1ZUNA

Crystal structure of a gtp-regulated atp sulfurylase heterodimer from pseudomonas syringae
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
204
Chain Sequence
LVPRGSHMVDKLTHLKQLEAESIHIIREVAAEFDNPVMLYSIGKDSAVMLHLARKAFFPGKLPFPVMHVDTRWKFQEMYRFRDQMVEEMGLDLITHINSAKHTDIMKTEGLKQALDKHGFDAAFGGARRDEEKSRAKERVYSFRDSKHRWDPKNQRPELWNVYNGNVNKGESIRVFPLSNWTELDIWQYIYLEGIPIVPLYFAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfate adenylyltransferase subunit 2
publication title Molecular basis for g protein control of the prokaryotic ATP sulfurylase.
pubmed doi rcsb
source organism Pseudomonas syringae
molecule tags Transferase
total genus 44
structure length 204
sequence length 218
ec nomenclature ec 2.7.7.4: Sulfate adenylyltransferase.
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01507 PAPS_reduct Phosphoadenosine phosphosulfate reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1zunA01
1H3EA 4YP5A 1M8PA 4ZT2A 1CT9A 1KQPA 1MB9A 4G6ZA 3Q10A 3SP1A 1G8HA 1QTQA 3ZXIA 1H3NA 4JZYA 2CFOA 1F9AA 1I6KA 2QTRA 1KQOA 4MUFA 2J09A 2G36A 3FY4A 4EGAA 1KP2A 1P7PA 4WNYA 2DUMA 1WY5A 3D6UA 4XFJA 1ZH6A 3IOEA 3ND5A 4MAFA 1NI5A 2QUIA 4EFKA 5F23A 3NBAA 2VTBA 4EF6A 1ZH0A 3QTBA 3PRHA 4MW5A 1M8GA 3RHSA 1TYAE 4EG7A 3UK2A 4JYZA 1KP3A 2D5BA 1PFVA 4XFDA 1WXHA 2A88A 1IQ0A 1F7UA 1N2BA 2PXHA 3KFLA 3COYA 4GRIA 4MVXA 2QUHA 1ZUNA 2WQ6A 1BS2A 1ZJWA 1NZJA 3FWKA 3L93A 2DEUA 4DDKA 4MW7A 3MXTA 2E18A 1GTSA 3VRHA 1GLNA 5FNZA 2CV1A 2A1TR 2A84A 3CVYA 1N2EA 1LW7A 2HMAA 2BYTA 5H16A 1O94D 4EG4A 3H05A 3UY4A 1KH1A 3ISJA 3RK1A 4AS1A 1NUSA 5K0TA 3CLTD 3GMIA 4NAHA 1QNFA 2CUZA 1QQTA 2IJGX 2ZP1A 4H3SA 3UC5A 3RK0A 3C8ZA 3FETA 2WSIA 2B7LA 2GM3A 2WB2A 2AKEA 3TQIA 4U8HA 2GOYA 1EJ2A 4DJAA 2DR2A 1U7XA 3COZA 4QREA 1MOPA 1O94C 2JANA 1R6UA 4ZT7A 4UZFA 2AG6A 3CLTC 3OTWA 4E1AA 1WXFA 1QRTA 1U0BB 2R5WA 3IMCA 4MWEA 5J59A 2Z3VA 4MWCA 3ND6A 3CVUA 4MUEA 3DLAA 1COZA 3RFFA 2O5RA 1MBZA 1T6YA 4DNXA 5J58A 5HG0A 4FZJA 2J08A 2QJFA 3N9IA 5KCMA 1GN8A 1OWPA 3D6VA 1JIKA 1Q15A 1JIJA 1GTRA 3M5WA 4R2LA 2E21A 1JEDA 2C5SA 1QU2A 3KT3A 2DERA 1X6VA 4WSOA 4ZCTA 1XNJA 2D54A 1O0BA 4QRDA 1OWNA 4DDMA 4ZT4A 1N2GA 2XRYA 3ZXSA 4MW6A 1N77A 2A86A 1O0CA 4PBTA 3CVXA 5KWVA 3IMGA 2PG3A 2J5BA 4HJRA 3CLUC 1MB2A 1R6XA 1N2OA 2CYAA 3TZEA 3P52A 1WQ3A 2CV0A 1JGTA 1FFYA 5J5AA 1O6BA 2EL7A 1K92A 3QE4A 4MVCA 4EG1A 1PG0A 4F3RA 1VBKA 4DDHA 5LM3A 2CT8A 1JEEA 1EFPB 4MVWA 3HZRA 5H7XA 1LI7A 1OWLA 2DXIA 1KH2A 4MLPA 4G5FA 2BTEA 2O8VA 1J1ZA 1WQ4A 4OJMX 2RD2A 1T6ZA 4KR7A 1OWMA 1KR2A 3IH5A 3IVCA 4MVYA 1YIAA 1I6LA 1VBNA 3ZIUA 1MJHA 1V47A 5LFAA 3N05A 4MQ6A 1V8FA 3L92A 1QRSA 3KT6A 1J21A 1WOYA 1X8XA 1KAQA 1VLHA 3FHJA 1M1ZA 2QTNA 1KKUA 5DASA 3SEQA 3LCJA 1QRUA 3IMEA 1M83A 1YUNA 4Q93A 2DLCX 3F3MA 1N75A 3CLSD 1PFYA 1IFXA 2QUJA 2X1LA 2GKSA 4YBRA 3SZ3A 4I6EA 2NSYA 1OBCA 3GUZA 1NUQA 4A91A 1O96B 3IUBA 1PG2A 4EG8A 1VBMA 1K4MA 1ULHA 2CV2A 3AFHA 2V0GA 3LE8A 4MW9A 3H9BA 1IH8A 1IRXA 3DO8A 4ZT6A 3A04A 3CLSC 3LOQA 4X0EA 3CVWA 3X1MA 2A1TS 4ZCQA 1EFPA 1WXIA 1TYBE 1N1DA 3TZLA 3TS1A 1B6TA 3JXEA 5EKDA 4NX2A 1F7VA 3K9WA 3KT8A 1EFVB 1MAWA 3Q12A 2RE8A 3GLVA 1WXGA 2X1MA 1Q77A 1XJQA 2VXOA 1O5TA 1NUPA 4NZPA 4CT0A 1WJGA 3I05A 1J20A 5HUHA 3N8HA 4UZEA 1ILEA 2X0KA 4CDMA 4ZCRA 5TEVA 4HPWA 2CYBA 4EG3A 1PFUA 4QBTA 1EUYA 5FO1A 1M8JA 1T9GR 1HYBA 2YWCA 3X1JA 1IQUA 3SDBA 3DV2A 4R0NA 3NBKA 4EG5A 3FG9A 4ZT3A 4RUKA 3TNJA 5TEWA 4AQ7A 3CA8A 1OBHA 3CLUD 2CSXA 2PZAA 2QTMA 1A8HA 4R2MA 1O97C 1JILA 5DK4A 1Y42X 4PBRA 3MUEA 3FI0A 1YUMA 3UOWA 3AL0C 1NUUA 1O96A 4NAUA 2V0CA 4L2IB 1M8FA 1WXEA 4GU5A 3PNVA 1YI8A 5AHWA 1TEZA 4TS1A 1FYDA 4YP6A 1J1UA 4KR6A 3FH0A 1MC1A 2ZUEA 1JMVA 2OQ2A 3K32A 4KPUB 1IHOA 5JBNA 1KORA 3HFJA 3IOCA 4JXZA 1IVSA 2WQ7A 1MAUA 5FO0A 1EXDA 3P0HA 2J4DA 2PZBA 2QUKA 1TQ8A 3VGJA 2X3FA 2NZ2A 1EFVA 4K0RA 3AIIA 1YIDA 4DE5A 5LLTA 3ILVA 1QJCA 1T6XA 1TYDE 2JAXA 4MUJA 1N2JA 3VU8A 3CLRC 1U3CA 4MULA 3PXUA 1JECA 1MRZA 3FNRA 4ARIA 2I1LA 4NATA 4JFAA 1R6TA 4MWDA 3RJZA 3H99A 1M8KA 1JIIA 1JZQA 4KKVA 4MUIA 1NUTA 3IUEA 3E27A 4RPIA 1N2HA 4MUNA 3G59A 4ND7A 4I6JA 4OUDB 4DLPA 4CDNA 3SZGA 3FIUA 3DPIA 5DEOA 1Q19A 1H3FA 4NDAA 3FOCA 1SURA 1G8GA 2PIDA 1F4LA 2A1UB 4MWBA 4PBSA 1EE1A 2PFSA 4EG6A 3COVA 1Q11A 1TFUA 3N2YA 4BWVA 2D13A 3SEZA 3HMQA 3IDFA 5K0SA 4JXXA 1QU3A 1NSYA 3HL4A 4L2IA 5HUJA 1N3LA 1YULA 3NV7A 4MW4A 1VL2A 4MW0A 1N2IA 3HV0A 4U7JA 3P0JA 1WZ2A 2EJCA 3ZJTA 4KPUA 1PFWA 1I2DA 4HJXA 3G6KA 3A05A 3PNBA 2CYCA 1KAMA 3SYTA 4J76A 3QTTA 2HGZA 4ZCSA 4J75A 1TYCA 3ZGZA 3UMVA 3HGMA 3G5AA 4MW1A 4YP7A 2E0IA 3ND7A 3KT0A 1JZSA 3P0IA 3MLBA 3IVGA 1GZUA 5TGTA 3ZJVA 5BNZA 2OV4A 3TQOA 4S1OA 4I6GA 1G59A 1K4KA 5KHAA 3CR8A 1U3DA 2QJOA 1N78A 4MUGA 2A7XA 3H9CA 1GPMA 1GAXA 4G5YA 3AG6A 4ZT5A 4MUKA 1U7DA 1O95D 3X1KA 1O97D 3CVVA 2ZUFA 1XNGA 1J70A 1D2RA 2QJTA 2A4MA 1S4MA 1XNHA 4P2BA 4K03A 3BL5A 4F4HA 4OUDA 2IELA 3ZJUA 3INNA 3S3TA 3OP1A 1RQGA 1NP7A 1OD6A 3COWA 1NYLA 4XSVA 4ZCPA 2YWBA 5TS2A 2DETA 3A4IA 4PY2A 3AKZA 2A1UA 4Q16A 3A2KA 2AZXA 2Z08A 2Z09A 2JA2A 2VTBB 1IQRA 3IVXA 1I6MA 1DNPA 1G8FA 2TS1A 1O95C 2YXNA 3U1VA 3FDXA 4CQNA 1KH3A 1K97A 3MLAA 3AG5A 1LI5A 1J09A 3MMXA 2H29A 2HZ7A 4MW2A 3ELBA 2H2AA 4MUHA 3RBAA 4ND6A 1WKBA 4YMIA 1UFVA 4KR9A 4HK4A 4U63A 1T9GS 5IHXA 3CLRD 3PNYA 2E89A 3H97A 2XRZA 1H1TA 5IJXA 2YY5A 1NURA 5DB4A 2DPLA 2J07A 1OWOA 3Q4GA 2PZ8A 3IODA 3IOBA 4ARCA 2IP1A 1KQNA 3ZUGA 1EUQA 1JHDA
