1ZUNA

Crystal structure of a gtp-regulated atp sulfurylase heterodimer from pseudomonas syringae
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
204
Chain Sequence
b'LVPRGSHMVDKLTHLKQLEAESIHIIREVAAEFDNPVMLYSIGKDSAVMLHLARKAFFPGKLPFPVMHVDTRWKFQEMYRFRDQMVEEMGLDLITHINSAKHTDIMKTEGLKQALDKHGFDAAFGGARRDEEKSRAKERVYSFRDSKHRWDPKNQRPELWNVYNGNVNKGESIRVFPLSNWTELDIWQYIYLEGIPIVPLYFAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfate adenylyltransferase subunit 2
publication title Molecular basis for g protein control of the prokaryotic ATP sulfurylase.
pubmed doi rcsb
source organism Pseudomonas syringae
molecule tags Transferase
total genus 44
structure length 204
sequence length 218
ec nomenclature ec 2.7.7.4: Sulfate adenylyltransferase.
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01507 PAPS_reduct Phosphoadenosine phosphosulfate reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1zunA01
1JECA 3VRHA 3IMEA 4MVXA 4MWDA 4Q93A 1QTQA 1ZUNA 1QJCA 3INNA 1I6KA 4XFDA 3IDFA 1R6TA 1QQTA 4EG3A 3N05A 2YWBA 4BWVA 4G5YA 4KR9A 1YI8A 4RUKA 2H29A 3NV7A 3CA8A 4DJAA 1NP7A 2A86A 2Z09A 1VBKA 1YIDA 4NATA 1V47A 2GM3A 4JFAA 4NX2A 1KH2A 3CVXA 3IOCA 3MMXA 4KR7A 5LLTA 4MWCA 1O0CA 3H9BA 2CYCA 1XJQA 3H97A 2CYBA 1XNHA 1I6LA 4ZT7A 1Q77A 3UMVA 1U7DA 3X1KA 1DNPA 2WB2A 3CLSC 3SYTA 1X6VA 1Q11A 1F4LA 1HYBA 4MWEA 4DNXA 1WXHA 3IMGA 2C5SA 2R5WA 1IRXA 4EG7A 4P2BA 5LM3A 1EE1A 3MUEA 4OUDB 4QRDA 2E21A 3IVXA 2WSIA 4YP6A 1NUSA 3N2YA 4G5FA 4MUJA 1X8XA 4U63A 4UZFA 4AS1A 1OBHA 4ND7A 5LFAA 3TZEA 4KPUB 1WOYA 2O5RA 1M8GA 3AIIA 1G8HA 1T9GR 3FG9A 2H2AA 3H9CA 4MQ6A 1MJHA 3GUZA 3P0IA 4MUEA 1JIIA 1N2OA 1O6BA 1PG0A 1RQGA 4MUHA 2DPLA 2X1LA 1TFUA 1MAWA 3VU8A 3K32A 1WQ4A 3QTTA 3SP1A 4DDKA 1G59A 1H3NA 5AHWA 4NZPA 2VTBB 3AL0C 2J07A 1H1TA 1OBCA 3TS1A 3HGMA 1P7PA 4DDHA 3AG6A 4MVCA 2CSXA 3KT3A 1F7UA 5J5AA 1KKUA 3UOWA 4MW5A 3UC5A 3HV0A 3A05A 1EFPA 5IJXA 2ZUEA 1F9AA 3RHSA 3SZGA 5JBNA 4OJMX 1WZ2A 1N2JA 4YBRA 3DO8A 3G6KA 1EJ2A 1N2HA 3G59A 3PNBA 4I6EA 4JXXA 2JANA 2A7XA 4R0NA 4HJXA 1QNFA 4EF6A 5J58A 1ILEA 3LOQA 3IOEA 1O95D 1EUQA 5IHXA 3TZLA 2CV0A 4JYZA 4ZCTA 4DDMA 3NBKA 1IQ0A 3QE4A 1ZH0A 3I05A 2TS1A 3ZIUA 3CVUA 2A84A 3X1MA 4MWBA 3UK2A 1KP2A 3FHJA 3FY4A 3ZXSA 4CQNA 4Q16A 4WNYA 1KH3A 1K92A 2J08A 4ZT3A 2QUKA 3ZJUA 1MB9A 4EFKA 1KQOA 1TEZA 3COZA 4QBTA 2RE8A 4XFJA 1NUTA 1GZUA 1N3LA 4L2IB 4EG4A 1EFPB 4HK4A 2JAXA 2V0GA 3D6UA 4X0EA 5TEWA 2PZBA 1NUQA 4ARCA 1VLHA 1GN8A 2CUZA 1LI5A 1GTSA 1IFXA 1N2IA 2A4MA 4G6ZA 1N75A 1WJGA 3ISJA 1KAMA 1O95C 1O96A 4MW9A 5FO0A 3P52A 1KH1A 1O97D 1NUPA 1TQ8A 1ZH6A 3ND5A 3RK1A 4DE5A 4MW2A 2QTRA 4A91A 2X3FA 3CLRD 4R2LA 2I1LA 4E1AA 3CR8A 4NAHA 2DR2A 1V8FA 1JIJA 3FI0A 1O94D 1J20A 4ZT6A 4MLPA 2GOYA 4MVWA 1JIKA 2PZAA 3L93A 5HG0A 4U7JA 1WXIA 3F3MA 5H7XA 4FZJA 2DXIA 4PBRA 1A8HA 2IP1A 1N2EA 1TYBE 5HUJA 1UFVA 3ZGZA 2EL7A 3HMQA 1LI7A 1JMVA 3TQIA 3Q12A 3CVWA 3H05A 1J09A 1WY5A 1OWPA 1Q19A 1NSYA 4KR6A 1WXEA 3AG5A 3FETA 1OWNA 3ND6A 4H3SA 3A2KA 1JGTA 3NBAA 1MAUA 2GKSA 2DUMA 2ZP1A 4NAUA 4I6GA 1G8FA 3N9IA 4ZT5A 2YWCA 3FDXA 4MW4A 3COWA 2OV4A 3RK0A 1O97C 1QRUA 1MRZA 4UZEA 1N77A 2YXNA 1YUNA 4ZCQA 4PBTA 4MUIA 1JZQA 1N1DA 1T6ZA 2A1TR 3CLRC 4ZCRA 1T6YA 1KQPA 4I6JA 3COVA 5HUHA 1FYDA 1XNJA 1JZSA 1NI5A 3U1VA 1O94C 3LCJA 2V0CA 4EG8A 1R6UA 1NZJA 1JILA 1QU3A 2D54A 2AG6A 2A88A 3M5WA 2QUJA 1CT9A 3CLTD 2X0KA 4RPIA 1BS2A 3HL4A 3P0HA 3PNYA 4MVYA 4ZCPA 3IMCA 2E89A 4J76A 1WQ3A 2QTMA 1H3FA 2DERA 1O0BA 3KFLA 3MXTA 4JXZA 1S4MA 4EGAA 2VXOA 4JZYA 4YP7A 3SDBA 3UY4A 4EG6A 2NSYA 3CVVA 3A04A 1J70A 3KT8A 1SURA 2XRZA 1TYAE 1Y42X 3MLAA 5EKDA 1YULA 1QRSA 2O8VA 3OP1A 2NZ2A 2PIDA 4CT0A 2CFOA 1K4MA 3DV2A 1JHDA 2AKEA 1IH8A 1KORA 1U3CA 1QRTA 1EXDA 1NYLA 3L92A 3ZUGA 1XNGA 2QUIA 1FFYA 2Z3VA 5H16A 2PZ8A 2QTNA 1IQRA 2WQ6A 1H3EA 1U7XA 3CLTC 1T6XA 2DEUA 3IUBA 3S3TA 1OD6A 5DEOA 1VBNA 2IELA 1KAQA 3PNVA 4PY2A 4ZT4A 3FIUA 2CT8A 4HJRA 4QREA 3ZXIA 4EG1A 4MW7A 1Q15A 1PG2A 3RBAA 1KR2A 3KT6A 3G5AA 3PXUA 1YUMA 3GMIA 4KPUA 3FWKA 4YP5A 2HMAA 3ND7A 5FO1A 3DLAA 4MUNA 3P0JA 4F4HA 1PFVA 2E0IA 4XSVA 1MB2A 4K03A 1KQNA 2CV1A 3MLBA 3Q10A 3IVCA 2HGZA 1EUYA 4ARIA 2Z08A 1J21A 2ZUFA 5DB4A 5KWVA 2QJOA 2AZXA 5KCMA 1I6MA 4HPWA 4MUFA 3HZRA 3X1JA 3GLVA 1ZJWA 3HFJA 5DASA 5DK4A 1N2BA 1M8JA 1EFVA 1N2GA 1VBMA 4MUGA 2VTBA 1U0BB 1WKBA 1MBZA 2RD2A 3IOBA 2J4DA 4ZT2A 1LW7A 4U8HA 2QJTA 2YY5A 1PFWA 1R6XA 3ZJTA 3IH5A 2B7LA 3FNRA 1F7VA 1M1ZA 1TYDE 5J59A 2HZ7A 1GPMA 2DLCX 3VGJA 2QJFA 2BTEA 1K97A 3JXEA 2OQ2A 3A4IA 4EG5A 5K0TA 4GU5A 4ZCSA 3RFFA 1GLNA 1QU2A 3QTBA 2CYAA 2EJCA 1M8PA 2G36A 3H99A 1KP3A 3AKZA 1MC1A 1O5TA 1PFYA 2E18A 2BYTA 1J1ZA 4K0RA 4ND6A 1O96B 3CVYA 2A1UA 3Q4GA 2D5BA 1M83A 1T9GS 5F23A 1ULHA 2DETA 1PFUA 3CLUD 2PG3A 2J5BA 2WQ7A 4CDMA 1GAXA 1IQUA 1B6TA 1WXFA 4WSOA 3IODA 4MW1A 4DLPA 1EFVB 1OWOA 4MULA 1M8KA 1NUUA 1K4KA 3FOCA 3LE8A 1TYCA 4PBSA 2A1TS 3TQOA 5FNZA 4R2MA 4TS1A 1GTRA 1JEDA 3AFHA 4CDNA 1G8GA 4L2IA 1IHOA 2QUHA 1N78A 3ZJVA 3SEZA 3DPIA 4J75A 1VL2A 1COZA 4KKVA 2XRYA 3PRHA 5TEVA 4S1OA 1NURA 3TNJA 1U3DA 4MAFA 4AQ7A 5TS2A 2D13A 4MUKA 2IJGX 3N8HA 4GRIA 4YMIA 3KT0A 2CV2A 3SEQA 3BL5A 2X1MA 3OTWA 4NDAA 4F3RA 3IVGA 1MOPA 1I2DA 5K0SA 1YIAA 4MW6A 5KHAA 5BNZA 3CLUC 3SZ3A 2A1UB 5TGTA 2PXHA 3ILVA 3ELBA 3D6VA 3RJZA 1J1UA 1WXGA 2J09A 3COYA 2PFSA 3CLSD 1OWMA 1JEEA 1M8FA 3C8ZA 1OWLA 3FH0A 3IUEA 3E27A 1D2RA 4OUDA 1IVSA 3K9WA 4MW0A 2JA2A
