4M1YA

Crystal structure of small molecule vinylsulfonamide 15 covalently bound to k-ras g12c
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
168
structure length
162
Chain Sequence
b'MTEYKLVVVGACGVGKSALTIQLIQNHFVDEEDSYRKQVVIDGETSLLDILDTAGEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords K-Ras GTPase
molecule tags Signaling protein/inhibitor
source organism Homo sapiens
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
total genus 59
structure length 162
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m1yA00
4KBGA 4HUTA 3SBDA 3FKQA 3P1JA 5L3VA 3GPLA 3OESA 2WOOA 2QTVB 3PG5A 3D8BA 1EX6A 1L4UA 4MGYR 4TSFA 4EQ6B 3OFND 1OH7A 4XTCS 1CJTC 3RC3A 4TLAA 3L8YA 1E0AA 1W0KD 3HYTA 1XTIA 2G3YA 2F1RA 4GBMA 5H8WA 2ZJOA 2FG5A 1HE8B 1ZMXA 2DFKB 1VCIA 1FL9A 1E69A 3AVYA 4C0BA 1A82A 5SZJA 1AGPA 5EP1A 1JALA 4JYCA 1SVLA 2YV5A 1XJ0A 3THYB 2BBOA 4Z51A 4UQOA 3NVAA 1EFHA 4WAUA 1AQYA 2QGNA 4BFTA 3UG7A 3MFYA 2ZPTX 4PZYA 3OHMA 1SVKA 4A2QA 5TY0A 5JI2E 1OKKA 5FOSA 4D2IA 1QRAA 4BRWA 4DT1B 1CRPA 3HR8A 2H18A 1RYHA 3BAFA 4E22A 1BYUA 4Q48A 4EAQA 1UBGA 1ZM3A 2I4IA 4Q4HB 3NDBB 2PBRA 4AKEA 2YWFA 1IN6A 1E1RA 2Q9AA 4LPKA 2WTUA 3S1AA 1JR6A 1XPUA 3BXZA 3GFPA 1IXSB 2LKCA 3QEJA 4KFTA 3TK1A 4YMWA 5FPSA 4LBZA 2YC2C 3WP0A 2ZVPX 2ODBA 4BZXA 1G5PA 1JXOA 3VR4A 4TLEA 1EFCA 5SZIA 1CRQA 1TQDA 1CLUA 3MG9A 4TLBA 4ITRC 4RJLA 3RS3A 4MRPA 2P5SA 1N0UA 4KODA 1F60A 3PXGA 3X1YA 1IY1A 4C9BA 5IF9A 1Z63A 3BB3A 1YZTA 3B1XA 3V00A 2ANBA 3CF2A 1VYVA 2BOVA 4OKSA 4Q18A 1A1VA 4FI3C 2V7QA 2AWNA 1OV4A 1P75A 2ZIAA 3QENA 4HDCA 1IJFA 1M2OB 4I1VA 4RKEA 4LYFA 1MABB 2GCOB 3K1JA 5BW8A 3NEYA 3I4LA 1BYIA 2H8KA 3U4QB 3GLIA 5LBIA 1OIWA 1R7RA 3CNNA 3A4LA 1KNXA 2ZVQX 2MMGA 3CB4A 4DHEA 2VHCA 3THXB 3QPVA 3RRZA 3WBKA 1ZC3A 2G9NA 3X1ZA 4II7A 3FOZA 1RE0A 4MRNA 4B6FA 1OLOA 1R0XA 2DFTA 3W3AA 2XX3A 4YDSA 3SU8A 1JJVA 2CDNA 3ND9A 4PHTA 4C3ZA 4B3GA 1O87A 4HAWA 1I2MA 3DZ8A 5H70A 3ZIAA 3QNUA 1Q0UA 1N0VC 3EC2A 1TQ6A 2XSZA 4PO8A 3W6NA 2PLFA 4N3NA 2GEVA 2QM7A 3CLVA 1D2EA 3BC1A 2CNWD 2NGRA 1VTKA 1OYYA 1AKEA 1HQYE 1F2TB 2ZI5A 3IPYA 1YZQA 5LB2A 1NF3A 5E4FA 3EA5A 4YXWD 4C0HA 2X1VA 4RZUA 3WYAA 4LV6A 5HTKA 2OZEA 4LYJA 1DADA 2O8BB 2FV8A 4UNPA 2NO6A 2ORVA 3MRSA 4N0DA 2EFHB 1T4GA 2OLJA 5EP3A 1NJFA 4FCVA 3RS4A 1ETUA 4LCBA 5GVRA 3TE6A 4B3DA 4C30A 2HXSA 3M6AA 1NVVR 2C98A 2JEOA 2Q3MA 4ZDKA 2AKYA 4B32A 1UKEA 5HZHA 1E2KA 4POAA 2RGAA 2YINC 3EIEA 1NVXQ 3W8RA 1X86B 4KLNA 4FWTA 3AM1A 1C1YA 4JZKA 4TL7A 5J4KA 3R8FA 3LX8A 2WJVA 2KBFA 4Q7LA 3U3OA 1NMYA 5FI1B 2C9CA 3SQXA 1XD9A 1MO5A 5JWRA 2A5FA 2V4ZA 3IQXA 2QQEA 4LRWA 4M1YA 2O8FA 3H2YA 3BERA 5EUQB 1GKIA 3NC0C 3BBPA 3R7WA 4A0GA 1Q3HA 2QPOA 3PEWA 2WPDD 3Q85A 4IJMA 3QJYA 5CM8B 4DLSA 2F43A 2EFDB 4URUR 3AVWA 4PAQA 4R2HA 3R20A 2FNAA 1XD2A 4YQFA 821PA 4YMVA 4A6XA 3OZXA 1Z8FA 2KI5A 2BCGY 2CHGA 2UVQA 2GNOA 4PXAA 2ZR9A 1G7SA 2F1JA 2V6JA 3PUWA 2IUUA 1CEEA 2IXEA 4UJ3A 3I5XA 4JMPA 4Q4JA 2WWFA 3SDZA 5L3RA 2D2EA 1NSFA 1S0UA 2J7PA 2EYUA 1X6VA 2YJTD 1NN5A 4HB0A 4LYHA 1U81A 2RMKA 2D7CA 4D0GA 4G0NA 2WJHA 3TSOA 4TYYA 5TARA 1W36B 4AG5A 5B30A 4LHWA 4CRWB 1US8B 1E4YA 3TUZC 1JR3E 4OI0A 3ND8A 3LBNA 2ZE7A 1LY1A 2BBWA 3CKLA 1BKDR 4QOSA 4CW7A 4DCTA 4OHYA 1QF9A 4F4IA 2ZRHA 2VYFA 4B34A 2QMEA 5JMTA 1JAHA 2JJ1A 2OAQ1 1EFUA 4DCVA 3NKVA 4CIDA 4KYIB 1QHGA 4FCWA 4HSEA 2QN6A 1A2KC 3JZMA 3TNFA 1JQJC 1OH6A 4NYIQ 3SJAA 4QBGB 1NI3A 221PA 3QKTA 3KKNA 2RH5A 5J47A 1RRFA 4E09A 4Z1MD 2PH1A 4B43A 4QGGA 1TF2A 3KJIA 1U8AA 5DLQC 3CH5A 3NWJA 3KJEA 3KKPA 1AQUA 1VCNA 1KO1A 2OLKA 3CW2A 2Q0HA 3CUEF 5L3SB 1IOZA 2OESA 1ZVQA 5KNDA 3U61B 2QI9C 1D5CA 2E87A 2W6ID 4HZIA 5DN6A 2RGNC 3EC1A 4PTLA 3O8CA 1EESA 3P20A 2OCBA 3REGA 3T34A 1Z3IX 4P33A 4BLQA 2AN9A 2R6AA 5EE1A 1XB2A 2NTYC 3T35A 1NBMD 1XX6A 1M34E 3K0FB 1Z0IA 4DWJA 3EPLA 3ICEA 4TMXA 2JLQA 2IA5A 5CYOA 4C7OB 5JWHA 1Q12A 2CCJA 4P0TA 1CJVC 1YQTA 2PZGA 4E03A 1TEVA 4TSFD 3GJ0A 3PV0A 1G6HA 4HUQA 5JHGB 4RD3A 3AGPA 5CB8A 2QP3A 2ZRAA 4M1SA 2FJUA 2O0KA 3I1FA 3QY0A 3CH4B 1NVUQ 1CR0A 1AIPA 2BKEA 2H17A 3T5GA 2GJAA 1D6JA 4URZR 2W6IA 4MYCA 4V03A 4TZ6A 5FPYA 5IRCD 5JSZA 4XIGS 4Q1AA 3RS7A 1WA5A 5CDFE 3ZZUA 3QBVA 3LQRA 3QXCA 3RYTC 2JJ1D 3BORA 1KSJA 3IUYA 4JJKA 2ZU6A 3GLHA 3OEED 1P4SA 1ZC4A 121PA 3PITA 3THWA 4B2LA 3NBYC 1Q22A 2ZTSA 4LC0A 1P9WA 1M1YE 1OKKD 2V9PA 4JLOA 1FNMA 5JJIA 2VP6A 4ZCIA 1XZQA 3AP1A 3CBQA 3VAAA 2QT0A 3O8RA 4D80A 1EXMA 4V0KA 3E5HA 5TDHA 3UXMA 4MRRA 2YYZA 3MGCA 4QFMA 2V8OA 3U3MA 4I99A 3TW4A 4MUAA 4TWZA 3N2EA 3V4FA 4W7SA 1WDTA 3BGWA 2IEZA 1WF3A 2MSCB 4LBVA 4H9GA 2NO1A 2ZI4A 4MKFA 1KI6B 3UMRA 1E1QD 6Q21A 3SYNA 4EFMA 1W46A 4RSGA 3QE0A 2NMVA 3U3KA 2HDNB 5AK0A 3RLFA 3L0PA 1NY5A 4IXMA 5AJZA 3B1ZA 4Q7JB 2OEPA 1E9AA 1G7RA 5P21A 1FP7A 3PIRA 2CL0X 3FFBA 1D8TA 2B21A 5DH9A 4BE7B 3GLHE 2JJ2A 3JZAA 2P2LA 5DE3A 1R8SA 2DCUA 2KJQA 1FZQA 4LHXA 1EFRD 5FTKA 2ZAMA 1YRBA 3IKJA 1NP6A 1ZD8A 1ZUNB 2ZRFA 2XZOA 3GEIA 2BC9A 3A1WA 2IK8A 3ZD6A 4WZ6A 3B6EA 1RVDA 3K53A 1Q3TA 2ZRKA 4BLTA 2BV3A 1E9DA 3ETLA 2CL7X 4PR0A 2QBYB 4QNRA 4O2LA 3W8NA 4DDWA 4FMDF 4MQBA 4U5XA 2J41A 1DAMA 2O8FB 2HF9A 3OIVA 1DAGA 1OSNA 3FGNA 3L2OB 4D0NA 