5FWXB

Crystal structure of the ampa receptor glua2/a4 n-terminal domain heterodimer
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
377
structure length
375
Chain Sequence
FPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNAAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords GLUTAMATE RECEPTOR 2
publication title Structure and Organization of Heteromeric Ampa-Type Glutamate Receptors.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 126
structure length 375
sequence length 377
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fwxB02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fwxB01
1QNLA 1NXTA 2HPHA 2PUGA 3FGZA 3G85A 2FMIA 2WJAA 1U8TA 3HDGA 5T3YA 3M9WA 1D2AA 3QLUA 3LUGA 1FFGA 2MYUA 2FN9A 1PNRA 4MQFA 2AYXA 1QPZA 1JYFA 3GT7A 4NQRA 4E7PA 4RY0A 2JVKA 3EDCA 1NXXA 5DKFA 3RVRA 4RV5A 3K4HA 4KRFA 1W9HA 4RS3A 3H1FA 2M1ZA 3HUUA 2YHBA 3IDOA 3MYYA 3N0RA 4IGAA 4ETNA 1VPWA 3JTEA 5TQ0A 4OLAA 4TMYA 5FBKA 5F64A 4RXMA 2PUAA 3H5TA 4MS3A 1EWKA 3F6CA 3KG2A 2FXIA 9ABPA 1TVMA 3HV2A 3JVIA 1NY5A 3HEBA 2KYRA 4KMRA 3DBIA 3CG0A 3ILYA 1NXWA 3FDFA 4IRXA 3A0UA 4JP1A 5CNMA 3LOPA 3BRSA 4QPJC 4W5OA 1RNLA 2RGYA 4WXEA 2A9RA 3H6HA 3H5WA 4PE5B 4YRZA 1TJYA 2PAFA 3MMNA 4JB0A 4W5RA 1OXBB 1F4VA 1SXIA 1BA2A 3NNNA 5EWJB 2WY2D 1URPA 3C97A 3TO5A 1K68A 4L4UA 5KC8A 2NUBA 4PICA 4MLDA 5IULC 1D1PA 3GA5A 4JA2A 1YS6A 1ZY2A 2P4UA 3CFYA 1WETA 1GCAA 3OO1A 1DC8A 3JVDA 4LE1A 1FQWA 3KCNA 2E4YA 3S99A 2FMFA 1EWVA 3T8YA 4KZKA 2IPMA 1USIA 5JNWA 3LUAA 3H5IA 1TMYA 2FQWA 2ID7A 1ZITA 1GLGA 1DC7A 5I4CA 4O5AA 1JYEA 1YMVA 1SXHA 3C6QA 3QEMA 4HYEA 1W25A 4JB2A 2HQOA 1CEYA 5JNSA 4H3HB 3N6VA 2VUHB 2MSLA 3GBVA 2RJOA 2PJUA 3OQNA 3DZDA 3H5LA 3Q7SA 4UHJA 2RDMA 5FBHA 2L18A 5TQJA 3LMKA 4ZPJA 4YV7A 1P6UA 3T6KA 5JNTA 1FSPA 2OQRA 3QEKA 1DBQA 1E6MA 4KQ9A 4OBBA 1D1QA 1EHCA 3EQZA 3LKVA 4P98A 3RVPA 3A0RB 3O74A 3LFTA 3EGCA 2HQBA 5BRJA 2FLKA 4EVSA 1Z26A 3IP5A 5JS2A 3FMVA 1KRWA 4RWEA 1A0OA 3ILHA 3MIZA 1LK0A 4ZMSA 5KC9A 2IKSA 2N9UA 1KGSA 4XASA 1YK0A 2QW1A 5JNUA 3HCWA 2WRZA 4PYRA 4G0QA 3H1GA 2FTKE 5D2CA 5ED4A 3EQ2A 4MR9B 5FWXA 4DADA 3KYIB 4W5NA 1QP4A 4YLEA 2H0AA 1FFSA 5EWMB 3TB6A 2RJNA 4MRMA 1YTUA 1QMPA 3QELA 4YO7A 4KVFA 5DCLA 4WT7A 3SY8A 2QXYA 4N0QA 3TD9A 4RKRA 2JB9A 4RZSA 3KKEA 3N53A 1GCGA 1QQAA 4CBVA 2E4XA 4PEVA 5DLEA 3HM9A 4DN6A 5IUNC 2YHAA 2PUCA 1L5ZA 3EAFA 4KPYA 1QO0D 4Q7EA 2GI4A 2FW0A 1DBWA 1LJUA 1R8JA 3LUJA 1U2QA 2R47A 4G0MA 4MPTA 3QK7A 1AB6A 3LTEA 1RXIA 7ABPA 2FMKA 3NHMA 4KK3A 2LP4Y 2B4AA 3SG0A 4NICA 4F8JA 4G97A 4ZMRA 4RXUA 2QSJA 4OATA 2X7XA 2CD7A 4KQCA 3R0JA 4ETIA 2JBAA 4WXMA 1JLKA 4ML3A 2R48A 2E4VA 3HS3A 2VUIB 4MAAA 1USKA 2L17A 3OLXA 4XXHA 2Q5CA 1BAPA 1IIBA 4Q6BA 5IBQA 4WUTA 3LUDA 4M88A 3M9XA 2QV0A 3N8IA 2PUEA 4ZYLA 1M2EA 3DLBA 1PHRA 4Z4FA 6ABPA 4N0PA 4IMIB 3C3KA 4MR8B 1D5WA 3RVMA 2PUBA 3RH0A 2MYPA 3SAJA 2NT3A 3FFWA 5IUKC 1LBIA 3D8UA 1YIOA 3HSYA 4G86A 2PUFA 4IILA 4JASB 3Q41A 5TPWB 1I3CA 1MAVA 3P9YA 1JL3A 2JRLA 4MS4A 3O1JC 1B00A 4F11A 2JCGA 5HKOA 2TMYA 3MQ4A 2IYNA 3VNAA 4S05A 4N47A 3RVLA 5EWLA 4EUKA 1QO0A 3O2QB 4KV7A 3RVOA 4RK6A 1K66A 2GWRA 2WMYA 3TX6A 1C0EA 5TQ2A 2MSWA 5KI6A 5KWSA 3EJWA 4MQEB 1GUDA 3DGFC 1Z2DA 1PEAA 4RY8A 2PUDA 2BGGA 4G0PA 1NXPA 1JDNA 5FWYA 2H3HA 5CHYA 1MB0A 2GX6A 4PZ0A 5JNRA 4MS1B 3JY6A 2JVJA 5KQPA 1BDHA 1TLFA 4FB4A 4MGEA 3F7NA 2QZJA 2R25B 2FQXA 4RK0A 2W42A 4IMJB 3IP6A 4LRQA 3QLVC 2FEWB 5TE9A 2ZWMA 3KJXA 4YP9A 2PMCA 1ISRA 1Z25A 3O2SB 1ABEA 1NTRA 2FEKA 3TMYA 4E7OA 2B1JA 1A04A 1SXGA 2QVCA 3A10A 3EODA 2A9PA 3QLUC 4XFKA 4WWHA 4TLMB 1RZRD 2IOYA 4W5TA 4NCBA 4IF4A 1FFWA 4EYOA 2F8TA 1MIHA 1CYEA 4ZJPA 3LUHA 2GKGA 4RDCA 4EY3A 1PUXA 3JPWA 2FVYA 2I6FA 1ISSA 2ID9A 5B3JA 4D6XA 1KRXA 4MR7B 3ROTA 1ZDMA 4UHKA 3BREA 1M5UA 3QELB 3IP7A 1P6QA 1YVUA 1JFVA 3N75A 4RK7A 2HQRA 5ABPA 1KMIY 1QP0A 3H6GA 3JS5A 4QICA 3OMXA 3HK2A 3GYBA 2F8SA 1L5YA 2FN8A 3DGEC 3H75A 3LUFA 4G0XA 2FSPA 3Q9SA 1JFSA 3HUTA 5HQJA 2AYZA 5E3JA 2J48A 2FQYA 1DCKA 3NBMA 4LE0A 4LE2A 3RVNA 4EYKA 5JNVA 4L85A 4TLLB 1VKRA 3KSMA 1E6LA 2PL9A 1NATA 1U2PA 3SNKA 3RVQA 1ZVVA 4D74A 2LUOA 1M2FA 4YS6A 5BRAA 1SRRA 4FE4A 4YWHA 3IP9A 2JBAB 3JPYA 1T34A 3QX8A 3I42A 1XHEA 2WB4A 1E2BA 5KQLA 3BILA 2VYCA 4Z9BA 3CTPA 4MQFB 4QYMA 1E6KA 1RZRA 4HNSA 1UDRA 5TPZD 2V0NA 4RKQA 3H5VA 4DQDA 1RPJA 4OTZA 3RVSA 1J56A 3B2NA 3LUKA 4RU1A 2PKXA 3L6UA 3HZHA 3EULA 5GOTA 5TQ0B 5GQSA 3GV0A 3KTOA 2FMHA 5KQMA 2E4UA 2FLWA 3CNBA 2QVGA 1SD5A 6CHYA 5HM6A 4MS3B 3UK0A 2NT4A 3NNSA 1Z16A 3Q7RA 4HNQA 1DJMA 1ZH4A 1OXKB 4GNRA 4KFCA 1ABFA 3LUCA 4W5QA 2FEPA 2JVIA 1ZAYA 2DRIA 3UUGA 4XAQA 1EFAA 1JX6A 3E61A 5JS1A 4OG2A 4HNRA 5BR1A 3KYJB 4Q6WA 3SM9A 1YS7A 1AB5A 4KK4A 2E4WA 3MA0A 3BBLA 2OENG 5DGCA 5IX8A 3HDVA 5C5EA 3O21A 4MR9A 3OQOA 2A9QA 3QLVA 3Q15C 3O2JA 3IPCA 3M6MD 5EWMA 1JHZA 3RQIA 4EGSA 5BQ3A 2MSKA 3MF4A 1DRKA 2MYTA 3CS3A 5CNIA 2CHFA 5IEBA 5TPZA 1D4ZA 4O1HA 1NXOA 1RXEA 1JWLA 1PEYA 2LPMA 1CHNA 1Z13A 3A3KA 4MLCA 2A9OA 1JF8A 1ZESA 1Y1LA 3QEMB 3F73A 5DTEA 4B09A 3IPAA 4Z4GA 3E3MA 4LDZA 1TM2A 1XHFA 5T7BA 2E4ZA 5KQGA 4Z4HA 3CLKA 3UKJA 1C4WA 3HO1A 1EAYA 3VNBA 1DBPA 3RVJA 3Q7TA 4EVQA 2GBPA 