5FWXB

Crystal structure of the ampa receptor glua2/a4 n-terminal domain heterodimer
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
377
structure length
375
Chain Sequence
b'FPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNAAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMATE RECEPTOR 2
molecule tags Transport protein
source organism Rattus norvegicus
publication title Structure and Organization of Heteromeric Ampa-Type Glutamate Receptors.
pubmed doi rcsb
total genus 126
structure length 375
sequence length 377
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fwxB02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fwxB01
3QEMB 1YS7A 3Q9SA 4YLEA 3H1EA 3RVPA 3SG0A 4F12A 3MIZA 3GL9A 4XAQA 4H3KB 4S05A 3LUDA 3FGZA 4RK4A 1EWTA 3ROFA 3RH0A 1NXPA 1LJLA 3FFWA 4HNQA 3W9SA 5KC8A 4IGAA 4MR8B 1MVOA 3HCWA 4YR7A 4G0OA 2IDMA 2H3HA 3QLUC 4ETNA 3CFYA 1ZVVA 4EVRA 2NT4A 1J56A 4KVFA 1E6MA 3O2SB 2FSPA 2QSJA 3Q41A 5CNKA 1PUXA 4IMJB 1DCKA 5KQPA 1ISSA 5JNSA 4ML3A 6ABPA 3SY8A 2PUCA 3DZDA 3CTPA 3A0RB 1JL3A 3KG2A 1C0EA 1JFSA 1QMPA 1E6LA 1MB0A 1Z18A 5TQ0A 1P2FA 1QQBA 1YMUA 3NNSA 1FFSA 4FE7A 5KC9A 4MQEB 4ETMA 1DC8A 3HK2A 3IP7A 1LBHA 2CHEA 2A9PA 2CD7A 4DADA 2PUDA 3O2QB 2L17A 3MMNA 3QELB 2PE5A 1QP0A 1IIBA 3OMXA 4WT7A 1XHEA 4XASA 1KGSA 4O5AA 5EWMB 3O1HB 1CEYA 1KRXA 4KQCA 3LTEA 1DBPA 4YP9A 1C4WA 1BA2A 4EUKA 4JB0A 4G0XA 1S8NA 4RKRA 3NNDA 3QLVA 1TJYA 4IRXA 3EODA 4EVSA 3E3MA 4MS1A 3CZ5A 1NXOA 1YIOA 2AYXA 3GV0A 2IOYA 2TMYA 1Z12A 3RQIA 2FEWB 4RY9A 3KS9A 3T6KA 4E7OA 3M9XA 1ZGGA 5C5CA 3Q7SA 4L4UA 2HQOA 1D1QA 2MYNA 4NICA 4CBVA 2PUEA 3HDGA 4XLTA 4PICA 1AB6A 3EQZA 1CYEA 1D2AA 2N9UA 3ILHA 3HS3A 4D6XA 1QQAA 5JNRA 5JNWA 5GQSA 4H60A 3KHTA 2HSGA 2FN9A 5DCLA 2JCGA 5EWJA 5DTEA 3L6UA 1GUDA 5FWXA 3FDFA 4FB4A 2BGGA 1BAPA 4JB2A 2GI4A 4O1IA 3URMA 5FWYA 3OQOA 4OTZA 4Z9AA 1JF8A 2OQRA 5DGCA 3M9WA 1DBWA 4NCAA 4P1ZA 2O20A 3QEMA 5JNVA 4RY0A 4MRMB 3Q7TA 2PL1A 3GT7A 3MA0A 1U2QA 2R47A 1YTUA 3LOPA 3EAFA 1OXBB 3JTEA 3NHZA 5T3YA 4MR7A 2WY2D 3T8YA 1FFWA 4EYGA 1JWLA 1M5UA 2QZJA 1GCGA 1SXHA 4PYRA 4Z9BA 2RDMA 3CG4A 3L49A 3QX9A 4F8JA 3RVMA 3HM9A 4Z4FA 2QVGA 3K9CA 1A2OA 3IP9A 3EJWA 4XARA 3SM9A 1E2BA 4Q6BA 1ZAYA 1JDPA 3OLYA 2FLWA 4IILA 4KFCA 1A04A 5BRAA 1DCFA 1VLZA 3OLXA 4NQRA 4ZYLA 1NY5A 1DJMA 5CNIA 2FLKA 2QW1A 4WWHA 1QP7A 3TD9A 2VUHB 4MYRA 3DLHA 4KNYA 5TE9A 2WMYA 2HPHA 3JVIA 3RVSA 4KPYA 1MB3A 4KK4A 3A0UA 3HXMA 2L2QA 5HM6A 4MQEA 1FQWA 4LRQA 3FFTA 4QYWA 3OM0A 4RSMA 3NHMA 4IMIB 3OMWA 4LZLA 4YCSA 5KWSA 3P9YA 1GCAA 4OG2A 1K66A 3OQNA 1KRWA 3D02A 3RVNA 2P4UA 4G86A 3ROTA 3CU5A 5IEJA 1NATA 2PUGA 4D74A 5DKFA 3LKVA 4RWEA 3LUJA 4Q7EA 4KQ9A 4Z4GA 3GRCA 1QKKA 4MR9A 2PL9A 2IPLA 1JDNA 4MS4B 4ZMSA 4MPTA 3H5OA 2PUAA 1D1PA 4P98A 9ABPA 2QV0A 2FMKA 2PMCA 2FMHA 3KLNA 5F64A 1BDHA 4OLAA 4OLBA 4YGXB 1EFAA 1Z17A 3LUKA 4W5RA 1W9HA 4D6YA 4MS3B 4XFKA 1H9CA 1JYFA 3E61A 4LX8A 2GBPA 2JVKA 3GYBA 3Q15C 5EWLA 4HYEA 5TPWA 5KI6A 5HSGA 3KYJB 1TVMA 4E7PA 4JA2A 5KQLA 3RVQA 1FSPA 4RDCA 2PKXA 3H75A 3IDOA 2E4XA 1DRJA 4TLMB 3H1FA 2NZVG 4RXTA 1JLKA 3OQMA 2MYPA 1LJUA 4XXHA 3QX8A 4Z4EA 1BVHA 2W42A 1NTRA 4UHJA 3SQNA 2RGYA 3A10A 3DLBA 3HZHA 5HKOA 2A9OA 2MSKA 4RV5A 5FBHA 3C3MA 3K4HA 3IPAA 2FMIA 1F4VA 2FQYA 3IPCA 2KYRA 1MAVA 5IX8A 1DRKA 1U04A 3BILA 3QEKA 2HQBA 2RJNA 5TQ2A 1GUBA 3N0WA 3HUTA 4YO7A 1I3CA 3N53A 1D4ZA 3DGEC 1ZESA 1YVUA 2FVYA 1XWWA 1LBIA 4FE4A 5FBKA 3T38A 5TPZA 5T7BA 1VPWA 1ZH4A 3BRQA 1HEYA 2JBAA 3C6QA 2QVCA 3N8IA 4PEVA 2FN8A 3OO0A 3UUGA 1B00A 2HJ9A 5KQGA 3CG0A 5HQJA 1PEAA 1Z16A 1DZ3A 1RXEA 1WETA 3H1GA 4Z4CA 2LIVA 1ZITA 4JP1A 2JVJA 4F11A 2LUOA 2E4WA 4KRFA 2FMFA 1L5ZA 2DRIA 4S04A 2I6FA 4KK3A 5JS1A 3CLKA 5TQJA 2FXIA 2H0AA 4Z4HA 4EGSA 4TN5A 1JFVA 2M98A 1MIHA 3FMVA 1NXXA 2FTKE 1RXIA 2ID9A 4L85A 4YRZA 3O2JA 2F8SA 2PJUA 1QNLA 3HEBA 1ABFA 3JS5A 5JS2A 2JVIA 1SXIA 3OO1A 3VNBA 4YWHA 4EVQA 3EQ2A 1SD5A 4MS3A 1T34A 4NV3A 3HV2A 2ZWMA 1D5WA 1RZRA 1ZH2A 1XHFA 3SAJA 1USGA 2Q5CA 2WRZA 3MQ4A 3KYIB 5FWYB 4JAVC 1BDIA 3T95A 3TB6A 2LBPA 2L18A 3QLUA 1JBEA 4W5TA 1QO0D 4DN6A 4ETIA 2PUBA 3EDCA 5BQ3A 2VYCA 1QP4A 1JX6A 4WXMA 1W25A 7ABPA 8ABPA 2NUBA 3HUUA 3CHYA 4RXUA 2IYNA 1P6QA 3RVLA 5JNUA 3MF4A 4G0PA 4F06A 4IF4A 5BR1A 4ZJPA 2XDYA 4MQFB 4QICA 2X7XA 4RKQA 4N03A 3LUAA 1DCMA 2VUIB 3N0XA 4PE5B 5BRJA 4ZMRA 3A3KA 4YS6A 1U2PA 4RZSA 4QPJC 1R8JA 1K68A 1P6UA 3EGCA 3F6PA 3FFXA 1FFGA 4MR7B 2ID7A 2E4YA 5IUKC 2LP4Y 4MQFA 3LUFA 4WUTA 5D2CA 4RS3A 3H5IA 1Z2DA 4GNRA 3LUCA 5JNTA 1U0SY 3RVKA 3QLTA 1EWKA 1JHZA 3H5LA 3O1JC 3RVRA 3F7NA 1P8AA 1YK1A 3JPWA 4H3HB 5IC5A 3BRSA 4RK1A 3C3WA 4KZKA 3CNBA 4Z0NA 3HJFA 2IPAB 2LPMA 3ILYA 3I09A 5C5EA 3GA5A 1NXSA 2L19A 3TX6A 1EWVA 3GWGA 4WXEA 3VNAA 3H5WA 4MS1B 2IPNA 3KCNA 4EYOA 4JOQA 4QYMA 1M2FA 3BBLA 2FW0A 2FEPA 2V0NA 3I42A 5EWMA 5TQ0B 4LE0A 2PLNA 1USKA 2E4VA 5E3JA 2MSLA 2JRLA 1SXGA 2MYTA 1VKRA 3OLZA 3N0RA 4HNRA 5PNTA 1JH9A 3QELA 4EYKA 3HO1A 4G0MA 4OATA 1ZDMA 3GBPA 4LE1A 1GLGA 2JBAB 2VK2A 3NNNA 2QR3A 2J48A 4MR9B 5DLEA 1DC7A 3QLVC 3LUGA 1OXKB 1URPA 4RK5A 3RVOA 4O1HA 5FWXB 3BREA 1EHCA 1YMVA 3C3KA 5CHYA 1ABEA 2WB4A 1JFTA 1NXVA 6CHYA 3DGFC 