4ON9A 1UF9A 4DUGA 1ZM4A 4RD2A 1ANKA 4IRUB 2GHIA 5CJ2A 2ZS9A 3SNHA 1P6XA 3UG6A 1KJYA 1UKYA 4HLCA 3BD9A 4JLPA 3RHFA 2GETA 5JLJA 1XPOA 5F9HA 2WPDA 4P4SB 4Y0AA 1OH5A 1N2CE 4G5QA 4LWZA 2FSGA 5IK2A 1OHHD 3HU3A 4I81A 5KU1A 4Q9KA 5BN3A 2FMXA 4PZLA 3VR3A 2GJ8A 3EZ2A 4LJ7A 1IONA 1IN8A 1K5GA 3T06B 1MT0A 2B92A 4HLUC 3ASYA 3AVPA 4OQNA 3VU9A 1FX0A 1FTSA 521PA 2XSZD 2QORA 2QU8A 1K5DA 2FPKA 1P5ZB 5JCPA 1E4VA 3GLHB 4JKIA 1Z6AA 4BFXA 2C2HA 4XH9B 4KYUA 3T1QA 4CT4B 2O8DA 2XITA 1RJ9A 3IIKA 3NBXX 3TR5A 4FMBB 4V0MA 2OM2A 3CX7A 1UPTA 2WMOB 3FB4A 4G5SA 2C8VA 4LJAA 3WP1B 2ZS8A 4LPSA 5CLQA 1TNDA 4KCGA 4BZQA 1XF9A 2ZE6A 4H1UA 5KNCA 3KQNA 4L9SA 2C77A 1IHUA 1QHHB 3B5JA 1KJWA 3KFXA 1W4AA 4DCSA 3PEUA 4DBLC 4BFUA 1II8A 3B85A 1N6HA 1FTNA 2G0TA 3G82C 2BMFA 1CXZA 4FINA 4BECA 3QKSA 4OHXA 5CYPA 1M8PA 5JS7A 5AUPB 2HT6A 4DZZA 5DISB 3RRNA 1LW7A 1NMXA 2CJWB 4GL2A 4HDOB 4CEHA 1P9RA 1KK0A 2PL3A 4V0ME 3ZH9B 2OCYC 1EFTA 2J3EA 2JLVA 2R44A 2NO7A 1OXXK 5AR1A 1UADA 3QVVA 2ZSDA 3EAQA 1DS6A 1E79A 4DDVA 4ABYA 4ZDWA 1XD8A 1T3SA 4HZUA 1H8HA 2NOAA 3K0FA 1NIPA 1SXJD 2DR3A 3BB4A 3NXSA 1UDXA 4MUBA 3K70D 2YHSA 5FBVB 1FQJA 2PZFA 4F93B 2YZ2A 5F98A 3GLIE 2J87A 4TQUS 3Q72A 2F1HA 2BDTA 2J9RA 1KDRA 4KXFB 3VR2A 1AJEA 1GFIA 5AUQA 4IEIA 5AJYA 3PUVA 1KI9A 4HUQB 1N6NA 1XBTA 5D3QA 4AKHA 2CXXA 2J0UA 1S2MA 3PQCA 5KDOA 1G20E 1M74A 4MRSA 4FIDA 4NL4H 2XNSA 1E9BA 3VX4A 2VHUA 1N6KA 2WSSA 4EKDA 3ADCA 5CK5A 2WJYA 3FHTA 4IOMA 3LBIA 2FPLA 3OFNA 3MWJA 1CR1A 3TUJC 1QHIA 4B2IA 3NEJA 5EP2A 2FA9A 3LAWA 3BFKA 4IVRA 4ZKEA 3U44B 1ZU5A 1HE1C 2P6NA 4BASA 4LX0A 2ZJZA 3BE4A 2DFLA 4G1UC 4HDQB 2QQ0A 1U94A 2JIZD 1Z29A 2F6RA 3AKEA 3F8TA 2XXAB 4R71A 2VF8A 2QTHA 4TMVA 3U4QA 1CR4A 5EQTA 2BBTA 1DAFA 2G88A 1GRRA 1ZCAA 3HPQA 1EWQA 3IO5A 1AA9A 1TEXA 4PSKA 3T5DA 2V1XA 4N0EA 5C4MA 2ZETA 4D4KA 3R7WB 4TL8A 1VECA 1AS3A 3GJ5A 5JECA 4L9WA 3I5YA 4EJSC 2VA8A 3VNVA 1OJLA 1S96A 3IO3A 3K0CC 4IVQA 1KAGA 1DEKA 1XXHE 3B82A 3GJ7A 4KO8A 4URYR 1PJRA 2XTNA 1R8QA 4U02A 2QSYA 3FPAA 4F4CA 4RKFA 4OHZA 2OXCA 2HCJB 2W2VA 2WWXA 1WRBA 5FPTA 4CEJB 4LUCA 5J40A 4I1SA 3NH6A 5CLLA 3PEYA 1G4UR 1ZP6A 1IXZA 4ASUD 1T0JB 4PC1A 2ZE8A 3UWOA 4B74A 3TQFA 3K0AA 1ZUIA 2J59A 2ZUDA 3PJRA 4QL3A 5AJXA 4IFBA 1G6OA 4RFSB 3LV8A 4GP6A 3RRMA 1PUJA 4OJQA 2J7KA 1MABA 2ZYWX 2ZSAA 2ZJ8A 2GCNA 2OCPA 3FVQA 5CITA 1G3RA 2OV2A 3MWLA 2QMUA 1RRPA 4ZPXA 2V6IA 3C16C 2VBCA 1AGRA 4UNQA 3THWB 2Z4SA 5CIQA 1J7KA 3AH8A 3GLFB 3R9WA 3ZYCA 1XNJA 1OH8A 1IXRC 1J99A 1U9IC 1GUAA 1MO3A 4LJYA 3W5JA 4K81B 2GF0A 1KI2A 1TAGA 1LB1B 1OXUA 1QG2A 3RSOA 3WNBA 5DO9A 4F92B 2XJ9A 2P6UA 2JAQA 1ZNXA 1NKSA 2BHRA 3HYRA 3QF7A 3QXSA 3GJ8A 4LJ4A 2BMDA 2OFWA 4ZI2A 1P9NA 4MGZR 3SJCA 4B3BA 1BMFD 1P2UA 1P2VA 1LV7A 4GOKA 4DLRA 3AKDA 4G5GA 3ZS9A 4O3MA 4RD0A 1HUQA 5H1YA 1JAIA 4DCUA 3EPJA 1COWA 1E96A 1B23P 3Q7PA 5J4YA 2ZI6A 1Z08A 2QAGB 4B71A 4HAVA 1P61B 3V4RA 3KKOA 1KDTA 4BPBA 2PT5A 4NYIR 4US1R 4HEJA 4IDOA 2HV8A 3M0EA 1PUIA 2IUSA 1H65A 3NC1C 4PO9A 3DEFA 1MO4A 3TSWA 5JRZA 4IEEA 5KSZA 3LO5A 2J0SA 4W5JA 1KJZA 1NG1A 2GXQA 1EX7A 1RIFA 2Q6TA 2IYZA 5L8VA 4DC9A 3QQ5A 1HV8A 4D25A 4OI4A 5JRJA 3A4NA 4F4JA 4I1OA 3AVTA 1JJ7A 5FUVA 2BBSA 1G7CA 4KAXA 2ZANA 2Q21A 4RVCA 3QSYA 1CTQA 1MRSA 3MAAC 2FN4A 4LBYA 1NLZA 2BCJQ 4HLQB 2A5YB 2F3RA 2AK3A 3R9IA 3A58B 2A3RA 2G6BA 2ZEJA 5G3ZA 2ZI3A 3A1UA 4M9XA 4QM7A 4DXAA 1R2QA 5C18A 2CNWA 3W9YA 1S3GA 2Z43A 3E2IA 4GOJA 5A4JA 1B0UA 4PAMA 4PPNA 4E5UA 4B76A 5A5GA 1E9EA 2B8WA 3Q5DA 1G21E 3THOA 3ZQ6A 4PC7A 1IAQA 2W0MA 3B13B 1MO6A 3VR5A 2H57A 2GJ9A 2ZRIA 3TVDA 4Q1FA 3KX2A 5DYGA 1SVMA 4QNMA 2GRJA 2JA1A 2W58A 2LKDA 5FOUA 3ADBA 1YRAA 2FX3A 2JLXA 4GRAA 2ZRBA 5DNYB 3W6PA 2QT1A 4V0NA 1E2NA 3GCGA 4K46A 1Q21A 4HAZA 3I73A 1IY2A 3EASA 2MMCA 4DIDA 5K8IA 4B3XA 3TGPA 3SHWA 2FE4A 4OL0A 3WMEA 1BS1A 2VSOA 1N6PA 1V5WA 1ZW6A 1TQ4A 1W48A 4FMCF 3KXLA 3TBKA 5FPKA 3FHOA 3ASZA 3THXA 1F3OA 1OFIA 3IPXA 3LXXA 4Q5IA 1AS2A 4LGMA 5F3WB 1C9KA 2QE7A 4HLUA 1W0JD 1X8JA 4LZZA 1XRJA 2VHQA 3RNLA 2Z4RA 3HPRA 3OIWA 5DHFA 4A0FA 4B44A 1U8ZA 3DZDA 1ELOA 2YWEA 3C14C 4C2UA 5KO2A 2GZAA 5FI0B 1S3SA 3CZQA 4UJ5A 2A78A 1KDOA 2HT1A 4PPGA 2WZQA 1ZYUA 4TTQA 2CCGA 3BH0A 4F7WA 2IBMA 3W90A 4TQ9A 4UNRA 2O52A 5AUNB 2F55A 1XCMA 1BO6A 1F2UA 3DM5A 1CR2A 3DPUA 1ESMA 4MKGA 4IDNA 1XEWX 1G41A 1N5KA 4LBWA 1CS4C 1P72A 2RGEA 4PO1A 1TX4B 4KLZA 2D62A 2PMKA 2ZYVX 4XWAA 3RS2A 2H5EA 2FZ4A 3BRWD 2FDCA 3WYFA 3NTUA 4LDJA 4MYHA 3U7GA 1G8FA 2WKPA 4JS0A 1GRNA 1G1MA 3QI2A 1GTVA 2VSFA 3AKYA 2FFBA 1DARA 2VIIA 2VP9A 3C41J 2HXYA 1PV4A 4LJ9A 1DTSA 1GKUB 3KL4A 1SGWA 1R10A 2JIZA 3OEHA 3SYKA 4BZPA 2GCOA 4NKRA 3AF0A 3HDTA 3TUIC 3BFVA 1JPJA 2ASEA 2J1LA 2WVJA 4Q66C 5FFMA 2CK3D 2G0NA 1LTQA 3UKDA 4DJTA 3PVSA 1W44A 2ZRGA 3HJNA 3W5IA 3NDPA 3VR1A 1M7GA 4BLPA 2OSBA 5SZHB 3C8UA 3SJBA 2R6FA 3AB3A 3HR7A 3QXHA 5GJVC 3P27A 2EVWX 2R8RA 1ZM2A 4QGFA 2ODWA 1KMHB 5AJVB 3K9HA 2CE7A 1FPMA 1QHXA 1N6LA 4ZIRA 3AVXA 1XMVA 5AJWA 2IXFA 3I8SA 3CIOA 1E2HA 1VMAA 5KPJA 5KSPA 4JBYA 1MKYA 2FZLA 3GEHA 1UEJA 2HF8A 2ZRNA 3OAAA 3RWMB 1UBEA 3BWDD 3PENA 5CB6A 1KZGB 1ZNYA 2DWOA 5B2ZA 5JFGA 3QEOA 3FE2A 1RFLA 3VR6A 3WRXC 2OFOA 1Q1BA 1J2JA 1Z0FA 1CKEA 