2BISA

Structure of glycogen synthase from pyrococcus abyssi
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
440
structure length
440
Chain Sequence
GSHMKVLLLGFEFLPVKVGGLAEALTAISEALASLGHEVLVFTPSHGRFQGEEIGKIRVFGEEVQVKVSYEERGNLRIYRIGGGLLDSEDVYGPGWDGLIRKAVTFGRASVLLLNDLLREEPLPDVVHFHDWHTVFAGALIKKYFKIPAVFTIHRLNKSKLPAFYFHEAGLSELAPYPDIDPEHTGGYIADIVTTVSRGYLIDEWGFFRNFEGKITYVFNGIDCSFWNESYLTGSRDERKKSLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELEGWARSLEEKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRDIITNETGILVKAGDPGELANAILKALELSRSDLSKFRENCKKRAMSFSWEKSAERYVKAYTGSIDRAFDFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLGA GLYCOGEN SYNTHASE
publication title Crystal Structure of an Archaeal Glycogen Synthase: Insights Into Oligomerisation and Substrate Binding of Eukaryotic Glycogen Synthases.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Transferase
total genus 165
structure length 440
sequence length 440
chains with identical sequence B, C
ec nomenclature ec 2.4.1.21: Starch synthase.
pdb deposition date 2005-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00534 Glycos_transf_1 Glycosyl transferases group 1
A PF08323 Glyco_transf_5 Starch synthase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2bisA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2bisA01
2QN7A 3G2LA 2R4UA 4RIFA 3FROA 4MHSA 3UYLA 4RENA 1SXPA 1Z62A 1O6CA 3BEOA 3MS4A 4MI9A 3S2UA 3H4TA 1FC0A 5IKPA 3QKWA 1L5WA 3Q3IA 3CUYA 4YUAA 1C8LA 4REMA 3RHZA 3CEHA 3VDNB 3T3GA 1P4GA 3OY2A 1E4OA 2AW3A 4RBNA 1NVKA 4XIFA 1JG7A 2BGTA 4CDRA 1IXYA 3G2NA 2QLMA 3E3OA 2QN8A 3T5TA 5HXAA 2BISA 2X0FA 2H1FA 2QN2A 1WUYA 4GPBA 1L7XA 1GPYA 1NOKA 5DLDA 2QRPA 1XOIA 3MRVA 1UQTA 1P2BA 2QLLA 3WC4A 4YI3A 3UYKA 1UZUA 1NZDA 4KQMA 3OTIA 5IKOA 2GPNA 3L7CA 1YA6A 4BQFA 3IAAA 1JG6A 4N3BA 4BQIA 2X6QA 2XGOA 4CTOA 4X7PA 3T7DA 2GPAA 4Z5XA 4W6QA 1RRVA 1IIRA 1EXVA 3QHPA 4HWGA 2FETA 3VDMA 2GT1A 2QN1A 4NESA 3CX4A 4MRAA 3OTGA 3ZCPA 1ABBA 1UQUA 5TMDA 4KQ1A 1LWOA 1QM5A 1Z6QA 2VG8A 3CEJA 2H1HA 2P6PA 1GGNA 3CUWA 1NOJA 3IA7A 1NZFA 4RIIA 1J39A 3MQFA 4MI6A 3ZCRA 2IV3A 3MTAA 5C1DA 1AXRA 1L5VA 4M7PA 2IYAA 3SYRA 3OKPA 3TAXA 4XI9A 1Y6GA 4FZRA 1WV1A 2JZCA 2IUYA 2F3SA 2R68A 3MT8A 2GM9A 4M83A 1E1YA 1F0KA 1GPBA 3D0RA 3MTBA 2XA9A 2G9UA 3C4QA 4F97A 3WADA 4NEQA 9GPBA 2XCIA 3E3LA 3MRXA 3H4IA 2IW1A 1FU8A 1K08A 2G9VA 3C48A 2QN3A 4RIGA 3DDWA 4GZ6A 1C8KA 2AMVA 4M60A 1QKJA 2XGSA 3L79A 4MICA 1JIUA 1L5SA 4GYYA 2VSNA 3ZCUA 4YI5A 1FTYA 4LDPA 4BQEA 2IEGA 3HBMA 3S29A 8GPBA 3C4VA 3Q3HA 2XCUA 3HBFA 3MS7A 3DD1A 4MI3A 4WADA 4N3AA 1XV5A 1A8IA 2VSYA 2SKDA 1XC7A 5JTTA 5ENZA 3DDSA 1V4VA 1Z8DA 3Q3EA 4N9WA 3NP7A 2ASVA 2JJMA 2IYFA 1KTIA 1SXQA 2QRMA 3S0JA 1YGPA 1PSWA 2R66A 1JIVA 1P2GA 3T3EA 3OY7A 3NCHA 2GEJA 4N39A 3T3IA 3HBNA 3MSCA 1FA9A 4RIHA 5D00A 4MHOA 1XL0A 6GPBA 2ECPA 2XA2A 2F3PA 4EKYA 2ATIA 4RIEA 4EL0A 3BD6A 2ZB2A 2PRJA 2XMPA 1JIXA 3RSZA 3L01A 1WUTA 3BD8A 3RT1A 3SYMA 2X0DA 5I45A 3E3NA 4PQGA 3MBOA 4GZ5A 2SKEA 4AN4A 2QRGA 1P2DA 3OKAA 4KQ2A 1FS4A 1F6DA 1EM6A 1RZUA 5TMEA 2X0EA 3BCRA 1XL1A 1PYGA 3MT9A 2IV7A 4WHMA 2FF5A 2HY7A 1Y8ZA 3CUUA 3CUTA 4HLNA 2R4TA 1L5RA 2PYDA 2WTXA 5GPBA 3MTDA 3TOVA 2F3UA 1FTWA 4CTNA 2R60A 5DU2A 2G9RA 5TVGA 3NB0A 2YJNA 1FTQA 4RELA 2QLNA 2C1XA 3S28A 1C3JA 2QRQA 5LQDA 2Q6VA 4EL5A 2ACVA 3CV3A 1GPAA 3L7AA 1K06A 3T3HA 3OT5A 3BCUA 3NAZA 4LEIA 5D01A 3G2JA 3L7BA 3G2KA 2G9QA 2BGUA 2PYIA 1Y6FA 3ZCVA 3PE4A 1GG8A 3ZCQA 2QZSA 4AY5A 2AV6A 3VUFA 2QN9A 2QRHA 3AMVA 4NC9A 3L7DA 2PQ6A 3CEMA 2X6RA 3HBJA 5DXFA 2GJ4A 1P29A 4AMBA 4QLBA 3PE3A 2C4MA 1P4JA 2QNBA 4AMGA 3BD7A 2GPBA 4F96A 2SKCA 3COPA 3ZCSA 3CUVA 3GPBA 2F3QA 1FU7A 1P4HA 3NC4A 4AY6A 1VGVA 1PNVA 3NPAA 3VUEA 3RSCA 4N3CA 1GZ5A 3WAGA 3G2HA 7GPBA 1JEJA 4X7RA 1C50A 1LWNA 1XKXA 4F9FA 2AZDA 4GZ3A 3G2IA 2JLBA 2O6LA 4EKEA 2ACWA 3OKCA 1H5UA 1Z6PA 3ZCTA 1BX3A 2KS6A 1NOIA 2XGMA 4G2TA 4GYWA 3OTHA 4CTMA 4L22A 2C1ZA 1WW2A 1HLFA 3D0QA 3S27A 4X7MA 3NP9A 2VCEA 3O3CA 1PN3A 4BFCA 3T3DA 5JTUA 3D1JA 3BCSA 4X6LA 4FKZA 2FFRA 2GEKA 3TSAA 3MS2A 5TMBA 2OFFA 3GUHA 3EBPA 1B4DA 3BDAA 4EJ2A 1L6IA 2VCHA 1M5RA 2BFWA 2IEIA 3DZCA 1AHPA 1WW3A 3MRTA 2C9ZA 4WACA 1GFZA 1L5QA 2PRIA 1WV0A 5BNWA 3EBOA 2F9FA 3MT7A 1FU4A 1RZVA 1NLMA 2XA1A
chains in the Genus database with same CATH superfamily
3G2LA 3ADKA 4NRDA 2YNMD 5AOBA 3PGXA 3ZW8A 1GRRA 3DZGA 1RHQA 2EBUA 1EG7A 4RJTA 1R6DA 5BSWA 3ZDFA 4RX1A 1B2RA 1OBHA 3EDQA 3L0PA 2FZLA 1JHRA 1AF7A 3BEOA 5F23A 4XWWA 4MQBA 5JUWA 5AH0A 1EWVA 1OIVA 4HATA 4LXYA 2X7JA 3GJ6A 1VRVA 2OHIA 3DVQX 4C7JA 1PCXA 5I9NA 1JDNA 1RYEA 4BKRA 1YZHA 1CUGA 1JDBC 3O95A 4GVLA 2YMLA 5FI1B 2HB6A 1PS8A 3VDNB 4RTMA 5C4MA 3WJ2A 4FVTA 1YJ8A 2QAGB 4CWAA 2P9ZA 3R5KA 3ZHXA 4ITUA 1L5LA 1E4OA 1BGVA 2BI7A 1YQQA 4XDGA 3GMDA 3UOGA 4F93B 3GEDA 2BFMA 2H1VA 3HJHA 2IYWA 4G56A 3RREA 1TM1E 3TSZA 2H85A 4LCEA 1I2MA 1NJ2A 4PIVA 4DJAA 1BA3A 3VX3A 2FWPA 3G2NA 3QXJA 3GFSA 1JYFA 4C4YA 2QM0A 2QN8A 4FFMA 2JK0A 2N1MA 2ZJ3A 3PL5A 5HXAA 3PHLA 3OZ7A 3E4CA 4CKWA 4YS6A 1ENYA 1ZNWA 2I7CA 3HMQA 4IWYA 5AQEA 3FBGA 3D8RA 3RSGA 2XUZA 1JR3D 1RVDA 1YZFA 1T0JB 1XCLA 1UZLA 2ZUVA 3AG5A 5ALXA 1B0UA 1TLLA 2FW0A 1Z4LA 3T41A 5I7FA 1XOIA 2XI4A 