4ZPJA 4RU1A 1DG9A 2NZUG 3CKMA 4MAAA 2IKSA 2F8TA 3OM1A 4KMRA 3RVJA 5ED4A 2FQWA 2IPMA 3MYYA 2CHFA 3KJXA 3I45A 1ZY2A 5TPWB 2E4ZA 4RK7A 1SRRA 2MSWA 3Q7RA 3QK7A 3H5VA 1PNRA 4DQDA 5B3JA 3KSMA 4Z99A 4KV7A 3F73A 1Y1LA 1ZHHA 2B4AA 3MM4A 5B3JC 3H5TA 1USIA 5IULC 2E4UA 4N76A 3HVRA 4F3TA 4YV7A 2GWRA 4OBBA 5ABPA 4M88A 3LUHA 1JYEA 1E6KA 4LDAA 2QU7A 4N0PA 4N0QA 1Z13A 2R48A 1LK0A 2PAFA 2WJAA 4MR8A 4LDZA 3B2NA 2OENG 2FKAA 4MRMA 1ISRA 1KMIY 1QO0A 4NCBA 1NXWA 5I4CA 5TQ2B 3OLWA 2HQRA 3IP5A 3CZCA 1YS6A 3G85A 1RNLA 2CWDA 1TLFA 3C97A 2GKGA 2R4QA 3O74A 4RK6A 1DP4A 3TO5A 2NT3A 1RZRD 3D8UA 3O75A 1U8TA 4MLCA 1F51E 2PUFA 3DBIA 4G0ZA 3HDVA 3R0JA 2MYUA 1DBQA 2RJOA 4MS4A 1RPJA 1EAYA 1VRVA 2JB9A 3CRNA 4GPAA 4EYQA 5IUNC 2QXYA 5IBQA 2P9HA 3H6GA 3SNKA 1APBA 3JY6A 4N47A 2R25B 1ZN2A 3N75A 4G0YA 3CS3A 4MGEA 4Y9TA 3JVDA 1Z15A 3I5AA 1QPZA 4W5NA 2B1JA 4Q6WA 1CHNA 1M5TA 1YK0A 2A9RA 4JASB 1TM2A 5EWJB 1Z25A 3G1WA 3HSYA 3N6VA 1ZGZA 2WJWA 3KKEA 2YHAA 5GOTA 4TMYA 4PZ0A 3TMYA 3NBMA 4RY8A 4TLLB 3UK0A 2FQXA 4MLDA 4EY3A 4N41A 1TMYA 1M2EA 2GX6A 3EULA 1UDRA 4W5OA 3KLOA 3M6MD 1PNTA 4G0QA 3LMKA 4RXMA 1Z26A 5CNMA 4B09A 2M1ZA 4KREA 3GBVA 1BDJA 2FEKA 5IUJC 4HNSA 3S99A 2YHBA 3UKJA 1L5YA 3O1IC 3LFTA 5CNJA 2JK1A 1Z2EA 1A0OA 1NXTA 4WZZA 1PEYA 5TPZD 5EWLB 2WWVD 1PHRA 3O21A 3OLVA 3F6CA 1AB5A 2ZAYA 2AYZA 4UHKA 3IP6A 4W5QA 3H6HA 4LE2A 2A9QA 3KTOA 5KQMA 4Z4IA 4RK0A 5IEBA 3LKBA 4G97A 3JPYA
chains in the Genus database with same CATH superfamily
3AFNA 1UBLS 1YB1A 1EPUA 5LA6B 1GJRA 1GKKA 1VKJA 1ZNYA 2W83A 3QKSA 4QFDA 5E0OA 5EQJB 5AUQA 4FDVA 1FPMA 2SICE 2ZBUA 3DD1A 2XIJA 3KAPA 1SHTX 1BHO1 3LUDA 1MO4A 4Y2SA 1TZKA 4JLBA 4JV5B 3PVZA 1NXPA 3FFWA 1SU4A 3N76A 3C6YA 3GLGA 2YQ4A 1MNQA 3FY4A 2EVWX 4YWJA 3LT5A 4CETA 4V38A 4DL9A 5LDDC 1U99A 1AKTA 4C4AA 4HDKA 4EUSA 5I8PA 2YDXA 5K8UA 1N2CB 2R65A 1H65A 3KC2A 1YHYA 1ULZA 4IOLA 1LSOA 4MV4A 2AE1A 3EVGA 2WWWA 2ZVPX 5JIBA 5CD1A 4UVHA 2W8ZA 1E6LA 1E2MA 2B7LA 4HQ6A 1V8BA 4J1SA 3L4JA 4XVQA 4X6YA 4YRFA 4NCXA 3O9VA 2UVPB 4Y67A 3SYLA 1RKQA 1HKHA 2G80A 3ZEAA 1G60A 5L3SB 1YCFA 2CHEA 2A9PA 4M1TA 3OEHD 4ND7A 4L0CA 3ZDQA 1RJWA 3VR3A 4QAJA 1LTQA 3WGZA 1YZLA 3WA7A 2JIMA 4Z2YA 3SEFA 1E18A 4IVRA 1RXSA 3EZYA 2Z2IA 4CHTA 3BJRA 2OGTA 1ENYA 1AKUA 1QLWA 3MWYW 3KQVA 4Q7JB 4RF3A 1J1IA 2C2GA 2R6CA 1CE8B 3QFRA 3T9FA 2J8ZA 4B33A 3X2FA 4HWSA 1ZN9A 1BA2A 1DG1G 1GY8A 1H2AS 5G0WA 2RHHA 1NN1A 3DFUA 3OU2A 3P0HA 2QUJA 5AW1A 1K8YB 3IL2A 3SPXA 2P0YA 4MVJI 4MW7A 5ANRB 1NVFA 1QYIA 3E3MA 4Y2JA 2OV3A 1EUQA 1V4BA 2VT6A 4I4NA 2TMYA 2OKCA 2QAJA 1FP1D 2W6JD 3LCCA 3NRCA 3I64A 4WXRA 3W1WA 4MQBA 4OGKA 2HMWA 2FGJA 3ESZA 5JCOA 3ZJTA 1SBQA 1K97A 2QZ4A 3ZIAD 4DDHA 5B3KA 4NWIA 1GFWA 2O6HA 2APJA 2JDIA 3IC5A 4LJ5A 3LGAA 5NLLA 1P9NA 1RHMA 1JZQA 2FUCA 1HG1A 2ZM5A 4F5ZA 3ANNA 4CMHA 4HEJA 1H8ED 4IVPA 1S4QA 5ILGA 3O9ZA 3HI6A 1C3LA 3AIMA 5AHRA 2ZSAA 3DLAA 4Q4JB 1AKEA 1O54A 3TKYA 1W85A 3CB2A 4HTFB 1R5JA 4TXLA 1ZRHA 4KDFA 5GAJA 2NO7A 3DWGA 4JB2A 1UP7A 1G5PA 3HZZA 4QARA 3S40A 3I62A 2Y4OA 4RTLA 1Y1TA 4LZNA 2NU6B 3T54A 4WOKA 2UYCA 1YJ8A 2BM8A 3OBBA 4P1ZA 3TEFA 1XFDA 3FHTA 5EXTA 3ICCA 4G5GA 2H0RA 3AF5A 4K9NA 4C4YA 4DLSA 1D6NA 1YF3A 3NM6B 3TLYA 1KIFA 2R4UA 3RR2A 4IIVA 3MS4A 3VMMA 1QVAA 3II6X 2EL9A 1XXHA 3Q0IA 4Y1FA 3A6PC 1GCGA 2RIRA 4Z9BA 4DABA 4DWOA 2DUNA 2RDMA 3L49A 3HM9A 4OB7A 1NVVQ 3X1WA 1QQTA 4YEDA 3TIGA 4HLQB 1VE6A 3CZAA 2EGHA 3KXPA 3L77A 4KQ1A 5CU7A 5GV7A 5C37A 3G59A 5K8CA 3ETJA 3HA5A 1PEDA 1S8AA 2P3OA 4ENSA 3RIYA 4RHCA 1CUYA 1DCFA 1VLZA 4K5QA 2HPAA 1GXSA 2IF0A 1NOIA 3TRIA 2EG9A 4UC0A 3QX7A 4EJSC 2E6UX 4WSOA 1NUSA 2Q5IA 1KBZA 1YB4A 4D5GA 3M1LA 1V9LA 4QUIA 2X4DA 4HJXA 3SC2A 2LVBA 2PXCA 2EZ8A 1EK0A 4RLFA 5KOIA 3IOMA 3CCCA 4MQEA 1IONA 1WLSA 1TF2A 3BFKA 1B7GO 5B6JA 4RSMA 3WYBA 3UMVA 2Z57A 4B3DA 3IXMA 3QU9A 4LZLA 1FC0A 5C4IA 2DFDA 2ZYSA 4E08A 4AMZA 1VL0A 2BEVA 4XOUA 1SUPA 1ENOA 1ONNA 1YKGA 1T5HX 2P4UA 1NG1A 4PF1A 1BFUA 3PHBE 1WG8A 3T12A 4B6EA 1E0AA 5DRYA 1ORTA 4INJA 2O7NA 1USVA 4OBWA 1SEVA 3E8XA 3RD5A 1DQSA 2NU7B 4PC1A 1ZH0A 3K9QO 2QN9A 4OGGA 2WTXA 2IYQA 1DQPA 4RA6A 3VVLA 3OZDA 4V1CA 2QV0A 4HAVA 3DOHA 3ZDFA 4IUBS 4AJJA 3AX6A 3ZWDA 4F9FA 4HZGA 3VYRB 5LQDA 4JBHA 5HKKD 1EFAA 3G82C 3P9XA 2VYVA 3D7RA 4W5RA 3ADKA 1B8VA 2GXUA 2PLFA 3DL0A 2GJAA 4LX8A 3HB7A 1NR5A 3A9SA 1XZ8A 5TPWA 3MG9A 3KYJB 1Q0ZA 3OFND 1FDUA 5KQLA 1JVNA 4BZXA 1MKYA 2YY7A 1Z35A 3PKZA 1IN4A 3R5SA 2E9SA 3KFXA 5A5VA 1J0EA 4TLMB 2NZVG 3H65A 3X1KA 2H3EA 2IS2A 1BH2A 2JGNA 4UULA 2RAUA 4M1KA 4MQLA 5LA6A 3O4VA 4OXRA 4EKEA 3NC1C 1ZJWA 1NMZA 1UOEA 2E21A 4M0MA 4TKUA 4PN7A 2X1LA 4I66A 3SYNA 1W1IA 1ZJYA 4S24A 5K5EA 4DNPA 4RVHA 1ZMXA 2A9OA 4IQ4A 1K6EA 2O2XA 1RLOA 2PS3A 3OG9A 2PH1A 3LF2A 4N3CA 4UE6A 1IUNA 1E7MA 4AZSA 4L5AA 3A9VA 1JG4A 2OO5C 1ZGBA 1ZYUA 8ADHA 1T6ZA 3RYIA 4BE9A 1OWLA 4CEJB 1KYQA 3MB8A 5BURA 1J5XA 5TGZA 1PL0A 3ENNA 5KNBD 4MUEA 3QU7A 4FS3A 3LQ1A 2H2DA 4BX2A 3AL3A 3EZLA 1U2DC 5C81A 4BP9A 1PWEA 5F1PA 1N2EA 3QEAZ 3EPJA 1ZR2A 2G1UA 4CVNA 2J7PD 1F4PA 1MH9A 2ONCA 2WSSA 5DBOA 2OPHA 1E60A 2FX5A 1Z0DA 2F9MA 2GKOA 1Z62A 4BBAA 1DS6A 3AL2A 2UZAA 5KYYA 3BWBA 4X20B 3VHLB 5TX7A 3VPHA 3M3HA 3QVGA 1FDOA 