4D8YA

Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in space group p212121 at ph 5.6
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
240
structure length
240
Chain Sequence
GLVPRGSHMSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase deoD-type
total genus 86
structure length 240
sequence length 240
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d8yA00
3SCZA 4F2WA 4JWTA 1JPVA 1PBNA 3KVVA 3U40A 3DDOA 4DA7A 1I80A 4RJ2A 1Z37A 3E0QA 1V4NA 3FUCA 5EFOA 3DF9A 2IQ5A 4OF4A 2RJ3A 3EUEA 4IP0A 5B7QA 4D9HA 1YRYE 4QASA 3BGSA 4D8YA 3ODGA 4GMHA 4D98A 3T94A 1FXUA 1B8NA 2A8YA 1PR2A 3GGSA 1LX7A 4DABA 4G89A 1K27A 3KVYA 4L5AA 4DAEA 3O6VA 4QAQA 2PGAA 4YO8A 1JDUA 3EUFA 5I3CA 4L5YA 1NC3A 1JDVA 3PNSA 4FFSA 1Y1QA 4M3NA 4I2VA 1V2HE 3ONVA 1VFNA 1OTYA 1Z5PA 5B7NA 1PR0A 1TGYA 3BJEA 2QDKA 3LGSA 4PR3A 4F1WA 1PWYE 5CYFA 5JPCA 1PR5A 1ECPA 4OY3A 1PK7A 1ULBA 3DP9A 1V45E 1T8SA 5F78A 4JP5A 3ENZA 4TTIA 1TD1A 1JYSA 4QEZA 4R2WA 2P4SA 3KVRA 3UAXA 2B94A 3UAWA 4DA0A 1RXUA 4BMYA 4WKBA 4R2XA 4GLFA 4F2PA 3DPSA 4OGLA 4KN5A 4K6OA 4GLJA 5EUBA 1CB0A 5IFKA 1JP7A 3UAYA 4TXLA 5F7ZA 1A9PA 3KUKA 5FAKA 1OUMA 1ODIA 1ODKA 3EEIA 5C80A 1U1GA 3UAVA 3NM5A 4WKPA 5B7GA 4MCHA 4EB8A 3FOWA 4TXHA 1YQUA 4U2KA 4P54A 4BMZA 4LDNA 1ULAA 2AC7A 5DK6A 1ODJA 4LNAA 2HSWA 4LNHA 4R31A 1PW7A 3C74A 4TS3A 4DARA 3IOMA 3UT6A 4TXJA 5IU6A 1OVGA 1VHJA 4L0MA 2QTGA 1RCTE 1Z38A 1TGVA 1K3FA 3PHCA 2AI1A 4LZWA 4BN0A 1RFGE 4WKOA 1PR6A 4QFBA 1QE5A 4UC0A 1JE1A 1LV8A 4LKRA 1SQ6A 5F73A 5CCEA 4TTAA 5CXQA 5F76A 3KHSA 1N3IA 3K8OE 3OZDA 3OOHA 4BMXA 1V48A 3FNQA 1SD1A 4QATA 3FB1A 3F8WA 1A9RA 3O4VA 3OZEA 1RXYA 4L5CA 1RXCA 1YQQA 5KB3A 3NM6B 5F7XA 3BSFA 1YBFA 4OGKA 1OV6A 5ETJA 4NS1A 1A69A 1ZOSA 3P0EA 3OCCA 2OC9A 4YNBA 2ON6A 3FAZA 4NY1A 5F77A 1T0UA 2AI2A 1A9OA 1A9SA 5F7OA 4EARA 1Z35A 4WKNA 2OECA 1U1DA 4QARA 1B8OA 5K1ZA 4F3KA 1VMKA 3NM4A 3E9RA 3MB8A 2QPLA 3FWPA 1JDTA 2OXFA 3K8QA 1NC1A 1OU4A 3IEXA 1Z5NA 3LA8A 1K9SA 4E1VA 3MMSA 1RR6A 4H1TA 2HWUA 3E9ZA 4G41A 1Z33A 1PK9A 1WTAA 3GB9A 1YR3A 4YMLA 4JOSA 1Z5OA 1PKEA 3EMVA 2AI3A 1C3XA 4PNPA 3DJFA 4DA8A 1T8WA 1A9QA 4D8VA 4M1EA 1RSZA 3LBAA 4DA6A 4L6IA 1V3QE 1TCUA 3TL6A 1JE0A 5CYGA 2I4TA 2QSUA 4MCIA 4DANA 2A0WA 1JDZA 1U1CA 1ODLA 1JDSA 1Y1TA 1OTXA 4M7WA 2ISCA 3D1VA 1PR4A 1Y1RA 2BSXA 4YJKA 1Y1SA 1ZL2A 5CXSA 3PHBE 2HN9A 2XRFA 1Z34A 3OOEA 1U1EA 3NBQA 4MARA 1T8YA 5EPUA 1SJ9A 3QPBA 2GUWA 1CG6A 1XE3A 3BL6A 3PNPA 4GKAA 4TXNA 3UAZA 1T8RA 1RYZA 1NW4A 1PF7E 1RXSA 1V41E 2H8GA 1Z36A 2Q7OE 1TCVA 3OF3A 4NSNA 1Z39A 1Y6RA 5F7JA 5CCDA 1RT9A 1A9TA 2QTTA 2A0XA 1SD2A 4TXMA 2A0YA 1M73E 3P0FA 4OEHA 3INYA 1PR1A 5B7PA 4WKCA 4X24A 3OZBA 4TYMA 4F3CA 3KU4A 4D8XA 4G8JA 4OJTA 4DAOA 2OC4A 3OPVA 4TS9A 2HRDA 1LVUA 1Y6QA 1VHWA 4TTJA 1U1FA 3OZCA 4ECEA 1Q1GA 2I8AA 1G2OA
chains in the Genus database with same CATH superfamily
1R0ZA 3EEQA 3HN7A 2HK9A 3OURA 2WINI 4GPAA 1A9YA 1N2CE 2IDMA 2CXXA 2G4LA 2OY0A 3OZAA 5DH9A 4Z4HA 1QTRA 1FEZA 1HLFA 3KVVA 1T4MA 2V7XA 2FH5B 4KC0A 1AIPA 4PZ9A 5CK4A 4DPLA 1AH2A 1IOVA 3D8BA 4YLYA 2OBMA 5KWSA 1O96A 4ZEWA 4EMBA 4TWIA 3JVDA 4GWKA 1YFLA 1AV6A 5FV4A 1BVHA 4LGYA 4EHLA 1QFZA 3D7NA 2E6KA 1AHHA 3WGLA 3HI4A 3B1KA 4BB9A 1GPNA 1CJMA 1G8GA 3BFXA 1PSWA 4WZBB 2C8JA 3MJSA 3NORA 3FUCA 2YX1A 1NP6A 4AMBA 3L4JA 4Q3BA 4BLWA 2IQ5A 2F17A 1E6CA 1KKLA 2QEQA 3W1WA 3UWSA 1QZUA 4E6PA 1VE7A 1EFKA 1O97D 2NWQA 4CNBA 1CJKC 3EUEA 1N2CA 1YI8A 4HZUB 2O3SA 1CNEA 5ITZB 5IT9A 1NDQA 2BDEA 2OZLA 2W8ZA 4R9NA 5I4KA 3U4IA 5TC4A 4XW2A 1M5RA 2E18A 4RKEA 1TF5A 5JADA 1QRUA 1R66A 3IS3A 1UMDA 2OFXA 1FFCA 3RRZA 4FP9A 5MHTA 2C4NA 3TGWA 4C6TA 1MRSA 4XARA 1M2VA 2FF7A 2PSFA 3DNPA 3K0KA 4HYQA 4ITRC 2FQXA 2GVZC 2ZBUA 4X8OA 3K2QA 1M74A 1FTYA 4LZAA 4JB3A 3VDMA 3WK8A 3E3AA 1PW5A 3KAJA 4RSHA 5HIMA 5JCJA 2OXTA 4TWJA 4C06A 4G89A 3VKFA 2JJMA 5BW8A 5DCYA 2HHLA 3VR2D 4GR5A 4Q9AA 4PXAA 5CCBA 4RUKA 2G5PA 1BOOA 1TLLA 2JIRA 2QLBA 3KT6A 3K0AB 2QJWA 3S2UA 5TPWA 4CV0A 3GLIB 2OCIA 2O48X 2BAGA 3E03A 1JF8A 4XWKA 4GF5A 5A0TA 1JLLB 3TSCA 5JQGB 3GVIA 3HV2A 1FTNA 4QOHA 5GM1A 5LL6P 4W5NA 2KSQA 5DNYB 4Q7MB 3O4JA 1IMJA 2VUHB 4H3HB 3AWIA 4HXFB 4P0TA 2B7BA 5JSKA 4C04A 4RVUA 4JYPA 1I7LA 5DT2A 1G1MA 3KALA 2W6NA 3A04A 4D98A 1JEAA 3VUEA 3ZVKA 3ZH9B 1GZ7A 2B2CA 2A1IA 2QMHA 2WDPA 4M1SA 3BJEA 3EZXA 6REQA 3NRJA 4EHFA 5E7JA 4G36A 1ZNZA 3K0FA 3T15A 3C5WP 3TKAA 5CB4F 3BG5A 4TUYB 5SICE 4CMIA 3M2PA 1G3UA 1JQ5A 4ZI7A 2HAEA 1M34E 4N3CA 4WUTA 2ZR0A 1OXKB 3D6FA 3G6WA 5CITA 4OY3A 1V1MA 2C96A 3I0ZA 5JISA 3AR3A 1JTEA 1FA9A 4LYYA 2IDZA 4MUJA 3CRVA 4J43A 3MD9A 2Q3EA 1A82A 1O08A 1Y8AA 2QRVB 3AR7A 3L01A 4H3KB 4NPHA 2J3IA 4PO3X 4D5GA 4BRUA 5A4FS 2FWIA 5BQXA 3JQFA 5EZYB 3WYAA 3CW2A 2R8XA 2VNKA 4GGOA 4PBRA 1TZCA 2XYPA 4WOJA 3MINB 3T35A 2QRKA 4KFCA 2EJWA 4EHKA 2G71A 5EPOA 1X19A 4L02A 1HE3A 4B6GA 2BR3A 3VU0A 1ORHA 1WNFA 5KYXA 3FHTA 1S1CA 2C5AA 4F2PA 5I9SA 3H5TA 3SPXA 1XCBA 2R1TA 1ZD5A 2L69A 3QKRA 3DBOB 4KB5A 3WHKA 5I45A 1AXEA 2CKMA 2P11A 3R2JA 5FQOA 4KPYA 1GAXA 3CRQA 4QL3A 5T7BA 2RD2A 4DSAA 4CHTA 5JZSA 1RRMA 2ZRGA 2WYOA 3V1MA 3W0LB 4YT4A 4RFSA 5LQDA 1QU2A 2AXPA 1MH9A 