4D8YA

Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in space group p212121 at ph 5.6
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
240
structure length
240
Chain Sequence
GLVPRGSHMSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase deoD-type
publication title Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 86
structure length 240
sequence length 240
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d8yA00
1G2OA 3KU4A 1YBFA 3PNPA 3C74A 5KB3A 1ODLA 4RJ2A 1Z33A 1K3FA 1PK7A 1B8OA 2RJ3A 1PR1A 3MB8A 4LDNA 1A9PA 4BMXA 5F7OA 1Q1GA 1ULAA 3T94A 4EB8A 1PWYE 1TGVA 1VFNA 3LBAA 4TXMA 1JYSA 4DARA 3KUKA 4DANA 3DDOA 5EPUA 5CXSA 1OUMA 1YR3A 2A0YA 1JE0A 1A9TA 1Z39A 1T8RA 3UT6A 1M73E 5JPCA 1PW7A 1ODJA 2ON6A 4D9HA 4DAEA 3BL6A 1Y1SA 1YQUA 4F3CA 5CYFA 3K8QA 5CCDA 2QTGA 2AI3A 1PR5A 4TXJA 4JOSA 1V48A 4M7WA 4DABA 1SD2A 5ETJA 4OGKA 1PBNA 1V4NA 1A9QA 3E9RA 4WKOA 1T0UA 4YNBA 2IQ5A 3TL6A 1RXCA 3KVRA 2A0XA 1Y1QA 5B7PA 4LKRA 1JPVA 4TS3A 1NW4A 4LNAA 4JWTA 3OZBA 4MCIA 4F2PA 1Z38A 1PF7E 3O4VA 4TS9A 5F7ZA 4L5AA 3DPSA 4WKNA 1LV8A 4DA7A 4YO8A 1OVGA 1ECPA 4EARA 4M1EA 3F8WA 3O6VA 5EFOA 1RYZA 4PNPA 1JDUA 1PR2A 5C80A 2A0WA 3OPVA 4BMYA 1OU4A 4TXHA 2PGAA 4GMHA 2BSXA 3INYA 4IP0A 5IFKA 3K8OE 1CB0A 1VHJA 1Z5NA 3BGSA 5CXQA 3NM4A 1YQQA 2OECA 4D8VA 1PKEA 3OOHA 1RCTE 3NM5A 3FB1A 1RXUA 4BN0A 3E9ZA 3OCCA 2QPLA 1T8WA 3EUEA 2QTTA 1V2HE 4DAOA 4PR3A 4TTIA 5K1ZA 1Z5PA 5EUBA 1LX7A 1U1EA 4QASA 4P54A 1T8YA 1ULBA 2I8AA 1PR6A 1K27A 2QDKA 1TCUA 5DK6A 1A9SA 1VMKA 1Y6RA 4L0MA 3DF9A 1Y1TA 1U1DA 4F3KA 1K9SA 1ZL2A 3PHCA 1JDTA 3QPBA 1VHWA 1ZOSA 1Z37A 3OF3A 1RT9A 5IU6A 3FUCA 3ONVA 2HN9A 1U1CA 1Z35A 3DJFA 1PK9A 3SCZA 1U1FA 4GLFA 1RXYA 2I4TA 3UAYA 4R2XA 2HWUA 4JP5A 3OOEA 4ECEA 3DP9A 4KN5A 1Z36A 3UAZA 4NY1A 2OXFA 3D1VA 4M3NA 4GLJA 4L5CA 1N3IA 1T8SA 4OEHA 2HRDA 3FNQA 4OJTA 4OY3A 1V3QE 1Y6QA 1CG6A 3OZDA 4LNHA 1PR0A 1JDVA 3FAZA 4L6IA 3KVYA 3UAVA 1V45E 2OC9A 1A9OA 1A69A 4QATA 4WKCA 2GUWA 1RR6A 2OC4A 5CCEA 3MMSA 3EEIA 1JE1A 4GKAA 4DA8A 1TCVA 1ODIA 1OV6A 5F76A 3U40A 3FOWA 1XE3A 4WKBA 3GGSA 3EUFA 4FFSA 1NC1A 3KVVA 5B7GA 5I3CA 1WTAA 4BMZA 3PHBE 3ENZA 2XRFA 4YJKA 2Q7OE 1TD1A 4UC0A 1ODKA 1OTYA 3E0QA 3UAWA 1LVUA 5B7QA 1JP7A 5FAKA 1RFGE 4TTJA 4E1VA 1QE5A 2A8YA 1SJ9A 4QAQA 1NC3A 1SD1A 1RSZA 3PNSA 5F73A 3GB9A 4D98A 3NBQA 4D8XA 3EMVA 4TYMA 1OTXA 1I80A 4G89A 4NSNA 3BSFA 5B7NA 1Z5OA 2AC7A 4QEZA 4TXNA 4YMLA 3BJEA 2HSWA 4R2WA 4H1TA 5F77A 5F7XA 1JDZA 3IEXA 3UAXA 2P4SA 4I2VA 1FXUA 2AI2A 4F2WA 3OZEA 1B8NA 1RXSA 1YRYE 4WKPA 1TGYA 2QSUA 4DA6A 1A9RA 4L5YA 3P0FA 1PR4A 4MCHA 5F78A 1U1GA 4NS1A 3LA8A 4R31A 3ODGA 3LGSA 4LZWA 1Y1RA 1SQ6A 4D8YA 1Z34A 3IOMA 4TXLA 5F7JA 3FWPA 4U2KA 5CYGA 4G8JA 4OGLA 3P0EA 4MARA 3NM6B 4TTAA 3OZCA 3KHSA 4K6OA 4QFBA 1V41E 2AI1A 1JDSA 2B94A 4X24A 4DA0A 4QARA 2H8GA 1C3XA 4F1WA 4G41A 2ISCA 4OF4A
chains in the Genus database with same CATH superfamily
3RODA 4BX0A 1Y0BA 1T5SA 3ESRA 5A4AA 2QAGA 2BBTA 4L6CA 1PTJC 1HETA 2E18A 1IJKA 1NY5A 1PG5A 3P19A 4LSGA 4QHYA 3CG0A 3ZGZA 5I7HA 2ANBA 4AMBA 5HTOA 3PPVA 2OYCA 3EPLA 2WHRA 2I03A 3KHKA 4E4RA 4LFAB 4Q00A 1XDZA 2ENUA 2FFQA 2W37A 4DIOA 4E2XA 2J45A 2EKBA 2OVBA 2BM0A 2IEBA 3CGWA 1NQXA 2B0JA 3UM9A 3L01A 3IQEA 4G1MB 1QOZA 2REBA 3TNDA 1KOLA 4EAAA 1SHUX 2IOHA 1JI3A 4O3FA 2EDCA 1M1NB 1TGVA 4G37A 5DRYA 4BEVA 4CETA 1ZCJA 3W04A 2C9CA 3FXAA 3UNXA 5FOTA 3PNOA 1SIWA 1E3LA 2WWRA 1EE9A 2R4QA 2ZRMA 2AR7A 2J9GA 4OAQA 4DMKA 4WD3A 3OH8A 1VLJA 1I2MA 2EWMA 2YNMD 2EEZA 4MPPA 1F48A 4UHKA 3ST7A 2C57A 3DDOA 4KGVA 1IG3A 3TZHA 4UTNA 1WXWA 3L4BC 1MGPA 2XT0A 1XJWA 3S40A 4OP3A 1K8RA 1AN0A 4IHJA 4TZKA 3EY4A 3LBHA 2O2ZA 2VVTA 3C45A 1QH8A 4MP8A 1Y6GA 2GAIA 5C1IA 4QDOA 1GU7A 2DRIA 3QI2A 4LDRA 2UKDA 1ONOA 3D3QA 4G25A 4R8KA 4KIFA 5D87A 5EAIA 2TMDA 3LWNA 3RU3A 5JPCA 1GGMA 1V5IA 3PHGA 1A5AB 1P0QA 4BTVA 1Z5VA 1KWKA 3BMQA 2GPTA 2YVAA 1YE3A 4OI2A 1JNYA 5FTWA 2HCRA 3HNOA 3LYUA 3KXKA 3CVOA 4ILEA 1MQAA 3K0EA 4GL4A 3RSOA 5FEUA 1M6WA 1OROA 2EF1A 2GBCA 4US1R 3OOYA 4V0LA 10MHA 1P4GA 5EIBC 3FKSA 3QUSA 3B6EA 3T3EA 4PQGA 1O7JA 2HD4A 2P0YA 5TQVA 5E3HA 3A3NA 1RM0A 4QELA 5THKA 5CFLA 3SSMA 3RJTA 2BBSA 4B5KA 2OFWA 4M7WA 2YR0A 1ZBQA 2JHGA 1J2YA 5BUCA 4FFBB 1W59A 2VHZA 1SD2A 1TJPB 2X0NA 4P7GA 2O5RA 4HB4A 4L2IB 1TB4A 1X7HA 4BP1A 1G8HA 3FOFC 1E7WA 4WQMA 2WHPA 3GLVA 4D4JA 2F4VB 2H48A 2HY7A 4OFXA 2VWQA 3F5FA 4ARUA 3EISA 4MRMA 4HJXA 4QUJA 4UOZA 3ZJUA 3HO6A 2V5AA 3KKLA 5DB4A 1V26A 3SIXA 5BQFA 3RUFA 3KLMX 5C1PA 5EZ6B 5B7PA 5JSZA 2ZDHA 4EELA 1KEWA 2ODEA 2VJOA 3MTEA 4JI6B 5D3KA 1AO0A 4E51A 2XTMA 4NQZA 3GBSA 4OBXA 5PGMA 2AOUB 1N2EA 1T6ZA 4BYGA 1HEYA 4GLBA 4QYTA 3ASYA 2O8DB 1X9GA 2VSYA 1K4YA 2IPMA 2FPPA 4UQPA 2H2WA 2DX7A 3T3MB 1TU3A 1G6OA 2B98A 3COJA 2HA4A 4G0VA 1S9DA 5EWLB 1YNSA 4FMCB 1EK2A 1L4YA 1PF7E 2BIFA 2FP3A 2QMHA 3AEUA 3M70A 1JG2A 1JXMA 3P9NA 4YDSA 1ZIDA 2V3VA 4CL0A 2JK0A 1WLYA 1ECGA 2VNJA 1PQUA 4HAYA 1M76A 2YMQA 3DMTC 4PZDA 4XGRA 1BQ4A 3PXUA 4Y9RA 3DEYX 4MI9A 1DO8A 2FW1A 1JLSA 4UVHA 5BW4A 3G0OA 3ZNPA 1C0IA 1XTUA 2C92A 1RYZA 4FGUA 2PFGA 2HQSA 1JS1X 3IDAA 3P9RA 4PPGA 2I4RA 4UW9A 4HQRA 