3HCFA 5I9NA 2GTPA 2UZ1B 1J7KA 4DWWA 1KQNA 4MV0A 2I4TA 1BVYF 3T7AA 3H7AA 2NYVA 3R0XA 3OVMA 5JTTA 3N0TA 3R6GA 4PNHA 2FW9A 4D25A 3WY9A 3L0DA 2B1QA 2QPAA 3QFTA 4PO1A 2QZSA 3PHCA 1R50A 2HBZA 2VZEA 2WWXA 5JUWA 3B5EA 1ABFA 3JS5A 3K6JA 1TZJA 3L1VA 3OO1A 4XQ9A 5I45A 2BCJQ 2PWBA 1PQUA 2VA8A 4JC0A 4RTOA 1KSJA 3E0XA 3S8YA 2WI8A 1DT5A 1C4OA 2X7HA 2QJOA 4JJAA 4ZANA 1TM3E 3PPXA 1UKAA 2BBTA 3R0ZA 2AWNA 4KUEA 5FWYB 3U37A 3U4AA 4DBLC 3GHYA 3BOSA 4HFJA 4W5TA 1HRKA 1N2ZA 4E5PA 3JQAA 5BUQA 4OREX 1I7PA 1Y1QA 1YQEA 2K4MA 1O5TA 1UXGA 1PZEA 4LWPA 4UXHA 1TM5E 4EMUA 2R8RA 1GA4A 4UTOA 2RC6A 3K31A 3E3AA 3TAHA 3S1AB 3W3AH 3RBXA 2OVBA 4MV3A 4WI1A 3BF7A 2Y92A 3TEJA 3OJFA 3WMXA 1V7PC 2XVMA 4A8PA 5I7HA 1YC2A 4GGPA 3WGJA 2RONA 3ASUA 4L5CA 1ISMA 1DOAA 1RKUA 1RXYA 3P2OA 5DU2A 1X86B 3RF7A 3LW7A 5LYJF 1JMKC 1XCGB 2A7QA 4MQFB 5SYNA 5MFPA 5AQEA 3ME5A 1C0PA 1P74A 2JHPA 2VUIB 4UM9D 5A05A 4Q9DA 2D1RA 3A3KA 2IV2X 2ODWA 3EISA 4M22A 4MCJA 3SR3A 3E7XA 5AXDA 2OQVA 2X0JA 5FTWA 2CYAA 1OROA 3D6VA 2EW2A 1GXSB 1VOTA 3F6PA 4BNGA 2QGNA 4U7FA 4R5MA 3R3VA 4BC1A 4L9AA 4OPMA 3FZGA 1P0QA 5GM1A 5BMVF 1NBEA 3I9FA 3IMGA 4KYTA 3M1YA 1LBQA 3OHMA 4HMPA 1WXFA 4P2GA 3ZOZA 2DHRA 4F1WA 4PPFA 1W4AA 4TS1A 4J3JA 2NPFA 1H0RA 5KOHA 3VR1A 4CKXA 5HF9A 1N33B 3WGNA 2HF7A 3JV7A 1QE3A 4WNAB 1JVSA 1OXXK 1DDOA 3LXXA 2IZ1A 3PJEA 4G25A 7AT1A 1ETUA 1P73A 4UE3S 1QIMA 3VBCA 5IVDA 1T2UA 5KSYA 3C14C 1ZVKA 3P20A 5F4ZA 4B5KA 1VJ5A 3MUNA 2E85A 5CJJA 2CN1A 3HNOA 5HS4A 3BXZA 5EYPA 1K5HA 2ZU6A 2A9KA 5DI9A 2NO6A 1O6ZA 1R7RA 1N9ZA 1P1JA 4MVJD 1YS9A 4CM8B 4FJ2A 5K8JB 1JR3E 2IYFA 5ALRA 1N25A 1TW2A 2ATXA 3QVGB 5LQNA 4R1UA 1XQ6A 3Q6MA 2O0JA 4J2OA 4XPIA 2CLHB 1YRWA 2WICA 3D0KA 3CNQS 3PEEA 2DX7A 1L9XA 2JBAB 4R8KA 2WOOA 1W87A 2VDKB 5BR8B 5IYZF 1XPJA 4LX0A 3RAFC 1UDBA 4LF9B 4QNNA 1FXWF 4IGFA 4CKWA 4MQ6A 5T5QA 2VBCA 1C3OB 3MWKA 2WBLC 5BSFA 3NBAA 5CHYA 2EFGA 2V4ZA 3GLFE 1R4NA 1CJKC 3AESA 5D1NA 1PWHA 1PZXA 2XJ9A 1BS9A 3JW8A 2YXEA 3QJYA 1TIBA 1T3TA 5FLKA 4DUGD 5HFAA 3OM1A 4MRVA 1A4RA 4UCQA 1W6RA 4LRXA 3T1HB 1E9BA 1F9EA 3E8SA 3GLVA 5EHZA 5IT4A 4IJKA 5JALA 4HNAB 1O08A 4MX8A 2PLWA 5ALNA 2H51A 3QH4A 4K9SA 5FPHA 3VA7A 3QRWA 3RNOA 4NULA 1BQ4A 4IDHA 1JLHA 4KPUA 1WW8A 2WM8A 4ZGBA 1OU4A 3MMXA 4KV7A 3LX4A 3F73A 4PYIA 4ND8A 1ODKA 3GVPA 2C4KA 4HFMA 5BYAA 1OFIA 5AP9A 4F3TA 2GWRA 1M2HA 2ZOSA 2JL1A 2JLWA 4K9PA 2OSBA 4E5SA 4ENUA 1UJNA 2HRQA 3Q9UA 1ZM7A 1FP6A 2KSQA 3ADPA 1IBRA 3I2HA 1TFUA 1GZ6A 2XV1A 3W5SA 1WL8A 2GSDA 3L6EA 3DWEX 3H9JA 3BAZA 1HKUA 1QKIA 1OTHA 2BMWA 2B83A 5M29A 2DWCA 2RSLA 1EVEA 1N1DA 5KOJB 2UUCB 1CS4C 2ORWA 3CPJB 3OFSA 1Y3IA 4DMFA 2Z83A 3OLWA 3I2IA 2QSUA 4L4YA 4Y7DA 2JJ2D 1Q95A 4W9RA 4AO8A 2ZSFA 1KI3A 3F8TA 3D4OA 5FAKA 2VP4A 3SQOA 3WYFA 3M70A 1K3FA 3OH8A 5E3IA 1K6JA 2NT3A 3EYAA 5C34B 4QGAA 2JNWA 4GWLA 1XMPA 4FFRA 1O6GA 3RKRA 1C4XA 2R6FA 3V42A 5JSHA 1SHZA 4HSEA 5JAIA 4G4SP 5EEGA 5F35A 2J4DA 4YRQA 2B2XA 2XH8A 5CB0A 2C7RA 3KQQA 3ZXSA 2G09A 4H2DA 2E7ZA 3F0TA 5E1MA 3WFJA 1SKBA 1BW9B 4NZ9A 1SU6A 1EMDA 4WKGA 4OHFA 2FW1A 3M4ZA 4NPAA 5EGNA 5F3DA 3IT2A 1CT9A 1NAIA 4AWBA 4ER7A 3SZRA 3ZD8A 2GN8A 2YNMD 2SHKA 1SCUB 3F4LA 2W71A 4TMTA 5AVKA 4BFZA 3PTAA 4HXYA 1ESDA 4FGLA 4TL9A 5H82A 5G0UA 1WVIA 1SOVA 1N6KA 3FZQA 2GA8A 1ZLXA 4MI9A 4ZVUA 1FS4A 1PNTA 4LJ4A 1N0WA 4X1IB 1NNI1 3SHFA 5HEKA 4ACBA 4TXNA 3WRYC 4NJOA 2GAIA 3TNYA 4HNSA 3PSHA 3PCXA 4ZMBA 2NZWA 4PLYA 5BQOA 4GI2A 1T5IA 3PYXA 1L2TA 2W6ZA 4G37A 3ZKWB 1CIVA 1Z6AA 5L53A 2VQEB 2A57A 1QK5A 5DF1A 3DA8A 1DXOA 4QL3A 3ZDXB 1GVNB 1K27A 1YSCA 5DTJA 5ICSA 1XXHB 3ND5A 4ND1A 3Q2IA 4YAOA 2FHPA 2ZXUA 2CZQA 3G88A 1DHRA 2PTGA 3G9UA 1ZIPA 1OOEA 5E9AA 5LQUA 3R6WA 9GPBA 1WDWB 1Z6ZA 4IQFA 4RK0A 4YREA 3W8EA 5JFTA 4UHBA 2VP6A 4XX0A 4RIEA 1SO8A 4R83A 1UBHS 4I9UA 1CS0A 2XODA 1UKYA 3KZCA 3TXAA 4BEBA 1U0BB 2E1PA 1Y63A 1PJ2A 4E2YA 5H4HA 4MGIR 3GLIB 3PXBA 3L8DA 5EIBD 3WQQA 1LI5A 1QE5A 2Y1WA 1SN7A 1Z8NA 2YINC 4MR8B 1MVOA 5FLEX 4YR7A 3DVQX 2QL7A 3RAGA 1RD4A 2Q8NA 4CLDA 3EMDA 4OI0A 3LHKA 3HY4A 3UXEA 2GZAA 2E48A 2B4YA 5JYDA 2F64A 3GRRA 3NBYC 3ZK8A 3Q41A 5TY0A 1FTQA 1AK9A 1EFTA 4RPJA 1E6UA 1Y8CA 4RTQA 4JI7B 1Y1RA 5BN5B 3F71A 4RIGA 5DNCA 3NTUA 4HXEB 2PMEA 3WLSA 2XZTA 3RO7A 3R7WB 4WZAB 1VDZA 2P8SA 5ETJA 2ZSUA 2OA0A 4NMHA 4P5DA 1TLLA 2R68A 4WLVA 4POOA 3E2MA 4XFJA 3KJGA 1FDVA 2P9FA 3GVHA 4FKMA 2HXGA 5KPJA 4ZTZB 1F3LA 1MB9A 3ELYA 2O5EA 3SYRA 3AEKA 5CEJA 3OMXA 4FFBB 3VH4A 1P5FA 3L0ZA 1Y9DA 5J2TF 5LYJA 1QIKA 4CLOA 2W2TA 4YK7A 2O59A 3BFVA 1C29B 1YONA 2A3RA 3WAKA 3Q4GA 3LTEA 1DIHA 3UMCA 3DOUA 1L7MA 1G20B 1R0KA 4WGFA 5G3YA 3STYA 2IXTA 2W9XA 3R0VA 1T8SA 3E81A 1QDUA 4MDYA 3IDZA 3MJ4A 1GGHA 3AJ8A 2FPOA 4UFNA 3IVGA 4JI0B 5CH8A 3F97A 1G21B 1U9IA 1N8SA 2GN9A 2ZRNA 1G1MA 3JQQA 4MB0A 4PLHA 4UEQA 5AJYA 5JZMA 3JARA 3K5PA 3UBTA 2CBXA 2W6ID 1QFSA 5E2BA 1UL1X 1EK5A 4YC7A 5IWCA 3AKYA 2HLHA 4KTVE 2HQOA 2I0FA 3D2CA 3B53X 3WQHA 4D4HA 2KLBA 2X1VA 3K0FA 4C21A 1O95D 1E0DA 1W5TA 2VJBA 2Y0BA 4IJ5A 5KYUA 4JQOA 4KXWA 2CNBA 4D6XA 5LIRA 1MAWA 3KJZA 3EB9A 3MJFA 2XMBA 1CQIB 4RH3A 1EJBA 3HCBA 3VNUA 3CUTA 1Q1ZA 3L07A 4OKSA 2E5WA 3WO1A 3D7SA 1GG9A 3BRCA 4J0QA 2CBGA 4QUEA 3L6UA 1QAMA 1BQ3A 