5FWXB

Crystal structure of the ampa receptor glua2/a4 n-terminal domain heterodimer
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
377
structure length
375
Chain Sequence
FPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNAAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Organization of Heteromeric Ampa-Type Glutamate Receptors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
molecule keywords GLUTAMATE RECEPTOR 2
total genus 126
structure length 375
sequence length 377
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fwxB02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fwxB01
3NNSA 4N03A 2R4QA 5EWMA 1MAVA 4RWEA 3KYJB 3O1JC 5TE9A 1EHCA 2ID7A 4L4UA 2LIVA 4W5NA 3MF4A 4O1HA 3UK0A 4PYRA 4DN6A 1VLZA 4TMYA 3TX6A 6CHYA 1LBHA 4D6XA 2AYXA 1VPWA 2E4VA 1BDHA 4Z99A 3HZHA 3NNNA 3H5TA 3MA0A 4MGEA 4YS6A 4KQCA 4MYRA 1QKKA 2HSGA 3H5LA 2QZJA 1J56A 5FWXB 4WXMA 4MR7A 1KMIY 4XARA 1NXWA 4IILA 2HQBA 3HUTA 5BRAA 2HPHA 3NHMA 5FWYA 1ZGGA 5EWMB 4FB4A 2CWDA 1ZESA 2PL1A 5KC9A 1F51E 5DTEA 4H60A 2PUAA 1B00A 4RK1A 4KNYA 2QR3A 1DJMA 4DQDA 1Z18A 5BRJA 4EGSA 3C6QA 4FE4A 2X7XA 3O1HB 2IPAB 1URPA 1E6MA 3DGEC 4G97A 1KRXA 2FTKE 3EULA 1Z15A 2E4UA 2NT3A 2FSPA 1W25A 2L17A 1QPZA 2R25B 2QVGA 2PUGA 2PKXA 2NZUG 4JP1A 3T38A 4NV3A 4HNSA 2IKSA 3IP9A 1IIBA 3O21A 4O5AA 3OM0A 3HS3A 2IOYA 7ABPA 2E4ZA 3HXMA 5KQMA 3EGCA 3ILHA 3EQ2A 1A2OA 3N0RA 4RKQA 4N47A 4HYEA 3EQZA 2FKAA 3HV2A 4RK0A 1NXTA 2FQWA 3KG2A 4MPTA 4RK4A 5EWJA 3VNAA 2WWVD 1ZH2A 1DC8A 4ZMSA 3CG4A 3GT7A 4IF4A 1LJUA 4RK6A 1DP4A 2FLWA 2FN9A 1TMYA 3VNBA 4MS1B 5CNIA 2A9PA 2ZWMA 4YR7A 1NXPA 2M1ZA 2YHAA 4LE2A 1JDPA 2FEPA 1YIOA 3DBIA 1PNTA 3JPWA 3H75A 5B3JA 3QEMB 4MRMB 5E3JA 4Z0NA 1JDNA 3MMNA 1PHRA 4DADA 1RZRA 3A3KA 4XLTA 4YWHA 4D74A 1U2QA 2VUHB 4Y9TA 3KJXA 4G0XA 4EYOA 2CHEA 3QELA 3OLXA 4KK4A 4RKRA 4JB2A 1JF8A 2HQRA 1Y1LA 3SY8A 3GA5A 1QNLA 2FN8A 4H3HB 4Z9AA 3OQOA 1DRKA 3LKBA 1CYEA 2JBAA 5JNTA 1JBEA 2CHFA 4IRXA 1C0EA 3GBVA 2JBAB 1F4VA 3K9CA 4G86A 1U2PA 2JVJA 3BILA 1A04A 4OG2A 1JYFA 2P4UA 3IP5A 3BREA 2I6FA 1JYEA 1RXEA 4KFCA 4PZ0A 4RXMA 1EWTA 3SNKA 1DG9A 1QO0A 3H5WA 4Z4GA 3O75A 4E7PA 3CRNA 4W5OA 3DLHA 1D4ZA 2JVKA 4ZMRA 1ZN2A 5IEJA 4RS3A 5C5CA 2E4YA 4L85A 3CZCA 3LUHA 4RDCA 1M5TA 4YGXB 4B09A 1MVOA 3FGZA 3G1WA 5B3JC 1FFWA 4H3KB 2YHBA 1C4WA 3LUKA 4Q6WA 1U04A 3H1GA 3KTOA 1VKRA 3UKJA 4EVRA 1E6KA 4KK3A 1M2FA 5IBQA 4W5QA 4OLBA 1JFVA 3QLVC 4YCSA 3I42A 4QICA 4QPJC 1YK0A 3LOPA 3E3MA 3A0RB 1JL3A 1SXIA 1ZAYA 1GLGA 4G0MA 2MYNA 5FBHA 4Z4IA 2RDMA 3QLUA 3B2NA 3QEKA 5TQ0B 3F7NA 4NQRA 5KI6A 1RXIA 4LDZA 5KC8A 3MYYA 1MB3A 1OXKB 4F8JA 4LX8A 4WWHA 4TLLB 5CNKA 5EWLB 4EVSA 2L18A 3EODA 2GI4A 1DCFA 1FQWA 3CS3A 4MS4B 3FMVA 2FMHA 3QX8A 3SAJA 5FBKA 1JFSA 2PUCA 3KLNA 5BQ3A 4XAQA 1YTUA 2HJ9A 4XFKA 4F12A 3TD9A 2FEKA 3Q7RA 1K66A 4RSMA 3M9XA 4UHJA 5KQLA 3LUDA 5ABPA 3CNBA 3NNDA 3OM1A 4NCBA 4MS3B 1QQAA 2WJAA 4EYQA 2P9HA 1PEAA 1RNLA 5TQ2B 3K4HA 4LRQA 4UHKA 4MS4A 3OLVA 2MSKA 4S05A 1RZRD 1KRWA 1CHNA 5C5EA 4KQ9A 1JX6A 5DLEA 2PMCA 5KQGA 3SG0A 3F73A 1BA2A 3KS9A 4RXUA 2FLKA 5GQSA 4WXEA 2GKGA 3C3MA 2PL9A 5TPZD 5JNUA 3Q7SA 1FSPA 1D1QA 3I09A 1U8TA 2TMYA 4Z4EA 3JVDA 3S99A 2RJOA 6ABPA 2A9OA 1YK1A 4G0OA 3OLYA 3ROFA 1PEYA 4GPAA 2E4WA 3OMXA 5ED4A 4ZYLA 2ZAYA 2F8SA 3CG0A 5DCLA 3O2JA 3JY6A 4OBBA 3FFTA 3QK7A 3N75A 3RH0A 4G0PA 2NUBA 5I4CA 2FXIA 1MIHA 4MQFB 4G0YA 2JRLA 3C97A 1TLFA 1QO0D 3A10A 1JFTA 1PNRA 1LK0A 4MS3A 4RU1A 1UDRA 3C3WA 2MSLA 3NHZA 2WB4A 1DZ3A 3EAFA 4JB0A 4IGAA 1LJLA 3KYIB 4IMJB 2IPMA 3RVNA 1QQBA 3A0UA 3DLBA 1JHZA 4RV5A 1VRVA 5JNRA 1BVHA 2L19A 4ETIA 1NATA 3CLKA 1YS6A 4HNRA 5F64A 3QLVA 1JH9A 1ABEA 5CNMA 3IPCA 4Q6BA 1QP4A 3HVRA 5JS1A 2MYTA 3N53A 1ZGZA 1R8JA 5IEBA 4XASA 2WRZA 1DBQA 3RQIA 4G0QA 1M5UA 3N8IA 1USKA 1E6LA 3C3KA 4ZPJA 1W9HA 3P9YA 4EYGA 3QELB 2GBPA 2J48A 3IDOA 2VUIB 4LZLA 4MR9B 2KYRA 2PJUA 1NXSA 3KLOA 1RPJA 4QYMA 2PUDA 2PUFA 4WT7A 3RVJA 3I5AA 3OLZA 1BDJA 3O2SB 1A0OA 5HSGA 3FFWA 3CU5A 1SXHA 3SQNA 1QP7A 9ABPA 1I3CA 3F6CA 4N0QA 3T6KA 4YO7A 4CBVA 2HQOA 4XXHA 3O1IC 4P98A 3SM9A 3FDFA 4MLCA 4JA2A 2A9QA 2GX6A 1AB6A 5TPWB 1ZVVA 4GNRA 2B4AA 1DC7A 2FMIA 3H6GA 1Z17A 2JB9A 2CD7A 3OMWA 2LPMA 2OENG 4EYKA 5HM6A 5EWJB 2WY2D 3GYBA 1GCGA 4G0ZA 3JPYA 1ZITA 3HDVA 3IPAA 1GUBA 4KMRA 2DRIA 4O1IA 3BBLA 3EDCA 5TPZA 4JASB 1YMUA 1XHEA 4OATA 4RXTA 1Z2DA 1GUDA 1Z13A 3BRSA 3H1FA 4LE0A 4EVQA 1Z25A 1OXBB 3HCWA 1MB0A 5CHYA 4F06A 1DCKA 1U0SY 3RVKA 4Z4CA 3EJWA 3KHTA 4MAAA 4TLMB 4RK7A 2BGGA 4ZJPA 1YVUA 5JNSA 4QYWA 4W5RA 3JS5A 1ZHHA 1D1PA 1P8AA 4N0PA 3RVRA 4YP9A 3HO1A 4F11A 1D5WA 3Q41A 4ETNA 1USGA 5KWSA 2PUBA 1D2AA 8ABPA 2QW1A 3OO0A 2PE5A 1P6QA 2VYCA 1YMVA 3QLTA 2E4XA 5JNWA 1NXOA 1XHFA 1P2FA 2IDMA 4HNQA 1APBA 4KVFA 2JVIA 4F3TA 2XDYA 3D02A 1SRRA 1Z16A 3OO1A 5PNTA 4MR7B 3F6PA 5IC5A 5FWXA 2RGYA 4KV7A 3RVQA 2MYUA 2R48A 2H3HA 1HEYA 3OLWA 1E2BA 1ZDMA 3URMA 3H5IA 1NTRA 3HDGA 3O74A 2QXYA 3UUGA 2JK1A 2OQRA 2VK2A 5GOTA 3MIZA 1P6UA 4YRZA 3N6VA 1LBIA 1ZY2A 2V0NA 3KSMA 3N0WA 3HM9A 3M6MD 2AYZA 3I45A 4NICA 1SD5A 2Q5CA 3O2QB 4M88A 2FQXA 3ILYA 3HUUA 3KCNA 4P1ZA 4S04A 1JWLA 4KRFA 2QU7A 4PICA 2PUEA 