2EF0A 2DMRA 1PR2A 2P68A 3GCXA 4KK4A 5D7BA 3IODA 4R1QA 1TKAA 2R00C 1K08A 3UK1A 3PQ3A 3AUYA 3R7DA 2O0KA 1EA5A 1M1YA 1EKXA 2Y8EA 3AK4A 4DQKA 3ON5A 2EW1A 4DBLE 3U16A 1MFZA 5LZ9A 2QTCA 3DCNA 3N0TA 1R8YA 3SJZA 2GPSA 4Y6GB 1QDEA 4ZANA 3U7IA 2PBLA 5JARA 4D4KA 1LY1A 1UAGA 2OCIA 4MPRA 5EIBD 1ZZEA 1M5RA 2AIRA 1ADBA 3MHTA 3KNZA 1PNVA 3KT6A 3UANA 2JAOA 4IVNA 3VYSB 2QQGA 3EGIA 3F0TA 1POXA 3LX8A 3PICA 4XCXA 3PFBA 3V6MA 1W1WA 3QYJA 4EPYA 3DNMA 1DWOA 1XVUA 2BRUC 4V0SA 3EQ6A 1P4RA 4CF4A 4Q9NA 1QH0A 1WHTB 3IUBA 5IYZA 2GHRA 4G4IA 1WD7A 2HA7A 3VKUA 4FLMA 1XTKA 1W0KA 2G70A 2GPWA 4HN9A 4RIFA 5HK9A 2GPYA 4IV0A 2GPBA 1EVEA 1UXIA 2JHPA 2V8OA 1J6UA 2W6MA 3MILA 2IXAA 3OJLA 4K5QA 1WQ4A 3NM5A 4J03A 4Q02A 1UJNA 1AKUA 1XEWY 4S24A 5AI8A 5DYGA 5CFOA 3ZZNA 2WFLA 2FAXA 4OHPA 1JQLB 2D7CA 2IW1A 3F3KA 2I5PO 4KV7A 4S2EA 3WL6A 4PR3A 1KIFA 1UXHA 4TTIA 3BXHA 1DG9A 3C1OA 3NHMA 3Q0EA 4QOEA 4RVNA 1YQEA 5DNWA 1G55A 1XROA 1ZINA 3WB0A 4NDZA 3WIOA 4Q7LA 1SCJA 2CCGA 2RHRA 2R6CA 3FUVA 4NCJA 5FUMA 3W6UA 1RAHA 3MTGA 2QNBA 4L50A 2WLTA 3H4TA 2WJJA 3L84A 5H3CA 2RCNA 1ZR2A 3N3AC 2OO7A 5FI3A 5TB5A 2BGUA 1T4MA 2JLSA 1XT6A 3ND7A 2V03A 3U26A 5AJXA 2WAAA 3V8PA 4AWBA 1CEQA 3ELBA 4GMKA 5DTRA 2WZBA 1BVRA 4MQ6A 4ZAFA 2B1QA 5E9AA 1P3DA 2FY8A 1RJ9A 1Y7HA 2BHNA 4MQEB 4QSHA 3QP9A 3NNSA 5FUBA 4NXNB 1A82A 2N46A 4MJ3A 3WQQA 3HVRA 2V1UA 1E5VA 1G7CA 2PBRA 3DBHA 4YVFA 1VHWA 3ZYZA 1TT5B 3WGOA 2FN8A 4HAWA 4H6WA 2G8LA 1NFQA 1RQ7A 2FUG6 2H1LA 4IWNA 4NENA 3TRJA 5KDOA 4CXMA 4CG3A 2NVUA 2XKKA 2Q5IA 1M7HA 1QH8B 2ZANA 3WTCA 1QF9A 5IUJC 1U1CA 2XKBA 3AY0A 3QFHA 4EJ2A 3ESAA 1Z68A 3ESBA 2WF8A 4J1QA 5AKHA 3NEYA 4XVQA 4U3JB 3WGUA 1UMDA 5KTOA 1TJ5A 4Q03A 4V24A 1C7RA 1YUNA 4J3JA 2GBFA 2I4TA 3UYKA 1H23A 2J4DA 5DM70 1FA9A 3LXRA 4PLWA 4R2XA 1MZPA 4FE4A 4XPIA 1TJ3A 2ZBEA 3O8RA 2E4VA 4R68A 3GZTB 4C14A 4CG1A 3FR8A 2ZVQX 3OEEA 3NS7A 3QVLA 4NG5A 2EWWA 1CW2B 1X1EA 2CNNA 3UWSA 4YRBA 2Y1DA 5IP5A 1E2UA 2ZJOA 4J1TC 2EKPA 4B7UA 4YCCA 2JF0A 4L07A 3WB9A 4P4TA 1P0FA 4F2HA 1VKZA 2XWBF 2RK6A 2N47A 2WPDA 2XDQA 4A36A 2OCYC 1T4CB 3SYTA 4K6GA 2R86A 2IZZA 1UKAA 4TMFA 2DVMA 5AJZA 5DISB 2H1WA 3N8DA 3V4LA 2GWHA 2NXEA 1E61A 4Y9TA 1Y6QA 1NUAA 3I9LA 4XSGA 3MOGA 4DLYA 4LNHA 1PR0A 3DMNA 4HVTA 1T3GA 5AXDA 3N2KB 1LDBA 2DEUA 3QWIA 5I7AA 1JJVA 1CBUA 4D26A 1OBVA 2CNBA 3F46A 2DF8A 1U0RA 2BSAA 2COEA 3BL8A 1J23A 1QG4A 3EMDA 3K0CC 5ERGB 3T1OA 2AKAB 3PUIA 2ZRCA 5JSZB 2ORWA 1G5HA 2DWQA 4L6IA 4PS1A 1P6XA 4YP9A 5GVRA 3UXHA 2WAMA 4IZIA 3GRFA 1L5FA 3V7YA 4BNIA 5LZ8A 1FBTA 1RMQA 2OK8A 4G1BA 2OCBA 3B1WA 3FHOA 4TKZA 4D4MA 3A6JA 1FTGA 1OFUA 1X87A 1PDOA 2F8LA 2GBGA 3FWKA 3HCPA 2HA5A 1BHQ1 3L77A 3C3KA 2QY9A 4O5OA 2O52A 4XWTA 1JGTA 2QJWA 3UV7A 4XGIA 2C2HA 4WTOA 3SY8A 5FH9A 2Q3LA 3AVYA 2OC4A 1H2AS 3GN2A 4C7OA 3OQPA 3OCXA 1HQYE 2VJKA 2ZIEA 1B23P 2HHHB 4IHKA 1QC5A 1XMXA 1U8YA 3C8MA 3E2MA 3ZHOA 2FW6A 2QUKA 2QMUA 4B76A 4HN2A 5DRTA 3FYUA 1MLDA 4IICA 5T67A 3STVA 3RYTC 2O8FA 2FA9A 3W6OA 4YMGA 1L5QA 3Q7SA 3UOGA 2YJ4A 3H83A 2IU3A 2D62A 1RVV1 1LPBB 3AI7A 1L5KA 3K15A 3EVFA 3P32A 3QPWA 2H85A 4FNMA 4F71A 5A4MS 1SBIA 5HE8A 3S2IA 2P2LA 2AEFA 1GUYA 3QOFA 1PRYA 3QJ5A 4YCBA 3EEBA 1HI9A 3RO7A 4HDCA 2QMYA 5IDXA 1W8DA 4Q4JA 5AW5A 4MGZR 2CXXA 2BF7A 3L2OB 2DC1A 4WX2B 4BWFB 1WZCA 1YB6A 3BE5A 5LQNA 1A76A 1SCUB 4L5BA 4UUPA 1NJFA 4XD2A 1MB2A 2GESA 2XQIA 1W44A 4C7JA 1VECA 3W4JA 3PGA1 3SBEA 3ZIDA 1FB5A 5HMLA 4H7JA 1QK5A 1OZ0A 3BAFA 5EMHA 5CHYA 5DNCA 3PDHA 5AVVA 3VC1A 4B3FX 2WU8A 3F4BA 4LI0A 4FHEA 5AKJA 1QP0A 3GU3A 5IYZB 3WKEA 3KTOA 1EQUA 5A5EA 3N0RA 3FOCA 5JCJA 2PKQO 1EK1A 2QXTA 4H1UA 2ZCJA 1XRSB 4EHDA 4LK2A 2YWEA 2R3SA 3DE1X 2VKQA 3GNLA 2CXTA 4Y6RA 4F4IA 3I5MA 1C0EA 3OTQA 2IU0A 5COAA 3CX3A 4NABA 3I4LA 3TRIA 3TW6A 1I7QB 3KDAA 2WE8A 2WABA 3L7LA 3BJZA 2GN1A 1SOVA 1KPHA 5EXTA 1IDN1 1RZ3A 4G5OA 4MVJI 1C14A 1B73A 2X4LA 3IHWA 5F52A 1ZRNA 5A4FS 3SVTA 1O9GA 2AEEA 3G9UA 2F1HA 3FNBA 5H83A 5JJBA 2CT8A 3EXHA 4B09A 1RCUA 3ECCA 1XHEA 4HTFA 4WZ6A 5LQSA 2V7UA 3WLIA 4PGHA 4ITRC 1X1RA 2HJWA 1D1SA 1B74A 3QSGA 2OHXA 1M5UA 2VYCA 1QRRA 4V0QA 2BJWA 2BFMA 5G1PA 1TRHA 2RFLA 5DHRA 2OXRA 3A3YA 4BTEA 1B4DA 3MHPA 5EMLA 3NBUA 3ZE9A 5EP4A 4D0LB 2AN9A 1KOJA 1ZWLA 4MV5A 4NL4H 4B3CA 3VAAA 1YQXA 4O4IA 3RRZA 4ZEMA 3KX2A 1NP3A 4D82A 4XR9A 4LRYA 5KO2A 3TUZC 3FHCB 4NH4A 1FXUA 4C4PA 3PLAE 3WL8A 3N2LA 1WZUA 2R8ZA 3EN0A 4MPDA 5JAOA 3L6EA 3SDZA 1K2VN 1Z0SA 1F14A 1YQGA 1O9HA 3TQRA 1KAMA 1SRQA 2F67A 2QZ9A 4GZ5A 5FOWA 2RBGA 3VH3A 4TQUS 1MJGM 1BXZA 1NFFA 4P08A 4WINA 3V8RA 1A72A 4UHDA 2SCUA 2ZE8A 2ZVJA 3SYRA 1M0TA 2IK8A 1RZRD 3E3LA 1KEEA 1QCCA 2ZUBA 1M8FA 5GOTA 3TR6A 3KQLA 3CNOA 4EZIA 5KTRA 2QEQA 3BVPA 4RZIA 1GCUA 2H3EA 3CH4B 3IBGA 3WGMA 2R5NA 3A1TA 3U4DA 3UJDA 3RG2A 1G66A 1FTSA 1QS0A 1NR5A 3V48A 1JBEA 4RHXA 4YXWA 2JG3A 5F35A 3N0XA 2C2WA 2VJLA 2WLSA 1MX5A 5AW0A 2Q3HA 4LBZA 1V8PA 3R44A 5KNCD 3H75A 3LGSA 2OZPA 3ND9A 3FYSA 2AS0A 4RLSA 2OCLA 1T6XA 1Y8RB 4H3KB 4YV1A 1NXSA 2QY6A 2WTAA 1E9CA 2GTPA 4GHWA 4UVGA 5FJIA 3SSAA 1L4HA 4URZR 4YQFA 4I4CA 5JH7A 4IFBA 2EFJA 4C4AA 1AHNA 1F51E 2HJRA 2FSIA 4RKFA 4MPJA 1MOQA 2HLHA 2ZXFA 2R6GA 4N9QA 1LXCA 