3PHLA 3CF0A 3GZTB 4EJSA 3W4KA 1HNWB 1VKOA 5JSQA 2GZ3A 2RH8A 3UJDA 4BNLA 3JQFC 4JVLA 2HLDA 4L08A 2OV1A 5E1DA 4C22A 4TYYA 2LCFA 4PSDA 3A4YA 4IFEA 3KWLA 1U7DA 3MOIA 5CUQA 3YASA 4DB2A 3V8NA 3CN9A 4II7A 4HX2A 3RYIB 4BFXA 1R10A 1PR3A 5AI8A 3SKXA 3PRJA 4I4LA 4IV8A 2PJRA 1JT9A 1VLMA 4M3NA 3BTUA 3JQCA 4OQXA 1JWLA 1NLYA 1SOUA 4PYRA 4DJAA 3OU7A 1AC5A 1L4KA 4KX3A 1STOA 3EA5A 3FTPA 4IHJB 1J99A 3RVDA 1H2FA 2R62A 3DHWC 2LCQA 2B9VA 3IBYA 5T4BA 3GRAA 2I6SA 4C30A 1U3VA 5CBKA 3K2BA 5KOJA 5EUQB 1XOIA 3IIKA 3M9LA 4R84A 1N7IA 3K1YA 4WVLA 5CNIA 1KVQA 2FLKA 4L5BA 1A76A 4AS2A 1EWYA 3M6IA 2C3YA 4EM6A 4YCDA 4KWHA 1TU0A 1BD3A 2ZQZA 3LLUA 4FYKA 4R7GA 2WZBA 5FWNA 1Z3IX 4HP8A 3N6XA 5CLJA 4P81A 1HK7A 4JJKA 3V8VA 1FU7A 1E94E 5HYVA 2UUBB 1DJQA 1TA0A 2D0IA 2ZULA 1P4HA 3AVOA 5CM8B 4PCUA 2CFCA 4MUGA 5BWOA 5JJ5A 1VCIA 4ROTA 1P2TA 4JDPA 4CPDA 5JFOA 4M49A 4NFLA 1CUGA 4MRPA 2Q5EA 1DBSA 1Z8DA 4Q1AA 3ZGNA 4H4EA 5GP1A 1GTRA 2O3SA 4IVQA 4XJTA 1QKKA 4Z4GA 4WESA 3D3EA 1LA2A 2IPLA 2WVGA 4MS4B 5A3VA 4M8NE 2GZ1A 3AINA 2JHAA 4IHJF 2FN3A 2YWXA 3WLHA 3U44B 4BNDB 1QIHA 2YBEA 3IBGA 3IS3A 3BFPA 2Y9MB 5DIFA 2IY9A 2PMCA 2DG2A 1V4VA 2QD3A 1KO5A 1SHKA 3IHKA 4QSMA 3MAAC 4OHMA 4BRUA 2PFSA 4E70A 5E7MA 3PWTA 1YC5A 3WIEA 2HTEA 1MJNA 2Q0SA 4DC9A 2NUAB 4EWLA 1AM4D 4JA2A 2OMKA 4YA6A 2BGTA 1VLJA 2YOHA 1FU4A 1RCUA 1OA0A 1HLFA 2AR9A 4MUJA 1MHPA 4WJZA 3VHQA 1HPLA 2E4XA 2YUIA 3ZE8A 2E1RA 1NN3A 4CEIB 1KDOA 1SC4A 3UFXA 4C78A 2QN1A 3WG9A 4RBNA 2DUMA 3G2LA 4XXHA 2P79A 4Q9AA 1T6NA 3FWZA 3I04M 4XEHA 3WB0A 1ZVQA 3ZVNA 1V3VA 3TWOA 4I9FA 1EA7A 4ND5A 4V0MA 4WOCA 3WWZA 1SIWA 5J4LA 2WSSD 3DZFA 4BO4A 2AH5A 2I7CA 4HFNA 1D5CA 1JKFA 4XIYA 2E0IA 2CHQA 2I78A 3A1UA 3F1KA 1I6KA 1KS9A 4PBTA 3J7TA 4GAEA 5BSGA 2RGBA 2FE1A 1M75A 1H2XA 1F8FA 5AHWA 3SICE 5KOHB 3RBZA 4Q1BA 4YI3A 5E4FA 2Q4TA 1IOZA 2JZOA 5E7JA 1YE3A 4TTAA 3ZBQA 5ICGA 1DIAA 3CSUA 4RF4A 5ALGA 4FE4A 1T0UA 1LBIA 4R98A 1VM6A 3T38A 4NMXB 3OIDA 4Q9JA 2QMZA 4QREA 1YQUA 4U6NA 2HA3A 2IWHA 1OH7A 2DFKB 3EH1A 2QVCA 4BNWA 1TF5A 1X1EA 3N8IA 4ZVSA 3R7WA 3M6VA 3U4GA 1DRUA 5GINE 3IV7A 3L7AA 1TYZA 1MC4A 5F33A 3JD3A 5KTNA 2CNOA 2JEZA 2YWFA 3C4VA 4AU1A 4Z4CA 5EFZA 3EOBI 1HETA 5B30A 3GJ0A 2P3LA 4R2LA 1XZLA 4F11A 4FFOA 4F4CA 5GJVC 1L6RA 4S2EA 4TMKA 1G7TA 2XUJA 3EXEB 1NF2A 2J9ZB 3LBAA 4KK3A 3PF8A 3UC5A 2PGNA 5H9WA 3T4PA 1OX6A 1HGXA 3ZD6A 1L8LA 1JR4A 2A8YA 4NH0A 1GLVA 1L3IA 1RJGA 4MB6A 1AUVA 3Q1LA 2P2NA 4HB0A 1RXIA 3L7IA 4LJYA 4PFKA 3DMTA 2B4TO 4YAUA 1SG6A 5F52A 2DE0X 1GPH1 5E4JA 1KFCB 2VZ8A 2VLBA 1LBSA 1QIGA 2WP8J 4UUNA 3TE7A 4YR9A 4DT1A 3PI7A 2XUGA 4DANA 3HGTA 4MS3A 3MZ0A 4RTPA 1XD9A 3GYGA 4I08A 5AVQA 3UOAB 1NVDA 4F46A 1R8QA 2X8AA 3CC8A 4MXDA 4WN9B 5DLQC 4A27A 4DSZA 1VE5A 4NZZA 3IDFA 5H7XA 3Q11A 2D0OB 1KPHA 4JN6B 5G4KA 1AVTA 4DR1B 4AG6A 1EZ4A 2HNAA 3ZHQA 1CUAA 2DQZA 3VDXA 2RHRA 2MR6A 4FMCF 3CZPA 2OHVA 1YR1A 3CZ4A 3AV0B 1QO0D 1R5NA 1SU7A 1YZUA 4I1SA 4ETIA 3O26A 1QP4A 1JW9B 1G20E 1YNSA 4P38A 1NSTA 4JOCA 1WXHA 3VVMA 2XI4A 2ZRJA 3CVJA 1EFLA 3PGJA 1DWUA 1ZD8A 1P9LA 3H8JA 4DCNA 4YJ3B 5L51A 1P6QA 3UJAA 5K8LA 4B3MB 2EG5A 2HU8A 4QFCA 2PZLA 4YI5A 1IK6A 1G8SA 4W9NA 4C0SA 5EMJA 3MTJA 1M1YA 3TIIA 4ALLA 2C8VA 1BE6A 2AW3A 1OC4A 3A4TA 5IK2A 2GEDA 5J63A 4JL5A 4YLYA 3C16C 5IHXA 2GN6A 2V98A 3ZE6A 4OBEA 4BMCA 3KJHA 1M10A 1U9JA 5I6DA 1ZCZA 2PV0A 2RB4A 3B3GA 3EVZA 1G7SA 2FWNA 1W34A 3OPYI 4BYGA 1JEYB 4B4KA 4MR7B 3E7WA 3QXSA 2CLSA 2Z4RA 5D2CA 2X0KA 2F9FA 1SK8A 3A1FA 3K8OE 1BYUA 3LCRA 3H99A 3ZJUA 1NC1A 1WSWA 3OHPA 4TV9F 1QWSA 4Y0AA 3WLFA 4Z4IA 2JATA 2E5LB 4J90A 1WP4A 2IOFK 4TMZA 2ZAGA 3DL7A 3MJDA 4TXHA 4AAYA 1TCBA 3RS5A 5D5PA 4PIMA 4H3HB 4DZTA 1KP3A 3ASZA 3BGDA 2BI7A 4LSMA 2X2PA 4XUDA 4IDDA 4X24A 4FDUA 3GA5A 1NXSA 2G77B 3IAUA 3H5WA 3IAM6 1O9BA 1S96A 1RE0A 1SM4A 3QXHA 4GBMA 3OQBA 4XYLA 5HJEA 3WGOA 3K96A 1AE1A 2CV0A 2ZT6A 2FUG6 2DH6A 2AJCA 3OP1A 3QW2A 1NBIA 1TPZA 1GL9B 1XA3A 1NN0A 1QLJA 2WYWA 3NRJA 4HZUB 4KAJA 1ZXLA 3HKEB 1GEEA 3MWGA 4R1MA 2C2WA 4AG5A 5GOZA 4RV4A 3W05A 1WTAA 2A0YA 3QBVA 4EY8A 1UMDA 3NNNA 1IYZA 1ECBA 5EMMA 5E1OA 4ZEWA 1E5TA 4O8ZA 5J40A 3K71B 4Q3LA 2E37A 3PQ4A 5AIAA 2E55A 4YVFA 4F7DA 1GV0A 3DXXA 3MCUA 2NSYA 3QWAA 4PAMA 3TRHA 3RGGA 3IR6A 1JIKA 3QVJA 1GPKA 4TTIA 3RS2A 2NU8A 4FGJA 1Z5NA 4ASUA 1IN1A 3FUVA 4J0FA 4QE3A 4QYSA 5G4LA 3ZCRA 4B3CA 2VWQA 5AQ1A 2Y1XA 2XKAA 3WWYA 4M1MA 2C4VA 1C7QA 1PVDA 2ZB7A 4MUMA 4QDKA 2R86A 4HT3B 3ADBA 2CF6A 2J7KA 1T5OA 3KFLA 5FT9A 5DHRA 4BMOB 2Y6VA 3QPCA 1ORRA 1AN0A 1BWRA 2QAGB 2X5KO 3PC8A 1NYTA 1LF5A 1E9AA 1A8PA 4OMFG 3LUPA 1G9SA 1TAGA 4OB8A 4CMIA 1EQ2A 3MJVA 1GTL1 1UXIA 4AX4A 3ILVA 3AM5A 3RJZA 5J58A 2JHFA 4Z99A 1ZGAA 2WYVA 2Y0DA 1UBUS 3GR6A 3NTXA 2CMKA 3ZG6A 1Y1LA 1ZHHA 2PX3A 3D1JA 2PTHA 4K03A 4JJ6A 1EM8B 1TRKA 1GGVA 1WEHA 2AFRA 4RMHA 1XQ9A 2PVCA 2O14A 3DOOA 4M88A 3LUHA 3LJKA 4L07A 5G1PA 4GX0A 5L7YA 3ER8A 3ESBA 4F3RA 1QRRA 4GC5A 5LMZA 2D3WA 4BGEA 5F2NA 3ITEA 4L51A 3HCNA 4AS1A 1P9WA 4ZO6A 1TZBA 2WJAA 3ELWA 4LDZA 3VZPA 5K0ZA 1HT1E 3G5MA 4YMSA 1K4MA 5L8VA 1ISRA 4IRUB 4DV5B 1E9EA 1N8KA 1QO0A 3U3JA 3IEUA 4CTMA 1NXWA 3C4QA 2CT8A 3BXPA 1G8KA 3FHOA 4ZZ1A 4MMYB 1KJQA 3FA2A 3X44A 2PKCA 