2VHTA 4N1AA 4TZ0A 3VKGA 2QEQA 1IN5A 3AVQA 4A4DA 4EPRA 5CJPA 1VG0B 3U3RA 5KNBA 3W6OA 2IWRA 3X1WA 3F0TA 5EE9A 1NNEA 4AY2A 3LW7A 1CIPA 2IT1A 4CYMA 2BMJA 3HP1A 1E9SA 4Q9HA 3NG1A 2KBEA 2XGJA 5J4HA 1PLKA 2EFCB 2QTFA 1G8GA 2IEYA 3Q5EA 2N46A 2RHMA 2REBA 1GP2A 1KZ7B 2OUKA 3I3SR 2MSDB 3EPKA 3OEHD 1UKVY 4WOPA 5FOTA 2V1UA 1W47A 1GWNA 5BYKA 2AFIE 1G8HA 2GBLC 2VP4A 4Q19A 2HLDD 1SKYE 4GT1A 2W83A 2PX0A 4Q03A 2XZPA 1A5TA 2B8TA 4LY6A 5FBLB 4ZI3A 4B47A 2F43B 2D4HA 2FGJA 1YR9A 4JLKA 1AN0A 3JVUA 4QHYA 2WICA 4YXWA 1PVOA 5FBWB 3EZFA 3OE7D 5G3YA 4UNNA 2ATXA 4HATA 4IOJA 1KO8A 3LLMA 4IXNA 4PC3A 4Z54A 2NIPA 3WNCA 4CDGA 5LB4A 1SZPA 4RD4A 1W36D 3GJ6A 3UANA 3L43A 4D4MA 2DWPA 3QVUA 4PPFA 4Q4HA 4V0OA 2WKRA 2VP2A 3B9PA 4A6PA 1M7BA 4WIAA 3EZ9A 4W9MC 1E0JA 4B2PA 4NH0A 3ICQB 4OI1A 1UBCA 2FPMA 5DHAA 1KTVA 5E7JA 4DLTA 2WMNB 3MMPA 4WVFA 5DI9A 3AUYA 4HB4A 2IYLD 3KB2A 3U44A 1DELA 4NPHA 1RPZA 1M6NA 4JT4A 2ZITA 2JATA 2ZRJA 2P3SA 4OJKA 2JLZA 2PJRA 1NKTA 1KK2A 5KTYA 5A0FA 1GNPA 2OG2A 2QROA 1UAAA 3FKSA 4GP7A 4X8LA 2ODEA 1P2SA 1II9A 2BJWA 3C5HA 2QBYA 3QKSB 4IDQA 4TN1A 1QZXA 4WZAE 2B7BA 2WAXA 3SC3A 5GVSA 2J0VA 2CLCX 2NG1A 2JASA 2XZLA 3AEZA 2IYRA 1E6CA 3DOFA 2Q3HA 4F38A 4DLWA 5JEEA 3P26A 4B3FX 3MLEA 3QPUA 2ZAOA 4QJ3A 4M53A 4TYPA 1E2EA 2BIFA 4QG7A 1GL9B 1KKMA 4OQFA 1N3BA 4P31A 1T9HA 2YNMA 4CVNA 2EFEB 4URXR 1R0WA 2HJGA 4XVRA 2WM9B 2I1VB 1COWD 1ZNZA 3GQBA 3U60B 3PUZA 3TR0A 1GZSA 3MCAA 3T1VA 3KDSE 1T3HA 2C5LA 2ZI9A 4CEHB 2JLWA 3VHLB 1WBBA 5FBRB 3H4MA 3OIUA 4L5BA 1NMZA 1LF5A 4MA4A 3EZ6A 1GG2A 1Q1EA 5FH9A 5HZKA 1AS0A 1NLYA 1SXJB 2V54A 2A5JA 3E70C 1ESNA 1X3SA 1OB5A 3GJ4A 1ZM7A 2QAJA 1ZUHA 3X1DA 1LS1A 3B1WA 3ZVMA 4KITB 3GLGA 3EWSA 2IYUA 1KI6A 3EARA 1G64A 3CONA 2BEJA 1FP6A 2RGDA 2VSXA 1MH1A 2D74A 1RZ3A 1RJ9B 1AZSC 1Z5ZA 4AURA 4AWXA 1UM8A 3GMTA 3BJIC 1YVDA 2YC4C 3K0EA 3R9XA 3Q8XB 1XTKA 2WWIA 2AX4A 4G3XA 1L8QA 1Z2CA 2EWWA 3CX6A 1W4BA 3FHCB 1H8ED 1RRGA 2IC5A 4C0SA 3TAUA 3EWAA 1MOZA 1T5LA 1GL6A 1CU1A 2G83A 2IX3A 3SFZA 1YZNA 3QF4A 3BFXA 3LRPA 3PFIA 2IF0A 2QG6A 2XB4A 3W34A 1Q1QA 4GNKA 3MWYW 3DDCA 5FOXA 4GOXA 3T12A 3TLXA 1EWRA 1SHZA 2PCJA 3LA6A 5ANRB 1E2FA 3SE0A 4AG6A 2H1LA 1CBUA 1OPXA 2QAGC 3M4YA 3L82B 4L16A 4XTRA 5BQ5A 4Q4LA 1HURA 5JHHB 2GDJA 2Q9CA 4TL6A 2VPPA 4A0HA 1G8PA 3CWZA 3KQUA 1E3MA 4NCHA 1HH4A 1XD2B 1MR3F 3B8HA 4IW3B 1HT2E 1KSFX 2PLRA 5EE3A 4ZIRB 1BOFA 4A92A 1Z6YA 1N5LA 2OBNA 3ZDQA 1IQPA 2FSFA 5DN6D 4UNSA 4MGIR 3WXMA 2QRZA 4G5OA 2CBZA 4RD1A 3O8BA 1H8HD 4Q21A 4PQYA 4Q00A 2O8CA 4DUGD 2QE7D 3KJHA 4Q1BA 5KOYA 5B58C 3UIEA 1NL3A 3U7HB 2O8DB 2IYWA 2FH5B 3GLFA 3H84A 2QM8A 1T6NA 2VO1A 5EE5B 1K8RA 2ANCA 2GEDA 1I2DA 2J0QA 1KK3A 4XJXA 1QDEA 1X8LA 1VPLA 4C0AC 3N5CA 4OBEA 1CP2A 4GZLA 4HAXA 1GITA 1II8B 4D82A 4DEYA 4AIIA 2O5VA 2WSSD 1ZIPA 1VKJA 2CK3A 2W2TA 3O47A 3BB1A 4FN5A 1R6BX 1OXVA 3EPHA 1D9XA 2Z5FA 4NYMQ 4Z1MA 4LJ8A 1KI7A 2REOA 4BFSA 2DPXA 1YHNA 3AUXA 2XB2A 1DAIA 3X1XA 4HZUB 1N25A 3BS4A 4XWKA 1JEEA 5FR1A 4RD6A 4EIWA 2WWWA 4LHVA 4DSNA 4C4PA 5JI3E 3A8TA 2FEMA 2WAYA 3U6KA 1EG7A 4Q9LA 1JPNA 5E7IA 3X2SA 5CIWA 3K70C 2GVDC 5FTJA 3AF3A 1ONBA 1FW6A 4A8JA 3NIBA 3TJZA 2QENA 1G3IA 3LBHA 4EQ6A 1JR3D 3SQWA 3IHLA 5AUOB 2WHXA 2GAAA 3H0KA 2AD1A 2XTZA 1U8YA 5EUMA 4V0LA 4Q9JA 2FF7A 1F5NA 1NLFA 3D31A 4WZBE 3A36A 3KUCA 4CF7A 1QHYA 2EFGA 1DO0A 5D3MA 2V55B 3TH5A 1UEIA 5LDDC 4JLAA 1G18A 1Z6TA 5FBQB 4XD7D 4TL9A 4D0LB 4D4JA 3VHXA 2QP4A 4NDZA 4M9ZA 2VP0A 3THYA 1DG3A 4RZ2A 3QF4B 1RC8A 4AC9A 2BWJA 1HEIA 2RKOA 4GMXA 1FOEB 2Y8EA 4QXAA 4EPYA 3NHAA 5FTNA 2H7VA 4EJSB 4AI6A 1E94E 1T8TA 3KQKA 3LVRE 3AP2A 1XTRA 5DGXA 2J5XA 5TB5A 2GBLA 4MYTA 3CO5A 4P4UA 3SS8A 2JGNA 2Z0MA 1TU3A 1YR7A 3DMNA 2JJ2D 1N0WA 4W5HA 3FKSD 2JCSA 2ERXA 1TL7C 1XJQA 1UJ2A 2FFHA 3RS0A 1XTQA 1LS6A 1DE0A 3LWNA 4JT2A 1VDZA 2CE2X 1E2JA 1WE2A 5EXSA 3TRFA 1E98A 4R98A 2HYDA 2GZHA 2EW1A 1GNRA 4KI0A 4LI0A 1SQ5A 2Z83A 4OK5A 3CX8A 5IT5A 1L4YA 1KNQA 1XMJA 2XTMA 2A5DA 2VQSA 1KAOA 1P3JA 2XJ4A 4GPTA 4JJZA 1KY2A 3GFOA 4LC1A 4RCZA 4P32A 4QBFA 1KMHA 4WXRA 3TIFA 1G7TA 1KHTA 5JS8A 4WXPA 1EFRA 5IDVA 4BLSA 3DVLA 1NBME 4RFSA 3K9GA 3REFA 2VRWA 1T5IA 4RY2A 3AF4A 3C15C 2GVZC 4OI2A 2GESA 2P65A 2VF7A 3KTAB 4QHSA 1YZKA 4JYBA 4NP6A 1I4TD 421PA 2ZRMA 2LCFA 2PT7A 2X2FA 4JKYA 4DLVA 2A2ZA 3QIAA 4G5RA 2CCKA 2ZSBA 3P4YA 4YMUA 4JBXA 5EE0A 3K0CA 2ZJBA 3KXKA 2WWGA 4OHVA 5KSOA 2AXPA 3DKVA 3K0SA 4EFNA 1A2BA 2AL7A 1YZUA 3ZVNA 1VIAA 4ESVA 3N2IA 4W5WA 3A6PC 3SR0A 5LD2C 3CF0A 2AR7A 5KUTA 1W7AA 1GSIA 1G8YA 1E2QA 1PLLA 5UKDA 4CEIB 2UKDA 1X8KA 2XXAA 3CWQA 2WOJA 2K5UA 2ZI7A 1KO7A 2OBMA 1OIVA 4M1KA 1K6MA 1OXTA 3B60A 1Q1ZA 2D3WA 3ADKA 5HCIA 3BOSA 1JB1A 1QVRA 5FOVA 4A15A 3BH7A 1LVGA 4KFUA 1YE8A 3WRYC 2X8AA 4IFEA 1J8MF 1I4DD 2CVHA 4A9AA 2P0EA 3GJ3A 4TTPA 4Q4AA 4OK6A 2R62A 2A5GA 4TMZA 2V7QD 2QMHA 2W6JA 2DBYA 2GK6A 3GLGB 2UZ3A 1CF4A 4BWYA 3BK7A 2WKQA 4DSUA 1G19A 3B1YA 4R2IA 5B64A 2NZ8A 2GWHA 2GILA 2AKAB 3TSZA 1D9ZA 4QKQA 1KIMA 1EGAA 4UKDA 4GDFA 5HPYB 1J8YF 2C99A 5TVKA 5EP4A 4CEJA 2DFNA 4S2EA 4NU0A 1Z2AA 2ZR0A 1KGDA 1Z28A 1ODFA 4AKGA 4MRVA 4TT3A 5G53C 4QRHA 1T3LA 2IYYA 5KSYA 1F2UB 2F9LA 1RKBA 3JVVA 3PR1A 3PUXA 4KBFA 