1JXQA 2PUTA 3W9SA 2ZBEA 4B80A 5AK4A 1NVTA 2PKQO 4F4HA 5J4HA 2AK3A 5BV0A 5T67A 1S9DA 4WK2B 2VDRB 1FF9A 2V7PA 2QLLA 3OJCA 3UJCA 1EFCA 3CGWA 1NV8A 1P6QA 2VNAA 1SQGA 1PEDA 2BGJA 3QQPA 2ID7A 3F6YA 3WA6A 5KSWB 3FOEC 1UKZA 5L40A 1RQRA 13PKA 2W2VA 1MH1A 2YQ5A 3I2FA 4P35A 2VH2A 2IIPA 4ARIA 3L7CA 5B3KA 1LI5A 3DMTA 1QH1B 4MZDA 4BQFA 2BUAA 3GP3A 3N6XA 4TSKA 1GSIA 1YS9A 1HEIA 1R10A 2WUVA 2YWJA 1XO1A 3KQHA 1UXOA 5F76A 4WOCA 5A02A 4ESOA 1DKMA 1TKAA 3B7GA 1OBFO 1VECA 5CFPA 1ESNA 1PR9A 1TIKA 2KBEA 4Y6GB 1Z26A 1TJNA 1PF7E 2PRSA 1LV8A 5L7WA 1NFQA 2D1YA 2WD9A 1EXVA 1C3EA 1ML4A 3R20A 5TEWA 1R5NA 3GQVA 3I9LA 2FRXA 2PUJA 3WBKA 1BO6A 2PTGA 1E9RA 1LWOA 2A5LA 4H1TA 5IS2A 1V9LA 1B43A 4WQMA 4Y1EA 5AW6A 1CUYA 1IY0A 1XN1A 2QUZA 1E9AA 2WIGA 4XTCS 3PXBA 3F98A 3AW9A 3L7IA 4KMOA 4BNMA 2QV7A 1IM5A 2MOKA 2HKIA 4FZJA 4EZIA 4JAVC 4ZK2A 3N9IA 4M1OA 4YRBA 3ORHA 3KLOA 3CSUA 4M0LA 3ZYCA 3ICQB 4IOLA 7MDHA 2CLKB 1HT0A 3GZJA 1OLSA 2VEOA 4LYEA 3WRWA 4K03A 2BTQA 2P91A 1UKEA 5T3YA 1E2NA 3C3YA 4RF3A 3GJ7A 4CUZA 3GQBB 1GL9B 2QP4A 4AKGA 1XDGA 4C4ZA 3A9UA 2WTMA 4HDQB 4LG1A 1CW2B 1W4ZA 1SU6A 4IG4A 4JOBA 2E5FA 3TTWA 2CHQA 5HOQA 3BFVA 3AY0A 3G5LA 2P4UA 3D8TA 1U8UA 1CB0A 4OJNA 1O96A 2BIFA 2F8MA 4PW0A 4HH3C 5ILGA 5KHAA 5KNDA 3HVRA 3GT4A 3GNQA 4CM1A 2ACEA 2FWAA 4TXMA 4CRWB 2PGJA 5JRZA 3HG7A 4HDOB 1OFVA 1CUUA 2JFPA 2XA9A 5CFRA 2YJZA 2WKPA 3AFNA 4WN3A 2HBYA 4MR9A 2DR0A 1U2RA 2VQ6A 4MNTA 4B3JA 5JQWA 1O8CA 1FDTA 3OM1A 4OQMA 1PFUA 3JWPA 4UAUA 4F1WA 5AM5A 5GONB 5IU6A 1Z4PX 4CMAA 1A9SA 5FV7A 4CQLA 2NQ8A 5KYNA 4Q9HA 4ZAXA 2P5SA 5F21A 4YAGA 5JWOA 2W2PA 1U3CA 1SG6A 4FFPA 1Z7WA 1AGPA 1GPJA 4IXTA 1KY5A 2IW1A 4KWEA 4NATA 1W88B 2ZUTA 3B6JA 3C48A 4CG3A 4BMSA 3Q8MA 1XAHA 3T9FA 2XB2A 5B6PA 2HHHB 2GN0A 5SV2A 1BHJA 1RMQA 1USVA 3ND6A 4C7OB 3OI7A 4R9VA 2QD2A 3WJ7A 2C3OA 1E2UA 1L5SA 4GYYA 4JFAA 4G36A 2J3HA 3W8FA 5IXJA 3KXPA 3IBSA 5DGTA 1TK2A 2RGGA 3FAKA 4G0MA 3REFA 3EDMA 4IDCA 3U3DA 3LDUA 3ZJ5A 3L7LA 1IN8A 1G291 1P2VA 4J0HA 1HTWA 1HDXA 1LX7A 1SQ6A 3A14A 3PHHA 4FMDB 3UMGA 1RJGA 4TT8A 1L7MA 5JSYA 1EHCA 5JNTA 4M9CA 1IRXA 2ON6A 4X61A 3S40A 3SEAA 1WHTA 3EZ6A 1ZP6A 3SKXA 4JKOA 3V1MA 4DIBA 2A59A 3NQ41 2PZBA 2D2FA 1Z7BA 2A9KA 4DDMA 1DEXA 1UDRA 3KWLA 1VL2A 5F1OA 4DUPA 5AVXA 4HAWA 2O7RA 4HGZA 4CPDA 1NIPA 4H60A 3LYLA 1N6PA 3ZGNA 4HZIA 3S1AA 5IEJA 2K6GA 3QE4A 4J3JA 5F4BA 2JGMA 4G2NA 4G4SO 1IN7A 1EEXB 1V4VA 4RSHA 2FF7A 2VHUA 4XUEA 4JI5B 2JLZA 1VPLA 5JH7F 1QMGA 2FQQA 1RI4A 1JFVA 1WVGA 4X45A 2CMKA 1XLWA 4LNAA 3G88A 3HACA 4AY3A 4CR7A 1OIWA 1KJIA 4HGYA 1PAUA 1YVDA 1ZR4A 1EVJA 1SC6A 1SCAA 1WCV1 1MD9A 1X38A 2FE1A 4JI0B 4UEJA 1Z7EA 3QJGA 4KRGA 1Z0FA 2XEXA 3OT1A 2H3HA 5DM0A 5EUMA 4D9HA 4YCMA 4EQ6B 2BMVA 2QQ0A 2JI8A 1RIFA 3OY7A 5T4EA 4GSYA 1HO3A 4IDDA 4YMHA 2NO9A 1IUNA 2XNDA 3ACBA 5FWDA 3T1OA 3ZBTA 3OTWA 4PHTA 1BAPA 5HUQA 4KFRA 3OEHA 3RF7A 1J07A 2A86A 5FI5A 3SM9A 2ZIFA 2EV9A 2O2DA 4Z4EA 3DPSA 4DA9A 2H18A 4M54A 1EP1B 1EWYA 2DLNA 4QFDA 4CGYA 4RK7A 3TTTA 5KJCA 1VZ3A 3DC2A 5KYYA 1U0EA 4G4JA 1KGDA 2Z98A 4FFBB 3WK4A 3VMMA 2QSZA 4I19A 1DBVO 3B2NA 2I9KA 3PHJA 1VI6A 2HJWA 2MTBA 2PA0A 2H57A 3A05A 3ET4A 3N2KA 5KC8A 3ZVLA 5IUNC 2LDXA 1RAAA 3H0CA 5T57A 4M0DA 3PNLA 2H16A 3KQSA 1VHLA 2HQSA 2QQ5A 3NBQA 3JQDA 2YIMA 4GI1A 2FUNB 4MULA 4LJ6A 3GVHA 1XLVA 4O2AF 3TQTA 4CV0A 3RTEA 4E4RA 4IDAA 2BGIA 1NNEA 2HK7A 2FWBA 2OCGA 4C1BA 1VSBA 1LNSA 1AM4D 1FNDA 1D5CA 2VDQB 2REQB 4MAFA 4RVNA 2V7VA 1E2JA 1PLLA 2Q5JA 4B09A 3MBOA 2VI5A 1POWA 5H4GA 3BEDA 1DWQA 4Q18A 3EUEA 4ZOCA 2E4AA 5HKOA 2Y9PB 4ZODA 1V1RB 1YB2A 3JTMA 4FOSA 5EIOA 4C2AA 5ADUS 1UWKA 2VAPA 3R0IA 1U7OA 1ZJ4A 3O8OA 4P32A 5EINA 4AIIA 3CIFA 4B4WA 4DWOA 4E51A 4MKHA 3OETA 5EE9A 3QMWA 2NZXA 2WYHA 2VQDA 4C06A 1IONA 4GYJA 2IL1A 5LQNA 5DPMA 5G4KB 4WOBA 1YB7A 2CYBA 1L5KA 4BCBA 4ZOLF 1E7RA 2G1AA 3CS3A 3FX2A 4DY4A 5LKRA 5CBKA 2AMFA 4K5QA 1RZRA 2V65A 5JQGF 1IE3A 2IH4A 4JGBA 1SQSA 2HGSA 2V97A 3TBKA 2OY0A 2GK3A 3SQOA 2JFOA 3F7NA 5FWNA 1KI9A 2ECOA 2MMCA 1R0KA 3EVZA 5EZYA 5HJ2A 1V5FA 4BNUA 5A4FS 5LJIA 1J9ZA 3LHKA 3I12A 2PYDA 3IHKA 1IZ8A 4L57A 2HRRA 3WFZA 1O6ZA 2JATA 2C99A 4YMUA 2PU5A 3TOVA 1R15A 4HFNA 4QFBA 4AP6A 3KQUA 5EJMA 1M1NB 2FG6C 2QXYA 1OPRA 1USIA 3TAUA 1OAOC 2I7DA 4XARA 1G20B 1E99A 1MTOA 1ORRA 4ZQEA 4ADSG 1QIFA 2AFHE 1J49A 3K7EA 3D54D 3EDCA 5IYZB 1JR2A 2W2KA 4KG7A 4X63A 1FNSA 3B6IA 2NUAB 5CEJA 3EAFA 4ZARA 4X1KA 2A9QA 2IGBA 1G8FA 2G25A 4LRYA 1IBLB 3Q87B 5HM6A 1Z4JA 5AJUA 5AVSA 3SK0A 1YI1A 3KB2A 4Q34A 2ATVA 3DTTA 2Q6VA 3EXFA 4HQKA 4KUEA 2HV8A 1CY1A 2MIIA 1OI4A 2VP4A 4DDHA 5JHHB 1OJLA 2RGNA 4RZXA 1T9GR 1VSQA 4LYGA 3KZMA 1Y4UA 2O7VA 3ISTA 4K0RA 3T3HA 4CKCA 1QIIA 1QYDA 2FV8A 4RM3A 3T38A 5KS2A 1F2DA 2QNIA 4FYVA 3UPDA 4BDTA 1MAWA 2BEUB 4TX1A 2W48A 5CVTA 3G2JA 5CNMA 1UDAA 1EVQA 1PNQA 3OUZA 4FU0A 5A0TA 4G1BA 4WJLA 1KWGA 3HDQA 4DSOA 1RPAA 2EFJA 1R0CA 1XSEA 2FWRA 2Q3CA 3U49A 3AT1A 4I1YA 2YZMA 3Q88A 4UTRA 2XH8A 3DT6A 4QPNA 5JO9A 5TT1A 4MUEA 3UPTA 3WIVA 2OZEA 1RKUA 1SRQA 2D0PB 1FEZA 1MF7A 4Q5IA 5JSQA 2JASA 5DH9A 3PE3A 3FPLA 5CDFA 1BYUA 1P7WA 2VAXA 3JATB 4BZXA 3LUKA 1E6UA 1P4JA 1HUQA 4KLAA 1DAKA 2H4HA 2Q5QA 1O97D 3A9SA 3QIVA 5GTDA 1ULSA 1KAOA 4QTZA 3T9BA 5FA5A 2I99A 1A8SA 4L5JA 3UGKA 1PZHA 3OJWA 3RSHA 1NGSA 3IQXA 2AI1A 