1ZUNA

Crystal structure of a gtp-regulated atp sulfurylase heterodimer from pseudomonas syringae
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
204
Chain Sequence
LVPRGSHMVDKLTHLKQLEAESIHIIREVAAEFDNPVMLYSIGKDSAVMLHLARKAFFPGKLPFPVMHVDTRWKFQEMYRFRDQMVEEMGLDLITHINSAKHTDIMKTEGLKQALDKHGFDAAFGGARRDEEKSRAKERVYSFRDSKHRWDPKNQRPELWNVYNGNVNKGESIRVFPLSNWTELDIWQYIYLEGIPIVPLYFAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sulfate adenylyltransferase subunit 2
publication title Molecular basis for g protein control of the prokaryotic ATP sulfurylase.
pubmed doi rcsb
source organism Pseudomonas syringae
total genus 44
structure length 204
sequence length 218
ec nomenclature ec 2.7.7.4: Sulfate adenylyltransferase.
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01507 PAPS_reduct Phosphoadenosine phosphosulfate reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1zunA01
4R0NA 3IMGA 4CDNA 1EFPA 1NI5A 1VBMA 4I6EA 3ND7A 2X0KA 2D13A 3F3MA 4DNXA 2D54A 1IHOA 1M8JA 3ILVA 2CYCA 3A04A 5DB4A 3TQOA 2E18A 1MB9A 1NSYA 4G5FA 4JXZA 5K0SA 2E21A 1KH2A 1NUTA 4MAFA 3TS1A 3FI0A 3IODA 3ZXSA 4E1AA 3FOCA 2ZUFA 5HUJA 2HGZA 3IDFA 4F3RA 3RHSA 3G6KA 1F7UA 1K97A 3N2YA 3QE4A 4G6ZA 2XRZA 1MB2A 1V8FA 1OWLA 4JZYA 2XRYA 3X1KA 1YIAA 1YUMA 1IVSA 2J08A 4HJRA 1IQRA 3FH0A 4PBRA 1N2EA 4KR7A 1WXIA 4EG1A 3ZUGA 1GN8A 3SDBA 1EFVB 2AZXA 5J5AA 2EJCA 2GOYA 1O0BA 2O5RA 3FETA 1YI8A 3SEQA 2PIDA 5AHWA 5FO0A 2PG3A 1S4MA 4MUEA 1JIJA 2B7LA 2QUKA 2CV2A 1OWOA 3AIIA 1R6TA 4DDKA 3COYA 2YWBA 3FWKA 4ND6A 3N05A 3DPIA 3Q10A 3COVA 1I6KA 1MC1A 2GKSA 2VXOA 1N77A 4AS1A 3CLUD 4PBSA 1TFUA 3HZRA 3PNYA 1MJHA 5HG0A 3QTTA 1NZJA 1O6BA 3MUEA 1JIKA 1WOYA 2QJFA 3VGJA 2DR2A 3U1VA 1MRZA 2QJTA 1M8PA 2V0GA 5J58A 3ELBA 4NAUA 1TYBE 4ARCA 1MOPA 4DDMA 1ZUNA 4HK4A 4L2IA 2DXIA 3Q4GA 4I6GA 4Q16A 1EFPB 3UC5A 3GMIA 1EUYA 1JZSA 1LI5A 2R5WA 2JAXA 3GUZA 1JGTA 3H99A 4BWVA 1Q19A 3PRHA 3PNVA 1K4MA 1WKBA 3SYTA 3OTWA 3SZ3A 2IJGX 2QJOA 4YP7A 1KAMA 4PY2A 2CT8A 4MVWA 5KCMA 3H05A 4EG4A 1GTRA 1JEDA 1N75A 1KP2A 1NUUA 1B6TA 2CYAA 3D6VA 4HPWA 1KQOA 2A1UA 2YY5A 2CYBA 1TYAE 1X6VA 2JANA 3IMCA 1O0CA 4EG7A 3CLSD 1H1TA 4YP6A 4MUKA 4ZCSA 1NUQA 1RQGA 1O95D 1WJGA 1O94D 2IELA 4DE5A 1YULA 2RD2A 3LE8A 1TYCA 2ZUEA 1F7VA 1OD6A 4EG8A 2BTEA 3ZIUA 1IRXA 2X3FA 4ZCPA 4ZCQA 3RK0A 3X1JA 3UY4A 3COWA 1KKUA 1ZH6A 3FHJA 3NV7A 2CUZA 4MUHA 4EFKA 5IHXA 4K03A 4J75A 3ZJUA 1JEEA 3C8ZA 4ARIA 4ZT5A 1LI7A 4F4HA 3K9WA 3KT6A 3H97A 1U3DA 3P52A 3NBAA 2A84A 4ZT7A 2HZ7A 3AG5A 2RE8A 1Q15A 2X1LA 1NUPA 4ZT4A 3NBKA 3UOWA 1A8HA 4MW0A 1GTSA 5EKDA 1U3CA 1QNFA 1QRUA 3A05A 3UMVA 1H3EA 5DEOA 3CLTC 1O97D 1H3NA 4TS1A 1O96A 3ZXIA 1F9AA 4I6JA 4ZCTA 3P0JA 1JZQA 3M5WA 3Q12A 4UZEA 5TEVA 3P0IA 5HUHA 1XNJA 3CLRD 4UZFA 4MUNA 1TYDE 4MULA 2QUJA 1HYBA 1KP3A 3TQIA 2PFSA 1WXGA 2DEUA 4NATA 2E0IA 4MUIA 1NURA 2QUIA 1KH1A 3E27A 3L93A 4L2IB 2DLCX 4ND7A 3IOEA 3VRHA 3ZJVA 4JFAA 3HMQA 1OBHA 1WQ4A 2A1TR 4MW1A 3CVXA 1YUNA 1ULHA 4QREA 4GU5A 3FY4A 3OP1A 1YIDA 2QTRA 3KT8A 2A1TS 2J09A 3KT3A 2C5SA 2CV1A 1EE1A 4RUKA 1M83A 5LLTA 1JECA 2A1UB 3FIUA 1CT9A 4OUDA 3FNRA 2D5BA 4MLPA 1J1ZA 1IQ0A 2PZ8A 1EUQA 1M8KA 4KR6A 1J09A 2WQ6A 2A86A 1I2DA 3I05A 3IVXA 1DNPA 5DK4A 4Q93A 4ZT3A 3MMXA 1OWPA 1M8FA 2Z3VA 4GRIA 4DDHA 2DUMA 5F23A 1J70A 2CFOA 4MVXA 2QTNA 3AL0C 2DERA 1U7DA 2O8VA 2X1MA 1J1UA 1T6YA 4U63A 1N2GA 5TEWA 4X0EA 1R6XA 1PFVA 1J21A 4HJXA 3SP1A 1ILEA 2Z09A 2I1LA 2WSIA 4MW6A 1GAXA 2EL7A 5DASA 4MUFA 2VTBA 3HV0A 1QQTA 3CVVA 4CT0A 2WQ7A 3CLUC 3L92A 4CQNA 3HL4A 1F4LA 4XFJA 5FO1A 2NSYA 1O96B 1Q77A 3KFLA 2YWCA 1TQ8A 3KT0A 1QRTA 1Q11A 1OWNA 4J76A 4ZT2A 4AQ7A 3RK1A 1X8XA 1TEZA 3TZLA 1XNHA 1VL2A 2AG6A 2JA2A 1O5TA 3A4IA 4MUJA 5KWVA 1N2IA 3COZA 1J20A 1WZ2A 4R2MA 1PFWA 1G59A 1IFXA 2PZAA 3MLBA 1VBKA 3GLVA 3RJZA 1KAQA 5FNZA 4MW2A 2QTMA 1FFYA 4YMIA 1T6XA 2Z08A 2A88A 3D6UA 1GZUA 4WSOA 4DLPA 1IQUA 3RBAA 1PG0A 3VU8A 3PXUA 2BYTA 3FDXA 1FYDA 2J5BA 3CVYA 5H7XA 4JXXA 3INNA 3DO8A 1EXDA 3SZGA 5JBNA 5K0TA 2V0CA 4MW5A 3CLSC 1KQPA 2E89A 4XSVA 5KHAA 1OWMA 2OQ2A 1P7PA 4FZJA 1JMVA 4MW7A 3P0HA 2A4MA 4OUDB 1O95C 2PZBA 3K32A 1O94C 3ZGZA 1WQ3A 3LOQA 1D2RA 4A91A 4KKVA 3IVCA 2HMAA 3HFJA 1OBCA 1WXEA 1PFYA 1MBZA 1WXFA 5TGTA 1XNGA 1PFUA 1ZJWA 1N2BA 5TS2A 2WB2A 1QU3A 1K4KA 1M8GA 2OV4A 4KPUA 1QRSA 2AKEA 4U8HA 2IP1A 3ND5A 3TNJA 2GM3A 5BNZA 3DV2A 4DJAA 3UK2A 3RFFA 3CA8A 4MUGA 4XFDA 1H3FA 3MLAA 1K92A 3G5AA 1U0BB 5LFAA 4EG6A 2VTBB 1WY5A 1PG2A 4MWBA 3ND6A 3ZJTA 1GLNA 1O97C 1V47A 4YBRA 3AKZA 2H2AA 4MWEA 1I6MA 4EG5A 2YXNA 1WXHA 1SURA 3FG9A 1BS2A 3IOBA 1NP7A 1KORA 1ZH0A 3CLRC 3G59A 3CVWA 3N8HA 1QTQA 3CR8A 4G5YA 4MQ6A 1LW7A 2ZP1A 4MVCA 4MW9A 4K0RA 3LCJA 2G36A 3IOCA 4P2BA 1T6ZA 3DLAA 4MW4A 4CDMA 1N2OA 4ZCRA 3ISJA 4RPIA 5LM3A 1N3LA 1G8FA 3IVGA 5H16A 3PNBA 4EGAA 1G8HA 1IH8A 4H3SA 2NZ2A 3BL5A 1UFVA 1JILA 1Y42X 4JYZA 3MXTA 4EF6A 1COZA 4KR9A 3CVUA 3AFHA 3A2KA 1N2HA 1N2JA 4NAHA 1EFVA 3H9CA 4PBTA 2A7XA 3IUEA 4NZPA 4WNYA 1R6UA 1KQNA 1JIIA 3SEZA 3H9BA 1T9GR 3IMEA 3TZEA 2DETA 4MWDA 4S1OA 3AG6A 3IUBA 3HGMA 4R2LA 1T9GS 1GPMA 2TS1A 3IH5A 3X1MA 1VBNA 5IJXA 2CV0A 4MWCA 2CSXA 4MVYA 5J59A 1N78A 2J07A 2QUHA 1NUSA 4OJMX 1JHDA 1N1DA 2H29A 4U7JA 4KPUB 1QU2A 3QTBA 4QBTA 1I6LA 3N9IA 4YP5A 1G8GA 4NX2A 3CLTD 4EG3A 1KR2A 1MAUA 2DPLA 4QRDA 1QJCA 4ZT6A 1M1ZA 1NYLA 2J4DA 3JXEA 1U7XA 1MAWA 1XJQA 1VLHA 3S3TA 4NDAA 2PXHA 1KH3A 1EJ2A
