5FWXB

Crystal structure of the ampa receptor glua2/a4 n-terminal domain heterodimer
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
377
structure length
375
Chain Sequence
FPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNAAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMATE RECEPTOR 2
publication title Structure and Organization of Heteromeric Ampa-Type Glutamate Receptors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 126
structure length 375
sequence length 377
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fwxB02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fwxB01
3LUJA 5JNTA 2FXIA 3DZDA 3LUKA 2LUOA 3RH0A 2E4WA 4G0MA 1QKKA 1XHFA 2YHAA 4YS6A 5FWXA 1RXEA 1MVOA 2RJNA 1VRVA 4TLLB 3KG2A 1DBWA 2JB9A 3VNBA 4MGEA 2AYXA 4MR9A 2FEPA 2RJOA 2WJAA 4KRFA 3KYJB 5KWSA 1NXPA 1CHNA 1Y1LA 1L5YA 1SXGA 1Z12A 2QZJA 2MYTA 3MF4A 1DG9A 1TVMA 4EGSA 2M98A 2GKGA 4F06A 3CU5A 4RY8A 1ZITA 4Z4CA 2A9OA 1GCAA 3KKEA 5IEJA 2NZVG 2PL9A 3CG4A 1E6KA 4YO7A 3LFTA 3ILYA 4W5OA 4E7PA 1Z18A 1DP4A 3Q9SA 1QPZA 4ZMSA 1UDRA 3FFWA 3C3MA 4YR7A 3NNDA 3OLXA 4KK4A 3CRNA 4XAQA 3SQNA 4G86A 3N6VA 1JBEA 4GNRA 4ZJPA 1P6QA 4HYEA 2P9HA 2WJWA 2X7XA 4W5NA 1A0OA 3MA0A 4JOQA 3GT7A 1Z2EA 5TPWB 5KQLA 1JDNA 5JS1A 3IDOA 3HS3A 3H5OA 4MLDA 4RK0A 3I45A 4XASA 1W25A 1SXHA 5FWYA 4KFCA 5KC9A 3RVLA 4G0YA 4TN5A 4DQDA 2IPLA 2FLKA 1R8JA 3HDGA 2RGYA 1M5TA 3QEMA 3QX8A 4MRMB 3QELA 4Z4FA 3N0WA 2E4UA 1LBIA 2CHEA 2PAFA 2V0NA 3GL9A 4EVRA 4S04A 1YVUA 3RVKA 1QNLA 4S05A 2MYUA 5CHYA 2PE5A 1E6MA 2NUBA 3KYIB 2IYNA 3KHTA 1D1QA 5TQ2B 4YRZA 2MSWA 4G97A 5TQ0A 4EVSA 1JFTA 2JRLA 4H60A 4P1ZA 4MAAA 1DZ3A 4F8JA 5IUNC 5KQGA 4MPTA 4MS1B 3O1HB 4UHKA 3BREA 1BVHA 4JB0A 2A9QA 3OMWA 5CNJA 5DCLA 2FTKE 5JNWA 1DBPA 1L5ZA 4ETNA 1PNTA 1ZGGA 3JVDA 4O1IA 2PUEA 1EWTA 4L85A 4M88A 3BRQA 1H9CA 2JBAA 4JA2A 3E3MA 1GLGA 1VPWA 5IEBA 3Q41A 2FN8A 1QO0A 3HDVA 4MQEA 2QU7A 1F51E 4KQ9A 4MS4A 3HM9A 4RY9A 2PLNA 3BBLA 3FFXA 3T8YA 3GBVA 1YS7A 4KNYA 2PUBA 4RXMA 1JF8A 4IMJB 3RVNA 5KQPA 1U0SY 1TMYA 3H5IA 2FQYA 3CZCA 2QVGA 4KMRA 3H6GA 