4D8YA

Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in space group p212121 at ph 5.6
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
240
structure length
240
Chain Sequence
GLVPRGSHMSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase deoD-type
total genus 86
structure length 240
sequence length 240
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d8yA00
2I8AA 1G2OA 2B94A 3F8WA 3UAXA 4LNAA 4TXHA 3DP9A 3OZEA 1PR5A 3DDOA 4TTAA 2HRDA 3IEXA 2AI1A 4MARA 4TTJA 1K3FA 1YR3A 3GB9A 3FUCA 1CB0A 4L0MA 4ECEA 1RYZA 3PNSA 1RCTE 4DA6A 2OC4A 4F3KA 3C74A 4DA7A 1VHJA 1A9RA 2QPLA 3FAZA 1Y1TA 1B8OA 4GKAA 1Y1QA 3EUFA 4D98A 1T8WA 3KU4A 1PR2A 1T8RA 3LGSA 1QE5A 2RJ3A 1ECPA 4NY1A 3K8QA 4GLFA 1JE1A 1YBFA 4UC0A 4JP5A 3OZBA 4L5YA 5F7JA 4L5CA 2HWUA 1VMKA 1Y6RA 2A0XA 1LV8A 3T94A 3OF3A 5CYGA 3UAVA 1JP7A 1TGVA 4TXNA 4G41A 1Z34A 4F3CA 5IFKA 2Q7OE 1XE3A 4QARA 1V2HE 1V41E 5B7PA 2H8GA 3EEIA 4TS9A 1WTAA 1Z5OA 4TYMA 1U1GA 1T0UA 1N3IA 3O6VA 4TXLA 3LBAA 1TCVA 1OV6A 1Q1GA 4L5AA 4G8JA 4FFSA 2A8YA 3NM4A 5EPUA 1Z35A 1T8YA 4P54A 2A0WA 4JWTA 3PHBE 3OZDA 4WKNA 5JPCA 1PWYE 4WKCA 1ODLA 3UAWA 1PR0A 1YRYE 1A9SA 3FWPA 4D9HA 1V3QE 5F77A 5F7ZA 5F7OA 1LX7A 4BMZA 2ISCA 1RXCA 3BSFA 1A69A 4TXMA 4PR3A 5F73A 4EB8A 1PR6A 4MCHA 2BSXA 1OVGA 2A0YA 1ODKA 4RJ2A 1PKEA 1PR1A 1JDUA 3DF9A 4D8YA 2AI3A 5FAKA 3GGSA 4M7WA 2OXFA 2OECA 2QDKA 4LNHA 4D8VA 3FNQA 4DAOA 4OGKA 1JDTA 1Y1RA 5CCDA 1Y6QA 5KB3A 3SCZA 5C80A 4LZWA 1VFNA 3UAZA 3QPBA 1RR6A 1Z33A 3P0EA 1I80A 1JDSA 3BL6A 1ODIA 3E0QA 5K1ZA 4QATA 3MMSA 2QSUA 3D1VA 1U1EA 1Z38A 3KHSA 4EARA 3UT6A 4K6OA 4U2KA 4F2WA 4YO8A 4R2XA 1RSZA 1V45E 3OOEA 1RXSA 1A9PA 5EUBA 1Z5NA 3U40A 4OY3A 1Z36A 1JE0A 1A9OA 1CG6A 3KVVA 1U1DA 4BMYA 4GMHA 1SD2A 4NSNA 5ETJA 5I3CA 3OPVA 5B7NA 4F1WA 2AI2A 1A9TA 4JOSA 4D8XA 4OF4A 3INYA 4TXJA 3E9ZA 5F76A 3EMVA 3P0FA 1TD1A 4WKPA 4I2VA 1VHWA 1T8SA 1FXUA 3NM5A 4R2WA 1NC3A 3ODGA 2ON6A 3UAYA 5CCEA 3TL6A 4OGLA 5DK6A 4MCIA 1A9QA 5F78A 1PK9A 4KN5A 3KUKA 1ZOSA 3KVRA 1PF7E 4F2PA 1U1CA 2I4TA 3O4VA 5IU6A 4OEHA 1B8NA 1YQQA 4BMXA 3OZCA 1TCUA 1ULBA 1K9SA 1V48A 1TGYA 1SJ9A 5F7XA 4QEZA 4H1TA 1YQUA 1ULAA 1M73E 4WKOA 3FOWA 4DAEA 3ONVA 2P4SA 1PBNA 1JDVA 2QTGA 4GLJA 1SQ6A 5CXSA 1NW4A 1RFGE 3PHCA 5CXQA 5EFOA 3KVYA 1K27A 2QTTA 4M1EA 4R31A 1C3XA 2OC9A 4YNBA 4LDNA 3NBQA 2PGAA 2IQ5A 1Z39A 2GUWA 4IP0A 1NC1A 3DPSA 3PNPA 2AC7A 1Z37A 1OU4A 3BGSA 5CYFA 4WKBA 4L6IA 3OCCA 4YJKA 1ZL2A 3K8OE 4YMLA 3E9RA 1Z5PA 3MB8A 5B7GA 3FB1A 4LKRA 4E1VA 1PR4A 1PK7A 4QFBA 1JDZA 3LA8A 3IOMA 4TTIA 4X24A 4PNPA 1JYSA 4DANA 3EUEA 1RXUA 1SD1A 5B7QA 3ENZA 3NM6B 4DA0A 2XRFA 4TS3A 2HSWA 1OUMA 1ODJA 4BN0A 1OTXA 4M3NA 2HN9A 4DA8A 4OJTA 4DARA 1RT9A 1U1FA 4DABA 1Y1SA 1RXYA 1OTYA 1LVUA 3OOHA 3BJEA 4G89A 4NS1A 1PW7A 4QAQA 1V4NA 4QASA 3DJFA 1JPVA
chains in the Genus database with same CATH superfamily
1CT9A 5BV2P 1P2UA 2JZOA 3PGA1 4PIMA 4B4DA 5HJEA 4YJ2F 5A9TA 5FPPA 1NUSA 2G1PA 3NGXA 3LOQA 4NAVA 4CKWA 4BNMA 3X1WA 4TXHA 3I1FA 4TYPA 2FG5A 2WB2A 1LRKA 1VE1A 4GMGA 2XH8A 2EW1A 1Z16A 5IVHA 2OBMA 2ZW9A 2YV4A 1ZC3A 3CNQS 1RQGA 3D1LA 3QU7A 3H8SA 2BM8A 5IBRA 3AY7A 2ASEA 4LCEA 1ZVJA 1XJ0A 5I4KA 1LX6A 4BN5A 3GI1A 5U1PA 1O95C 2D54A 3BHJA 1SC9A 2NYAA 1O5TA 3G5LA 3KJXA 1TZBA 3LCVB 4LJLA 4U00A 5GJVC 3ZWPA 2X86A 8MHTA 3HO6A 5IJ9A 3LUFA 2I7DA 1XWIA 1VPLA 4P3KA 3VKGA 1XQ6A 4DV7B 1UP6A 5LZ7A 2HSJA 2QYSA 4BBJA 2EYQA 1D9ZA 3MWEB 1S2OA 5KINB 5LXTA 4ZEVA 1DGQA 4L4UA 4FYPA 3AY0A 4OHWA 3X1KA 2D2EA 4W7SA 3PUKA 4I5FA 3MIZA 1NFFA 1S2MA 1FFYA 3VMMA 1HL3A 1Q83A 1QQ5A 2Z2YA 2GVDC 3AEKB 2W2KB 4H77A 1LWOA 2AX4A 2PX6A 5AO9A 5IK2A 3UHFA 1TJ4A 5J58A 5BQ3A 1ECPA 1RKBA 1CUHA 2GK7A 2VJAA 1IN1A 1ETUA 1BHSA 4CGZA 4OX9Y 1YBFA 3FOAA 3KALA 1REQA 1E94E 1OX4B 2AW3A 1T1IA 4MMYB 5SYNA 2NT4A 4JP1A 1QH0A 2BIFA 4HDNB 1U80A 3EXEB 1RJEA 3NHWA 2IU0A 4FVTA 2DWUA 1I4TD 2R8PA 2EJVA 3KT0A 2H1SA 3L8CA 1TKRA 1KP9A 1XELA 3OF3A 4X93A 4EECA 3I9V1 4I4TA 4CMGA 1BU5A 3BS4A 2A0UA 1K6JA 1UBRS 4DMCA 1ZIDA 3HB9A 3U4IA 5AK0A 4LXIA 4PZDA 5ALVA 1FDTA 1L9KA 1NY6A 4YCDA 4Z7OB 5B6IA 4JH0A 3WQRA 3OCZA 1MRSA 3O1JC 5AQ1A 3V2GA 4GYJA 2OMKA 2VA9A 1YB2A 2VCHA 2XEXA 1YFZA 4G1BA 2I03A 4FYYA 3DTTA 4W5RA 5BVGB 4BEWA 1QS0A 5HVNA 1EE1A 5DYNA 4A1OA 4K26A 1IWOA 4LX0A 1T6XA 3HDJA 1I7NA 1ZK4A 4L78A 4U7HA 1MRZA 4WNIA 1Z5OA 1M8FA 4M9XA 3KDAA 3A3YA 4U6SA 5JHGB 3QA3E 4TYMA 3G8YA 1H6BA 1WNFA 4UEOA 5AW9A 1P4HA 4D0SA 3D4NA 2A6PA 2QKYA 1EGAA 4IWXA 2AKAB 1TUIA 3ZU3A 4C06A 1P5JA 1WUHS 1KXZA 3EVZA 3EZYA 1A82A 1U2GC 3MTIA 5EC8A 3D0QA 3IXMA 3OFNA 1F6DA 1L8LA 1QRDA 4INAA 3D7NA 3PD1A 3IQFA 4JR1A 1VYTA 4N5LA 3ZV6A 3ZXYA 5EZYB 4PZYA 1BNCA 4RQAA 5K0TA 2HBRA 3T54A 2DLCX 2DUJA 1YMQA 4YUYA 1R50A 3OPQA 1WOMA 1NI3A 4HNAA 3BIWA 5IYZF 4AJLA 4B5KA 1LPOA 4CR6A 1OLXB 2C1EA 5DHRA 2VT3A 5H16A 5KSWB 1WBBA 1TFUA 1GDDA 1J00A 1XNHA 5BW8A 2ZB2A 1A8PA 3FLEA 4JQZA 4G1EB 3CVWA 3K6SA 1VDMA 3SK0A 3SLGA 2O8CB 2ZAYA 1Q14A 2C3MA 1PFUA 4S35A 5EG5A 4GR5A 3BH7A 1V1MA 3T1VA 3VNSA 4ALNA 2ZZMA 2QMQA 4QUGA 4D0LB 3T12A 1DIGA 3RNLA 4F0JA 4A2PA 4DDTA 3PHJA 3VGJA 4Y2SA 2PT7A 1ZSNA 2PANA 3Q40A 3WWYA 4BQNA 1L7EA 