3CTPA 4MQEB 2JCGA 4PEVA 4Z4HA 4WZZA 3HK2A 2FEWB 3CKMA 2N9UA 5CNJA 4KPYA 1SXGA 1Z2EA 1BAPA 3FFXA 3H6HA 3IP7A 4IMIB 2R47A 4MQFA 4RZSA 4RY8A 4MS1A 2FQYA 3CZ5A 3CFYA 1ISRA 1PUXA 3H1EA 5TQJA 5KQPA 2F8TA 3HJFA 3H5VA 4OTZA 3NBMA 4PE5B 2LP4Y 5T3YA 5FWYB 3LKVA 3GBPA 2WJWA 3JTEA 3E61A 2ID9A 4RK5A 4WUTA 3TO5A 1QP0A 3D8UA 4N76A 2QSJA 2LBPA 2FVYA 3T95A 1ISSA 1USIA 1FFGA 4FE7A 3KKEA 3HEBA 1H9CA 4JOQA 3G85A 3RVLA 3N0XA 5DGCA 5DKFA 4EUKA 3Q15C 5IX8A 5JS2A 2MSWA 3RVSA 1FFSA 3OQNA 2RJNA 2LUOA 3LUJA 1JLKA 1BDIA 1GCAA 4EY3A 1L5YA 2L2QA 1NXVA 3LFTA 4W5TA 3LUAA 5IUJC 5IUNC 3R0JA 3CHYA 1DBPA 1WETA 1TVMA 1DBWA 3TB6A 3GRCA 2W42A 3QX9A 1QMPA 5BR1A 4E7OA 3LUCA 1TJYA 2PAFA 3Q9SA 4MR8A 3ROTA 5T7BA 3QEMA 4MRMA 4Q7EA 1Z26A 2H0AA 3IP6A 4MR9A 4YV7A 1T34A 3DZDA 1EWVA 3Q7TA 4D6YA 1ABFA 4KREA 1DRJA 1EWKA 1NXXA 4YLEA 3OQMA 3GL9A 3GV0A 3MM4A 3QLUC 1KGSA 3M9WA 4ML3A 4TN5A 1TM2A 3T8YA 3TMYA 5D2CA 5EWLA 1EFAA 2B1JA 4JAVC 2FW0A 1ZH4A 3LUGA 2QVCA 3MQ4A 1YS7A 2M98A 3L49A 1NY5A 3BRQA 5TQ0A 3W9SA 3JVIA 3LTEA 2FMFA 4LDAA 4LE1A 2QV0A 4Z9BA 3DGFC 3H5OA 2NZVG 3GWGA 3RVOA 4Z4FA 1CEYA 4ETMA 2A9RA 4OLAA 1K68A 1XWWA 5HKOA 2FMKA 4RY0A 5TPWA 2NT4A 1EAYA 1M2EA 2IPNA 5IUKC 3RVPA 3L6UA 2IPLA 3LMKA 4NCAA 5IULC 1DCMA 1L5ZA 5TQ2A 4KZKA 3LUFA 2WMYA 4RY9A 5HQJA 2GWRA 4MR8B 1AB5A 2PLNA 5JNVA 4MQEA 3RVMA 4N41A 2O20A 1Z12A 4MLDA 3HSYA 1S8NA 2IYNA 2MYPA
chains in the Genus database with same CATH superfamily
3NNSA 1NGSA 2JH8A 2R7LA 1D7OA 1DARA 2HJWA 2G6BA 4N03A 4WDQA 5HK8A 3AY3A 1EK6A 3C5VA 3PRYA 1RWNA 1O89A 2G9ZA 1HV8A 2ZIWB 4HQKA 1OLXA 1VLZA 1I6KA 5BNFA 4TT8A 4LRSB 4QIHA 1JLMA 4Q3KA 4NS1A 1HT1E 3AKDA 5KX5B 2ZROA 3B20A 2W6IA 4O2BA 3OF5A 3AV3A 4ALNA 2O2HA 2IYYA 3H5LA 3OPXA 4NOMA 1ZQ1A 4BNJA 4TKLA 2X8BA 4TS9A 3ZN2A 1SOUA 3IP3A 5A4FS 1J56A 5CR9A 3UAXA 4G4SP 1XDUA 2A92A 4HTFA 3GFPA 3T5DA 2AE2A 2QI9F 2VF4X 1NXWA 2RHJA 3H2GA 1DC4A 3QKSA 4LV6A 3E5NA 4GPEA 3EGXB 3QNUA 1LSUA 5H1YA 4ED9A 4QXMA 1H2WA 4XR9A 1ES9A 2PJRA 1CVRA 1VKHA 1TZMA 2YNMC 4TV9B 5ARCA 5EAIA 5L4SA 4DB2A 1QB8A 1MJFA 2F8MA 2G0AA 2OHIA 2VJMA 3O9VA 5KAMA 2IPAB 5LA6F 3TQOA 5FOVA 2FTKE 4Y1RA 4K9LA 1RLTA 1U8AA 3NWOA 4IKEA 2FR0A 2IU6A 5KREA 3E18A 4B3SB 2E3JA 3EOZA 3EVEA 4PNEA 1BQ4A 3UIEA 1AMUA 1W4RA 3E2PA 2XRYA 3GMDA 3KYDA 5B1DA 5KCZA 1FUUA 3A2NA 1Y4UA 4PV7A 5B58C 2MJLA 4WK2B 3EQ9A 1M10A 4M9UA 4MSUA 4L07A 4PY2A 5BMVB 4N47A 4BPRA 4HYEA 1G8GA 1QM5A 3AB3A 2OUKA 4YWJA 3QXCA 1ZOOA 4JGBA 2HO4A 5B2ZA 4PNHA 5G4KA 3O9ZA 1II9A 1RHKA 2QG6A 3L8EA 1MOSA 4KWHA 4QXOA 3ZD7A 2F67A 1DKNA 3EA0A 1HK7A 4CKCA 4UPEA 1WNFA 4M36A 4I1PA 1T0PA 2O0MA 3GJ5A 4YJ3B 2N1BA 5FI0B 4CI9A 4IXMA 2A67A 3KUKA 1PL6A 5F9FA 4E2YA 4FEEA 4LMRA 3DOOA 4LHSA 4HT3B 2XAAA 1I32A 1X7HA 3B7GA 3FWPA 3EX7C 2FEPA 4OGKA 2HMAA 1GVHA 4EIWA 3NG1A 4X65B 5LBUA 3N58A 1K5HA 3RTGA 3CWCA 2B3DA 3G5AA 1C8KA 4DR7B 4BLTA 1H22A 2Y1GA 1XF1A 3M2TA 1JDNA 2WE8A 3MMNA 1UJ2A 3DCYA 3IQDB 3NVDA 1PHRA 3P27A 2ZE6A 4EFDA 3G5UA 4RTOA 3Q6NA 3A3KA 5I48A 3DYIA 3IQHX 3AL2A 3O3OB 4MRRA 4EHHA 1U94A 2ZVQX 3T1YB 4UD2A 2CVOA 4NMWA 2N42A 3JYQA 1ZKMA 2ENUA 3H2SA 3ZNQA 3N5KA 4EYOA 2H2AA 2C3YA 3PDJA 3NUZA 4XEHA 4YXWD 4QG7A 2UVPB 3HUFA 5JSZA 1F7UA 1B6RA 2H18A 3D4LA 3E22A 1XKLA 3E7FA 4GD3Q 3SDBA 1VMEA 1JHXA 2PJZA 3LKBA 3VPCA 3UHFA 1G8FA 3L6RA 3JASA 3CPJB 3VHXB 1K7CA 4D8VA 1J5PA 4EMBA 2NU8B 1F4LA 3PC4A 3NT5A 3RAJA 3UOAB 1N9GA 3UT0A 4LNAA 4YXWA 1Z0ZA 4ILEA 1VPEA 4MTCA 3GQBA 4UBLA 4JX8A 5TF4A 4JI0B 5H82A 5JWHA 1OFUA 3RFUA 3L6BA 4CM8B 1J9EA 1DFIA 3BWDD 4BRZA 4FM9A 4LOKA 5I9MA 1I7DA 5DDIP 3QHPA 1GZ3A 1LNZA 1QFSA 4QE3A 3FNRA 3MTAA 5EIBD 4A16A 3BT7A 1RBQA 1ODJA 1WMAA 3NOVA 4UHFA 4GLOA 3GD7A 2OM6A 3HJNA 5IABA 2CMGA 1OBOA 3G9UA 5CM2Z 3ESDA 1IVSA 2RK6A 3C85A 2KS6A 4B0OA 3AONB 1TYCA 5GJVC 1P2SA 5ISMA 4O2LA 2GLXA 2R8OA 2I3AA 3V8BA 3H8WA 1VSVA 2OV6A 3HB1A 4Q6WA 1UBNA 4MWSA 1VRWA 5FOWA 1KPHA 3HN2A 2JH3A 2Z43A 3DDWA 3F5DA 1QKIA 3CVJA 4NULA 4QO7A 3TRHA 2BHRA 3IHKA 3ROGA 3NH9A 1AHIA 4HGOA 4R1NA 1R5BA 5DHUA 2X2PA 4IIFA 1DXYA 5CLJA 3U56A 1PD1A 3ZK9A 3B3JA 4D41A 1USVA 3UUWA 4DEVA 2FPRA 3LSTA 1UXIA 1E7RA 1J5XA 4CIWA 3TLAA 2A2ZA 2VRBA 1MB3A 3K0AB 4ZI2A 3OHMA 3ZDYB 2J0VA 4TLLB 4ZIRA 4PN7A 5AESA 2YJZA 3PT5A 4WIAA 2JHAA 1SQ5A 4ZVQA 1K9SA 4J9UE 4OQFA 4FR5A 4URVR 1HC7A 2J3IA 2J6BA 4RFSB 1T5IA 2QWXA 3I8XA 5E8JA 4DQKA 4KP7A 4YI3A 5JSKA 3HV0A 3NHWA 4M98A 4R9UC 2CMDA 4EPTA 1E9VA 4W8GA 1ZSVA 1RE1A 3GZJA 3DS8A 5I8WA 1IJEA 5KOJB 1XLVA 3B48A 1BCRA 3KT3A 3QMVA 1KK1A 3JD0A 5JXWA 4D26A 3E0QA 3VZDA 4CFZA 4LZWA 4UHJA 2BIFA 2JJ2D 3PGJA 1MOQA 5A3JA 3UAZA 3V7WA 3OM1A 4NXNB 2CC2A 2NUPB 1HTBA 3SQXA 3FRHA 1RNLA 4LJ8A 1A2BA 4PPQA 3K4HA 2HUPA 1O2DA 1M8KA 2PX3A 8LDHA 5BQXA 1IULA 5LBIA 3ONNA 1H6BA 2MR6A 3R5FA 4MV0A 3KJNA 4UHDA 2JA1A 2DPYA 1PFQA 1M76A 4LY3A 3WMRA 3T5PA 1FTSA 2GCGA 4ZOLB 1RYEA 4AJNA 4OYYA 1H8ED 1PQWA 1Y1PA 3L1KA 3A7EA 3S99A 4Q7LA 3V7FA 3PUHA 2ZSKA 3OLYA 4LYJA 3BQNB 2JGNA 1UH5A 1RWBA 5ECWA 2NAFA 4BVEA 3C8HA 4C6TB 4GRDA 1Z39A 2R3SA 2EGHA 5H02A 1LLFA 1EUCB 4ZT3A 1Y4AE 5IFKA 1A3CA 3I73A 2REBA 4J0FA 2LZ0A 3Q4GA 4X61A 3KOOA 4LHXA 4LKOA 1YBFA 5SZKB 1KDZA 4DQ0A 4DWOA 5KNLA 2BDTA 2D62A 2BJVA 