3IERA 1YS1X 1HMPA 3MBIA 4HQ0A 2PJUA 3CF4G 3NLLA 5CB8A 4LXGA 3ZGXA 4CU5A 2A2ZA 1YVEI 3ZWXA 5CCBA 1ODSA 3EQ2A 1L6IA 4ND6A 1V6SA 3P0EA 4RH1A 3TCKA 5BW5A 1F3LA 3OEHD 1TQHA 1MXFA 3O92A 3HJAA 1YHYA 2GAJA 4QWMA 1VL8A 3SZ3A 1LI7A 2EBUA 1YJQA 2AG1A 3IUJA 4MVJM 4B3IA 3HR4A 3W8RA 4FGLA 4XDHA 4RTLA 5D3MB 3DAYA 3LQQA 5IVIA 1FX0A 3P9SA 3HA5A 5GMOA 4ZI7F 4B8YA 1QK3A 1ZCBA 5ECWA 4C7OB 5B3KA 4G8BA 1DBQA 2F90A 5L95A 4UXHA 1Z2EA 1XLTA 2R47A 2X8JA 3I6ZA 3IPCA 3T7EA 1WB5A 4DM4A 3M9XA 4ZVSA 1O96A 3V4VB 1JHPA 3EGOA 2E2WA 4R81A 3IKVA 4M0LA 2M6KA 5HPYB 4D5EA 4LS3A 3K9QO 1ZUNA 3N70A 5DNDA 1YFZA 4EYEA 3CB2A 1VE5A 1SCNE 2WD8A 2ZAOA 2O8FB 1Y9EA 1QAQA 1J0XO 1BO6A 5ALEA 4ZQBA 1TI7A 3KYCA 1XZBA 2XQGA 1ENYA 3N59A 4PFQA 3KU4A 4ID9A 1QE3A 3ISTA 2O3SA 5AKYA 4MS4A 4LDPA 1OSNA 1UBGA 1VA5A 2MSCB 2O8BB 2VBFA 3CEAA 4UUAA 3RVQA 3E9CA 5L6MB 5AI6A 4FOPA 3WI7A 3BWDD 3JATA 4JKIA 3QELA 3QPCA 4N65A 4JP8A 3VJKA 2V45A 3MMNA 2BFEA 1M72A 1PK7A 2ATVA 1BW9B 2HUPA 3FNFA 1ZXXA 4WK6A 4WOKA 4Y2QA 1SC6A 4EM6A 4Q4JB 2CMHA 1PJQA 4I55A 4ER3A 2Z5VA 2Z3WA 3KSBC 1W36C 2H7XA 4KGDA 4ZI2A 3WGIA 3QLVA 2UYYA 5THQA 3SEQA 3B9PA 3MTJA 4YMTA 3T94A 5J2TA 2XB4A 5BN5B 2IIPA 2RGEA 1SVKA 4HXGA 1D2CA 4N5IX 4KC0A 3ZUPA 2YWRA 1OAOC 1TM2A 1XQVA 4DR4B 3BKWA 5JT1A 4P84A 4DANA 3MEQA 3ONDA 1FYEA 3JALA 4JR1A 2WMYA 4PZCA 3TMKA 1W96A 2FR8A 2ZFUA 3H17A 4WLUA 3D54D 5K0SA 1AZTA 1GT91 1WF6A 1YR3A 2KMLA 1R9JA 4OHZA 3G2KA 3GH3A 4TN1A 4YRQA 4CQMB 3EFHA 4FTWA 1JE0A 1W2WB 3OIWA 4KDFA 2F1IA 4K9OA 1Q6ZA 2XUAA 1LF0A 2A7XA 3ANTA 3IPAA 1Y5LA 4U7HA 3TOVA 3K94A 2IUUA 2YC2C 3V1NA 2VK8A 1ZS9A 3UHFA 4FWTA 2D59A 2IEZA 4YRAA 1N6HA 1KS9A 2NZYA 1R6VA 2I9PA 2ZIAA 1ZKMA 1JVBA 3TQOA 4B43A 2PAFA 5BV1A 2ZW9A 1Y8CA 5KDLA 4M1KA 4DAEA 3BL6A 5BSHA 5BT8A 1P7ZA 2C78A 2DUJA 3NXKA 3ZV3A 1PNRA 3MS7A 3IFSA 4K2AA 1JR6A 1YQUA 3SSNA 1S3SA 1ZC3A 2Z9CA 3K8QA 4NPAA 4O0MA 3G89A 3OM1A 4GRAA 5J47A 4HXFB 2RGYA 1YR2A 3O83A 1LSJA 1YCGA 2IYPA 2E4UA 1YZLA 1OYVA 1ZEMA 2Q5EA 3D7RA 3ZXYA 3QUAA 4KQFA 1NW9B 1FK8A 3HKCA 4BFUA 3SQNA 1B2LA 1N0HA 1IHDA 2GNPA 3EC7A 5ETJA 3GRKA 3UIEA 1I6KA 3LT5A 4NYJR 4JOBA 1PBNA 2WYHA 3LFHA 1U8CB 4IGAA 2PUWA 4LMAA 4MWOA 1IN6A 2BD0A 2Z2IA 4LI3X 4Y6PA 1FFBA 3S1SA 2IEIA 4D7AA 1P2SA 1XPUA 2XODA 3DQPA 4E5MA 4MR8B 1WPQA 1N33B 3K9NA 3B1KA 4KPEC 1CY6A 3DEZA 1DX4A 1Q0HA 1ZHOA 1KF0A 4KR2A 2W58A 3NHLA 2G08A 3LDGA 4WFIA 2J9FB 1UWLA 3C7TA 1NW4A 3PIDA 1TIKA 3DXZA 3QYPA 4R41A 2YUTA 5LN1A 3BQMB 4CT0A 3JQ8B 4ZIRA 2ZYVX 2D1QA 4AP9A 1EM6A 1E0JA 3G9TA 2CKMA 5EFZA 4DBZA 1DZ3A 2HLDD 1LRJA 2DWCA 4JBIA 4NBRA 4DA4A 5C7YA 3MBKA 2OGWA 1TYCA 3U61B 1H5UA 2NSDA 1GRCA 1WZNA 2JLUA 2DU8A 2GLUA 4X6YA 2XADA 5ILOA 1OVGA 1KBZA 2BTQB 2WM9B 1HFEL 4IIJB 2FPXA 4KQEA 4LMRA 4TMYA 4OXRA 1AMUA 1DKOA 1KEVA 4DIFA 4CIDA 3INNA 5KJFA 4GKKB 4BB9A 3I8OA 4L4RA 4DWOA 3I2FA 4U2BA 2QK4A 1MAWA 3LPNA 4P5PA 1K75A 3O47A 5F2OA 1NJ1A 4CG2A 1OASA 4M53A 2R65A 1CUWA 1Z83A 3Q40A 1P1CA 1YKFA 4MKXA 2QX6A 1T2DA 4GM1A 5C0OE 2DAPA 1J25A 2PH1A 4JL5A 4AX8A 4CJXA 4OQPA 4RTQA 1RYMA 1P6QA 2RH4A 4NMWA 1R4MA 4LE2A 3W90A 1RNLA 1ZEJA 2OBMA 2GNOA 4W8HA 4R0NA 4CL8A 2E48A 3NAZA 4DMGA 2VO1A 1C0KA 4RTMA 1QV7A 1M3SA 3K8OE 3NRCA 4OGFA 1KJWA 2VJQA 3KLBA 4OJNA 3TUJC 4A2QA 1GZ6A 1H2EA 1JQJC 2J5KA 3PC2A 3NOXA 3F7TA 2V9PA 3MCAA 4BNFA 3LCJA 8AT1A 3C6BA 4QM6A 3L8FA 5J4HA 1RQGA 3HXTA 3KQOA 2VPWA 2CFOA 4QXAA 2QMOA 3U4GA 4E12A 2N42A 5AI4A 4GYJA 1G98A 1Y37A 2FSHA 3BK7A 1XRQA 4WESB 2JGAA 2EYUA 3H2BA 1PKEA 3T3PB 2A67A 3I2GA 1W73A 3GUCA 2P2YA 4FDUA 4YHBA 3KYCB 1ZMBA 3ETLA 3GRPA 2C03A 4I9FA 2GCPA 2JIZD 3GVHA 4DAOA 3HG7A 3DDSA 3PEUA 4LZAA 1WJGA 2UU9B 1RJGA 1UL1X 5FIUA 3TZLA 1G16A 9LDTA 2ZIVB 3EEYA 1CY2A 2GKGA 3GJ8A 1AK9A 1FVXA 2BMJA 4FYMA 4HDRA 5T8KA 3TFWA 1O54A 3NRBA 4XQ0A 2D1FA 1AV7A 3NCTA 3DZFA 4HV4A 2GEBA 1K27A 2O2JA 2YBDA 3I92A 4QA9A 5CFZA 4MDEA 3T1VA 2G40A 4K05A 1A9SA 1LA2A 2IKSA 2NU6A 3AKZA 1R5OA 3BCRA 2A88A 1FJHA 1NBOA 3KEMA 1B41A 3C3WA 3DFZA 1SIUA 2NU9B 4G1FA 3QI7A 1J90A 4RSGA 3DBRB 2ZRAA 5TQJA 4DM3A 5KBYA 2ZSAA 2UXBB 1KO4A 3G68A 4QULA 2IYFA 3SF8B 4Y2VA 1FQJA 1Q0RA 5ALKA 1H94A 1VHDA 3KSRA 4ZDWA 1DKRA 3SR4A 1RT9A 2IVFA 1BQ3A 4KE7A 4ETIA 2QLMA 1PGOA 2IYQA 1XWWA 5EE3A 1ZHFA 3ONVA 5JRDS 1EVLA 3IBSA 1KI1A 4TVOA 5FNZA 3O21A 4XM0A 4BNZA 3T99A 1UXKA 1LC3A 3C14C 4LTNA 3C3CA 4U63A 5CH5A 3UMFA 5JALA 3DG9A 3BFXA 2OM6A 2B4YA 1MFPA 4CWAA 3C6KA 1SD5A 2XWJI 3K9LA 3ZGLA 5I7FA 2FTKE 3WS7A 1NQTA 3TQFA 4KPUA 5B53A 3GJXC 2WTXA 3C85A 3L7MA 1DO2A 5AOCA 3WSWA 2HDHA 4LOJA 4PTZA 2ZETA 2ISSD 2CXRA 1SXJE 2ZR8A 2HPZA 3M7IA 3QVVA 4IM7A 4ZHQF 5HIKA 5I9NA 5KUTA 1VKHA 3DAFA 4I5DA 3USCS 1Z7WA 3CM0A 4JU9A 4G23A 1XCBA 2CJFA 4YT2A 1YR6A 3L4KA 2XNHA 2YJ6A 1N77A 1UBOS 1U98A 1VHLA 3HU5A 3GG9A 3PI6A 2JGDA 5C9ZA 2ZM6B 2PWPA 2WUVA 1T8SA 4UHJA 5H1YA 3L7OA 1KFCB 3U5ZB 2YNMA 4NVRA 4OXXA 2A59A 3U81A 4A8JC 1JZSA 3EGWA 4IUYA 3FNQA 5TT1A 1DT3A 3V8MA 2QV7A 4ZEXA 1SH7A 4RULA 4HUTA 3TW0A 2NMVA 1R0KA 3IJPA 1I1HA 2O3TA 4NZPA 1GG9A 2FWMX 4M0MA 4GNRA 5CB0A 3ZJTA 4TTSA 3CYFA 4KR6A 3GMTA 4YV0A 3BXFA 2J33A 4OO3A 4MYSA 2AFHA 3L7CA 3BM5A 4K9LA 2UXCB 2A5FA 2PLRA 2SNIE 4Z8YA 2J87A 2V54A 