chains in the Genus database with same CATH superfamily
1O4VA 1Y5MA 1FUIA 3FVTA 3VRHA 2CBXA 3DAFA 3H0KA 2YC4C 4MV6A 2UVQA 4RZHA 1DXQA 1ZUNA 2HSZA 3INNA 5CTJA 2ZAGA 3I0NA 2ZSKA 4C0HA 4XD7D 3IDFA 3KVVA 3TZHA 1ONPA 4JUAA 4QQFA 1R0SA 4CV3A 1HEUA 1PGNA 2WB4A 2H1VA 4G07A 2V9ZA 4NYMQ 4WK4B 4BGUA 2GYVA 2WA1A 3KZVA 4Y2UA 4I4IA 3UW1A 1ZKDA 3VQTA 1W2WB 5JSYA 2GBGA 2IIQA 5EJGA 3AVTA 4QDUA 3JSAA 3S2EA 4AJLA 3N07A 3LQ2A 4BRWA 2Z09A 3L7JA 3UKDA 3K5IA 1VE6A 4IMPA 4NATA 4RDCA 3W5HA 4X8HA 5NULA 2G3YA 3DMHA 1W8IA 1JRLA 2DSTA 4KE9A 4QQKA 3AKDA 4J07A 4MVJH 2I2FA 2QVBA 5CAEA 3JWIA 2XVAA 2MSLA 2WIJA 2X9VA 3RVRA 1CSEE 4YRTA 1QQBA 6LDHA 3EZGA 4QZVA 1JE0A 1MX5A 1NU6A 1G60A 1JG3A 2A59A 2G5PA 4G9GA 1L5GB 4JI1B 1XVAA 2VSYA 1ULSA 2V6FA 5BNFA 4PS0A 1YJ5A 3CLSC 1NKVA 3UAOA 2FR8C 5DOZA 3VR0A 2NO6A 4EMSA 5BUQA 4RULA 1Y8CA 2FP4A 4XWYA 2UYGA 3FUVA 3WE7A 2I4MA 2X3YA 4F5EA 4AURA 5I45A 3QVGA 5ALSA 3F3YA 1X7XB 5AKEA 4LFBB 4DAOA 4QODA 3REQA 2PIAA 1Q0QA 4H3HB 3HMKA 4X6UA 3WGOA 3A06A 1Z4NA 2AG0A 3GRZA 1DO8A 2P11A 1RI3A 4D3DA 2QQ5A 4QRDA 1I8TA 5KNCA 5KYXB 4GOXA 3GPCA 4ECAA 1VPWA 5IC6A 3VX3A 2BC9A 4Y2GA 1CUEA 2N0SA 4WJZA 5JVDB 3LGSA 4BFZA 5DBGA 1X7DA 1XX6A 2EX1A 5JDCC 3OZCA 4UHDA 3TZEA 1UEIA 4R9SA 4QE3A 4YMVA 1CQIB 3AOEC 2W58A 3PKIA 3DLBA 4CIXA 4DCVA 4RAOA 4R3NA 3P9IA 2BFEB 2B1QA 2HPZA 1RQGA 4HGRA 4HR7A 4PPFA 2FHSA 2FQ1A 3BD6A 3OZRA 2GCPA 2IYXA 4FS3A 1J24A 5EWMA 1M74A 1XLTA 1CUAA 4OI1A 7REQB 2RCYA 5JXJA 1YB5A 3DD1A 4GBJA 3G85A 3PZRA 4TSFA 2XUZA 3P97A 2ZSDA 4X1KA 3MJSA 4P7FA 3QE3A 5L3QB 3CH5A 1IVNA 1FNDA 2X2PA 4WCDA 1S8FA 1KI4A 2DWQA 5E0KB 3VC3A 3I62A 3WJ7A 2SKCA 1IZ9A 2Y77A 3Q40A 1H1TA 4EM6A 1C3XA 1DIRA 2JFPA 4OCZA 1TAHA 1IDN1 4HEHA 2V7PA 4RS4A 1SUSA 4M0DA 4YYEA 5BMVB 3WX0A 2GSDA 4DLLA 3VOSA 5JNTA 1JIQA 3UOWA 1U7UA 4MW5A 5EUQB 2GZDA 4KGVA 2AXPA 4KI0A 3D8RA 4B9EA 3BGVA 4LS3A 4PPGA 3NOXA 5CA0F 4S12A 3MXOA 5DN9A 4EHAA 1LY1A 3II6X 2GXSA 4AXBA 2BFBB 3DPUA 4FGZA 4C7KA 2IHKA 1YOVB 5ALHA 2YR0A 4CTNA 2JLSA 3E4DA 5GONA 3N2GA 2BMWA 1V26A 1G5TA 2WQZA 2XHEA 3RF6A 3SQMA 2PWBA 1CZLA 1XCOA 1VG1A 2JANA 3EQ8A 2A7XA 4Q05A 4R68A 3JWGA 1NQAO 2UUBB 5ICMA 1OXSC 1GDTA 3LU1A 2BI7A 4CIAA 2RAPA 2MU1A 3EXG1 4KWCA 5FHRA 2ONCA 4I2NA 3SY8A 1IXZA 3QY9A 5JZMA 1MABA 2G08A 1Y33E 5MN5A 2ZJ5A 5BN5B 4X1IA 3IOMA 5EINA 5H8WA 2F43B 3GLHB 4FFBA 4ONEA 4WIAA 3H9QA 4C4YA 4RVOA 1UFQA 2AW3A 3ZQ6A 1TJNA 2ICAA 2WSLA 2FF5A 1MNAA 4PF1A 3KP1A 2ZAOA 1K3FA 3QOYA 2Z0MA 1N4DA 3BWCA 4R8LA 2FZEA 2RHMA 2HF8A 1ODTC 4CL0A 4RELA 1WCYA 3THWB 1FPMA 2DB3A 2QI9F 1LSUA 1M1NA 2B4QA 5FR2A 1GEGA 3X2FA 1XG5A 3FOZA 4DNQA 1XE3A 3V8BA 3HVJA 1UPXA 1X1TA 4KXXA 3EVZA 3HJCA 2QE6A 3ZZ0A 5BSKA 4WNIA 1N3LA 3GUCA 1AMUA 4JI8B 4H4CA 1C1DB 2H4JA 2DPMA 2QB5A 3T4UA 2Q62A 3NLLA 3TB6A 3YASA 4AZSA 4D0SA 2DKFA 2FGJA 3W3AA 4LZOA 4NF2A 3S6JA 4BRZA 5T4EA 2FFRA 4OL9A 3B3QA 2V7XA 2OV3A 2DBVO 1TRHA 4OPMA 4XQGA 3U2QA 1JHOA 4QDXA 4N18A 4J7AA 2F3RA 3RTCA 2ZLBA 3HUTA 4N3NA 1Q0PA 4H60A 4M0EA 1D6SA 5BWMA 1O94A 3TH5A 1YQQA 2PAAA 5IW8A 3VOBA 4DLRA 4KGXA 1XR3A 3PRJA 2QTRA 4A91A 1NONA 2BFAA 3GELA 3NGLA 4QBIA 2EGUA 4NJMB 2OB1A 5CT4A 3S2UA 4KRFA 3GA0A 3U3JA 1KO1A 1GTL1 1VLZA 1JIJA 1COWD 1OU0A 3QQ5A 3UWDA 5HRAA 4LDPA 2Q2QA 5LQUA 3O4RA 3QUTA 1KEUA 1A95A 4ZV9A 1YR1A 3WJ1A 3A11A 3CC8A 3ZWBA 4EPRA 3UZUA 5K8UA 4E4YA 3R5TA 3PQ5A 2FG6C 1JIKA 1Z0KA 3GRAA 2IYZA 3NNSA 4ZO6A 5AKGA 4EKYA 1VJ1A 3GXOA 3WLFA 1N5LA 2B5WA 4H27A 1L8OA 4FZJA 4HNTA 4PICA 2YXEA 3GHYA 3UHJA 1RR6A 5F12A 4OXXA 5KYKA 3MWDA 1JPJA 5EHGA 2G4VA 2MOKA 1DUVG 1SC4A 2AFVA 2EJWA 3E9RA 3FZYA 3FWZA 3I5MA 2ISQA 4WUVA 4TTPA 1CEQA 4DA7A 4D4JA 2Y66A 3RS7A 1GCIA 1X7ZB 3KSUA 5BSHA 4AO6A 5T6MA 1YF3A 3PE3A 1IJBA 1BIFA 1E4OA 1NSYA 4RFLA 1VKNA 5JZBA 4HY3A 2PVSA 2VH2A 4M4SA 2X0DA 3LFUA 4QAQA 3WGTA 1X1RA 4F85A 3R40A 1BCRB 3SC6A 2D5CA 4KQWA 4H31A 4BCBA 4RU1A 4HLQB 3ZBQA 4OYYA 3AF5A 4U2KA 1OXUA 4MW4A 3RK0A 1N5JA 3HEMA 2OHXA 1QRUA 3IAHA 3C3PA 2FPUA 3EK2A 2IHJA 3MIZA 4WECA 3J80A 1KQPA 3ADPA 1O4WA 3QM1A 1IZYA 5FWYB 3A3PA 4FSXA 4W63A 2XYGA 1XNJA 3MSCA 5CT8A 4G8CA 2HH9A 2JFVA 5AT1A 3LX6A 721PA 1NZJA 2WU3A 1BXGA 4CI0B 4CHTA 1TXGA 3CEAA 3ZV6A 3TRHA 4JVNA 4IH1A 2RKWA 1JHPA 1GAQA 2OZPA 3KQOA 4RVDA 4EOGA 7ADHA 3KJZA 2JZCA 4KRGA 3NEAA 3BMQA 5IZCC 3A2MA 2LZ0A 3BD9A 2FSVA 3OM8A 1DDOA 4XQEA 3HKCA 5E1OA 2DPGA 3RIMA 4QYIA 1QR2A 1G20B 1FCJA 1L4BA 1KF0A 2IE0A 3CPHA 3ZOKA 2VP6A 5IVIA 4F9EA 1A9RA 4CKBA 3F7OA 1PQ4A 1MAHA 1SJ9A 1U8ZA 2VNAA 1VCMA 2J5RA 4IFTA 4MH0R 5AO9A 4E5UA 3OQVA 5L3VA 3A9TA 4NEQA 1I5EA 1AK1A 1XROA 2D2FA 3I0ZA 5FADA 4HWKA 3OKCA 1RKVA 2P1RA 3P0EA 4OJKA 5AUOB 2NX2A 4JLNA 4ACBA 1MG5A 4W9RA 2CY0A 2RGYA 4W1SA 3EGOA 3VUEA 3JARB 4XWOA 3OQ1A 2Q2OA 4HCJA 1A7KA 1RLUA 2DHCA 3OF3A 2PKYX 1GL9B 3MCVA 4KFCA 4I9UA 1Y5LA 3ASZA 2M6LA 1XCJA 2PZ8A 3SS9X 1AVTA 4L50A 3DOFA 2BAGA 2IUEA 5EZYB 1EK2A 2HOQA 1CDOA 4TXHA 2CLDX 3K9GA 5C37A 1QZZA 1RBQA 2NXNA 2ERCA 3PE4A 5CT6A 2O52A 5ALNA 4LSWA 2BF7A 1PD1A 5A6SB 