3ABZA 2HEGA 4YRCA 3R0VA 1QBGA 4JUDX 2VATA 5F3RA 4EZEA 1AXGA 2RFLA 3JARB 1KVTA 1WB5A 3KTAB 1U2TA 4PU0A 1ZICA 2HBZA 5C4IA 1Z0DA 5CTJA 3QKRB 5FUQA 3ZHYA 3ED5A 5HKBA 2BGRA 2CW5A 3JZDA 2GETA 3QY9A 3EA4A 4DF3A 2L82A 3A6EA 1HNNA 4MCIA 2CNDA 5JNRA 3VVBA 2PLWA 1J20A 4XR9A 1QCYA 1UADA 3CG4A 1YA4A 1V9CA 4LZJA 1JXOA 3SSAA 3W05A 2HW8A 1TIBA 1FYDA 1T3LA 4V39A 3DB2A 4CJXA 2CBZA 2WIAA 5HK8A 1OXXK 2A9OA 4Z9YA 5EJGA 4N01A 3ZY3A 1EBBA 1ZGJA 5E4TA 2V0NA 4PQEA 3G7UA 3OM8A 1IK4A 3C45A 4D1YA 3FOCA 4B44A 2EL7A 2WLSA 3MD0A 1WU8A 2BLLA 1CFZA 2JLBA 2ZI9A 4P4NA 5AW4A 3RAEC 3N5CA 2N1BA 3K6SB 1T9ZA 4E88A 2P6UA 2XJ9A 2NV6A 5F7ZA 4YRRA 4WTOA 2DUJA 3PFBA 3TX6A 3UA3A 4LOLA 4DS3A 1LPNA 2ZSUA 1LVUA 3MVEA 3UHOA 4A82A 1CEEA 3TJMA 1BXGB 2G72A 3WDMA 1XYGA 2XXAB 3TH5A 4OHWA 4UVGA 2V3WA 1Z12A 3R3HA 3MWFA 3O03A 3RSLA 4TWIA 2C4VA 3DMTC 1NAHA 3KJFA 2HZ7A 1LSSA 5FLEX 2FH5B 4ZVSA 2Y1EA 3R75A 3TW0A 3URKA 3PUHA 2DBVO 2Q1YA 2QM7A 1BSVA 4HUJA 5IJ9A 2GM3A 1QTNA 4OXQA 1TA9A 1YR6A 1Z45A 1MGOA 2YZ7A 1NXXA 3BWCA 3D6VA 2LKDA 2LUOA 4BO7A 1O57A 4D7AA 3HUDA 1EM8B 1E79A 3KR2A 4H3HB 4C4TA 1N7IA 3O2JA 2R6R1 2W0MA 3PPYA 4RF2A 1A7UA 1CCWA 3V3TA 2OWEA 4LSZA 4Q3KA 5IBPA 1QK4A 4DM3A 3C6QA 4DIEA 3PFKA 4DIOA 4E7OA 5MFZA 3ADOA 2G5CA 3TVDA 3BH0A 4BQQA 3REQA 4KXWA 1XRQA 3ZIAD 4MUFA 3ZZ1A 3LO5A 5EN4A 4B5KA 1RFLA 3DEHA 4MVJH 3Q9UA 3GJZA 3ASUA 4MLZA 4F2GA 2J45A 3RSQA 1ZA1A 1O95D 1JQJC 1N32B 2HA7A 1G20E 4ZHQB 2AE2A 2OUKA 4AZ0B 2Q3DA 2C9ZA 4NENA 4PYKA 3T0FA 1K5HA 2E49A 4NYIQ 5AKJA 3EPJA 1PGQA 1O1YA 1ZXXA 3WGIA 4DGSA 1Z82A 2XYGA 4NV3A 3BIWA 4EVRA 4RTPA 4LUCA 3CW8X 3PS9A 3L8ZA 2C88A 3BXZA 5FBWB 4HTAA 3F3YA 1P31A 5I51A 2VRBA 4R84A 4ZU3A 1C81A 1OT3A 1CJVC 4W6ZA 1QDLB 4D3DA 1Z8NA 2X1VA 5FJIA 5BYJA 3U16A 1JAIA 2GS9A 3HGMA 1X1EA 1IDOA 4A8JB 3EQ8A 4PCAA 2ZT5A 3SIRA 5LQKA 2XB4A 4CG2A 4AG6A 1QTRA 3OCCA 3DA8A 1M8FA 1FDVA 1GQ2A 1HOXA 2X3YA 2JCYA 1VYUA 3FPGA 1X7WA 1FMTA 3QXGA 5B1IA 3VR4A 4E94A 4OP3A 1R5JA 2HDHA 3MTQA 2BSXA 3O2SB 4Y6LA 2J0UB 3G02A 4YPFA 2VCYA 1WKBA 1X1QA 4MVJP 1LD3A 3B8EA 4NYMQ 4H27A 5AJVB 4AURA 4MS3B 1ADCA 1G64A 2AW3A 1C7EA 2BEKA 1TKRA 4C4RA 1PEKE 1D0IA 1UDCA 2J3DA 2VHEA 3AV3A 5CVDA 2G4VA 4EX7A 1DQSA 1BCRA 4FHCA 2ZWVA 3FYDA 4EBBA 1X7DA 4GC5A 4PCVA 4E70A 4CDRA 1HFKA 5J2TB 4BQPA 1XLTA 3GBVA 1HF3A 5C8YB 1H4SA 1EQAA 4OHKA 1GQSA 1L3CA 1JDJA 1EBUA 5CW2A 4BX8A 5K0EA 2BISA 2I91A 1GAWA 1TJYA 4Z8YA 4BNTA 2WFMA 1KAQA 3DKKA 1MO6A 3H5LA 1J2JA 4V0LA 1R8SA 2C3PA 4OI4A 5IDYA 3HRIA 2GTPA 4KJZA 4AZ3A 1II8B 1VMAA 4FFNA 5EJFA 3KHSA 5K09A 1I3CA 4NQZA 1MP0A 1M73E 3AEKB 3FUVA 4YJFB 2JGFA 2YV4A 3MXOA 4B5LA 5JW6A 2RD2A 1KVSA 3T0IA 1SZCA 3Q5DA 2J9YB 2G28A 4CQJA 2IY9A 4FR0A 1JA9A 1FRQA 2W22A 3BHJA 5HRUA 3UMYA 1X1SA 2RIRA 4CMJA 1CVIA 3K16A 5IBRA 4IHQA 1B3BA 1L7VC 1LNZA 1NUTA 3WRYA 2QV0A 1X7XA 1HMPA 2FN9A 4OYYA 1NZDA 4J7XA 2BTOA 2BBOA 4DRXA 1MENA 3EGWA 1ZW6A 2FP3A 2AYYA 3O4FA 4G25A 4U2DA 4HS4A 1YFKA 4RGVA 4DZRA 3H84A 2YYAA 1R4AA 2X6QA 4JZYA 2IKSA 3MJFA 1U9YA 3DVAA 3PDIA 4EARA 1PJTA 4PIPA 4G0OA 5C7IO 3KEFA 2Q1XA 4KRXA 1QPZA 2APJA 1OX5A 1PWXA 3V7YA 2O8EA 3KG2A 3PUYA 3PFGA 1R0SA 1SVLA 4FIZA 2HDWA 3OZXA 4ZGGA 2F3TA 3NBFA 3Q6IA 2HTFA 3QY0A 4JUCA 4MPJA 4PSAA 1V8OA 1SUDA 2ILTA 2CSUA 2YFQA 4L4YA 4X8HA 4KV9A 4YQEA 3VVLA 4ZVPA 4KR9A 4QUHA 3K0SA 4QYSA 3E03A 4KQ1A 2PEZA 2KJQA 1SKMA 5LDHA 1WUKS 1QM5A 3M9LA 3WL4A 2WWWA 4P4UA 3F3KA 2JLSA 4KAJA 3WYFA 1JHMA 5ALGA 4WLFA 3S8MA 5KTYA 1KEKA 4A2PA 2L42A 3PCRB 2QD5A 1YASA 2LD4A 4PZPA 3WGHA 5COAA 1QYVA 1HI9A 2P2GA 1IXKA 3LZ6A 3F5SA 4JSRA 4LK3A 3VR5H 4RZ3A 5K3SA 2E4ZA 2IYSA 3WB2A 6PFKA 2WUWE 1M3SA 3PD0A 3K35A 4RSRA 2NU7A 1DBIA 5CLGA 3ROZA 1ECCA 4M3NA 4MV6A 2GLUA 1U8EA 2E1PA 3FNRA 3MYYA 1QQ5A 1VJ0A 2YS6A 4IXMA 1CUHA 1XKTA 4ZT4A 4YONB 4B75A 4AY2A 1VHDA 1P61B 2QTNA 2ZLBA 3PPVA 4FZRA 4JV5B 2F1OA 3K71B 2BRUC 2J3KA 3GMSA 1NX9A 1WY7A 2ZB4A 1IAVA 3FRHA 3S5UA 2R9VA 1YIOA 2TMGA 5T8KA 4YRQA 1ISRA 3N2GB 1OWNA 3NVKI 2FP4B 2OCYC 1P9WA 4UMDA 2Y1OA 4BNNA 2Q21A 4G8DA 1P1RA 1COWA 3L4BC 3SEFA 5BORA 3DZDA 1FIUA 1DJMA 1KSHA 4WZZA 3WLOA 5JH7A 4BNHA 3TNYA 3ECSA 3HHEA 3BXEA 1GO2A 3H2BA 1FS5A 1HH4A 3KOZA 1QX3A 1G42A 2ZM6B 3BBLA 1H9CA 1UH5A 4YHBA 4HZUB 5A6VA 4UBOA 1GGKA 2BEJA 3B1ZA 3E3LA 3A1TA 2YNMA 2DKFA 2ORVA 3IDOA 4RWZA 2RGRA 1JA1A 1VJTA 3GJ3A 2QZJA 5EMHA 1RWOA 2AXEA 1U80A 3OQIA 4C5AA 3U4QA 1W96A 2ZJZA 3L1KA 5J4KA 4OKSA 1C1XA 2AJTA 3H2KA 3U44A 4RPKA 3ZK9A 4F8EA 1X0VA 3RRBA 1IQUA 1L6RA 1GCGA 1SQ5A 2C07A 2Y05A 3JWJA 4I5FA 5F2OA 2PIAA 3H2GA 3LWBA 5FUVA 4BWYA 4L76A 2CV1A 3AESA 1GZ7A 3VSCA 3PBKA 5DO9A 5JYCA 3QFSA 4JJ8A 3RWOA 1E0SA 1U9ZA 2OORA 1MO5A 2E48A 3WGJA 1NU6A 3GYGA 1G8PA 4FTWA 4WADA 4P81A 3KUKA 5TQ2B 4O2AA 2FWMX 3DQPA 3V8PA 5AICA 4KTTE 2P6NA 3R23A 2VSYA 3A3KA 1L7EA 2X2FA 4YREA 3V2GA 2R65A 3WICA 3C7CB 3ZWDA 2DTXA 1E6EA 2P9HA 2OENG 3PJFA 5JOQA 4WCFA 4DILA 4JQZA 2IXGA 2YRWA 2ZUUA 2AXNA 4PYLA 5TGDA 4E6EA 3F71A 4N9WA 3QYAA 3IMFA 4IIDA 1CERA 3THYA 4NZOA 3F6RA 3COWA 1Z39A 5A9SA 2C9YA 2Q6TA 3ZVKA 1JR4A 2P30A 3P45A 3E9NA 3T61A 1KK3A 5EWLA 4DMCA 4KO3S 4Y2JA 1PSWA 4GBJA 4RD1A 1Y9EA 2DPLA 1A76A 4GEGA 2RGBA 1QZUA 4U7HA 1AQIA 1OCEA 2TMYA 4W9MC 4ZOLA 4Z0HO 4AI6A 4JHLA 1JG4A 3G8CA 4HAIA 1GYQA 1YH3A 4ZCTA 5JQGA 4MGHA 5ILQA 1JRLA 1Z4IA 3B1WA 