3R5TA 1KJQA 1WB9A 3A1EA 4M0MA 2XI4A 5CM2Z 5EGNA 4DCSA 1SO8A 1Y1LA 3GGDA 3ZVLA 1L7BA 3QPWA 3B8EA 5BQ3A 4IIHA 1PL6A 1D6SA 1FY2A 1U7XA 3K0HA 3MJDA 3SEFA 4N8DA 1EK1A 4B75A 3ZWAA 1YR7A 3OKPA 4QT0A 2I3GA 3DA8A 1JFFA 1S7CA 3EG9A 4HEQA 5HEKA 3HJNA 4H1UA 5H9WA 2WR8A 3PUWA 1BXGA 2ONCA 4P3OA 2D2XA 5ALUA 5JD6A 3HJGA 4M86A 2EBUA 3SS7X 1XVIA 3RYTC 2ZRLA 1IBRA 2C59A 5K3FB 1R15A 4DG9A 5BR8B 1T13A 1X1EA 1YZFA 4ILKA 5JVDB 4FZ5A 5DGCA 2NGRA 2X9LA 2HXSA 3HSKA 3OPYB 5BO5A 4DMRA 2H2WA 4NMXB 4PZPA 2NPFA 1JQ3A 2C2ZA 3OCZA 3I0NA 3M6AA 1DRWA 2P30A 4ZI5A 2OORC 1L7AA 2XMCA 4ZCQA 1Y1PA 2GEDA 3SOPA 4Y67A 4WJKB 3V9PA 4FLMA 4C7XA 3HACA 2AZ4A 3FRIA 1TDJA 3MN1A 4JR1A 1RQPA 3QXCA 5LDGA 1RYYA 3IUBA 1TM1E 2V7TA 1ZU5A 1EVQA 2BE9A 5GY7A 3IDSA 2J33A 2PDAA 3ZD8A 4G1UC 1NF9A 4K6MA 1O9GA 4FMCB 1P9NA 2AEFA 4YA6A 2NU6B 1NMXA 1YB1A 3T7TA 4DMGA 2DPGA 3I92A 4G0ZA 1L1EA 2AH5A 2G40A 3LWDA 2XVYA 3GRFA 4R31A 4P5PA 4X1IA 2Q6TA 5FQNA 3FIUA 1NV8A 4IIGA 5B37A 1PJBA 3BCUA 4I5EA 4LOKA 3ZU6A 3ZWNA 1XLTC 5DTJA 4K6HA 5L51A 4KXYA 1QVZA 1SXHA 4KGDA 4BU0A 5LB2A 4EX6A 5GOZA 4G37A 1H5NA 1XZCA 3RFXA 1N5JA 3R3HA 2X0IA 4JCCA 3X43A 1VRVA 5IMBA 1K66A 3E7FA 1L5HA 4R83A 3TTXA 4V1CB 5EP2A 1FSSA 2HD4A 1NXVA 3FOCA 1AM4D 3KYDA 5TVKA 4WEQA 4YVFA 1NZJA 3JQFC 2V97A 3G9UA 3AEQA 5LMCA 1UDXA 2FR0A 4OI2A 4X6LA 2G08A 2P2NA 4E2YA 3R7FA 1KQGA 3PTAA 1D6JA 4Q5IA 5JO0A 5BQPA 1Y6ZA 3K72B 2WIAA 5AVQA 3NG1A 4R1PA 5I7EA 1M0WA 3DEYX 4MKFA 4P4LA 1M34B 2K5UA 1G291 5FPQA 1WUIS 1U8FO 2E87A 1SIOA 3BD7A 3SBXA 3CWZA 2PYZA 1EIZA 1PLLA 1POWA 1MH1A 5ERGB 4WY8A 1SBTA 4EGCB 3KELA 2HGSA 3ROQA 1SQ6A 3G13A 4DWJA 1WBBA 2RE8A 4LV6A 4H16A 3A1TA 3AY6A 4PRZA 3I32A 2PMFA 4N18A 4TN5A 5ESRA 1S3FA 3TOSA 3W5UA 1XEXB 5B1HA 3WADA 1XD2A 1FFDA 3DC2A 1MFPA 2X3FA 3GU3A 5DBIA 5JT1A 1QBKC 4QTXA 5ECGC 3GRKA 3LOUA 1VG9B 4BFZA 3WLHA 2Z4SA 1F4PA 2PZGA 4QATA 5ALQA 3V4VB 1LLUA 5IN4A 3MGAA 1R5JA 1Q7RA 1Z29A 5HTOA 1ESZA 1HNXB 2ZSKA 1NAHA 3BSFA 3VVLA 5JS8A 5IG2A 2Y77A 4E70A 2GPWA 3NWOA 2W6IA 3HKDB 1F8GA 1Y37A 1BO6A 2F9MA 2QR2A 3HE3A 2AN1A 1CY2A 4Q03A 2Q6LA 3K70B 4JSRA 3G88A 3SWWA 1L5OA 1NM5A 3D6TB 6LDHA 2IGTA 2PZMA 4XAQA 4ZVVA 2GD1O 2XBLA 3D6AA 4K86A 1CE8B 3GOQA 1U9CA 3MUNA 4XFJA 2QV7A 4DY4A 2A9QA 1ZM2A 2R6AA 3DYBA 3H3JA 2I62A 2R2GA 1KZ4A 3TR0A 2BJHA 3H1BA 3L49A 1U04A 2CVZA 3VH1A 4DC0A 1EHIA 4MMYB 3IC5A 4BO6A 1Y3BE 3K9LA 4RD2A 4MVJG 2BR5A 3C45A 2OBBA 4I5FA 2OUKA 2RGNC 3TMYA 1D2GA 2E6UX 3I1IA 4R8MA 1VI2A 2I6TA 1ZBDA 2GK3A 1S3SA 2CEKA 3QKRB 2JFBA 2PN1A 4BX0A 4AY2A 1Z13A 1UXIA 3MBIA 1YR1A 2O3JA 3CLRC 4F3KA 1IMOA 1C8VB 3R0VA 3PLNA 4XSGA 1DELA 2QRNA 4C2BA 1KU6A 1OILA 1ESEA 3FFWA 3ZHBA 3KWJA 4M54A 3CY6A 3JSXA 3LG2A 4QFMA 1SNYA 1XAGA 1XYVA 5H68A 2OXFA 5KYVA 2DECA 1IBKB 5IEBA 2NACA 3GJRA 3L77A 4RF2A 1PO7A 3TIXB 1J0BA 3LFTA 5EQDA 4BE7B 3U7GA 3AVXA 2ECFA 3U13A 1EP1B 4LDZA 3X1KA 4MHTA 3AJ8A 3DONA 1Z75A 5E38A 3NDBB 2ZRKA 1CW2B 3BH0A 4R5HA 3HCFA 1Z3IX 1W75A 2I4IA 5JTUA 1KZ6A 1GG9A 4GX1A 1XZGA 4MS1A 1LF0A 4NG5A 3WV5A 2I4OA 3FZEA 4FJ0A 3EGOA 1Z33A 1ADCA 1MEOA 3CEHA 3FZGA 4J4TA 1X1CA 1PK9A 4Y0NA 5LXTF 3EZGA 4F3TA 2W37A 4WK0B 5J5CA 4OYRA 1GTJ1 1UBKS 3ZIAA 3WOVA 3ZV7A 3H2BA 2Y1CA 9LDTA 5BVHA 4M1OA 5M3BA 2R97A 4I8IA 1R4NA 5KX5F 3KSMA 4WOKA 1FSPA 2I2DA 6REQB 2P69A 3BJZA 4D56A 3FNGA 3PWTA 1ZINA 2ZBPA 3P9KA 3H7IA 2ZRFA 1JIKA 3H84A 3MD0A 3E8MA 3QX7A 1H8HA 4NBUA 3MCAA 4EITA 1KVQA 5KQPA 3C6BA 3A9TA 3ITEA 1LLQA 1M2VB 1NBEA 2H08A 3H83A 4G07A 2C4KA 1YA6A 3AUSA 1OI7A 4YCAA 3DE6X 5KNCH 3WL4A 4M1EA 3THWA 2RHDA 3AK4A 1K8QA 3KQSA 1N5OX 3Q8KA 1E7QA 3DC7A 3SLKA 2OB1A 2RK6A 5ITZA 3DEZA 1XVTA 2GLTA 2B37A 2EW2A 2HJRA 3OMLA 3TL6A 3QJGA 3D2CA 5K3BA 4KO3S 3TNYA 3NDIA 4IDDA 4FQ7A 1Y4ZA 4BEJA 1SXJD 1KOLA 2QT1A 5ICCA 1W88A 3FUXA 2VA9A 3OY7A 4LSMA 1SUPA 5NLLA 4FFLA 2MSWA 3HUDA 3IMKA 1JQJC 3H5AA 5HOEA 3DOUA 3OOYA 4FEAA 3AUAA 2WMNB 3LP5A 3R6TA 4GNRA 3U17A 4HF7A 2ZQ5A 4Q6WA 1P1KA 3WV4A 1CJUC 1UR5A 1F4LA 4KQEA 5DE3A 2QJTA 1YCDA 4BQRA 1CEEA 5DNWA 3DDSA 2RH4A 4KVFA 1CUGA 1RBQA 2WC1A 3OJCA 5DWDA 5A7GA 1V1RB 3EZLA 1BEZA 3NALA 2YVQA 5F5LA 3L7BA 3PNVA 1ZUD1 3DH0A 1N2CB 3G2MA 2VBFA 3V55A 4HLUA 3FBWA 4HZIA 4V1CI 3ICWA 4L9RA 2QTRA 1U90A 3A1DA 2GBIA 2P2GA 3QF7A 3RNOA 1NJ1A 1K7SN 3HM2A 4FK8A 2FVXA 5DLQC 4EVIA 4MDFA 2YV1A 2LCFA 1CLEA 5KJEA 4RV5A 3BE4A 3SDSA 3F4KA 4YCNA 3OM9A 2YJNA 4PYKA 3UKJA 1USVA 4OXIA 2V96A 2XCIA 2N9UA 3IOCA 3NATA 2WJGA 1M54A 2PTGA 3BWXA 3W8DA 3OM0A 1SCKA 1H0RA 1R0LA 1JWLA 1EFAA 1WPGA 4XX0B 2IP1A 2VQ6A 3PHGA 2H31A 2GMWA 2OZEA 1SJ9A 2PGIA 4ENPA 2QT9A 1H4SA 4A2PA 2FTKE 3HA3A 2O1WA 2CZQA 4H7PA 2PMBA 4IZIA 4F1JA 5BV7A 2XOKD 1SM4A 1UMCB 1M6EX 1XP5A 1RJ9B 3UA4A 2WNIA 4LJYA 1O3YA 1DO2A 1DX6A 2AXQA 3MMPA 4YASA 2JJYA 3COJA 3QPAA 2C88A 1UODA 1G5HA 2VJKA 3MCWA 4QJ3A 3AHDA 1XZPA 2Z83A 4N49A 4WBNF 2ZZKA 3I5YA 1OKKD 4NONA 4PRLA 3CPJB 4ZO4A 1II8A 1SN7A 4G84A 3PFWO 4U00A 4DC1A 2EU8A 4C21A 1X2BA 4EQZA 5J2UB 3BXZA 5KMGB 3WMFA 1V5IA 4D8TA 2GZ3A 2WPNA 2ACVA 3HRKA 5CCDA 1RT9A 3CG4A 4K5QA 3KT8A 2HWYA 4DLWA 2EFYA 3ZD6A 1P7YA 3AFOA 3QEOA 7GPBA 1G3QA 2O54A 4GMFA 1GTL1 4IDQA 5TPZD 3WIOA 3KXIA 1Q7EA 4JA2A 