2YKGA 1AKYA 3ECCA 4EPXA 4BUJA 3ZZTA 2RGBA 4JLJA 2Q9BA 3VTKA 4A0RA 2CVFA 3ZGXA 1S4QA 2OXRA 4FD2A 3LVQE 2YWGA 2ZYUX 4XSHA 4LYAA 2GXUA 1QBKC 2PX3A 4KFSA 4O0MA 1E99A 1E79D 3EA0A 4BLRA 3B7GA 2EQBA 2IYQA 4PSAA 1P60A 4QC2A 2XAUA 4M2LA 1DVRA 1WB9A 1GRQA 5EXTA 1O3YA 1N6OA 4IDHA 4Q01A 1XCPA 2GCPA 4KFRA 4M22A 1T8UA 2OBLA 1X1SA 1KKLA 2F7SA 3DHWC 4PANA 3FDIA 2TMKA 1P73A 4NCNA 1UDWA 1ZD1A 2A30A 3FYHA 3H1TA 3I32A 1TTTA 2SHKA 4YDHB 4RZ3A 1XTJA 4TT3D 4HYYA 2IYTA 4JLBA 3DM9B 4B75A 4XOIA 2BKUA 1W0KA 2CJWA 1XU4A 4BFZA 2OFXA 3AVOA 2NPFA 4AKIA 2VLIA 4DCNA 4JVSB 1F6BA 5DIFA 2FSIA 4JL6A 2GJSA 1GM5A 4LHZA 1U0LA 1PZNA 4HLDA 2AWOA 2AXNA 4CZ2A 4NBSA 3KQLA 5BYJA 3CNLA 3QUSA 5IHPA 5C4GB 1SULA 2WJGA 3K0AB 4GI7A 3F3YA 4M0LA 1XEXB 4DVGA 5EXPA 3WMGA 4PQFA 4M9QA 1U2RA 2ZE5A 1J70A 3AVVA 4M1OA 3IEVA 2GTPA 4JBWA 2ZXUA 1D2NA 4D81A 2ZQ5A 1HA3A 4KV9A 3U7FB 1NIJA 2ERYA 3CPJB 3P32A 4P3YA 4LSGA 4M8NE 4LHYA 1JR3A 2G1JA 2GAOA 3FTQA 3L8ZA 3QOFA 5DSZA 5J5CA 3AF2A 5CDFA 4DRZA 3LQQA 1II0A 3K09A 1E2PA 3SZRA 2D7DA 1ZM9A 4AYWA 2IUTA 4EPTA 2IXGA 2WWHA 3TMKA 4Q47A 4JLNA 1VG9B 1GVNB 1UFQA 3U6BA 4QBIA 5JJKA 2J7PD 4A2WA 5FUYA 2AHOA 4FWIB 1XPRA 3C5CA 2QP9X 1XEFA 2WIBA 1FUKA 4DT1A 4LK2A 4XD7A 2GZDA 4ZV4A 3LDAA 2EWVA 1JI0A 5BWMA 3CRVA 3I8XA 4RFVA 4X8HA 3RSLA 3SJZA 2N1BA 3CR8A 4YLGA 2B6HA 5LPNA 4TYNA 4OHWA 4TMKA 2HCBA 5HE8A 3FMIA 5GJCA 2YWHA 1N6RA 5HKKD 4ARZB 2ZUCA 1R4AA 5JEDA 4OQXA 4PHHA 4KJZA 3G0HA 1T91A 2PZEA 2AD5A 3KQHA 3OF5A 4XVUA 4FXPA 2QGZA 4JVNA 2L0XA 2W2XA 1QG4A 4US2R 4YC7A 3KKMA 1HT1E 4PQRA 4EPWA 4OYHA 4ZDJA 3Q7QA 1XMSA 2GA8A 2R6DA 5FPHA 1N5IA 2QNRA 4TTRA 3BIFA 2IL1A 4GZMA 4HAYA 4QHTA 1Y3AA 3PUYA 1DAKA 4QGHA 1E32A 2CMKA 2FGKA 2RGXA 2X19A 5GADl 3VMFA 3NBZC 3EIHA 2O8CB 3OAAD 1P2TA 2BM0A 2WV9A 1S9DA 1N6IA 3A4MA 4PSVA 1F48A 4U00A 1VHLA 3U7EB 4TQAA 3WHLA 2D06A 2HYIC 3QKUA 3FMPB 5M04A 1XXHA 2VH5R 3GLFE 4X8MA 2ECKA 3FMFA 2E9SA 3CRQA 2WSMA 3RANA 3MJHA 4KVGA 2RB4A 1MV5A 1Z0KA 3EIQA 1TUEA 4HAUA 2ZREA 2N42A 4NONA 2NQ2C 2PMDA 5LD2B 4IOKA 2CEAA 3LLUA 3VFDA 4MITA 1E1RD 2W0SA 3T1OA 1E0SA 3L0OA 3ZLJA 1VHTA 1V43A 1KSGA 3SHFA 3VQTA 4Q4JB 2C9OA 4JSYA 2JLRA 4BFWA 3D6TB 1Z06A 1ZCBA 2QY9A 1E1QA 3A1TA 5FL7D 4Z8XA 2GF9A 1GNQA 2GXSA 3ZQJA 3AP3A 3CRRA 2R9VA 5HKKA 4O25A 4UXHA 1Z83A 4C0LA 1YZLA 5JZVA 1FUUA 1R0YA 3CZPA 3GEEA 2QAGA 1GDDA 2QPTA 1EK0A 2I1QA 4QJ4A 3SEAA 5L3QB 4V02A 4Z8YA 1OW3B 2FOLA 4ZDIA 4IHQA 4GMDA 3Q3JB 3UWKA 1F2TA 2XOKD 3OEEA 5H68A 621PA 1S1MA 3IBYA 4QJ5A 3SFVA 2AK2A 4NTZA 3TQCA 2O8BA 1RRCA 1R5NA 1Z0DA 3FWYA 2IYXA 4NCIA 2IS2A 3I61A 1Z0AA 4NYJQ 5CM9C 3RWOA 2W6JD 3AV0B 2RHDA 1TADA 2IWHA 3K9LA 1ZRHA 1W4RA 3GP8A 1XWIA 4IKEA 2OHFA 4JL5A 1Z0JA 1J90A 2R65A 4A36A 2ONKA 3LNCA 3DL0A 5D3MB 4PHGA 2F1IA 3PEVA 3M1IA 1R5BA 2ORWA 5FL7A 4IOLA 4XVQA 1AZTA 5L3SA 3IILA 4C0JA 4MDEA 2QUZA 2O8EB 4AK9A 8OHMA 5K8TA 2BM1A 1G5TA 2OT3B 2QL6A 4ZO4A 4FMCB 3GLIB 1SKQA 3GLGE 5GJBA 2CHVA 3U5ZB 4DLZA 2W00A 4L15A 1X1RA 4M1TA 5DI3B 4R9UC 4FW9A 1TUIA 4D26A 2H16A 1Q20A 3QG5A 3MD0A 4NYMR 2G1KA 4RZXA 1JECA 4Q1CA 2IHYA 4TLCA 2REXB 2WBLC 3BH6A 2X2EA 4DLXA 3A1SA 1SVWA 4MGKR 3UMFA 1A4RA 1UKZA 5GJWC 4NHOA 3H86A 5HE9A 2CHQA 2VEDA 4ZCMA 4PAOA 4O2RA 3VU9B 4Q1DA 3UMSA 2D2FA 1FX0B 1WMSA 1OF1A 3FMOB 3SI7A 1SXJC 5BXQC 1Q44A 3LFUA 2YOFA 3ZD7A 4NZYA 1T0HB 3DOEA 3SYLA 2RGNA 3RRYA 3S1AB 2ZRPA 4NCJA 1SXJA 1W2GA 3U2QA 3J81k 3IGFA 2OE2A 2RGCA 3RS5A 1G17A 3ZJYA 1KOFA 1KO4A 1LNZA 4B73A 2CLDX 1W36C 3CRW1 5J4LA 4EPVA 5K8UA 3KTAA 4QGAA 3UK6A 4DEXA 1PLJA 2Z6VA 3K8YA 3RVBA 1IN7A 4BFYA 1L7VC 4YMSA 4EDHA 5KPDA 4LV5B 3KXIA 2JDID 1OYWA 1TU4A 1KI4A 3HWSA 1BH2A 4K8OA 4Y0VA 1E9RA 4Q7MB 1HTWA 2ZU0C 1KI3A 1W2HA 1ZIOA 1XMIA 4A2PA 2ZR7A 3L0SA 1HYQA 2C04A 3RDPA 1G291 4CT5A 3G5UA 2FWRA 2YOGA 3WY9A 5K8LA 1OFHA 4C0KA 4M9SA 2OCAA 1Z07A 3CNOA 1GL7A 3I62A 4P4TA 4JLVA 1NRJB 3NBFA 1GAJA 5L3QA 4I1UA 1U9IA 1S9HA 4ZCLA 4ACAA 2O0HA 5EZ5A 1U0JA 2PEZA 4NCKA 1I4LD 1XZPA 4PC2A 3A1VA 4WW0A 1JXMA 4X8OA 3T61A 2ZRCA 1IN4A 1LF0A 5CK4A 1DPFA 1SHKA 1TPZA 2AFHE 2QRNA 2BJVA 4DB2A 2P5TB 5E3HA 4EFLA 2GXAA 3OE7A 4DKXA 1DAEA 4B33A 3QXJA 2DHRA 1NN1A 3ZZ0A 4NYJR 2J46A 5IK2D 3D7MA 4Q1EA 1TF7A 2PEYA 2QMOA 2QZ4A 5DYIA 1WP9A 2A7QA 4QM6A 1NN0A 3V9PA 1W1WA 4AYTA 3NHBA 1DBSA 1G3MA 5BN4A 1OFUX 2IF2A 4JSTA 3IIJA 2BVNA 5FTMA 4ZKDA 3W3ZB 1SVSA 2VTKA 3LX5A 1GILA 4MKIA 3MUFA 4XSGA 4ASUA 3T15A 1GKYA 4TMTA 1XEWY 2X77A 4DIEA 2O8EA 1OE0A 4U7DA 2NO0A 4TLDA 3VX3A 1FMJA 4RCYA 1E2MA 4UXJA 4C2TA 2KE5A 4PX9A 1US8A 3UATA 2GKSA 3TAHA 2YVUA 5JSZB 2XEXA 1VCMA 5BN5A 1E2GA 4PPQA 1Z47A 3KB1A 3K9NA 2HEIA 3I92A 1Y63A 2ZYTX 2VL7A 2BMEA 4OK3A 5JBQA 2HLDA 1DOAA 2OILA 3PCRB 2CLSA 1R0ZA 2ZJAA 4M4SA 1KO5A 4KSCA 3WHKA 4B48A 3UPUA 1JQLB 5FR2A 3MWKA 1W5TA 4US0R 4KSBA 1ZD9A 4Q02A 2LWIA 3VNUA 3HU2A 1XJCA 1W5SA 2EU8A 4R7ZA 1MRNA 2ZJ2A 1E2IA 4HB3A 1G16A 5HR5A 4PHFA 1VIYA 4S35A 1AM4D 3CPEA 1NSTA 3C4JA 1IBRA 1XDBA 4L4UA 3ZS8A 3LXRA 5J4VA 2IYVA 2QA5A 1E9FA 4BFVA 1DG1G 2P67A 2NZJA 3EXAA 1ZBDA 3LY5A 4A8JB 2XNDA 2NO9A 2H92A 3MJRA 3ZVLA 3F5FA 4JVLA 5EXXA 2ZRLA 4C7OA 3GD7A 1KI8A 1U99A 4PZZA 2PCLA 1IM2A 4LJ5A 2YOHA 5FL3A 3RABA 3QKRB 1AK2A 2KB0A 2V3CC 