3O75A 4H60A 1APBA 4JAVC 3NHZA 3L49A 1H9CA 3FFTA 3OLZA 3CZ5A 3I45A 1PNTA 5CNKA 3O1IC 3CHYA 2LBPA 4FE7A 4QYWA 4XARA 3KS9A 4XLTA 4N41A 3RVKA 3CRNA 4Z0NA 1F51E 1QKKA 3H5OA 1BDIA 3CZCA 3N0XA 2LIVA 2WJWA 4Z9AA 3I09A 1M5TA 2QU7A 4G0OA 3C3WA 2PLNA 3GBPA 4G0ZA 3OLVA 1Z15A 3KLNA 4EYQA 2MYNA 1DCMA 4YR7A 5FWXB 1Z17A 3MM4A 2WWVD 4MR8A 2O20A 3OLYA 3I5AA 4MRMB 4EYGA 3GL9A 4YCSA 2PE5A 1JBEA 1MB3A 5TPWA 1HEYA 3OLWA 5IEJA 5CNJA 1DP4A 5C5CA 1BDJA 1BVHA 1ZN2A 3O1HB 4NCAA 3LKBA 4EVRA 4RXTA 1JH9A 4RK4A 4RSMA 1ZGGA 4Z4EA 1EWTA 3H1EA 3N0WA 4F06A 1A2OA 4OLBA 8ABPA 4N76A 1VLZA 1ZH2A 4MQEA 5EWJA 3C3MA 1Z18A 1QQBA 1NXVA 3OM1A 3G1WA 1JFTA 4D6YA 1LBHA 1XWWA 4MS1A 1JDPA 2IPAB 1Z2EA 1VRVA 4NV3A 1S8NA 2HSGA 2L19A 3KHTA 3HXMA 1DG9A 3OO0A 4ETMA 2IPNA 3F6PA 2JK1A 4KREA 2R4QA 3URMA 4N03A 1GUBA 4LX8A 1NXSA 2CHEA 3T38A 3ROFA 4O1IA 2HJ9A 1YK1A 2IPLA 1DRJA 1YMUA 2ZAYA 1DZ3A 4MYRA 4F12A 3OM0A 3NNDA 2NZVG 1MVOA 3FFXA 4LZLA 3T95A 4F3TA 2CWDA 4YGXB 3D02A 5PNTA 4H3KB 3QX9A 1Z12A 3GRCA 5B3JC 3KLOA 5IC5A 3GWGA 4MR7A 1P8AA 1QP7A 1ZGZA 2P9HA 4KNYA 2IDMA 3DLHA 4MS4B 2VK2A 2L2QA 4RY9A 4Z99A 4S04A 4G0YA 3HVRA 3CKMA 4Y9TA 4Z4CA 5IUJC 5EWLB 4LDAA 4P1ZA 2NZUG 2FKAA 4Z4IA 3BRQA 5TQ2B 4RK5A 1LJLA 4JOQA 2QR3A 4RK1A 2PL1A 1ZHHA 5FWYB 5HSGA 1U0SY 1USGA 1P2FA 3SQNA 3OQMA 3HJFA 3K9CA 4GPAA 2XDYA 3CG4A 3QLTA 1U04A 2M98A 4WZZA 3W9SA 4TN5A 3CU5A 3OMWA 1DCFA
chains in the Genus database with same CATH superfamily
2VWQA 1YKFA 3NALA 1GNVA 2MCFA 4X91A 1C9MA 3QFTA 2RFLA 1L7XA 5FPYA 3VHXB 3S2GA 3PDIB 4NU0A 4WASA 3LUGA 4ZEVA 2FPRA 3CJRA 1DFHA 4WY5A 1QPZA 4LJ8A 2H3EA 3NDPA 1ORTA 3K72B 1Z82A 1P1FA 2JJ1D 5AKEA 4C4YA 3U1BA 1D2RA 2QUAA 1WSDA 2H1RA 2P2YA 2HXYA 4FCTA 2EQ5A 4YIKA 1K92A 1N2GA 3X1YA 2VDNB 4E3ZA 2PBZA 2ZRPA 5TMDA 5JBNA 4TMYA 2XW6A 2X14A 2Q41A 1OAKA 2I7DA 2KLBA 4FJ2A 3KQLA 1FTNA 1I24A 1RPNA 4HQ6A 1WCIA 4MGKR 2QP4A 1C0KA 1EFCA 2IHNA 1LFAA 1UAAA 3L06A 1UM8A 5BQXA 2KYRA 3IJ5A 2HT6A 2IY8A 4OXRA 2XIJA 4EA9A 4QDKA 4X93A 2QVBA 4EATA 1KSFX 1Q15A 3NTVA 3DMTA 2P4HX 3SC2B 1Q0ZA 2RGYA 4U3JB 1T5TA 2RHBA 3H5WA 3USES 4BX9A 3CSUA 3WA6A 5C5IA 5C4MA 3UAZA 3PQDA 1M1ZA 4JL8A 2A0FA 1HNZB 2P65A 4G07A 4W8OA 3WO0A 1C7FA 1NLFA 1U98A 3BH7A 2QZSA 5JWRA 2C7RA 1REQA 4YJ2B 3MT0A 3V32A 5ARBA 5CBKA 4AJ1A 5IC4A 4QRHA 4X95A 2NSLA 1GSOA 2NIPA 2C5GA 3VYWA 2P4UA 1HFWA 3QMMA 1KJJA 1FS6A 4D9HA 1XO1A 3HDYA 4URFA 3JQAA 5H9WA 1JQLB 4KPUB 2BEUB 5DCYA 4JBIA 4B85A 1CHDA 1OLXA 5EN4A 3FCSB 5JSZA 4ZHQA 2YMQA 4D42A 5CW2A 1QF6A 1XD2A 4XIJA 1V9CA 3W5IA 4EL0A 5I9NA 5TQVA 3AVYA 1DC7A 3EPKA 2QL7A 3PXGA 4JEHA 1JYEA 1YMVA 2O8NA 4HYEA 3H5NA 1W25A 3DWEX 3E9CA 2I3DA 2KW5A 3ITEA 4PZYA 4Q7LA 4FE3A 5B2ZA 4R9VA 5DM70 2VUUA 5H3CA 3G02A 2H4XA 4OGWA 2JAHA 4HZIA 3QEAZ 2P9JA 4UHJA 2VDOB 3C5WP 1KAGA 5LDHA 2FF5A 1C9JA 1CIVA 2CLLB 5T4HA 3O8DA 4AYWA 5KYYA 4GMKA 3KEQA 1CJVC 4A91A 1Q0PA 5D01A 3TW6A 4MAFA 1TXGA 2ZZNA 1WAMA 4GG1A 4RKYA 4GOND 3WYGA 4Q3AA 3WNZA 5BSHA 4KR2A 1L5LA 3KPYA 2DUNA 3LLSA 3U4DA 3IERA 4NFSA 1SC4A 4ON9A 1P3JA 3EGCA 3M6XA 3ETCA 1QYCA 3PXDA 3DZBA 1R74A 1MZVA 1IOVA 1DOHA 1Z8FA 3B9RA 3DVAA 4PHGA 4YJDA 4GOOD 3WGLA 1XK7A 1LK0A 3HBFA 2O6LA 2PBLA 4WINA 1NZFA 3ZWYA 5JZOA 2PXHA 3JXEA 4PYRA 5AUNB 3AW8A 2WJGA 1HYQA 5SY6A 3MXTA 4RPIA 1FPMA 2FZEA 3TNJA 1G8KA 4MVCA 5EJEA 3Q98A 3FD8A 1NDUA 2M1XA 3WP1B 4BMDA 4XWKA 4YLEA 1QHIA 1LJ8A 5FA5A 1GKLA 2IF0A 1QWSA 3A6FA 4QOSA 2F90A 2VHCA 3I9LA 1FPQA 5DLDA 1HFJA 4ZVTA 1IYZA 4P38A 4EWLA 2ZPTX 4AUKA 1VHDA 4FZRA 3EXEB 1CZLA 3IAHA 3NAGA 3H2JA 1IN8A 1HT1E 2FF7A 4N7RA 4GPBA 4EJFA 3PNLA 3BIFA 1FP6A 4E15A 1BC5A 5CLLA 2NMVA 2FXVA 3AY0A 3K9QO 3ZHRA 5JCOC 1JEQB 3A26A 4YACA 3H11A 5FA6A 1AB6A 4HDSA 4NEGA 1JFRA 3VR3A 3FOFC 3O3OB 1W46A 2IVZA 821PA 3D6NB 4NICA 2IS1A 3D59A 2R1TA 1YJ5A 3B2EA 4P7JA 5ADHA 2PXXA 1QR2A 1IQRA 1G2OA 4PNHA 4PQFA 5TGTA 3S29A 3H2BA 3AI3A 1Z8NA 3ZKWA 4WBNA 2Q0HA 1TCVA 4MAAA 1KK3A 3M4XA 1O0SA 1T9GR 4JELA 2PKWA 3W7BA 1M8GA 3JQ9A 1Y4SA 1PJQA 3JZIA 1KR2A 1V43A 4G23A 1MX5A 5FQNA 4DJDC 3F7MA 5DNDA 3X1ZA 3E53A 3F78A 5B3LA 5J4VA 3L6OO 2XE6A 3FVQA 1ONNA 2DSTA 1J2RA 4NYMR 2NT3A 4C0QC 2O59A 2XGOA 3FFWA 4YMLA 3LL7A 3TUZC 3HSYA 4E5MA 1M1NA 4EGQA 1ADBA 1FLDA 4KPFC 1E3JA 1HOXA 5E2BA 3SEFA 1IEVA 1KFJB 3OCZA 2PWPA 2W4QA 3M0EA 5F7OA 2RONA 3B7PA 1HDYA 1L3BA 3CEPB 1LDMA 4E46A 4ZDJA 1O0BA 1H0HA 1JLLA 1Y9ZA 4MIYA 5CM8B 1JHRA 1OBVA 1HRKA 2XNKA 1DNPA 4MIOA 4AF8A 4H4EA 3DD1A 2JGMA 4QODA 4UM9B 1R9NA 1NXPA 3P4XA 3MSCA 1XEWX 5CHYA 4IINA 5CTAA 5GJCA 1H6CA 4BV9A 1Q74A 5LA6A 1Z56C 3M4ZA 4CKBB 4E6PA 5BVHB 1QHEA 3RAPR 1UMBA 3TE6A 4MGEA 3QU9A 1I7DA 2FQXA 2AW5A 4W8GA 3J80A 2F62A 4EUNA 1EZZA 3H2HA 2ORED 1XF1A 5A0FA 4N9QA 1L1EA 1EM8A 4YRAA 4Q9JA 1Y34E 4X7BA 2OB1A 1S4MA 4WWHA 1TJ4A 2VSQA 3L1IA 2JLXA 1KK0A 2XRMA 3IO5A 4E09A 1DCTA 1IJFA 3VTFA 1ILEA 2GK6A 4LTNA 4ZZ1A 4M6WA 4JENA 3W3ZB 1MIHA 1UEXC 4D5EA 5AVXA 4KH1A 1HYHA 3BAFA 3LPDA 3MPUA 2ZQYA 3J7TA 2AI2A 1JR3E 2GBIA 5AM4A 1V25A 2W6NA 1G1AA 3PGA1 3UMGA 1IFXA 2Y6VA 1F2UB 2LKCA 4LJKA 2Q1TA 3WQSB 1T5HX 1U0RA 2AQ8A 2EQAA 2X8LA 1QJCA 3QELB 4DLUA 3N75A 4J6FA 1W44A 4WXPA 4JLUA 1T26A 5FRDA 3TNDA 2V5AA 3GYBA 4DMMA 3UMCA 5AW7A 