2X1MA 4NJOA 3ZGNA 5KNDH 1NSYA 3GLGA 1TUIA 4V3BA 5TQJA 2ST1A 3GYBA 5LQRA 1M2JA 2HK6A 2HQBA 3ZQJA 3RIGA 2QUAA 2HDOA 3U3MA 3KPWA 1Z4NA 4DV7B 1GPJA 3O7MA 2AN4A 3VZDA 3FHJA 4HS9A 4KQJA 2ODTX 1NPTO 1AX9A 1QGUB 4PCVA 2VZEA 4G8JA 3GEDA 3A6DA 1OZAA 2I8CA 4LCBA 1I4OA 3CRNA 1NBWB 4G81A 4DQXA 1J25A 3QUSA 3U31A 2FLVA 1T3TA 1V7CA 2C99A 3HCOA 2WAOA 4HQFA 4XQ0A 3FZNA 3ZXXA 4CQJA 4DSUA 1JFTA 3LGXA 2JRCA 4XD7A 1K6JA 4X3CA 3A7DA 5C8VA 2PU5A 4I8DA 2Q50A 4ND5A 2A3NA 2HSEA 4D92A 2BKVA 3NHLA 3EB9A 1H94A 2ONYA 1ZH2A 1QIDA 2I2BA 2FUNB 2B35A 4RGYA 1WW8A 1R9JA 2PZFA 4ZOLF 2VDUE 5HKAA 1YZUA 2XT9A 2WTBA 1FP1D 4FGLA 4KQGA 2JGLA 3MCVA 4QYIB 4RF5A 2QRJA 4KK3A 3A1NA 4MR9A 4Q05A 5IP5A 3WBBA 4CR7A 3AKZA 2C3MA 4CMEA 3HZZA 4J0CA 5EZQA 4AY6A 1XTJA 3K92A 1B14A 3K9GA 1ECBA 1X80A 1EAYA 4LOAA 4C7JA 4XPIB 1DAOA 1MJNA 1O03A 5GQSA 1PEYA 3BE6A 4IUYA 1W30A 4CEHB 2B4RO 3S5JA 4KDEA 2QRPA 2GN6A 3OCWA 3QWIA 5AI4A 1ULSA 3Q9SA 1OIVA 4FT2A 4JLKA 2AMLA 4KE9A 3VNVA 2VT7A 3V2IA 3QEMB 1D0IA 3QXXA 4OA5A 3E84A 3MWYW 1NKTA 4HVTA 4OL9A 4G25A 5DCUA 1XMPA 3JAWA 1C4OA 4B76A 5C9ZA 4HL6A 5CG1A 3HRIA 4E4TA 1JLKA 1Q19A 2AR9A 2IUEA 3AUYA 2HBYA 1ML3A 3KXKA 1X1QA 1D09A 3LHSA 4O2BF 1B8NA 2J67A 4BDTA 4RELA 1EWKA 3P2OA 4X94A 3OEWA 1U28C 2AUTA 4QPJC 2IH2A 1OC4A 3HKCA 3BSYA 3T7DA 4OAPA 2X0FA 1WG8A 4ZOQI 1DIBA 1BDBA 4E5VA 3KVYA 4FCTA 1DCFA 1D07A 1E2FA 1EZZA 1T24A 3O6VA 3FUUA 5JANA 3V33A 4O1IA 1HY3A 1Q7GA 5GV7A 1PFVA 5AM2A 3QWBA 2AFHA 3VNSA 3WMRA 2VSFA 5GINE 4FKMA 3N6XA 1EWQA 1EZ4A 4RV4A 3JZFA 3H18A 1ABEA 3TRDA 3CVUA 3PEUA 1ILWA 2BCEA 3OLVA 4QDZA 2VDMB 3BHIA 2IELA 1DWUA 2Q2OA 8AT1A 2N1BA 2EARA 5B6JA 1XUOA 2HRZA 5AHXA 2ETVA 1SKQA 1DAEA 4O4JB 3V7FA 1O97C 2QD5A 1ZM9A 4BWVA 3ONVA 1CVRA 3HNRA 5MFZA 2AW5A 5CDYA 3CLUC 2F62A 3AI7A 1ULUA 3E22A 2OM6A 3ENKA 4IDPA 5IUKC 4GLLA 2FQQA 2YIJA 3UHPA 1KWGA 1H1TA 3CUVA 1NOJA 2M2IA 4CI9A 1QR2A 3EC2A 4JI3B 3PUHA 4MQMA 1KVTA 3BT7A 1ZW1A 1GEEA 3GV0A 1NVVR 2NO7A 1PWYE 3BM5A 4AUMA 3U4CA 3JU3A 4GR9A 4TOIA 4FHEA 2QN7A 3RS2A 1FLVA 4EI2A 4O3FA 4QREA 1J97A 1JR6A 2R3SA 4DEVA 2NQTA 3DP9A 2BVNA 3R44A 3PFCA 2VL7A 3JD4A 2DHCA 3QELA 2HMSA 2XUFA 4TV8F 4BP3A 5ULLA 2H1CA 4ZAFA 1JYSA 4NBSA 3FKJA 1A04A 2W11A 2ZS9A 1RZ3A 2A30A 3JZDA 4UHKA 2H65A 5TVGA 3ILYA 1DJPA 3ZGZA 4IWNA 4FMPA 3VHQA 5DT9A 3RS0A 3F73A 3RARA 4LQCA 3UAWA 1FMFA 2UVDA 1RXUA 1JKJB 4IH9A 2Q5QA 1C80A 1FPQA 3GELA 4HGNA 4A6DA 5G40A 1C30B 1ELOA 2CC2A 3Q0TA 3I39X 3UC9A 4UE6A 4BO7A 2ECQA 5LDDC 1YK0A 4JJ6A 3ML1A 2YVLA 4QUEA 2QX7A 4LA4A 4MW0A 3AYZB 2H29A 1TMKA 2W2KA 1JU3A 1N6RA 3KDPA 3OOJA 4TRRA 2WJ3A 3F0TA 5G4LA 1M6VA 5EUBA 5E6SA 3BJMA 2ZVPX 4C0AC 1UZUA 5CVDA 3B52X 5DYWA 4MV0A 4U6SA 4EABA 1YACA 4WV3A 1FQWA 2PSDA 5BN4A 3MUOA 2HO4A 1FNNA 1Q91A 1AXGA 721PA 1EFRA 4RL4A 5HRUA 5ITWA 3WWOA 1Z6PA 1TQ4A 5CH8A 3WBFA 5FLXA 4DBVO 3ICEA 1CDEA 3ZZMA 4CKBB 4M0KA 2WWIA 2B20A 4YJDA 4K46A 4EECA 4L9WA 4EPWA 1HOXA 2EAUA 2IYUA 2L82A 5KVAA 3KLMX 3R23A 1ISJA 2W4IA 4OXKA 2BEKA 1XZ8A 2PQ0A 1FRNA 2JJ8A 3EEIA 3PHHA 4TTSA 5H83A 3FCOA 4F9FA 1E9AA 2JI9A 3ESAA 3VR0A 3PKIA 2PMWB 2XYRA 3GWZA 5ALSA 4MV9A 3WXBA 5BYKA 2HV9A 4R1LA 4CM1A 1Y4DE 4PX2A 3NM5A 1GITA 4EAAA 1JTFA 1Y7PA 2Z3ZA 3CHYA 2A78A 5J5AA 2ATIA 3CR8A 3AOEA 3VTAA 2C9BA 1YZVA 1USIA 2I87A 4N1AA 5EJEA 2DYKA 1V5EA 4EB8A 5JNLA 1CDDA 2C92A 3WQSB 4A6EA 2ZRJA 2GYUA 4L22A 4US1R 1YWGO 2C2XA 3WLKX 4G0OA 4W9NA 3RSCA 4DZTA 3AW8A 4LDNA 4V0QA 2BM1A 5DU2A 3CFYA 2PX5A 2RGWA 1IQRA 5IPFA 1JZSA 5IN5A 2EJBA 4YRIA 5K0NA 3NNNA 1FUEA 5F2KA 2ZBGA 1YXMA 4CMCA 1EFVB 2IYNA 3JQ9A 1XLUA 4S1VA 4LNHA 4DCNA 3E0XA 1S3GA 1S0UA 1TCBA 1CUEA 3KD3A 4TS3A 5DKFA 4QOGA 1R4ZA 4BQEA 3PGJA 3WFJA 5U1PA 1TZKA 2VHVA 3KETA 5IC5A 2QDXA 2HA3A 4QYIA 4JHXA 1NXSA 3LTEA 4LYEA 1OBCA 1TE2A 3SIPA 5C1DA 5CG2A 3LC1O 3NHFA 2O1XA 1GGJA 1V11A 5C52B 4H17A 2ZBRA 1CS0B 2ZCVA 1Z38A 2OBLA 3FSGA 2WA2A 2GEJA 1ZAYA 1OI4A 2F8MA 2VSXA 1K7EB 2YNMA 5H82A 4RTMA 2PA3A 3WL3A 1VLQA 3RHTA 5B12A 2X2EA 3VZRA 4DV3B 4TUYF 3CNQS 2WD7A 2YH2A 1JHAA 5AHRA 3I5AA 1XTIA 4KQWA 3I61A 3OD5A 1N6KA 1N8SA 3OM8A 5DTIA 3ZOKA 5H5JA 3JQCA 4AKTA 5BQFA 5L7YA 5EMMA 5E9AA 1FCJA 5EE1A 3OZGA 1GPUA 4M7RA 3Q7QA 3BE8A 1TLTA 4CM4B 1I3CA 1N7HA 4NMWA 4GSLA 2F1KA 3U80A 5GV8A 5CGQB 5L3SA 4LKRA 2REQB 4HDMA 2VWQA 1T1GA 1IUKA 4PVCA 1NUAA 4Q7KA 1NI4B 4HPWA 5CW2A 1XZLA 2PRZA 1N3IA 5GONB 1FDSA 3VPBA 2VAXA 3OZDA 5EIBC 3AOEC 1UKEA 4HAOA 2IFTA 1B3RA 2NQ8A 2OL4A 2XMSA 4YECA 4BMXA 3U19A 2V6IA 3ZY2A 3TI9A 2A59A 5CRIA 3TKLA 1IHUA 1XRMA 2XQIA 3E2MA 3HFGA 4FS3A 3K70D 1KVUA 1ZUWA 1DG1G 2X58A 3DD5A 1A9XA 3BB4A 3PVCA 6GPBA 1CR1A 4PZEA 1KEEA 2I99A 4XIYA 2J5XA 3QUAA 3PR1A 4AUNA 4J0EA 4Q21A 2HMUA 1QH9A 2CLCX 3EUWA 1K7XB 4EW6A 1KI4A 1HYHA 1UDCA 3DAPA 5HJ2A 4DDHA 2Q2WA 1XXHE 3GEBA 3LDHA 4I9HA 4EY6A 2I91A 4FGWA 4KVAA 4BZQA 4K2AA 4OAQA 2NSYA 2GZ2A 2ZIEA 3FNFA 4M98A 3RVKA 3CBGA 1NFQA 1GUFA 4LGMA 3F74A 2VCYA 5CNMA 1RM0A 2ENWA 5AW6A 1LQUA 5M34A 1BZYA 1YBAA 4YJ2A 2MR6A 4FYYA 5F7OA 3R09A 2R8RA 1SEPA 3SKXA 1FLNA 5IAAA 4NENB 3OFNA 5JWOA 1J5XA 4MV4A 3A4IA 4FW8A 3A10A 3MT0A 3L0PA 2ZAGA 5I7WA 2GCEA 5FLKA 5EJ2A 3BIOA 4REQB 1IK4A 1ZVQA 5EXPA 