4OBBA 4OG2A 4RV5A 5JNSA 3MQ4A 2FKAA 4IF4A 2CWDA 4LE0A 1VLZA 2NT3A 4LZLA 4N0QA 4QYMA 1ZGZA 4G0PA 4NQRA 4H3KB 1A2OA 4LRQA 2PUGA 3IP9A 3O74A 1DC8A 2GX6A 4RSMA 3NHZA 4MS3B 4MR7A 3SG0A 3OLVA 1NXXA 4MR8A 3CNBA 2HJ9A 1PUXA 3CLKA 3IP5A 3KLOA 4OATA 1SXIA 1DC7A 2LBPA 1WETA 4KPYA 2FQXA 4NICA 1OXKB 2A9PA 1BDIA 3N0XA 3Q7TA 3W9SA 5FWXB 2JVKA 3LKVA 2QVCA 1I3CA 2JVJA 5PNTA 1Z15A 4H3HB 4EYOA 1B00A 2FMHA 5ED4A 5IUKC 1YK1A 4MYRA 5E3JA 2OENG 3NNNA 4F12A 2MSKA 1U2QA 2ZAYA 3BILA 4IGAA 4MR9B 1DRJA 3OLWA 2VUIB 1FFWA 3JTEA 3K9CA 3IPCA 4Y9TA 4EYKA 5EWMA 1EHCA 5EWJA 3C6QA 3TO5A 1AB6A 4KZKA 1ZH4A 1JWLA 5HM6A 3L49A 3F6PA 5IUJC 3RVSA 4Q7EA 1USIA 4DADA 3OO1A 1ZAYA 1YMVA 4EUKA 2E4YA 3RVOA 1BDJA 1KMIY 2MSLA 3B2NA 3RVQA 4EY3A 1OXBB 2AYZA 5FBHA 4OLAA 2FVYA 1TLFA 3EJWA 5TPZA 4QICA 1URPA 2QXYA 5BRAA 4D74A 5CNIA 1MIHA 4JAVC 3RVMA 3SY8A 4CBVA 1MB3A 2DRIA 3O2JA 1ISRA 1M2EA 1ZHHA 2GWRA 3DBIA 2L19A 5IX8A 1K68A 3CS3A 2L17A 2H3HA 3A0UA 5FWYB 3KS9A 3CFYA 3M9XA 5IULC 3I42A 3O2SB 1TJYA 4ML3A 4KK3A 1BA2A 3BRSA 2VUHB 3RVPA 3T38A 3IP7A 3HZHA 4DN6A 3K4HA 4OLBA 3QELB 5IC5A 5GOTA 4HNQA 2QR3A 5BR1A 2HQBA 1IIBA 2QV0A 7ABPA 1YK0A 1PHRA 3HVRA 2FQWA 4EYQA 1SD5A 3OQNA 4NCAA 4Q6WA 1FFSA 4MQFA 2LIVA 3G85A 3DLHA 1K66A 4W5QA 3LOPA 2R25B 2LPMA 5TQ0B 1P2FA 4UHJA 2PUAA 2KYRA 1JDPA 3JPYA 2R4QA 1D4ZA 2NZUG 1Z17A 3Q7RA 4D6YA 4ZMRA 1T34A 4Z4HA 3N75A 3HJFA 5BRJA 1SRRA 2WY2D 1LJLA 1E6LA 4PYRA 1RXIA 3L6UA 5HSGA 2H0AA 4TMYA 4NCBA 2FEKA 1DCKA 1ISSA 4RWEA 1RNLA 1U2PA 4Z4GA 5C5CA 1CYEA 1AB5A 3C97A 3SNKA 3QK7A 4QYWA 4MQEB 1NTRA 4ETIA 4O5AA 5T3YA 3HEBA 2A9RA 4MS4B 4RK5A 3GWGA 1EWKA 3H5LA 3RVRA 4RU1A 3HUUA 1NXSA 1JFVA 4MRMA 4ZPJA 3ROFA 3RQIA 1ZN2A 4Q6BA 4XARA 1LBHA 2CHFA 3GBPA 2VK2A 1P8AA 3E61A 4XXHA 5FBKA 2FEWB 3OLZA 4RK4A 3GV0A 3OM0A 3ILHA 3OO0A 5HQJA 3TB6A 4W5RA 5JNUA 3LUCA 3O1IC 4N03A 4WUTA 3H5TA 4F3TA 1LK0A 2IDMA 2WRZA 3URMA 5DGCA 4YP9A 3HSYA 3H1GA 1Z25A 2N9UA 4MR8B 3D02A 4QPJC 2J48A 1GCGA 1PNRA 1JX6A 4RZSA 4N76A 3JPWA 1CEYA 3MM4A 2FMIA 3LTEA 4RDCA 1U8TA 9ABPA 3OMXA 4IILA 3N8IA 1USGA 3HCWA 2XDYA 3S99A 3EGCA 3GYBA 