4CCYB 3THXB 2VPPA 1S7CA 1T1IA 3QE2A 4CGZA 2OBBA 2YINC 1QIMA 4G23A 1H42A 4K7JA 5AD1A 2VJLA 1I13A 2GHRA 4F71A 5CX1B 3FDZB 5GV7A 1AQ6A 1H2ZA 2HYIC 4LYDA 1S01A 3ON5A 3AWIA 1C30A 4A6XA 1U8TA 1Y5RA 3FR7A 4LKRA 2DHQA 2XMPA 1T0PA 1UXIA 3G5MA 1IIBA 1UWVA 4UU8A 1ZBQA 4GD3Q 4DCGA 1MV8A 1ZGAA 3HB0A 2B7BA 3M9XA 2QX9A 4X94A 4Y1FA 5L3SB 3R5FA 2G5GX 2VYND 4ZKDA 4ER7A 4N49A 4N41A 3M6FA 1LLDA 4GOKA 4N6GA 4M98A 3TWOA 3PKZA 4PNHA 2ZBUA 3LHDA 1GGMA 3WL3A 1IY1A 3E3NA 4WNAB 4ZC8A 1J2TA 3RS8A 2WRZA 3Q9SA 2A1IA 2JBAB 3UT5B 4RLQA 4XUGB 3RYFB 4ESVA 2MDTA 4GZ5A 2RH9B 4BVEA 1W34A 2W90A 3R9XA 4YMVA 2XT0A 2P9JA 1SUCA 3HZRA 5FUWA 1UP6A 1FS4A 1MKYA 1Y3FE 4MO2A 4HXGA 4O4IB 3CXRA 2Y92A 1RZUA 4XB1A 1P6UA 4GYKA 1WSDA 3ET5A 3DV0A 1M2OA 4K9DA 1T4GA 4ZHQF 2QRNA 2XUJA 1FFEA 3IKLA 4R05A 1FSZA 2D8AA 1RADA 4QVGA 2HN9A 1NY5A 2WFLB 2P9GA 1CRZA 1GDTA 3EUAA 3ZI4A 2FF5A 4BJ6A 3R7WB 4EO9A 2HHJA 1T36A 1EUDB 2HLNA 4J3FA 2W93A 3T7KA 2C2KA 4V0NA 3VZRA 5AOVA 3VYRB 4PANA 3HDHA 1V71A 1ZAYA 1GZ3A 1HSOA 3CF2A 5EERA 4D6YA 1XDWA 3CG0A 1B6SA 2VIIA 2A0FA 1JI0A 4ZO6A 3ETCA 1TT5B 4EKGA 1U94A 4TPKA 4YLGA 2OHHA 1MRZA 2IOFA 2ZKLA 4KRYA 3IRVA 4L9WA 5JWRA 3HABA 1UOQA 1UBGA 3HDTA 2HLDA 2G71A 1WCWA 3C8UA 4B43A 3GT3A 3FOWA 5C1OA 4L9AA 2AOWA 4HC4A 3LZDA 3IJPA 2AFVA 5CUQA 4G63A 1SXHA 4EH1A 2CXOA 4AAYA 4DQDA 1KKLA 5J5AA 3CZ4A 2YWBA 1EUYA 3LPNA 3MERA 4OATA 4UMFA 5ES3A 2ZI4A 1KWKA 1TAGA 4QQ8A 4B35A 3INYA 1CULC 3PX2A 3LUGA 1H2EA 2D3WA 2CWDA 1NW8A 1V41E 2DWQA 1TF5A 2CK3D 2YDYA 2A0WA 3GW8A 4BV3A 3M81A 4IVQA 2HJ9A 4QUIA 4V0OA 4S1NA 2XMSA 3E1GA 2IYEA 4XE5A 2B4AA 2R5WA 2Q1UA 5FLXA 5C8YF 1LBIA 1BS1A 1HRDA 2PNJA 4DA0A 4DEXA 1USGA 3UAYA 1A9PA 2Y93A 3QG5A 3FY4A 2YIDA 3W2FA 2I33A 1A77A 2HO4A 4P3KA 3V4PB 2PS3A 1XZAA 2QJWA 4LEIA 3C7DB 2JLYA 3ZXYA 4O1HA 1F3OA 4UU7A 3LUHA 4UEKA 3OIUA 1HZJA 1P72A 3T4UA 2DWUA 4NPHA 2Z5LA 4B6FA 1GG8A 1GAJA 1V8PA 2AOVA 2IZ0A 2O14A 3ENVA 3IQWA 3QEOA 4AYWA 4BJ1A 1YQTA 3VUFA 4ARZA 1FW6A 4YECA 2BCJQ 4FHFA 3RB8A 3GQBA 3ZH2A 4RF4A 3AR8A 2AB0A 1TE2A 4G89A 3RAFC 5FBKA 4QLBA 1WB9A 4BB9A 1ODFA 2OGZA 3I5AA 4ASUD 10MHA 4DABA 4P54A 4CM8B 4F5ZA 5CB4F 3B9QA 4CIWA 1VPEA 1N2OA 1F6BA 4OFXA 2Y9MB 2FGJA 1XZCA 1DIGA 4PQFA 4JLJA 4Y3UA 5ADVA 1JMKC 1AK2A 1CUIA 3K0AA 2P40A 4NZNA 1A9XB 1XU4A 3COPA 3AHFA 4J7AA 4HH4A 4N5DA 5GZ6A 3MJSA 2WG0A 1QFSA 4UCWA 2Y77A 1YDGA 1O94D 3FTDA 3NC4A 5ETJA 1C9YA 1JL3A 1LBQA 2FZ4A 3D1VA 1OFTA 2YZNA 1VGVA 1CQZA 5DTQA 4F3CA 3TRHA 5FPHA 4FFDA 2BCEA 3NXSA 2ZUWA 3TJRA 3VU3A 3M4XA 4C0KA 4LOJA 5FPQA 2OO7A 5C80A 4YR7A 1PR1A 3ESCA 3IEVA 4DDWA 1FRZA 5EJ5A 1DV1A 5KVCA 2JARA 3VA7A 5B7GA 1XLTC 2WV7A 2WJJA 3M2PA 5EXDA 1I1OA 3ONDA 2GFHA 4EO7A 1GT91 4LS3A 2DPHA 5HJ7A 2ODPA 1NXOA 4QHTA 4MOWA 1Z6ZA 4KVAA 1W88A 1ZD4A 2YJTD 4NQRA 2AFHA 1KQFA 3PV0A 4RFVA 4L07A 1GSOA 1L5OA 3K9NA 2Y6VA 1JP7A 4KAXA 4BXOA 3A9WA 2BHRA 3B78A 1UIMA 3E0XA 1RM3A 3QFCA 2XYHA 3BQ9A 3C70A 5DDIP 3OFSA 2UUOA 1FW8A 1MJ5A 3JWEA 3T35A 1NDUA 1SZDA 4C76A 3V4LA 4A0QA 5DCWA 4PFQA 1POXA 2WMYA 3IO5A 1SPXA 2PWZA 4L8GA 3JAKB 1E6MA 4Z9BA 2W8BA 1K8RA 4H0CA 3ILVA 3WRYC 4CR8A 2EP5A 3DNMA 3GLGB 2XGMA 2BR5A 4TLEA 1DO2A 3H16A 2FEWB 3A26A 3BE8A 4HAXA 3A1DA 3PPWA 3R6GA 4GLOA 3PWTA 4RNCA 2P78A 4EF4A 1WW2A 2E7ZA 2V7QA 2P2CA 3QF7A 3VJMA 3JQRA 4EW3A 1B3RA 1GPNA 3BAZA 3EA5A 1DXYA 3JQGB 3K8ZA 5B7PA 4WXRA 4JYPA 4YRFA 5JFTA 1L5MA 1NUQA 4D0NA 1FMFA 5LLDA 1WDMA 1KS9A 1Y63A 2A92A 2FPSA 4LMAA 1SUPA 3I23A 4FKZA 3CTMA 1XMSA 2F43B 2OCIA 3JD2A 3OJLA 3KFXA 1KMIY 5IF3A 5IN5A 3GNSA 1HG1A 1UJ6A 3UC9A 2KM1A 3LF1A 4URZR 2GAFA 4MDFA 1GQFA 1EFVB 2IHTA 1BDBA 1MN6A 2GBCA 1BG6A 1MA0A 4R41A 2XPCA 3A27A 3I39X 1RYYA 3R09A 4DV3B 1NXPA 2FGKA 1L4LA 3EPRA 3W3ZB 1AMNA 2MSNA 1ZKDA 3E8MA 5E9QA 3RVKA 3TD2A 4DLNA 3F6SA 2HLPA 4MW5A 2GB4A 5KVAA 1T8SA 1BTOA 1V16B 1NE7A 3IBYA 1DIHA 2UYHA 1K3TA 3L0IB 4U3JB 4YJHA 3GP5A 2CFSA 3NI2A 2YY6A 4QJBA 4QWWA 4ND1A 4NTZA 2GESA 3BERA 1X19A 1E1RD 3FCUB 3PNVA 2BEWA 3GZNA 2ZTSA 2WU4A 4FFBA 1NQWA 3LFUA 3WK5A 4B4VA 3V4FA 2YVLA 2W37A 5BNWA 4AG5A 1N6RA 3K72B 1JHYA 3VHXA 4F5WA 2CSXA 1I4DD 1J42A 2CV0A 5DRTA 2H1WA 3KLBA 2QN7A 4P4TA 5JWHA 3IFSA 2PAFA 1FLDA 1B8VA 3FROA 1DBSA 2K5UA 2Q0SA 2PZGA 2ST1A 3DGEC 4KXFB 3OP1A 2AEMA 1SXPA 3DF9A 3LAWA 3D0OA 1M2VB 3LCVB 3OF3A 2XCQA 1T1JA 3DKVA 1XMQB 2AX4A 2RG1A 5FUXA 5BWLA 3GOQA 2DCMA 4U2FA 1G3RA 2V5UA 2Z3VA 1Y4ZA 1GU7A 3BRQA 2Z2YA 3KK0A 4NZYA 3UMRA 2H8GA 3NFYA 3R3ZA 4TLCA 4DV7B 2VA9A 5IT0A 4FPXA 4AG3A 3DKIA 5HE8A 1BROA 1JKJA 5A3VA 1V1RA 5E4JA 2V6BA 2ZBQA 3HUEA 3O4IA 1RABA 2BBSA 4GZLA 1QC5A 3A2KA 4TWAA 3DCIA 3M82A 5BT8A 2BEVA 2EP8A 1W9HA 2RHOA 2X8LA 3AYXB 2XLCA 3AF5A 3ESAA 4BO6A 4IDFA 3W5JA 3OT4A 1ZOSA 4HAZA 2C5HA 3IAM6 4LV8B 1Y81A 4IYRA 3GJTA 4D43A 1SHKA 1HFJA 4MK4A 1EGAA 2JGKA 3PVZA 2MSDB 3QVGB 4G5QA 4CI0B 3LVFO 3DH0A 3DEFA 3JYOA 1KSFX 4JITA 4YX9A 4J0GA 1T1RA 1YBFA 3BGVA 3JZMA 4L74A 5AK5A 4HX9A 2BKVA 5I9TA 3CKMA 5C5IA 1KZ7B 4RPLA 4IS2A 1M2KA 3P9PA 2V1XA 4LKOA 2FEKA 2XDYA 1N2HA 4FQ5A 4H17A 4BNWA 4Z7NB 1K7EB 1C3OB 4GLLA 3MRVA 4RE6A 2NZWA 3G1WA 1I6MA 1CC1S 1ZONA 4ENRA 5H0IA 3AF3A 3FKQA 2VYQA 3PNYA 3LPAA 1UL1X 3OCYA 1CT9A 1M66A 2ZSHA 4LHSA 1IWOA 1TUBB 4M7OA 4BMCA 4DCCA 4K9NA 3DE5X 2JLQA 4ZK6A 3ZLJA 5A2GA 3LUBA 2V03A 4R5MA 4W8GA 4M6WA 