chains in the Genus database with same CATH superfamily
2UVQA 3KVOA 2OORA 4PRYA 2BOVA 4KYVA 3DT6A 2DRIA 2Y1KA 3B6IA 4PANA 3SOPA 4D46A 4X1KB 5KSWB 4O4LB 2YXDA 1QQ7A 4TVSA 3GJ6A 3RVDA 5D2CA 1Z7BA 2CL5A 2SBTA 4MR8B 621PA 2PKRA 1E2MA 1JPNA 2DHEA 2WPDA 4X7RA 4GKVA 2PKQP 3QYFA 4QUEA 3P2JA 4DMLA 5A6SA 2BEVA 2FWNA 2W48A 1OCEA 2C3YA 2ASEA 2ZTVA 3GJ5A 3I34X 4QXMA 2Y67A 3EXIA 4QVKA 4D0NA 3ISVA 2WT4A 3D0RA 4GD3Q 4B6FA 1E5QA 3NWJA 1ZW1A 3AHCA 3PC3A 3FCXA 4B82A 3NS7A 4PCVA 1CQZA 3JD3A 3CMCO 2HGZA 4NFHA 1MMFB 1U1EA 4F3RA 4KYTA 2XQIA 2AEEA 3AB8A 3LUFA 1RAHA 1A7KA 1NVWQ 2WJAA 3AF1A 4FHDA 1D2EA 2VKQA 2YS7A 3QE4A 1N5JA 3V48A 4BB5A 5JJ5A 2OCAA 2Z1NA 1NNI1 1JDUA 1XP8A 1XVTA 3NH6A 4JC4A 2ZBQA 4YROA 3NB0A 2JIMA 3AQ4A 1WUYA 4R16A 1BEZA 4YCJA 2C7RA 1ZXLA 4TRJA 1KE2A 3GGSA 1VC2A 4XCQA 2V9PA 1KRXA 2NQTA 2FG6C 4HVAA 4AJJA 1SHZA 3N59A 4BEJA 5IVDA 3QENA 1RCUA 2YWRA 3VU1A 2DC1A 2AFIB 2PX4A 1CD5A 1WXIA 1L4NA 2D4HA 2X0IA 2IW1A 2ONYA 3GBPA 3P8ZA 3WWPA 4G81A 3WHKA 1EFVB 2C4MA 2JCSA 3ORQA 5IKXA 4MB0A 2VNHA 1CG6A 1UFQA 2ZT5A 3HEAA 4IAOA 3HWWA 4GEGA 4Q3AA 5TQJA 2C83A 1JYSA 4OHRA 1E5DA 3TOSA 3SEQA 3E1KA 5C7IO 1W44A 3FFXA 5G4KA 2G1PA 1K86A 2I7CA 5EYPB 1SHUX 4MUEA 3V7FA 2FDRA 1T25A 4RZUA 1OAAA 2GEVA 3AIIA 4IXWA 1AGPA 3HCCA 2B99A 2Y1EA 5TMDA 1FNBA 4I4TB 1THMA 1I30A 3LRPA 3OM8A 4TKUA 5F5XA 2O0MA 3R7AA 3TZCA 4FSDA 1ZMXA 3U4DA 1YFKA 3FHLA 5M2QA 1E77A 1Y98A 3LAWA 4D3YA 5KSYA 2P9GA 1OBOA 4IRMA 3LHIA 2BBSA 2JD2A 2C2HA 3AVPA 1CCWA 2DWCA 3FWPA 2PX2A 2OY0A 4DBLE 1E7MA 3BK1A 1C8LA 1GM5A 4UD2A 4RV4A 1O6GA 3RHTA 1YMVA 3E9MA 4AMYA 2V0GA 1CUWA 1M8PA 3DMGA 1ZK1A 5JQGF 4F2PA 2FZ5A 4PCUA 2P62A 3ELBA 4M9SA 5KWIA 3ANXA 3U7IA 5H80A 2OXCA 1DHTA 3KDPA 1WE2A 4LXHA 3ENNA 4D82A 1TZ2A 3ZHRA 2EAUA 4HWOA 4XAQA 2TMGA 3Q4GA 4YAFA 1PL7A 2B0JA 2BKXA 2B8NA 3GZTB 3LXRA 1X7HA 4B7UA 1OFGA 2CMDA 2RHDA 1T5TA 5BNTA 3FCEA 3GUZA 3HL0A 3A8TA 4QXPA 4N65A 4QJ3A 4UAVA 3JRWA 1Q19A 1DDIA 2B36A 3V80A 3RIXA 3GD7A 2TYSB 3AJ9A 5EIBD 2IJGX 2QJOA 4UVIA 3FRIA 4MVJD 5ELMA 4YN3A 3W9BA 1SPBS 4O4JF 2B20A 4PY2A 3VZCA 1ZAKA 3CF4G 4KDEA 1T8SA 1ESCA 3AOEA 1XHLA 1FL9A 2VPWA 3CRZA 4O2LA 1JH9A 3LD9A 3II6X 1ZLYA 3BAZA 4I5DA 4XD7D 3KB8A 4RY8A 5H83A 1PO7A 2RG1A 3S8EA 3ZD6A 3KJFA 4N3NA 2IYSA 2HREA 4PSAA 1GAJA 3KUUA 5IPFA 4M37A 1XOIA 2C7QA 3PC2A 2NUAB 3EGDB 1A7UA 4HO1X 3HUUA 3QXHA 4BO5A 2EX1A 3MMNA 5ELLA 1ZOSA 3OFSA 3IL2A 2Y68A 1GKIA 1HBJA 3FR7A 3W79A 4MCJA 4ABTA 2FJ0A 3SPXA 4NZOA 1NFRA 4YAUA 4KVFA 2B35A 4DLLA 1B8NA 1G20A 3JQPA 4JLVA 5LDHA 7YASA 1N7GA 1QWOA 2P9FA 5DWQA 2OFPA 4F72A 1NG9A 2FQWA 4FI3C 4XE5A 3O7MA 2F7SA 2W70A 4NESA 2HHCA 2JGDB 5JISA 4KQMA 2V9CA 4RL6A 3RS0A 4B31A 4YRBA 3ZGOA 1P5HA 1E5TA 1JEAA 2IZ6A 1RJFA 3N6XA 2VVTA 1MVLA 1JV2B 1ZBDA 2XJ9A 4WQMA 1Z2DA 3G8BA 3SGLA 1J33A 3MHTA 2EW1A 1I7SB 3OMXA 2P8SA 5JBQA 2JI7A 3VR4D 4A26A 4G0YA 5BSWA 2FEMA 4BMOB 4EY5A 2WTBA 3ZDFA 1NC1A 1Q0QA 2A3RA 1XU4A 4Q7LA 4A0QA 4H7KA 1B43A 4HLNA 4BFWA 2HR1A 3IUYA 4NCBA 3K53A 2PWBA 1E3SA 2X9LA 1UWKA 1MIOB 1PQ4A 1RDFA 1Y8CA 2QD4A 2Y76A 4D9KA 4C5AA 4NMMA 1ZU4A 3ZXIA 3ZKWA 1SCQA 4LGMA 1DP4A 1LEHA 1YAJA 3MOGA 2BN4A 1IM5A 2WJPA 2WIFA 3CU5A 1SY7A 4LZNA 5IVIA 3P0JA 4TRNA 3ZS8A 4YDQA 2Q3BA 5CLJA 3UMJA 1W1IA 3WV5A 3F6BX 4CMJA 1Y7IA 2CFCA 1DAOA 1XVLA 2GDJA 4PC3A 1NW6A 5AYVA 1HDZA 4MULA 1F3LA 1KOFA 2AYXA 4TWAA 4QBIA 5EKSA 2IHYA 1ISHA 1UJNA 3MBOA 3JRNA 4MUIA 4LI3X 3TK1A 3OQMA 3C2QA 4ZU6X 3L1UA 1W5TA 3KJNA 1KEZA 3PUHA 3AT1A 2C4HA 1TVKB 4B0OA 4GXTA 3W4KA 1G98A 4J9UE 4TVBA 3AM5A 1CZHA 4O5AA 3DBHB 4FNAA 4M7RA 1XMPA 4F7WA 3NHPA 4FX2A 1YVRA 4A92A 2RIRA 2NQ8A 1YIDA 4O3FA 1U8AA 3DMHA 4QRHA 1EFRD 1WF6A 3LC2O 2VDPB 4F86A 2I78A 4UHJA 2JPDA 3G8CA 1AE1A 5C34B 5FH9A 2G04A 2ZVPX 3COSA 3VR5H 2VQEB 4K88A 1SULA 1Z74A 3L8ZA 1KNXA 3WLIA 3TCNA 1CT9A 1ZKMA 3BXGA 5KNBH 4XTRA 5EJ4A 1YUBA 3PDJA 4PLFA 3RANA 2XXBA 1N9ZA 5FA6A 4WZAB 2FPGB 1UBHS 1M76A 1R16A 2NZXA 2VT7A 5LZ7A 5KYTA 3LZ6A 4JLMA 1NJGA 3GT0A 3OM1A 4OOEA 4AJEA 2YS6A 1N6RA 5JYCA 3VO8A 4DG5A 2JBWA 1R0CA 3CT4A 3NTLA 3PHIA 5IUKC 4L08A 4EW6A 4BBZA 1J70A 3PHCA 2QQFA 1ITZA 4A16A 2YVAA 2E5LB 2DERA 2ZJZA 1L8LA 1XTTA 4OPMA 2W2KB 1FPMA 4RD3A 4S24A 5ALDA 1X14A 3M3PA 4KMMA 1CE8B 3HJBA 3EX7C 2ECQA 1Z2AA 5DGDA 4TXMA 3UC9A 1NLMA 4BUCA 5JSUA 1IG0A 1LWNA 4EWLA 1IMJA 1Z0ZA 3ZLBA 4K9DA 1PQYA 5A3JA 4M7OA 3PIRA 5DASA 1ZCZA 5B3JA 4OJYA 1R0ZA 3JQ7A 3E61A 2Q7DA 3RW9A 5JIBA 1ML4A 2NNLD 4UATA 1JSLA 4XTCS 5HSGA 4CT0A 2WR8A 4G86A 4WK6A 1JQ5A 1DBVO 1TEVA 1U04A 4RDXA 1TMOA 1ZINA 3FMIA 4QDOA 2PX0A 3O4HA 1E4YA 1C7FA 1ZN8A 2IYLD 2NU8B 3ZHUA 4I1IA 1XXHA 2WM3A 4FYVA 5DX8A 3I8SA 2Y99A 1M7HA 2GF0A 4EHDA 4J16C 5JMOA 1C30A 1GQRA 2PKCA 2BPOA 2Y1CA 5LWHA 3AKZA 3UN1A 1CYEA 4RDHA 1BHJA 5CDHA 1KIFA 2V1XA 5D7BA 2P27A 1RI1A 2Q4RA 2WMDA 3K5WA 5IT4A 5C51B 2ZITA 1OTHA 1KZ6A 1D4FA 2P2CA 3FNHA 4AUNA 2F1JA 1IFXA 1US8A 3CSUA 4MTCA 4L74A 1GXSA 1KMNA 3H5AA 4LJ9A 4OK3A 3WGZA 3PNQA 5F7JA 5AWFC 4MIOA 3N0XA 2BRUA 3I1YA 1MH9A 4GM0A 4QUJA 2H1RA 