ZE6A 1KHTA 4GOJA 1R0WA 1RIFA 2R6GA 2J0SA 1HT2E 5A4JA 1II8A 3KKMA 1NVXQ 1S8FA 2ORIA 1Z47A 3AF4A 2CL6X 3KB1A 3SQWA 4HAVA 3VNVA 5TXGA 1IY0A 1G41A 2CHGA 4TLEA 2F3TA 3AF1A 4BEBA 4QJ3A 3AQ4A 3T06B 1NSFA 2V8OA 4OHZA 2ZI7A 2JLYA 1AS3A 3TAUA 2P5SA 4CIDA 3THYB 2X77A 1ZNXA 4HAYA 1N6OA 2J0VA 4R7ZA 2FE4A 2RGGA 4PAMA 1QHGA 1XZPA 4EFNA 3IILA 3W6OA 3KQNA 4GOKA 5AR1A 2HYIC 1A1VA 1S9DA 4OYHA 3KFXA 2MSDB 2GXAA 2PCJA 1P72A 2HUPA 2Z4RA 4CEJB 1GP2A 4RCYA 1TQ2A 1DADA 3GLHE 2J87A 2O8CA 4IXNA 3ZVLA 1KJYA 2W0SA 1XEFA 4AWXA 3Q7PA 3RLFA 2IUSA 1XU4A 2QT1A 2YWEA 3GLIA 3CPHA 5G40A 4DCTA 1SULA 3U4QA 4Q4JB 2CNWA 4TMZA 4HATA 5KDLA 1G3IA 4KBFA 2H16A 4EQ6B 4E07A 5J4YA 3ZZ0A 5EXTA 1SHKA 2OM2A 1E6CA 2UZIR 3W6NA 1NMYA 4GRAA 2OCBA 1OB2A 3SYNA 3SR0A 4GSYA 4R9UC 1G21E 4PZLA 2Q9AA 4KAXA 1KK2A 5L3QA 4AKIA 1CIPA 2CLCX 4RFSB 1IONA 1UDWA 1YZUA 3R7WB 2VYFA 1XXHB 3QKTA 1L7VC 5DLQC 2CLSA 1E1RD 1RYHA 4II7A 521PA 4B6FA 5FL7A 1ZUHA 4A8JC 1NBME 2XEXA 3A1TA 1TU3A 4B3CA 3NH6A 4IOMA 3I92A 1ZVQA 1KK1A 2HJGA 1TQDA 4A0GA 2VP6A 4FINA 1HQCA 1KK3A 1VHLA 1QVRA 2EYUA 3BH7A 3LH5A 1ZCAA 1D8TA 1RJ9B 4M1TA 3SBEA 5FI1B 3QNUA 3ONWA 2WMNB 4NYJR 2NPIA 1XMSA 1ETUA 2IHBA 4IDOA 1XMVA 4Q01A 1PUJA 2NO9A 3VHXA 1UBCA 2E9SA 2R6DA 1L4UA 4Q48A 2ZRDA 4TL7A 1OH7A 3K8YA 2FSHA 1E0JA 1J70A 2YKGA 1TF2A 1G5RA 1NN1A 4WZ6A 1W0JD 4DT1B 1KI4A 3B60A 3OEED 4ZV4A 2GVZC 2EWVA 2ZJAA 4A2PA 3AEZA 3QF4B 4QBHA 4AIIA 2VHUA 2W0MA 3TJZA 1QVAA 5JCZA 4C7OB 4GMDA 3K9HA 5HR5A 3W34A 3BB4A 4E22A 3AF3A 3TK1A 2PMDA 4OJQA 3KUCA 1I4LD 2RH5A 4A9AA 2NOAA 2ZRHA 1TUIA 1HY3A 3I72A 4ACBA 2AKYA 2JDIA 4ARZA 1CJKC 2GF9A 4TL6A 4QBFA 2QBYB 4G5GA 4B3BA 1EWRA 3RYTC 3QOFA 2BEJA 4IXMA 4CEIA 2YINC 2D2EA 2LKCA 5D3MB 2W2TA 1NKTA 4MITA 2IWHA 4A2QA 4B34A 4IFEA 4JKIA 5DISB 2PX0A 2GCPA 1US8A 2OO7A 3LX8A 4IDPA 2WJGA 3SE0A 4N0DA 1CR2A 3H1TA 2ECKA 3A8TA 1SXJC 3BAFA 1XF9A 2BOVA 2ZRJA 4EJSA 5FBVB 1KI8A 4GMXA 3FMFA 3UPUA 4C0QC 4JMPA 2XB4A 4W5JA 1BYIA 4CW7A 2RGNA 3K0FA 4JVNA 3PCRB 5K8UA 2V6IA 4AYXA 1QG4A 5KOYA 2OFXA 1KO8A 4GBMA 2C77A 2P67A 1T6NA 3K70C 5CM9C 1DS6A 1DARA 3CH4B 2B21A 3SU8A 2ZRLA 4K8OA 3T12A 2ZREA 2W00A 1Q3TA 4FCWA 4PANA 2W2XA 2F7SA 3HYRA 4PAQA 2IA5A 2V6JA 3SC3A 2FH5B 3EASA 4EPVA 2R6CA 3B9PA 3DOEA 1EFUA 3BOSA 3CH5A 2IC5A 1XCPA 3OFNA 3SEAA 1XMIA 2FZ4A 3T1VA 3WMGA 4TZ0A 3HR7A 1IJEA 4EPXA 2EFGA 3QKRB 4B75A 4NYMR 4URZR 3AVUA 1SQ5A 3N5CA 3BERA 1D9XA 5EE5B 1U8YA 1M8PA 2JIZA 1G16A 2WPDD 3UWOA 3VMFA 3FHCB 5IT5A 2ZM5A 1OIVA 3SBDA 2G0NA 2Q9BA 4CDGA 1HV8A 2GXUA 3C4JA 3LNCA 2IYLD 2RHDA 3VQTA 2V7QA 5HZHA 4A2WA 1ZCBA 1TTTA 1R7RA 3THOA 3B8HA 3DMDA 4NYJQ 2XB2A 3B78A 4GT1A 1ZM3A 2ZYVX 1R10A 2EVWX 8OHMA 1QHNA 3X1DA 1G8FA 2VLIA 4RFVA 1FMJA 1NF3A 3AH8A 2H57A 3JZMA 4HB2A 3BE4A 4PPNA 1EFHA 5BWMA 3MAAC 2JJ8A 3KFVA 4PC7A 5JEDA 4LK2A 2IYTA 5FUYA 1N0VC 1E2LA 1G8GA 1ZW6A 4KFRA 5SZKB 3EC2A 4BFZA 5HPYB 3SFVA 4U00A 1J90A 3OHMA 4YXWA 1AS0A 2IBMA 2J0UB 3V4FA 1AM4D 1AQYA 4DC9A 3U5ZB 3EPHA 3R9WA 1XTQA 2A3RA 1II0A 4XVQA 4H9GA 1COWA 1CXZA 1ZJ6A 3CRW1 4Q7MB 3CONA 1FNMA 1KSGA 3K70D 1DPFA 5M04A 2Z5FA 1N5JA 1I2DA 1N6PA 1JR3D 1OH8A 4NCKA 2QGZA 4S35A 5HE9A 2C95A 4Q4AA 3PUYA 4CVNA 1CF4A 4O2RA 1G3UA 2VSXA 2DFNA 1EX7A 2AFHE 3FYHA 4N3NA 1CR0A 1EFTA 1G7TA 4JJZA 4RFSA 2J7PA 3BD9A 1U99A 3AVVA 4KXFB 1MRSA 1E9RA 3LRPA 3A37A 2QAJA 3HDTA 2CEAA 5KPJA 3NXSA 4UXJA 2WOJA 1HTWA 4MYUA 5P21A 2OXRA 3EZ2A 4B32A 3I5YA 4Z1MD 4JBWA 3IPYA 4CRWB 1GAJA 2IF2A 5KSZA 4Q7JB 3A1UA 3GEIA 4MRNA 2ANCA 1E2FA 4XD7A 5HKKA 3BGWA 4L15A 1QHSA 4GDFA 3B82A 1CBUA 2CE2X 4RD0A 