4G63A 4M87A 2EJBA 2BCEA 2AQIA 3VHXA 1DQRA 2WSYB 1ID8A 1KH2A 1S8FA 3PRHA 4H0NA 1P7CA 2R8PA 3B2QA 3KKMA 3N2GB 4QEDA 3ECAA 3WB2A 4A1OA 1W4ZA 2Q07A 2EKLA 1O0BA 3BZBA 1EGVB 3CYFA 4PINA 1WJGA 1M2OB 3LPNA 4JI4B 1NF9A 3BGWA 3IMEA 3N2LA 2IOHA 2WAAA 3OM8A 2C5SA 1RPJA 1DJNA 1QB8A 2BGUA 3G3EA 4WVFA 4TL8A 2LWIA 3VPAA 5CDFE 1M5RA 1VG0B 1NLUA 2WYUA 4Y1RB 4OX9B 1PDVA 3WKEA 4DB4A 1BA3A 2QN2A 3AG6A 5GPBA 1USWA 2Q45A 3IGFA 5KYUB 2GOYA 4YDHB 4Q3KA 4X1OA 3CEPB 5DWVA 3ZV7A 4W5NA 1JLRA 4IHAA 2ZAIA 3FX2A 1TM2A 2WAMA 3OQ1A 2B30A 2PQ6A 3HSYA 1G5QA 4OHWA 2I22A 2PSDA 1L1QA 4B2PA 3VO2A 2QVZX 3MJTA 3ZNNA 5F5LA 4GI3A 1JGTA 2FQXA 1RAIA 2A1TR 4UXJA 1RQPA 5IASA 2VPZA 5JSFA 4QBIA 4W5OA 4PR0A 1G55A 3BCSA 4MVYA 5AJWA 2DETA 1XTJA 3KQHA 1PLKA 3GCGA 1U4SA 4HS9A 2PFKA 1GM5A 1U98A 2BWJA 3F5DA 4K8OA 4P5EA 2K7FA 3LFTA 1N5JA 5ITZB 3IQHX 3OZFA 4LZWA 4WCDA 4KJZA 1A0OA 5CA0B 3FFBA 4EENA 3COPA 4Y2VA 3L8CA 5LXTF 2XZLA 5ARDA 1U2TA 1BS2A 5SYAA 2O8DA 1T8TA 5F23A 1Y80A 1SURA 4LXUA 3E9ZA 1XJWA 3D0QA 4I81A 5FNVB 5IJXA 3LKBA 1PK9A 4JNCA 3BYZA 1HV8A 4Z3OA 1M8PA 1A2BA 1V1RA 2X4GA 4H7HA 2C7BA 1XK7A 3KAJA 4LNAA 3PFCA 4XAQA 3UMJA 5I7UA 4FONA 1XQXA 5BWLA 1OI4A 2WVAA 1KYZA 1OBOA 3JASA 3NU1A 3OIUA 4OD0A 5ALZA 3VPXA 3EXFA 3N28A 4QUJA 4Y9DA 5FL7A 2DQ4A 4ZCIA 2H31A 4C5BA 4ARCA 4CYMA 1R0SA 2IDMA 3LX5A 4NCHA 1KDZA 1OYYA 3FXAA 4WACA 1Z4KA 1Z6QA 2VWGA 1R6XA 3JD4A 1CRQA 2YXBA 4BN0A 2ZTMA 3UHAA 3ILSA 1QRSA 1SCQA 5BQXA 4GHWA 3BAFA 3FSJX 3RC8A 3ZVMA 3EPKA 2FJUA 6REQA 3WRXA 4ML3A 1ANKA 2F48A 1KQPA 1YAHA 2BH9A 1XTTA 3CTPA 3PICA 4WK6A 1TIKA 3EMVA 2F3QA 4OU5A 4G23A 1ZL0A 4PG4A 4HGPA 2XF2A 4OM7A 5CVDA 1K4YA 3A11A 3DEKA 4XGIA 1P2FA 2C1ZA 5EYPB 5JG7A 4EI2A 1SB9A 4NZYA 4ETMA 2HTFA 1ECLA 1LBHA 3IP7A 2PZFA 3L82B 2RGCA 4OJMX 2QG4A 2B5OA 4QYIB 2PDAA 4EUNA 1SXPA 5CM9C 2XTMA 3LT4A 3HBLA 2C5BA 4R9VA 4YO8A 2CK3D 1ZGCA 2DYKA 3PE4A 4JYBA 2OD9A 1N1MA 4LVNA 3GJRA 3GNQA 3GELA 5DFAA 4YIKA 3DONA 3V3TA 3LTNC 3ZC3A 4TYWA 1E89A 2P9BA 2ZEJA 1DBPA 1JDBB 3KPUA 2I1QA 4KCGA 4OIMA 3HLYA 1T0PA 4JB0A 3SHWA 2IFTA 4K6FA 4HLUA 3X1YA 1WCIB 2JFYA 4C0KA 3UM9A 2QRVA 4HOYA 4DILA 4ZZIA 3QEBZ 4HBGA 4EVSA 2VRCA 1X1QA 3E22B 1CFZA 1V96A 2AYXA 2NMVA 1W76A 4P2BA 2QAIA 3FRHA 4V0SA 4RZQA 3T0GA 4AJ1A 5K3OA 1BMQA 2BFBA 2GLUA 5L3QB 1GPAA 1P44A 2H92A 2WJJA 2XOKA 3C3EA 4MRRA 3ZZUA 1Z75A 2IXEA 3PQFA 4DUPA 5CCEA 4JB3A 3QP9A 4WFKA 2G1PA 3FNFA 1BXKA 2GM5A 1WMDA 4TWZA 3DOJA 1XGKA 3PUYA 1NNUA 3PT5A 3ZS9A 1F17A 4NH4A 3A28A 4X54A 2ZRHA 1OW3B 1GGEA 1Z47A 4LWOA 2HN9A 3HWRA 4NPCA 3G8CA 3KCQA 1ONBA 5I7VA 4C6TA 1GUDA 3KUUA 3EEYA 2PSHA 3S4YA 2P75A 1P3DA 2OPBA 4BKRA 3KVRA 3RTAA 3V55A 3RADC 2IVZA 5F77A 1U90A 3OQOA 3Q98A 5CAEB 1WV0A 2Q1UA 5EP2A 3M34A 5K3FA 1BMFA 3L4BA 4OOFA 1DDIA 1GPJA 2BFMA 2WLSA 2XNHA 2JH3A 5AVSA 2YW9A 1UEXC 1UZLA 3A7DA 1KZHA 1NONA 2HK7A 1LPSA 3Q7EA 4JJGA 3PEVA 4LBVA 4RULA 2YV3A 3DR3A 3A31A 1WZIA 2N47A 3EAFA 5E1BA 2ZYHA 5JAZA 3EGEA 1UJ6A 3CTMA 3DFFA 2HLDD 5ALUA 2WMDA 3AHIA 4QLOA 4RHFA 4TLCA 5DM70 4YDSA 3C7TA 3ZHUA 4BB0A 5I7OA 2HA4A 3AEXA 4TLBA 3WWCA 3K73O 2DJIA 2BRUA 2OQIA 1Z68A 3NTLA 1XYYA 2E3JA 4H31A 4H27A 1L5QA 3L93A 5AFSA 3L7DA 4Z8XA 1JIXA 2FLWA 2PAAA 2ZSIA 2F7SA 1MGOA 3B7GA 5CB4A 3W7BA 1F60A 3TQFA 1KAOA 1JHMA 1Y1SA 3O9MA 4I55F 1Y0BA 1M0WA 3EK2A 4HB2A 4XUEA 5CLHA 3FLAA 3PQ2A 1E6WA 4KKXB 3EE6A 3S7TA 2QX9A 3TD9A 1Y48E 3WB1A 1VJDA 2OVFA 5C8DA 5LDHA 3BS4A 1T9HA 1U28C 3ICEA 4HGQA 4XFDA 1XN4A 1OFVA 2UV8A 1EUDB 2E2WA 2W2VA 2DFVA 4G8DA 4O4HB 4WBXC 3V1KA 3WISA 4BB9A 2IDJA 3EFOA 5FJJA 3WK5A 1V5EA 2WG1A 1LRJA 1OI3A 3NTQA 4XTCS 2WIBA 3PT9A 1I2DA 5BPHA 1WPXA 2EFHB 5IEJA 4XVRA 1Z2NX 3GRZA 1G2QA 2C54A 4JX8A 4MH0R 3TNFA 3B8EA 3VR0A 2XZPA 4LDJA 1H6BA 4DSOA 1LLDA 1U28A 1PJ8A 2P3SA 3AP1A 4K9OA 3IPXA 2FWPA 1RHKA 3PFWO 2D8AA 1NC3A 3OJCA 5JBQA 4KKVA 3HJGA 4CHGA 5AOCA 4EEZA 1PLLA 1QHIA 1VB5A 2CE7A 2XX3A 4M99A 5L4SA 2VWPA 4GUDA 2OZKA 2HIMA 2FMKA 2R751 5AI9A 1SCAA 4Q9IA 4TM8A 4ESHA 4OLBA 2H5EA 2XWQA 3BEDA 1RP1A 1IB0A 2BRUC 4HDNA 4K9MA 2HMYB 2QT1A 4QRIA 1W9HA 3T99A 1VGQA 1UMCA 4QM6A 2QL6A 3L0PA 3RFUA 3SP1A 1NQWA 4MW0A 2A94A 2QY6A 2VDRB 3EUWA 2DECA 4A16A 3B9QA 1TVMA 5DOZA 5TC4A 4DA8A 3JQDA 2DHDA 1G9TA 1PYOA 1LPAB 5IDXA 1U0TA 1V7QA 4Z7NB 2CCJA 1JHDA 3K9NA 1Y6RA 1RTTA 3FH0A 2BHTA 5EE0A 2F55A 4KLZA 4POAA 3VPGA 5B1SA 1Q0QA 3ECCA 4DA6A 4QAQA 3N59A 5IDVA 2GJSA 2R11A 2O5CA 3W2IA 4LDRA 1CLUA 3QG5A 2J6BA 2R7AA 3AVUA 1N57A 5DW0A 1H0SA 4LDNA 1T9KA 4RYLA 1RU3A 4ZJUA 5HBRA 1XX6A 1CUHA 1YMQA 1KR2A 3CUVA 1O95C 1ZJZA 1L5HB 2DHEA 3PLNA 3N2NA 4WZ6A 3A1TA 1A9ZA 5EZSA 4CIWA 3T1OA 4N4AA 5SYMA 1A8SA 2HQBA 2WQ6A 2M9MA 3A06A 5DHAA 4YO7A 5A6VA 3W4IA 5JAHA 5JRJA 3RREA 2W6QA 3ANXA 1V7ZA 2FZLA 3DMGA 3M6LA 4LJSA 4XRRA 3KALA 3N53A 1D4ZA 2X0RA 3D6FA 5CCXA 5ELXA 5A0TA 3I9V6 1UUFA 4HN2A 3WICA 4CQNA 3NP9A 4PG5A 5THKA 3W2HA 1THMA 1X1TA 3BRQA 3GLKA 4DDKA 3B6EA 4EO9A 5IJ0B 5LZ2A 4IM7A 1TNDA 3ITNA 5E9WA 1OKKA 5EKUA 4YRBA 1TO1E 3MELA 1IRIA 2WHQA 3AW9A 3H4TA 5DGTA 4MWCA 2EWMA 4ES6A 2OFFA 4OAQA 4PO8A 4FR0A 2VT7A 2H29A 1F2DA 3GDHA 4BATA 4C07A 3FOZA 2GCNA 3MGBA 1ZITA 2OT3B 1AKNA 4BPRA 2JVJA 2CFSA 2FG5A 2HK8A 1RAFA 3FOBA 3KZVA 4ZQHA 