1X1CA 5E8RA 3TD9A 3GJQA 1Q7RA 1KPHA 3TM5A 1EGVB 1U9ZA 3E82A 3O5AA 1AZSC 3GFQA 2F6RA 4MV1A 3I2HA 2QNIA 3RE1A 1CS0A 1U02A 4KMSA 4DSZA 5BW8A 3OU7A 4YAIA 3TWOA 1LS1A 4CEHB 3EYWA 4NARA 1E2EA 4YVFA 2CJWA 3QWBA 1YDGA 1XCGB 3AI2A 4KXLA 1USGA 4FFNA 2BGIA 2J33A 4D3DA 1TMKA 2AFHA 1ND6A 3SQMA 2IHBA 5G3ZA 3REOA 1OGIA 1D7AA 5TPZA 3T4UA 4S35A 3MINB 3I01A 5BUQA 4LV8B 5MF6A 3KKKA 4GPBA 5B6IA 4LVOA 4MUBA 5AVRA 2HA5A 4BVBA 2XZLA 4HT3B 1CF9A 1NXTA 1N5OX 3IUSA 3JW8A 5JAHA 4EZBA 3KZ1E 2YQZA 5FB3A 4UDOA 3NDRA 2E6KA 3GJYA 5CYPA 1M67A 3UANA 5LIRA 1Z4NA 3JQGB 4TWIA 1MBZA 2N0SA 2QU7A 3KZXA 1B1CA 2RG7A 1RKQA 3SBOA 4DRYA 6CHYA 2PFKA 3CH7A 3A06A 4HGRA 4IQGA 4MI9A 4WPGA 3M89A 1Q92A 3IULA 3TLBA 1RC1A 1FC0A 1IJFA 2W37A 5C37A 1SUFA 5KU7A 2A14A 2YR0A 3R0QA 3R6GA 2W6QA 3SYLA 2ZS8A 1PL8A 1S9DA 3O0TA 2IK8A 4CDGA 4Z3DA 3HFRA 3QY0A 4LRQA 2UUAB 1I7QB 3CA8A 2VO1A 3L2OB 4MUGA 4XFDA 4OQLA 3UPTA 2DWPA 1PT6A 3SVTA 4ZV7A 1PGQA 2O7SA 2R47A 3GA0A 3HA5A 3O4RA 1UBLS 2Z4SA 4JQZA 4B79A 4DLRA 3W1EA 4CTOA 3PVSA 2HMVA 4YX9A 4FLFA 2OBMA 2VNKA 3KB6A 4TS4A 4UNSA 3ZZTA 5BYAA 2NZWA 4EUNA 1NL3A 4EW3A 1OAOA 2XRFA 3F4BA 1I33A 2ZRAA 1P0MA 1C9KA 4WAUA 1G291 1W19A 4QYWA 4NBKA 1SQ6A 3O21A 1ZNZA 1OU4A 2HLDD 2WWHA 4EG5A 4OMDA 1RABA 2BBTA 1UBMS 1O58A 3AGPA 3IOBA 1EM8A 3C3MA 3FCAA 3NHRA 3NHAA 5K8JB 3W2EA 2FP3A 3K6JA 3GXBA 3K0AB 2WWVD 2KWIA 1IPHA 2JVKA 4OJTA 3ZU5A 3ETEA 3RRJA 1CDEA 5COQA 1U1IA 2J9YB 1Y9DA 3B12A 1NN3A 1L1QA 3I6IA 3ER9A 4OB7A 1EZ4A 3E9RA 1DMSA 4DOMA 4LSZA 3IAUA 1H69A 2EX4A 1RQ7A 3KQPA 1E1YA 5DE3A 1OB5A 2NSLA 2AX4A 3LT4A 1RYYA 1ORVA 3ZWDA 4LBYA 1HL3A 1LQUA 3B7WA 2AOWA 4HLDA 2JRLA 4QBGB 4L7VA 4RVCA 2Q4OA 1XO1A 3PXBA 3QF4A 3QU4A 5E0OA 4D3FA 3G5UA 4EEZA 2G88A 4OYRA 2AN9A 1W35A 4CPDA 1YFZA 4P36A 2IS2A 1D03A 1MRSA 5J2UB 1UXHA 1NV9A 3IXQA 3MXTA 3Q87B 3GFBA 4IDDA 3U3MA 3UMSA 4UNRA 2XA9A 5FLXA 4JHLA 1TW3A 3VZQA 3FGZA 1AZTA 4NYIR 4ZI7A 2R7AA 1SXJC 2I65A 1D5CA 4IXMA 2GAAA 4NAHA 3A2KA 1NATA 2AN5A 4XKJA 3UUWA 4AXBA 4IR7A 1GZ5A 2PH3A 1A9XB 3I04A 4OXYA 3LUCA 4LC9A 2OCLA 3MZ0A 5ER9A 1QHHB 4E4YA 1P2SA 3F96A 4NBUA 1L5MA 5BQ3A 2ZJ3A 1HNZB 3O4FA 4U3JB 4HLUC 3DZGA 1X8JA 4BE7B 3IPYA 2QP9X 3RSFA 5DO9A 2QLMA 5FTJA 3SVZA 1B00A 2JA1A 3WNQA 5SZHB 2WJHA 1TQ2A 1EWQA 1ZO8A 3IEMA 2CSXA 3K9GA 4P31A 3KJGA 2PRZA 1ZOPA 3CX7A 1K4YA 1NUSA 1RJ9B 4ZAYA 4OJMX 1YE5A 5AVVA 4TYQA 1V9LA 2QAGA 1KO7A 3DVQX 5DYNA 3RJ9A 2Q6VA 4LNUA 4GX2A 5IF9A 1M5RA 4L3WA 1FRZA 4HAYA 3N9IA 3E4DA 4TTQA 2Q3DA 1G8GA 3NWOA 4XJXA 1Z5GA 3MF4A 4NX2A 1X70A 4WLNA 4D44A 4C06A 2DX7A 2WQZA 3G8DA 1QHYA 1NX6A 4X65B 2X3UA 1BDMA 3A26A 4PC6A 4RKQA 4FYIA 3AZPA 1H6AA 4HXFB 2Y0DA 4RD2A 3SKYA 1G7TA 1W6UA 1YQQA 4ZO6A 3WWDA 1XZQA 2ZUSA 5JASA 2MIIA 1YQEA 3KEGA 1EJ2A 2GK3A 3R09A 4A82A 2WWWA 3EGIA 2IT1A 3QWAA 5CB6A 1K9VF 2O2DA 2OBBA 4DNXA 4XIGS 3RBVA 4HEJA 2AOUA 4P7KA 1AIPA 4RETA 3EQ6A 3UF0A 1QGZA 4NH4A 3VPSA 4QUDA 1HLDA 2Y77A 4J0HA 3DL2A 1N5MA 3V9AA 1OLXA 1X7YA 2E18A 5GWXA 4RKEA 5DRYA 2IGTA 2A5JA 2YYZA 2J41A 2H5IA 4L15A 1ODIA 3NOVA 3V34A 3RSZA 2PQ0A 5HW0A 3X2SA 4ND1A 5KU1A 1OC2A 3IV6A 4GMDA 5B2FA 3OHPA 3TGPA 1XD2A 3ZI0A 5B58T 4XX0A 1AVTA 1ESZA 2VUIB 3G6KA 5FUYA 2FWAA 3C48A 3DM9B 1P60A 1DEHA 2Z6AA 2NTVA 4ZOCA 1FS5A 5CA1F 3EAGA 3KJHA 4LZOA 4XWAA 1H4QA 3R0IA 4G8JA 1XRPA 3HZOA 1NPYA 3E5HA 2HCTA 1RRKA 2G9QA 2XTNA 3BWCA 4OKNA 1IQRA 5A9SA 3OIGA 4B81A 1CY0A 4CKBA 1TLTA 2JJ2D 1C0IA 2WYUA 4TTVA 1EVZA 1YVPA 1GNVA 3IKLA 1ZVKA 3JQ9C 3LU1A 3AJ8A 5JDCC 3S2SA 2K6GA 3IQFA 2PUVA 3TRJA 4F3NA 1AD2A 1KC3A 2G70A 1EDBA 4NPCA 3SR0A 2UUCB 3DE6X 3E7PA 5CXUA 1CRZA 4R9SA 4QUKA 1ZUNB 5J2TB 1DELA 4F9TA 5TY0A 1XPJA 3C8DA 4WEQA 5JS8A 3AHFA 3KDSE 1YI8A 3EQ8A 4EATA 4NYMQ 3GDHA 2VDUE 2D2VA 3KKMA 2JLQA 3L43A 2AR9A 4G1EB 3STVA 2IBSA 5FO0A 4BFSA 2H1WA 1S4MA 4GOND 1JIJA 2PO7A 1C7EA 5LVAA 2WWRA 4N0QA 4EPYA 1L4BA 3L79A 5FCDA 4M1TA 2OLEA 3IO3A 1UM9A 4EB8A 3AO0B 3X0DA 4WESB 4EF5A 5B3AA 4EH1A 4JIGA 4WX2B 3TZHA 4KRFA 2QUAA 3ZNNA 2CFRA 4LXGA 2WU1A 3I61A 4KXMA 3SLRA 1CIVA 1XDSA 3WQQA 4C0QC 1I6KA 4Q3EA 3N2LA 1T13A 2I6SA 1EX1A 2VI5A 3DHNA 5HF6A 2J32A 3AEZA 4AS1A 2GQ0A 4RK4A 4C7KA 4HDMA 3H3FA 1V6CA 3E7XA 4EMSA 1K2VN 1OAKA 1THZA 1RYBA 1LJUA 2ZYTX 4P1ZA 4UZSA 3URKA 4V1CA 1KJ8A 2QL7A 4QT4A 1JKMA 3BE4A 4FOSA 1IDN1 2GN9A 3FDJA 3CKMA 4LHZA 4WUTA 3TE6A 3TLGB 5BMVB 2O8BA 4KJXA 3BC1A 4WVLA 2GFIA 3I0MA 2DBYA 3EJ6A 1UZUA 3DFMA 3BX1A 1EJ0A 3DCJA 3EEBA 1VIMA 2DLDA 3M4JA 5IABA 3MN1A 4RK7A 4DCJA 3RVMA 4BYMA 2GM4A 3ODGA 4FYHA 2WFLB 1P0FA 5GZ1A 1X86B 3BD9A 3H6GA 3O8DA 5ETJA 2IU0A 4ATNA 2DUUA 1Y6JA 1BXZA 1EUYA 1G18A 4ZRMA 4H1VA 3AJRA 2RHWA 4K5QA 2IOYA 1YASA 3ELDA 3M2PA 2IYUA 1QPZA 1S0UA 3QEJA 4RA6A 3BKXA 1W75A 2HK6A 5TNXA 5HQTA 1SXPA 3UMYA 2AJLI 3RS3A 3F71A 3ZTYA 1Q0ZA 2BEWB 1M1YE 1ZJYA 3QU7A 4EHFA 4W5HA 3K4QA 3FCSB 2FQXA 2KBEA 3LI2A 1N57A 3NIGB 3R6WA 4NXNB 4HPWA 5DJ5A 5KNBD 2HNAA 1U7TA 3SKXA 1JHVA 5LZ4A 1M6HA 4BX3A 3KJQA 2WU0A 1QH1A 2X3YA 4NLLA 5IANA 5HM8A 2WIGA 4DY4A 5ECWA 1C4XA 1LLUA 2DPXA 1NE7A 1OXBB 3GUVA 4I81A 2CXTA 2IY9A 1GVHA 1YQXA 4AP9A 1GIAA 2J5KA 3NAMA 3QFCA 1SXJB 5KB3A 5F1YA 4LF7B 1KVUA 2YWJA 4DE5A 2K2WA 5E9AA 1TYCA 2FZLA 4UM9B 3MJHA 3T7CA 1R8QA 3OE7D 3ZVMA 2ZYGA 3HKDB 