2WIAA 4AYXA 5E95A 2DYKA 4HI0E 2KSQA 1VYUA 1XP8A 1CULC 1G3QA 2JJ8A 5SZKB 3AGQA 1ZU4A 2DY1A 1Z6GA 4DDUA 1FMLA 2HJVA 3O8DA 5KDLA 4MH0R 1Z22A 2JLUA 3N70A 3D3QA 1SVIA 3RAPR 4EJSA 2WWYA 5JCZA 1YZGA 1GIAA 2MSEB 4GSYA 2FU5C 4DSTA 2FSHA 3DKPA 5DI3A 3R8CA 5TMPA 3WMFA 1ZNWA 4B35A 2CL6X 2ZJYA 4M21A 4YONB 1NG9A 4KVAA 4QBHA 4Q4AB 2ONJA 4DSOA 1YR8A 2XOKA 3Q9LA 5C46F 3DMDA 3IQWA 4F91B 2B7CA 2JDIA 3B9QA 5EJEA 4KHZA 1KI1A 1JEDA 1G4AE 1A7JA 3GFTA 3C7KA 5FOWA 4BEBA 1QHNA 3ZVRA 2ZRDA 1E2LA 2ODNA 4A82A 1QVAA 3P4XA 1NJGA 4PC6A 2J0UB 3VKWA 4D4LA 4URVR 2C03A 2R6CA 2FEOA 4AD8A 1IJEA 5JJLA 1G9XA 4M1WA 1YR6A 2BEKA 1NVWQ 4B6EA 1P7CA 4D6PA 5G41A 3CR7A 1C4OA 3LW8A 4FCTA 4MKHA 3RC8A 1VYTA 1TQ2A 2XNDD 1NVVQ 2GJKA 3B78A 1DO2A 2DWQA 1KYIA 4KU4A 1H8EA 1G5RA 2R6GA 5C2JB 5FTLA 2IS6A 5FUXA 4XWOA 3IBGA 3E1SA 3WBJA 4E07A 4MDFA 1BIFA 4IDPA 1S1CA 3NH9A 1N5JA 2ZM5A 1TMKA 4M1MA 4Q7KA 1TF5A 2IS1A 4WA7A 2F9MA 1UBFA 5HCNA 1L2TA 1SXJE 2IS4A 3IIMA 4DLYA 2VP5A 4BQSA 3SN6A 2OAP1 4GFDA 2DB3A 1JBKA 5G40A 1QHHA 1R5OA 4OQLA 3FFAA 1KSHA 1JNYA 3OIYA 3SOPA 4CEIA 3I72A 3WYGA 5E7MA 1Z6XA 1FQKA 3K09C 1LFDB 4JLMA 3DO6A 2WJIA 1E2DA 1KDPA 5EZ6B 1W4CA 3AVUA 1CJKC 1U98A 4TYQA 2ZJ5A 3EX7C 3CPHA 3IHWA 1E0KA 4BGDA 3KZ1E 2ZSEA 2ZUBA 4EUNA 2EYQA 1HY3A 5F2EA 1GOTA 1W0JA 1VCOA 4FMDB 1WXQA 2RGGA 3QPWA 5KYKA 1VG1A 3KKQA 1S8FA 3MSXA 4WBSA 2I3BA 3AQ4A 3IDQA 4ILEA 4P4SA 3KUDA 5KHOC 1FFHA 3QBTA 5B57C 4BEJA 2ZS7A 4DDTA 1NY6A 2O0JA 1QHSA 2IHBA 1ZINA 3L0IB 5F9FA 2F3TA 3TKLA 1CJUC 2G77B 1OHHA 3CM0A 1SVOA 2JLYA 1RYFA 1D2MA 4L8GA 2QPAA 2PJZA 1RW4A 2QSZA 3HU1A 3ADDA 4A8JC 4NMMA 3A37A 4PFSA 2GEUA 2FFAA 1VG8A 3KJGA 4BRUA 4ACBA 1YJ5A 2FFQA 4URWR 3AF1A 1DAHA 5TXGA 4TYWA 3T1TA 4JLDA 1M7HA 1XTSA 2ZROA 4C0QC 4JL8A 3TW8B 3QG1A 5C1BA 3AKCA 2ORIA 4B3CA 4I4LA 4OQMA 3ZIAD 1WQ1R 1ZAKA 2JLSA 4YMTA 4ESHA 1YKSA 4IVPA 3B2EA 1OT3A 3ONWA 4JIMA 3CF6R 3IEUA 4UXIA 3LD9A 3TVTA 5KDDA 1U90A 3B1VA 2RAPA 1YU9A 3EG5A 3EZ7A 4NE2A 1W49A 1G3UA 1OB2A 3VKHA 2WJJA 1CJMA 2IW3A 2A9KA 1XFAA 1SKYB 2C96A 5TV2A 5ELXA 1OXSC 4DB4A 3WNDA 4LOAA 4H1VA 1KY3A 4HB2A 4ERNA 2E1RA 1ZJ6A 2OO7A 3SBEA 4ARZA 4BLOA 2IYSA 3LH5A 1KK1A 2J45A 2VHJA 4MYUA 1WBDA 2P6RA 4CGZA 3KFVA 2GK7A 4G01B 1OIXA 1WCV1 1OFTA 2R2AA 3K70B 5FUWA 4LV8B 4A1FA 4Q9IA 1BMFA 2ATVA 2RCNA 4J0QA 2ZSFA 721PA 1IY0A 1HQCA 1P62B 1KMQA 3CRMA 4JVMA 1XEXA 2Q3FA 3U3JA 2UZIR 5AWFC 1NBMA 1E9CA 4DLUA 1XXHB 2C78A 5JWOA 3QXXA 3GJXC 3EW9A 1XCGB 2HUPA 1Q57A 2KWIA 1FNNA 2C95A 2C9YA 2NPIA 3QKRA 4LJ6A 4TMWA 1NN3A 1U0HC
chains in the Genus database with same CATH superfamily
3R4VA 4L3OA 5DW0A 5E6RB 1O9GA 4N8EA 3P1JA 2FN7A 5JBIA 3PG5A 5K6AC 3FNHA 5LWQA 1YF3A 4TXJA 5E38A 4TSFA 4EQ6B 4LMRA 3SHOA 3NO4A 3BJZA 3RSFA 3VO8A 2ZAYA 1GPJA 1JKXA 3IH5A 2ZB8A 4H6WA 4XTCS 2QUIA 1WZ2A 1JTEA 3L8YA 1W0KD 2C5SA 4HXFB 3HYTA 1T2DA 4FXOA 1W85B 1V26A 2QXTA 2G3YA 1JDTA 1QYCA 2F1RA 4GBMA 5CH5A 5ALUA 4C1NA 1YO6A 4M0FA 1VCIA 5HFJA 1E69A 4M3NA 3B3GA 1JB9A 3TCNA 2EKQA 4E46A 4ZHSA 3P19A 3ZXSA 1S7CA 4G56A 1X15A 1YVUA 1CY0A 1XJ0A 3B3FA 2QL9A 3IIIA 3THYB 2PKRA 1NW3A 3INRA 5BWNA 1OZFA 2INGX 2P6PA 1EFHA 1WWKA 1V16B 2YMLA 3NVAA 4MJXA 3ZHBA 2L19A 3FCAA 4RTNA 2VH2A 5AI0A 4BNHA 3A11A 1W29A 2F8LA 3LRXA 4KXYA 1L5MA 3OHMA 4Q34A 1RXSA 4O3FA 3IXMA 2QYHA 4EJFA 1OKKA 5FOSA 3SZGA 1QRAA 2CDBA 4JGGA 4L3VA 1AO0A 4D3SA 2DR2A 2CJFA 3QWIA 2H18A 1RYHA 5FADA 1WZIA 3K32A 4G5HA 5ESWA 4BGVA 5FUMA 4QU0A 4HNAA 2PBRA 8ABPA 4AKEA 2YWFA 2F64A 2ENWA 1Y1LA 4ZOLA 1MHTA 5BQFA 2O07A 2Z6AA 3M2TA 3S1AA 4BO9A 3F3SA 3FDJA 3KL2A 3QEJA 1GARA 1UMCA 4KIFA 2DKNA 3K94A 2FI1A 2ZTMA 3COPA 3WP0A 1SQ6A 2O3UA 2GS9A 2ZVPX 4BZXA 2YCBA 3VR4A 3BEOA 1CRQA 3PE6A 4R2JA 1CLUA 5C7YA 5IKMA 3RS3A 4W7IA 4WVLA 1ZONA 3I6ZA 1WMEA 4ZMRA 1EP1B 1N0UA 2E37A 4KODA 4XFJA 5K0BA 1IY1A 5G0UA 3R3XA 1PDOA 1XK7A 3BB3A 3M6FA 1NBIA 3VR5D 1VXRA 4DFDA 1ONPA 1WXDA 3ZK9A 4YX9A 4OKSA 2WFZA 3PI6A 3OP1A 1SG6A 3H18A 3L6OO 2JI4A 2V7QA 4G0PA 2WWVD 5M29A 3TX6A 4LYFA 4N7JA 3HL4A 3UVEA 2GCOB 3LCUA 3OMXA 2FLKA 4BUZA 3NEYA 4JQYA 1XU9A 4HWOA 5AW5A 2UVPA 3TXYA 821PA 2RE8A 1AKRA 2IGBA 5T67A 5LBIA 1R7RA 2HHAA 3CNNA 3A4LA 4XJVA 4EABA 3G7SA 2MMGA 4OQ4A 4LFAB 1YJAA 3C8ZA 3A3NA 1DT5A 4TKVB 3L4EA 2W71A 3NR2A 3FOZA 4P93A 4LDPA 1DC4A 2WM2A 4B6FA 1ZGZA 1OLOA 1R0XA 1U0SY 2DFTA 4R2LA 4RH0A 4IG9A 2GBIA 1PZEA 3IC5A 5KBYA 2CDNA 5JUWA 4B3GA 4LVUA 3DCIA 3OJLA 3QNUA 5COQA 1Q0UA 3EC2A 5KQGA 2XSZA 1GAWA 5TJ9A 3W6NA 3X0DA 4AS2A 4LRSB 4N3NA 3JQ8B 1Z4PX 5DBEX 3BC1A 1EINA 3Q7RA 5LLSA 1UBJS 4DV0B 3G6WA 1VTKA 2BUCA 3MXTA 4QA9A 3GRPA 4DA7A 1NE2A 5LQJA 1NF3A 5ENDA 1S2IA 3A2KA 4JMLA 4BKPA 3VR5H 1M2KA 3SC2A 5KKCA 1VLMA 2OZEA 1KVRA 1S8AA 2XDWA 3O7MA 1JGTA 2FV8A 4LYJA 5BT8A 1RYNA 2NO6A 5SYAA 2ORVA 3NTOA 5C4IA 5BSFA 2IV3A 5C52B 1I5EA 3FNIA 3QBJA 3PZRA 4QTTB 3INGA 3M6AA 4DLNA 2XE4A 1GCAA 4MKXA 4NMWA 2VF5X 4L0MA 3MLAA 1P7ZA 4LZPA 4YIHA 2AFHB 2JEOA 2SECE 1QU3A 3RNOA 4ZDKA 1VHDA 4B32A 2QOEA 3HI4A 4H6XA 2OCIA 5F21A 4GLOA 1CNEA 2QR3A 2PWZA 3CB2A 4QLAA 3N75A 3W8RA 1J8QA 3LUGA 3UKOA 4JZKA 4JJEA 1IE3A 1MHPA 4J7XA 3S8EA 3BFPA 3EUFA 5E9WA 5J4KA 3R8FA 1ND6A 1CUFA 1NMYA 2C9CA 6REQA 3AETB 