4M1YA

Crystal structure of small molecule vinylsulfonamide 15 covalently bound to k-ras g12c
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
168
structure length
162
Chain Sequence
MTEYKLVVVGACGVGKSALTIQLIQNHFVDEEDSYRKQVVIDGETSLLDILDTAGEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords K-Ras GTPase
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 59
structure length 162
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m1yA00
4URUR 3EX7C 3CKLA 1SXJE 5KNCA 1QHHB 2WJJA 3IIKA 1JNYA 4JLDA 1YR8A 1U8AA 3C8UA 3D7MA 2ZRIA 5FH9A 5KO2A 5G41A 1HURA 4KBGA 1CU1A 3K0SA 4BEBA 2CE7A 1A82A 4QC2A 1GWNA 3S1AB 2VL7A 4C2UA 2C5LA 3ICEA 1FX0B 5J40A 1PLKA 1CR1A 4OL0A 1OW3B 1W5SA 5J4VA 1S9DA 4UJ3A 3B6EA 4MGIR 2C98A 1VCIA 5ELXA 1TEXA 2WWXA 2JDIA 3QG1A 4AURA 1VCMA 4AKGA 3TIFA 1BKDR 1IY2A 2JJ1D 2NMVA 2O8FB 2JJ8A 3I8XA 2IC5A 3LBHA 4MKFA 2X8AA 1GL7A 2HEIA 1UKYA 4Q66C 2OESA 5SZJA 3VR4A 1Z6GA 3CRRA 2IUSA 5CIWA 1NVXQ 3EWAA 2ZJBA 2ZS7A 5SZHB 2GXQA 3UWKA 3GEIA 1FW6A 4HB4A 3AF3A 1AQYA 4N3NA 3A1SA 2NZJA 5EQTA 1FX0A 1RKBA 1E0AA 4TLAA 5EUMA 3DMNA 1E9FA 2JJ1A 3K09C 2RHDA 5DE3A 2GXUA 1AQUA 1IQPA 3NC1C 5E7MA 5KPDA 2ZITA 1J8YF 3I5YA 2WJYA 2I1VB 2MSEB 4URZR 2AX4A 3BH6A 1E96A 4A4DA 5JSZB 3BD9A 3GLGA 1OYWA 2QTVB 1Q21A 1DAIA 4MRPA 3AVUA 4RKEA 1G21E 3QUSA 1QRAA 2V6JA 2VP0A 2QTHA 4NHOA 3N2EA 2D7DA 2CK3D 1JQJC 3AP2A 1G18A 4E07A 1Z6YA 2A2ZA 3FE2A 4FMBB 3TQCA 1EK0A 4F4IA 4TL7A 3MWKA 4GMDA 1SZPA 4D0LB 4LV8B 3WBKA 4C0QC 5IRCD 3PXGA 1SHKA 2QM8A 5KDLA 1MH1A 4DXAA 2IWRA 4D82A 1W36B 3WY9A 3OIUA 2GZAA 3AVWA 2HT1A 1IN7A 2PT5A 4F38A 4QBHA 5JSZA 2EYUA 2OILA 1DAHA 1E9DA 3EG5A 3KDSE 3GLIB 3TR0A 1W36D 2AK3A 3CX6A 4NP6A 1RYHA 4KLZA 5EE3A 5CM9C 3BJIC 1MO4A 1W0JA 2G1JA 1VG9B 4YMVA 1G3MA 4OJQA 4D0NA 4A9AA 4QBIA 1VYTA 4UKDA 4Z54A 2XJ4A 3OEHA 3WRXC 3KXIA 3A6PC 4XVQA 4UJ5A 2WAXA 1L2TA 3X1DA 1E2KA 5FTMA 3FOZA 1GRQA 2BV3A 4LBYA 5FBVB 4PC7A 2V1XA 4JLNA 1G4AE 1E1QD 1N2CE 2WKPA 3GLIA 4TMTA 4A82A 2IXFA 1Q3HA 3REFA 5IHPA 1DBSA 4US1R 3KKQA 3T12A 4LK2A 1UEJA 4FXPA 4XD7A 4DIDA 2BWJA 2OFXA 3VFDA 5KNBA 3LVRE 3TW4A 3RSOA 3B85A 2C8VA 3A4LA 5HKKA 2WKQA 4J0QA 3EW9A 3KQHA 3I8SA 4K46A 4JKIA 1QZXA 1E2NA 2GK7A 1DARA 5FL7D 1MRSA 1KO7A 2BM1A 4RD1A 5FTJA 1XX6A 1V43A 2CVFA 1OT3A 1P6XA 1HQYE 3N70A 4RFVA 3SOPA 1KO5A 2IW3A 1R0ZA 1XWIA 2WHXA 3QXHA 1XMIA 4AY2A 1EG7A 2G1KA 2NTYC 2J3EA 2QUZA 5AJWA 4A2PA 2ATVA 1YQTA 3QSYA 4POAA 1N6IA 1HUQA 2GRJA 1G19A 3TUJC 4IDOA 2GCNA 4B47A 4A0GA 1VCNA 2GILA 2OV2A 4RD3A 1RVDA 1RJ9B 2D74A 4P4SB 5JMTA 5KTYA 2AL7A 4Q1DA 3FB4A 4L8GA 4PQRA 5JRZA 5G3YA 2GTPA 2IXEA 4YC7A 4BWYA 4MDEA 3EC1A 5HR5A 1FP6A 1YJ5A 5KNDA 4CEHA 4ACAA 3K53A 4JVSB 3VTKA 1US8B 2XSZA 1EESA 3MWYW 4OK3A 1P2TA 4JS0A 2BBOA 5FFMA 4PC6A 3ZVLA 5KU1A 4JYBA 3DOEA 3E70C 3CNNA 2O0JA 1VPLA 4KI0A 3FKSD 3VR6A 1WBBA 4WA7A 4BLPA 8OHMA 5CK4A 1P2UA 3FVQA 4P4SA 1ZIOA 5CLLA 5LDDC 3ONWA 3SQWA 3KB2A 1P3JA 2VP4A 3LRPA 1XEXA 2R8RA 1GVNB 4ILEA 2RCNA 3TSZA 2C77A 4LI0A 2GJ9A 4Q1EA 4E22A 3TK1A 4ITRC 3GLGE 1R4AA 4FN5A 2VA8A 4Q5IA 3DKVA 1JQLB 4B43A 3HJNA 3M6AA 5KSZA 3LW8A 1GUAA 2VHQA 3OE7A 2ZSBA 3M1IA 2ZE6A 2R62A 5KPJA 2ZRFA 1KNQA 1XD9A 1TL7C 3RNLA 3UMSA 2GBLC 3LLUA 2IF2A 4JZKA 3UMFA 4X8MA 1KJWA 2IYRA 2VP5A 1XP8A 1DAGA 2QAGB 2DPXA 2W6JD 4KV9A 2IS2A 1SVSA 4IDPA 1AA9A 1E0SA 4KO8A 3IILA 2H92A 3CH4B 4JSYA 4QGHA 3KQKA 4C0HA 3U7HB 4RVCA 4CGZA 1XTKA 4GRAA 4H9GA 1PV4A 1QHIA 3BS4A 1S0UA 4YONB 3TVTA 1SVOA 1J70A 1G7SA 2GAOA 2Z0MA 3UATA 3N5CA 2FSIA 2QRZA 4PO8A 5DGXA 5KDOA 2FPLA 1KZ7B 2QP9X 3QF4A 1M7BA 4DDTA 5JWHA 2ZUBA 3ZVMA 4ZI3A 1WE2A 1FTNA 5JRJA 4XWOA 4EQ6A 4D25A 1NN0A 3LQQA 2CJWA 4AC9A 1CJVC 3UG7A 2CE2X 3AP1A 3GLIE 1EFHA 1HY3A 2VHJA 2O8EB 3EZ2A 2QMEA 4GL2A 1Y3AA 2WJGA 1X3SA 2LWIA 2RKOA 5E95A 4FMDB 3DDCA 5AUOB 4PO1A 5KUTA 3A58B 2W58A 5BN3A 3GLFA 2IS6A 2VBCA 3NBYC 5J47A 1RPZA 3K0FB 4KVAA 5K8LA 2HJGA 1OJLA 4ZCIA 3U2QA 4HZIA 1XPRA 1KI7A 1J7KA 3U6KA 2IBMA 2Q0HA 5DH9A 721PA 3QI2A 1I4TD 5BYJA 1KGDA 4FCWA 3THXB 3UMRA 2C9YA 2W0MA 3P26A 2CL7X 3RAPR 4OJKA 1IN6A 3VR1A 2A5JA 2XX3A 3OAAD 4ZDJA 1ZCAA 4ZV4A 3L0PA 2O0HA 5AUQA 2IS4A 1OXVA 3SE0A 1E4YA 3B13B 3KTAB 3A8TA 3GJ7A 2C9OA 5E7IA 2QBYB 3THYB 2ZETA 3KKPA 2J41A 3I3SR 5DNYB 3K0FA 1LY1A 1FUKA 3MRSA 1G16A 1ZBDA 2O0KA 1HT1E 1G64A 1C1YA 2BJVA 2G77B 2IYQA 3WNDA 4B33A 2GXAA 4B3GA 1E9EA 4GP7A 4TSFD 3THXA 2VYFA 3PUWA 2B7CA 4Q7KA 4WZAE 4D2IA 3A4NA 3GLHB 1YZKA 4ZCMA 2IEYA 1PLLA 1Z6TA 1UJ2A 1GM5A 2IS1A 1DO2A 5JEEA 2NG1A 3KTAA 3M4YA 2Z5FA 2OEPA 2QBYA 1G8HA 4BASA 3RRNA 2QM7A 4LRWA 3AKYA 1IN8A 3O47A 4RKFA 4B35A 1CXZA 1WF3A 3LFUA 2A7QA 1II9A 4BLSA 5J4HA 3CNOA 3TE6A 2XTZA 3H86A 3GP8A 1XNJA 3ZQJA 2ONJA 4MDFA 1NG1A 3EZFA 1TU3A 4TMWA 1C9KA 1Z2AA 1YU9A 1YZUA 2C99A 2O52A 2A5DA 3HPQA 3AF1A 3W5IA 4C3ZA 4IVRA 2BKUA 4Q02A 4KYIB 2ZU0C 4NONA 3MAAC 4HI0E 3DM5A 4V0LA 1OXXK 3R9IA 2IXGA 3OZXA 4ARZB 4DC9A 1WB9A 1TF5A 4GFDA 3WMEA 2P65A 4Z1MA 4BE7B 4LHYA 2AXPA 2XB4A 3NC0C 1F60A 5DLQC 5EXTA 5A4JA 1E9AA 3O8CA 3C14C 1KI4A 2ZSEA 4MGZR 1WCV1 2QMUA 3NVAA 1Z0AA 5FTNA 3TUIC 1J8MF 3KX2A 2X19A 3ZH9B 2BOVA 4KITB 1KO8A 1RYFA 1VIYA 3IGFA 5FI1B 2XGJA 