4DJJA

Crystal structure of the complex of peptidyl-trna hydrolase from pseudomonas aeruginosa with pimelic acid at 2.9 angstrom resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
194
structure length
194
Chain Sequence
MTAVQLIVGLGNPGPEYDQTRHNAGALFVERLAHAQGVSLVADRKYFGLVGKFSHQGKDVRLLIPTTYMNRSGQSVAALAGFFRIAPDAILVAHDELDMPPGVAKLKTGGGHGGHNGLRDIIAQLGNQNSFHRLRLGIGHPGHSSLVSGYVLGRAPRSEQELLDTSIDFALGVLPEMLAGDWTRAMQKLHSQKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Crystal structure of the complex of Peptidyl-tRNA hydrolase from Pseudomonas aeruginosa with Pimelic acid at 2.9 Angstrom resolution
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 57
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2012-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4djjA00
4YLYA 2NAFA 4DHWA 4ZXPA 3KK0A 4OLJA 4QAJA 3TCNA 4QT4A 4JC4A 4DJJA 3OFVA 2Z2KA 2MJLA 3P2JA 2Z2JA 3VJRA 4JWKA 4HOYA 4LWQA 1RYMA 3TD6A 5IVPA 5IMBA 4JX9A 3TCKA 5B6JA 2JRCA 4P7BA 4Z86A 1RYBA 3NEAA 5IKEA 4FOPA 3V2IA 4JY7A 4QD3A 4QBKA 3KJZA 2PTHA 5EKTA 4IKOA 4ERXA 4FNOA 1RYNA 2Z2IA 4FOTA 3TD2A 4FYJA 2LGJA
chains in the Genus database with same CATH superfamily
1CUSA 1GCOA 3JQ9A 3D4PA 4MI9A 2NAFA 3L4EA 3VM6A 2NO5A 4GLLA 5J4KA 1H8ED 2A2ZA 3BK7A 4PC3A 1E7YA 3AJAA 4HXGA 4U9HS 2JHCA 3KLOA 5ECYA 3N8GA 5TY0A 3TNLA 1PU2A 4ZT3A 4NU0A 3LSYA 4OI1A 3W2IA 4IHJB 5BR7A 2GXUA 2PUWA 2VWGA 3D6HA 2O7VA 3OM8A 5IUNC 1WXQA 4Q4JB 3K4HA 4YAOA 5P21A 4FNAA 4RPLA 1D9XA 5CB6A 4PZZA 4DR3B 1XPOA 3LBYA 3S2ZA 1TW2A 1DC5A 1LQUA 5AYVA 4BEJA 3RC7A 5KOJA 4RQTA 4ENQA 4O3MA 4ZXFA 2BCGY 1B0ZA 5KYUA 4DT1A 1R8JA 5LDHA 1CDZA 2P1RA 3K73O 3W05A 4MVYA 1VDMA 3G1WA 4B3XA 2JIPA 3ZJYA 5AW4A 3WL8A 2HYIC 4J7AA 4MKZA 4BFCA 2REOA 4ID3A 1SBHA 1L4HA 4MPPA 4NBSA 4AZ3B 2PJUA 3EXAA 2FA9A 4D9NA 1IQUA 2O52A 3GNTA 1SG0A 2IHKA 2WWGA 1W4CA 1Y89A 3DOCA 1Z0SA 3A8TA 1OI4A 3NFRA 1FY2A 2J9XB 2QX9A 1LTHR 3FSJX 4HB4A 2YYYA 3HDVA 4MQ5A 4YO7A 1EQUA 2AN4A 2HBZA 4ZYWA 5EXEA 1G21E 2DTXA 2X13A 2UXBB 2Q3MA 2C88A 3GYBA 4EGCB 2RHOA 1OKKA 2XRYA 1DIHA 1G5HA 1HYGA 1PJQA 4B7UA 4DRXA 1CE8B 1FNNA 4E5DA 1ZK1A 4QGSA 1W5FA 3O82A 3PL5A 3SX2A 5L3QA 1CUUA 1KQ3A 4G26A 4Q7MB 4FYYA 2YJ4A 3CZCA 221PA 1BFUA 3RTEA 3SZ3A 1JLKA 2Z57A 2H9YA 4KQCA 2F9LA 1PX0A 2XKAA 5AHKA 5SZKB 4M0UA 5F35A 1SCQA 1MPXA 3RS2A 2R6DA 3RF6A 1QIJA 2JBAA 2QNIA 1NVAA 2B6HA 4RS4A 1E96A 1E9FA 1OXXK 2XT6A 3TDNA 3LY7A 3CRVA 4M49A 4TYWA 2FVYA 1QGDA 2VQFB 4NPCA 1PYDA 4LRUA 3RIYA 3B48A 1SURA 3GFGA 5SZIA 3GDWA 1M2VA 2E4ZA 3UK6A 2FWRA 2OCLA 3O21A 3Q7PA 5I3ZA 3KWJA 4AKIA 2GYWA 2EXXA 3KHSA 1MDBA 4HGYA 4BNTA 4K3VA 4E09A 4ZU1X 4C14A 1PTJA 1SKMA 1C14A 4O2BF 2XA2A 5SZJA 5CVUA 1N4AA 2RGDA 1MEOA 4RZSA 1TJYA 1P5FA 1T5SA 4ZQHA 1OE0A 5EJ2A 3BEOA 1FJ2A 1RJ9B 2FSIA 1FJHA 1VL0A 3CZPA 4JP1A 1GNVA 2VJNA 3UQYS 1B41A 4R9RA 1HTWA 3HKDA 2P5UA 3IAXA 3JATB 2FQ1A 3ZH2A 5E2IA 4P5EA 2AD1A 1KS9A 5CPFA 3LVBA 3AUXA 3KDSE 3PFBA 2CFRA 3Q0TA 4RVDA 4ZQBA 5BN4B 4LJRA 1G7SA 4HDSA 2IXGA 1MXFA 3NV9A 2IZ7A 2EVWX 1Z75A 1PW5A 2ID9A 2NV2B 4XD7A 1J0CA 4ZPJA 4UOEA 1I51A 4N47A 1T2EA 2BH9A 2YWDA 4IY1A 3JQ7B 4C5AA 4JSTA 1BWSA 3P9IA 4XPIB 3OOYA 5FHQA 2GTIA 2XQFA 4IICA 2QTNA 2WP0A 3EZ2A 5JNUA 2JGKA 3TINA 5EIOA 1IN8A 3ZHQA 1ZGAA 3G23A 1ZVVA 3X44A 2JAXA 1V5WA 1F0YA 5IVHA 3C3CA 1ZK2A 2RI0A 1YO6A 3H2YA 3SSMA 1ZM7A 4TWIA 3Q6MA 4U8GA 4BQQA 1N7HA 4MARA 2XMRA 4MPRA 4PGFA 2WT8A 1WZ2A 4WXPA 2N1MA 3WGQA 1FVOA 2C61A 4BTVA 3SQOA 2AJCA 4BC1A 4CZ2A 4R5MA 2EW1A 1MQ9A 1LV8A 1PJLA 1NVUQ 1PYGA 3IAFA 1K89A 2P62A 3RFCA 3CF6R 1PIWA 4O3FA 1E4YA 2Q50A 3KSRA 3Q1KA 3N7UA 3QWFA 1TC2A 3CPHA 3OFND 2Q27A 4JU9A 3RSZA 1UKCA 4JWKA 3ECAA 1ZCZA 4EG1A 3B7WA 4EMSA 3W8FA 1N0VC 3WZMA 2FZCA 2VDQB 1E3MA 4UEJA 3FYUC 4G0XA 3T9EA 3IULA 2FEWB 2W6JD 4CLOA 1XCLA 1L6IA 4LPKA 4AXXA 2C4TA 2XSZD 4B8YA 2A88A 3NORA 1DP4A 2QAIA 3PPYA 1KFBB 3B38A 1Z4MA 4KAJA 3VPXA 4A26A 4ZI7B 5CYFA 1U4OA 4NBUA 4L16A 1KU6A 3T99A 4FNOA 1BJKA 4UM8B 1MB9A 1KEEB 1L1QA 3HUDA 1EXMA 3V8BA 2MINA 4MWTA 3VR6A 1E4EA 3KR1A 1XKLA 1N34B 3AHJA 3GUVA 5ULLA 4XYMA 4C4TA 4YLYA 2GBFA 3QVMA 4G63A 3GBSA 2X8JA 1M33A 4JXKA 4KIWA 1RQGA 3MSXA 1TAQA 3W3AD 3TRHA 4LNUA 4II7A 2HWKA 3B1YA 4PZ0A 1Z6AA 4FJ0A 4KIGA 3ND9A 3Q7TA 1CR6A 4QFMA 3FAZA 5AW5A 2QJFA 2VCEA 4Z4GA 4DR4B 2IHTA 2GVZC 1QYXA 2HXYA 4PAQA 4BMXA 3MXOA 4WLVA 1PDWA 2QW8A 4UNIA 1QP7A 2NU8B 4QASA 3ZYZA 2BM9A 5BQOA 1N7GA 3EYAA 5A1JA 3PRHA 3O0TA 1X8JA 5JSHA 5IYZA 2PJZA 3D7KA 3IE0A 1SEVA 1NVGA 4E7OA 4LGVA 1GL6A 1HFJA 2FPGA 4B5LA 4BFXA 2Z6VA 4AAYA 3TSAA 5KYWA 3DMHA 1MQAA 3EGWA 2NTJA 2EQBA 3EG5A 2W2XA 1SULA 4Q4DA 1BU5A 3AB7A 1JE0A 3R7SA 3FCCA 5C4MA 3M6FA 3I92A 5LBIA 3JD4A 4R01A 2PZAA 3NYWA 4GMHA 3COVA 1F7VA 1E8DA 3D8RA 2FMIA 3NYIA 3OF2A 1BHQ1 4PO1A 1R4MA 2PSEA 3PNBA 2AOUA 3AI2A 4E1BA 1WVMA 5JLJA 3EIQA 3A1TA 1J99A 1XWIA 3V33A 1R9GA 2J3KA 2N9UA 1JJVA 3I8SA 4LDAA 1SUSA 4EF6A 4G1UC 4MWOA 2R86A 3H05A 4ZZ0A 1DAFA 5JJLA 4OAPA 1O2DA 4PYRA 4ZO4A 2IS4A 2JJ8A 5LZ5A 5D3MB 4WOKA 2WTNA 5FUMA 4PQGA 4DLRA 1YKFA 1OIWA 5CAEA 2E4XA 3T1HB 4UW9A 4FSXA 3D3KA 4C6TA 2JIMA 4YXFA 2YV5A 5GMOA 5GV8A 3GLVA 2J6BA 4BPRA 1TLTA 2PRYA 3TI9A 2IOYA 1HYQA 3KL4A 