1N6KA 3JV7A 1ORHA 3ZZ1A 2PG3A 1TUIA 1GKKA 2XUZA 3HCPA 2C4VA 3I72A 2CVPA 4D3DA 1DZ3A 1JDJA 5G0WA 4PAMA 3KYIB 4LHYA 4EATA 1QQBA 2IIPA 4M0FA 1EP2B 3OTGA 1HDGO 2IYAA 2NVBA 4BVBA 4C7JA 4WLEA 2AZ4A 2HWUA 1PZXA 2YXNA 3TBHA 5TMPA 5JTTA 4YT5A 1E2LA 3JQGB 1MA3A 4NY1A 4PO8A 4RHFA 3A9WA 1JQAA 1NT2A 5D01A 1JHRA 1SBZA 3LQQA 4R1UA 4WECA 4F86A 1RQPA 5DI3B 1QP4A 4YAJA 4DB4A 1MT0A 4LJAA 2WT8A 4BLPA 3HYSA 1BEEA 1QXSA 2W9XA 4ZC1A 1X1TA 5T3UA 3UKDA 4C07A 2BJWA 1T9ZA 4ZREA 4FMCF 4EP1A 2YIJA 1WRBA 2JD2A 2XYHA 5C1IA 5E7IA 1PSZA 4KQKA 5CU7A 2GESA 2J48A 5BUZA 3B6EA 2OAGA 2FF7A 2VUIB 4LZLA 3PT9A 2EARA 1LNSA 2ZWVA 1Z2OX 2NOAA 2RCNA 4WN3A 5EIAA 1N8KA 1WU7A 3ZKWB 4DR5B 3K2EA 3QV2A 1A8SA 3TX2A 3TG2A 3G8BA 5EKXA 3V8QA 5AVJA 4BJ1A 3P20A 4JLVA 2Y1WA 3DDCA 3EH2A 2DBVO 5F12A 4RVGA 4E2FA 4YO7A 3VPFA 2WF7A 2V3CC 3HFRA 4MA5A 2Z1MA 4MLCA 1TA0A 4RZ2A 2V7BA 3EWIA 3OWXA 5TPWB 3H13A 2YC2C 3ODGA 4HDSA 5EMNA 2CK3D 2OCLA 3T7RA 1Z17A 3QPDA 3JZIA 2ZRLA 4WLFA 3IT1A 5C8YF 4B3CA 3PNMA 2NWQA 3QH4A 3SXJA 4J1NA 2FRDA 2ZIXB 5TMDA 3GYBA 3D2AA 3VUEA 4ASUA 2BBOA 3FLMA 1PG0A 3TCKA 5B30A 1JEQA 1GUBA 1Y4DE 2BFEA 3E5HA 4BMOB 2RAVA 2BEUB 3I2KA 3QFCA 2JFOA 1I3MA 2VXBA 5TPZA 3NWBA 3PF8A 1QFYA 2IIBA 3UQYS 5HUQA 1FLDA 4TMZA 5CVDA 5JZSA 2HTEA 1TDJA 1XV5A 3TM5A 3STVA 1DCKA 4PBTA 1NBMD 3OFJA 3MCVA 4YNBA 2BGGA 3AR8A 1ZH8A 3VKUA 5JFGA 2KI5A 4KQJA 3IQIX 3IBGA 1ZPDA 2J3DA 3KZKA 4U7GA 3UG6A 3GLKA 1RQXA 3L7MA 2AUNA 3Q85A 4HAWA 1J42A 1RM0A 2EKBA 1USUA 3ZNPA 4EHKA 3KPJA 4DW8A 1TFUA 2VYCA 2GYWA 3N2KA 2ZTUA 4OUDB 3EEFA 1KYVA 4PG6A 4MICA 1N2CB 4DHWA 1E5VA 1LSSA 3BCUA 3MCWA 3MZ0A 5FOSA 3QVGA 3SHFA 3OFNA 1X7YB 3TJRA 1U2ZA 2RGYA 1SVWA 1B0UA 1NP7A 2K87A 4M0LA 3OZAA 1HEYA 4DY6A 8MHTA 1RT9A 2X86A 4WCDA 1G5FA 3MTDA 4U7TB 3BJZA 4BEVA 2W2KB 4QBHA 3WRYC 3N6RA 3FETA 5DNEA 3L4JA 3SI7A 4B8ZA 3ZJYA 1YR2A 3PXAA 2AG1A 4JJKA 4LSZA 3CUTA 4N49A 2NV2B 3GFQA 3AK4A 2IHVA 1U3TA 1I10A 4MV8A 2DQSA 2YJNA 2CW5A 3Q3HA 1QGYA 4G1UC 3S5JA 4GI5A 4WBNA 1UMBB 3Q3CA 2R1VA 3B6MA 1IOVA 5IN5A 5T4HA 3TVDA 3X2FA 4EB8A 1OT5A 3THOA 2UYHA 4DR2B 4QBTA 5ER6A 1WBBA 4S04A 4MEJA 3DMHA 5K45A 4G2NA 3KUDA 3DAOA 3WHLA 1R6BX 2TECE 4S12A 1I36A 2PEYA 3HN6A 3TINA 4YDQA 3C6BA 2WAMA 3IPXA 4IOKA 4RTPA 1RYMA 4DA8A 4KPYA 3IOYA 5EQJB 3R44A 4YT8A 1R88A 2A5GA 1CUYA 2FG5A 2BFNA 4F3YA 3H1EA 1H0HA 1OJLA 5JJCA 3PGLA 2X9QA 4AUKA 2BFFB 5HRAA 3L7DA 2BUBA 3ZWCA 3HL0A 3WNVA 1XSEA 2OKCA 1BRMA 2G4VA 3AW8A 3JQFC 2P91A 3F6RA 2WJWA 4X64B 1E8MA 1W0CA 1KC1A 3T4XA 2EP5A 4KDCA 4O4JF 5KTNA 5HBRA 1R5NA 4MYDA 3G0BA 4IINA 1X0XA 1WZUA 3EZGA 2ZEJA 1M2KA 4D0LB 1GNTA 4XDHA 5JDIC 4EG7A 1I2BA 3P2JA 4C4SA 4HPJB 4XVCA 4QVGA 4Q9HA 1F0PA 2HLPA 3MSXA 2VJKA 2WKWA 1YR6A 3AJ9A 3AU9A 3EGEA 3P4YA 4HV4A 2Z2KA 1BJRE 1OAOC 3ADDA 1E99A 1KH1A 2Q4BA 3T9BA 1EU1A 3FRJA 3FZGA 3BIOA 1NI3A 3BSFA 4GECA 4HDOB 1N8NA 2B35A 2QQEA 2QUBA 4LGCA 4K8OA 2ZIAA 3I8OA 4RHXA 1NAIA 3CSDA 4P36A 3ZZUA 5BURA 4W5TA 3AP3A 2PKCA 4OPMA 2AN3A 4FGJA 3IEIA 2XV1A 1Q0QA 5FYDA 1N0WA 1GU1A 1R5OA 2G08A 2XTNA 2DFPA 3TOVA 2VYFA 3V2IA 2Z5LA 4X5OA 4HLUC 5JDCA 1E3WA 5FTJA 3C7KA 3QVKA 3KNZA 2QW8A 3IT0A 1RJGA 1RWMA 2V74B 3FTDA 1V39A 2R79A 1WHTA 3JQPA 5A4IS 4CM9D 2B6HA 2NX2A 2ZJ4A 1H4VB 3JALB 3NTRA 4MW2A 4P4UA 5LZ9A 4COOA 2Z08A 1UZMA 1UKCA 2JJ1D 4PXSA 1J24A 1S8OA 2PRIA 1U63A 2B1JA 1E98A 3QZUA 5B4TA 4AMZA 3X43A 5KJ1A 4MGIR 2ZPUA 2Q5QA 3R3HA 4HZUA 2F4VB 3JZAA 3JVIA 1GGNA 1ZGCA 2V9CA 3LAWA 1U8FO 2RHMA 3I5MA 5A7FA 3RF6A 4YUZA 4CGYA 3QG5A 4I99A 3GLRA 3V00A 2GHRA 2DPMA 3DV0B 2NZVG 3N86A 2HTFA 3MQFA 1EXWA 4HDKB 4HLDA 5E1OA 4C0BA 1KAGA 4ENSA 2A9RA 2ZJ7A 4DSOA 4BYGA 2P5YA 1G2OA 3DZKA 4NAHA 1E1RD 3IOCA 1KVSA 4KNWA 1Q7EA 5TB5A 3VYUB 5JMTA 2VOEA 1JQ3A 3FZEA 4UZSA 3EF0A 3P97A 4G9EA 2HLDD 1GKLA 1RPNA 1IHUA 2BPOA 4M1ZA 1Q1BA 3MJFA 4MCIA 1SA0B 3TOZA 4EPYA 1II8A 3T3PB 1R12A 4MR8B 1QTRA 1V11B 3RI3A 4MEAA 3UVEA 1X86B 1QVZA 3K1AB 3LCCA 2IYNA 4XPZA 2AX4A 5DIFA 1HDXA 1CNEA 3WGIA 4UOEA 4QUHA 4CDGA 2HA7A 3T15A 5ALRA 4KAAA 1FLVA 3UUFA 3JTMA 3WLOA 4YCJA 4EMTA 1Q50A 3ANTA 4JYCA 4JYBA 5EJ8A 3UV3A 3CF4A 1P2GA 3L7NA 3LYHA 2INGX 4HRAA 5IVDA 5LZ7A 3W0LB 3NJ8A 4A2PA 1JTEA 2IP2A 2PUAA 3P9XA 1DEAA 1QKKA 3D6UA 3O84A 4JNCA 4XPIB 2AOUA 2R96A 5LSAA 2W83A 4J07A 1A5BB 4KRYA 4BQRA 4Q9IA 2EX1A 4MLZA 3AG6A 1Y9EA 4C78A 6AT1A 5JG7A 5IHPA 2Z8ZA 2J3MA 1LXCA 2JHPA 3IESA 5KVAA 4RANA 4OQEA 1JG3A 4S1PA 3RTEA 3AERB 2RG1A 4M9QA 4TUYB 1TK9A 3WMWA 4MMXB 4D3XA 3VJLA 1P7WA 3IUSA 2OOSA 3DVLA 4IHQA 1UBJS 3J81k 4RW0A 3GYGA 2C0QA 2WFLA 4N0DA 1Z4QA 4G41A 1UOOA 3EXG2 3GIWA 5T41A 5EIEA 2P7IA 3PE4A 4L4ZA 5JS6A 4L02A 4EY8A 3DR5A 3K9QO 3CNEA 2AZMA 2V59A 3EBLA 1VLLA 3IE2A 3OQ6A 5GIOE 4JI4B 1L5HA 4JXXA 3CX4A 4JDUA 4AULA 2R65A 3OE7A 3AFNA 3GK3A 1YJQA 3ZY5A 2P6PA 4M1OA 4NV3A 4BQPA 4FN5A 1IIBA 2AOWA 1PJAA 3PIRA 4D44A 1P61B 1DUVG 1T4CA 2IOYA 3DOHA 2E1RA 5H5JA 4F3RA 1VCHA 3MGCA 4PSDA 2QNRA 4YJGB 1V7QA 2E6KA 1D1TA 4XJSA 2FK7A 4BVAA 1ZK3A 2R2GA 1XTUA 3CEMA 2CVHA 3JQBC 1G8MA 2BJHA 3AM4A 2HV9A 3L8FA 3CLTD 4ZDKA 2HMTA 2CHVA 2EX4A 3VNAA 1LLDA 1OC4A 2O3QA 4UEOA 1KI6A 1O94D 1WXHA 1UDWA 4IHJA 3ESXA 2JAWA 1I30A 1C30B 4YACA 1TMYA 1OYOA 1SVIA 1T4MA 