3NEJA 4M21A 2JAQA 2QRNA 1U9IA 1FX0A 1G6OA 1GFIA 2VO1A 4DHEA 3T61A 1JBKA 2WKRA 3RS3A 5LBIA 2A5DA 4B3GA 2YOGA 1FNNA 1VCOA 3QF4A 3TW4A 1AS2A 1QG2A 4NYMQ 1G8YA 1KI6B 1R8QA 3N2IA 2Z6VA 1CRPA 4URWR 1Q1BA 1XJ0A 3LBNA 5GJVC 1OYYA 5CJPA 4IKEA 4M9SA 4US2R 3AF2A 4PQFA 5E3HA 3VU9A 2JLUA 3LBIA 2ZS8A 5JRZA 1HT1E 2HT1A 3O8RA 4BFVA 3M6AA 3X1WA 4A8JB 1KAOA 1QHHA 1DO0A 2JASA 3RC3A 3C15C 2VP9A 4CZ2A 1GUAA 4MUBA 1YE8A 4HB0A 4NE2A 2B92A 3S1AB 4D80A 4BRUA 3G5UA 2VPPA 4DLYA 5B58C 1UKZA 5KNBA 1BKDR 2FX3A 4JKYA 2JLZA 4NDZA 1H8HA 1ZD1A 4URXR 4PO9A 1TEVA 4V02A 5EP1A 1E1QD 2JDID 2VA8A 4Q66C 1ZUIA 2ZROA 2ZSFA 4IRUB 3K1JA 1SVKA 2P6NA 1ZP6A 4PQYA 4HLDA 1CTQA 1L2TA 4Q1AA 1JALA 2ZTSA 4EFMA 1YKSA 2CL7X 3GJ5A 2WM9B 3L8ZA 4C0JA 4WA7A 1VG8A 2CJWA 4B2PA 1WRBA 1KO7A 4QHSA 2W58A 4I1VA 4TYPA 3U7FB 1G64A 4M22A 3UMRA 2J9RA 3KX2A 1NJFA 4QM6A 3A6PC 4I4LA 2CE7A 2JJ1A 2VHCA 4WVFA 5JMTA 1RVDA 2KWIA 1QZXA 2B8WA 3DVLA 4JLPA 1UKEA 4LYAA 1VPLA 3AVWA 1F2UA 3LW7A 4HAXA 3T5GA 4FMDF 2DWOA 4JL6A 3UANA 4F4CA 1W0KA 3QBTA 3KKNA 2RKOA 3C8UA 3QKRA 3VHLB 4DLSA 1PV4A 1NN0A 2QEQA 1QHIA 3QPVA 1I4TD 4PHFA 1SKYB 2DWPA 1OE0A 4RD6A 2BVNA 2IXFA 2D06A 2OBLA 2QL6A 5FOWA 221PA 4OI1A 4EPWA 4DDVA 2R44A 3AKDA 3PR1A 4LV6A 4BQSA 3W90A 3U2QA 3H4MA 2O8EB 1MR3F 1N5LA 1SXJB 3T1TA 3GLFA 3W3ZB 1P5ZB 1CJTC 3NH9A 1M74A 1W4AA 2KBFA 2QUZA 2C78A 3SJCA 1SKQA 2GEDA 2PBRA 2FFHA 4TLAA 5FR2A 5GJCA 4YC7A 3DKVA 5JEEA 5K8IA 2YC4C 3GJ3A 4MGYR 1R0XA 1KI9A 1OB5A 5KPDA 5G41A 2C04A 2ZR9A 3GMTA 2ANBA 3K70B 3B1WA 3GD7A 3EZ6A 4AG5A 2OZEA 3KL4A 5EQTA 3UK6A 3CRRA 4LHZA 3SDZA 1AIPA 1Q20A 2JIZD 2OESA 2YOFA 3AUXA 3EWAA 2HLDA 2QRZA 4BLSA 2O8BA 1YQTA 4J0QA 3TRFA 2QPTA 4I1UA 3QG5A 5KU1A 4C0AC 2QMEA 1Z07A 3OE7A 2VSFA 3AKEA 1KO4A 4ZKEA 3O8BA 4JJKA 1NJGA 2GCOB 2W6IA 1GL9B 4LV5B 1F2TA 2V7QD 1DAHA 4FCTA 5DHFA 4MKHA 1OH6A 2J0QA 1ELOA 4HUTA 3U61B 3WBJA 3MWYW 4QL3A 2REOA 2XNDA 4JLJA 1PVOA 4CEHA 1ZM9A 1U0HC 4WIAA 4IDNA 4PHTA 4URYR 2LWIA 1O3YA 3EARA 4P4SB 1CR4A 2WSSA 1DO2A 2D2FA 1FTSA 2GA8A 3Q72A 5B64A 4ASUD 3CUEF 3C5HA 1E2GA 2E1RA 4LBVA 4DSTA 2GXQA 3HU2A 2XXAB 5TDHA 3ZQ6A 4LBZA 4TWZA 3A36A 4WXRA 3MCAA 1E9FA 1X3SA 2GRJA 5AJWA 5G3ZA 3P4YA 2QPOA 1ZC3A 4LCBA 3D7MA 2CHVA 1P4SA 1G1MA 1PLJA 2XZLA 3QEJA 3SYKA 3DZDA 3TE6A 2AD5A 3VFDA 3BBPA 2PEYA 1SGWA 1T3SA 4UNRA 4MDFA 2ZVPX 1DG1G 2AXNA 2YWGA 1GRRA 2IYRA 3X1XA 1WP9A 3B85A 3K0CC 5JJLA 2XAUA 4G1UC 4MGIR 1C4OA 1KI1A 5KNDA 4LC0A 3RS0A 2RMKA 5EZ6B 2NPFA 2FFAA 1XWIA 4LRWA 2F1HA 2G3YA 1T8TA 3ASYA 3VR1A 4D4JA 2A78A 2QMOA 1KMHB 1NP6A 5EXXA 2TMKA 2WWWA 2ZRGA 5FTNA 3QSYA 2AL7A 3QKSB 3FHTA 2QPAA 5K8TA 1N6KA 2ONKA 1RRGA 5FOUA 4ZDWA 4Q03A 1AN0A 2QTVB 3FPAA 2ZJ2A 2AHOA 5TY0A 3K09C 2IS6A 2WOOA 4QJ4A 5F3WB 4KLZA 3U44A 2IYUA 2WAYA 3D6TB 1F5NA 2QN6A 3T5DA 2D3WA 1R5OA 1G8HA 2J5XA 4ZIRA 2OFOA 2J46A 4W5HA 3L8YA 3PUWA 3I4LA 2GWHA 4B76A 3F8TA 2IYVA 3BFKA 1BMFA 2GZHA 1MOZA 1QBKC 2QSZA 5FOXA 3WHLA 2QY9A 5LPNA 2W2VA 2QZ4A 1OSNA 4IOLA 2DFTA 1ZM4A 2ZE7A 3ZIAD 1M6NA 1B0UA 4A8JA 5L3SA 2VRWA 3PIRA 4LC1A 2ZSEA 4A0RA 1Z0FA 2PX3A 4B3FX 5DNYB 3D31A 1VYUA 4Q00A 1HYQA 4PO8A 2GCNA 4OL0A 5JI2E 1RPZA 4BFYA 1GKIA 1XD2A 4KSCA 2NG1A 4MRRA 4LJ8A 2F1JA 4LOAA 1GILA 2W83A 3LD9A 3WHKA 3Q9LA 4TZ6A 4U7DA 1BH2A 4KJZA 1E9EA 1N0WA 1RE0A 1E2KA 2D4HA 4LJ4A 3VR5A 3C7KA 3CF6R 3QF7A 1E79A 4QGHA 3L0IB 4NL4H 4Z54A 2OCAA 3KXIA 3K0AB 3QPWA 1JAIA 2WWGA 2AX4A 3DPUA 3I32A 2OBMA 1KJZA 1G7RA 1T0JB 5E7IA 1W1WA 3CZPA 4DCNA 1YHNA 4UJ3A 5FPKA 5IRCD 1U0LA 3WBKA 3TQCA 3WY9A 5KDDA 4KFSA 4MUAA 3M4YA 2QGNA 4YONB 3UXMA 