3C7DB 4L7VA 2REBA 1E61A 1AKMA 2X8LA 4J3FA 1YWGO 1S5PA 1UMKA 2CKDA 2ESRA 3PCRB 4BECA 4LMBA 2AFIB 2R62A 1ISGA 2QYTA 4GGOA 4IMRA 4US0R 5AIAA 4ANFA 2HX1A 3FCUB 3P9ZA 5LKRA 3NIWA 2R60A 2NP6A 4GX1A 2R4TA 5F9MA 5B1YA 4PPNA 1WTAA 5GZ6A 4IXMA 4H7JA 3KVYA 1GG5A 2FE1A 2XUOA 2G7ZA 4RK5A 3KKMA 1AHNA 4WCFB 4B7AA 5D3MA 1M73E 5J3JA 4R54A 3LECA 1N0UA 4PTYA 5EMMA 4CTJA 4PNHA 1DKUA 5SYAA 4KAFA 3A6DA 1MT3A 3I39X 4URXR 3NAQA 4XSVA 3JRXA 5KX5F 3LZ6A 5LKAA 1JFRA 5EPOA 5K1ZA 3HY6A 3TDNA 2XBUA 4Q9IA 3DJFA 1HRDA 1ZMBA 5B7PA 5AHRA 5ELMA 4L5AA 3HCOA 4C4RA 2AZXA 1XEWY 1NFFA 5BV2P 1F51E 2VNIA 4E03A 3D6NB 5IK2A 1CIPA 2XDWA 4I4CA 4PQYA 1R7RA 4IAOA 4FOLA 5LXTA 3AB3A 2YOFA 1ZGGA 3LAWA 4AWAA 4RDXA 1D1PA 2O05A 3PT5A 3CBGA 1NVVQ 1FL9A 4KN6A 4X8LA 3MFQA 2NTVA 3IOBA 2F3QA 2P90A 2IZ6A 4OKNA 4LXUA 4G37A 5FCDA 1HT2E 2JJQA 4QG7A 3V6MA 1H1DA 3GLIB 2CVOA 2NVWA 5JBQA 3HXMA 1DUIA 1R3UA 4AWXA 1HM5A 1HTWA 3LP8A 4N0DA 2FETA 3C14C 2ONJA 4B7XA 1TYDE 1JHQA 2HZ7A 2JCGA 4KCGA 2FWMX 3BYZA 1QP8A 3W34A 2DLCX 3AVUA 4BNVA 3FNIA 3H3XA 3M4XA 4JIGA 1AF4A 3L8DA 2WFZA 1E94E 3ABOB 2I34A 3ZU5A 1JEYA 4OYLA 4WN3A 4FMBB 3PWTA 4RSGA 4NI5A 3TVTA 3NT5A 3EIEA 3ZQ4A 3H99A 4R1UA 4DV6B 2GB4A 4FINA 4XB2A 4Y7CA 1FMTA 2A5LA 2XZTA 2WR8A 1IY1A 4O4HA 3EMKA 5K3DA 2K7FA 1EWVA 4F72A 5LP6F 4RLSA 2IHNA 1YZFA 2RGUA 2P7IA 4ND6A 4WK0B 1JTVA 1L4FA 1R10A 2HK8A 3NUQA 4AZ0A 4B6JA 5BWOA 2FUKA 4LDAA 1Y3DE 4DR6B 1GWNA 3QYAA 4A26A 1KU6A 1E5QA 2J0EA 1Q7EA 3LQQA 1XYGA 4KR0A 3L0CA 4QGSA 1QRAA 3MCTA 5KI6A 4AS2A 2C8KA 4Q0MA 2Q21A 5KQSA 2O06A 3PDIA 1U1CA 3ZCTA 4DCTA 2FEWB 3BE4A 1PYGA 3KLBA 4BBZA 2RK4A 3N0RA 1ULAA 1U1EA 4E30A 4RMHA 3BIJA 1LNSA 3TQQA 1DRJA 5EXDA 2XUFA 2F6RA 4G1MB 1TK3A 1TT5B 1WLSA 2EL9A 3E1KA 4YFYA 5ENZA 2WAMA 3T5CA 3UWOA 2BTQB 4W8OA 4PGAA 4YJHB 3BMOB 4K81B 3VH3A 2ZJ7A 3UANA 2X4IA 2XXAB 4AF8A 2AE1A 1DJLA 2QUHA 3CW2A 4FR0A 4NCBA 4MKHA 5KYNA 3DLCA 5K8TA 1A9TA 3ICQB 2MT9A 4HZUA 3IBGA 1E1RD 5KMGB 2I7VA 2EBUA 4IZ6A 5CVCA 3IULA 2VZ9A 1IXSB 1AS3A 4CODB 1AK2A 3H1FA 2XRYA 1TJ5A 1XVVA 3IELA 4DA6A 3UAWA 1FS5A 4YCJA 3F4BA 2R66A 4N3CA 3O4FA 3DUWA 3JWEA 4B82A 2P40A 1JAHA 3E7XA 3NZEA 4KC0A 4WZAA 1PWYE 1T3GA 1MAAA 1C3JA 1ZGHA 2FPIA 2Z5GA 3AF1A 1DAEA 3EXHA 3M5PA 5ESDA 7MDHA 2ZR7A 3LVBA 5G41A 1G0OA 1CUYA 3PYLA 1IN8A 4EK9A 3SC4A 2B94A 2BKAA 3TCNA 1TLLA 1A4XA 2CNLA 4F45A 5ALUA 1CF2O 2EV9A 3V1NA 4C0WA 1SMKA 3MGKA 4TMFA 1AUPA 1V8ZA 4ZI5A 3A1VA 3H2ZA 1TIKA 3CURA 3E58A 4Y6SA 5IKXA 5ALFA 3JATB 4KPYA 3M6AA 3T4XA 1APBA 3U48A 3D54D 4HSEA 4YYZA 5I7RA 1Y8RA 1JXOA 2OECA 1NJ1A 2JAWA 2YDYA 4IJKA 1K7EB 5BW8A 3I9LA 4HB2A 3VPGA 5I4BA 2FLKA 2I4OA 3D3NA 3FTPA 4UM9B 3ZNQA 3P4XA 3KKQA 2PWAA 4PQGA 4L9AA 2FQYA 1TF5A 2GZAA 3HPRA 1Z8HA 5IT0A 1CQZA 1YU9A 4A2CA 2WJGA 4GVLA 4IZIA 1ZIYA 1W4BA 2VIIA 2JIBA 4AU1A 4TPKA 4E33A 3UH1A 3VHQA 3U7JA 3GLGA 2VP4A 4R2WA 1WSDA 2A14A 4RUKA 2OZKA 4X85A 4JJGA 4UFPA 2NZVG 2YQ4A 4WBNF 3V7WA 1VBKA 1PUXA 3JQRA 3WYCA 5BYKA 5MF6A 3R3SA 4X7MA 4UAGA 3EZFA 5TC4A 5TQ0B 4LPSA 4CUKA 1Z7WA 3K16A 1X9GA 1ZA1A 2AHRA 1Z33A 1QE0A 2OV6A 2WU0A 4F46A 2XB8A 4TX1A 2CF5A 2J0UA 1EP2B 1K6JA 2R6ZA 2X1VA 4TVOA 1ZSNA 3C3WA 3GB9A 3KEFA 4GYWA 4MP8A 3QYJA 1SD2A 1XXHE 4LCJA 4S05A 4M9CA 4IVRA 2PGXA 4XPIB 3M0EA 4LSZA 4WESB 3UATA 4Q9KA 1KZ4A 3H17A 3NIGB 2JJ8A 2NU9A 3IPYA 4OU4A 4RVUA 1DX6A 1SZJG 4FYIA 3B5JA 5HPYB 1F2UB 3SMQA 4UTOA 1YD7A 2PFGA 4WVLA 4A15A 4BP3A 1KZ1A 4BWYA 3EIOA 4INAA 1EJ6A 3PEVA 3UB2A 1EEHA 1H85A 4IWYA 3DZDA 1ZMXA 3HHEA 2VLIA 4N8EA 3PJEA 1MJGM 4QASA 1RHRA 4AJ4A 1MDBA 2Y4OA 5JSQA 3MTJA 1KKLA 1XALA 1BFKA 2P1ZA 5AYVA 1VYHA 3MUEA 4BLQA 3G9QA 3F97A 3L7IA 2WSIA 4JV5B 3NC4A 5ECGC 3FGPA 5F5XA 3T52A 2XGOA 1XZAA 5EY5B 3U61B 1BYIA 3DM9B 3STXA 1C8BA 1CUVA 3R8XA 4FEGA 1LVUA 1DFIA 2C7GA 2NTEA 1MX9A 2Q4BA 4LPKA 3NG1A 5H0IA 1RJGA 4RGQA 4YRMA 9MHTA 2GARA 4KVAA 3HYCA 1C3LA 3WV5A 1FF9A 1O57A 5H83A 2BLNA 3EPPA 3V8NA 3K9FC 3GFGA 5K3FA 2COKA 1TFUA 4F91B 3BSWA 4HAVA 3WHPA 4G97A 1M2JA 5JSHA 4IHJF 1GKYA 5A9TA 3IO3A 5FI1B 3GU3A 2CFCA 3AUYA 2VF2A 3B48A 3FUUA 2V7EA 3NBFA 4DANA 2QW8A 2IUFA 1Q84A 3DEFA 1U81A 4M7OA 4AF7A 3KJNA 3ON5A 4NZPA 1G8PA 2JFYA 1BN6A 3I12A 4AX8A 2JH9A 3KTAA 1MO2A 1ZA2A 2WG2A 3OF5A 4MVCA 1A5ZA 2I2WA 2IT1A 2UZ3A 1P18A 1KTIA 2XD9A 3FFBA 4C29A 3I5XA 1MXFA 5DN6A 5ETJA 4PYMA 1JQBA 1W0JA 1PJQA 5F5LA 4HQRA 3HUUA 4JKOA 2BBOA 3REFA 4YXWD 2QRNA 4URZR 1PBTA 5EWLA 1XDWA 1UDWA 4KQCA 3WWOA 4I7EA 3MINA 3MAJA 2BHNA 1TQDA 1GFWA 4ACAA 1FX0B 1II0A 5CM8B 4LQ4A 1CFZA 4BNLA 4DWOA 3QF4B 1I33A 2AEEA 1Z34A 4M9ZA 4UD6A 4EKNB 1BDBA 5KCZA 1JKFA 3BORA 1E1CB 3R4VA 3ZCRA 3KFVA 1G66A 5BT8A 2VH5R 2DECA 1JDVA 4TQUS 1E2FA 4QUBA 3UHPA 5A3RA 1A9XB 1AHHA 4QHTA 4FS8A 3OAAD 5ECYA 5ALTA 3RYCA 3HXLA 3AF3A 2OKGA 4D9HA 5DZSA 1U02A 2PMCA 4NOKA 4CG3A 2HD4A 4XGIA 4EIWA 2P0EA 2RHGB 2JFBA 4RXMA 1ZOLA 4YWHA 3R75A 1Z3CA 2EQ5A 3HKDA 2FJUA 2YWGA 1T2NA 4HGZA 4QXRA 2EZUA 4ETWA 3MS4A 3LHDA 4IHQA 3E6AA 4MI9A 4A8HA 2AF3C 3L6DA 4RO0A 1N8KA 4EKIA 2R6GA 4C04A 3JQBC 3CUEF 3IE2A 3Q5EA 1RQPA 4R5MA 3FKSD 4R0MA 3CNNA 3NHZA 4FNGA 1J33A 5DM1A 3RYHB 1IBLB 4OX9Y 4PCVA 1PYOA 4JGBA 4LBZA 3DQZA 4LOIA 1LBIA 4HLUA 4CQNA 3CNEA 4GQAA 4UNPA 3AJ9A 5LZ9A 3QIVA 1U1GA 5JS2A 4DSTA 2PGOA 