1JE1A 5HCUA 1MNQA 1G3IA 1N2CB 2SCUB 5FLYA 2GZ3A 5A4MS 4PLFA 4DJTA 5JJLA 4V0QA 4YFVA 5IJXA 5I6DA 3KPJA 1KFBB 2YJGA 1CZRA 2ZJ8A 2JD0A 3T1VA 5LQAA 4P3OA 1P0MA 3BRWD 4BZPA 2JEZA 3EMDA 4E09A 1OA1A 2AMLA 3LWDA 4U8HA 1R4MA 1BVUA 4K87A 3OFJA 4OM7A 2OYCA 5IZ4A 1L9KA 5E0OA 4GMGA 1X94A 3IR7A 4YAWA 4FDAA 4Z5XA 3EHEA 1RYZA 2Q3MA 1JEEA 5B64A 5CITA 2HF8A 1QYRA 2BMJA 4F11A 1KRHA 4P82A 3HB7A 2QN1A 5LNK6 1F48A 4JYMA 4PF1A 1QJCA 3J7AC 1FX0A 2PGOA 3KE8A 2PR7A 1CJUC 5I3ZA 5ERXA 4CLRB 1PWEA 5ALOA 1VFPA 3FTNA 1LCIA 3WHLA 3MWDA 3MMSA 1MT3A 3RBZA 4Q4JB 1RWWA 2WHXA 4N12A 4S0XA 1EIWA 2ZIVB 3LWNA 1YE3A 4OI2A 1ML3A 4MRNA 1MJHA 2HHCA 4TZKA 5J5VA 3IEMA 2Z6QA 4ZCPA 1U5BB 3ZDXB 3UWOA 3ZDZB 2QP3A 2QVBA 3CWQA 3E5NA 4Q03A 4RHUA 2GDJA 3K2BA 5ERGB 1G4UR 1SFRA 2VSQA 4D4KA 2QM8A 1PNRA 1QE5A 2X40A 2OM2A 4OM8A 1VLMA 4K9KA 3K8QA 2YR0A 3T7AA 1HYBA 1OTYA 2VPIA 3RU9A 3ETJA 3G13A 4HN4B 5I9SA 3TSOA 5DBFA 1WBJB 2X5OA 5ALJA 4B76A 4BWGA 3ZIAA 3PDJA 3WYDA 5KWJA 4QQKA 3TI7A 2M6SA 1NUAA 2CMGA 4C03A 4OEHA 4AS2A 1T5HX 3JQFA 2YX1A 1NMXA 1MA3A 2ZRHA 3PHGA 4LWOA 5FTNA 2HPVA 1VLQA 2JA1A 2QT0A 3MT8A 4GS5A 1V48A 4DC0A 2Z58A 4M89A 4DFDA 2B36A 4JX8A 1KQPA 1YRWA 1DFGA 1YDWA 4LMRA 3RPEA 4CEHB 1TM2A 2QD1A 3GLSA 5HGJA 4EMBA 5H82A 1RKVA 4P5DA 4P5EA 1KDOA 2A0KA 5ALSA 1T4DA 3UGTA 4UTXA 1SVOA 4LVNA 3U1VA 3V6LA 1EG2A 2IT1A 4IJWA 3NEAA 5CVVA 3TUIC 4Q4HA 4WAUA 3D4PA 4PSDA 1AT1A 4QUKA 3G82C 3I1FA 3I04A 5ALQA 3QKUA 4BO0A 2F48A 4MLPA 4MARA 1MIOA 1X9GA 1BOFA 5E7JA 4ZCLA 5DB4A 1NMZA 1QHHA 4OLBA 4EUEA 2YW2A 5BUZA 2CL7X 1Z83A 1PEYA 3OEEA 4IILA 4JYCA 2WAYA 4KC0A 4LDPA 3VNBA 5LVAA 1WUHS 1G2OA 3LXRA 4DV0B 4FZVA 4JUFA 3WZ2A 5DT2A 1MUUA 4BY9E 2YXPX 3VFDA 2B4QA 5BT9A 4HB3A 4G1VA 1TTTA 2JIPA 5IW8A 3DD1A 5CJPA 3WKDA 4DL9A 3RYCA 3TXYA 2OA0A 2R8ZA 2NU8A 4DSTA 1U2SA 2BMAA 2M6RA 1RHMA 3JVUA 3DFKA 1G6HA 3C5HA 1GNTA 3N8GA 5BN4A 2X9GA 4CF7A 5L45A 1P81A 2WYWA 3WA7A 1ZK1A 4EY8A 1WOMA 3DPIA 4RZUA 4QRIA 2R86A 3M34A 4QM6A 2PWAA 2EEPA 1LDNA 3PVSA 1HE8B 1N3BA 3ROGA 1F5NA 3H1GA 1DIBA 2HA3A 4OQYA 5DGDA 3H8WA 4QX6A 3EVEA 4Z4FA 4XRGA 2E5WA 2GJ8A 4DR4B 5E0KB 3IDZA 3N2LA 3OX2A 4YUXA 4N5NA 3A0UA 5E1MA 3UK7A 2O2IA 5B58T 3K0EA 1KDYA 1A7JA 3SDBA 3A36A 3WNCA 1CQPA 3TW8B 2BGWA 3TAHA 1HE3A 5DGXA 3U56A 1XNGA 4ZHQA 2CLFB 3DXFA 4LJYA 2XRZA 1P4AA 1RYFA 2DAPA 3FG9A 3C6ZA 1C8BA 1W0JD 1QYXA 1EWRA 4CT4B 1X7YA 2RMKA 3O3MB 2ECQA 1DC6A 4DN6A 3LRPA 2DX7A 2AS0A 1FDSA 1QG0A 4N39A 3VTFA 5KWVA 4O8ZA 2RAPA 5JS2A 4JUAA 3DB1A 1JZQA 2ATCA 3QLUA 4P58A 1RXEA 2JB9A 4QPPA 5L95A 2FFAA 1AS2A 4S12A 5JRJA 4GP7A 4KO4S 2RCNA 1VBKA 1NT2A 5KYKA 2Z8YA 1A5AB 2WPNA 4WDQA 2WW8A 1KVRA 3K0FA 3KYCB 4AUNA 3I2YX 5G41A 3A7DA 4P53A 3WGMA 1OXBB 2W2MA 3O4GA 5KKAA 5J63A 4HWOA 3CSDA 3U7EB 1G3UA 4JXKA 4BP1A 3ESQA 3FF4A 2FQYA 2WIJA 4JVSB 3LC2O 1Z36A 4HNGA 3JYPA 3LV8A 5E7IA 2O1SA 3HN6A 3VGJA 1FZTA 5C1IA 1Q1BA 2D7CA 1YUNA 4QDUA 4OJKA 4UC0A 4UUOA 4CM3A 1XQ1A 4K6MA 1XDUA 5J5CA 1C14A 1SCBA 3BL5A 1M34B 2P6MA 1M6YA 1NUSA 2RHGB 1SOWA 3T1YB 4LXIA 1R8YA 4R1OA 4YEDA 1DAFA 2HAEA 4MRVA 1G8GA 2Z3ZA 1W19A 2VDWA 3DEAA 2LXNA 4NK5A 3SS7X 2O2HA 3UV7A 2C98A 4FJ1A 5C8YA 1EM6A 5TF0A 3HY4A 1P8JA 4C0LA 4BLQA 5DIFA 4IZ6A 3PQCA 5TS2A 4RD0A 3HKDB 1GTRA 1FYFA 5K4HA 5GIPE 4W82A 4G1CA 3G2QA 3MPUA 1GA1A 3SAJA 4RKEA 4EZBA 1GRCA 1VBFA 3R4CA 4RUKA 1Y82A 1Q2XA 4WOPA 4RMJA 2J48A 4MUHA 4QU5A 2VK4A 5CH8A 5C8VA 1DEOA 1Y5IA 2XZDA 4KXLA 2XADA 3SXPA 3CTPA 4MKRA 1I5RA 4Y8VA 3TSWA 1NVXQ 2D0DA 3IHTA 5ER6A 2XBMA 4QPJC 3VOTA 1WDKA 2X41A 3OA0A 3OZEA 4MW7A 5DTEA 2FW6A 3TZKA 3KKZA 5CB4A 1EDZA 1AKYA 1L4YA 4LDNA 1GZ4A 1ENZA 3PGMA 3PXGA 4C3UA 1PJ8A 3LUJA 4O59O 2QX6A 1OASA 3PP8A 5IDQA 4PYOA 1V6SA 3SG0A 1GKIA 2B1IA 2J8ZA 4XASA 5JS7A 4RF5A 5EIFA 1PQ4A 5DI3A 2B5OA 1W49A 1SR8A 1XMJA 2IP1A 1S2MA 2WWFA 2XE7A 3KQVA 3QU4A 2H00A 4WV3A 3W2TA 3NB0A 2NYUA 1FTQA 5I7SA 3PGKA 4RELA 3NHMA 4NZ9A 4WKPA 4NNOA 1M2JA 4FGKA 3QTBA 4TUYB 5DM4A 1E5TA 4GEKA 3FGZA 4FGLA 3SJZA 1PHRA 2D06A 4IJUA 5CLJA 2DQ4A 4LBVA 4M8NE 3DOFA 2ONCA 4DHEA 3OX4A 5DBEX 2FEOA 1OD6A 4UUBA 5JXJA 2ZAOA 1WXGA 1F2TA 3F8WA 1DXHA 3R44A 1G4AE 4BMYA 2V3CC 3LOPA 3NBYC 4J9VA 2MCFA 1TQ6A 2NMVA 4B7ZA 1AQUA 1FYVA 1SJ9A 3NLLA 2I03A 1T15A 4JI4B 1XVAA 5E7MA 4Y7DA 2UYGA 3I42A 2Y0EA 1M10A 5A4KA 1N3IA 1UZMA 2PD4A 4QGFA 4WOKA 1I4TD 1DKOA 2WJPA 4H4DA 4K2HA 3F6CA 4E46A 3N74A 2Z5GA 3RYIA 3WL8A 4AY5A 4YPOA 2NXCA 1WBBA 1CRQA 2OV8A 5CD1A 5MN4A 3HBJA 3OPYB 4EHJA 5TPZD 1GTZA 1Y7PA 1FXSA 3Q2KA 1B23P 4HDSB 1AKNA 1XTJA 3PHBE 4IHJB 4LPKA 2EZ8A 5D2CA 3RJMA 5C5CA 4ZO7A 1P17A 3TRIA 2VYCA 2QVCA 2YOFA 4RKYA 1G8JA 1G5PA 1SHLA 4OJMX 4RLFA 2WT9A 1PK8A 4BP9A 4F96A 2F8SA 1OGIA 2QD3A 1WMSA 3BULA 3ZCSA 4AYTA 1XD9A 1UWLA 1B2LA 5E3JA 1FU7A 2FSSA 3L8YA 3R7BA 3AKZA 1ZC3A 3JYNA 5AP9A 3PQFA 5F12A 1PR2A 3UT6A 4YXFA 1T25A 3OHMA 5EXPA 1UBCA 3O47A 2N46A 4IW3B 1EZ4A 1SNYA 1KO7A 2VHYA 4JLKA 3VKVA 3V1UA 1Y8RB 4JS0A 5ELMA 4EBFA 5JXHA 4WA8A 1T13A 3D8NA 3TKYA 1DT3A 1TM4E 2FMKA 3LQYA 5D3ZA 1ADGA 3CKKA 4EJSB 1E3JA 5KTPA 1Z6GA 3PUZA 2C2YA 3IPLA 4PCLA 3VBEA 4IQ8A 2CJPA 1SKBA 2C7RA 1PL6A 3AL2A 4MWOA 3W2EA 4EG5A 4BBZA 4HO1X 4YUZA 1DUVG 2R7NA 3OJEA 5EZ6B 5KZMB 4DIKA 2VXYA 3TNJA 3WK7A 3PYXA 2HHLA 3KJEA 2BONA 3H0EA 1G18A 2AG1A 3CVVA 2DE0X 3JD1A 2ZSFA 4QFCA 