1X13A 1C0IA 5FJIA 5FPKA 1MRNA 4I50F 4IY1A 5K6AC 4NBUA 2VDKB 1NUSA 3B1FA 1MPTA 5CAEA 4BX0A 2W93A 1GZ6A 2X8WA 2CWWA 4I36A 4BAGA 1ARZA 1XMVA 1IBLB 3RVNA 3SCZA 4JN6B 1DV2A 1NW8A 2JAPA 2W6CX 3UYKA 4P5EA 4QU8A 4E2WA 5J1SB 4PTYA 3VU8A 1XEXB 3HYCA 3JAWB 5HZMA 3KSMA 1XKLA 2GN1A 4GMFA 1CZRA 2GUGA 3SXUA 3AFOA 3OX1A 3PPWA 1N3LA 1ZCFA 3WLRA 2Y9MB 4H7EA 5J2TF 4E5DA 1LW7A 1JPUA 4NAVA 3BMNA 3DBVO 3TXYA 3QXSA 2PS1A 2QZ9A 5COAA 4HBZA 4Z9BA 5K8LA 3G6KA 5EY5B 1YC2A 2JFOA 5C2JB 2IHZA 2O7RA 2V0NA 2Q6IA 3KFXA 1NUAA 5CB4A 1RPJA 3DO6A 3KXDA 5EE3A 1QQ6A 1JSCA 1Z68A 3IS3A 5IBRA 4V0KA 3M1IA 5FO0A 2POCA 5KX5A 5LVAA 5LD2C 3QOFA 1BO6A 3NYWA 2GNOA 2SNIE 2Z5GA 1YU6A 1WL8A 3ZV3A 1DQRA 5KYXA 13PKA 1QYDA 5KQMA 1YS1X 2JJ8A 3CB2A 3SC2A 1VOTA 4I9FA 4EDFA 2JGDA 2YHIA 3F6YA 3NORA 2O8VA 1Q14A 2K87A 1JILA 2W9XA 4GMDA 5LLSA 2PDAA 3UK0A 1TVCA 4DV0B 1GYRA 4Z9YA 1PG2A 5DBIA 3P9QA 5JRZA 2AFIA 1YULA 2I2CA 2VJMA 1EGHA 1SKAA 3IR5A 4W5QA 2Z5VA 3DC2A 3JD1A 1WMEA 1WUJS 1XSEA 5FLKA 4D9MA 4JMLA 3FZNA 2GN4A 2O0JA 3WQRA 1TIBA 3G89A 2IW1A 1KARA 2VAPA 2JFPA 2ZRJA 3REFA 4B84A 1QG0A 5JYDA 2OGTA 3KTAB 1A72A 1DG1G 3P9XA 4H31A 4NV0A 2PGDA 1E63A 5JATA 5LLDA 4GOKA 1Q0LA 2YN0A 4U8GA 3BL6A 1YDWA 2B8TA 2UYGA 3IAM6 4YWJA 3C5CA 1I4LD 4KG7A 3VOSA 1TTTA 5FL7D 1BX0A 2AYYA 3MWDB 5EE1A 3F4KA 3DWGA 3R5JA 1RM5A 4LY0A 5KTKA 1FDOA 5G41A 5EMMA 1AG9A 3B13B 4D9JA 1XQXA 4RFSA 5EWMA 4TKUB 2CHVA 3MGKA 1D4OA 4LRUA 2EZ4A 4M7RA 4X1IB 1LC0A 2HUPA 2ZTVA 1WB6A 1C1HA 4K8OA 2YUTA 3T4XA 5HKAA 1MIOA 3KQUA 3FTFA 2E18A 5JNSA 2WD7B 3FOZA 1LS6A 3PJRA 2DB3A 1I2BA 3E3MA 3UTCA 4RH1A 1Z07A 4EBBA 2Q6OA 4IVNA 3UEOA 5BW5A 1XCPA 3T7SA 5K0JA 5KVSA 4UBJA 2B5OA 5BYBA 1RQNA 4PTLA 3ZEAA 2ODNA 2X9VA 3UJ9A 4DCOA 1DBPA 1Z4QA 1U8CB 1YA4A 2CCGA 3O75A 3FVVA 4AXBA 3DOEA 3HB0A 4N5NA 2GCIA 3PGLA 1AS2A 3L49A 4B7UA 5C18A 5KWEA 2C8KA 4OJKA 1ND5A 4K8RB 4TKLA 2NZYA 4R5MA 5LBIA 4D98A 3PC6A 3UGTA 2B4KA 2KLHA 4XTRA 4P08A 2AUNA 5GV7A 3MSXA 2BM8A 5KOHA 3Q2KA 4CLHA 1B2RA 2GPJA 1JT2A 1JTEA 1SOAA 2IU4A 2QYOA 3HBLA 3ET4A 4MUJA 2C5BA 2J4FA 1JDBC 4JC5A 4MI3A 1ZXLA 7REQB 4FJ1A 3D5QA 1M8JA 2QT1A 3KUXA 1NYLA 1XDGA 3M6UA 5KYUA 3WGKA 3E23A 3H3XA 4KXQA 4L2IB 2XB9A 3UG6A 2IYUA 3D6UA 2I4NA 3PICA 1PGQA 5AOVA 2EFDB 4KE9A 4KJXA 2V6MA 1BWQA 1RBMA 2BUCA 3LL4A 3ZQJA 3TXXA 3F3KA 1ZEMA 2Y1EA 4RQAA 4DB4A 1J5PA 1ZD2P 2C5SA 1BXZA 2G1JA 5TPWA 2DSNA 1F8FA 3NWJA 4Z6KA 1CR6A 3WRYA 4ZC8A 1AS0A 3MJFA 2LCQA 4C5AA 3GAAA 9MHTA 2VTEA 3B3FA 4NNJA 4BO3A 1F0NA 1Q16A 1GZ3A 1KMNA 3OOWA 2GLXA 1EYZA 1FYXA 4OH7A 4QGHA 2GBLC 4XFDA 4ZVUA 4EF6A 4ZI5A 1ZGGA 5IDWA 2XQFA 2ZS9A 2R2AA 3DDWA 1C9EA 1PJ8A 3U6KA 4NZZA 4PQRA 3A6GA 2F1KA 4AJHA 2QTNA 4LXTA 3P9NA 4C07A 4DEVA 4P2GA 4FMBB 2BVNA 5HMMA 3L5KA 1TPYA 1Y80A 1YNSA 3MJRA 5AOBA 4M22A 3AVTA 4XVUA 4QTTB 3PEUA 3EA0A 3QPAA 1FFCA 2TYSB 3MEQA 4LMAA 4E2ZA 3DUFA 3PCXA 2XCQA 1NZJA 1DG9A 2ZIVB 2ZWAA 3ZXYA 2VRCD 4BVGA 1BGVA 2GCEA 5K2OA 3KHKA 1ANKA 4BXOA 4IJWA 5BV2P 3EDOA 3AC0A 3TZKA 5EJ6A 1F2DA 3C45A 4KSBA 1FRNA 3IR6A 4UEOA 1WF6A 3ZR4B 1G5FA 5ESWA 3DLIA 2AEFA 4PY2A 3RAFC 1N36B 3UGJA 4ZJUA 3ZLJA 2A67A 1U9CA 4BUZA 2FOLA 1T1IA 1GQOA 3BZWA 1IZYA 4ENVA 1H0SA 4URWR 2FSHA 2PR2A 2QG6A 4A0SA 3EPLA 4G5OA 1VCMA 1GPNA 3VO1A 3K9HA 1J0EA 5AOAA 1Z4KA 4LW8A 1T6BY 4OJNA 2QN6A 3NBFA 3WVNA 3VC2A 1VSTA 3GWGA 3Q3GE 5JH7B 3FETA 2Q46A 3EISA 4A27A 1W47A 3THXB 4HGZA 3DZIA 3FPJA 3DKIA 2I71A 5GY7A 1CLUA 3KPWA 4LSMA 3MD0A 3E18A 1UBLS 2JDID 1IXKA 2FW6A 2WNSA 3NGMA 2XCSB 1P3Y1 4MUHA 1JAIA 3JD4A 5CVVA 3BT7A 2ZWOA 4HXEB 5DNYB 3TDKA 4WN9B 3D2CA 1ND6A 1VLLA 2H4JA 2D5BA 1LRKA 3DCNA 1BVRA 1E5TA 2QR3A 4UJ5A 1M8KA 4BKOA 1TEZA 2BM1A 1GNTA 3UKOA 3ZWWA 3M89A 5HTKA 2PHZA 3WGJA 1J8VA 4L0CA 3D0RA 4OY3A 3IKMB 3TZQA 1HKUA 2FRDA 4ICIA 3QVWA 3K1AB 3NR2A 3KUDA 5EESA 3CU5A 3OPVA 1K98A 3P52A 4F9EA 1TMGE 1I7NA 1T3LA 2H5EA 5FPQA 1W4RA 1YQWA 3A28A 2FPMA 2VYQA 4EUHA 4R6WA 4ZDIA 4F91B 1FZTA 1A8PA 2B20A 5SZHB 4PQEA 3EWNA 3EZ6A 1ZJWA 1WY5A 1BHSA 4CQMA 3IVRA 2EBHX 1IY0A 1CX9B 1AK1A 1YZGA 3RS7A 4IDDA 4XOUA 3UQYS 1JYFA 4POOA 2GNPA 4AY2A 1M73E 1X7DA 2QA5A 3EDCA 4RJ2A 1DQYA 4AZTA 2IOFK 4JP3A 1YACA 4WLFA 3HVHA 4PWYA 4G0VA 4YMHA 2OM6A 4OI1A 1EDEA 4BN0A 1VPWA 5LZ7A 4OLAA 2EF0A 4DIFA 1ZD8A 2J6CA 4RXMA 1CY7A 5BW8A 1A7AA 3WBKA 2ZUBA 1SOMA 2ZI5A 4RF5A 2P6RA 4MB6A 2C92A 1P9WA 1IN7A 5C8DA 4ISCA 4BGEA 2X9QA 1CUIA 3WBFA 3ZX5A 1O08A 2HO4A 3HFRA 1ECFA 2GVZC 1NXWA 1U80A 2B7CA 3VNVA 4XSVA 4IRXA 4PV7A 1Q20A 4DSAA 2NN3C 2QJFA 1GUFA 4RLSA 3CZRA 5K0EA 4MRAA 5F7JA 1FJHA 3UK7A 1E98A 1OXBB 2RHWA 1JG3A 4X3CA 3NNNA 3QMWA 1RPZA 2BC9A 2CFRA 1H05A 2NUBA 2ZGVA 4HR7A 4HEHA 4L4UA 3OJEA 2X13A 3HXOA 1I4OA 1M2VA 3MMXA 1YVRA 2W11A 2P9ZA 3B6JA 4IV8A 1NGSA 3D8RA 4BMXA 1BD3A 1H2HA 1QLJA 2WU0A 3R3VA 3NJRA 4YV0A 4J0QA 1ZD3A 4QPNA 2YIDA 4Z7QB 2HF2A 5KJCA 4URUR 2OP1A 1E2UA 3KCNA 4C4TA 2J0SA 2LDBA 3SICE 3L8EA 1FQKA 1XQ6A 3RBAA 4UM7A 3EEFA 1QV9A 4YB8A 3RT9A 2OQIA 3SFZA 4AUNA 4HNGA 2HT1A 1L7MA 1ZW6A 5ALJA 4CI0B 2HMAA 3MT9A 3K0EA 4AL4A 1GSIA 4BVAA 3LSYA 1TLTA 2DCMA 4JB2A 4AO6A 1QRAA 4ALMA 2XUIA 3AFIA 4GGOA 2QBYA 1JXOA 1V7QA 2O0LA 2OFOA 1YNOA 1G2IA 1TAGA 1NVAA 3R75A 4BNFA 1ECGA 5AJTA 