3WV5A 1NMZA 3B70A 5EYPB 1E9FA 4WA7A 1O95C 1UINA 2I2BA 2QA5A 1S01A 2GM4A 3R7AA 2FX5A 1JU9A 4HF7A 4K9PA 2NVOA 4NOJA 3OQOA 3G2IA 5F9HA 4YCJA 2VQSA 3KAJA 4KMMA 1WV1A 1YS2X 1AS2A 3GJQA 2O0HA 1KRHA 2M2IA 1T2NA 4J0JA 1UJBA 4K1XA 2N3ZA 5ALIA 5TGZA 3WJ2A 4TT8A 1CLEA 1JXAA 1NFRA 1QBGA 3A11A 3C3BA 3HDQA 3UC9A 5AVWA 5SZIA 2PKWA 4KJZA 3RS0A 4WSOA 2HL6A 4XDGA 2PWAA 2PX4A 1TRKA 2NW6A 4QTTB 5FUYA 4HNRA 3ZCQA 4MUXA 3N2EA 4PAGA 3G2HA 1UPXA 5IJWA 1X1SA 1EXVA 1VSQA 3GLHA 3NT4A 5AOBA 2Q4RA 4W5OA 2QR3A 1K6MA 2ZITA 1CJVC 3LUPA 1XU9A 4WWHA 4BNDB 2VTVA 4RD3A 3M1YA 5E6SA 4PM4A 1PTJA 3P27A 2RHGB 3DHVA 2OFFA 3FOWA 1GNQA 1NONA 4XYMA 4FFSA 2ZVDA 3A32A 5ICGA 5KI6A 2SBTA 2VDPB 1IEWA 3KXLA 1IBRA 4FT2A 4DSUA 5B7GA 5IKOA 4JCOA 3QTBA 2PH3A 5D3ZA 4K9QA 1ZGCA 1T2VA 4CR7A 4NMLA 2IW3A 1NG1A 2QTLA 4KQWA 4WECA 5SZJA 1CJTC 4ZZ1A 1BVYF 4WK4B 4KGXA 1R8JA 3DQQA 1RLIA 4HBZA 4KDEA 3RIXA 4AICA 1K7EB 3SDSA 1YMQA 3L1KA 4FNAA 1N3BA 4XASA 4EPWA 4BLQA 4EGJA 2BFPA 4DQXA 2GF0A 3D5QA 4YJKA 2ZCVA 1LLDA 1KQFA 2QD3A 3ET5A 3P9XA 4TX1A 2ZB3A 3TX2A 4MO9A 3L4BA 1UBRS 4IFEA 5JS6A 5DTEA 5BNWA 2IPAB 4MRVA 1YJ5A 3QEMA 4HRXA 2W6ZA 5EINA 2GN4A 1FSSA 4P80A 3EEQA 4XQCA 4J6EA 5T4BA 1T0HB 1RE0A 3HUEA 3TTWA 3W8FA 3ZWOA 3UJBA 5KNCH 1U3CA 4GP6A 3KLNA 3UJ9A 2ZRKA 3JX9A 4YMUA 1ZD3A 3RBZA 5CYPA 3IULA 5F64A 1TUBA 2L19A 2XA1A 4ZDJA 3PXDA 2I80A 1RP7A 4OHRA 3UVEA 2CYCA 2J5RA 1NC3A 1TECE 3BMNB 4DT1A 2Z8ZA 2SHKA 3K7EA 1S2OA 3Q8WA 3BFPA 1XMPA 3WJ7A 1ZFNA 5K0JA 1MRZA 5JO0A 1I0ZA 5MN5A 4R83A 3U5TA 2OPBA 4MHSA 2I29A 4TM7A 5IX8A 2LTAA 1GR0A 4Z54A 4TUYA 5JI3E 4GPZA 5K3CA 2ZRQA 3FA2A 2PGLA 3V8QA 1XPRA 2BJVA 1S3FA 1MAUA 1EDEA 3ETHA 4PC2A 1BMDA 3TGPA 4N0DA 1Y6FA 2GH1A 1POWA 3M33A 2O54A 2IYOA 2HSWA 3FGZA 4BFSA 4HWOA 4Q4DA 2V97A 1E4EB 2P9EA 2R1VB 4PZAA 1GSIA 3GRYA 1XRPA 4AP5A 5CX4A 4DDUA 5IUNC 4RIIA 3FHTA 1PNTA 3L07A 5IN5A 1JVSA 4S1NA 3NIFB 4XYBA 4ZHQA 4YJ2F 1TK9A 1ZRSA 3BXOA 3BRWD 4H0CA 1OFTA 2X58A 4EEKA 2ZM5A 2FDXA 1P1JA 1QIGA 3WGGA 1DFGA 4B7CA 5KSOA 1RU3A 3DZBA 1AUXA 4P98A 2DBRA 2QGNA 4FMBB 4MVCA 3EVGA 4I9UA 4WGGA 5GY7A 4D8TA 1D6JA 2BH9A 3QVUA 2MIIA 4DA6A 3O3NB 4DUYB 1QJCA 2QX9A 4R2KA 2Z0MA 2BFAA 3T8YA 1UBLS 3IT2A 2YTZA 1Z2CA 3HV2A 4GLOA 4QEKA 2AVDA 5DCLA 5INTA 1ORTA 3AL3A 1SAYA 3B7GA 5BYKA 3RAEC 5CA1A 1N9ZA 2D2VA 1KA9H 3A3KA 2FOXA 1QIIA 4GBGA 3EC1A 2ZBPA 4LAFA 1FFGA 1R4NB 1T1EA 3IAAA 1H4QA 5KIAA 1F38A 4BFYA 1Y98A 3CH7A 3NBFA 1NZFA 4MWTA 3UKOA 4ZMRA 1KRXA 1HTTA 4EY3A 1T1GA 2XCTB 2CFRA 3ICOA 3L40A 4G85A 5KQMA 3QKWA 3UUFA 3W6ZA 2E1RA 2OBNA 4LG1A 3G0HA 1PO7A 2G72A 2ZAMA 3O94A 3MQ4A 3KHTA 3O0DA 3PDIA 3VI3B 3SI7A 3VR4H 3DA8A 3MMXA 3RC7A 6REQA 1K5HA 3F8TA 5KHLB 5MGBA 4OHWA 1JLHA 4P8RA 4QPCA 2DCMA 1A8UA 2EBWA 2B30A 2R00A 2R48A 3NHZA 5IULC 1B8VA 2W4QA 2Y1WA 4OUKX 3VU9B 3C7AA 2YMPA 3TD9A 2DE0X 1QV6A 3WAJA 3G0GA 3HMKA 4MR7A 4G8JA 4XJXA 1SCAA 4C2AA 3TF5A 3B48A 3ZU2A 3DFIA 1Q84A 1ZGBA 4G5XA 1IATA 1LW6E 1NVVR 1VI2A 1CDZA 1OZHA 3LXXA 4L4XA 1Z4LA 4X44A 4AJ9A 1JAZA 1X7YA 3FSRA 3UPTA 2HCJB 3G8CA 5J23A 4OHBA 4PYMA 5HRUA 2GZ3A 2MSLA 2WEKA 1NQWA 3NDJA 2ZS9A 2BGGA 2F1KA 1TIBA 5L3SB 3MCWA 2PYIA 3M6XA 3ROPA 4EFLA 1HX7A 2FMXA 5BOSA 3R3YA 1QKIA 2BRUA 2Q1WA 1D8AA 5LU8A 5FL3A 4NFSA 3G5TA 4LZOA 5FX2A 3MNFA 4WZAA 3MGAA 4Y2PA 1QO9A 4JBNA 4Q3NA 2Q4DA 4KN8A 1LSSA 4OQEA 1CZRA 3CLSD 3QITA 2PCLA 1WDMA 5FOXA 5GAJA 4QJBA 3WRXC 5C32A 5JSFA 1Z07A 3E5MA 3HA3A 4K3UA 4POOA 4ESOA 4KHPB 3O8NA 2W2XA 3A0UA 3ZBUA 3MCTA 1BE6A 4MVJP 4JT9A 1JHRA 4HNAA 2X2EA 3TR5A 3CUEF 1L5WA 3NV9A 3GVPA 1GHTA 1MW8X 2IXDA 1B8OA 2BKUA 3EZXA 2Y71A 3K2IA 4R05A 1PR1A 5KNBD 5CD1A 1FRZA 1AXEA 4Q1VA 2ZT5A 1J56A 2YQZA 2FUCA 3IT1A 3U9LA 1DAMA 2FSGA 3D02A 1JQDA 4JMPA 4F3RA 5EKUA 4IV8A 3EPKA 4PSKA 1NVTA 1SU8A 2AD5A 2JIOA 2FSVA 4EJ6A 4B45A 2X19A 3WAGA 5AXCA 2WK1A 4J1SA 3KUKA 5EEHA 3SMVA 4BQRA 2PR2A 4EFKA 1AHIA 3T9FA 1SQ0A 4KLCA 2HIGA 1RBYA 1UJ6A 3PCXA 5B6JA 4H0NA 4MV3A 4EGFA 2QRPA 4FCTA 2CNDA 1QHNA 4ZVTA 5C3MA 5JJ5A 5LD2B 2ZYRA 3HYRA 2ALJA 1MH1A 4NJEB 4Q21A 3HVHA 4JL8A 3WLNA 5BSEA 3PL1A 3ROQA 4LZNA 3DBLA 1HDYA 3WMXA 2BFOA 4F92B 4EMBA 4P82A 1B6RA 3PCRB 1E1CA 4RIHA 5DM1A 4ENRA 4MWBA 1K8YB 3ABZA 4BEBA 1E7YA 1R88A 2WM2A 4EO4A 1E2JA 1G2QA 3O2NA 4PNZA 4RO0A 7MDHA 4EH1A 2O8EB 4KKXB 1NR7A 5KVCA 4EZEA 4EX6A 4MQFB 1MG0A 4ATNA 1HT3A 2HQ1A 3JQFA 3R5TA 2GO1A 2MYPA 4YPFA 2AV6A 2NZUG 1N2CE 3RVNA 2Q7DA 3SEAA 4FE7A 4I1OA 5JZOA 2AJTA 1OLUB 4N3GA 2G3YA 2GT1A 1USWA 4WJZA 2OZKA 2HYIC 3OSZA 1DKNA 4ZCPA 1X1CA 1YZTA 3RGGA 5M04A 2IV2X 3EGDA 2H1FA 2ZR9A 1PR5A 4IDEA 4J1TA 4M1QA 4NCNA 3SJBA 1E9EA 1D07A 1AVTA 1TZJA 4TUYB 2QYHA 4ERNA 5FWYA 4OH1A 3C8UA 1GCOA 1Z4PX 5IJAA 4Z9FA 1NN3A 1HV8A 3RANA 4UKDA 5DYNA 4E32A 4G0UA 1HT2E 2GRJA 2XE6A 3ZJYA 4YAGA 2P2CA 2VP0A 2CMKA 4PGMA 4MOWA 3SLRA 2VF2A 4HZUA 4FD2A 4KN6A 1HRDA 4MUFA 2LZ0A 3A0RB 3IOBA 4Y2HA 3NUGA 5A9RA 1LLCA 4GNKA 1KARA 4HMQA 4HGOA 4JJ6A 1CS0A 3K2EA 4HYTA 4M0CA 4Y2RA 1RXCA 3KVRA 5CM9C 5HCNA 3SLKA 3V6LA 2LDBA 3W7AA 1SWVA 3K0CA 1G5FA 5ILGA 5L3SA 1CZUA 1JPVA 1HA3A 3RYIA 4NU6A 1KSHA 3WSVA 3RD5A 4CCYB 1YI0A 3G9QA 1PS9A 4CKBA 3ISJA 1F4LA 4O8CA 4B2IA 3GFPA 5LR6A 3CVVA 