2GERA 3K2IA 2PGOA 5EINA 3VM6A 3CWZA 5LCXA 3RTGA 3W3AH 1RM3A 2XWPA 3VC3A 4EA9A 1IZ0A 1HRDA 1P1HA 2Q4EA 5EWMB 4JUAA 3NV7A 4GZLA 3UFXB 3AUYA 3ZJUA 2GVZC 4J75A 3BJMA 1T4CB 3RVQA 1JPUA 3VAAA 3U19A 2BDEA 1AA9A 1XLTA 3A1TA 1LPPA 2O4CA 2F1HA 4YRIA 1VL5A 3IP7A 3HJNA 3KUCA 2R2AA 5CIWA 3C16C 2P69A 5AM3A 1PNQA 2Q4BA 1PLJA 1P4JA 4B4VA 3Q0IA 4CWAA 1VL1A 2RSLA 3MWEA 2WDPA 3UJCA 4QLOA 2HJ9A 4ZO8A 1LUAA 3PGVA 3IRVA 1AKMA 4DN6A 4PGGA 3VU3A 3H4MA 1X7XB 4L9SA 4BO3A 1XV5A 3PNPA 1GAEO 3LLCA 1ZICA 3DB2A 4DR1B 3UMVA 3HUEA 5FXMA 1U0TA 2GBLC 2FSFA 3HJRA 2QQ0A 4KH0A 4TLCA 2NWQA 3OE1A 3W04A 3U80A 2DQ4A 3LZDA 1E79D 2HIAA 2LZ0A 1KJJA 4YT4A 4HDAA 2BP7B 3EVZA 1B0PA 1EU1A 4DMFA 2FSVA 4O4IB 2FNAA 5LP6B 3E6AA 4XQGA 1XWWA 1L4MA 1NYTA 1DKNA 1RE0A 2OTCA 3GLHA 3GFGA 3L7DA 4EVIA 1QONA 3K0FA 4HYYA 2WY2D 1RYHA 3UVEA 3JU3A 4DSNA 4RS3A 3FCUB 3WB9A 5G0TA 3ZLUA 1TOAA 2CJXA 2XTZA 2J9FB 2JFXA 3QKTA 3P2IA 2UVPA 4BJ1A 3UJDA 1V8DA 3ABSB 3LKDA 4Q4JA 1VJCA 3FOWA 3OJCA 3OJWA 4HQRA 1XTUA 1J90A 2FZKA 4TQ9A 4FHGA 4P3YA 3S81A 1LX7A 1QVAA 3HO6A 3TIGA 3L8MA 4UHBA 1SCNE 2BY4A 5AXCA 1T36A 4NMWA 2LIPA 3PHJA 4YRGA 3TLCA 1ISJA 1CK4A 2E6UX 2IFTA 1V16A 3VPDA 1R8JA 4K2HA 2ZRQA 3U44B 4ILEA 4TT3A 3TNFA 3WJ2A 3R77A 4G4GA 1TJPB 3U9TA 1RYMA 2Z2JA 3WQRA 4FQ8A 2IE8A 4C0AC 3NJ4A 1DEKA 4E5NA 4KZPA 2CHEA 1DQYA 2VXYA 3QLUA 1DL5A 1VRVA 2LDBA 1TPYA 4XFKA 5C7OO 4ZVNA 5EXXA 5J1SB 1DNPA 5DK4A 3CNNA 4ZT3A 3TVYA 1RPTA 5FAKA 2Q99A 1JHUA 1YA4A 2EDAA 3EPPA 3NNSA 3S6JA 1TUIA 3ZTWA 3WJAA 3I6BA 2VK4A 3CT6A 3HSKA 4OBXA 1L4LA 1U7DA 3DEZA 2X1MA 2GJKA 2OV8A 3KUKA 5KX5B 3LBAA 4U63A 1WP9A 2V6BA 5GVRA 2OCPA 5JEEA 2CXNA 1RPAA 3N6RA 1GRQA 4I8IA 4U5XA 1PFVA 4UCXA 1V95A 2QRJA 5JH7B 1J21A 2ZRNA 3NHLA 1CUIA 5DISB 5FEUA 3ZDQA 2PZJA 5CVTA 1X2EA 2Q27A 3IDZA 1T0IA 5I7HA 1W4CA 5JY6A 3LWZA 4KQXA 5E7MA 3INRA 4AKIA 4FR5A 3RTEA 2O1WA 2Y0PA 4BLQA 4F21A 1E63A 5I8WA 2PDAA 3CX3A 3B1WA 5A4FS 2EP5A 2F3SA 1KJWA 3LKVA 2RJ3A 2PAFA 4PEVA 5ECYA 1NULA 1SBCA 2Q5JA 1K66A 3DEKA 1DIAA 1U3WA 1CRQA 4KAAA 1FCJA 2G17A 1X13A 3NVMB 3O93A 4YJFA 5DBFA 1BDIA 5H4HA 3KQOA 4ARAA 4GPIB 2MSKA 4Q1FA 4EEKA 1QGAA 5FTWA 1BFDA 1SKYE 1JVBA 4IJKA 2FA9A 3PD7A 2NAFA 1TQ8A 2Q8QA 1DXQA 1TK9A 3NVAA 4TV8B 1YBHA 2C9YA 5IAKA 3NAZA 3ZE7A 5AVUA 4XYGA 2H16A 3ONVA 3PDIB 2Q2OA 2WJIA 1R6VA 1EWKA 1MZPA 2PNFA 1HE5A 2MU1A 3TECE 2ZU0C 1H6CA 2O5VA 3F8SA 2JHCA 4EK9A 5EERA 2P30A 3O94A 2AOTA 1V9SA 2VRCA 3IBCA 5DK6A 5DFAA 2WF9A 3GG2A 2D5IA 3A0UA 3KLNA 3L4SO 1KZ7B 4RPCA 4IDFA 4CMAA 1U0EA 2XYRA 4B34A 3R9XA 3HWSA 2XIJA 2ZWIA 1VPLA 4FT2A 4RDIA 3E3MA 3JQFA 4QD3A 4GKJB 4ZAGA 1H8HD 2Z08A 4BN5A 2A0WA 2ZJBA 2V6GA 1RXCA 4ZAFA 2I6TA 3T99A 4QQKA 2VF4X 3PFHA 4HAVA 1EFLA 4DVJA 1ZONA 4J0GA 1PG0A 2I2FA 3RBAA 4XYBA 3ZDBA 2BI7A 3CVYA 3VSCA 3V4FA 2VPZA 5ADUS 1E2LA 2IZ0A 4K9PA 2BF7A 1Z2NX 2FG5A 3BQ9A 4UUNA 4DWJA 4PSVA 3AKEA 4Y2XA 2WUVA 1GPJA 4DW8A 1P1FA 3JZDA 4WZBB 4MRRA 3NGMA 4XSVA 2PE5A 5KTKA 1P7PA 4FZJA 4DSAA 4OUDB 1EGHA 1N92A 1O77A 1O95C 1U0OC 1Z4JA 2ONKA 3QYAA 1ESNA 1V37A 4RHFA 1WQ3A 1UPTA 2LW7A 1IIRA 1H8ED 5E4YA 3ZDDA 2A0YA 3CXRA 1KRWA 1J0XO 4YI5A 3HVHA 4X60A 4RVHA 1GPWB 2AT1A 4YREA 4FS8A 5L4LA 1A76A 1OX6A 1WMSA 4PN3A 4UPVA 5LA6A 4CT5A 1FE8A 1G8PA 1J8YF 3LT1A 4ESEA 4G0WA 1U2DA 1ZDMA 4R2XA 2ZVDA 3RYHB 3OSZA 4I1RA 3PUIA 3AWDA 5M5BA 4LQCA 5E2BA 5H5JA 1GFIA 3JPYA 4NBSA 1PCXA 3BJIC 3CUSA 2O8EB 3OX1A 4OMCA 5JNLA 2FPUA 1OBFO 1V7CA 3TEMA 3LFUA 5DSTA 1ZJ5A 1QE5A 2I6QA 3UK2A 4KRGA 2G0AA 2PEYA 4E2FA 2HAEA 2AMFA 1ENPA 2P0YA 2XB4A 5A3SA 2V4ZA 4BQFA 3HU1A 1U6KA 3EGWA 3T7SA 5IEJA 1WMFA 1FUKA 4KPGA 4IO1A 4QGSA 4RVFA 4DV2B 2LGJA 2FWMX 3EZGA 4X1KA 2I6UA 2W5UA 4O4LA 2QR2A 1ZK0A 5H82A 4Y9UA 3PYLA 4AJ9A 1WCYA 5BV0A 2CLEB 4D3ZA 2NTNA 1KNQA 3AW8A 3IKMB 1ZMBA 4MR8A 3LDAA 1Q3KA 2D6FA 4ZI2A 4LHWA 5I7AA 4UM9D 2NXJA 3NEJA 1UKEA 1EFAA 3W1WA 4F2HA 3UCEA 4AJIA 4E13A 1WHSB 4QG3A 1KHHA 2GILA 4LTNA 1YS4A 4R8KA 3QKRB 1EXVA 3AJAA 1Z6QA 3FBWA 2QE7D 3LCJA 3D2BA 4UAJA 1RLOA 3PI7A 1EWTA 3RIEA 4B7XA 5E4JA 1O87A 5FPQA 1AK9A 1BTOA 3D7NA 2ZREA 2PRKA 1SZDA 2PD6A 3I52A 4FR0A 4K6HA 4N76A 1Q57A 1Z8NA 3P20A 1YJBA 2WRZA 3HJUA 4RV9A 5JI3E 1UJ2A 4FEAA 4ZO7A 5KVSA 1IVNA 1SC3A 4UU8A 5EUCA 2HPHA 2ZTHA 2Q0XA 1EXNA 4P4UA 3FCOA 3ZNOA 2XT6A 4PNZA 2ZR8A 4HXEB 3FNQA 1XEWY 4P80A 1SAYA 1BVUA 2B6NA 4HH3C 4WFQA 4ZYUA 4EF6A 4PM4A 1EQAA 1Z13A 2Q1WA 1FFAA 3G9UA 4GH5A 2FEPA 2EFYA 2AFIA 1Q5PA 4HGPA 3HRIA 3QE0A 1TQDA 4U6QA 1TM2A 4MA4A 1EFVA 4JU8A 2A7XA 2QK4A 2VHEA 3OPVA 4PLGA 3SOZA 1UXIA 4AZWA 3OEWA 5DH9A 1E5VA 4X41A 1EFKA 1E7SA 1RWWA 1ZQ1A 2Z8ZA 4CVNA 3W5BA 3JWEA 1DKOA 1HE3A 3DE0X 1LSSA 3IMEA 5EYPA 2FR8C 1LK0A 3L7AA 4OTZA 4Z7QB 3ADBA 3QX3A 2H1SA 2QW0X 1SRQA 4M99A 4CR7A 5JAZA 3DLTA 4KI0A 1PBNA 2IOFA 5IASA 1K8ZB 1GN9A 5EVCA 3ZDCA 4RX1A 3IP9A 1GSAA 3JWHA 3MUOA 2IOFK 2YFKA 3CJRA 3SFTA 1K27A 5KDOA 4MVYA 4CM3A 2HFJA 2X4LA 3C41J 3EXG1 1C9YA 1E60A 4LHEA 2H48A 4Q9AA 2PL3A 5BWCA 3O4JA 4G1FA 4MMXB 4F46A 4PZ0A 4IQFA 2R4QA 4O0LA 1DV2A 4H6WA 5DIFA 5JPCA 5K8TA 3L05A 1CJUC 2EBWA 3FPAA 2O5EA 3ENVA 1SZCA 4W4TA 1QU2A 3TCKA 2IDJA 4QJBA 3TSAA 1DG9A 4KSCA 5MFPA 4G0QA 3HB0A 3LFTA 3DEAA 2YXLA 5LJIA 5IJWA 4GSKA 1UPUA 4YJGB 3LWDA 2VAVA 1VXRA 1X74A 4DV0B 