5G1NA 2C4NA 1M34E 4TKUA 1T1GA 2XGGA 2ZRCA 2KS6A 2ZPAA 2PANA 1A3CA 1UBMS 3CN9A 4PYIA 1KR2A 4XIIA 3KZ1E 5KSPA 5A03A 1Z63A 2QTBA 4KLNA 3KALA 2FSIA 4FFVA 1JIJA 1PHPA 3B3FA 4MPTA 3KDPA 4EGQA 5KX5F 5AVWA 5B5SA 1HLFA 2GHTA 3ZQKA 1UQRA 2WZDA 2CJFA 1ZINA 3VR3D 1KK0A 1K97A 2RI6A 4GPTA 2VXOA 4MPDA 1E0DA 2OC9A 4G4IA 5KBYA 3DYVA 1XJQA 2RK4A 3GVPA 4YAFA 3T3DA 4KIUA 1UZAA 1SEPA 4II7A 4QEDA 2XGJA 1DDIA 2YN4A 2FG5A 3F5MA 2ESRA 2I4IA 1Y4AE 1NRXA 3DGFC 3HFGA 4IH4A 4W8OA 5HVNA 1NXTA 4IUYA 1WXWA 2QTVB 3CF0A 1L2TA 1RRMA 4FILA 1W9MA 1H22A 1K98A 4COOA 4X5OA 4EYSA 4WXEA 1XHFA 2QLTA 2FPKA 2PSFA 4N3NA 4XOIA 4E4YA 1WD5A 1XKQA 4NEHB 5IT9A 1WXFA 1PIWA 3OAAA 1TPZA 1Y4DE 1G5HA 2O3UA 4Z1OA 3TPZA 1PT9A 2VOJA 4MKIA 1C7ZA 4X00A 4GWGA 5EP2A 1SAYA 4P98A 5JY6A 2B83A 2G77B 2OBNA 4BNKA 3O74A 4QIHA 4D8TA 3THXA 4MIYA 2G40A 3L6EA 4E5VA 2ZATA 2Z57A 5AHWA 2BFFB 3A37A 4Q9NA 1JS1X 1R8QA 4LCBA 1FDIA 1WF3A 2Q2WA 3K5HA 4ZEOA 5LYJF 5ED0A 3UAVA 2H52A 5M34A 2VUSA 2AZTA 2W6ID 2ZT8A 1BWSA 4WKCA 1BWRA 1N6HA 5LBTA 3V7NA 1FP6A 5LP1A 4K05A 3OO0A 1GZ6A 3ZE2B 1E1MA 5HM8A 4DC9A 3PRJA 3I3SR 4HWSA 3HJGA 1QMPA 4GUDA 4MS1A 4RIFA 3DBLA 2PUHA 3IQIX 2VJKA 1T8RA 3QUTA 3D64A 4XUCA 2JAXA 2XNCA 3UFXA 3O38A 2OFPA 3ZKWB 4WNAA 2VNIA 1J5PA 2WVJA 4XPIB 1QGOA 1WE2A 2J9ZB 3DBRA 4NFHA 3PT5A 4QNNA 4X20A 2PMEA 3UT5A 4D42A 2WAXA 1NJ8A 1C8LA 2Z2XA 2XZLA 1NDQA 2QZZA 4H1UA 5AHRA 4Z7OB 3NBKA 4LJKA 1A4RA 2XDQA 1FFYA 3N7AA 4XM2A 5KYUA 2FHPA 4UW9A 3ELYA 1JQDA 2YHBA 1OC2A 1ZNYA 3OWOA 4PAMA 4R7TA 3C8HA 2W58A 1X6VA 2X58A 1MW9X 2GBGA 1RKXA 2WFLA 3F6EX 4YY3B 2PBFA 4OP2A 2PJDA 3T3MB 3QBJA 4LOHA 2R8EA 4RVCA 4BECA 1N3YA 2O2EA 4M9RA 3W4IA 3TR5A 4AUMA 1JEQA 1JU3A 3BFJA 3LP5A 3AVWA 2WU8A 3A6GA 1G0NA 3IESA 1Q7CA 1VE7A 2XXBA 3JR7A 4B3CA 1OSNA 4RKWA 3EFHA 2XWPA 2NW6A 2ZRIA 5FLKA 1OILA 5JSKA 4KHPB 3FTPA 4NJEA 2H1FA 3AR5A 4E5MA 1E1CB 4ZPJA 5K6TA 2IIVA 1ESCA 2EIXA 4B71A 5C3UA 1A04A 3C8ZA 2C5EA 2W4QA 3VOBA 3RRYA 4IGAA 2G76A 3FPEA 4RPIA 1ORIA 4EVIA 3A3PA 2IK8A 5C1PA 4J0JA 3VI3B 4EEXA 2MR6A 3QVVA 4TTTS 4C87A 5B57C 1C0KA 1JNXX 1NJFA 2AJ8A 2AGVA 2C58A 4YAIA 2AXQA 4JWKA 4UHJA 2HR1A 1RKBA 3N7TA 2H1RA 5AKIA 1JLRA 1XMVA 2OQRA 3SOPA 4F1KA 4CEJB 1W85A 3OICA 1QH8A 3ROTA 3PSHA 2D1RA 3BJEA 4MKZA 3RVSA 1C9JA 3WOHA 2PX8A 4E32A 2CB0A 4Q7EA 4X44A 3USZA 1E1QD 5JXWA 4MH0R 2YVQA 4ACBA 1DJPA 2UZ1A 3BQNB 3G2OA 4RJIA 1K8ZB 3GCZA 3D8BA 1EUQA 1ZA2A 2CNWA 1DQRA 1W4BA 3FGOA 4IDEA 4MWBA 1Q3TA 1KARA 3OF5A 3RTCA 4IXNA 3WYNA 4CTOA 1AKWA 1I1HA 1WNFA 1U0LA 1FNCA 1NQTA 3PB3A 1E9DA 1MOQA 2DFKB 1K4KA 1ZSYA 2MINB 2W6CX 1D03A 5BUCA 1VJ5A 1ZUIA 3VOAA 4KSCA 4W9RA 3QLUC 2A7QA 4AMUA 1OH8A 2VLIA 1S4QA 1K5GA 2A78A 2CLCX 1LLCA 2N42A 3IOEA 5JANA 3U7GA 1U65A 4MX8A 3OPNA 3EZ7A 1ORTA 2C9MA 3RFVA 2J5QA 1GTMA 5FULA 2C2ZA 2Y1DA 4XD7D 1GQYA 2OB1A 2KWIA 3QEMA 4OQPA 2JLRA 3DR3A 4O3FA 3UUWA 3MOIA 2YFYA 3M9WA 3MUEA 1U1GA 1BKDR 1EFKA 1UXJA 3OPXA 3PD7A 1MMFB 4PBSA 5B3AA 2R4QA 5ALVA 1EEHA 1JLKA 3MUFA 3VPFA 4X97A 2VZLA 3H5AA 1WMDA 5C1DA 4NI5A 1OTHA 4L0DA 2PAAA 3OHPA 4ZV4A 2YZKA 5JYEA 4QBFA 2GN4A 2J1LA 2VP5A 3DAGA 4L3OA 3ZW9A 4EG4A 4IBOA 1FFCA 4RTNA 1W48A 3NPMA 3IDFA 5CP8A 5DZSA 3V8MA 2JG3A 1NKTA 3WAJA 4JOSA 4PLZA 3D2BA 2ZP1A 2EU8A 2GI4A 3AY3A 5JMTA 1QKIA 1GN8A 1KA9H 4B1FA 4BAZA 3INTA 4F7WA 1B41A 1AA9A 1M2NA 1Q7EA 4KH1A 4PC1A 4ZT6A 3SVLA 1RXVA 4GPAA 5CU7A 1H23A 4BO9A 3RAPR 1KDPA 3IR6A 4BX9A 4P7GA 3G68A 3KWMA 2VZ9A 5CDTA 2XMZA 1LSOA 1UAYA 1Z6XA 1PG5A 2B34A 5DWDA 1M2EA 4YUWA 3EMBA 4PLPA 2EDAA 4DBLC 5T4BA 3UICA 2AYXA 2XMQA 4OHXA 5KOHB 5F9HA 1LNQA 3C1OA 5KPDA 2PUWA 4A92A 3NBMA 4BNDA 1IQ0A 4X1YB 2IIBA 2FPGB 2GBLA 4MGEA 5AK0A 1KZ6A 3I4CA 1VMIA 1CPYA 4FKMA 1KF0A 2XW6A 4I2VA 3QUBA 3ROEA 3VH1A 5C52B 3W5HA 1TU3A 2R2AA 1NUPA 1LLQA 1J8FA 2QN3A 3OU6A 5EIWA 3S2GA 3MJDA 1VCNA 4MA0A 2V4UA 4YV1A 3ZCUA 3WLRA 4CTJA 2H6EA 4HLUC 3UOAB 1ZNZA 3T15A 3TOXA 2AOTB 4KPYA 3AEUA 3FZNA 1JU4A 3JQGA 3C4VA 1SBYA 1U6IA 4ETWA 3D2LA 3C97A 4ZDJA 4MKGA 3G8BA 4G86A 3K96A 4RGYA 4QYWA 3HM2A 4YDSA 1P77A 1VMDA 4OKIA 5IH3A 2JAQA 4L2IA 4KN9S 4R9RA 3TR0A 3P0FA 4FWBA 1EFVA 1OFUA 1UM8A 2PO5A 5AKXA 3G9XA 5ELXA 1FFDA 1Y3CE 3IPXA 4TTIA 3ZE9A 3P0JA 5TS3A 1MOPA 1E2KA 3I53A 4O6VA 3SXUA 4AMZA 2CXUA 2DHRA 2EQ5A 3TKAA 4WXYB 3RRMA 1N7GA 1ESMA 3CZQA 5EIBC 5KYWB 2OOSA 1HT3A 1NWCA 1V16A 2X9VA 4HDMA 4LF5B 4U3JA 4BWFB 2NSHA 1UKAA 1BFUA 2C7BA 3CRRA 3C1AA 3JAWB 2F1IA 3S0JA 4KQKA 5BUSA 1LBEA 3B1XA 5DWVA 1V3QE 3KB6A 3N2NA 2AKEA 5JVDF 2YUTA 1AK9A 4PQYA 1JJIA 4OXRA 1IPHA 5DHFA 3U3OA 1W36B 4UKDA 1NVWQ 3KJZA 4HGQA 4BNFA 2CC2A 3LUFA 4DCPA 3MHTA 5GGYA 3PIRA 2PSEA 3F96A 1ZJ6A 1CVLA 4GOLD 1Z0SA 4QU0A 3W5UA 1JQLB 2QAJA 2E6UX 5F52A 4GAEA 4UDNA 1AVTA 3AJAA 4DNPA 3WE7A 3M5CA 3IAS1 1M33A 2H63A 4FLEA 4M36A 3HN7A 2V9PA 1XQVA 1XL0A 1ZH4A 4FXPA 2IA5A 5THQA 1I94B 1KJQA 2QAIA 5K4GA 1I80A 1PL0A 4RIEA 1RXYA 3SQDA 4ZAFA 5C53B 2MWMA 5F33A 1FTGA 1Q21A 4UM9B 2QENA 3FPKA 3N6RA 1U90A 3ZV7A 1V37A 3AJ9A 3HPRA 2ZYTX 4GNKA 4EPTA 4DB4A 1UXGA 1T4CA 1VHTA 1EFHA 3CINA 4CF3A 2NM0A 2WHQA 2EWWA 1SOVA 1M8PA 2IVFA 4NCXA 3F5FA 4MEJA 1PGJA 2QR5A 3N1UA 4JMLA 3TI9A 3L1HA 5GJCA 3LOUA 4FHDA 4FSHA 4AN0A 4UVIA 4DXHA 5HYVA 2QD4A 2V8BA 4KZKA 2JGEA 4LGCA 2DSTA 3ORQA 1JE0A 2CLSA 5TE9A 2BP7A 2CNLA 3TLEA 1V6CA 4NDAA 