3EA0A 1J2JA 2WVJA 1RRFA 2AKAB 4NCIA 3MMPA 4QGAA 2JLXA 4RY2A 4M53A 1GKYA 1OXVA 2ZE8A 3ND8A 5FR1A 2GZDA 1DE0A 4G0NA 3THWA 3LXRA 5HZKA 4DDTA 1S4QA 1GG2A 3FKQA 1IN7A 4MRVA 5FBQB 1U8ZA 4HUQA 1OKKA 4PPGA 1E96A 1E4YA 2QQEA 1Z0JA 5KTYA 3F3YA 4XJXA 2BCGY 2Q3FA 1Z5ZA 4TMKA 5JECA 4D25A 1TADA 4M1SA 4EPTA 4LI0A 1Z6XA 2GAAA 4LWZA 3RS4A 2QQ0A 2ZR0A 1XTKA 2KJQA 4B3DA 1JECA 1SXJA 3LQQA 2JJ1D 2C2HA 1II9A 2RB4A 3CNLA 4LHWA 4C30A 3T1QA 2I3BA 2YC2C 4MYTA 2IL1A 2EWWA 3EW9A 4OK3A 3Q8XB 1DELA 3B1ZA 5DN6A 1KDPA 3IEUA 5CJ2A 2C03A 4L8GA 2QI9C 4C0SA 1E4VA 2ZJBA 4Q4LA 5EE1A 4D0LB 1L4YA 4W7SA 4IDQA 4XOIA 4LHVA 1CJMA 4GP6A 4V0MA 5FOSA 1YVDA 1X8JA 3GJXC 2IYWA 4TYWA 5KSPA 4F4JA 1LS1A 4UNSA 3A4MA 2NZ8A 3AP1A 1CS4C 2BMEA 3B9QA 2B7BA 4WZBE 4XSHA 4DEXA 3PEVA 1Z3IX 2A7QA 1SVSA 2H92A 3PEWA 4DXAA 1L8QA 1YU9A 1UAAA 2QROA 4HYYA 5SZHB 3VTKA 3WMFA 4LYJA 1DAGA 1OPXA 4GNKA 3V4RA 5L3VA 2NMVA 2QG6A 4TT3A 4Q47A 4TSFA 4P4SA 1KDRA 1XEXB 3IHWA 2H17A 2WWFA 4UNNA 3ZVRA 3QY0A 5DH9A 3GLHB 2WIAA 2HLDD 2IXGA 4GPTA 4ESHA 2ZRAA 2OLKA 1R5NA 2BIFA 3LFUA 2NO1A 2C8VA 3E1SA 1P62B 3RC8A 4DCSA 3THXB 5DIFA 4GZLA 2R62A 4F93B 4GOXA 2G0TA 2W6ID 5JWOA 3R9XA 4Q18A 4ZIRB 3VKHA 3BB3A 2JJ2D 1F3OA 4A1FA 3IUYA 3KKPA 3KB2A 3TVDA 4EPYA 1NI3A 2F43B 1KI7A 1IJFA 2CCJA 3ADKA 1OH5A 2ZJ8A 2OCYC 3RS5A 1WXQA 1YJ5A 3CKLA 4TMVA 2AWNA 3ASZA 3SNHA 5KSYA 2ZSAA 1X1SA 4LJ9A 2QMUA 1Q1QA 3FWYA 2CBZA 1GNQA 3ZH9B 4DLZA 1KTVA 2P65A 3DDCA 1TF5A 4Q1EA 3WMEA 2NQ2C 1G4UR 4TN1A 4M9XA 2F55A 4LJAA 4PHHA 4Q4HB 4D0NA 2DWQA 3AVOA 3U7GA 1FUUA 3PUZA 1KJWA 4UXHA 1XEWY 1CLUA 1JXOA 1E9SA 4IFBA 1XZQA 2ATXA 3NHBA 4I1OA 3REFA 3AGQA 5CLLA 3RRNA 4B43A 4BZQA 1KDTA 4PAOA 1R8SA 1DEKA 3UKDA 2ZR7A 4NZYA 2DBYA 4Z8YA 4D26A 1U8AA 3CRMA 1JEEA 1P9WA 4YQFA 4AKEA 3GLGA 4LDJA 5BYKA 1D5CA 4EIWA 2SHKA 2H8KA 5TMPA 4Q1FA 4G01B 3UIEA 2IF0A 1K5GA 4PC1A 4TYYA 2PT7A 2WICA 4RSGA 2R9VA 2I1VB 3HWSA 3U60B 1X1RA 3K9NA 4O3MA 1BS1A 3D3QA 4PXAA 5AWFC 4EFLA 2J45A 3ZVNA 1G8PA 4P3YA 4RD1A 1I2MA 5LDDC 1G6HA 4URVR 4ZCIA 4KFTA 1M1YE 2WKPA 2GBLA 1XBTA 4PX9A 1Y3AA 4DUGD 1NMXA 2GEVA 2R65A 3GJ7A 4KU4A 3AB3A 1BMFD 1OV4A 4HLUA 3PXGA 1U94A 4M8NE 4TTQA 1ZUNB 4NKRA 1LY1A 3CWZA 1WMSA 1YR8A 5IDVA 3EPJA 1QF9A 4DZZA 1ZNZA 2DPXA 2OSBA 3RWOA 2O0JA 4JT4A 4HZUB 2CK3D 1YRAA 4AKGA 2BJWA 1VG9B 5IK2D 4HZIA 3TW8B 1YZTA 3U6KA 1NG1A 3C41J 2GHIA 3ZZTA 1P73A 2GDJA 4CF7A 5FI0B 3AP2A 1NY5A 3PFIA 1Z29A 2GJKA 3NG1A 4LYHA 5JSZA 2Z4SA 1XFAA 2W6JA 3IBGA 5EP3A 2EFCB 3GLFE 2I4IA 2R6AA 4LY6A 4A92A 4JL5A 3HPRA 4JLNA 1SVWA 2PMKA 1D6JA 4LUCA 4GFDA 2DFKB 1UBGA 3DHWC 2MMGA 1E79D 3E2IA 2HCBA 4QGGA 4BZXA 3FMOB 3DO6A 4LJ7A 1W36C 2G88A 2JATA 4EKDA 2B8TA 2CLDX 2XOKD 5FOTA 2ZYWX 5DI3B 3SJBA 1C1YA 3B1YA 4B33A 4RD2A 3QVVA 3IDQA 3AV0B 3O47A 3T1OA 4LGMA 4QHTA 5G3YA 3THYA 1P2UA 2VH5R 4QBGB 1KI3A 4YMWA 3I62A 1G3RA 1LNZA 1UEIA 4GP7A 1MH1A 4QRHA 3GJ4A 2ORWA 3ZDQA 4MRPA 3WRXC 5F9FA 1J8MF 3W9YA 4DWJA 3TVTA 5CIWA 1NSTA 3KTAB 1TF7A 2I1QA 3IO3A 2F6RA 1MO6A 2FMXA 5FOVA 1PLKA 2BMJA 3ECCA 2OE2A 4ZO4A 3R8CA 4CEJA 1NG9A 3A58B 3C14C 1RFLA 1YZQA 2ZEJA 4JBXA 4QM7A 1AGPA 2AN9A 1WBBA 2A9KA 3ICQB 2OT3B 1XTJA 4Q9LA 2XNSA 4D2IA 1DOAA 1X8KA 4JLVA 4DRZA 3RABA 4Q4JA 2E87A 5FTLA 2IYXA 1E0KA 4QNRA
chains in the Genus database with same CATH superfamily