1UZNA 1E9SA 4OVKA 3WDMA 4DTIA 4EK9A 4DIBA 3GFSA 1KJIA 1W94A 4MAFA 4YACA 3U7GA 4G23A 2PTHA 1MRNA 2OHOA 4RH1A 3EBOA 1AKUA 3O2NA 1T2UA 5J4LA 2VHXA 5LDGA 1KZ6A 4K03A 4FFDA 4F96A 4KZPA 5L6MB 3RYHA 3G6KA 1YE8A 1EK1A 1HTBA 1DXYA 2ZZKA 3E58A 4DJTA 1FC0A 3E8SA 2X0FA 4YUWA 1C7JA 1GU0A 2ODPA 5F64A 2BFMA 5EWMA 5C3MA 1K2VN 5ITZA 1N7HA 1TUGA 1Y7IA 2V7EA 1I0LA 2CZQA 2VAPA 3F1LA 2FY8A 4LKOA 2ESRA 3QRWA 1KC1A 3FUTA 1N2IA 3KYCA 2QNBA 3I6MA 1ZHFA 4FKZA 1M74A 3EE6A 5FUXA 1ZR4A 1YR2A 2G0NA 2NACA 4GD3Q 4IWNA 4NH4A 3V42A 3OTOB 3QG1A 4L08A 3OCVA 2V6MA 1D4AA 2QQ5A 3TIGA 1XN4A 2QZPA 4QPCA 1Y1RA 3QJYA 2RH8A 4B6EA 2EAUA 3EIOA 2I2WA 3SCZA 4B74A 4CF6A 1AHNA 1PWEA 4RA6A 4X95A 3PFNA 5THXA 4E51A 5H81A 1ONBA 2NV2B 3L5KA 4HB4A 2VR1A 4R2IA 4UM9B 3AESA 1GTVA 4JBWA 2W58A 5ALGA 3ZWWA 2O8EB 1JBQA 3GIDA 4U2DA 5F5NA 4UM5A 4YJ2B 4A5SA 5MN6A 3EZ7A 3ABIA 1IDOA 2VJLA 3EJWA 2FDCA 3ROFA 2E4VA 1M2NA 4B6SA 1NU8A 2NO9A 2YJZA 4UVGA 4GKVA 3RU9A 2GSDA 1RAFA 1KTVA 3CEAA 4X1KA 3W79A 4C20A 1NQAO 4D74A 1R66A 4EVSA 3C8DA 4ITVA 4RSGA 3VO2A 2YHIA 3N0TA 2FWMX 1BG6A 1MOPA 1ZGHA 3DKRA 1FYVA 3FE2A 1FFCA 4JFRA 3U09A 2UXCB 4OBXA 4F5EA 2J3EA 2NUAA 3UT6A 2DY1A 4K6OA 1E18A 2QW1A 4KQMA 4LJSA 2CJWA 3DE2X 1C14A 2EQBA 1YWGO 2QV0A 1JG4A 3EQZA 1M2KA 4M76B 5CVEA 3FGPA 4Q4AA 5MDHA 1JQBA 1QDEA 4UM9D 3KZCA 3VOSA 1GPKA 2V59A 1UJ6A 1YQEA 3NXKA 5ERXA 4PAMA 2H07A 2C1XA 2Z95A 3H84A 1NVGA 1KOLA 4CMIA 1Z5NA 4HNVA 1YVEI 2PZJA 1LVHA 3BZBA 4IKOA 3OE7D 1B16A 1E66A 2GM9A 2WA2A 5BW5A 1JE0A 2F2TA 5CT8A 3GJZA 4JOCA 1R0KA 1YOVB 821PA 2P90A 3GFOA 1LI7A 3FTPA 1UJNA 3WK4A 2DUMA 1H9CA 1H1TA 2BCGY 2IUFA 4NOJA 4R2JA 3V9PA 4B4UA 4B6JA 2A78A 1A9TA 4JOSA 5C37A 3IR5A 2Z2KA 1GILA 3GWZA 4GP6A 4KQXA 4N12A 1WEHA 2FUCA 2ZAMA 5LUAA 2D1TA 3ZX5A 1CS4C 2PEZA 3HJNA 1JA0A 2C7BA 4TTTS 4DR7B 1SKYE 4TLEA 1TVKA 3BK1A 5EIOA 5IUKC 1NZDA 1YCGA 4WK4B 1N6OA 5H68A 3NKLA 4HTAA 4BZXA 2JFBA 2IOQA 2LE0A 4Z6KA 5CLJA 5EL0A 2CNNA 4J3FA 2H4YA 1B76A 3NIBA 5HKBA 1H4SA 3LXXA 2YXEA 4IJ5A 1OYYA 1P5RA 2QTCA 3D4LA 2PA0A 5E2BA 2K87A 1XEXA 4B82A 3LAWA 4RHUA 1U0GA 3WGYA 1EP9A 4WKPA 1N5IA 3EIQA 1QZTA 4QYIB 3REFA 5C4IA 3HC7A 4BJ1A 3G2LA 4EKIA 4MKXA 1KSHA 1UF9A 2L69A 2QT1A 3ON5A 4D92A 1DBIA 3AGQA 3QEMA 1TLLA 3QVXA 2UUAB 1GGVA 4WJLA 4DNQA 4EA9A 1O4WA 3N75A 4MGZR 1W2HA 4OQDA 5DM2A 1TEHA 1DO8A 2C54A 3EOZA 3CH7A 3ESBA 3FVWA 4B6OA 4JFAA 3FSGD 4RD1A 4BKMA 3DDUA 1MR3F 4BGUA 1P1JA 2E9SA 3ENWA 4FT4A 3CLRD 4JODA 5DO9A 5MF6A 3ML1A 1YU9A 5DNAA 4CG2A 4KFCA 1GQFA 3MGBA 1KDVA 1YNSA 3RAGA 1WLSA 1JLHA 4R84A 1ZW6A 2VYQA 3FYUB 3O4RA 3PNLA 1UMBA 1I6KA 1WL8A 3UA3A 4N9WA 3EIFA 3ZBQA 4O2AF 2JLVA 4ICIA 1Y5LA 3N07A 2O0LA 4ONEA 2BGUA 4LJAA 1J5PA 1EDBA 3SC4A 2OK8A 1OR8A 1OAOC 2H1WA 4A15A 3SX2A 4FM9A 4NPAA 2FZVA 8LDHA 2H16A 2H4HA 1V8ZA 2XTNA 1RZUA 2AG8A 4QEZA 4QQRA 5M3BA 3RVLA 2BM1A 2I71A 3FCEA 3QE3A 4IMJB 1YJXA 1WZIA 2MSCB 4NNJA 3T35A 1W44A 1GRRA 2PDAA 3ZV3A 1X77A 2CW5A 2NTNA 3PITA 3DCIA 1TLFA 2VDMB 6LDHA 3ZEAA 4QU0A 3RPEA 4D45A 3VJRA 1XCJA 1JJBA 2UDPA 2JLRA 5JQGF 3OZIA 4BNVA 4CIBA 4WKOA 4Y9TA 4OHBA 2IS1A 1LLFA 4CI0B 2O20A 2VP6A 2X6QA 3N0WA 3MSXA 4QOIA 3TF5A 3WK5A 2BEJA 5ADHA 2JGKA 2JLBA 4Q21A 5CX1A 5CNKA 2VJQA 3IBCA 2OCPA 2C4WA 2CEAA 3RFUA 4TZTA 3O8QB 2LRHA 1C7RA 2OWEA 4KXXA 2PUBA 3QKTA 5G0UA 1FJHA 1U3WA 4H4CA 2D5IA 1JHVA 4GUDA 1RC8A 4J0EA 2ZPTX 3K1ZA 2P3QA 4P32A 4OUDA 2NXEA 3PXBA 1JR3D 3U9LA 4B7UA 1EEXB 3NHUA 2PL9A 3CLUD 4G5YA 4M1EA 4FK8A 1XMVA 3K70C 3DG9A 4NAUA 4UTVA 1DCTA 4JXZA 1A2BA 1FPMA 3LK7A 1TF5A 1H9BA 1ISIA 3MTQA 3EZNA 3FF4A 2WM9B 4U3JB 3RHSA 5MGBA 4GOLD 1I2AA 1YXMA 3W6UA 2C4UA 1SM4A 3CT6A 4O4HF 4ZAFA 4POAA 3FVRA 2CHVA 1Y3CE 3NHPA 3TB6A 1HXHA 4Q3AA 1U7WA 1F06A 2DBQA 4KMRA 4B45A 2H5EA 1TVCA 3JYOA 3ELYA 3F3SA 1I33A 4NDAA 2WAAA 5LQNA 4U7PB 1GQYA 1J2TA 1JXOA 1FSGA 5A6SB 3Q8WA 1CRLA 4L28A 4QVGA 5AI8A 1Q3TA 2OQIA 3T34A 5JY1A 3AXTA 4FZVA 4W5NA 1E8DA 2BDEA 2XXAB 1M72A 2OVFA 4J4HA 5HRAA 3PIDA 3HNOA 2I3AA 5KYUB 4I50A 1G291 2NVWA 1Z25A 2P3SA 3S2YA 3CF6R 1NUHA 5ER6A 2VDJA 2ZYTX 1GLNA 3U7HB 2HCBA 3HV2A 3MB8A 3FB1A 2YWHA 3LDAA 1FQKA 3D59A 1KJQA 4RC9A 3RBVA 3I6QA 1QYVA 3NHYA 4J2HA 1H5UA 4JSRA 1GYPA 3VSAA 4JU9A 1HOTA 2BHSA 4HY3A 3CE6A 4PZUA 4H7PA 4PYMA 2EBFX 3VVMA 5KJ1A 2C77A 2GKOA 3A26A 3SY8A 3U4HA 3GJ0A 3TVYA 1ZU4A 3AJEA 1PEKE 1ATZA 5IJZA 3NM6B 3K2IA 3KETA 1KI6A 4YRKA 4IHJB 1IHOA 2AOTB 1TZCA 2I4OA 1F2TB 1L4YA 1ODJA 3ND9A 3ZWNA 3N8KA 2P2SA 1UANA 4LDZA 3CYFA 2G1JA 2X7HA 3CB2A 3Q9UA 1Z8NA 1KZ1A 1GPH1 1Z5GA 2XCIA 3AR2A 3ILXA 4X6XA 4AZSA 5DM70 3IXQA 3K5WA 3KUCA 5LBTA 5HR5A 1OAAA 3L05A 4CIAA 1DC7A 1GNVA 1GGKA 2NUPB 3ETNA 5T8KA 5C2JB 1SCIA 2IA5A 1EINA 1S7GA 3H5TA 3GH1A 1T3TA 3AVPA 3GAMA 1E9CA 3M6WA 1OVMA 4DABA 1V6AA 4TYYA 1UK8A 3OTWA 5FFFA 4BRZA 1XA4A 4W1QA 3EWNA 3EZ6A 1W2GA 2GN2A 2VZLA 4KODA 2WKQA 1JLSA 2PFSA 3N8GA 4MINA 5HDQA 1ZHOA 2YFHA 5I5GA 4JQOA 5F1PA 1Z6ZA 2IHTA 2MSEB 4HI0E 2VBFA 3UW1A 3ADKA 5SYAA 3PYXA 4HWSA 1JPVA 3ZK9A 3LP6A 1ADFA 4IDBA 1VXRA 4Y2GA 1KETA 2XADA 1B0UA 1GUFA 1UC8A 1OFUA 2K4MA 2JI8A 5TPZA 3UMFA 3WSVA 4KSBA 5HWSA 1AE1A 3JRXA 2QORA 4OB8A 1FP4A 3KAPA 1ICEA 1C2TA 3FPGA 