chains in the Genus database with same CATH superfamily
4Q6WA 3DFMA 2FWPA 4RADA 4G2NA 4IINA 1NDUA 1M8PA 3H87A 4TT3A 3SQXA 3DV9A 1M7GA 3Q9UA 4QLBA 2PM8A 3PENA 1KQPA 1COWA 1MB9A 3QPBA 5ENDA 4YMLA 4X65B 1J00A 2WYIA 2ZJ2A 2DWUA 4LIPD 1LBQA 3NC0C 3OEHA 4QFDA 5DX8A 3LUCA 1RVV1 3K20A 2R60A 4NU8X 4BMOB 5IF3A 2FW8A 4Z4CA 1JSZA 1WDTA 5JVDF 4B3XA 3TEJA 5IFKA 3N75A 4OMFG 3T1OA 1VHTA 4H0NA 1SU4A 2CLSA 4GSYA 3QU9A 3PV0A 3W7BA 3DT6A 5CVUA 4PIMA 3RODA 4P4TA 1OASA 1NNEA 4KXUA 1NMQA 3MOGA 1DMSA 2EW8A 1FXWF 2CBGA 2HMTA 2Z2KA 4GOLD 1ORVA 1J8VA 2WFLA 4RY9A 5AKHA 2OGSA 4B4WA 1XTIA 3PDCA 2OORC 3U3KA 5FLKA 7YASA 1QH1A 3ZOZA 5FPHA 4TQUS 4J0IA 4BRWA 2XB8A 1U7PA 4YXFA 3ZE8A 2CKMA 4D4MA 1QPBA 2V03A 2VHJA 1FFAA 2P4HX 3I8SA 4D9MA 1LSJA 1E1RD 1YQDA 4NZNA 4OMUA 4MP6A 1TMKA 3S4YA 1OLXB 4M9ZA 3V80A 3LPLA 1RI2A 3U7HB 3VKGA 1CDOA 1BC5A 1PD0A 3RASA 4ZMSA 4JN6B 4H7PA 4MV8A 1QVZA 4RL6A 1PL7A 4G81A 3JQPA 4M99A 3OIDA 2PL5A 3L0IB 4DRZA 1BS2A 2XH8A 3QPDA 4O3FA 4EHNA 1K0UA 4Q4HB 3G89A 4PN3A 3HJCA 3SC2A 1TRHA 2WSMA 5H3CA 4KQ2A 1UBEA 3L7KA 2OLKA 4GMHA 1UOEA 3W5CA 3FGZA 3IPAA 3R3YA 4MQFB 1T43A 3DL4A 5E6SB 3ZIAD 1FDWA 3JZAA 4FJ0A 4XLLA 3PCTA 3KQPA 4U6NA 4OHKA 1QCZA 1DT3A 3OKCA 1L9XA 3NHLA 4GI7A 2OZLB 3NRBA 1CYEA 3TNLA 4GOND 5A3QA 2IK8A 1N3YA 3SS8A 1Z0FA 3DCJA 1UT6A 3F3KA 1RYYA 4FYMA 3NP7A 1E0DA 3OTQA 4Q12A 4NZ9A 3OZXA 2QM7A 1WCXA 1MXHA 4KOAA 5AK6A 3W6NA 4DT1B 1O4WA 2ACVA 3TUZC 1VSQA 4A9AA 2DGDA 3P5SA 4P54A 1NJFA 2GM3A 5JU6A 4PYJA 5KNBD 2NUBA 3NUZA 3L8HA 4LE0A 4P58A 3ZV7A 3KTFA 4KQCA 1EDOA 1XJ5A 4PN7A 2JGAA 4GLOA 2JFGA 1G9XA 5K45A 4ZT7A 1YD7A 2QTGA 2C4MA 3FGPA 1P39A 2B35A 4XQ9A 3MBIA 3ZCSA 4B8WA 1B73A 3CLTC 3COPA 1ZOSA 2BHRA 3PQ6A 1NW6A 3OO1A 2YHAA 2DR0A 1R0CA 1WZCA 1ZVMA 2V3VA 3PLRA 4IG9A 3OQNA 4BVFA 5AJUA 4AO7A 1Z29A 1J2TA 4MRAA 2W4IA 2BIFA 2WYHA 1UQRA 3EWIA 4ZO9A 3ACCA 4MWCA 5FBLB 1Z4KA 3S27A 3TZHA 1J9ZA 5C7YA 1U8TA 3DMRA 1I3MA 2O2YA 3AGQA 3C48A 4CLOB 1TF5A 2PSEA 2JJMA 4L3VA 5KX5F 1COZA 2G1AA 2XF8A 4PXSA 4XGNA 2G28A 2BN4A 2EHJA 1U04A 3ICVA 2ZI4A 4HAVA 2F59A 3WLJA 2I1QA 1CY4A 2F67A 3L0CA 2QJFA 1KI2A 1P4RA 1SU6A 1ZN9A 2FWMX 3ABZA 3ROKA 3AVVA 3OZVA 3UJBA 1NHGA 2NV2B 2AEJA 3K16A 2GFQA 2ZBFA 3UGKA 3OHMA 9MHTA 4OBWA 1RU3A 1P2GA 2ZRHA 4ZQGA 2PNJA 4D43A 5JSUA 3CXRA 3JZDA 3BDVA 4JUIA 4YMGA 1GQSA 1Z62A 4EF5A 3IIKA 1JDSA 2ZSFA 3L0BA 3TLMA 1G20E 3E5RA 4WZBA 5EJMA 1RM5A 3C6KA 2IYNA 3JWJA 1W30A 3GN2A 5AJWA 2PO5A 2G77B 4QOEA 1H0KA 1PJCA 2GTHA 4HUQA 4BNDA 1CD5A 4WOBA 1FTSA 4L4UA 5JS8A 4JSTA 5GONB 4E5SA 3P71T 2DR3A 3GLSA 2XRYA 1JN0A 2EKDA 2GK4A 3W2FA 4BKQA 2JAPA 2J3MA 1RPZA 2IS1A 1H4VB 3G23A 1UBCA 2C7BA 3ON5A 3QFRA 4LDJA 4MEJA 1XZGA 1WQ3A 1SA0B 1N0VC 1SB8A 5H59A 2O3QA 2P1DA 4DV0B 1DJOA 2XMBA 3DAGA 5HZHA 1CZLA 2H1CA 3H4IA 1YH3A 3M6MD 4B2YA 3AF1A 1PG0A 5J5CA 4F3RA 1EVZA 4EMSA 5REQB 2X8LA 1ESDA 4S1WA 4OD0A 4WA8A 2IKQA 1TIBA 3BGWA 4JP8A 2A33A 3UJPA 2WUGA 3L07A 4ES6A 2PCJA 4HH3C 5JJ5A 4KZPA 2EFHB 5JZ9A 3KKMA 1KDZA 3WL8A 1Z5WA 4PCVA 5FUXA 4XW2A 2H4XA 5KB3A 3HUDA 1UPUA 5DNDA 4KXNA 2YXDA 2QLNA 5JAIA 4Y1EA 1T6ZA 3PDHA 2VAXA 3KOOA 3DULA 2ZPAA 3ZVNA 1SIBE 4BNVA 2WUWE 3SX2A 3ZZTA 1ZL2A 4A0RA 4Y8VA 2BHSA 2XCIA 1EG2A 3E4DA 3Q87B 2VUTA 4CM7A 3B6KA 3PFKA 4DXHA 4R9RA 4KAJA 1NZDA 2A2ZA 1KGSA 5KC8A 7MHTA 3RC9A 3L92A 4AO6A 2QG6A 1CS0B 5AVOA 5B6JA 5CB4F 3A4TA 4N5DA 4GYKA 2D2FA 1ORTA 1MPTA 1EWKA 3V7NA 3E1KA 1PIWA 4O4IF 2WY2D 2ATVA 1H2XA 1O57A 1RLTA 3SS9X 3W6ZA 2D1RA 2J31A 1TZBA 2O7VA 2RG1A 4EL0A 1ZM7A 5KIAA 1CUFA 2VNJA 1BHJA 3HKEA 1GUFA 1UBKS 5CCXA 3C6XA 5MFPA 1EE2A 1GD1O 3ELDA 3LF2A 3S5UA 2X1LA 3GUZA 3M5DA 1TLLA 3W3AA 4RPKA 2OV2A 4P2GA 3SS7X 4Q9AA 3ZGVA 3OCXA 4F4CA 5HM8A 3VNBA 4BO9A 3TECE 1GPNA 2QQ0A 1KOLA 3P9QA 4CIXA 2PUGA 1R4NB 1Y7PA 3HA2A 2H18A 3FKQA 1PG2A 4M3NA 1KK3A 5FLYA 3FWNA 1FTQA 4L9SA 3C7TA 5FTNA 5AKEA 5JYCA 4UNSA 1KY2A 2OENG 3H9BA 1SOMA 3VNRA 2C2GA 1JSCA 1KQFA 4DR2B 1PK7A 2BEUA 3EIWA 4YJ2F 5LCXA 4DJJA 4EHHA 1DBPA 1MIOA 2O0LA 2XDQB 4MS4B 2IBTA 2E3JA 2NVOA 3HEAA 4PG7A 5IM4A 3AL2A 3DFFA 5F7JA 1U0LA 4B09A 3CVWA 1DEHA 1PR0A 2BFOA 3IV9A 3NONA 2H3EA 3H4VA 2JEZA 2PKQO 2ZBUA 3H16A 3IPCA 3EYWA 4RQTA 4GGPA 2NUPA 2VPXA 3CX6A 3U1TA 4ZAVA 2RHRA 2O6LA 3NLLA 3UWOA 4UBIA 3B8EA 4RIFA 1ID1A 2ZB2A 4BB5A 1B8PA 2YFHA 1SRQA 1Z39A 3HHEA 1PZGA 1OAAA 1S8AA 4AXBA 1QYDA 3I05A 3EGWA 1W93A 1P0PA 2QD1A 4QSMA 4OHOA 1N0UA 1UOOA 2Z04A 4LQLA 5JVDA 1ULTA 4ZD6A 3TI9A 1R6AA 3OUUA 4IUBS 3UB4A 2IIQA 3LNCA 1OYWA 4Z4IA 3OPNA 3H2SA 2H6EA 1JG3A 2I76A 4G2TA 4P31A 2ZJZA 2O23A 3MRSA 1Z22A 4W7IA 3AC0A 3SDBA 2ZT5A 3I37X 2HBYA 2MYUA 4R0NA 3V4ZA 1JAIA 4I0WB 3U13A 3NETA 2O8DA 1C29B 1FXWA 3LBNA 4M1WA 4OPMA 4KGXA 2GHQA 3QKTA 3TKYA 2BUCA 3L7MA 5DWVA 3DDZX 3RTCA 3DH0A 3P19A 3WGIA 1ISGA 1XD2A 2RBKA 2A0FA 4WUTA 2NACA 1V4NA 1H2WA 1P7YA 1DBQA 3CT4A 4QUKA 1PR2A 3HDTA 4TTJA 3KKNA 1E1CB 4I9FA 2Q4OA 1T2DA 2JLVA 2VJMA 4FXPA 1NJSA 4MGEA 3NTOA 2WFMA 1AQ6A 1U6KA 2RGAA 1XGKA 5CNJA 3ZK8A 4JSRA 1KRWA 