3D0QA 3KOOA 5HUHA 2V6GA 2E89A 4GL2A 1EUCA 2A92A 3Q6MA 4IHQA 4K40A 3UWOA 3ZXSA 5IBQA 1MA3A 5IDQA 3I6YA 1H2RS 1ZD8A 3LKVA 5AKXA 3D3KA 5DX0A 1PR9A 1WPXA 4O2AF 2V6MA 2VT6A 2JAHA 4L5AA 2ZG6A 3JWPA 1SG6A 2EFDB 3B9BA 4BU0A 4ZYWA 4B31A 4BZZA 1J5XA 1FYXA 1W0JD 4NV0A 1G8KA 2OWEA 4HSGA 4PC6A 5ALOA 3WL4A 4ZZIA 5LQDA 1OXUA 1UXGA 1DGQA 2AB0A 2WRZA 3W3AH 5H9VA 4WBNB 1FJXA 3FAKA 4DRXA 3LHIA 4MLCA 4DMRA 4ER6A 3HWSA 1UM9B 1NQAO 2XEDA 3PX3A 4AF8A 6REQB 3V2IA 1DJNA 3IUSA 2M6SA 3GYBA 2OV8A 2P40A 2PMBA 1OU4A 2HXGA 2XWQA 1V16A 3OY7A 1R6XA 4RADA 5L40A 3VZQA 1JFRA 1C4KA 1GTSA 1SZDA 3DLBA 1X1QA 1W34A 1YA8A 2G67A 2LGJA 2AOTA 4MV1A 3QF7A 2BSXA 2Z58A 1RP1A 1I32A 2HPAA 4OMFG 4PRYA 1CFZA 3Q3JB 1NIPA 4PV7A 1RZRA 1YZYA 1GNVA 2I1VB 3FTNA 3AW9A 3LQ4A 3JQEA 2ZIWB 4H2DA 4ZYLA 2NXJA 4B85A 2WNHA 2I78A 2XOKD 5DFAA 4RXMA 3ZK7A 2WWYA 2PXHA 3BCHA 4HAVA 5NLLA 2OFPA 4Z9YA 1TK3A 4MKGA 3MQ2A 4OHKA 4YMWA 5BV2P 1J20A 2XCLA 2KX7A 1SZJG 1TPZA 1W85A 1LPPA 4RD6A 4CHGA 5BOSB 2R7LA 3OE1A 1WXFA 4OOEA 5CXQA 3K6SB 4JXJA 3LKDA 4AURA 2YIMA 4G81A 4LA4A 4WH0A 3ESYA 4X61A 4DE5A 1N7GA 4YJ3F 5ICFA 3OQMA 5KNCA 1G3IA 1TMYA 1PNQA 3U7RA 4HT3B 1ZU4A 1OX4A 5JMOA 4DDTA 2FEKA 4M9ZA 1F4PA 3I6IA 3OUUA 4INOA 4RM2A 3T9DA 3X43A 4B47A 2CVHA 3VU0A 1RLTA 4INAA 2YMMA 2IOYA 3F5MA 3RR2A 2OFOA 3AI2A 4AJIA 1TU4A 1D4ZA 1QG6A 1VB5A 1VSUA 1IONA 2D8MA 3LBIA 4JENA 1C8LA 5CVTA 1QRTA 5EUBA 4KWEA 1L1RA 1WCXA 5HUQA 4LJKA 2HXYA 2EVWX 1WBBA 4U2GA 4JA0A 4UFPA 4RVUA 1VP9A 1L2TA 3KB8A 1E3SA 3LX5A 3OEHA 1TCUA 5DXJA 1XJ0A 1SQSA 2HMAA 4D3ZA 5DNAA 4NE7A 4EG3A 3AG6A 3PFKA 4X7MA 2BFBA 3K20A 4GG1A 2PT6A 1RKVA 3GAFA 4WBXC 2H1HA 3P0JA 4HEA1 2P6NA 2R97A 4E6PA 3JQGB 5FFNA 2H2GA 4KWIA 2PD3A 1UZLA 3M6AA 5FBHA 1CUXA 4ND2A 4HDMA 1H05A 4IXWA 3LXMA 5HTKA 2PV7A 5JYDA 1R3DA 3BICA 1UP6A 4HN4B 721PA 5CG2A 2P4EA 4GU5A 2CSXA 5DBOA 4C5BA 4A6DA 1P29A 4RWEA 4X3PA 2D5AA 4WLVA 3K5WA 5AW6A 4EAQA 1N5KA 1HLPA 4LHWA 4MS3B 5TVKA 4BUZA 2Q5OA 1E3DA 5KYUB 1ZM4A 2IJGX 3WLJA 1VM6A 2CHQA 2P5UA 5JAPA 4BBJA 2VP4A 1GXSB 2XNSA 1ESMA 4QYXA 5JNVA 4BP8A 2ZE6A 2X0KA 4BN5A 3NIWA 5DF1A 5DLDA 3F6PA 5IKPA 5KTPA 3H2SA 3ZUGA 1JSRA 2MSEB 2POCA 3SJAA 4C0KA 3RK4A 3DBOB 1P1HA 1VYUA 3EGDB 4ZQHA 3PD7A 5DWVA 4OK5A 2GETA 4OL9A 2O07A 2Q3FA 2BT4A 1ADJA 1TC1A 1DADA 1Z8DA 2P4HX 1PFWA 1TMOA 3LXUX 4C03A 2QJFA 3BBLA 4WLOA 3Q7TA 4WDRA 1OC4A 2L82A 3PC8C 4X1IA 4FJ2A 4Y6LA 4B71A 4PEVA 1E98A 3MT8A 3RARA 5IM4F 1O0CA 4RNDB 1O03A 4XX0A 2AXPA 2HO4A 3EZ2A 3OZDA 5DYIA 4ZT6A 1E9RA 1PT9A 2Y1KA 4M1ZA 2BGJA 1NVEA 1X74A 4TV8A 4UHCA 5BQ3A 5KMGA 4MVYA 4OYLA 1E3WB 3LYAA 1H2XA 2Q0QA 3GGPA 1XKTA 2G9ZA 1MJGA 2LD4A 1M2KA 3AERA 4H60A 4Q6WA 3I0MA 2CHUA 3VNBA 4A0HA 4CMEC 4QRDA 5LYJB 3RH0A 5LJIA 2JJQA 4I4NA 1Q0ZA 1EUZA 1V45E 3H99A 3TOXA 1A7UA 5H81A 2J3EA 3U17A 4TTTS 1OX5A 4JI4B 1P6UA 4LQLA 1OT3A 5CNIA 5HQ3B 2TMYA 2QL7A 3BKXA 1WKBA 2WWVD 2C7VA 4JIGA 2DTXA 1BNCA 2NZVG 2L18A 3IAM6 2HQBA 1OXKB 2E5FA 4R98A 4ZOBA 1BX3A 1SOWA 2ZRJA 4CM1A 2ADFA 3AOEC 3LRXA 3L7AA 3ORYA 4AF7A 1HQKA 2N1BA 2FG5A 3FIJA 3MMSA 4ZGBA 1XLWA 4EOGA 3WLLA 4LBWA 5TIIA 3ICCA 2GD1O 4PYNA 2YDYA 1T5OA 1WMFA 4FWIB 5ALFA 1UQTA 1EP9A 4TLAA 4B4UA 3A6PC 4DRXB 2QQ0A 5BN1A 1W5EA 2JAPA 4BVLA 3AVXA 2EL9A 5C2JB 2QMQA 1KIMA 3QVKA 4Z5XA 1XE3A 5AQEA 3N86A 3LA6A 4WCFC 4WKBA 1PZHA 4BAUA 4RJLA 2FPLA 4QG3A 3CIFA 4UCQA 3G3EA 3HCNA 1NC1A 3N2NA 4E6EA 1GZDA 3E2PA 1M2VB 4QBTA 2Z1DA 4S1OA 2BONA 2C2BA 3PRHA 1JDPA 1NXTA 2G77B 2WJAA 2EJVA 1KO1A 2F6RA 2QRVB 1MG5A 4BMZA 2HBRA 1WXDA 4Y7DA 4LHYA 3I45A 3DGFC 1D2MA 3HU1A 4FCVA 5IABA 2ZUEA 1RHRA 2PZAA 3I04M 4MIEA 4UE2A 1NKSA 1PVOA 1IG0A 2NU7A 2IU4A 5I4IA 5SICE 1GD1O 2X0EA 4Y2TA 1LVHA 1C9DB 3KQVA 3KS9A 1W85B 1ACJA 2G06A 1Z2DA 3RVPA 3CW2A 3VNRA 4YP5A 3BUSA 1E9AA 4G97A 5ALSA 4R9SA 2BFDA 1I33A 4G5FA 4AVYA 3FW1A 4U8HA 1N32B 3T6KA 3B12A 4X60A 2WP0A 4PXAA 5CIWA 5HS6A 5KYWB 3GVIA 3PK0A 3RIHA 1FVOA 1R10A 1G20B 1D5CA 2NPOA 2DPMA 2XF8A 1VGRA 3DPUA 1D6MA 1CERA 1NPTO 1UF9A 3CH5A 1NMQA 3E81A 4WXPA 4HNUA 1T91A 1XYYA 1GU0A 2AG5A 4JI1B 2QWXA 2VWPA 1B00A 4UQOA 4FP9A 2FXIA 2EJTA 4EG6A 2BTEA 3ZTYA 4M0DA 4MVJG 1XTBA 3HV0A 1NLYA 1NVUQ 1QFSA 3GB9A 3JD4A 1U9YA 1ZRHA 2I22A 3ZCRA 4EMSA 2FN4A 2FKAA 3DZ8A 3NBQA 3WKBA 5I8WA 5HRCA 3O90A 5KTTA 4XUCA 4MWDA 3RUPA 1H3EA 4BU1A 3D4NA 4Z3DA 3I9V1 4BP3A 4WK2B 1NUSA 2E21A 1GWNA 3QOWA 3DVAB 2GDZA 1AKEA 3PT5A 3E4CA 2MINA 1X3LA 3QFRA 4OJTA 4I2NA 5DU2A 2P5TB 4R9VA 5IJXA 1KK2A 1U0GA 2CVZA 3PC3A 4A3SA 5AW8A 5F77A 1FLDA 5CR9A 5GV7A 2BGMA 4AG6A 1JDZA 3TN7A 4DWJA 4QDJA 4QPZA 3UAXA 2P4SA 2VSNA 3U62A 1SCBA 4ENSA 4FILA 1TLTA 3JYHA 1JKIA 3T7DA 4ZO4A 2IY8A 1AH2A 4J1NA 2DTEA 4W99A 2JIZA 1WEHA 5G3ZA 3PKZA 3QKSA 2ZXUA 3IXLA 3HMQA 1U9IC 3RHSA 2FEPA 1L1EA 2O2SA 2ZSBA 2BKAA 1RVDA 4UTOA 3M82A 1FXWA 4L5YA 2BI7A 4FYHA 5EP1A 4DQVA 4O08A 4PO1A 2QLBA 1E7QA 4OV6B 1NTOA 4NEQA 3URKA 1FOEB 1MC5A 4D9NA 5JSYA 2IHBA 2P1RA 1J7KA 3DMYA 2FETA 2JLBA 3OOJA 4GUAA 3ZWNA 4YRPA 3ZVKA 5KNBH 1ZLXA 1ACLA 5HKAA 3IP1A 2WSSD 2Y05A 2GFHA 3ID6C 4QYMA 2FWNA 4RZXA 2UV8A 4EHFA 3LH5A 3FFWA 2H07A 4P22A 4X1IB 1V9SA 1QONA 1Q21A 2A4KA 3OIDA 3PTAA 3X1YA 5ECDA 2XR1A 3R3ZA 3O91A 