4PXSA 4EFKA 1NF8A 1OVGA 2I29A 3DB2A 1YXMA 3JPWA 1WNFA 4V38A 4YAEA 4G5QA 5ENDA 3THYB 4HB3A 1K88A 1T3LA 1T10A 5G4KB 4ME6A 3T0FA 4N7BA 1C4KA 2Q2WA 3BSYA 3MUOA 4YRCA 3VPAA 2HFJA 1JI3A 4NU5A 1QHEA 3QMMA 4JEUA 4HK4A 4LHYA 4ND8A 4PRYA 4YN3A 5HE9A 2CHEA 5KDLA 5LD2C 1LDMA 1OLXB 3B1YA 1NDUA 1Q2UA 1USGA 3VNQA 3WZ2A 4L78A 3QX7A 3EY4A 4YS6A 1GN8A 1ZP6A 3HCDA 4X63A 2HB6A 4QPDA 3GARA 3K0SA 4MYUA 4KOEC 3IDOA 4JA2A 4G0VA 3BJMA 2TMKA 3S7ZA 3DT8A 2O6HA 3F73A 2BHLA 3WBKA 4WERA 4MUYA 2VNJA 5ULLA 2HQRA 1VSVA 4LYHA 3T95A 4E08A 5LWHA 3S5JA 1B15A 1SCUB 2E2WA 4EYSA 2YXDA 1GQSA 2D1FA 3GNQA 1LLDA 1VP3A 3JQ7B 4OGKA 4ALJA 3V97A 4FD2A 2EEPA 2BN4A 3W7VA 3QEAZ 1V8FA 3HJGA 3G2JA 2I6GA 1VOTA 1TAUA 2EBFX 2BUAA 1ISMA 3HVKA 4D8VA 1EGHA 1BVUA 4OY3A 1T4CB 2G04A 4AYTA 1SQ5A 4EJSC 2X1HA 2WC1A 3SEAA 1L7DA 2XEDA 3KHSA 2AZDA 4E94A 2H1OA 3M6WA 1EHCA 3OT5A 1A8HA 2IP1A 3A4VA 4IX1A 3ETNA 1A4UA 1PJTA 3CY6A 4TTVA 3ME5A 5CA0B 1VHLA 2JGMA 4QDJA 1XQ9A 5SY6A 3M6XA 5IBQA 1GNPA 2OHFA 4C7OA 1HK7A 1TU0A 4TXNA 1JMVA 4X1YA 5KSPA 2NUAB 2FG7C 4IJVA 2NWQA 3O03A 2D1QA 4DCNA 2XTAA 4DLKA 3PGJA 3VU0A 3WA6A 1Q3HA 3PD1A 4DMFA 5I8WA 1MAUA 1EVEA 5SYNA 7YASA 1Z08A 2I6UA 4NAUA 2DE0X 4MRSA 3ZI4A 4YCLA 3EISA 3ETHA 3LXMA 4HH4A 3DGFC 4QDTA 5KWJA 3DAHA 1UBKS 2FJPA 2YHBA 3FPLA 1FY2A 4MR7A 4R7TA 2ANCA 5IEJA 4Z4GA 4UTZA 4GZ6A 1IZ0A 2VAWA 1G4HA 1ZM7A 4NEHB 1NJFA 3FSGA 4QO7A 1FYWA 4FPXA 3R8FA 3Q8WA 3QK7A 5GPBA 3V5NA 1AT1A 4K28A 4V0LA 4IIBA 3AR9A 2P9GA 4CCSA 3LT1A 3FSJX 3UMGA 4QECA 3CKKA 2DFVA 1I13A 2R6JA 1MXHA 2OQIA 4D4IA 1RZUA 1S0UA 4FN4A 3M33A 4FFWA 2FR1A 1OU4A 2FN7A 1UM8A 2X0KA 3TPFA 1KL7A 2XT9A 3DE1X 3LKDA 2BBWA 2J0SA 1O9GA 5DTRA 1P4HA 3GA5A 3AHEA 2J5KA 3TJZA 1AXEA 4Q3LA 2L18A 4KAJA 4H1VA 1RXCA 4FT4A 821PA 1O6FA 4QTZA 4Z3KA 3NC0C 4WX2B 1C9KA 4PC2A 1VL0A 2EF0A 4UC0A 4K05A 1ZUD1 1OT3A 1YRBA 3F67A 2XQGA 3KFLA 4B7ZA 1BXKA 2XKAA 4UD2A 4DKXA 1S02A 3I1FA 4P7JA 4RZQA 4W5HA 4D9GA 2NSYA 3ZVNA 2VCEA 1E7QA 1K0UA 1Z5GA 3EIWA 5HF6A 5AVZA 5IABA 1ORRA 5EERA 1CY4A 5CJ2A 1NFQA 2BH9A 3ESAA 3E5NA 3KCQA 1H4TA 3W1WA 5IT9A 1PL0A 2CNBA 1AS0A 1VMEA 2H1SA 4B1FA 1PDOA 2ZEJA 1L7AA 2E9SA 2P6RA 4XUCA 3PX3A 3U31A 4AB1A 1NVDA 2OBLA 3KETA 3OESA 4HRVA 1TEXA 5F9FA 2WU4A 4PZZA 1HYQA 2YH2A 3V8QA 3N2KA 5JISA 5G2OA 2PX4A 1SKBA 1C14A 4LTNA 2FZCA 1DXOA 1U8CB 4E32A 4OV6B 3CX4A 2C7RA 3P9QA 4COKA 3O91A 3I34X 1W47A 2C4MA 2V7TA 3TTXA 5GV8A 1US8A 4F92B 2ZCVA 3IUBA 3TNDA 4M1YA 3TGPA 2IYRA 3G2LA 4KG7A 4YFVA 5AOBA 1U0SY 2FZKA 1T1GA 3HP1A 4PTLA 1CR6A 5AW0A 5BN1A 4YLYA 1DJMA 3FIUA 3MJTA 4N76A 1TZJA 4E09A 4YUYA 3PI6A 3D2LA 2E37A 2J6CA 4G1EB 3T1HB 1G17A 4QT4A 4J9UE 4P0PB 3OWOA 2CNDA 3O94A 4HSGA 4OQFA 1RZRA 1QF7A 5K45A 2WD8A 2Q4TA 4H08A 4WOPA 3LPCA 3O9MA 2OLKA 1YE3A 5C34B 2CHFA 1AK9A 2XDYA 4HAYA 4WXHA 3VC1A 4DLAA 3ND7A 4F4HA 1AQ6A 2VHUA 2NZYA 3RS0A 5JH7A 1PFVA 4MTLA 4RV9A 1RXSA 1LV7A 1NY5A 1OYWA 2W2KA 1MB2A 2ZIUB 1JLRA 1EDOA 1OFUX 3JVUA 2R8YA 3GDOA 4H1HA 4HEA6 4B3GA 1TA4A 4EG0A 2IXBA 2K7ZA 1H5NA 2VHEA 2J59A 1YQ9A 3BIXA 4I5IA 4M1ZA 3VR4H 1T34A 3HL0A 5FL7A 3DLIA 2D8MA 1TLTA 1OX5A 1FMFA 1N2GA 3HEAA 5FTNA 4V03A 3LY5A 5HJ5A 1BKYA 2IZ1A 4UJ5A 1AM4D 2RI6A 2DT8A 5GJWC 1MGOA 3SLGA 5I4CA 1YZQA 2P6UA 4OSOA 4J6EA 3STWA 4R40A 4D9MA 4XI9A 1CU1A 1ZL2A 3F5DA 5CK4A 1LW7A 2HQOA 4CFYA 1HLDA 3OD1A 4FFVA 4U6SA 4D7AA 1XMSA 5FBRB 1KY4A 3FJYA 3EF0A 4YP0A 1F6DA 3EOZA 1FZQA 1LPAB 2C94A 1PHRA 3CEJA 4TKVB 1FW6A 4QLBA 4QQNA 1F20A 1K97A 4RHFA 3CUVA 4FI3C 4LAFA 3UFXA 3UJ6A 2QROA 2V97A 2X8JA 3KJEA 1UFRA 3NDJA 4MMYB 1KVRA 1PTJC 3H87A 1KY5A 5B7QA 3IJPA 1ECGA 1P3Y1 2P5TB 2X5JO 2ORIA 4YAKA 2H0RA 1XZJA 5EGNA 3ZTYA 1M10A 2DR0A 1MW8X 2IWHA 4HPJB 4KNWA 2DBQA 1A2QA 2IP2A 1IJEA 3A9SA 1ECFA 1QX4A 3EWIA 3EDOA 5AW9A 1IB0A 1FFCA 1QZTA 2QZJA 3HU2A 3KKOA 2EWWA 1M9NA 4IP0A 4DG8A 3E0QA 2F90A 1N1MA 3E22B 3R3UA 3WLJA 1AA6A 1YDHA 1EESA 4UHFA 1EUZA 2GJSA 1N5DA 1D7OA 3ZDAA 1G1AA 4L3OA 3BWDD 1T8YA 4IIEA 1Y3CE 5K4GA 1BWPA 1WSWA 1ISIA 5F21A 4E11A 3KEQA 4HFRA 5EJ9A 5K5EA 2ILTA 1M7GA 2YOHA 2P6MA 4PYLA 5L3ZA 1IQUA 1CQJB 1RQLA 4JQSA 3QEKA 1QV7A 4OXNA 3STHA 1I5RA 1Y89A 3DS8A 4EFDA 2XYRA 3RIEA 4E2YA 3K9CA 1IBMB 3L7BA 5JJCA 3SXUB 4FMCB 4Y1RA 5AK3A 4O0MA 4DW8A 1MW9X 4RA6B 5JFGA 3IQEA 1XJCA 1DV1A 3U56A 1E9CA 3BIOA 2WABA 3EZ6A 3PHLA 4O5OA 5CEJA 4M54A 2H4ZA 5LQMA 3W0LB 5CT9A 2SCUB 4HDKA 2A0YA 2VYCA 2AKYA 1DAHA 1C4WA 3HJNA 4Z0NA 4ZVOA 4UDOA 1QB7A 2VDLB 4QVGA 4WZBA 5J40A 2PBFA 3VAYA 4ZO7A 3M1YA 4JSTA 4YUXA 3QU4A 2ONYA 2RI1A 3Q88A 5FRDA 4UE2A 5KYVA 5JDIC 3JYLA 4HDCA 2JC3A 5JIBA 2I0FA 2JGLA 4L9SA 3WP0A 2H1HA 1C9MA 3ACCA 1U0HC 2WTNA 4MX8A 4W4TA 2ZXUA 2RH4A 2QN3A 4JEHA 2R00A 2C4TA 5HQJA 1OBVA 5TS2A 1EWQA 1O03A 1B8NA 3HKBB 4IDGA 1XTPA 3ZTTA 3H6GA 1E3DA 2JCXA 3DV0A 1YB7A 4F3RA 1XAIA 2O1XA 5IARA 4KREA 3HADA 3B12A 2GBIA 2WYUA 2ACWA 3ZHOA 2GCIA 4BMYA 5B3JA 3WGUA 3ZYCA 1CLUA 4FYVA 5AFSA 3NUZA 3W5UA 4UCWA 4UEKA 3VBEA 4F7DA 2O07A 4B33A 2CL6X 4JP3A 2ZJAA 1E98A 3OJEA 4NMLA 3OOSA 3ZDXB 3LHFA 3T9DA 4S1WA 3OTIA 3ACDA 5HZKA 1HETA 4DQLA 1D03A 3ROQA 5HCNA 1SUIA 3M1AA 3GCZA 1V35A 3B3FA 2VJNA 3CIOA 1ZD3A 1R6AA 3GWZA 4BAUA 4NBUA 2C59A 1PR3A 3C3BA 3GRCA 5C7IO 5C81A 5B4UA 3FHCB 2VAPA 1SG9A 1WBDA 2RBKA 