4M1YA

Crystal structure of small molecule vinylsulfonamide 15 covalently bound to k-ras g12c
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
168
structure length
162
Chain Sequence
b'MTEYKLVVVGACGVGKSALTIQLIQNHFVDEEDSYRKQVVIDGETSLLDILDTAGEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords K-Ras GTPase
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 59
structure length 162
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m1yA00
3PUYA 1CBUA 4BFZA 3K09A 3LQQA 4AWXA 721PA 4Q7MB 4F4JA 3A4MA 3RVBA 1KMQA 4JSTA 3HWSA 1Z22A 3SEAA 1ZIPA 5EQTA 3SS8A 2FA9A 4X8LA 2ZS8A 4LY6A 1XD2A 3E70C 4TMVA 4A2PA 4D2IA 1GVNB 1C4OA 4HATA 4I1OA 4KYIB 3A1SA 2VPPA 4D0NA 3EZ2A 4AYTA 4DUGA 4QKQA 3AQ4A 5GJCA 4ACBA 4GRAA 4W5HA 1E9RA 1AZTA 3BJIC 5CK4A 5C2JB 4Z54A 4A36A 4LOAA 3ZZTA 1I2DA 5F9FA 1T9HA 4H1VA 1H8EA 3QY0A 3CZQA 3ND8A 3SZRA 1T0JB 4BRUA 2ZI9A 4G5SA 1Z0AA 2ZYUX 3BS4A 4LJ6A 5DSZA 2VQSA 1XTIA 1MO5A 2PX0A 2YHSA 1K8RA 4Q9LA 1OXSC 4BZQA 2DFNA 1WBDA 2ORWA 2XB2A 4EDHA 4QBIA 3KJEA 5BXQC 2BVNA 2REXB 5H1YA 4A0FA 5FTJA 3TBKA 2FN4A 1UKVY 4HUQA 1S9DA 4MGIR 4NDZA 4A6PA 1EESA 5IT5A 4JLDA 1E4YA 3KXIA 2NG1A 2O8EA 1G7TA 4TMKA 2IUSA 4P4SB 4R7ZA 2IXEA 2GCPA 3GJ7A 3QBTA 3Q3JB 5CLQA 4XH9B 3H86A 4R98A 4BASA 3G82C 2OV2A 4EFLA 2W6JA 3AB3A 1OIXA 4M9SA 3VMFA 3K09C 4W9MC 5TV2A 1CR2A 3QPUA 4FI3C 4QM6A 4IXNA 2VA8A 5GJWC 1P2TA 5FR2A 1TU4A 4U00A 2ORIA 3O8RA 1C1YA 2FMXA 3BBPA 2EFGA 4F38A 4JLNA 2P0EA 3NBYC 4UNQA 4AG5A 5AUPB 1J99A 1KI6A 1AS3A 3W3ZB 4M1MA 4DT1A 5C18A 3X1YA 4ITRC 4AY2A 4CF7A 2QQ0A 1YZLA 3FKQA 4HI0E 4KFUA 3GD7A 3MWJA 2RB4A 5FL3A 5K8LA 2ZRLA 1NG9A 1GITA 2ZRMA 1EX6A 3TK1A 3DMDA 3EPHA 4BLOA 1G5PA 4IRUB 1KO8A 5FPYA 4DDWA 3LLUA 4V0ME 4EFNA 4CEIA 3QE0A 5AUNB 3LDAA 1VIYA 1YZKA 3NH9A 3FHTA 1PLKA 1CR0A 2W83A 4XVUA 2EFDB 1PJRA 2WOJA 1N6RA 4RFSA 4TMZA 4I1UA 3REGA 4EAQA 1U2RA 2JJ8A 4HLDA 1F6BA 3CBQA 5AUOB 3SE0A 2ZXUA 3FHOA 1R5NA 4OHXA 4XJXA 4EFMA 1OIVA 3UG6A 2NOAA 2GESA 5J47A 5BN3A 1EWQA 1K6MA 3RS2A 4PC7A 3WY9A 2PZFA 5DIFA 2R65A 4LRWA 1TUEA 1S3GA 4MKHA 3QXXA 1KZ7B 2AK2A 3A4NA 1N5IA 2ZE8A 4U5XA 1P9RA 2GAAA 3CRW1 5KSPA 5FOSA 4B3BA 3BGWA 2O8DA 4GP7A 4PPQA 3GPLA 2F6RA 4LHWA 3FE2A 2Z4RA 2QGZA 2V9PA 4LYFA 4TL7A 3WMEA 1VYVA 1YKSA 3GLGA 1OB5A 3SBDA 4QGGA 1M1YE 2JEOA 5BQ5A 3SQXA 4Z1MA 2JLYA 4AKIA 2JGNA 4Q4JB 4RD1A 5KTYA 4NYJR 5AJXA 1IN8A 1GWNA 4PAOA 1FX0B 3SR0A 2C8VA 4RZ3A 3CWQA 1M7GA 4JYCA 4EQ6B 3T34A 2NO1A 1Z07A 4QHSA 4E22A 4IEEA 2OCAA 2ZRHA 2J1LA 4O0MA 4BWYA 3LVRE 1KYIA 2Q9BA 4PHFA 3T5DA 3TUIC 3PEYA 5TDHA 4XTCS 1R10A 2GEDA 3AKCA 2UZIR 4B76A 2QENA 1II8A 4US1R 1KO5A 3KTAB 3AKYA 2O8FB 2EFEB 5KU1A 5CM9C 5CK5A 1SVKA 1GTVA 3VX3A 4GDFA 1UKYA 5D3QA 2DFKB 1JXMA 3W5JA 3CR7A 4JVMA 1I2MA 3FMFA 1ETUA 2RKOA 4RKFA 2QA5A 1VMAA 2X2EA 3THYB 1G18A 4ZKEA 3IUYA 4NYIR 2CVHA 3THWA 4B3CA 4QJ4A 1P6XA 1VHTA 2VH5R 3VFDA 2HDNB 5JS7A 1E2MA 1GILA 3PENA 3S1AA 4A0GA 4M21A 5F3WB 2XAUA 2G3YA 4GMDA 3U6KA 3OAAA 5L3RA 5KOYA 1OH5A 3CPJB 5HCNA 3D6TB 2XZPA 1Q1EA 3DM9B 2ZRIA 4II7A 4CZ2A 2CLDX 3U7HB 3NDPA 2XX3A 4AD8A 1KK3A 1Q1BA 4OQNA 1TADA 4M1OA 2A78A 4G5RA 4PANA 2GJ8A 5DNYB 2W2XA 3A37A 4Z51A 4LWZA 2ZYTX 2OILA 3RC8A 1MRSA 1WB9A 1UDWA 1W4RA 4MRNA 3OZXA 4FIDA 3WHLA 5HKKA 1W7AA 2ZI5A 3WBKA 2J7PA 4DCTA 2XTZA 4OHWA 5EZ6B 4YDHB 3I61A 1P9NA 2VSXA 2ZJYA 4HDCA 4B35A 5EXSA 2FGJA 2WJHA 3ZD7A 2ZE5A 2GDJA 1Z0JA 4FMCB 4UQOA 2FEMA 2ZSFA 3K0AA 3W90A 1E0AA 2OZEA 3BB3A 4DRZA 3I5XA 2HCJB 2GK7A 3ZZ0A 1YZNA 4LPKA 2VF7A 4DEYA 4TLBA 5L8VA 1DOAA 1YZUA 2NO9A 2DWQA 1R8QA 4LX0A 1F5NA 2P5TB 1R2QA 1GKIA 1LF5A 3CF2A 4TT3D 3U4QA 1KZGB 2OBMA 1HT2E 3K70B 4OI2A 4WA7A 4Q66C 1AIPA 2W00A 4G3XA 3RS7A 1HEIA 3BOSA 2N46A 3ZGXA 3ZIAD 4RKEA 4PQFA 4ZV4A 1XEXA 3W6OA 4Q1FA 4LDJA 1U8ZA 2ZQ5A 1RRGA 3SBEA 2YWEA 1OV4A 2BM0A 2VP2A 2C2HA 2FFQA 1OFHA 1VCMA 2P6UA 5DI3B 1NIJA 1IXSB 1EFCA 2IYWA 2QI9C 4PSKA 5EXTA 2PZGA 4YQFA 4DDTA 4B6FA 4AYWA 3MAAC 3WP0A 1NKSA 3ZLJA 2OG2A 1VG1A 1YRBA 2C99A 2P67A 3WRXC 5KDDA 1Q21A 3VAAA 2HLDD 3L2OB 4EPXA 421PA 1XU4A 4L8GA 1QHYA 1W48A 5FTMA 3U61B 1XTRA 1SVIA 2MSEB 4NKRA 3UMRA 4KLNA 3RS0A 4BFTA 2PX3A 3TQFA 4GOJA 1IXZA 1XTKA 2YV5A 3QQ5A 3EARA 3FKSA 3FOZA 3QSYA 3NHBA 4PZYA 1SGWA 2GKSA 1CJTC 1CIPA 3CWZA 1G3QA 2PL3A 3SNHA 3ZVLA 1QHNA 1QHGA 2NPIA 2OT3B 2GETA 4GI7A 1E6CA 2J0VA 3ZZUA 3U7FB 4WXPA 3T15A 3GJ4A 3QVVA 3MG9A 1G4AE 4HDQB 3P27A 2VHTA 2J59A 1DAFA 1L7VC 2QP4A 1S1MA 3SQWA 3HR8A 4NYMQ 3THXB 2EYUA 1ZD8A 4BFVA 1YR8A 3B2EA 3RRZA 2IYLD 2HV8A 3EIHA 4IOKA 5J4HA 4KVAA 4CEJA 3W6NA 1TEVA 3SDZA 2PBRA 3CH4B 2ZTSA 2NPFA 3CX6A 2REBA 3MJRA 3WNBA 2ODWA 1E4VA 2VP9A 3A4LA 1QHIA 4HAUA 3CRRA 2ASEA 3CR8A 3O47A 3C4JA 3U44A 4IOLA 1WDTA 3TIFA 3K9HA 2F3RA 1CRQA 3AVXA 1IBRA 3CX7A 4OQFA 4QM7A 4M1YA 4ASUD 2ZR0A 4A8JC 3DOEA 4B3XA 4W5JA 3HPRA 2SHKA 1W0KA 1IJEA 1JR3E 4NCIA 4HLUC 1ZU5A 2BOVA 1P7CA 2ZRCA 5GVSA 1LNZA 5EXPA 4JL5A 2IHYA 1RJ9A 4PHGA 2YWHA 5SZHB 3U60B 4MQBA 1YRAA 1TEXA 1CP2A 2AD1A 2B7BA 3LW8A 2ZU6A 1RYHA 3KKNA 5C4GB 3CM0A 5BN5A 1NKTA 1OKKA 1T8TA 5ELXA 4IOJA 1N6PA 2QPOA 4RY2A 3ZS8A 1R0YA 3GLHB 4FW9A 4HAYA 3TGPA 4D0LB 4D4JA 1PUIA 2IYXA 1SVLA 2CLCX 