4LUCA 1GNSA 4R68A 1VA4A 2ST1A 3G5LA 1Y1TA 5DLQC 3KOXA 2LPMA 4ND7A 2PWBA 2FAXA 2PYDA 1SD2A 4D41A 2ZSKA 1KO5A 1YOBA 4QYWA 2JIRA 1JYFA 4YDHB 4FD2A 2B4QA 3PE6A 4NABA 1J1IA 4GXTA 4BTLA 4KNYA 1SO8A 1IBSA 2NYAA 4L5BA 2HH9A 4D46A 4PSAA 1LY1A 3OQVA 3UMCA 2E89A 1SU4A 4KODA 4O59O 3IELA 1OHHD 3DBHA 3PUYA 4PAWA 4EW6A 1KVRA 2GCNA 3NHAA 1ECLA 2CNBA 3EOBI 5ALWA 5C7OO 4TRMA 1S8FA 1W36D 3DBVO 4KZPA 3EVAA 2FWMX 2I3AA 1ES9A 1POXA 1KXZA 1NN5A 2HX1A 2N75A 3QE4A 4MS3B 5EZQA 4BBPA 5BOSA 5LQJA 1IZ0A 3ON5A 3CUWA 2IBSA 3G7SA 4YMVA 4BY9E 1HNNA 1Z3IX 4IM7A 4EJMA 3NTUA 5EUMA 2EZUA 2VC2B 1N6IA 2PMEA 4X65B 1G6HA 3UMBA 3H3JA 3PEVA 5JCJA 5AVUA 1O8CA 3O6VA 4ZO6A 1NL3A 2NPIA 3FIJA 4GP6A 4HL6A 4QUKA 3RPEA 4CM5A 1UMDA 5JAMA 1ZW6A 3UK1A 2Q8PA 4CCYA 4DHWA 1V16B 3ZVRA 3CZQA 3M6AA 3TQQA 4E2FA 2OZKA 2PD4A 2C4KA 3FPLA 1SBQA 2C03A 4N3AA 2OMKA 2PX8A 1QHIA 3H2SA 4JA0A 2GMWA 3F3YA 4JVNA 1AXGA 1RVV1 2ZE5A 3ZEIA 2DG2A 3P9YA 2NSDA 1FXSA 4MQEA 2CLOB 4NH4A 5IJ9A 4MUYA 4MYRA 4NC9A 3PV0A 1DC4A 1ZC4A 1TZKA 4XVUA 4KQJA 1ORDA 2YWHA 5MFZA 4PLFA 3I2IA 2D1SA 2JC3A 1U7ZA 1QQ6A 1TTHA 3TUIC 5AK0A 4LDNA 2LDXA 5JU6A 4IZOA 1XT6A 1MOZA 1X1RA 2OP0A 4UD6A 5KNDA 3GQVA 5DP1A 5A05A 3FFWA 3LXRA 4QLBA 2OGZA 4Y6PA 4BWFB 2JGNA 5AVKA 1A3CA 3I8XA 3MWEB 3V2UA 3P2MA 4WCFB 2QUKA 3D6UA 1FUEA 1XD2A 2FUEA 1G8HA 2BVNA 3IUSA 4X5OA 3RQIA 4CIYA 5LQNA 3R4CA 4LTDA 5TXGA 1TA0A 4BU1A 4IF6A 1XQYA 3B8EA 5B6JA 4Z8XA 4O2BB 1IWPB 9LDBA 3CQ9A 1NRWA 1NF3A 1AZLA 2E0IA 2QLBA 2X8WA 4GWGA 1EK5A 2FDRA 3V4OA 3VR4D 5KDOA 1Y4AE 5KEIA 5KOIA 2GI4A 2DB3A 1ACMA 1XDWA 3BE4A 3V6LA 3UJDA 3QW4B 3DTTA 1A0OA 4CIWA 1YDWA 2REXB 5A9SB 3O8NA 2H65A 5B2FA 2GYYA 3O4GA 5A04A 1NXWA 2JHFA 2E4UA 2L18A 1W5SA 1FZQA 1F8GA 3V3KA 4KO3S 2CHEA 4ZOLA 4EL0A 1OLUA 2IHUA 4Z4CA 5HKKD 1BO6A 2QYTA 3E4DA 4PZCA 1XZPA 4MKXA 4B81A 1TYZA 1D2AA 4BNDB 1ZOLA 4K81B 4P7FA 4DEYA 3UUGA 4DG8A 5ALMA 1PWHA 1FYXA 2QTMA 1HDRA 3L0DA 1Y98A 3WP1B 3JWHA 4E4TA 2BMFA 5IDQA 3PNPA 2G1KA 2BGLA 7REQA 1NA5A 4Z99A 4NCIA 2QQ5A 4HWKA 4QYIB 3DHVA 3UW1A 4CMCA 4ABTA 4RFLA 3W7VA 2R8PA 3HBMA 4V3CA 2ZREA 4U0KA 4KUEA 4DCNA 2BN4A 1E2UA 4CMJA 2WHRA 3EJWA 3PHHA 4PQEA 2G76A 1RBMA 5G0SA 3UJNA 3QPWA 2ON6A 2CYAA 4LHVA 2IYQA 4NESA 5C8YA 4MW6A 2Z6UA 5ILOA 1RKUA 2CVOA 1AGYA 2B82A 2GRAA 3NUQA 3V4PB 5KKNB 5HIMA 3NEJA 1EYZA 1JXQA 2WPDA 3VJRA 2X9QA 1I6WA 1NUSA 3FYUA 3O95A 2CXTA 3AEZA 3P9NA 3DHWC 3P19A 4CM9D 1H1LB 3LBHA 4CTOA 4YT5A 2NQTA 3X1MA 2BI4A 3R20A 3PB3A 1CT9A 3M6WA 3JY6A 5CVCA 2WWVD 1JKXA 1ONBA 1FJGB 2XQKA 4UFOA 4I3GA 3K92A 1WHTB 1FK8A 4LCJA 1TZJA 2JHPA 4PX3A 3RWOA 4K05A 2I0FA 2Z08A 4US2R 3I6BA 3IQGX 5HUHA 4NZMA 3CR8A 2XF8A 3LNTA 1L1EA 4EY3A 3U3JA 1QIIA 1U1FA 4WFKA 5L3SA 5C1BA 1MO5A 1KDVA 5IF9A 2CZCA 4AMVA 5EHIA 1PT5A 1D0VA 2WAMA 4F11A 3DPSA 1WPQA 3L7CA 4QHSA 3X1DA 1F0NA 3MGBA 1YSCA 1XHEA 2OQRA 3NASA 5BSWA 5DHTA 3F4LA 3HB4X 3UAZA 2EAUA 1M8PA 2IDMA 2WKSA 1CSEE 2PQMA 2W6CX 1T6NA 1EDEA 2P2LA 1OTHA 5F4ZA 1FXWA 4K6KA 1DRKA 3EC2A 1EZ4A 4GQBA 2I4LA 4IDNA 4KHZA 5CM2Z 1OSNA 4EPRA 3IFSA 1RZVA 4A6XA 4XIIA 5GZ3A 1U3VA 2DFKB 4JOBA 2AG6A 3H5RA 4PHFA 5HYVA 3B7GA 4WA7A 4XB1A 4JENA 4AD8A 2AW5A 2QUBA 1YR3A 1NJ2A 2BFNA 3IOBA 4ITRC 2ZDGA 3T3EA 4H3HB 4LF6B 2D3WA 4N48A 4EHBA 2F48A 1C4KA 2X3FA 5DSTA 3W0LB 5K3CA 3NM4A 4NG4A 5A7FA 4S1VA 5HRCA 2Z5LA 1X1AA 3ETHA 2XCQA 4REQA 2A5JA 2QR3A 3E4CA 3DXZA 1SKUA 4NK5A 1ZITA 2G06A 4EJSB 1GLVA 4TL8A 4HNRA 4V0QA 4B48A 4CE6A 3EJ6A 4XH9B 3AEQB 3V1TC 4DBVO 2FUCA 3EYWA 1NW4A 4AECA 4ENWA 1Y5MA 3OP1A 5FUBA 4Z9BA 4DJJA 4I4CA 3OKFA 1E2MA 4L2IB 1EVIA 1NMXA 5F7OA 5CTAA 1AXEA 1IY8A 3QUCA 4L15A 5BMVA 1IY9A 1FLAA 1NF8A 2QIOA 2HIGA 3CF0A 2OMEA 1AUXA 2D4HA 1Q19A 3F1KA 5TMEA 1KMCA 3EMVA 2Q9AA 2WBLC 3DULA 1K6IA 1M2OB 1DCFA 2OZLA 3M81A 3OIDA 4J8PA 3WIVA 4KREA 2BFEB 3TZLA 5GV7A 2VN8A 3T7JA 5KCZA 3DPUA 2O8BB 2NWQA 2SKCA 4BX0A 3LX4A 1DKOA 4ACAA 2JGAA 2V7PA 5A6SA 2A4MA 2NO0A 2X5NA 1A04A 3C2QA 2MU1A 2P4UA 3IA7A 3PYXA 4QWMA 3UPUA 1O0BA 3LVFO 4RTPA 2TRSB 3UHFA 1K3FA 1MT0A 2WF7A 1P1RA 4J7XA 2OFPA 3KALA 6LDHA 3L77A 4RORA 4PN3A 4QDTA 2ONKA 3OZWA 4FONA 1ZN2A 3DAFA 1UMBA 4C1BA 3OOJA 4L0QA 1DQSA 3OTHA 4MWDA 5EHXA 1DQZA 3EGCA 4LJ5A 1YRLA 4R1NA 1DNPA 4Q3BA 2VSYA 1YBAA 4L78A 2BGTA 2YR0A 3K1JA 1TCCA 3ZDFA 3ORHA 4AY2A 3A10A 4TKZA 4DMMA 2E48A 3RAPR 2X2EA 3FPKA 1IBLB 3T94A 2WSLA 4L76A 4CM8B 5LMZA 1E60A 1JQ3A 3PG5A 5HIIA 3T61A 2GFIA 4UHHA 3K6SB 1JDNA 2QAJA 3IOCA 2OOKA 1VCNA 1D7AA 3OIFA 4ENUA 3MAAC 1GTL1 4ND3A 4TRRA 1V4VA 3I2JA 1MENA 4IYRA 3OX4A 1E5VA 4QAJA 3WMXA 4BRWA 2FRDC 5AIBA 4WNAB 3VC1A 1B93A 1S01A 1TO1E 2J1LA 3GEHA 5KKCA 3A32A 1KZ6A 5EXTA 3H2GA 4C22A 2DY0A 3MJTA 4NZOA 4QOEA 5KSOA 4D8XA 5ITSA 3X1ZA 3M6IA 3JAKA 2GARA 3OHSX 4LZAA 5AOBA 1G9SA 4S1NA 5EWJA 3CEHA 3OTQA 4V39A 1L7OA 5D1NA 4ZGBA 1ZVJA 4J3JA 5T41A 3SY8A 3HDJA 3GJYA 3MVEA 5JPIA 1OC4A 5GINE 1KOGA 1CY6A 4HTAA 3TW8B 2AG5A 3IR7A 4CEIA 2YXNA 3WXMA 1W6UA 3CH4B 1TCBA 3FHCB 1Q91A 3D8SA 4ZJUA 1JH8A 3U3ZA 1JKFA 3OJOA 3PC4A 5EJGA 1JWAB 2FW6A 4B85A 1WU8A 1E5QA 2YINC 3ETGA 3ME5A 2SCUB 1FSSA 3RU3A 2WJJA 1EG7A 4MWGA 3GGOA 1MB2A 5TEWA 3G88A 2Q3JA 1LJ8A 1G20B 2H8KA 2K4MA 1XZFA 2Q3FA 4MHOA 3HXMA 1D09A 4Q4HB 1KA9H 2P4EA 4P86A 