4DMGA 1G7RA 4Z0TA 4L3OA 3WK7A 4JB8A 1YIOA 1YZYA 3MT9A 3IEVA 4JUAA 3EHEA 1AK2A 2CJWB 5IWCA 2WA2A 3BWVA 3W5IA 4MRMB 2RD2A 3AJDA 5FI3A 2RI6A 4TWJA 3KQLA 1US8A 3HR8A 2YR0A 4IIYA 3WGOA 3GVXA 1N6HA 4XI9A 3KEFA 1UAAA 3R5KA 4C7OA 3U7RA 4Y9TA 2GJKA 3R8CA 3UUEA 3TLMA 3GLIB 3K2QA 2JAQA 4M6WB 3OLQA 4AO8A 1UBFA 3ORQA 3PEUA 4RF2A 2FRDC 3DL7A 5JCOA 2BM9A 4YC7A 1FJ2A 1Y81A 2HYDA 2WD7B 4YP1A 3UT6A 2BP7A 2EBUA 1P4RA 3DWEX 3G9QA 5BW8A 2GGSA 3MOIA 4RFLA 4GBJA 2ZCVA 1ONNA 2IQ5A 2O4CA 1RPTA 3EZLA 3TI9A 3M82A 1E0AA 1PFUA 1Q12A 2QJWA 4TT3D 2BDEA 3OAAA 3TIGA 3JWIA 1TVEA 3SICE 4OG2A 1XD2B 4CKBB 5FWDA 1JYFA 1E1RA 4DZRA 4RTRA 2ANBA 4F6CA 3AOGA 1SVLA 1RXEA 3DAGA 4YH1A 4A91A 4AMYA 4H15A 3TW8A 3ASUA 1MJNA 1ZH0A 4JHXA 1V37A 5FF9A 4MHOA 4TT3A 5C5CA 2C7QA 1K6XA 2TSYB 1Y98A 1W34A 3H9JA 2EJBA 1HXHA 3P2KA 2H2GA 2PBRA 3SYRA 4O29A 4V1CI 3WQQA 4TSFD 3ZV3A 1S9HA 4L2IB 3MJHA 3K32A 4C22A 4YX9A 2PXXA 3FPEA 3VR6A 3P9RA 4H3KB 4OJNA 2YHBA 1XXLA 3RIGA 3FMPB 3OT4A 4X41A 1P0PA 3H1GA 4IHJB 3DWFA 3H65A 1KOGA 1PR4A 4KK3A 1MFZA 3TNJA 2WIDA 3I42A 4YMIA 2RHOA 3DE6X 3VR6D 3E3MA 3M70A 2VRWA 3WK4A 2P2GA 3NBUA 3KDPA 3HJAA 4FGSA 4CLHA 3OE1A 2WZDA 1VIVA 1IOLA 1U7OA 1Q7BA 1OI3A 1PR1A 1SU6A 1UIRA 2X4DA 2Q5EA 3BICA 4LYAA 5CPBA 2J6HA 2E18A 2X19A 2EW1A 1K4YA 4JITA 4CF4A 3KALA 1JDTA 1GRQA 4NBTA 1KS9A 1TA4A 2OHHA 2XD9A 3QNWA 4DIOA 3GGDA 3EGWA 3KO8A 1P0FA 4O8ZA 3IGFA 4GOKA 1HT0A 1TM7E 4WFQA 3WQRA 3SR4A 5KDDA 1ZL2A 3U3MA 4GO1A 4F9EA 3OM9A 5HS4A 4JY7A 3O5AA 4XFKA 1SD2A 1I6LA 2B2NA 4UM5A 1Y1TA 1HX7A 1VHJA 2ODWA 1YKGA 2EHDA 1X74A 2NTEA 5L7YA 1GP2A 1KEUA 3WISA 1T0UA 2IGBA 3U4IA 4LN1A 2I65A 5AJXA 1LV8A 3WGJA 1UWCA 4F2WA 1NBAA 1KRWA 3ESRA 5C5EA 4HC4A 1LUAA 1J23A 4ASUD 1BWQA 3O8BA 4NJEA 3OP1A 3NHUA 1S89A 4ZT6A 1O5OA 1S3IA 2AOUB 1GEEA 3SJBA 2PWPA 2ZRAA 1JRLA 3H9GA 4QRDA 1LFAA 5FXMA 1LLQA 1XLTA 4B75A 4MRVA 2P5SA 3ENQA 3FAZA 1U8TA 3GB9A 2GCOA 3N7AA 3EUEA 4MVJE 1O1YA 3A6ZA 3ET5A 4W1PA 3N39C 4C7KA 3NKFA 4ZK6A 4XD7A 1NW9B 2R8ZA 5D86A 5GGXA 1CUUA 5ALNA 3GLHE 2H7VA 4JODA 3USES 7MHTA 1OH7A 3MUEA 5E8RA 3I6QA 1D0IA 2YFYA 3NBFA 4I5DA 2HF7A 4OHCA 3V34A 3ONEA 1AN9A 5IFLA 1AKWA 4IV5A 1H8EA 1NN1A 2FXIA 2MSDB 1IOWA 1FTNA 1PTJC 1V11A 4IM7A 4ZVOA 3W2GA 4QAQA 4FLMA 1SA0A 2F9FA 2HLHA 1ZCAA 4GAEA 3VTKA 2B37A 2GSDA 3E81A 4LYFA 1K7YA 3F49S 3R0XA 3ZW7A 3IR6A 3RUHA 2H5IA 4J7CA 4RU1A 4US0R 3MK31 2XQVA 3RG8A 3ITKA 4GRAA 1Y1QA 3VR3A 3L8HA 1X38A 2BZ1A 2C92A 4FMPA 4KMOA 4AXBA 2DCMA 1GT6A 1M34E 4DREA 3VZRA 2RBEA 4TN1A 2G1UA 2DOKA 3MTJA 4XGIA 1KZ1A 1OYVA 4AN1A 2W11A 1NVKA 3DV0A 2VT2A 2ZQZA 3IMKA 3STYA 3WGKA 5HJ5A 3CLKA 1HURA 1WU8A 2J32A 1HWYA 1FS6A 2ORED 3KAJA 2XDQB 1J7KA 3AWDA 3RAPR 3FPFA 3VO1A 3GRVA 3AU8A 3LM8A 4K28A 5GIPE 1QHGA 1HMPA 3AF1A 1EX1A 1CWUA 2BFAA 2ATIA 3FJYA 3H16A 5BMVF 2QUZA 5FUBA 4BNDB 2IKQA 3W9YA 3UJDA 4BO7A 4LWZA 3OJFA 4RTNA 1AZTA 3K7EA 2BF7A 1QH8A 3CT6A 4LSGA 4L9RA 1X7GA 1W9HA 2W2PA 3K8QA 2WMNB 1A95A 2DKOA 4NMMA 4JLPA 1V6CA 4OA5A 4MV3A 2DFVA 5JCZA 4B9EA 3EPRA 2PJUA 4IFIA 1SY7A 2ZJOA 4FCCA 3RK4A 1U7HA 1FW6A 2PU5A 4NHOA 2VH5R 2BLNA 5BY2A 4MARA 1NDQA 2A0FA 3PNYA 1XLWA 1O4WA 5E7MA 5HF6A 3CF4G 1MC5A 3QP9A 3CH6A 2AFIB 1GN8A 4BZWA 3CYFA 2DGDA 2CT8A 5LMUB 1GQFA 4ZJUA 1PI3A 2GPYA 3QE4A 3ZWMA 3WXMA 3G8AA 1J0XO 1UZAA 2QTMA 2VHYA 1SK9A 4P98A 3PXGA 1TKBA 1TM4E 1ZK1A 2HA4A 3I34X 4FT4A 4QX6A 3SEZA 1U6IA 2WUEA 4F91B 2IF0A 1XZEA 2ISSD 3BE8A 4BO0A 1FDOA 2R2AA 4FFWA 4X54A 2D5BA 1V96A 5COBA 3GMSA 4GM0A 2GWHA 3MAAC 5BYAA 5LWHA 1ZVKA 1E79A 3MCAA 3A4VA 4H7IA 3TUJC 1YB2A 1RTTA 1MGPA 3HDVA 4L16A 1IVYA 3CVWA 4QELA 3D5TA 2VUUA 2YZGA 5JANA 1M2VA 2E0IA 2PZMA 3GQVA 2B98A 3E84A 3USCS 4ROSA 2ZJ2A 4EVQA 2QRZA 4GWGA 1OXBB 2XVZA 3LT0A 5CAEA 3GA7A 2O0KA 2WHRA 2RKWA 3S2GA 4DNQA 3S44A 1OV6A 5ED4A 1TCBA 5L3QB 1YA8A 2G1KA 4ZU3A 3RYTC 3DBRA 1D1PA 4R8KA 4MO2A 3KEQA 1DZIA 4IDNA 3RR2A 2OFXA 5GPBA 1BZYA 3PNKA 1HE2A 1XVTA 1XZIA 2V9ZA 2VK8A 3KL2A 2PWZA 3L92A 3SC2A 1U65A 2C1ZA 5B36A 1DCTA 1XBTA 2EIXA 1C4OA 1P2FA 4MIYA 3LP5A 4KVFA 2JVIA 3WR5A 1NYRA 1C9YA 2ETXA 4J2OA 3G2NA 3DH0A 1X0VA 5FWXA 2AR0A 2FWNA 3GN2A 5K05A 5JALA 2AC2A 1ZDMA 1ECJA 5ALHA 2FN7A 3TR5A 1AHPA 1A9OA 1B3RA 2AI1A 4TVOA 4BRUA 4J29A 3BE6A 4FHEA 4OKSA 3V1KA 5CW1A 5ALVA 1U2RA 4RSRA 5TQVA 3CKKA 4GOMD 4MWDA 4KO4S 1S7CA 3AIKA 1XROA 2C00A 1U0NA 2J07A 3F71A 3N6VA 3ZY4A 4YRZA 4X20A 3HU5A 2GD6A 1BGVA 3NEYA 1EE2A 4N8SA 4ZCMA 1G0NA 2GVDC 1OKKA 1WBJB 2O2YA 1KMNA 4TMTA 4BHTA 1ONSA 3DE3X 4OI1A 1SXQA 3BDVA 4UMDA 4TKUB 4PEVA 2VN8A 1VRCA 3VNUA 1I0IA 4MA0A 4MUFA 2RC5A 4NE9A 4Y2QA 1RQLA 2GNPA 121PA 2OHOA 1SXGA 1Z2EA 2CBXA 4C0HA 1TAHA 1KF0A 1G8KA 5JCOC 4QSHA 5KINB 1QO9A 3GF4A 3G2KA 4R9RA 4F56A 4QUDA 2QD5A 4PRYA 3ET4A 3WLHA 2V6JA 3EXIA 3AHCA 1SULA 1V9LA 3KR0A 3HVHA 2IEGA 1AXGA 1FFEA 2IHUA 4EKGA 3OOHA 5FHQA 4C4AA 2BFEB 4RCVA 1Y4SA 4ZANA 4OMUA 1FDVA 2O5RA 4TKZA 4N76A 4HATA 2ZIXA 3W8NA 1JR3A 1Q17A 1XXHA 1R6UA 4O4LA 4AP9A 4QDKA 5J2TA 1COZA 1P1KA 1P4JA 1KARA 5LD2B 5A04A 4OAQA 1CDOA 2P9YA 2P4QA 2IV3A 2HBRA 4EPRA 1Z3IX 4MI1A 3N0XA 3KTAB 3RSZA 2Q6OA 1G98A 4ENVA 3H0CA 4M1SA 3AUAA 2E37A 3FDIA 2AXNA 1D2HA 2QL5A 3GLUA 3KXIA 3HJGA 1KJ8A 1CY2A 