3K0AB 2O5VA 3CF6R 4B3FX 2L0XA 2NO1A 2YWGA 2GJSA 3AV0B 3G82C 3EA5A 1XDBA 2BM0A 5BQ5A 2IT1A 3GQBA 1CJTC 1P9RA 2R6CA 4DRZA 4ARZA 2KJQA 3QENA 1QDEA 1VG0B 4E5UA 4DIEA 2F9MA 4NH0A 3FGNA 2HYDA 4LJ9A 4D0GA 3PV0A 2EU8A 4BRUA 3NG1A 4IEEA 2CL6X 4LYAA 4HZUB 1KK1A 4IXMA 4TMKA 5KSOA 1TNDA 4QOSA 4LYHA 5BW8A 2WWYA 1E2QA 4CF7A 1NVUQ 3F0TA 2PJZA 3CO5A 3PENA 4US0R 2VQSA 3K0AA 3X1YA 1SXJC 2FV8A 1XEFA 2JIZA 5JI2E 2QTFA 2GJKA 3OEEA 2RGAA 4C0SA 3U44A 1CEEA 3NEJA 4KVGA 4XSGA 1FL9A 1FPMA 2Y8EA 2PT7A 1CJUC 3BFKA 1N5LA 4WZ6A 4KFTA 2KE5A 1DS6A 1NIJA 2QNRA 4NBSA 3AF0A 3ZDQA 1YR9A 1WRBA 4LHWA 3KKMA 1ZCBA 4DZZA 2FSGA 4MRSA 3ND9A 3U3RA 1KI2A 5ANRB 2QL6A 3GLFE 3PG5A 2HDNB 4EKDA 3PUXA 2OAP1 4DSOA 2CCKA 4MRRA 4OKSA 1F6BA 4TQUS 1FP7A 3U3JA 4I1SA 2F43B 3CZQA 1XCGB 2VP6A 3TRFA 4MA4A 4A6XA 4OBEA 4EPWA 4Q9JA 5BN4A 4URYR 5KYKA 1DOAA 1LS6A 1XJCA 2ZRLA 2P5TB 3C16C 1AIPA 2YINC 1GIAA 1Z3IX 5B30A 2VEDA 4EPRA 1KK2A 2QROA 1T91A 1HYQA 1ZU4A 2PLFA 4I99A 2DR3A 2QGZA 3ZGXA 1WA5A 4QNMA 4YXWD 4C0KA 1ODFA 1GOTA 4PX9A 4C0AC 3U60B 4ZPXA 5CYPA 1U0LA 4HDOB 3VKHA 1ZC4A 3AUXA 4PZYA 2VP2A 5DIFA 4X8LA 3SFZA 4PPQA 3WMFA 1Q20A 3PCRB 4HATA 1W4AA 4NYIQ 2A3RA 2HLDD 3JZAA 3T61A 3C4JA 3NTUA 5FTLA 1G1MA 1ZD9A 1N6LA 2FG5A 2WWFA 5TVKA 4DCTA 1NNEA 3Q7PA 4HB2A 2FMXA 4ACBA 4WIAA 1LV7A 3FYHA 4DLWA 3IDQA 4TYQA 4QM7A 4Q00A 1GTVA 3K9GA 2HLDA 4DWJA 4JLBA 3FHTA 2O8CB 2WPDD 3RRMA 1HV8A 1WDTA 4OQXA 2YC4C 4BGDA 2IX3A 1KY3A 5P21A 2O8BB 1HE1C 4NYIR 4Q47A 5L3VA 4QHYA 1Z0DA 2W6IA 3AUYA 3MGCA 4LHZA 3THWA 2FEMA 3PJRA 1KHTA 3PR1A 3U4QA 4QJ3A 2WPDA 2QAJA 2AWNA 3ADKA 1AZSC 1JECA 4TLBA 3SNHA 1W4BA 1M7HA 4UNQA 3LDAA 4A0RA 1WMSA 1KI6A 3CH5A 3G0HA 2IL1A 2GZHA 1KDTA 3TBKA 4Q9KA 1G3UA 2VIIA 5JHHB 2OFOA 1KKLA 1A1VA 1CKEA 4IDQA 1EX7A 3I72A 1JAIA 1E32A 4DDUA 3KQNA 2CHQA 4O2RA 1H8ED 3C5CA 3P1JA 4DVGA 1KTVA 1A4RA 3ASYA 4KYUA 4TTPA 2WICA 3K70C 2VSFA 2YWFA 1COWD 3GD7A 4HUQB 4NCKA 4UNPA 3WP1B 1ZP6A 1G7CA 1UAAA 5AJVB 4HDQB 4DJTA 3IEVA 2J0SA 1AM4D 4NYJQ 1FMLA 5DI3B 5FPSA 4KU4A 4HYYA 2YC2C 3QY0A 2J5XA 3A37A 1KKMA 4O0MA 1XMSA 3SEAA 2A9KA 2PZEA 1YRBA 3SN6A 2GNOA 4FMCB 3PEYA 2FPMA 5JWRA 3Q5DA 4A92A 4B75A 2OBMA 4EJSA 4Q4AA 4PQFA 2CEAA 3IKJA 4URVR 2J7PA 1OH8A 2GETA 4PSVA 4DB2A 1E79A 4LDJA 1FFHA 2AKAB 2B92A 3UPUA 4A15A 2YNMA 4HUQA 3T1TA 3V4RA 2P67A 1E0KA 2PZGA 2WJIA 4MKHA 5HPYB 2OM2A 3K0EA 3QBTA 2SHKA 2WSSD 5FL3A 1HE8B 4DBLC 3AVXA 2PX3A 4TT3D 3K70D 1JXOA 5BYKA 1Z28A 4OK5A 2QSZA 4EPXA 2B7BA 1YVDA 1X8KA 5DI3A 1N5IA 4G5RA 3W90A 3ZIAD 2WWWA 5GJVC 3VKGA 4NYJR 2BBTA 3Q3JB 4QGGA 1DEKA 1TQ6A 3P20A 4YDSA 3AKEA 4B6EA 3BIFA 4B2LA 1R0XA 4NU0A 2MSDB 3LY5A 1ZNWA 4JYCA 2JEOA 2QZ4A 5FPHA 4M0LA 4TL6A 1HQCA 3I73A 3ZLJA 5HE8A 5EJEA 2LKDA 4RFSB 1EFTA 2FFQA 2ZS8A 1KO1A 2OBNA 3K0CA 3QF7A 2IHBA 1S3SA 2OCBA 3CWZA 1UKVY 3ZVNA 2J7KA 4PAMA 5GJCA 2GXSA 2ODNA 2ZAOA 3P4YA 5AR1A 5AUPB 1MT0A 2G0TA 1N0VC 3V9PA 3A1WA 2GVZC 2TMKA 6Q21A 4P31A 1S4QA 1IXSB 2P6NA 4JLKA 4UXJA 2ZJOA 3BH0A 5G40A 3FMFA 3RS0A 5D3QA 2JDID 1KI3A 5CDFA 5FOWA 2N46A 3SYLA 4ZKDA 2V55B 4PXAA 2NO7A 2YOGA 4K81B 2ZJZA 4A6PA 1CLUA 3PEUA 1KDRA 4RFSA 3REGA 2F1HA 3U3MA 3PFIA 1Z47A 2CHGA 2ZSAA 1T0JB 1N6HA 1G3RA 2AFIE 1NN3A 3TAHA 4B73A 2PJRA 2ANBA 4Q19A 3PUZA 2AWOA 2YWHA 4OI2A 2ZAMA 121PA 5TY0A 3IBYA 4C4PA 4TLDA 3SBEA 2GEVA 1ZIPA 2W0SA 5DYIA 3QJYA 2DFTA 4G01B 4DDVA 3RC8A 1S9HA 1GNPA 4M9ZA 5HCNA 4US2R 2ZE8A 3GLGB 3CM0A 1T3HA 4HEJA 4U7DA 3EPLA 1VHTA 3CX7A 5AJYA 2Z4SA 4Q4LA 4AYWA 1ZVQA 4TMXA 4WOPA 1NBMA 1PVOA 3K9HA 3Q72A 4DLSA 2DHRA 2DFNA 3QNUA 4U02A 4M2LA 521PA 2VP9A 2EW1A 1IBRA 1E0JA 4F92B 3P27A 3H1TA 1XCPA 2ORVA 3GFOA 4BFZA 1W36C 1OHHA 4B34A 5HTKA 4QBFA 1AK2A 4FCVA 4UNNA 1G6OA 1MO6A 5C2JB 5KHOC 1AJEA 1N5KA 2UVQA 1FZQA 2B8TA 1T3SA 4LC0A 3L0IB 1E9CA 1QF9A 2H7VA 4FWTA 2F1RA 4OHVA 1R6BX 1W1WA 2QE7D 2FH5B 1W5TA 4GOJA 1NMXA 4B3DA 3LQRA 3KJIA 1R7RA 2C2HA 3A4MA 4KFSA 4IHQA 4JL8A 4DSTA 2NQ2C 4GOXA 4TYPA 3PQCA 4HLDA 1NMYA 1DPFA 1AZTA 1ZJ6A 1W0JD 2D7CA 5FOVA 2Z6VA 4NCHA 621PA 2H17A 4G5SA 3JZMA 5D3MA 3CRVA 2XTNA 2ZRGA 1D8TA 3EZ7A 1ZM7A 4IRUB 4KLNA 5JCPA 3OEHD 4PSAA 2QE7A 3X1XA 1R0YA 2BCJQ 3DKPA 1MR3F 3DZDA 1GL9B 1IONA 2QP4A 2C9CA 3KFVA 4MUBA 3VX3A 2JLWA 1KY2A 4C0LA 5TDHA 2BMEA 1Q22A 5C1BA 821PA 4XD7D 3W9YA 2R9VA 3KJGA 4NPHA 3RSLA 1D9XA 4NTZA 3ICQB 1E2JA 1XZQA 2HCBA 3ZD7A 5HKKD 4B32A 1Z5ZA 1A5TA 1M74A 1NL3A 4TLCA 3BRWD 2OXRA 4DEXA 2JLYA 4IEIA 3LBNA 1E1RA 4M1OA 4NKRA 3L8ZA 4CEJB 2XITA 2ZYWX 3SJCA 1R5BA 1EWQA 2F6RA 4TQAA 1YZTA 2H5EA 1U9IC 4UNRA 2GAAA 2CL0X 5FTKA 3K09A 3K9LA 3CW2A 4BFWA 1TUIA 3R8FA 4I4LA 2ZIAA 1KI8A 3FFAA 4JLPA 1H65A 1P9NA 2V6IA 4ZDWA 5HCIA 4MUAA 1G3QA 5JJKA 4UQOA 1N6PA 4TZ0A 3FHCB 2R6AA 4NCJA 3KL4A 2HUPA 3ADCA 4F91B 1OFUX 1IJFA 3OESA 1U0HC 1RRFA 4E09A 4JT2A 5JCZA 1VHLA 5FUYA 3CIOA 4IFEA 1F48A 4XWAA 4CEJA 3QPVA 3CPEA 5B2ZA 4C7OB 2WBLC 5CK5A 1T3LA 4CEHB 4LWZA 4NZYA 3T15A 2EWWA 5CDFE 2FSFA 3I1FA 3QEJA 4FD2A 5IT5A 4ZDIA 2BIFA 2HXSA 2JAQA 3KZ1E 1IY1A 4W5WA 2E9SA 4P33A 4BZPA 2JATA 3QKSA 3AH8A 3EWSA 2XSZD 4JJKA 3VR2A 3WHLA 1NJGA 1OIWA 1Q44A 2ZYVX 4M9QA 4JVNA 3WYGA 2GVDC 3R8CA 2V54A 3NWJA 3I32A 5HE9A 4B74A 4HLQB 