4GEKA 4D57A 2NVUA 3SHVA 3BXFA 1HWYA 1QHYA 5FOTA 3PSHA 1JQ5A 1AO0A 3AFIA 1L6IA 2G9ZA 3CZCA 3I01A 1Y8ZA 1OCEA 4CEHB 4YRFA 3VX4A 4FE3A 2IDJA 2VJOA 5EJ5A 2A9JA 1NY6A 2A9VA 4CTOA 4W5QA 4PCLA 2ERXA 4PYIA 4J90A 1YIDA 3S1AA 4K9NA 5G0WA 2VRWA 3FPKA 2HXYA 5C0OE 1PL7A 2HT6A 3NXKA 4Y6GB 1NE7A 5IMSA 1SULA 2L2QA 3W05A 3GH1A 4YEDA 3DDSA 5HKOA 2HJSA 1H9CA 3TG8A 3V4ZA 1RJWA 2HUNA 4HDRB 2X77A 3G2PA 3A70A 1T5SA 1C4XA 4LGYA 3UM9A 2BGIA 1UBNA 5JEEA 2FEXA 2O2CA 1E89A 4B44A 1M6YA 2LWIA 4B3SB 4QHSA 1Y3BE 2QD1A 4Z7OB 1MLDA 1J00A 1BH6A 1Z7BA 3AINA 5ALWA 2NSJA 4ARVA 1WBJB 1Z47A 2XOXA 4RLQA 3W5BA 1PDWA 3S1LA 4N39A 1X6VA 3H16A 1O5OA 3AW9A 3H83A 3AVWA 3JYNA 3GRFA 2F62A 3RYFA 2W5UA 3EZNA 4YNBA 3BMCA 2ZE5A 5BWCA 3KL2A 5E4TA 1WXHA 1X38A 4Z0HO 2B92A 1FTQA 5ALYA 1PN3A 4P86A 1EFAA 1NXOA 1T6NA 4Q3EA 1B0PA 3O4VA 1KS9A 3QUSA 1UK9A 4G36A 4KQMA 5F2OA 3ZE2B 2BGJA 4AS3A 4R01A 5KWIA 5ALOA 1MD9A 3PEUA 5BRAA 1Q16A 2FZVA 3TAXA 2EVWX 3BGOS 2OHIA 3TL3A 4X6LA 1X8XA 4KN5A 1KEVA 3VDXA 4C1NA 4TKZA 5M5BA 2WP8J 3HWSA 3K1AB 3PT9A 5G1NA 3HDHA 3VMMA 6NULA 1EWYA 1KJIA 1RLJA 3K9BA 3E9EA 3RFVA 4ARZA 4F9TA 3CIFA 4FP9A 4D43A 2GEDA 1JIIA 1DRKA 1NVTA 1VRCA 5J4HA 1CUWA 4E12A 4U3JA 4FDVA 3VPBA 4I14A 1P1BA 5JMWA 1ZN2A 3LW7A 3VTFA 1EWKA 2O3RA 3ORFA 2G0TA 5D1NA 2ANBA 2C2XA 1QAQA 3GUUA 4HB0A 4IQ8A 4KLAA 5J2TF 2XE4A 5A71A 3ZWOA 1WQ4A 2CEKA 4KE7A 4CF5A 4ZOQI 2I8AA 2GK3A 2G9NA 3DTYA 5SICE 1UKEA 1UMDA 2I2DA 3UOAB 4CKXA 2CC2A 2XQIA 3R9IA 1WDLA 1XLWA 4AG6A 3QKSA 2JJ1A 1N9GA 4M7PA 1GU7A 3SYMA 2CL7X 5TV2A 2WAXA 4JYPA 1RWKA 5A05A 3L05A 4QULA 4U7WA 4IDEA 4I4LA 4D4MA 4NBSA 3P2MA 2V4UA 2ZPAA 1PR5A 2HSGA 3HA3A 4YJFB 2C5EA 5KINB 1UXGA 2J67A 4HDSA 1EFPA 3K1JA 5EKUA 4BNMA 4AG3A 4G8DA 4YAFA 3OFVA 2XADA 3M9XA 1NMQA 4EGJA 1K8RA 3RHSA 5EL0A 5KIAA 3WDMA 5B7GA 1UPCA 1HZZA 1XZCA 1ZUHA 3PQ3A 3WK7A 4F11A 5I4IA 2JEOA 4DYVA 3H2SA 2CDBA 3A14A 1PQYA 9LDBA 1PR4A 3IGFA 1PRYA 4GR9A 1ANKA 1ONBA 1GPDG 1JMKC 2Q29A 4V0ME 2AEJA 2QGNA 4Q4LA 4V2IA 3FZEA 1HYEA 1TDJA 2F00A 3JASB 5JY6A 1MUUA 2XYQA 2FR8A 4DCOA 4LRQA 4EF6A 4YRBA 3K70B 4HKTA 1P7CA 2D74A 2NUTB 3H5TA 5D6NA 5IBRA 4IIGA 5HZGA 1CD5A 2W6MA 3ZY4A 4NNOA 1NFRA 1T26A 4YRGA 1RPZA 1AKNA 1SR8A 3EIXA 3VMFA 3T9FA 1CUIA 2VNHA 4JL6A 5LCXA 4DCUA 3A9CA 2G9QA 3NTUA 5JRJA 2XKKA 1QLWA 1PEYA 1RRFA 4N54A 5GVSA 2JKVA 3KPJA 1M1YE 1TADA 2GEBA 5JAPA 4PHHA 1HQDA 1U8XX 1FSFA 2YIDA 1DELA 1XELA 7GPBA 1BGWA 3ONFA 3A7EA 4E88A 1K92A 2GTHA 1KRWA 1G2OA 2YZ7A 2XWJI 4W7SA 1ENOA 1KDTA 4B8YA 4A8JB 1FNNA 1L8XA 1LJ8A 1A7AA 1TEZA 4YK7A 3D5QA 2RDMA 4WKNA 1S8NA 2VXBA 4BX8A 3RRMA 4HEJA 3D6HA 5IN4A 3H2GA 2NV6A 2FN4A 2MJLA 4AG5A 2L19A 4RDHA 1GZ6A 3VU1A 4WGFA 2FY8A 5HUJA 1EB9A 1V1JA 5K0ZA 4ENSA 1UP7A 2GCGA 2IEAA 3K0AA 5A06A 5KSYA 1KO4A 3UT5B 2ZUWA 1HDGO 4BIMA 5TVGA 3TN7A 3N1UA 4RPKA 2GAIA 5ALVA 1I1HA 2WF6A 1AKRA 2WLSA 3R2JA 3K15A 1XA3A 4WCFC 3ZGOA 1RE1A 1USIA 3BWYA 3VZCA 4IHJB 5AKJA 3HNPA 3RK1A 1YT5A 3O1HB 3Q0TA 1N5IA 1H05A 1J99A 4D42A 3WGZA 2G6TA 2R87A 4NH0A 3QLVA 2IF0A 3KALA 3FMOB 5LB4A 4TYPA 2JAPA 3WB0A 2IF2A 3B38A 1U9JA 3KSRA 1QHFA 4G65A 1NVXQ 1WUIS 2EFYA 2BEVA 4MLPA 1LC0A 2WYHA 4M0CA 5M34A 4LV6A 2GOYA 4ZVPA 2LCQA 3CVOA 2DCMA 4BO8A 1WCXA 5IAKA 2QUBA 2NUPA 1HDOA 3IV7A 1VPTA 3OQIA 3OVMA 1FJGB 2O0HA 5GOZA 3ED5A 4IJ5A 4TQGA 4Y6RA 4BVFA 1TYBE 4YIHA 2H2GA 1E62A 4X20B 1N36B 5INTA 1KDYA 2AVDA 1ID8A 1ESZA 4D9FA 1O9BA 1QIGA 3OM0A 1Y1SA 2PT5A 3HCBA 4BQOA 4GNRA 2OCPA 3WKCA 1B76A 1JGTA 1NXXA 1DBWA 4YQZA 2GKSA 3EQ6A 1M6EX 4LRSB 5K3BA 4B6FA 1JJ7A 4MV3A 4EITA 2JLAA 1Z2NX 3FMPB 4DQUA 3CF4G 4O8CA 4QGFA 4F2WA 5BOSB 3UJ7A 3DKRA 4M8KA 4L1KA 3EXFA 1C7JA 1AS2A 2VXCA 1ADCA 3RPEA 4MDFA 3AUTA 1NVWQ 4Q6WA 2A5DA 5EJ7A 2P9HA 3DYIA 1J5EB 3PC7A 4YMGA 1AB6A 2HJRA 4HC4A 1YL5A 1FSSA 2NZUG 1W4AA 3GPBA 1TRKA 2CFRA 3EWAA 1G6KA 5C1DA 4R71A 5L7WA 1P0CA 2JNWA 2C8LA 3TPZA 1SC3A 1FQJA 3ET4A 1YS1X 1JWAB 1Z6XA 4RKFA 1JILA 4MP6A 5H3HA 3O2SB 1E1YA 2GN6A 4W9MC 3ZH9B 4FOPA 5B6JA 4Q3BA 1KAEA 2Z8ZA 4ALKA 2C95A 4LI0A 5F73A 4EHLA 2HSJA 3C5WP 5SZJA 4D3FA 1Z17A 1WQ1R 3ZLVA 1C81A 4ZCPA 2PLWA 1F2TA 2YV3A 3EHEA 4MVJG 4ZZIA 1H42A 1BCSA 1WS6A 4KIUA 1HGXA 4FDUA 4FZ3A 3LRPA 2M9MA 4KMRA 1DIOB 1KAHA 5JARA 3FOBA 2XI4A 4CL8A 1DQRA 2ZETA 2OC9A 4F56A 4UM9D 5KYUB 3CF4A 2O6LA 3T7SA 2VRCA 4EWLA 3KPVA 3A3KA 3RVSA 3VH2A 4ZVQA 4D4GA 3RYIA 1IY2A 1EX9A 1Z12A 3AZQA 3IUNA 2AJBA 2F1JA 3EVGA 3PCXA 5CA1F 1HE8B 4K5QA 3WLOA 5EHXA 4BB5A 1PVDA 3RQSA 2QM3A 4CT0A 2XTJA 3AKEA 3DV2A 1IH8A 1U3CA 4QOSA 4HAUA 5FQOA 1QHHA 4LC0A 2CV0A 3BXGA 3C4VA 1L1FA 4KITB 3I5AA 4G9EA 1KOFA 3I8SA 4V0KA 3ZNNA 3N75A 2WMNB 2PDAA 3EOBI 2G7MC 4FSDA 5TF4A 1P91A 1TQHA 4TV8A 1R8SA 5C8YA 5TE9A 2H0QA 4TV9F 2XDQA 2DEUA 4Z53A 3R0XA 2Q8PA 3EA4A 5DCWA 4ND5A 1ZK3A 4I1RA 2J0QA 2FPOA 2GPAA 3L0ZA 3CZPA 5DSZA 2LE0A 1FMJA 3KLPX 4KAXA 3T7KA 3WMWA 5K0GA 1BMFA 4MVJA 3RUFA 1ZONA 1WHTB 3BQNB 4TLMB 4TVBA 3TJMA 4AKIA 1XMIA 2WV9A 4OGWA 1ZGJA 1N3IA 1J8VA 4A03A 1A2KC 3ZHRA 5IJ0B 1T0PA 4QXPA 1Y3IA 4ZODA 1Q15A 1JZTA 2AFHA 3RBAA 1BJTA 1PSDA 1WUYA 3SK0A 5L3SB 3OQNA 1DCFA 1RQ7A 2ECOA 2GWHA 2WP0A 4H7PA 2I03A 3I2JA 4OIMA 2YVUA 1LZLA 1EZZA 4PPQA 3VJLA 4JP2A 4R1OA 4BO2A 5L7TA 1RRCA 1P4JA 4L02A 1RWPA 3EXIB 