5LB4A 3OJXA 4JN6B 5CYOA 2XB8A 5LDGA 1Z34A 5DHAA 1C8BA 1MUUA 1AKRA 4BFXA 1EBUA 1UMBA 5KMGB 1WB9A 3LL7A 4IWXA 2X1VA 3CZCA 2IU6A 5EXEA 1QP4A 2GEUA 4R69A 4RVSA 3S1AB 3AERB 1NYLA 1TTQB 3TLXA 2PO7A 2NX2A 4HDKA 2QR5A 3P5BA 3RQSA 4DQUA 3A27A 2IZ7A 5WRFA 4YH1A 3IA7A 1U7UA 4QU8A 2R85A 3CNBA 2ZZKA 4U2EA 1C9KA 1E4YA 3CSUA 3KR9A 4XWOA 2PRZA 3UMRA 4LJRA 1CJMA 2BKLA 1OZGA 4BB0A 4Z3OA 4K6OA 5L51A 1WCYA 1CEYA 4HB0A 3NTOA 3GPCA 5DW3A 1HYBA 1K1EA 2B36A 2NO0A 1OBOA 4FB5A 1O5IA 4HWSA 1PQ4A 4DA0A 1VKOA 4K88A 5ALYA 2A33A 4LZPA 2GK7A 4FN5A 2Z2XA 1ICIA 1SBCA 2CB9A 4E4TA 2JARA 2Z2ZA 2PSFA 3D2CA 3MG9A 2A0FA 2O7VA 2YYSA 4PHHA 3HGTA 4F1WA 4ZK6A 4JLAA 3DV0A 1B6SA 2LXNA 5TS2A 5MF6A 2Z6QA 1RJWA 2QRUA 2QYSA 3I73A 5HA5A 4IUDS 4ZYTA 1A4IA 3EXEB 1VG9B 5LC1A 2ID8A 2GO7A 2ODBA 4AZTA 3HDGA 2XA2A 1BD3A 4UEOA 3W5UA 2Q3EA 3GRAA 7MHTA 1NE2A 3Q11A 4UM7A 4CKYA 1TA4A 2P65A 4XB1A 2I6XA 2IODA 4O2BF 1U9CA 3L8GA 1O5OA 5E1DA 3HYNA 4CCAA 5EJ7A 2ZBGA 2GR9A 5A9SB 1F17A 1XTPA 3GVCA 4B1FA 4XIYA 3BDIA 1KDTA 3BC1A 2VBCA 3MB8A 4TTRA 1C4OA 2EW2A 3HI6A 1PL7A 3QMMA 5HSGA 2QM8A 1A9PA 1MV8A 1UKZA 4C9BA 5LIPA 1YS4A 2ZDQA 2X5KO 3T5GA 1YNOA 2EHDA 5KNDD 5A3RA 4F7WA 4CQNA 2MWMA 3JD0A 1OXTA 1VFNA 1JH8A 2X0IA 1PJLA 2ZWMA 3K9BA 1V7ZA 3N8KA 4JEUA 3NEAA 3ETGA 4LPSA 3I32A 2PL3A 1H5NA 2BR5A 3KJZA 1KI8A 3BIXA 1KO8A 2YV4A 4NAUA 1XXHE 2CXHA 4X1KA 5EPUA 4DTCA 4EHNA 4F5ZA 5AM0A 1H4VB 3DP7A 3FY4A 1RRMA 3BK1A 3A1WA 4J4TA 4P33A 5TC4A 3T4UA 2CDNA 1FDSA 4RD1A 1BAPA 2G71A 5EA2A 4OLAA 1BGWA 1XGKA 1B0AA 1YZKA 1Z62A 4X62B 4D6YA 1SBTA 2BFDB 2C7OA 1LPOA 3H7IA 3TL3A 3AB3A 2FZ4A 3DXFA 3DHEA 3BB4A 1XEWX 3UJCA 4CV3A 1QHEA 5KZMB 4TZ0A 1ZNZA 3DKPA 1G17A 3O4HA 4WERA 2V6BA 3DLTA 4BKOA 3OLYA 1F2UB 1CQZA 2ON6A 3F2VA 3HCEA 2YW2A 5IC6A 5JS1A 3H1GA 1H9CA 3IKTA 4CE6A 3KJXA 1GRQA 1Y1SA 2ZJAA 3OT4A 5TARA 4KX5A 3D6MA 1SC9A 1NOJA 4HX2A 3MTIA 3U0BA 3P9QA 5DULA 4NYMR 5ED0A 1XAIA 1ISRA 3J80A 4B81A 2AI3A 4V0KA 4ZCTA 3W2FA 3GGGA 3WLEA 2QN6A 2B9EA 1BFUA 1PT5A 1WD5A 3RSCA 3N74A 5C46F 2PKRA 3SC6A 4ROSA 3RBAA 4LYJA 5CX1A 2YN4A 4C0WA 1WMBA 2MINB 4OLFA 1P7CA 3EH2A 4OSPA 4GPEA 4OGKA 3NBYC 1U6JA 3TVDA 4DDMA 3FGNA 4W9MC 4WKOA 1T0UA 2ZZNA 4A8JA 1Q1BA 1B6TA 2A5LA 1RKXA 2LKDA 3OMXA 2I66A 1RYNA 1MHTA 4FFPA 2J5BA 1KP3A 4WXYB 3CEPB 3P9YA 4AN0A 1U7DA 4J76A 2PT5A 2ZYGA 5GV8A 2VSFA 2W2NA 2WF7A 3HJCA 4NESA 1Y1QA 4C4OA 4DGSA 3ADBA 1WUYA 2E37A 2IYWA 4IGIA 4OXKA 3IIMA 3ZWMA 2PKQP 4KLZA 3JQDA 3FTCA 3H1EA 3RBVA 3STWA 2HK9A 4HLUC 3HDYA 2C2YA 1FU4A 5C7LO 1KYYA 4P9NA 1G18A 1MF7A 2FHPA 3ZHRA 2YN2A 2H0RA 2Q4BA 3LRTA 4ZQEA 2IS2A 3W9SA 1R0YA 3E0XA 2ZBRA 3OT1B 4PPNA 5K7SA 2VNHA 2ZJ4A 4M9QA 3ZV5A 5JOQA 4D4LA 3HB1A 1JT2A 2GEVA 4IDPA 2DZDA 2Y76A 3ICVA 5JC8A 3I8XA 1TF7A 4YBRA 4FNGA 4ZAWA 5LNK1 1D9XA 4KUGA 1QQAA 1U2EA 1NIJA 4I5GA 4BEJA 2A94A 1A97A 1G41A 2QLTA 4HPJB 1IHUA 3FDZA 3C5VA 2C5AA 4GBED 3MS2A 4NOLA 3PNLA 2I2AA 2Q5JA 2C5FA 4B6JA 5K0FA 1ADCA 1SUIA 1FLVA 4R1SA 2X5XA 4HFNA 4WNAA 4TWJA 3BGOS 4O4JA 1JHUA 1IOWA 3NHYA 4YC7A 3SK0A 4E7PA 1CF4A 2H54A 5CH8A 4R5HA 2H59A 1H2HA 1LSOA 1E3QA 4HDKB 1IBCA 4RFSA 4YCLA 5K8IA 3KBOA 3HY6A 4C1NA 2YFHA 4M22A 1SBZA 3SHWA 2J4CA 3WBKA 1Q0PA 2JRCA 4PZZA 5K8CA 4E13A 2WNSA 2JAWA 3HCCA 1KR2A 1JYFA 3CT6A 3DR3A 3OZSA 3QBDA 5LVAA 3WBJA 3T3DA 1JDNA 1SM4A 1YB4A 4DR2B 3HSYA 4RX1A 3MAJA 3P2YA 4RDCA 2IYRA 1DHRA 4LQCA 5CDFE 1M34E 3HSKA 3T7JA 3ZWCA 2NNLD 1Z5NA 4LRQA 5B3AA 2HV8A 3F96A 4REQA 1LF5A 2X0JA 1U0JA 1HDEA 1W52X 3DM5A 3GG2A 4ALIA 4RD2A 5KTSA 2EQ5A 2JZCA 2V7WA 5L3ZA 4D8VA 1I30A 2UZIR 2VYFA 5LYYA 2B4AA 1TU0A 3HM2A 2Y67A 4OP1A 5IW8A 3JARB 1Y8ZA 1G42A 3NVDA 3DT8A 1Y89A 3EIHA 4HGQA 4DCUA 4LWQA 1AZWA 1DAKA 1NZJA 1WA5A 5T7BA 3K09A 4Q7JB 4XI9A 3OFSA 5FNVB 4V38A 3U6BA 4NCBA 2X8AA 1G4AE 2Q8PA 1RHKA 3R09A 3T5CA 2IF2A 3V1UA 2VKTA 3RUIA 1PIWA 4LX0A 1OH6A 5KNLA 2HRBA 4FDAA 5J2UF 2QX8A 1RC0A 4UZSA 4YALA 1S2LA 1T10A 1QB7A 3KO8A 3E05A 4IDAA 1GTMA 5HKKA 4ZA2A 3KDPA 3OF2A 4OHFA 1XWFA 4JI0B 4JUDX 1QHSA 2VPXA 3U4QA 4U7GA 5C4GB 1UZAA 4Q19A 1OBCA 1X80B 1VJ5A 2PN1A 4YECA 4D44A 1RPZA 3Q5EA 1ZL2A 2UZ1A 2XJ4A 7ABPA 3FPAA 2CN1A 1W49A 1TQ4A 1Y6JA 2A5DA 3INRA 2P4QA 3LZDA 1GPJA 2W8BB 4RKQA 3UB3A 3C3YA 2C00A 4OHCA 1HQCA 3BRQA 4G9BA 3TW4A 1M6NA 3HA2A 4H7KA 1YVPA 3L6CA 5FOVA 2AMVA 4NBUA 1Q15A 1THMA 2QW8A 2YIVX 1YZVA 4M4SA 1V0JA 2Q5LA 2XHEA 4H59A 4QT0A 5GIPE 2RHLA 4D57A 2V7VA 1U3FA 1N7HA 1OYYA 2BMAA 5IWCA 3M1IA 3BZWA 2LV8A 4YB8A 1U2ZA 3IXQA 3UAYA 2FSFA 1RAFA 1SXJD 2UVQA 3RHZA 4YIKA 4CVNA 1IFXA 1EZZA 4F12A 3CKYA 3MTDA 1J7JA 4JVOA 1P9RA 2CWDA 4JQYA 4MV9A 3OQJA 4V2UA 3NHFA 3VUFA 1TX4B 3SAJA 3THOA 1N34B 4UEWA 5KNBA 1F8UA 3I01M 4LV8B 4RHCA 2OCDA 3CLUC 3FVTA 4K87A 3WNVA 3H9QA 3KEQA 3WYDA 4PG8A 1NNI1 3AX6A 3FRHA 3PC6A 3ROMA 3RU2A 2XCRB 5JNWA 2W2PA 4EA7A 4F46A 1QYIA 5EIEA 1JF8A 2NTEA 4ODIA 2NQTA 3RRMA 4LDZA 4EUSA 2PGNA 3DO8A 4N39A 3D9QX 4RZSA 4LF9B 4GWGA 1H8HD 4RAOA 2O1SA 1XDWA 3P1JA 3PHLA 1NW3A 1RMYA 2SKCA 2ECQA 3KOWA 2FMIA 5H02A 2ZSFA 3LUBA 2OXTA 3RABA 4CIBA 3T3OA 1G8GA 3Q8LA 2BKXA 1E99A 4NPHA 3OC0A 3PUVA 3GNTA 4CPDA 4TYQA 3T9EA 4YJGB 3R75A 4DYVA 4V1CA 2FNAA 3JAKB 5EMKA 4BRSA 