1X86B 3SHFA 3TMKA 5JS8A 1UEIA 3VQTA 1ZAKA 2CLSA 1XEXB 2WMOB 2ZR7A 2X77A 1T9HA 4C7OA 1E99A 2XOKA 3SYNA 2XZPA 3GEEA 5JEDA 1KDPA 3QKRB 2A78A 2ERXA 3AVOA 2V4ZA 4JBXA 4LHVA 1R0WA 4PC1A 5LD2C 2ZYUX 2B6HA 2PLRA 4DCSA 5JJIA 2QG6A 1ZW6A 3T1VA 5DSZA 4YMUA 1IY0A 2R65A 4D81A 4OI4A 2YOFA 1LTQA 4RD0A 1N25A 5FR1A 1NBME 1ETUA 1U0JA 5B57C 3MD0A 4G5GA 1IN5A 1UBFA 5F9HA 1SHZA 3F3YA 3Q7QA 2RHMA 3OE7D 2QAGC 5DO9A 3EIHA 1CBUA 1TQDA 2ODWA 4KFUA 1GITA 3CWQA 3QXSA 3A1UA 3QKRA 5FR2A 5LD2B 1W2GA 3H0KA 4QRHA 1D5CA 1K6MA 5BWMA 2WSMA 1OFTA 3VX4A 3AVQA 4Z51A 1FQJA 1GILA 1R5OA 4FWIB 1T5IA 4QGFA 1NN5A 2GJAA 2HF9A 4XJXA 2QY9A 4AK9A 2ZTSA 1G20E 3WNBA 4DLZA 1JAHA 3QF4B 1M6NA 1SVKA 2C95A 3W6PA 4L16A 1HA3A 2A30A 2GCOA 5DN6A 4EIWA 1UBEA 3ZS9A 1NJFA 4EQ6B 1C4OA 5FBLB 3AVPA 2J45A 2JA1A 1OH7A 3MCAA 2CJWB 4Q4HB 4DUGA 2BMFA 1OB5A 1P62B 1QHXA 1F5NA 3BXZA 1ZM2A 1G7RA 4I81A 4BECA 4V0OA 4Q03A 5JBQA 3FMOB 3U7FB 3DL0A 3I92A 3W6NA 3R20A 2ZR9A 3GLFB 3KXLA 421PA 1LNZA 2IYWA 4PAOA 4DLRA 3QKUA 3RLFA 4HAYA 3BH7A 1DAFA 4Q9LA 2IF0A 4W9MC 3GFPA 3QBVA 3GJ6A 3TGPA 4TYYA 4Q4HA 4I1VA 3RHFA 3EIQA 2PCLA 4RZUA 2QU8A 2NO0A 2V9PA 1SKYB 4BFVA 5CJ2A 1PLJA 4NYMQ 2J0VA 2B8WA 4H1VA 2V8OA 2ZROA 3FMIA 2RGCA 2PZFA 3SU8A 1XMJA 2XEXA 3SR0A 2ZEJA 1MRNA 4NDZA 1JBKA 2IUTA 4QBGB 4MYTA 4B71A 2DYKA 4G5QA 1Z22A 2AKYA 4MRVA 3DZ8A 1Z2CA 1W0KA 3SJAA 5DHAA 2QN6A 4DSNA 3HU3A 5C4GB 2GESA 1LW7A 3BOSA 4Q1FA 5IF9A 3GFTA 1N6KA 5EXPA 5FPTA 4HB3A 4M1YA 2ZE5A 4V0NA 2H18A 3WXMA 4M9XA 3IIJA 2CLCX 4LBZA 4NYMR 4ZIRB 1OXTA 1S8FA 2OXCA 3QVVA 1BMFA 4GT1A 1II0A 1VIAA 3IBGA 1UBCA 5JS7A 4HDCA 1G4UR 2R44A 5FBRB 1AN0A 3WYFA 2BHRA 1G5PA 2ASEA 4YQFA 4BLOA 2EVWX 1BOFA 1XZPA 2J46A 3WNCA 2ZI9A 5CB6A 2QGNA 1QG2A 3NH6A 2I1QA 1F2TB 1NY6A 4YMSA 1ZUHA 2CHVA 5GVRA 1Z6AA 1TADA 4ZIRA 5L3QA 2GA8A 3LH5A 3LO5A 4GI7A 2V7QD 3A1VA 2EFHB 4JL6A 1E6CA 1UFQA 3OF5A 3FMPB 1LF0A 4UXIA 5EZ5A 4Z1MD 4RZXA 1P2SA 2N1BA 1QG4A 2ZI4A 3LVQE 1G3IA 2RGDA 4EPVA 2PX0A 1H8HA 1E2DA 2ZRBA 5JLJA 4DSUA 2YYZA 1XF9A 2ODEA 2EQBA 2REOA 4Q48A 3VHLB 1BS1A 1S96A 1OPXA 3B1YA 1U98A 2QRNA 4M1SA 2ZYTX 5FUVA 2WOJA 1F2TA 2V7QA 4Z8XA 4DKXA 2W2VA 1ONBA 1KSFX 1XD2A 4KODA 2J59A 1P7CA 5DYGA 3JVUA 1E98A 3UWOA 3BB4A 4KCGA 2Q9AA 3OHMA 3X1ZA 3T34A 4PTLA 1D2EA 2X2FA 1EFCA 4OHWA 3GEHA 1QHNA 1UDWA 1NRJB 3Q9LA 1YKSA 2YVUA 4MITA 1E2PA 3IEUA 1Z07A 4Q9HA 1Z63A 3ZS8A 2XAUA 5B64A 5GVSA 3RS4A 3B78A 2JLVA 1G7TA 2FNAA 2LCFA 3BERA 1AKEA 2D62A 4OQLA 1W7AA 1KMQA 3EASA 3VHXA 1XFAA 3RANA 3U44B 1F2UB 4Y0AA 5AJXA 3ZZUA 3AVVA 4YMTA 4BFSA 2ERYA 2NGRA 2AXNA 2DBYA 2HYIC 3UXMA 4PHFA 2JIZD 1RIFA 3MUFA 3OEED 4L9SA 3BFVA 2J87A 4WAUA 2ZJ5A 2IWHA 2DWQA 3B1ZA 3ADBA 4QGAA 1XBTA 3CLVA 3JVVA 5SZKB 1Z0JA 4AKIA 4L5BA 3C7KA 3ND8A 1LVGA 5FI0B 1AGPA 3TVDA 3RRZA 3RRYA 4AG5A 1EFUA 5HZKA 5DHFA 1S3GA 1WXQA 4M4SA 1ZRHA 4OQMA 4LBVA 1W47A 4BQSA 4I1UA 1F2UA 3QXXA 2HT6A 3SJBA 3HP1A 2GF9A 4DCNA 1VECA 4LJ5A 1DAEA 4IOJA 4QHSA 4LY6A 4BEJA 2REBA 4LX0A 3FKQA 4NCIA 1YZQA 2CCJA 1D2MA 2WWHA 3RC3A 1HH4A 2NO6A 5L8VA 3AQ4A 4NCNA 1O87A 4HB0A 2UKDA 5FPYA 2DWOA 3NHAA 2D3WA 1GG2A 5A5GA 5SZIA 1AS2A 3QKTA 1CJMA 3GMTA 1XCMA 3NHBA 2H1LA 4A8JB 4B3XA 4MYUA 3THOA 2IYTA 2ZREA 3MJHA 4PHHA 3QG5A 2FGJA 2KI5A 4ASUA 4OHZA 4GNKA 3AP3A 3WRYC 1SKYE 2VF8A 3UK6A 5JI3E 2C78A 3U7GA 5E7JA 1NLFA 4Q1BA 2Z4RA 2GF0A 1E2FA 1CRPA 4PFSA 4Q7JB 2WTUA 4C0BA 3BORA 3W6OA 2ZRKA 2RGNC 4NE2A 4XTRA 1II8B 4ZDKA 2B21A 1J90A 2EFGA 2XNDD 3CF2A 4RJLA 4U00A 1E94E 2HJVA 4LOAA 4KSCA 5DISB 4EFMA 4EDHA 1TF7A 4A8JA 2IK8A 4QL3A 2GZDA 2YOHA 1RW4A 3QE0A 5L3SA 1EFRA 1XXHA 1QVAA 2BBSA 1XU4A 3LXXA 4R9UC 4TMVA 1N3BA 3THWB 4DEYA 5EE5B 2ZANA 2XB2A 2XNDA 2BDTA 2ZSDA 3U4QB 1VG8A 2R6FA 3N2IA 2W6ID 5EE9A 3IO5A 4IDHA 4G3XA 2YHSA 3M0EA 3ASZA 1II8A 1KMHB 1SVMA 5AWFC 1KI6B 3ZJYA 4AIIA 1NMZA 1ESNA 1G6HA 5FUXA 3RABA 1SXJA 4TYWA 2VF7A 3BC1A 1M8PA 1SULA 2VO1A 4E03A 3RWMB 3UG6A 4LGMA 1QHYA 1R8SA 1XJ0A 3MJRA 2E87A 1KK3A 1OV4A 4RCYA 2WZQA 4R2IA 1X8JA 1UF9A 3HR7A 3GJ3A 1YZGA 4ABYA 3SC3A 4BRWA 3FFBA 4LJYA 3MWLA 1RRPA 2ZI6A 3GJ0A 3AVYA 2ZM5A 4JMPA 4RZ2A 5IK2A 1IN4A 1KMHA 4U5XA 2ZXUA 3CB4A 3SI7A 5C46F 3BE4A 2I3BA 3A1TA 1EXMA 3GJ4A 1MO5A 4TLEA 1G9XA 3RYTC 3K8YA 1QHSA 2H57A 1EWRA 4WW0A 1Z83A 3CR7A 3IO3A 1Z08A 5G53C 1T8UA 3QQ5A 4B6FA 2J1LA 1GRRA 4UNSA 4F7WA 4LV5B 4M21A 3EAQA 4EJSB 3LAWA 4Q4AB 1R10A 5M04A 4Q4JB 4IOKA 4LPSA 1D2NA 2LKCA 2A5FA 5GADl 2JLQA 3L82B 2J7PD 4HSEA 1E79D 2HF8A 4OQNA 2BCGY 4B48A 1FMJA 3TUZC 2FZLA 3V4FA 3IUYA 4PANA 4XSHA 1TF2A 3X2SA 2ZUDA 4M1KA 2GEUA 1M7GA 3IQWA 1CF4A 2C03A 3PUVA 3PVSA 2IYYA 4IOLA 3KQUA 5KDDA 4Z8YA 3BB1A 1HT2E 3B60A 4XWKA 2Z43A 1GKUB 3QIAA 1WP9A 2YWEA 4Q4JA 1ANKA 1NSFA 1JEEA 1I2DA 3BFXA 4DB4A 4DLUA 2CXXA 1QHGA 3BK7A 4G1UC 2RGGA 3HDTA 4PC2A 4QNRA 1T0HB 3R7WA 3TAUA 4FMDF 2IUUA 1MO3A 4C0JA 4D4KA 2FA9A 1IHUA 5EP4A 3V00A 1RC8A 5J4LA 1P4SA 1TTTA 1W46A 2OAQ1 1ZUIA 1OFIA 4YLGA 1UBGA 4DLTA 3VNVA 4AYTA 4PQYA 3CF0A 3AKDA 4AKEA 4PC3A 2X1VA 2G3YA 5A0FA 5LPNA 4KSBA 2XZLA 1TQ4A 4HLUA 1W4RA 2FSHA 2IYXA 1N0WA 1UKZA 3AF4A 3B1XA 4LJAA 1M34E 5J4KA 1GRNA 1ZMXA 5KOYA 5FOSA 2VSOA 1W49A 4TMZA 4Q1CA 1P75A 1ZNYA 1HTWA 