2VP4A 1DVRA 1GKUB 1X6VA 1J7KA 2W2TA 4Q1BA 3SJZA 2ZE6A 4DEXA 1MOZA 4B6EA 1T3HA 4B3FX 1G4UR 1V5WA 3B85A 3RHFA 5A5GA 2B8TA 5JBQA 3CX8A 2W6IA 2WVJA 4UJ3A 2ONKA 3A1TA 2RGGA 3I32A 3QXSA 5D3MB 4GL2A 2CK3D 3GP8A 1ZRHA 2HXSA 1N0VC 2ZSBA 3FMIA 5HZKA 1F2UA 1XZPA 3CF0A 3IIMA 2F1JA 2C96A 3J81k 4TQUS 3B13B 3D31A 2FSGA 4PPGA 2Q9CA 5JWOA 5GJVC 3IEUA 5F9HA 2FF7A 1KDOA 2IS6A 4PZLA 4XIGS 3IKJA 1FNMA 3E2IA 3HJNA 1JNYA 4ZKDA 4I99A 4JZKA 3ZDQA 3K0EA 2C5LA 1U8YA 1VECA 4A92A 2VP5A 3V9PA 4KLZA 1ZVQA 4BZPA 2WMOB 1KK0A 3DO6A 3EAQA 3EWSA 2WHXA 3BB4A 1U98A 4BUJA 5E95A 4Q02A 1KY3A 3HU3A 1T0HB 1IN6A 1T8UA 3EX7C 1UKEA 3EW9A 3NBZC 1XBTA 5DYGA 3B7GA 2IEYA 1RRPA 4TSFD 3W6PA 1NVVQ 2Z43A 4LPSA 3ZYCA 1XD8A 3I3SR 1E2DA 5JZVA 3QF4B 3DZ8A 1OFUX 3V00A 3TLXA 5KNBA 2JAQA 4TT3A 1QG4A 1NVXQ 5JHGB 3NH6A 2V6JA 4KHZA 3OIYA 4M8NE 8OHMA 1N6HA 1UAAA 1ZP6A 2WKPA 4P33A 1JR3D 3D7MA 3BK7A 3KX2A 4DSTA 1ZUHA 3V4FA 4FCTA 4GP6A 4HZIA 2CL7X 5CB6A 1JALA 1AJEA 4NCHA 4HB2A 3B82A 1E9EA 2BDTA 3AKEA 4P3YA 4QXAA 1IQPA 2O8BA 3GLFA 1HH4A 3GLIE 2F9LA 1KK2A 2C98A 1CR1A 4LV6A 2C9YA 2RGNA 4YMUA 2H57A 2PCLA 2CCKA 4OQMA 4EJSC 3A8TA 2WKRA 4ZCLA 2IYUA 5SZJA 3L82B 4UNRA 2NO0A 2HLDA 2OSBA 1X8KA 3K0FB 2QPTA 2CXXA 2GCOB 1P5ZB 4YXWD 2ZR9A 3CF6R 3RYTC 1W49A 2AR7A 1MR3F 2EWWA 4NE2A 3H84A 2GXQA 5DLQC 2GXUA 4IW3B 3FMOB 4XTRA 3KUDA 6Q21A 1QF9A 1GDDA 4RCYA 3R8FA 4C0AC 3AH8A 4M2LA 4H9GA 4KODA 4M1SA 4US0R 4C0KA 2DYKA 1MH1A 1PZNA 2J41A 5KPDA 3VNUA 4DDUA 3QG5A 3Q85A 2FE4A 5FTNA 4FCWA 4IFBA 1CULC 4URWR 1GL6A 4XWOA 3UXMA 4QC2A 2GJKA 3T1VA 2O5VA 4NCNA 2VHCA 2AXNA 3QVUA 4M22A 4GOKA 1FZQA 1S2MA 2FPLA 1CTQA 1KJZA 2WJIA 4B43A 4ZDIA 4FMBB 3EASA 4KBFA 1M74A 1MO6A 5DHFA 2QMEA 1NF3A 2YC4C 1OE0A 1DAIA 5J4LA 1XD2B 1HE8B 3KFVA 1NLYA 4PFSA 1VCOA 4OK3A 1U0HC 4AKHA 1TTTA 3CLVA 2OXCA 1JAIA 2PH1A 5CB8A 4L4UA 3NG1A 1N25A 1SVOA 5JRJA 2RGNC 1JJVA 1XCGB 3F3YA 3I73A 3PEVA 2BMFA 1NBMA 3QPWA 4ASUA 4BFUA 4QOSA 1UEIA 4RCZA 2QRNA 3REFA 1XMVA 2RGXA 2J0UA 1OLOA 4IDOA 2Z83A 3D8BA 2HF8A 2V7QA 1D6JA 4HUQB 1DBSA 1E32A 1HYQA 1JECA 2A30A 2QN6A 4HUTA 2JLWA 2BWJA 4Q4AA 3EPLA 2AFIE 3FDIA 2CLSA 2O8EB 2EFHB 4KVGA 1R4AA 1TMKA 4Q7LA 1G9XA 2IUUA 1Y3AA 4E03A 1ZINA 3B78A 1ZM4A 1SHZA 2CJWA 2B92A 2MMGA 2KJQA 3D3QA 4L16A 1W36D 3TR0A 5JHHB 3C41J 1Q3TA 1VKJA 3OEEA 2A5JA 3AGPA 3I72A 3T1TA 2P6RA 3KQHA 2FZ4A 4GMXA 1RRFA 4DT1B 2CK3A 2WKQA 2BC9A 1E99A 1Z08A 5JCPA 4RZUA 1ZUNB 1G8HA 4TYNA 1OIWA 2YKGA 4P0TA 3BH0A 2CCGA 2JJ2D 3WBJA 3CNNA 4IKEA 1OW3B 1GFIA 4Z8XA 1RZ3A 5FI1B 3DOFA 3T5GA 1NSTA 5LB2A 2FSFA 3RNLA 1R5BA 1W1WA 3LA6A 3CRVA 4MDFA 4QFMA 2QZ4A 4YMTA 2IYZA 1SQ5A 4RFSB 1CF4A 4FWTA 4TTQA 2ZVQX 1MRNA 4BLSA 2C9CA 3KFXA 3CRQA 5K8UA 3M6AA 4MYCA 4D81A 3PXGA 2X19A 5TVKA 2VBCA 3PQCA 1R6BX 3LBHA 5EE9A 3PVSA 2C9OA 1E9AA 4JLAA 1N0WA 2HCBA 4IVQA 3UANA 3C7KA 3OIVA 5DO9A 1BS1A 1G3RA 3AVOA 4MGYR 1H65A 3CZPA 3AEZA 4OI1A 1YVDA 1GRNA 1XB2A 2XSZD 3HP1A 3IBYA 4K8OA 2G88A 2O8DB 2FOLA 1N6OA 2GBLA 3TUJC 2J9RA 3GLGB 4BFYA 3DKVA 2OLJA 5G53C 1Z63A 2WSSD 1VPLA 2AHOA 1FMLA 3B1XA 3SJBA 2PEYA 5KHOC 4RFVA 1KTVA 1AK2A 1K5DA 1KO7A 1Q44A 2P65A 3UATA 4ERNA 2Z6VA 4B75A 4RD0A 3WYGA 4DHEA 2LKCA 5FOWA 4Q9HA 4BLRA 2BCGY 1KNQA 1U94A 2IYYA 2JDIA 2ZE7A 4Q01A 2WWYA 3EPKA 1W4CA 4TZ6A 1WF3A 4A2QA 4ZI2A 2UKDA 2O0JA 4NZYA 3VR5A 3VKWA 1RW4A 1J70A 5C46F 1DELA 1II8B 1DO2A 2QT0A 3FWYA 2VHUA 3B9PA 1KI9A 1YJ5A 2JLSA 4W7SA 2E9SA 3AF0A 4URYR 1VDZA 5FBQB 3ZD6A 3AP2A 1GSIA 4YXWA 1VCIA 5L3SA 1E79D 1KI7A 2AK3A 4EPYA 1SXJB 4K46A 3FFBA 2WICA 4ZIRA 2DFTA 3THWB 2OCYC 4LBYA 4PO8A 5FI0B 2ZRJA 4CT4B 1G8FA 1XTQA 2QP9X 3SYLA 3FVQA 2IWHA 1DG3A 2R44A 3S1AB 2OHFA 1TU3A 1EG7A 1N6LA 1YHNA 5EE0A 4C0BA 1UDXA 1FL9A 3VTKA 4NHOA 4ARZB 2ZJOA 3ZJYA 4XSHA 2GBLC 1E1RA 5IHPA 1JQJC 1X1SA 2WSMA 4HEJA 1JR6A 5H8WA 4LV8B 3GQBA 5FOUA 3ZQJA 1PV4A 3V4RA 5P21A 5C4MA 4A9AA 3AUYA 1LTQA 4IXMA 4KFSA 1IY0A 4DLUA 4YMVA 2H1LA 4Q9KA 1YU9A 3BWDD 4PC3A 5KSYA 1FP6A 1ZNYA 3T61A 1BO6A 4FMCF 4P4UA 1DEKA 2OFWA 4LI0A 2FFAA 1SZPA 1T3SA 4DLSA 1TQ6A 1W0JA 5FUVA 1U0JA 5SZKB 3ADCA 1E98A 4OBEA 1UKZA 2QAJA 4GT1A 2J5XA 2ZAMA 2WJJA 3QIAA 3WNDA 4B71A 1OB2A 3K0AB 5FPHA 2H8KA 1YQTA 3TQCA 2NZ8A 2GNOA 4E5UA 1XXHA 3I62A 3VR2A 1H8HA 4HAZA 5TY0A 2Q6TA 2WMNB 1ZIOA 2WIBA 3KB2A 2C77A 1IN7A 1S4QA 5C1BA 2VP6A 5CDFE 1OH7A 5B2ZA 2ECKA 1Q12A 5JJIA 1XJCA 2ZPTX 3U4QB 4KU4A 3SOPA 1RRCA 3H2YA 3DDCA 2UVQA 1TPZA 4LC1A 4QJ3A 3AGQA 3EG5A 2OXRA 3VU9B 3IEVA 3B8HA 4C0LA 3K1JA 4RD3A 2J0SA 5EP3A 4OJQA 1ZYUA 1E0SA 4JKYA 3RS3A 2Z5FA 1MV5A 5G41A 4PSVA 4D4KA 1GP2A 1Z6XA 5L3QA 2FFHA 3CNLA 4HLCA 2JLUA 1QVRA 3B60A 2QP3A 3WMGA 4C2UA 3K53A 1SVWA 2PJRA 5JWRA 1ZAKA 3I8XA 3EXAA 4OK5A 5TMPA 3SI7A 3QOFA 4PAMA 5H68A 4URVR 3QEJA 4OHZA 5G40A 2JJ2A 4D82A 5FBLB 1OH6A 2Q3HA 4GBMA 4IDNA 2QAGC 3CONA 4I1SA 3BH7A 2WWFA 1DADA 1LF0A 2ZYWX 2QUZA 5KPJA 4RVCA 1IOZA 1Q20A 3TKLA 3C15C 3IQXA 1FOEB 3RS4A 1JB1A 3KKMA 4WVFA 2GXSA 3LNCA 3NEYA 3QBVA 5EUMA 4IVPA 1COWD 1EFTA 1Z3IX 1E0KA 4LHXA 1BIFA 4B32A 1GRRA 2H18A 3PEUA 4FD2A 3P32A 4B48A 2WWGA 3R9XA 1UBFA 3BIFA 2YOFA 2IBMA 4A0HA 1WBBA 1D2NA 2MSCB 4CGZA 3LO5A 4JLOA 4YMWA 2BKEA 4HAXA 1G5TA 4HLQB 