1ADCA 1B15A 1I2BA 1MB3A 4TM7A 1FLVA 3N8DA 2XKKA 5IVPA 1RXWA 3T35A 5BNTA 3SHVA 3AXSA 5IC5A 1ZL0A 2E82A 2ZYGA 5EZQA 3JV7A 4NCHA 1LLUA 2RGYA 4I5EA 4R5HA 4RETA 3UIEA 4Q7QA 5JBNA 3H5IA 1K0FA 2OD2A 3QPVA 3QW4B 3SSMA 5JXHA 4JXZA 4KMOA 2O5EA 2P7HA 2YWHA 3HDHA 2F8MA 2CXHA 2MIIA 4PC1A 3H9EO 1GNPA 2RDMA 4U7PB 1OI7A 2QMZA 3SSNA 2IEAA 3W4KA 2YXBA 3A10A 3BJIC 4CKCB 1NXOA 4DJEC 2LBPA 3PK0A 3MUOA 3I30X 5ALYA 5EQFA 1IB6A 4KL8S 2WJYA 4NSNA 4TSFD 2PUCA 2YCBA 2GJ9A 1FB5A 1FP6A 1ZR4A 3O8CA 3CF6R 4ZVOA 2GXUA 3HP1A 1EK1A 3D6NB 3I6BA 1ATZA 1GZ5A 1GWNA 2ZSBA 3S8EA 3CSUA 2H48A 5D7BA 3M3PA 3PWZA 2XOKD 2YKGA 1ZN7A 2Y1WA 3N86A 4GXNA 4MUIA 4D82A 1MNAA 1Z13A 1ZGHA 1JTFA 3GZJA 2XWJI 3EEBA 5HJEA 1AKNA 3IS3A 2Q7OE 1B14A 2JA1A 3TTVA 5DYGA 3VR4H 1YOVA 2GVZC 1HBJA 5A4MS 4I8XA 5LC1A 2QRUA 2WWTA 2WMYA 3OZRA 1WCV1 3IVMA 3QA9A 3QPAA 4KLZA 4RPGA 4BGEA 4DLAA 4PQRA 4O4JF 5DVZA 1UM8A 1AKUA 5JO0A 4P7FA 5TT1A 1F4LA 1PV1A 3A7EA 3GV0A 4NIMA 3B5EA 2WDZA 4R1SA 5DOVA 1Y7HA 3MCVA 1E5TA 4K6MA 4AQDA 4BGVA 4U39A 4UCFA 5FWYA 4HLUA 1U28A 3ZQJA 4L4YA 4EG0A 3R7WA 4JXXA 4ZCIA 4Z8YA 4AMVA 2BZSA 2E6UX 5EP3A 1UFKA 1FE8A 1N3LA 4TTVA 2ACKA 4HGYA 5KX5A 3OLWA 3PQ4A 1HDZA 4NNPA 621PA 1NW4A 5COAA 3VSDA 4DNPA 2Q6KA 5SY4A 3PQ3A 4HY3A 2QHXA 3ZJTA 2C29D 2FH5B 1H23A 4HP8A 3E3LA 3CCFA 4S05A 2V59A 4F5EA 1Z4OA 4N8DA 4FSXA 2QRZA 3PNBA 3PXEA 4RDCA 3V4PB 1KGDA 2B5VA 2WWRA 1CJCA 1W88A 4KLCA 5D6OA 2D2VA 1LRLA 2A7QA 3CPHA 3OVMA 2IOYA 4CKXA 5F23A 2BDUA 3RS5A 3L8ZA 2ZUBA 3MJVA 4OH7A 4MKXA 3ZTTA 3ZXYA 4CG3A 4CT5A 2PLWA 1BXGA 2RI1A 1UR5A 4URVR 4L6IA 5TGTA 1ZIOA 5JMOA 2Q4DA 1G42A 5HKKD 2FZ5A 3H6KA 2IYPA 3L7JA 5LIPA 1XCOA 5C1IA 3GOHA 2BKEA 2ZLBA 3DMDA 2L18A 2CCKA 2V4MA 1U8FO 1LGYA 4HMQA 5BYJA 3QXXA 5IAGA 4OGKA 1U7DA 1NHWA 4E5VA 1ZJYA 4XTCS 1ZG3A 4BWFB 3DO5A 4K3UA 3GVXA 5T4FA 3P97A 2VJLA 3HXPA 4LMBA 4E1BA 3G1WA 2ECPA 5CITA 1K3FA 1ZM9A 3U37A 2FPIA 1HSOA 3PFFA 1HWYA 4GX0A 4YH1A 4AY2A 4G1EB 5JYBA 1A5AB 3JQ7B 4YPOA 3E1GA 2FR8A 3WQBA 3RQSA 2HGSA 1M2FA 5L9AA 4X9XA 1Q83A 1M33A 2JLBA 4EUNA 3LK6A 3BHJA 1UWCA 5D7NA 1CY2A 3U9SA 4DAOA 4NENB 4MROA 2AG8A 4KXVA 1V7ZA 1WNFA 2FLKA 1XKQA 3BOSA 2VDKB 3QYFA 5FBZA 4BNFA 2Y1XA 2IKSA 2ZM6B 2XDAA 1UKBA 1A2KC 4LTNA 4WCFB 4CUJA 3FOBA 3UFXB 4Z51A 2VRNA 2BR4A 1UBJS 3C3CA 5K01A 5CJJA 3GT3A 1Q2UA 4M0MA 5AI0A 2DC1A 4ILKA 1UFVA 5KMGB 2JGIA 3RDPA 2Q7DA 1QFSA 4XGQA 3N74A 3FWZA 3WGTA 3TMKA 2JFYA 6NULA 5CB4A 5AK3A 3EZXA 4MNTA 4A27A 3RAJA 3D4PA 5AVQA 2XRZA 1QF7A 2BFNA 4O4IA 1RM0A 3G88A 4PLYA 1N5DA 5IJXA 3V2IA 4DLKA 4A36A 1PQUA 3JQDA 1Z0DA 2CY0A 3C8UA 1KVTA 3Q8WA 2DPXA 3PFCA 4M76B 5EIBD 1JHOA 2A5LA 3IODA 3E9QA 4YFVA 1NUHA 1VKNA 3CNBA 1SCUA 1JDNA 5B1DA 3NNDA 5IKOA 1UFQA 2AFIA 4CT4B 1Q7CA 2HSGA 1OXUA 4A03A 1B6GA 1X0VA 3E3AA 3RFUA 3MN1A 4MA0A 1JSRA 4I81A 1CZKA 2VNAA 5ITZA 1QTQA 1H3NA 3BRQA 4MITA 2P9FA 3KJIA 3FMIA 5K0EA 2VO1A 3JTEA 4YP1A 3VHLB 1RKXA 5BV8A 1XKXA 5AJHA 2DQSA 4G1FA 5CH3A 2QVGA 2QRJA 5L7WA 1ZNYA 3P2JA 1JU3A 1LDNA 2GERA 4RORA 1VYHA 4YJ2A 3O8RA 3B89A 3L46A 1QRAA 4YASA 4XD2A 3SBDA 2X0RA 1QDLB 3E35A 4CCAA 2A1IA 5DI3B 5IHPA 1B76A 1TOAA 4HGPA 4EFNA 4KCGA 3GLUA 4B4VA 1Q0HA 1X7WB 3MAGA 5JQGB 3QBJA 2MU1A 1SB9A 3AJAA 3T99A 2R7KA 1JS1X 2WD9A 4FSDA 4B2PA 4NE9A 1UPTA 3ZLBA 1P3Y1 3BGDA 4B6RA 1V6AA 1DKQA 5DF1A 5IW8A 3ZD7A 3BXXA 1PNTA 2FN3A 1P2UA 4DDVA 5HIAA 3T41A 3OQVA 1FRNA 1P77A 3HCWA 1SG9A 3ZH2A 3IEMA 4RTSA 1ZJ5A 2D3TA 3GEBA 3KFLA 3Q6MA 3RTGA 3U6BA 1VLQA 5EINA 3U9TA 3QE0A 3UAXA 5LN1A 4AX8A 1W6UA 2PGXA 2VKTA 4X7RA 5CA0B 3LBFA 1A1SA 1GEEA 5DBGA 5JAOA 1GCAA 1OFUA 4K9OA 5LQRA 3QNWA 3TJZA 1TJ3A 1Z06A 4IUDS 4O3MA 3LFUA 4JVLA 1E9DA 4QBHA 1HKUA 5CVJA 1N6HA 2CEAA 2CW5A 3A1DA 2C95A 1U7UA 1U81A 4LBYA 1PNVA 1FL9A 1QGDA 4R2KA 2ETVA 5KJFA 3BH0A 2A84A 3UOAB 2J48A 1FW6A 1ZK4A 3IFSA 3CIFA 3IEPA 5TMPA 2QRHA 3E82A 2ZRLA 3N0TA 2OOSA 1IM5A 1F38A 1AQJA 4TV9F 3GGOA 5BUSA 1IG0A 3I01A 2R25B 4RGQA 4MVJH 1ISFA 4BLWA 2CUZA 2BBTA 3ZU5A 3A6JA 1U2ZA 3O1IC 5FOVA 4QJ4A 5CFPA 1P6XA 2GESA 1XRRA 4K7JA 3IIIA 3NTQA 2X2PA 4O5AA 5CRIA 4BNXA 4BMYA 1YZYA 3ZU4A 1QGYA 4QUJA 5KHOC 3NEJA 2JDID 1AGPA 1EJ2A 2G5TA 2GN9A 2FY8A 3COZA 5AJYA 5SZIA 4IAOA 4TMWA 1IJFA 3UCEA 5AVXA 4TUYF 4MV6A 1CUWA 2ZCVA 3HB4X 3A6GA 2VXCA 2B1JA 1NW5A 3I9V1 3PEUA 2PD6A 4FMDB 5BV2P 5JMPA 4KRGA 3OBBA 4H35A 1GYQA 1OU0A 1T4MA 4P0QB 4UPEA 5TQ0A 2KBEA 3FOZA 4N6OA 4DV1B 1ZCFA 2Z3VA 1NBIA 3MCTA 4QT0A 5KI6A 2H9IA 3JARA 3FMOB 4P98A 5GOTA 4BCBA 2GVDC 3ADOA 3JQAD 3ZGOA 1RTTA 4GM1A 4AVYA 2GRAA 5KNDA 1DG1G 3KS9A 3DV0B 4CJXA 4LQDA 5J63A 1RR6A 1K75A 4V39A 3RWOA 4QU0A 3WA7A 4C43A 4HTFA 1R0SA 4RGVA 5TS3A 3RFFA 3RABA 3TOZA 1L7QA 1L8LA 2WHYA 2GAIA 3DZHA 3WB9A 4EA7A 1Z0AA 3R1IA 1LK5A 4PS1A 3SIPA 2BKVA 1JR2A 4IO0A 4P0TA 2A78A 2K4MA 3HEMA 3RRNA 1NSTA 4P4SB 4CLRB 3CB2A 2ZRPA 1YBFA 1Q1BA 3HACA 4O4JA 2ERCA 3EXFB 1KDOA 2R1VB 2I6FA 3QEAZ 3L6BA 1EBUA 1JHAA 2AK2A 1Z5OA 2I6TA 4N8SA 5BQ5A 2J9XB 5LD2B 1GXSB 1RWQA 1H94A 4MHOA 2IZ0A 1OJLA 2HMVA 1XBTA 3P2KA 3KEQA 4EW6A 4G25A 4HD8A 5JD6A 4Y2GA 1QH9A 1IYZA 2XCQA 4C05A 1JEAA 1N6PA 2XRMA 4CM4A 1MEJA 2CDBA 2R6AA 4UC0A 4MAMA 4LQCA 3MHPA 2FXVA 4IMIB 5FHQA 3UWPA 5JC1A 2RGEA 4BXOB 1KJIA 5L40A 1NI4A 1CUHA 1VLJA 3BQ9A 1TW3A 