2GWHA 5F98A 1X1RA 4MRNA 4OQFA 2MSCB 2GJ8A 4LCBA 4RSGA 3SDZA 3DVLA 2OUKA 1U90A 1Z8FA 4OHYA 3NBFA 1MABA 1FNNA 2XTMA 2QQ0A 3AM1A 1RE0A 2DWPA 5BXQC 1VCOA 3FPAA 5CITA 3LV8A 1E2HA 2WJVA 2K5UA 3LLMA 4K8OA 2CCGA 3T35A 4TYNA 3IQXA 4DLVA 3G5UA 2AK2A 4L4UA 1G5RA 3ZZ0A 1P5ZB 4MQBA 1NBMD 4DLYA 1D6JA 2G83A 1Q3TA 2IYSA 5AUNB 1XTJA 2ZRNA 1T8TA 5EE0A 5UKDA 2KBEA 4R7ZA 2Q3MA 4PZZA 2WIAA 2OHFA 4IKEA 4KXFB 3U3KA 3ZZTA 4EAQA 3WMGA 2FOLA 5CIQA 1OHHD 2BC9A 2AFHE 2JLXA 5EP2A 2WAYA 5LB4A 2V1UA 3CRQA 3U6BA 1KDOA 3SHWA 1OE0A 2RB4A 2JGNA 2BEKA 4GPTA 4D4MA 2F9LA 2O8DA 2ZJ8A 1OYYA 1UM8A 2QEQA 1KJZA 1L7VC 1ZNZA 1JR6A 5B58C 5D3MB 1NI3A 3TH5A 1RRCA 1QHHA 1PUJA 2G0NA 2FFAA 5JWOA 2GKSA 2P0EA 1UADA 3B7GA 4OK6A 5H1YA 3HWSA 2PH1A 3VU9B 1G8GA 1DVRA 3S1AA 3VNUA 2BBWA 4G0NA 4PPNA 3UKDA 1NIPA 4CT5A 3VMFA 4EUNA 1NY5A 4Y0VA 2CDNA 1B0UA 3CBQA 1R2QA 1GKIA 1P2VA 2QP3A 1OXSC 3K9NA 3TJZA 4MKIA 3TKLA 1OIXA 1ZNXA 4R71A 2D2FA 2WWIA 5L3RA 3T5DA 3LX5A 2P3SA 4YDHB 3HPRA 2ANCA 2O8FA 1L4UA 3GJXC 1VDZA 4OI0A 2XJ9A 3IPYA 3QPUA 2Q3HA 2ZQ5A 3GCGA 2CNWD 3PUYA 2C04A 4Q01A 4FINA 3IHLA 1ELOA 2CVHA 5JZVA 4L15A 2P2LA 3VU9A 3CX8A 3QEOA 1B23P 2VRWA 3SBDA 5BN5A 1DG1G 2F1IA 3DEFA 3ZYCA 2ZRAA 1E1RD 1FOEB 2OLJA 4JIMA 1MKYA 2YZ2A 3TNFA 2PBRA 3D31A 3NDPA 1CR4A 3LX8A 4BLRA 2CNWA 2E1RA 2DB3A 4HUTA 5K8UA 2EFDB 4AWXA 1TEVA 2BMDA 2CK3A 3EPHA 1E2LA 3CUEF 1CP2A 4A0HA 1G291 1E69A 1ZD1A 3RS5A 1GZSA 4I1OA 3HR8A 4CIDA 2CBZA 4GSYA 2D06A 2JLUA 2NOAA 1I4DD 3MG9A 1Q0UA 4JVMA 2IA5A 4B44A 1AS3A 1G41A 1UDXA 1XTSA 4FW9A 3ECCA 1OIVA 3TSWA 2ZI3A 3H2YA 3NKVA 2IYVA 3T1OA 2FF7A 2KWIA 3QKSB 2JJ2D 2ZSFA 1NKSA 3AF2A 3HYTA 2Q6TA 4CEIB 2KSQA 3GJ5A 5FBQB 1IXRC 3Q85A 2DFKB 2WKRA 3AGPA 4BUJA 1J2JA 2FEOA 1KJYA 4IXNA 4RZ3A 5FUWA 2BMJA 4O25A 1Q1QA 1SKQA 4LJ6A 4GOKA 4HAXA 1QBKC 2BVNA 3K1JA 1E9SA 2JJ2A 1Q12A 2XNSA 1L8QA 4CW7A 3FTQA 2A5GA 2FPKA 2XOKD 3CPJB 3F5FA 1E1QA 2FDCA 2RH5A 2ZJ2A 2IYUA 4LHXA 4KHZA 2Q3FA 4L9WA 3TQFA 2WWGA 3C41J 4FI3C 1E2IA 3HU2A 3U3OA 5TMPA 4CEIA 1CIPA 2AHOA 5EP1A 1K8RA 3EXAA 2W83A 4GMXA 4V02A 4D4JA 2YKGA 3HU1A 5E4FA 4OI1A 4QM6A 3WBJA 4QKQA 2ATXA 5FL7A 1E3MA 3SJZA 1YZNA 4JJZA 2FFBA 2WV9A 4P4TA 4QXAA 4UXHA 2WVJA 1IM2A 3BWDD 4LUCA 3U61B 5KSYA 1W44A 3P32A 4QJ4A 1G8FA 3DMDA 1GAJA 1OFHA 1OLOA 3EPJA 2ODBA 4EPYA 1S1MA 2FX3A 3B2EA 4S2EA 3WYAA 4CVNA 1ZM3A 1IJEA 1YRAA 3KUDA 1ZYUA 2ZRCA 3AB3A 1X8LA 2ZJAA 1ZM9A 4WXRA 5DI9A 2GCOB 3KJHA 4F93B 3FDIA 1U9IA 3HYRA 5EXSA 1ZD8A 1NVVQ 1LS1A 4LJ4A 5AJZA 2AD1A 5EE1A 2IEZA 1KZGB 5DN6D 3ADDA 5EP3A 4IW3B 2D4HA 5TB5A 2H16A 4DUGD 4PPGA 4IJMA 4URXR 4C30A 4V0KA 3ZVRA 1XEWX 1YR6A 4N0DA 4WXPA 1XRJA 2PMDA 1N0UA 1RJ9A 2FN4A 2OCPA 2NPIA 2PMKA 3E5HA 4D4LA 3CZPA 2BJWA 4JL5A 2IYLD 2WMNB 2YJTD 4KAXA 4TTQA 1KSHA 1OSNA 1SVLA 3LW7A 3W3ZB 2XXAB 3QPWA 1AKYA 4CYMA 1US8A 2A5YB 3FKSA 5CJPA 1NVVR 1S1CA 4B3BA 3QXCA 3EZ6A 2G6BA 3LXRA 1BYUA 1AS0A 4FMCF 1GDDA 5LBIA 221PA 3KFXA 2ZRPA 4TL8A 2Q9BA 3WHKA 3H84A 4JLJA 3I61A 3EC2A 5K8TA 1Z6XA 2ZVQX 1XTRA 4CZ2A 2C96A 1CJKC 5TXGA 4DT1B 1P9WA 1RRGA 1KIMA 3L8YA 4CRWB 3TLXA 2XXAA 3MSXA 3NIBA 1IXZA 1S2MA 3DHWC 1U99A 4WVFA 1TX4B 2F3TA 1KNXA 1DELA 1W0KD 4LYFA 2VTKA 5FPKA 2ZJYA 1KAGA 1KOFA 2MMGA 4ESHA 1Q57A 1JPJA 2OCYC 4M1WA 2W6JA 3TSOA 2FZ4A 1ZU5A 2OG2A 2OO7A 4Q7MB 5G3ZA 4ZI2A 2W00A 3PIRA 3P4XA 1OXUA 5H8WA 5LB2A 2QI9C 1GNRA 2QAGA 4DT1A 2VPPA 1EX6A 4MH0R 2PCJA 1Z0IA 1NLYA 1BMFD 2HV8A 3H4MA 4JLOA 4XTCS 4MGYR 4FIDA 4AYXA 3KQLA 1T5LA 2FFHA 4W7SA 1I4LD 1FUUA 1P73A 4TL9A 4XVRA 2RAPA 2AN9A 1U8ZA 1NP6A 1GKYA 2R2AA 3LA6A 1XMVA 1DADA 2QMOA 3X1WA 4LV6A 1KYIA 2BKEA 1FNMA 2XZOA 3NBZC 2DFLA 2REXB 3KUCA 2OE2A 1RFLA 1VYUA 1DO0A 4OHXA 2J0QA 2GBLA 2G88A 2QPTA 2ZPTX 5L3QB 3SYKA 1P72A 2V3CC 2VHTA 4LBWA 5H70A 2OT3B 1FTSA 1XEWY 2JASA 3VAAA 2GEDA 1Q1ZA 1GP2A 1SQ5A 4V0MA 1ESMA 1E2GA 3IHWA 2QT0A 1K5GA 3ZD6A 4IFBA 1A7JA 1JPNA 1XB2A 1L4YA 2F3RA 2O8EA 1EGAA 5H68A 5HZHA 4ZCLA 1XD8A 1ZC3A 1NSTA 2QQEA 3CRMA 4PHTA 5CYOA 3MWJA 3FWYA 2JCSA 5FOUA 1H8HD 3KB1A 4PO9A 4RD2A 2ZRDA 1XD2B 2OZEA 2PL3A 4LJ7A 2GK6A 2FJUA 1TUEA 3B1VA 2WIBA 2EWVA 2N42A 1VMAA 5JJLA 1VG1A 3VKWA 1N5JA 4TN1A 2RGEA 3OAAA 4IDNA 4ON9A 4A0FA 3R9XA 2ZRJA 1R8QA 4PZLA 4C9BA 3MMPA 3KJEA 4P0TA 1LF5A 3NXSA 3GPLA 4II7A 2QENA 3CPHA 4DHEA 5C4MA 4YMWA 1CS4C 1E9BA 3C15C 1U8YA 4GZLA 5EZ6B 3I4LA 4JLVA 4X8OA 3THYA 5F3WB 1WQ1R 3SFVA 3CR8A 3NEYA 2ZE7A 4TSFA 2AR7A 4KFRA 4PPFA 1JI0A 4F4JA 1GL6A 3D3QA 1O3YA 5IDVA 3SZRA 4A1FA 4ERNA 5E3HA 4CDGA 1JJ7A 3L2OB 2NZ8A 3DO6A 1NVWQ 1M1YE 4XIGS 3OIWA 4DCVA 2CMKA 2UZIR 4JBWA 3GLHA 3O8RA 2Q21A 1JXMA 3BBPA 1BH2A 2MMCA 3RDPA 2BEJA 3C5HA 1U94A 1XTQA 5GJWC 1CR0A 3DOFA 1R5NA 3TR5A 1JR3D 3A36A 2GHIA 1XPUA 3B1WA 1DG3A 1E9RA 4LPKA 4JKYA 3BGWA 3DPUA 4AI6A 4URWR 1CR2A 1GFIA 3SS8A 3J81k 1PZNA 3E2IA 2FWRA 3B82A 1Q1BA 1JB1A 2DCUA 4JVLA 4IVQA 1ZUNB 2OCAA 4JLAA 1NF3A 4TZ6A 4Q21A 3U7EB 5CLQA 1NN1A 4ESVA 2QPOA 4W5JA 3KKOA 3FHOA 1JR3A 1N6OA 1PUIA 4EFNA 4M53A 2OFWA 4BFXA 4D6PA 2P6RA 4O3MA 2FU5C 4D26A 1UPTA 1LB1B 1ZINA 3BAFA 4A8JC 2OSBA 3B9PA 1G5TA 3T06B 3EZ9A 1E2EA 3ZQ6A 1BO6A 2NPFA 3QVUA 1IOZA 4Q1AA 2QPAA 4A2WA 4LJ8A 1YE8A 4ASUD 1D9ZA 2VLIA 