3HZRA 4IDQA 3ZIUA 1BN7A 1GCAA 3IODA 3OEWA 4FMBB 1L7RA 2Z1NA 4DFDA 4F5YA 1UINA 5A3SA 1TM1E 4UULA 5DK4A 5ALMA 1P2DA 3M3PA 4MULA 1EM8A 3PEVA 4IIUA 3M3DA 5BUQA 2PR2A 5JBQA 1JIKA 4AJEA 1H6CA 3PIIA 4HN2A 5DGTA 5LUAA 2EJCA 2M6SA 1A2QA 1SBNE 3EGVA 1I2DA 2ROQA 1UJMA 2NYUA 5ALKA 1DAEA 4S35A 2D0DA 1JLRA 1RPAA 3GCGA 4GL4A 4KFTA 4UU8A 4DPKA 3OJ0A 4XWAA 2XUQA 2HDNB 3MTBA 1H4TA 1E2QA 3PU6A 1QS0B 3LWDA 4YLEA 1Y7TA 2E48A 1KEVA 1A9TA 1AUXA 1Y82A 1UCFA 3FY4A 1OIWA 1Y9AA 1KGSA 3BGDA 3KLBA 4IVRA 2XGGA 4V2UA 5EP4A 3IHTA 1D07A 5KO2A 3QG1A 5FT9A 3LI2A 3CLUD 1V4NA 3LUGA 2FQ1A 3DT8A 1RDFA 4B3MB 4Y9RA 5DI3A 2NXWA 5L3ZA 4WLOA 2FMFA 1TUEA 4FKZA 3FAKA 4MB2A 4XA8A 2X0JA 2X8JB 3CEAA 3PG5A 4FX2A 3D7MA 4BY9E 1GSHA 2QD4A 2XAUA 3N87A 5E7QA 1E8NA 3DVSX 4FGWA 3TGWA 1OIXA 2ZBQA 2Q7XA 4PRLA 4C0AC 2HLNA 1NG1A 1I2CA 4OQXA 1KMQA 2WG2A 3VNSA 5AKYA 3W6ZA 4AD8A 3BE5A 3O4GA 3WL4A 1M1NA 1N2JA 4TLAA 4QHYA 1Z07A 1T9AA 3L6UA 4H08A 1DCMA 3I4CA 3LX5A 4KIGA 3S68A 3F9IA 1N34B 4I9GA 4AY6A 4BLQA 5C35A 4YUXA 1Z8NA 3M8KA 3SHVA 3DMTA 1X19A 4U00A 2XMQA 3KR1A 3UMBA 3IBCA 2JIRA 5BN4A 1GRVA 3HFSA 2K2WA 1VIDA 1QIFA 2O2XA 3DFUA 3WLAA 4E51A 4X93A 5EUBA 3MJTA 3T1VA 2ID7A 1YBAA 2X3FA 1YULA 2J0UB 1XAJA 3PRKE 5C7LO 5JHHB 2W2LD 1P0MA 3MF4A 2PR7A 1KIMA 3QHQA 1X7ZA 3H7AA 5K3AA 1QU2A 4Z2YA 5K0EA 2ZB3A 5THQA 6CHYA 4K3UA 4XQCA 4RZQA 5E4FA 1NZFA 5AOCA 4OHYA 1SZJG 4YPOA 1YB6A 2FOIA 3LQFA 1MPXA 2GBIA 2CNOA 3PWSA 4JWKA 4MGEA 1IZ7A 3R6GA 5K3FA 3GFFA 5A3QA 2AQ8A 4IMPA 5JC8A 3HL4A 2W4MA 1R9GA 3KJIA 1WXXA 2AWOA 1DT3A 1OKKD 2EEZA 2W2LA 4MR7A 1PTJA 2EWMA 4NLLA 4XARA 4XD2A 3TWOA 3OHPA 3KQNA 1SKYE 2B4RO 4L9SA 3ZDFA 5BRAA 4J0IA 5LP6B 2NUPA 1E2KA 3NKVA 2R1ZA 2BHTA 3VTZA 1ZGGA 2YRXA 3VZPA 2EZ4A 1FDIA 1OTXA 3DZGA 4MRNA 1NKVA 5TRTA 4QHSA 3TOXA 2DF8A 3RC8A 1NNI1 1E9CA 1EM8B 4RK1A 2HH9A 1DJMA 2O7RA 3N5CA 4OI4A 4CMAA 2J85A 2R751 1BMTA 1HL3A 2PGAA 2AC7A 3CEJA 3ZKAA 1TC1A 1QZXA 2NQTA 1LTHR 1MB4A 3MBIA 5GZ1A 3ND5A 4ZCLA 1W25A 5K0LA 1VA4A 3OF2A 2QM8A 1S2IA 1FZTA 1QYRA 4HS9A 3KTAA 4UDYX 5SV2A 3T41A 4GL2A 3PS9A 1XP8A 5HA5A 3I05A 4MRPA 1FY2A 1M0EA 4NR0A 4OM8A 2LW7A 3HXMA 4HDAA 3U5ZB 3IEKA 4O4LB 4DIFA 1BCSA 2A14A 1WS6A 5BN5A 4NE2A 1UPTA 3DSRA 4RMGA 2JEZA 3S2UA 4N7MA 3KE8A 3BJIC 1T2NA 2QDKA 4UU7A 5ICFA 4B8WA 1GYRA 4PHCA 4P4NA 4LDRA 2IELA 3IV6A 3HCDA 3L7OA 4TX1A 1VZ2A 4OM7A 4YRSA 3SX0A 2JLCA 3AQIA 3LHSA 4KGDA 4ICIA 3JU3A 4Q4HA 5IUNC 3IMCA 2A84A 1G21E 2QQGA 2WNSA 5BXYA 3IAEA 5D51S 4D96A 2FHSA 4BNNA 5IJ9B 1PNTA 3LXRA 2XT6A 3GP8A 1C41A 4AL4A 3ZW8A 5KOHB 4J2TA 1NSYA 3OC0A 3BPSA 4ENWA 5SICE 1IY2A 4G8CA 4WUVA 1W36B 2VQEB 2V7PA 1G9TA 1Q1ZA 2M6LA 3WIBA 1SGWA 1WWKA 1ZD2P 3KJXA 3E6AA 3MS7A 1FFAA 2YV3A 1E0DA 2PRZA 3CW8X 3F5FA 4FUTA 1XN4A 1MO5A 1NT4A 1YS4A 3K5IA 1FFCA 3KEGA 4GP6A 4NZPA 1JF8A 1F8FA 4B43A 1NUUA 3NAGA 3A31A 3CWZA 3UXHA 1H94A 1MR3F 1A4XA 3FYCA 1SG0A 4U39A 4PNZA 2OSVA 1G6HA 3GXOA 1XRJA 3R4VA 4B3FX 5JQGB 4X6YA 3RYIB 4EPWA 5ADHA 4X24A 3UPUA 4G86A 3QPWA 1KO1A 3X1MA 1DXHA 4XGQA 2UVPA 2P4UA 1QIMA 2OBMA 1NZJA 4PIMA 1OC2A 4RXMA 1QO0A 3H5WA 4WHMA 3R3UA 2O2EA 4HMQA 3VJRA 4GPZA 3WJ7A 3KHUA 3SC2B 5KSWB 4YK7A 2JLYA 3NTLA 3OAAD 5ERYA 2PQ6A 1T3ZA 3OC6A 1S1CA 1RC8A 3AUJB 4AWXA 4OYHA 4BNYA 1NU8A 4GE0A 2CUNA 2BZ0A 4X66B 1YHYA 3HR4A 2G5GX 4W63A 1TJNA 2EP8A 1XCBA 2OESA 2XH8A 3FGZA 3I53A 3G1WA 1DMRA 1ZONA 4JU9A 1NRXA 4WOBA 5LLSA 3BD6A 1RWKA 5CAEB 1AXEA 4LV8B 1S7GA 5J5VA 2HPZA 2D5IA 4I5EA 4RKFA 4BP9A 5KSZA 4JL5A 3DEHA 2C7PA 4JH0A 3MUOA 4W5QA 2OR3A 3V4OA 4YCSA 4YP7A 1ZINA 4PU0A 3ICCA 5G4KB 5BSGA 3FMFA 4V3CA 1ZIDA 3VX4A 1KYXA 1SOWA 3L9WA 3LBAA 1SUWA 2VP2A 3CRQA 2PS1A 3NHPA 5E6UA 3QEKA 3DC2A 1WDLA 4HXYA 4M0MA 2GRAA 1AD2A 1LDGA 1NJFA 2OV2A 4MB0A 4X8MA 5FLXA 2VJQA 1CIPA 3EZXA 4F8JA 2P9FA 1K4MA 3KT0A 5KWVA 1RIIA 4F7DA 4YYZA 3EPHA 5IDXA 2BUCA 3D8NA 4LG1A 1N2BA 1V48A 1TGVA 2Q3LA 3HPRA 4ARBA 4PHTA 3SAJA 2HJVA 1MLDA 1F4PA 1GGKA 3PXEA 9LDTA 2AFIA 4LMPA 4B3IA 1XPRA 1JDBC 2HT1A 1SM4A 4A8JC 2VJMB 2UVDA 2RHDA 1B3BA 1NMXA 1QFXA 1SD1A 2IJGX 3FOEC 2GN6A 3F3YA 1K5DA 3AFIA 1KZGB 2ZANA 1XJ5A 2OAQ1 1R5JA 1U80A 1YL6A 1KBZA 1U7ZA 2IZ7A 2KE5A 2R8RA 3M81A 3P26A 1NC1A 3SJZA 3U7JA 4S1VA 2HU5A 2FUEA 3SJAA 2QR5A 2G77B 1GTMA 5F3RA 3QA9A 5EMHA 1OR8A 4XGRA 3NT2A 2GF9A 3TRKA 5A0VA 1SPBS 5EJ2A 2F3QA 3FCYA 1U2DA 5AVTA 3U09A 3UMVA 2GSWA 4IDAA 4BNDA 2UZ4A 1NBEA 1WVIA 2C99A 4BVHA 3THXA 3KS9A 3MW8A 3P5BA 4HQRA 1TZ2A 2G5TA 3A6EA 4LYEA 4RFVA 1FP4B 4FSHA 4M55A 4RL4A 4BDTA 1PJ4A 1R0KA 3E9MA 4J76A 1Z4PX 2A35A 1X1QA 2RJOA 3L8YA 3EDMA 2A9OA 5HBGA 5EPOA 3LRTA 1FU4A 4RBNA 2A9FA 4PX3A 1BMDA 3OTIA 3CX8A 4LRYA 3OPVA 4MLPA 2OSBA 1S3FA 1P8JA 2CLLB 4NG4A 1ETUA 1GYQA 1NF2A 2C1XA 2NUBA 5ITZB 5TIIA 1Z88A 3SBEA 4EGJA 3G82C 3CW2A 3DXYA 3CY6A 2QT9A 4AZSA 4R84A 3DTYA 4RQUA 1QOPB 3SCZA 5JCJD 3L1IA 1AY0A 4GYWA 1AKRA 3G9ZA 4AS1A 3TIVA 4ZAZA 2ST1A 3ANNA 3LF2A 3ICQB 1H2XA 3DE4X 4LBVA 4MIEA 3IOEA 3V7UA 2J7KA 2LDXA 3OZEA 1IDOA 1M8PA 3SBXA 3AJEA 2B7BA 1E2IA 2Z4TA 3PQ6A 1VRVA 2DEUA 2AMLA 1SC9A 4ETIA 3D6HA 4DDTA 4HH0A 1WULS 3WLLA 5CP8A 2IU0A 2FP3A 2G1JA 3H9BA 4WASA 4J90A 3NB0A 1K06A 1DBSA 2F4NA 4R3UC 1ULSA 4EL5A 1MCZA 4HGZA 3DOFA 