4MP3A 3SYNA 4O1MA 1N33B 3LMKA 3BHNA 3M4JA 4BZQA 4RNDB 4DIOA 4W7IA 4C87A 4UUBA 3HJRA 1P9NA 1TA9A 1W5TA 3RSHA 4G4JA 1X8LA 2O5VA 4DNPA 4YCNA 1QHIA 2O8NA 1WRBA 4P22A 1ZR4A 3AEZA 3ZBPA 1JUDA 3C3DA 2XCSB 2YV4A 3BWXA 3CE6A 3FRJA 4YRSA 1HDIA 3SIWA 2XKBA 1OLOA 1PFQA 4P32A 2BFDA 3C3YA 4TM8A 3EZ9A 2BHTA 1P61B 2Z30A 4NDNE 5EP2A 1MBZA 2O1EA 5D86A 1A71A 4YECA 2XIJA 1DKNA 1DKQA 2WT9A 4KLNA 5T4BA 1VG9B 1MB3A 4ZVUA 4BMDA 1I9GA 1W4ZA 2J3MA 3N8KA 1AGPA 1E9EA 1Z6YA 3PXCX 2V6GA 2VPYA 3OZIA 3V4FA 3FBTA 5LYJF 2ZAMA 4UNQA 5F7JA 4HVLA 1IJKA 4UUAA 5EIFA 3MUFA 5CNKA 3KQLA 3ZCVA 3R0ZA 4K6HA 5BURA 5JS7A 2V4MA 3FDZA 3R23A 2PX2A 1RKQA 1IONA 2MR6A 2I6FA 1CHNA 1T43A 2PMWB 2VJDA 4I3GA 5FLXA 1EUCB 3JY6A 2AE2A 4BTLA 3WNBA 1U5BB 5JMTA 4LY3A 5H3CA 1DX9A 5G1PA 5GJBA 1X86B 2CJWB 4UMEA 2G40A 4RIGA 4UAJA 2W6ZA 3SSOA 2BMFA 2DQSA 2Z3WA 3GUHA 1GQOA 3LQFA 4OU5A 2VSFA 3V1LA 2YRWA 1L4YA 1MRNA 2EW2A 2QAGB 1RAFA 4X3PA 3VR1A 5IJWA 3L1UA 4HQKA 4O4LF 3D8NA 3PJFA 4BNUA 3WBFA 5KVAA 3LJKA 4UDNA 3F7MA 2KBEA 3KQSA 1B0AA 5CB4F 3D81A 3WK4A 3GT0A 4LI3X 5KOHA 2H1RA 1DC4A 2QMHA 2BPOA 2ZJYA 2EZ4A 4RIEA 1YS2X 1WXFA 4IH4A 3Q2KA 1PNTA 1U7ZA 5C53B 4DLUA 1SC1A 1UMBB 4LXIA 2PZMA 1V16B 1O2DA 1TT7A 4P3XA 3F8SA 4PANA 3IAUA 5K3OA 1NUUA 2C97A 3X1DA 4J0CA 5CNMA 3VC7A 3LE8A 4NZNA 5AVJA 1Y1TA 1V5GA 5EXSA 4HN9A 3VI3B 4J2OA 5F9HA 5JC1A 1B14A 3KAKA 3ZE1B 4F5DA 3QH4A 4R2MA 1H93A 4F38A 4MKRA 1SVMA 1NJSA 4BX2A 4EW2A 3I28A 3IPRA 5ALXA 5FUYA 1VJTA 2C2ZA 2C2GA 3L4BA 3ZJ5A 5DT2A 2F9LA 5JFTA 1QH1B 4FX2A 3SZMA 1COZA 1C0PA 3NHRA 3W5IA 4EGFA 2QBYA 1VMDA 2DAPA 2B98A 3I76A 4TSKA 1QONA 4UOZA 4DCCA 3MS2A 1ZRMA 4WCVA 4CMIA 2XB9A 2AIRA 2WSSA 3QVTA 3ECCA 1OJLA 4J1TA 4K9RA 4C08A 3FX2A 3Q3GE 2PS9A 2IS4A 1E20A 1E3IA 2HDHA 3WMXA 1W76A 2WINI 3ZU3A 2O50A 4DXHA 4F3TA 3LUFA 1E9VA 1V45E 3OIFA 1PNOA 4FBGA 4L28A 2OAP1 3DCJA 3L6OO 3ZDQA 3WR5A 3ZJ4A 4HDMA 2QVLA 1NX9A 4DEYA 4ZXPA 2JLZA 1CJSA 2OGSA 3OP4A 1WHSA 2QDXA 3FPAA 2C7VA 4Y6QA 5LSAA 4LISA 1HE1C 4MDEA 3OWHA 4OBEA 5LA6F 3HEBA 2CXUA 5EPUA 2EKPA 1WB9A 4N4AA 1PP4A 1Z0IA 3H3FA 2BFCB 1EJBA 1TD1A 2XCOA 3T61A 4J0DA 3GT4A 3OOEA 1Q0ZA 4CM6A 3DMDA 2YNMA 1NM5C 2Y1XA 1QIJA 1XT6A 3AY6A 1DI0A 2QG9A 1UBRS 1W85B 3GRUA 4RAQA 3VKWA 4HNVA 1QQTA 2JD0A 1JSLA 3W8EA 4OFBA 3SS8A 3BULA 4Q7LA 2H57A 3OZWA 4LXQA 2Q49A 3TOSA 3WLAA 1WUHS 3IPLA 1IIRA 2G0NA 4GLFA 4KR9A 1ZFNA 3N8NA 1FRVA 2A3RA 1JAXA 3OTHA 1QS0A 2PUDA 3PC4A 2IYSA 3VR5D 1BVHA 3MT9A 1JNYA 4KQGA 4HXEB 3EW7A 2IHZA 1LSSA 3GZTB 4L16A 5EN4A 5HE8A 1E4EB 2AQIA 3VHXB 4BL5A 4LGVA 4GMKA 4F4UA 3D64A 3FRHA 1FEZA 4NJEA 1Q1BA 2PZGA 4IZOA 5EEHA 1T8UA 2UVPB 1UXJA 1V8BA 2WM2A 1QORA 1R9GA 2RHCA 4I55F 4YLGA 4EUFA 2X40A 2I7DA 2MSWA 4X91A 2RJ3A 1ZC3A 2Z04A 3NTOA 1RKUA 5LQSA 3A25A 1F4LA 2YJ3A 4DNXA 2GM4A 1ZAKA 3ICOA 4RL4A 4E5SA 2EHDA 3LOPA 2X86A 1BO6A 3QFRA 5J5VA 3ZWQA 3NYQA 1RC1A 1HLGA 3IMGA 2BM8A 3P9SA 3FJOA 4NICA 1OAKA 3SYRA 3GQVA 5EWJB 3WOHA 3TLJA 5JECA 4CUZA 4UASA 5K0JA 1VIAA 2VPXA 3QEMA 1PQWA 3NRBA 5EMNA 3ILXA 1VI5A 2XUHA 5E4YA 4FGLA 5HMMA 5JYBA 1X70A 4DMCA 2CB9A 5LFAA 5CT5A 3I04M 3VR3A 4TMVA 3KYJB 4GE0A 1U9IA 3OZGA 4TUYA 5PGMA 2G71A 3EHDA 3LQ1A 3KWMA 4K88A 4RIFA 1MO4A 1Q92A 2I7TA 3GPIA 2A92A 1ADJA 2KM1A 4MUEA 1DT3A 1ZNYA 1ENZA 2MHCA 3AQIA 4MPJA 2CLOB 2M1XA 2XUAA 1E2PA 2PH3A 2ZDGA 1N0IA 2X1LA 3C1TA 3WAKA 3AXTA 3EEFA 3IAXA 3WA7A 1TVKB 1CE8A 5E4FA 3F3KA 4FDTA 4PS1A 2C99A 3WMGA 1T4BA 3I6MA 2HL6A 4BCDA 4QUHA 3PC2A 2W90A 3PYXA 1QNLA 1V5EA 1JVBA 5E4JA 1FOEB 1HORA 2CLFB 2PD4A 3KKNA 4FYXA 3HRKA 3TS1A 1E7WA 3H2IA 4R3WA 3VDNB 5ITSA 1RFLA 2GVNA 1QHSA 4AY4A 4PLYA 4K8RB 4V0SA 4WEQA 3I4CA 2RFLA 2ZREA 4GPIB 4JLVA 3OICA 3PA8A 2O2GA 3OD5A 4HYYA 5HM8A 1C1XB 1X7YB 1W36B 4KQ9A 4H18A 5REQB 5I7HA 2ZUEA 1H1LA 1ZICA 5JPDA 1IAQA 3AI7A 4UDXX 4GXTA 1IUKA 4MR9A 1TUIA 3V46A 3DZIA 5IBPA 1WZ2A 3ENWA 2H8GA 3ZGVA 2J4CA 2P6OA 2QI9C 1K0FA 1L5LA 3BBPA 3W06A 1ORDA 5I4KA 2YJ6A 3O8QA 3CKMA 4P1ZA 3DHYA 3PNOA 2AYYA 4BFTA 5PNTA 4I6EA 4NC9A 1N1EA 4OI4A 5ALZA 1QNFA 3ESBA 5H80A 2HRCA 2O0KA 1X7WA 1N0HA 1RAGA 2JIZA 1OZFA 4LWPA 4ZRDA 5HIKA 4EJFA 1QTIA 2CXNA 2Y9PB 4N40A 1M72A 1F17A 1W8DA 2W93A 2R7AA 3QNUA 1G3UA 4JB8A 3KWFA 3GLSA 1THMA 1AQNA 1RMYA 3O2NA 3PR1A 3WZLA 2UU9B 2PGLA 4DDMA 5I48A 5A3QA 5IYZA 3FKJA 4CHGA 5TPWB 1QH9A 3A1WA 3QFTA 4LXYA 3EB9A 3L0DA 1Y98A 2XMQA 1MC4A 4O2AF 4Z4FA 2EXXA 1EP9A 1UBMS 2GGSA 4Q3DA 3Q8XB 4Y9RA 3OZAA 3TLXA 1SUAA 5HIMA 3MWYW 3T4PA 4DEXA 1KH3A 1GTVA 1I2ZA 5AVXA 3DZHA 3OE4A 4U9UA 1U6IA 4RFSB 4G0MA 4NE7A 3DT6A 4Q7JB 4WTOA 3SQDA 3MSXA 3T06B 1MOZA 3PQFA 5DLQC 2X5XA 5G0SA 5DX8A 4GPEA 3B6ZA 2KHZA 3ODGA 2NAFA 1FRZA 4FX5A 1ZRSA 1NQVA 1CKEA 3NP7A 1JG7A 2ZSFA 4RV5A 4XWKA 1H6DA 3D8HA 3BT7A 1PEAA 5EA2A 3QA9A 2JFQA 3FKQA 4RKYA 3QUAA 5IUJC 4Q34A 5HKLA 1WCV1 1KETA 5TMPA 4NCHA 4ZI3A 4QQ8A 3DAOA 1EI9A 4GGMX 4QDKA 3VVMA 1E63A 3M6MD 4XR9A 4QTUB 3LX4A 3PEEA 3QEJA 4L8VA 4R84A 5B36A 5FUVA 4LY0A 1HMPA 3BJRA 3E9DA 3FMFA 5KYWB 5FOVA 3U9TA 5BQXA 5K8JB 2QF7A 2NU7B 1KAMA 4L75A 1O96A 2ZM5A 4ZTUB 2R86A 3AWDA 1TQ8A 3KJIA 2XMRA 4MGYR 4TLBA 3K20A 5K03A 3U0BA 4YRIA 3QE9Y 5DVZA 2QRKA 3OPNA 1YA6A 2YY6A 1F8YA 5FB3A 4XJVA 4EY7A 1U9ZA 2JATA 4Z4HA 4FDAA 1F2DA 1NHWA 4MKZA 2C3UA 