5J4YA 3WP0A 2RMKA 2J9RA 4C2TA 3VR5A 1CRQA 3LD9A 3MLEA 2VH5R 2Q9CA 5FOXA 2ECKA 5GJBA 1YR7A 3RS7A 2YV5A 4XVUA 1JJVA 2DY1A 2PEZA 4M9SA 4NMMA 1SGWA 1LFDB 4IOMA 4RY2A 3EPKA 1IAQA 3EIEA 1JALA 2WJHA 2ORWA 3B9QA 4P4UA 4GP6A 4M1TA 1SVWA 5FBWB 5L3SB 2F55A 1XXHB 1TQ2A 2QORA 1XPOA 1KSGA 3AVTA 4M22A 4MGKR 1TAGA 2JLZA 4A2QA 1Z0KA 2KBFA 4QG7A 3CONA 4CT4B 4AKHA 1EFRD 3DM9B 4HZUA 4PSKA 1NLZA 2ZS9A 1X6VA 2EFCB 3PITA 1WBDA 1FQKA 4DDWA 3U5ZB 2NO9A 4FCTA 3AKCA 4RCZA 1SVIA 4S35A 4JBYA 4DCUA 2UZ3A 5JFGA 4BFTA 2F1JA 3B5JA 1VKJA 1SXJB 4V0ME 4ZO4A 1I2MA 4N1AA 3KXKA 4O2LA 4TWZA 5TV2A 2AD5A 4PR0A 3QOFA 1SXJD 2EFEB 1OKKD 1VYVA 3IPXA 5F2EA 1U2RA 1Z29A 3CNLA 4AG6A 4M1MA 1RZ3A 5JHGB 1GSIA 4R98A 2P5SA 1TU4A 2VHCA 4NL4H 5EXXA 3RS3A 3VR3A 3R9WA 5J5CA 4BZQA 2F43A 2G9NA 4LZZA 4TTRA 3D6TB 4GZMA 2ZI5A 3UANA 5CM8B 1UKEA 3L43A 1XTIA 4B2PA 3CRW1 3T1QA 4BLQA 3O8BA 4HAZA 1OKKA 3OFND 5IK2D 1AGRA 3NBXX 2EYQA 2I4IA 4QFMA 4XOIA 4MYHA 4YXWA 2NIPA 3E1SA 4GBMA 1X1SA 1A2KC 3W34A 1OF1A 4N0EA 1NKTA 4EJSC 4RD6A 3Q5EA 1DTSA 4BLTA 1OB2A 4GDFA 4Q9IA 4KJZA 4WZBE 4P32A 1F3OA 2QT1A 4AD8A 1PJRA 3QXJA 3W8NA 1T6NA 4B2IA 1TMKA 3OFNA 1W48A 2GCPA 2JLSA 1HEIA 3OIYA 3PEVA 3EARA 3F8TA 1N6RA 4B76A 3ETLA 2ORIA 1KO4A 2QMHA 4QHTA 3O8DA 4HAUA 3PEWA 3B8HA 1V5WA 3GLHE 3NH9A 1Y63A 2X2EA 2ZRMA 3Q8XB 4W5HA 5AK0A 2HXYA 2R6GA 1A2BA 5FOTA 3AEZA 5JECA 2J0UB 1G17A 1E2MA 3L0OA 2RGNA 2W2TA 4JT4A 3MFYA 4P3YA 4EPTA 4BZXA 2IHYA 4LC1A 2FGKA 1J99A 1DAMA 1VTKA 2WOOA 4M8NE 3RS2A 1T4GA 3LBIA 4TQ9A 2O8CA 4HLUC 4D80A 3AGQA 4HAVA 3K0CC 3R7WB 2Z83A 1OH5A 3LNCA 2ZUCA 3L0SA 4QJ5A 3IIMA 2O8BA 1JR3E 3SQXA 1Z0FA 3BB3A 1TPZA 2JLRA 1BYIA 4DLXA 4A36A 2ZU6A 4PHGA 4Q18A 2J0UA 4MYCA 4F4CA 1P61B 1G8YA 4BFUA 1Q1EA 3I5XA 2WM9B 1ZM4A 2ONKA 2VSXA 1G8PA 2GDJA 1OH6A 1KI9A 1QVRA 4EFLA 1KAOA 1H8EA 2W2XA 1P60A 1W4CA 5KSPA 4KBFA 2KB0A 1COWA 4MKGA 3RWOA 2RGBA 1KK0A 1GNQA 2QA5A 1W2HA 2IYZA 3KKNA 3K70B 1MABB 2ZRHA 1BIFA 5K8IA 1N6NA 4R2HA 1MV5A 1K5DA 1KI1A 1MOZA 4H1UA 4PAQA 4B3CA 2HCJB 4OYHA 1KSJA 4LSGA 4JSTA 3EA0A 4LYJA 4WBSA 4BFYA 2RGXA 1DAKA 4JLMA 2VHUA 4V03A 1YZLA 2QSYA 4Q7LA 3RVBA 4RD4A 3D8BA 1DE0A 2OBLA 5TARA 1CTQA 2D2EA 2OLKA 5EUQB 3I62A 2ZR0A 3OIVA 2WSSA 3LWNA 1U81A 1NG9A 4TT3A 5C18A 4HAWA 2CLDX 3W5JA 5F9FA 1E4VA 3W3AA 4IVPA 1M2OB 1XXHE 2P6UA 2FE4A 4XH9B 3ZIAA 1JEDA 4G5OA 3GJ8A 2R6DA 1XJQA 3UIEA 3W8RA 4X8HA 3TW8B 3T5GA 2ZI7A 4BPBA 3NDBB 1CULC 4ZKEA 2F7SA 2ZVPX 1Z06A 4HLCA 2O8DB 1YHNA 5CB8A 2PEYA 2H8KA
chains in the Genus database with same CATH superfamily
4URUR 3CKLA 1QHHB 1RZVA 1VM6A 2IDZA 2R00A 3H2ZA 3N0TA 3R0IA 2FEXA 3C8UA 3L92A 4F5EA 4MV8A 1WCYA 1POWA 5G41A 2L82A 4TKUA 2F9FA 4KBGA 2ZCJA 3O4GA 4AZ0B 1ZBQA 2CE7A 3VI4B 2J5RA 4OB6A 4IFIA 2XT0A 4OHPA 4BMYA 3IE2A 1O58A 2OD9A 4N7RA 3ZKWA 4J7UA 1FX0B 4CUKA 4OL0A 5J4VA 1OW3B 1W5SA 1NBIA 1AK9A 2VZ0A 3B6EA 2O20A 1QFZA 2Z95A 4YUXA 1DNPA 4ZVQA 2FUEA 3CQ9A 3X43A 3QFFA 4M1ZA 1WU7A 3KVVA 1MIOB 3FAZA 3M5PA 3L6BA 4IM7A 3TIFA 2JJ1D 1NMSA 1UZLA 4BNHA 2VYQA 4DG9A 3H7IA 2JJ8A 1BU8A 1IHXA 3STWA 3EF3A 3LBHA 4F71A 2GM5A 1UKYA 1A5BB 3V4SA 2JAPA 5C51B 2VHEA 5IDWA 3V2IA 4ZRDA 4QQFA 4HXYA 4E4RA 3MOGA 1EMDA 4AP9A 4G65A 2ZS7A 5SZHB 1JLHA 2GXQA 2Q49A 1JLLB 4MCAA 3ZV4A 3JRXA 2R8PA 3LNTA 1CUXA 1BW9B 3BEOA 4RBNA 1E0AA 1PJTA 2ZDGA 3OD1A 4IJQA 5ITSA 3WGOA 4L85A 4XOUA 4X44A 2GXUA 1YUBA 3UUEA 4HN4B 2P77A 5KPDA 1R66A 2ZITA 2NU6B 1J8YF 1T8SA 3I5YA 2WJYA 3TTTA 1UT6A 1LBHA 3WFJA 1GZDA 4URZR 3BZUA 3W1VA 1YCHA 4IINA 2R8BA 4JB3A 4U6NA 4AIRA 4NV1A 2QTVB 3FPCA 3SM3A 4NJEB 1DAIA 1P39A 2AG6A 2EHJA 3ND7A 1Y37A 1ZX1A 3H1BA 3WLRA 1QRAA 2HA6A 5LOVB 3N2EA 5A7FA 1JQJC 2OHIA 2PQ6A 3K1AA 1Z6YA 2AI2A 4YX9A 4OHCA 4F4IA 1N9GB 1USKA 2KLBA 3FRHA 1LDEA 3KPJA 4OHFA 1SZPA 3EGCA 2GDZA 1C8BA 1N8NA 5ITVA 3PXGA 1V1RB 3EOAI 2G09A 3OE4A 3LPNA 4MV9A 4EB0A 4L72A 3L40A 2IWRA 2IV7A 5GVSA 4U2EA 3HRKA 3WYBA 1IN7A 1S8OA 4JGGA 4WPGA 1HDZA 3UHJA 4EI2A 4WASA 1E9DA 2PR2A 5L4LA 3HHPA 3KVOA 4NBUA 4GECA 2C4MA 1P19A 2ODQA 3NR2A 5AM4A 3RUCA 3SS9X 1W36D 2AK3A 3L8DA 4NICA 4NP6A 2PRSA 2PWBA 5CM9C 1N2BA 1XRMA 4R1LA 3FJOA 5TJ9A 1JFSA 2ZYAA 4C4RA 4R6XA 4UMDA 3W77A 1VG9B 5DP2A 2VXOA 1QXSA 1G3MA 5CLHA 3IULA 1YUNA 3OZTA 1ATZA 4QBIA 3SX4A 4UKDA 2JGIA 4MMXB 4R81A 5KYTA 2P4QA 2R8ZA 1L7PA 3H04A 2AOWA 4RX1A 5CT8A 3WGLA 2VHZA 3OCZA 1FRZA 3EGEA 3L3BA 4FLMA 5AVZA 1E2KA 1FP4B 1GPYA 3FOZA 2NVUB 1Q6ZA 1AGXA 4P3PA 1ZVVA 5KJFA 3SX0A 2B25A 5KYWA 1G4AE 4GZ3A 2R7MA 4OB7A 5DKFA 5LP6A 5HKOA 1FFBA 1XC7A 1GYRA 5MF6A 3GRZA 4YRPA 4KDFA 1Q3HA 1JHZA 1Z4IA 1Y48E 2HJWA 4QUAA 4M1EA 4Z5XA 1I6LA 1GPH1 3VU1A 4A73A 4DVJA 3L6EA 5JROA 5EZQA 5L53A 2RHTA 1GG8A 1CHDA 3TW4A 3EUWA 5BWLA 3A4LA 5HKKA 3AESB 3CTMA 4J0QA 2P6MA 5K6AC 1JDTA 3QU7A 2BMAA 1QZXA 5FL7D 5DASA 1MRSA 4AZ3B 2C4WA 3GRVA 4YACA 1W25A 1R9JA 2VNHA 1XL0A 4TTVA 1E8DA 1ZVKA 4RD1A 3ZY4A 4ABTA 3OHSX 3OJCA 5ED0A 1C2YA 1V43A 1OT3A 1PHPA 4RPCA 1Q0RA 5CHYA 3VKFA 3ZBTA 3LY7A 1KO5A 2ENWA 3I0MA 1YNOA 2IW3A 2CXNA 3IVXA 1GCIA 3ILVA 3PD7A 4QDUA 1IXKA 4WKGA 4O4JB 3CLKA 4BQNA 4CL8A 4WH0A 3VZRA 2QUZA 1JF8A 3MAJA 4UCFA 4J3JA 6LDHA 1YS9A 4POAA 4MVWA 4K5QA 5KJEA 1L5HA 