4UHDA 4P5DA 3SBXA 4YT8A 5AIBA 1T34A 3PUZA 4MQLA 1YR8A 4RJIA 4DMKA 3LY9A 1PJRA 1NAIA 2ZP1A 2VTVA 1THZA 1M67A 3DDOA 5AXCA 4GHWA 4JLUA 2P65A 2W5UA 1BEZA 4Q3KA 1RWKA 1ZISA 3QVGA 4X45A 4C1NA 4XB2A 4YV7A 4BP9A 3K6RA 1O58A 2IHBA 3C7TA 3UKOA 4DLSA 2O3QA 3FJYA 3JR3A 4OHCA 1YI8A 4Y2JA 1PYDA 4D6XA 2BOVA 1M7GA 1SC1A 1DWPA 1FFXA 5DLYA 1WZEA 5LMNB 1R00A 4X00A 3OM8A 5BW6B 1PV1A 2B7BA 4C6RA 4JLJA 4GEGA 1ZICA 4Y0NA 3W5JA 3LECA 2RGDA 4TYQA 4KE8A 1YZLA 1JWBB 1B3BA 1UQUA 4LXQA 3UYKA 4LF9B 4KXFB 3FHJA 5A5EA 3W5SA 2P2ZA 3FAZA 4NQZA 3IESA 2QX7A 3AR9A 1PJ2A 2RGXA 2RGEA 4GKAA 3SBOA 3KKZA 3W78A 1T36A 4MRRA 2FAXA 1G18A 2DBZA 5KWIA 5MHTA 3IP9A 2QN1A 4IV8A 4EITA 4DQKA 3P1JA 5JXGA 3R8CA 5HE8A 1CV2A 1R16A 2ID7A 2VDOB 3LH5A 1EUQA 2BD0A 1CUUA 1NVFA 4LECA 2V54A 4KH1A 1E9FA 1A4RA 3CRNA 4BO0A 4ZO9A 3JQGB 3KTOA 2W9XA 4RORA 4HNTA 2CWDA 5LMZA 4HVCA 3L01A 3LV8A 3G9XA 1M6NA 4G07A 1LZKA 2R7LA 2WHYA 3AW8A 2WF7A 1ZNZA 3DV0B 3OLWA 1K0FA 2R47A 4K9KA 5D5HA 5AVYA 3RFTA 3T3OA 1IAVA 3FROA 3HJAA 4FLEA 4KPFC 3VNBA 3HFRA 2GHIA 1WZUA 2A58A 1JHAA 2QLLA 2PUJA 3JQ7B 4Q6WA 5H02A 2A0XA 1LV8A 2IEZA 5LYJA 3MAAC 4OHOA 3T9AA 1X1AA 4JJEA 3HVRA 1MVNA 1M54A 4O4IA 5FA8A 4NEQA 2AXNA 1JVSA 2IF0A 4UUNA 5JYEA 2E7ZA 1H8HD 1PWHA 5HCNA 1H94A 3L0IB 4DIDA 2V7WA 5DJ5A 4J0JA 4O0LA 4YRZA 3N6VA 1NBME 4MIYA 5SY4A 1LZLA 3UJ8A 5B58C 4NK5A 3R9XA 3V1UA 4LJYA 4GI5A 1YHYA 4BVEA 2G0AA 2BKEA 3VYTB 5AM4A 2PWAA 3EEFA 4RQBA 1FTWA 1H2WA 4W9NC 2CLDX 5EP2A 3I5MA 4ISCA 3GEMA 4RF4A 3BA6A 3HSSA 3BD7A 2ZSIA 1T9GR 2RHWA 5A7HA 2R68A 4EQ6A 4XQGA 1J8FA 4EG6A 2WVAA 1UWKA 2G70A 2I6SA 2EKZA 1GWNA 3O0TA 3ZZ1A 1O87A 4ABTA 2Q2OA 1RMQA 2QZ4A 1PQUA 3LUHA 3TTVA 1GSAA 4PGAA 3VYWA 1BOFA 4LUCA 3AEYA 4FMCB 4QPJC 2I4IA 4J0CA 2XOKD 4Y2VA 5FEUA 2QTHA 5K2MA 3WLAA 2JLWA 4F1KA 1ZIOA 1HBJA 1D8TA 1DKRA 2PVCA 5JDCA 2WQ6A 1NU6A 2B92A 4DLNA 4RZHA 5HOQA 1CRQA 1PFVA 5CPFA 1KO4A 5CT4A 3LLVA 4NZMA 3O47A 2FH5B 1BRMA 1E58A 4H6PA 4ARZA 3DFKA 4KSCA 4WKCA 1KI2A 4ZEXA 3WNBA 4JT4A 5JYBA 1KRWA 2PRKA 1YRYE 5H3CA 3UXHA 4I1PA 1DIAA 5P21A 3DH0A 1VLVA 4DCNA 3PPVA 1HK7A 3ZI7A 1DEHA 1JQJC 2AD5A 2CBGA 2UVPB 5F77A 3DMYA 3WB1A 3JAWB 3TOCA 5F7ZA 3DS8A 1XZFA 2XB4A 3DMGA 3H5RA 3HJUA 3HV0A 2XDWA 3QYFA 2JBAA 4X44A 3RO7A 4IIEA 3UN1A 1RXEA 1XQ9A 2GCIA 3MTDA 1TVEA 1IY1A 3SFTA 1J8QA 2OWDA 4O2LA 1J1IA 1YHZA 4FDLA 3SIRA 2I33A 2LD4A 1SK9A 3BL5A 1OXBB 4DPMA 2ZDHA 3OC6A 3FCCA 2Z6AA 1P1IA 5C1BA 3I3SR 5DXJA 2ROQA 3KPWA 3H1EA 5FL7A 3NCTA 4CQNA 3U3ZA 2ZSDA 1FB5A 1U65A 4WZAB 5K3OA 2ZPAA 2WJPA 1E8MA 3LIIA 3MTJA 4MCHA 4URVR 2GBIA 2Z9DA 1RHRA 4N39A 4EM6A 4B80A 1DFHA 3HFJA 2CNWD 4L07A 1HRDA 4RFVA 5LOVA 4C4RA 1GQRA 2H63A 2JIPA 4NU5A 2ECQA 3CINA 4Y9SA 2Q5QA 3A6FA 1EZ1A 4WY2A 1CNEA 4FCVA 4AO8A 4DLXA 3M49A 4HS4A 3ZHTA 4R83A 4WD3A 3ZBTA 2CDRA 3IAHA 4E6PA 2AXEA 4AY5A 1ITZA 2OB1A 4C78A 4M7WA 5FAKA 4KREA 3R6LA 3BJRA 2D1FA 3WQHA 4NTZA 5CEFA 5LSAA 4A6DA 2P7IA 5BYAA 1M0WA 2BMAA 1QKIA 1HE3A 1FMTA 1PTKA 4DCOA 4TKVB 4RKFA 3OWXA 1YB4A 3CH5A 4X5OA 3R6TA 4DJFC 1C4OA 3G3EA 3KQVA 2P2DA 2HWKA 5AJYA 4IIHA 4D4IA 4XTCS 5AFSA 3EGWA 4LV6A 1EWVA 1I13A 4EBBA 4CR7A 2GXUA 2PXXA 3RQSA 1E5XA 1T25A 2E4AA 2PSFA 5JS1A 4FB5A 3G5AA 3P9NA 5DF1A 2REOA 3G2PA 1E3QA 4ZRNA 1PX2A 2AWNA 4I6EA 2F1HA 3CG0A 1EDEA 2PKXA 5AVWA 3ESYA 4OTZA 1XZ8A 4WINA 3SE0A 3U7IA 1Y8ZA 1RACA 3GVIA 4QNRA 4YRFA 3K0FB 1L8AA 2JFHA 3OCXA 6NULA 1PLLA 1QH8A 4AICA 2PYIA 1XVUA 2W98A 3DLBA 4YCCA 4P7KA 4OHVA 4EGSA 4J03A 3EIWA 3QVKA 5G1OA 4DOMA 3JQ8B 5LKRA 1ZNQO 5F4ZA 1XKTA 2X76A 5KWVA 3NUQA 5CMLA 1C1HA 1AGXA 2QX8A 3I9MA 3PGJA 3EZ9A 2BBWA 4HTFA 4IPTA 5E6UA 1EGMB 2DKFA 2X9QA 1RP1A 1PU2A 2EYUA 3GZNB 3HP7A 3D8NA 4CEHA 1P19A 4INJA 4PW0A 5IEBA 4EARA 2OGWA 2OCIA 1KHTA 3O4JA 1FQJA 1VPEA 4Y6QA 1CJCA 3ZJYA 4RX1A 3A31A 4KPUB 3QQPA 5ELMA 3KDPA 4TWRA 2YZKA 3EEBA 3SQXA 2JEOA 1OT5A 1OW3B 3D7SA 1PJQA 3TGWA 2C4MA 4BASA 1CVLA 4V0KA 3RVPA 4MI3A 1VE9A 1WMEA 4ZO7A 1BHJA 2B8WA 4DQVA 2FUNB 4MIEA 1TM5E 4UMEA 4UKDA 1C9DB 3A36A 6ADHA 1G98A 2DJIA 3IP8A 5FF9A 2UZAA 4LAFA 2F3PA 5COQA 3UHPA 3BREA 4MUBA 1H2XA 5AW0A 5TY0A 4M1SA 3L7IA 4LMRA 2V7TA 1UFKA 3F5FA 1GG8A 4PXAA 1LJUA 3BMCB 4YAEA 7REQB 4X90A 2HLDD 4BLPA 4HNHA 3IBYA 1H6CA 1T5BA 3A4NA 1WU7A 1RJDA 3SD7A 3VR0A 3I05A 1SFRA 4UDNA 1K4MA 1VC2A 2UYCA 5LC1A 1JR3E 3Q12A 3IOYA 1AA9A 1EU1A 3OURA 4WADA 4WT7A 2YASA 5DI3A 3DHVA 4UHCA 3BB1A 2WUWE 4FC7A 4P5PA 2DHDA 3QUAA 4J7CA 1JEJA 1E4EA 1KXJA 5D1NA 5AWFC 5G4KA 3RROA 5A4IS 5FPTA 2YYSA 4LRSB 4AJOA 3H75A 4RY8A 2P9FA 3C16C 5CD1A 1XEXB 1FP6A 3QXXA 3GEIA 3D4BA 2IYWA 2P4UA 3EFEA 2ACEA 5AJXA 4CCSA 2BFEB 2J0VA 3KD2A 4O4HB 3BGOS 4S2UA 4TS4A 3WXBA 2I76A 3CM0A 4CG3A 3R5TA 3BZWA 3VQTA 4FHDA 2JDID 2UAGA 5D3ZA 1FVOA 1JQEA 2XUIA 4LPSA 2JHAA 4OXKA 3ZV7A 3DE7X 4E07A 4UNQA 1B2RA 2F3RA 3KUKA 2BE9A 2QP9X 5EKUA 3IUEA 1B26A 4I14A 5CD9A 4GXQA 4UXHA 2DQ4A 2NV0A 4F4IA 2PWBA 2H6EA 1U1CA 5DV9A 3IPLA 4OK5A 2BRUC 2JEYA 2XZPA 3S6JA 2ZYAA 3K31A 5DU2A 4EJSC 2Y8EA 1OBOA 2O8DB 4OFZA 1JPNA 4E33A 5BN4B 4M46A 4ZD6A 3DV2A 1OAKA 2ZIFA 4TLDA 4KLZA 5FORA 4BB5A 1XPJA 2BDUA 1C8KA 2RGNC 1CC1S 4IQGA 1JLKA 1G0OA 4PV7A 2Z08A 4N0QA 4L9SA 