3M83A 4XJSA 1OOEA 3ZX5A 4ADSG 3H2YA 1HOXA 2GM9A 3GT7A 4PLGA 5EUQB 3URKA 1C9MA 3QEMA 3RQSA 3TCKA 2XQFA 5BMVA 2A35A 3PEWA 2XGSA 2WPDD 4LS3A 4IJMA 3RARA 4QOHA 3QVXA 5CM8B 3QFSA 2EFDB 4YN3A 1XZIA 1SQGA 1B8VA 3H5LA 4R2HA 5T8KC 1YZYA 1HQDA 1VL1A 5A3VA 1Z15A 4E5DA 4YQFA 4BCCA 1A5BB 3BVPA 4UTXA 1IUPA 2BCGY 2CHGA 3CEJA 4W8HA 2HA7A 2E4WA 4YRDA 3SE7A 4LN1A 2GUGA 2WTXA 4QQNA 1Y3HA 1DIBA 3PUWA 4OQPA 2Z57A 4RX1A 3WLTA 1CEEA 3DYIA 2WF7A 4KN8A 5A4KA 3QVLA 4MW4A 4FOOA 1E3DA 1QGYA 2E4UA 4Q4JA 4U3JB 1NSFA 1S0UA 2J7PA 3GNTA 4OM8A 5L3RA 2EYUA 4DYDA 1GTMA 1NN5A 1IQ0A 4XUCA 1VC2A 3HV2A 4ZJUA 1H23A 3G2KA 4G0NA 4WLFA 1BGXT 2BFDB 4WK6A 2H4ZA 4AG5A 2Y1EA 4NENA 5B30A 1SFRA 2IEBA 4Y6PA 1U3WA 3AF6A 1QNFA 2HRDA 1DC8A 1GTJ1 3HCBA 4FFBB 5CURA 4ZTBA 1O89A 2C3YA 2ZE7A 3LBNA 3ND8A 2BBWA 2OK7A 3CKLA 4B81A 5EJ6A 1U4OA 1PEAA 3DAGA 3KPYA 2G76A 5H7XA 1KQFA 3U1TA 1JFSA 1ZOPA 1V48A 3K05A 1Z5VA 4MLZA 4NS4A 1P29A 2QMEA 2XY4A 4R9RA 2WU4A 4TQGA 2EIHA 4M6WB 2X9VA 2ZIGA 5JMTA 2JJ1A 4UAUA 1HG1A 3L0CA 4CIDA 2ZKLA 2JIPA 3NANA 4FCWA 5ENZA 4CU2A 3I04A 3O1IC 1GLGA 5TQ2B 3JZMA 1OH6A 2DT8A 4HZGA 4RXMA 4V2UA 4LF8B 3IESA 1ZBQA 1J4AA 1N92A 2CFOA 221PA 3QKTA 3OCCA 3LOQA 4CKEB 1PYOA 3NBKA 4Z1MD 2PH1A 3N2KB 4Y6QA 3USCS 4BN5A 4BNGA 5DLQC 3AWDA 3ILVA 2OV4A 4MLDA 3SS7X 3KJEA 5B5SA 3KKPA 1AQUA 4EHDA 2C2GA 4O63O 4P2BA 4QPDA 4C5BA 3WJAA 5CFZA 4DMRA 2OESA 3TBHA 3U61B 3IB6A 3OETA 2W6ID 3D3WB 4HF7A 5H59A 3EC1A 4JP1A 1X0XA 4DQUA 3O8CA 1EBBA 1KYXA 1Q7TA 1TO1E 4P8RA 2WNSA 1BWPA 2PO7A 2QNBA 3EVBA 4BLQA 4F3NA 3AZQA 2HU8A 4KK3A 3KHTA 4G1BA 3V4VB 3KVYA 4LSMA 2FJPA 2V6BA 4H7PA 4PC6A 1Z0IA 4D8YA 4DWJA 4KQCA 4C7OB 1CUXA 3EGXA 3FOBA 3K1YA 3N1UA 4JAVC 2CCJA 3O03A 3PRKE 4PLTA 5JWHA 4UEKA 4CMHA 2PZGA 3SVTA 3O5AA 4NV3A 4HNAB 4YJ3A 3EWNA 4KLRA 1E3IA 5TE9A 2BLNA 4B5KA 3WICA 1N77A 4YJKA 1G6HA 4HUQA 4TM7A 5JHGB 1RWOA 2OHOA 5IM4A 3D0KA 1EX1A 4QUGA 4EEKA 4PBTA 1X7YA 3I1FA 4JC4A 4KMRA 2R7MA 4U8HA 5IKEA 2J3HA 1CZHA 1NVUQ 1CR0A 4C4ZA 1DJNA 5DTIA 2GJAA 1D6JA 4URZR 4DV2B 1SKBA 2UDPA 3KSBC 1MQ8B 2P62A 3G5LA 5MN5A 3TL3A 1GQYA 5FAXA 5HRCA 4PCVA 1BFUA 4XIGS 1C1DA 3KT8A 4QO7A 1YFLA 4IGKA 3RYTC 2X76A 4K9RA 1NVMB 2WFAA 2XDAA 1XQ1A 3JCZA 2RAFA 3OEED 1P4SA 2ZB4A 3T1YB 1W8IA 3THWA 1UMBA 1Q22A 3L9WA 1WL8A 4IFTA 1P9WA 4KX5A 3WFJA 1M1YE 5AW0A 4U9UA 2WY2D 4GPZA 1EAYA 1IVNA 4K0KB 5BW5A 4BO2A 1XZQA 3BIOA 4JUFA 5KYWA 4KC0A 4E6EA 3W77A 3O8RA 2X3YA 4TKZA 1V8PA 4D80A 1Z5OA 4HDNA 4YT8A 2Z98A 4MMZB 5A9SA 4GPEA 2V3WA 3UYLA 2Y1GA 3OQHA 5B53A 3WHIA 2VQEB 1R9MA 4J29A 4N5MA 3VO9A 1CEYA 4QFMA 4BNZA 4I99A 4MUAA 3O74A 3FCCA 3N2EA 2VDQB 3MJTA 3VJLA 3V4FA 1ZK4A 4LYEA 4MUKA 3TF5A 1WF3A 2GX6A 2MSCB 2Q45A 3AC0A 3H2GA 4BKMA 4IIJB 4Q3AA 2NO1A 1BE8A 1I2BA 2KW5A 3VR3D 2C7VA 3FHJA 2BFWA 2R4UA 4F46A 2P0AA 3PS9A 5CU7A 2DSNA 2YFQA 4NU8X 4EFMA 3EVZA 5ARBA 3GG2A 3QE0A 4CQJA 2ACKA 3QVKA 2HDNB 5AK0A 1PFVA 3CISA 5H4GA 2OUIA 2Z2YA 5DHRA 2Y0BA 5CVCA 3LIIA 4OGFA 4AXXA 2FRDC 1YNOA 4HDSB 1QK3A 4M83A 3UW3A 4IXMA 5AJZA 1G7RA 4JN6B 2WYIA 1Y6QA 4LCEA 4QRDA 2B21A 3C7DB 3ZV7A 2WAAA 3GLHE 4HDRA 2P1DA 1E18A 1RCTE 1AUVA 1V7PC 4X1OA 1K6XA 1EFRD 3GX1A 1UJMA 3KT3A 1YRBA 3GG9A 5E6UB 1TO2E 3LY9A 3TB6A 4GL4A 4NPCA 2R7KA 2BC9A 4WKBA 3GVPA 1RXUA 2WNHA 4WZ6A 4DIUA 1RVDA 3K53A 1Q3TA 2QJWA 3I01A 1N8KA 3KU1A 2G09A 1Z2PX 1BE1A 3EGOA 2CL7X 3ETLA 4YUVA 4BLTA 1Y5LA 2HK7A 3JYQA 3H3XA 2HF9A 3K30A 1N2CB 1GN8A 4PN3A 3IJ5A 1EMDA 4GKBA 4AZ3B 4DUGA 2VDWB 1P74A 4TKMA 3PI7A 1EBUA 1M1NB 3ZU2A 5L7TA 3IODA 1V1RB 1XDSA 3EZGA 1BKYA 3IDOA 3QGMA 4IRUB 3NNSA 2GHIA 1L4KA 4Q05A 1C9DB 5CJ2A 4B8ZA 2H63A 1P6XA 4IZHA 2BEVA 1KJYA 3UA3A 3IKMB 2RH4A 4TKUB 3U13A 3NAQA 4QQKA 1BE6A 1FUIA 4IMJB 1XPOA 4MW1A 4NAHA 4F3TA 1FRZA 4Y0AA 3GCXA 4EH1A 5CNJA 1U31A 1CB7A 1J39A 2ZQZA 2NT3A 3GVXA 5IK2A 1OHHD 2HX1A 5KU1A 2YX1A 3ONNA 2IEIA 3A4VA 5BN3A 2JW5A 1J8FA 4C4XA 2HFKA 2ZSIA 1BSVA 4WNCA 1QF6A 1TD1A 3E1GA 4L4XA 1ZL2A 3FIJA 4BTVA 1FY2A 1IN8A 1JHRA 3HCEA 4E5YA 2I8CA 3EDMA 3T06B 1MT0A 2B92A 5AICA 4OQNA 2JFPA 2X3UA 3V7UA 2Q1UA 1GTG1 1CHDA 1E7MA 1NC3A 3WGQA 1Q0QA 1N5MA 1RT9A 1I3MA 2ONZA 5ALPA 1P5ZB 3DZKA 1V6SA 3G8YA 4KQGA 5E1BA 3JAWB 1JE0A 4JR0A 1Z38A 1Z6AA 1TA0A 3T1QA 1JVBA 1KU0A 2O8DA 4HWRA 3BD6A 4M38A 4E08A 5YASA 1JHUA 5J1SB 3AFGA 4V0MA 1IB0A 4OM7A 2XMSA 1V8OA 1EXVA 3HFJA 5JMWA 2HJHA 3FRHA 5KC9A 1UT5A 5E2AA 3E1KA 2C8VA 3Q3CA 4QJBA 3NYRA 1U0BB 2O0LA 2Q3LA 1DO8A 1U0FA 4KGXA 2ZS8A 5CLQA 3HCDA 1CVRA 4B17A 5KNCA 5AW8A 1VMEA 3LO8A 3CCBA 1M6EX 4G1EB 3ZUPA 3M5CA 1IPFA 1E7SA 1KJWA 3A70A 1N8SA 3KFXA 4RY9A 2GMWA 2JKZA 4ZN6A 2C07A 3P9ZA 1N6HA 1FTNA 4XWGA 4KE8A 4NZNA 2FW6A 2BMFA 1TYDE 4BECA 3EGCA 2QD3A 2ZWIA 5JS7A 4PYOA 4O2BA 1U1DA 3PHBE 1R0SA 2JFZA 4OXXA 1P9RA 1KK0A 1P8JA 3WYNA 5L4NA 1M9NA 1NI4B 2FY8A 2R44A 3OZFA 1OXXK 1UADA 3IAUA 3EAQA 1E79A 4YA6A 4JITA 4K5QA 4DDVA 2SCUB 3EIWA 3S44A 4B85A 3RBAA 1H8HA 1QMPA 3V7NA 3ICWA 2D5BA 1J1ZA 2B98A 4ZO9A 4LJRA 4GG1A 3VV3A 5CNIA 5FBVB 2PZFA 1QORA 4HHEA 2YZ2A 3ZBTA 4CMBA 5EQDA 3GLIE 3SSMA 5F98A 3CZAA 4GI5A 4IJWA 2BDTA 1LSSA 1OZHA 4Z4HA 1AJEA 3A6KA 2XUIA 3D8HA 4MIEA 3KZNA 4CKYA 3PUVA 1QCYA 4HUQB 3T4UA 3ZWVA 3A6DA 4AKHA 