1S3FA 2A86A 3B36A 3M3HA 2C0QA 4KFTA 5HE9A 2XUIA 3N2KA 5JHGB 3L02A 5CB8A 3UA4A 1YJBA 3LTEA 1R5OA 4EPYA 1GAEO 1N2OA 2CYAA 2DFNA 3P52A 1M6EX 1KFCB 3R44A 4PU0A 4Q03A 4MHSA 4OQDA 1V3QE 3ORHA 4DG9A 5KPJA 1XN4A 4PCUA 1N92A 1F0PA 2KW5A 4X1IB 1GVHA 2X9NA 1D4FA 1EK2A 3THSA 4CQMB 1CW2B 2P6RA 2P27A 4TWRA 3PNQA 4RA6A 3WHPA 2PRJA 5KQGA 2PT5A 2GWHA 1WMSA 3ZDDA 2IIPA 1S2IA 4TX1A 1IULA 3NV9A 4BV9A 1PDOA 1XJCA 4G5FA 2J85A 4QJ3A 3OWXA 3HK2A 2C98A 1N2CA 1LH0A 2FDRA 2I2CA 4WESB 1Y6RA 3M9LA 4Q3CA 5FWAA 5ECWA 4CIVA 3DGEC 3TM5A 5BN5A 1YCFA 2CKDA 1EI9A 2QW8A 3B1YA 5DM2A 3ZK9A 2RAPA 3IVCA 5IMSA 2F2TA 2GHRA 3SSOA 2UUOA 4RZ3A 2NU9A 2RCNA 2HBRA 1WETA 3KJZA 5IFLA 4S0XA 1Z0KA 3LT0A 3ROPA 1FMJA 4CL0A 5ARBA 1U9ZA 4FFOA 3ZK7A 1J8FA 5BWNA 2BGWA 2XLCA 5CFRA 3C14C 1FBTA 1FUIA 1XZBA 1WKCA 3OOWA 1UMDA 4GFDA 2FRDA 2GT1A 4OFZA 1LPNA 3QXGA 2OY0A 4OBEA 3MWFA 5LZ9A 3A1SA 1YUNA 1X7HA 2AEFA 2CF5A 2PXCA 4H7JA 2H7VA 3OPYB 4MKFA 4ZQBA 4DADA 5LQJA 3QF4A 3B1VA 4XD7D 1N75A 3SR0A 1SKYB 4XM0A 3EODA 2RKOA 3C4QA 1QYWA 1MJ5A 3AF3A 4MR8B 4J0JA 3SLKA 4BV2A 5JNTA 4I9NA 3S70A 4LYYA 4PQEA 5JJCA 3B1FA 3GXOA 4QJBA 3DBOB 2JJQA 4GQAA 3HCCA 1XALA 2FPKA 3G5MA 1PW7A 1CETA 3N2ZB 5FEMA 1R2QA 2O8NA 3E03A 1KYYA 3GLHE 1I7NA 1XAIA 3FMVA 5B7GA 3ZS9A 3LX4A 5FYQA 1M5TA 1SO8A 3OT4A 5IT0A 2PCLA 1H1LA 5I01A 4HVLA 3RU3A 4EY5A 4O2BB 3O94A 4QL3A 2Z9CA 3AWDA 2O06A 3BFKA 4N65A 1DCKA 3MAJA 4EFDA 4QWWA 4MMYB 2FK8A 3OZDA 2QVYX 5BSMA 2QX6A 5AJZA 1FQWA 1MR3F 1NXSA 3VH3A 4EZBA 1EWTA 4K88A 3T5PA 7ABPA 3MM4A 2JVJA 4IIVA 6PFKA 1KFBB 2I54A 1UJCA 1N32B 3KUUA 1KYZA 5FQNA 2C94A 4GZ3A 4XWTA 3ZDRA 4BNWA 4A6XA 2XKJE 3EXEA 1YFLA 3LHIA 2D8MA 4G0NA 3NUQA 4Z2YA 3SKXA 3TQHA 3W7VA 2RGCA 4B7CA 2W2PA 3RGWS 4JBYA 3LPMA 1KFKB 3PBKA 2GN0A 1T15A 3U3JA 1IPHA 1JAHA 1RYFA 1XTVA 2IGTA 4AF8A 5GTDA 3ZI0A 4DKJA 4RW0A 3ROZA 1WXWA 2JD1A 4WMLA 2C59A 2XYVA 3ECAA 3VNQA 1Q1GA 2J5RA 1FP7A 4J1TA 4DUGD 1Z6GA 1P1RA 2HB6A 4DMKA 1P60A 3OEEA 4EFMA 2VPPA 2XOEA 3JQ9C 4YV2A 1ZRNA 3ZDEA 2CSXA 3J7AC 1AM4D 3LWDA 3UV3A 3HVUA 4BV8A 2G0AA 4U2GA 2I2DA 3ZPXA 3RVRA 4E7OA 1N5JA 4B40A 3F3SA 4BP8A 3EGEA 2CLDX 1T3SA 3ZHOA 3H1PA 3Q6IA 4H7FA 4ZQIA 2XUDA 4NAUA 1VXOA 3C3DA 3W77A 1B8NA 4JI6B 4FCCA 2JFZA 1IY8A 2DUJA 1U28C 2BPOA 4HDKA 4LHZA 2Q5HA 4PAOA 3NJ8A 5DV9A 2X9GA 5I5GA 3PUKA 3GLQA 2UVQA 4QDJA 5B1SA 2MR5A 4TS1A 2AI1A 2D5AA 4X8OA 2BWJA 3DLBA 2Q5EA 5EXTA 4CMGA 1UT5A 4A1OA 3CO0S 3L79A 3EX7C 4YWHA 4MRPA 2P9YA 1GUAA 5C7OO 5E4TA 2XUJA 3T3EA 3VHRA 4KQ6A 2W8ZA 4KAAA 4EDFA 2ZRBA 4KLRA 2BD0A 2TRSB 3EFHA 4YRFA 1WDMA 2H11A 5EKTA 3VDMA 4I1PA 1BQEA 3VPBA 1NNI1 1TVCA 3IMKA 3ESXA 3IO3A 3LUAA 4G0YA 3V97A 4MLCA 3U61B 4IWNA 4PG6A 1VMAA 5ENVA 3OC6A 4TV9A 2HIGA 1U8XX 4QDOA 1P74A 2AG1A 4ECEA 2I55A 4NL4H 4G4IA 4PNPA 2XZDA 2CFTA 3HFRA 3F78A 3I2IA 4H6PA 5D1HA 5AM1A 2ZM5A 1YHNA 1BCRB 1NMZA 2OXCA 2V6BA 4ITRC 1ZLYA 4KQIA 4KQ1A 4BN0A 5KOHA 1PR1A 3CKMA 4CG0A 4C88A 1DRWA 4Q3DA 2I34A 3RARA 1EJBA 5HF6A 4DIMA 4O29A 3C6ZA 3NHBA 1EA5A 2FW0A 4AY5A 4QU9A 1RRFA 2HRDA 1V41E 2QPLA 1ZD9A 2Q9BA 4IIHA 3RRMA 4CMIB 1O6GA 1GFWA 2QZSA 3ZE1B 5AUOB 4CKWA 3HDYA 2FZLA 2QZPA 1P0QA 5F76A 3V2GA 2GXSA 1A7KA 3EAGA 4XFKA 1V71A 4TUYA 5DDIP 1NRJB 1QC5A 2J9ZB 4Z4QA 2EZUA 2SKDA 1E3WB 1H3FA 3DW1X 4NDAA 2FWRA 3H1TA 3VMMA 4YCLA 2JI6A 4RS4A 3RS7A 5E0OA 1JJIA 3PPIA 4PBSA 4EQ6B 2VHYA 3Q3EA 1MRSA 1KXZA 2WD8A 2R0QC 3AHGA 2C8JA 2F3UA 5KYNA 3HMQA 4LMRA 3D6HA 1KMHB 3QF7A 1CY1A 4L2IA 4Y0NA 1P2FA 1JX6A 2ZEJA 1N6NA 5FNVB 3VDNB 2I4TA 3DEZA 2CLHB 3H2ZA 1L5KA 3D8TA 1RWVA 2VYVD 2VJBA 3ADBA 1XMPA 2G82A 2XUPA 1DKNA 5AH0A 4YYEA 4JVSB 2GO7A 1X2BA 5FLEX 5GJBA 4J0DA 4M83A 2X8JA 1BVRA 3TQQA 5B2FA 1QH8A 2HTFA 4ZCSA 4TXLA 2GPSA 3PF8A 1F14A 1JDJA 2HNAA 3LMKA 4R2JA 3UMVA 4YP7A 1QO9A 1HDCA 1PWXA 2PUBA 1C9NA 4OU5A 3KQYA 3UJCA 1NVTA 2OV4A 1QQ5A 2BMJA 2PRSA 3ZVMA 2JBHA 2GBLC 1ZMOA 3A1FA 2NZWA 4YHHB 2I2AA 1X9IA 4G9BA 2QJOA 5CM8B 3DKKA 1XXHB 4KYUA 3ZBUA 3LI2A 3BXZA 3ZR4B 3GJ8A 1TAUA 1YOBA 3TGWA 3Q9NA 3NRCA 3MWEA 5D3MA 1AHIA 5IVKA 2BFEB 4RF4A 1YRQA 5DM0A 1Z5PA 2WF9A 2E2WA 1CWUA 3BL5A 3RVKA 4B6GA 1GV1A 2OCBA 3EZ7A 3C4VA 3DLIA 3MMPA 4Q9HA 3M0EA 1G4AE 3SFZA 3IBYA 4ANFA 3CUTA 3K2QA 2PLRA 3MTJA 4XYBA 5DN6A 4WXRA 4ZC1A 4AULA 3FUVA 4ZCPA 4JYCA 4LGYA 5TS2A 4WVLA 3ZZNA 5AW1A 2OCAA 2EWVA 3GZNB 3PQEA 2WM3A 2QGFA 4Q16A 2O5CA 2PD3A 2Z09A 2YFYA 3K15A 4OGLA 5C1OA 1GNSA 2QE6A 1XMSA 3HU2A 1A4UA 3U4CA 3IP8A 1DX9A 3U1VA 1CQJA 1U2QA 3I23A 1FFEA 1LJLA 4EUHA 2H29A 3A1WA 3I2HA 4RC9A 3H1AA 5DYWA 5DTIA 4MYHA 4BGDA 2OMEA 3LCCA 1A72A 2B9EA 2VC2B 5KNBH 1OC2A 1A77A 4I8IA 1KZ7B 2A9OA 1DLIA 1QVWA 4XIIA 1VJGA 2WWHA 3SHWA 1E1LA 2NZ8A 3DE1X 5FIUA 1Z4JA 5J1SB 2NMVA 1T1RA 5FWDA 4C7JA 4Q9NA 4YAIA 1N8SA 1KDPA 1U0JA 4DY6A 4PZYA 1XZJA 5IHXA 4LCJA 4KMSA 4DL9A 3FDJA 2X7HA 3EZ6A 4D0LB 3HSSA 4GKJB 1Y8AA 2Q5IA 3BM5A 3PHIA 1KPHA 5IDXA 4N3CA 1TK9A 4KBYA 4PHTA 1E3MA 4JL8A 4WNCA 4L22A 1SR8A 3K09C 3EPRA 3ZUGA 3P9SA 1LXCA 2OAEA 3V1NA 5HS4A 3KWMA 1DEKA 2O6HA 1CJTC 1E1DA 1R8JA 2WE8A 3U0VA 3VR6A 2EJBA 1WVGA 5KWEA 4E5NA 3F8WA 2MYNA 2WINI 2Y1GA 3GRVA 4PPNA 5IDQA 2EBWA 4P4LA 1X1SA 2XWPA 1CFJA 1XO1A 3BFVA 3WKBA 3L41A 1XMJA 2D1SA 4EAAA 4R8VA 4F91B 5I8WA 3T34A 4N39A 4TYPA 2G4VA 