5FBLB 1QDUA 3WE7A 1FSZA 3JXEA 4EGSA 4D45A 5JW6A 3W3ZB 1HZJA 3QXSA 4OHFA 1UJBA 3A9RA 3A9SA 1PR5A 1ZRSA 3GEGA 5B7NA 4GOXA 2VEDA 4P3OA 2GJAA 3GEMA 4C20A 1B2LA 2NYRA 2PVCA 1Y3DE 3OPQA 5CT4A 2Y1GA 1P61B 3PR2B 4Y9DA 1T3ZA 4U00A 3M3DA 2GD2A 4ZV4A 5I7FA 1PYOA 2J6HA 3EA5A 4ZPJA 2IEBA 5ILQA 2WIAA 5TLSA 2NTEA 2OV3A 3H17A 2R1VB 3EIWA 3U09A 1PR3A 3FSGD 4MLZA 2H3HA 3AL3A 3IPAA 1QLWA 4NK5A 2YKGA 2DJIA 5MN6A 2NMVA 1RW4A 1VPDA 1KZ4A 1P73A 1RFLA 1VMKA 2J8ZA 2VNSA 3K94A 2OBNA 2DPGA 3QE2A 4RTSA 2HA4A 2ZE7A 4PZZA 4BKRA 2EJUA 1E0SA 3FVRA 3H2GA 5CURA 1E9CA 3HO1A 4D8XA 1UQRA 2FR1A 4PHFA 1D4AA 3OOYA 3KS9A 2NUAA 1SIBE 3EGDA 1R5OA 2A6PA 2BTQB 2HIMA 3Q7TA 4G0ZA 1W30A 4YRAA 3V8PA 5EGNA 1A0OA 4FS3A 3W1VA 1VCNA 1CQWA 1U4NA 4ADSG 3A1CA 1B42A 3I2FA 5KMGB 4JI6B 4FFOA 2QVBA 1PTKA 2XEDA 4IHJB 5JMPA 3T7KA 3MGAA 2BFEB 3FXAA 4MRPA 4CM8A 3AM1A 2VG8A 3W3AD 4CKEA 2ZE8A 2AUTA 3DL7A 3QI7A 4NJEB 4PC2A 4BNGA 4F8YA 2Q3FA 2QMUA 2FXVA 2ADFA 2JGDA 3PRJA 3JQBC 4LJ6A 1RWQA 4HZUB 4KGZA 1UMCB 5IMBA 2PMDA 3Q3CA 3B6MA 4IIJF 2APJA 1XZPA 2AVNA 2O2JA 3BFVA 3FETA 1RRVA 5IXYA 3G7UA 5A5FA 4BBJA 1IY2A 1Q21A 4D80A 2VQ6A 3ROEA 4OOFA 4BLTA 4YMSA 1XEWX 2NW6A 2Q9CA 1M73E 4IIGA 1W4AA 4W82A 2FU5C 3SIXA 3WGUA 5I4IA 1PS8A 2DGDA 3PUYA 1I9CA 4B8WA 1XQYA 4FGZA 4NHEA 2YWXA 3H83A 2L69A 1PVOA 1MIOA 5C5DA 4BB9A 2Z6QA 1MD9A 3O1JC 3WLHA 3FDZB 4J0IA 3HVUA 2YVUA 1W5EA 3FWNA 3A14A 1JLHA 1K8QA 1N34B 4RJ2A 2CXXA 1VSUA 1SUCA 4M0FA 3SC3A 1W9HA 5F52A 3IQXA 1DBPA 2GZDA 3B2NA 3S27A 1WOYA 2OXRA 1GA4A 4QOSA 3UWMA 3H18A 2Q4DA 2QG9A 3RV4A 2ZCVA 3BGWA 3R6LA 4WASA 5KVVA 3ESBA 4LCJA 3UJNA 1XBTA 5I4BA 4JYBA 1IXYA 4O1IA 3PE4A 1CUXA 4BVEA 4I0WB 3S1LA 4IIVA 4AY2A 3V97A 2FJPA 1WCV1 1U7OA 3CE9A 3KWLA 1ABEA 1TVKA 4XLZA 4LMRA 3VH4A 4XUGB 4ETWA 2BJVA 1KJZA 4DR7B 2BR4A 3NBFA 1RZRA 3DBHA 1E1QD 5DBGA 1WKBA 1MTZA 3C1OA 3JQEA 4QAQA 5EXPA 4MDHA 3KXPA 2OGZA 2Q46A 3GRPA 1U99A 2ZFUA 4ZOLF 3BSFA 4EG4A 4ZV9A 2GHTA 3ASUA 4C6TB 3E15A 2GN4A 1S8OA 2WKSA 4JLSA 4P58A 4Q6WA 2UKDA 5ER6A 4CTNA 2X13A 4B3DA 4C14A 3CZ9A 4EG7A 4GPZA 6PFKA 4WZAA 5DGIA 2WKRA 1H1TA 2FPGA 1AM4D 2Z30A 3PX3A 4O8CA 3HG7A 4F4DA 1QYCA 4G84A 1OZGA 4Y67A 4JA2A 2EU8A 3ZPXA 4CGYA 1EI9A 2F3QA 5A7HA 1K89A 4RVNA 3THWB 2CXQA 3PGJA 1RCTE 5AM2A 2VTVA 4TYWA 4UOQA 4JAVC 4RKWA 4Z4IA 1IHDA 1Z8FA 3QG1A 4DGSA 3MD9A 1SCAA 1ISFA 2O54A 3I9FA 2DAPA 4MV4A 1I5OA 5CDUA 4P4NA 2ZJ6A 1CJKC 2W2KA 4NMXB 1GA6A 2KSQA 1V96A 3LHFA 4OSPA 4WZZA 4X1YB 1CE8A 4HQKA 2XDYA 3RWBA 5IHXA 2DTXA 1P81A 1C2TA 4YHHB 1MENA 4LX0A 1ZL2A 2WD7A 1C80A 4YRJA 4F56A 4OHKA 2JFWA 4YDHB 4YLEA 4UHCA 2OOSA 1J0AA 3CH6A 3ONWA 3LTNC 1U3DA 1QV6A 3K5HA 4B09A 2R6HA 1D4ZA 1PWXA 4V1CI 1P8AA 5EC8A 3VKWA 3CZMA 4KVZA 1UAGA 1CU1A 4PAGA 3MCAA 4ZEXA 5E7IA 3T7EA 1M6NA 3LPNA 4X64B 4S3MA 3UOWA 4R68A 2OUKA 4MW0A 2JJ2A 2Z2IA 2XBMA 1U3CA 3WLRA 2HH9A 2XODA 3SQXA 2CWDA 3LQKA 3M34A 2XPCA 2NU8A 3OP4A 5KJCA 4G24A 1ZLXA 4AN4A 3GCDA 4H4CA 5GJBA 3F6SA 2BGGA 4CQMD 4HG2A 4BZZA 2EZ8A 4ZCTA 2R8XA 3LS2A 4O08A 3WGVA 5L3VA 3JWIA 3E0QA 1PZGA 5A2GA 1A96A 3M5WA 3L49A 3EVFA 4RF2A 3OQPA 4H1WA 2VNAA 3LYLA 3N2KB 1KIAA 1XNJA 2O1EA 4J7AA 5AW6A 1E92A 4MUNA 2VHYA 3Q7RA 1R4MB 1Z5OA 4BNNA 5C46F 2J4CA 2HADA 4CYMA 1J25A 1TIBA 1TYZA 4AJHA 4BX8A 4TGLA 4L2IB 1NJ2A 1GTVA 4ZAWA 2GPYA 1YK0A 1N8SA 3OJ0A 1OH5A 4C0BA 3F6RA 4M1YA 4YRFA 4AUMA 1OPXA 1UODA 4BCDA 2VWQA 5DM0A 1UC9A 1HZZA 1YUNA 4D0SA 2FH5B 2HJSA 1XP5A 5K3BA 4UTRA 2GYWA 4CEHA 5D6NA 2QNBA 4OO3A 2C7GA 2QTRA 3S7TA 1SUPA 5FBZA 4JI0B 2C2MA 3FX2A 5ALIA 3RHZA 3BGDA 1J06A 4YJ3F 1IY9A 1TD9A 4I19A 2QG4A 4XLLA 2VZ9A 1SCDA 3OAAD 3DYBA 1CJMA 3PF8A 4I66A 2C0CA 3MINA 3PPWA 1J1ZA 1JW9B 1H0HA 1OA0A 4JHXA 4WJZA 1IN1A 4EKDA 4KR6A 1EZ1A 2R0QC 4X3PA 4O29A 2JB9A 3GCGA 4R31A 4KX3A 4BYGA 1UMBB 3LK7A 3SMVA 3JQGA 4XD2A 1OWPA 3KZMA 4YRDA 1GGKA 3MTJA 4XIJA 4IFBA 2OHIA 2HRQA 4GZMA 1XMSA 2O7QA 4M0PA 5HZMA 2QTNA 4NP6A 4ALLA 4PQGA 1JR3D 1P9OA 3USES 2O8VA 4HUJA 5JTUA 2FFJA 4LXQA 2ACVA 2GD6A 4JEIA 3IYLW 4M9UA 1GUBA 1YL5A 1DRVA 1NVDA 1PVVA 3EIUA 3LLUA 5AQEA 3GBVA 2CDCA 2E4ZA 4HWPA 3R4CA 4RGBA 3V9PA 2VPTA 3D6FA 4GYJA 3G13A 1JE0A 2WHXA 4L27A 4E14A 3WQHA 3SF8B 4A6EA 5IZCC 2ZI4A 2HB6A 3N76A 1TL7C 3EA4A 1GQOA 2ST1A 1O6ZA 2P79A 4EFMA 1M0TA 3UXEA 4JYCA 4D9CA 2H31A 2B9EA 4UNNA 4JVLA 4HS9A 3A6KA 1PGOA 1PZMA 1J22A 2ENWA 2ZBPA 2AJBA 2QZSA 4HXGA 1VOTA 4UULA 1HEIA 2W6JD 5F1KA 4BLRA 5JO0A 4KODA 1E1CB 3JARB 4A73A 3O47A 3EARA 3JZFA 2DECA 2GPSA 3HJGA 5CYFA 2OWEA 1ORWA 3IP8A 4JJ4A 4YAEA 3PX7A 4ZOBA 3V8BA 2F8SA 1BKSB 4R2HA 4DBLC 2ZZNA 2A30A 4JA0A 2HD4A 4L22A 2CMHA 4CM5A 5GONB 3E4CA 3UXYA 1WZ2A 3AWIA 4WOPA 1Y9EA 4UE3S 1Q1BA 1T9ZA 3RJZA 3GCZA 3RNLA 1E99A 4ML3A 2DPYA 2KI5A 4RYLA 4ARUA 4ZIRA 6Q21A 3Q7EA 2HSWA 1OJLA 4WWHA 5FJIA 2AD1A 2G4CA 1BWPA 1QPGA 3K0CC 2EG5A 3KD2A 3NHYA 4JR1A 2V1UA 1KEEB 4NBTA 2YVKA 2A88A 1Y6ZA 3BM5A 4CCSA 5DLDA 3QU5A 4GQAA 3G1UA 1XXHE 5GJVC 2BGNA 3R8XA 1BDBA 3VYRB 4H17A 2FLKA 1FXUA 2HJWA 5J2UA 4X84A 1E79A 1ECCA 3NR2A 1DAFA 1D6NA 1FYDA 1X92A 2PQ2A 3CISA 4M2LA 4W1PA 3OZSA 2VC2B 3KSMA 1EVEA 1I51A 3HN2A 3EXAA 4NU5A 3D59A 4P9NA 3O4VA 3QX8A 3P4XA 2HF2A 2VA8A 1A9XA 4A03A 4FBGA 1YB6A 2AFVA 5KYXA 1H05A 1JMVA 2VNJA 2PPLA 1XQVA 