2XLBA 1HTWA 3DTVA 3LQKA 4TQ9A 4C6SA 1GGMA 4HGOA 4EHJA 1WHSA 1ESNA 1KAHA 1I1QB 1PGQA 3BWVA 4DXHA 2HREA 1YWGO 5FUMA 2NSHA 2W90A 3NW9A 3FMVA 2WMNB 2OV4A 2FTKE 2W43A 1TMGE 3HJBA 4JKOA 1IG3A 1A9OA 1GYRA 3AHDA 3HEBA 3WNDA 4W63A 3UA3A 2G1KA 3F9CA 5FX2A 2ADOA 4EB0A 2YBDA 3DOIA 4XB2A 1SD5A 2AXEA 2ONYA 3ABSB 4R3NA 4AWXA 5K2OA 4BFTA 2HA6A 3Q85A 4U7HA 1HDOA 3B6IA 2XYRA 4JVNA 4XD2A 4GOOD 1I01A 2JAUA 5JVDA 2CVQA 3AEQB 3BTVA 2NW6A 1MENA 2NTEA 3PR2B 4ZU3A 5KNBH 4YT5A 1WKCA 2NVUB 4B3RB 1RYEA 4M1YA 2JJ2A 1BDIA 4NJMB 3P9SA 4IIDA 1XAJA 2ZYAA 4LMAA 2BZGA 3NIFB 1IHYA 1V3TA 3C6ZA 2AN3A 1D8TA 3SXPA 4OSOA 3EF3A 2QRUA 1HDXA 2H2HA 2YC2C 3ESQA 3K4QA 3F3KA 4XSGA 3S2FA 3O8RA 4X8HA 3PB3A 1EM8A 2AG8A 2BELA 4IF4A 1YR7A 3I6BA 4EMTA 2GAOA 4YMLA 1OGYA 3Q1KA 2H07A 2PJZA 4ZJPA 3EDOA 3VH2A 3LZDA 3THRA 1IH8A 4RZHA 4Q7QA 5EIEA 3DBHA 1TGVA 1UKCA 4GW3A 5F76A 1C1XB 4Q4HB 3WNQA 4NENB 2D1SA 2QYTA 4G1CA 1N2BA 4QDZA 2IYWA 1IHXA 1W8DA 2AQHA 2VNSA 2YC4C 3OOWA 3Q6NA 3G68A 4IYJA 4GYWA 4UFOA 4YT2A 3PUXA 4PTYA 2PUVA 2BGWA 3G2HA 2F1IA 2WD7A 4D81A 1CVIA 2WIFA 1RYZA 4IQ0A 2VTDA 4QUKA 5AO9A 2I6UA 4PHTA 3F4KA 4BE7B 2XD9A 4L5JA 1PQWA 5T4EA 3RRYA 4MV5A 4LXTA 4O4JA 1IN8A 1SC1A 2C3OA 1YBAA 3O1JC 4FLFA 2D5LA 4O2AA 2P0AA 3HJFA 2VDMB 1XLTC 1TQ4A 4R31A 1GSOA 1TJ5A 5J47A 3JZDA 2IPAB 3HXTA 4KSCA 4PLVA 5CK5A 3R9XB 3BQ9A 1K7XB 2R96A 5I8WA 1W52X 3CY6A 4EYOA 1Z5OA 4F60A 5IJ0A 3HV0A 4LOIA 1KWKA 2FW0A 2XB9A 3A37A 5BSUA 1EXNA 2XUPA 3KOWA 4XQGA 1GPUA 2NGRA 3D0OA 3N0VA 1OVMA 2WPDA 4MKRA 1VKRA 5HIKA 1Z88A 5K01A 2EEZA 3N0RA 5LUAA 4B48A 2XVXA 3MRVA 2VCYA 3C1OA 2QK4A 3SYKA 4X90A 5KBYA 1YR9A 2QQEA 5LB2A 4EFMA 3HO1A 1E20A 2DFNA 2BZ1A 2JLQA 1P1CA 1IDN1 1GLGA 3EWIA 5ITWA 2UVDA 2P78A 3DTYA 1AKRA 2IHNA 2IY7A 4OUKX 3SIRA 4NBUA 3AUSA 4UUAA 1F2VA 3NJRA 1AMUA 1L4HA 4ILEA 1BX1A 3EXIB 5ITZA 2Y0CA 4DDWA 1XAIA 4FYYA 2Z4TA 1HL3A 3FWNA 1ZN8A 1INLA 1Q2UA 2FPWA 2B3DA 3K0BA 2JS7A 3E82A 2NQ2C 3DEHA 4JLNA 5ERGB 4RC9A 5F7ZA 4XDYA 3SE7A 4LISA 5E3HA 2ADFA 1NQUA 3N87A 2VH5R 1BU8A 2FQWA 1A9SA 3I5YA 1L7RA 2FN4A 1JU3A 2Z2KA 2Q1SA 5KMGB 1E58A 1F14A 1X7WA 2H2IA 1XLTA 2VF5X 2VSQA 3U26A 1PJQA 5D84A 1Q1AA 1IZ9A 3BQMB 3FOWA 1U0LA 2IHKA 2J32A 1HE5A 4ZEMA 3A2KA 1Y5NA 3A2MA 3T1QA 3V1NA 3QK7A 4JSTA 2B21A 2WF6A 5BUZA 1Z6YA 4MICA 1CWUA 4AXXA 3COSA 4CN9A 2GHQA 2R6ZA 4QTXA 4ZZ3A 3BTSA 1KDPA 2BBSA 4R81A 4N76A 1PEKE 2JKVA 4YV7A 4EOGA 5L4LA 2Q1TA 5BOVA 4EMBA 1CQPA 2Z5VA 2P35A 2RFLA 1YASA 2PS0A 3JQ9C 3Q3CA 1AS2A 1XEFA 4HI0E 5F3WB 2OYRA 3QNWA 2G9NA 3AEUA 5TXGA 2JBWA 4BLQA 4DIBA 1LK0A 2HMUA 2BTQA 4P4SA 1SC3A 1ZJJA 2X1HA 3E9DA 1B8UA 121PA 1J09A 1NXQA 4G5QA 4GC9A 4GPZA 3WBKA 1RAAA 1UMBA 4MAFA 4BVEA 5A5GA 5IT5A 4OHVA 1RCTE 5JAOA 4OQYA 1TL7C 3FD8A 3IEPA 3LWBA 4GM0A 4H15A 1U2ZA 3WADA 2F90A 4H7FA 3IP5A 5TGTA 1GQ2A 2FUKA 3TINA 3KB6A 2KW5A 3K0CA 4BN5A 3FCOA 3IJEB 2PX8A 2F1JA 2XUOA 3D8NA 3TO5A 2JCBA 4G65A 1NT4A 1ZSYA 2XYGA 4JL8A 4RADA 3P45A 3QE9Y 4FU0A 2V8OA 3KTDA 1C8VB 1DBQA 3LL4A 2I3BA 2KMLA 4WZAA 4OQLA 1M8JA 4JODA 3O3MB 4TUYF 2WKWA 2XNKA 4F56A 3JRXA 4HTAA 3KYBA 2KB0A 2CWWA 2P9HA 3E48A 3K0KA 4ODIA 5J43A 2H5LA 1JNYA 3H04A 3I0NA 4M9SA 4NNOA 5CEEA 1LQ2A 5IM5A 1D2CA 1KEEA 3TPZA 1OILA 1K8QA 4A0QA 4JJEA 3HR4A 5FBWB 1W46A 4YASA 3JALA 1TB4A 2QUAA 4D3YA 3D3WA 5DNEA 4NG5A 4FYVA 5HG0A 1UK9A 2NXJA 2QNBA 4A6EA 2ZI5A 5FI5A 1SCNE 1C7EA 5EE3A 3EMBA 2OBLA 3S2ZA 1LPPA 2QP4A 2YVUA 2Z30A 4D8VA 2XMZA 3FNRA 5ELLA 5CVTA 4GVPA 5IUJC 4MUNA 3QF7A 5EMKA 1WXEA 3TAXA 4RDXA 1SQFA 4YDRA 2OC4A 4HEQA 1ATIA 3ABQB 2AZXA 4YJ3A 1XB2A 3WB9A 1GTSA 5EG5A 1NTOA 2A7XA 1R9GA 4GNKA 1I2CA 4PLFA 3U1TA 1T2EA 1YTLA 1AB5A 1JKMA 4OU4A 1QHHA 2ZBEA 3KQTA 2PK3A 3A4MA 1XTUA 5KNCD 4DAOA 4Z4QA 1PR9A 3AYXB 3GH3A 4BBZA 2XMDA 4PFQA 3UAZA 3H16A 3WYNA 2XF8A 4MIOA 1L7EA 4FT2A 3BMOB 3L0SA 4B9EA 3MIZA 5B57C 5JZOA 1Y42X 4HWOA 4E30A 1W48A 4BE4A 1G98A 4FHFA 4OM8A 4G0VA 2I7XA 3H42B 2ISQA 4FCTA 1WBDA 5CYOA 4G1VA 2BGLA 2HJHA 2DWOA 1C1DA 3B1JA 1ZRSA 1J07A 4IP0A 3PNBA 4KWIA 4P3OA 4XIJA 1RM4A 3AYZB 3E9MA 5F1OA 2VL7A 4M60A 4QRDA 4EJ0A 5KWIA 3GFGA 1IY0A 1V39A 2ZPUA 3CINA 3D59A 1JJ7A 5EAIA 5JV5A 3CPHA 4UBKA 1ZX1A 4FBMA 4H7PA 4EZIA 3EFOB 4A2QA 4BMSA 5HW0A 1PUXA 1FS5A 3IBTA 3OFNA 5HZMA 4KPUB 4LVCA 4N7BA 2VIIA 3H2GA 3A0RB 1BWPA 3B1FA 3FYHA 3MVEA 4FFLA 3QPDA 1V6SA 1QYRA 1IPHA 1B8OA 1UKZA 3NTVA 4PAQA 3UWPA 5JOQA 4CT0A 2AGVA 1Q0UA 1I9CA 3S55A 1UXJA 2HT6A 3NNSA 3PNMA 5U4XA 1GGFA 1X80B 1JH8A 3FLEA 2PYDA 2CMDA 2BGIA 2PYZA 3NH9A 1YXMA 1G2PA 1XZAA 5C8YF 2ACWA 5TJ9A 4COOA 1NVGA 4WT7A 3C7KA 3AILA 3E9NA 3S2IA 2NYAA 1I36A 1TT5B 4MAMA 2H4FA 2OGUA 3QSGA 4WDRA 1JDZA 3AF3A 3RRBA 1ZINA 4KQCA 5JC1A 2AJ8A 3W5DA 4TZTA 2GEBA 4HEHA 2PRIA 4BFYA 4OMDA 1IN6A 1O8BA 1XELA 4G0XA 1ZBDA 4M1SA 2IYAA 4XYGA 1GZUA 3AF6A 1PT5A 2QUBA 3VTAA 3LYAA 1EK6A 2QRZA 3GG9A 3JQBA 4MUBA 1NXOA 3TR6A 2EJCA 4RTNA 1TUIA 1J06A 1NSYA 1ZD2P 2C7PA 1H5QA 1NUQA 3F5MA 5KVSA 2DTEA 1N4DA 1V95A 3WV5A 4NZNA 1JT2A 4R1SA 3U7GA 1F4LA 4CDNA 3QITA 3R41A 4GBED 1U3DA 2ZBPA 3KD3A 3QVTA 5DO9A 3DBLA 1MEJA 1MABA 5TMDA 3BH0A 3L7MA 2EJVA 3HN6A 4ZYYA 2Q3MA 4MB2A 4J07A 1L5VA 1HE8B 1K5DA 3HCCA 4MOWA 3V6LA 3MWJA 2G28A 3ORFA 2W2KA 