1YZGA 3BORA 3C5CA 4URXR 2QTFA 4PHHA 1E2HA 2D4HA 3TVTA 2XSZA 2XJ4A 4IVRA 4RZXA 4RD4A 1E2IA 3PUXA 4CEJB 2R6FA 3BRWD 1G19A 1W36C 4NCKA 1N5LA 4V0NA 2ZRNA 2WSSA 2PLRA 2ZJBA 5E7MA 4JLJA 5JMTA 3GLHE 1CXZA 5AJWA 3HDTA 4TQAA 1OSNA 4QNMA 1D8TA 2QNRA 2H16A 1GL9B 5DISB 5H70A 3A1UA 4O2LA 4DLTA 1I4DD 3E1SA 3P4YA 4HB0A 4U02A 3GCGA 2A5YB 2N42A 3EIEA 2HYIC 1GNRA 3ZS9A 1Z83A 5TARA 1U8AA 1RJ9B 1S96A 4KSBA 3KJIA 2K5UA 1Z6YA 2MSDB 3QXHA 5G3ZA 1NVWQ 1TQ2A 4LSGA 3KDSE 4CW7A 4D4MA 4DZZA 4LCBA 2B8WA 3CO5A 3DPUA 4ILEA 3HR7A 4NYMR 1E79A 2I1VB 4FINA 2ODBA 1BOFA 1KMHA 4PHTA 5IK2D 5JLJA 2ZANA 1A1VA 3ICEA 4JMPA 1ANKA 3DVLA 5FUXA 1Z47A 2WIAA 1CU1A 4N0EA 5LD2C 4RD6A 5AR1A 2ZIAA 2ZI4A 4OJKA 4IDQA 1M7BA 4QGHA 1EX7A 5FUWA 1R0WA 1T4GA 3CUEF 3IIJA 1F2UB 4GZMA 4DSOA 5JSZA 2AFHE 3PUVA 4KFRA 1LV7A 5DE3A 5A0FA 2W0SA 3LH5A 4AIIA 1CJMA 1A2KC 4Q19A 5DI9A 3WHKA 4R2IA 1GNPA 4A8JA 4JIMA 4Q4JA 1F2TA 5HZHA 1DS6A 1XMSA 4MYUA 2VLIA 2J45A 2V3CC 3CW2A 4R2HA 1T5LA 1XMJA 2G1KA 4HLUA 3UMSA 121PA 4EQ6A 4JL6A 4YLGA 5JJLA 3QJYA 4UNPA 4YONB 4LBWA 1YZTA 1ZM7A 2WAYA 4QRHA 3TW4A 1G21E 3K0CA 3KQLA 1XEWY 4Q1AA 3LX5A 1FNNA 1NMZA 5EUQB 3EWAA 3AVUA 4ZO4A 2FV8A 3WNCA 3OIWA 2FSIA 3CPEA 2HUPA 4P32A 4I1VA 1X8LA 3OFND 4WZAE 4OQLA 5EP4A 4E07A 2XTMA 1G20E 1LY1A 2B6HA 4Q4LA 3U7EB 4JVLA 3QKTA 3QENA 2ERYA 2AN9A 3VX4A 1E9FA 4NCJA 3NIBA 4XWKA 1VHLA 1FW6A 4UNNA 1P62B 3RAPR 1P60A 3A1VA 2H17A 4DWJA 1TF7A 4BFWA 3FGNA 2ZRFA 2V55B 1MABB 4DLYA 1RYFA 1FMJA 1W5SA 2W58A 1ZU4A 1A2BA 4KO8A 1VG8A 2HT1A 2H92A 4TL8A 2IYTA 3WYAA 1II9A 4MKFA 4JKIA 2ZSAA 4L9WA 4MUAA 2TMKA 4LZZA 4ZCIA 2D7CA 2VL7A 2O8BB 3GLFB 5J40A 4MITA 1UBEA 3L43A 4C9BA 1XPOA 1AA9A 3C14C 2BMEA 4E09A 3LFUA 4TLEA 2YOGA 1JJ7A 2OFOA 3A58B 3GEIA 3N2IA 3CKLA 5FL7D 3FMPB 3SU8A 1AS2A 1W47A 3TW8B 4Q9IA 4YDSA 1NJGA 1NVVR 1M2OB 2CHVA 1AZSC 3BXZA 2GZHA 1R0ZA 3K0CC 3K0SA 2PT7A 2CEAA 2CVFA 1XEFA 2GA8A 4IHQA 3RC3A 2VHQA 2BBOA 2G9NA 4V0OA 2J7KA 4JJKA 2FH5B 1KSJA 1CLUA 2KB0A 2XXAA 2C03A 3Q9LA 1COWA 2NQ2C 1KJYA 1GNQA 4NU0A 2OBLA 3DKPA 4JT4A 1HV8A 4V0MA 3L8YA 1US8A 4LBVA 1J8MF 2CL6X 4Q47A 2KBFA 1GIAA 2Q0HA 4JLBA 3NHAA 3SN6A 3IGFA 2GK6A 4M1KA 2VRWA 2O0HA 4L15A 1ZW6A 2V4ZA 2ZRGA 4PSAA 3I8SA 4NPHA 3QKUA 3ASYA 2A5GA 1ZM3A 4PZZA 1KY2A 1GKYA 4JS0A 1L4YA 2OBNA 3GFPA 2GWHA 3K9NA 3B9QA 4EJSA 2AWNA 1NL3A 4DB2A 2F9MA 5DI3A 2GZAA 2EU8A 1DARA 1D2EA 5FUYA 4XWAA 2YNMA 4LJYA 4WZ6A 5CIWA 2R8RA 1F60A 1QDEA 1D9XA 2ODEA 2VIIA 3TSWA 1NN0A 4AKGA 1Z2CA 2HXYA 2BBTA 3AF3A 2FWRA 4TLDA 2I3BA 1LS6A 2ZJ2A 3ADKA 3L0SA 4I4LA 4QNRA 3UPUA 2GEUA 1EFUA 4IJMA 3NBFA 5AUQA 3AVWA 1OFTA 4MRVA 1E96A 2J3EA 2J0UB 5B64A 3JVUA 1K5GA 4I81A 4NH0A 1KGDA 1TNDA 5K8IA 2OFXA 2XNDD 2OAP1 3LY5A 2DFLA 4DDVA 2V1UA 4CIDA 5KSZA 2ZU0C 1G3UA 3KB1A 2ODNA 3W8RA 2C95A 3ND9A 3GMTA 3OEHD 5SZIA 2FPKA 5FOVA 1QHXA 3SHWA 1KI4A 1RPZA 2F43A 2FFBA 3ETLA 5FH9A 1UFQA 5HTKA 1XMIA 3ZIAA 2DPXA 4OK6A 3FHCB 2CJWB 3KXLA 1W4AA 2PJZA 3IILA 3AP1A 3PUZA 2QMUA 4FN5A 3SYNA 1VYTA 4C0QC 3K70C 4NMMA 2FNAA 5IK2A 5KSOA 1E9BA 3ADDA 1UF9A 1G3IA 1HA3A 1XD9A 2FEOA 4QHTA 4JLMA 2G0TA 2WWWA 3T12A 1E9CA 5EE3A 1U90A 4BEJA 2L0XA 2R6DA 1RFLA 3CPHA 4A6XA 2ZM5A 3LLMA 5UKDA 4TMXA 3VQTA 3HU1A 3BAFA 5EP1A 2IWRA 4AK9A 2JATA 3VR3A 4LHZA 2ZRKA 3U5ZB 4AKEA 1IN4A 1E9SA 2JLVA 1CKEA 1X86B 1ZUIA 1H8ED 1P75A 4AC9A 4KSCA 2QE7D 1E2KA 2ZRBA 3E5HA 1G41A 1N5KA 1Z0IA 3SHFA 1GAJA 4LHYA 5CIQA 3GLGE 3Q5EA 2IHBA 4B74A 1WA5A 3HYRA 2GZDA 5JEDA 1RE0A 4ZPXA 1IY1A 3T35A 3I92A 4PR0A 5JS8A 4TYQA 1N3BA 1GOTA 2QBYA 4CEHA 2IK8A 2R2AA 4KAXA 2WV9A 3BERA 2A2ZA 2QL6A 3QNUA 1SKQA 2OO7A 4OI0A 3TUZC 4XOIA 2J46A 3QKRA 3B1ZA 4PQRA 4C7OA 1KDRA 1OPXA 2E87A 2AKYA 1NMYA 2O8CA 1EK0A 2GCNA 3OFNA 4UKDA 2YWFA 4NL4H 4B47A 4KJZA 2W6JD 2FG5A 2R9VA 4DCSA 4N0DA 4QBHA 4DXAA 4ZI3A 2BBSA 3W9YA 4IFEA 2IW3A 4OKSA 1MKYA 4M53A 3TSOA 1DG1G 5AJYA 2UZ3A 1KI2A 3PG5A 5FBRB 2NIPA 3M1IA 1NNEA 5D3MA 3X1XA 2WM9B 1G8YA 1LS1A 1SXJE 2C04A 2GJSA 4G5GA 4NBSA 2DWPA 1XRJA 3B1WA 3MWYW 4F93B 2I4IA 4FXPA 2IXGA 4DB4A 3AF4A 2F55A 2OCBA 3W3AA 5BWMA 2ZS7A 3PCRB 4FMDF 3R8CA 2RGBA 3UMFA 3T1QA 4M4SA 4K81B 1RVDA 2HT6A 1SULA 3VKHA 3EC2A 1UBCA 4MDEA 1A82A 3NBXX 1E2QA 4IDPA 521PA 1RC8A 1EGAA 2AL7A 5CM8B 1Z2AA 4GFDA 1IXRC 2ZROA 4HZUA 2IS4A 2WAXA 4LV5B 3LBNA 5E3HA 5FPTA 4DSUA 3R9IA 2DB3A 4A0RA 2CL0X 5L3SB 1WMSA 2YYZA 3VR1A 1G6OA 2PLFA 4ZIRB 2LWIA 4O2RA 4BQSA 1KJWA 4Q18A 2A3RA 2FJUA 2GTPA 3U3RA 3PJRA 5GVRA 1W4BA 4XSGA 1AQYA 1DPFA 1P61B 1U99A 4TMWA 3X1DA 1M8PA 3CNOA 4LJ5A 5TB5A 3T1OA 2P6NA 2XZLA 3KKQA 3EZFA 2JASA 3RABA 2HEIA 1KI6B 3BD9A 1L2TA 5FTLA 3P20A 1M6NA 2OLKA 1L8QA 3KQUA 4MYTA 4O25A 2D2FA 4TYWA 4G1UC 1LW7A 1PLJA 2AD5A 1WRBA 2GF0A 4Q1EA 1NIPA 3ONWA 5J4YA 4HAVA 4CEIB 1KI3A 1U81A 5F2EA 3O8BA 3ICQB 1E1QD 4PC2A 4PO1A 4MUBA 2DCUA 2GRJA 5CYPA 3A1WA 1XJQA 3EZ6A 5CJ2A 2IX3A 3EPJA 1E0JA 1GRQA 4MKGA 3ECCA 2CCJA 4W5WA 1JPNA 3W8NA 3VHXA 4DLWA 1A5TA 4AURA 5M04A 4TSFA 3K0FA 4JLVA 4B34A 1XXHB 2OM2A 4RZ2A 3P1JA 1XTJA 1JEDA 4PAQA 4S2EA 2BMDA 1N6IA 3RRNA 2BMJA 4B2PA 3PEWA 1SXJD 1WXQA 3GEHA 5HR5A 1VIAA 2XNDA 2ZJ8A 4CYMA 2O52A 1BMFD 2V54A 1UJ2A 3Q72A 2QORA 1G6HA 4GNKA 4C3ZA 2QU8A 