1HORA 2XVXA 3FSEA 1N7GA 4QXPA 2R97A 1W0JA 2VT7A 3GXOA 2QMZA 1AXEA 2JLQA 3JD0A 1L8QA 5KHAA 2YW2A 1SZPA 5BQ5A 2ATCA 2D2XA 2X0JA 1BXGA 4F85A 4OIMA 1OC4A 2YXBA 4L8WB 3ZNOA 2C98A 2I6TA 2WAYA 2FPGA 4WEQA 4Q93A 3VDNB 2X23A 5IJWA 1I7DA 4BCCA 1MMFB 3PFHA 1JQAA 1Z6TA 2IXFA 3S8EA 3VC3A 1ECLA 4JBXA 1UT5A 4PZ9A 5IT9A 1W8IA 2HJ9A 1CUSA 5FBVB 1LTQA 4J0HA 5BSKA 3NWJA 4I5EA 1RD4A 2O4CA 1JDVA 3COPA 4DUZB 1PJCA 5ECYA 4IF4A 5BWNA 1T2VA 2G71A 1G4AE 3T3MB 5M5BA 3CXRA 3U44B 3D43A 1X7XA 1KPGA 3N76A 4QYWA 4KIJA 3RSSA 4DQXA 2CLHB 4JT9A 4Z3DA 4TLCA 3VPGA 2AE1A 4JVOA 3NJ8A 2VL7A 4A03A 3SU8A 3KSRA 5FLEX 2GLUA 4G0PA 3QNUA 1HWYA 3VI4B 3VHXA 1BX3A 3GZTB 1NM5C 4YMGA 2XPCA 5I6DA 1L5QA 3F0TA 4DDVA 4MQMA 3GL9A 1VA5A 4RKRA 1U2RA 4R16A 3G2QA 5C5CA 4QA9A 3U3JA 2QI9C 4D9CA 2UZ3A 1Q1BA 4EYOA 4YMTA 5FLYA 4TWJA 4E31A 4XJXA 1TTHA 4XGQA 3SKXA 4Y2UA 4Q4CA 1KZGB 1E1LA 1L7PA 1OZFA 2GPTA 2ZJ3A 1B14A 3AJAA 3BXZA 4FGJA 4V0RA 2RD2A 2EFEB 4HNAB 1ISPA 2EF1A 1BWSA 3SYKA 2AFIA 2IQ5A 4BFTA 3TLEA 4B1FA 5FXMA 2GUWA 1PJSA 1QQAA 1RHQA 1YRBA 3FTDA 3WK9A 4XSGA 3FHOA 4IH9A 3PQ3A 4EO9A 2CHGA 1J70A 4ARUA 4G24A 1QGED 2ACWA 2Y0PA 3AY6A 3OFKA 2X1LA 3TAXA 1H3FA 3ESCA 4EB0A 1YTLA 1J8DA 2GBLA 1DIOB 1T6NA 2A7XA 2VP5A 5AVZA 5IWAB 2OLKA 3IAUA 5CYFA 1J1ZA 5JMTA 4FNOA 1PR3A 1Y7TA 4WKBA 4CT0A 4L6IA 3AIIA 3A4IA 3OCCA 3IVGA 4QSMA 4AU1A 2ODEA 4ESHA 3ELWA 2BBSA 1Q7RA 4LFBB 4KFSA 3D4PA 5FUQA 1E3WA 1HLFA 1H4VB 1RHUA 4DXAA 2I2FA 3FOCA 2Q4DA 3NHBA 5HF5A 3ROKA 4P86A 2I0FA 3KC2A 4JLNA 3WKCA 1DHRA 2JCSA 4H3SA 3T9CA 4OK6A 3HO1A 1VL0A 1GR0A 1M5TA 1T2AA 1NBMD 3Q7TA 4KX5A 5ERYA 4R7GA 4MKIA 1O5IA 4W4TA 1PL7A 3EUEA 4FX5A 2ZJ8A 4KIFA 4A92A 5JBNA 4TT8A 1DKMA 5A05A 1NBWB 3F8TA 2Q9BA 3GRVA 1YASA 2WSBA 4HNRA 5C8DA 3Q4GA 1G6KA 4O1MA 3LC7O 1WMFA 2J9RA 2VDQB 4WV3A 4CLDA 2I8LA 1PQ4A 5KTSA 3BWDD 4KXQA 5T4HA 4LHXA 3WLNA 2F3TA 4OXNA 2AGVA 3KYCB 1L5RA 2WWFA 2WINI 3K94A 1JKMA 1OTXA 3ZE9A 2MMGA 2ZI4A 3OCUA 4TSRA 3CJRA 3WOHA 5TQ0B 4I9HA 2IEIA 3V7FA 1T1RA 2X2OA 4GS5A 2KLHA 4IGEA 1VI5A 1F5NA 3CRW1 1EXMA 5GV8A 1JFTA 4N3GA 4LGMA 5CLFA 3INTA 3T4XA 1ZR2A 4DVJA 4EY8A 3G8BA 3MUEA 3SQLA 1FNSA 4EHIA 4LXHA 5M7EA 2Y93A 5J1SB 4HZGA 2B83A 4F6RB 1RQ7A 1GNSA 4U5QA 2Q41A 4HH1A 4NS1A 1NMZA 2FP4A 3I6YA 1HSOA 3IEMA 4EFDA 3NTOA 4B43A 1MOSA 1RWWA 2AD1A 2PSJA 2WVGA 2CNLA 3M5PA 4OQZA 4RMIA 3O8CA 2O8BA 2DSTA 3AZQA 3L7LA 1G19A 4C0AC 3R1IA 4FILA 2Q45A 4M37A 5JAHA 2IYNA 4L5BA 4H1UA 2D0PB 2TYSB 3I34X 5CLQA 1U9JA 2HK8A 1EFLA 4S12A 2O0HA 4OV6B 3MT9A 1NUUA 3CGGA 3IVXA 2FPKA 2Z1NA 1V9LA 4A10A 1XEWY 3MJTA 2VBCA 5FBQB 5GOTA 2X5NA 2VDPB 5FUMA 5HKAA 5IH7A 3Q5DA 3NH6A 3MQ4A 1WCWA 2VHWA 3R2JA 4OP1A 3C98A 2Z8YA 3WZMA 4AT1A 2QD3A 2PS3A 1EVYA 2VPPA 3F67A 5JI2E 2HV8A 5B1SA 1B6GA 1E2IA 5T4BA 4I99A 4YT2A 1R0LA 2ZXEA 1IB6A 1VYVA 2GCNA 2H92A 5TMBA 3WRVA 5C1PA 2G40A 2G80A 4RK4A 2RB5A 3EGXB 3HCCA 1Z5ZA 3OG9A 4F3KA 5IVKA 3M3PA 3L7OA 2ZWOA 1Z7EA 4KVZA 4LC0A 1SBQA 4I3FA 3URKA 6GPBA 3R9WA 1QX4A 3AVXA 2XNJA 4O25A 9ATCA 4C3OB 2QJTA 3HN7A 1AQUA 3GU3A 5DOVA 3CFYA 5K20A 1SAYA 3LUGA 3TSZA 1T9HA 2H3EA 2AEJA 3CKLA 3VU9A 3OZRA 4CM6A 3CNEA 1MDBA 5F1YA 2OBXA 2IUEA 2XZDA 1L3CA 3DDWA 3EUFA 4N7RA 2VWGA 2GM4A 5JJLA 4NE2A 1JXQA 1UK9A 1TIPA 2WF5A 2MYPA 2XUKA 3KLOA 2QNIA 5HIIA 4TKLA 5KQSA 1T29A 2WILA 4PO3X 1QFMA 3DMFA 4YWHA 1QIDA 5CDSA 1SCNE 3CG4A 1ZGGA 1D09A 4JI0B 3L7KA 1KDPA 5EIWA 5K99A 5DFAA 5EIBC 3PENA 2ZS7A 5GTDA 1QFSA 4UCQA 4BGEA 2JH3A 3CWQA 1N5OX 4L73A 2BGJA 1ZIPA 1DU4A 1Z4PX 4WGFA 5J43A 3RVNA 1N75A 1ZH0A 2DPGA 1H8ED 2F90A 4L02A 1GXSA 4J9UE 1IUNA 1JMVA 3ITNA 4P7JA 3T1HB 3QITA 2WC1A 5SY6A 1B74A 3OT4A 2JJYA 1OYWA 5IYZB 2CHUA 5AKHA 2IOHA 1YK0A 1L7NA 3UQYS 4NXMB 1LPSA 3A6HA 3PFWO 3TLKA 3ZWXA 2NP7A 1B6RA 1EDDA 3H2HA 3GJQA 5AESA 1O96A 3E15A 3NT2A 4BYGA 4F3CA 1K7XB 4GI7A 4NOMA 3UGKA 1GUZA 1BWRA 4D46A 4D4LA 1FNMA 4AJPA 1F48A 1T5DX 2QUAA 2V6FA 3R7FA 3VHXB 4QARA 1I36A 2WD8A 1CEEA 4DBVO 1DXHA 1RP7A 1CZLA 4HD8A 4OKSA 1ST2A 1JFFA 1IEWA 2MSNA 1FU4A 2TRSB 3DZGA 2V9PA 3I12A 4A27A 4F5WA 4ZI3A 5A4KA 1KMMA 2PR2A 3QVMA 3AI7A 4R68A 4CIWA 5CAEB 3EEIA 2BEVB 4IRXA 2XZOA 3ETEA 2PKYX 3JATA 3TXYA 3W2HA 2MCFA 4JI5B 1P1HA 3JQDA 3L43A 3C14C 1AMNA 2QTVB 1AOXA 1I30A 4NNPA 1MFPA 3IERA 1JKJB 1KEEB 3ICOA 3L4BC 4G8BA 3C41J 1N2EA 5IFLA 1O94C 3W9SA 1II0A 4X66B 1XXLA 1N3IA 4O59O 2D7DA 1BXRA 3RUEA 5KSOA 2OD7A 3FX2A 5HJ5A 4D9EA 2QXTA 2IPMA 3WVNA 1OI4A 3ZCPA 1YJ8A 1N9GA 3NEAA 1GPMA 5JD3A 3WK8A 2FEXA 4GE0A 4RVUA 1AT1A 5K0ZA 1MXHA 3PA6A 3HM9A 3OP1A 4KLRA 1ZJ4A 4NABA 4UAJA 1OH8A 4JWTA 2JJ8A 5DKFA 1ESZA 3H6HA 1MB0A 1SHKA 3OZDA 3PSAA 2XNSA 2Z1MA 2OCDA 3IO5A 1QPZA 1IWPB 4P98A 2YWXA 1E6CA 2WWIA 1K8ZB 1L2TA 3QPUA 4ENUA 1D2CA 2FE1A 2O3TA 4V0OA 2HR1A 3WY9A 4AY2A 5ARBA 1FRZA 2ECPA 3NYQA 4LGCA 2C57A 4X65B 1WG8A 1QIHA 1G5IA 4AULA 1M7BA 5E7IA 4C6TB 1YONA 2A9OA 2W8BA 3FDIA 3MW8A 3TVTA 3NALA 3MINB 3T0GA 1KPHA 3PDHA 5IN4A 4OQPA 5LWQA 2WFZA 1REQB 1NIPA 2EKBA 2Z57A 3KJFA 2Y92A 4HNSA 5KOHA 4C22A 1V11A 1KNXA 1R9NA 4P2BA 3OZGA 2Y1DA 4W9RA 3U56A 4EPTA 2B2NA 1VP3A 2D1SA 2HFJA 1DV2A 3AFOA 3K32A 1PIWA 2FSIA 4OU4A 1TF2A 3VAZA 4OM7A 3SSNA 1TT5A 