2V4ZA 2DR2A 4NBLA 3CQ9A 1FYEA 1OI2A 4EENA 2GXAA 3TMYA 1ZLXA 2COEA 2PV7A 1KHHA 2VK4A 5IT4A 5ITZB 2P6NA 3EGXB 3ICVA 3N2LA 5GAJA 5IN5A 1RQNA 5BQPA 5ARCA 4AZVA 1PR6A 2G5GX 2OSBA 5CVDA 1MV5A 2A35A 3IQXA 1WXIA 1ZN7A 4UULA 3AUXA 2PSJA 3ZIDA 1IIBA 1BE0A 1KYWA 1L4UA 1SN7A 1Y0BA 2DFDA 2Q3EA 1V6CA 3GJQA 3GCWA 4KYIB 4QO8A 4XQ0A 5DYNA 3V4OA 1E3LA 2JJ2D 4GO1A 1QPZA 2F4NA 2PGIA 1YH3A 3FYUA 5SZHB 1XQYA 4J4BA 3GA7A 1UK6A 4O25A 3SXJA 2HA4A 3GRYA 1J09A 2I8LA 2VP3A 5CFZA 4B17A 3ESYA 5BT9A 2WT8A 4KSCA 2PT9A 5BVHB 1YFJA 1GKUB 4GMFA 1Y1QA 3VR6H 5EYPA 2DUMA 4MIEA 4F4CA 1FP4A 1U2EA 3SKXA 1EK6A 1KFBB 2BEKA 2ECPA 2FXIA 4G81A 4EPYA 4KVFA 2RI0A 2YWCA 1VDMA 4JOSA 2ORYA 1OROA 4K9DA 2WMDA 5CBPB 2I5PO 2J30A 2A5JA 1N8SA 4KQIA 4V02A 4ZCQA 2C2YA 3ABQB 5FT9A 4D80A 2XCLA 3OY7A 1WUJS 2JGDB 2QPOA 4WUTA 5HOQA 1HT0A 4JLUA 4KIWA 4A6DA 2VDPB 3N58A 4L73A 4K3VA 1MJ5A 4PGMA 4EHFA 2ZYGA 2JH8A 2WWTA 1FTNA 4P4GA 4PAGA 3USES 4RADA 2VP5A 3KDPA 2WJJA 2YVAA 3JR7A 2O8BA 3WYEA 2RGNA 4Y6OA 2AOUA 2O7QA 4DZRA 1MENA 3HABA 2H54A 5T4HA 3SJBA 3CLTD 3PFHA 1USUA 5P21A 5KNDD 2WIDA 2Z5FA 4RVCA 5LZ4A 1OHHD 3JYHA 2QJWA 5G0VA 1G55A 3ZUPA 5JD4A 1DAGA 2PS1A 1W9MA 5JCXA 5CUQA 1M2OA 5DU2A 3I92A 4I19A 3P20A 2P8JA 1RWWA 1C9EA 1MH1A 4I4TF 3CM0A 3LP5A 1JALA 4JEIA 1OT5A 3V8RA 1JYEA 3DMTC 4X97A 2WBLC 4XSHA 5THKA 1J8MF 1JQDA 1U28A 3HSYA 5LMCA 2CJPA 1J70A 2P35A 2G80A 4EKGA 2YVKA 4HLCA 2F64A 1ZYUA 1DC8A 1SBTA 3V9AA 4XIIA 1CETA 1KMIY 1Y7TA 2NW6A 3GVIA 3WL7A 5B2EA 4EUHA 5BUZA 1UXOA 1QDUA 5K2OA 1TC2A 3B7WA 1WCWA 1QYRA 2I4RA 3DF7A 3GG2A 1NRWA 3ONNA 4RWEA 5TJHA 5KTKA 5ALDA 5ENVA 2FK7A 2XX3A 2R8RA 2D2VA 1J2UA 2OHGA 3GZ4A 3VDMA 4AKEA 1DTEA 4BMNA 4O2BB 5A9SB 2VXYA 2H16A 4QWMA 1M5UA 1H23A 1OLUB 2QGZA 3CLTC 2R2GA 3CISA 3IQZA 1PQPA 3SQWA 4YCCA 4MICA 3CUUA 3OU2A 2UVDA 2FKNA 5DEOA 3U60B 3UK0A 4FXOA 3EARA 3LP6A 2E5FA 4M88A 4R83A 2IXAA 1I7PA 2V5UA 3KXDA 4REQB 4CG0A 1R0XA 3S5UA 3GJ6A 2NO4A 4MPTA 2GUWA 3OFJA 2X9NA 2QENA 4ZJUA 3RU9A 4ZI7F 4HRYA 3IR7A 4EPVA 3U3XA 3B6EA 4K86A 4O4JA 1AC5A 1GTMA 1XTBA 4M22A 3A4MA 4WKPA 2YWXA 3OX2A 4R1NA 4D25A 1I80A 4D8XA 2JGEA 3KZMA 2V65A 1C30B 4KFSA 3SQXA 2ORWA 3AM3A 5B30A 1A7UA 1XAJA 2FPSA 1F9EA 1U3FA 1AE1A 2C83A 1T25A 2M1ZA 2OILA 3BERA 3BK7A 3IYLW 4N7RA 2NT3A 1EUYA 3KUCA 4P4SB 1JW9B 5DB4A 3DYBA 4ZIRA 4CRWB 4TMKA 1FDTA 3EAGA 1QDEA 3LWNA 1G7SA 3QNMA 2Q1YA 2R48A 5ICSA 1NIJA 3DAPA 3HCPA 3OU6A 5P8WA 3KYBA 5KJFA 2WT4A 5DASA 3ANLA 3JQGA 1TMYA 4FFPA 4WKGA 4E6EA 5DNUA 4CIYA 3OU7A 4MUGA 2G06A 3A3YA 4OQNA 3RRYA 3K2EA 2C4NA 4LWQA 2JGJA 1FDOA 4GWGA 4QGGA 4DV3B 4INJA 2KI5A 1AKYA 3ETGA 4CM8B 3PUXA 4U8HA 1Q0HA 1B93A 1RYHA 1UDRA 2DVMA 3T99A 4YPOA 3GFTA 3PJRA 3BFXA 3LYLA 4D0NA 3D59A 4LYEA 2PZJA 4BNXA 2QLBA 3A4LA 4PQFA 1RYNA 2CHUA 2YICA 3JXEA 2VHYA 4HBZA 1YHYA 1GRVA 1M2VA 4C20A 4K9PA 3ZVKA 4ZCSA 1CP3A 2WKRA 2H4WA 4YDQA 3BEDA 2QTTA 1XHLA 1ZCBA 1VKHA 2C9CA 1V41E 2G5TA 4F3YA 2VBIA 3U6KA 1Y4DE 1M2GA 2DQZA 2F67A 3I52A 3PTZA 2HLPA 2QXUA 2VBFA 3G13A 3OZXA 3ZV5A 4B8WA 1QYCA 1F60A 5KQPA 2XQKA 4HHEA 1KNQA 1V6SA 1YHZA 2BRUA 4XYMA 1KDVA 1E2LA 3UHOA 4D9BA 2OMEA 3KCNA 1XTUA 1T9ZA 2CN1A 4HWGA 4MUMA 5F4ZA 3V48A 2WOOA 5EKTA 4PYNA 5JNWA 3I4LA 1Z5VA 2QTGA 3K31A 4AZTA 5CFQA 2EGGA 3SN6A 1ULHA 4X84A 3QE0A 5LQCA 2G28A 3RUPA 5DYWA 4NY1A 2GNOA 2O3JA 3QOXA 2H51A 5K20A 1CJBA 2QL9A 1PLKA 2ZRQA 4GOLD 3UBTA 2H3EA 5DBEX 4ZKEA 3H4VA 2HLNA 3QELA 1WPRA 1Q6YA 1RYMA 2XVMA 4JR1A 4TV9B 4HNGA 5AH0A 3TZBA 4PBSA 2E6UX 3GN2A 2P9QA 4B3FX 4EPXA 4GOJA 1G5IA 2AX4A 2Z4TA 4BGVA 2J6HA 3AFHA 3ZK8A 2JRLA 8LDHA 5AIBA 1SBQA 3ZK7A 2BLLA 1IHOA 3STTA 3ZNPA 1JIVA 4ECEA 5K6TA 1QDLB 2WDPA 1CXZA 1QFSA 1HFKA 1G3IA 3P2OA 3QQPA 4CEIB 2C29D 3KD2A 1Z6ZA 2YZKA 3DFKA 1NQOA 1JAZA 4FIZA 2P3QA 4Q4HA 1DPFA 2J41A 2C2OA 4WW0A 4BEBA 1HX7A 4PZPA 1Z5UA 2IPOA 1U3DA 2IPMA 1AGNA 4MAFA 4PIVA 4XX1A 4JJ8A 1JTFA 4MUKA 1ECJA 1CZRA 1O87A 4EKEA 1DRVA 3BS4A 1N9ZA 2CV2A 1ZXXA 3U3DA 4MIOA 5AJYA 3TSWA 3IVGA 4ROTA 5BWBA 2RONA 5K0SA 2P30A 3OFND 2OP0A 1QGOA 3HWWA 3RVNA 4Y2PA 1JPVA 5L4NA 4DCSA 4QUIA 1G9XA 3QPUA 3FJ1A 4PG4A 3RJZA 3NX4A 1OX4A 1X92A 1WXGA 1X7XA 4N3AA 3KQHA 4N8DA 4GT1A 4RD2A 5ES3A 3TNYA 1H2WA 3E5HA 1AHIA 1F0YA 2ZSJA 4E7OA 3VUFA 2IRWA 4PAMA 4CL2A 3KC2A 3G5MA 1Z36A 2C88A 3EJ6A 1QRDA 2IV3A 3VC2A 3TSYA 5GIPE 4NYIR 1CZHA 4NKRA 3VJKA 4JBGA 3R0IA 1QIMA 3IQFA 3PSAA 4EB3A 1RYEA 3CR3C 4ZDIA 3DQPA 1WMBA 3QVUA 1QZXA 4GFDA 3GLFE 1VJ5A 1W44A 3T15A 4ZHQF 3W5JA 5CCXA 1Q0SA 1VJGA 3RVPA 4A8JC 3MOSA 1KMHA 3QFSA 4EA6A 5JZOA 4MAMA 1Q22A 1ZCAA 3EIUA 2H29A 4HNAB 4N5MA 5ARDA 1GGHA 3C85A 3B78A 4DJAA 2PXXA 4BC1A 4UW9A 1UJMA 1GT91 3OJWA 1E6KA 2V03A 3JQEA 5FOXA 4YMHA 1VYUA 5FDFA 2CD9A 3EVCA 1JPUA 5T3YA 4EY6A 4KR7A 3FCXA 2B1GA 2WKQA 4QAJA 3NKFA 2O8CA 4W9NA 1E0JA 4KO4S 3CX8A 4HTFB 3L1KA 3BX1A 4Y2QA 2CYBA 2D2EA 1KK3A 3C5VA 3FN4A 1I6LA 3C74A 3I2KA 2YZMA 1BMTA 3NM5A 3PC8C 4QNNA 3WIVA 5CB4B 5MGBA 1J2JA 2XR1A 2DLDA 4B0OA 2OFXA 1B26A 3IRUA 1UK7A 4L7QA 4QFCA 4B3HA 1Y4AE 4LOJA 1IOVA 1NXTA 4QJBA 3HXPA 2DRIA 2KSQA 4WNAB 5TPZA 2IODA 1Z75A 3PKJA 1XPUA 3R44A 1O8BA 1CR1A 2CXHA 1ZC4A 2ZWIA 1MPTA 2P2CA 2QVXX 2NXJA 2F9FA 3QV2A 2BHRA 3LPLA 3AYZB 3H4MA 1CUFA 3PLNA 4L4YA 2ZUTA 3TM5A 2WAYA 