1YR7A 3L0IB 4C0JA 1UEJA 1FQJA 3OAAD 1PLLA 1I4LD 1JR3A 4PXAA 5BYJA 2LKDA 1E69A 1ZD9A 2B7CA 2D74A 1G5RA 1N6NA 5KNDA 1ODFA 1W36B 5L3QB 3MD0A 4B44A 1G7CA 2V6IA 2QMHA 4BEBA 2ATXA 1CRPA 3QKSA 1KDTA 4BE7B 1N2CE 3TAHA 2JA1A 2G6BA 5HKKD 3OF5A 4POAA 3AF2A 2J7PD 2YC2C 1IAQA 3KXKA 1MO3A 3NWJA 4FMDB 4KCGA 1KK1A 1BYIA 1T6NA 3IDQA 4Q5IA 2JLRA 4Q4HA 2QE7A 2W0MA 3FYHA 3PITA 1KSGA 1Z29A 5LB4A 3DM5A 1OYYA 2ZJ5A 2ZJAA 4XVRA 2WJYA 4HYYA 2JLQA 1NMXA 2VF8A 3F0TA 4KYUA 5EE5B 2JLXA 4ESHA 1KAOA 5CYOA 4EPVA 4D26A 3KUCA 2CHGA 4UNSA 4PX9A 4RSGA 3M0EA 2FSHA 2D2EA 2X1VA 4IDHA 3A6PC 2KI5A 1R7RA 3UIEA 2QQEA 4DCVA 1HTWA 4EPWA 3R7WA 1P2UA 1FTNA 3GEEA 1KNXA 3RWMB 4Q7JB 2OEPA 1T91A 2OUKA 5EXXA 1FFHA 2BCJQ 2XNSA 1S9HA 1KDPA 4U7DA 1DO0A 1SKYB 5DH9A 5LD2B 3UK6A 2QTVB 1BH2A 1JI0A 1XZQA 2EWVA 3MUFA 1UM8A 3GJ5A 4M1WA 4MYHA 5A4JA 4C30A 1WP9A 2P5SA 2IYVA 1JAHA 3R9WA 1FPMA 4KFTA 3QEOA 4BFXA 2GXAA 4JL8A 5LPNA 1TX4B 1HE1C 2PMKA 2O0KA 3NKVA 5AWFC 5JRZA 1GM5A 4Y0VA 2BM1A 5FPSA 2WBLC 3TR5A 2ZRPA 3L8ZA 2ZYVX 2XEXA 3MWLA 3CRMA 1E2JA 2A5FA 1VCNA 1AGRA 2QAGA 4A4DA 1WE2A 3LX8A 3GJXC 1EFHA 2BHRA 1CEEA 1IN5A 2WPDD 4BZXA 4LHVA 3MRSA 2WZQA 1Z0FA 3SFVA 4D6PA 3A36A 2QSYA 2EQBA 2ZRAA 4D0GA 1QHHA 3IBGA 3AM1A 2BEJA 4LYHA 1UBGA 5K8TA 4A1FA 1KIMA 3ZVRA 1KO4A 1P9WA 3FKSD 4BLQA 1A7JA 5EE1A 5HE8A 5IDVA 4GSYA 3IPYA 3TVDA 5E7JA 1G64A 1XX6A 2IEZA 3C8UA 5BW8A 4MRSA 1VYUA 5AJZA 5JWHA 1KSFX 4UXJA 1S1CA 4AG6A 3MFYA 4TWZA 4PC6A 4RD2A 2P3SA 1OF1A 1G1MA 3BH6A 3IQWA 3JVVA 3OHMA 3GLIA 4ZDJA 4JLPA 3NEJA 4B3GA 1XEXB 1OHHD 221PA 4QBGB 4LYAA 3ADBA 4QHYA 1KMHB 1BYUA 4ACAA 2RGDA 2ONJA 1UADA 3AV0B 2VYFA 4WIAA 1VTKA 3IIKA 3EIQA 1N0UA 2ZETA 3VNVA 4LJ9A 1TAGA 4BLPA 1MT0A 3U7GA 3EA5A 2GVZC 4R71A 2BBWA 5EP2A 1LFDB 2A5DA 2IF0A 5JSZB 2RH5A 3LD9A 1LB1B 5AJVB 5KDLA 2OESA 4GOXA 1XPRA 4KBGA 4JBXA 3N5CA 2ANCA 3NTUA 4A8JB 1NSFA 1NVUQ 2GAOA 2GEVA 1F2TB 2X8AA 3SYKA 3I5YA 4PO9A 4D25A 5KDOA 2WTUA 2VTKA 1DAKA 4TTRA 2IS2A 2NZJA 2IA5A 1TUIA 2NGRA 1E1QA 1SHKA 2OAQ1 3VKGA 2GJ9A 1NLZA 4KITB 1W0KD 3B1VA 3FTQA 2QMOA 3MMPA 1IHUA 4C0SA 3NC0C 3RRYA 2CE2X 4PPFA 1JPJA 1P73A 4EPRA 4PTLA 3F8TA 1G7SA 4PQYA 2XOKD 1KSHA 2WJVA 1TF5A 3K70D 2ORVA 3RDPA 1Z6AA 3GLFE 1OKKD 2P2LA 4BLTA 4P4SA 1Y63A 1OXVA 2XITA 3GJ8A 4UXHA 3TRFA 4EPTA 1X1RA 1W2GA 1A4RA 2QTHA 1SXJA 4NONA 1ZM2A 3QG1A 3AKDA 1AS0A 2KWIA 4DLRA 4F92B 5JI2E 3U2QA 1QVAA 1BMFA 4GPTA 3RWOA 2ZJZA 1IJFA 5B30A 1G291 1Q22A 2W6ID 2IC5A 2CDNA 1S0UA 1ESMA 2HYDA 1D5CA 2AKAB 2GJAA 3B1YA 5CLLA 5TXGA 4S35A 3LWNA 2G83A 2QSZA 4ARZA 1GL7A 1B23P 1XP8A 3U44B 1YR6A 4LUCA 3RSLA 4Q48A 2WWHA 3U3KA 1TQ4A 2OCPA 4DKXA 4GZLA 4L9SA 1UPTA 1E2GA 1F3OA 2VSFA 4JBWA 2YWGA 4WW0A 3U6BA 4Q03A 4NYJQ 1E2LA 4JVSB 1QG2A 3WYFA 4Q21A 5FTKA 3PV0A 3UKDA 4TN1A 2EW1A 3U3JA 3BFKA 4C2TA 4B3DA 2QM7A 3DEFA 2DWOA 3KJHA 5E7IA 2R6AA 5E4FA 1ZC3A 1GZSA 3OE7D 3KQKA 2ZEJA 2ZI3A 1KOFA 2V8OA 2LCFA 1EFRD 4V03A 3K8YA 4DBLC 5KYKA 1R8SA 1ZC4A 3KZ1E 1Z28A 2R6CA 4V0LA 5J5CA 4F91B 4O3MA 2HF9A 2IT1A 1FUKA 1PUJA 1FUUA 1Q3HA 2XXAB 2VSOA 1M34E 3SFZA 3B5JA 4HB3A 4OQXA 3TMKA 1KAGA 2DHRA 1AM4D 1SXJC 2RGCA 2ZVPX 3GJ0A 4NYIQ 1NBME 1US8B 1J2JA 4M9QA 1J8YF 2PZEA 5LBIA 3THOA 2R6GA 1AKYA 3VU9A 3WMFA 2F1RA 4G5OA 5JECA 2CHQA 4TL9A 2GF9A 4DLZA 1AQUA 2Y8EA 2V1XA 4KI0A 3X2SA 2RCNA 2D7DA 2ATVA 3IHWA 5J4VA 1E2EA 4YMSA 1FX0A 3H1TA 4EJSB 1Z06A 4URZR 4BPBA 4BECA 2ZUCA 4Q9JA 1Q0UA 3GJ3A 4DVGA 3MCAA 5AK0A 3PFIA 3UWOA 4LJ7A 2JCSA 1IM2A 2DBYA 2CMKA 4HDOB 1ELOA 3LAWA 1TQDA 3PUWA 1ONBA 2J87A 2XJ9A 1ZJ6A 4DCUA 1IY2A 2BJWA 2WPDA 3KTAA 4LK2A 3HPQA 4OHVA 3VHLB 1II0A 3RANA 3UWKA 2O8FA 4M9ZA 3K9GA 2YINC 4TMTA 1SVMA 3Q8XB 4BFSA 4Z8YA 2EVWX 1EXMA 1OT3A 4DJTA 1OXXK 4PPNA 2JIZD 2QGNA 1Z6GA 4V02A 2YOHA 4OYHA 1G17A 3THYA 2OE2A 2JJ1D 5CJPA 3ZH9B 2ZR7A 4NP6A 4CVNA 3I1FA 3BFXA 1QBKC 3SJCA 1Q1ZA 2WWIA 1ZMXA 2IUTA 4G0NA 3NDBB 2F43B 4XD7D 1S3SA 3KL4A 4N3NA 1OFIA 2RHDA 3ZVMA 1TL7C 2F1IA 4X8OA 4A2WA 2F1HA 3G0HA 1OHHA 1DAEA 1Q57A 4G01B 4OI4A 2ZUDA 4AI6A 4ZDKA 4A15A 3EZ7A 5FOTA 2D62A 3WRYC 5KNCA 2B21A 3G5UA 3AP3A 3T06B 3B6EA 3FPAA 2IYSA 3DZDA 3QF7A 1J90A 3QPVA 1L4UA 2ZS9A 3BC1A 1XNJA 1M7HA 1ZBDA 4UXIA 3CB4A 1LVGA 3MGCA 5HCIA 4KV9A 3U3MA 5JEEA 1G8PA 1O3YA 1S8FA 1E2NA 4JT2A 1NY6A 3WXMA 4LGMA 5BN4A 3OESA 1DE0A 3R20A 1P72A 1WCV1 2RGAA 3TE6A 3Q5DA 5IF9A 1CS4C 5JFGA 1RKBA 1FTSA 2XZOA 2ZI7A 1NBMD 4Q7KA 3MJHA 3O8DA 2CNWD 5KUTA 2GHIA 5BYKA 4B73A 5DGXA 3K9LA 3RLFA 5FBVB 1E94E 1F48A 2E1RA 3IO5A 5FBWB 2QBYB 4CEHB 4B2LA 2V7QD 2KSQA 3I4LA 4D80A 2NTYC 2H7VA 1N5JA 2FX3A 1HUQA 4M0LA 4TQ9A 1NP6A 2XOKA 1DTSA 4Q1CA 3QKRB 4ON9A 1G16A 1RIFA 4M9XA 2NO6A 4MRRA 5DN6D 4C7OB 2G77B 5GADl 2O8CB 1ESNA 4BGDA 3O8CA 2CBZA 3TSZA 2XGJA 2FPMA 3DHWC 1U0LA 3P4XA 3H4MA 3GFTA 3H0KA 4CRWB 4FWIB 2FDCA 4LJ4A 3QI2A 1C9KA 4JJZA 1Z0KA 1GUAA 3VR4A 3RSOA 1G3MA 3QXCA 3AVVA 1CJKC 1OXUA 1GG2A 3OEED 2YVUA 1FQKA 3MWKA 4TTPA 2ZITA 4EUNA 1ZNWA 1DAMA 3N70A 2QT1A 1OYWA 3FFAA 2KBEA 1YR9A 2MMCA 4B33A 5HPYB 2JLZA 5CDFA 3DMNA 3AVTA 1ZNXA 1ZCAA 2BEKA 1EWRA 5CITA 4F4CA 3W34A 2A7QA 1ZCBA 4LJ8A 2X2FA 1JEEA 4WZBE 5DYIA 3X1WA 4TLCA 3Q7QA 3SJAA 1AKEA 1IONA 1U9IA 1W2HA 