5KTOA 1QFJA 3DSRA 1Y7HA 4EFDA 1XD8A 3Q6IA 3IALA 2JLXA 4GZ6A 1JG1A 2R87A 3JQ6A 3TECE 4KL8S 4IJVA 3W5SA 3NI2A 4ONEA 2PQ2A 4N5HX 3T5AA 1P5ZB 6REQA 4MKHA 4DCMA 3QH4A 3SSNA 4RGQA 2CDAA 4HRYA 3ZTWA 4EW2A 1K4MA 1NR5A 1Z74A 4UBMA 2J0UB 2IA5A 2JARA 4KR9A 3IP1A 1GPKA 4YWHA 3T7SA 3ZGXA 4NXNB 2WVGA 3AF1A 5D3QA 2GHIA 2ID4A 3MXTA 5SY9A 3W6UA 3GCDA 1YB2A 3WHLA 1ZIYA 3UT0A 5I45A 2GF9A 3B9QA 3D3WB 3MYRA 3OU6A 3TL2A 1DAIA 4PVCA 2ORIA 3TQFA 1ECCA 3VISA 1DJOA 1MRSA 1Q15A 3FOBA 3HRHA 5TC4A 1IE3A 5JS7A 3THWA 5HKLA 5IAGA 1UC9A 4CG3A 2NP6A 2UYOA 4UNQA 3DP9A 1QF7A 3B5JA 4WGFA 2GPTA 4TL6A 3CKYA 4LQLA 3VPBA 3W3AH 1CYDA 1MQSA 3JALB 3G0HA 4QXMA 1Z0UA 2RC5A 1QUFA 1G6KA 1VYTA 2E5WA 3C3MA 3L7LA 3OQHA 4GRIA 4UNPA 2QX8A 3PQDA 3PEWA 3SVLA 4A5SA 2AHOA 4UHDA 3P2OA 1TD1A 1LRJA 1UT5A 2EG5A 1FEZA 3B1JA 4IS3A 4QYMA 4UEOA 1YA6A 3VX3A 1HURA 1EFKA 2D5LA 4QYTA 5F21A 1APBA 1RZRA 3OZDA 3R09A 4GQIA 4LVNA 3MT9A 2B8TA 1T3GA 4WADA 5AD1A 3UFXB 2WF9A 2FTKE 4G5RA 2XQJA 3CYFA 1W85B 4OI4A 4JT4A 1G9XA 4F1KA 1H1TA 4YMIA 5FBWB 4TPKA 1SMKA 3D0KA 3NUZA 1FLDA 4U3JB 2F67A 1BMTA 3GLFB 3CVUA 5ALPA 3JYQA 1EFHA 3CUUA 3EWNA 5K8IA 5AJXA 2OSVA 2QNBA 4Y1RB 3VAAA 1N77A 4OHCA 5CD9A 4GS5A 1B4DA 2DHCA 3RVDA 4FDLA 5JO0A 4QQ8A 5FOXA 2WNIA 2A0YA 4JBYA 2O5CA 1E1CA 2OV2A 3C8UA 3FKQA 1YVEI 3NBZC 3QVKA 4IDEA 4KO8A 4M0PA 3UJ9A 4DCPA 2FZKA 1GQSA 1EWYA 1LNZA 2FF5A 2BDUA 4ZHQF 3FWHA 3K0CA 3G5TA 1TK2A 2WC1A 3U9TA 2LWIA 4KAAA 1I6MA 1W4BA 3ZH9B 1ZH8A 5CG1A 3AETA 4N5LA 2B2NA 3E3OA 4K88A 5EGNA 2M6LA 5BORA 4QVIA 1KKUA 3L4JA 2O7SA 1KTIA 1B8NA 3BJRA 3JZDA 3DDCA 3MQ4A 3NALA 4Z54A 2EHJA 1Z56C 4QBHA 1K66A 4AX8A 4AUEA 4K9PA 1A2QA 4OHZA 5IU6A 1T34A 1UKBA 4FMPA 4BJ3A 3ER9A 3GO4A 1ZBDA 3SYMA 4Z9XA 5AI9A 3JU3A 3WMRA 1G2IA 1NDQA 2JJ1D 3KELA 5DNEA 4JVLA 4X1YB 2GK6A 1T1IA 5AM5A 4ODIA 4ZVVA 3QXSA 4QODA 1WXWA 4GZ3A 2O0JA 4RZIA 1SC3A 3NJRA 4UJ3A 1B6SA 4S05A 2O6HA 2ZSDA 4OXNA 3ADKA 3FYSA 4ARAA 4FMCF 5LKAA 1CJMA 4S35A 4WOBA 1V4NA 4N3CA 5FBRB 1C7FA 1H2YA 1U2TA 1T5OA 3UV6A 2R3SA 1YR1A 5AJYA 1O5OA 4BV8A 5TARA 3KOMA 3T06B 1GCUA 3LRPA 1GZ4A 1K6EA 1R0WA 4JCOA 3AGPA 2C57A 2J9FB 3E58A 1JR3A 4JODA 1A96A 1U3DA 3UWOA 3AILA 3H19A 2GCPA 3H5WA 2ODNA 1H2HA 1I2MA 2GA9A 1CZRA 4KXLA 4J0FA 4MKIA 4MGHA 1BVRA 1FRNA 1W9MA 3K0BA 3DOIA 3OJCA 2C1XA 3AX6A 3OUUA 1KJQA 1WS6A 3C5CA 2WHQA 3JQEA 2PBLA 4YAWA 2H4YA 1MOSA 2GVNA 4DXHA 4KI7A 1T9DA 4PLZA 2CMGA 4B3IA 1T5LA 1SWVA 3H2HA 5JTTA 1ZHHA 2R8YA 1W76A 1N5JA 2X0JA 5I4IA 2NU8A 1IN1A 3TKYA 4KFTA 3SQWA 4X60A 1PJ2A 2PHZA 3AJ9A 4KW7A 4BB6A 3LYUA 5B3KA 1I94B 1XYVA 3T5GA 1NKVA 1Z63A 1SB9A 1VSQA 4UULA 4YK7A 3FKJA 3FSRA 4EGFA 1GLGA 2ZIVB 3ENVA 1GGNA 3WLNA 4F1JA 5LDDC 3BIWA 4OHBA 1CUHA 1GU1A 4C0HA 4CL8A 2N47A 1Q22A 2QENA 3RKSA 4BUZA 4L6CA 2ZKIA 1UWLA 2QG6A 1CZUA 2PVCA 3L7OA 1JTFA 1I24A 3VU0A 2EDAA 4HN4B 4Z0TA 1ANKA 3RC2A 1LD3A 4UU1A 4MV1A 1Z7WA 3CLSD 5DGHA 4A6PA 2A9VA 3LO5A 3BXGA 3PWSA 4EPTA 5I9LA 2FRDA 4E21A 3PE4A 1MNAA 1KXJA 1NBME 1XN4A 3RT9A 3Q40A 1ONOA 1SB8A 2Z4SA 3NR2A 4FZJA 5DXAA 4W1PA 4EYQA 4OX9Y 3ORYA 3QEAZ 4HYQA 5I5GA 1MCZA 4FDUA 5EJIA 1UWKA 2D4AA 2YXPX 2G4VA 3ZC3A 4DY4A 1FYFA 4KQ1A 2PGAA 2W37A 3ZV5A 2WJYA 1ZIOA 4RJLA 3EN0A 4PYKA 1E2JA 4XGQA 1A1SA 4RE5A 5G1PA 3RYIA 3SHTA 3X1JA 3KEFA 4EKNB 4EK9A 5JZSA 1ODTC 1V4BA 2XYQA 2O7NA 4MKGA 2FEKA 3TZQA 3PFKA 1OH8A 4AF6A 2ZRIA 3RFXA 3P0JA 1UPUA 3VR4H 2NG1A 5DJ5A 1OI3A 3MRTA 4DDUA 2QUJA 3PLAE 3IP7A 1QE3A 2H2IA 1E9EA 2JH8A 2RKWA 4KX5A 1TD9A 4B3MB 3DB2A 5H81A 3GLQA 4XJSA 4AG3A 3JS5A 4HATA 4QXOA 3SC2B 2Z2YA 5BRAA 1QYDA 2XCTB 5EJMA 4PLCA 5B57C 1TLLA 1IAQA 3DKIA 4HNAA 5AOCA 3OSZA 1M2JA 1Q14A 3CN9A 3TR6A 2IQ5A 4D5EA 4BKMA 2B36A 3H87A 4CM7A 3QV1A 5LQRA 1Z4IA 1UP7A 1CJBA 3LDFA 3P4XA 3ZU3A 4C7OA 1ZGCA 2X0RA 2ZETA 1M10A 3FPBA 4Y2SA 2EGHA 1L8OA 3L0OA 4RV9A 3J81k 1SVSA 2A59A 1BH6A 3NXKA 4HJRA 1AS0A 4CM3A 2OZVA 3TH5A 5FB3A 1GILA 1M6YA 3HCNA 2RB5A 3ETJA 4X8OA 3CY6A 4FI3F 1L5GB 4CWAA 3S27A 2IE8A 4AP6A 2H2DA 1XRPA 2PZJA 3WV5A 5GY7A 4A0RA 3NT4A 1P81A 5JY6A 1RDFA 3H8JA 1W49A 1V7PC 2VPQA 3GGGA 3OM1A 4GDMA 1ZH0A 2CJFA 2ZUWA 1KRHA 3OQIB 2N0SA 1ST3A 2XCUA 2DCMA 3PXDA 2E1PA 3HL4A 1ARZA 1U2QA 4BP3A 4PLTA 3UK2A 4MEAA 1NN1A 4MVJG 2O0KA 4P3PA 3SF0A 2CV0A 2PKQP 4QU5A 3USZA 1JALA 1SU6A 3RANA 3JV7A 3L7IA 4TQUS 3W9UA 4WKCA 2H52A 1JEAA 2HSJA 1UPAA 2VT3A 1REQA 2VQ3A 1KOFA 2CNWA 2P65A 1IZZA 3AR8A 1VLZA 2WIGA 3TEMA 1XTKA 4GM0A 2PYZA 3BHNA 3T12A 1MIHA 4GMGA 1PD1A 4TV8F 4RA6B 1YQ9A 4J0CA 1K5PA 1PG2A 1R8XA 2I4MA 2WAXA 1ULTA 2XQGA 1T8TA 1C3LA 1EVZA 2JFPA 2XDQA 1BD4A 1SBTA 1ESNA 2O2CA 2TMDA 3SYRA 3ZBQA 1XTRA 3GG9A 1GPH1 4JXXA 1GIAA 2BZ0A 3KWFA 1UBUS 1IOLA 3DJYA 2QRKA 3BS4A 1X7GA 5B37A 1O87A 1SXIA 3CM0A 3UJ6A 4ZRNA 1SU8A 3MMZA 4H3SA 3C8HA 3R6LA 1GA4A 2C4VA 2XBUA 1JHXA 4K86A 4Q48A 2CYCA 3DV2A 4XD7D 2ECOA 4WXMA 4LOJA 3TQHA 1AO3A 2G5TA 2NVBA 3BKWA 3SKXA 4LYJA 4ZTUB 1PUIA 4WZZA 2O20A 2QIPA 3A1SA 1RQPA 3S70A 2OA0A 2BL4A 1GDHA 1E9RA 3LM8A 4INJA 4LPSA 3C87A 1OXVA 5KU7A 1QR2A 3Q2IA 2E5LB 1SXQA 3VI3B 1G291 1PL8A 2H4JA 2VPPA 2I4RA 1HDCA 3LH5A 1JHVA 5CVDA 3WK7A 3CLUD 4QL3A 3MCAA 3SX4A 1PZXA 2NUAB 4YYEA 4EGSA 2EWMA 3GCWA 2Y1LA 3MK31 3LUBA 2V9PA 2C8VA 2YJ3A 3D7SA 