1NLZA 2YMLA 2D5CA 3OCUA 4Q9DA 4BMSA 2DY0A 1C9KA 1PW7A 1ML3A 4FFSA 5A0FA 1RNLA 4MV8A 5I4CA 1OLUB 3KQVA 2VPIA 4MAMA 5ITZB 5B1EA 2G09A 1HEIA 4JT9A 5AOBA 5J2TB 4CKCB 2WIDA 1KE1A 4XB6B 3DOFA 3EXEB 4RVSA 5F23A 4GBJA 4JLKA 3QVUA 3H1EA 5CURA 5I48A 2YZ7A 5IX8A 2JCBA 1VHDA 1MAAA 2ATEA 2Y1FA 3L6BA 3ZYCA 3TKAA 3E70C 1ZL2A 5ARDA 4B87A 1JR6A 3ZWAA 5IC5A 2PZGA 1DAMA 2YFHA 2XBLA 5KWEA 3DHEA 4WXEA 2CNWD 4I5EA 3WKCA 2QZPA 4YRFA 1E3EA 3A9CA 3G5MA 4ZQGA 4B82A 4DJTA 2C2BA 3RUEA 2ZVQX 2CMHA 2NVOA 4NBRA 3IKJA 3IVCA 4F92B 2QE7A 1VSBA 1Z39A 3RYFB 4QU5A 1W59A 4UD2A 3FYCA 2EFDB 5ENZA 4ERNA 2Y05A 5KOJA 2H1OA 2NSJA 1DXOA 1J8VA 1FRFS 3ZU6A 4DM3A 1VGRA 3INTA 621PA 4Z4GA 2I9PA 3CW9A 2CEKA 4IOKA 3BGOS 4JUBA 4CXMA 2C84A 3U3MA 2GK3A 4NJEB 1Q11A 1R88A 3RFFA 1B8UA 1I4EB 1NQ5A 4QREA 1PQPA 4DOMA 4N01A 4HRAA 3FCUB 4YCNA 2XADA 3PSHA 3SKYA 4BQNA 1VE9A 1LCIA 4C4AA 4DS3A 4DILA 4FDTA 5EVCA 1Q83A 5FL7D 3OLWA 3RVJA 2WF5A 1N5IA 2POQX 1V71A 4J2OA 2ERXA 1SVIA 3QLVA 3RYIA 3L7YA 2V03A 5C1DA 3RS8A 3WISA 5JOQA 3DW1X 3EF1A 3F3KA 5K3OA 2ZBRA 1CD5A 5K8VA 1LPPA 3U81A 3KQUA 2IS4A 4DANA 1NKSA 2VYVA 1FS5A 3D0RA 2VP0A 4FMBB 4ZV7A 4CMIB 3N0XA 1Z63A 2G04A 1FFDA 4ZAZA 4C7OA 5AHXA 2EHDA 4WCFA 3IOBA 2O2DA 5KOHA 2JPDA 1BOFA 3AR6A 3JQGA 3OCJA 1J07A 3MBOA 5FIUA 5TGTA 4R2HA 2JI6A 5DBEX 3S2IA 5AJVB 1REQB 5F5LA 4P2GA 4Q7LA 4ZDIA 1R66A 2HH9A 3KSRA 3WMRA 1FDRA 2YN4A 2PLRA 5K0NA 3I9OA 4YY3B 2NXEA 3W79A 1AOXA 1GT91 3QI7A 3VH2A 1LTHR 3KFLA 3PFWO 4B71A 1KL7A 1YZNA 4AAYA 2I6GA 3T7CA 3FROA 2WIKA 1L5ZA 3D8SA 4NONA 3DDZX 4PVCA 5LXTB 1TGYA 5EP4A 3RS7A 4ZCLA 1DOHA 2A5LA 5JWHA 1UK6A 1NXTA 4R41A 1H9CA 4CU2A 3UA4A 2PU7A 3JARB 2EKQA 5JBNA 3HACA 3P45A 4PR3A 5JSKA 2XT6A 1IN8A 4YCDA 1FP6A 3SZUA 4C4RA 1U0RA 4EABA 1PSWA 3DAFA 3OQPA 3QYPA 2FE1A 4LTNA 4CL0A 1WKVA 4JVLA 4YR9A 1Z0AA 1W6RA 2Q8PA 4LJYA 4KIGA 1NT4A 1U0JA 5ALFA 4LDQA 4D4MA 4RK7A 4YMHA 3UJAA 2NUPA 1D4AA 1L4NA 4RKEA 3WGHA 1EQ2A 2XSZA 4R1PA 4H15A 4YA6A 4BNMA 3CUKA 4Y18A 4CTOA 1PFUA 1MBZA 2VUHB 3GLTA 4QC2A 4ZMBA 3VI3B 4KIFA 1XYGA 3ANTA 1FFHA 2J07A 3QUCA 2VQ6A 4KIUA 4R8SA 5C4MA 1U9YA 4WKNA 3RRJA 4U2DA 1TYZA 4PLFA 5CLGA 4AJ1A 4ZICA 2PUAA 1NNEA 3RRZA 3DTNA 4O33A 2OPBA 2P2YA 1MB3A 5FTMA 1A8QA 4DGSA 1E7RA 1VLZA 1UZMA 4PGGA 1P2VA 4B74A 4JZKA 1KQGA 2CF5A 2I0FA 4OQMA 3UMSA 3WLRA 4EF5A 4JBNA 2Q0HA 1LJLA 3DH0A 2O2ZA 1YQQA 5EXSA 4L57A 2J5QA 1V45E 2HNKA 1N5KA 3F49S 3FUVA 3FPBA 4MYHA 1MRNA 2GI4A 4NCXA 1XDBA 3BWMA 3KYCA 4KXNA 1JHYA 2WWXA 1XL0A 4COOA 4N6GA 4NMHA 3STTA 3CX7A 3ONFA 4NNJA 1SUEA 3QVMA 1JNXX 1TRKA 3L4BC 3L7AA 3Q7EA 4K8RB 4CIBA 1MB0A 4AZVA 4XD2A 4BJ1A 4A15A 1YB4A 5T67A 1K7CA 3R5KA 1YE3A 4I5GA 4QOEA 4TGLA 5LQJA 5L7TA 4P08A 3KUUA 4XQ0A 1Y6GA 1YL6A 2RARA 1W96A 4PZUA 3GEEA 1V5FA 3R7SA 1SMKA 3OU2A 1RM5A 4PSUA 2CDNA 1INLA 4OGWA 5F4ZA 2I71A 2SCUB 5K0BA 3WAGA 4IG4A 3S68A 3VGPA 4NHOA 4CIWA 1UEJA 4NBSA 5L4SA 2WDPA 4HADA 3PI6A 4H77A 1R9JA 5SZIA 2PO7A 4JEIA 4X45A 1FA9A 1OZ0A 1UFOA 4A5SA 1X1CA 5GTDA 2ONYA 5ALMA 1HURA 1CIJA 3SYLA 3GIDA 5DHAA 5E8RA 3FVRA 3GRVA 4KHZA 1K9SA 3WG9A 3IRUA 1SHJA 3A2MA 5IBCA 2ODTX 3P26A 1JW9B 2P8JA 3OMWA 1XU7A 4MO9A 2OQIA 3MERA 3DL2A 3EQ2A 2ZJ7A 2E48A 4XH9B 1EUCB 4TL8A 3NHAA 1JHRA 4TS4A 1KKMA 1NSYA 3C16C 3EYWA 4D5GA 4WEOA 3R0ZA 4ZRNA 4N5HX 3EXFA 4G9GA 5DWQA 1G5PA 1C7QA 5DGHA 4E33A 4FGWA 4FXOA 3L8FA 1VP3A 1IM5A 1XNRB 3WZMA 4U3JA 3A4TA 3PR2B 3CLHA 3TTUA 4BFTA 3E5MA 1LF0A 2GNAA 1T5IA 1BAPA 2RI0A 3STWA 1NI5A 1DHTA 1QRAA 5A3QA 4JSTA 4JCCA 5AW4A 4AJ2A 4EGSA 4XDZA 5AHKA 3PFNA 4FWBA 1EFKA 1Z56C 4KO2S 2J59A 3VOBA 3E7DA 3IHTA 4LF4B 2HPVA 4F86A 1CJBA 1QYCA 3GLQA 1NVVR 1U3TA 1HC7A 2HADA 5HW0A 1DC4A 3F9RA 1U1GA 2EDCA 1N5DA 4HPXB 3SI7A 5CIQA 3RTGA 2O2IA 4AL4A 4C6TA 4F5EA 2ZZMA 2WWIA 4QFMA 1SIUA 2FX2A 2ZS9A 3H8WA 3HEMA 1W36B 1ZN8A 1QG6A 1QRRA 