3NC1C 3M89A 2VH5R 3FTPA 1PZFA 2PSJA 3AGQA 2R87A 1DXOA 2PUGA 1P4RA 9GPBA 1ZCAA 3VHRA 1RI5A 3DBVO 5D51S 3EF3A 2CV1A 4GPZA 1JDTA 2XE6A 4MYUA 4H18A 4IS2A 1R6TA 5EC8A 4MGIR 1KR2A 1SHTX 5DYIA 1DTWB 2FJ0A 2Q1WA 5EZSA 4FZRA 1RNLA 2QA5A 3EIOA 1XJWA 1U9JA 4KO1S 4ZO7A 5E0OA 4ZK2A 2RKWA 3OVMA 1K98A 1X7ZB 3GGCA 2Q1TA 5CLIA 5A62A 3C3BA 4Q00A 5C4GB 2B2NA 2WOOA 4LQDA 3T7SA 2FWAA 2R6FA 3WYEA 1WDKA 4P2BA 2B1JA 2JB9A 2VDWB 4L74A 2A4MA 1MXFA 2FQYA 2OXIA 5C3UA 1WTAA 1QP4A 3PE6A 3F3YA 2UDPA 4JJEA 4MV8A 2LCQA 2GCNA 4JYBA 2BH9A 4JI0B 4DTIA 5F98A 1H2HA 4DNPA 3WNBA 1RHUA 1J5EB 1LNZA 3CLSC 1UAYA 4YHHB 1EXDA 3BORA 3FPGA 3QE2A 1A5AB 3PYLA 4J3FA 1NLUA 1Z5OA 1G6KA 2R1TB 4L1KA 4NBWA 3FAKA 1G3MA 5DHUA 5LOVF 5GJWC 5HNKA 4NE2A 4JC8A 4LGVA 1GTRA 2G5CA 4UDOA 4UTVA 2W2QA 1A8UA 2ODBA 4CV2A 3LTNC 1RRPA 4HV4A 1BJKA 3T9DA 3B3FA 4JI2B 1MX9A 4OX9B 3EQ2A 4NV3A 3OZFA 2PLRA 4QBFA 4LX8A 3WFZA 2O05A 2YYAA 4CLRA 1M5UA 2G1PA 4XZ3A 3SP1A 2XTZA 3PC4A 1SPXA 3GFGA 1SKBA 4LDRA 1W2HA 3IE1A 3FRJA 2ZWMA 3EZ7A 3PSHA 4YAFA 1ZZEA 3C5VA 2VHYA 1ZUIA 2WHEA 4EF5A 5FH9A 3M0EA 1EUZA 3IA7A 3AY0A 3DMPA 4IYJA 1EXWA 4X93A 3CXRA 3TZKA 1ZVJA 2WAAA 3TSWA 5H16A 4GC9A 4WY2A 4MRMA 4AMYA 1E4OA 4Z49A 1JDSA 3EGCA 4G5SA 1WPQA 3WL7A 2XGGA 1ZH4A 5FJJA 1GL6A 1FS5A 1NJ5A 3K6JA 4QHYA 3RABA 3WXMA 5EJ5A 4AUKA 1SKMA 3PHLA 1YQGA 1FYEA 1GU7A 3DXXA 3FCCA 3H1TA 4PFJA 5DGIA 3TL2A 2FPXA 3VPDA 2J07A 3ZV3A 1E3MA 1H0KA 1GSAA 2PL1A 3H2JA 3AX6A 3NBMA 2NXWA 4JYCA 1Y3HA 3ABQB 3DAGA 3I2YX 4O2AF 2G9NA 2DHEA 5IBRA 4YREA 2QUJA 4V38A 5A7HA 3HPRA 1O87A 3FVQA 3MW8A 4OQMA 1F4VA 1U1IA 3G7NA 3MERA 4YTEA 2VP4A 4Y2QA 1K8RA 2QP9X 2FB9A 2M32A 4WZAE 2PZAA 1HEYA 3M3DA 4E88A 4ZDIA 1M6NA 4IMJB 5EESA 4JJFA 221PA 1GGHA 1TYCA 1Y4UA 3L8DA 5THQA 1J4AA 3DLTA 2PJDA 2BBWA 1A2OA 4Q19A 3PNPA 4BC1A 2PV7A 3C6MA 4PCLA 3M6LA 2G36A 4RVGA 5CDHA 4LPKA 2EX1A 4FMDF 3VR2A 5KDLA 1T6XA 2EFGA 4FDVA 4DQDA 1RAGA 4FGSA 3H1PA 3UV3A 4BEVA 2WSLA 1NZDA 1EM8A 1NW4A 1IXYA 4QTZA 1V8ZA 3LW8A 1IVSA 3HU2A 4BLTA 2IZ7A 5HQ3B 2H8GA 2SBTA 2DP4E 3I9JA 4E0BA 4CKCB 3U7EB 4HR7A 4YBRA 1AHIA 3CZAA 4P7KA 2AR7A 2NPIA 3OF3A 3KUXA 2LE0A 1E9BA 3AETB 5DIFA 4PZZA 2V1UA 3VH3A 4FYVA 1P3JA 4M88A 4CLXA 4DVJA 5ALXA 1DCMA 1PWXA 2BMFA 3E3LA 3L3BA 4GSYA 3TFQA 5CU7A 5JROA 4PZAA 3RBXA 4MH0R 1JI3A 2IH5A 5AK6A 1MGOA 5TPZA 1CUFA 4BKMA 3DAYA 2RH8A 1M73E 3BPSA 3C6ZA 1SVKA 4O02B 4F9EA 1NR1A 1OBVA 2Q21A 4NLLA 3QLJA 4C87A 2ZUTA 1YZHA 1P4JA 4MPPA 1FNBA 4UHHA 4AF7A 2MTBA 4C05A 3E9NA 4MMXB 2ANCA 4Q47A 4IVQA 2OP0A 4G9EA 2OD2A 4XIJA 3DEIA 4J1TA 3HGQA 5DNDA 2A33A 4PQEA 2QM0A 1PUJA 2JCSA 1Y9AA 2VF4X 3MRSA 4RY0A 2G07A 1KVSA 2IW1A 3ER6A 4LYFA 4DLXA 4M1ZA 1VG1A 4E13A 3GCWA 1DI0A 2H7VA 2IA5A 3A7EA 3H5LA 4D41A 3P9QA 4B7XA 1U1FA 1Y7HA 2C4TA 4IJ5A 1FFHA 2X15A 1GSOA 4B3XA 2BHTA 2BONA 3T0FA 1HG1A 1REQA 1BGVA 3ED1A 3EVBA 3R3UA 3CJRA 4F9GA 1FW6A 3LKZA 1DX4A 3IDOA 4XYBA 3W8FA 1WHSB 1OPRA 1I94B 2Y4NA 3ES9A 4KAFA 1RTKA 1MGPA 1JG7A 3LU1A 4BEWA 4G65A 3W4JA 4XIGS 1K89A 1Q2XA 4KV7A 1E1NA 3H6GA 3KUDA 1Z7GA 4J4BA 1YIOA 3PDUA 1EFCA 4IPTA 1QHXA 2VDQB 3QMMA 2XZOA 1AKYA 1Y6FA 2Y05A 4MQBA 3MTQA 4GGMX 5DWQA 2OZPA 5IFLA 4TT3D 4V03A 1OXVA 1XQWA 4Y2UA 3K4PA 4KV9A 1XCGB 4ZEXA 4DHWA 1MO6A 4HWGA 5HQJA 3ZNQA 3WSWA 1XWWA 4B3MB 1TIBA 3Q7IA 1WF3A 3DOEA 4XE5A 4HH3C 4ENTA 1NXOA 2JD2A 4KXFB 1R0XA 3D5QA 3HKEA 4MW5A 4ETIA 3NWPA 4A8JB 5B36A 5K8VA 1RZVA 1YJ8A 5EFOA 4QBGB 1MPXA 4NYJR 3HUEA 3DKPA 2OHVA 4TV9A 1A4RA 3L40A 4H7JA 1ZA1A 2ZAMA 4I6EA 4QNMA 5IMSA 3EPHA 5CLJA 2YWBA 3RSFA 4E1BA 4R9RA 5IVIA 2HIAA 4PPQA 3R7AA 4P4UA 3F6CA 3VYVA 5EIXA 1ENZA 2DZDA 2PUVA 3EEYA 4QDJA 4DR4B 1USWA 4RZHA 2ACEA 1RRVA 2UZ1A 3BGSA 5LBIA 1N1MA 3TECE 1SG0A 4JJKA 4Y2SA 3U4DA 2A67A 4GUAA 5EMNA 2D13A 1M8KA 3QPCA 1ZESA 1IIRA 1MEEA 3AUTA 4JYZA 4B3FX 3JW8A 1WPXA 4MV3A 2TS1A 3B1JA 1ULZA 3CM0A 4JXJA 2FFHA 3TIVA 2QUIA 1V71A 4I5GA 3EVTA 2ZSBA 1EGVB 1IH8A 1NUUA 1BXGB 1U7UA 2C9ZA 3R7WB 4X64B 4EHHA 4RTLA 5FKJA 4A8PA 2PCJA 5IUJC 4MA5A 4BBZA 3GA7A 1SBYA 1X2EA 4JZKA 2Q07A 5JCPA 2JZNA 1KTVA 3PJEA 4N4AA 4WOPA 2OAP1 3LS2A 1YCGA 1P1CA 3FYUC 1UDBA 1QLHA 1FFAA 2NTVA 3LY8A 3R0XA 5JNVA 1DFHA 1JZTA 2QTZA 4H15A 4XOUA 4IFIA 4YQEA 2O8CA 3ZLTA 3BZWA 5C1IA 3WWCA 1GRCA 1FLAA 4DRZA 4IWXA 3MOSA 2CXSA 1L7MA 4IRMA 8GPBA 1DQNA 1P3DA 2UVPA 3BCRA 2YWCA 4TS4A 1VFNA 1Z5PA 3UTDA 3HNOA 3Q85A 5B7NA 1YQ9A 3D3WA 1PQUA 3DAOA 4WLEA 4IOKA 5A4AA 1RC8A 3QXGA 4HRXA 3N2GA 1Z4JA 1WCWA 2JKYA 3ISVA 3PD0A 3KHUA 3QJYA 4LBVA 3TEFA 5A6SA 1O0CA 3CX3A 2JLZA 3C70A 3IPAA 2CDAA 2E9SA 1H4QA 2Y3IA 4HNAA 4CJXA 3MWDB 2AZXA 2V6GA 3DWEX 2NVWA 4Q66C 3FUWA 4HG2A 2O2DA 4N7RA 3O4IA 1G9TA 1DBPA 1ORDA 4KGXA 1EDZA 3AWDA 4I5IA 4JP1A 1WZUA 4OHPA 1H6AA 2X6QA 3BGVA 4ZVSA 5CXXA 4E15A 4KAJA 3E9MA 5IWAB 2R4QA 2VXYA 4D26A 3NGLA 1FU8A 1XNGA 2PL5A 2Y27A 5H59A 2UZIR 4CUZA 4DG5A 4NQZA 2FRVA 4OA8A 2CDRA 4FFNA 4A15A 2C61A 4EZBA 5IDXA 1TJYA 3HYSA 4L51A 4A8TA 1PQWA 5TGZA 2X4IA 2B94A 3MTEA 3HN6A 1AT1A 4DA0A 2DHRA 3GLHB 5A71A 1KH1A 2WLSA 1T4CA 4HFJA 3FTCA 4KPEC 4X71A 5A7FA 1C7QA 2B4YA 2NV2B 3B3GA 5JSUA 4CTMA 1SA0A 1DXQA 3EG5A 2YXEA 1C3VA 4GD3Q 5FA5A 3BIWA 2O0HA 