1RWBA 2R87A 4BAZA 1KQOA 1I1HA 3HA7A 3TD6A 3D4BA 2G36A 5DK6A 2EIHA 3QJYA 4OP1A 3UQZA 2I6SA 5LYJF 4PAGA 3FPAA 3EPJA 4FNAA 5KAMA 1V6SA 2PFKA 3PE3A 2QT0A 1Y1KE 1RACA 4M1MA 1U31A 5HK8A 5SZKB 5HDQA 2OT3B 3UMBA 3BJZA 2EIXA 2GCEA 4AJJA 1NOKA 3O75A 1ZISA 2DFPA 2ZI6A 3AESB 4BX3A 4DC9A 4EEKA 5GOZA 4AS2A 3SHTA 3ZC3A 4M1SA 1TEHA 4GLBA 5A7GA 5IMBA 2IX3A 4EG7A 5I51A 2PUAA 3B6IA 3L01A 3NVMB 5DT9A 4ZV7A 3ADDA 1R4AA 1GSOA 4FN5A 3VUEA 1NBMD 1M2OA 3NB0A 3WGJA 4LK2A 4COKA 2ONYA 2PMFA 1VMKA 1GU1A 2AJCA 4HC4A 3QG1A 4QLOA 1HEUA 2GEKA 2XZLA 4MVXA 2HRQA 3ZNOA 5LMUB 3N39C 3V8QA 1RMYA 5B58C 4GKKB 4QDUA 3RB8A 1ZUNA 3RC2A 2XCLA 1P2SA 1NZJA 3V4LA 4LVNA 2DEUA 5AHXA 4DDKA 3B85A 2BMEA 4YX9A 1ULAA 2P9ZA 3BULA 3GEDA 5EJ4A 3LT5A 4UVGA 1YVEI 3V8MA 2W71A 2NPFA 3ROXA 4BIIA 2CV1A 1I4TD 1EFRD 4LHVA 2BTQB 4L73A 2VAVA 2EJVA 2GBCA 1MB0A 1ORIA 3QY9A 4FD2A 2QV7A 2YVKA 3C39A 1H8ED 2GK3A 3VKVA 4QXPA 5CYPA 3HCAA 5AM2A 2ZZMA 2LIPA 3H3XA 1P2BA 2NO1A 5ETJA 4K9QA 2OVFA 3E18A 1TNDA 4Q66C 5FTKA 2B92A 1C0EA 2Y0DA 2JFVA 4RX1A 3R76A 1TA9A 4RACA 1JEYA 2ZP1A 4V0MA 4EPXA 1JLRA 4I4TB 3ZWYA 1QE5A 5CA1A 3JWIA 4OMCA 3PUZA 4QNMA 1NXWA 4K5QA 2C0CA 3DS8A 2CNKA 1RBMA 2I4NA 4HRXA 4DYHA 5C8YB 4UKDA 4G8DA 4IX9A 2WB2A 2CBXA 1AK1A 1FVXA 1GRRA 1H69A 2HDOA 2I6QA 1YB5A 2OG2A 2AMLA 2XTZA 1U5BB 3G8AA 1E3IA 2ZIXB 3HLYA 5DCLA 1X14A 3GY0A 3WJ2A 4PG8A 2ET6A 4DUYB 2XE8A 1FMTA 3B1XA 1SGWA 3RAPR 4DC1A 3E70C 4MV0A 3BD7A 1P5ZB 2PUDA 3BHIA 4J7AA 5AICA 4GZMA 1WXFA 1BJTA 3H5WA 5LQAA 3ZD6A 4E1VA 1RW4A 2W58A 3MCAA 2WWGA 1RIIA 2C4WA 1SD5A 1G2PA 3LQKA 4CIAA 1T9KA 1RADA 2AFIE 4GBMA 2OP0A 3T38A 2IP4A 4JELA 2UVPB 3A9CA 3Q9SA 4QPDA 3AEUA 2ODBA 5EWLB 3T54A 5IAOA 2FG7C 5L3SA 4IDAA 1D8AA 4NHEA 1EHCA 3I42A 2RH9B 3IAXA 4LXIA 3WRVA 3HO1A 2JLCA 1FNSA 1ETUA 3VQTA 2D5IA 3K0HA 3MOSA 2F17A 1ZI6A 3NXSA 4PTZA 3OE7A 1PUIA 5AKKA 3STVA 2GPBA 2ILTA 1BGVA 1ZCBA 1JIKA 4W5JA 1CRPA 4QA9A 4C7XA 1NVMB 3GFBA 1DKPA 3SOPA 3ZN2A 4QBKA 1GDTA 4NE7A 3TLBA 3HB9A 4NS1A 4ZVUA 5ILGA 4R2LA 3P96A 1GQQA 4FMBB 4QQNA 4TTQA 1WBDA 1AT1A 3AKDA 5KYXB 4L27A 2B21A 4UAJA 3IPLA 4FCVA 2GZMA 1G17A 1B26A 1Q0PA 2WHPB 3NJ4A 2AHOA 4NS4A 1XNJA 4B71A 2PBRA 2O2HA 2YHSA 1RHMA 4FXOA 5KJEA 2P4EA 1UJMA 1IOVA 1JDBB 4PLZA 4DDMA 4ZK6A 2J6HA 3HYLA 4OI4A 1U8UA 1R8SA 1HMPA 2CJYA 4GYYA 4JV5B 2BFBB 4H17A 4J8PA 2WVAA 5IT4A 3O26A 4QM6A 4IDQA 3GT7A 4H77A 3K30A 5IKMA 2J6CA 2QTAA 3D3JA 5NULA 1H05A 4FD3A 4C20A 2ZRAA 5IJZA 2BF4A 4IV8A 2G80A 1TZ2A 1YGYA 1O6BA 2ZB7A 2IE0A 1TUEA 1VBKA 4MP8A 1JQJC 3HYCA 3PXGA 1X92A 1A2QA 2FWAA 1PG5A 1XKTA 2L82A 1V0JA 1FFWA 3TZBA 2W6IA 4MLZA 5EYPA 4TLBA 1TXGA 1BU5A 2DXIA 3I9JA 1JP7A 3B51X 3I5XA 2BTEA 2WJWA 2FP4B 5KKAA 5LZ5A 1JLLA 2O8VA 3L8DA 1W46A 3EGVA 3U16A 2CJPA 3O6VA 2GAJA 1Y1LA 2PBLA 4EO4A 4IIJF 4PPGA 3VYVA 3F9CA 1WKVA 3NGXA 3LC7O 4EI8A 2ZI5A 3E61A 2WF7A 3PZBA 3IPRA 4V0OA 1I6LA 4KWTA 5JTTA 1OHHD 4ED9A 1BEEA 3NFRA 4PLTA 3AFMA 1P3JA 1TUIA 2AFHB 4X8LA 3K9NA 1DAMA 1M67A 2V6JA 1THMA 2QQ5A 5KTKA 1DO8A 5JMTA 4BFWA 4CMHA 1M0EA 3SEQA 1PEYA 4K9KA 4B35A 2G1KA 3SYRA 1AO3A 1MD9A 2QJRA 3G2QA 1MX5A 1V4VA 3AM5A 3BSSA 3A58B 4MO2A 2R7NA 3U81A 4HYYA 4J1TC 4OXRA 4GECA 3PTAA 4W5WA 1WHSB 1B4DA 4YXWA 4IHKA 1QDEA 1KSHA 1U90A 2V1UA 1O6CA 1S2NA 3IERA 3OJLA 4RVHA 2WJGA 2HI0A 2G9VA 2GZ1A 2PWPA 3EIQA 3HB0A 1VLMA 3UT5A 4FI3C 2QU7A 1P1CA 1YQEA 3FZNA 4LN1A 4B3SB 4PG4A 4JC4A 2HRRA 3V8NA 3PVZA 3TLCA 1Y80A 3OTHA 1HC7A 2Q1YA 2P75A 4DA9A 1JJFA 1JYEA 3CX4A 1P1BA 3JALA 5CTJA 2XMRA 3VR4A 2WF8A 5ALIA 5KYWA 2J8ZA 4MOWA 3WLFA 5KZMB 4EYGA 4JMPA 1P17A 2ZROA 3HXLA 2QLMA 3K9QO 2VUSA 1J49A 2LDXA 3PPVA 4QTZA 3WC4A 1XVLA 1W94A 1Z0ZA 3V8EA 1U11A 2PY6A 3CZQA 4IM7A 4V0NA 3GYGA 5T4EA 4R51A 4Y2UA 2O7RA 4QPPA 1J9GA 1EFPA 2HBZA 2Q3CA 3I32A 3D3KA 5K0NA 5A3RA 5E9JA 1CR1A 3IVAA 3NCTA 3SM3A 3RO7A 1WZIA 2R8YA 2VG8A 2CFSA 3JXEA 4XEHA 1BCSA 1XK7A 3ENVA 3H11B 3K94A 4XYGA 1LC0A 3H8WA 2J3IA 2IGBA 4L07A 1UBGA 1TM1E 4MQEA 4PRKA 2HQ1A 3QVUA 2F8LA 2PSFA 1IPEA 4P33A 2WYVA 1J9EA 3O82A 2DG2A 5JNRA 2ZAGA 1P7CA 2QVBA 4R5MA 4DSNA 4G0UA 4NJEB 1BWPA 1ILEA 2EFJA 2XQIA 5DXAA 4FYWA 4EO9A 2XJ9A 1Q16A 1OSNA 2ZYDA 3BDIA 4HEJA 5DI9A 2Z8XA 1KERA 4OLJA 1JZTA 2W5UA 5LYJA 4HGNA 3VR5D 4RK7A 2ZTVA 1SK9A 4UU0A 5ALTA 1IQUA 3DE2X 4KV7A 3Q9LA 1PEDA 1A0OA 2W37A 3C43A 4WLNA 1ORWA 3KJGA 4BB6A 4MQLA 4RTQA 1TTHA 4B3JA 2W6ZA 3FG9A 1WXXA 3JYOA 3W0LB 2ASVA 1MA0A 2X1HA 1JF8A 1L1FA 4BN5A 2LKCA 1AHNA 3MWJA 1AS0A 2X6RA 5EI5A 3GDHA 4K9LA 2VYCA 1EVLA 5BNWA 3QEMB 1TZMA 3S1SA 3CH6A 4UHHA 2JJYA 1YDFA 2Y1OA 3T5GA 2O59A 4IILA 3I1YA 3WLOA 3WMEA 4IXDA 4O2LA 5EXXA 3AI2A 1THTA 2FW9A 4B0OA 4B4UA 4DANA 1N2CE 1WXEA 4DCMA 2UKDA 2GPWA 1FC0A 3QK7A 4IJVA 4YRIA 1XVUA 3QUAA 3NC4A 1SQSA 4YP6A 3WRYA 4YUAA 3FVTA 2R84A 5BWBA 3TN7A 4D99A 3CB4A 3QX7A 4X93A 1N0WA 1XVIA 3JAMA 1FIUA 4PPYA 1J0BA 3DTNA 3RIYA 2Q8QA 2YOGA 3WO1A 1OH8A 4FYVA 3KE8A 3FTPA 4X45A 3VGJA 1Z2DA 1ELOA 2PK3A 3A9RA 3DT9A 4Y2PA 5AOAA 4MH0R 4DF3A 1XVTA 4PGHA 3D6TB 4DCOA 2R66A 3AJDA 3FW1A 4PO1A 4LRYA 5ISMA 1DIHA 1E2GA 4TLEA 2QY9A 3EVAA 1BIFA 1JHXA 1T5TA 4M98A 4EYEA 2AQ8A 5C46F 4CG2A 3TTYA 5J4KA 5DULA 3QYAA 5IYZB 1DFGA 2GN4A 1ZAKA 4E03A 1VE3A 2XXJA 4AJ4A 5EIBC 4TLDA 3AEKA 3HYTA 4RTJA 