3ORYA 4ER6A 3UK7A 2PMCA 3ZBPA 4G2TA 1WG8A 2DG2A 5L3ZA 3HVHA 3L07A 4RPHA 4TPKA 1COWD 3OD5A 4F5ZA 1PX2A 2W6NA 2ZRNA 4JEHA 3IQXA 4KVAA 5CBPA 1D2NA 1K6XA 5LYYA 5C8YF 5GM2A 1X42A 4EKGA 5LQKA 5HJ5A 1RWWA 3IGFA 3M1IA 3LC7O 3QPCA 4UARA 1BMTA 1Z22A 3IMCA 1H9BA 1GCIA 4GI7A 5JQGB 2ZT8A 2JCYA 4BMNA 2VXBA 4NEGA 1OT3A 1K0FA 2X2EA 4E70A 2EBFX 2V97A 2I7CA 1E9VA 3PDHA 5FL3A 2P9HA 2AB0A 4J0CA 1CR1A 3KQPA 2X7HA 4TV8B 1FVHA 3DMFA 4KGDA 1GZ5A 4KR6A 4IUBS 4HI0E 3OQVA 4H3SA 3EXIB 1WZEA 2ZUVA 3LUFA 5E2IA 4P5DA 1NUHA 4LMAA 5JCOA 4BCCA 3AV3A 3JYHA 1E7SA 5F64A 1DHRA 2DKFA 3S2GA 5F1KA 1KSJA 3O93A 1KNXA 5E1DA 4G5XA 4RQTA 2VHXA 4YJFA 5KKCA 1VCIA 2Q4TA 3OETA 3TR5A 3WXMA 4YRZA 1ZXBA 3B3GA 1GPWB 4MEAA 2XR1A 4QAQA 3VHXB 1KQFA 2Q21A 4G0XA 4G5HA 4GZ6A 4NZOA 4PLCA 4POAA 5BN4A 5JJKA 1USUA 4PSVA 4ARSA 1H4SA 2ISSD 1ZOOA 1RCFA 2Q1SA 1LBEA 1IWOA 2O7SA 4DDHA 1P3Y1 5ARCA 2QE7D 2NGRA 2ZSJA 1XF1A 1QK4A 1KI6A 1OI3A 3DA8A 3MAGA 1ULBA 5BT9A 4F2PA 2OSVA 5EQDA 3G9ZA 3AUKA 4QGBA 1X0VA 5D85A 1ZJ4A 5EKDA 4BO5A 4LZNA 4A1OA 3HCRA 1VMAA 3G49A 3RGWS 3N86A 1H85A 1NZFA 4XD7D 3VDRA 3T7RA 4D41A 1OBCA 1RMTA 1QLWA 1REQA 2WT8A 1B6GA 1EX9A 5DULA 4Q1CA 5LIRA 3FTNA 2YFKA 4BQPA 2E4AA 4MS1B 3ZVMA 4AULA 1UBRS 1NYQA 4MUXA 3GN2A 4CTJA 1N3BA 4JHXA 2WTMA 2XJ9A 3DVRX 4EUFA 1WA5A 2H0RA 3TRHA 1QS0B 2D1RA 3D3NA 1Y1QA 1NONA 4ZAYA 4AP9A 1G5TA 4JEMA 4KRGA 2H7VA 4J9VA 3RE1A 3BMNB 3S1AA 1A5BB 2HDHA 3BSYA 3K0EA 3ZZ1A 2AX3A 3G2QA 1KVRA 4PS0A 1FTNA 1GHTA 1MC8A 1WY5A 3D4OA 3GG9A 4WFKA 5BUCA 1VE5A 1YJAA 3R20A 2HT6A 2H0AA 5DBHX 2FMIA 3BTOA 4ES6A 2OCXA 2JIQA 2QENA 3QW2A 1Z4OA 2ZJYA 4Q21A 4V2IA 1ND5A 1QBGA 4EJSB 2OZKA 3HKDA 5CLQA 2WZQA 4YAJA 2FEPA 1CVIA 4D42A 4K9OA 4UTOA 2ZB3A 3EXG2 3ACBA 3DV2A 1ZPDA 4AYTA 2PS9A 4YCCA 4IL5A 3ZEAA 4PR0A 1IPEA 2IVZA 2NM0A 4JJGA 2OILA 5LD2B 2D7DA 2CNDA 4OQZA 4GPBA 4K1LA 1VYVA 2LW7A 3E84A 3H2SA 2VP4A 3MMXA 5JNWA 3K71B 4F3TA 5KHOC 4FYJA 4NMWA 3OEYA 4DCNA 1RQNA 4X1YB 1KXZA 1JFFA 5FT9A 4FLMA 1TTHA 3V6MA 2W4QA 1JFSA 2NTJA 3HDYA 1A2BA 1IZZA 3PVSA 3R5TA 4KVGA 3UK0A 3CVVA 2GASA 5BW6B 3Q8MA 2HWXA 1AK2A 5CG2A 1X6VA 3JVEA 5FFMA 2GCIA 4GGMX 3WOHA 2C5AA 5I7RA 5F1PA 3EQ6A 2YHAA 3PNPA 1DBSA 5HCIA 1SIBE 4ODIA 3EA4A 3HVKA 4M8SA 5TEVA 3T8YA 1EK0A 1HE5A 4D4HA 4GQIA 1C2YA 2HQOA 4ZQIA 4IIGA 4W5RA 3FBGA 3E7FA 1G38A 4NCHA 2YL2A 2PRJA 4Y2QA 5PNTA 4DLRA 5IXSA 2NO0A 4P4UA 3V2IA 1L3BA 3HABA 1YQXA 2E2WA 3PQDA 3DTVD 1LPBB 3BORA 4E4RA 5C0OE 1GZDA 2Y3IA 4BFWA 1NW6A 2G6TA 3UCEA 2AOUB 5B53A 1EM8A 2O8EA 3GGDA 2FA9A 1KMQA 3FDXA 1IDOA 4KE9A 1V5EA 2QAIA 2M2IA 5ALZA 3LTEA 3NW9A 4P36A 4QPZA 3C5EA 3RNOA 3LQRA 4ZGBA 3EH1A 4W9NA 4Z3DA 3HEBA 1E1LA 1PE0A 3RRYA 3SE7A 1XQWA 4P35A 1YAJA 2HHAA 3WA6A 1YT5A 4MWTA 3AHGA 3WWYA 1W0KD 2FK7A 1QGDA 3H84A 2RAVA 3DEHA 1EDBA 4FOLA 1XTIA 4QQFA 1KBOA 2QRKA 4ZD6A 1IM8A 1PNRA 2JLQA 3JSXA 5IUNC 2WMOB 5E95A 4ZCRA 2PX6A 2NAFA 4P84A 1YGYA 2Q8NA 1J06A 1P17A 1ISJA 3DV0A 1CB0A 1SC4A 1JR3A 3M6UA 1SAYA 3H7IA 4HEA1 2GJSA 1F48A 3FZGA 4R84A 3BFPA 4XTCS 5DK4A 5KSOA 1BE1A 2WV9A 2IK8A 3L0PA 4K26A 3X44A 3I64A 3H1AA 4LRYA 2RB5A 1OHHA 1JG7A 1E20A 4GR4A 4BE9A 3H9CA 5HTKA 5EKTA 1K86A 3CQ9A 3R3VA 4PYIA 2EP7A 4ZRMA 3W5UA 2WFAA 4DCVA 1RFGE 3QXHA 3SSOA 3G8DA 1GJRA 4LEIA 4PICA 4EBBA 3FRHA 2O3QA 5SICE 3BDIA 4EZIA 2FWIA 2XZTA 2Q1YA 1KIMA 3FVQA 3I5MA 3RVBA 2VRCA 3UO8B 3U31A 3OECA 3KZXA 1AGNA 2Q0QA 5ELXA 3TN7A 1XPJA 3PEUA 3RBAA 1N5OX 1LS6A 5T4HA 2LDXA 4IVPA 2X1HA 2XAAA 5KTSA 2VPZA 2WUWE 3UUFA 3LL4A 3QUSA 4X20A 1JI0A 3DMRA 2AVDA 2H48A 2RGEA 3BJIC 1L1FA 4OQXA 3RU7A 