4DBLE 3MBIA 3ADPA 4CMIA 4EABA 1VCNA 2RAVA 1POXA 2HEGA 3FSEA 3O4JA 4ZYZA 4RD3A 4IIEA 4NOLA 4C7XA 16PKA 1N5OX 4G0ZA 4RA6A 1Z38A 3RC7A 1GZ7A 4CKCA 3CRNA 5BOSA 5KJ1A 4HC4A 3WJAA 3PFFA 1L8AA 4BWYA 4YC7A 4KIFA 4TX1A 3EC1A 1JLKA 1YJ5A 3ZWBA 5KNDA 4RGBA 3A4VA 4CEHA 1ZXLA 4JOSA 2X0FA 4ACAA 2XKKA 5H4GA 3VTKA 5TGDA 3CFYA 3G9QA 1EESA 3MWYW 3EIUA 3ECAA 1Y6FA 5CU7A 4RJ2A 2BZ1A 4FZVA 3EEFA 1P2TA 3UJ7A 4PLCA 5JZ9A 5KTPA 3F5MA 4JYBA 3CNNA 2RARA 4KI0A 5ICFA 2EJTA 4IDBA 4Y6PA 4WA8A 3RIMA 2YS7A 4K6GA 1A98A 2I34A 2C4VA 3A25A 5CK4A 3FVQA 1K7YA 1XDDA 4GG1A 3ONWA 1Q84A 3NM6B 2VP4A 4KPFC 5MDHA 2R8RA 2AQ8A 2WVAA 2HIHA 4ILEA 2ATCA 4G09A 3M82A 1KP3A 4Q4CA 4F7DA 1J2UA 2G63A 2NQTA 5K1ZA 1J07A 1AA6A 4QLOA 5H0IA 2G0AA 2NSJA 2V45A 4FN5A 1TT7A 1M0WA 3C6ZA 4EG3A 4QYTA 1QNLA 3AI7A 2QTBA 3TF5A 1I5EA 4OGGA 4GMHA 5SY9A 1JMVA 1VE1A 3EIOA 5BRAA 1ZXXA 4MZDA 2G4VA 2WMYA 1MT3A 3G02A 3OPXA 4P36A 4UHKA 4N3AA 3M1IA 2ZE6A 5LJLA 3RNLA 1X7XA 2EAUA 5L6LB 1Q14A 2VF5X 3WV5A 3B53X 3AR2A 3U5TA 3G2QA 2IYRA 2VP5A 2BSXA 4LYGA 1MRZA 4FFOA 2ZM6B 4YJ2A 1BEUB 3I37X 3OO0A 2X9VA 2Q7DA 1WY5A 4LVCA 5KOIA 3INRA 4IDPA 2ZZNA 4OJTA 1AA9A 4JROA 4Z0HO 2YFHA 5GAJA 3O8QA 3BN3A 3OUUA 2QTTA 4P58A 4RK4A 1C3OA 1A71A 4QGHA 4TRMA 1Z2NX 3ZXXA 4RVCA 2WZDA 3ND5A 5FJIA 3OZ7A 3NASA 2HA4A 4P7FA 1QHIA 5LA6B 1WXHA 2HBZA 1EFLA 2HLNA 4YONB 3TVTA 1SVOA 2Z0MA 3UATA 3AXSA 3MPOA 1WS6A 2FSIA 4XJVA 2QRZA 1OILA 3MZ0A 2PGLA 5DGXA 4F3TA 1R4MB 3GGPA 4CF4A 5B7GA 4CI9A 1EFPB 2X7HA 5CM2Z 1DXYA 1NUHA 4BFCA 4EHLA 4OAOA 1FX1A 2DWUA 4NK4A 1WE2A 2FG7C 5BSHA 1HE2A 3ZWVA 3TTWA 1NOIA 3PDUA 2IUEA 1CQJA 2V6FA 3Q41A 5JNTA 1NN0A 4JP1A 4HMPA 4AC9A 3DBRA 4RGVA 5EIFA 1UT8A 1RCUA 4YO8A 2CE2X 3D6JA 3NUQA 3PHBE 3G9TA 4U8HA 4UBJA 4R05A 2UUOA 3N7UA 4M0DA 4ZT4A 3RYFA 3GLIE 5AKEA 3LLSA 3BXPA 3DZKA 3FPSA 3FDZB 4L76A 1JEOA 1Y3AA 5CNKA 1M6WA 4GX2A 5CB0A 5F4ZA 5K0CA 5EWJA 4BC1A 2RKOA 3N8NA 2GO1A 2WUGA 4UDXX 3WO1A 3MHTA 3BTOA 3ZWKA 5KUTA 2H1FA 2W58A 1DKUA 2Z5GA 4GPAA 2GZRA 3GLFA 4Y2TA 3MM4A 3FTEA 5ALVA 1ECCA 5HM6A 3K0FB 5K8LA 3E27A 5A9SB 4YLEA 3RKSA 5EGNA 3TRDA 3VU8A 2AMYA 1RJDA 1KI7A 1J7KA 2BDUA 3WDSA 3JQGB 1B3RA 4YECA 2IBMA 4I9NA 3HDHA 5DH9A 3QI2A 3W04A 1YI0A 3NJRA 5JYEA 1RJFA 4FCWA 3OLQA 1GTRA 1D4AA 3UMVA 4RTPA 1I14A 2W0MA 3RAPR 1E3EA 1QFJA 1A27A 1IN6A 1DI0A 1ZGCA 2A5JA 4EJ2A 1GTSA 3FSJX 1BFDA 1S8AA 4AX4A 2ZIXB 2NVWA 1LUAA 5AUQA 1A8QA 3OX3A 4WKNA 1MB3A 3B13B 3KTAB 3A8TA 4Y9RA 4WZBB 2C2MA 1T36A 1EAYA 1RXCA 3THYB 5E4JA 2WLSA 4LGYA 4LWQA 3OP1A 4Q7EA 3DTVA 2NV6A 5CNIA 1G16A 2CNLA 2O0KA 1YOVB 3UVEA 2C00A 2BJVA 4EHAA 5TE9A 1SKAA 2FQ1A 2FPIB 4ER3A 3MRXA 1TJ4A 1UZAA 3Q3CA 4RH1A 4EKIA 4REMA 5B7NA 2VYFA 3RK0A 3MTEA 2XQFA 4KG7A 1F0KA 4WZAE 4JA0A 7GPBA 2X7XA 1CS0B 3A4NA 3GGSA 5F1OA 1YZKA 1PLLA 1ZRMA 1NT4A 2C3UA 4DUPA 4C7MA 5DNWA 3A9CA 1A8UA 4IIJB 3P2EA 1PTKA 4DPMA 5EZYF 1MA0A 1YC5A 1W88A 4FPXA 4KMMA 4RANA 2NG1A 5JEEA 1EUCA 3W1EA 2VJPA 2M6KA 4R3NA 1CZKA 5AVXA 4RKFA 4ZOLF 3ZWQA 3KOWA 4K3UA 3LFUA 4QEDA 2I8CA 3FAKA 2JI4A 1WMEA 2Z57A 3G59A 1H3NA 1L7OA 5J4HA 1R5JA 3VI3B 2VK1A 1XNJA 4P5DA 1OZFA 2HNKA 2HU8A 2QRLA 5KYUA 1P18A 4GI2A 2ONJA 3QVLA 2FLKA 3WSWA 5E6UA 4DQ0A 1C9KA 2Y4OA 1YU9A 3ZQKA 3CLSD 5COBA 1YZUA 1V25A 1LBIA 2Y1OA 2Z8YM 3HPQA 3IDFA 3T3DA 5CFZA 1BA2A 1TUBA 3EXEB 1T0IA 1DEAA 5LQAA 1SCKA 2X5NA 1Y7HA 1L1QA 2BKUA 4Q02A 1R9NA 4Y8VA 2J09A 4KYIB 1CY1A 2VNSA 3BZBA 2OGSA 2A1UB 3EGXA 1SC9A 1VLJA 4II2A 1SELA 3Q0IA 4UC0A 4BE7B 4KE6A 1QX4A 3GB9A 4TV8F 5HBGA 4X9XA 3UAGA 1FFEA 1Q7CA 2YYSA 3K2QA 4MPJA 1VE9A 4PSCA 1F60A 3ZUGA 3WB9A 1CG6A 4YCSA 3WB2A 4IIXA 2ZSEA 3RFXA 2EKDA 1EBUA 3R0VA 4FKMA 4C05A 1J2TA 1WCV1 4M9RA 3KX2A 4G41A 5DX1A 1DKPA 1SK8A 1X15A 2JFPA 2OENG 4U2GA 5LR6A 2TMGA 1FLNA 1QVWA 4KQJA 3A6HA 3PFHA 2AMLA 3IDSA 2WD9A 1RZRD 3CF6R 1X77A 4DV3B 2WG1A 2YWGA 4I4TF 4YAOA 1X94A 3UJHA 3VR5D 2Y99A 2I7DA 2FMHA 2IT1A 3GQBA 4QU9A 1CJTC 2R6CA 3T3IA 3C98A 4CKBB 3B36A 1XYGA 2FSVA 2KJQA 3QENA 3RC9A 3O4VA 3ZV7A 4ZEWA 3W78A 1M83A 2Z9DA 1IZ8A 4FR0A 4F6RA 4X64B 2NSHA 2QLJA 1EWVA 1PE0A 1UZUA 3IUJA 3RTBA 3C3BA 4BRUA 13PKA 4IEEA 1WKBA 4Y1RA 2ABWA 1HMYA 4QOSA 3T7SA 1JKJB 4WLNA 5DLEA 1Z17A 3AIIA 4G81A 1GU7A 4OU4A 3UPDA 2CJXA 3IC5A 3X1YA 5CW1A 3V7YA 3C6YA 5JJCA 5KQLA 3ML1A 3TQTA 2V0GA 2BLNA 2QTFA 2GJKA 1RI5A 1J8QA 3D2BA 2Q1XA 4QASA 4Y1EA 3TQRA 4NU8X 3QY9A 2J9FB 2R48A 2Y8EA 5BQ3A 1CJUC 1RYNA 2QVLA 3BFKA 4D7AA 1SCQA 1YE3A 2P2GA 2C31A 5FEUA 4DSAA 2DBQA 3AF0A 2R751 4WGFA 3WGZA 3ZDQA 1WRBA 4AQDA 3N5KA 2VNKA 2HWKA 2IITA 3UICA 1I5OA 3ND9A 4DZZA 4EL0A 3HWRA 3ZPXA 1VL0A 3ETGA 3PG5A 2A88A 1NT2A 5F64A 1U4NA 2OAP1 3L0DA 1BCSB 3PUXA 3WKCA 4MRRA 4WVLA 2H4XA 1SBQA 1AN9A 2F43B 3CZQA 1XCGB 2VP6A 4A6XA 3RJMA 4Q9JA 1YO6A 5FWXA 4Y2SA 2LUOA 4QWWA 3PFWO 3KEOA 3DMTC 1P77A 2WVGA 4ZU1X 2ZRLA 2YJ4A 1DAPA 2XUIA 1NW4A 2PRZA 1GIAA 4E5KA 1NC1A 1Z3IX 3VMMA 3MS4A 4DA4A 1KK2A 2BF4A 4WKPA 4Y98A 2I6QA 1QGUA 4XEUA 2J07A 2PLFA 3ZGXA 2DR3A 2QGZA 3AZQA 4ESEA 1OZGA 4QNMA 3WWCA 3P2YA 3ZHOA 1ODFA 2TMYA 4ZGWA 2AFIB 4YMGA 3R75A 4PX9A 3R8XA 1FSFA 4C0AC 3DJYA 4MHOA 5CYPA 3RSQA 4D74A 2IEGA 5IU6A 1ZC4A 2BUCA 1DX9A 1M0TA 4WWHA 2BHLA 