3TSWA 4KVAA 3HXQA 3K8QA 4BBJA 5EIXA 2HA2A 4XQ0A 3PC3A 3F7NA 4EA6A 4RPIA 1N2HA 4HQKA 2DZDA 1UJ4A 3VISA 3THWB 4IXNA 4BTLA 4OJTA 3CKLA 5I47A 4XCXA 3QTLA 3ZJ4A 4PHFA 2QK4A 2FX2A 5HZGA 1BEUB 5B55A 4UVEA 3SD7A 4OP2A 1Q91A 4OFBA 1EE1A 1WSAA 2HX1A 4JWTA 1KDYA 3K35A 2XA1A 4BWVA 2WIKA 1W2GA 3MGCA 1BFUA 4FDMA 3F7MA 4IFIA 1MH1A 2FLWA 1TGYA 2FSSA 5HRUA 3ETJA 4GP9A 4P3XA 5HUJA 3EC1A 1PGOA 1ZSVA 4R40A 4HUJA 1IBSA 4REMA 2EKQA 2GF0A 3G2HA 2PUWA 2FP3A 4MAAA 4CKYA 2WV9A 4GOMD 3HQ4O 3NHRA 3B5JA 4OHRA 2BM8A 2IPMA 4UUQA 4AJOA 1BYUA 5AM3A 1AZWA 1PTKA 2P30A 4MPDA 4BNTA 1H5NA 2F9MA 3GFTA 4ZJPA 4OP3A 3TNYA 3D3QA 4NH0A 1UK8A 1ZJJA 1A9OA 1GSHA 4Q1AA 4ZVQA 2O8EA 2CYCA 1QCDA 4CYMA 4IJ5A 1V8PA 1WSBA 2IXFA 3GFSA 3OCCA 3OFSA 1KI4A 2IUFA 2M1ZA 4G56A 4IXMA 4OIFA 1ORRA 1YR3A 2VPWA 1ZGCA 2VWHA 2W11A 3EXHA 4K46A 1XTKA 3F5SA 4S0ZA 4YNBA 3R8XA 1XZEA 5CDYA 1HTTA 1BRTA 3DM5A 1UBNA 5IDVA 3TR0A 1T0IA 1S5PA 5BNZA 2FPWA 2WYUA 4DCSA 1G59A 2NVWA 2YRWA 2AC4A 4WGFA 1HOTA 3LVQE 5KHAA 2W00A 2BISA 2B78A 2JLRA 3CSSA 2HQSA 4BNGA 5JDIC 1GPMA 3BMCB 4L5YA 2ZRQA 4YI3A 5J9FA 1USGA 3ZVLA 2QNRA 4MCIA 5HKLA 2QL9A 3V55A 3GUVA 3GLGB 4LWOA 2SCUA 3K0BA 2IS4A 3FCEA 3FBGA 1H2AS 1C14A 1PK9A 3V4VB 1DEXA 5DTMA 1SU7A 2I78A 5JXWA 4X94A 1P1HA 2KSQA 3HRHA 3NTVA 5JHHB 3SLRA 2G63A 1WDLA 3QA3E 4O1MA 4XJTA 2DETA 1JB1A 4OFWA 5L8VA 1PBNA 2IPAB 3AB7A 2NXWA 3CG4A 4A26A 2LUOA 1P5RA 1UBFA 4LJLA 3E8MA 4QGAA 3UKOA 3R3XA 2VDUE 5BSFA 3TZ6A 3WJAA 1XTTA 4HVTA 2AJLI 4N7MA 3FYTA 1P0FA 2RGNA 3DNFA 5GONF 3ETCA 2JGRA 4IIJA 3LQ1A 2HZ7A 1MPXA 4WOPA 4CF5A 1ZW6A 2VYNA 4ZARA 3GPIA 2GUGA 2R4UA 3IHLA 3KZKA 2FWNA 1HXHA 4G4SP 1EWVA 4HRVA 4YCAA 4R0MA 1Y9ZA 3PI7A 4X95A 3LUPA 1Z2OX 2V6MA 4GT1A 3JCZA 4JASB 5A71A 3TW8A 1ABEA 4B3DA 4IS3A 3CR7A 2TMDA 2PYDA 3NYIA 1Z45A 2YC4C 4DG5A 4DYDA 4F4DA 1QKJA 3JQGB 4WADA 4QYMA 3V4FA 3O8DA 1YIOA 3FSGA 1E62A 4RLQA 4BP9A 2CMKA 4EGJA 3W5AA 3ULKA 2NTYC 4F5YA 1KXJA 2HH9A 1XEWX 4Q18A 1QIJA 1YS6A 1AK2A 1RP1A 3SP1A 3UV6A 3L6CA 4WERA 3WYAA 1BW9B 4AXXA 1WZUA 2QYTA 4C14A 4AJ2A 1F9AA 1IU9A 1L7XA 3QE3A 1KAOA 5P8WA 1KIFA 3GQBB 3WGYA 2P5UA 4E08A 3E7XA 4H4EA 5PNTA 1C3EA 2QGNA 3ANNA 1AQLA 1UC8A 4IGFA 5JSZB 1OMOA 2QM0A 3D5QA 2JCXA 1JVBA 1KP2A 1YS1X 2VK2A 5TPWA 2N46A 2O2JA 2DYKA 1E5DA 2WQZA 4KQKA 1IY2A 2NP7A 1X80A 3MIIA 1SG0A 2R6HA 2I8AA 3IP3A 1PW5A 4GPTA 4LBZA 3PA8A 3RE1A 4J1NA 2C7PA 4LHSA 1JJVA 3T5TA 2LTAA 3R20A 1Q3HA 4FDLA 4YJ3B 1S2OA 4GPAA 4F9TA 1TUGA 2JKZA 3VVBA 1GPKA 2I7DA 4LXTA 1NW9B 3IVRA 3M3DA 4KQXA 5C3UA 3KQTA 4RKEA 1DTWB 1BX0A 4B3HA 5EP1A 1KJYA 5AHKA 2FMXA 2ILVA 1VL8A 1WTCA 1PFGA 4M6WB 4P08A 3LA8A 4AO8A 5EHZA 2Q9UA 3O3OB 1NJ5A 2BI7A 4LYAA 1XEFA 2FSPA 1MC5A 2QL5A 3GRYA 3T1NA 3AF5A 4BFLA 1UKAA 1PTJC 3QXSA 2GKOA 3ZEAA 4KHPB 3V8BA 1OFVA 3HL0A 1FDUA 1GM5A 5I9MA 1FPMA 2X58A 1JKMA 4M37A 5FTLA 1GJRA 4CEHA 2IYAA 2ZVQX 3M6LA 1MC4A 3GLTA 2CB9A 3IA2A 3OA0A 2YOFA 1L5WA 2ZJ5A 1IXRC 4KDFA 3UHPA 3G2JA 1Q22A 3DZGA 1V1RB 3JSXA 1W29A 2QORA 3MTDA 4JBIA 2BMFA 4Q9DA 3TBHA 2XUQA 3MPUA 4RK4A 3WMXA 4E22A 2VQFB 2DWPA 1II0A 4QM7A 2HK6A 4V1CB 1NUSA 4X7MA 4L0QA 3HKBB 5F2OA 4DR1B 3CRZA 4NV1A 4EJMA 4H3SA 5B4TA 3G9QA 2XCOA 3TGLA 2I3GA 5AJTA 1G2OA 4U7FA 2OO5A 1LB1B 2DPMA 3EHEA 2OV1A 4YMVA 2HV9A 3KV1A 2C4KA 2DKNA 3O2NA 4L5BA 3TEFA 2XVAA 1ZHOA 4YRTA 1VJ1A 1EM6A 3C97A 3GJXC 2GEUA 3JY6A 1DWOA 1GA4A 5CX1B 3T4UA 1C3JA 1I2MA 1ODLA 1QGUB 2B4TO 2GOYA 4LXHA 4WK4B 3JQ8B 1U7XA 2ZT6A 4FB5A 3UMYA 1W25A 3NDIA 1QXSA 2HHCA 4Y0AA 2HJ9A 5A0VA 3V9PA 1O7JA 2LNDA 1L4KA 3GR6A 4I4NA 4PX2A 3PFBA 4F97A 3C1OA 1LZKA 5D01A 3RJ5A 3QJ5A 3O93A 1PL6A 2I8LA 3NRJA 4JCCA 3RS8A 4ACAA 4D8VA 1K6XA 2NO0A 5BWLA 2W0MA 2V55B 2P2NA 1X39A 1TRKA 3FPSA 1OLXA 2SNIE 5IKXA 3UKDA 4QYIA 4G09A 4DB2A 2JGKA 2GAFA 1HTWA 3D9QX 3KZCA 4MQUA 4QICA 5A3JA 5L53A 3WKAA 1YK1A 1KJZA 3QYPA 3QLUA 1HA3A 5IPFA 4BL5A 2BGJA 4Z99A 5DW0A 4KAFA 4AG3A 2DFDA 3N9IA 4Q4HA 5JECA 1ZDMA 3RC8A 3PFIA 4KUGA 3RKSA 4L74A 3H9GA 2NOAA 4JGBA 4KJXA 3ZHBA 1RC1A 4F3NA 3EGDB 1UZAA 5KBYA 1G5QA 4UE3S 5AW0A 4MQFA 1GTRA 2I7TA 5E6SA 4NYIQ 1Z5GA 2PGAA 3E05A 3CWCA 2WKPA 1V26A 1P9OA 4NF2A 4AB1A 3X44A 5L4NA 1E0SA 1JYSA 2E21A 2V0NA 4N6GA 4YGXB 1XTRA 4KR3A 2OZLA 4LDPA 4DJ5X 2FUG1 2IOFA 3BRWD 5T67A 3ZHSA 2XBMA 1RHJA 2FZWA 5EOVA 5G0UA 2PXAA 3W2EA 5EWMA 1ZEMA 4WEQA 1L4YA 3DBVO 4KE9A 5K0LA 2D1TA 3JD4A 5B12A 3K6KA 3ZXSA 2RHWA 5CW1A 4DT1A 3MELA 4H4CA 3UF0A 5HGXA 4DJTA 2ZUWA 5DO9A 1JEYB 4QHYA 3F4BA 2MMGA 1W0KA 3N59A 2XNSA 1M0SA 2YZ2A 3H9JA 2DWQA 1QIHA 4IQ4A 1JGTA 1WY7A 2ZS7A 5EJAA 1Q21A 3EGXB 1JAYA 3H4MA 3C7KA 4AP9A 1UBSB 2O2SA 3EA0A 3PHCA 2P40A 3WJ1A 4BVAA 4QG7A 4D3DA 4EG1A 1RPJA 3K0EA 3OMWA 2I91A 2J67A 4WKNA 1QTRA 2M6KA 1YGPA 3SJZA 4OHFA 1OA0A 3A9UA 3LF1A 3NEAA 2EJWA 4YT4A 4FFDA 4BATA 3IJRA 4OO3A 2Y99A 1LI7A 1O95A 2I3BA 1J8QA 1KH2A 3PE6A 5DE3A 4OBBA 4BVGA 4DWOA 2JVKA 5HIJA 1J1ZA 5LP1A 5EAIA 1T1SA 1CUIA 1FNCA 4N54A 4J0HA 4FOSA 4M1TA 4CLOA 1OWMA 2JAOA 3ENQA 1X87A 5FEUA 5AT1A 4U6SA 1RQPA 4OY3A 3CEHA 3AO0B 2WLSA 1NT4A 4NPCA 2IOQA 2D0OB 3R5HA 4RF5A 4LZJA 3S0JA 1ZK3A 4DBZA 1MJHA 4PSUA 1M1NB 4LJ9A 3JAKB 3KOXA 3SIRA 4IWXA 4RTNA 1Z5UA 1ZLXA 3IQHX 2FPXA 4HNVA 1D03A 4DQXA 3Q7EA 4MEBA 3TRFA 1KE2A 4AM8A 