1QHHA 4TLAA 3ESAA 3ISTA 2EKZA 4INJA 4KSBA 4KDCA 1J0DA 2WP0A 1JQ3A 4U3JA 1V3TA 1I4TD 4ZO4A 2QP4A 5COAA 3AR7A 1D2RA 1S2LA 2EP7A 4E5YA 4OX9Y 2CSUA 1JXMA 1SVIA 1L7XA 2P91A 2AF4C 2XSZA 5BR1A 2PUAA 4L0DA 4CQLA 4HWRA 5ALGA 4G2NA 5B1IA 1LD3A 2C5AA 4WFKA 3UKJA 5BOSB 4QTXA 5DTEA 2IP2A 3C98A 4WBNA 5IUJC 1RJ9A 4GO1A 4RELA 3HDVA 1CX9B 5FULA 5TS2A 4L6AA 3T9BA 1E0JA 1X1EA 2Z56A 1RHUA 3ULKA 3VC2A 2D2XA 4XR4A 1TA9A 2J5XA 4QT0A 4U8HA 4A0GA 3B9BA 4M8IA 3WZMA 1UZLA 2I6GA 2CKDA 4UVEA 3WLQA 4TWZA 4CLRB 4L8WB 4BO7A 1YD7A 4UPDA 4EENA 2Y1LA 3AUJB 3G5AA 3H9JA 4D96A 1TAGA 2EJBA 2ZETA 3L7YA 4M55A 2MR6A 2VJOA 2XGGA 5EZSA 3SSAA 3BTOA 2VTBB 5KSPA 3MJFA 4C78A 4PO1A 3FWYA 2NO6A 1TKCA 4J16A 3L7LA 1UCFA 4PFSA 1RJGA 2JFZA 4FN5A 1NE2A 5IKOA 4BEBA 2R00A 3QWIA 5AM1A 2IKSA 2GF9A 2R79A 2VP3A 3ZWBA 4Z7JA 1UBCA 3K7EA 2GTIA 4LMBA 4DNOA 1A4RA 1AUPA 3TPFA 1Z17A 3BOSA 1JSZA 2RHHA 3I5MA 4PV7A 1HNXB 2C8VA 2W2QA 3QV2A 4FCTA 5CXXA 1Z88A 3QIAA 4MW9A 4PNEA 4LF8B 1B8UA 2IUFA 2WA1A 2HJHA 2H63A 1TVEA 3PC8A 2Q50A 3CRNA 3CEHA 4G67A 4N6GA 4TV9B 4V0SA 4XWTA 5TGZA 4BMDA 4GMXA 4CDMA 1A4UA 4MDYA 2O20A 1U0SY 4H35A 4IUYA 1XMXA 3Q0TA 4OYHA 4Q0MA 5IAJA 3ROQA 5ALNA 1PL6A 2F4NA 3QHQA 5FKJA 2OESA 3TQQA 4AWBA 4Q02A 1B41A 1ZIPA 1RR6A 5AOAA 3ZNQA 4Q3NA 4A23A 1X19A 4R98A 3BJZA 4AZTA 4ZAVA 5HOEA 3LUGA 3K8OE 1MEJA 4BASA 2WI8A 3T52A 2P4EA 5SYMA 2JNWA 3NOOA 3ROZA 5BT8A 5CVJA 1IH8A 3LPDA 3WBKA 4NRDA 3VMMA 4OI2A 4TMZA 1EHIA 2RHRA 1KGSA 2JFNA 4FYKA 2AZMA 4I50B 4EFNA 4KQ1A 4KMOA 4TXJA 3Q6MA 2ZBDA 1I7LA 1QORA 4JMPA 4ENWA 5DIZA 5DN6A 1N2JA 3O26A 4J4BA 1Z0FA 1ENYA 3BQNB 4PBTA 4E51A 5J2TA 3NASA 1FIUA 1QHSA 2L2QA 1KQNA 2BSXA 1CZNA 2LKDA 2MOKA 1T1JA 3KV1A 2W98A 4PRZA 3MA0A 2KHZA 2IIPA 4UVHA 2GLTA 3O8LA 2FWBA 3JQ6A 4Q82A 4Y7DA 1VP9A 2PMEA 3VPXA 5A05A 1VA5A 1FW8A 3P9QA 4RCZA 5AJVB 5B1HA 1LGYA 3AMVA 3GPDG 3KJXA 5KQSA 3PUVA 2IQIA 3LCUA 1DCTA 1HLPA 1H8HA 3ASYA 3GJTA 3PTAA 3BGIA 3PGXA 4WESA 4UEKA 3K2BA 3O83A 2FB9A 5LB4A 4RM2A 1VJGA 4CLDA 2SKEA 4XWOA 4AX8A 3TBHA 2V5UA 1VL8A 3F1KA 3LECA 3DQZA 5CX1B 5J47A 2GXAA 4W9NC 2UXCB 2PL9A 2YJ6A 1FVHA 3DZFA 1TRKA 1T6NA 4B6RA 4EABA 1IWPB 1N1DA 4TL8A 1SUAA 4KPUB 5HPYB 3EG9B 4IGFA 3RUFA 3UJPA 5K3EA 3V8EA 5K3OA 3H2YA 1R0RE 2A35A 1GQ2A 2PLWA 2ZDGA 1MOZA 2P9JA 1MA3A 3KKNA 3TLGA 1Y9JA 3ZW8A 2MJLA 3B82A 3CGWA 3IP5A 3TRKA 4M8LA 1D6JA 1PWHA 2JFHA 2OHOA 1OI7A 3I5UA 3OPXA 3WZ2A 1H8EA 3TBKA 2VPPA 2E85A 4LDRA 3EFHA 2BUCA 4NPAA 4YRRA 4MVJP 2CDAA 4KE7A 1KH3A 4FGLA 2WFLA 4QQNA 3RUEA 3HB4X 3RVJA 3NYRA 1P2DA 4C21A 5KOHB 1DG3A 2AJCA 1U6IA 1G3QA 4FEGA 1XWIA 1YZNA 2D54A 3CZQA 3H5OA 1EVLA 1M8JA 3AERB 3AX6A 4POOA 5LQAA 3ILVA 2VTEA 4JL8A 2P9TA 2ZCJA 5DB4A 4OAOA 4F71A 2BEWA 5L3RA 3L6EA 1MDFA 4QX6A 3TIVA 2PYZA 1DIRA 3MMPA 2ZIVB 3KAQA 3HADA 4AK9A 1GWNA 1KO5A 4FZRA 3PHGA 4XVHA 3BBLA 4RKYA 4CF4A 4JVOA 3AUKA 4WD3A 1NA5A 4EMBA 3DT8A 4M22A 2ZUFA 4NOMA 1KI7A 2CCKA 3B7PA 4EHNA 2PZFA 1ZIDA 4Q48A 4YRCA 2WJYA 4WA8A 1VFNA 1SXJA 1H0SA 1DC6A 3WRYC 2XRYA 4IUBS 1IVSA 1K7YA 3B8EA 3LYHA 5DNUA 1QIIA 1P72A 1KKLA 1VQ1A 1VJ5A 4X61A 4DPMA 1B6RA 3VOAA 5BURA 1MFPA 3E9DA 2R1TB 3HKDA 4D97A 3LOUA 2HW8A 1I4EB 2CMGA 4HLUA 3GP5A 4K0KB 1I0LA 4JC5A 1C0PA 3UFXA 4ZGGA 2QE7A 3BS4A 4QOEA 3GEDA 5J4KA 2CDBA 1CF2O 1FRQA 1HWYA 1T4CA 2HT6A 3EE6A 3M9XA 4XRRA 1CR4A 3CRW1 4IJWA 1L5OA 1JQDA 2WINI 3CKYA 2JLXA 3WXBA 4DA7A 1UBUS 4E5MA 4JITA 5J63A 1P91A 3UIEA 3PWZA 2QRHA 5DCYA 5J5VA 2J87A 3WLNA 5IH3A 4V2IA 4ZMSA 4KN9S 4JODA 4DG8A 1X7XA 2JVJA 4IH1A 1RPJA 3L5OA 4EW1A 4IUDS 1IOZA 5IHPA 1DAIA 1RPNA 2I62A 2WVJA 3DTVD 3QFFA 1OYOA 1R0LA 3U0BA 5H9WA 4D43A 3OE4A 2QS9A 3D0QA 4FGKA 1NXXA 1VMAA 4DC9A 1N77A 2HLHA 4WY5A 3LBNA 5F9HA 3AF6A 3AI7A 4H31A 3CCFA 1S2MA 1PK7A 2N3ZA 4ARVA 2ZYVX 4CUJA 1XF9A 3OTHA 2AH5A 2PJDA 1DCFA 3OQJA 3OCJA 2BP7A 4M1SA 4RY9A 3PEWA 3AR5A 3V6MA 2XMBA 1B16A 3R40A 4O4IA 1KKMA 3IMFA 1Z3IX 3KZOA 2R5NA 2IV2X 5LP6A 5EQDA 3DE1X 3P9IA 2GXUA 4I5EA 1P5RA 1F5SA 3DC2A 4MKHA 3HS3A 4ZCIA 1JIUA 1RZUA 2JHPA 5CPFA 2J9FA 5B30A 3AVVA 3N70A 4KVAA 1WL8A 1SQ5A 4WOBA 2XJ4A 2LWIA 3B9RA 2A0UA 1GL3A 1JNXX 1M6WA 4NXMB 1SOWA 4QL3A 3OMWA 2FUNB 5FOTA 1LI5A 2WA2A 1IN4A 4BWYA 4CU5A 5HXAA 3E9NA 1GTMA 5FD8A 4D0GA 4PW0A 3RASA 2ID9A 3DLHA 4KFCA 4B3SB 1TFRA 3DA8A 2I3DA 5AKGA 3T15A 4LJ5A 1DAGA 4OFZA 2CT8A 3IQZA 2OGUA 2ORWA 1CP3A 4MVWA 1LSOA 5F78A 1NJ1A 2F3UA 2VBGA 2VPIA 2EIHA 3KTFA 1EGMB 2I1WA 1FSPA 1PK8A 4DDUA 2VDKB 3GJ3A 3U44A 4RHEA 5G0WA 2DG2A 2XCTB 2CYBA 1TU3A 4B7AA 5A1JA 3ABZA 1TZMA 3QI2A 2AW5A 3A1WA 4GUDA 4QOFA 3W7VA 4PNPA 1RQRA 1VE5A 1T29A 3QE3A 5GGXA 5KHLB 1KVSA 3JQ9A 2CJFA 1P0IA 1LDYA 3WOHA 2V55B 2A5LA 3LO8A 1RQGA 4R1MA 4XJTA 3PSAA 3CRMA 4GX5A 2ZYIA 5JC1A 4NK4A 5AW7A 4OV6B 3E5MA 1J9EA 2O3SA 3IUPA 2VDWB 5GV7A 3DUWA 5FIUA 2PXXA 4R1NA 1XZBA 1V0JA 5LZ5A 4OKSA 3G0OA 3MAAC 3EFOB 3ZG6A 5KX5A 1V3UA 5CT5A 4EFKA 2I8AA 5FADA 1BHO1 4ND5A 3H4IA 1IZ9A 4JKYA 1UBFA 1G55A 4F9GA 5JH7A 3IR5A 4LF4B 1IHYA 4RW0A 2YZMA 1L4GA 2BUBA 3GAMA 2QV7A 5JO9A 1AURA 1EE2A 3BSWA 3NHWA 3N5KA 1Y81A 4QGHA 5CITA 4KPYA 1Z36A 3VNQA 1AZLA 3EZ7A 2H51A 4LPKA 5ALTA 3AYZB 4N8DA 3LO5A 1L5WA 3CSSA 5CBKA 2AJ8A 2NZJA 4QDZA 3WAKA 1FDVA 2E49A 2PLRA 3GVPA 1AG9A 5KYKA 4P5DA 