2CXXA 2O6LA 1D0SA 4HWGA 4BNUA 3PWKA 2BI8A 3D3NA 1GRVA 5J43A 4YFVA 3E9DA 3TQHA 3VX4A 1N6KA 1ML3A 3AYZB 1BQEA 2B34A 3E6AA 4WKNA 4EKDA 3X1MA 3FHTA 1EWYA 4B82A 3BHMA 2BLLA 3NP7A 4IOMA 5F3DA 5T64A 3OFNA 2FPLA 3TOXA 4EFDA 1W0CA 1BWRA 4IIGA 1G2OA 1CR1A 1MC8A 3I6BA 3ORQA 1IUNA 1GUFA 2FPIA 3NEJA 3P45A 2J31A 2FA9A 2GBPA 2Y67A 4ZKEA 4DY6A 2A59A 4YPVA 4GKJB 2P6NA 4LX0A 1KC3A 1PTJC 4R68A 3DOUA 3BE4A 2DFLA 1MB9A 4ETIA 2JIZD 2O5EA 3TI9A 4FYPA 1PR3A 2BFEA 2C2XA 2X9QA 4KGVA 4NG4A 4TMVA 4WZBA 4XLZA 3CKMA 2PUBA 4ZOEA 1CR4A 3H9UA 3IMKA 3LIPA 3P9YA 7GPBA 5EQTA 2BBTA 5EJAA 1DAFA 1XKQA 1XKXA 1P91A 1ZCAA 4PLPA 1BJKA 2HWYA 4JWTA 1LSJA 4YECA 5C4MA 5MFPA 3N86A 3QIVA 3R7WB 1XHLA 1QTIA 1VECA 1RMTA 5GM1A 2DHEA 4R1OA 5JECA 3NTVA 2AB0A 4L9WA 1JP7A 2VA8A 1YQ9A 3VNVA 3RTCA 3SDSA 1VHWA 2PXHA 5E0OA 3TTXA 4D9FA 2EGHA 4QDTA 3UHJA 4IVQA 1MFZA 3GJ7A 3OJEA 3SZMA 3G2JA 3JQGB 2XTNA 3ZX4A 3MTIA 3NCTA 4U02A 1Q2XA 2QSYA 3JAKA 3RUEA 2W98A 2UV8A 4B1FA 4F4CA 3MTGA 2HCJB 4MZDA 1JR4A 3VOAA 4BQIA 4LUCA 2H59A 1WCWA 5J40A 2AG5A 1KFCB 4I1SA 3GUVA 2GZRA 3GAFA 3NH6A 2VJOA 4IH1A 4UMEA 1B74A 1YH3A 1W30A 3GELA 4IQ4A 3OZGA 3UCEA 1SBNE 1VMIA 5AKKA 1U1GA 3IVXA 1CDDA 1GU1A 2ZE8A 2L18A 4QU5A 3GIWA 4TUYB 5F4ZA 1TAQA 2HB6A 4CXMA 5CDGA 4BO4A 2VNKA 2YZGA 1QLWA 5FFNA 3ML1A 3E3MA 1Z4OA 4IFBA 5IKXA 5IC6A 3LV8A 3QX9A 5KOJA 1BN6A 1ZD2P 2J7KA 1WSBA 2WU3A 2ZSAA 3EMVA 4CNQA 4CLOA 4PF1A 3B6MA 3MWLA 1NSYA 1UZNA 3TLKA 2AOUB 5CB0A 3KHKA 1AGRA 2C5GA 4FGZA 2H1VA 2IXAA 3AEQA 3FFTA 3V34A 4MUJA 2RH9B 3GFVA 1SA0A 1VFPA 3ZWDA 1UK6A 1OH8A 1U9IC 1XU7A 5JNUA 1HR0B 1L4BA 1P7YA 2B2CA 1I36A 2ACWA 2RAVA 4K81B 1IM8A 3L05A 4OQEA 3ZHQA 1K92A 1TAGA 2ECOA 4MR9B 1WVMA 1QG2A 3EXG2 1TKCA 5K3SA 1FU7A 2P6UA 5G0VA 3QXSA 5DCWA 4NXMB 3MWGA 4ZI2A 4RJJA 4MGZR 3SJCA 2E6KA 1UPFA 4IIYA 1P2VA 4EI7A 1I4WA 3FBTA 4WLNA 3W2TA 3AKDA 4DLRA 4EAAA 5BV1A 4G5GA 3UY4A 2XUFA 1JAIA 1OTHA 2ERCA 3U80A 1DTWB 2PUAA 2AYZA 4XIJA 4JI1B 3UICA 1PL7A 3HB7A 4RGQA 4HAVA 1P61B 3RIMA 4QULA 1HT0A 3K1AA 5T5QA 4BPBA 2PT5A 4JELA 4A5OA 1FDVA 4YRFA 2WK1A 1NT2A 1ZVJA 3M0EA 1PUIA 3HDQA 4AJIA 1RQNA 1H3FA 2JVJA 4TTIA 5DMHA 3DEFA 1LLDA 1PJ3A 3LYUA 2ZCUA 4RKQA 5CG1A 3KSRA 3QEMB 4W5JA 3T9CA 1NG1A 1URPA 1X7ZA 3LCVB 4XGIA 2WB2A 1EX7A 4YMIA 1RIFA 3PC4A 4MCHA 1BHQ1 2IYZA 3QQ5A 1HV8A 1O95C 4OI4A 5TT1A 3QLJA 4I1OA 4R3UC 3DUFA 5ADVA 1X87A 3ANLA 2BBSA 3AY3A 2FVYA 4JSRA 1EK1A 3OBIA 4WLEA 2Q21A 4FJ0A 4DVJA 3MHTA 1CTQA 1MRSA 2Q6VA 2FN4A 1O95A 3LUCA 3PBKA 2XIJA 2NW6A 1V9CA 3BRCA 3F90A 3C7TA 4JDUA 3UHOA 3VPFA 3R9IA 1E2BA 2ECPA 1E1YA 2DBZA 2A3RA 1RYDA 3TWOA 1OGIA 2ZEJA 5G3ZA 4HQ0A 2C7PA 1EVEA 4DXAA 2Z8YA 1NZJA 3ZKWA 1EUZA 4GMKA 1ECGA 3MS2A 4UFNA 4UU7A 4EY8A 4UFPA 1G6KA 5AKHA 3ZK7A 4E5UA 4XYGA 1G59A 2D6FA 3WQSB 2JH8A 1G21E 1Z2DA 4QFBA 2C57A 5IBCA 5HMLA 5G1NA 4PC7A 4Z4FA 2BFAA 3PXAA 3SFTA 1MO6A 4F3RA 2H57A 3TVDA 5DNCA 5DYGA 3L7JA 4INOA 5DOVA 5HFNA 1GEGA 3KZKA 3TD2A 3KZXA 1PTKA 2YICA 4JYPA 4MV7A 1C9NA 5FOUA 3ADBA 1YRAA 5IVKA 5E1DA 2JLXA 4UAVA 3DMTC 2ZBFA 3CVVA 2E6UX 2ZRBA 3BMQB 3W6PA 3R9XB 2ZIUB 1WTCA 1C80A 3MBOA 1YI0A 1NATA 3JATB 3JYLA 5DZSA 3KAQA 3ZE0B 3GCGA 1N8NA 1Q21A 1IZ7A 4ZZ3A 1HPLA 1D5WA 1T36A 3DMTA 1WOYA 4PTZA 4PZDA 2DLCX 5HJ5A 2VRCA 8LDHA 3SEQA 5K8IA 5KYYA 4OL0A 1V5IA 3QYPA 1N6PA 1ZW6A 1USGA 1TQ4A 2KX7A 1PDWA 3AFHA 1P9OA 2NU9A 3BF8A 3FHOA 3ASZA 3MTBA 4MMYB 5A06A 1F3OA 1ORDA 3LXXA 4RVUA 3Q8LA 1AS2A 2I7XA 1VE3A 3CNHA 1IZ8A 3WLOA 3T5PA 4RDHA 5F3WB 2QE7A 1PGJA 2I3ZA 1XMPA 1XNGA 1K63A 4EB6B 3KKKA 5F4BA 1N4AA 2IY8A 1V9SA 1XQWA 2DAPA 4F45A 1GDTA 3RV4A 1ELOA 1MT3A 3C14C 4F1WA 3QFTA 5FI0B 1S3SA 1SEVA 2XUHA 3QQPA 3LP6A 4EGQA 2BP7A 1JIIA 1P0CA 3Q3EA 3ZCVA 1GU7A 1YL7A 1ZYUA 3AJEA 1PV2A 4E94A 2BGNA 4ZI7A 3BH0A 3VYRB 1ONNA 4O59O 2FUG1 2KMLA 2XHEA 3EMKA 1BQ4A 3GUUA 3HZRA 4FYWA 1VL0A 5AUNB 1LX7A 2F55A 1XCMA 1BO6A 2HRCA 5T4FA 3PJEA 3ZZ1A 4CM8A 3STYA 3EOBI 3KD2A 3OFJA 5IZ4A 2GH1A 2ZTLA 1KE1A 2QVCA 4JD5A 4GE0A 1G41A 3LT0A 8ADHA 1SKMA 1WB5A 1GLNA 4LBWA 1CS4C 1P72A 1XZDA 2RGEA 1YHZA 3EAGA 3UGQA 2DP4E 4ARSA 1L4NA 3GUCA 1SUEA 2FZ4A 2NXWA 2FDCA 2C29D 3C3EA 3AIIA 4FT4A 3KQWA 3N2LA 5EERA 3WYFA 4MYHA 1QB7A 1X77A 3DBRA 3TZLA 4UTVA 5JOQA 4FB5A 3GOHA 3QI2A 1GTVA 3U4MA 4FOPA 3PL1A 4M1EA 4D9CA 3P2MA 5A4FS 3T3MB 4B09A 1YWGO 4E15A 1GKUB 3M3DA 1SGWA 1B42A 2DTDA 3OEHA 3LP8A 1WQ4A 1I1HA 2RHCA 2FR8C 3VR2D 1HDRA 3GXOA 3KWFA 4DR7B 1ZKMA 4QXOA 4KR0A 2J1LA 5FFMA 2WAMA 3WLIA 4AUMA 1LTQA 3NWOA 5HK9A 3HJNA 4BJ5A 1R27A 4L22A 1DC5A 3DFUA 2OSBA 5HIIA 3AOEA 3O9MA 1GUYA 1TIKA 2R6FA 1YS1X 5GJVC 4H1WA 3A05A 2EVWX 1YUMA 2O4CA 2XXBA 3GNSA 4EHIA 1HZZA 1KMHB 2PQ6A 2G82A 3IPLA 5AJVB 2HO5A 2OXTA 1DBWA 3K9HA 3U40A 3UT5B 4XWYA 1BDMA 4D3ZA 4MUMA 2BH9A 5AJWA 1VMAA 2XAAA 5KSPA 4WE3A 5JYCA 1MKYA 2FZLA 1WULS 3ST7A 4AZSA 2I66A 2XE7A 3HVUA 3QH4A 3OAAA 1KWKA 3TMYA 1P2DA 1QP7A 5GV7A 3MTDA 3BWDD 2ARKA 1DV2A 1U6JA 2HK6A 1I5RA 1L7DA 1UDCA 3ENNA 2Y4OA 3RFCA 2DWOA 3LC7O 5ALRA 1N36B 2I2FA 3QEOA 4L6CA 2FRDA 4IDCA 3VR6A 1IULA 1RWQA 2OFOA 3SZ3A 1Q1BA 1J2JA 3BIJA 3ZDAA 2LPMA 3ISTA 4TZ0A 3OQIA 3I9LA 2JCXA 2R6HA 3H42B 1IN5A 3B51X 4Q7QA 4EPRA 5CJPA 3ELYA 3V4OA 1VG0B 