2QSUA 4Y1RA 3FCSB 1BZYA 1E96A 2PU5A 4S35A 1VB5A 1ZNZA 4FR2A 1CP2A 1DU4A 2JCVA 4ZO4A 3C41J 1E9VA 4B6PA 3B6EA 4R1OA 4Q93A 2JFOA 5ULLA 5FBVB 1W5BA 2QUJA 1MEEA 1KO1A 1NBAA 4KE7A 1OFHA 2AG0A 2C31A 2FEMA 5GONA 1G4HA 3UGQA 2Q9AA 2XSZA 3ICWA 2BH9A 2V96A 4QPNA 2HC9A 3ABOB 3TL3A 4QJ5A 1YZTA 4DYVA 3C6QA 2Q3EA 1CHDA 3VPAA 4OOFA 2ZJ4A 3DBLB 2P2SA 2RGDA 3IUBA 1IN6A 4U5QA 4RQUA 3FCOA 2E55A 3Q88A 1M6VB 1SUDA 2ZIEA 1SA0A 1V95A 4WXHA 4C0AC 1SPXA 2CXXA 4DQKA 3WBFA 4RHXA 2V0GA 2AFRA 5BQ3A 4HZUB 4MW9A 3AEZA 4WK6A 3WL7A 1Q1AA 2VNKA 1NWHA 4FIDA 4W8HA 4XA8A 4CMCA 1NQXA 1RCTE 1V3TA 4RVCA 5REQA 3GP8A 4BRZA 5G0WA 1MZVA 3CLSC 3VDXA 3U4QB 4XIGS 4TYMA 2FZKA 2NV6A 3AEQB 5JYDA 1GGFA 4K2HA 3D4IA 1GL7A 3AP2A 5EEHA 2OESA 1GL9B 2PH7A 3TZLA 4OJNA 3CE6A 2REQB 2Q5CA 1F1JA 1I30A 1DAIA 1J0XO 2EBHX 5B57C 1SXJD 3VI4B 4X3CA 2CNLA 4QGHA 4L9AA 3A9SA 5E7MA 5AWFC 1H5UA 1YQUA 1G18A 1NLZA 2F8SA 3KT8A 4M36A 2RE8A 1NIJA 3P4YA 3UHJA 2ZWOA 4CT0A 3MILA 4EELA 3KQSA 4FMPA 1UAGA 1GCGA 2QTWB 4XJSA 3SXPA 4X63A 3KHKA 2X0KA 3QSYA 4J29A 4MGYR 3RBVA 1KOFA 2YN2A 5LDDC 1CS0A 3K6JA 1I13A 2IOFK 5KTSA 1W34A 5G3YA 3EDRA 3SC6A 3OIFA 2GGSA 2FMIA 2JAHA 3AI3A 3NBKA 2OGWA 5DXJA 1F48A 1A3CA 2YJZA 1P4SA 2R6ZA 2EAUA 1SUCA 4II2A 1OXMA 6AT1A 4R2XA 2JZNA 4FB4A 3K1TA 4G24A 5BW8A 4HQFA 2OHOA 4QDXA 2Y9PB 5G2OA 4AI6A 1VPDA 1JG2A 4IL5A 1F4VA 4JC8A 2CMGA 4S12A 2IV7A 4BQRA 4O4HB 3LCRA 2IBMA 2IIVA 5FUBA 4DEXA 5AQ1A 4G5RA 1U2RA 3N53A 1OYVA 1K8RA 3R9KA 4NULA 4TS3A 4CLHA 1R4NA 2PV7A 3U39A 3QNUA 2QGZA 2OILA 3LP5A 4FOOA 2HK9A 1RLJA 1FDOA 2H92A 4KKXB 1ONBA 1XZ8A 4UATA 5JC8A 4OL9A 2XODA 5F1KA 1N9KA 5CFLA 2CK3A 1HR0B 1JMVA 2XB4A 1W75A 3A4YA 1SVUA 1QIKA 3NR2A 3PCRB 3WAJA 2ODEA 4MS4A 3ZIAA 1KORA 3IOCA 1T0JB 5G0SA 4P9NA 3Q0EA 5FO0A 4LVUA 3V48A 4CL3A 2PZFA 3OH8A 1RYEA 2PZBA 4ZQFA 5JQGF 4LA4A 4XRRA 4P93A 2YWEA 3IDAA 4UHBA 3RM3A 1PWZA 3WNBA 4JH0A 4WXMA 1BMDA 3QVXA 2H59A 1QIIA 2LR0A 1E7QA 2YXLA 1OX5A 3HY6A 2F1RA 3ELYA 3U4IA 2A0XA 3OZBA 3L1HA 2GARA 1VIAA 2DQZA 2Z1NA 3CGWA 3O95A 4BZXA 3WKCA 4ARIA 1PKEA 1G7CA 4IXTA 4EMTA 4HXYA 3PIDA 1YQ9A 4XJVA 4EBFA 5CA0F 2HYIC 1PN3A 1M8KA 3ZY3A 3SZLA 2ZJBA 1VHQA 1EM8B 5EKSA 4IIYA 2WVJA 5JWOA 1QQAA 3I5MA 1TC2A 1MO2A 2EV9A 1OZHA 1Y7IA 4LDNA 3R9WA 2BM1A 3HA5A 5G4KB 1GEGA 2Q4RA 3L8GA 1UXIA 1XUOA 3DZJA 4K9SA 2RHLA 2OECA 3CZMA 2HCJB 3JX9A 3Q2KA 4KFSA 4UARA 5JLJA 3OBIA 4YALA 2O0JA 3T12A 1HF3A 2HJSA 1FFCA 4TTIA 1AC5A 1LJ8A 4MV1A 1XDZA 2X23A 2ZREA 4I1YA 3EVBA 2DFTA 1X1AA 4EH1A 4ZZ3A 1QGOA 5HSGA 1DSSG 3SX4A 3ZS8A 1E1CA 1D04A 2HJVA 4OHUA 4KQWA 1P9RA 4A0HA 3G82C 3VPXA 5B7PA 1NSYA 1U4OA 3LP6A 3TQSA 1QU3A 4G4GA 4BBZA 5BPFA 4NXNB 3EDMA 1YULA 2VKQA 2JF0A 2HUPA 1F5SA 1PR4A 4X60A 1E3DA 3A1TA 3TLGB 2EKLA 5AW6A 1Y8QB 1X13A 3GLHB 3A3KA 1A96A 4FT2A 4NMHA 3HV0A 4OSOA 4YJKA 1I3LA 2IHUA 2BLLA 5IBCA 1FXSA 2RHCA 2QR5A 1AF4A 1QANA 1F17A 1U2EA 2C3YA 1J39A 3HWX1 4PLFA 4ZN6A 1F8FA 2BTOA 2ZU0C 5FH9A 4HLQB 3GA7A 1Z25A 3ICOA 4FMDF 1E4VA 4H6VA 4WXEA 5DHPA 3ZE2B 5KCZA 3WAKA 3IL2A 3ZD9A 4WOJA 5B3AA 2B4KA 3ONWA 4UU7A 5E4JA 4CKCA 3WMFA 1YTUA 5IC6A 1ZRHA 3KT0A 3V1TC 1UJNA 2WC1A 1BAPA 3MLBA 3O2QB 5KUTA 1VLLA 1KEEA 2J5QA 4I6GA 5I45A 1K4KA 3QNMA 1G6OA 3M9WA 2I6UA 3K8OE 1T4DA 4GX5A 1QR2A 3TAXA 5FB3A 1MZPA 2KHZA 3THYA 2ZUFA 1V5GA 3UFBA 1TD1A 1AF7A 1ZXLA 2CXTA 4CIBA 4KPYA 1Y9DA 4W5TA 4URYR 5LIRA 4ND3A 4GZ5A 4Z1MD 1GGKA 3AI1A 5EHNA 2Q46A 4UUAA 3FD8A 5JDCA 1QJ4A 3W8NA 4IGEA 1AZLA 1HEYA 4REOA 1OXSC 3HFSA 1CJVC 3NXKA 3WV5A 4YRPA 1N7IA 3ZJUA 3AV3A 3UB3A 4GPEA 2Z30A 4QPZA 1GL3A 4R83A 2Z58A 5DP2A 4C4RA 1RJFA 2PS3A 3F6PA 3Q72A 1J22A 2BL4A 2WKRA 4GF5A 4PY2A 5EQDA 1F4PA 2H1IA 4FHFA 3R5TA 4CTOA 1VLZA 4JT9A 1RI4A 3SLGA 4OU4A 4RHFA 3QMVA 2QD3A 1CRWG 3OZTA 4EPRA 1RXCA 1CQIB 4IIFA 3KEFA 1YR6A 3MLAA 1LI5A 2I6GA 4Q3NA 3QPWA 1SC9A 1YS2X 3QMWA 4EENA 4L76A 5E0KB 2PUFA 1HX7A 1NOJA 1Q6YA 4YCSA 1Z8FA 1VJCA 1NGSA 3F9RA 1Q2XA 4QYTA 3EYAA 3K6RA 5J1TB 2AXPA 2ODNA 2LIVA 3NUGA 1KI1A 3GU3A 1N0IA 2Q5FA 2W6MA 4HK4A 4LBVA 3ESDA 3IHWA 4WFKA 4C4YA 3RADC 1YF3A 3B9QA 5K6TA 3G5LA 3LAWA 3RAFC 2EQBA 3O9MA 2VTKA 1OH7A 4KTVE 4HAOA 2V5UA 3EQ8A 1TIPA 4YCJA 1OWOA 1I1QB 2GAOA 3AZQA 1QO7A 1MCZA 3BWMA 3LXMA 5EIHA 4EUSA 4F71A 5GINE 4WKPA 2VPTA 3J81k 4G89A 3WIUA 4DSZA 5KNCA 1SBCA 1I3KA 5IF9A 2H57A 4BQEA 3HUUA 1DIGA 2C2BA 2PEZA 1HYEA 3JZIA 1M5RA 4HSEA 4MVJI 4RGYA 3LVRE 3EW7A 3RNOA 5IXSA 5IN4A 4QVGA 1G8HA 5CX4A 3ZXIA 4HDMB 1V43A 1BO6A 5K0BA 3AVXA 5BR8B 4RZXA 4J49A 4AJKA 2WU8A 4CEJB 2QTRA 3H1FA 4K6KA 4A0GA 1YNOA 3ZKWB 1K8QA 4IMRA 3TQFA 4OREX 2DUNA 2J09A 2OO5C 4FYXA 4Q02A 1QFYA 4YRMA 2GFIA 1G291 2PJDA 5ICFA 3R74A 2O4UX 1RLIA 5E2AA 3RSGA 3GBPA 3TO5A 3WLSA 4JCOA 4JXKA 3JQ7A 4PVCA 1KZ4A 1TADA 1JIXA 3D43A 1Z0SA 1R0LA 2R00A 5FPTA 5CT4A 3PJDA 4GEKA 3PRJA 4NENA 1GG8A 1TZKA 3I5YA 2OD7A 3FPHA 4G86A 2EFYA 3PRHA 1XZLA 1GITA 4WQMA 3WLQA 3OM8A 4QU5A 3R77A 4WCFA 4V38A 4JYZA 1L7VC 2C92A 2C07A 2NW6A 3UFXA 4LY6A 4RMIA 3AY6A 3ZTWA 2Q7XA 3KPYA 4PIPA 1D5CA 2GYWA 4B83A 2CMHA 3ZZ1A 1IQ0A 1EAYA 1XTUA 2X19A 1AO0A 4MJ7A 4Q82A 1YJ5A 3AVUA 1GO2A 4KQMA 5KMGA 3U7GA 1RHKA 1ZD5A 3J7TA 3OM0A 3DF9A 3UPTA 1YS7A 1SHLA 3G5TA 4LAFA 2WQ6A 2GLUA 3LCMA 4PAMA 3N7TA 3FWKA 5K7SA 1HDEA 