2DGDA 4X8LA 2Q5FA 5EHNA 1M0EA 1A8HA 1Q20A 1QMGA 4L8YA 4HATA 1W4AA 4OMDA 4RY9A 4NYIQ 4DV2B 1QGDA 2HLDD 4F60A 3I01A 3JZAA 2BGNA 4WCVA 3S29A 3WIBA 3UFBA 1QU3A 4O08A 1MQSA 1H23A 3ZIUA 4PYRA 5ESXA 5JAOA 5IJ0A 1GT6A 1E2UA 3HEBA 1G1MA 2JIRA 1ZD9A 2ILTA 2WWFA 4WMLA 2OCXA 2YFQA 5TVKA 4YRSA 4HB2A 1PEDA 2FMXA 3EVEA 3KWJA 2HBQA 1XMQB 5BSVA 4TYQA 1KAQA 1FVOA 3ZHYA 2CFIA 2W7TA 3WHIA 4GLBA 2QVYX 1RWBA 1RJWA 1T5OA 4CKWA 2R0QC 1P1HA 1PZGA 3KZOA 3M2PA 3QYAA 1HV8A 4OQXA 4PZPA 3OTOB 1BDHA 2R1TA 3DFUA 4RXTA 3R44A 3SP1A 5C32A 3V1NA 1HE1C 5JADA 1E63A 1H66A 4NYIR 3DC7A 5DMXA 4QHYA 5L3VA 5LM3A 1A95A 5K3SA 2CYAA 2M1ZA 2ZQYA 2W6IA 4TTAA 1K75A 2IGTA 3BDVA 2F3SA 2YY7A 3MGCA 4LHZA 4M3NA 1EQUA 3GA7A 1IHDA 1R0KA 2XUZA 3BRCA 5IBPA 2WU4A 3L07A 3SNHA 3VZPA 3WI7A 4ERXA 4UNQA 3V6MA 4RVHA 2XUQA 4Z4IA 3G0HA 2IL1A 3A7DA 5CJJA 4H3VA 5F5XA 5KB3A 4G84A 4TVBA 2I78A 3TBKA 4Q9KA 4QREA 1M2GA 1TZ2A 4IIGA 2GH1A 3M4NA 5FA8A 1R12A 1KKLA 2B83A 1EDBA 1OGYA 2I3GA 2OFOA 4MVJP 1EX7A 3I72A 3A6GA 5EL0A 1Z4PX 5EIOA 4R84A 4F06A 4IWNA 4DDUA 2JHAA 3RHSA 3ITEA 1XCJA 1PG5A 1ISIA 1RM0A 3Q3GE 2OQIA 4Y1GA 4DVGA 1MHPA 5J59A 1SQFA 4KYUA 4KSYA 2WICA 4NAVA 1BFKA 1OAKA 1ABBA 5FA6A 1ZP6A 5J2TF 4G07A 4LSWA 4NJMB 3SZUA 1QV7A 3T0GA 5AJVB 2H0AA 4MW5A 4B6GA 1AHPA 3IEVA 5EMMA 1AM4D 3UUWA 3VOAA 4F5ZA 4BN4A 2QRHA 5DI3B 3PPIA 4LDNA 5JSFA 4V1CA 2VH2A 1CQIB 2J5XA 3SN6A 1JQDA 2VZ8A 4ND8A 2PZEA 3HXMA 3MCVA 3OJXA 4R8MA 2GNOA 4MGHA 5G0WA 4AO7A 3PEYA 2PLNA 3BDIA 5HMMA 3Q5DA 3COWA 3G1WA 3FVRA 1MAVA 1Z8DA 4Q4AA 2Q5CA 1RWMA 3G6KA 4LDJA 5AIAA 2B92A 2XXJA 4PGGA 5HBRA 4YAFA 3UPUA 3ILYA 3ZDEA 2BFOA 2ZVJA 2BEUB 3T1TA 3VPXA 4MKHA 2I76A 1X7HA 3K0EA 4RJIA 5ICCA 3U6KA 2CFTA 2WSSD 1MB2A 5EESA 1FNDA 1ZSVA 5HIJA 1WG8A 2ZT8A 1Z28A 4KN9S 5EQDA 1RQRA 4OK5A 3E58A 4EPXA 1X8KA 2WWWA 3FYCA 1MW9X 1ZESA 2BBTA 3Q3JB 4QGGA 1TQ6A 3P20A 4XUEA 4RTNA 1GGEA 1TYBE 3L5OA 4PNHA 4B4WA 5C5DA 1ZOSA 4B2LA 3W7AA 1MNAA 3GNLA 2X7JA 2G82A 5DCUA 2G5GX 1L4BA 2GK4A 2C29D 5DM4A 4B46A 2Q3EA 2HGZA 2D5IA 4C78A 3JQ9C 1JFFB 2FMFA 5JQGA 3ZLJA 1J5PA 1WY7A 1DV2A 1GDHA 4DJJA 2A1IA 2W98A 2OCBA 1UKVY 3WS7A 1OJ7A 2WF7A 1QPZA 4XIJA 3E82A 5AR1A 3O94A 4C4XA 1XKLA 1MT0A 2CHUA 1MJHA 1HC7A 2GVZC 2OHHA 3A1WA 2X9LA 3AHCA 6Q21A 3JQFA 4UXJA 3BMCB 5U9CA 4DQUA 5TT0A 4KGDA 2YIDA 1PGPA 2FDXA 5D3QA 1MQ9A 3RS0A 4CM1A 1ZOPA 4FIZA 4MRAA 3PTLA 1A9TA 5FOWA 5KTMA 3QE3A 4ISBA 1C50A 4AUKA 3RADC 1W35A 3VKUA 3CN9A 2ZJZA 1P1BA 1ZH4A 3PEUA 4P86A 3HSYA 3LQKA 4JJAA 2A86A 1HI9A 3REGA 3ZCRA 4YCLA 1EG2A 1W581 2QMZA 5D86A 5ICEA 1RAAA 2CHGA 2PRKA 1T0JB 4B73A 3IR7A 4QDKA 5ALNA 3MWEA 1ZGAA 4JK3A 4XX0A 1FFAA 1V4NA 1FMTA 3JQ7B 4WK6A 3TGWA 3VSDA 4Q0MA 1VE6A 1IB6A 2W0SA 3CZCA 2I4RA 2B1JA 3R0ZA 4G01B 1XMPA 3STUA 1DIOB 5HCNA 2VTEA 2O3QA 2ZE8A 5BSTA 1X7YB 5LIRA 1AMOA 4H7EA 3GLGB 2YW9A 3OU6A 1JEYA 4N5NA 4X20A 4CDMA 4OXIA 1Q1GA 4J0CA 3UC5A 1VHTA 2Z4SA 2GSDA 4K6KA 1ZVQA 4TMXA 1QH8B 1NBMA 4KE9A 1H2XA 4KOAA 5SY6A 3Q72A 2REQB 4YJHB 3KJQA 3ENKA 5D6NA 3GXBA 3LPMA 3PQDA 3T7KA 4D9KA 4FILA 4U3JA 1V39A 4HS4A 1EM6A 1NE7A 4YCJA 1E0JA 3LIIA 4LOJA 1JS1X 1DC4A 4X1IB 3W2EA 4F12A 4F4HA 5TPWB 2Y27A 1JTEA 1M2EA 4UUOA 4JI8B 1OHHA 5HTKA 2GSWA 4AJOA 4OH7A 3CW8X 4WBNB 3V8VA 4J9UE 1MO6A 3IUPA 1OWOA 2P1RA 2J3LA 5KHOC 1HQKA 1AJEA 2Y0EA 1FZQA 2A8YA 4C7JA 3L0IB 4RZSA 1LV8A 1E9CA 1RXUA 2QE7D 2P3QA 4NEHB 4YI3A 4R2MA 3WLSA 4NFLA 1WEKA 4FHEA 4ROTA 1N5RA 2GKGA 3EYAA 2BCEA 3R3YA 4IHQA 4JBLA 4JL8A 4G25A 3P9IA 4K9MA 5C1IA 2AEFA 2H2DA 4ZOAA 4IDEA 4GOXA 1FUIA 4HLDA 3WWOA 5KTSA 5JZOA 3LPLA 4WX2B 4MVJI 1NMYA 5KKAA 2ZAIA 3JWHA 5AK3A 1G98A 1LEHA 4F6CA 1S7CA 3VPCA 5D3MA 1KEUA 3I52A 4AF7A 2ECQA 2ZRGA 3HZZA 1ZM7A 4KLNA 5JCPA 2ADMA 1D04A 1OBHA 1RI1A 3H13A 5JU6A 4FHFA 4ENWA 2G36A 3PEEA 3UCEA 3PR3A 2G17A 3U1VA 2BCJQ 1CX9B 4RKWA 2GEKA 1MR3F 2QXUA 1GL9B 2RC6A 3F6EX 1IONA 2H11A 1MX1A 5DX8A 4QLBA 4MUBA 4JBGA 3UNXA 3HJFA 5C1BA 1K0UA 1NQAO 3D7LA 1IK6A 2P6PA 4MQUA 4NPHA 1WMFA 4YBZA 1VJRA 3SE7A 2O59A 2CXHA 3P9RA 1XZQA 3H5NA 2BTQA 3QELB 3EVGA 2AV6A 4FOOA 4INZA 2IFTA 5HK8A 4ZCRA 2JLCA 5HKKD 4TLCA 1NL3A 3K32A 4TRNA 2ZFUA 3DULA 3RLIA 4Z3KA 2CNKA 3V1KA 4C4SA 3V4ZA 3LBNA 1TUGA 2V5VA 3HVKA 1TVMA 4OPMA 4QTYA 1U5AA 5IXJA 5JNRA 2B69A 1XVTA 2P69A 1QP7A 1OMOA 1QIJA 1UDRA 3RAFC 4AMGA 1TO1E 2BFPA 2F6RA 1XDZA 4N6NA 3OZSA 1HZJA 4TQAA 4LZLA 2GAAA 2CL0X 3ZLVA 2RGYA 4BKOA 4OJYA 3GWGA 3DVRX 3K94A 3DR5A 4Q6BA 5B53A 1W6RA 1TUIA 4Q34A 3AR6A 3R8FA 3FFAA 4ECEA 4X84A 3D0QA 2ONZA 3GHHA 4U2BA 3NRCA 4QQRA 1G3QA 2WFLA 3I42A 3LQ1A 1P7WA 3WZ2A 2QJTA 5HOQA 5KWSA 3CF4A 2BGUA 5LLDA 1Y8QA 1OI4A 2HUPA 2Y1WA 3QOYA 3LRTA 4ENVA 2ZYRA 3OESA 1H2RS 4XGNA 1LH0A 4EMBA 2J9GA 1T13A 2Q8NA 3H8WA 2BFBA 2PQ0A 3SYMA 5K0ZA 5FUYA 3CIOA 4A2CA 4XWAA 3NWOA 1EHIA 4OM8A 3HBNA 3HDGA 5B2ZA 5TQ2A 3NHJA 1IY8A 3W79A 2WBLC 4BJ1A 5T6MA 5CK5A 4DA8A 1O6GA 5A9RA 4UAVA 2EWWA 3AW9A 2HO5A 1HLFA 4FD2A 5IT5A 1FUYB 1GCGA 1OCEA 2JFYA 4OQDA 5D3ZA 3KZ1E 5KNDD 4S2UA 2E9SA 3V4VB 4J1SA 3BSSA 4KI7A 3QEAZ 4XUCA 1PT6A 3D4NA 3JQ8B 1LXCA 1ZJ4A 3NVMB 3OBBA 2COUA 2JGDA 4UE3S 3WHLA 1RBMA 3GUVA 4K86A 1JVBA 4M9QA 4N48A 2GVDC 5L7YA 3GROA 2V54A 3NWJA 