2YFKA 4Y0VA 1JFSA 1L1FA 2J41A 3GBSA 4ZT2A 3RROA 2WT8A 1V5FA 1E99A 1P17A 1E0DA 3PA8A 1E5DA 1G4AE 1OXXK 1TM2A 3G68A 5K0FA 3RV4A 5CMLA 3RREA 1MQ8B 3P1JA 3CUUA 3ENNA 4MWZA 1RMQA 3HFJA 1BCSB 4KXVA 4PSDA 1Z74A 3ROZA 4MB6A 4O3MA 2XCUA 4RSMA 1XZFA 2QAGB 5K4HA 3S55A 2PPVA 2V5VA 3CB2A 3A0UA 3EZ6A 1HF3A 3FJYA 2VNJA 2PV0A 5DX0A 4D3FA 5JNWA 4AU1A 5LD2B 1SXJE 3EQ6A 3LQQA 1U8AA 3V4RA 1AQYA 3RRYA 4U6NA 4HRYA 2GQ0A 3EAQA 3KR1A 2WV7A 3QIVA 2GZMA 2ODNA 3SDZA 4MVJA 2BTQA 5IJ0A 2GF2A 3TZEA 5KTNA 1QMPA 4Q6BA 4R8LA 4NC9A 1Y98A 5ICGA 3LRTA 1F2TA 1RJEA 5LJLA 2QSYA 2F00A 2PMDA 4X90A 2RAVA 2CLFB 1WY5A 2Q29A 2AJDA 3F6PA 4C3ZA 1J2UA 1X7HA 1GGVA 2R8BA 3QVOA 4QJ5A 3O84A 3CLSD 5F5NA 5K0JA 1O6GA 4KBGA 3W1EA 2JFQA 1GZUA 4HRAA 1G0NA 1YZYA 3FYDA 4REQA 3JASB 1BDJA 2Q4EA 4RIHA 3FDFA 4JMLA 1XAJA 3C7KA 2DCMA 2H3HA 4EJSB 5ESXA 3ZBUA 2CBZA 3WWEA 2VFAA 1I36A 1AN0A 1MT0A 2AD5A 4O25A 2QW1A 4XDGA 2A35A 4RKWA 4ZFNA 1W19A 2OHIA 1N78A 3IP1A 1AZWA 1Z7EA 4JC5A 2V45A 3PK0A 5C31A 2HSWA 3LVBA 2R751 1IE3A 2DG2A 1XHFA 4CMAA 4O5OA 4DR2B 2SKDA 2FSGA 4Z3OA 3GF4A 3W5HA 1KK0A 4W63A 2JFPA 3G1TA 4L8LA 2M6RA 4G2TA 2JGAA 3MGGA 4DJFC 3JAMA 3D0KA 3AZQA 3KR9A 2RHCA 3L0IB 4JEHA 1P9LA 1KJ9A 2YWEA 1QPBA 3KHKA 4CRWB 1TVMA 1V16A 2DETA 1MR3F 3USZA 1I1NA 3AR8A 4JLUA 3EGDA 3QJ5A 2CV2A 1QG2A 1HT2E 2WNHA 1T2AA 4MJXA 5KMGA 5JD3A 1GZSA 1HTTA 3SS9X 3FYHA 5DP2A 1NP3A 2AQIA 5F4ZA 5CB8A 1KL7A 4AKIA 1O5TA 4D4KA 4EJ2A 4BO3A 1L8AA 2FX2A 3PUZA 1QHHB 4TWRA 4CDMA 2YV4A 4BVEA 1TC1A 1A4UA 3TN7A 3FVTA 2IVFA 4YYEA 1VE6A 1T0PA 2QRGA 3WKDA 4QOEA 1XQYA 2FZKA 3ZTYA 1SKAA 2I6XA 4MWTA 3H2IA 4TV8B 2P9QA 4EO7A 1GPAA 1RFLA 2ZUWA 1Y3IA 3H1GA 1A7KA 2P6UA 4ID9A 4X60A 5K0CA 1NKSA 2P41A 1QIFA 1SUCA 2O59A 2FZ4A 4Z9YA 2C95A 1NASA 5HDQA 3M2TA 1DGQA 2AG8A 3B6KA 3LY5A 2HRRA 3HZOA 4TMTA 3A36A 5TMBA 4FONA 3ZR4B 2B25A 1LQ2A 3RS8A 3FNQA 4I7EA 4LX0A 4LZNA 3GFBA 1N3BA 2YRXA 3EIUA 3PC3A 3PTLA 4JA0A 3F8WA 1PFQA 3AC0A 4PQGA 4TLLB 3CZRA 2IEYA 1QK4A 4P33A 3AP3A 1QS0A 4UD2A 4ESEA 5K8UA 2ZJ2A 3EE6A 4FHCA 3OLWA 1KPGA 2GEVA 4EMTA 1NOIA 4WE3A 3RK4A 4OTZA 1YA4A 5LP6C 2AN9A 3E1GA 4OHMA 1L7DA 5AXDA 3AG6A 3OMXA 4W7IA 3NT5A 3IP3A 4U2BA 1BX0A 2G5TA 5E1BA 1XLVA 4AJNA 4C7OA 3DOFA 1Z4QA 4I66A 3BD9A 3HCBA 2SKEA 3GJZA 1XEWX 1XEFA 1P4SA 3AUFA 1U6KA 4EP1A 5GVSA 1E3DA 3N6RA 4NVRA 4HATA 5DHFA 4XDYA 2QLJA 4KHPB 1H6CA 2Y8EA 1Q83A 4F96A 1ZY2A 2YY7A 2VRWA 1W88B 5HPYB 4U02A 3WA7A 3DLAA 3MK31 2OFPA 1C9KA 2RH9B 3RVRA 3RU3A 1H23A 3VJKA 5FUWA 4YPVA 5DW0A 1P8AA 2BGNA 4UUMA 2C5GA 3RRMA 5C5IA 4YMUA 3S81A 1RQ2A 2MWMA 2ZR8A 2D1QA 4MYHA 4NULA 4PC1A 4PLZA 4ZA2A 4BGIA 3ZWQA 1A2BA 2XADA 3BK2A 1FX1A 3GR6A 3BXOA 1LJUA 1EX6A 3RVNA 5AQ1A 2C2WA 2GAAA 4PM4A 5IH7A 3T0IA 3OQOA 2WHYA 5GAJA 4IH4A 2F4VB 1VIDA 1OU4A 3ORFA 4B33A 3CB4A 2B9VA 4UU7A 3COYA 5F1YA 3RIMA 3VR6H 5AFSA 1FFSA 3KKMA 2QENA 2C3UA 4XLTA 4L4UA 5AUPB 3PWZA 3NEYA 2JKVA 3N8DA 5GVRA 1QCCA 1OBHA 4QDXA 1HRDA 3K20A 3RSOA 3EFBA 4JYMA 2EFCB 3VYSB 2BMJA 4U8GA 5LZ7A 2W6ZA 4JAVC 3HY6A 1NYRA 1ZNWA 3FLBA 1EWRA 2J32A 3O74A 3PXAA 4GOKA 3T38A 3W9UA 4F7WA 3TR5A 2D06A 1XDGA 4ZI7B 4QU5A 2Q8QA 3WTCA 1YR3A 3E58A 3SSAA 3BL8A 2J9RA 1PE0A 1G8PA 1GFIA 1NAIA 1PKEA 1P81A 3L6DA 4TQAA 2BM0A 3PX2A 5EE5B 4ER0A 5AVTA 1QDEA 2G7MC 5F33A 1CQIA 3G5AA 3NIGB 3T1QA 3LIPA 4E51A 1E32A 3I5XA 4PN3A 3N2IA 1N2SA 4UE3S 4DA8A 1YIDA 2BY4A 3TFOA 3PBKA 1QO0D 2I78A 3T7AA 3QVSA 2NZWA 4TPKA 4YT8A 5IK2A 1YJAA 3NOOA 1PJ3A 4X7RA 1KKMA 1F5SA 1L9KA 2NZXA 1CHNA 4X20A 1V3QE 2LKDA 2PT5A 2IDKA 2IC5A 4TLCA 3OQ6A 5DEOA 4EB6B 2PLAA 4ZDKA 1TCUA 4A10A 4XDZA 2BDTA 2N46A 4EK9A 4MQ5A 2D0IA 2IPMA 2YASA 2DULA 3N2ZB 4F84A 1OFUX 2EQBA 2Z2ZA 3WRYA 4U8HA 4LXYA 1OREA 4FE7A 1CULC 3RSSA 2JI8A 1P7WA 1N4AA 2P0EA 2J09A 5FOSA 4E5PA 3WVNA 2QE6A 3S1LA 2BFFA 3I4FA 1D1TA 3MHTA 1R0RE 4BWGA 4C0LA 1YRLA 3ICVA 1Q0HA 3KKKA 2PFSA 1WQ4A 3BMQA 1M8FA 1N1DA 1E2UA 3TD2A 3ABOB 4V2IA 2X1HA 4LZZA 3N0RA 4RX1A 3RVSA 1M2GA 3AIIA 4B6RA 1Q0QA 4UXJA 4CE6A 4DR3B 1SOAA 1C8LA 4KOAA 4RVDA 1ZN7A 3PEVA 1TVKB 1UJBA 2BSXA 5FBWB 3T9FA 3TS1A 2A0UA 3HJUA 3QI2A 1S2NA 1TZJA 2DX7A 3F2IA 3LGAA 4N41A 2B2XA 4YACA 3ANMA 2Q0HA 1QC5B 3T9AA 4TMWA 2ZTUA 3M5PA 1Z7YA 1XTZA 2GF0A 1ZI6A 1ULTA 3AJ9A 4A26A 4QTUB 3S2EA 5CFOA 5LUAA 5FTMA 1E7RA 2V58A 3R7NA 3KSDO 4E07A 3LPLA 5DNVA 3PTZA 2CFRA 3HR4A 4EUSA 3J81k 2HZ7A 4FDAA 1UM9B 2XMZA 3DDZX 1IDN1 2P79A 3BL6A 3F8SA 1COZA 4CF5A 3G9TA 4WECA 1U2GA 2PQMA 1B00A 1Q7BA 3DW1X 3GAMA 4LYAA 5T6MA 3MPOA 2WJYA 1L8QA 3ESDA 3FPBA 3AL0C 3LDUA 2VUSA 3D2LA 3AHJA 3QZUA 4HTFA 1RYZA 2PUFA 1WVIA 3EODA 4LE0A 3SZ3A 3NVDA 1C14A 3W3AD 1VGRA 5AVKA 1C3OA 1GLGA 1XV5A 1YDMA 3A1UA 4QDOA 3TTYA 1B3BA 2OQ2A 2HA5A 3K09A 3OSUA 5IBPA 1FRVA 1M2NA 1W581 2H1SA 2J6BA 3L8HA 4OQPA 1JKXA 3O94A 2ZLBA 5CT6A 4ZKDA 1JDBB 4MUMA 2PMEA 1G21A 3ZS9A 2BGTA 3GJSA 2IYOA 1UC8A 1Y6RA 1EG7A 2CLSA 4NZPA 3FLEA 3IR5A 5K51A 3G9ZA 5JXGA 4PHCA 1GRRA 2XUAA 3BXFA 2F6RA 4ED9A 3U3DA 2JIOA 5SV2A 2KYRA 4FFRA 4TXMA 3R7LA 3WGMA 5FL7D 1FTWA 1L1RA 2O3UA 3KB1A 4H7FA 1Y1KE 1DTSA 2QG9A 1YIAA 5I9NA 2B92A 3IX7A 1DOHA 5ED4A 1I24A 8MHTA 3TLGB 2Z98A 2ZJBA 3T7KA 2QNIA 3JWHA 2FPMA 