4TTTS 3NEYA 1QRUA 3ZWKA 1I7NA 3UOAB 1XZNA 1EVKA 3LTEA 2DYKA 1ANKA 4TS1A 4Q12A 5DULA 5EKXA 3SHTA 1Q84A 4TV8A 1YV9A 1A8UA 4E3WA 1TTPB 4NE2A 5ES3A 3PDIA 3M4YA 4HUQB 1GGHA 4CG3A 3LHDA 4ES6A 2F17A 2GXQA 4KBFA 2B8EA 1DJLA 3FTNA 1NQTA 3B3JA 3WWZA 2BMDA 2IOQA 5HP4A 3HSYA 1CIJA 3KOMA 3PE3A 1P5ZB 1LPSA 1EEXB 2OAEA 1D07A 4ZVOA 5KNCH 5KWEA 2VSFA 2YVQA 3T5AA 2BKEA 3ICVA 4FWBA 5BNWA 3GPLA 1TRHA 1OYVA 3D3JA 3EQ7A 1OH6A 2UZIR 1Z5WA 1XELA 1TUBB 1ZI9A 3LOPA 4IILA 3MYYA 4X7BA 3ZE9A 3G0BA 2X0NA 1V8OA 1MU0A 2IA5A 1XR3A 2EGGA 5ALHA 2NPIA 4YASA 4BQRA 5JDIC 3QA3E 1YQWA 3GT7A 4CGZA 2DOKA 4UM5A 4B5LA 1GLGA 3JYOA 5DHSA 4AY4A 1LF0A 3FA2A 2J45A 4S2UA 4U7GA 4YGYA 3T41A 3ZD8A 3IAHA 2XMGA 1BN7A 3BH6A 4WZBA 1FNSA 2FGKA 4B71A 1QE0A 1V1MB 2YH2A 3LY9A 4BL5A 1JBQA 5JU6A 3IIEA 1TU4A 2A1UB 1W0JA 3SE0A 4OUDA 4YFVA 5A62A 3VTZA 4RADA 2D5BA 5CT8A 4P2GA 3OH8A 1QRRA 2Z5GA 1U8YA 4TUYF 4DHWA 2I80A 1OC4A 3RRMA 2B8WA 1EUQA 1QV7A 3HCRA 2EIXA 1J09A 3L06A 4K40A 4ZVPA 5JZ9A 4JBLA 1MN6A 1PN3A 4C6SA 4JXKA 1A9PA 2HCFA 3PQFA 1NQVA 2FRXA 3W77A 2DUMA 1ARZA 3BHJA 3G88A 3ZD9A 3KSAC 1JHPA 2CFOA 3RYHA 3DYVA 3B20A 2PWAA 3AL0C 1KDTA 2HMTA 1JDVA 1UMDB 1Q83A 2QYSA 5M29A 1XSEA 1UWCA 4QYMA 3FPEA 1F51E 1ZZEA 5JVDF 4TRMA 2O8EA 1R6XA 3C7TA 3V2GA 1XMIA 2QORA 4M86A 3T9FA 4BIMA 1NW9B 1ILEA 1Z56C 3RFTA 1HYHA 3BRWD 4P6VF 1ECLA 4LYFA 3U3DA 1DG1G 1DB3A 4RIGA 2X77A 2GBLA 4A15A 2OPBA 4MYCA 3QEOA 3TW0A 3LUPA 2HJGA 1DXOA 2FFQA 3AXTA 5C7YA 3I2JA 3KDAA 5K4AA 3OURA 5AJXA 2GWHA 4J7UA 3TZBA 4S1PA 3RD5A 4RTKA 1UEIA 2OYSA 1F4LA 2RONA 3H5TA 4E1BA 4M60A 2PJRA 2HSEA 5BORA 2OGTA 3JQCA 3A4MA 5LOVF 2MTBA 3TTUA 2ZR7A 2OSBA 1FU8A 2ZIXB 3KT0A 4R3UC 2GGSA 1WHSA 3D43A 5AHKA 2BFDB 4JR0A 3SQWA 4TZ6A 2YIJA 4TS3A 4EUFA 1E58A 1OA1A 2XZTA 3QKRA 1SUSA 1ZG3A 2PU5A 1XNHA 5FR1A 4A2CA 1Q7TA 4NF2A 5LYJB 1U65A 1VHLA 1I3MA 2Q1UA 2E2WA 1CPYA 2JGEA 221PA 2VJCA 2UYHA 1NJSA 1KJIA 3V8NA 2Y71A 1SC1A 4OVKA 3IT2A 2EX0A 3CR3C 4JLNA 1G5FA 5EZYF 4OI0A 2C97A 3LA8A 2CUNA 1ZEJA 2RHBA 1T6XA 3BSYA 3L8HA 1KDYA 1K7CA 2ANBA 1NASA 2O3RA 2X5NA 3ZV3A 2A92A 3I2YX 3T95A 1Y82A 4DMHA 1BEEA 1BX3A 1PFKA 3UAYA 3T5CA 1TF5A 3OMLA 2G63A 2QW1A 3BIOA 4R1TA 3ZD7A 4L78A 1HF3A 2P3SA 1QXSA 3HSSA 4IW3B 2RCYA 3B52X 4UTVA 3TLEA 5EJ8A 3L8EA 1XQ6A 5AM5A 4OUKX 1GZSA 2VN8A 2JCVA 3OUZA 1Y34E 1RM0A 4R2KA 4D9GA 3AFNA 1U9YA 4JNKA 1E64A 5CP8A 4DJDC 2G25A 3T35A 3D7RA 2VATA 5DGTA 5EAIA 3NTXA 4YT2A 4UXJA 1QCCA 3E8XA 5TRTA 4D57A 2NU7B 4FW9A 1HY3A 2WU4A 2H54A 4OU5A 4IDEA 1DBIA 1YDMA 3WL8A 4W6ZA 2QM3A 3M1LA 4TLLB 2VJAA 3JZAA 5TGTA 1KO1A 2RFLA 1N8TA 3HA2A 3KQMA 1PWZA 2RGRA 1N1EA 4V0KA 2J30A 2J3QA 2WB2A 3K0EA 3LM8A 5B12A 3DOCA 2ZB7A 3OE5A 3R3VA 1DPGA 1JYFA 4M88A 1FJGB 2OMEA 4JLBA 2IEIA 1P9RA 3L1KA 3OAAA 4MCAA 3ZW9A 4REQB 5JZBA 4CMIB 1V45E 1ZM4A 2WSSA 3RSGA 4DJAA 3K16A 4YJGA 4KCGA 1W94A 2C4UA 4EB6A 1GL7A 5IULC 2B4KA 3RJ5A 4DWOA 3AESB 1DADA 2X8BA 3FTCA 3R3UA 4LMAA 4MGIR 4OBEA 3OZFA 3O8BA 1A3CA 3CE6A 2AWOA 4Y0AA 3U3JA 1E9DA 5L7YA 4DL9A 1SEVA 3GRCA 2XHZA 4DHEA 4ND2A 2UZ1B 5EE5B 1Z82A 5A7FA 1E1DA 4BFVA 3FE2A 1NONA 3O95A 4K9KA 4V0RA 3KETA 3EEQA 5EIAA 4CMEA 4KXYA 2GAJA 2WSLA 3GWZA 4F9FA 4PYNA 4A36A 1GSHA 3QVWA 3EB9A 4AL4A 1P2TA 3ANSA 3UYKA 4JEUA 1PS9A 1ZH0A 3HM2A 4ZHSA 2R1VA 3D6TB 5AVYA 3W6NA 5BY2A 3TOCA 3BTUA 4IKOA 3MRTA 3V7WA 5AHRA 1NI4B 3KOOA 3MIZA 4CETA 3I3SR 4Q5IA 1J07A 1NV8A 4MV5A 3X43A 1NBHA 4JC0A 1ODLA 4N03A 3A6HA 2Z2ZA 4HWSA 2Y92A 1SVSA 1UZNA 3AHHA 3HGQA 1NY6A 5IJ9B 3USZA 3QVSA 4MW4A 1B76A 2R8BA 3K8ZA 3THXB 3LP8A 1A4XA 2NVOA 1IDOA 1RLUA 2W11A 3RVLA 1A5ZA 1ZGAA 1E1KA 4RZ2A 2AXEA 1ZSVA 1RAEA 2BTQA 2X5XA 4MRMB 4X8MA 5EFOA 4AKEA 1JDSA 3PPVA 2LE0A 1HG1A 1SH7A 2WWXA 5KMGA 1AGXA 4IHJA 4GOMD 3N3AC 1S3IA 2BFEA 4QYTA 4JYZA 3NKLA 4UJ3A 4NJEA 2FPLA 1W36C 4CIWA 5KQPA 4QDTA 1NLYA 1QS0B 1FTYA 1X9IA 5JHGB 3RC1A 4N01A 3A1NA 3B48A 1Z07A 4HZUA 1UMCA 4ZOAA 4BKMA 1PR1A 5JCXA 1T0BA 2YYYA 3P26A 1JIIA 1M6EX 1L5VA 3WK7A 4ZZ1A 4BXOB 2SECE 1FYVA 1KEUA 3I2KA 3K9FC 4MRAA 3LT2A 2CWWA 4OQNA 5KJ1A 3OCWA 1QMGA 3NOQA 1N5IA 2RKBA 4UUAA 5JNUA 1KQ3A 2C77A 1OKKD 3IAM1 2V6MA 1ISGA 2HY7A 3KQVA 1L5QA 3TMKA 3FZEA 5BSHA 1N0VC 1JNYA 1GGJA 1GPMA 1P7ZA 1WZNA 1F0PA 2VTDA 3A1UA 2BBOA 2CD7A 3I39X 3M4XA 3PE6A 3L4BA 4UTZA 4F2GA 1N78A 4LJLA 4BLPA 2JGFA 4YO8A 4PHTA 3TB4A 2B8JA 2FG7C 3ANMA 3FDZA 3LCVB 1E6EA 2O0JA 3AEQB 1RHRA 2AUNA 4IJMA 2RBEA 3D1LA 3IV9A 4W6QA 4OFBA 1NWHA 3T12A 1GGVA 5U4QA 1DKUA 4DLYA 3ESDA 1HTBA 4EG3A 4IF6A 5K05A 3SSNA 3D2LA 4AURA 4MX8A 4B3XA 1VHJA 3RM3A 3W8DA 4CF6A 1K6IA 1K8XB 2O7NA 3LA6A 4MDFA 2GETA 1QO0D 2J4DA 2IVFA 3B9PA 4IMPA 3WO0A 1SWVA 3U17A 2ORED 3LRXA 4LN1A 3L0SA 3PCXA 1D2NA 3PD0A 1DU4A 4LDAA 4YJ2F 2UXBB 3ED1A 4LQDA 4IHQA 1G5PA 1NX9A 1XRRA 1CETA 2ZQ5A 3ZBUA 2QROA 4KEAA 1XLUA 2HCBA 1IHOA 9ABPA 3EFEA 3IUNA 1W59A 1CZOA 3LV8A 3DM5A 4K87A 3Q9LA 3NUZA 4P81A 3ETHA 5E2AA 4ZVKA 2QD3A 1X3SA 3VKUA 1XEFA 1DC3A 3IE0A 4KL8S 2B5OA 3OZBA 5KREA 2EVWX 3JQ8B 4C6TA 2A9QA 1UJ4A 2C84A 2RCNA 3V4OA 4DPKA 4JXZA 1RQLA 2GK6A 5L3ZA 2Q3HA 3M6FA 4Z7OB 3IVMA 3WLJA 4A1OA 3CRVA 3CWQA 1NYQA 1BH2A 3TSYA 4EPVA 1WXXA 4Z2YA 3QKWA 3UAVA 4GM1A 2ZRMA 3C5CA 1H2EA 1UL1X 4NU0A 1P39A 2FAXA 1L4HA 2VAMA 3G2KA 3T4PA 