4EHLA 2X23A 2QPLA 4J9UE 4AZSA 3WMXA 3SBEA 1NTOA 4M1SA 4KTVE 5BQXA 1Q0QA 4FIDA 4HQFA 1C1HA 4U9HS 3W90A 4I0WB 3BG5A 2VOEA 2PSDA 2QR3A 2PYZA 1QUEA 3L5OA 1AQLA 1U04A 4Y0VA 2WD7A 4FYWA 5LYYA 1Q7GA 2BT4A 3EODA 3L07A 1OFGA 2V45A 3V97A 1XA0A 1FPQA 5FBVB 1K7XB 3ZGLA 5EPUA 2W0SA 2X1HA 4W1QA 1YJCA 1U02A 1GSAA 4J49A 3VAZA 2JLUA 2B35A 3GAFA 4RHEA 3MTIA 4BO3A 1A88A 5FUMA 3C4JA 4C0JA 1QVAA 4MP3A 4JVLA 3BJMA 3OX1A 5DN6D 5I47A 1W36D 2WU1A 4UOZA 4Q1DA 3AF2A 2IOFK 5DSTA 3PKIA 4MRPA 4PAOA 4E5SA 1DCTA 1RLTA 2IYLD 3QBTA 3O8NA 4LGMA 3KLMX 4BU0A 2C5FA 1MC4A 1Z4KA 3F7MA 2HJVA 1GYPA 1VCHA 2PX3A 2V7XA 1Z5PA 2AN4A 2WWGA 3BTSA 3P9QA 4G81A 5DLPA 1BEZA 3FTEA 5FKJA 3V4SA 5C7LO 3Q3CA 4RKRA 5A1JA 1WY5A 3OOWA 5F7JA 3WXBA 4LF9B 4E11A 3HADA 3A4VA 1SZPA 2MMGA 1U7XA 3DHYA 5CJ2A 3QKTA 3ZGXA 4D96A 4ECEA 2HRZA 2JGDA 2PHZA 1VP3A 3STTA 4ZI3A 2NVUB 1RTKA 2IZOA 2JGIA 4M9XA 3I9JA 2GN1A 4UM9D 4BTLA 1U0HC 4BQOA 1SC9A 5FFMA 3A1FA 3TNDA 5LQCA 1OH6A 1HURA 5U1PA 1NC1A 1OFUX 2JJQA 3KB1A 2IX3A 1MB4A 4RJKA 1I2AA 5ALEA 2FPLA 1VJ1A 2C9DA 4KW7A 2G17A 3QOWA 1LVHA 3ANYB 1M1XB 2E6KA 4H6VA 3GLIA 4UPEA 4EY5A 3GWZA 4LV5B 2Y68A 1UJ2A 3SHVA 3ZNNA 3UT0A 2FDRA 2OP0A 1SVWA 4UBKA 3LBAA 3OESA 3JD4A 4ND4A 5D01A 2MYTA 3PT9A 1B8NA 3G2KA 5LDGA 3TEJA 1Y98A 1OAAA 1PT7A 3MEQA 3GCGA 1PJ2A 4R2WA 5JCOA 2O8CA 1BMTA 3H5OA 1LRLA 5AKLA 5CAEA 1QP7A 4MVJD 4EKDA 1SKUA 1RE1A 1L4UA 1TA4A 3MCTA 4I1VA 4BNXA 5EYPB 1GNRA 1Z3IX 4G8CA 5CT5A 3OCXA 4K26A 4F2PA 3VI4B 2BDTA 1L1EA 2IHYA 2C2GA 4Y6PA 1IUPA 2GERA 1O6GA 3JWIA 4QEKA 3OE1A 3IC5A 5DM1A 1EP3B 1D4ZA 4BJHB 5KX5A 3B1YA 1H5QA 3I6ZA 2C3UA 1L5NA 4NCKA 4UBMA 2CUNA 3OKFA 1RBYA 3CUVA 3E3MA 1WB4A 2AR9A 1CP2A 1P4HA 1MCZA 1YZTA 2CLDX 1A4IA 2P5YA 2XNKA 1F17A 2CKDA 5KHOC 5EMMA 2HHAA 1MEEA 1PNVA 2FKNA 3WNDA 5P8WA 1E7WA 2GLXA 3ZQUA 4D4LA 3EIFA 5LB2A 1KP3A 2GEVA 4LK2A 2PV7A 1X1DA 2UVDA 4XYLA 3GFFA 1IBMB 1DX9A 4HEA1 2QVXX 1RQ2A 2I3DA 4QOIA 2KX7A 2PZ8A 1TDJA 4RD2A 7GPBA 4A0SA 4X7RA 1MX3A 2QZPA 3HFSA 1Y3HA 3QKIA 2H7YA 4KNVA 4XVQA 3O94A 3CLKA 4W9NA 3VZDA 1PZMA 1HQKA 4EA6A 1YFZA 2PJRA 3A4LA 4TTVA 4WBSA 5GINE 1U28C 4RLHA 2OHFA 1NM5A 3SOZA 1K75A 2CV2A 3EH2A 2DZDA 1OX4B 3KJGA 2R1VA 3CN7A 1UKYA 3DT8A 4TV8F 1QK5A 1SHZA 1AD2A 4Z51A 3T52A 5LYJA 1T6YA 2HWXA 2YN2A 3EWNA 4X54A 3BSYA 4XDHA 2VTDA 1RAGA 2C2BA 4H4EA 1IHUA 2I3BA 1H8EA 3NHRA 1E2FA 3LC0A 4YMGA 4QQNA 3FPAA 5K05A 1M54A 5ILOA 2O2JA 1AKVA 3TINA 1VSVA 2KHZA 2P77A 3N8HA 2C04A 4NWIA 4CKBA 5JNWA 3E7DA 1JFFA 3SKYA 4LVOA 4BDSA 1VRWA 2VZEA 4H08A 1N6IA 1KP2A 1MJGM 3LCUA 4KE9A 4GH5A 4PHCA 3WX0A 1FSPA 4WZAA 9LDTA 3E81A 4MVJE 2GKSA 2H0RA 3ZHRA 1T9HA 1NLZA 3E22B 3JS5A 3SE7A 2J0SA 3P9KA 4H3SA 2TSYB 1P9NA 5IAEA 3JPYA 4OK5A 4H15A 1ZHFA 4P7BA 2GUWA 1QWSA 2FFJA 2WD8A 1Q1ZA 3AR9A 1Q7BA 4R1TA 4ANFA 2PVPA 2ZIXA 5DE3A 3VYUB 3LTNC 3NHSA 4R6WA 3TW8A 1ODTC 2HFJA 3EVNA 1F8FA 4WMLA 1XKLA 2XYPA 3M4JA 3ZOZA 4QBHA 5D3MA 5HQ3A 4J8PA 1ORVA 1YOBA 4D9JA 2YBEA 2XDAA 4R8SA 5D6NA 3SBDA 2RHMA 1XZNA 3ADPA 4B4DA 4WKGA 3GDWA 3SBXA 3UJ3X 2VCHA 4EG6A 3SP1A 3UCFA 3AKEA 1LY1A 1QIJA 3N28A 4PLCA 1NQXA 1E2IA 3HA3A 5JAQA 1RLOA 1PJAA 4MYCA 4ZOBA 1AHPA 2Q3EA 1QKKA 3FFTA 3HN2A 4NHOA 3UCXA 2ZZNA 1DMRA 5DKFA 3RV4A 5C8XA 5HJ5A 1Y9DA 5HE9A 3L84A 4Y2UA 2HM7A 1L5HA 1ISIA 4UE3S 4CF5A 1QRUA 1LH0A 4UHCA 3ETEA 4AJ9A 3H3FA 3KSMA 4WLNA 1DLJA 1JYEA 3DXYA 3QWHA 1T3ZA 1KNXA 2B1JA 3B36A 1BS9A 1WPQA 3BUSA 1WB6A 1LW6E 4R69A 2WWVD 4OXIA 5A0FA 2X42A 3ZWBA 4JX9A 2OE2A 3B1FA 3C3WA 1NWHA 3LY9A 4WN9B 5EEGA 1PR0A 4CMEC 4ZYXA 1P5HA 1ZS9A 2V0CA 1FC0A 1GG5A 4HLDA 3QKWA 4O2BB 3U3MA 1XMOB 2VSOA 3EEQA 1MIHA 3I45A 4KYVA 3HNPA 4GOMD 4CMHA 3V8VA 2ZJ5A 3UATA 3ZZUA 3T3OA 3KOMA 1R0BA 2X15A 1PFQA 2GBLC 3GVIA 2PV0A 2Z56A 4INJA 3U7RA 1SU7A 4I55B 3EEFA 1P4GA 3QUAA 2J5KA 4L8VA 1E61A 4JSYA 4YWJA 3WGGA 3M6MD 1U7DA 2CVQA 1PV1A 3TL2A 4CHGA 3KQLA 2YH2A 5TPZA 4F3NA 1A71A 4BMOB 1X8JA 5ITZA 4RBNA 3H5WA 5F3WB 1E9VA 4XIFA 2UVQA 4Y6OA 2C0QA 1SBNE 3B6KA 5D51S 3B7PA 1EXDA 4FONA 6REQB 2NN3C 4JROA 4ZMBA 3B13B 2FTKE 4OBXA 3MJHA 3T5TA 1XTQA 1HXHA 3FPSA 3M5WA 3ZWNA 2JJ8A 2ZTLA 1ZPDA 3U3JA 3IIEA 4KQ9A 3S2EA 1W73A 2YJ6A 3KD3A 3O4VA 5B4TA 1CZUA 5EE3A 5FDFA 3C5WP 2NZJA 4GOXA 4CHTA 3UAGA 1MHPA 1VKZA 1XD2A 3LY7A 2QF7A 5FNVB 2J9GA 4PXAA 4PSVA 4ZCSA 3DD5A 1WNTA 1KQGA 3I73A 4M8LA 2GWRA 3WIBA 5FTLA 4RACA 2EAUA 1QORA 2EZUA 4WK0B 2P2ZA 1X1CA 3O7MA 3R40A 4R16A 2IYQA 3PYLA 4RHXA 3KAKA 4RW0A 5LA6B 2OL4A 3VR6A 1PJ3A 1L4BA 4RNDB 3WIOA 4AFNA 1MEJA 1MAUA 5IDVA 4UTZA 1P33A 2G0NA 2NUPB 4NBUA 3BIFA 4X6UA 1JG6A 4EI8A 3G9TA 5C34B 2ZJAA 2J32A 2R97A 1GILA 4UQOA 1ULHA 3SM3A 1NW3A 4OUDB 4EHAA 1YZVA 2JRCA 4XGQA 4QASA 2GQ0A 1HTBA 1Z38A 2VYVA 3D2AA 3K8OE 1ZK4A 1E4EB 3AC0A 4PC7A 3V6MA 2PBZA 1ZH8A 4F06A 2VTVA 2X8JA 3D4IA 2VHZA 5AUNB 1Z7YA 1I1QB 2GZRA 2V6MA 2YHIA 4G26A 1QNLA 2CNKA 4HWGA 4RV4A 2HMWA 1E1NA 2JIRA 4JLWA 5JXGA 4XUDA 1DJNA 3AL3A 5KDDA 1ABBA 1FYWA 5J2UF 5G1PA 5J58A 1KPGA 4UHFA 3ACCA 3ENKA 1Z8HA 3GXOA 3S2ZA 1TYDE 3BFPA 4ZYVA 3I9V1 1KDRA 1U0RA 3OPYA 1ZIDA 3CEJA 1JDSA 2CCJA 3DTNA 4EB3A 3MILA 4FGJA 4DV4B 3KU4A 4PLTA 3PQ5A 3C8MA 5AXDA 5K3AA 3WZLA 1JFLA 1KEEA 1V9SA 4M1KA 4JEMA 2PZKA 3T3PB 821PA 5LZ9A 3KV3O 1HNZB 3ZN2A 4QDZA 1SIWA 4WD3A 4JVOA 5C8ZA 5KDOA 1KDVA 1T6NA 4PFKA 4JJGA 