3H5AA 1Z08A 2B5VA 2HM7A 5GJBA 2E82A 2Q29A 1OLOA 3LYLA 3L0BA 3IQGX 4XXHA 4YAGA 2XXAA 3OE7D 2E6KA 1Q17A 1O77A 2CHEA 4YN3A 4EJ6A 2BGMA 2BM0A 2YW2A 3H8JA 5BQFA 5IAOA 3WQQA 4JB8A 2G76A 2JVIA 2YVKA 4IIFA 4OQNA 1N1DA 3Q41A 5JAUA 5G0WA 4JR2A 3O03A 3JWJA 1M5RA 5EVJA 3PITA 3T9EA 4V0LA 4F91B 2C61A 2PAAA 2XNDD 2BTOA 1EX1A 1A4RA 2H2AA 3SLGA 2G80A 2V65A 1DC5A 2VPTA 1T5BA 3H6KA 2APJA 2G77B 1K5DA 3RUHA 1IBRA 3TIFA 4XQCA 3NOOA 2DHRA 4KN6A 1QIIA 4NAVA 4WBSA 3JQRA 4WZAE 1JG6A 1DCFA 3AP3A 3LFTA 4KG7A 4Z49A 4C08A 3LW8A 1K3TA 4TV9A 2HF8A 3DJFA 3UJCA 4EFDA 2CHFA 4F5DA 1J1ZA 2K7ZA 3HP7A 3EN0A 4JJ4A 4OQFA 2CUZA 5JCXA 2BSQA 4YRCA 1FNCA 4BMDA 1Y89A 4CKYA 3MUEA 3EGDB 1A96A 3TUIC 3JQ9A 3MJFA 4LQCA 4QAJA 5FP0A 4DLTA 2HIMA 1PTKA 4G5QA 5C3MA 3RAGA 3WSVA 3FYDA 5JSHA 4C29A 4Y6RA 3K96A 3RNLA 2NAPA 4YAOA 3MOGA 2Z2YA 1AK1A 1ZNWA 4OXYA 3EPLA 2D3TA 4LOHA 5DYTA 1YOBA 1E1CA 1Z33A 2FHPA 2IEYA 4TX1A 3RVQA 3MTIA 5FH9A 2SICE 2XV1A 3PRYA 3I76A 4REMA 3IUPA 1GYQA 3BCSA 1HL7A 4MV9A 1Y8RA 4Z9XA 3O7MA 1M7HA 5B1IA 3UT0A 2ECFA 1F9AA 1T3GA 2AVNA 1KPGA 2XUKA 4P83A 4BNUA 2PGNA 3O8NA 1EFPB 1RKUA 2J41A 4M98A 2ZKIA 2AXQA 1Z83A 3D6VA 2P9BA 4W9MC 3L0DA 5L95A 1GQ2A 3EBLA 5DMXA 3GP8A 2EATA 3DMPA 1UMKA 1COZA 2O5RA 5FBZA 2ZQ5A 1WXWA 4MGKR 1CUIA 4DL9A 1WNTA 3VU9B 1ZEMA 2YHUA 1E1QA 3O31A 3TRDA 4YT4A 3HCCA 4M1ZA 1F8YA 3W1VA 1AQ6A 3ECAA 4REOA 4LGVA 2PAFA 4CG1A 2UVPA 3M1YA 1U7XA 1NQVA 1T9HA 4MV0A 1W76A 1Q6YA 1Z34A 2X0KA 3CCFA 4EARA 1GAQA 1BQ4A 1UP6A 3LJKA 4YO7A 2B1GA 2FPMA 4PFQA 1HSZA 1RQXA 4N8EA 3X2FA 3CMCO 2X5JO 5JD5A 2BGJA 2ORVA 1EVYA 1IH8A 4X1KA 1YGPA 2MYTA 2HU5A 4K5QA 1T1JA 2BH9A 1SA0A 1QP8A 3F8WA 4MV5A 2JA2A 4U2GA 1PJRA 2Y2VA 1ONSA 3TM5A 4CR6A 4ZI7B 2IH4A 2W6OA 2XWBF 2FWAA 1N33B 2RI6A 2ZETA 3O1IC 3FN4A 3VNSA 4BKMA 2ZPUA 2MR5A 4M0MA 3ENKA 4N65A 5JJIA 2A92A 5KNCA 2VTDA 1S8OA 2N42A 5DX1A 3BF8A 1E8DA 1KH2A 3G2IA 4AUNA 5J4HA 3B51X 2OEPA 4RANA 1NXVA 2Z3ZA 4RZQA 2J4CA 1XJCA 4IIVA 2J9XB 3JWHA 3RHFA 2X5KO 4WRRA 2ECQA 3VZPA 4ND6A 3WNBA 4NYIR 3ZUPA 4M7RA 2ZXUA 2AN4A 2Y27A 1BHO1 4B7XA 2JCXA 2I3ZA 1CY0A 1MV5A 2QUHA 2IU6A 4JD5A 5CXUA 3GPCA 3AR2A 3FF1A 2J6IA 1WDKA 2GJAA 4PCVA 4BLVA 2PEZA 4MQLA 1JQKA 3HCWA 3OZTA 5EEGA 2NU6A 1HM5A 3VR5D 1QKJA 4GRDA 2QKYA 3FYTA 4YWJA 3OZWA 4AXBA 3EMDA 1T3LA 4W4TA 3WNDA 1M1YB 2HJVA 1SC1A 3PXUA 8MHTA 3ADBA 3MCUA 1GD1O 3A70A 5JFGA 5DCWA 1E18A 3R6DA 4RELA 5D8DA 4DMMA 3W77A 4GWLA 4OOEA 3A4IA 4J1NA 4YDHB 1PL8A 1DG3A 2V4MA 5LZ7A 2Q5CA 4J94A 2MMCA 4Z9AA 2XHEA 2G9RA 4IMRA 3TD6A 2BBOA 2QL9A 3R5XA 2J6BA 1LB1B 2ODNA 4WBXC 1F06A 1EP3B 1TT7A 1XRNA 3H6GA 3OJWA 4R2WA 5JIBA 1NDUA 3CVUA 2IUUA 1A82A 2OYRA 1H8EA 1F4PA 1Y4SA 1Q0QA 4QXPA 5FUMA 4MKRA 2QYOA 5J40A 3EPKA 4CLDA 4HR7A 1F51E 2YHBA 2FPPB 1JJBA 4H3VA 1GLVA 2HR1A 2C57A 2UZAA 2WM8A 3D6UA 3FYUB 4OYYA 3T4UA 1IXSB 1XNJA 1IN6A 1WV0A 2C3PA 2YRXA 1OKKD 2JAXA 4YO8A 1OXBB 4QPNA 4YLGA 2ZUSA 3IT0A 4JI4B 1GPNA 3O1HB 3RUFA 2JFWA 4BLTA 2BDUA 1NN3A 2FZGA 3AEUB 2ZLBA 4RMJA 1MEJA 4NF2A 1BDBA 2Z0MA 1C0EA 3C1AA 4X66B 2XZPA 1UWVA 2WP8J 1JEDA 4DIBA 1JPNA 4EY8A 4N7JA 1A27A 1XA4A 4ZTBA 2B36A 1L4MA 4JVSB 1E3WB 3IA2A 3W3AA 3SJUA 4CKBB 3DUFA 1S2GA 2QV7A 3NYQA 1ZKDA 1MN6A 3X2SA 2YICA 3UN1A 3IQZA 3DWIA 1CY6A 3IJRA 1MQSA 1KSFX 3C3AA 5ILOA 1CQIA 1JIIA 3M0EA 4MI6A 4L4YA 4ETWA 4BLOA 2AZXA 3DCYA 4G2NA 4B9EA 4WKBA 2GN0A 5CH5A 1VOTA 2IEZA 3FR8A 3F71A 1JLHA 3CTPA 3GXBA 1FDOA 4MRMA 3DEZA 4FFRA 4P31A 2OFWA 5A2QA 2OXIA 3S2FA 3LDFA 5HDBB 3ZE6A 2R2AA 3GLHA 2P9TA 4P32A 4EVIA 1K6MA 3VYWA 4OHKA 5ER9A 4EAAA 5H4GA 4A91A 