1GITA 1SVUA 4X8MA 1ZZEA 4D9CA 5JAPA 1PN3A 1QVRA 3PEFA 4F72A 3GLGA 1CDOA 2PUEA 3IKJA 5JO9A 4JFAA 4KFCA 3S1AA 1KYYA 2O1EA 3SXUA 1R50A 1JJ7A 4B45A 3UYLA 2ZT5A 1Y8ZA 2HMVA 2I8CA 3IDSA 3KD2A 1NPTO 3JQQA 4L51A 3PFHA 2C9CA 4OB7A 5JJKA 4KXVA 2IPMA 2PCJA 2C9MA 3Q2KA 1KZ7B 2H48A 3SOZA 3UJBA 5I51A 121PA 5C53B 1HE8B 3ST7A 2OHXA 4MEJA 4RE6A 4Y9SA 4EHFA 1BZYA 5L40A 4ZHQB 1X2EA 3M49A 4NYMQ 3HTXA 4NJMB 3DC7A 1YB5A 3WNVA 4PHTA 4B7XA 4CMEC 4H31A 3HYTA 4MA5A 1GAXA 1KH1A 2TECE 2WFMA 3A4TA 4LJLA 4X6YA 5DK6A 5CVTA 2K5UA 1YZKA 5C46F 4L4UA 4XR9A 1VRVA 3T1TA 5FPSA 4MR8B 1PR6A 3DTVD 1H0RA 2DJIA 2WJ6A 1JZQA 1FPQA 1C8KA 4MO9A 3RWBA 3VR6D 3JCZA 2P5YA 4KWIA 5KSPA 4YPFA 3QK7A 1Z29A 2R751 5A5DA 3R74A 3JQCA 2XOKD 3SC4A 2RDMA 4TMFA 2GO1A 3MJHA 1QH1B 1SU7A 4QNRA 3TW6A 4B3BA 1YCHA 4BKOA 1D04A 1KO8A 3NH6A 2R7KA 1X80A 2JFNA 1AU9A 3BICA 4FMCB 4HD8A 4M8NE 4NBWA 1S3IA 2G8NA 3HYCA 4RPKA 1OMOA 3QF4B 3M9XA 5DYGA 1DKLA 1KI9A 1QGOA 1TJ3A 3HL0A 4J16C 5T3YA 1HT0A 1DCKA 4K9LA 3WNCA 3X2FA 4LBVA 1CQJB 1EEXB 4RVCA 2I6UA 2DR2A 3ZD6A 2HWXA 4LYAA 2WFAA 1D7OA 4ZVTA 2D13A 2FCRA 5CT5A 5JC8A 4MGKR 2AQIA 3ROQA 3LTNC 1Z68A 3Q9SA 2UXDB 2PWAA 2H1OA 3OZFA 3AR2A 5GZ6A 4C29A 4CM4A 4G1CA 4XB6B 4H7DA 4F92B 2VBIA 1YE3A 4ZI5A 4DWOA 4KITB 1XZJA 3NNDA 4N0EA 2A92A 5BNZA 1XAIA 3ADBA 2ROQA 1JJIA 1ZRMA 2FPXA 1JNYA 3ZY2A 2WTUA 3IA2A 2I22A 3QBJA 1ZSYA 2IOFA 5F1PA 3EVDA 3N8HA 4JGIA 1UPTA 1TVKA 2FWNA 2XNKA 4ZO7A 4HRXA 2JLZA 1RKQA 3K9GA 3MIIA 4YRFA 4O08A 1JV2B 1QS0B 1AQJA 1KMQA 2B4TO 3DT9A 3FW1A 3DG9A 5GM2A 3TBKA 4CUJA 4ZU6X 3KYDA 5C4IA 1XZDA 1KDOA 3C6MA 4UDNA 1QGYA 2ZTUA 3G8AA 4MRAA 3T1OA 2Q3DA 4BN5A 4K0KB 4LJ6A 1S7GA 5IRCD 4YDQA 4PZYA 5AKEA 5JAOA 5KOYA 2RHWA 2GN1A 3DE1X 3MGCA 3TOZA 1YONA 3HFJA 1BXRA 2A30A 4KIUA 4E2ZA 3FHOA 5KNCA 2YRXA 3FWYA 1L5NA 3ID6C 3UOGA 3VKGA 1ZQ1A 3ZD9A 5M3BA 4RJJA 2X0KA 1GG2A 3WWYA 2CXOA 1KP2A 1SNYA 3LCVB 1V6CA 3A2LA 3ICEA 1FDTA 3PDIB 2CL7X 4INZA 4PXYA 5K8TA 1IN7A 2FOLA 1IWBB 3TJMA 3U17A 4DZTA 4GKJB 2XUQA 3Q0EA 4AN4A 1A9ZA 5EWMB 1GEGA 4D57A 1TT5A 3T7DA 3S4YA 1V8ZA 4PXSA 5K4GA 3MLEA 3UWMA 3QIVA 1UDBA 1K3TA 2ZRGA 4D3DA 1H6AA 1CVLA 4Q16A 1EH5A 1N2HA 2NT3A 1WM1A 3AUTA 4P35A 3U62A 1WCV1 2EX4A 1KR2A 4X6XA 1K75A 3BK2A 3LAWA 3ZDRA 2G1AA 2QSYA 3GLGE 5BWCA 2IW3A 3L4KA 2NU7A 3QYFA 2W42A 4AN1A 2BDEA 4IZIA 5L7TA 2YNMD 4WOCA 5DLEA 3WWEA 3NOXA 4MUXA 1EU1A 1Z5ZA 3CWQA 1TCAA 1LC3A 2IELA 4IKPA 3NANA 4PSKA 5EQFA 1Y6ZA 4DF3A 1LQ2A 4YDRA 3PIRA 1KAEA 5JCJD 4D8WA 3R9XB 3PK0A 3HCDA 1H4VB 4CF7A 2XI4A 3DDSA 3KFXA 3QKWA 4RAQA 3WS7A 4PC7A 1GYPA 2GZ2A 3FZYA 5TRTA 5KNLA 5DN6A 2WJAA 1SJ9A 4W5HA 5K3OA 4UARA 2QXUA 3QKSA 4CKWB 7ADHA 4WK2B 3SWWA 1XB2A 5JSKA 4AIRA 2OV3A 4ESOA 2GYVA 2V0GA 1JDTA 4YCAA 4D99A 3UMJA 3NYRA 1UKAA 2W2PA 3KKPA 4U7WA 5CDFA 1V41E 3GEEA 1BCRA 2GQ0A 2XOXA 2QZSA 4NE9A 3EE6A 2A58A 4A2PA 1GV1A 2AN5A 2E4WA 2KYRA 3NIWA 4Q1FA 5CURA 1CD5A 2A1UB 3ASUA 4YRIA 1RKBA 2VAXA 3VC7A 4NCBA 1UXIA 4OBXA 1JAZA 3GDFA 3QUQA 1QRDA 2PU5A 3DM5A 5DTQA 1H4TA 3FCSB 3QX7A 2XOEA 4JLKA 3MOGA 5JADA 4R2IA 4F5YA 3UWSA 3A9VA 5KNDD 1IM8A 1ZL2A 2QD5A 3RUIA 1H6BA 4N0MA 4L27A 1G2PA 3UFBA 2EOAA 4AZVA 3K5HA 1DUVG 4U7DA 4NJEA 3W1VA 2Q4TA 2ZE8A 2FY8A 3Q8MA 2FJPA 3X2SA 4L95C 2Q3LA 2AR7A 3FMVA 3GJXC 3QGMA 3DYVA 1P1HA 1RLIA 1NVKA 5K0GA 2AG1A 3W2TA 2FI1A 3F2IA 1T8UA 1KDYA 5F51A 4DC0A 1YS6A 3SQMA 2NACA 2Q28A 3INNA 4TV8B 3ZR4B 4G0UA 2VSNA 3THOA 4LSZA 4H1VA 2VF2A 5AKYA 3N2NA 3CZ5A 1KSJA 2DRIA 1BD3A 3E8MA 4F7WA 4YCNA 2IU6A 2ZXFA 1FUKA 1N5LA 2NSHA 2QWXA 3C3JA 5F5XA 2UYHA 3ZS8A 1OZHA 2R11A 2YN0A 2ABWA 5KJ1A 2BHTA 3A6HA 3LD9A 5CEEA 1XRMA 3QRWA 2WFLA 3W5UA 5EKDA 5BUCA 1XMIA 1AX9A 1WQ3A 1VPVA 5FFFA 1WB9A 1UODA 1PGJA 4R69A 1U7HA 4EHNA 3EBLA 3C43A 1E64A 4XX0A 2HF8A 2XMPA 3HLTA 5BVHB 3IHWA 2ZBFA 4OYRA 2OILA 2DAPA 1HL7A 4L9WA 1G7TA 3COYA 5TPWA 3WQQA 1YUBA 2FSHA 2POCA 2WMNB 2VS1A 5T8KA 5HSGA 3LUGA 2YJNA 1DBSA 2J07A 5K8VA 3ILXA 3KZKA 4OGFA 3VXKA 2HIAA 4NXMB 3WAGA 1KERA 2FP4A 5HX7A 1D07A 4NKRA 4MW7A 4CT0A 1FYEA 1E3EA 2W5UA 1QFZA 5SY4A 5JQGA 3HU3A 1GFWA 3QVVA 4XOIA 4ZQIA 4OFWA 3VX4A 2ACEA 4E2XA 2D74A 2HRRA 2WPDD 3GGDA 1MB3A 3TNFA 2ZSHA 2XTJA 2J9GA 2ZK7A 5C34B 1U0LA 2NZ8A 1SUIA 2QQFA 4PRZA 4CMEA 2PWPA 4X7PA 4QTXA 5AT1A 2I2BA 5ES4B 3IMGA 1FU4A 2EFDB 4CNQA 4A10A 3VKHA 5L3ZA 1YZUA 3FN4A 3TM5A 4RLSA 4WSOA 2PUDA 3K96A 1KIFA 2G9RA 1K06A 2IU4A 2Q7XA 4IQ0A 1GO2A 4DLYA 3RIGA 3BB1A 3OJFA 1DZ3A 4JSYA 3TZCA 3UA3A 1WOMA 4B34A 3I0ZA 2H7VA 3OCZA 1Y1PA 5HFJA 2GVDC 1JDZA 2DJ5A 4XWYA 1YD7A 2VZ0A 1GNQA 3W2HA 1MZPA 3OFVA 4I5IA 1PL6A 4CDRA 2XBMA 3AK4A 4MP8A 5AVWA 4NSNA 2B0JA 1GPUA 3HRKA 1FXUA 4JITA 1Z6QA 1YRBA 2BKVA 2OZEA 2YFQA 3BSYA 4GH5A 3ND6A 4J16A 3GEMA 4BVEA 3TBFA 4F2DA 2H5JA 1QP0A 1XVIA 1BX0A 2X0EA 2ZAYA 1C30A 4LFCB 4E11A 3L7AA 3UKJA 1ZK4A 4JLAA 4LRTB 1ODKA 3WVNA 2OENG 2XNJA 4NOMA 4RF2A 1BDIA 3FGPA 1FDUA 3B1KA 3NP7A 4RTKA 2IH2A 1CEQA 3PQEA 4PS1A 2AJDA 1U2DC 4UCFA 3LP6A 4OKIA 5CDFE 4PO9A 2QLMA 1IIBA 4WT7A 3ZOKA 4EY6A 3OQNA 3QG5A 3A28A 3DLIA 2X7HA 2B78A 1AHNA 2GZSA 3KXDA 1X8LA 4PANA 2MCFA 2KS6A 2BLNA 3EB9A 4KQGA 2QM3A 1SUCA 4OMFG 2C4WA 3VOBA 4C89A 3B6EA 4LZWA 3UCXA 3B13B 5JXHA 4DLVA 5LIPA 1D6JA 1U8ZA 4LF7B 