1GT6A 3I9V1 1V8FA 1YONA 3ZJ5A 4E08A 4LSWA 2ZTLA 1Y4ZA 3R3HA 3THWA 2B4RO 2L19A 1A9TA 1IOLA 1NSFA 3AP3A 4O4HF 5DPMA 3U4HA 1DE0A 1DBWA 1M1YB 2I4NA 4ARBA 5CNIA 1E7WA 4EZIA 5IT5A 3HDHA 4GL4A 2DEUA 4C05A 2C31A 3RKSA 3WLPA 2AK2A 4G8CA 4TL7A 3ZUGA 4X1YA 1GN8A 3BFJA 4NJMB 1XMOB 2ENUA 2WP8J 5FPPA 1VM6A 2GCIA 2Z2XA 3A2LA 3GGDA 3QPUA 3ID6C 4MV0A 3RTCA 5KWSA 4QM6A 3I9LA 4Z9YA 2OMKA 5HIAA 5D5QA 4IRUB 3L4EA 1P31A 4N7BA 2E4UA 3E3OA 4LRWA 2R86A 2FSUA 4RZXA 4AIRA 1Q2UA 4B48A 1OI2A 2XKAA 2PG3A 1II0A 5C1OA 1DJPA 1S8FA 2C88A 5G02A 2B7LA 5CA1B 1Y0BA 4Y2QA 1KO4A 1U8UA 4LBVA 1L5HA 4MQUA 1YBVA 3BHNA 3ZWPA 5ES4B 4R2WA 2VQFB 3H5RA 2HK8A 1A2OA 1J00A 2H2FA 2VHWA 3G0IA 4RZHA 1MJGM 3WIEA 1C7JA 1JI3A 4PZ9A 3R4VA 1IN7A 1MC1A 1RXVA 3TLJA 4PICA 2WYWA 4C4XA 5ALJA 3JPWA 4HFNA 4G97A 4O1MA 1C3VA 2JAWA 4QM7A 5CNKA 3F7NA 4K1LA 3AUUA 3SS8A 3OM9A 3QA9A 5TT1A 1YCHA 1GRNA 3ESYA 3EZ6A 2HXSA 3N2KA 3IBYA 4XGQA 3SJAA 3ZWCA 1VG9B 5A5DA 5KNCD 5KVCA 1AV7A 2D7CA 4BP3A 4BLVA 1XTBA 1HPLA 1R4MA 3IRUA 2W6NA 5GZ6A 3WYFA 3K1TA 4L2IA 2QTCA 4H59A 3KYCA 1ZMRA 4R9RA 2OYRA 4US1R 2D0PB 2DR0A 3HCOA 2P8JA 3Q2IA 1YF3A 1VKHA 1JGTA 1M6VA 3DDHA 1K6XA 1CB7A 3F5MA 3K9CA 4FYWA 4NBVA 4P7FA 4RVGA 4HDCA 5KQLA 2B7CA 5LBTA 3BZBA 1RC8A 1F1JA 5T4BA 2FVXA 5CG2A 3ZLVA 4MWSA 2BZGA 5D5HA 5CDFA 3HB7A 5DTIA 1JSRA 2CYAA 5FWNA 2PRYA 1CZUA 2GCNA 2X8AA 4GMKA 3WIBA 1IXSB 4S12A 4EARA 1R5JA 3NEAA 1B7GO 4HGQA 4QULA 2ZROA 3IMCA 4DYDA 4TSKA 1EVQA 3A10A 4TXHA 4UD6A 3EIHA 4GSLA 3QHPA 2QT0A 4RJJA 1Z0AA 2AMVA 3EK2A 3GLUA 3K5IA 4L95C 3T1QA 1W36B 1KJNA 2IEZA 4DM3A 3ZHTA 2UU9B 4EZEA 3JQBA 5HKAA 3AFOA 5KQRA 1UMBA 3M70A 4BP9A 4DG9A 4DABA 3NDIA 4O5OA 2VLIA 3ER6A 5K3FB 1IJEA 2FPPB 1T8PA 1UJMA 2PBRA 2I5PO 1LNQA 3CYFA 2QE6A 3RK0A 3BB3A 1CY7A 3BMXA 4MVJM 3P5BA 4OSOA 3T9DA 2VRNA 2WEKA 3N2NA 1BSVA 2RJOA 2RK3A 3E8SA 4ARIA 5KIAA 4GEKA 4RBNA 3RB8A 3WAGA 5EESA 4B3HA 3CNLA 4DREA 1QZUA 1USUA 1NMZA 4Q3CA 2ZAOA 4BFYA 1F3OA 2QN9A 1ISIA 2A5DA 4GZ5A 1E9SA 2XECA 4TSFA 4YRNA 3EA0A 1AMNA 3SF8A 5GINE 1P4SA 1F12A 4M0DA 1TJ5A 2O0HA 4BNWA 4DQ0A 4FONA 2HWWA 2HFKA 3AG5A 2NO1A 1DOHA 4URUR 1AQUA 4QEZA 2RH5A 4RHYA 5HJEA 2HQ1A 2RHMA 1R4NB 1A8HA 2I22A 5EZQA 2Z6UA 2BT4A 5IJAA 2LIVA 1RWVA 3MNFA 3DGEC 4S04A 3C43A 5HA5A 1H3NA 1LW6E 3OO0A 1VE3A 1E1CA 2SKDA 3JARA 1XMJA 3NC1C 3BICA 3QBTA 2IDKA 2V7XA 3IHWA 5A3RA 1UR5A 4EDHA 4MINA 4C3ZA 1UOPA 4D0LB 4DPLA 3I76A 3P0IA 2X5KO 1Q7BA 1QMPA 1G1MA 2AI3A 3OX2A 3U48A 1N2SA 5GONA 4B6SA 1ZGBA 3MJTA 3H1GA 3TRDA 3S2UA 1MQAA 4WINA 5AVSA 4NZ9A 2WUFA 4PSKA 1VLVA 1YKSA 5IFLA 1KP3A 3ZUPA 2FVYA 2WWFA 2XTAA 1EG2A 4HQ0A 2OC9A 4HDSB 1VIVA 2QDXA 3QUCA 1SKYB 1KEEA 1DC4A 1MEOA 3KEMA 5HKKA 4PAQA 5EWJB 1V5EA 4LJRA 1JFRA 2X0EA 3AXSA 3IT1A 3OP1A 4E0BA 1NHWA 2QKYA 1JZTA 2XOXA 4HH0A 4DLBA 1JALA 3A6LA 3ZI7A 4BO6A 4YXWD 4HAOA 5TVGA 1CUUA 2C5SA 2WFAA 2P3QA 4UHHA 1WABA 1YR2A 2O8CB 1U3UA 2P7HA 3QKUA 1XVAA 4YT5A 1YKGA 2AI1A 4JUBA 3E7DA 4Q7MB 3V42A 2AZDA 3AP2A 2M6LA 4B74A 2V59A 4FQ5A 3RUDA 3EPHA 4IQ4A 5GVSA 1UBSB 1Q17A 1MAHA 1XRQA 3K9LA 3JD1A 1P4RA 4L8GA 4Z0TA 3I05A 3IVXA 4DV4B 1MO6A 1ZNYA 1Z35A 2BHRA 3HRHA 3WGGA 2O2SA 5JMTA 5BOSA 3DEJA 5CB4F 3WYCA 3AHJA 3DDCA 4U9IS 4FYYA 2DWOA 4PG7A 4WL0A 3T1VA 4D9NA 3NTVA 4KO4S 3LSTA 1VECA 1WR8A 1NVMB 1PKXA 1Z15A 1J1UA 2CXPA 1R0WA 4N39A 4HFJA 5TEWA 5CFNA 1DBRA 1D2MA 1GILA 1UKCA 1NR5A 4KC0A 3ANLA 4QYIB 4RY2A 4WHMA 4FLEA 4H9GA 4BVJA 3MTIA 1EGQA 4IV8A 1L1RA 4CLRA 3OQBA 5KYWB 1HQDA 4F11A 4MW6A 4KQ2A 2EL7A 4GAEA 3K9BA 2FW8A 2WC1A 2ZWAA 5FPYA 2VTBA 2VFAA 1DVRA 1H1DA 3C8UA 4L6CA 3W5UA 4MR7B 4EHHA 1JEYB 3JQAB 1SCKA 1Y3HA 2XYQA 2YN2A 2YY6A 4I55F 1K6JA 4X97A 5EUMA 3VBCA 3WIDA 1BGVA 4HAXA 1Q44A 3TUIC 3PYXA 1LTQA 4ZHQA 3R3SA 2O2ZA 1QX3A 3E05A 1NU8A 3PICA 2R85A 1Z6XA 2KW5A 1Y5LA 3KALA 5FWAA 1RBZA 4WGFA 3AI3A 4AULA 1SIUA 3RNOA 5CD9A 3FZYA 3ILYA 1Z68A 8GPBA 3BXFA 2AG5A 4E1VA 1Y7PA 4J76A 4BPBA 2W8BB 1V2HE 4N18A 2XCLA 1UDXA 3RT9A 1CUJA 121PA 1NZFA 1FFSA 2W90A 3NATA 4DLUA 4JQCA 4P92A 4TV9A 4V3CA 2F2TA 2CMFA 4AS3A 5JSYA 2YYAA 3K4PA 1G59A 2A3NA 3WZLA 5DYYA 4W7IA 2I03A 1OMOA 1QFZA 4GE0A 1QSGA 2DT5A 2X9VA 1J4AA 5AXBA 2MSWA 3OKPA 3ETDA 5DNWA 5ICCA 3C1AA 3SDSA 1U0RA 4UM7A 5I9TA 5KC9A 1UPBA 1O6FA 2Q62A 1XCBA 3CPEA 1YTLA 1JE1A 2XWJI 1IQUA 1VB5A 3UWOA 4I50A 4MROA 4C29A 2IZ5A 3VZPA 5FDFA 4R2JA 3FOAA 1BJTA 3AP1A 4IDNA 4Z9AA 3ESCA 3AOGA 2BFNA 1VRCA 4X90A 3DP7A 5K0TA 1JLRA 4ZU3A 2P2NA 2PRJA 1HNWB 1JDTA 3FYUB 2V5VA 2YZGA 3HO8A 5H9VA 3K35A 2I8LA 1B1AA 4AECA 3ZCQA 2QMZA 3CZCA 3D4LA 4Q7EA 4OHZA 2C82A 2C04A 2VAPA 2GUWA 4CBVA 4YCDA 5U4XA 3LDHA 3IT3A 3VJMA 5C53B 2JLAA 2HDHA 2O8DB 1PZXA 4KUGA 3GT3A 5C52B 3HFJA 1FMTA 3GVCA 1NU6A 4M7PA 1E9FA 2BGJA 4BFUA 5AT1A 4ALIA 1PFYA 3UHJA 5CX1A 2X23A 4Q66C 2GBGA 4BCCA 4Q3LA 5CLHA 3OKFA 3UBTA 3KOYA 1WSBA 1WB6A 1O08A 2EKPA 3SQDA 1BRTA 1QU3A 1Y4AE 4FOOA 4KPUA 3EG9A 5IZCA 2QMHA 3S1AB 2AL7A 3B1XA 1CUAA 3BXZA 2JL1A 3WBJA 4DANA 3RFFA 4RGQA 4F5ZA 4R0MA 4LQLA 2HU8A 3PKJA 4QYSA 2G4VA 4IMIB 1N3YA 3PDCA 4L4XA 5I8ZA 4OLJA 2BELA 4BO9A 1AQ6A 5AW5A 1PG2A 2G1AA 2GVNA 1DIGA 3C8MA 1GU0A 1OOEA 3WSTA 4GMFA 4HYTA 4C4AA 1HL7A 4K9RA 1Z0IA 4RABA 3C87A 4HSGA 2K5UA 2RHTA 4BEVA 1F14A 3SD7A 3BB4A