5FBHA 3L8HA 5EXEA 16PKA 4ZPJA 4YV7A 5CH5A 2PX4A 3D6VA 4DXHA 1COZA 3IVXA 4BP8A 1B15A 1SVWA 3T1YB 2WYUA 2VNHA 2G76A 4X44A 4YPOA 3K32A 2QP9X 2ZB2A 2ZI6A 2IUSA 2QQ5A 3DTVB 3KEMA 3P20A 1U6IA 3DP7A 4UQOA 2PIDA 1Z0IA 3WZLA 3ZBTA 3FMVA 3R7BA 5DSZA 4BNHA 4D4MA 3ILHA 2JHCA 5DN6A 4NNOA 4EHLA 1P45A 3L3BA 4YREA 1AV6A 3TFQA 4I4TA 1OHHD 2FPIA 4CN9A 1YRAA 4RGQA 3VNSA 4U7DA 3TR5A 2XNCA 4TXHA 5FL3A 1CQIA 1WE2A 3OOSA 4RZQA 4XGKA 5DE3A 5DMXA 3TUIC 1GPKA 4EYSA 3UJNA 2BP7B 2YXPX 2HRBA 1YCDA 4U2FA 2IHKA 2I03A 3CF2A 3HGMA 3F97A 1VCNA 1V1RB 5L3SB 4IFTA 4XZ3A 3MCWA 1QMPA 2IXEA 1Y37A 1X77A 5B7GA 1B8UA 2PKYX 2QD2A 3LGSA 4A1OA 1FA9A 2Z6QA 1IZ9A 4I1PA 1A5AB 4RPLA 3VDQA 4RKRA 1HFEL 1ZJJA 3N53A 2F4VB 4RTOA 1S3FA 3FNEA 3V8PA 3G9QA 1XZEA 4ER5A 1UFKA 2BRUC 3DT8A 4L1KA 2PUCA 4MKZA 2QX4A 2AA3A 3DE6X 1N3BA 1TCBA 2ZAIA 4HGRA 1TFRA 2YNMA 4ZEOA 4WXYB 5E1DA 1W4CA 1VPEA 2PS9A 2V55B 1FFXB 3JSXA 3PXEA 3R77A 3RJMA 3SYKA 5K0TA 3PL1A 5L8VA 3LG2A 5BSFA 4WK6A 4M9UA 5F3RA 1ZQ9A 2R4TA 1FUYB 3SG0A 3AF6A 4PPFA 3NX4A 3ADCA 4RANA 3BF8A 1X86B 3VC1A 5JTUA 2Z98A 1ZM7A 1E1MA 3R09A 3OPYI 3QWAA 5CLHA 4EVIA 1RBQA 2Q5CA 4FZ5A 2M6LA 4GOMD 2QZZA 2J0QA 5CCXA 1PRYA 1U2DC 1WUYA 2DWPA 3M9XA 4CKWA 2O7VA 3HJRA 3HY6A 1B4DA 2I3GA 2XQVA 3ISVA 1P0QA 1W0KA 1RQPA 1IXYA 3JALA 5T3UA 3UOWA 5LOVF 4X7MA 4HEA6 2PBFA 3FDZB 3RH0A 5B7PA 2B83A 3RB8A 5BORA 2ZKIA 2ZW9A 3LAWA 2HSEA 1SU7A 3FYUA 4NENB 5CYOA 5HKLA 2V45A 2X5NA 2P77A 1Z5GA 4I8DA 1C9KA 4R8SA 2B1GA 3GR6A 1C7IA 4J0JA 5E7IA 3TBFA 3V8MA 5AVUA 2HDNB 4A8TA 1H65A 5HIAA 1E0JA 1D6JA 4JIGA 2XUPA 4RFLA 3MUOA 4XM2A 1X38A 1KJIA 4JCOA 3N7UA 4FYVA 4A8JA 2C00A 1FDRA 3TGLA 1KY2A 1R1DA 5THQA 3BHMA 1K3UB 4HY3A 2BELA 4FS3A 1WCXA 2YIVX 3UWPA 3QUSA 4PVCA 3EJWA 1IRIA 4MGYR 5BT8A 1Z2DA 3IQGX 5DYNA 3IB3A 2YXBA 4G0PA 1JB9A 1NKTA 4WIAA 3WBJA 4MW7A 4UCQA 4ZU1X 2NQ8A 1P1BA 5REQB 2VBFA 3ZD7A 5D84A 1IY8A 1YFKA 3ZBQA 5IW8A 4AS2A 3F6EX 4NIMA 1T1SA 4IIFA 1C1XA 5F12A 2GBFA 2K5UA 1T6ZA 3PDHA 4NCKA 1JKJA 1V1MB 3LX8A 4DKJA 1CRWG 4MRPA 3FFAA 2AMJA 3NC0C 5KTTA 1IZ8A 4BP1A 1ODKA 4PYOA 3VR5H 2ZYRA 2P6MA 2PK3A 2OM2A 3EMDA 4ND8A 2DERA 2DBZA 1U2ZA 1SZCA 2PMDA 3QVSA 5EZQA 1LPMA 2HWWA 2OD9A 4EPYA 2OP0A 4Z5XA 2A0KA 3DNMA 4DLZA 4DV4B 3ODPA 3K16A 3H8WA 2XITA 2PZKA 2WF9A 4TT3D 3U9TA 3VDNB 5KTOA 4KTVE 4MO9A 4GX2A 4MRSA 5AK6A 5EUQB 5KS2A 3AFNA 2M6KA 4R8LA 3IV9A 4CR6A 3KP1A 4H6PA 4D79A 1C9YA 4JLDA 4JQYA 4BV2A 5JSHA 4IXTA 4XIIA 1T0JB 1KAEA 2QPOA 3MWLA 1JR2A 1Y5LA 3Q7EA 2F55A 3JRNA 2PCLA 1QCYA 1XTQA 2DWCA 3ZGZA 1IHXA 1DCKA 1NC1A 1KDRA 4YCJA 3V1TC 1X1CA 1WXEA 3UHFA 5B1DA 3H0KA 1R50A 2HC9A 4D3XA 1U9JA 2WYIA 4BFUA 3D4PA 1VKRA 3VOBA 1JS1X 3VU9A 5DNUA 5IJZA 3OJFA 4P0PB 3PQ3A 1NATA 1DB3A 1XN1A 1ZVVA 4UUBA 3IDFA 3TECE 5AFSA 1R0SA 2B4YA 3BERA 4BB5A 3ABRB 2OILA 4O59O 1UM9A 1QU2A 1WKVA 2ZYGA 4RMGA 5JNLA 2X6RA 5HBGA 2FJUA 3RQSA 4QRDA 5JO0A 1SG0A 3OZ7A 5A3VA 1XRSB 3B2NA 5EMNA 3K0BA 3PXAA 1MEEA 4R05A 3OF5A 5JECA 3NIDB 1BHO1 1E2KA 3GJRA 4IFIA 2JLWA 3THWB 2P27A 1Z7BA 3DEZA 2FI1A 3HYTA 5KINB 2VDRB 4BNXA 2O2HA 1ZD1A 2WF7A 4IIXA 5BWCA 1UZLA 4MS3B 5FUYA 3UPTA 3Q7RA 5FV7A 4UD6A 4TUYB 1PDWA 1JECA 3I28A 1ABFA 2HFKA 4YCLA 2JVIA 2DP4E 2R6DA 3PC2A 3R3ZA 4CEJA 1NBAA 3NHRA 5BSEA 2DR2A 2WJ4A 1XQWA 3EW7A 4O2BB 4Q1AA 2YVQA 3BEDA 1J07A 1EDBA 1XL0A 3U0VA 2O2EA 4Q9KA 4IKOA 4X7RA 4Q6WA 2WSLA 5AVRA 5FIUA 3GH3A 1I3NA 3EWAA 1X2EA 3GAMA 3OCJA 3LC0A 1XF9A 2ONZA 2ROQA 2X8JB 4PPQA 1JR4A 5J2UB 3GVPA 4KKVA 3TKLA 2BGNA 1R0KA 2DY0A 5CEJA 1Y3AA 1X8XA 2ENWA 3ZQUA 2ZR0A 3S68A 2O23A 4PYKA 1NF9A 1CZKA 3O8OB 1NN0A 3RFXA 3UXEA 4YUXA 2CYCA 4R1SA 3OQOA 3ZWKA 3AJRA 3EVFA 3QLVA 1RMTA 2GPYA 2JIBA 3VI3B 4F2GA 4MGHA 4Q3DA 3RQIA 1QH0A 2FG7C 2H1CA 2OK7A 3KDPA 5C8XA 2MYTA 1JIKA 2GJ8A 3HUFA 4MV4A 3JQBA 2BE9A 3PE6A 2QYSA 4ZHQB 3S70A 2H31A 1Y3DE 1JF8A 1UZMA 1XBTA 1ZESA 2QTRA 5EFZA 3H19A 4J7CA 3ZHUA 4QRIA 3IPAA 4GXRA 4P31A 4YA6A 5K3EA 3D8BA 3VJMA 3DLAA 3KYDB 4Y7CA 4E3WA 5L51A 2DLCX 4R2KA 3MLAA 3SX4A 3VHRA 1Z35A 3R3SA 1G4HA 1V4NA 4FGWA 4CM8A 3N2ZB 1QZ3A 1DX9A 3EGOA 1EZ1A 2XCUA 4IQ8A 1E3TA 5DM0A 3IX7A 1C4WA 2P6PA 2IDZA 3W5UA 1EAYA 1SCUB 3M33A 2X22A 2R6AA 3DAPA 3IQWA 5K8TA 2EGGA 3NPMA 3P4YA 2NU8B 3E05A 5E4FA 3TYXA 2WWYA 3KWMA 5FNVF 3W2FA 1ORHA 2O3QA 3HP1A 4ZTBA 2VJLA 3HCDA 4M87A 4QYWA 4XYGA 4F3YA 4YT2A 3QXXA 3SE7A 4WMLA 4BMZA 3EYAA 2IXAA 3I30X 3I61A 3H2ZA 1XDBA 3RYHB 3VV3A 1HE5A 1NVKA 2FZCA 3ZWAA 3FR7A 2H1SA 3UMMA 1YA6A 4D26A 1PR6A 1N32B 3D7MA 2R6JA 3K9BA 1M5TA 4AROA 4ZRNA 1WXQA 2JLRA 2GFIA 3IUNA 4ROSA 3KLNA 1CD5A 4H15A 2BFNA 4C06A 5C7YA 1M2JA 3PBKA 4E1AA 4XJVA 1E62A 1PL6A 4EMUA 4CM1A 1HT0A 1O2DA 4KXWA 4MEAA 4J76A 1TD9A 5JO9A 3SSOA 3T1QA 4B80A 3OLYA 5C1PA 1US8A 6LDHA 3JYNA 3B70A 2VRNA 2FW1A 4LGVA 3GNQA 3V4FA 5BSKA 3FSGD 1U8AA 3GRRA 4PO8A 5AKIA 3E7XA 4B2YA 1VE3A 2A84A 2I87A 3GDFA 3GRZA 4EH1A 5IEJA 2YV3A 5I01A 3CRRA 4ZCPA 2FPGA 3JYOA 1BDJA 3SIPA 3I3SR 4AQDA 3G9XA 1RQLA 1E58A 3NIFB 4XJSA 4JYBA 3I5UA 2D5IA 1K4MA 2PM8A 4RXTA 5DNEA 3V2IA 4DTCA 2A9FA 2HMUA 2GZHA 1EWTA 2HRRA 4C89A 5J47A 2YDYA 1KNXA 1KVTA 4NARA 4HB0A 4A2QA 3NUZA 4BV3A 4UVDA 4D41A 4BVHA 1NMZA 3QITA 1HO3A 2WKWA 3W2HA 3A31A 1E2GA 