3R8CA 5HE9A 4BNKA 2IH4A 3JALA 3TMKA 1UEIA 5SYNA 1L8LA 2C5BA 2CLSA 2PFGA 3DE7X 1RM5A 1ZOIA 2YL2A 3ZOKA 3D4PA 4MULA 1FYVA 1KMMA 3FIUA 4UPDA 4ZCQA 2HRBA 4C6TA 1AV7A 1O94C 2PRJA 2XZPA 2XUKA 3ZCUA 1FE8A 2HRQA 2KYRA 3QKRB 2HD4A 3AVOA 3PNMA 1SWVA 4LHVA 4ZEXA 3TCXB 4PHCA 4F1JA 3OQOA 2B6HA 2PLRA 5JJIA 1NVDA 5FF9A 2CMHA 1PEAA 1JSCA 3AW8A 2O2ZA 1LTQA 2YOFA 4RD0A 5FR1A 1ETUA 2EDAA 5B57C 3D5EA 4LFAB 2ZXEA 1I3CA 4G5GA 2ZT5A 1IN5A 4Y7DA 5ALRA 3W3AH 1P7YA 3HK2A 4BVKA 3LLVA 5BO5A 1XIVA 3NGMA 1MVLA 1EWTA 2Y67A 3AFHA 3A2MA 4JB0A 3DE3X 4K6CA 4QRIA 4EELA 5EHQA 1RWOA 1DZ3A 3DNMA 3Q7RA 3QQPA 3BSYA 1TQDA 3COPA 2ODWA 4NS1A 1BXRA 1UPBA 2QL7A 2TSYB 1EUDB 4GM1A 4EZEA 3R24A 1VMEA 4MQLA 2HL6A 4DDKA 4CLXA 1AX9A 3H0KA 4M46A 1H6DA 3HN6A 4K9SA 5AKHA 5CVEA 5BWMA 1PNRA 2WSMA 3VYWA 5A4AA 3M6XA 5HJEA 3AVQA 1GILA 1T5IA 2GJAA 1Q7TA 2HF9A 2QY9A 4AK9A 1NR1A 3EEYA 4W8HA 3ROXA 1ZISA 4EJ6A 4DLZA 1I32A 1C81A 1RYEA 1D2AA 3PGMA 1JKIA 1I36A 1ST2A 3W6PA 4FEAA 4EA9A 2Z6AA 1AKQA 3O4FA 4PYQA 3V97A 4O33A 5DN6A 1UBEA 5EMNA 1C4OA 5K3BA 3TN7A 3AVPA 3SMVA 2EZ9A 2JA1A 3V7FA 2CJWB 4DUGA 4TN5A 1QHXA 3EXIA 5KKCA 3GCXA 1ZIDA 5ILGA 4WY2A 1OFUA 1G7RA 1L3CA 4O5OA 4FNAA 4QA9A 3GFFA 3PFBA 1V9LA 4MPRA 1HORA 2A3NA 2G9VA 1RYBA 3NHKA 1FP2A 3VR4H 4GM0A 4PG6A 2ZR9A 4ZVLA 3OX1A 1TC1A 2XMGA 1LNZA 421PA 4TKLA 1V2HE 4MDHA 2BFDA 2DPMA 2GM3A 3FI9A 4UFOA 1PFKA 2PS0A 3RLFA 1CUFA 3HY3A 4ZZ0A 2Y05A 3BH7A 3H2HA 2E37A 4Q9LA 4L08A 3O3MB 3QBVA 2Z1MA 1SC6A 3TGPA 5D8DA 1RXWA 2AXEA 5J2TB 1WUKS 4O2BF 4J1TC 3PNOA 2I6GA 3RE1A 1Z4KA 5HRUA 5JSUA 1T26A 3LA8A 4X0EA 4BFVA 1QOQB 3ZK8A 1KA9H 3G8DA 4P7BA 1FRNA 5IC5A 4ND7A 5JR3A 4UUMA 5DBFA 4HAOA 1N1MA 3BCUA 2X0KA 4YRDA 3FMIA 2LCQA 4IICA 1DWOA 4EGCB 3CNBA 3H87A 2EFJA 4QSMA 3RCBA 4NDZA 3HO1A 4CMCA 1U7XA 1B00A 1PR6A 4JYPA 4EX6A 1GR1A 2VCHA 2PK3A 2ACKA 2AKYA 3JQQA 4MRVA 1QH0A 3CLTC 4DN6A 1Q16A 4BXOB 2Z1DA 2BGWA 1OZ0A 4RADA 1WOYA 1RIIA 4E32A 3DTVD 2QN9A 3RU3A 3LE8A 3K6SA 1QS0B 4GMKA 4UW9A 4EVSA 2D0IA 4C88A 2D1YA 1F6WA 5FPTA 1N6KA 4O4HF 3IA2A 5A6SB 3BICA 4B8YA 2ZJ4A 3AF5A 4HB3A 4ZHQF 2IY7A 5J23A 2PUEA 3R5HA 3ZDAA 2CLCX 3D6HA 4PNPA 1NXSA 5JARA 4GT1A 3GGGA 3GP3A 4TPKA 1HLPA 3G7NA 2MYPA 4FD3A 2JVIA 2OXFA 1B6TA 3AERA 4YJ3A 2XCQA 1QCCA 1G5PA 1DAOA 2EVWX 2FF5A 1OX4A 3OJOA 4G86A 1PJBA 4MS3A 4RYDA 3L79A 4MQMA 1GUFA 4BLUA 2RIRA 2QDKA 3ZU3A 1SVUA 1ZGJA 1ZK0A 3FSRA 1MGOA 4LXUA 5HRCA 4GXNA 1QG2A 3EDCA 8GPBA 4C6RA 2D1SA 3P8ZA 1H0RA 3H2JA 1GPBA 3MMXA 5GVRA 3C0KA 1BQ4A 4ZAZA 1L5QA 1K4MA 2NTVA 3LH5A 3LO5A 1P1JA 3S2EA 1QK5A 3DQPA 2EFHB 5F3DA 3L7BA 1E6CA 1ZD3A 4RQBA 4CNBA 3CKKA 1X1TA 1NRWA 1Z56C 2QYHA 4MR8B 1KDZA 1LF0A 1OI2A 4PZDA 1TZCA 4EA8A 1U2SA 1X0XA 3LYLA 1QQ5A 4GAEA 5JALA 1YH3A 3PLNA 3R74A 5C5IA 5CMLA 3T5CA 1TFRA 1L5WA 1R27A 1A8PA 3BTUA 4WJZA 2YYZA 3WLKX 3VHLB 2FKAA 3HVJA 5AXDA 4Z1OA 4KFCA 1BS1A 1S96A 2WIGA 2GPNA 4DLLA 1O8CA 1F2TA 1QV6A 4Z8XA 4DKXA 1HDYA 2W2VA 3HN2A 1ENOA 1AVTA 4EMSA 1EEXB 3RR2A 4JJEA 2Q9AA 5A62A 1QYCA 3OHMA 4RSMA 3T34A 4PTLA 5L4SA 1AKMA 2X2FA 3PGXA 4EFKA 1AH2A 2B9EA 3ELDA 1JL3A 1V1MA 2J5BA 3OCWA 4GL4A 5E6RA 3FHJA 3L8HA 5H7XA 4DJFC 5H9WA 2H0RA 3BWVA 3WA7A 2C9DA 1VJ0A 3DWEX 3ILSA 4NSNA 2GNAA 3CEHA 3QYFA 3BJZA 5T4BA 3HVRA 2EJUA 2XAUA 2VUTA 3HKDB 3C5WP 3OT1B 2G8NA 4FFDA 3RS4A 1K06A 3B78A 4EGSA 2OYRA 1G7TA 5DM60 2LCFA 4GKJB 5HQ3B 1KMQA 1N2JA 1F2UB 3ZXIA 5AJXA 3ZZUA 4TS4A 3AVVA 1OBFO 1CVIA 4BFSA 2OGTA 1ODLA 2NGRA 2DBYA 5JC8A 1C0LA 2HYIC 3A28A 5I3ZA 3UXMA 5C5EA 5KTKA 4L9SA 5NLLA 3QFTA 4JBHA 3BFVA 3JAWB 2BFEB 3TLKA 2ZIWB 5SICE 3VDRA 2IWHA 3WLMA 2DWQA 5EFZA 5JS6A 1Y9DA 3H8VA 2Q7XA 2ZOSA 3PD1A 5IN5A 1OV6A 1YA8A 3SHVA 2PUWA 2PH3A 1T2NA 4B87A 4AKIA 2VK2A 3QU5A 4N7MA 1A76A 4ZQCB 2C7QA 4R83A 4RHUA 5C53B 3TVDA 2ZUEA 1ZOOA 3PX3A 4BWFB 1BMDA 3H2KA 5DHFA 4BRZA 2AX3A 5A9TA 1S3GA 3G89A 4IAOA 2WYOA 2LXNA 1R00A 1TB4A 2YS6A 1W47A 1JAZA 3D43A 4LBVA 4PIMA 3FRIA 1JDNA 1MCZA 2VUIB 4YUAA 3R41A 3HP1A 3DZGA 4KQXA 3UH0A 3RUHA 4A23A 1NVAA 4DCNA 3DEZA 3I9V1 4LJ5A 3VR0A 1D3AA 4IL5A 1BG6A 2REBA 1S2IA 3FKQA 4LX8A 4QZVA 2X41A 1RKXA 2NO6A 4RK1A 3T4XA 1PX0A 2R85A 5I7WA 3WGGA 1INLA 3G2HA 3OEYA 5BYAA 8AT1A 2CXUA 1GG2A 1MDBA 3AY6A 1JHAA 2FB9A 3QKTA 2QX4A 4GW3A 4UBKA 5AW0A 1XCMA 3NHBA 4GPZA 3EJWA 1D1PA 3IUMA 5C37A 5EIHA 3DEAA 3THOA 1RWQA 4EK9A 3MJHA 2QTMA 3QG5A 2BI8A 1K98A 1ZGZA 2H07A 3GZNA 4B6SA 3NTRA 1VSTA 2YXBA 1T9DA 4LY9A 1FYDA 2C78A 4XIYA 3OZRA 3DSRA 2I7XA 5FI3A 3DBIA 3RUPA 3R5XA 4Q1BA 1GTZA 2W6PA 3ZW8A 2H7XA 4B0PA 1YJAA 3HBMA 2WC1A 3PKJA 1T1RA 4F2HA 3U56A 4P0PB 1CRPA 4NCBA 1SBYA 1ULAA 4C0BA 3K96A 2WQ7A 5LKRA 1KPHA 1U28C 3IV9A 3QVJA 4LE1A 3V4OA 4HX2A 4OXKA 1EGVB 3W06A 4HJXA 4FU0A 5DGHA 4JQSA 4FX5A 2WSYB 2EFGA 1N9ZA 2XNDD 3S5JA 1RNLA 1QM5A 3WC4A 1SQGA 4LOAA 2WTBA 4AROA 4E6EA 2VQ6A 1WXWA 1GPMA 4FFBB 1X1EA 2GS9A 1QCDA 2CDAA 2PDAA 1KVTA 3OUZA 1EFRA 1S2DA 2HADA 3EW7A 1G60A 3I4CA 1VQ1A 1VSUA 2VN8A 2BBSA 3SC6A 2VJDA 1I30A 1IRIA 1WHSB 3LM8A 4BTLA 1XU4A 4X66B 3LXXA 4MB2A 1P6QA 3H5TA 1T9CA 1UC5B 2LR0A 2P27A 4FQ7A 3PHCA 4IS2A 5AI6A 2ZANA 4ZJUA 5KS2A 3VYUB 4URHA 2ZSDA 4X61A 1VG8A 2GAJA 1UBTS 4NONA 2AH5A 4AZVA 2NPOA