3E1SA 5DNCA 1YA8A 4JKOA 4DUYB 1KK2A 3OX2A 2P4SA 5LZ8A 3MOIA 1J21A 4AS3A 5ICGA 2P41A 1W36B 5CP8A 4WL0A 1ZVKA 3AQIA 3D5QA 4BMZA 5AK3A 4G5QA 3C7CB 4YIHA 4HBGA 5JWOA 4W5QA 2D8AA 5E1MA 1NGSA 1IQPA 5F33A 1HK7A 1NKSA 4TZTA 4R1QA 3W5CA 2EFJA 2WB2A 1NLMA 1IDOA 1GPAA 2H4FA 3BXOA 2QU8A 5FWDA 2C31A 4TXLA 4MULA 1NC3A 4PNZA 1T2CA 3C74A 4LXQA 1AA9A 4F9GA 1SKBA 4UNNA 4K9MA 1IXYA 1UH5A 2CVHA 1I32A 1M7HA 3JQBC 4ZAXA 2QUZA 1U7PA 3PE3A 1PL7A 1U2RA 3KZVA 3NBUA 5ES3A 1JA1A 3W4JA 5BV8A 3HN6A 2X4GA 3GV0A 4B40A 5BPFA 2AOTB 4FOTA 3P71T 1KJ9A 4TGLA 3TRFA 4PF1A 4BMVA 1P7CA 4J9UE 4YRBA 1X9GA 4KG7A 5FV7A 4CDNA 1QWSA 1P8JA 4OJNA 3OQBA 4KQ6A 3ZUPA 2QRMA 1QCCA 2JHAA 4LECA 4KC0A 1UBNA 5DF1A 5LNK1 1PFGA 2BEVB 1TCUA 4BX9A 2GRJA 2GLUA 3DOEA 3DVLA 5BV1A 2IPAB 4N9WA 1HXHA 3EEOA 1WBDA 2R68A 5DBGA 2OGUA 2DTDA 3PZRA 1QORA 3IBTA 1H4SA 4F2WA 4DA6A 3EXFA 3GPDG 4K9KA 5J5VA 1LLUA 4MUIA 5TMDA 5D6OA 1DMRA 1L3IA 1D1QA 1E4OA 2V45A 5D7BA 5IVIA 3R7AA 1KK3A 3IP3A 4EGQA 2DUUA 2WRZA 1RRMA 4ILKA 1T3SA 1OU4A 3BHIA 1ZRNA 3I5UA 4P8RA 1K8ZB 4C04A 5K20A 3VDRA 2J6IA 1YS9A 1K2VN 3AI1A 3PI6A 3IC5A 3V34A 2POQX 3AKCA 3D1JA 2OXEA 1AT1A 2X4DA 4Q05A 3AF5A 3PHGA 3WLQA 2XVYA 4DM7A 2HREA 5EZYF 3FRHA 3HU1A 1EVEA 3ND8A 5H0IA 4LI0A 4GC5A 2ZIGA 2WIFA 3ZWMA 5ISMA 4C5BA 2P27A 1IEXA 1S2DA 1UXOA 1V3TA 3JXEA 3M4NA 5EIWA 4UQLA 1KI2A 4MRSA 2A4KA 1KQGA 1N3IA 1P1KA 2YIVX 1XTPA 1TFUA 1X7XA 1YB6A 4ZQCB 3BULA 3H9BA 4AM8A 3IO3A 4KXXA 1NNI1 3JQAA 1N8KA 2OY0A 4NFSA 4E08A 1AHPA 1LRKA 4JUBA 3A7DA 4U9IS 3ZZUA 2ZUDA 3LBNA 1UDCA 5A3RA 7GPBA 1T26A 3LW7A 4A82A 4HH4A 4HQFA 4U8HA 3P96A 1XN1A 2QTFA 4XQEA 1TF2A 4PFJA 8ADHA 5DASA 1JXMA 3E1KA 4A0HA 3BXEA 4IUYA 5AM3A 6ABPA 1P2UA 4MMXB 1E7SA 2JASA 4FC6A 4B73A 4Z7QB 2WG2A 3RUHA 4WKNA 1W5EA 3BSWA 1B6RA 4NOLA 2GEFA 2B83A 3IS3A 3B6IA 1YV9A 5JCXA 1T8SA 1T5HX 4WK4B 4J29A 4B46A 1NW7A 3AG6A 2OD2A 5LZ2A 1RNLA 5FUWA 1AC5A 4KEAA 5CUQA 5DX8A 1M8KA 5E4JA 4XDHA 2XHEA 1R37A 4M8LA 1AM4D 3EDCA 1BQEA 3EHDA 5KJEA 2AC2A 1YZYA 1NG1A 3PD1A 2HCBA 4WACA 2GCOA 2FZGA 2Y0DA 4PHCA 4L8VA 3MTIA 4CFSA 3VVCA 2HU8A 3VH1A 4GEGA 1JAHA 1NZJA 4HDNA 4KBYA 4YJFA 4G36A 5EP4A 1IJFA 2P3LA 5JSQA 3QVSA 1XMQB 2P0EA 1TYDE 3NHLA 2MIIA 1NJ1A 1X7YA 2ZRNA 3A9SA 3R3VA 4I7EA 4IIDA 4HEA1 4B31A 3OM9A 3L04A 1I2BA 3QLEA 2REBA 3KFVA 4UUMA 1P29A 4JBLA 1C9JA 1HSOA 1NBWB 3R3UA 3P5SA 4HAWA 4WOPA 3KB6A 2H1SA 3NC1C 4ZAYA 3TXAA 2MR5A 1DXHA 1OV6A 1W94A 2YVKA 3O4VA 2DSTA 4WCVA 2P75A 3ZGNA 3TF5A 4Q7QA 4JOSA 2VF4X 3MJEA 4PYOA 3N58A 1NMZA 1U31A 4OXIA 1LSSA 3A7EA 5B1YA 3MIZA 4TYYA 2OFFA 3VR6H 3V48A 1I3NA 2P11A 1XGKA 4GWKA 1MHTA 2DPLA 2YV1A 2E21A 1DDIA 1FFGA 1EFRD 4W9MC 3MLAA 1NX6A 4B8ZA 4E13A 1Z5UA 3DOHA 4OYYA 4PV7A 2YHUA 5HZGA 1QF6A 1NBMD 1GRVA 3BBPA 1WW8A 3QEMA 2A35A 2QQ0A 3CG4A 4ED9A 1SHUX 1XHLA 3F5DA 1RIFA 1SBZA 2JD0A 3KB2A 4KAFA 4YUXA 1OFUA 3U4QA 4TMTA 1SHJA 3OURA 4H7IA 1W48A 1KAGA 4UBLA 4AZWA 1RZRD 4YDSA 3M4XA 1WDTA 3RVBA 4DYDA 5B7QA 2QA5A 1HEUA 1KY5A 1RWWA 3HB9A 3EY9A 4P7GA 1Y3FE 4UHCA 2O8NA 1S3GA 2AOXA 1RTTA 4JEIA 4KDEA 1XDUA 1H5NA 4Q1DA 3GLHB 3D81A 2C29D 1WG8A 1T9KA 1J24A 1VCOA 4NMWA 5EXSA 3RVSA 3AM4A 2QN3A 3QLUC 4TOIA 3AYZB 3N8KA 1QG4A 4UUBA 3ZXUB 5JFOA 1PQWA 1Y6RA 2WIKA 2H1CA 3IBSA 3OY2A 4RC9A 4U2BA 5EMLA 4OHPA 3R40A 4ZP1A 5LQUA 5DM70 1BN6A 5CT9A 3W6OA 4HNHA 4PYJA 2A9FA 3LLSA 3BWXA 1U2DA 3MNFA 5DDIP 2OPBA 3GFRA 3PPWA 1XEXB 1KVTA 1LFDB 2AJTA 1J90A 3QUSA 1RD4A 3IOMA 2VTBA 4ZTZB 3SYKA 1UEXC 2ZWIA 2HFJA 3FUVA 2GJAA 3K5IA 4S0ZA 1NBOA 4EP1A 1H0HA 2GZ3A 1DO2A 1Y42X 2OBMA 5DSXA 2IYZA 2ZI9A 1KKMA 3RE1A 2E6KA 3GZJA 4MOWA 5J58A 2JBWA 2Q0SA 4DB4A 4WBNF 2JGDA 4UHBA 3BMQB 1O9BA 1W30A 3AR5A 1WPRA 1QZ3A 4FFBB 2HRQA 1Z16A 2BTQB 4FB4A 4HQOA 3TQIA 3JQDA 1CBUA 3OLXA 1GWNA 1ZOIA 2DXIA 2XYHA 3L0SA 2VQEB 3VPHA 2GN2A 1XAGA 2ZJ8A 2BFAA 3U1VA 3FHTA 3ZWKA 3RS0A 5EZ6B 2HU2A 4E6PA 1P7PA 2HKIA 5L6LB 5ILGA 4A6EA 5AKHA 2RONA 3WHIA 3I2HA 4ALIA 1E2LA 2Q5LA 4DUGD 2WSYB 5A3VA 1ZD3A 5KREA 2PBFA 2PLNA 1T0JB 3CRNA 3OFKA 2CNNA 1KMNA 1O6BA 1OZFA 1WB6A 2ZRJA 5F73A 3WADA 1BRTA 1RRPA 4O1IA 3RF7A 1QBGA 2ESRA 1UAAA 2G17A 2P9ZA 5K0TA 3OF5A 4G1FA 3TE6A 4EH1A 2BM1A 4L8YA 4G0VA 1O97C 1Z47A 1ZM3A 2XW6A 2ZVJA 3FNGA 3JQBA 2PFGA 3NTLA 4DVJA 1DC3A 4FGUA 1ZNXA 1IJEA 3IUMA 4Q3EA 1T9ZA 3CUTA 4HWOA 1N1DA 1WE2A 3D43A 3PWKA 3TD9A 3OWXA 2IEBA 2FWIA 4FUTA 3KXLA 3B3QA 1E1DA 3HCAA 3HP1A 1Z0DA 4NDZA 3NNNA 4NNOA 2Z9BA 2PEZA 4L8FA 2EX0A 4J2TA 2AL7A 1F5SA 1TUBB 4RGYA 4BZZA 4CEHB 4TXMA 2W2NA 4IJUA 1QHEA 4GNKA 3WGHA 4N1AA 3FNHA 3ZWOA 1BX1A 1SOWA 3IJPA 3STYA 1JEYA 4QT4A 5LJLA 4GMDA 3HUEA 3O8BA 1WTAA 1JEJA 3PVZA 3TMYA 1SZDA 4GGPA 5K6RA 3BOSA 4JZKA 4HLUC 3NIDB 2I4OA 1QF9A 2WUDA 3V9AA 1BOOA 2E18A 3UOWA 3MTDA 3T9CA 4DWVA 5CB8A 3VNUA 4FGKA 2R7MA 3PVCA 4BNFA 2VSOA 2YCBA 4MJLA 2NPFA 2BFBB 1XNRB 4LYGA 4B4VA 3T41A 1XPUA 2ENWA 1KNXA 4JN6B 5A3SA 3EA0A 4GSKA 3EHEA 4HCJA 2XUZA 2Z2ZA 4MV3A 1YRYE 4CETA 3ROFA 3DHNA 1KNQA 3DR3A 4H0CA 6NULA 3DZFA 1CUBA 2AC7A 4AURA 2C96A 1O6FA 2VP5A 1U9CA 1WUTA 2SKEA 1LWOA 1EFDN 1QHXA 4OU4A 3UXYA 1RC1A 2YN4A 4HDAA 2BIFA 2QRLA 4LS3A 3VVBA 1V3UA 4BEVA 5KNDH 2O2JA 1VL6A 2NO7A 3ONDA 2EFYA 2P5TB 3FUXA 4J0HA 4BCCA 3OCCA 5AQ1A 2IEIA 