1EXWA 3WIVA 1QQBA 1F17A 1X7XA 5BY2A 2EFCB 1E64A 2VQSA 5ICFA 1XWWA 1G291 1G8MA 1SR8A 2X2FA 4X24A 2OBBA 2AFRA 4F21A 3CVOA 3LRPA 2QRHA 4O25A 3TLGB 1Q95A 4B8YA 5DM60 3B1KA 1SCBA 3Q8MA 2ZITA 2D4HA 5D8DA 2DFTA 4OA8A 1PT7A 1NJ2A 1EG7A 3I5MA 4LCBA 3V1NA 2GYYA 3LXUX 2B35A 3T38A 3UV7A 5CDTA 3T5AA 2A7XA 3O3CA 4O1IA 4UTNA 3GHHA 4M54A 1RXUA 3RC7A 2SCUA 4MW0A 3UF0A 2ZT8A 2PTGA 3VSAA 2XTMA 2EZTA 5JCZA 5CT8A 4QZVA 5KQRA 3I6IA 4RKWA 3UT5A 4TXLA 4EJSB 2Y3IA 1XP8A 3GZNA 3CVYA 4GR4A 4OU4A 4PGMA 3UWSA 1KYXA 2FUNB 3QX9A 4PAQA 3V3TA 2H59A 5DXJA 3KLOA 3T3DA 2FE1A 4AXXA 3PE4A 1NI4A 4W6ZA 4E21A 1O0CA 1ACMA 1A5TA 1DFGA 1FUEA 1WXXA 1AZLA 3ED1A 3KJZA 2WV9A 2O5CA 1CR0A 3LCRA 3BFJA 2G17A 3ZWVA 3WGGA 4RTQA 1JJBA 3I01M 1IBSA 2NVOA 4P1ZA 1CS0A 4CG1A 4KWTA 5A4DA 3HBMA 4BNDA 2X76A 1U5BB 3SYMA 5DTIA 3BRQA 3RFTA 3CISA 4F86A 5KYNA 5LWHA 1TECE 1OYVA 4RK1A 2VA8A 4DAEA 4EB6A 2NWQA 1JGTA 2V6BA 2XDWA 1Q7EA 3DF7A 2UKDA 4RA9A 3WHKA 4FFMA 2ASEA 5HSGA 4IXNA 2R0QC 2O2CA 4M53A 3IBGA 1YF3A 1R7RA 1MA0A 1KR5A 2PPLA 3RSCA 1QLHA 4I55F 4HWTA 5FTWA 3I76A 5JMTA 1FMFA 4YCAA 1E69A 3HR4A 4DRZA 3H9JA 4V0MA 4NK5A 3V2HA 3HDGA 4PYIA 3TS1A 1D2AA 1RQGA 4MWDA 1FFGA 4XSGA 3KJEA 2MYUA 4CF4A 2FG6C 5E9QA 3IE0A 5DX0A 5HZGA 2FUKA 3GT7A 1SOUA 1G9SA 4WKPA 4HG2A 3UPUA 1KI3A 2EKPA 5GGYA 3SPXA 1OT5A 3BGOS 4K9KA 4G4GA 3EUEA 3MWEB 4G81A 4D9BA 3MYYA 5E7QA 5LUBA 2GXSA 5H4HA 1H4TA 3EDRA 4O4IB 2BFBB 1CY1A 2PT7A 1VKHA 2FDRA 3FUCA 3WX0A 3LD9A 2J32A 3RS2A 3E5NA 1WW3A 2OO3A 1P9LA 3KG2A 2BKUA 2XVMA 4Q18A 5FBWB 1T0UA 1S6YA 4K26A 4ZGWA 2PT9A 4O4LB 2WINI 1Z29A 1ZIYA 1CUFA 2V6JA 4Q66C 3IOEA 3CIOA 3IXQA 1PBTA 3PNVA 1U3DA 4G01B 2PRSA 4HK4A 4IIYA 4P4NA 2W6OA 4QPJC 4WXEA 4YDQA 3HTXA 1EM6A 3BJZA 3I2IA 2ZUDA 3BORA 1KKUA 1R15A 2JFWA 1P7YA 1XFAA 4RE5A 4CDGA 4HV4A 3KVOA 3EHEA 1QHHA 2DTXA 2JJQA 3L07A 1QRDA 2PL5A 3OZWA 5B57C 5HIIA 1AK9A 3GU3A 5K4AA 3KX2A 4CCAA 4D0GA 1ODLA 4LF9B 3LVQE 1PD0A 1KZ9A 1ORIA 1ZGBA 2XECA 4Y1FA 3AXSA 3H13A 4YI5A 1P2SA 1YB2A 1B0AA 4NP6A 3T35A 2XUQA 4PC3A 4UCWA 4I50B 4FOLA 1NSFA 4YDRA 5E3IA 1R0BA 3LECA 5KVVA 4FGKA 1BRMA 3DDSA 2WUDA 4BKMA 4YYZA 3AIOA 4QM6A 3BS4A 1FVFA 2O1EA 2FQWA 1ZNXA 3A9WA 2RG1A 3MJDA 1Q2UA 3HBAA 1W59A 1I0ZA 1QFZA 2C83A 1WABA 3DV2A 4RLFA 5IJXA 3I1JA 1RYNA 1IDN1 2BZ0A 4QAQA 3BJEA 3QFFA 1P2TA 4H7KA 4H3HB 3QIAA 4KQWA 1JXQA 5GAJA 1C1DB 1BEZA 1G8AA 1NJSA 1L8QA 1YVEI 1C8BA 1ZINA 2HMYB 4K40A 3QOXA 4P6VF 3GG9A 3MCUA 1JVSA 3MRVA 3DQZA 5DYGA 4ABYA 2BIFA 4YP6A 3K6SA 1FSPA 4CGYA 2IEZA 1JEAA 1Y9EA 3VR3D 1DUVG 4EKDA 1YRHA 3MYRA 1OFUX 3CGWA 4B5LA 3VV2A 4B4WA 2RJ3A 4P81A 4HNTA 4ITUA 1SNYA 3CUTA 3EASA 4U7TB 3V8QA 3B5IA 5BRJA 4V1CB 2D0PB 4LY6A 2ZJ1A 4PM4A 1IWBB 1X0XA 2HSWA 4J1NA 1VYVA 5CFQA 4AUEA 3CVUA 1YA8A 3RKUA 4N0MA 3U7IA 3BL8A 5KC9A 4D8WA 3DDNA 4FHDA 1IN4A 1ST2A 3EAGA 3QE3A 1C50A 4DEXA 2VEDA 2G7MC 3L18A 4MX8A 2Q9UA 3BMXA 3GLSA 3RUPA 2G07A 3C4QA 4BUCA 3R9KA 2OA0A 4ACAA 4MWOA 5FPSA 3U56A 1LLCA 5GPBA 4MYHA 3MCVA 2R66A 4RDXA 2DG2A 2DT8A 4MRMA 3WB9A 1N5JA 4LC0A 5GM1A 4AIRA 1ODJA 4CG0A 3LYHA 4FGUA 2QXYA 1PJ3A 2EKQA 1UMKA 4MV5A 4O2AA 4WHMA 1LBTA 2EJVA 1OY1A 1GGEA 1E5VA 2DZDA 1SUSA 3LWZA 4NZMA 4CKCB 5TS3A 4ZZIA 5CFZA 2Y1WA 4BQOA 2G9UA 2DR0A 4NX2A 1JKMA 5EZ6B 3M6FA 3A14A 4X1KB 4M8NE 1IUPA 1Z0SA 3PVZA 4HSEA 5AI5A 2FFJA 2GOYA 4NABA 1E61A 5AK5A 5G3YA 2FMUA 2JANA 2QTFA 1IQ0A 4TYQA 4U8HA 5BO5A 3JR3A 1N1MA 4QVIA 2CFOA 2R47A 1R8QA 2NPFA 3FGNA 3LTEA 4HVTA 4IKPA 2HFJA 4Y8VA 5DM2A 2XX3A 4D8UA 5J2TA 1K5DA 4CMBA 2Q4RA 1SIBE 3F6SA 1LDYA 1N2JA 1R0XA 1WTCA 2J67A 1D9XA 2R7MA 3BBPA 1RJFA 7GPBA 4YMTA 2KWIA 2DQKA 3ANYB 3EIOA 4OATA 5KPJA 5CT9A 3F4LA 2JBAA 2PWBA 4LXIA 4YRNA 3R0VA 2E4VA 4BN4A 4KBFA 3H5AA 3RS3A 4RY2A 3HKBB 5KSWB 4GVPA 1FXSA 2GEKA 4JLNA 1IWPB 1YQGA 1D4AA 1GKUB 3DOFA 3DL2A 4LZOA 4W5WA 3SDZA 5KEIA 2CCKA 3TQTA 3C3CA 1E9FA 1KVUA 4IH1A 1F1BA 2EHDA 3BE5A 4J4TA 1EK6A 5KOJB 4KYIB 3WRXC 1RFLA 1Y9AA 4FXOA 4LZJA 3LUBA 4TL7A 4F5YA 4KBYA 3L8FA 4AMYA 2DLNA 2P69A 2XYPA 4OU5A 4D0LB 2GZAA 4TWZA 1QRUA 3BGIA 2WF5A 1NU6A 2XUHA 3A1UA 1CPYA 3ZH9B 2JIPA 1NRIA 4DR3B 3A32A 4WCFB 5FX2A 3LUPA 2FK7A 3H5RA 1UBMS 4ZQIA 2PUTA 4M98A 3K71B 3BWCA 3AKEA 2JCGA 1W2HA 3ANXA 1K5GA 5DW0A 3W1VA 1T29A 4Z3KA 3EBLA 4CM7A 2W22A 2BMJA 4UATA 2OBMA 4UTZA 2X0FA 3CVJA 3TEJA 3ONWA 2B94A 4BUJA 4QHYA 2C96A 3EIFA 2VTBB 4MKIA 1C0EA 4EHDA 1XA4A 3GVCA 3QKRB 3DGFC 1E5XA 2Z08A 2W71A 3CE6A 4ANFA 2GF0A 3AMVA 1JG1A 2GX6A 3PP8A 3BRCA 3PQ6A 2ZUWA 1GEEA 2MSEB 4HNAB 2O8DA 1LVUA 3G3EA 1TLFA 1UKCA 3OD5A 4DDWA 3SIWA 3AQIA 1J1IA 4RCZA 3IXLA 3A2LA 2QQGA 2CEAA 2F1HA 1IRXA 4P34A 2J07A 4EFMA 1LKZA 3KJXA 4P7FA 1E4EA 1NOIA 1TJ3A 3G79A 2FEKA 3BQMB 1J2UA 3H18A 5G02A 2QVCA 4PXYA 1OLUA 4F85A 3G0OA 4MA0A 1KSGA 1E1YA 1MFZA 2YWXA 4ZCLA 5K6RA 3KQHA 2VPTA 1RJGA 2FR8A 2VSFA 3QTBA 1GPBA 3FM9A 1XHLA 4Y3UA 4CTJA 4QELA 4TVSA 4EY6A 4J43A 1TIKA 1KRHA 1WXHA 3S1AB 5HUHA 1Z5UA 4DV1B 2BEWA 2VDWA 3AUJB 1ISSA 3HO8A 2G1AA 1KRXA 4QUIA 1Z5VA 2SKEA 4NE2A 3BREA 1I2CA 2J30A 2ZU0C 3DV0A 5G1PA 3RI3A 4B48A 1P6QA 2N0SA 1GJRA 2F67A 2NZWA 3EUFA 3KKZA 4RSRA 4W4TA 2Y05A 3H6GA 2XDQA 1C9NA 4W82A 4UUPA 3WLLA 2QTCA 3HWSA 5EP3A 1H94A 1SELA 