2IWRA 4GBJA 3ITKA 2JGKA 4RYLA 1F1JA 5F78A 1T3TA 3F0TA 1NNEA 3PIIA 2JJMA 4J49A 4GI3A 4O4LA 5FIUA 1GTSA 5EIHA 1KFJB 2C94A 1BMTA 4WERA 4HFJA 4AZ0A 3SIRA 5EXEA 4DNOA 2C7OA 2Q62A 3H7AA 4E2WA 1AD2A 3BHNA 3PFNA 16PKA 3OM1A 1L8XA 2G63A 4MDYA 5E6UA 2DWUA 3C8MA 4BVKA 1UKVY 2FE1A 3OC6A 4CKEA 5ARDA 1UUFA 1IH8A 3PHLA 1PDVA 3KLPX 4L07A 2AFIE 2FOIA 3AR6A 4RO0A 3IP9A 2PT9A 2HLDD 4OL9A 3K72B 4MVJD 2W83A 4X90A 2CUKA 1ISFA 5B4TA 3U31A 5E7QA 1AX9A 3C1OA 1PZGA 3ORSA 4LY6A 5FBLB 3DKKA 3VXKA 3FXAA 2D5IA 2HA2A 2O50A 3CLUD 1ZZEA 1AHNA 4G84A 1N4DA 5J23A 2FGJA 4I4NA 1W87A 2NWQA 2WU8A 4JLKA 4ID3A 5AP9A 5EHQA 5B4VA 1XZNA 2W2KB 2WICA 1UC8A 2ZIEA 2ZIXA 1MEJA 3WAJA 5FBWB 2DEUA 1FFXB 2PKQP 2ATXA 1H5QA 2EKLA 4HATA 4UNNA 3AM4A 4UBLA 2KQUA 3X2EA 1QIDA 5FULA 5IG2A 1XVTA 1QX4A 1AKWA 3GN2A 3KV1A 4JBIA 2NN3C 4Q16A 4GOOD 4CDGA 1SZPA 1L1RA 1P0PA 1PQ4A 1YBVA 4ND8A 3B89A 3GJ6A 4OOEA 4S1TA 4XFKA 3RHSA 3ESBA 4NJEA 5HFAA 5IAAA 2DWPA 1K0UA 4NJOA 4Q4HA 4V0OA 1J97A 1E92A 4A6PA 2GVNA 4TTAA 4XA8A 3ICQB 1OBFO 2EKDA 5DHAA 3S7ZA 4O29A 1KTVA 1E9VA 4AECA 3WV4A 2RGWA 3FZYA 2C97A 3U44A 2R84A 1RU3A 3QUTA 4NPHA 4DNXA 2UUBB 1RPZA 3WLQA 3CCCA 2JATA 4DPMA 3C5EA 2ZQYA 5C3UA 1JIVA 2B25A 3PQ8A 3BJMA 2X1LA 4I4TB 4WLUA 4E7OA 4ZOBA 1THZA 5KTYA 4UAJA 4B7CA 1QSGA 3K9WA 1GNPA 4HS4A 4QDXA 4CKWB 4HDKA 2HQ1A 3IPRA 3V33A 1ORTA 4X8LA 3ZHZA 4DDMA 1RSZA 4Y1GA 5JBNA 2OENG 2EDCA 4OX9Y 4M87A 3WKCA 2OV8A 1XTPA 4KWHA 1AXEA 1P1BA 4WZAE 5BVGB 1RM3A 4BLWA 4QUKA 4J9UE 4Y30A 4Y2PA 1MAUA 2JASA 3LPMA 3ORFA 3OOSA 4U6SA 4UBIA 2CBXA 3O73A 3SK0A 3FDZA 3DLPX 4D5GA 5ICCA 1KEKA 1UPXA 2C4VA 2Q3HA 4MI6A 4DLWA 5JEEA 4YAUA 4B3FX 1FUEA 3MLEA 2VKTA 3TG2A 5C1DA 2V5VA 3KCQA 3NKFA 2YNMA 3DWIA 4AWBA 2EFEB 5DULA 5IZCA 2XXJA 1R0WA 2HJGA 3PF9A 4OHOA 1A4XA 5HKBA 1YMQA 2B8EA 4CQLB 1F8XA 3AL2A 1COWD 3UCFA 2X6TA 1ZNZA 4UULA 3PUZA 3TR0A 3MCAA 1YJQA 4ND1A 2QVLA 4REOA 2C5LA 2GKGA 2G67A 4YQZA 3A6FA 4ZVQA 3ROMA 1CQXA 1DLIA 5ABPA 4L5BA 1NMZA 1LF5A 4FDLA 4FSHA 5LZ4A 1GG2A 4XIFA 4TKUA 3D6VA 4UMVA 2ATEA 1E3MA 2B7LA 1ESNA 3GYGA 1OB5A 1RWWA 4G09A 4L57A 4ENUA 5JS6A 4XRRA 5EFOA 2QAJA 1ZUHA 1OVGA 1POXA 2WYWA 1LS1A 3X1DA 4EQZA 3W2IA 3GLGA 3EWSA 3UJ6A 2AC4A 2YY7A 7MHTA 2BEJA 3RT9A 1YUBA 2ZKIA 1YQXA 1MH1A 3QHAA 2D74A 4FX5A 1RZ3A 2OV6A 1I3NA 1AZSC 4AWXA 4BMXA 5BNIA 1JMYA 1CUCA 1VFNA 4BMOB 3W1WA 3OVMA 2A4MA 2DR0A 1Q7RA 2BM8A 1L7RA 2P69A 3F6YA 4WY2A 3UWDA 1XTKA 5I4BA 1U5BA 3O4JA 4KXQA 2F3SA 1ENOA 1K68A 1NI4A 3BHJA 4FYKA 6GPBA 5AVQA 1Z0SA 2PXCA 1H8ED 1RRGA 1VHQA 2GPJA 4TTJA 3NHZA 4GPBA 4KWEA 4E2ZA 4M49A 4TN5A 1G20A 1YZHA 2YXPX 4P4NA 4P7FA 4M0DA 5IAOA 3GHYA 3GGPA 4Q9AA 3F9CA 3WB0A 4AY4A 3IQHX 2X42A 1U04A 1GUZA 3PHIA 1YZNA 3QF4A 5C81A 3BFXA 3EXHB 2P4SA 1ODKA 2QQGA 2IF0A 1KPIA 2WT9A 2F62A 2BHLA 2XB4A 3A14A 3MPOA 3OJFA 1SK8A 3W34A 4B9AA 1JHDA 1OZAA 4BPRA 4EG6A 5FWNA 4GOXA 1SHZA 2Y1XA 3TLBA 4WHMA 3JRXA 5IX8A 2PS1A 1N5OX 2H1LA 1I7NA 1Q5PA 5D5HA 1O5TA 4A5SA 3O9VA 4XTRA 3KTFA 5BQ5A 2C1XA 4ND2A 5JSHA 2H4JA 4HQ6A 4IDGA 3HKBB 1CDZA 4DDHA 5A1TA 5A9SB 2VDWA 1QDUA 4IXWA 4ZQBA 4PU0A 3KQUA 2G5GX 1XAJA 1CERA 4N5HX 1B0AA 1KSFX 5EE3A 1J33A 1BXKA 2CJPA 3HRHA 1UJ4A 2QV7A 4A92A 3STVA 1P1KA 4AMBA 5DN6D 2YWCA 3FR8A 4WH0A 2R1TB 3JAKB 3EYWA 3N3AC 1TK3A 4J16A 4RD1A 3ZXXA 4Q21A 4PQYA 4Q00A 2XOEA 5BRNA 4YAIA 3L7DA 2YW9A 3K7EA 3FF4A 4HNSA 4QTZA 3W4JA 4LZAA 2Q4BA 4RIEA 1C7EA 4Y9RA 2PH7A 2CV1A 3QYJA 2O8DB 1A9OA 2IYWA 2FH5B 4KDEA 4TZTA 5A62A 3GLFA 3H84A 4QU9A 3DLBA 3AR4A 3KC2A 5FFFA 4G8BA 2CWDA 2DH6A 1NVTA 2VO1A 3AERA 1GPUA 3EDOA 4YQYA 3OE5A 4E12A 4ZZ0A 3QEBZ 4X1IB 1SG0A 2NO5A 2ANCA 2XODA 1I2DA 3ZGNA 2AZDA 3SP1A 1NW6A 2LBPA 2GO1A 1T35A 1TVKB 1X8LA 3HYLA 3L79A 4C0AC 3ZY6A 2RHRA 5DLDA 3PD7A 2AZXA 2FG7C 3ZWOA 1II8B 3T5BA 5U1PA 2WSSD 4Z2AA 3ZCPA 3DB2A 1MC5A 1VKJA 4ARIA 1M75A 2A9FA 5LA6F 3VU0A 3MYYA 3IV9A 2BFOA 4LE2A 1OXVA 1LXCA 2O20A 1ZFNA 1IIRA 2Z5FA 2IYNA 2JH3A 4NYMQ 4AMUA 5I47A 2M6KA 2W48A 3DG9A 1UH5A 3JQ6A 1DUSA 1K9SA 2C4UA 2A92A 2XMRA 2DULA 4LWQA 5KREA 1YHNA 2VG8A 2ZR8A 2E0IA 3LG2A 3X1XA 1N25A 3RROA 1P17A 1F4PA 4OVKA 4YGXB 4XE5A 3WV5A 1V11A 1T8SA 2JEZA 5FR1A 2J5QA 3JQGA 1FXSA 4OXYA 4MP3A 4NXNB 1PG2A 2RC6A 3ZOZA 4DSNA 1J22A 1UPAA 4FZJA 2H4HA 1F3LA 3D6NB 3UAGA 5JI3E 4F6CA 3U6KA 4WX2B 5DTQA 1JPNA 2WT8A 3K5IA 1GUBA 5E7IA 5B3JC 2FPWA 4MHOA 3M9XA 2HW8A 2YFKA 2ZZMA 1U65A 3DV2A 1YB4A 5JD3A 4A8JA 3SQMA 3TJZA 1GSAA 3B20A 5J1TB 4IV5A 3INYA 1CEQA 4J91A 3NFYA 1AV6A 3SQWA 3IHLA 3W5SA 5EKUA 2WHXA 5TS3A 3HEMA 3ME5A 1M2VB 2XTZA 5GV8A 2AOTA 2YBDA 3PCXA 5LR6A 3AEUA 1L7XA 2FF7A 1AGNA 1SD5A 4YLEA 4Q9JA 4Z99A 2ICAA 4DCMA 4GKVA 4CM4B 3PNLA 2G8LA 1UK9A 4CF7A 1L5ZA 1DO0A 4RF3A 3W7BA 1JDSA 5JC1A 4L74A 2D1SA 2QWXA 2OBYA 5G2OA 1SZJG 2IY9A 4TTTS 5LDDC 1PKEA 1G18A 1XSEA 4XD7D 4D0LB 4P3NA 3VHXA 4HRYA 3AHCA 2AVNA 3TUJC 1V4NA 2VP0A 3FAZA 3HMKA 4X1YA 3EHEA 2OYCA 2Z08A 3QF4B 1A2OA 3A4IA 4AC9A 1HEIA 2ZYGA 3WGTA 4GMXA 1TUGA 3D4NA 1FOEB 2VUIB 2Y8EA 3NHAA 5HM6A 5FTNA 5D8DA 1RR6A 3I42A 3NORA 3FTFA 1E94E 2V4MA 4AI6A 1K6EA 2J5XA 2GBLA 2C4HA 2Q07A 2JGNA 4X7MA 3JWJA 1ZJYA 1KE2A 4Z3OA 4HEA1 2OZVA 2Y1LA 5E9AA 3E7DA 3FKSD 2ZWOA 3D7LA 3IVRA