3Q8XB 3ZPXA 1SCUA 2GQ0A 2XQKA 4ERXA 2ZP1A 1ZUHA 1CUDA 1TAHA 2PZ8A 1X7WB 5KJ1A 3HA3A 3TLBA 2BP7A 1EXMA 5DWDA 2CXOA 4CU2A 5I7SA 3VTZA 4KR7A 1L4BA 1S9HA 4FHZA 3WMWA 4QNMA 1OXTA 2OV8A 1W6UA 2JGJA 2IBTA 1UM8A 1EVYA 4I99A 3LRPA 4RSRA 3DKIA 2FSVC 3ELUA 4OFXA 4F9EA 1M83A 4MW2A 3D4BA 5ECDA 3A6ZA 1E1RD 3O8OB 4KE9A 3AF2A 4WKPA 4Q7KA 2OV6A 3IOBA 3CZ9A 5FL3A 3DNFA 2EIHA 3CF2A 1XZGA 3LY8A 3NJ4A 4Y1GA 4A10A 4MW6A 4PRYA 1QOQB 2ZT5A 3RVMA 4AF6A 1AURA 3I72A 5I5GA 2Z3VA 1L5SA 1QCYA 4KFUA 3K70C 5EHQA 2HSJA 3K5IA 1RZUA 3H84A 3R3JA 4D9EA 2Z9DA 4ZT5A 4NBNA 3LV8A 3ZV6A 2O4CA 3C6BA 5T41A 5AW5A 5JBNA 3NT2A 4GXNA 2QW1A 2E87A 3JD0A 1JEYA 4RLHA 1X7YB 5JQGF 2HD4A 4UPVA 1GG8A 2IOFA 3A8TA 3P97A 1PZNA 3DT9A 4EECA 3SXUA 2ZSDA 3FCAA 2BOVA 1K9VF 3BB3A 4R54A 4XD7D 1AKVA 4YRTA 3P4XA 3OZUA 5FPQA 4B7CA 3QQ5A 5G40A 5E4TA 1GCAA 1VHJA 1E6CA 1KKUA 4Q5IA 5IKMA 1CR4A 2YDYA 3MWLA 4NV0A 1G9XA 5KAMA 3LU1A 5JXIA 5AW7A 3RJMA 3VX3A 4DRZA 3MJHA 1TAUA 2YWHA 3CB4A 3CUSA 4WXYB 3UH1A 5A9RA 1PS0A 2R84A 1N2CE 1N8NA 2PX0A 1XQVA 1Z2PX 1DUIA 3T5GA 2NUTB 3A70A 3L7YA 1KYTA 2BLLA 2DFPA 4ZMSA 5DNUA 2BPOA 1AK2A 4BFUA 2JLCA 1FLDA 4Q15A 2BTEA 4FI3C 1KI6A 1LDEA 1V48A 2OCAA 1S7GA 3PDHA 4AQDA 2UVQA 3MEQA 2GR9A 4FOOA 4ZFNA 3PK0A 1BDHA 5G53C 3AHCA 2CSXA 1Z17A 1G38A 5F2KA 2JCSA 3WLAA 4P31A 1P2DA 3CURA 4LAFA 4MS3B 1HH4A 4D6YA 4Z5XA 2GD1O 3NXSA 3QNMA 4AYXA 1GL3A 2D00A 3BEOA 4HYEA 3SEQA 5HSGA 3SIPA 4BMZA 3SBXA 3ZWKA 4Y2UA 3WZ2A 4N0DA 4R1QA 5FUWA 3H11B 1V1JA 1AY0A 1WMAA 2Q1XA 3VKVA 4XUCA 3MJSA 3GQVA 4MJLA 3SQMA 3JSAA 4XWTA 2R3SA 3SZGA 2FSVA 1DADA 3U7EB 5CH5A 1PSDA 1SOWA 2C2XA 4YNBA 4BMXA 4MZXA 5KIAA 3PEUA 3Q7QA 3DJFA 3IHWA 1YRHA 4DCCA 4RJTA 1IJFA 2VCEA 4I9GA 3K7EA 4BVGA 1N1EA 2R2AA 2VQDA 5I7FA 1J0AA 4ARZB 1OAOC 2EBUA 1T8YA 1HORA 2A3NA 2FV8A 2NXCA 5EN4A 2NTYC 3ZDDA 5KKNB 4AQYB 3AP3A 3W2TA 4GXTA 5J1TB 1G5TA 2BDTA 3CZRA 3RTBA 2NXNA 3BILA 3UUWA 3VAZA 4CQMB 4WERA 2MTBA 4EI8A 3N0WA 5HFJA 5CDYA 2ZVQX 2H1SA 4M7WA 3TLKA 1EX7A 1OPRA 5LC1A 3F6EX 5HA5A 1YVUA 2V6MA 5FOVA 3FPBA 3DWIA 4X8OA 2P6NA 4ZODA 1VPWA 4Z49A 5HZHA 2NG1A 1ZC4A 1CUUA 2VPWA 2V03A 3ETCA 4N82A 1G3UA 1P0IA 3BJMA 1POXA 2Z8XA 1SAYA 3PXUA 1HT0A 1ML3A 1NWHA 1U1CA 3RFVA 1KEPA 2IYLD 2CFIA 3KLMX 3IT0A 5CT8A 4UU1A 2Y99A 4MHOA 3QJGA 3ICOA 3ZY5A 4IZIA 4W9MC 4MRNA 4E3WA 3CBQA 1TF7A 2QI9F 1O8CA 8GPBA 2DLDA 2Q5HA 1EIWA 1LQUA 1X7ZB 3GJQA 2ZTSA 5LU9A 2P4EA 1NU8A 1JFRA 3L6DA 1ZH8A 3KKKA 3SBEA 1NJ8A 1T9BA 3WI7A 3ZCPA 2BUCA 1SIOA 1SJ9A 3FOCA 3WC4A 4A9AA 5BV0A 3AR4A 3RG8A 4CFZA 1JFVA 4F9GA 2C03A 3NYQA 4I5FA 3GB9A 4G56A 3U7JA 1HE4A 2XXAA 4RFSA 2MSNA 3CF6R 2KWIA 4QECA 3LC7O 1R88A 2P40A 5LD2B 4DUYB 2P11A 4IH9A 4CM7A 4EFLA 3I53A 4RPGA 4L72A 1RT9A 1KK1A 1QG2A 2FGKA 1RZRA 3WLKX 1R27A 2J0UB 2PZBA 2X9QA 1G5IA 1WZEA 1MABB 3DHNA 3HP4A 5DI3B 3OF3A 3DKRA 4JAVC 5EPOA 821PA 1RWNA 3Q6IA 1S6YA 3TB6A 3DO6A 4H6PA 5CFMA 1JBEA 2XZDA 1SBZA 3PFFA 4QBGB 1IY1A 3AEUB 4E14A 1QQ6A 2PT5A 3Q3IA 2Q9BA 2VSXA 1PQ4A 4QGFA 5LP6C 2Q5FA 3EEFA 5FFFA 2FSHA 2HEGA 3FPSA 4HMQA 3O3NB 1NJ5A 2W8BA 3AEYA 3JQPA 4LY6A 4PYQA 3UMFA 4EHLA 3GROA 2J6HA 2RI0A 5BYBA 3DD5A 2XDYA 2WA2A 3ZHOA 3CGWA 2RD2A 3HPRA 4D97A 2X5JO 3EZNA 4L22A 3C8DA 5FQOA 4XWAA 3SZMA 3H9EO 1JQ5A 4IPTA 3T5TA 2PA3A 2Q2QA 4EDHA 3UMRA 3C3PA 1TTHA 2X2FA 4O29A 4Q34A 4B2IA 1Z5UA 4MCIA 5GM2A 1T15A 2YWRA 2FUG1 3UXMA 3EPHA 1E6EA 1SPXA 4GWGA 1FVHA 5IUKC 5CDFA 1Q16A 4TKZA 4GXRA 5AVTA 1IEWA 1CUJA 1NE7A 1XRNA 2QX4A 4QPNA 3VNSA 3VSAA 2QRQA 2YMQA 4R16A 4B46A 2CZGA 2FDRA 2OZLA 3EGXA 2ZREA 2EYQA 3KOMA 1IJEA 1Y81A 5GONF 3TS1A 2VTVA 4REOA 4C7VA 4BWFB 4RK1A 1Z5WA 4XPZA 4E5YA 4QLBA 1TEVA 1ZUNB 1KMQA 1QGUB 2L19A 2B37A 3RC1A 2IPNA 3HWWA 2C5HA 4JKYA 3IQGX 1BCRA 5JS7A 3WLRA 3EARA 1TLTA 3NQ41 3PLAE 3IAS6 1PRYA 1UFRA 3E1SA 3C3BA 3IIMA 3ZE2B 3DFMA 4GL4A 4J7XA 3ZHVA 1H2RS 1OLUB 4RIFA 3B7WA 1KZ9A 1OYWA 2OQ2A 2WZCA 3PJDA 1WCXA 3RK4A 1I2BA 3W9BA 1TU3A 4LE1A 4DM3A 2PKQO 2VK2A 3CT4A 4OMCA 3UQZA 1S2NA 2YJZA 1C0KA 4WESB 3TN7A 3DH0A 4BNZA 1QFZA 5FWDA 5D86A 2G8NA 4L75A 4Q4JA 1J33A 5IAGA 2VXCA 1ZMBA 3LSTA 1G20A 5CLFA 1QRTA 4HH0A 4ECAA 3C3KA 3FPEA 3VNQA 1KPGA 4U7DA 5FOTA 2D5BA 3LPDA 1IY8A 1L4FA 1REQB 1Y4DE 5DBEX 4OHYA 4D3DA 1WXWA 1E2HA 1ZIOA 3HI4A 4OXXA 4B9AA 5BSRA 2FZWA 5EA2A 4FE3A 2B1RA 2ES4A 2IPMA 1PJ4A 2A1UA 1C7IA 1LEHA 4K81B 2Z56A 5DI3A 2PNJA 4F6RB 5IJWA 1SUCA 5FNZA 4CG1A 1P0MA 2CK3A 3HVIA 1DELA 5AJUA 1DXHA 3KT6A 2I6TA 3H9GA 4JLMA 5CLQA 4ZAVA 1DG3A 3WDLA 5I7AA 4DFDA 4Z1OA 1KYIA 2OHFA 5FBZA 5B5SA 4R2XA 3ES9A 1R6UA 1YFKA 3E7PA 1ADFA 5DNDA 2JKZA 4X00A 5K6AC 3U56A 3TQQA 3DAOA 3MPUA 3EWAA 4GR5A 2J5KA 4YMGA 4XYMA 2H54A 2PSEA 4QG7A 3K9GA 4FCCA 2ENUA 4WY5A 1C1YA 1JYEA 2QUZA 4LDAA 1H2YA 1JV2B 4YDQA 1YDHA 4J3FA 4N0PA 3BX1A 4FS8A 1V43A 4L4RA 2YV5A 2AZDA 2WLTA 3IR5A 3EDQA 1GU1A 1HTTA 4QBKA 4BTEA 3A14A 3L7NA 4BMPB 3THOA 1LNSA 2WJIA 3NPAA 3RUIA 2D6FA 2PT7A 1KMIY 1SKYB 3CO0S 1FX0B 1Q21A 1W0KA 2UVPA 3S1AA 3V1TC 1YRLA 4DSNA 2DERA 1B8NA 5A3JA 1FF9A 3QVSA 2PVSA 3M1IA 3K72B 1DFGA 4ISBA 4LHEA 1G19A 1WE2A 4WK4B 3EVFA 4D3SA 2CWDA 2JARA 2PX5A 3HN2A 3L92A 4AIRA 1DWPA 3QVWA 1Y7TA 3IAS1 4ZDKA 3KPYA 4ZVKA 1TTTA 1F51E 4G0UA 1PSWA 