3A1EA 2HJWA 2HGZA 5JV5A 5A5VA 5CT6A 3NO4A 3ETLA 2IZ1A 3ELYA 3DMTC 3G2MA 3OEYA 2C82A 3TI9A 4ENUA 3G1TA 3Q6NA 3QHPA 3R7NA 4S1OA 4B3SB 3VKGA 1PO7A 4XD7A 5E2AA 3BHNA 1NX6A 5BWOA 4IJQA 2A86A 4LMRA 5K99A 3OTQA 3QVKA 3V80A 3QE2A 4MGZR 3WWPA 1HYBA 5A0TA 1Z75A 1PVVA 2ZJ0A 3R5KA 5B58T 2XGJA 4MVJH 3H9EO 4KQIA 4HD8A 1CUEA 4RDIA 3KK0A 3OU2A 4NSNA 3ZUGA 2FFQA 1D0SA 2JLYA 3AR8A 721PA 1FLAA 1N0IA 2CKDA 4X45A 3M3DA 2GZ2A 3C3JA 2AJBA 3VYVA 4DYDA 4O1MA 2UZAA 3QWFA 2G4VA 3TKAA 1NHGA 4TKVA 1NJ5A 4JDUA 3HA7A 2IRWA 4I9GA 5AO9A 5H16A 4OJYA 4WJZA 5C52B 4ZZ2A 4CF5A 4YJGB 1CR2A 3NGXA 2VQ3A 2K6GA 3LY8A 2I4OA 1VGRA 1L7VC 5I9MA 5GOTA 2I6UA 2J59A 4OREX 4WZBB 4YRTA 7MHTA 2QAGB 2RCYA 3CONA 3IEPA 2QVGA 3OPYB 1HLGA 4ZK2A 2YJ4A 2PYZA 2AR9A 4BNZA 4BO9A 2EJUA 2W2OA 2NT4A 3WJ7A 4TMVA 5JR3A 3L0YA 3WMWA 3VPAA 1F7UA 2J3EA 1Y7IA 3IOBA 3OD1A 3SIXA 3TQQA 3STWA 4EM6A 1W85A 3SDBA 2Z1MA 1ZAYA 4F97A 4DDVA 4BASA 3SC6A 1ZC3A 2GD2A 2V59A 3F0TA 3AVQA 3WJ2A 2H1LA 2Q2NA 5EZYF 3ZH2A 3ZDYB 1N0UA 1YOVA 2YRFA 3C8MA 4LZPA 1P81A 1CUXA 2QAIA 3GLIB 5AVTA 1H2XA 2X86A 4DOMA 3IUYA 5CA1A 1G0NA 2J7PA 2VRBA 3MRXA 3CF6R 3E7FA 3QVGB 1PTJC 2AOVA 2HCRA 2HMVA 5KZMB 4F4FA 4JEUA 1M7BA 3BVPA 4Q47A 5CM2Z 1DSSG 4MR9A 1MB4A 3KZVA 4WI1A 1IBKB 1F0YA 1YL5A 1Q0RA 1YJCA 1KU6A 4Z53A 1M74A 4QYTA 3CR7A 4AQYB 1ISPA 4CXMA 1GN9A 3X44A 3T9FA 4BV8A 4CKZA 1CEQA 4J2HA 3ZI4A 1CHNA 2VF7A 1U7ZA 2BGKA 2PFGA 3ADOA 3KKKA 1Z33A 3MG9A 1KYIA 4IBOA 2UUOA 4IDQA 4LGYA 1K7FB 5BMVA 2AXQA 3ESRA 4N54A 5F3DA 4Z4GA 3ELDA 3FYCA 4J0FA 4JFAA 1N9GA 3ONFA 3WMFA 2QJRA 2OHHA 4HFNA 2E4ZA 3UOGA 4LN1A 4UBNA 3U62A 4D74A 5IS2A 2GAOA 4BECA 2I62A 2XMRA 1Z4OA 1KOJA 4DPLA 3HYRA 4C29A 4AMZA 1PNTA 3QI7A 1O5IA 4FINA 1C3XA 4Y1RB 4R41A 1CF4A 2E55A 2Z3ZA 2K2QB 1Q21A 2DUWA 2PKCA 3BAZA 1Z7WA 3C3YA 3PDIA 4GR5A 3GJZA 1FJXA 4C3ZA 2VUSA 4HZUA 3A1WA 4NJMB 5F4ZA 3TLEA 2AC2A 3BJMA 3PC4A 3QOWA 3IH5A 3JQ9C 3UGKA 1Z15A 5ECYA 1OW3B 2TMDA 4F2HA 2HEIA 3OA2A 3NHFA 5C8YB 3AHHA 3DUWA 4URVR 2O8CB 1HTWA 3OTOB 2GXQA 2AFVA 1Q7BA 4B79A 1M6WA 1Z6XA 1YS2X 4QQKA 5AW5A 4JJGA 1H2YA 5ILGA 1T8SA 3L4EA 5IYZF 3L8MA 2PPVA 3ZBUA 2GCGA 3V8RA 2DWQA 4LPKA 1GPDG 2ZJFA 3OEWA 2I6XA 4I8XA 2Q2QA 2JAXA 3WKCA 1RWBA 2QM8A 3LDHA 3DC7A 3MGAA 1DP4A 4OQQA 3BXXA 4OB8A 1HE8B 1R5OA 4DZRA 2ZIXA 2EKBA 4BPRA 1Y6FA 1JQBA 3KZMA 4ITRC 2J46A 3V9PA 2XJ4A 3RWBA 2QTVB 1OR8A 1QU3A 2W2PA 4U3JA 5LMNB 3LYUA 1TQ2A 4C4AA 3W3AH 1LCIA 3GOHA 5H02A 4ZMBA 4ALLA 4DIOA 4N76A 1IHUA 3QUQA 2C03A 2L0XA 2IHBA 5MDHA 2ACVA 3LBAA 3L79A 2XCIA 5CLJA 4NDAA 1R9MA 2EG5A 3WKBA 4P80A 4OK6A 2HLDA 2V3VA 4H9GA 4K2AA 3AT1A 3K0HA 4R0VA 3WGOA 1S8NA 3TJMA 1O5TA 1JQ5A 2XMZA 2QUZA 4QUKA 3KQMA 3RUFA 2A3NA 1GOTA 1Y8RA 3L0ZA 3LT4A 1S2NA 1L4LA 1KMQA 2BEUA 3T5GA 3NKVA 1FMTA 1JH8A 1PQ4A 1GN8A 1FVHA 2CUTA 1EJ6A 4F4IA 1TF7A 4CQMD 5KNCA 4OMCA 5T8KA 2HR1A 4LQLA 4Y6OA 5JQGA 4N48A 5H7XA 1DZ3A 2V8BA 1AUXA 3W9UA 2ZSHA 4IR7A 4B0PA 4L75A 4F3TA 1YHNA 4JI1B 1G8SA 2QMYA 3T5TA 1W8DA 4EB6B 3FMIA 4BFXA 1SA0A 4ZQEA 4MR7A 5C31A 1WW2A 4IZHA 1NI5A 2IZ7A 1CQJA 2AJLI 3AI7A 3DZGA 2VL7A 1UWCA 2L2QA 2R8BA 2VK2A 3KELA 3KB8A 3KHSA 4GQIA 3D0QA 2P9TA 1BCSB 1ATZA 3BZBA 4NBRA 4RPGA 1YQEA 1WQ4A 1U9IA 2WZBA 4WZBE 4GYYA 3KT8A 3KKMA 3SXPA 1SG6A 2Z3WA 2VP4A 4I4IA 2C59A 3FSRA 2PRKA 1KBOA 4ND4A 3LQFA 1CRPA 4KB5A 1ZM2A 1UDBA 1I3LA 3OIGA 1U4SA 4WNIA 5IAOA 4I8IA 2GJAA 1CIPA 1P17A 1MDFA 2VCEA 1MN6A 1G8HA 1T10A 2X4IA 2CBZA 2F3TA 3RV3A 3OECA 3DOHA 3PV0A 1ZSVA 1QGUB 3QA9A 1IBRA 3PFNA 5AQ1A 2X1HA 4L08A 4P22A 3OJCA 1K6XA 5DTJA 1V7ZA 4W1RA 4AMVA 4CIVA 3EEIA 1O8CA 2O2YA 1O3YA 2BR4A 1JLMA 5DWQA 3DVLA 3PUVA 4KDFA 2PO5A 4UNQA 2Q0SA 3GLIE 1EFTA 4MKGA 5F2EA 3LY7A 1NLUA 4I0WB 2JH9A 2NNWB 1CNFA 4LXXA 2WYVA 2REXB 2XOKA 4M9ZA 4MIEA 1HWYA 4N3AA 4R40A 4ZVQA 4B7XA 2AYXA 3LNCA 3JD0A 1P5HA 1GDHA 1U6JA 4JT8A 2AK2A 3RK4A 3WDLA 1QGAA 2WIKA 1C3EA 4ZAXA 2BF4A 3IBFA 1R00A 4Q3CA 1MC1A 2B78A 4MRNA 3Q7PA 1Z8DA 3H1FA 2KBFA 2YOHA 4V03A 3IDOA 2VJCA 4IGAA 5EL0A 1ABBA 3PTAA 1UBHS 1W1UA 2X6QA 3CQ9A 2YVLA 3G9ZA 4B2PA 3AR5A 3RFCA 1MCZA 4HAOA 1NQUA 1JEQA 2X5KO 2EDAA 3OEHA 5AHKA 3DA8A 2FXIA 4CRWB 4RQBA 1HBJA 2PVPA 3KV3O 1DQZA 1IJEA 3JVIA 3LZDA 4YK7A 5A03A 3THYB 2Z2ZA 3C2QA 1HYEA 5FOUA 4AJEA 2AH5A 2HSZA 1T1EA 3V4ZA 3BRSA 3DJFA 1FTYA 4HMQA 1PV4A 2GRUA 4V02A 1DG3A 1HT2E 2H08A 2JK0A 3H2YA 3PG5A 4FP9A 3NBUA 4EGFA 2ZE6A 5DN6D 2ZDQA 3DMFA 5EXXA 1T2CA 2RC5A 4UEKA 2NU9B 1JP7A 4WERA 5HTOA 4PYNA 2PWYA 2HRZA 4EUSA 2RGGA 3QYPA 4IO1A 4O63O 3ROPA 1T8TA 1YR6A 3O4VA 4IMRA 4WECA 1LLDA 2FN7A 1USIA 1G8PA 1V3QE 1HQDA 1NBMA 1SB9A 2Q1WA 5AJHA 1D2EA 1DELA 3AJ9A 3D7LA 1G5HA 1KJNA 3DG9A 3OCXA 3R3YA 5FKJA 3WV4A 3I6QA 3SMQA 3PGJA 3RIMA 5BSGA 3P2JA 5JRJA 3P7MA 1W73A 4HQRA 4X61A 4RE6A 4KQHA 3B6ZA 3N6VA 4Q4HB 2W4MA 1TIPA 3K92A 2IELA 1F06A 2H7XA 3OQJA 4PWZA 1DTWB 2PJUA 1DJNA 2YNMD 2YMMA 2YY6A 4YAWA 2HI0A 4DHWA 2XD9A 1H93A 4R1QA 3TVDA 4GE3A 4RVSA 1NQVA 4AMBA 1ZP6A 5JNTA 1ODSA 4MUIA 4PNEA 4JLOA 1X1QA 1JJVA 1BIFA 3DB1A 3RYFA 1SK8A 5BWMA 1VPDA 2YW9A 2AI1A 2FZGA 4MQBA 4CT4B 1R37A 4J7AA 3KSZO 3FB4A 4QTUB 4RVNA 2R4UA 5H5JA 5TF0A 3KYBA 4PU0A 3SBXA 1XDDA 5JVDB 4Q37A 8OHMA 4F56A 4RGVA 1YZYA 2FE4A 