5CFPA 4HLQB 1FA9A 2O48X 2CCJA 3BCSA 3AZPA 3G0IA 3U9TA 3DAPA 5IM4A 4MDEA 4R1PA 1LC3A 4BKRA 2QUZA 4BIIA 5IP5A 3E5NA 1ODKA 2EEPA 2GVZC 3QUQA 5EE9A 1P33A 3SSAA 1OB5A 1Y3HA 4JI3B 1XVLA 3VSEA 2H1LA 2H2AA 3CPSA 1E3IA 3H5AA 1I3OA 3QW2A 4HBZA 4DLKA 3RE1A 5DM4A 4QQ8A 5TIIA 3HYSA 4RNCA 4OBWA 4W7HA 3FH0A 3AP2A 3GGJA 1G41A 1MORA 3CRRA 2ATEA 3GGSA 2R5WA 3ZCXA 2O2HA 3OH8A 3B5EA 4GMDA 2XSZD 3A9SA 3AGPA 3Q0TA 1BHO1 1EYZA 4JGIA 4LOIA 3RW9A 2AC4A 1UBTS 3TLCA 3ZVMA 4BE4A 1PD1A 1C3VA 1KVTA 1MZVA 2JS7A 2J3IA 4QYXA 2ZRHA 3ZHSA 4DAOA 5LIPA 4OGKA 1NRXA 1N8NA 2VCEA 3A6EA 1AKVA 4RSHA 2PX3A 5FTKA 5TJHA 2FZ5A 2WM2A 4YRQA 2G28A 3WGLA 2J9XB 2ENUA 3REQB 5IG2A 2JD1A 4J16A 3M9LA 1PBTA 1FDRA 1AMUA 4TYNA 4P1ZA 4I36A 4QREA 4FMBB 3NIFB 3OKCA 5TXGA 5AXBA 5HZHA 2RI0A 2I2XB 5JR3A 1TQHA 4OKNA 1D2RA 4MHOA 1DUSA 3KR9A 4N8DA 2DPMA 3U4CA 1GFSA 2ZPUA 4J29A 5T4EA 1XJWA 2ZQYA 3Q9LA 4N54A 4WMLA 421PA 1E6UA 2CVFA 1DLJA 2MDTA 3E2PA 4PNZA 4XWAA 4BNGA 2LNDA 2HA7A 3EFBA 3GRAA 2MYTA 4YAKA 4UUBA 5J9FA 4RBNA 4AKHA 4YRPA 3TRIA 1IY8A 4JP2A 1WXWA 2QZSA 3FTQA 2Q3CA 3X2FA 4PZLA 3ZWAA 4MJXA 2WIJA 1BEEA 4KQFA 4XWGA 4XYLA 1U7TA 1KE1A 3AYXB 1HETA 1BCRB 3BWEA 3CNHA 1BKYA 3LUPA 3LT0A 4MVXA 4P4NA 3B1YA 4PHCA 3E5RA 1LLCA 4B2LA 2EERA 2Z5FA 3WYGA 5F23A 2OCAA 3CSDA 3CEHA 4JLWA 3LHIA 4JYMA 4U0KA 2LUOA 3MWJA 5LZ5A 5DW3A 4UBNA 2IV7A 2H5IA 3CR8A 1D1TA 4I3GA 4LWQA 1WQ4A 3G1WA 4LZLA 4ASUD 3FM9A 3W5AA 3DKKA 2QAGA 1NUQA 2R6JA 3UG7A 3ZXXA 4TTPA 4GMHA 1MT3A 1SD2A 1MHTA 1LBIA 3DUFA 4ACAA 3U3MA 1ECFA 1P61B 1FUEA 1UCFA 1TZMA 2XCLA 3B3FA 5DBHX 1JHRA 2GJ8A 4F1WA 4XVCA 3O8RA 2PGDA 3W2FA 1IONA 3VU1A 4ENSA 4IDDA 1AV7A 1G60A 3M2TA 4HATA 4QECA 3T5GA 2YVLA 4C14A 1CRZA 1C1XB 3WTBA 1CE8B 2ARKA 4DGSA 1RAGA 3HCFA 3FGZA 4RJTA 5DHQA 1ULUA 3DOUA 2NXCA 3FRHA 2BJHA 3PQ8A 4NYMR 4DC1A 1B6TA 2K2WA 1DAGA 1AVTA 1JJFA 4IWYA 3EDMA 3G8DA 3UJAA 1YAHA 4NQRA 1GY8A 1R8YA 2EATA 4R0NA 3PB3A 1XDWA 4X63A 5E9AA 5FI3A 3RM3A 4YRGA 4KHPB 3D6HA 1VSQA 3Q1LA 4IOKA 4PSDA 5CH3A 4N0PA 5AK4A 4YT4A 2Q4OA 2PUDA 3TEFA 5AR1A 1E2MA 2C2KA 3B9PA 3L6EA 3L40A 3CEPB 1RHKA 1YQTA 3NRBA 4MVWA 5K3AA 2P78A 1SIBE 2AC2A 4I9NA 2OHXA 3UHAA 5TC4A 4PN7A 4BNDA 3PG5A 1MQAA 3U7EB 1NSYA 4OHPA 3M6FA 2DEUA 1SU8A 1BA3A 2NU6A 2NUBA 2PGLA 3NHKA 3STHA 1J0AA 2GN1A 4KR7A 2IPOA 1XF1A 5L8VA 2WYUA 5AQEA 2FK7A 3MELA 4UFNA 1QWSA 1UOPA 3C7KA 3B48A 1NP3A 1X9HA 2X0NA 1DIHA 4I55B 2VDNB 5IF9A 3BXGA 3X3HA 2PUGA 2EJTA 3C48A 2W2XA 2AYXA 4UHHA 1J56A 1KOJA 3ROPA 1RZ3A 2O4UX 2I4RA 3T8YA 5KNCA 3BL8A 1ZK1A 3BT7A 4LRUA 5K8CA 1IN8A 1ENOA 4PGMA 2EX4A 2DKNA 4R1OA 4MW6A 1G2PA 2YHUA 1A7AA 3MWDA 2Z9CA 4EB3A 2PUCA 2J9FA 1KO8A 2I1LA 4YMWA 1Q95A 2COUA 3MJCA 4B87A 2QR3A 5ALSA 1JYEA 4ND7A 2IWRA 4U8HA 3T52A 5C1DA 1PEYA 2P2GA 2IPXA 4KQCA 2R86A 2QN6A 4GWLA 3ZHCA 2BMFA 4DDKA 3D6JA 3B3JA 4P8RA 4MUYA 2GYWA 3H9EO 3QU2A 2G25A 5ALFA 3G9TA 2EDCA 2Z0MA 3CO5A 3O82A 2Q8PA 1MIOB 3LDFA 2BTEA 1E2FA 1VYUA 4NH0A 4XX0B 1ULBA 3IEPA 4Y30A 2C03A 2H5JA 1RABA 4IIJF 2KWIA 4JYAB 3Q6IA 3ZEIA 1U0RA 2W22A 3AEKA 4TL7A 2PG3A 1HQYE 3MRSA 3NH9A 4FOPA 3FPBA 3HB4X 2CJXA 3THWB 2O23A 3HKEA 3PTLA 3SHWA 3EIHA 1QJCA 4OYHA 2DWQA 1GL9B 2P0YA 4QPNA 4FMDB 2EDAA 2QM7A 4QOHA 1AU9A 2EL7A 1SUIA 3SEFA 3VJMA 1AKEA 1MD9A 1SXJD 3O1LA 3VJLA 4COOA 1SBNE 2PX8A 4HDNA 1SRRA 2IUTA 1QDLB 4BJ3A 4ZYXA 4DAEA 3B1ZA 1CUIA 4Z99A 1ST3A 2P4SA 1JU9A 1PBNA 2RK3A 3NXSA 4MW2A 1CUVA 4H7JA 2VK8A 3KUDA 2EFYA 2ZVQX 4DRZA 4EG5A 4FD3A 3V97A 4PC3A 2WE8A 3I4LA 3G23A 3HA2A 4Q3OA 4UOEA 2OM6A 1SKMA 5EGNA 4QYSA 2HA0A 1QANA 4M8NE 1UBOS 2ZI9A 3K09C 2L19A 2QAJA 1V7CA 3KQSA 3BICA 4XUGB 5EVCA 5LCXA 4K28A 5F3RA 3VHLB 2PFKA 2ZI3A 1LS1A 3NANA 1TQ8A 2QIOA 5EFOA 2GEFA 3QA9A 3EWAA 4ZRMA 4ETNA 4P4GA 2BLNA 4Q12A 5IMSA 1Z07A 3DPUA 1OGJA 3SYTA 3A6DA 4FYKA 3S1AB 5KOYA 2NZUG 1X19A 2AIRA 5HK9A 5K4AA 3OFJA 5K0GA 3EGEA 1Z12A 3IUPA 3LYHA 1HEUA 3EVNA 3OUZA 4YA6A 2VPXA 1U0EA 4RHXA 2PD6A 2IZ7A 2V7PA 4CL2A 3JZAA 5EMMA 2O1SA 2YMMA 2W2VA 3DAFA 3EXAA 4TMTA 3EQ8A 3GRCA 3S27A 3UHOA 4IV0A 2JC3A 1T5HX 3HVUA 3NHLA 1XUOA 3QHAA 3ZBPA 4E5SA 5DYIA 1HZZC 3Q3HA 2Q6OA 4LIPD 4KMMA 1LDEA 2J5KA 5JRZA 3BGDA 3EXIA 2AUTA 3VNRA 2DPYA 1QYXA 3JAMA 1E64A 3ZDZB 4BQFA 4KTVE 5EUCA 1AURA 1YL5A 4OKIA 4Y1FA 5FJJA 1OU4A 2HTFA 3IILA 2C2ZA 2QW0X 4V24A 5ER9A 2PKEA 2Y6UA 1EBBA 3GFBA 2VQ6A 3Q3EA 1OLXA 4MUFA 4C4OA 1NX6A 5A2GA 3HDTA 5TVGA 4Z4QA 1KSGA 5LUBA 5JASA 1JVNA 4YCSA 4AG3A 5AUNB 1GL7A 1SHUX 5B7GA 1D2GA 1GN8A 1N0HA 4LKRA 2A3RA 4KZKA 3V4FA 2I3BA 3MMPA 1EWKA 1DS6A 3OIUA 4QFBA 4RV5A 4BV3A 4X85A 4IBOA 4XGNA 4C88A 5A5FA 5G0WA 1RKVA 3NG1A 1RAIA 4ZWNA 3UMRA 1GU1A 5AM1A 1T1EA 5HS6A 3D4OA 3TQSA 5CCXA 1JSRA 2HX1A 4FYXA 5AW2A 5JUWA 4MCAA 2JRCA 5C8YB 4IF6A 1OH7A 1JIJA 3JARB 3I30X 3KSZO 1GSIA 1C9NA 2CD7A 4MV4A 3FNGA 5HIMA 3FFTA 4CKZA 3ENZA 2RDMA 2XLBA 5B3KA 3IEIA 2Q0HA 3MB5A 3UB4A 1RYEA 3HM2A 4FFNA 4ED9A 1TVMA 3K53A 4IFBA 4PLTA 1IUPA 3COVA 1OI3A 1JI0A 2ZRAA 3PKZA 1O6FA 4EEKA 3TTSA 4UHJA 2P1RA 2AN9A 2R44A 3EHDA 1ZK0A 3NNNA 3OIFA 2HN9A 2BM9A 4DA8A 3CUKA 1UMKA 1I24A 3W6PA 2O3RA 1ACLA 3ZU4A 3EZLA 1F8UA 5EWMB 4CV2A 3H42B 3C3AA 1TMGE 3W8EA 2VH1A 4BCBA 