1CVIA 2IX3A 5SYMA 4C4AA 2BP7B 4IBOA 4Y2PA 4JT8A 1E3EA 3KS9A 4FHFA 4GE0A 2XB2A 4TS9A 4DDTA 1ZMTA 1E0JA 1TM5E 2I2AA 3H17A 2NO4A 1JTVA 4JX9A 3N2EA 5D6OA 3V2GA 2UZAA 1CQJA 3Q1KA 4OX9Y 3AO0B 5HQ3A 1J2YA 1R74A 5IJAA 4M1KA 4TTRA 1SU4A 5KQSA 1LBHA 4PG6A 3NTRA 5EOVA 5I7OA 3PLAE 3L0SA 3TGPA 1O7JA 2MSDB 2PX8A 2VC2B 3CNEA 4PGGA 1J39A 5E95A 4BE4A 4BNXA 3M1AA 3E53A 1JPVA 5G3ZA 3RSZA 3ZJUA 2GHTA 2XXJA 1XC7A 3MWKA 5EEGA 3ETNA 5DI3B 3ASVA 3H11A 5I7HA 1VLHA 1GKUB 1OZFA 5TJ9A 3KTOA 4RF4A 3ETHA 1C8BA 2QY9A 3DWIA 3H9CA 3PXBA 3VYTB 4B2PA 1E7MA 4J8PA 4RJ2A 4DWWA 5D01A 5FHRA 1GL9B 4EW2A 2O50A 3CCBA 4A0HA 3UMFA 1Z62A 4JR0A 1KJYA 1R6DA 2DBYA 3P9ZA 4JI7B 4LQ4A 2NP6A 2X5JO 2E4AA 3KQNA 4CTNA 4KXQA 2OPBA 1GTMA 1V37A 1KO1A 1MC4A 1LW7A 5T4HA 4BNGA 4DCUA 4EF4A 4G5YA 2VP9A 2K7FA 3EBOA 5FUMA 2IYWA 3AI2A 4JKIA 4OMCA 3UO8B 8OHMA 4GMHA 4UBLA 2HYIC 1R88A 3T5CA 4AJ2A 4ZAYA 4ZAXA 1IYZA 2Y0PA 1LK5A 4JBXA 1L5NA 1GGEA 2FOXA 2A8YA 1ZH8A 3MXOA 1BNCA 1AQNA 3DV0B 1BMQA 3L9WA 1G8MA 2NTEA 4KVZA 5EP4A 3A4YA 3CJTA 4MQFB 1GWNA 4UARA 3EPLA 3FPCA 3WGUA 4BIMA 1Y81A 1T5SA 4IW3B 3NJ8A 3RASA 1D2NA 4QGBA 3RIEA 3JYQA 3PNMA 2IF0A 3M83A 3NHPA 3PPVA 4MITA 4B48A 4DXHA 5JUWA 3T1HB 4R6XA 3KLPX 1CUDA 2GBCA 3WE7A 4FI3F 2PGAA 3T7IA 4CM6A 2Z08A 3NEPX 3U7FB 2HHAA 4FMDB 3KJGA 1IONA 3LC0A 4YO8A 1JB9A 2H06A 4MW1A 1Z4OA 4PAGA 3VM6A 3E35A 1NJ8A 4GPIB 2B69A 5CYOA 4AI6A 4HGZA 3ND5A 4XUCA 5AI9A 4U7PB 2H4HA 3JARB 4HNAB 3CF2A 1WUKS 1A72A 1SZJG 1HNWB 1R4MB 5AKZA 2P2LA 3H0CA 4YPOA 5MN6A 1OMOA 4DV1B 4Z99A 3A1WA 3GCGA 4G5XA 1TO6A 3GX1A 4ZANA 2C7GA 4RKFA 1JW9B 3R5JA 1L8OA 1P4HA 2IHJA 1OTYA 1AOXA 3OBBA 4GWGA 5JAQA 1BHJA 1NULA 3VV2A 4M8KA 3ZDXB 5KTKA 2RGRA 1WPRA 1QHSA 4RAOA 2YXBA 4B80A 4AP5A 2WDZA 5FBZA 3TB4A 4X44A 3SXUB 3R75A 4NTZA 4CU5A 2NOAA 3PE3A 1G38A 5L9AA 1GN9A 2BE7A 1A98A 1KQPA 2JD0A 2KPOA 1H3EA 2FUG1 3M4NA 5H80A 2XEXA 1A5ZA 2HW8A 4WLFA 1ILEA 3SLGA 4RJTA 2V7VA 4FBLA 3C7TA 1EESA 2WF5A 2NUBA 4KR9A 2RB4A 3L8FA 4E5DA 1MW9X 4NYMQ 3AERA 4D82A 3BKXA 3GQBA 3N5KA 4OB6A 3RLIA 4WGGA 1TYDE 2RHWA 3KWLA 1OBOA 3H99A 1Y5RA 4RFLA 5LLSA 3L92A 3NETA 4UCQA 1RKUA 1E6KA 1ONPA 5GONF 3AKCA 3SEAA 4D0NA 3E48A 1EUYA 4CGYA 5FWYA 1T0HB 1TUEA 3UK6A 5L3ZA 4WN3A 1R5OA 2Q3MA 4U7WA 2B5WA 2C3PA 4ENQA 3ODPA 4H1WA 4WEOA 5FUQA 1ZNQO 1BU8A 1E1LA 1B4DA 4LG1A 2EJTA 1RXIA 1WMDA 3VO8A 3VSBA 3ZW9A 1TEVA 3I3SR 3ZHRA 5HJ7A 4P4SB 5GIPE 1RC0A 3AI3A 1I32A 2BEUA 1VBKA 5I7SA 4YP0A 2QS9A 3FDZB 1PK8A 2MYPA 4G67A 5BV0A 1LBIA 4JT4A 4CPDA 4E32A 3NRCA 4RWEA 1ZKDA 5EZ5A 4G5FA 4ZQIA 1U28A 1OASA 2QXUA 1PVDA 1GQFA 2CB9A 2A9OA 1T0IA 5BQOA 4ZCMA 4P2GA 2O7RA 4BQIA 4Y2GA 3UA3A 2JW5A 1BS1A 5JS6A 1SEVA 4BKPA 3RFTA 1NUHA 2K87A 2X5KO 3WAJA 2ZM5A 3D4IA 1QIMA 3ZZNA 1N4DA 2YCLA 4KLCA 4ODIA 3CZ9A 3LUPA 2MCFA 2D5AA 3KE8A 4BIIA 1GPDG 5LYJB 4JS0A 1GT91 3COVA 5A3JA 2ZIGA 4HN2A 4E2XA 1Y7TA 5C8YF 3E22B 4DRYA 3WBKA 2AX3A 1V9CA 2QQ0A 2ZSIA 5A4JA 1GKLA 4M46A 5AJTA 1FVXA 3TE6A 2WQZA 4GX2A 1U99A 1JZQA 4NCIA 1VZ3A 1Y4AE 4Z0PA 2ZRMA 3FCXA 1WHSA 3WYGA 1XPOA 1A9XB 3G2QA 1FFXB 1QYDA 2DFNA 3T7EA 1PG2A 4DDKA 1HR0B 3QBEA 2WFLA 4XGIA 1BW9A 1TQDA 2WWVD 1G64A 5KYTA 3ZIUA 4OB8A 2R8YA 1A1SA 1IEVA 1M0TA 3B6EA 1AJEA 3N70A 4GEKA 1J8YF 4OKNA 1OYYA 2QT0A 4BZZA 1UMBA 1P2VA 2AMJA 3QKUA 5ILOA 5KS2A 4LWOA 1MQSA 4ZKEA 4MLDA 1MD9A 3C5HA 2DBQA 4HNTA 2H85A 2JEZA 4NDNE 5M2QA 3LP8A 3CH6A 1U9IA 3I5MA 5LIRA 3NHRA 4QYTA 3FFAA 4LOHA 4MRNA 1K86A 4B31A 4S1PA 4RORA 5HXAA 1VP9A 2HCFA 1U0FA 3AEZA 1I3OA 3RH0A 3GT4A 3WK9A 2QYSA 3ZV4A 1VJGA 2VPZA 4FR2A 4C76A 5EFZA 3VO9A 4PGHA 1OVGA 3R0JA 3RAJA 2P4EA 2PX6A 2VA8A 1CDZA 1DFGA 3H9UA 4J0IA 3R8CA 2I7DA 1Z0KA 1M2OB 3TNDA 2OQRA 5D3ZA 4X45A 1GRQA 5LQCA 3BMOB 3LBFA 5AVSA 10MHA 2FEMA 2PL3A 1QJCA 5FDFA 1PQYA 5JAMA 3E5HA 4RK7A 1TCCA 5CD9A 1Q1AA 2F8TA 5CNIA 3SBEA 3I01M 4PPYA 3UUEA 5JHHB 3NBFA 4JBLA 3TUJC 5KZMB 1S4MA 2XVZA 2IE8A 3UICA 4E09A 2VAPA 2YHAA 1KO5A 2DPHA 5HZGA 4QFBA 3I28A 3EZFA 4WD3A 1DVRA 1U8UA 4C5AA 5SY4A 4REMA 3UHAA 3D0QA 3RUFA 2Q7XA 3GY0A 4TYQA 4YV2A 3NVAA 3HEAA 2NLOA 3K32A 3P2IA 1Y9EA 3D3KA 2UYGA 5DVZA 1NMYA 2EYUA 3G8BA 2W0SA 5CNJA 1WW3A 4HWPA 2AQ8A 4HWRA 5ERXA 4EGAA 4HVLA 2A9KA 4NEQA 1V3UA 5JJLA 3KAPA 3OU6A 3UG7A 5AJZA 3PFFA 1A9RA 4F5EA 3CUSA 4HEA1 1E5TA 1WHTA 1DDOA 3CNNA 3NU1A 4MAMA 4DMMA 4F86A 4C7KA 2Z43A 3KPYA 3EVFA 2P90A 4B44A 4D81A 3C3JA 5C1PA 5GZ1A 2Q4OA 2O6HA 3EGDB 2H4FA 5EG5A 4L5IA 5AIBA 1V8BA 1GR1A 1GQSA 2HSGA 2WKQA 1N5DA 1YHNA 1Z2OX 2PKXA 4QJBA 1P5ZB 1NLFA 4RLQA 4B3GA 4JLMA 3KNZA 4P7GA 2HCRA 4ARSA 3VR6D 5FL3A 5E4YA 4CQLB 2DQSA 2J3QA 1GDTA 2WP8J 4O2AB 4OQEA 2BZSA 2DPXA 5WRFA 3RYHB 5B3AA 2GTIA 1QXSA 4ICIA 4AZSA 4EARA 3ADCA 4PWZA 1VB5A 1YE8A 5K3SA 5A6VA 2D6FA 3IDZA 4HFRA 1DIOB 1O9HA 1QZZA 1ZCZA 2SHKA 2C42A 3JS5A 2HLNA 4GIBA 4EB3A 3QA3E 2O2YA 5CXUA 3CIFA 1E2KA 1MDFA 1PQ4A 1SVSA 2FGKA 3LDAA 2OB2A 4HNGA 4NBRA 5FD8A 3S2ZA 3W7VA 4LF8B 3ZWXA 4ZIRA 5MN4A 1F9EA 1X1DA 2HC9A 1QTQA 2ZYIA 3UC5A 1KU0A 1KJWA 3LCCA 5FL7A 3C87A 5H9VA 5AVXA 3N6VA 1D0VA 2IEIA 1DC6A 2FPUA 4K2HA 5LOVA 1O77A 3HR7A 3MYYA 1V5WA 1RJGA 1RKVA 4BKUA 4FOSA 1BWRA 2X8BA 2I1WA 4UNPA 1DAHA 2YW2A 