4OHYA 4JSYA 3KJGA 1TF2A 1WQ1R 2G1JA 3P26A 5EJEA 2QPAA 5JJKA 4US2R 4UJ5A 1Z6TA 4Q4AB 2WOOA 3OE7A 2IS1A 3LXXA 3N2EA 3LBIA 3IPXA 3ZVNA 5GJBA 1NG1A 4HZUB 2G0NA 1X3SA 4YC7A 4MRPA 1XDBA 1EFRA 1BKDR 3BFVA 4LBZA 1W44A 2F7SA 1KKLA 2VP0A 4BRWA 2REOA 3AVPA 2Q21A 3JZAA 4FCVA 3MSXA 4DLXA 2IF2A 2DR3A 2F3TA 3AVYA 3GFOA 2ZSEA 1Z8FA 1Q1QA 2PT5A 2QM8A 4TL6A 3THXA 3DL0A 4X8HA 621PA 1JBKA 4MGKR 2YJTD 2AX4A 1XXHE 4DUGD 1P2SA 1DAGA 3KKOA 1PVOA 2D3WA 4P31A 1I4TD 1MABA 1O87A 4MKIA 4Y0AA 4ZDWA 4WXRA 3AVQA 2ZSDA 2ZI6A 4ESVA 1R0XA 3TJZA 1XWIA 2IYQA 2A9KA 4R9UC 4M1TA 4IEIA 3X1ZA 1JQLB 3LRPA 4DIEA 5LDDC 2JDID 2RGEA 2ERXA 2QY9A 1B0UA 3VR6A 1QZXA 1MO4A 1U9IC 4DCNA 3NVAA 2PMDA 1Z0DA 4RJLA 2BKUA 1YZQA 2PCJA 1KI1A 2H5EA 2ZAOA 3ASZA 4PC1A 2AWOA 2KE5A 3PIRA 2HJGA 3LQRA 4MA4A 4C0HA 2JIZA 3GLHA 3C5HA 3EA0A 3JZMA 1T5IA 3L0PA 3CIOA 4JLKA 4DC9A 2JJ1A 1G7RA 1T3LA 3SC3A 5FOXA 4C4PA 3ZQ6A 1DAHA 3RS5A 4TLAA 4DIDA 2Z0MA 3U3OA 1KI8A 4MH0R 4V0KA 3C16C 4TYPA 4IOMA 4XD7A 4EIWA 2IL1A 3QUSA 3LW7A 1XCMA 4WOPA 1AN0A 1ZM9A 1E2FA 1E1RD 1ZD1A 2BV3A 2FU5C 4ZCMA 4DSNA 2IYRA 5EZ5A 2XTNA 3M4YA 2FGKA 4QGAA 1P4SA 2BIFA 2GILA 4H1UA 2I1QA 2NO7A 5J4KA 1W46A 4Q1DA 2RMKA 5B57C 3IHLA 4WBSA 2QG6A 1HURA 4XVQA 1D2MA 821PA 4P4TA 3BE4A 1P3JA 3QKSB 3NXSA 1NI3A 1R5OA 3LVQE 3EC1A 2RAPA 1SKYE 2VEDA 4QJ5A 2HJVA 1W0JD 5FL7A 1KO1A 4F4IA 1N6KA 1V43A 2AXPA 1KHTA 3TAUA 4Q4HB 1X8JA 3TNFA 4LJAA 1JXOA 2W2VA 3OIUA 2ZREA 5B58C 1W5TA 2VO1A 4Q00A 4QL3A 2NMVA 1E3MA 1HT1E 4F7WA 1XEWX 2Z4SA 2ZRDA 1VG9B 3PR1A 4N1AA 4L5BA 3TH5A 5L3VA 2CNWA 1H8HD 2EFCB 3AUXA 5FFMA 1E2PA 1SVSA 2XB4A 1NJFA 1QHSA 4QBFA 1OJLA 1NN1A 4WAUA 1HQYE 2Q9AA 2QROA 3QXJA 5FR1A 3QF4A 3RRMA 3KQNA 1CJUC 2Q3MA 4AYXA 1NY5A 2PEZA 3MLEA 3NC1C 3WP1B 4OL0A 4URUR 4ABYA 1D9ZA 1XJ0A 3EZ9A 1KKMA 3KKPA 3R7WB 1VG0B 3UG7A 4DLVA 5DN6A 4EKDA 3HYTA 3LXRA 1CJVC 2WWXA 1CR4A 1YE8A 4D4LA 1G8GA 1NN3A 4TZ0A 1XFAA 2GVDC 1Z5ZA 2EYQA 2WJGA 5DHAA 4Z1MD 3W5IA 2FZLA 1E9DA 5F98A 3L0OA 1NLFA 4LYJA 4JBYA 1QRAA 3HU2A 1XTSA 1XCPA 1HQCA 2QEQA 2D06A 4TYYA 2QRZA 4CDGA 3GJ6A 4JVNA 3CH5A 4X8MA 2QAGB 4CT5A 5IRCD 4KXFB 4QGFA 2CE7A 2ZUBA 3AF1A 4MGZR 4NTZA 2N1BA 2ANBA 5FPKA 2J0QA 1XF9A 4HAWA 4HB4A 2C78A 1P2VA 4B2IA 3Q7PA 2GCOA 1QHHB 4G5QA 1OH8A 1XPUA 4HSEA 2Q3FA 2RHMA 2YZ2A 4LC0A 5JI3E 2VHJA 1FP7A 5HE9A 2X77A 1NRJB 3FB4A 4A82A 4JYBA 1NN5A 4QG7A 1AGPA 2IXFA 1HY3A 1ZNZA 2DY1A 5G3YA 5JCZA 5ANRB 3OEHA 3BB1A 3F5FA 5KO2A 1OXTA 3GLIB 2R62A 2BJVA 4J0QA 3IO3A 3LV8A
chains in the Genus database with same CATH superfamily
4C43A 2PUEA 1CBUA 5U9CA 2FZVA 3DYBA 4IS2A 4INPA 4YBRA 721PA 3C3DA 4WNYA 1EXWA 3KCQA 4ADSG 3S8YA 1X74A 5IJZA 3U9LA 3Q3HA 4K9SA 1SEPA 3GIWA 3KTOA 2CWDA 3RKSA 3HWSA 5DVZA 2BR4A 1N7HA 1ZIPA 4ENPA 5EQTA 2M6RA 1AKTA 3E9YA 2O1EA 4L3WA 5EWLA 1GL3A 4TMVA 5ILGA 1IFXA 1GCUA 4ZVLA 2VPPA 4PQGA 4D0NA 3EZ2A 1VKOA 3WGZA 4YT8A 5C7YA 3OO0A 2WYUA 3JX9A 4GRAA 3MTAA 5B58T 5K2OA 1AZTA 3L40A 1VLMA 2G70A 2J67A 4YUVA 4QFBA 3HYNA 4PZ9A 1OTYA 1ZLXA 4LOAA 4U3JA 3ZZTA 3ZHQA 1T9HA 4A36A 3QY0A 1TZBA 3QJ5A 5H9WA 2P69A 1T0JB 1V3QE 4LY3A 3GEGA 5DTEA 3ES9A 3SIXA 1KYYA 1W9MA 3WAKA 2XB2A 1K8RA 1WBDA 3W5VA 4EDHA 4ZAFA 5H1YA 2UYQA 3K96A 1ZNQO 1PFWA 3K6JA 3NRBA 1PW7A 1SUSA 4NECA 4X45A 3R6TA 1N1DA 1FNSA 1UKVY 1ZI9A 4G41A 3GGDA 5EPEA 4RKWA 2E6KA 3JXEA 5IT5A 4M37A 3CN9A 4QD3A 4L5CA 4M83A 4QXRA 2H7YA 3KXIA 2AG1A 1R8JA 2O3QA 5HP4A 2O8EA 3GH3A 3KTFA 4R7ZA 3KEGA 1X7WB 5KYGA 5LP6F 1XIVA 1QS0B 3QBTA 4XH9B 4IX9A 4R98A 5EMHA 3G82C 1M54A 2H1FA 2PRSA 4BASA 4M99A 4CKEA 2I2DA 2QN1A 2W6JA 5JDCA 3EVFA 1OIXA 4M9SA 1BE0A 3QPUA 4GD3Q 5IVHA 4CJXA 5HUJA 4AN4A 4MUHA 4CFYA 1SBTA 4B7AA 4BO8A 4URFA 4BWGA 3O8RA 2XQKA 3QBJA 3VZPA 1O5TA 1KVUA 4U2FA 1F5SA 4JCCA 2O1WA 4V2UA 5KREA 1RXVA 1C0PA 1T2VA 5AUPB 5IJXA 3QJGA 3W3ZB 3LBYA 4M1MA 3SAJA 2FPGA 1JMKC 1H0RA 1L7MA 3GT0A 3L7CA 2FP3A 4G4IA 4ITRC 3FKQA 4KFUA 5JXWA 5AW6A 1QE3A 4P5DA 2Q5IA 2ZRLA 5K8LA 1NG9A 1E4OA 1PJAA 1RYBA 2ZRMA 3S6JA 3HLKA 1PF7E 1K7YA 1PGPA 3DLBA 3JAWA 4V0ME 4EFNA 4R69A 1MX9A 1T9DA 1GPBA 5EHQA 2XYVA 3GGCA 1OA1A 2DTXA 1YAHA 1YZKA 4MUGA 4QUJA 4ZAZA 5AUNB 3FHTA 5I51A 1OWOA 5EN4A 2DP4E 2EFDB 1QPZA 1L5OA 2E4XA 3I9LA 4XQ9A 2IELA 3REGA 3KJXA 4I3HA 4C22A 3RO7A 4HLDA 5K6TA 2FZGA 4GYWA 4S1TA 1ZMBA 3CBQA 1JQEA 5AUOB 4ONEA 1V5IA 5CAEA 1XN1A 4N5HX 4XJXA 5MN5A 2GZ3A 4MQEB 3UG6A 4YB8A 3ZHOA 2N3ZA 1VGQA 5IKEA 5JD6A 4PC7A 2V6GA 1JA1A 3FTCA 3SSNA 2OGUA 2R65A 1NQ5A 1V9SA 3H18A 2R1TB 1SOUA 1V3TA 3HKDA 3HVKA 4BCDA 2DBQA 1MAAA 3QXXA 4FT2A 3A4NA 1J25A 2BLNA 2LTAA 4CQLB 3GHYA 2ZE8A 5CLIA 1DX6A 3CRW1 2AI1A 4PZAA 5DM2A 3CXUA 3HZRA 5FOSA 1J2RA 4B3BA 1CFJA 4FLEA 4GP7A 4D9MA 4LHWA 1JV2B 1U1IA 1AKWA 2Z4RA 3GLGA 1CQJA 1KFBB 3LZDA 1YKSA 2I33A 3WMEA 4QTZA 2CGEA 1EQ2A 3SBDA 4QGGA 3R1IA 5M3BA 4Z1MA 5CA0F 1ZL0A 3SQNA 1I10A 1RXIA 2UV8A 2FEAA 2IQIA 3GGPA 4RD1A 2VJOA 1PFVA 4NYJR 5KTYA 1GWNA 4JC5A 3F47A 2EW8A 4P8RA 1BXGA 1ZMTA 2DFVA 2O8NA 4JBLA 2VZ0A 4B85A 1M8FA 4W5QA 4WN9B 5FF9A 1GYPA 3I0MA 3OQNA 2WDPA 2JBHA 2ZRHA 3EJ6A 5A9RA 5HIIA 2ETXA 3OE4A 1VM6A 4XTCS 4MCJA 2AH5A 2D6FA 3ZHYA 2QTZA 3AW8A 1II8A 1K7EB 2V7TA 3K71B 2ZCVA 