3BXXA 2XPCA 3OM8A 4LHEA 5FQOA 1AN9A 1V37A 1CUSA 3LT2A 5HKOA 1ILWA 2BELA 3LCVB 3JZDA 4WEQA 3FROA 4MWSA 2EOAA 4D3DA 2VTKA 4C3ZA 2EDAA 2ZUUA 2XUJA 2J48A 3QU9A 4D9FA 1YRQA 3IJ5A 3VJRA 3CW8X 4QSMA 3WLMA 1T3LA 1FP7A 2VZ9A 4Z1OA 4RMJA 1X38A 4BNLA 1VG8A 3LC0A 1ZOPA 2IXTA 1BCSB 4N5LA 2R1UA 1DLJA 2X77A 4W6QA 2IE0A 2GXSA 2OZLB 4G5RA 4DADA 3NAGA 2ZTHA 1EGAA 1NAHA 3RVDA 1OHHD 1I51A 3L6OO 2IH5A 3JQQA 5GZ3A 2HEIA 5B6PA 3HN6A 2G80A 1JZTA 3BE6A 3QEAZ 4K03A 4H3VA 4OHOA 4QGFA 3DDHA 3LDHA 4L7VA 4Y8VA 5TQ0A 3S7ZA 1A96A 4ZVUA 3CJRA 1PVDA 3SQDA 4BQOA 3RUCA 1MJFA 2OORC 4OFBA 5IAJA 3WRXA 4PIMA 3VOAA 2C2ZA 5JCPA 5TPWA 4Y6QA 4EQZA 1DX9A 5IANA 3QA9A 5LWHA 4O4JB 3DMGA 4II3A 4F6LA 3DV9A 2SKEA 2G1KA 4LPKA 4LDAA 3ZDRA 3P9PA 1NP7A 3AFOA 3UBTA 2XE7A 4Y9UA 2FV8A 3MZ0A 2JIMA 1E9DA 2NT4A 4I3GA 5BVGA 2AL7A 1Z0IA 1WDKA 3Q0TA 2DFDA 4KYVA 3H1BA 3KJNA 1DTWA 1BS2A 3HFRA 3R3XA 3HBLA 1KORA 3VNAA 2BEWA 5ALMA 2J0EA 2IYTA 4BMPB 2V4ZA 5IKMA 2C29D 3EARA 3H8JA 4DCTA 5AD1A 3GAMA 1DO0A 2O4UX 4MV4A 4YMHA 5A3JA 2NN3C 5MHTA 2W2OA 1H1LB 4LOLA 1W0JA 1PZGA 1G6HA 3ZLTA 1CR4A 1ZMXA 5F1KA 4I14A 3GRRA 3M5CA 4G8CA 1DRUA 4PAMA 3D7NA 3D8BA 3E9EA 4LEIA 4Y1FA 9ATCA 5J2UA 3JRNA 1IDOA 1KERA 2XMRA 4HYEA 4I9HA 4JUCA 4BV9A 1Q7RA 4UDOA 1JFLA 2JVJA 5DLPA 4EPRA 3OBIA 1A2BA 1I9CA 4LWZA 1N3YA 1F9EA 5IXYA 3L0ZA 3PYLA 4Q3KA 3GZ4A 4DLPA 1JP7A 2L2QA 1BE8A 1UKYA 2ATEA 1SHZA 1DG1G 3B3QA 3ROXA 3VDNB 4RD0A 3ZHBA 4DIBA 2XQVA 1UDXA 5JCOC 4IVQA 3MAAC 4OK6A 3AVWA 4ZDIA 1VJTA 1KKMA 1MBZA 1VKNA 1WOYA 1SXIA 5G0UA 1XTVA 3WGLA 1QVZA 2DTDA 1ZJJA 4E0BA 2DBZA 2IZ5A 3NJ4A 5K0NA 3V32A 2RC5A 4MB6A 5E7IA 2POQX 2YBEA 1PD1A 5IAKA 4M46A 1TQ8A 4ENTA 4CIXA 1RTKA 4G2TA 4I50A 4P58A 2OBFA 2F17A 2XOKA 5EGSA 2NTJA 2ZAIA 3ZWWA 1YZ3A 2UZ1B 5KYXB 2VP5A 3ER8A 2AX4A 4YCNA 1W1IA 1MO6A 1VG1A 2D3TA 3ETDA 3M6FA 4HZGA 4XARA 4LY6A 2IYEA 4OKSA 1GG2A 1KJIA 4R7TA 1QBKC 1ZM9A 3NAQA 4KPGA 4BLWA 1K7CA 3ZHTA 1N2BA 3GJ4A 3SE7A 4R8VA 3HJFA 1GSHA 4JXKA 4DB2A 2F43A 2QPOA 3I52A 4L57A 4LWPA 1DIBA 4QGGA 1XG5A 4V0ME 1RI4A 3OJOA 1V1MA 2ZRBA 3D7KA 2KM1A 3EQ8A 3HADA 3ONWA 4G9EA 4OQDA 2JBAB 4ZAYA 1XZQA 1TO6A 2I0FA 2JCXA 2QAJA 4MJXA 2YJ5A 3P0FA 1KC3A 1PR4A 1DELA 1UPFA 4PO8A 4X7BA 3ULKA 1VL0A 2I6FA 2D1YA 2Q46A 5DHTA 1WDTA 1XYGA 4QJ4A 4EVQA 4BGDA 2N9UA 3D4OA 1NJ8A 3O8OA 3RYCB 2P77A 2V5UA 3PXCX 3TJRA 3IT3A 1A5ZA 2TRSB 4XUGB 4ZZ0A 2XQFA 4URVR 1Q6YA 5KSYA 4OQMA 3FMOB 1P60A 2K87A 5C8VA 2AOWA 3GDGA 1MAHA 4LZLA 1JXOA 2CCJA 3H18A 3EWAA 2J85A 3TBFA 1F12A 2PFSA 3K73O 3CUKA 1TJYA 3THYA 4M8SA 3VI4B 4GW3A 3ZE2B 3CZ5A 2UXDB 1L4UA 4N8DA 1ADYA 3N05A 5H8WA 5DK4A 1JFTA 3IAUA 3IOMA 3W5CA 3R0XA 4O1HA 4BO1A 3UHPA 2CFCA 3R5SA 4XCQA 5G41A 1C2TA 4P93A 2Y68A 1B1AA 2VXBA 4O2LA 1RM4A 4FYXA 4MUNA 1WEKA 2CYBA 2GXUA 3NXSA 4XE5A 1AS0A 4PZPA 1TJNA 3NU1A 3VO8A 2Y3IA 4UMVA 4LHVA 3AHDA 4X1OA 5D1NA 5GGYA 2X3YA 3UN1A 4ENPA 1A1VA 1IZ7A 4MARA 2C1XA 4Q48A 3SX2A 5EHXA 5K3OA 1XCGB 1QRDA 1VYTA 4XEHA 3ZQ4A 4AKSA 3TZQA 2PPVA 2I71A 2I87A 1EYZA 2VH5R 3MS4A 2Q7XA 4XYEA 4O2RA 5BR1A 5IASA 4PFSA 2FEOA 4NC9A 3PNYA 4QTXA 1FTNA 1IOLA 1JQKA 3DCYA 5D8DA 5G53C 1UBSB 3W2GA 5LU9A 1IXYA 4QWWA 1P1IA 1L5SA 2H7VA 3FCCA 2QROA 3W6NA 3BA6A 4W5NA 1UZMA 3AJEA 4GKVA 1RC8A 2ISCA 5TQ0B 3I2IA 3U7HB 3JVIA 2PSDA 2CLSA 4Q24A 4ZICA 2YFQA 1SA0A 3AH8A 4TTQA 3K5PA 1EB9A 4UAJA 4AF6A 2ONYA 4ARZB 1MIOB 3EAQA 3I1FA 3PNPA 4R4JA 5KB3A 2X23A 2X76A 4E31A 3Q7PA 1J42A 3TLGA 2GSDA 2Z5GA 2FPOA 1P4HA 3WYFA 1JDBB 5HF8A 3OPXA 2X8BA 5IF9A 5GJVC 1PW5A 2O7NA 3TG8A 3MM4A 3ER6A 4Q5IA 4B3BA 5LCXA 5HF6A 1IJEA 4OFWA 3BGWA 4BE9A 4HLQB 1ORIA 3DCJA 1L4BA 4G1UC 2FSSA 2YDXA 3HBMA 1L4NA 1KGSA 2C77A 4R0VA 4YCDA 1H8ED 5HQJA 4YIHA 5IRCD 2WICA 4CEIB 1NVKA 2DB3A 2OZVA 1ZQ9A 2NTNA 2I6GA 3FVVA 1XZCA 3Q2OA 4TTPA 4LRWA 1WUIS 4X85A 3BG5A 1W5BA 4IIXA 4ZVLA 3LY7A 4UBMA 3GMSA 3IR5A 3AWDA 3CLRC 3WL3A 4KL8S 1G3QA 2P8JA 4FHGA 2GCNA 1Z39A 2CXPA 4HFJA 3PPXA 1FNBA 3UT6A 1M73E 3KCNA 4B2LA 3ZDEA 2I7CA 3DTNA 5TQ2A 4CKCB 1OR8A 2HSDA 4QXQA 2AHRA 5ALVA 1H2ZA 4FB4A 5CT6A 1EAYA 2HA0A 2ZS7A 1EFDN 4LN1A 4P31A 2NYAA 2FWIA 3WX0A 1JLKA 1RADA 1CJSA 4UZEA 5DIFA 1A5BB 4FWBA 1FNSA 5JJCA 1PCXA 4Y2GA 3JQCA 5DHPA 5JBIA 1KQGA 4G26A 4LJYA 3DHNA 5LBUA 3H0EA 1MC4A 1XZKA 2VAMA 4WEOA 3G0BA 2R7MA 1ES9A 4URHA 4G0QA 3LPDA 4I50B 4JJIA 3HC7A 4QTZA 2Q8NA 4NHOA 1OCEA 1XMVA 1XZ8A 1Q20A 1CZOA 3UWPA 5JZBA 3X1MA 1ZIXA 3K4HA 3MWGA 1CV2A 4K8RB 4DPKA 2ZRNA 4DMHA 3HKEA 4BJ1A 5JS8A 1KZ9A 5C81A 5K0BA 1MTOA 3S8EA 1Q2XA 2DY0A 1TZCA 1UJ4A 3ABSB 3HBAA 1G5PA 3PC8A 4IXTA 4J94A 4Q1FA 4O0LA 2X3FA 4LOIA 3T4EA 3T7RA 1GAWA 1JLLB 3L93A 3VZRA 5IDYA 4MRNA 5CDTA 5JQGF 3TWOA 1T3ZA 4G65A 5B1IA 1SXQA 2C5EA 5AYVA 1H0SA 1TFUA 3ZG6A 4ZT3A 2OHHA 1JJAA 1CY7A 2IGBA 2ZWAA 2J9YB 4KQIA 3LAWA 5K99A 4UU1A 1M0WA 4CTKA 3HKDB 2GN0A 3LVQE 2HNAA 1R64A 1JVNA 1XB2A 2HJVA 1NSTA 1GZ7A 3C15C 4YRIA 3VDXA 5AUPB 5JD4A 3LQRA 2H18A 4QUHA 3S81A 5K0TA 2OVFA 1I94B 5TX7A 2O2HA 4JBHA 3O03A 5F5LA 2HPVA 5LQAA 4QUAA 3ROGA 4JJFA 5LMCA 1U9ZA 2Y0EA 4L0DA 1CHNA 4XWYA 2YASA 3PXXA 1CTQA 3WDLA 3VVCA 4MQMA 4ZZ3A 4P1ZA 1RACA 5FDFA 2XUHA 1IPHA 2OUKA 3AOEA 1NRWA 1Z26A 4LC9A 4KWTA 