2MHCA 1ID1A 3SF8B 3HDVA 5G0TA 5BXQC 2CV1A 1A8UA 1C2YA 2IRWA 4WOPA 1KNXA 3ABZA 3QMMA 3UXYA 2H17A 2G88A 1EAYA 1GZ5A 4HRXA 4TMXA 2P2LA 3E2IA 3TG8A 1VYUA 2FP4B 4DSUA 4XM0A 1UM9A 1JAZA 4MGEA 5JH7A 3CX4A 9ATCA 4CR8A 1Z15A 4MGHA 5DM2A 5LDGA 3I5AA 4IF6A 2AG0A 2F6RA 3DLBA 2UZIR 2VP2A 3NLLA 4FZ5A 5EWJB 1H42A 4F84A 3DE1X 4ZCMA 1ZGZA 3I4FA 3VC2A 4C0LA 1B16A 2FR1A 3NDRA 3ROZA 2BAGA 3U4IA 4R0MA 3IO3A 4BXOA 1CP2A 1A4XA 1TMYA 2MJLA 3FSRA 3ZY2A 4AW9A 4AZWA 1NQOA 3AONB 2RH9B 3H1PA 1PGPA 2XUQA 3MGAA 4WZAE 5H68A 5LWHA 2FPPB 4EYEA 3T1YB 1ONOA 3PHGA 1DQYA 1AUXA 4ZAYA 3GP3A 2QJWA 1IC6A 1I4TD 1KI7A 1X1RA 3SSOA 3UHPA 1UPUA 3UKJA 5CFLA 2OB2A 2REQA 4QKQA 3EVTA 1PEYA 2EAUA 2X0IA 3RS7A 4DXAA 5L95A 1JIVA 3L0YA 4TXMA 3ETLA 3F6CA 2WHPB 2GPAA 1U1FA 2HDHA 1DPGA 4FJ1A 4HAIA 4WLEA 5CP8A 2CHGA 3GLIA 1AQLA 1XVIA 2G0TA 1A9XA 4BNUA 1JHUA 1DCTA 1XZCA 5LU8A 3K8QA 2VBFA 3AR7A 2R6GA 2NZXA 3WTBA 3OPXA 4NYIR 1Q3TA 1U5CA 3I37X 3VZSA 1YUBA 4PG8A 1N78A 1WPRA 2OAP1 4HPJB 5GVRA 1YNOA 3LCVB 4Z54A 2IUFA 2ZWOA 1XVTA 2XBMA 4HNQA 1CP3A 3GEIA 1BCSA 4L8LA 4XVCA 3FVQA 4D0LB 3BGVA 3OY2A 5JU6A 5FO1A 4G0OA 3KUCA 2C5AA 4DC0A 3K6SB 5EXSA 3QXCA 1O6FA 1WNTA 2PQ2A 1JUDA 1VJCA 3HEMA 3WL5A 4TTQA 1PFVA 3D3JA 3BFXA 4IKEA 4DPLA 2CVPA 3FVVA 3NFYA 4AICA 2DQYA 2XKKA 4E13A 1Y1PA 2P9YA 4TTJA 2VNIA 1O58A 3PXAA 5B1DA 1J24A 2BSXA 3DYVA 4DCTA 1AG9A 1JA0A 7REQA 1SB8A 4N48A 1IPFA 1KI4A 2D5AA 5HS6A 3ZWXA 4DPKA 1HMPA 4G9GA 1OXUA 5ICMA 1PL7A 2GZHA 3RNLA 1IDOA 1VJRA 2O8CB 2YZGA 3KR0A 4L2IA 3NUZA 1AHNA 3WP0A 1WEKA 2WHRA 1I3OA 1ORVA 4DUZB 2PE5A 2JAWA 1SUWA 2PR7A 4KN8A 1O7JA 1RADA 3CEAA 1I4LD 4B3JA 1E3WA 1UJBA 1XHEA 3EHDA 3C3XA 1T3LA 4X95A 1N6NA 2JFOA 4FGKA 2WNIA 4MEAA 3ZTWA 4FOTA 5LQJA 2YH2A 3A6EA 4E5KA 2PQ0A 1P4AA 2WUWE 1QDLB 1JFLA 3ONVA 4JKIA 4LPKA 4BFSA 5BV1A 3J81k 3O7WA 1P6XA 4J76A 3DE6X 4N5MA 2R6JA 4YBZA 2ONJA 4MINA 1JFFA 2YYZA 3UZUA 1ZJ4A 4CTOA 3WDSA 5DLDA 5CXQA 5L3VA 1D4AA 3G5AA 2Q3LA 1OFUX 1RKBA 4XD7A 4P6VF 4F8YA 3WK9A 3ZE9A 1E62A 3T4XA 1U2GC 4IIBA 1C3OA 3ZCXA 1VL8A 4E32A 1CRLA 4A36A 4FW8A 2X58A 4PZCA 5T6BA 1VSBA 4OH7A 1IZ7A 2Q5LA 3BKWA 1JR6A 3MHPA 3G0GA 3HNRA 1DAHA 4ZV9A 3FGOA 1KZYC 4L9RA 4GSKA 4S1NA 4BRSA 4U63A 5MGBA 1X8JA 1P3JA 1PSZA 4GX5A 4Q18A 4FB5A 1KDTA 1LU9A 1Z0SA 3DKVA 3K09C 5C3UA 10MHA 3DE4X 5JJLA 3DLPX 3V1YA 1P4SA 4L74A 4AMVA 1J0CA 3AV3A 3FAKA 4QGGA 3TVYA 2G06A 1CF9A 1M8FA 1G8JA 3Q87B 2Q3HA 3UPUA 2CLEB 3PHHA 3L9XA 3SVTA 1DBWA 1W93A 1LVGA 3R7NA 5CA1F 4QUBA 4QSHA 2C82A 4BVKA 2QQ0A 2XUFA 2JAPA 4U00A 4PTLA 3P0JA 3NAQA 3O3OB 4R9RA 3ADCA 3KELA 3TRFA 1EVKA 1OXBB 4FPXA 3ODPA 1IL0A 2GK4A 2VJLA 4TXJA 1L3CA 4TWJA 4B87A 3QHQA 2X15A 1T1IA 2AMYA 2YJ4A 3KK0A 4QGBA 4K3VA 5BQPA 2R7KA 4D4GA 5L40A 2HAEA 4H59A 1TXGA 3STVA 3UAOA 3U9TA 4Z4FA 2VF2A 1QGED 2C77A 4ERNA 1COWD 3LBHA 2I2AA 3NVDA 3ORRA 4A82A 4JUCA 4B3XA 1SKMA 3NUGA 3QA9A 4QZVA 3LY9A 5K7SA 1UQUA 3EIWA 3ZHXA 2PH7A 1NP3A 4I1VA 1KAEA 1ZNQO 4XDZA 3HUDA 5IK2D 3GEHA 3OX1A 4KIJA 1QVRA 4O8CA 5HKLA 3L6BA 2ZUDA 2DWQA 5JS6A 3JVIA 4ZCRA 3UN1A 4LGCA 1PK7A 3A0UA 1XZNA 2OGSA 3FB1A 4F2WA 5HM6A 1FQWA 2I76A 1ISFA 4JD5A 1IM2A 1KC3A 4XYBA 3SZLA 3ZCSA 4DC1A 3OM0A 3AM1A 1FFHA 5JD5A 2JJ8A 5ISMA 2VJPA 1R4NB 3NBUA 1QHSA 3QYPA 2I6XA 3EXHB 5EIWA 2C9YA 4HVAA 5AW4A 1K4KA 3EVCA 3GP8A 4BNJA 3HGQA 4OHZA 4AJ9A 4IDQA 3HB0A 4D96A 1OZ0A 1VQ1A 2REOA 3ZCTA 1R6VA 1EUZA 2QLFA 1NV8A 1ZK4A 3GMSA 5I4KA 1QE0A 3EA0A 7GPBA 4LG1A 3NEPX 2I4IA 3I5UA 4XM1A 3BE5A 5FR2A 1K7EB 2ERCA 1R6DA 3W1EA 3MWEB 3W8RA 3KLNA 4OLAA 3UC9A 2YCBA 1E2FA 2O7QA 4MUYA 5NULA 1CUZA 1G8MA 1PUIA 1G66A 2PGAA 3TLZA 1E9CA 3U80A 1H0HA 3MD9A 4WDQA 2OYCA 8MHTA 1UKVY 4ZU1X 4EUFA 1SKUA 1XA0A 1Y4AE 1VL6A 1ACJA 3Q15C 4K6KA 5DHQA 2VRWA 1GUYA 4HQOA 1DXQA 2YJNA 2REXB 2A5DA 3NKFA 1ZNWA 2I7DA 3K30A 4RABA 3KPJA 1NW7A 2C42A 4HH1A 3MSCA 4C9BA 1LY1A 4G09A 1BROA 1O1YA 1SG0A 4X61A 3MTAA 4BNFA 3VXKA 4OA5A 2FPUA 2XYHA 5IKXA 1DBIA 3QVLA 4TMFA 2XR1A 3LT2A 5ER6A 3A10A 1YE8A 4D4MA 3TFQA 5DTMA 3L7CA 3PUZA 2GB4A 1RC1A 3PQ6A 4RQAA 1AUQA 1YQXA 2ZB2A 4TT8A 4URYR 2X0DA 2O2EA 3BHNA 1DMRA 1NFRA 2XE4A 3T9BA 3FCSB 2VK8A 4RENA 1V9SA 5LM3A 4UARA 3C85A 3ICQB 3BULA 1K88A 3FHJA 3G17A 3NM4A 4Q48A 4IDBA 1JBQA 3VU1A 4MVXA 3TLGA 4C06A 3P1JA 3DZJA 3BJZA 2NO1A 5PGMA 3WKCA 5IZCA 2QX6A 4JR0A 1UOQA 4MVJM 1M2WA 4FTWA 3CMCO 1XAHA 1YI8A 5IBRA 3B70A 2O3JA 1AXGA 4TTRA 3T7TA 5BN1A 1KFKB 1NPTO 1Z6TA 1RYYA 3OM9A 1OHHD 4S1PA 3K9LA 1NR7A 2Y1GA 1VGVA 1WVGA 1EFDN 2JFZA 2XVYA 2ZCVA 4YT4A 4X66B 2D1TA 2EGGA 2IV3A 1H1LB 3DBVO 4JDUA 2A1IA 2OUIA 2V7QD 3M6AA 3IBCA 1DC5A 5CX1A 2CB9A 1UAYA 1CDDA 5I4BA 3H1GA 3ZE1B 4O4HF 4BIMA 2XDWA 2M6KA 2BUBA 1FFEA 3U6KA 4DBZA 4PX9A 2FMFA 4C1NA 4M6WA 4C2UA 2P77A 1NM5C 5K2MA 2PGDA 3N3BC 4R40A 1YE5A 4YMHA 1PR5A 3C4JA 4I55B 1Z7GA 2ZE8A 1C1HA 2J9FB 3ETGA 4QTYA 1T10A 3U7FB 1NXXA 4D9CA 2EKQA 3LHIA 1JA1A 3E5MA 2AFHB 4L85A 1XNJA 3DXZA 3UATA 4FFMA 4KBGA 3SJ7A 1OWMA 5JS2A 1VJ0A 2QRGA 3QM1A 3TSZA 4FWIB 1R0XA 2G7ZA 5AJZA 4Z51A 3VDMA 5AKLA 1SUAA 1UBOS 2Q9UA 4EHIA 5TLSA 2FI1A 2V59A 3V7UA 2BZ0A 5B7QA 3PUVA 2H2AA 4JY7A 2OXEA 1E1LA 1QH8B 2JANA 3I34X 3UYKA 5M34A 2JLBA 2I80A 2OORC 2Q27A 2R5NA 3NFRA 1OU0A