1H4QA 3Q9UA 4XB6B 3PFNA 4YEDA 3RSFA 5CM9C 5CK5A 3VX3A 1GFSA 1KAHA 2V59A 3CCFA 1UKYA 5D5QA 4M0UA 3UGJA 1I2MA 2I66A 3PNLA 5E9AA 3CEJA 2COUA 1M10A 1LWOA 3IJ5A 1VMAA 3CZ5A 2B69A 2NXNA 2VAXA 2X2EA 4G81A 3THYB 4XDGA 3FPLA 2CVHA 4YIHA 3THWA 1FS4A 1V7ZA 1OTXA 1OV6A 1P6XA 2VH5R 2Z2JA 3NCHA 1ES9A 3DBVO 4R2JA 2AMYA 1SJ9A 2HPZA 1E6LA 2EHJA 2KM1A 3CTMA 1X77A 3L05A 3S1AA 1H1LB 4A7PA 4H4DA 4A0GA 2XAUA 3GFBA 3U6KA 4BPRA 3N8HA 4RO0A 1KMMA 3NV7A 5GV7A 2CYCA 4K40A 5REQB 1TJ4A 3F73A 4RIHA 3D6TB 3H3XA 1B8OA 1RPJA 1X9HA 2VPZA 2EARA 5KTPA 4JHXA 1A98A 2B7LA 4AM8A 3KWJA 1XKLA 2CLDX 2OD2A 3U7HB 2QF7A 4MJLA 4OQNA 1Q1BA 1IATA 1RVV1 1QVZA 3VOBA 1E8NA 4AJKA 3UHPA 5JS6A 1DKPA 2A78A 1Q0PA 3VSCA 4PANA 3HL4A 2GJ8A 3KKZA 3KQMA 4XQCA 3JALA 4JT9A 4Z51A 5JARA 2PU5A 4YWJA 1NBOA 4PGAA 5JIBA 4P84A 2NZWA 3I12A 1QKKA 1VFPA 3FTDA 3KOZA 1UDWA 3D0RA 4MRNA 5HKKA 4U0JA 4TVOA 3WBKA 2J7PA 1UZAA 2XTZA 1MW8X 2IXBA 1GNVA 3K5WA 1WHSA 2Z09A 3DD5A 1QO0D 4MQ5A 4B35A 5MFPA 1WTAA 4WXRA 1LKZA 1P44A 3AY0A 1Z2OX 2FGJA 2DU8A 4QODA 1J6UA 2ZE5A 3H6GA 1Z0JA 2GDJA 4FMCB 3W90A 2FEMA 3G2MA 5KMGA 2IEIA 3SKYA 2AOUA 3BB3A 4HWKA 1IOWA 5I4KA 2HCJB 5ADWA 2GK7A 5BUQA 1Y9ZA 2XKBA 1ILWA 1RZUA 4XFDA 5LOVF 3HO1A 1P17A 1YBAA 1IPHA 1TZ2A 3AI1A 3IBSA 3UMMA 1TUBA 1T1JA 2B20A 4S0ZA 1LTHR 4KMSA 1R8QA 3RYHB 1SBQA 4JOCA 1DQYA 2FMIA 1LF5A 3U4QA 2QTLA 1M8GA 1KZGB 1YB2A 1XEAA 4O29A 1S8OA 2FVXA 4TT3D 4V3BA 3RS7A 2ZCUA 4AUNA 2C8JA 1EFLA 5ETJA 1UMKA 1YMUA 2N46A 4EKGA 3B1FA 1EUCB 3SIRA 1JHOA 3ZGXA 1PG0A 3WB1A 2XRZA 3E81A 1C81A 4Q1FA 1QJCA 5JSUA 4W8HA 3SBEA 1HF3A 4NZMA 2VNHA 1VJ0A 3D1JA 2DLDA 4HDMB 4OLHA 3G85A 3QA3E 4MVYA 3U56A 1NV9A 2G9QA 4R31A 4D9KA 2X3UA 1H2FA 4XEHA 3RFFA 2JFYA 4X9XA 1YB5A 5EYPA 5LZ5A 1L4EA 2GCIA 3W9SA 2C7PA 1EFCA 1JA0A 2IYWA 4X71A 4RZIA 3MRTA 1H66A 1S6YA 3R3YA 4O2BA 2HQ1A 2FZKA 3O3NB 5B1IA 1X1TA 3BHMA 1ST2A 3GEBA 4MMYB 3T6KA 3WRXC 2Y92A 4M7OA 3PPYA 2RHOA 4GKBA 3OZUA 3H42B 1QHYA 1RABA 5FTMA 3EXEB 3RV3A 4EI9A 3ND5A 3WA7A 3UMRA 5CRIA 4AJPA 1R1DA 2CXUA 2FZEA 4HMOA 2PX3A 1ZSVA 1AB5A 4PEVA 4Y7DA 3FOZA 1XNRB 2Y1CA 1BCRB 4KX5A 1K68A 2GKSA 1CJTC 1CIPA 4QVIA 1K7FB 1RNLA 2OXIA 4Y2RA 1A9OA 3VISA 2PL3A 3SNHA 1R4NA 5LIRA 1ZK3A 3C48A 3NM6B 3D3NA 1OT5A 3O7WA 4RWZA 3FOCA 4QDTA 1VJ1A 2J0VA 4BQIA 3ZZUA 1ECCA 4DUPA 4ZGWA 3T15A 5JRDS 5HNKA 3LI2A 4TTTS 3VH3A 3RRJA 1XAJA 4ED9A 2VNIA 3EIOA 3UAGA 5E9JA 2V9CA 4NY1A 5BSMA 4EW1A 2LDXA 3HJFA 1G4AE 3EIUA 3Q9SA 4TWAA 5ADVA 3N8IA 1E63A 3FFTA 3I3OA 3UZUA 2RFLA 1S1MA 4RPIA 3HR8A 1GZVA 1TEHA 3Q7SA 3TIVA 4G8CA 4CG1A 4BFVA 3JYNA 4TKMA 1G9TA 3B2EA 3PC8C 3RRZA 3VC7A 5B36A 3OUZA 2BW0A 2HV8A 2IYLD 4MIEA 2GLXA 1J1IA 1RFGE 3EIHA 3FCSB 1GG8A 2PRJA 1H2EA 4IOKA 4JEHA 4OKNA 3C1UA 3KC2A 4XCXA 5FPPA 4CEJA 1NPYA 1YJCA 3PX2A 1C30A 3C97A 2ZTSA 4I4TB 5LIPA 3CX6A 2ODWA 3A4LA 3H8WA 1CY8A 3BDIA 1QHIA 1EMDA 3CRRA 3EQ9A 3L5KA 1OBVA 4GP9A 3RFCA 3UY4A 1Z7EA 2MINB 3ANYB 3K9HA 2P4HX 1AV6A 4DQDA 3C8DA 1H93A 2XUAA 4NG4A 4OHPA 1SBNE 3CX7A 3QRWA 2AUNA 2RAFA 3KYCB 3SYRA 2ZG6A 4OOFA 3AUAA 4W5JA 1X8XA 4J91A 3HPRA 4YACA 5TQ0B 1W0KA 1JR3E 1ZU5A 2BOVA 3P0IA 4BMXA 2VXOA 5GVSA 1LNZA 5EXPA 3PKJA 4J8PA 5F3RA 1KZ1A 3BMCA 4BQEA 4Y9SA 1C7FA 2PN1A 4YIKA 3EFBA 4QWWA 4EGCB 1BJRE 1TEXA 2I7TA 5E9QA 4A0SA 1MZPA 1N33B 1MEJA 3PFHA 5ICFA 1BW9A 3CM0A 5DHPA 3GRUA 1B6GA 1NKTA 1T8TA 2PANA 3JQFA 4NNPA 4F4UA 2FX2A 2BHSA 1R0YA 4HAYA 4ETWA 1UPXA 4EKEA 3DE0X 3V6LA 4D0LB 1I94B 1PUIA 4RDCA 4BBJA 3VJMA 2Q6LA 1DVRA 1X6VA 3WR5A 5LVAA 3AEQA 2W2TA 2J32A 5ALUA 4ZU3A 4ES6A 1CWUA 1FDTA 1Z16A 3MFQA 3DTVD 3VR6H 3MERA 4XXHA 3RK4A 4ZYZA 5J2TA 4KQIA 3F7OA 2B4KA 1U7HA 2DUWA 3QXSA 5D3MB 2UUBB 3B36A 1HI9A 2C1XA 1ZRHA 1KBQA 3FMIA 3IIMA 4LEIA 2WB2A 3EA4A 1T1SA 2C96A 2P6OA 4J9UE 3AK4A 1T9BA 4N01A 3B13B 4TQUS 2FSGA 4PPGA 4OLBA 4LDRA 2PMWB 5GJVC 2BELA 5F9HA 2FF7A 2RIRA 3E0XA 3QMWA 2IS6A 3IKJA 2G8LA 3E2IA 4LZOA 5FORA 2Z6UA 3K0EA 1U8YA 1VECA 1P2DA 2FPWA 3OZTA 2QRLA 2WAOA 4P08A 4BNKA 2BF7A 4OB8A 4KLZA 1ZVQA 2AQKA 3ZHTA 5EUBA 4IIXA 4NOJA 4DV3B 4HZGA 4UUOA 4BUJA 1QO0A 5E95A 2AFRA 3HU3A 2NYVA 1IN6A 1UKEA 1LJUA 1XBTA 4JZYA 4TSFD 2CFCA 4MI6A 1WB6A 1IIBA 1X7HA 3FCAA 4LPSA 1QGUA 1FJGB 1E2DA 1T35A 3AX6A 1H2BA 1O08A 2GQ0A 4IH1A 4KIGA 4UQPA 3RIGA 4DAEA 4R1OA 4U9IS 3LM8A 1HMYA 1OFUX 3V00A 3VYRB 2D0DA 3E9MA 1G5HA 2JAQA 4TT3A 1QG4A 1NVXQ 4Z0HO 5A9TA 5JHGB 3DUWA 3NH6A 4TLLB 3FFWA 1XZFA 2YFQA 4W1SA 1SXPA 4REQB 4H0NA 3MT9A 3EMDA 3ZUGA 4Y2QA 1ZP6A 5ECDA 4DIOA 3H0CA 4MOWA 4P33A 3I2IA 3D7MA 3V2UA 4JDUA 3FZEA 4RGVA 3WZMA 2HWXA 5IARA 1EDOA 1I0IA 1G21B 2WUVA 1W4LA 3KEFA 4KXNA 4GP6A 3T9CA 3V4FA 1CHNA 3F67A 4YJ2A 3DMFA 4HR7A 4XPZA 5HM6A 2OCKA 3ZE6A 3EEOA 1Y9EA 1GZUA 3V4VB 3KKLA 1N92A 5K01A 1E9EA 1QKIA 1Z4MA 2H48A 2NAPA 3AKEA 3SXUB 1QRDA 1BE8A 5IDWA 1SKMA 2JK0A 1IQPA 3BXOA 3DTTA 4UHDA 1S8NA 1MVLA 1K63A 2Q3CA 3DOCA 3HQ4O 1N9GA 2IODA 4DDHA 4JI8B 1KK2A 3FY4A 3PZBA 3L46A 5EZYA 4NBKA 1C4XA 1G20B 2CCKA 4A10A 4S1OA 3PDCA 4M49A 3A8TA 2IOYA 3P9KA 1MBZA 2WKRA 4ZCLA 3M7IA 4MVJH 4BN4A 2IKQA 2IYUA 5CA1F 5SZJA 1CZLA 1EBBA 1W0CA 1YCGA 4KP7A 1F8YA 2RSLA 2JAPA 1SCIA 1ZXLA 1TEZA 1X8KA 3LUKA 1UK8A 5IYZF 2BFCA 