4GYWA 4ZCIA 1IEVA 4Z4CA 1OTYA 3GGPA 1IUKA 2ZK7A 4HGYA 2ZRGA 3FI9A 4LVNA 3BFPA 3FGOA 3BJEA 4KXWA 4DV2B 4M1YA 3G5TA 1XRPA 3QNMA 1O94D 3OFVA 3N3AC 1Q0UA 4KQ9A 2OFOA 1DX4A 2P68A 2W0SA 4OI1A 3SZUA 4BAUA 2H48A 4FW9A 1SVKA 2AOUA 3OIWA 1BGXT 3B1XA 3TQCA 2PZ8A 1YNOA 3QHPA 4QXRA 1CJMA 2HCJB 3GPBA 4B75A 1A9XB 1T26A 1I2DA 4D3SA 1XMQB 3BCRA 2E4XA 4NBKA 4B4OA 2CJPA 1TVKB 1SELA 3ETHA 5KQPA 4DLWA 5CDFA 4JCCA 4PLCA 5E4TA 1DJMA 4D43A 2GD6A 2BEWB 4JLAA 3U2QA 3SC2A 2E2WA 2PRYA 4HTFB 1KJ8A 3EYAA 2R1ZA 3KT6A 4ID9A 3TZCA 4CQLA 2LIVA 4DRYA 3WLIA 4AG6A 1NVVR 3HNPA 2ZBQA 2ZE7A 4PZAA 4D4HA 1OY1A 3HKCB 3HUDA 1E2KA 1NRWA 3F73A 2JDIA 3NP9A 4EMBA 4I0WB 4EG8A 3GHYA 3V7WA 4DIMA 2VCYA 2C2YA 1GPDG 5BSRA 3UK6A 3HY6A 4DCUA 3OF2A 1PGQA 2CNWA 3BRQA 3M89A 4MW1A 4ROTA 1GM5A 5LZ2A 3LT1A 1LPAB 1SBCA 3N87A 4FMPA 2APJA 5FI0B 5FKJA 3HUTA 1BQ3A 1R0BA 4LQ4A 5DTIA 1BROA 1ZQ9A 3OJWA 1B8OA 4D26A 1EMDA 2YHAA 1MJHA 4P3OA 3N39C 3K70D 3VI3B 1XTJA 3LX8A 3MCWA 1NW6A 3VU9B 1BD3A 1VJRA 4E5UA 3MNFA 1ZM4A 3CMMA 3KWLA 4KUEA 4KWCA 4X1OA 4AJ1A 3ER8A 3CX3A 1MENA 2XE6A 3S4YA 4N48A 4W9MC 1K3UB 2ZYWX 2VLIA 1P44A 1TZKA 4ARAA 2IOYA 1EK2A 1P1BA 1VECA 1W30A 2G4LA 3LY5A 4FEYA 4MW0A 4Q9IA 4YJDA 4Z8XA 3ZX4A 4DBZA 4EPRA 4KQKA 1TCAA 1KDTA 4K6HA 3B6EA 3NOVA 1VCHA 2G9ZA 1M76A 3HCNA 4G5HA 4S1WA 3SEQA 2Y1FA 3B78A 3WHLA 3R40A 3P2KA 1Y3AA 2G1AA 3MCVA 4OMUA 3GGOA 4GBGA 5DTMA 4MR7B 2X6RA 3LLUA 3L1UA 5LPNA 2VK2A 1KVSA 5CITA 3VNAA 1BAPA 3A3OA 3OLXA 2MR5A 3KHUA 5B6JA 1T3SA 1FTNA 2GD1O 1D0IA 2O2EA 4GSYA 2AZXA 2C83A 1F12A 3B6JA 1V2HE 2BKXA 1VXOA 4ZDWA 1NY5A 2QY9A 4LZOA 1S89A 1WUYA 4CM4A 2I1VB 3U7RA 4C1BA 4YPVA 3RTCA 2P6RA 5JAMA 3QEMB 2ZTLA 2H8GA 1J0BA 4Z3OA 3D5TA 1MEEA 1FXWA 1TZJA 1XLWA 3HCBA 3IA7A 2LWIA 4MXDA 4Q1CA 4RK5A 3TQRA 2AMVA 5CH8A 2FZKA 4B3JA 1N2XA 2XAAA 1U0NA 4D3XA 1QYDA 3AHIA 2FHPA 3L5OA 4ZV4A 1X1QA 1U0LA 4ZCSA 1E6KA 3TCKA 4F93B 4L9AA 1BVHA 3U31A 3NRCA 5B57C 4AVYA 3VR5H 3GCXA 4D7AA 3PJFA 4G1VA 3ACBA 1JIIA 3V5NA 3WLTA 3G79A 3JWPA 3T4EA 3NWOA 2PWZA 3F7NA 4WX2B 4NULA 4GG1A 4LRQA 1Q2UA 1ENYA 1R4NA 3ILSA 5FTMA 3A70A 1TO6A 1CLEA 1EP2B 1MQ9A 3VPSA 1CZKA 4CG1A 3VYUB 1MG0A 2FPPB 1C0KA 3TDNA 1YR7A 1U8FO 1UODA 1VBKA 3DO5A 4K46A 4LOJA 4EGAA 2RH9B 2F4VB 3THXB 1VKZA 2YOHA 2PJRA 1ZM7A 2CDBA 5PGMA 2OP0A 2XUZA 4H7HA 2D13A 3CJTA 4CM8A 1GU7A 4IM7A 5SICE 1T0IA 2JIBA 1JNYA 3A4TA 3PUHA 1PQWA 4S0XA 4S1VA 3BUSA 2Q46A 4UE2A 2NO7A 4BV2A 5CXUA 3VX4A 1BZYA 4DCJA 4MR9A 3G1TA 2AR7A 2QRGA 3R7WA 4ZT6A 5J2UF 4FDVA 1HTTA 1E96A 3FWHA 4DIEA 1QHHB 1AZTA 1T9ZA 3DZKA 2IWHA 3CZ4A 3P0JA 4LDRA 1L7OA 4ZEMA 3U1BA 4FLFA 1RLTA 2XJ9A 5LU9A 5AUQA 2PXCA 5F73A 1QIKA 4NG4A 1R4AA 1WX1A 2QRVB 5FBKA 4QHYA 1V6CA 2IIBA 2HV9A 3T61A 1OKKD 2XNKA 2PGNA 3M4XA 1XNQB 2OGZA 2IDJA 2QD1A 3Q7EA 4H3HB 2A84A 3B1WA 3PD0A 1PKEA 3BIJA 2J5RA 3WGVA 1PR1A 2QV7A 3U80A 3DKVA 3IV6A 2C07A 3MRXA 1NXWA 4AECA 4P08A 2Q4RA 5ESWA 4TMZA 1N1MA 5E95A 2AI3A 1HQDA 3DLAA 3PNVA 3D2CA 5C51B 4YO7A 2KS6A 1TUEA 4LBWA 5TMDA 1HT1E 2VXOA 4DADA 1Z6XA 4EHBA 3DAHA 2BSQA 2LPMA 3RS4A 1USKA 1C7FA 5HQ3B 1O03A 4TRMA 2J7KA 3SQNA 1I0ZA 2PFGA 3FMGA 3L84A 3OLZA 2V0NA 3PZBA 4MVJF 4TMYA 4TQUS 1SCUB 2I87A 5TT0A 2FWIA 1CHDA 3TTYA 1DDGA 3W3AH 2HNBA 3TX6A 1ZU5A 4BBZA 1JR6A 2FFAA 4FOOA 3ZH2A 1EUYA 5J5VA 1TD9A 2C9MA 2PSHA 2YUTA 1GDHA 5BUSA 3S99A 2GETA 2VTEA 2YXLA 3AF3A 1J0EA 4QUKA 1ZRMA 2IKQA 4CM9D 2A92A 4H6VA 2MOKA 1DUVG 4NS4A 3NO4A 5CB6A 2PO7A 1NASA 2B34A 2GPBA 5IXYA 1Z33A 1A9YA 2C0PA 3FSRA 4QXMA 5AKGA 2H00A 4RADA 5KTMA 5LOVF 5EIXA 2NO0A 2OV2A 3CZCA 5HTOA 3NKVA 4NESA 3WKBA 2C3OA 2EX0A 2IYZA 2JFUA 1GUAA 1K89A 1HNNA 4CKBB 2QLBA 4HDRB 3UF0A 4F3TA 2FR8A 3T3IA 4MGYR 2B4TO 3OAAD 1OGYA 1UIMA 4L5IA 3ZW9A 4OHFA 5BV8A 5K7SA 3IDZA 3LCJA 3QVUA 4MUIA 1U7XA 2Y77A 2ZRPA 4ZKDA 3A9TA 3JYNA 4L4ZA 5KSZA 1YS7A 4HL6A 2D1RA 1PJ3A 1KJYA 1QYWA 1V8OA 2GTHA 4BLWA 3O94A 2DAPA 2A2ZA 1ZWKA 2Q6LA 3OMWA 5LXTF 4CT5A 3UJNA 4V1CB 3JQAB 4PZCA 2AKEA 3LQFA 4P3YA 2H65A 1VI2A 4LF7B 4FWTA 4OIFA 2XSZA 1RLOA 3U17A 3IKTA 1D2AA 5E4FA 1X1CA 4XW2A 1E0AA 2G77B 2VQSA 2QAGB 4ZU1X 4YGXB 2XNHA 3L8GA 2Y99A 4AYWA 1H2HA 2IYSA 3AU8A 3I2FA 1CNFA 4JY7A 3T9FA 1QYRA 1MUUA 2PGIA 1RPTA 3KHKA 1P60A 1T36B 2FQQA 4GE3A 4UDOA 2B99A 1DG1G 1XJCA 2B21A 3QPDA 4RGQA 4WZ6A 4X92A 4RTNA 5TS2A 1RWVA 4YV1A 1OREA 2DFPA 4WRRA 1R0SA 3MBKA 4HB2A 4MYHA 5I51A 3AR8A 1Z13A 3HKBA 1Z0SA 4HGZA 3SR4A 3HJHA 4LJ9A 3QX3A 2J0UA 2XCUA 2W90A 4B73A 1ODSA 1WSWA 4JQYA 4KAAA 3FCAA 4MLDA 3TZBA 4Y2YA 3M70A 3QPWA 3QKIA 1RC1A 5CCBA 4YH1A 4MR8B 5L3QA 5BNFA 1V16A 2H1RA 3C6YA 1CR6A 4Q82A 1OFGA 1WB9A 2HMUA 5JATA 3B2EA 4HPWA 3B70A 1IY0A 2GAFA 4EVIA 1KMIY 2OP1A 1J42A 2BT4A 1O08A 4KO4S 2OBLA 4C3VA 4TSKA 2GA8A 3E9QA 3FHCB 3AO0B 2WY2D 1ILEA 4I46A 1T2EA 2I6UA 1GNTA 4MV9A 1LLQA 4PPQA 1Z2CA 4Y9UA 2QPAA 2ZBDA 4TSFD 4P6VF 4Z9XA 3S2ZA 3USZA 1OX5A 1Q7EA 4BMOB 4J0KA 3OI7A 4QYMA 4CF4A 1RZRA 4RFLA 1O89A 1A8UA 1L4EA 3CNBA 4HZUB 3MXTA 3HRKA 1CUCA 4ND8A 2IVZA 3VX3A 1MX1A 4JVNA 1JA1A 4L9RA 4DV6B 4HN9A 3DVQX 5L4NA 5D84A 4R81A 2RHDA 5AJWA 4NU8X 5AVKA 3VKUA 3IVMA 3W5DA 5L3ZA 1GCOA 1II9A 2AR9A 4M60A 2X6TA 2WKSA 1AGNA 3D6VA 