1IM2A 2H54A 1QV7A 5EFOA 1TVKB 3FDXA 3ILVA 3KIPA 3JRNA 4CRWB 3B70A 4TKMA 4IL5A 2QN2A 4CQLA 3CT4A 5AICA 4QM6A 4HNUA 2ZAIA 3KOXA 4Z86A 1LBEA 3CMCO 4NDNE 4PR0A 3SJCA 3MXOA 5CXSA 4E13A 4ZPJA 1KJZA 1MAAA 3R3JA 5FBRB 1BROA 3M6AA 4I5FA 5A6SB 4HEJA 2VDPB 1Y6FA 4C5CA 1S2LA 5GTDA 4FLEA 4NJMB 3I01M 4I1UA 3ZHYA 4E3ZA 3AETB 4AQ7A 1P91A 3VVMA 2BKAA 2PUDA 1SVNA 2QY9A 3GT3A 4JZYA 5JJBA 2I22A 2WWYA 1P45A 2YWGA 1BDBA 3O2SB 2FPXA 4R40A 1ZMTA 4UUBA 4B2LA 1YI1A 1ZRHA 2C0CA 3L93A 5KOHA 4PTZA 2DWQA 1VJTA 1PR3A 1XMSA 1W0JA 2FV8A 3I0ZA 2HL6A 4INJA 5IJ9A 1FDSA 3HU3A 3EZFA 4A7PA 4QASA 4TVSA 2P9EA 2OP1A 5HRUA 1IIRA 1VIAA 1A97A 1FX0A 3QEJA 4JT9A 4Q4HB 1NPYA 3SKXA 4II3A 2OBLA 1UC5B 3HPQA 5LPNA 3HRIA 2HHLA 1T9BA 2PUHA 4PZEA 3PHHA 4FOOA 1Z6GA 4XRRA 5BV1A 3NBXX 2ZDQA 1G5IA 1J39A 2RIPA 3PDWA 5COAA 4B76A 4BQNA 2XCTB 3QXHA 2OORC 1KGDA 3LYUA 4J16C 1N4AA 2VDRB 3R7FA 3UBMA 3RYFB 2VZ9A 5FA8A 2X40A 3S81A 3DT6A 2ODQA 4NU8X 1VCOA 2VPIA 4FW9A 2QG9A 1L4MA 3RFVA 1SN7A 1T1EA 3ZXYA 1ARZA 2VKTA 3I9NA 1YJBA 3E9ZA 1E94E 3KOMA 1VSQA 3QI7A 3W1EA 4X6LA 4LV5B 4RNCA 5AKHA 1SXPA 4ARUA 3MLBA 5IF9A 4LJSA 4RJJA 4GI1A 3U4QA 3H2ZA 1U0TA 1HE1C 1Y89A 2PGJA 1FDUA 3FTNA 1H1TA 4L8LA 4MV4A 3WO0A 2JCYA 4NS4A 3VA7A 3K70B 3E7WA 2V6BA 1FNCA 1U9YA 4PG8A 3GNTA 1XKTA 1PYGA 5ESDA 4ETNA 3RQSA 3TW8B 3ODPA 3UMYA 1MD9A 4KC0A 3D3WA 1P7CA 2AC4A 2SCUB 1SKMA 2A1IA 4IHJF 3U7HB 1O6BA 2Q6IA 3FVRA 3B6KA 1SRRA 1WB9A 4MR7B 3QEBZ 1JWAB 4QWMA 1BW9B 1BXZA 3FPLA 3SC6A 3WS7A 4W8OA 1IJFA 2FFQA 4ZO4A 2XYRA 3IMEA 4IXNA 1TT5B 4MW7A 2YY7A 2DAPA 2ZITA 1OW3B 3AHHA 3KD2A 3O4VA 4WNAB 5HXAA 2ACWA 2NQ8A 1MEOA 3DEZA 4RH3A 4U5QA 3U19A 1V8OA 5BOSB 3ZV4A 1ISHA 3CBGA 4RACA 3SZGA 1SKUA 1LVUA 1ZY2A 4M8LA 3N0WA 1KYQA 1NW4A 1M74A 1TJPB 3N8KA 3TNFA 2DJIA 1E9SA 3ILYA 1OVMA 4PSVA 2AR7A 1JQJC 1VKOA 3OP4A 4BZZA 2GAJA 4FDUA 2B0CA 4KE7A 2H51A 2GJ4A 3L7BA 3HNOA 3KEOA 1P7ZA 4DDKA 2AEEA 5BUCA 3H4VA 4MGZR 4MQFA 4RZSA 3THWA 3BS4A 3K5WA 1ISRA 1Z9BA 1NFRA 1W5BA 4OGWA 4PZAA 1OU0A 3BWYA 1X42A 4TS4A 1KI6B 4WKBA 2IVZA 5T3YA 4NATA 4PSCA 3BD9A 1E2FA 2HF2A 3JTEA 4JLKA 1I1QB 4KBGA 2IEAA 4LF9B 1DC6A 3P0HA 3LJKA 3QBTA 3RV4A 3VAYA 3D8HA 1UBLS 3D8UA 5KVCA 5IT9A 1NLMA 3OZFA 3SS7X 1NQ5A 4DLLA 4OHMA 4CM3A 1ZS9A 3F78A 2AH5A 1DQNA 2CGEA 3V8NA 3FTFA 4G5GA 1Q0TA 3FR7A 1WXIA 4FK8A 1Y8RB 1PVOA 5GM2A 1DAHA 3TXYA 3JAWB 5HCNA 4EAQA 2JAUA 2Q29A 3Q15C 1N5MA 2BMWA 3ZE2B 7MDHA 4MPPA 4WRRA 4KN6A 4QYSA 4EEKA 4GZMA 1LQTA 2C8KA 2WWXA 4I8DA 3ND6A 3K6RA 2Q27A 3WGYA 1VHWA 1MXHA 2C4WA 1TLLA 5L3VA 4Q3DA 1JBQA 5JOQA 3CR7A 1U1EA 3RRNA 4BLOA 2XF8A 4OHXA 2WFLB 4LWPA 3WJAA 4DIMA 4DV2B 2J5RA 1A7UA 5BW6B 2P3SA 2VHVA 3SIPA 2D0OB 1V7ZA 4FS8A 4C0WA 4MR9A 3AW9A 4NZMA 3PDIB 1L8QA 2GFQA 3WAGA 3Q7TA 2IK8A 4R2XA 1ODCA 2OXCA 1NXXA 3FOAA 3WWDA 2V55B 3BQMB 3E7DA 3L0YA 2I4OA 3GY0A 5DYTA 5LCXA 3T8YA 4BJ5A 3LQ1A 5DRTA 1IHPA 2A57A 1BVYF 3O8QB 3M2PA 2OLKA 4PCLA 2XT0A 4M1MA 3NVMB 4Y0AA 3KTDA 3VI4B 3L0PA 2OYRA 5JZVA 1UPFA 2ZYUX 3FNGA 3BRQA 1C8BA 4OHOA 3JCZA 3LTEA 1QDUA 1QYIA 4ND1A 4U2CA 2XGSA 2X2OA 3DGFC 2JJQA 5ALEA 5HF8A 5I4BA 5JSQA 2V6GA 4IOMA 3HJTA 4RIHA 4P5PA 4Q9LA 4HVLA 5BSWA 1G8JA 1SZPA 3K1TA 3TLBA 4TV8B 2I2DA 4DWJA 1AUQA 1MAHA 5D6NA 4E08A 3EXIB 4L4SA 1TCCA 1P7YA 4MV9A 5CDUA 1M2EA 3BF7A 1KMMA 3BFJA 1VPTA 4ZVLA 3SJ7A 4WOJA 4ZKDA 4JYZA 4RF3A 3EFHA 4LTDA 4RD3A 4YRRA 5LQDA 1EUYA 4C43A 2ZRBA 5HQJA 1Z36A 3A04A 3DTNA 1CCWA 4C76A 1GSOA 3C7CB 3O4FA 4CLEA 3W77A 1PJLA 3R8FA 1N0VC 2I6QA 1M2WA 3EDRA 1U2DC 1NV8A 5CW2A 1Z12A 1LRLA 3HSYA 4LHEA 3ROQA 2PNJA 1AUPA 1AKEA 1YRHA 2IYOA 1K6MA 2KX7A 2R4QA 2W6ID 2WJZB 1MAVA 1QE3A 1WD5A 3E9QA 1S0UA 3MN1A 4OXIA 4RLFA 2AXQA 5TS3A 3UH0A 3VVBA 1D0SA 2R1TA 3L6EA 3QHAA 5LYJB 2OXFA 3EMDA 1H5NA 4DVJA 1VPWA 2Y1KA 5CYPA 3D4PA 1VXRA 1NHGA 2O1XA 4BXOB 3H5TA 1MA0A 2ALJA 3KQWA 3NYRA 5DXFA 4AZTA 1C7JA 4D4LA 3EZ7A 3PP8A 3NHAA 3M6IA 1BMFA 3NIFB 2W70A 5FWXB 3H1AA 1RAGA 4QDXA 3AVPA 4DZTA 5F2OA 3IXLA 3LWZA 3ANMA 4NU5A 3SP1A 3IBFA 3WYGA 4BFVA 4BB0A 3LU1A 3S8YA 4BFYA 4DMFA 2X6QA 2I4TA 1I3NA 2DWPA 4NYIR 4S0XA 1JMKC 2WQ6A 1TTPB 2R11A 4A8HA 4PLFA 5LXTF 3UEOA 4DIBA 1Z0JA 5DNVA 4KLAA 3FSEA 1E6MA 2BVNA 3EULA 5MFZA 2JG3A 4GMXA 1E20A 3A9VA 2GN4A 4LOHA 2W6QA 1HZZC 1KOJA 2VS1A 3AR4A 3LGAA 1Z37A 5TVGA 1HYBA 1WDMA 3WNCA 4B4WA 3R9WA 1DO8A 1WEKA 1P5ZB 1NSFA 3SXUB 1XGKA 1M6EX 3IQEA 3ZE1B 1Y3BE 1LV7A 2IHTA 5KSOA 3CRRA 2KB0A 1OSNA 4Y67A 1PX0A 3ILHA 4C0QC 3G2JA 4G5QA 4OO3A 2CL6X 3DCNA 5H59A 4MPTA 4Q3EA 5EZYA 4DSUA 2NZ2A 3QENA 5AHOA 2NVUA 3IUYA 4ZWNA 3VNVA 2OXIA 3BDIA 1DRWA 3RJZA 4OVKA 2NUAA 5JAIA 1PIWA 2QN6A 1HYHA 4F9FA 1ISPA 2ABWA 4G67A 5J5AA 2WFZA 2P2SA 4YJ2B 2PTGA 4U7PB 2IRWA 2KLHA 3CPEA 2REQA 1ID8A 3LLVA 1MH9A 4HLQB 5LZ5A 2M1XA 1NMZA 2XWBF 1W88A 2VI5A 3DCIA 4N5HX 2BHNA 5F35A 2Y1EA 4QEDA 5B3JA 3HE3A 5ICMA 1H2ZA 2QDXA 3UK2A 3LY8A 3V1MA 3DE5X 4TZ6A 1N7IA 1RCFA 1LRKA 1EX9A 2YV1A 2AFIE 2KPOA 3CUEF 3HACA 4NI5A 2R1VB 2W98A 1SHTX 3IKMB 3OEED 2HDOA 1M1XB 3EXAA 1T5HX 3LPNA 2CHEA 3H5NA 4DV7B 4QQFA 1FMJA 5DYWA 2O8EA 2D2IA 1Z4NA 4RKRA 1UPXA 4MUMA 5T67A 4ZN6A 5JEDA 1QH8B 3O4RA 5AJYA 4KIWA 4U9IS 4TTAA 1CYEA 1SUSA 1Z6TA 1BX1A 1FQOA 1O97C 4ITUA 