3RAJA 2XITA 1SXIA 1P2GA 5KQGA 1G3QA 2EX0A 2RH4A 2QRHA 3P2JA 3QEOA 3ZQKA 1OHHD 1ZICA 4RSRA 3RUIA 4KE8A 3BRWD 1MA0A 1YC2A 2A1TS 2AMLA 4C43A 3FUCA 2UZ3A 4P4LA 2ZU0C 5HNKA 4C2UA 2PYDA 1DKUA 4I8DA 1TAUA 2XD4A 4C3ZA 821PA 1YTUA 3AM3A 1JE0A 3LV8A 3LQ2A 3VC3A 3TFQA 5BWOA 1JHPA 4W1RA 5K3BA 1R00A 4TSFD 1SCAA 5MN5A 1SVUA 1OZGA 4WECA 4J2TA 1EE1A 4MV6A 5KCZA 5F9HA 1FP7A 1ZH4A 3WRVA 3RTDA 4K6KA 2A94A 4CKWB 4OBBA 2H7CA 2EZTA 3C3CA 2B4KA 2HZBA 4ENVA 1OWMA 2CHUA 1XPOA 4DM7A 2CBXA 1UBLS 5CA0F 3KWMA 4YRPA 3P32A 4BQRA 1GQQA 1CY2A 4HXFB 4BO3A 3AFNA 3OFJA 2CVOA 2G1AA 2XGJA 4KRXA 2HMTA 3DXZA 3O9VA 4XI9A 3VYVA 4EG3A 1L7DA 2ZRPA 4PBSA 1Z6YA 2A5JA 5C1IA 1MA3A 4JI7B 1Q7EA 2FPSA 3ABRB 1ZGBA 3UH0A 1RAFA 2ZRQA 3SQNA 2HPAA 2QM0A 2IYNA 3H0CA 2HV8A 3TS1A 3Q6NA 4V0SA 3KT8A 1KETA 4HF7A 1AGRA 4R40A 4ND5A 4R8MA 3VR5H 2QTGA 1IN4A 1O8CA 3D1VA 1S1MA 1EHIA 1A8PA 1JQBA 1ATZA 2JHGA 1YQEA 4BBPA 3AUSA 1ZMRA 4BAZA 4YUAA 2XI4A 4JQOA 4L51A 4DSOA 3GFVA 4ZIRB 3OZXA 2XTMA 4L9SA 4PSDA 5ALEA 3REOA 5K8JB 1ZU5A 4ARIA 5B12A 2OZLB 1Q77A 4K81B 3DDUA 5SY6A 1B6TA 1Z12A 1ODKA 2IXBA 3I9FA 4X24A 2YJNA 4AJHA 3HY3A 4FU0A 3ZTYA 5KBYA 1PNVA 5I7AA 1AC5A 1ABBA 2BTEA 3TGWA 1X8LA 2BEKA 2WJPA 5FBWB 5L6MB 2WFMA 1IXKA 2WR8A 1ES9A 3MGCA 3V97A 5IDQA 1Z73A 1MOQA 3Q5DA 2JCVA 3IDFA 3K0CA 4XX1A 1E4EA 1OA0A 1M2HA 3ER6A 4EA9A 4WOJA 5JQWA 1CX9B 1WUTA 2FVYA 4MTCA 1RWVA 2RGYA 3GFOA 4FD2A 4FHGA 5DXAA 3NC0C 4YMSA 2O2XA 1BDIA 2CFOA 4ZCTA 2DX7A 1K98A 2ZIAA 3DE5X 4JV5B 1H2XA 2QW1A 2PKWA 5AJUA 2HDNB 1YJBA 3ZHQA 3WGUA 5JNLA 1TM7E 2P4EA 1ZUNA 2PXHA 3COVA 2WU1A 3EGCA 1GTZA 4QPPA 4AYWA 2OXCA 4I99A 4I55A 3PENA 3PXAA 5GWXA 1JJVA 1SKYE 4PYOA 5T41A 2FPUA 4HZUA 3MJRA 3RRMA 3DOUA 4KLNA 1M6YA 1W4RA 1Y3CE 2DFLA 3COPA 2R3SA 3CB4A 5EZQA 5G0VA 3SLRA 1ODCA 2ZDHA 4JBLA 3LY7A 1Y1KE 2UDPA 4O2BF 5EIXA 5DGXA 3H65A 3K4PA 3L4SO 3IURA 1SXJE 1PFVA 2HBQA 3P71T 1R6UA 3SVZA 1IXYA 2PIDA 3K2EA 3QEMB 2Q1TA 2YRWA 3U39A 121PA 4MCAA 2WJWA 4D5EA 1QYVA 4D82A 3UT6A 2JFFA 2B9EA 2DC1A 2ZAIA 4NENA 5E2BA 1TJNA 1PHPA 5AICA 4KCGA 5GONB 5ADWA 3THWB 2ZOSA 3EEYA 4OHVA 4CL3A 4RVCA 4WPGA 3H75A 4PX5A 1DCMA 4UMFA 1XNHA 1E2NA 3UOGA 5LU8A 3TGPA 3TQSA 5KNCD 1YJCA 4ZI5A 1ZMXA 2EZ4A 4RA9B 4JFRA 1DSSG 3JPWA 4QYIA 5JASA 2XE8A 3RR2A 1UT5A 4IJMA 3STVA 1PJ3A 4HV4A 4ZC1A 3OIDA 3RAPR 3KJGA 4MI1A 1J5PA 1MB2A 2OMKA 4N40A 4BV2A 3Q1LA 2W6JD 1GKKA 3KDAA 4KPFC 1QG0A 4OXIA 4DLKA 2OP0A 5LQRA 5F52A 3G2PA 1SHTX 3BA6A 3N2KA 1QF7A 5EJ9A 5H80A 3T7JA 5C34B 4CV3A 3TLYA 1KZ4A 5H5JA 1ULHA 2E4VA 4Q3OA 3L0SA 2KI5A 1HDZA 2W2KA 5EEHA 5KTPA 3HRHA 2ETVA 2BZGA 2RH9B 3IOMA 4NCNA 4RZ3A 2XCQA 1Y7LA 1UQTA 3A1NA 1H5NA 1B00A 4W1PA 3DCIA 4LI3X 2WHXA 2WWTA 5AUNB 4Z1OA 5BWLA 4F46A 1GNPA 1R5BA 1T4GA 1Y6QA 2P5TB 2ODBA 4YEDA 1N34B 3PLNA 4B0PA 3IIKA 1Z26A 1ADCA 2JIDA 3DKRA 4AKHA 3AKCA 3LE8A 4WKPA 1E3WA 2NO6A 3IMGA 1E3MA 4MWCA 3HKEB 1I9CA 5MGBA 1H8ED 1XEWX 2E6UX 3PUHA 5GQSA 4I5IA 3C0KA 1Y42X 4J43A 1ZD5A 2J3QA 4NOMA 1TZMA 4CQMA 5EJAA 2I3AA 4K6HA 4KGVA 3J80A 3Q2IA 4KDRA 2FR8A 4P80A 4EYSA 3RTAA 2ZAGA 4RGQA 3WLMA 5ISMA 1XPRA 2AR0A 3IB6A 1XB2A 1XRPA 5I7SA 1GPDG 1H4VB 2BFBA 3T34A 3F47A 1NP7A 3CNEA 4GL2A 4O25A 1WLSA 3OLYA 2DLNA 1LGYA 2XT9A 4ESOA 5JMWA 3V3KA 4HYEA 1L5OA 4IRMA 5JO9A 2I8LA 2GILA 4BPBA 3UA3A 3KZNA 3UICA 5A71A 4WERA 4JNKA 3KYIB 4WLOA 5BQ3A 3ST7A 4E51A 2OCIA 3GEHA 2I2WA 3V4SA 4CWAA 1T6YA 3BICA 5DDIP 4NNOA 2P9GA 2VDNB 4CFZA 1RYEA 1TFRA 5F98A 2TECE 4HHEA 1W0JA 5M29A 1A2KC 3UBTA 4IJKA 1DAKA 1CDDA 1OASA 3Q3CA 3DOOA 3KB6A 4DR5B 4ETIA 1H6BA 1VGQA 4GZMA 