3NJ8A 1KY2A 3H87A 1BYUA 5CTJA 4EARA 3ZGOA 2EGHA 2YVLA 2QL6A 3F8WA 2RHMA 2I33A 1ABEA 1PBTA 2VJMA 1EDBA 1WSAA 2CLOB 5EJMA 3TI9A 5BVHA 5GWXA 4EW6A 3MB5A 1M6VB 1E0KA 3CLRD 2HLPA 4C0SA 2IXEA 1T4GA 3L92A 1ZUWA 3C97A 4ZOLF 5EIWA 3AF1A 3UK0A 3NKLA 5JSQA 4L3WA 4KJXA 5ALWA 2P9HA 2XTAA 4Q1CA 3SEFA 2WF9A 1QGZA 5D6NA 4ZI7B 1G64A 1GQSA 1N36B 1XDGA 4KHZA 4UJ3A 5D2CA 1QANA 1US8B 2WVJA 2AZMA 3FPEA 3TK1A 2OBLA 4CDGA 2G1PA 4AY2A 4HH1A 2YY5A 3TW8B 3WIUA 4OX9Y 3GI1A 1YAHA 3HLKA 4YP6A 4TROA 3MCVA 4J0QA 4PNHA 5M5BA 3AV0B 4B3RB 1JZQA 4RGYA 1SCQA 3HZZA 3G7UA 3PQ4A 1VIMA 3LM8A 5BSKA 2Z6VA 1CZHA 2OYRA 1ORVA 2ZYIA 4R40A 3LDAA 3VFDA 2EZTA 5E6UA 4EUFA 1ZX1A 4C2BA 3MRSA 1OGIA 1Z2PX 2FH5B 4BO0A 2WSSA 4L1KA 3ZY2A 4GMFA 4HY3A 1AMNA 3T5PA 2UUCB 3KKMA 1SUDA 2G09A 4DLZA 1GNTA 4RE5A 2BOVA 4OQNA 4DIUA 5C1BA 1XCOA 2BMWA 4I8XA 3HB4X 4Y30A 4KEAA 5K3FB 1E9SA 3OOHA 3CXRA 2BCJQ 3GT3A 1U3GA 4F38A 3FB1A 1RXUA 2ZRLA 2QRNA 3E9ZA 4FR2A 2PKYX 3JY6A 3Q8KA 2E82A 3WDSA 1DC5A 4KOEC 1Z5WA 1UJ2A 2QTTA 1V2HE 4QD3A 3LO8A 3HUFA 3UJ7A 4AZSA 4ZCIA 1HFJA 5B30A 5K1ZA 3KOYA 3QBTA 4MR9B 4XQ9A 1NMSA 4DXHA 4X64B 1RI1A 3AY7A 1A77A 1JJIA 5DT2A 4EY4A 3DLAA 1T1JA 1NZDA 3G88A 1LBQA 4BX3A 4L0CA 1WKVA 4R8RA 3WYAA 1JJBA 4D6PA 2F1OA 3I04A 1G4UR 4A2WA 4MSUA 1MAAA 1V11A 2RHOA 3SBDA 3ADPA 3FE2A 3MC1A 3K0FB 4J0GA 4OMUA 2GYVA 4F11A 5BWLA 2V9CA 5EJ2A 4F3KA 2I9KA 1K7SN 2M1XA 3Q9SA 1NP6A 1XCJA 5FUQA 3H1PA 2ATIA 1PLJA 4U9UA 3TSCA 5FWXA 1JIKA 2R6FA 4QXPA 3JZAA 4PG5A 3WR5A 2YWXA 2FP4B 1PEKE 1ZD5A 1JG4A 1Y5NA 2HTEA 1EJ0A 3HUTA 4FT4A 1D03A 3K53A 3M3DA 4JZKA 4D9IA 1J2RA 4ZJUA 4XM2A 2CZQA 3TRKA 2P7IA 2OCKA 3GC6A 3JWGA 2R6R1 4CKXA 5ELMA 4IIBA 3AW8A 1IXKA 1R9MA 2E9SA 2MMGA 2Q6LA 3ETEA 1MRNA 3O4GA 3M4JA 4XRRA 5E4TA 3K70C 1U8ZA 4K3VA 5DTJA 4CF5A 5BWMA 2WDZA 3ELUA 4L0QA 1U9IA 1BTOA 1RXYA 2CUKA 2INGX 2QMZA 5ESXA 4I7EA 3X2SA 4BNJA 1XFDA 4JC8A 3GH1A 3ENQA 4JFRA 3DP9A 1CEEA 3OESA 3UHOA 2VRCD 4GGMX 4E21A 1YCFA 3MYRA 2H1SA 5MFZA 1CPYA 1Y4SA 3BWYA 3UAZA 2OEPA 4EYOA 3U3XA 5ALPA 2VDMB 4ZVNA 2EAUA 1BWQA 2PVSA 4RA6A 3WNBA 2AN5A 4ES6A 5KNDA 1CJCA 1MPXA 1SBNE 4JT2A 3SXUB 3ADCA 4DNFA 5JCZA 2XQJA 4I1PA 1YDHA 3RVMA 3ZQJA 1RRFA 1CNFA 1KH3A 4OEHA 2CYAA 2QVXX 1V3VA 4G0NA 3B36A 1TUIA 4RQAA 4B2YA 3KKEA 4FYWA 4M76B 1XHLA 4KE9A 4LY0A 1G60A 5CW1A 1BWRA 1E18A 1SVOA 3D3NA 3CWQA 1OLXA 3IT0A 1IWOA 1GADO 1UQRA 4K6FA 3WWDA 2JGMA 4C21A 5IAGA 1E5XA 2VHTA 4YJDA 4A8HA 5BT9A 3ROTA 2JLRA 3MIZA 1DS6A 4HDQB 2FVXA 4JI7B 1II9A 4XIFA 3PQFA 2X42A 4M88A 4MQBA 5B36A 9GPBA 5JQWA 4ESVA 4FI3C 1JAXA 3JQ9C 4GXRA 3VR0A 1GQ2A 1KQNA 4M83A 2DLDA 4C08A 4CKWA 3UAVA 1IZ0A 2IY7A 1U7XA 1A9OA 2WTEA 4XTCS 1JKJA 3WGZA 1BEUB 5GONA 1DPGA 1O1YA 1R8QA 1PN3A 2KBFA 2XYQA 3K4PA 4KQ2A 1REQB 4HOYA 1Q1NA 4KQJA 2DJ5A 3P52A 5FPHA 3ZCTA 2GUWA 5AKKA 4QT4A 1LDMA 1RRGA 1MOSA 1CVIA 3ZKWB 4P7JA 3PENA 3EB9A 4LJ6A 2REQA 5CCEA 4RF2A 1E1QD 2QBYA 4EY6A 5FYDA 1JIIA 3QKTA 1RPAA 2QAIA 3QE4A 2P5YA 5TSDA 3UMSA 3V9PA 3ZU3A 3Q1LA 2VTBA 2WNIA 1SIOA 1A5TA 1E2FA 3JW8A 5AUOB 3NTUA 5FPKA 3B3AA 4ZVOA 3VUEA 4PGGA 1QGED 2C8VA 2XCOA 1XTQA 4GXTA 4DJTA 3J81A 2IHZA 3TE7A 2JW5A 4PS0A 2JATA 1JU4A 3U3KA 1DQYA 1X13A 2B92A 3LLSA 3PL5A 1XKLA 4QU9A 1AMOA 4ER0A 5D7NA 1Z0DA 3K70D 2PZEA 1EFPA 1Q1EA 4BFLA 4LF6B 1Y5MA 4Y18A 1P74A 4Z1MD 2QLJA 1WDWB 5FI1B 2RHTA 3ZDXB 2V0CA 4CR8A 1V25A 4L6AA 4R1TA 1NVGA 2AN3A 1VPVA 3ZW8A 1R9NA 3CUSA 3ANLA 3N5CA 4BMDA 2EBHX 1GLNA 1NGSA 1ZCZA 4UBIA 5HIIA 1EVKA 1K4MA 2YXDA 3KFXA 1ZI9A 1G19A 4KLRA 1KFKB 4MDYA 4NBWA 2WJZB 1NSYA 1QAOA 2YZKA 1AK2A 3AIOA 3D3JA 3IEIA 1H2WA 4FNOA 4HTAA 4CFSA 3KTAA 8LDHA 4ESEA 2JFOA 2GLTA 1XC7A 5AW3A 1JLMA 1FC0A 4IIGA 3LP8A 1URPA 2XRFA 1WF3A 2Q7OE 4LZZA 4S0XA 2PUVA 3P9IA 1OLSB 2NWQA 5FBKA 1EK6A 4XJSA 2AT1A 2PZMA 1JSZA 1TKCA 5CIQA 2VJPA 2C7BA 3QHAA 4IEFB 4IZ6A 3E0QA 4NBSA 4RXUA 5FA6A 1BHJA 1ZISA 3TPZA 1KAQA 3J7TA 4FOSA 3UAWA 3H3XA 4LJ7A 3HGMA 3ZD9A 1DQNA 1UPTA 3W8NA 1AY0A 3L8ZA 1QX3A 2DULA 2PM8A 2M1ZA 4K6HA 3EF1A 4MEBA 1YCHA 2XOXA 3O2QB 3U2QA 3L4EA 4KGZA 4UEKA 4I1RA 5HK8A 1E7MA 2YCLA 3BD8A 3JQBC 4IEIA 4M8KA 1WMDA 1ETUA 1JHMA 1JMKC 4TTJA 4WA8A 1BXRA 4ARAA 1ZICA 2C1EA 3RC2A 5FEMA 2GZSA 3P71T 2EIXA 2AD1A 1ZH0A 2B4RO 2HHCA 2KSQA 3ML1A 4R2MA 4TKLA 5FADA 2W42A 3FDFA 5CB4B 3IC5A 3SZLA 2P9CA 4GBJA 1V11B 1YHZA 1PJ2A 4G67A 4R2HA 4TYMA 5AP9A 4WOBA 3RF6A 2QUZA 2GBLA 2HRQA 4DGQA 2H16A 3FHLA 4EB6B 2XEXA 3ECAA 4FINA 4R3NA 3VRHA 2Z4SA 3NHAA 3IDOA 4CMJA 5I7WA 4QFDA 1K0FA 2W2LD 3FBWA 4ND5A 4CGYA 1KI6A 3SS7X 3ENNA 1B14A 2B8JA 3RUAA 3RIGA 5BN3A 4Q1AA 1YFJA 1V9LA 5AVKA 3IEXA 5CCXA 1WZIA 3USZA 4IILA 1VC2A 4XWAA 4IPTA 1JWBB 3UB4A 4E33A 1E1DA 3W2IA 5BNIA 3ZEAA 1VP3A 3HCOA 3PXBA 3V7UA 2KPOA 3STHA 1VKRA 4D25A 1D6NA 3T15A 2MMCA 4RGBA 5HKLA 2H8KA 2WJ4A 2BUBA 3AHCA 4UASA 3UJ6A 2B69A 5TY0A 1J39A 2ZRGA 4B4KA 2PUEA 8ADHA 1ZJZA 1NG9A 2ORYA 2V58A 1DEOA 3LNTA 2PU7A 3CKKA 1Y4UA 4DEVA 4HLUA 5FUVA 1AZSC 1J9EA 3A9VA 3N7AA 4QXRA 1ZITA 4EA6A 1X0XA 5K3DA 3VO9A 4CV0A 4DZTA 4OM8A 1U5BB 2X9NA 3MMZA 4IGEA 5KWEA 4N12A 2ZPAA 2IFTA 3HNPA 2PYZA 2Y2VA 4GE0A 3TB6A 2NUAA 3UG6A 1ZN9A 1FNNA 1NVDA 2DHEA 1VSVA 2P3QA 3PTLA 4R31A