2Z6VA 2Z8YA 3IP5A 2HADA 2AQHA 2QTMA 1RRVA 1AQJA 2VSYA 2Q3LA 4IF6A 3VU3A 3HCBA 1EFHA 3WYEA 3ICVA 5KKCA 1YK0A 3QY9A 3B3GA 3O94A 5JXJA 3AH8A 2JHGA 3CPSA 5JZSA 3PXBA 1KC1A 1ZIPA 4MZXA 3P32A 5F73A 1FRQA 2ECOA 2GYVA 3A70A 5EEGA 2V6IA 3ZY2A 2CL7X 1EGAA 5CB0A 3WAJA 5B30A 4NK4A 5EIAA 4CNQA 2XPCA 4ROTA 3MHTA 2O8EA 3IV6A 2ZJ2A 3OFNA 3WP0A 1NJ6A 1EUZA 1R8YA 1U2RA 3KQPA 1U94A 1DJLA 1YZUA 3QELA 3D0KA 4BLRA 3H4TA 1ZGAA 3U3DA 2AT1A 3BD9A 2FPXA 3AJEA 3GNSA 2XZDA 1XMQB 1ACLA 4TWIA 1KJQA 5E6SB 5K0LA 3WRYC 2GH1A 3F96A 4AZ0B 3RVBA 1ZAKA 2D5CA 2B7BA 3GROA 4TZTA 3EAFA 3SZ3A 4KXNA 4DFDA 3B38A 2GF9A 4OHVA 4Q7EA 2IDJA 3T3PB 5K4GA 2X3FA 2F3SA 1KY4A 4HZGA 2H2FA 2VFAA 4KPEC 4JNCA 2VT7A 4KR6A 2C0PA 1JPVA 3FXAA 2OUKA 4NH0A 2OY0A 2QRVB 2FQ1A 3R20A 5M3BA 1EHYA 1T1JA 3UJ3X 3QX3A 3EPRA 2HXSA 3SXJA 1PS8A 2CD7A 2X7XA 3KUKA 4DJAA 3MBKA 3GZ4A 2O6HA 3U9SA 1OV6A 3WLJA 3NASA 4YRJA 1RM3A 1C2TA 2F8LA 3HDQA 4Q6BA 5LSAA 5FUVA 4CR8A 2AEEA 4RD4A 1VSBA 2XMQA 1N6PA 2H16A 1M2EA 1AT1A 1I01A 4R1LA 1C80A 1P9OA 1UCFA 1UXHA 2PX0A 3FYHA 4MRRA 1HF3A 5FNVB 1Z2AA 4KQ1A 4QQ8A 3K96A 4ZO9A 5KNBH 4D4IA 1LBIA 4WNYA 2VDJA 2G6TA 3O91A 1R16A 2NSDA 3OQ1A 3EZ9A 3VHLB 3K5HA 2IIVA 4QIHA 2FCAA 2QYHA 3G8DA 4MS4A 4BCBA 4DYVA 2Z57A 2RGBA 1OH5A 1NMXA 3GH1A 3VDRA 4CDMA 3ZDQA 4MVJE 1W88A 2PT5A 1V9SA 5EWLA 3RVLA 4U2BA 1CRQA 3UICA 1JIUA 4CKEB 4C01A 3GGDA 1OBHA 1PJZA 5JAZA 5KB3A 4DNFA 1PR3A 1OI7A 5IJWA 1RC0A 3ROKA 1G7RA 1PNOA 1BYIA 4MNTA 3V1LA 1RHQA 3U09A 4WLEA 3JQFA 2DUUA 4PPGA 3AKZA 4IKEA 2OK8A 3NC1C 3GP8A 2C2ZA 2CD9A 1U3VA 2FRDC 3MJTA 4PX3A 2JFGA 3FF1A 3PSHA 4BFZA 1CY8A 1KFKB 4TTTS 1X7GA 2F1RA 3N2EA 3TOXA 1M0TA 4BX2A 4YCMA 3MAGA 2OOSA 3NM5A 1TGVA 1THMA 3IVGA 1ISRA 2JA1A 2Y77A 2XZPA 3OOJA 4H77A 4LKRA 4M9RA 5DHPA 5BR7A 5DN9A 1KFEB 2R11A 4F3KA 1NY6A 4HF7A 2C9YA 4B1FA 1D2GA 5I51A 2VXCA 1XZCA 1NPTO 1XJ5A 1DBRA 2LRHA 2VYND 3R5SA 4FEAA 4GP9A 1XTTA 2RGNC 2F48A 3FI9A 1MT0A 4LJLA 5B4UA 3R7LA 1HOTA 2OKGA 4NNPA 1NONA 2ATEA 2MIIA 5EUMA 1MQSA 2CYBA 1LF0A 2YV5A 4UAGA 1G9TA 2PGXA 4GLOA 5DVZA 1ZJ4A 1NZDA 2PJRA 1G21B 1JWAB 4LCEA 2O5EA 1T2NA 4CV3A 5ESRA 5L3QA 4QICA 3HZRA 4FFDA 2IWHA 4WACA 2YXEA 3C70A 2O1WA 3TTXA 4FN5A 3ZVNA 3VPBA 4RENA 2GB4A 2BUAA 3QVJA 3STHA 3X1KA 4TV8B 4EPTA 1QZUA 2ZBFA 3OSUA 4XQ0A 3MWYW 1K8RA 3WC4A 3ZI0A 3G5MA 4DRYA 2B34A 1RYHA 1EFVB 3IAS1 2Q99A 1FP4A 3IT0A 2C2MA 1VLJA 3CYFA 3PB3A 4PSDA 3A2MA 1JTFA 2D00A 3S1LA 4QNRA 2CE2X 3UMSA 2AQKA 4RTMA 2X0KA 4Z1OA 1UUFA 2AIRA 3U4GA 1GNLA 3Q0TA 1PJ4A 4IDEA 3DW1X 4GM4A 3HGQA 1AUPA 1DO8A 3AO0B 4HH3C 1RRPA 3KQQA 2I65A 2XZLA 1Z5PA 1T34A 4O6VA 4HC4A 4Q34A 4DJTA 4YRMA 4RHEA 1QR6A 3NW9A 4AZSA 3M1YA 3M4JA 4QYMA 2MHCA 1OWOA 4E51A 2CNDA 2ZIAA 4LJSA 5IPFA 4BFVA 4CMKA 4RKQA 4C7OB 3KTFA 4ZQFA 5I9SA 3VPHA 3Q10A 2CFTA 5FEMA 2GPBA 1VDZA 2BWJA 4UCXA 3L6UA 2MSDB 2I78A 2QG4A 5DYWA 3VZRA 3DKRA 1E0SA 4JNKA 4DMFA 2G70A 2YJ5A 4ZI7B 5AVJA 2FLWA 4ONEA 5KMGA 1SD5A 1XKQA 4KXFB 2IBSA 2GZSA 4NCHA 2EFEB 2GR9A 2QVLA 4BBJA 3Q7QA 1UK7A 4PFKA 3A6DA 4MZDA 1FJ2A 3LQQA 4UC0A 4X1YA 2EF1A 3TDMA 5K0FA 3AY6A 1EEXB 4UDNA 3RABA 1ZH0A 3H8VA 4FHCA 4CKYA 4F4DA 1K88A 1T4CB 2DRIA 2Z83A 1NVFA 4XD2A 2B2NA 4HNVA 4S1NA 1SHKA 5K0BA 2BI8A 3CX8A 4FDMA 2RBKA 1CEXA 4R2WA 5A7GA 2I1QA 2R5NA 2BOVA 3BH6A 5ITSA 1H5NA 2OG1A 5L7WA 2IP4A 3G9UA 4CNBA 5FEUA 3HHEA 1V3UA 3HDVA 3RREA 3L7AA 1YQDA 1ZVQA 1I0IA 1FZQA 2F17A 5FBQB 1EGVB 1QRRA 2AN4A 4JI2B 1L7EA 3MB5A 3PUXA 3M6MD 2WV7A 2WOJA 3QKUA 5CNIA 1AVTA 2X0EA 3IIMA 3THXA 1P0FA 1XD8A 5EIFA 5AJUA 2VP0A 5EJ9A 2H63A 3A6ZA 1K9SA 2ISQA 1A2QA 3E58A 3BD6A 1VG9B 5K20A 1X19A 3EC7A 4O4JA 1WM1A 5L3ZA 1DARA 2VHVA 1EX1A 2DQYA 1HTTA 3T5BA 2YFYA 3NONA 3U40A 4B82A 2QTGA 5DWDA 2ERXA 1MDBA 2IYSA 2YNMC 2EP5A 1H5QA 4GZ6A 4I55A 4LA4A 4PRZA 4L8LA 3EPHA 4Q21A 3RVJA 1J9EA 1AA6A 1AN0A 4U7WA 1DO2A 2GAIA 3E1KA 5E9JA 1VPLA 2B92A 3KQOA 3EXFA 4GLLA 3RRXA 3VC3A 1LK7A 3A9TA 5CDSA 1C8VB 3QPDA 3UWMA 3DBHA 4NMWA 1GZSA 4XDGA 3VO2A 2XA9A 4X3OA 4XLTA 3K7EA 2WYWA 3FCYA 4CYMA 1CB0A 5CDFA 1K4KA 2HBYA 2PX5A 4ID9A 4Y9DA 3DP9A 3I09A 1V47A 2ODBA 4EENA 1S7GA 3FI0A 1WWKA 3GBPA 3QVXA 1QV7A 3NVDA 4OX9Y 3TX2A 5DU2A 2ZULA 2LIPA 3G5TA 5DBGA 4XLZA 3U4CA 2PSHA 1HEUA 2H5IA 4I66A 1ZRNA 4O33A 1FTWA 2BBOA 5MGNA 1ZLXA 1F8GA 3JTMA 3W5CA 3LC7O 5LB2A 2NZXA 4PLHA 1G20A 3FYUC 3AM4A 1ESDA 1LDEA 3MINB 3LDAA 2QX8A 5A05A 4QPCA 4BWFB 3AOEA 5UKDA 4AKIA 1CQZA 5FD8A 1P2UA 4IDGA 4CV2A 3ND9A 3FLBA 4EHNA 1M76A 4KP7A 1V4BA 4QATA 4Q24A 4Z4EA 1N5KA 2JFXA 1N6KA 3CLUD 2NVUA 5F9MA 5SY9A 2ZP1A 2GSDA 1E9SA 3EJ6A 3N0WA 1A2BA 1Y63A 1I36A 5L95A 1JV2B 2IEYA 2V7PA 1BE0A 2ZZKA 3WYFA 5BP7A 5IULC 1H8HA 4L7QA 1G0OA 4MQEA 3I4LA 1GQFA 4F9TA 1EA5A 3C87A 1AQYA 4HWPA 1JFTA 4FFVA 4D6YA 1MJFA 2WABA 5BOSB 2YIJA 4R9NA 3G68A 1VHWA 2A4KA 2O1SA 4Y1EA 3K5WA 1TRHA 2GN8A 4FDLA 2P2GA 2D0IA 4BQRA 4QVGA 3W9BA 3QUCA 3QXCA 1VKNA 1YR9A 2RI6A 3EIUA 3IB6A 4HX9A 4RELA 1GUBA 5H68A 5HIMA 5J4HA 3K9FC 1VB5A 3NVKI 3IEMA 3GJ5A 2JI4A 3GHYA 4GC5A 3AVUA 1E1RA 3RS4A 3FBWA 4D97A 2AKEA 4ARSA 1YMUA 5LQKA 2R1VB 4Q4JA 3V7UA 1JZTA 3CJTA 1HG0A 4L73A 3K0AA 3ECAA 5FYDA 1ZCAA 4CL0A 2H4ZA 2QD5A 4YGXB 4BRUA 1XCLA 2OV6A 3FY4A 1PK9A 