4OAQA 3FOFC 3GJYA 1TQ8A 3LOUA 5LP6C 2N47A 1K6JA 1XD9A 4YJ3A 2B35A 2JFZA 4JUCA 2IH5A 1KYXA 1I6WA 2WA2A 5EHNA 3IEIA 5D5PA 3L77A 5DPMA 1R5JA 2AFHA 3IERA 4HH4A 1UDXA 2CWWA 3NFYA 2O2SA 2H2IA 5TJ9A 3PCXA 2FZWA 5AW0A 3OOSA 2JGIA 3OZAA 4OU4A 1ZJYA 4YMTA 1FIUA 1T6BY 4QQNA 3ROPA 1S3GA 1EFRD 4PWYA 5CM8B 2NNWB 4LDZA 4ZTUB 4NHEA 2OUIA 5E7MA 4F6CA 1EWTA 3O38A 2ZYHA 3D43A 5E6SA 4BJ5A 3WBFA 4A8TA 2GHRA 5EWMB 5J4KA 4MKIA 1QOPB 3OFKA 5CFQA 4NCBA 3FDZA 2Q2VA 3E8SA 4MLCA 4FE7A 5TV2A 4FCVA 1F17A 5A3RA 1NULA 2G9QA 3GAZA 3JVUA 1GO2A 2FI1A 1IE3A 3RW9A 4ARZB 3DO8A 3HGMA 1QAMA 1RWBA 2ENUA 3ORQA 3PWKA 4MPTA 5B58T 4BAGA 2PZFA 2ZCJA 5LOVF 3QU5A 1Q0LA 3IH5A 1YVEI 2YV3A 1P2TA 2YIMA 3W5IA 5KNCH 3IE1A 3FLBA 4G8DA 3GT0A 5ADUS 2AXPA 1R0KA 1STOA 1XSEA 2CL0X 2VUSA 2Z1DA 3K4QA 2O19A 4XPIA 2OK7A 2XNKA 4U4AA 5EUQB 3LT5A 3I2FA 3VSBA 5E9WA 4U39A 3HCFA 5JNRA 3W5JA 1SCJA 2J3IA 1IG0A 5TS2A 3IVXA 3WP0A 3ZS9A 1W6UA 2C58A 3L84A 1TAGA 3OTIA 1UAGA 3O1JC 2C1XA 1KGDA 1KVSA 3A1FA 1F1JA 2GK7A 1ANKA 2ODWA 1N2OA 2VSOA 4H7IA 1DTSA 2UXBB 3ZWWA 4AROA 5A0VA 4JBYA 3M7IA 2FWRA 2WMDA 3Q9UA 1Z06A 5FORA 4GLJA 2WJ3A 4AQDA 3VC7A 2VZ9A 4ZU1X 4YT8A 3T0FA 2PKQO 4B47A 1YVUA 2B3TA 5JBQA 5IZCA 2Q3CA 1A95A 2J3MA 3M4JA 3A2LA 5J47A 4FNGA 5EHZA 3OJCA 1NLFA 1BO6A 1ZD9A 4PPQA 5CMLA 1BRTA 1G1AA 1NW4A 2BTQA 4FC6A 4IUDS 4MKFA 4KR9A 4QFBA 1UKYA 5FWAA 3CURA 3WLLA 1J49A 2QX9A 3KSBC 2Q28A 5ERGB 1VJGA 3ORFA 1L5VA 2WWHA 2Q0XA 2ZRBA 4OLAA 1V1MB 1W46A 4KACA 1T1SA 2ZI9A 3WL8A 2C4VA 2VN8A 3QEMA 5JSZB 1T35A 1YXMA 2WJIA 3OAAD 1CUCA 3EEIA 4MPPA 3KLPX 4QTXA 5C4GB 2YYAA 4C7VA 1AA6A 3ZDBA 4H1VA 2ZSIA 3FFBA 2YNMC 4MRSA 3NT4A 4Q37A 5HXAA 3ZHSA 2OV8A 5IAKA 5BYJA 4U6QA 1KEZA 2CVQA 1Y34E 3I53A 2B94A 1II8A 3K1TA 1NVXQ 3KKMA 3QFSA 4FUTA 5AVKA 4B4UA 3DCJA 1Z47A 3AF4A 4MI9A 1DQZA 1QFZA 1VLVA 5BQPA 1DQNA 1QZZA 2BY4A 2VZ8A 4R1OA 1C1DA 4HAVA 3SQWA 5TXGA 2XDAA 2Q49A 2NZYA 4TLEA 4I3HA 3FFWA 3RSHA 4D45A 4YAIA 4NCAA 4YAEA 1TM4E 4I66A 1E7WA 3NB0A 3AK4A 3PYLA 3TAXA 2CV0A 2V8OA 1UC9A 2YR0A 2D8AA 3FOBA 1ZDMA 3OP4A 4B6OA 1YWGO 2GZMA 1KORA 4R7ZA 1EGQA 2RGGA 4YDQA 2AFRA 5BUSA 4ARVA 1FU7A 1L0BA 3LLVA 3WL7A 1B6SA 3IILA 4EFNA 3IL2A 5ER6A 5F1YA 4JELA 2BL4A 2W8BB 1H69A 5AM2A 2GXAA 3E05A 2HUPA 4O29A 1WABA 3MVEA 4BVEA 3QEBZ 1ECPA 1QTRA 1TQ2A 1JHUA 2V7XA 3H5TA 3OX2A 1R6AA 1B0PA 2W11A 4XVHA 4IXNA 1C7ZA 3PX2A 4E13A 2IPNA 2P2NA 3ZVLA 3FNRA 4UQPA 4AWXA 4CQLB 2OA0A 3Q7PA 3GB9A 2W5UA 2YWEA 3ZLBA 4LNAA 3B6KA 3ROGA 4ER7A 2HLHA 3FZNA 1YA4A 4I46A 2I54A 1SULA 1SVNA 3TF5A 1TUBB 2Q1WA 3GEDA 3U4QA 2QXUA 3GELA 3H13A 4TMZA 1IDN1 1T8PA 3QKWA 4C4YA 4E07A 5JG7A 5BUQA 3S2SA 4RDXA 1EPUA 3VVLA 1P6UA 4MNTA 4IHKA 4GRAA 1RKVA 1FSFA 3I2IA 5G02A 7AT1A 2I8CA 1KQNA 1Z36A 3L7KA 4Y6SA 3DLBA 1HG1A 3QWAA 4K6GA 2ONCA 4MIEA 5DJ5A 1G21E 2PUHA 4PZLA 3S55A 4KAXA 5JISA 2HB6A 1YULA 2FWPA 4FT4A 2QTMA 1DUIA 1CIPA 4AKIA 2BZ1A 4EHNA 1UDWA 1KWGA 1EUYA 2GTIA 1L9KA 1XXHB 1RBZA 1UXOA 3QKTA 5LLTA 2IIQA 1AXRA 3GNSA 1E1RD 2FLVA 2GB4A 1DQPA 3GF4A 2FQXA 1ZUHA 3Q88A 4G85A 2JEYA 2C5EA 2I33A 1KF0A 3HJUA 3I83A 3KQQA 4NPAA 2YNMD 4B3CA 1TU3A 2PANA 5JAMA 3AZQA 3NH6A 3OD1A 4MKZA 1Z62A 2JVJA 3WRXA 5KQSA 3A6KA 3IUMA 4IOMA 3I92A 3SC2A 4CQMD 3K1AA 3KEMA 4EO4A 1TQDA 4A0GA 3GAAA 5EOVA 3PTAA 3AZOA 1TQHA 5HUQA 1PG0A 1BSVA 5FYDA 3A9TA 5LQMA 1VHLA 1VZ3A 2R86A 3BH7A 3CGWA 2FZEA 3LH5A 4A0QA 5SYNA 1C9DB 3C6MA 3EIXA 4M1TA 5E6UA 3KE8A 2POCA 3GJQA 3QNUA 3A6ZA 4GMKA 4XGQA 1H23A 3L18A 1T9CA 3U4IA 4NYJR 1TB4A 1H1DA 3D6FA 1T2FA 1UFVA 1ETUA 2P5UA 2YWDA 1DRUA 4IDOA 5B4VA