5B4TA 1NW3A 4IHKA 1I10A 2ILVA 1SXIA 5CLHA 1PL8A 2CB0A 1SCQA 3FWKA 3MS4A 5JJIA 3QLUC 4OK5A 3DE4X 3OX2A 3ORHA 3SJCA 5DOVA 4JQYA 4Z1MD 1G9XA 1WIWA 1LBEA 3GH3A 3NHUA 1LDYA 3SS8A 4TS1A 2PUTA 2VXCA 1Z8HA 1A8SA 1HTBA 3PR3A 4KWEA 4Q1BA 1OJLA 4Q3OA 4URHA 5JCZA 2GN9A 4F8JA 5HCUA 1Q1EA 1N2EA 4Z0TA 1ARZA 2G4CA 2ZXFA 2WVGA 3F46A 2Q5HA 1JHPA 4HPJB 3SX2A 3NR2A 3UTCA 2Z6AA 3BWEA 3ZGLA 1CZUA 1JSLA 4MKGA 5A0FA 3UHOA 1I4LD 5ALNA 5K03A 1TYZA 3IUPA 4EB0A 2QP3A 3WHLA 1ZM7A 4YFYA 4INJA 3LX8A 4PNPA 5BUCA 1EM8B 5D86A 3F7TA 3LUHA 1JECA 4QBIA 1GA6A 3ZDEA 3DZFA 3OPYI 2EL7A 4HDNA 1JHUA 1YAHA 3Q12A 4AYXA 3NTQA 4LNUA 2UYQA 3SR0A 2RAPA 4CL0A 4G5QA 4R68A 5ICEA 5D5PA 1MC5A 1RSZA 3ZXSA 1T4GA 2HHHB 1EQUA 1CUXA 5KKCA 1K6EA 1J49A 1W34A 1PJ4A 2CYBA 2W98A 4N0QA 1NVBA 3WWYA 3IKJA 4TM7A 4UUNA 1IHYA 1KDZA 1W8IA 2GZHA 3WLJA 4M8IA 2WF7A 4AMVA 4Q9LA 5AW5A 3UW3A 4BNNA 4PSAA 1QP0A 3KAKA 5CFZA 3LX6A 4PN7A 4D4JA 1X7WB 1Z6ZA 1CBUA 3RC9A 1JIVA 4JI8B 1E7YA 3L04A 4GR4A 3THWB 5ESDA 1ZSYA 3G82C 1BU5A 1X7XA 4XWOA 3WWZA 4Z4FA 4V0OA 4ME6A 4PE5B 2OCDA 1JVBA 4FFBB 3WP1B 2WWXA 4L0DA 2F55A 3IBYA 2PS9A 2RHMA 2WJVA 2PANA 2ZUUA 4XYMA 1L4MA 1TF2A 2UU9B 3F6YA 2VZ9A 2XF2A 2YW9A 3LZDA 4P3XA 4DB2A 5IW8A 3VC2A 1Z9BA 1IVNA 1YZTA 2A9VA 4IJQA 4U7FA 2WD8A 2NUTB 1M7BA 1BGXT 1O2DA 2I6QA 1RI3A 2LIPA 2Y0BA 3B7PA 4HDSA 5LNK6 3JWEA 1O1YA 1XP8A 1EYZA 1IY2A 3WGZA 3FTQA 5DW3A 3TVTA 1L5RA 5ICMA 1D0SA 5YASA 3AVPA 1CZOA 4ENRA 2VR1A 4IUCS 3HBLA 1I6LA 3CZ4A 3NX4A 4BASA 3Q7TA 2H6EA 1KMNA 4Q4DA 3AF1A 2GEKA 2FMFA 1UWCA 1KI8A 2VYVA 1E2JA 5IXYA 3NBQA 3QX8A 1KZ9A 1YVRA 3BA6A 3T52A 5EKDA 3FGOA 4QU8A 1PHPA 1QONA 4KXXA 5REQB 5DM4A 3B8HA 3SXJA 3WK6A 2AMFA 2KWIA 4W8OA 3ZHYA 2FFJA 1O54A 1EQAA 4HDRB 4C0JA 4MQ6A 4LFCB 1NL3A 1XNJA 3PD1A 4FDMA 4HDMB 4D79A 4DT1A 3GG9A 2JFWA 2WSSA 4KNVA 4KPUB 1FTQA 2XKAA 1NMZA 3C98A 1H22A 1RQLA 1H2AS 4S0XA 1NVTA 3S68A 3UJ6A 3RJ5A 4HKTA 1NNSA 2BUBA 4HH4A 4S1TA 4U3JB 5AJXA 4AMZA 2II6A 4BNIA 1JFLA 4OP3A 1E89A 3VAAA 3DHNA 4HUQB 5AK5A 5IYZF 1PT7A 2QB5A 4N6OA 4BVFA 1TCVA 5EJAA 4DIUA 4OHUA 2MYUA 3H75A 3BFJA 4GYJA 1HUQA 1NBME 2F90A 2GXUA 3OHPA 4YRFA 3LO5A 2QD1A 4LZLA 5A3RA 1OA1A 3VVBA 4B84A 4CMKA 3GJ4A 4URVR 1NU6A 1TM4E 3AQ4A 4TMKA 4UHBA 1U0TA 2DPLA 3RR2A 3N76A 2Z9DA 3GEMA 5F4BA 1O94A 4B74A 2O2CA 3OE1A 2YIMA 5DGTA 4N6GA 1Q6ZA 1AK1A 3H9QA 1KOJA 4FDUA 1CY4A 3SG0A 1C7EA 1G1AA 2HBZA 2MSEB 2RDMA 3KEGA 2OZKA 4KIUA 4LY3A 2YNMD 4MKZA 5CYPA 3EFEA 1VGVA 1JEEA 1I2BA 1ND5A 5LU9A 2YZ2A 3FROA 3OQIA 3G0HA 1JHYA 3KOXA 1YBHA 3T3HA 1U5BB 1EK0A 5KOJA 1UM9A 3L0CA 3W4IA 2Q9BA 2BKEA 4MVXA 3GLUA 4X65B 5H3LA 2Y1DA 2H52A 4HB3A 1OX6A 4K6CA 4EZEA 1QGDA 3C3WA 3Q3JB 4IGAA 3KAQA 3PGMA 4H27A 2CFCA 4RHEA 2VK4A 3FMPB 3SQLA 5EHXA 4FE3A 4HYEA 2J5BA 4LBYA 3EPPA 2AS0A 4I50A 4J7CA 3BH7A 2H54A 2HRCA 3KKLA 1R0WA 2AOVA 4I1YA 1ID1A 2GEUA 1RLJA 3AR5A 5LUBA 3EOAI 2A5LA 1YMVA 1JJFA 1V9SA 2B98A 3MMNA 4OXQA 3X1ZA 1ODSA 3DE7X 1DKUA 4JWTA 1SRQA 2CUNA 4V0LA 3PNYA 4QQ8A 1HNNA 3PDJA 4JI1B 2H2GA 4YY3B 3B70A 3WMGA 4E1AA 5KNBH 4LMBA 3K1TA 3QMPA 3LY9A 4MWDA 2X8JB 3CISA 1F2DA 3JQAB 2I2WA 1N9GA 1PT9A 2HQRA 3L7YA 4KDFA 5M5BA 1HPLA 1Z0FA 2BHRA 2QMYA 4JZYA 1N6HA 5CA1B 3K1ZA 4FPXA 1QV6A 3FVVA 1V1JA 4IQ4A 3ZVNA 1A5SB 4XIIA 4PQYA 4Q02A 3L7IA 3H16A 1CRPA 1HE4A 3PRKE 4WQMA 1C7RA 3OETA 2ORYA 1Q11A 1YBMA 1AK2A 1UL1X 3KZVA 1F1JA 3PPIA 1YOVA 3O03A 4OKIA 3S1AB 3B13B 5SZIA 1PCXA 3HG7A 3PL5A 3RVOA 4B3DA 3DZCA 2LIVA 1P1HA 3SC4A 1W0KA 5DHPA 5F21A 3P0JA 1E3TA 3GZNB 2IS4A 3WGOA 1G20E 1CX9B 2ASEA 1Y8CA 2GTPA 3G02A 4KP7A 1YRYE 5FPHA 1SC6A 3ODGA 3F6RA 3PU6A 1EVKA 2P68A 3OAAA 1KP2A 2R9VA 3AW9A 1DBRA 1FXUA 1BHSA 3F49S 3H1AA 5AIAA 5HM8A 3R40A 3E81A 3EBLA 4UDXX 1GIAA 3GP3A 3Q40A 3B1ZA 1TAUA 2WYUA 4MCJA 4AJKA 2H2DA 3F4BA 4E46A 4ZZIA 2QBYB 4RLHA 3CC8A 3NKVA 2PE5A 3KEMA 1ECCA 1L9XA 4ILEA 1FUIA 1F0YA 2DWUA 2PR2A 5KREA 3AHEA 4KWTA 2PVCA 4OQLA 3I6YA 4EOGA 1H4TA 3H42B 3IVCA 3TMKA 5JXHA 1SXPA 4KX3A 2QAGA 3TG8A 3W6OA 1ODFA 3PKZA 4W5OA 2JLWA 1NBOA 4EY7A 1ZA2A 2IRWA 1RVDA 2ZI5A 3SC3A 1UPBA 1Z15A 3DTNA 4TKVB 2VQEB 4FXPA 2IOFA 5D87A 3VU8A 1AF4A 2Q45A 4FSHA 3PWKA 3W5BA 3T9EA 3RU7A 1V2HE 4GU5A 4CKWB 4AG6A 3B9RA 4JK3A 4BTEA 4X7PA 3W9BA 1E5LA 4W9NC 2JASA 1JFVA 2IY9A 2QP4A 3BD6A 4KE7A 1MJHA 1URPA 2GNOA 3FPHA 1FMLA 4OXYA 3CUWA 3T3PB 1WWKA 2QW0X 3CX8A 3AJEA 5ALTA 1XLWA 4KN8A 5A3SA 4JWKA 4X62B 3GRCA 1VPWA 2VPQA 3STTA 4PS0A 2ZWVA 3STXA 3QOFA 3NHJA 2AZDA 1UOPA 4NRDA 4OXXA 2ZM6B 2LKCA 2X8LA 3WNZA 4JOBA 4ATNA 2FPOA 1GUDA 2YHSA 4MI9A 2PH3A 1E9SA 3E61A 1P1RA 3EWSA 3TM4A 3PFGA 4ZRNA 3OI7A 1UOQA 2GVDC 1Y9DA 4FDLA 1FTGA 4KE6A 1PL0A 4RFSB 3QYAA 4F4UA 1E6LA 1ULBA 2WHQA 5ALFA 8ATCA 1E3LA 1KZ7B 4HGQA 3DHEA 3V4OA 4ZVNA 5LB4A 2VNHA 3ZE7A 2R8PA 1TD1A 2ZPTX 3A4VA 4BRZA 1HFJA 2J0EA 1HDZA 4KX5A 3KCNA 2HMVA 3V1KA 4XGKA 2RHHA 1LPAB 2P27A 3NI2A 3OWOA 3S70A 3KVRA 1NX9A 4RPJA 4WLOA 4CG0A 1V4VA 1VDMA 4ZVTA 4B6FA 9LDBA 1L7PA 4NCXA 2W83A 4O8ZA 1BYUA 1KI2A 3N2KA 4YQZA 1T2VA 3B51X 4WKBA 4QG3A 5F5XA 1E9EA 1BDHA 2C0PA 3DPSA 2JIQA 3FZQA 4JVLA 3DB1A 4PG4A 4RLSA 3THOA 5C35A 5GIOE 2XDQB 1MFZA 3H0EA 4QD3A 5AVOA 3UEOA 4EUFA 4EUNA 