2FZLA 1EQ2A 1QKIA 2D0DA 3WLTA 4JJZA 3S1LA 4GM4A 1QG6A 3F6RA 4HH0A 4AJ9A 3MAJA 3WYBA 1SHLA 1VTKA 5K3SA 3AZOA 1VGQA 2YXDA 4S24A 3DWGA 1YZ3A 3EMKA 2AE2A 5EZYB 4LVUA 2IS6A 2IUUA 4YN3A 4L1KA 3MAGA 4D9EA 2FZVA 2HQSA 5LR6A 5AVJA 1AS3A 1DIBA 2ZB3A 1U1CA 3R7WB 2QVXX 4URFA 5JVDA 5K0ZA 3QE9Y 1VJCA 4FMDF 5ALYA 4BLPA 1R16A 1J20A 1EGHA 4HDRB 4QDJA 4DQVA 4EKEA 2COKA 1FYVA 5FWAA 4K6HA 5CX1A 3LGSA 1JIQA 1OXUA 1O95D 1U2SA 3PGLA 4J6EA 4BFZA 1XF9A 4HR7A 3HA7A 1JIVA 3RFFA 2OGWA 4DLUA 3VO8A 1Y1LA 3C3WA 5DHPA 3LW8A 2H1LA 3ED1A 1E3LA 4F12A 4LSMA 4E32A 1JS1X 1Q21A 4J7UA 4XJTA 1ID1A 5ED0A 3V9PA 1N1GA 5DK4A 1T4DA 1GCGA 3LWDA 1AHIA 4YP9A 2JAHA 1TM7E 2I2AA 4M1ZA 5BSHA 5HE9A 4GFDA 1Y34E 2JS7A 2CDNA 1UXKA 4US0R 4QOGA 4WQMA 4BBAA 5KMGA 2JLUA 4AQ7A 1Z8FA 2TS1A 3A4IA 2AXEA 1TAHA 3EVBA 3PRKE 5KPDA 4HDKB 3ETNA 2XXAA 2GM9A 3E70C 2IXDA 3C97A 4XOUA 4DSAA 2PXAA 5FWNA 2V0NA 1L5LA 5DVZA 1ZZGA 4U6SA 1P4RA 4RPGA 2JGRA 5LWHA 4UPEA 2YQZA 1PR5A 5B7GA 1KDTA 3L1JA 4EW1A 5JD3A 2GPBA 3U3MA 1H2RS 3OF3A 4HDMA 4L02A 1QE0A 2FK8A 5GVRA 4EB6A 3K0FB 2NZJA 2P2SA 3Q3CA 3LC2O 1H2AS 2B8JA 4KK3A 4ZA2A 3VU1A 4G4SP 2Y1WA 3BPSA 4PINA 3RIMA 2GNAA 5KTNA 1QGUB 4B0OA 4IWNA 2CW5A 3LC1O 3NV7A 4GGOA 4A03A 2JKYA 2VSFA 3QBEA 5CFRA 2LE0A 2VRCA 2JCSA 2DKFA 1A4RA 1Z3CA 3C85A 4GXQA 5KKAA 4ER3A 1M5UA 1CUYA 2W83A 4ZIRB 4DCCA 2F8SA 2HMWA 1U28A 2CNWD 2Z8ZA 3PNKA 1KBQA 4JI3B 1KHHA 2D5IA 1GRCA 3WG9A 1YU6A 4YAEA 4D9IA 3V4RA 3E2IA 2ET6A 1ZS9A 2VJAA 3RKUA 3EG9A 3T8YA 1RI5A 3DHYA 3H1AA 4GU5A 2RHHA 1J5EB 3IX7A 3OAAA 2IHZA 3CBQA 1WZCA 3CONA 1S8NA 3P45A 4JS0A 4JH0A 4M8SA 2FF7A 4RVHA 3BK1A 4YO8A 3WBFA 1X92A 4N76A 1J2RA 4AC9A 5K3AA 3VUEA 1JU4A 4X66B 3GZNB 1F9EA 1C7QA 2VF8A 3P0HA 3QWIA 5TJHA 1HYHA 5U1PA 3FG9A 1EXVA 4DZRA 3USES 1GUFA 3U9SA 4AW9A 3LVRE 1ZNQO 2FE1A 2I76A 3IR5A 4JBHA 1TW3A 1G21B 3EDRA 2GTPA 3TFWA 4BAUA 1RXVA 1KR5A 4R16A 5D87A 4Z7OB 1GKKA 2B25A 3W9YA 1EXDA 1PBNA 4MS1B 4MRVA 4QHYA 4ZU3A 3OJEA 4AZTA 4HX9A 3KJNA 1HH4A 4NENA 3IODA 4AY6A 1YJBA 1Z4LA 1R0YA 3B3JA 3QLUA 4UDYX 3N28A 4HQNA 4TTIA 4GD3Q 3HKCB 1FA9A 2VHWA 3PNMA 4XIYA 5AHXA 5K3FA 3ZE2B 4B2LA 4D1YA 1U5CA 4HRAA 1OA0A 2PDAA 4Q37A 1MH1A 4OLFA 1T2NA 3GROA 3VNRA 4P0PB 2CDRA 3L6RA 3BDIA 3R3ZA 3SD7A 1T4CB 2OAEA 2O8DB 2RK3A 4EY8A 2OT3B 1E79A 3FH0A 4MUHA 4QXPA 3JPWA 3KKOA 5AMXA 3ZU6A 4D98A 5B58T 3DW1X 3K8QA 5AVRA 3ECCA 4BNZA 1OPXA 2YWFA 2XDYA 1E8MA 1XI2A 3BJIC 4HVLA 5E6UB 2ZOSA 1DPGA 4GPIB 4LXUA 4X94A 5EUBA 4ZANA 1KEZA 5IYZF 4BNGA 5K09A 2VK4A 3I23A 1LLQA 2B1JA 3D1LA 3FYTA 4Q4AB 2BSQA 3VSDA 2RJ3A 2ZIEA 4PFQA 3EIWA 1UM9B 3S0JA 2I6QA 1E2HA 3G6WA 5BW4A 4US1R 2VOJA 3G2PA 4KQ9A 4LJ4A 4OJMX 2PS1A 4A1OA 1JPNA 2PE5A 4GM1A 2HFKA 1JGTA 2Q8NA 1OGIA 1HDIA 4CYMA 1WULS 2YQ5A 4HK4A 5FBZA 4B09A 4CCAA 4U2KA 4F06A 4H1UA 5REQB 3G0IA 3Q2OA 3QFSA 1L5QA 3V7NA 4WBNB 3L8EA 3L0CA 2Y9PB 4Y67A 4Q3NA 2I7DA 4D3XA 5GIOE 4M99A 4G0WA 4FKMA 1L1FA 2FR8C 2O2XA 3IV6A 2QTCA 1H2XA 4JGGA 3BVPA 3K9HA 4J90A 4KE8A 1HFEL 4FKZA 3ZOZA 1W35A 2Y4OA 3GRAA 5FNVF 4DXAA 1C9EA 2B2XA 2HOQA 4Q9NA 1W0CA 4NEQA 3IUQA 1NFRA 4MRRA 4Z8YA 4QIHA 2J4FA 1FQKA 5LU8A 5CFLA 1KZ4A 3K8YA 1Z8HA 4OUDB 1SC9A 2VXYA 1GQ2A 1LDBA 3BWYA 3CKLA 1O9GA 2BHSA 1Z6XA 3DNFA 3VR1A 1R74A 4RTLA 3AOEC 5K0EA 1TZ2A 2QJRA 3OMLA 1L5VA 1UKZA 2E7ZA 3FTFA 4KMSA 2CDBA 1JHYA 4TM7A 5LYYA 4B6GA 4CFYA 2FGKA 3QEOA 4MWSA 4TWJA 2H63A 4DYVA 3WAJA 2H4ZA 2Q4DA 1UP6A 4ES6A 1ST2A 3VPGA 1JDJA 5EWLA 5CNIA 1NQWA 5LKRA 3UVEA 4GEKA 3EFHA 4HLUA 4ZREA 1WUYA 5DZSA 3AONB 2F9FA 3OPXA 5F5LA 1Q0TA 1E2NA 1YS7A 2DP4E 2GN4A 3FJOA 4QDKA 3I9V1 2DHDA 3SU8A 4F6RA 1V1RA 3JYPA 4YAIA 3UF0A 4ZCMA 3AIKA 2ZATA 5JZMA 3C7TA 5K4HA 3N0VA 3TGPA 5KOJB 2IYWA 1XCPA 1M9NA 3CCBA 3MFQA 4FYHA 3ZN2A 3IQHX 3K2EA 2WFZA 4CMIA 2CUKA 2ZYAA 4GBGA 4EA8A 5KYUB 1E89A 1NWHA 3DUFA 1KAQA 2PXHA 3VHLB 2JLSA 3SFZA 4DT1B 5L3RA 3U44A 4L72A 1FFEA 3OP4A 1JG7A 3Q4GA 3KSUA 3HP4A 3WR5A 5AXCA 4BMNA 3H5TA 3OJXA 5E9QA 2ZUCA 4P6VF 1RAEA 2WTMA 1DFGA 5KB3A 4AQYB 4Q9LA 4XQ9A 1IHPA 4CG0A 2QM0A 1LVUA 4EELA 2A78A 1QQTA 2H1IA 621PA 3DZCA 4C78A 3K16A 3DZIA 4E88A 4NZZA 4ZVUA 2YV4A 3WFZA 2D2IA 1JFSA 3BD9A 3GI1A 4DA8A 2HO4A 3W6PA 1QMGA 2V59A 1KSGA 4UATA 2VFAA 2QEQA 2FN9A 4DA9A 2CHUA 2I1WA 3ZDAA 2ACVA 1F6BA 5I7RA 4B6RA 2H5LA 4DRXB 5K0BA 4YUVA 1Q5PA 1MFZA 4UZSA 3AHFA 3WDMA 1QBKC 3K15A 4B83A 4EITA 5L3QB 3QPVA 5AJZA 1D4OA 4C7BA 2IYOA 5DLPA 1NQUA 5E4TA 4IVPA 1CFJA 2B92A 5EIFA 5JAIA 3FWKA 2Y6UA 2EL9A 2ZPTX 1NXTA 1U4NA 1JLLA 3E81A 2H0AA 4LY6A 4Y2XA 3SKVA 1IL0A 2JBAB 3U80A 3ZQKA 2JD2A 3EEBA 3NVKI 1PWZA 2WJIA 5F1YA 1FSPA 3AVYA 5EMKA 1KGSA 2Q1SA 1G3IA 2VDWA 4FMDB 1U5BA 1XVLA 1M2VB 4EBFA 2VHTA 3HU5A 4BGVA 4F4IA 4DIMA 4I1RA 4RKYA 2G8LA 1FFYA 1UFRA 3RKRA 1U0NA 4Y7DA 5I7UA 2I6FA 4MRPA 4ZMSA 5CCDA 4DCJA 3KXIA 3NBYC 4KPGA 3UJ7A 4A15A 3O9VA 4KTVE 4QUGA 4F4FA 5CEFA 2DBYA 2EZTA 3B51X 3FMIA 3HLKA 4ESHA 3MGAA 3CGGA 1MO2A 1FSFA 2V4ZA 3F7MA 2JFGA 4K1XA 2QDXA 1QO7A 3HKDB 4MR9A 1C3JA 2L69A 3HJBA 5I9BA 4YREA 1M76A 1G6Q1 3RC1A 2G0TA 4HJXA 5ALIA 3HHPA 1OVGA 2A57A 2EZ4A 1NT2A 4MR7A 4ZOLF 5DN6D 1Z83A 3BERA 1EG2A 2FUKA 4FEYA 2ODAA 4HDSB 4QGGA 1FNDA 3CF4G 4ZO9A 5B7NA 5CLJA 1E6KA 1RI4A 2WP8J 1ABEA 1I1QB 4TLMB 