1K6XA 1TYCA 3FMIA 3K9WA 4JP1A 2IYAA 1E3WB 1JBEA 2W8ZA 3HBLA 3OKPA 1EX6A 5CG2A 3U9SA 3VKUA 4HDKB 1KERA 5AKYA 1DTWA 3CR8A 3EH1A 4I14A 2TS1A 2XQGA 1DX6A 2AC4A 2HDNB 4INPA 2R62A 4ZFNA 3AF0A 4HS9A 5FP0A 1K86A 2QUAA 4ZVTA 1UT8A 1F0KA 3E27A 3JQPA 4OHUA 1P2TA 5KNCH 1FYEA 1J09A 4MVJG 4R3WA 1WPXA 3KHKA 2Z4SA 3KDSE 2O57A 3AVXA 4LA4A 5BOSA 1ZGZA 4C3VA 8MHTA 3A1NA 1HDZA 1ZYUA 5DF1A 3GJ8A 4I5DA 2O2CA 3CZ9A 3OFKA 4YO8A 3RVRA 4E3ZA 3DKRA 2B7LA 3HYNA 3KT3A 3VR0A 1QHIA 1W0CA 1U4SA 3GT7A 3D7NA 4ZZ0A 3MLAA 4JI1B 4DV2B 5JVDA 4Z4IA 3TX2A 1M74A 3G8YA 3C3AA 1S2GA 1FU8A 2I4RA 1J99A 1ATZA 1PX0A 3ENQA 3OZTA 5JALA 4NYJQ 1O7JA 1RHRA 3C6KA 4KMRA 4YR9A 4URXR 4YDRA 5K8TA 2C7GA 5DK4A 5IJAA 3VSEA 1TZJA 5AVJA 1K9VF 4JI3B 1J9EA 4ARUA 3AL0C 1A8UA 3NWBA 2HFKA 1BX1A 3P9XA 1WQ4A 3E84A 3G49A 1UKVY 8GPBA 4FCCA 3SYNA 3TZCA 1KYVA 4S2UA 3HM9A 3SHFA 4TV9F 5TPWB 4QSHA 1US8B 1OKKD 4I4TB 3AFOA 4OB7A 4FBMA 4J03A 5JCJA 4NCIA 4RJJA 4IJMA 1E5XA 1GRNA 3IALA 3NZEA 2QTVA 3NNNA 1L8XA 2GPWA 4PPYA 3SC6A 4DM4A 4QG3A 2JAWA 3IAM1 5SZKB 2G09A 2Q3LA 3LCMA 1RHUA 4JP5A 4HLQB 4K8OA 4PPQA 521PA 4KXVA 1TAUA 2VZ0A 4ER5A 1V95A 4CCWA 3R1IA 2DFLA 2ZEJA 3DBIA 4M0PA 5FOSA 1I6LA 3KX2A 2IUSA 2PZAA 3KR1A 1SXJB 2BKAA 1JHDA 3FSJX 2YJ4A 4WOJA 3ZR4B 1NJ1A 2GILA 5FOVA 1DWPA 5ER9A 5JCOC 4ZDWA 1GL6A 1YQXA 2B3DA 4TM7A 1WUJS 4MDHA 1E59A 2J9XB 1CS0B 5KO2A 2I0FA 4UTNA 1FTNA 1Z13A 5CDUA 3ROXA 3SC2B 2FPXA 4DIUA 5CLLA 1JHPA 1T9CA 1YQWA 4FD2A 1KAMA 4YP0A 3NG1A 4CV1A 3L06A 1RRGA 3NCHA 4G5FA 4BUJA 4OL0A 5ESXA 4JBGA 2FDXA 2I6FA 2ZAYA 3GJRA 2A9VA 3R74A 4BHTA 3QX3A 4H7KA 2WHYA 3HBNA 3SBOA 1EVKA 1JMYA 3M6UA 3QTTA 4HLCA 1E1QA 3P4XA 4E7PA 2YXDA 2IHUA 1OI7A 4FEEA 1RMTA 5TC4A 4BLRA 2ZJ7A 1ZMBA 3KTFA 4V0RA 1XFAA 4FFSA 1M72A 4MLCA 1YZUA 4FMCB 4OH1A 4R9NA 1LK7A 2ECPA 3HDGA 4L7QA 4RCZA 4WESA 3ZVMA 4UNIA 2ATIA 1C9MA 1CJTC 1QAQA 1DOAA 2WBLC 3LA8A 3NXKA 3UXMA 3NH9A 1U7PA 3BD6A 2DHCA 1QGUA 1WOYA 2ZB2A 3MUNA 1XFDA 1HEUA 4MUGA 4UM7A 3W2GA 3DUFB 4JL6A 2I8LA 1XQ9A 3FN4A 4H18A 2BZ1A 2YCLA 1WVMA 1WUTA 2VJNA 3Q7RA 4J4BA 4WFIA 1VL0A 2XCSB 1ODJA 4O2LA 1Z88A 2Z5FA 4W9NC 2PUGA 2VTBB 1CV2A 3FLBA 1QVWA 1HG0A 2Q0HA 4EYQA 4EY6A 3M2TA 1Q14A 2XSZD 1SWVA 5DNDA 1NM5C 1GPWB 2AG5A 1THGA 4GF5A 4TKVB 3BL6A 3A6ZA 5SZIA 1LC0A 5L9AA 1AA6A 1ZUHA 3OKAA 4DNOA 1P1KA 3O4JA 2B8JA 3GPCA 1E8NA 4U6QA 3DMGA 3I32A 2PGIA 2XQIA 3CZCA 2AG0A 3CUSA 3QHAA 4RA9A 1P9OA 2WU3A 3HJNA 4KFSA 2PEYA 1W30A 2BI4A 3EY9A 4IZOA 1Z3CA 1UXKA 1L5ZA 1N0UA 1SXJD 1PNTA 1V0JA 2XUDA 4I8IA 4UM5A 1N78A 1FUIA 2UKDA 4PEVA 4ZWNA 1L4MA 3TIXB 4C88A 3NHLA 2XUOA 4H6XA 1Z73A 4YLYA 4CKXA 1XCBA 3MTGA 2MR5A 4I1PA 3CRZA 2AQIA 2HY7A 1UBFA 4O5AA 1OXTA 2YMQA 5HNKA 1R5BA 4L85A 2J07A 4YRGA 5IK2D 4HLNA 2HNKA 2O1WA 3H1BA 5LQSA 1NPTO 4BOYA 2ES4A 4A26A 3TTVA 2XUFA 4PLVA 4EGCB 3CUKA 1KI2A 2Z9CA 3KQWA 1TF2A 3WQHA 2WF7A 2QS9A 3KLNA 1NRIA 4IIJF 3K5WA 4PVDA 1FJGB 1J0BA 5BXQC 4GX5A 3WLLA 1Y4SA 1SCJA 3K6RA 2BFCB 2Q7XA 1X80A 4BKMA 4GRAA 5CYPA 4PNPA 1B73A 3FDFA 1C4WA 4PHHA 1H6DA 2FJUA 1B93A 2HIMA 4I55F 3U09A 4YV7A 1DELA 1E1LA 1PI3A 3TGLA 2RCYA 2PBRA 4IFIA 4URUR 5H59A 3JQBA 2VDKB 2AZXA 2W4MA 4BE7B 5E95A 5C8DA 5AR1A 3NOQA 4KBYA 3L7NA 1IQPA 2B2XA 3K30A 2IE0A 1JU9A 1ZLXA 3LX5A 1DCMA 2I6SA 4P84A 1KZ9A 4ZV7A 3ZV4A 1V7ZA 4WFKA 5JAOA 4ZAGA 2OCKA 4NCJA 1HDEA 1XU9A 3OLZA 1EU1A 4ALMA 3R3YA 3L41A 4B48A 2WYUA 3ETHA 2ZUFA 1KC3A 3A06A 4ACAA 2FRDA 4TV8A 3LDHA 2AFIB 1UDXA 4FDMA 4DJJA 2GN8A 1H8HD 4N5LA 4B0OA 5CD9A 4KQXA 1GSHA 1SULA 2O2GA 5CEFA 1WQ1R 1Y0BA 2LCIA 5IBCA 1JFTA 1GHTA 2JFZA 2ZRLA 2O8FA 5F77A 1QP0A 2IQ5A 1KQNA 1EA5A 1Q16A 2GEUA 3W5DA 1UR5A 1RU3A 2HSZA 3L7DA 1CEXA 3UAZA 1I7DA 3R9WA 4UD6A 2W4IA 3ITDA 2GJ4A 4I9GA 1GVNB 1I6KA 5EHIA 3UH0A 5ERYA 1SXJE 3F74A 3PUJA 3ZCRA 5JJ5A 2VO1A 1N6KA 1JVBA 1L7AA 4IFTA 1BDMA 3G17A 4IGFA 2GN6A 4QUBA 4CCAA 3F49S 2XOKD 1KZ1A 3M6LA 1LDGA 3VHQA 1NL3A 4ZRNA 4Q47A 3LP8A 4I4NA 1CZOA 4IS3A 4B6JA 3GDGA 1NHWA 2GNOA 3PE6A 2P41A 5IVIA 3VGPA 1J1UA 3PEEA 1RWVA 5AJZA 5IUJC 1EFRD 4EHKA 1CK4A 3GF4A 4GX2A 3OJXA 1XTVA 4ESEA 2H1IA 2DPMA 3QV1A 1R6UA 1ETHA 4IIBA 3ND9A 5DNWA 3RSCA 2ZIZA 2ZREA 2ZYAA 1EVZA 4JQOA 3W8RA 4Z2AA 2C57A 1MX9A 1E6CA 1FQWA 2P1RA 2PL3A 4HNAB 3SF8B 4AK9A 1RI5A 3IRUA 3N39C 1M1ZA 1Y3IA 1K3UB 2B9VA 2XE4A 4LI0A 4ENSA 1C50A 3ELUA 1UOEA 1SHTX 2GAOA 2VK2A 4BVKA 3CH4B 3LT0A 5LMZA 1LWNA 2PU7A 3RIHA 1TT7A 4DMMA 3JWGA 2O0LA 4D25A 3DEJA 3GUCA 5FR2A 4KO2S 1BW9B 3DBHB 4NU6A 4IF4A 3F97A 4G5HA 4ZAWA 3W5SA 4CE6A 4HRVA 1G2QA 4BASA 4M0MA 3GX1A 2XT6A 5CR9A 2GCEA 5JATA 3JVIA 4XFDA 2A57A 3VZCA 4ALLA 2VJQA 3QTLA 4F3KA 1Q50A 1K0UA 2D2VA 1I36A 1P8AA 3LUAA 2WG2A 4HBGA 1Q11A 2OOKA 4HFRA 2QI9C 5F1KA 5HOEA 4NXMB 4ROTA 2X1LA 2QP9X 2REOA 1FY2A 3KSUA 3V42A 3AFMA 3ZI0A 3CSSA 4UQPA 3BKWA 4YJ2F 2PJUA 5AVOA 1PUXA 5CM2Z 3ZX4A 1BH6A 3OJOA 1ZHOA 3B52X 1EBFA 2HRQA 1DQPA 2C0PA 4GHWA 4BQRA 2GCOA 1H2RS 4U9IS 3K94A 1FFGA 3WWYA 4HWPA 3EULA 5G02A 2A5YB 4Q1VA 4NCHA 4D5GA 1KY2A 3IBFA 2Z95A 1C9EA 4LJ8A 2BE9A 2GEKA 4W7IA 1F60A 1VTKA 3WGQA 4C7VA 5D7BA 1J1ZA 1ZEMA 1TKCA 4OO3A 2DULA 2I7VA 2CYAA 3O0TA 4TMXA 3M6IA 4OP1A 3ANNA 4GKVA 2VJDA 3O6VA 1AN0A 4OQ4A 3OC0A 3SJAA 2WF9A 5AJHA 1OH5A 3NEPX 4M37A 4JP3A 4KLRA 3LDGA 1DHRA 2VUUA 5CDGA 4DB2A 2LPMA 2JFWA 3KR9A 5KMGA 4JVMA