1NVXQ 4P93A 3VR3D 1C7JA 2FEAA 2ZS8A 2WU4A 1J24A 4G09A 3UK2A 3NVKI 1DEXA 3D8HA 3IB6A 5IASA 1CB0A 2WRZA 4HWKA 1PFYA 3STHA 1W7AA 5DCWA 3JQGB 4ZJPA 5K4GA 2B4TO 1NWCA 1N0VC 2P91A 3W2GA 1WUJS 3M4ZA 4GG1A 2VJCA 3OIWA 1N57A 1IL0A 3K6SA 3TW0A 3GDFA 4LOJA 4OYHA 4GOND 1NN0A 2XUKA 2C0QA 4B4KA 4CEJB 2IP4A 3O1JC 3CJQA 3DF7A 5SZJA 3K16A 2IP2A 2V8BA 1BX1A 3D02A 3R0QA 3UFBA 1K7CA 1NXTA 1NVWQ 1SURA 1GNPA 2IITA 1JLRA 3L2OB 4H7DA 2D5IA 5CVEA 5TSDA 1PFKA 3ZI7A 2BJWA 2HV8A 4H7KA 2YV2A 4AKEA 4G01B 4S2EA 4HB2A 3V8RA 1ADYA 2JGDA 4H0NA 5BUQA 1ETHA 1XYYA 1Y8RB 2B4QA 2Q3DA 2Q6VA 3A3PA 3GJ3A 4MDYA 1LUAA 1LC3A 3DOIA 3UQYS 3QHQA 1YMUA 3U7HB 1Z4LA 1PZHA 3N7UA 3L84A 5LP6F 5BSUA 1BQ3A 5EJ7A 1GPYA 3K9HA 4UFOA 2WWFA 2DM6A 5JHGB 1NURA 1SUFA 3Q15C 2WT9A 4UAUA 4JVNA 4WOCA 1U02A 4EX7A 3BX1A 5LMZA 5KTTA 5HSGA 4DQKA 1HQKA 3IQDB 3HDVA 1IG0A 2W6OA 4OXRA 3M1LA 1NNI1 1SC3A 2O57A 4OREX 2IGBA 4ZREA 4IILA 3UY4A 2XHZA 3FRHA 1PN3A 2ORWA 4OV6B 5FFMA 4HAZA 1UXGA 2KE5A 3IXQA 4PC3A 2DFPA 3C6QA 5AK4A 4BZPA 4ES6A 2V0GA 3IVXA 3NV7A 1ML4A 2VTDA 1UMDB 2MIIA 3REOA 2O7SA 4F21A 2CZGA 1NI5A 1X14A 2W90A 5CPBA 2UXBB 1RPTA 3EVZA 4W1QA 5CEFA 3UMJA 2X86A 3UT6A 4ZI7F 4B40A 4BATA 3PCXA 4WCFA 2BGLA 3HRHA 3KCQA 4X1OA 5FULA 1D1QA 4ZU1X 1IAVA 1T0BA 4TL9A 2EGHA 4EVQA 3KYCB 3VOBA 1G21B 3MAJA 4IY1A 4BNUA 3J80A 3W05A 4IDHA 4LXGA 3DKVA 3HMQA 3LOPA 5K8JB 4IDFA 2NZVG 1EWTA 3T41A 2I4RA 3N59A 5DSTA 5AW1A 3O2QB 5TR9A 2LUOA 2QD2A 3C1OA 4XGRA 1M1NA 3RVBA 1U0EA 3QI7A 1WULS 1F2TB 4ZVUA 3V8VA 5AD1A 3OCUA 4G1CA 2V03A 4N0EA 2YJGA 1W25A 3JVEA 5KOHA 2K2WA 3N0VA 1D7AA 1RWKA 5CK5A 5F1OA 2RCYA 3IBFA 1HG0A 5ECWA 4NDAA 5H7XA 1MA0A 2P9GA 4YP6A 2V7QD 3U1VA 4C6HA 5IKXA 3C16C 4UTXA 4ZJZA 4ZO6A 5BN5A 5F76A 2SNIE 4TQ9A 5CXQA 1W6RA 3U0BA 2PT7A 2GYYA 3FDIA 5H8WA 1JAYA 1JIXA 2DLNA 2GHQA 1UDRA 3P94A 3RC8A 1XVLA 1E79D 2H7YA 1XROA 3M9LA 4L8YA 2WTUA 1SUIA 1KK1A 2ODEA 2KMLA 1XXLA 2YS7A 1N6PA 1EXMA 1P5HA 3OKCA 4OLFA 4CIVA 5KVSA 4XUEA 2XUJA 3FB1A 3QM1A 4OU4A 4CCAA 4DR1B 4EUHA 4EATA 2CMFA 4IXMA 3KV1A 1YQQA 2GI4A 1SC9A 1C1HA 2ZEJA 1II9A 1RRGA 1NUTA 2NV0A 2NIPA 3LPDA 4OGKA 1M7GA 3O4FA 1NQWA 2HU7A 4V02A 2EJCA 4XQGA 3VI3B 4EYOA 5FX2A 2RHJA 3TZLA 2FZLA 3NOXA 3M5WA 3N0XA 5ALMA 1OC2A 4YAWA 2M6LA 1XALA 3TDKA 1MHTA 2W71A 4XCXA 2XCTB 4O4JA 3M6XA 2ON6A 4KIJA 2B21A 2ZJ4A 4UDYX 3MINA 4DDMA 2O8VA 1T0UA 3G0DA 3MIIA 3V4SA 3E9YA 1K5DA 1A9SA 2B30A 5HKKD 5ELXA 1YRBA 2ECPA 3KYJB 1R0KA 2QTCA 4WKNA 2CJPA 5L7WA 1U7OA 3JXEA 4NE9A 1RVV1 4GRDA 2BSQA 5F3DA 5ESWA 2ILTA 3WRXA 3CVWA 4HWTA 4UAJA 4FNAA 1WOYA 5H3CA 3FSRA 2PZBA 3TDMA 3ZIDA 1H05A 3LCJA 4FHDA 4FS8A 4I4TA 4R0VA 3RQSA 3K1AA 4BFSA 1E9CA 1M8GA 4BGUA 4ZVPA 1E3QA 1TT5A 1N7JA 1VLVA 4RNDB 1UINA 1VSUA 2BI7A 1VMKA 2DY0A 1DG9A 2JGFA 4K9RA 3K70C 4MR7A 4YUAA 3E9RA 1PBTA 2AJLI 2Z6QA 1GG8A 1E2HA 1NYLA 5CUQA 5AESA 3VVMA 4BWFB 1T3ZA 7REQA 2MINA 3TW6A 1NYTA 1C1DA 2VCHA 1W44A 5LKRA 1QJ4A 5FOWA 2JIPA 1UPCA 2DUMA 1Q21A 4X91A 4ZCRA 1D8TA 4OQNA 4RK6A 3SYRA 2P7HA 5JCOC 3GG2A 3FOZA 1K0UA 3CE6A 3SIRA 1JQDA 4XXHA 1NFFA 3QWAA 2BFNA 4P4GA 1ZRNA 2HWUA 2GSDA 2QX8A 2NN3C 2QSZA 2CXTA 2VDRB 2JLQA 2RB5A 3IJRA 3Q10A 3U3RA 1N77A 2IXFA 2NU8A 1DJQA 5LZ9A 4Z7QB 1ZN2A 3TLXA 2HDHA 1JXQA 2BZGA 2FN9A 4HMQA 4A6XA 1ZGCA 5HJ5A 5ALLA 1QAMA 1ISGA 1JJIA 4NZZA 3ROKA 1JJBA 5BYAA 5JSZA 5D1HA 3NIFB 4NU0A 4R1QA 4D0GA 1IRIA 3C8HA 5EKTA 4OI0A 5E3JA 3OTIA 4DBLC 5J3JA 3C14C 5FFNA 4EBFA 4BLRA 4AFNA 3GP5A 4AKGA 4ZOBA 1WNTA 4KWHA 1Z45A 1E2IA 2JI6A 3LQYA 1RI4A 3MRXA 4X7MA 1JR3A 1Z6YA 5DASA 4CR6A 1WVMA 2ZUBA 2IPAB 2OLKA 4KTVE 3RVLA 3WNCA 5B57C 2LBPA 1O8CA 5BNFA 3KYBA 2QM8A 3N7AA 4OG2A 2ZRNA 3AVVA 1CUYA 1QQ6A 1TECE 2Z04A 4RHYA 3X2EA 4RQAA 5G0TA 5KSOA 1HZZC 4FYPA 4KR0A 2ZSFA 3X1YA 4D97A 4DLUA 4DN6A 2CVFA 1BE0A 5A5FA 4GI7A 4XJVA 4P5EA 2WHPA 1L5KA 2QKYA 2BP7A 2O1SA 3DE1X 1NYQA 2F1RA 4EFMA 4FIZA 3ZKAA 3LXMA 4IXDA 1UJ2A 1X1RA 1P9WA 3UV7A 4DW8A 5F2EA 4B45A 1ZBQA 4RL6A 3QPUA 2AG6A 2ZDGA 1OHHA 3E2PA 3L0ZA 3O8BA 1SUSA 4M1TA 4TSRA 2XT0A 3AHFA 4BVLA 1CIPA 3CRW1 2Z8YM 1D2CA 3T5GA 4Z7OB 4I6JA 1ODLA 4GOJA 1XXHA 4X1YB 1E2PA 3NASA 4DQVA 4QJ4A 1OTXA 5DB4A 2X8JA 1WZEA 1OGYA 2HIGA 2R6HA 1OH6A 1J0DA 1RM3A 1C9MA 3K4HA 4FD3A 5EIOA 5F23A 3FETA 2OEPA 3LLSA 1Q77A 1WXIA 2CFOA 3GZNA 3MAAC 4I1OA 4XDHA 4ZAWA 4QTYA 2BHNA 4PSUA 3HMKA 1QO9A 1CY7A 1LI7A 4LIPD 1ZKMA 4XVUA 2XE8A 3TLZA 1R1DA 1M6YA 3L7MA 3P8ZA 4BQSA 2R66A 1UKCA 3DFUA 1NSFA 2QJFA 3KZOA 4YRSA 4QRHA 4CF7A 3HGTA 2UVQA 2I2CA 2WZCA 4FIDA 3JQ7B 5LC1A 4D5EA 1R00A 3BIJA 1G5RA 2JJ2A 4GT1A 3DPUA 4PXSA 3NBXX 2YFQA 3O31A 2GUWA 1UMCA 2UYYA 3O3MB 4YMSA 4GZ5A 4QEKA 4QODA 3GFSA 5FLYA 4D4MA 4DPMA 1PLJA 2EKQA 4MQFA 2CT8A 4N48A 4Q3NA 5IYZA 3F96A 2VZLA 2YVAA 4EA6A 3UAZA 1VOTA 3MG9A 2YOFA 1VPDA 2H07A 4ZYLA 1NUPA 2EKDA 4E11A 2JATA 1ZK3A 4Z3DA 1BX3A 1PF7E 4E2ZA 2R1UA 3UXEA 4PG8A 4PNEA 2OPHA 2WB2A 4KWCA 2D62A 1BC5A 1DL5A 3BDAA 4KO4S 2WM9B 4ZVMA 1RWBA 4MR8B 1BVYF 1W93A 5AJHA 1R0SA 2F9FA 5GM2A 2EATA 4ID3A 2XA9A 4CCSA 4EFNA 1P8JA 1R16A 1K6IA 3CVOA 3QVVA 4WIAA 3QEMA 3KYDB 5EL0A 3W34A 4DKXA 1QVAA 5FBQB 1T6YA 4MQ4A 4NENA 3PI6A 2CXNA 4YJ3F 1TTQB 1LSUA