1Y48E 2PAAA 3NHSA 2ZR9A 2OHJA 1RAIA 2AR7A 4J0GA 3CUUA 3H6KA 3NDJA 3H84A 2GXQA 2O3SA 3BJEA 3ZE7A 5IC5A 2ILVA 1XRNA 3OPYA 6NULA 1SU4A 1NV8A 1C9MA 1XHFA 4C0AC 4ZVSA 3AH8A 1ST3A 1Z45A 3IMEA 3VUFA 3ZK8A 4B4VA 5K0CA 2ACWA 2GZMA 3KVRA 4C0KA 4RPCA 5KOJB 2DYKA 3AKZA 4DHWA 2BUCA 4DDUA 1I1HA 1W73A 3F96A 4RCVA 4FOLA 5ARDA 5BW5A 4Y98A 3RVSA 1TIKA 1GU1A 3AI2A 3ASVA 3UCEA 1QRUA 4URWR 1GL6A 4XWOA 5GPBA 4QC2A 4M8LA 1CX9B 1IB0A 3KP1A 1Y8QB 5EIFA 4XM0A 4E2FA 2AXNA 1HDEA 4FSXA 1S2MA 2FPLA 1A8UA 1KJZA 3KALA 3OE1A 4ZDIA 4LVUA 4FMBB 5AVXA 1GTSA 4JB8A 1BWQA 2FWNA 5DT2A 3R5SA 1M74A 5JCJD 1T8PA 1H94A 3K8QA 1OE0A 1DAIA 2CBGA 1XD2B 1SH7A 3DAPA 3WNZA 5K0BA 1Z7GA 1N78A 1NLYA 4P4NA 2P0YA 1GAQA 4PFSA 2I6TA 1VCOA 1WZEA 1ZJ5A 2I6FA 2JBAA 5L40A 4PYLA 3TI7A 3E2PA 3ZLBA 2O5CA 1P3Y1 5SYNA 1XQ1A 4KYTA 6ABPA 4KN5A 4N76A 2JGEA 3KT8A 4CGYA 3BGVA 1AQIA 3G89A 1V2GA 2HRQA 4WZZA 1XCGB 3I73A 2DERA 1XRSB 5KDDA 2Q7DA 3RJZA 2R5WA 3QPWA 10MHA 3OM8A 3HMKA 4M1ZA 4RCZA 2PUVA 4M0DA 1HFEL 2WTMA 2QRNA 4ARUA 1J49A 3REFA 4ZYYA 1T3GA 4H4CA 4J0CA 1G2OA 1Y8AA 2V7QA 1ZBQA 5HQ3A 4WCFA 6REQB 1E32A 1JECA 2QN6A 1S5PA 4Q4AA 3NT4A 3SZUA 4F1JA 5JOQA 5KTNA 3EPLA 2I29A 1Z6QA 2SCUB 5DTIA 1T9GR 2WJAA 1RWKA 3ITDA 1HK7A 2HU5A 3UWDA 3RV4A 5JAOA 3W4KA 3CUVA 2CVZA 5FWXB 1EK5A 1KETA 4Y6OA 2CY0A 4L5AA 1VL1A 1ZK4A 2DLNA 1JQ3A 2CJWA 1YNOA 3GBSA 4H35A 1Z18A 4IRXA 4HV4A 1OX4B 2GEKA 3DEZA 2NZYA 4L16A 3ZLTA 3IBFA 4BGVA 5JHHB 4ER7A 3ZXUB 1YZFA 4GPZA 2OO5C 4CIYA 1Q3TA 1V37A 1VKJA 2A5JA 2QM3A 2R48A 3I72A 3T1TA 3W2FA 3GG9A 1VHJA 2ZWOA 1H0HA 4BBZA 2PXHA 2M2IA 2PA3A 2BHNA 1NTOA 4OIMA 2BC9A 4DV2B 3DFKA 1QPGA 3EG9B 1KE2A 3U49A 2HOQA 3BK1A 1QFMA 1E99A 1Z08A 3JZIA 4KXWA 5F1PA 5FXMA 5JCPA 3JYLA 3ZE1B 1L8LA 3R3XA 2GF2A 2PBLA 1VC2A 3BH0A 4P0TA 1CF9A 2CCGA 2JJ2D 3IDSA 2HPVA 1DXQA 2A0FA 4A16A 1DC5A 4ZQFA 3OQHA 3BGSA 3T5GA 5I3CA 2FSFA 3D1LA 1LRKA 1CPYA 2EBHX 1R66A 2TECE 3CRVA 5J23A 4AMZA 4NV1A 2QZ4A 3ILSA 1F4VA 1FXSA 2LP4Y 2OV1A 3KT6A 1QIDA 3MAJA 2R2GA 1SQ5A 4HAIA 4HADA 2YV1A 1JGTA 3SEFA 2BFDB 3J7TA 3F3MA 3E8SA 4TT8A 3BBLA 3PXGA 3H04A 3LKBA 1X1BA 3PQCA 1R6BX 1U5BA 3MLAA 5DNEA 5BN3B 2HCBA 4IVQA 3SXPA 1T25A 5LDHA 3GK3A 2VKTA 1AF4A 3LZ6A 4J16A 1G3RA 2E6UX 4P4LA 4UASA 5DO9A 2GM5A 1H5NA 3UTDA 3CZPA 3DPIA 5ESWA 1ND6A 3UK0A 3I9V6 4OI1A 2W22A 3WGLA 1GQOA 3KSMA 1GRNA 1DI0A 3MIIA 2ROQA 3HP1A 3IBYA 4K8OA 2G07A 1KMNA 2Y6UA 5JD3A 4FOTA 3TQRA 3NAZA 1XTTA 1B00A 3L8HA 4FGZA 4E21A 5JH7F 1Q84A 2CXRA 1YBFA 4IIGA 1R18A 3E7XA 3L84A 1DRVA 3WA6A 4EEKA 1V48A 4MW2A 4PX5A 5CFQA 3KETA 5IN5A 4O4JA 3LP8A 4YAUA 2IUYA 2WSSD 1VPLA 2A0WA 4LKRA 4RM2A 3T3MB 3WLLA 3K5HA 5C7LO 1U04A 3GMIA 1ITZA 1OU4A 3O91A 3STVA 4Y2HA 1XZKA 1PJSA 1IEQA 3A0RB 4RFVA 3EH2A 1REQA 1O9BA 1JHVA 4FYVA 1HE4A 1WCIB 2Q3LA 3IKLA 1ICIA 4CM6A 3W8EA 1EM8A 2DT8A 5KTOA 3CUKA 3D54D 4Q9HA 2BCGY 1XZAA 2ZJ1A 2X7HA 2BD0A 4DC1A 2H07A 5JSQA 2IYYA 1MUUA 1TAHA 4M89A 1EUDB 1W4CA 2DC1A 2F1KA 2QD2A 4HTAA 3F4LA 4GE3A 4ZI2A 5HOQA 5ITWA 2D4AA 1HE2A 3VR5A 3VKWA 3DDHA 3PFCA 4HTFA 3ND7A 8ADHA 1EVZA 3TZCA 3MTQA 4RS3A 1F2VA 2C1EA 2YR0A 2Q49A 2YICA 5C32A 5JVDB 5JPCA 2WJ4A 1B93A 4RELA 1YJ5A 1TYDE 3WIOA 3U4DA 1MJNA 2CHFA 1VDZA 5ERYA 4BGUA 3AP2A 4U2GA 4DDKA 5BMVA 1VGVA 3ENVA 5TS3A 3FH0A 2AK3A 1XDSA 4EPYA 2F17A 4GO1A 5CT4A 4Z53A 3VH4A 2DFTA 4YRTA 2OCYC 4LBYA 1BZYA 4ABTA 4L6IA 4P7JA 2Y0PA 3CJQA 1GUZA 1V16B 2I7VA 3WKCA 4IZHA 3LBAA 3KZVA 1XTQA 4CT4B 4YJ3F 3PPVA 2IWHA 3R75A 4CCSA 2EDCA 4WZBA 1SUFA 2O4UX 5EGSA 3T4PA 1MDBA 4I0WB 1N6LA 1YHNA 4C0BA 4DGSA 1D7AA 1FL9A 5E8JA 4XGIA 4EUSA 1G8SA 5IHPA 2GBLC 1OXBB 1GZ5A 2FLVA 4OO3A 3VV3A 2PGXA 4EHBA 2R60A 3ABZA 3A1NA 1Q5PA 4HEA6 2J6CA 4YCSA 5P21A 4A73A 2EDAA 5C4MA 3Q40A 4A9AA 2B25A 2H0QA 3OPXA 5D2CA 3M6MD 4ER6A 1CZRA 5JCJA 2X0EA 3C74A 2QZPA 1P6UA 4NENB 4BGIA 1XCLA 2ZJ3A 4E94A 3AI3A 1SG6A 1L1EA 4Y30A 2H1WA 1LRLA 2JPDA 3HACA 3BWDD 4PC3A 5CP8A 1FP6A 1ADCA 3T5CA 2AVDA 3T61A 3HYCA 1M8JA 4LWQA 1XHLA 1ENPA 2XD9A 2H06A 1DEKA 4LI0A 3KYIB 2QNIA 2B6NA 1T3SA 2HSEA 4MR7B 3JRXA 4DLSA 4QUKA 3ERCA 1E98A 2DG2A 4JBHA 4OBEA 2YYSA 1UKZA 2QAJA 4FYWA 2J5XA 2PHZA 4M7RA 3H75A 4E13A 5CDTA 3RYCB 3A31A 2ZAMA 4KTTE 1RI1A 2WJJA 2WQ6A 1A9SA 5K8JB 4RMHA 1OB2A 1HEUA 2ZIXA 5FPHA 2H8KA 2Y4NA 2OGZA 4PCVA 2AE2A 4MV4A 2OZLB 4C3VA 4E5UA 4HAZA 4UVGA 4DMUB 4EVRA 2CN1A 2WMNB 1LNSA 1MZVA 1ZIOA 2WIBA 2BEVA 4FPXA 2Y67A 1L5YA 2XDQA 4KC0A 2WILA 4G8JA 5D8DA 1L5LA 1BU8A 4P92A 5B2ZA 4TTAA 2ECKA 1FY2A 3NDIA 4FC7A 1Q12A 2EIHA 4CL3A 1JAZA 2ZPTX 3CJTA 3EXHB 4HVLA 2R25B 4KU4A 2RD2A 3MJVA 2H54A 5COBA 1IY8A 4BJHB 3IAM6 4OB6A 5ALXA 4YRIA 2A4MA 3HKEB 3AGQA 3EG5A 3EODA 2B94A 3VU9B 2MYUA 3IDFA 1SCJA 3CE6A 1EIWA 4RD3A 1JHXA 1OROA 1WCYA 1DMSA 3DC7A 4JN6B 5IP5A 3ET5A 5TQ2B 4B3RB 1B74A 4JKYA 4UVHA 3RTBA 5KNCD 3NETA 1JIQA 1GP2A 1RJDA 5TGTA 1SXGA 5ALRA 3WWZA 1NVKA 2GZ1A 3CNLA 4HLCA 2J09A 1W1UA 2BFEB 4NJMA 4YAJA 4DTCA 2JLUA 1OU0A 1TPYA 4B09A 1F0PA 5CMLA 3K53A 3ZOKA 1NZJA 3EEYA 3GUHA 3SSOA 3KT0A 4BAZA 1ZAKA 5DLPA 4BRSA 4B80A 1KQGA 1JF8A 1YXMA 3HXLA 4W9NC 3ETGA 3SI7A 4EAAA 4B3TB 2JJ2A 3GO4A 2CDCA 2FPSA 2JIMA 2A7XA 3FYSA 4Y6SA 2CUTA 4GWGA 4IDNA 