5FR2A 2A30A 5SYMA 3KB2A 3I76A 3WYCA 2ZUWA 4DN6A 5TMPA 1I5EA 3OE5A 4EL0A 4NI5A 1RAEA 2NTYC 3PE6A 5DBFA 3FOBA 4EG4A 1JEYB 1P91A 1FLDA 3ZQUA 5KSYA 3V4ZA 3H5LA 5TT1A 3TR6A 4TOIA 5LBIA 2A9PA 2G06A 2FZGA 4JB2A 5FPYA 5A9SB 3KKQA 3SP1A 4U1RA 4UD2A 1YKSA 1IXKA 1EXNA 1QZUA 1P2SA 1YL7A 1KQNA 1SA0B 1SUBA 2RGGA 5A04A 1I4LD 8ADHA 3WIEA 1G6OA 2QTLA 4QJBA 3HA7A 1SIUA 1SWWA 2JFGA 4QOGA 2QBYB 4CTMA 3GOQA 1THGA 3THWA 3W9UA 4CF5A 4YECA 3RK0A 3N8HA 1LDGA 2OGSA 3LHDA 3W6OA 4O3MA 3PJGA 2Z83A 3A1SA 2C5FA 2FVYA 2WFMA 2YJNA 1K8XB 2ZSEA 4HJXA 4LYYA 4TL8A 4DM4A 3RIYA 1NP7A 1M7HA 1SOWA 5F5XA 4DJDC 1VQ1A 1U0HC 3T4PA 2IYEA 3HQ4O 4ZK2A 1INLA 1U5CA 1YVPA 1A50B 2VYND 3DQQA 4QODA 5A0TA 3DFZA 3RV4A 2SNIE 3LC1O 5KCMA 1PFWA 2GWRA 2JBAB 1E79A 1T1SA 4HADA 4M0FA 3H2ZA 1I94B 4PYOA 1MOZA 2YMLA 1RBMA 2IZOA 2BEVA 4G36A 3PFKA 4GLJA 3OQBA 3QYJA 1T4DA 1EUDB 2R6CA 3X1JA 1H8EA 1KYQA 3AEXA 4KK4A 2FN9A 4PFJA 4I1YA 4ZVMA 4COKA 3TZ6A 3W2TA 3GVCA 1TW3A 3MWLA 3GEGA 3F6CA 1BYUA 1AGPA 1UOQA 2PRJA 1XTBA 2ZRLA 3CLSC 3PD7A 1TNDA 3K1TA 2HPZA 4ZVKA 5HK8A 3WKDA 4B6QA 4O63O 2AEMA 4KEAA 2F8SA 3H1GA 3HO8A 2J4CA 1MX3A 2JAHA 5EQJB 5GVRA 1ADBA 3EXEA 5C7IO 1M0SA 5D1HA 2V6JA 4LWPA 2ZJAA 4IQ0A 1Y9JA 3WQQA 1LWNA 2YC2C 3BXHA 2ZULA 3I0ZA 5DSZA 3U3KA 4K88A 1GP2A 1XVIA 4ER5A 5CG1A 3AETB 1Y37A 2HZ7A 2ZSFA 5EJIA 1W19A 5H4HA 3ETCA 4QSHA 4NBRA 1PSDA 3PC4A 4G0YA 4IDGA 5BVHA 4H6XA 2GD2A 2GZ3A 2X5KO 1KK1A 4F5YA 3H18A 3OJLA 2W8BB 3WYNA 1KRXA 3B36A 2JHFA 4LYHA 2DWPA 3SQMA 3V6LA 4DQUA 2BGGA 1J90A 4K9RA 4R3UC 4C0QC 3RC8A 2XUOA 4L8FA 1W4RA 5KHLB 2X15A 1NKTA 1LB1B 4AKTA 3CO0S 5J5AA 5FB3A 3K1JA 5I9IA 2ATIA 2WD7A 1XU7A 2YRWA 4IGKA 2JGIA 1EBFA 1DAOA 3L02A 3UJ7A 3TB4A 2B98A 8AT1A 1DTEA 1JEQA 2XOKA 3FFAA 1QMPA 1SMKA 2DM6A 4K9OA 2VDRB 3EC1A 1IEXA 2YJ3A 3E1KA 2Y3IA 4WNAA 1Y3FE 4E1VA 2IH4A 2AFHA 5HKLA 2JA2A 2L18A 1M1YE 1YIAA 1ZXXA 2VZ8A 1OMOA 3H1AA 2E87A 5AXAA 1OLUB 5DWVA 3NT4A 5IBQA 4OXIA 4CCYB 1H66A 1W49A 5I8ZA 1TFRA 3F6BX 1HNXB 3GFGA 3G2JA 3VPCA 1KC3A 4JJKA 3DAYA 3OJEA 4MRSA 2JFNA 1R8XA 2CXTA 5CJ2A 1D0VA 4QUIA 4C87A 1E99A 2UZ4A 1WZ2A 4L72A 1LVGA 2JG3A 5IVPA 1WW2A 5CFMA 3TLGA 3X2EA 3TW8B 5K8VA 2OOSA 3ZDRA 6AT1A 1C3OB 1QF7A 4KWEA 1ZONA 1F3OA 3BMNA 3K9HA 1QO0A 1X1RA 2ZIUB 5MGNA 1WXIA 2BZSA 2C4TA 5HBGA 5BOVA 1AF4A 1NNSA 4MICA 4TWBA 2ZWPA 5FTWA 2CUKA 4O08A 3AM5A 3ANXA 3G1UA 1UBSB 1VCNA 3QH4A 4QLAA 4XUEA 3W5HA 5FNVA 4AZ3A 2NQ2C 3ND5A 4Q9JA 2MMCA 4AXXA 5I7FA 2DF8A 2PGJA 1RI1A 3K2QA 2XUPA 3CRQA 3GG9A 4Q9LA 4A0HA 5FOQA 2BY4A 5BMVB 5DWDA 5A9RA 1HR0B 4BKPA 2D3WA 2HRZA 4BO4A 3IJRA 4CHTA 4Q4JB 4IV5A 3IVAA 3MOIA 1MQSA 1I8TA 3TR5A 4BPBA 4H4DA 3E84A 1DI0A 1NR1A 4RLHA 3KP1A 5AOBA 1USIA 1Z56C 1UWCA 2HCRA 2CBXA 3A32A 4YMSA 4NYJQ 1G7CA 3G0GA 3WLFA 3VO1A 1H0RA 4OGGA 1ZEJA 4L4XA 2HW8A 2A4MA 4HGNA 4EFNA 2XZLA 4PO1A 1ULHA 2BCEA 4URYR 4YRIA 1L8OA 1NQ5A 1JSXA 4ZDKA 2IEBA 3RU7A 1I9CA 4J07A 4A0RA 3PF8A 3V1LA 2C7RA 4IAOA 3J81k 4BMPB 1HE5A 4ESEA 2BEWA 1L5GB 3HYTA 4C05A 1CQXA 3NWPA 2HGZA 2KI5A 1F0YA 2WSIA 2X7XA 3RNOA 2HF7A 2VHEA 4JKYA 2A5GA 4PYRA 1GOTA 3RRZA 5CVCA 2HEGA 2E4WA 2B82A 1FJXA 2JLSA 4G1CA 2IXDA 3K1YA 4OQXA 1MAHA 1MN6A 2QTMA 3C6QA 3GA7A 1RCTE 3PQ4A 4WXEA 5EE3A 3PT5A 4UM8B 2ZYSA 3EQ7A 4W1PA 5I9BA 1MAVA 4QRDA 1K6XA 2B6NA 4GSLA 3VPXA 5IJ0A 4GFDA 4RD2A 1TI7A 1DJPA 1OLOA 3PEEA 1QNLA 1US8B 2GPYA 3K1AA 1UJ2A 1VHJA 4GI2A 3RVDA 3VR6D 3JWGA 3LMKA 2PH5A 4FGUA 2FMXA 2CXQA 2P9HA 4FN4A 4K3VA 4TTSA 4CL0A 5HW0A 2P77A 4JX9A 3WIVA 1QPGA 2A88A 2B5WA 4KQ6A 1EFTA 3EBLA 2RJNA 3PUYA 4MPPA 2F6RA 2JBHA 1R5BA 4OYLA 3TIFA 1L5NA 2AVNA 2IZ1A 4EWLA 4KGXA 1FDUA 4IEEA 1M2FA 1CIPA 4DLRA 1IATA 3LFTA 4M0UA 4WK2B 3F6YA 3LGSA 5BN4A 1GRQA 3HFGA 1VIDA 2E49A 3FKJA 4HQ6A 4JNKA 3L6RA 3R0VA 1SKUA 1BOOA 5HM6A 5L4SA 2BTOA 5IDVA 1E8NA 1Z5VA 2LXNA 1FDVA 4NY1A 4UQOA 3UNXA 3WOVA 5C5DA 3KQKA 1R0WA 2VAMA 1JW9B 4KCGA 2WIAA 4ME6A 4ZAYA 1O9GA 5MN4A 3BD9A 5BY2A 5J2TB 2I6FA 4J91A 1NL3A 4MGEA 1Q0SA 1WUJS 3ZXIA 3ANMA 2I3GA 2AB0A 1JG2A 3GZJA 2EG9A 1AN0A 3HJTA 1RKQA 3M9WA 4LZNA 3VPFA 3WGJA 5JAUA 3ZGZA 3QMPA 4XUCA 3BZUA 1YBVA 2P5TB 2EX1A 1YCDA 3KZKA 1CZUA 1O4VA 1FFGA 1JP7A 2AMJA 3H5WA 3W34A 2CMKA 2ZRMA 2BFFB 3CF0A 2WHXA 1RRCA 4B5LA 3K35A 2PU7A 2PX0A 1FLNA 3DHEA 4DMRA 1K6EA 4KKVA 5COAA 1B8PA 1NWHA 3GDWA 1NJ8A 4LCJA 4EOGA 1V95A 2G09A 1A2KC 1UPAA 4FJ0A 3NBKA 2HJHA 1P75A 3AB3A 3AF5A 4UCFA 4YUAA 2JCVA 1WDMA 3R5HA 2DUWA 4OO3A 4D81A 1H85A 2DT5A 1RWOA 2Q49A 2YHBA 4JVLA 1W0JD 5HFNA 4B71A 2FG7C 3ZDQA 3BYZA 4KV9A 4XWTA 4JYCA 3RVMA 2OV3A 1E9BA 4G5XA 4YY3B 1RIFA 5DSTA 3AETA 1G42A 1DG9A 2A7QA 2QTNA 1X1EA 3LPMA 3VPBA 1RWNA 2Y0BA 2J5QA 4PN3A 1J5EB 1HYBA 4NJMB 2W8ZA 3ESAA 3RGGA 1OXUA 3H8VA 5I7VA 2XIQA 3LVFO 3LQ4A 4PIPA 4L5AA 2B1JA 1JIVA 1LK0A 3MT8A 3SJCA 3EW9A 2ZI5A 3MQ2A 4G3XA 4YV0A 1PQYA 2AH5A 2GCEA 3HKEB 1DOAA 4J49A 2JASA 4L4RA 2BH2A 3A14A 4UAGA 4WKNA 2OKGA 1BYIA 4WAUA 4YCAA 1H2BA 1E7WA 2GD0A 2MJLA 1GHTA 3HLYA 3IKJA 4ZYLA 1T2NA 2A1IA 1EGQA 1C41A 4WK6A 5E1MA 3V4SA 3TE7A 3SR0A 3WQSB 4DFDA 3VDMA 3OO0A 3TL2A 4RZSA 5EVJA 2HSGA 3OUUA 4ECAA 3K96A 2DTDA 3RFXA 4RCYA 2QG9A 1DIBA 2PXHA 3H5VA 3U37A 4AM8A 1CQPA 