3EA5A 1G5TA 2ZRGA 3AHFA 4TQ9A 3C48A 3K9CA 3PPXA 4DMLA 5CYGA 5DN6D 1AQNA 1GV0A 2NXJA 4OI0A 1CF4A 4BVKA 1H0RA 3C4VA 4YMTA 3VR4H 3WDMA 5L3RA 3OURA 3G9TA 2JD0A 1SWWA 4FMCB 4KFCA 1QWOA 1UDXA 1ZISA 4Y9SA 1OQAA 5GJWC 4FGZA 3RBZA 5F21A 3IO5A 1AK9A 1RI4A 3BTSA 4LQDA 4RHCA 4TTJA 5EJ6A 1G7CA 5ARDA 1LKZA 2IQIA 2GCPA 3C4JA 3K15A 4IIBA 3VH1A 2YQ4A 2IYUA 1CS0A 2ASEA 2OCAA 3NT4A 4BMZA 1FA9A 1TYDE 2RARA 3TTVA 1UKYA 3S28A 2HEIA 2KW5A 4Q66C 1QE0A 4FW8A 1QHXA 2OK7A 2QAGC 2FLVA 3M1LA 1U04A 2YW9A 4U3JB 1PZGA 3KBBA 5AVZA 3D9QX 1U9JA 2C2XA 3HI4A 4OH7A 3PQ8A 1KKLA 3GLSA 4TV8A 4ER6A 3QLVC 3ZEIA 1W30A 2DUNA 3CVXA 1L5WA 4MGYR 2GEFA 4JJ7A 2QMYA 1JEQB 4GPTA 4Y2SA 5IU6A 5K0GA 4JEIA 1B93A 1V41E 2X0EA 2Q4DA 4KO2S 3PHCA 4YQYA 5SYMA 4M0UA 2WPDA 5FL7A 3W90A 5E6RB 4G5RA 5B6IA 1GL3A 4QOEA 4UREA 4C7MA 3SMQA 4GKJB 2Y6UA 2J9XB 1R6DA 1EJ6A 2OVBA 4IJ5A 2RH8A 3F2VA 5FL3A 2I2BA 3R0IA 3QU2A 4EARA 1DKRA 1SUBA 1KK2A 3ORSA 1ISMA 3QX8A 5ER9A 3LCMA 2C83A 3ZDCA 1AJEA 2VRCA 4UE3S 1PR6A 3O8CA 4MYTA 4W7IA 3MJSA 2C7GA 4FYJA 4DARA 5CB8A 5IM4A 5TC4A 3SKVA 1GZ4A 3HWWA 1F38A 2AG0A 4ND2A 1XAHA 3TM4A 3WB1A 4WY8A 5D1HA 1ZUD1 3LA8A 3TOCA 5L3SB 3WL6A 3EIEA 4B81A 4D7AA 3RW9A 3M9XA 4N3CA 2H4JA 5KQLA 1G21A 1I4OA 4ZYYA 3KSAC 4ZARA 1P5HA 1CU1A 4QRIA 3ZTYA 4D2IA 2O2GA 5ALUA 4ES6A 2WSSD 1FOEB 2JKYA 3SBDA 4ZGGA 2WJ6A 4DSTA 1BMQA 1UZUA 1WZEA 3CUUA 1Y8RA 1BA2A 3NOQA 4KSYA 3ZGLA 2P75A 3ESZA 3HNPA 5WRFA 1L1EA 1WVMA 3MJDA 3WLNA 4U63A 5LQCA 4IO1A 1WOYA 1KPGA 4D99A 1NVEA 4ZT4A 1W85B 3JVVA 1UZLA 5CGQB 1G17A 2KJQA 5A0FA 2H3EA 2P3QA 3RE1A 3NTOA 3F2IA 3SYKA 1ZEJA 1E2JA 1XVVA 4FSDA 1Y4ZA 2J9RA 1UMDB 3INYA 2OXRA 1IH8A 4NNJA 4CMJA 2YW2A 4CN9A 2I33A 3OA0A 4K9MA 3H1BA 3KJFA 4RHTA 4RIFA 4EJMA 4EW3A 3U1BA 3IALA 4DV5B 3D54D 1VB3A 1GTSA 1SCAA 1ATZA 4TVBA 4ZAYA 5KTOA 4MQFB 2FCRA 3JQAA 4WOPA 2HMYB 3OOEA 2ZBPA 3ENKA 1U8ZA 2QLJA 3QKWA 1R9JA 2P5TB 2ZOSA 2AFHA 4L2IA 2NSDA 4QULA 4M8IA 3DV2A 3M1AA 5E6SA 5GJCA 4YRGA 1DWOA 1XMXA 3PPIA 1KWKA 1RYYA 3X1DA 2O3JA 1ECBA 3W5VA 5I9TA 4FMDF 1PQUA 2OGSA 2P6NA 2C2WA 2YL2A 4TLDA 1GKUB 4IGAA 5CYFA 1J0EA 1I0LA 3FLEA 2IPMA 4YJFA 5TLSA 3A0UA 3GG9A 2Q9UA 3JQAD 1E2EA 2XIQA 4JDPA 1G8PA 4S2EA 4XLLA 3S55A 3OZ7A 3TI7A 4V0ME 2I8AA 4YAEA 4Q9NA 4BO8A 2VUTA 4RJLA 3LT2A 1CT9A 4BASA 1NKTA 1SUIA 4FHCA 1PJRA 1QX4A 2HCRA 4MQLA 3U7EB 4J0JA 4R1LA 4F0JA 4BMYA 2V6MA 4IIVA 3O9MA 3I01A 5GJBA 2IWRA 1E18A 1COWD 4LGYA 4S0ZA 2WRZA 1P44A 3H7IA 2O06A 3FCSB 1DBQA 4IS3A 4PAWA 2JFHA 4ALMA 3FMOB 3ZE8A 1LC3A 4BKUA 5KX5F 3D1LA 4B4KA 4UJ5A 3N8DA 3ZVKA 3KYBA 1XEWY 1QK3A 1USKA 4MYUA 5AXCA 3SNHA 4Q9JA 4EYGA 5J4YA 1AMNA 2C5AA 3CZQA 2VA9A 4M6WA 4B47A 1DOHA 4Z7NB 2AOVA 2DR2A 1KJIA 4YJ2F 2KYRA 2I91A 2D1YA 4MRAA 2H1LA 1ESDA 4G9GA 2VF2A 3PCRB 1MIOB 2VR1A 3B9PA 2BFWA 1F8YA 1N0UA 3BSSA 4OMFG 3DD5A 3NZEA 5KOJA 3F3SA 1Z0FA 2EZUA 3S40A 2UUPA 1K08A 4QUJA 1H5QA 4ACAA 2XB6A 1H3EA 3BB3A 2HA6A 3ZY3A 1UKAA 4UPVA 1N5IA 5FV4A 4OX9Y 2CJWA 2SECE 1XTPA 4OKIA 4C29A 1R66A 4G0UA 5K03A 1TU4A 3EXHC 2HQOA 4MWZA 1FSZA 2ZJ6A 1EP1B 1H66A 2XY4A 2IWHA 4EZBA 1N5OX 4FCWA 3PV0A 4IXTA 1P1IA 3AVUA 1NQVA 2XB2A 3E3OA 2CD7A 3ZHZA 1GQOA 1UUFA 2DPXA 16PKA 2PFKA 4KGZA 5L53A 3RDPA 5LIPA 4QLBA 3RC9A 2E5FA 4IIDA 1F7VA 3FVTA 1YGPA 4MKXA 1T5DX 2D54A 3P9ZA 5AD1A 1ZR2A 1W85A 2BGKA 1Q91A 1E2HA 4YJGA 3L4SO 5LA6B 2D8AA 3LCVB 4H1VA 1E1QA 1H2EA 1A76A 2YOGA 1EEXB 4LMAA 3IJ5A 2EP7A 1FXUA 5IASA 1X3LA 2Y77A 1Z25A 3O8OB 4WY5A 1E7YA 1RQ7A 6LDHA 3HJUA 1O08A 2YMMA 3ZCUA 2YWJA 4M53A 3HHPA 2V5AA 3ABSB 1YZNA 1FNBA 1CZRA 4OK6A 1SHJA 3B2QA 2QVLA 1WE2A 3GT4A 2I7DA 4PFSA 1RWVA 1U2GC 5FB3A 3LBHA 5FPTA 5KTMA 3IIIA 4US2R 1AUVA 3UT5B 1K4KA 4F97A 1EFVA 5AM4A 3KK0A 4DL9A 3VU1A 3CVVA 1MG5A 1UC4B 1I9GA 4JMLA 1HE4A 4PONA 3ITNA 3GEEA 4L3WA 2QM3A 3EDYA 4F3TA 3TK1A 4Z1MD 2JJMA 5C3UA 5C2JB 4L50A 5I7HA 2JLXA 3EWSA 3P2IA 3EH1A 2JFGA 2P62A 1N9GB 3OQ1A 3RWMB 3TEJA 3VGPA 3WZ2A 3C3XA 4DLBA 2QQFA 1SO8A 4JJEA 1Q0ZA 3CRVA 2WP8J 1A98A 4D9HA 2OECA 2SKEA 3K9LA 2E6UX 4MUBA 3AI7A 3ZJ4A 1ZI6A 2VK2A 3BHMA 3CNNA 4EJ6A 2Y1XA 2MMGA 2J08A 5JSZB 3A3PA 2G9QA 4FJ0A 2IV2X 2Q50A 5BWMA 5JR3A 4I4NA 3VYRB 1B6GA 5FO0A 3IQXA 1KO8A 4H0FA 1VBNA 3OZSA 3SZ3A 2ZTVA 3W06A 1I1OA 1QO7A 4X7RA 1EFTA 3R3XA 1DQRA 3EBOA 2NW6A 3OZXA 3GEPA 1XCJA 4OUKX 4X7BA 5JDCC 5ICGA 4ARVA 2SNIE 2JGJA 3WHPA 1O7JA 3O7WA 3TKYA 4D4KA 5CNJA 2J09A 1HO3A 2ZYRA 4MUXA 4M89A 5BR7A 5BMOA 3WO1A 3P7MA 4P35A 2CDBA 2CLSA 4RE6A 2HHJA 1KHHA 3HJFA 3PYLA 4UEQA 3SM3A 1TQ6A 1XRSB 3DONA 1TW3A 3ILXA 2VJLA 3MLAA 4MKIA 4ZQCB 4HDKA 1E0JA 3QU7A 2O2JA 3WLPA 1T8PA 1X2EA 4L0CA 1Q14A 1QRDA 3EOBI 4QUEA 1X15A 1U0RA 1FJGB 2QSJA 1TOAA 2FPOA 1Y8AA 3A7DA 3PFNA 5IRCD 1RXVA 1IQ0A 2JATA 3FHOA 3KKMA 3LDGA 5JI2E 1FP4A 1RKUA 3NM6B 5J23A 2VHUA 3OTOB 3DOJA 3WFIA 5B1SA 3KSBC 3THXB 3KYDB 3OKAA 3H1PA 3ZOZA 3H42B 3Q1LA 2IOQA 2W2VA 3G7SA 3DBLA 5EKDA 5CBKA 3GI1A 5A6VA 4TL7A 1SKBA 5F1YA 4CKCB 2GJAA 1Z7WA 5IP5A 1G3MA 1WHTB 3W8DA 2J0SA 1B14A 2BGRA 2H5JA 1PVDA 5MN5A 2YJTD 3GJZA 2QJRA 1RW4A 3LUAA 3TB6A 3QX9A 3FXAA 3O3CA 5DT9A 3GFOA 2LDBA 3PTZA 4Q9KA 5DX1A 2XB8A 2R60A 3ELWA 1BQEA 4DXAA 4LECA 4QOSA 4YRQA 4HLCA 1Z75A 1T8SA 3NUGA 4ZU1X 