1Q6YA 4UTOA 2Q3CA 1OLSB 4FFBB 5KPDA 4QDUA 5FOSA 5EYPA 1C0PA 3WR5A 4BRZA 2REQB 3Q2IA 2Q3FA 3H2SA 1J5XA 3AEUA 3BDIA 3N58A 4LFCB 4NATA 4DL9A 1EVIA 3CH4B 2ON6A 1M1XB 3DNPA 3GY0A 5ITWA 3GFFA 1P33A 4ZCMA 2WWWA 2AVDA 1GCIA 2OCDA 4I46A 4KE8A 2OBYA 3N8DA 1DLIA 1ZBQA 3H17A 4AO7A 3OI7A 2Z43A 1NYTA 4XCQA 1B2LA 1G1MA 1VJ5A 2VJYA 3OCYA 1ZIOA 5AXCA 3A4LA 4D45A 3VSEA 3ABSB 3AXTA 3PRYA 3E48A 3AFHA 3EDMA 3U7QA 1M2WA 3UKDA 1JUDA 2ABWA 5H81A 3DFFA 2ZUFA 2V4UA 4N3GA 1GL7A 1Z2NX 4PBSA 1FMLA 3GZJA 3NHUA 4DQKA 4UARA 3SQMA 5EHGA 3GBSA 1DX4A 2VP5A 1AM4D 3OOEA 1U5AA 2UZ1A 3T54A 1YCFA 2IW3A 2WHRA 2C58A 3H9BA 3CKLA 5F3WB 4B4OA 4DRXB 1RMQA 3LBIA 2AKYA 4XB6B 3LLUA 4JBXA 5ALSA 3T3GA 3Q3EA 3FZYA 3LS2A 3UMYA 3ICQB 1A8UA 4NQRA 5FNZA 3WLTA 2EX1A 2ODEA 3N2KA 4KWIA 5GM2A 4RY0A 1SKYE 2JVKA 2VXYA 5FJJA 5J5AA 4F6RA 3Q9LA 4B4VA 4BP3A 3RHFA 4DARA 4WNAA 2AF4C 1M10A 1Y3IA 2A92A 1ODTC 3MPOA 5I7VA 5DOZA 1GZDA 2Q3BA 2NO0A 4TROA 4O4HA 2ATXA 3R7WB 1NOJA 5KJEA 4AFNA 4XWGA 2KQUA 9ABPA 4FC6A 1CDEA 1LS1A 4KMRA 1NY5A 3FH0A 3P0EA 2OE2A 2ZJ6A 3SU8A 3U48A 4W7SA 3U4QB 1Q1QA 2X58A 4IGIA 3N05A 4KN5A 4JP1A 2A59A 3L0SA 1JEJA 2V9PA 1UIRA 1Y8ZA 2XCLA 3H9UA 4BZZA 4INAA 5COQA 3VKFA 5CBPB 4YIHA 5JC8A 1N78A 2NSHA 3OCWA 4M99A 3UXYA 2ORWA 4GF5A 2FWAA 5JBQA 1GGFA 2O0HA 3I3OA 3DD5A 3NU1A 1XC7A 4JU9A 5HA5A 3RS8A 5KC8A 3D3QA 3C8DA 1D0IA 4FKZA 1TL7C 3GRUA 2FAXA 5B5SA 1BXGB 2HDHA 2R8YA 1T15A 2NXCA 3SSMA 1ZS9A 3P9CA 4L3VA 4QULA 3LF1A 1V11B 5A9RA 3FPEA 1W36D 3OM9A 4WLUA 4OQMA 1EXNA 4XGIA 4KH0A 2HYIC 3N7AA 3FDZA 4GI1A 3OIUA 1LX6A 2IK8A 3C1OA 5FOXA 3S0JA 1DC8A 5HRUA 3JQRA 1FQWA 4CIBA 1AX9A 2ANCA 1U3UA 4FQ5A 3ZOZA 5CG1A 2KMLA 4Q9AA 1TA4A 3JQBC 4YGYA 1Y1SA 4X7PA 3V00A 4Q3OA 4NYIQ 4XFJA 1O96B 1N2OA 1EG2A 3QEMA 4UZFA 3LHKA 1XTZA 3CLTC 4FYPA 1PLLA 3BPSA 4P32A 2OVFA 1UPUA 3G6WA 1Z7EA 1UKZA 3GBVA 5FOVA 3AUKA 1RT9A 2C2BA 4MP6A 3U4IA 3AEKA 4ZAVA 1ZO8A 3MWGA 1CUDA 4L9RA 4XVHA 3H8JA 4YJHA 4Q1EA 4JVNA 1DBQA 3TW8B 4D3YA 1SPXA 3WICA 1L7NA 3G0CA 2NUAB 4Q1VA 3ZQ6A 3K1JA 3JR7A 1MR3F 2ZIZA 3EFOA 4TRNA 1C14A 3RVPA 3FOEC 5I7RA 4AZ3B 5IJAA 3QXGA 4Z1MA 4E03A 4R2LA 3LRXA 1YAJA 4OHOA 5I3CA 1VE5A 2ZBPA 5ICCA 1ZRHA 1V1MA 1ICEA 1U7PA 4TZ6A 3D8SA 1F4PA 3CV3A 1CUHA 3FNRA 1A9TA 3UJ8A 3G0GA 1MUUA 3EK2A 3F8TA 5CYPA 3TD6A 4CMHA 4CI9A 5ALLA 5DGTA 4KXLA 1AHIA 4OB7A 1JWBB 2OXRA 4BLVA 1P60A 2ZUEA 1KAHA 5IVDA 3N59A 3GRKA 4YLGA 5GGXA 2BD0A 3GJ0A 4P82A 5JBIA 4NEHB 5EJFA 2CXTA 4EI9A 3PC7A 1Y8AA 1M54A 2IHJA 2KB0A 4YO7A 6ADHA 4X92A 3KFLA 4XM1A 1R4MA 2QLLA 5AUOB 3ZQKA 1GILA 621PA 1P91A 2GM5A 4JUAA 4L8WB 1JEYB 2A33A 4ENPA 2PLRA 2VDPB 4I6GA 1XZPA 3W9YA 3QKIA 5GMOA 4NFHA 2E7ZA 3IMCA 5K8CA 2JGKA 2WZQA 3RSZA 2YHAA 2JLCA 1OFUA 4C88A 4REQA 1SVLA 2QIOA 3BD7A 1HC7A 4IIJF 4A3SA 2RHGB 3WZ2A 1UAYA 4L16A 3O4IA 1TYZA 3LUJA 3ORYA 4L51A 4OLFA 4EG4A 2QNRA 3BB4A 2P3LA 3L7KA 3BK1A 1ISIA 2FH5B 2YW2A 3B1YA 2OV1A 4AY3A 2ST1A 3FDXA 1V16B 2LP4Y 2QX7A 5BXYA 1FDIA 3DEFA 4LHEA 3W6ZA 4AK9A 4F8JA 1H2FA 5KTSA 3TOVA 2NAFA 2XA1A 3G7UA 4IQFA 5D6NA 3R6WA 4YN3A 5TEVA 1DAHA 3JWJA 3KSDO 2QYTA 3PWTA 4GU5A 1P1IA 5JAUA 3GFVA 2X0IA 1STOA 2I2WA 1USKA 4BO5A 2VZ0A 4PSCA 4BTLA 5CH8A 5MGBA 2W2QA 3G2PA 3GOQA 2EBFX 2Z4SA 1KO1A 3R3WA 1G19A 2Q2VA 1CIJA 4G65A 3KIPA 4CW7A 3DLBA 3KSBC 1I1NA 3A3NA 4GSYA 3E22A 1DIOB 3NRBA 4IJ5A 4MR8B 3KPVA 4ZIRA 3RVMA 2I2DA 1FDTA 1P1RA 3SAJA 3FE2A 2Y0CA 4I3FA 5HIJA 4J6EA 3U2QA 4QKQA 4AG6A 2CBXA 2IS2A 4JGGA 1KOGA 2DUMA 2ODWA 1V95A 4TL9A 3TPFA 4DF3A 5ELLA 3C6ZA 2GZRA 2EATA 2Q3DA 1OXMA 1ZSNA 3BXZA 3IMKA 3OZCA 3C41J 1KA9H 3A6PC 3NWOA 4TV9F 5IXYA 5U1PA 3CLUC 2MINA 3QIVA 4HCJA 5DDIP 5IABA 5LJLA 1Q50A 3PTLA 4FW8A 1QPBA 2CW5A 1GUDA 3OZAA 4Y98A 1PEAA 3HU3A 3QX7A 4HAXA 5T57A 2P40A 1DJOA 1KEUA 4KYTA 4W8HA 3QLJA 4XD7D 1I7QB 1OXSC 2AG8A 2JF0A 1T36B 2OZLA 1BDHA 1CK4A 3MJSA 5BV7A 5ILOA 1P18A 1EBFA 1LPPA 2G40A 2WIFA 3K9NA 1GAQA 4Y30A 4YCCA 5HJEA 2W42A 4Y2UA 1CVIA 1Q0TA 5F98A 3GLGA 3ACBA 1SU4A 1DRUA 4K5QA 4R8RA 2Y71A 4C76A 2FUEA 1L4UA 1ABEA 5AKKA 2FYTA 1OC4A 2B1JA 3NYQA 2IU6A 3FTCA 3HHPA 4PXAA 1FFYA 1FFWA 5CDGA 4E1VA 4LIPD 3GMTA 4GM0A 2VQFB 2LZ0A 2QD1A 4KI7A 4C4RA 3HN7A 2J09A 4RDCA 4KLZA 1V96A 4N9WA 3HFSA 1OZHA 1TEXA 3R6GA 4HEJA 5AW8A 1TZKA 4J9UE 2VPQA 4V3CA 2C95A 5C4GB 3X43A 2JJMA 1DDOA 3ROTA 2H1OA 1A96A 1Y4ZA 2A6PA 4DCJA 2QTLA 1WOYA 2XWBF 1JFVA 1DAEA 5DYTA 2YBEA 3E5MA 1AHPA 2IL1A 1H2RS 3ZGNA 2XYQA 4FUQA 3U4MA 4IO0A 4LDPA 4D44A 1X3SA 4L22A 2CJWA 1F8YA 3BE6A 3ED5A 1BVUA 2GEDA 3GA0A 9LDBA 5HHTA 2Q8PA 3DV9A 4K0KB 5HFAA 1TUEA 1XTKA 1Y89A 3RYHA 4AT1A 4N8EA 4I5GA 2F1JA 4LE0A 4ECAA 1F48A 3KXKA 4Y9UA 2GK4A 4BO8A 5EKSA 2DF8A 1L7RA 2Q6VA 3B1XA 4NBLA 1EXMA 1F9EA 4MWZA 3VJLA 4Q9NA 5IYZA 2XXAA 3MTBA 5I5EA 1ML3A 2LWIA 2J7PD 1N1DA 2OXEA 3GDGA 4JKIA 1WKBA 2ZI7A 3CN9A 1QHNA 2CFSA 3P2YA 4BU1A 1NPYA 3AZPA 1LSOA 1N1EA 3PFBA 4C7KA 3PLAE 4OAQA 1EU1A 5HCIA 5BRAA 4MUEA 1J25A 1L6IA 4QL3A 3GI1A 4EY4A 1YONA 3UV3A 4ZV9A 1BRTA 2YYSA 1ESCA 3EVCA 2JLUA 4CV0A 4XYLA 5FH9A 2ZB7A 4RYLA 2Q7DA 2X3UA 2GYUA 3D7SA 3E0XA 3EH1A 1ZMTA 3ME5A 2ZETA 1Z5WA 4C1BA 4CMEC 3T1NA 1Q83A 1QQ7A 2AE1A 2Q9CA 4DLLA 4WKCA 4EHAA 3KT6A 5JT1A 1SVKA 4V0SA