4OI0A 4FSDA 1V9SA 4FC7A 4PG7A 5DKFA 3ILVA 5DX0A 2ZM5A 2CK3A 2ILVA 2QK4A 3RVOA 1QQBA 2P90A 1Y1QA 1IZ7A 2WSIA 2WQ7A 3QKUA 3ENWA 2R25B 5MGNA 1LTQA 3C24A 4I81A 2VHVA 4L5CA 4H0FA 2VI5A 2WI8A 2BHNA 1TEHA 5CYOA 3L7BA 4IIHA 1U7XA 2G63A 4A2CA 4F84A 3NLLA 4QWWA 3ML1A 5C8YF 5F98A 3H9EO 1HV8A 2PSFA 1RABA 2L82A 4FINA 2RHLA 2OE2A 4RZHA 1GU7A 1LPAB 2JVIA 3SS8A 3VYRB 3VYSB 2DULA 3PI7A 2HUNA 5FORA 3BREA 2XQVA 2MSEB 2NTNA 6Q21A 5IFLA 1HLFA 4FX5A 1A72A 4YP0A 2JLVA 3T3PB 2NV6A 2P3SA 1EUCA 2FU5C 3F49S 3WDLA 3EDQA 3OICA 4GWLA 5A4JA 1HE2A 3PRJA 4RDXA 4OQLA 5DWDA 5DNYB 3DAGA 3PDCA 1P0PA 1Z6TA 4L4YA 2ZYRA 4GBJA 5A7HA 2I3ZA 3TX6A 1JVNA 5F2KA 2PQ0A 3FZEA 2EYQA 1GZHB 2ZAMA 1WL8A 4FU0A 1BW9A 1B73A 4CLOB 5BWMA 2HK7A 3W4KA 2ZRHA 4F3CA 3RABA 2LP4Y 4FFPA 5AJUA 1E0DA 2PUVA 2BFEA 3ITNA 5COQA 2VNHA 2K2QB 5KDDA 1OFUX 3KTFA 4UOZA 4BNLA 2MINB 2IW1A 1E4EB 3OOHA 3II6X 2AEFA 4MW1A 2WU1A 4EHIA 4DLAA 4L9AA 1WJGA 2DBQA 2X8JB 3OI7A 1OZ0A 4INPA 4OQFA 4X1KA 5TPZA 3FOEC 4AKEA 2OWDA 2XUPA 4LNUB 2O50A 1SC1A 2RH9B 3L5OA 3KSAC 1VKHA 2CN1A 4AZSA 1BFKA 4JJFA 1FXWF 2VJQA 2AA3A 3EVEA 2PT9A 4YRPA 4RY9A 2NUBA 1N5KA 3P7MA 4JLWA 3VSCA 1RJWA 3IHLA 4J2HA 2C9BA 4J2OA 1CPYA 2BOVA 1MO6A 4PAGA 5I7FA 3AKZA 4YQEA 1D0SA 4R3NA 3SQNA 1ZI6A 2R0QC 5DTJA 3DAHA 4BJ1A 3KKZA 2IUTA 3IDQA 4R98A 3OE1A 4P7BA 4FTWA 1O77A 2ZJ2A 2XF2A 3F4KA 3UWKA 4BO4A 2F00A 2XTZA 5IYZB 4PG5A 3UNXA 2FPGB 3M6UA 4G2NA 2ATXA 1XJWA 1VP9A 3H9QA 4JUFA 4D0LB 5KYWB 2Q5IA 3GMDA 3D7LA 1QC5A 1XL0A 2FUG6 4JT8A 3MD0A 1N6KA 2FR8A 3OU7A 2F3SA 3CX7A 5F64A 2XR1A 4IP0A 3ZWDA 3CLKA 1UDWA 4KGXA 3C7DB 4UTVA 3U09A 1NXOA 1CP3A 1K08A 1OY1A 2XKBA 4IIBA 3FHJA 3IAAA 4CGYA 3UWPA 4BQFA 3QHQA 2HRZA 5ICCA 1FFAA 1PT8A 3QNMA 1VE9A 2GJKA 3TAHA 1OAOC 1S2OA 2B3TA 1C3OA 5BMVF 1E66A 3CKKA 5JCPA 2HNBA 5KTMA 1ULSA 1R4MB 4DNXA 1BMQA 2AOUB 3AOEA 3FY4A 5C8VA 1O0SA 4BFTA 5ALZA 3T38A 4JBXA 4CV2A 1UQUA 5FFMA 3U4HA 2O2YA 3U16A 4KBGA 1R15A 3G2IA 3H1FA 2MYUA 4DEXA 3DS8A 5IH3A 4DUZB 2Q2WA 4QDZA 3TMAA 3AVXA 1RM3A 3O3CA 3GDOA 4WZBA 1N2XA 5CAEB 2NU6A 2PRKA 1GUZA 2NVUA 1U0BB 4C6TB 3E7DA 1IUPA 3NUGA 1PLKA 1MOPA 4LSGA 2QTZA 1A9TA 2H17A 3L05A 1U7TA 1XMPA 3MHPA 3QW2A 5A2QA 5D5PA 1R0ZA 1MX5A 1GOTA 1PO7A 1SPBS 2PSJA 4D92A 4EI9A 4QOIA 3NJ4A 3PXUA 4CKEA 1NJ6A 1OTXA 2C4UA 1EFPA 1EFTA 2JA2A 3UB2A 5JECA 4X54A 3V97A 1G5RA 4AICA 1UXHA 1PRYA 4HYYA 3RTGA 2CJYA 3C4JA 2J8ZA 2F17A 2BRUC 2V6JA 1ZIPA 3DBHB 3FF1A 3KVYA 4YVFA 3DE7X 4UHJA 4ZYUA 3VOTA 5IX8A 1L4EA 1LFAA 2EFGA 3L8FA 4MMYB 1JPVA 5IPFA 1AKNA 1QIFA 1VLLA 3PKIA 5BYJA 3P2JA 3ZCTA 5IWAB 4KR7A 1CXZA 1QFYA 3VDNB 2PD6A 1F14A 5BOSB 5JSUA 4GKKB 3DB1A 4TXJA 3IAM1 1C1XA 2JFYA 2PGDA 2V4UA 1QOPB 2I67A 4UEQA 2Y1GA 4OP1A 5KQSA 3UN1A 1DUIA 3A1VA 3BCRA 3FDFA 4HFJA 3TZHA 2I8LA 3E9MA 3HCFA 1MV8A 1X7WA 4L8LA 1BEUB 2CLSA 2R6GA 1QFMA 2HBYA 2QW0X 2J9ZB 1A7UA 2IZ1A 3GRUA 3ZHZA 5JUWA 2Q2OA 1Y6FA 5C2JB 1P18A 1UMDB 2G9QA 3CX3A 3F90A 3TI7A 5BSEA 5ELXA 1RWXA 2VPIA 1YU9A 2GUWA 3GNLA 5CRIA 1VKJA 2G4LA 1UIMA 4P4SA 2Q7DA 4CCYB 1DJMA 3IH5A 2D5CA 2IXAA 5I9SA 3MB5A 1W0JA 2WMOB 5DULA 1TKCA 2HA6A 1J8MF 5EA2A 4RTRA 2GXAA 4GW3A 4EA6A 1KYVA 1DDOA 1P9OA 4B35A 1XDSA 1BQ3A 1BXGA 4BNHA 2JFUA 2J9RA 4MQEB 5B2EA 5IJ9B 4JLJA 2IH5A 2Q07A 2YOHA 5I4CA 1NVVQ 3TLMA 2PMWB 2RGUA 3GFFA 1KEPA 1NXPA 3DWEX 1ISGA 3U7RA 1TJ5A 4C5CA 2F7SA 2WKQA 5B3JC 1E3WA 2PO5A 3DV9A 4BO2A 4CMAA 3O8OA 1AKUA 2QT9A 1QK5A 2X3YA 1Y37A 1TKAA 5KQPA 4PY2A 5IARA 4RELA 4MDYA 3G59A 1CQXA 2Y1FA 5FXMA 3L8GA 4E5PA 3IJ5A 3KLNA 3OA0A 2OYCA 5BR4A 1FZTA 1PNVA 2GERA 2I6SA 3KK0A 4G5HA 1XD2B 3KC2A 4HSGA 4NBVA 3ZLJA 2GBGA 3OZBA 1PJZA 1SUDA 2C2HA 2DBVO 3ESCA 2GJSA 1DOZA 2ZIZA 2D5AA 4IRUB 3Q15C 4MO2A 4EFLA 4UM9B 1NMEA 5I7OA 1EWQA 5HR5A 2NNLD 4RGBA 1H9AA 2BV3A 4UVDA 3RRYA 2VP9A 4RMJA 4LXXA 2IYEA 1NUUA 2R7AA 2J59A 3V80A 4QQKA 2JEZA 4G0MA 1CJCA 5D1HA 2V6FA 4IZHA 3PJGA 4LISA 2V7QA 3TKAA 1GTZA 3C1TA 3VMFA 2QP3A 4DPLA 5JV5A 5LP6F 5EIXA 3DE4X 4UFPA 4BC0A 3UJ8A 1UK9A 3KQTA 4DPMA 3K2IA 4ZOLB 5G41A 1OLUB 4DJAA 3U6KA 1DTSA 3P52A 3H4IA 3QOYA 3RUPA 2EIXA 1EJ6A 1NVTA 2C2BA 2DPHA 2HD4A 3AUSA 3JQAD 3ONFA 5F77A 4AB1A 2QS9A 1WSAA 3CLRC 2QTRA 5CLHA 1FDVA 1QGED 1RWQA 1N4DA 2P79A 3QENA 4TS9A 1X9IA 3D5TA 5H4HA 3U4AA 2V7BA 1G5FA 1U3UA 2B30A 1NX9A 3P97A 4QYSA 5EHGA 5CNMA 1Z4KA 2XV1A 3HADA 5G2OA 2JGLA 3HS3A 1M0EA 3D6NB 2GSWA 3JARA 3NM5A 5CXSA 1BCSA 1H69A 4C07A 4B3JA 4DWWA 5AW6A 2ZWOA 5CPBA 1WWKA 3UV3A 4DDTA 3SXPA 3Q5GA 4A92A 3K53A 5C8YB 5EKTA 1KY2A 4KLZA 3UM9A 3VR2A 3NIFB 5AKKA 1NIPA 4D02A 1A8UA 2YXLA 3VZSA 3TG2A 3F6CA 3VH2A 3BN3A 5CFMA 1AMNA 1L8AA 3ERCA 3FYUB 3SNHA 5JAUA 1EVYA 4M1QA 1QPBA 4D0GA 4RVFA 3ABSB 2WA1A 13PKA 5G1NA 3UA4A 1SBYA 2I7TA 3I4CA 4K1LA 4K46A 5IJWA 2ZB7A 3ZX4A 3A05A 2I1LA 4OKSA 4QECA 4B4WA 3ZCRA 3UJPA 2HA0A 3FLMA 2XUJA 2YUTA 2XEXA 3SEQA 2WIJA 3WSVA 2G5CA 2QJWA 1E69A 4KZKA 2O0LA 1V7QA 2EP5A 2X2FA 3H04A 4HVTA 2H4XA 1DB3A 1N0IA 4WERA 5C5DA 4RULA 3A3PA 2WQ6A 1VPEA 3ES9A 5ARCA 4ZZ3A 5LP1A 4PS0A 4QBFA 2P9JA 3SPXA 2FG5A 4NAHA 1NMYA 4B87A 5L3SB 1P5RA 2IE0A 3FOAA 3SXJA 3WISA 2ONZA 3PQ3A 4Z3OA 1KDPA 1MQ8B 3G3EA 1ZONA 2HU5A 2OCKA 4FIDA 3H9CA 5CW1A 5E3JA 2JLRA 2TMYA 3LOUA 4MK4A 4FJ2A 3KEMA 