2QAGC 4PWZA 4OMFG 2FN7A 3RIMA 4EMBA 1QF6A 3DS8A 3DVRX 3EEQA 3H9QA 3TTXA 2WWFA 3PNSA 1Q7GA 1CZUA 1DADA 1LF0A 2ZYWX 3G59A 1HYGA 4N5NA 5FJJA 3ZBTA 2C84A 5EY5B 1FDRA 3GRFA 1FOEB 3X1MA 4UVEA 5KZMB 3KKMA 5EUMA 3LNCA 3QBVA 2YMLA 4IVPA 4S1PA 4WVLA 3LCVB 1J9EA 2FF5A 4X7BA 1E0KA 1QAOA 1BIFA 4IGIA 4H3VA 1NVFA 2GDZA 3JQ7B 4O0LA 3P32A 3UJ7A 4IHAA 4XCVA 3T4XA 4QT4A 4ZGGA 1P1IA 3BIOA 3ST7A 1C8BA 1DIOB 1U9ZA 1E3TA 2YDXA 4KR3A 1OX6A 2WW8A 2XMQA 1X7WA 3AEUA 3A26A 4HC4A 4HAXA 4OA8A 3TE6A 3RT7A 1E2HA 5IAAA 3B3GA 3D6JA 2Y4OA 2XJ4A 2W6OA 4U8HA 2QZSA 4DPLA 2L2QA 5TPZD 1AHHA 1E2IA 1SKBA 3GAFA 3LL4A 1NONA 3QUBA 4RD4A 2J6HA 5EIXA 2FSSA 2IEBA 4J0IA 4NF2A 1N5LA 1Z5WA 3SVZA 1HE3A 3F3KA 4O59O 1USIA 2WSSA 3ZH2A 4ENQA 3KUKA 1Q7TA 3GXOA 2YNMD 2WP0A 3GLHE 3HKCB 4JQSA 3DEJA 5JMTA 1A9RA 5AJWA 5D6OA 4MQFB 2VS1A 5T41A 1JKJA 5CVVA 5C8YB 1R9JA 2XB6A 3U4IA 1NXVA 3FYUB 3HXTA 4R2XA 3ZGNA 1V45E 1GAXA 5DISB 3H1BA 3QWHA 1IVYA 1XZBA 4OQQA 3A1UA 1RXEA 4N18A 2YY5A 1JMVA 1I4DD 4HB0A 1L5QA 3GCGA 3N0RA 2N42A 4K9PA 3U80A 1C0IA 4I7EA 2NLOA 4ALMA 1WPQA 3OCXA 1U8AA 1RJ9B 2WRZA 1VZ3A 3PUJA 3KZNA 4NJOA 4D02A 2GBGA 2VSNA 3LCJA 2FSUA 4W4TA 5EIAA 1V7PC 3ODPA 3DPUA 4IVNA 5FJIA 4U2DA 3HR7A 4NYMR 1AV7A 5T8KA 2B0CA 1DEAA 4RVSA 3WLKX 1YKGA 4K1LA 3OLZA 2EC5A 4HDSA 3S29A 5IK2D 5JLJA 1DFIA 1LPSA 1WUJS 4DXDA 4YASA 5LNK6 5LD2C 3FTNA 5JPIA 3I0ZA 2VATA 4Y1EA 1TYCA 1Y9DA 2REQB 2ZI4A 4OOEA 1J07A 4K7JA 2Q5OA 4IDQA 3TJMA 5AM2A 1FDVA 4ZZ0A 1M7BA 5IAJA 3EJWA 4LRXA 3KEQA 4WLNA 5FUWA 5JSZA 1F2UB 1USWA 4GZMA 1NUPA 4BJ6A 3HGQA 3NBAA 1TFUA 3PUVA 1BX1A 2HNAA 1TQHA 2LVBA 3MXOA 3LH5A 4GPIB 4WLFA 5AK5A 5A0FA 3ZW8A 4F1KA 4Q19A 3NBKA 2VEOA 5E6UB 4JIMA 1F2TA 5CR9A 4XDYA 1XMSA 4MYUA 3DE1X 1ZRNA 3OWXA 4HJRA 4K9NA 4F9TA 4JI0B 1MB0A 1KMIY 3IUQA 3BFPA 3B1KA 1JIJA 1V4NA 4JL6A 1O97C 2JARA 3UJCA 3VJLA 1BSVA 2JK1A 2YW2A 4UNPA 3ZDDA 1DV1A 4YONB 3DOIA 4LBWA 1GLGA 2DM6A 2WU0A 3JPWA 4G26A 3RB8A 2WAYA 2EJWA 2A86A 3GPDG 1C0EA 3VRHA 2VCEA 3B8EA 5J9FA 1XEWY 2CYBA 4Q1AA 1OA0A 3LX5A 3EWAA 3QUQA 3NGXA 4ZO4A 4TKVA 2CVOA 1T43A 1UQUA 4ZCRA 3I4CA 4QNNA 1WVMA 1IK6A 5EJMA 4BVHA 1DIBA 1T6XA 2XXJA 3D2BA 1X8LA 3ZDBA 3MRVA 1F4PA 4OQLA 4X90A 5EP4A 3VO1A 1A9TA 3I01M 2JGDB 4IYRA 4BNMA 1EQUA 2B6HA 2ZJ0A 1W5BA 2ZXEA 1QORA 2AX3A 5HXAA 2E7ZA 4JI7B 2O19A 4HL6A 3UJ3X 2Q6VA 2AN9A 2ZB7A 3VX4A 2C3YA 1VHLA 3BVPA 3ZWAA 2JCVA 4ID3A 2RAUA 1P62B 2GYUA 3RAPR 4DWJA 2QN8A 1AURA 2E3JA 4OREX 2FVYA 1MABB 1X80B 1JYEA 4P7FA 2AUMA 5AXCA 3DKKA 3MQ2A 1W5SA 1E77A 2OHHA 1ZU4A 4ENUA 3ESCA 3T5PA 1IBLB 2WU8A 3K35A 4YCDA 2H92A 3VBCA 4TL8A 2IYTA 3ICVA 4C1NA 3PHCA 4RTRA 4MKFA 1LZLA 2NUPB 4IF6A 4R8VA 5ALKA 4L9WA 4LZZA 2D7CA 3GNSA 3GLFB 4C9BA 3B5EA 4C03A 1XPOA 3CVVA 2Q29A 2W42A 2JEYA 3EIWA 4TLEA 4N0QA 2YOGA 2JD0A 3LDUA 4UEWA 5JLAA 4CF4A 3JARA 1HX7A 3MWGA 1LXCA 3GEIA 2P41A 3E3OA 6PFKA 2CNDA 5DF1A 2QMZA 2X5XA 1HL3A 4X61A 1KVTA 4V1CA 3SR4A 3RFUA 1AZSC 1YZYA 3BXZA 3ZCVA 4XRGA 4D9BA 5KINB 3D6FA 3IAUA 3GLQA 3K0SA 3OQ6A 1J23A 4RXMA 2FTKE 3OP4A 4F8JA 3VDQA 2BBOA 2Y68A 4F96A 2ISQA 2YBEA 4P3PA 4ZC1A 1NAIA 5ITSA 5JTUA 2KS6A 4Q9NA 5IH7A 1W93A 3R6WA 1KSJA 1ZJ4A 1CLUA 3U60B 1JRLA 1LPAB 2ZM5A 2KB0A 1XHEA 2XXAA 5DEOA 4ZALA 3TTYA 2NU9B 2PIDA 1K5PA 1W8DA 3IT2A 5BNWA 5C8XA 1KJYA 4G8DA 1L5GB 3CBGA 3DKPA 4J7XA 4NU0A 5M7EA 3JWEA 4EATA 5K0NA 4JT4A 1HV8A 5MN4A 1YL7A 3L8YA 1B14A 4LBVA 1CQZA 2JH3A 3W8DA 2I3AA 1CJBA 1CIJA 1JEOA 1GIAA 1A50B 2KBFA 3BIWA 4JLBA 5HZMA 4JEIA 5IMBA 4W5NA 1SU6A 2RI0A 5HF8A 3MWEA 1SQGA 4TXHA 3A2LA 1T2UA 2A9OA 3LPAA 4M1KA 3ZKWB 1E2UA 5LXTB 3OKFA 1WXFA 2O0HA 1C2TA 1ZW6A 3BK2A 5G2OA 1GSHA 3TMAA 5CFZA 1TM3E 3CZ9A 3ASYA 4PZZA 1ZM3A 2H3HA 3OD1A 4Q7EA 1KY2A 3KQVA 2Q5CA 3ZWQA 5JYBA 2QJOA 4JS0A 1L5HB 5TPZA 1TA9A 2GWHA 5MGBA 3B9QA 4EJSA 2CFTA 3OX2A 4EEXA 4DB2A 3N6XA 4YJGB 3OPVA 2GZAA 1Z5OA 1OI2A 1QH8B 3CKMA 3COPA 1FB5A 5AI5A 2BE7A 5FUYA 2D1FA 2QLFA 3CLSD 3NAGA 3V6MA 5B6PA 2YNMA 4WZ6A 5A2QA 5L4NA 4I5EA 2A0XA 1SRRA 3BGOS 2RH8A 2P11A 1TVCA 4UAUA 2VIIA 3KV1A 1FYDA 2WPNA 1CDOA 3DO8A 5ESXA 3NR2A 5JMWA 2FWRA 1OTHA 3ODGA 1LS6A 5T3UA 5GMOA 2ZJ2A 3ADKA 4I4LA 5G4KA 2QSJA 3TEFA 3UPUA 1YDWA 4N5DA 3VXKA 3AVWA 4MRVA 1R4MB 4OGWA 4J7UA 4XFJA 1Z36A 3R0IA 1M1YA 2J3EA 1MC1A 1XVUA 4L57A 3JVUA 1K5GA 3OE5A 3PX7A 4EYSA 2CSXA 3GJTA 4QPCA 2OFXA 1TRHA 2OAP1 2OQ2A 3PNYA 4FE7A 4IKOA 1MQ9A 2ZU0C 4XPIA 1G3UA 1X7ZA 2JHCA 3K7EA 5ENZA 1M2VB 3GMTA 1J0CA 2FPKA 4D6XA 1I01A 3H11B 4QEKA 4Y2PA 5FH9A 5JADA 2XMGA 3COJA 3IEMA 2GT1A 3TNDA 1QYWA 4CTKA 4RA9B 4EB0A 2YX1A 1W4AA 2PJZA 5D00A 3EXG2 5EPOA 4C0QC 3IULA 5JZSA 3UT5B 1V5FA 4BNGA 4DLLA 4MPDA 4WLVA 4DCGA 5IK2A 2FHPA 3K30A 2QU7A 3H1PA 2QPLA 1G3IA 1IM5A 1VJGA 1YCDA 3NYQA 2NT3A 4I66A 4NK4A 4NZZA 4XDZA 4XVHA 4F2HA 2ZWIA 1EXNA 4F9FA 1P2BA 4LDAA 1MB4A 1U90A 1N5MA 2P9YA 2L0XA 3SZ3A 1K98A 2R6DA 2XNJA 3CPHA 3FN4A 3LLMA 3QV2A 1A2OA 1QM5A 2QD1A 3OX4A 4QRDA 4RK5A 5JNTA 4ZHQB 3PVCA 5DM4A 2ISSD 2IWRA 3ZHUA 3IOMA 3NHPA 3V32A 2P9HA 3E27A 1P80A 2ZRKA 3IAAA 4MVJG 3U5ZB 1ICEA 1YL5A 2ZB3A 3GOHA 4TRMA 5JXJA 2JLVA 1CKEA 4YJHA 1YJ8A 1V9CA 2QE7D 5CB4A 3WZLA 3LUPA 1XDGA 4K28A 1GAJA 4PGMA 4UHFA 3G8YA