5KNLA 4TZKA 3EJ6A 4M86A 3AV3A 1R6AA 1X8XA 3N7AA 4TL6A 4BX2A 4O02B 4Q7LA 1GYQA 4KP7A 3TLYA 3ZDCA 3GIWA 5E9WA 1SUDA 3RIHA 2NGRA 4EA8A 4MB0A 4MEJA 1TT7A 4C2BA 2HA4A 3LW8A 4PVDA 4PR3A 1G20A 4GXRA 4QEKA 1BX0A 3IQZA 4L6CA 1C8VB 1OPRA 2Y0EA 2Q07A 2VPIA 4NBTA 2FPSA 3ADBA 2RONA 3CZMA 3HMKA 4JGGA 4KX3A 4G56A 1UDAA 3NW9A 3GLGB 2M32A 4Q18A 5KNCD 3RAEC 1QVRA 1PWZA 3VV2A 3PA8A 5KQRA 3Q8MA 1JFFB 4BNYA 1YQDA 5HA5A 1FRVA 4PLFA 2DP4E 4RCVA 2EFHB 1ZMRA 3F2VA 4A5OA 4TV8B 4GVLA 4D9BA 1E1YA 5FYQA 4QO7A 1ISSA 3K7EA 1OKKA 2Z3WA 3E9DA 4YONB 3V1KA 1GQ2A 1E9DA 1WZNA 3RYFA 2GN4A 4J6FA 2AUNA 4K6GA 4LN1A 2ILVA 1E59A 3ZY2A 4H9GA 4LNUB 1VIMA 3AR5A 3QG5A 3RHZA 2TMYA 3LG2A 2SCUA 2DCMA 1IZ7A 3KEQA 4J90A 5CX1B 4BMDA 3L41A 1AHPA 4RTKA 1E5DA 4F7DA 5EJ6A 1Q0QA 4IL5A 3AR3A 1Y6QA 1Q17A 3NDJA 4G5OA 3U62A 4H1VA 4LTMA 1F8XA 4EG3A 2EWVA 3I23A 1S5PA 4X3CA 5EXEA 1CQJB 1NPTO 2E55A 3AUJB 5K0SA 5KVCA 2AYYA 1XRLA 4Y6GB 4YXWA 2IZ6A 4GQAA 3QPBA 1PJTA 5FWXA 4YCLA 4HRAA 3QUCA 1WHSA 3TSOA 1E61A 3V2UA 3ER9A 2FF5A 1VTKA 3QVJA 1N3YA 1ZD8A 3EVEA 3L0BA 4Y1RA 5CT6A 5E7JA 2QW8A 4M54A 2IC5A 1B0AA 4DWWA 3KKLA 2HFKA 3QMMA 3AZOA 2AVDA 5EQFA 1U81A 3LT2A 5I8PA 4ZYTA 3E2MA 1N1GA 4IDAA 1GPUA 1XMJA 2ZRNA 3V6MA 3LW7A 3R24A 3RVJA 1OB2A 5BPHA 2PZLA 1QGYA 3S70A 4AC9A 1J8YF 4G5FA 1AK9A 2H29A 5HJ7A 2F3QA 2DQYA 4O4JF 1NXXA 1MB9A 3VU3A 5KS2A 1W0CA 4R2XA 4D02A 3NHJA 2XAUA 4PQGA 2FN3A 1QV7A 1TU4A 1QHYA 2ZQZA 3DBRB 3OOEA 2WTXA 4LE1A 5D00A 3LLCA 3VH3A 1RXSA 1RXVA 1NQOA 1ULSA 1XA0A 1A9PA 4ISBA 1YBAA 2RAVA 3LL7A 1YDFA 4J16C 3TOSA 4W5TA 1HDGO 2FPRA 5M04A 3ORFA 4NEHB 2WHPA 3U40A 1D1PA 3KE8A 3ELUA 1NMSA 3RRMA 2OZPA 2PKRA 1L3IA 5K8IA 3OU7A 3OIDA 5KC9A 1SBYA 3ORHA 5M2QA 1KMHA 1BXZA 3T99A 2PD3A 2Z2IA 3BMQA 5JOQA 2BW0A 3L8EA 4ENTA 3QKSB 4KXVA 2FQ1A 1RYHA 1PKXA 2HL6A 2OTCA 3A6GA 2UKDA 3G7UA 3Q5EA 4W6ZA 5CGQB 3LPAA 5EFZA 2V5AA 2Y0CA 4EKEA 1NQVA 5AW1A 1A9XA 2HTEA 2C4VA 1A97A 1CP3A 3GQBA 3HYLA 4RHCA 5DM60 1RBQA 3ZI0A 3HFSA 3K0BA 3N2KB 7MHTA 3OICA 2GAOA 4LK3A 1JDBB 2Y68A 4GPAA 3TGPA 3FPJA 1G7SA 3NRJA 3HE3A 3IPXA 2DFTA 3R6DA 3D02A 1S3SA 4KBFA 5EZ6B 4BU1A 1IK4A 2EBWA 2ZATA 3QM1A 4DC9A 1E9VA 3HVKA 1NOKA 3UO8B 1I7LA 3AVTA 1TCBA 3FJOA 2AYZA 5L3QB 2EJWA 3JQFA 2C5LA 2P75A 1P2GA 1VLQA 4I2VA 5FQOA 1WAMA 5B12A 3MYYA 3UMJA 4V0ME 3SM9A 1VHWA 1Q0TA 4KYIB 2QF7A 3P26A 3IODA 5DHTA 3B9BA 4KQHA 4PNHA 2H4WA 3MJDA 3W06A 5TGTA 4YBRA 5ITVA 1MOQA 3ABQB 3CRVA 4Z53A 2R8ZA 2GSWA 4I5DA 2IHJA 2WEKA 3GUVA 5ALXA 3TI7A 5EIEA 5GINE 4CWAA 2BEUB 1ODTC 2FRVA 2AN3A 4D3FA 3PYLA 3GJ8A 1BC5A 4LYDA 4XPZA 5LMCA 3A3PA 2VJMB 5B58T 3NTUA 3NC0C 3HDHA 1D07A 2QROA 1U2DA 3N2YA 3SOPA 1SQ5A 4IDQA 1B73A 4JWKA 1WXHA 1Y8QA 4ND4A 2OCBA 2YV1A 4C04A 2VXCA 2XDAA 3AC0A 4RA9A 5BRAA 2OV6A 1XROA 3E6AA 4UEWA 1XFDA 3N3BC 1S3FA 3VPHA 5IEJA 1A7KA 4OYYA 4BFLA 5A4FS 4C7JA 5EA2A 1KIMA 2PL3A 2MYUA 4Y2HA 1TJNA 2IELA 1VPDA 2W48A 1SVNA 3FRIA 3HCPA 3NUGA 3R3XA 2A33A 3NNSA 4Z2YA 4MI6A 5B2EA 2WZQA 3H2JA 2V7XA 1K7SN 1O94A 3GLGE 1SC6A 4KR2A 1KAGA 2OCYC 2R8XA 3L79A 4MOWA 3V00A 1QR6A 2V1UA 1GZ3A 2X22A 1G3UA 2BAGA 3BE8A 3NX4A 2MR6A 2YXDA 3DWIA 3QLUA 4PHTA 2O7SA 4R8RA 3O8OA 1K7CA 3PFCA 4WL0A 5DE3A 1LU9A 1T13A 3WL6A 121PA 4U7GA 2AFIE 5BYBA 3R5JA 4XYMA 5BN3A 1MW9X 4GI3A 4G0UA 1ESMA 3HJCA 1H5NA 5KHOC 2FJ0A 3PEWA 4EGJA 4X71A 1SG9A 4ZYUA 1P4JA 4L74A 3IQHX 4PBSA 1VKHA 4ZJUA 5ILOA 3LLSA 1VB3A 3DMNA 4GPBA 4QJ3A 3PXXA 3DL2A 1JS1X 4MRMA 4LISA 2HCTA 3A1FA 5HFAA 2QR2A 4O5AA 1F1JA 2NZ2A 3I8XA 5CXSA 4IFEA 5LLSA 3GJ3A 3V8PA 3W2EA 4G5RA 5AVOA 4MS1A 1NGSA 3RT1A 5IHPA 2O3JA 4JGBA 1U0JA 2DLNA 4Q9HA 2V97A 1EHYA 2IU4A 5HKOA 1ZXBA 2G6TA 2HB6A 5JSUA 4G0MA 1ZKMA 2ZIWB 4R8SA 1N6HA 4UDYX 4RPGA 1YI1A 2HRQA 4OUKX 3UJ6A 4WZBA 1JBEA 1M2VA 3GEPA 4RYDA 4UZSA 3DLPX 5JLJA 4BMNA 1K6MA 3HP4A 3IUNA 4LDNA 3I9FA 4HLDA 3VR4A 1RI2A 4IOJA 5BN1A 4HQKA 1BTOA 1J5XA 4L4SA 5CFQA 2CL0X 3R09A 2C58A 3KQOA 3IIKA 3HDGA 3W4JA 4RPJA 3TAHA 3RAPR 4P0QB 1LNQA 2UVDA 1L4NA 3FYHA 3UK2A 3UWMA 1XJQA 2QZ9A 3L1JA 1MV8A 2V7QA 1RM5A 4IP0A 4Y18A 5CUQA 4CEJB 3FUWA 1XU4A 5HPYB 4QPPA 1KYZA 2XMRA 4JBLA 1T9CA 2AC7A 2D4AA 2XVMA 1XNJA 2OZLA 3IAXA 4EY4A 2ZE5A 2ZTVA 2GA9A 5IUNC 3K9WA 3HVIA 3TMAA 3PJRA 4E5KA 2GLTA 3IUJA 4R8VA 2IOFK 3Q7PA 1P31A 2GXSA 1M0EA 4X8OA 4PPFA 4EQ6B 2HMAA 5F52A 5CDHA 2I65A 3UUEA 3AKEA 2GZHA 4A6PA 4X9XA 4BRUA 2AZMA 3IULA 4UMVA 1L5FA 1JL3A 2QYHA 2QX9A 2PMDA 4Q66C 4H31A 4NZNA 2RAFA 1U3TA 4JA2A 3ZV5A 3LXUX 2G3YA 3MWYW 4GPEA 4LXTA 2M1XA 1RQLA 1K6IA 4FHFA 4GBJA 2I7TA 1P1FA 1M34A 3ETGA 2XVYA 2HWXA 1SPBS 3G2OA 4X24A 4DLLA 3IQXA 1N9KA 2BONA 4INOA 3L4SO 4S3MA 4EL5A 3GLKA 4RZ2A 4N76A 1LBQA 5KYYB 5EP4A 3BTUA 2C59A 2VF2A 4DA0A 2BP7A 1Y8CA 4XWOA 4TTVA 3FZYA 1PV4A 3JYQA 3A3KA 3O1HB 2HSZA 5CLHA 5H1YA 5D86A 3SXUB 3K9FC 4LYFA 1U2ZA 2DJ5A 3E18A 1PT5A 3QK7A 4X1YA 4F06A 1RC0A 2DTXA 4P38A 2XGOA 2OK7A 4HRVA 3SICE 3T7CA 5DNUA 2CCGA 1KK0A 1DC5A 4MKHA 4UW9A 1DJQA 1DCFA 2OPHA 2H9IA 1EIZA 5T57A 1AKRA 9LDBA 3GG2A 4DL9A 1SXJA 4X7RA 1H9AA 2IYVA 1E1QD 1VLLA 3BGIA 3Q10A 2R6FA 4A6XA 4E5MA 5F2NA 3FCUB 3GQBB 4LYEA 2ORVA 1Y1SA 2WWRA 3OHMA 2PBLA 1RXYA 1ZA2A 5DGDA 1YZVA