1QQ6A 3OQIB 1G2PA 5JZ9A 4YT2A 4HY3A 1YU6A 4N82A 3UYKA 1FPMA 3ROPA 3GRAA 3WBJA 3DAPA 2YOFA 3GZTB 2B9VA 4YJ2A 1CUGA 4GS5A 2E49A 3GV0A 4XD7D 5DHQA 3DXZA 3ZG6A 3ZWAA 2PSJA 2CYAA 2GPWA 4I3HA 2J8ZA 1GOTA 2JH9A 4O2BB 1Q0UA 1VMDA 2QVCA 4P2GA 5H8WA 5KX5A 2ZVJA 1NY5A 4OYRA 4B6EA 2Z6AA 3NC4A 3PNOA 2BGLA 5JYEA 1MB9A 1ZA2A 2D13A 1QP8A 5ESXA 1XCGB 4F7WA 5C8DA 1QNFA 5H4HA 3K0CC 5K8CA 3CUKA 4OBXA 3GWGA 4IP0A 5F2NA 2RGDA 5C1OA 3GX1A 3NWEA 3M34A 3R3YA 3OCCA 4EJ2A 5JRJA 3IDFA 1ZGAA 3CUYA 4CUKA 3UGQA 2BFFA 3GVCA 3ZWYA 3UKOA 3SXUA 2CUKA 3GUZA 1T9KA 2G06A 1CUSA 3QPBA 4URHA 4CODB 2GPBA 3A06A 2ECFA 3GRFA 3LMKA 4MNTA 5CK4A 1YKFA 4OIFA 3F97A 4Q1FA 5TXGA 5M5BA 1G38A 5K8IA 1JSXA 4LTNA 3NEAA 3V3TA 4YLYA 4K8RB 2IBMA 1G4AE 3IAS6 3IJPA 5EJ4A 1SU7A 1P73A 1U9IC 2ZQ5A 2VSOA 3JSXA 3CR3C 3NC0C 5G0UA 5C7IO 2UUCB 3D4BA 4CM4A 4EFKA 1IN7A 1RI5A 3ZUGA 4ZZ3A 4LF5B 1FFDA 4RWEA 1JQBA 4LK3A 5TE9A 1KETA 4PPFA 3PNPA 1TD9A 2RI1A 4HK4A 2LIVA 3G8YA 2M6KA 3C7TA 3I1YA 3S2YA 2RBKA 4B2PA 1YE5A 1F20A 3Q8XB 3FF1A 4ZT5A 3WWZA 4CG2A 4HVCA 1IG0A 2GFHA 2VCEA 7ADHA 5JQGA 4CR8A 3CRW1 2IYWA 5JXIA 1ZUIA 1WTCA 1V1MB 4XUDA 2QK4A 5D8DA 1IPHA 1QU3A 4EZIA 1T25A 8ADHA 1X7YA 3OIFA 3DKPA 1GILA 4IQFA 4KYIB 4OGFA 4Q1EA 3T5GA 4B4DA 3V2GA 3K0FB 1N2CA 3HJCA 5KTPA 4MRSA 2R1TB 2D0IA 1XJCA 2BFOA 2PM8A 1X80B 4NFLA 3INGA 2QTCA 1GFZA 3GJ8A 3R6LA 1O57A 4UTXA 5K6RA 6REQB 4TXMA 3HP1A 5JBNA 2DERA 2YWFA 2QR3A 2QRNA 5FTKA 1ZWLA 3KPUA 1UBTS 2AMVA 3CO5A 1SRQA 3N7UA 2XMGA 5CLQA 3RK0A 4G0WA 2GBCA 2XMZA 3NV7A 4G97A 3K6JA 5HS6A 3EYWA 3LH5A 4MMZB 2IOFK 3MMSA 2QX8A 3WK6A 5F78A 2X76A 4RF4A 5EKUA 1Y9JA 1ZFNA 1XQYA 5ETJA 5H3HA 3U4MA 3FVQA 3AVVA 3GR6A 2FSSA 5FWAA 1N2EA 1ODKA 2P0AA 1VKJA 3B1XA 4EZEA 4LSWA 4S1OA 4UFNA 4P3YA 2E4ZA 4I6JA 4Q7MB 5HIAA 3D7LA 2HFJA 1LC0A 2XWQA 5EQFA 1FNMA 3QKTA 2J46A 3EQ2A 1A2OA 2QZ4A 1Y6GA 4TSKA 1KOFA 1BCSB 1K3FA 3B60A 3FZYA 4HQOA 4J75A 1DAIA 1NXTA 2BR4A 3AIMA 4KXLA 4B7ZA 4QGSA 1B8OA 3TL3A 1YF3A 4I2NA 1W1WA 5A2QA 2VJOA 4UNQA 1PFWA 4JLNA 2WICA 5CLLA 1RP7A 5KNBA 1LJUA 4DPLA 3C43A 5A02A 1XWFA 2WSMA 1F0NA 1DP4A 1P0IA 2C88A 2XE8A 2YYZA 3FHCB 4L4YA 1C4XA 4BVLA 4YR7A 1IMJA 3ZX4A 1T5LA 4EKIA 1JSRA 1P9RA 3G5MA 1FRFS 2HSZA 1SKAA 3A3OA 3PQCA 3R7SA 4RTMA 3KPWA 1Y3IA 2C5EA 2ISQA 2XYGA 4URXR 5E3JA 4W7SA 3VKFA 4BP1A 2CNLA 2WHQA 2HIAA 3I12A 5IS2A 2AFRA 4DE5A 3ZKWA 3C3CA 3NDPA 3MCTA 4D8WA 1JFLA 4NFYA 4AXXA 3DEAA 3OCYA 5IAAA 4GF5A 4PLGA 4E33A 1N4DA 4NONA 4PRKA 3PFWO 1DIHA 3D7SA 5JH7F 4GBGA 4I4IA 1YDHA 1XR3A 2HMUA 5AKXA 4ARZB 4B73A 3LF1A 4OH1A 5EUMA 2DQKA 4DIKA 4EB3A 3BB4A 4CMEC 2DUUA 2Y0DA 1N2XA 2GN2A 2VH2A 1THZA 4HO1X 4UEJA 4DCJA 4W8HA 1V0JA 1OOEA 3VYTB 4OB7A 1XA3A 2VWGA 4YEDA 4BO9A 4KNYA 1A04A 1PWEA 5CVEA 4MPJA 4ZQEA 4G2TA 4C05A 4RGBA 2I7XA 5AKIA 1PJCA 2AZTA 2DU8A 4H3SA 5CFPA 3RTBA 3V46A 5EJ9A 3E23A 1RZVA 4FYYA 4J4TA 2R8YA 1ADYA 5DBIA 2D7DA 2FFHA 1C9JA 2E4YA 4Y2VA 2V7QD 2OFFA 2DTXA 5BV0A 1UODA 1Y33E 4M0DA 3RUCA 1QHNA 1DXOA 1AQYA 1EFDN 1YQXA 3MWKA 1ULAA 1PUIA 1YASA 4KIJA 4LCEA 2G70A 1VGVA 1W4LA 1T2VA 3BXPA 2NYAA 4C4XA 3QWBA 3LUKA 3P0FA 1E69A 4WK4B 1SVUA 1IOZA 5DGXA 1OXTA 2G40A 3DE0X 4B44A 4R81A 4K9PA 4BNWA 2VJDA 1C2TA 1ZJWA 1RE0A 1TYEB 5DEOA 1TAGA 2SKDA 2TS1A 4QICA 5ALLA 5B3KA 1KBQA 3F4LA 3VPAA 3BK2A 4R7GA 2GD1O 1LDBA 2ID8A 4MAMA 3REQB 3K2BA 4DQXA 2OZLB 3QLUA 1AQUA 5BWCA 3VZSA 4NE7A 5KI6A 1Q1EA 5AM5A 4JB3A 1BJTA 1M7BA 2UYGA 4LGMA 4LX8A 3ZBUA 3ZWXA 3AZOA 3KAKA 2QGFA 2XA9A 3VM6A 1JFRA 1FFHA 2WTAA 1M6HA 3BL5A 1MZPA 2H7YA 4G1VA 1TCUA 4KXYA 3EVAA 1QS0A 4EHNA 1N3LA 3PGXA 4CLRB 3W7VA 4ZVMA 1E1YA 1RJ9B 1DIRA 3D3WB 3KB6A 4G5HA 5AK5A 5EZ5A 3T4PA 3UMGA 5JADA 5DLQC 1UT6A 1XTKA 3G68A 4RHYA 2P40A 2FEKA 5I01A 5FFFA 1MC1A 4IIEA 4P7KA 2YTZA 3CX6A 2OQIA 1DX9A 3AFMA 3DKKA 3MB5A 4UQPA 3WDSA 3VDRA 1QZZA 4HLNA 4UAJA 2I2FA 1PV1A 2DM6A 4D8YA 2I6TA 4M4SA 3ZDQA 1G3QA 4ER7A 1SBIA 2P5UA 2O8NA 3ZWPA 2FPPA 4BNIA 1AKTA 2QYOA 4BAGA 1VSUA 4LKRA 5ES4B 3GNQA 3L1UA 4KVAA 5T6MA 3DL2A 3T9FA 4LXQA 5TGTA 4MI6A 2N1MA 4NZNA 2JJ2A 3ZU5A 1S2OA 4AY5A 2GKGA 5JNUA 1O0SA 3Q7SA 1UF9A 1E1DA 1EA5A 2WIJA 3PFBA 3H4MA 1OGYA 2NYRA 4UMVA 3FFAA 4H4CA 4X3CA 4JYAB 4V0QA 1DB3A 4R4JA 5E1BA 1UPUA 1N1GA 4UXJA 1P4AA 4ZOQI 3BB1A 5GINE 4X94A 4J9VA 2X6RA 3MEQA 1QJCA 1JAYA 2KHZA 3C4QA 4LXTA 4X84A 1IBLB 5GADl 4JBHA 4H6VA 1MQSA 3K0SA 4A2QA 4DDWA 1JQEA 1OWLA 1IWOA 2FN4A 3KQPA 4H6WA 5EZQA 1Z5OA 4QGFA 1VHLA 1MIHA 2IXGA 4G0YA 3L82B 4AKSA 3MT7A 2ECKA 2D1TA 3VZCA 1HLGA 3VR4D 1C9NA 2YXEA 4FKMA 5DX8A 4F92B 3QSYA 4CPDA 3KOYA 4O4LF 1LI4A 3WLKX 2QZ9A 3TDMA 3HBFA 5ESWA 4BV3A 2J3JA 4HRVA 5T4EA 3ZI0A 1BXGB 3ZZNA 1JLSA 1OWOA 6REQA 3R9KA 1ORIA 3H9CA 1J0BA 1FFBA 4ZYUA 1X80A 2JLBA 2QTBA 3F7OA 3BGOS 1QLWA 2HDWA 1RJFA 3K0FA 1EFKA 2R85A 4KQ6A 4ZK2A 3C1UA 1PR5A 1JJAA 5CNMA 2FA9A 1T6NA 2PGDA 3KX2A 2PO7A 2P9QA 2BRUC 3NATA 1WM1A 3Q7EA 5K01A 2PT5A 2CXUA 4MCAA 4R16A 1R8JA 5HIJA 4K9RA 3VO8A 3JASB 4Q3NA 3RS0A 1DADA 5LDDC 4QVIA 2XUFA 5AVKA 1XK7A 3NXSA 1MJHA 4BO4A 3R0VA 3E22B 2CDAA 2WIGA 3P9YA 1J6UA 2PNFA 3NTVA 4Q1AA 2W90A 1N1MA 1G59A 4IY1A 4B1FA 1OXSC 3LPDA 4BFSA 1EG7A 3FUXA 2GVNA 5GZ6A 3NDRA 2PPVA 5JZBA 4YJHB 3KDSE 3IDSA