4P2BA 1Y7PA 5DF1A 2Y71A 3PQ7A 3AV3A 3QLEA 4G5XA 2BMDA 2XV1A 4S2UA 1X7HA 3TO5A 4KXFB 4EMBA 3BFPA 5DYYA 4AKGA 2W00A 4MUJA 1KVQA 5FOWA 3L84A 5L3QA 4Y1FA 5EIOA 5AI0A 4BLTA 2ZJ2A 3QFHA 1WDTA 3Q7TA 3OE5A 4B7UA 2XOEA 4QPPA 3VO1A 2J9FA 2BJWA 4RGVA 3VO8A 4Y2XA 4P81A 5A04A 1N7JA 1VMAA 3ZZ1A 4BKQA 1PG0A 1YVUA 2WILA 4ZVLA 3SFTA 5JBIA 1EX1A 3QXCA 3AEKB 2WSMA 1I1OA 2PO7A 2WEKA 4LHEA 4KXVA 3WB1A 1ZH4A 2F43A 2P79A 4PZLA 3SQNA 1ZR2A 3FGZA 1L5FA 3N53A 3MJVA 3K32A 3T3EA 3TWOA 1BEZA 3R3WA 4Z7NB 3ORYA 1QHGA 2ZYVX 1HYGA 1RU3A 3QTTA 5T67A 1D6JA 5GV7A 5AM0A 3RH0A 4A3SA 4PYJA 5HUQA 1R6DA 2P9EA 4HUQB 5AM3A 5TIIA 3QKIA 3V2HA 4JAVC 3DZCA 4XJSA 2J07A 1CJUC 3LSYA 1OBCA 5CGZA 3THWA 1E3TA 1K8ZB 2OVFA 3LA6A 3GVCA 3L1IA 1C0LA 3H19A 5KBYA 2VUHB 3EJWA 3R6DA 1J9GA 4LECA 4C0AC 2E5LB 1KKUA 2HPHA 2OTCA 1WVGA 3PHBE 5KNBH 1U8EA 2DQYA 3O8NA 4PXAA 2GPNA 4YRJA 2UYYA 3UC5A 4GR5A 1C1DA 2O8FA 1FSPA 1WDKA 1J8DA 1SU6A 2H17A 5AJZA 3KB2A 2GM9A 2MIIA 4LHZA 2FPGB 1K3TA 4HAXA 3EOAI 1Z8FA 3SZGA 4GEGA 3FPBA 5KX5A 4Z86A 3UBMA 3BAZA 2MWMA 4QDOA 3E53A 3BOSA 3FDJA 3IX7A 3G79A 2PSEA 1P1FA 4XCXA 3TTVA 2V6MA 3UB4A 4DYDA 4M0LA 3RVQA 1NRXA 1U65A 3LCUA 4EEXA 4GM0A 2R6DA 2HGSA 2WTAA 4JMPA 4ZDWA 3BD7A 4MRMB 3TI7A 2CLMB 2P62A 2P2DA 3VSDA 1JV2B 2G09A 1XRQA 4LF5B 1S2GA 3LLMA 3WHKA 1ILEA 3IOEA 4QUDA 3KUUA 1O95D 1GFIA 1MJGA 3IAM1 3QU7A 2A5FA 3K2IA 2UAGA 3FVVA 4B6OA 5IHXA 2MSEB 2QTFA 3O31A 4IXWA 4PSAA 3FAZA 1ZNXA 1Z8DA 4BO0A 1VLQA 3MJCA 1OH7A 3WL4A 5COAA 1P2TA 3GK3A 1SVIA 2HNAA 4B6GA 2P2SA 1DCKA 4GX5A 3ZW8A 4DMUB 4GKJB 3H1GA 1MGPA 1T9BA 1ARZA 2FEKA 2TMYA 2P4UA 1F48A 3ZS8A 3C16C 3P94A 1DKOA 1UQRA 1QP0A 3E9YA 4YJ3A 1TPYA 2GEVA 3K2BA 4ABTA 3CLVA 1CERA 1Z3IX 3GBPA 4D9JA 1QIEA 5CFOA 3BTOA 3LHSA 4JT8A 3IBYA 1X7ZA 2VK8A 5K6AA 2CLKB 1F8XA 2B1RA 1C7RA 3N6XA 4UAUA 5KQGA 1SXJB 3VR4A 4B3IA 2QS9A 2FV8A 4XFJA 3RS4A 2WUWE 1LBEA 4YACA 1SAYA 3R3JA 4G3XA 4QLAA 7MHTA 3AERB 4MEBA 3W1VA 1DRUA 4MROA 3L7NA 3WL5A 3UWMA 2KWIA 2HNBA 2DG2A 3D3JA 1D7AA 3HO6A 4YONB 3ZXYA 3QVWA 5JD5A 5FNVF 1HXHA 3SBEA 1X14A 4BO6A 1QYDA 1A4RA 3C8MA 1QO0D 2VUUA 5ARBA 4KP7A 1WJGA 3FPEA 5LWQA 5ICCA 1O95C 4W5NA 1Y9DA 5E38A 2PJDA 5JAIA 1QMPA 5CG1A 4KQ6A 5FWYA 2NZJA 3SSAA 1ZGZA 3LCRA 1EGAA 1RLIA 2GETA 1RHKA 5ICFA 4B9AA 2DR3A 3BCHA 2Z2YA 1J0AA 1SCAA 5BW4A 1T2EA 3KTDA 1GHTA 4ENRA 2TRSB 3CLRD 2MMCA 1AH2A 3B6MA 1X15A 4I5GA 3AJEA 4QYSA 4Y9TA 4IIHA 4BO3A 2X22A 3RIXA 1L4NA 1BH2A 2J9RA 1J20A 2R1UA 2P0YA 2WWIA 2X0JA 4ZT6A 4D41A 1GN9A 2NG1A 2ZE6A 3KJXA 5EQTA 3T5MA 3SM3A 4Y2VA 1EVLA 2YHAA 4EH1A 2IS2A 3UK7A 1XN1A 1V1RA 3VVCA 2RK3A 1L9XA 1P74A 3L93A 4GECA 3LWBA 3SOZA 1F8GA 4GKAA 1OFGA 2O0JA 1X77A 3NBYC 3WL8A 1Z22A 3PFNA 4EGCB 1WP4A 1G1MA 1VJDA 4BJ6A 5ALQA 4Z9FA 1UXKA 2HC9A 4WXPA 1A97A 2GRUA 1W2HA 3GNSA 3LL7A 1QVZA 1XD2B 3MJ4A 2I3GA 3WKEA 5ES4B 2QN7A 1SKMA 3KL4A 2PO5A 2PLFA 3SOPA 1ICEA 1LI7A 4B4UA 4CFSA 5BV0A 1V1MB 2C4HA 4RDIA 3LD9A 2VRNA 1MCZA 1XYYA 3RSSA 3C3MA 4KR6A 1OWNA 3VPCA 2XWBF 4PIMA 1GM5A 3RS8A 5T5QA 4ZYUA 3F6PA 4JN6B 4FYWA 4J94A 4KKXB 4BYGA 4I6GA 3THRA 5IJ9B 3N9IA 1VMKA 4JZKA 4ZT5A 1HOTA 4MCHA 8OHMA 4ZZ3A 2ZSBA 2HT1A 3PUHA 2HU8A 2YXNA 3BL8A 4G4IA 5H9VA 4LF6B 3SAJA 4WWHA 2FUNB 4ZCRA 4DSUA 3CLRC 3RSCA 4DPKA 3DO5A 5FPSA 1P0QA 3DBHB 1JR3D 4FEAA 1XDDA 3RFXA 4V1CI 1M54A 3C2QA 5EVCA 1DX4A 2IYTA 2QAGC 3OF2A 2OYSA 4PFKA 1CUBA 4Q7MB 4WOJA 1KU0A 3WKAA 3EDCA 3LDFA 4G5OA 4OHVA 4WFJA 4YCBA 3ZZMA 1KI1A 2VI5A 4N47A 4OQ4A 5F7XA 5SV2A 4PRKA 3DHEA 2BGGA 3JQAA 1P2BA 2AFIA 1U2DA 2VHVA 4W5WA 4F96A 1P4AA 3D9QX 1SOUA 3IR6A 1PQUA 1Z7EA 3DZFA 3RO7A 5DK6A 4DQXA 1DCMA 1ZJZA 2HV8A 3OZSA 3TQSA 5CM2Z 2C3YA 4GXQA 2AMLA 4DTCA 2WTBA 4DABA 2DF8A 2P65A 1YRYE 2WJWA 2FA9A 3PF8A 4GP7A 4BUJA 1LJLA 1QVVA 1J39A 1YMUA 2E89A 2UUPA 3FNGA 3HGTA 2IH2A 1PR1A 4ZU6X 3MNFA 3B7GA 1WB6A 4A73A 2CXPA 4BKOA 1WP9A 4ATNA 3KQYA 3T3DA 2CJYA 1XD9A 2VXOA 4PLHA 4TQAA 3MMSA 3UMFA 5KVVA 1DOAA 2XSZD 2YJ4A 1XLVA 4J0JA 3G8YA 2HCBA 2PCLA 1SURA 2CVFA 3O3CA 3S2SA 4P36A 3T3GA 2YJZA 4AUKA 4BE4A 2FUG6 4IDOA 1H4VB 2Q3HA 1I3NA 1YS7A 2EFGA 2PMKA 3GGJA 4JC0A 1O6CA 3SF0A 5JYEA 2XODA 2E6KA 3TZQA 3NWBA 4LRUA 5DP2A 3JRNA 5I7AA 1MF7A 4B2YA 3OKAA 1H8ED 3Q6NA 3UMRA 3KLMX 2IUUA 1CDDA 3UK1A 4BMXA 4YV2A 8ATCA 2B8EA 4MYDA 3UQYS 4YUWA 2Z3VA 7AT1A 2JLUA 2CL0X 1DV2A 3FHLA 1A4IA 1GUDA 2ZJOA 2G8NA 3NTLA 4FYHA 5ESWA 4RHUA 4BE9A 4ZQIA 3UO8B 4AY6A 5IC4A 2NSHA 4IGEA 4R4JA 1W88B 4UUNA 3LY7A 4MKFA 1OD6A 4ERXA 1TO2E 1KAQA 1X2BA 4HAOA 5C4IA 1Z15A 4GSYA 3WICA 2QZ9A 1P2SA 4LJ9A 3U9LA 1TC1A 2FEPA 1ZGAA 3DBLB 2JGFA 2B2NA 1LPOA 5YASA 4OH1A 4HX9A 4CKEB 4HXYA 2BIFA 1IN5A 2I9PA 4ZQHA 1AURA 3GLHE 1MKYA 2GBFA 3VZDA 1EG7A 1R0LA 4FHEA 3GVXA 1GSOA 4MRPA 1ZN9A 1GRCA 4B73A 2RG1A 3BPSA 3OQHA 3R7DA 4LWOA 2WD7B 3FWKA 5IM4A 3U49A 1WU8A 2XRMA 2YW2A 3MBKA 4TMTA 3SC2B 4BZPA 5AI4A 4L4RA 3W90A 1E6WA 1BX3A 3QTLA 1P73A 4B6PA 3F6BX 4J7XA 4TVSA 1P8AA 3IPXA 1P0PA 1LQTA 4YCAA 1C41A 1BX0A 1QPGA 1WCIB 4HOYA 3ROZA 3HCCA 2XYHA 2VWGA 4CN8A 5BN3A 1AY0A 2OXCA 3H11A 1DBRA 1R8YA 4U6NA 4DA0A 4DQVA 1P0IA 2I3ZA 2PUVA 5EJIA 5EMJA 5CD1A 3PPIA 3DW3X 2D6FA 1W1WA 1FRFS 1OAOA 2NV2B 4RVHA 1T2FA 1OB5A 2RGEA 3KXPA 1YV9A 4L3VA 4Q39A 1RNLA 1OOEA 3LSTA 3O4JA