4M4SA 2AV6A 4N40A 3L6DA 1V11A 4DXDA 1ICIA 1B3BA 1GR1A 4AJEA 3C3AA 1PW7A 1W47A 3DDNA 4P5PA 5BN1A 1JEDA 3KYIB 2GO7A 5DRTA 1OBOA 2X5KO 2FFJA 1RHRA 4ND4A 2LD4A 1U94A 3JZIA 4FCCA 5E7MA 1ACLA 1O89A 2Z3VA 4AMUA 5KTRA 2EF0A 3GAAA 1I4DD 3RNOA 1PGQA 4Y2HA 3TRJA 2V6IA 5K2OA 4FZ3A 3HK2A 1MGPA 3DWIA 4L07A 1VHJA 2M2IA 4AMYA 2ZUFA 4RXMA 3K35A 5JNSA 1V8BA 4UVIA 1OAOA 2QR2A 3DONA 4TVOA 5T4FA 3I1JA 1GZ6A 2XUDA 3F96A 4REQB 3PFIA 1EMDA 2OHFA 1N6OA 4NS4A 4UMDA 3PGJA 3V7YA 3NNSA 1T5TA 5JWHA 4BN4A 3CW2A 2W2LA 4YJHA 4KWTA 4RDHA 2FPMA 1FVFA 5B4TA 5T7BA 2B1GA 2NXNA 3B78A 4PPNA 3AH8A 3T7RA 3FPSA 2AG8A 2JHGA 2H06A 3A70A 4M1YA 1O0CA 1JZTA 3GJ8A 2JLQA 2WE7A 3HDQA 2Z83A 3R6GA 2AXQA 3PRYA 4V0SA 3LCRA 5IK2A 3W8NA 3L8HA 4X61A 2FEAA 4UM5A 3TWOA 2OZLB 1VECA 1ORHA 2NYVA 4KQHA 3CMCO 2ZP1A 4IDBA 2G5GX 1GA6A 2NO4A 4NRDA 1MLDA 1NVFA 3U4CA 3OCUA 3K9FC 1UT6A 1XCJA 1Y5NA 4IIJA 4PYLA 4U7GA 5A6SB 3VH4A 3ZCPA 4B74A 2GESA 1IY2A 2VHEA 4V0KA 1I1OA 3AF0A 3I4FA 1QQAA 5F9FA 3LP5A 1VIVA 3CZ4A 3U61B 5A1TA 2RHCA 2V6MA 4GPAA 1TTTA 2A9JA 3HB7A 1CS0A 4LJAA 5HGJA 1JMYA 3DXFA 2VXCA 4LK2A 3IUEA 1XIVA 4CT4B 5KYNA 1IQ0A 1UMBB 2PN1A 4M8KA 1J2JA 1D9ZA 1NRXA 1JU9A 1U3TA 1LW7A 2FE4A 5AI5A 3UT5A 3NMUF 3PLNA 1KZ1A 1V71A 3H8SA 3AFNA 1Q7EA 2IGBA 1CVIA 4I6GA 2C2KA 4OGWA 1D4AA 3R44A 4UPDA 1H2WA 3I6MA 1JLRA 5LZ7A 1HA3A 3OPNA 1D03A 1G18A 3A6KA 1N6LA 3LHDA 4D6XA 3TIXB 3PJDA 5AW3A 2Q45A 3ZW9A 3HLYA 3AV0B 4RU1A 1ETUA 1Z4JA 2Q1UA 3NWEA 3PQ6A 1TADA 3RRMA 2P6RA 1F06A 3PFFA 4F2HA 5A5FA 3WMGA 2G07A 1DDGA 1U2ZA 2FRVA 4EVSA 3BGVA 4KPUA 4BMYA 1Z5VA 3KQNA 4X84A 5IBPA 5ITZB 1N78A 2VSXA 4UTOA 4QLAA 4YFVA 2HA5A 3R3YA 2J31A 5DYWA 2AYXA 1EUZA 5IMSA 5FBHA 1JSRA 1O54A 1GA1A 2A5FA 2VTVA 5CFOA 5JJBA 3OT1A 4P4LA 3F2VA 4UOQA 3G2LA 3HSSA 1LU9A 3M5PA 4C4AA 4KAXA 2AR0A 1U98A 2FW7A 3PGMA 4MB2A 1HL3A 3GFOA 2VQ6A 4YCJA 2ODQA 4Z2AA 3JAKB 2QB5A 3HXLA 4QOHA 4DJ5X 5EWJB 1DXOA 2ID8A 2HEGA 5E7QA 1TGYA 1VHDA 3G8CA 1YZLA 4GHWA 4CMGA 1VKZA 2W8BA 2X1LA 1RC8A 1P0FA 1KH3A 2R66A 3LUPA 4CEIB 9ABPA 1ZKMA 3CE9A 2PX2A 2BJWA 4G0OA 4JCCA 2VAMA 3HACA 2FMUA 4DMRA 1KMHA 3Q12A 2G36A 3KSZO 3LUDA 4KWCA 1QVWA 3VZRA 3RHZA 3BRSA 2GX6A 1ISRA 1CRPA 5J4LA 3KB8A 2I1QA 3HQ4O 3QKRA 1F8XA 4AJ1A 3ORSA 3DE5X 3DDZX 4PLWA 4C4ZA 2IEDA 1KZHA 4H7FA 3BH7A 1MORA 3JWEA 1A5AB 1Z6PA 3KUKA 1RAAA 2QTHA 4O4JA 4TLEA 4O4IA 4GBMA 4AJ4A 2ATEA 2JK1A 4XTCS 2YWEA 2IUEA 3AKEA 3OU2A 1PJBA 2X8AA 1FS4A 4UZEA 1G19A 1UF9A 2ACKA 5KYXA 3BWCA 3FOZA 2MYPA 3I6IA 5EHQA 1YI0A 4F85A 3I6YA 1SCDA 9LDTA 1TZBA 5DT2A 6REQB 5TNXA 4YMUA 2C7PA 2QR5A 4Q6WA 1QB7A 2G6TA 1AZSC 2OHHA 5DV9A 5BQPA 2YY7A 4BWGA 5AW9A 5H02A 3E61A 2D6FA 4JUAA 3WB1A 4B0PA 2CMKA 3H2KA 3JQFC 1UCFA 3VYVA 4BRSA 1QO9A 2VT7A 3G0DA 3TSYA 4PYQA 1XZ8A 4EI8A 1KPGA 1PR3A 1UQRA 3L84A 4LYEA 1XALA 1T15A 2O06A 2CWWA 3P0EA 4WZ6A 4ZQGA 3VFDA 4EIWA 1OWPA 3ZWPA 5H4GA 2DWPA 2W6IA 4IS2A 2P9BA 3ANNA 2FPIA 3EIEA 3FYDA 1K8RA 1V0JA 2WM2A 3QTBA 4JLUA 2HV8A 4LX8A 4IUDS 4TN1A 2WHYA 3M2TA 3OY7A 1ZDMA 2P9TA 2WJ3A 3THWB 1Z2DA 2AMYA 2WE8A 2NQ2C 4NYJR 4WNYA 4R5HA 5AOVA 4ZT6A 2J0QA 3M7IA 2BBOA 3KNZA 4BFSA 2GR9A 1USWA 4GZLA 5K0LA 2ECFA 3ZQ4A 1SAYA 4HAZA 1XKQA 4LE1A 1POWA 3K05A 5JTUA 1A9XA 4ZZ1A 5THQA 3VKVA 5M34A 3R7BA 2O8CA 1B6GA 1M0WA 5EQDA 1B8UA 2ZAGA 3NAQA 5THKA 5KSYA 2GYUA 1ZSNA 3GLTA 3P9QA 5BURA 1RACA 3IEMA 2W22A 3ZJVA 4OGGA 2QORA 1DKMA 1BYIA 1M67A 4CKXA 4F21A 2YJZA 3JVIA 2VEOA 5ETJA 5A06A 2F55A 3ZNNA 5HKAA 3HVUA 4R2LA 2ZUSA 3QF4A 1WVIA 4OCZA 1U0TA 3SX0A 2PUFA 3KD3A 1KK0A 3P9SA 1VKNA 3OPYA 2IPNA 3B5IA 1PS9A 4WMLA 1T3TA 1QU2A 1JLSA 3FNBA 1D4FA 2VRCD 5KUTA 4B76A 9GPBA 1E0AA 1HDEA 1T35A 1YBFA 1C2YA 2BI8A 5FLKA 1DAHA 3FA2A 3QYJA 4AS1A 3A1FA 1KKLA 1V1MA 4RV4A 1IONA 3PFWO 3EXG1 3IQFA 2P30A 4AL4A 1OASA 4B3GA 2DERA 1EBUA 1UK7A 1E1CB 2BCJQ 2BELA 2D8MA 2H1VA 2Q8QA 1Y3IA 2UKDA 3I3SR 3OAAD 1RYEA 3EISA 4OB6A 2VJKA 4X62B 1RXSA 2WZQA 3HDGA 1EVKA 4F3TA 2AMVA 2OK7A 3H18A 3VNQA 1YBMA 2H4WA 2OKGA 2PZFA 5LPNA 4MIYA 4FT4A 4QVKA 3UB3A 1KI3A 2CCGA 3AETB 3MWFA 4FGSA 4G5OA 4K40A 4ASUA 3GVXA 4LZZA 3EFOA 4EKGA 3AJRA 1BVHA 4R1PA 2Q5EA 1WRBA 2ZDHA 2Y0CA 3RJMA 2ZRFA 2OZPA 4N5IX 4RTSA 3IIJA 3ICQB 3OLWA 4UDXX 2CXRA 5DSZA 3KR9A 1JJBA 1WXXA 4LQCA 1TIPA 2V3VA 5A9TA 3V8EA 1JW9B 1RLOA 1KFCB 4NYIR 1G3MA 1F60A 2ARKA 4GX2A 4L5JA 3X43A 3L92A 1XWWA 2OAP1 3AW9A 3BXZA 5LZ9A 3RK0A 3T34A 1EM6A 2L17A 3OG9A 1DX6A 2I9PA 5BO5A 4HQ0A 2VH1A 4RD0A 1YQTA 1PV4A 4S12A 2H8GA 3MJSA 1E79D 5EEHA 3KJIA 4Q21A 2Q3CA 3F5FA 4MRMA 1X1TA 5JSYA 2Q3EA 4IUBS 4J0IA 4V0NA 3NCTA 3AMVA 1CUJA 4DLTA 4BV9A 3D6AA 4U6QA 2LV8A 3TLJA 1GLNA 1K0FA 2JLCA 3W7AA 1FU8A 1Q0ZA 1QHGA 1TQHA 1Y9AA 4MICA 5ARBA 1YT5A 3E27A 3GCGA 4LEIA 3QUBA 1QO0A 1G8GA 2P2DA 3GH3A 4YRLA 4CF4A 4DTCA 1ESZA 4ZVMA 3G02A 1PAUA 4J0QA 1YJ5A 2JJ2A 4UUQA 1SQ5A 4HWGA 1DADA 1X42A 4ISCA 1NM5C 4O2LA 2ZJ0A 1ZJ5A 1ZM4A 3DCNA 3G9XA 2ZYIA 1XRRA 3INYA 4CF5A 1H22A 1PJ8A 3A31A 1N5MA 2JPDA 3I09A 1GTG1 1V8DA 2IYPA 4K6MA 1NJGA 4RESA 5LC1A 3M6LA 2FEPA 3MJCA 4GLFA 1L4YA 2EBFX 5C1DA 1WO8A 2JCYA 3AR4A 4HWPA 5ECWA 3GLIA 4DV5B 5GAJA 3FMOB 3I45A 3T3OA 3OE4A 4NONA 2OM6A 2YFKA 1E2DA 3N0WA 4AY3A 2C5SA 3QWBA 4D74A 2GLXA 4OL0A 2HSWA 4Y2GA