3EZLA 2CNBA 3QLUC 1YJCA 3P2MA 3JRNA 4GKVA 4E3WA 1M6NA 2NGRA 2PH1A 3MXTA 3R0IA 4O2BF 1FLNA 4Z2AA 1T0BA 1F06A 1PZMA 2OYSA 1ZSYA 1BS9A 2XECA 3PD1A 4QULA 1JLKA 3NHPA 4D74A 4MA4A 2N1MA 4BKUA 3ENZA 1YWGO 3S5JA 4KE8A 3BMXA 2R5NA 3DBIA 3ZDXB 4BDTA 1IK6A 2JBAA 5LQMA 2O54A 3FI9A 1Y5RA 3A4NA 1NKVA 1U94A 4RD4A 5JPIA 2BFDB 2OZPA 2ZT8A 2XT9A 1Y1QA 5ENZA 3CJQA 5FA5A 5AUQA 5BUZA 2CJWB 2E1RA 1PNQA 1V4BA 3HBJA 1YDMA 4IOMA 5JAQA 2IJGX 2YJNA 3LO5A 3Q1KA 2XF2A 2WTXA 1WXDA 4YRNA 2GEJA 3ETNA 3FDFA 5T3UA 1JH9A 2WYOA 3K1AB 4L7QA 2V3WA 1XZMA 4BUZA 5DBOA 2JB9A 1SUAA 2ZYVX 5G0TA 4U8HA 2VHTA 1VIMA 4F96A 2ZBEA 3OCZA 5DI3A 2PUVA 3MGAA 2QTTA 1T29A 3KZVA 1NX9A 2BH2A 3T3HA 5JQGA 1D8TA 2M2IA 3C3BA 2NADA 3E3MA 3RD5A 2AJ8A 3G7SA 3WO0A 2Q27A 3PRYA 4GLFA 1E2QA 4I50B 4CTMA 3WLEA 3M2PA 2KM1A 2J3DA 2PKWA 2AD1A 3HC7A 5J59A 5IUJC 2V7VA 2CL5A 2WU1A 3AVOA 2XCTB 4ZU3A 2DU8A 2XMZA 3V3KA 2J3QA 4EVSA 4Y6OA 3EIEA 1YV9A 3SIWA 1ZOIA 1YT5A 2EDCA 3ESBA 5EERA 3WK9A 4EX6A 1HE2A 1NNLA 2OOKA 3H1BA 5J23A 1P81A 5J5VA 4ZZ2A 1ESZA 3DLAA 4H3KB 5CA0A 4Q4AB 2HD4A 1JHZA 3MJFA 5K3CA 4LEIA 2O5RA 4X1YB 4WFIA 3WIBA 3U0BA 1U5CA 1CB7A 3WRWA 3ABSB 5GJWC 1DIAA 3JYLA 4BKMA 5JE8A 1WXQA 4IKEA 5U4QA 2VS1A 4ETWA 3T0FA 1R9GA 2V7GA 3A2NA 2B94A 3JR7A 4IKPA 4PICA 5DSXA 3UMSA 3CZAA 3VYTB 4M0FA 4FGLA 1I3OA 4YVFA 2PSHA 2QTZA 3AXTA 3NGMA 3RVMA 4PZLA 4BFZA 4DQVA 3EPLA 3JWHA 3R6WA 4KITB 3UJDA 2PS0A 3LWBA 4ROTA 1JEDA 1IY0A 3GA5A 4LC0A 4ZCTA 3E8XA 1GNVA 1E9RA 4FT4A 2X0EA 4YCBA 1SCJA 2JLQA 3IGFA 4PLPA 4EKEA 1PJQA 1QIGA 3IEKA 2JIOA 1NN0A 1C0LA 3E9EA 5EMKA 4DA0A 2NIPA 2ON6A 5JFTA 4KO1S 3O1HB 5ANRB 2CZGA 2AX3A 1T8RA 3C8HA 1YVUA 4W82A 1N77A 2WHEA 1P7VA 3VR5H 4L8LA 1ADFA 1WVIA 4OG2A 4XH9B 4ZYUA 5FI1B 5T4BA 3AUAA 2HIHA 2RAVA 3KZXA 3I9LA 2VF2A 1MB2A 2DQKA 3GFQA 1M6YA 1LEHA 3A26A 4RK5A 3HCNA 5ECDA 5ER9A 2ZYWX 5J2TB 1JFSA 2CCJA 4UD6A 1EWQA 4I8DA 1UWLA 3QVKA 4UNRA 1BS1A 1K92A 3VSCA 3NTRA 1FFHA 3DMTA 3BCSA 5CDHA 1CUUA 1WEKA 1EVEA 5TF4A 2P65A 3C4JA 3L5OA 1G5FA 1YRBA 3FIJA 2VDWB 3FYUB 1TKRA 4IR7A 4KE6A 1NAHA 2C2ZA 2AGVA 1HFWA 2OSBA 3NATA 2CNWD 4YN3A 4HI0E 2QG4A 1FLAA 2ONKA 2WABA 1VCHA 1YVRA 3A4MA 1J25A 1WQ4A 2MINB 2RSLA 4YR9A 1MA3A 1M74A 1YBMA 3A9TA 3MJHA 4OJMX 2PPLA 3DV0A 4ON9A 5FNVF 4WLOA 2EX4A 4R7GA 4BO2A 2E4YA 5TQVA 1FDIA 4GSLA 3F67A 2XGJA 3EPPA 2POCA 3UAZA 4W5NA 1U3WA 1V5IA 2CLFB 4URUR 5DCYA 5AVUA 3IMFA 1AUPA 4ZGWA 1MHTA 3U3MA 1BN7A 2L17A 2WAYA 3VZDA 3WJ7A 5LNK6 2FEWB 3FDZB 3RHFA 1J21A 3R7AA 4QGGA 8MHTA 4P4SA 4NZMA 4CLRA 4NR0A 5ABPA 3EXFA 2R1VA 4CM5A 2GVNA 1U2TA 1UADA 1DAKA 4ABYA 1GXSA 2X0FA 4W9MC 3P0FA 2AKYA 3P94A 4OLFA 1WMEA 3M81A 2YRXA 3PWTA 2Q1SA 3L3BA 2K7FA 2VZ8A 3LG2A 4CLDA 5J4LA 1IFXA 2WAMA 3KPWA 4ZWNA 4DM7A 4KO4S 4HB2A 1ZGJA 2IYZA 1HY3A 3PHHA 4JUAA 5E1OA 1F0YA 2NSYA 1X86B 2I2FA 2VJQA 2Y8EA 3NIFB 1EJ6A 2VHWA 3QU7A 1MT3A 2WWWA 3GEEA 4WJLA 4ZK2A 1BWQA 3KQMA 4E6PA 2VJOA 1ZM2A 2XNDD 1UMBB 1VE9A 2JIRA 3CZRA 5I9BA 4DGQA 5FWXB 3HGTA 1P1FA 2YYSA 2Q0SA 1L4EA 1DQSA 2CBZA 1QAMA 4DQUA 2CV2A 4ZYLA 3TAHA 2QP4A 2G1PA 3DDSA 3OOYA 4LXUA 4RH3A 4X1IA 3EIUA 3H2HA 5HCNA 4N48A 2EFCB 2OFXA 2QLFA 2F90A 3A04A 3QLVA 4CQMA 3N0VA 4NNJA 4PRZA 3X1ZA 4L8FA 3AUJB 4MJ3A 4C6TA 4OQPA 1Y8ZA 1PWHA 1C3LA 3KDAA 2IP2A 2RCYA 4ZQEA 5CXQA 3K53A 4HXGA 2XMCA 4HDNB 1F8UA 1H0RA 4RU1A 1GCUA 4WESA 4X7BA 2I65A 2LKDA 4MYRA 5AKZA 1J7JA 3V34A 5F5NA 4WKOA 1H9CA 4U6QA 1DC7A 1WB6A 2VF7A 2X1MA 1JHVA 4Q34A 1XJQA 2SKEA 2Y2VA 3F5MA 3QKUA 2BDTA 4OB6A 3WYDA 1U80A 1DC8A 2PX0A 3QUBA 1G3UA 2F1IA 4LRTB 5C0OE 3A0RB 4B4KA 3LXRA 2L2QA 4JZKA 5FI5A 5KQSA 2V6FA 1QLJA 1VJRA 3GPBA 4QASA 4QBTA 1R8YA 1YZGA 3RUIA 1YA6A 3ZV3A 4YQFA 1GZHB 1ND6A 3G17A 3GELA 1A8SA 3JR3A 2CEKA 1E6CA 1LTQA 1PX2A 3FSEA 3PFGA 3AOGA 1BDJA 2V45A 4EKNB 2GFHA 2AOVA 4KYTA 5AW3A 5DSZA 4KH1A 4MRSA 3I39X 3OPYA 2YJ5A 4LKRA 3E9RA 1A7UA 2PZAA 4ZQHA 4JY7A 1A8HA 4RA9B 1KVUA 1XDWA 3BHNA 2Q49A 1E79A 2H00A 4MR8A 5CVDA 5D5PA 1NU6A 3QELB 4PZUA 3PPWA 1OXBB 3KG2A 4G8BA 1T8UA 4UFNA 3U60B 1M75A 3G2PA 4JLWA 4D57A 1WBJB 3QXJA 3USCS 5KOIA 2W90A 1K8YB 3A36A 2G08A 4M1EA 2PKYX 3ED5A 4JJ8A 4MV7A 4KU4A 4L8WB 3OT5A 4X66B 1DCFA 1XQ6A 2ZPUA 4FFSA 4P32A 1G8YA 1YRYE 1ZW1A 1T2AA 4DLUA 1NJGA 2WDPA 3M4JA 1L5OA 5G41A 2DUUA 3OCWA 1E4YA 4C0SA 4O2BA 5LZ2A 3VTZA 1RXVA 1BH2A 3DPSA 3RRYA 1EXNA 3L0OA 4G85A 4PX9A 3S2ZA 3ZCVA 3VOTA 4ZHQB 1SJ9A 4ZEXA 2A58A 3P0HA 4C0JA 4BLVA 4IOJA 3X1XA 2J0EA 1MX1A 4JB3A 4U4AA 2OQVA 2I9KA 1KFEB 4FGWA 1M2GA 3P26A 5E8RA 1KVRA 3T5CA 5I7VA 4WH0A 4BMPB 3DEHA 1HNNA 1HQKA 4JVOA 3S28A 5B30A 1ADYA 1YIDA 3ABRB 1XU7A 3LS2A 4EHJA 1WR8A 3SYMA 1N2JA 1W4LA 1NRIA 2FFJA 1CF2O 2QX4A 3O83A 4FUTA 4HLNA 4L51A 4ID3A 4M49A 1TFRA 3D8HA 1JQDA 2JDIA 1JJAA 4IMJB 1S2DA 3DYIA 2QAGB 4R2IA 4LXYA 1JIQA 2GZ3A 4IJWA 1WHTB 5SV2A 4FJ1A 4F85A 2WSYB 1CTQA 1VJ5A 2MTBA 3EASA 4FFBB 4EECA 3NBZC 4KXYA 3OHSX 1IN1A 2W6PA 4CW7A 1OKKA 4TLCA 3ZGNA 3ZY2A 3E27A 1ISHA 1YS4A 3KR2A 2ZSAA 1V7CA 3U4AA 3C7CB 3L4BA 4UM9B 1JHUA 5T7BA 3FIUA 3DPIA 2R7AA 2OYRA 1HFKA 3DXZA 4Z4GA 3C98A 4KFRA 2QM3A 1EUCB 1MIHA 1GRNA 3LSTA 3TMYA 2GR9A 1MW9X 3ADKA 1U98A 3X1YA 3FBTA 4I1OA 2NSHA 2AOUB 3HWWA 1EU1A 1GT6A 2C54A 2ACEA 5AM0A 3AJEA 1PR6A 1LVUA 2REBA 3D4LA