2PUCA 4NV3A 1EAYA 4Z9AA 3H6HA 4RKQA 4KV7A 4XLTA 1BAPA 1Z16A 2R48A 3CTPA 3DGFC 5TPZD 3QLUC 5DKFA 2I6FA 3KCNA 3HXMA 4G0OA 4Z0NA 1DJMA 1S8NA 3EDCA 4JP1A 1DCMA 2B1JA 3A3KA 2GBPA 2ZWMA 3EODA 4RY0A 1ZH2A 3FGZA 5EWMB 5EWJB 3RVJA 5DLEA 3SAJA 3UUGA 3R0JA 3HUTA 1EFAA 4N41A 1C4WA 4YWHA 2NT4A 1JH9A 1A04A 2JVIA 4IRXA 4PICA 4WXEA 3GRCA 2YHBA 2M1ZA 3FFTA 3Q15C 1TM2A 1ABEA 4XFKA 1QP7A 1MAVA 2IKSA 3CZ5A 3A10A 3FMVA 2HPHA 1FQWA 3P9YA 3HV2A 2IPAB 2MYNA 4EYGA 2HQOA 1RZRA 1ZVVA 4FE4A 1ZDMA 3QLTA 4EVQA 1NXVA 5EWLA 2QSJA 3KTOA 2L18A 1C0EA 5D2CA 4RXTA 3IPAA 4E7OA 2PUDA 1E2BA 4PE5B 1YMUA 3QEKA 2B4AA 5T7BA 1QP0A 3G1WA 3KLNA 4FE7A 1QMPA 1ZESA 3O21A 4B09A 3N0RA 3I5AA 4RS3A 3F73A 2FLWA 2IPNA 5ABPA 2PMCA 3O1JC 3CG0A 1M5UA 4LDAA 6CHYA 3LUGA 4RK7A 5GQSA 3C3WA 3LUHA 4HNSA 2WWVD 5KC8A 2FMFA 4JB2A 2IPMA 4LE2A 1J56A 3KJXA 5JS2A 2PL1A 5BQ3A 2BGGA 1Z13A 4KQCA 3QEMB 1KRXA 3F6CA 2F8TA 1NXWA 4MQFB 5DTEA 4RK6A 3OQMA 2F8SA 3HK2A 4YLEA 3TD9A 4KVFA 2E4VA 3JVIA 3QLUA 5JNVA 3LUDA 4W5TA 3H5WA 1QO0D 3CHYA 2HQRA 4MLCA 5TE9A 3EQZA 2ID9A 2L2QA 3FDFA 4PZ0A 3NBMA 2O20A 3IP6A 1D1PA 1VKRA 2PJUA 1Z2DA 4HNRA 1GUDA 3Q7SA 5IBQA 4O1HA 4FB4A 3QLVC 4L4UA 4F11A 1NXTA 1NATA 1JHZA 3H1EA 4TLMB 2JK1A 1JYEA 3MIZA 3DGEC 1D2AA 4YCSA 4Z4EA 3H1FA 2E4ZA 5KQMA 3JS5A 1NXOA 3NNSA 4ZYLA 4D6XA 1XWWA 4G0ZA 2WMYA 1YTUA 4RXUA 5TPWA 3EAFA 3LUFA 3QX9A 1F4VA 4Z4IA 1P6UA 5KI6A 3OM1A 2JBAB 1USKA 2Q5CA 3LKBA 1YS6A 2E4XA 4LDZA 4WT7A 3GA5A 2FW0A 1DRKA 1Z26A 3JY6A 3A0RB 3H75A 2W42A 3M6MD 4LE1A 3VNAA 1APBA 3ROTA 5B3JC 2CD7A 2FSPA 3DLBA 4YV7A 1ABFA 1HEYA 2VYCA 2R47A 3CKMA 3N53A 5JNRA 1U04A 4P98A 1RPJA 1FSPA 3KSMA 1M2FA 4Z99A 4KREA 3T6KA 4G0XA 3M9WA 1JLKA 4WWHA 1W9HA 5HKOA 5TQ2A 3D8UA 1NY5A 4YGXB 2LP4Y 3T95A 3OLYA 2TMYA 4OTZA 2QW1A 3LMKA 4MR7B 3UK0A 1RZRD 1QP4A 3TMYA 2HSGA 4MS1A 2RDMA 4N0PA 2PUFA 2ID7A 1LJUA 3EULA 1MB0A 2JCGA 3UKJA 2FN9A 1XHEA 3I09A 3MMNA 4WZZA 2IOYA 3H5VA 1PEAA 4IMIB 1GUBA 1ZY2A 1DCFA 1QQBA 2P4UA 1D5WA 2FMKA 3QLVA 2GI4A 4PEVA 2PKXA 3F7NA 4GPAA 5CNMA 3TX6A 1YIOA 1BDHA 1FFGA 3O2QB 4WXMA 2OQRA 4ETMA 3LUAA 1KRWA 5F64A 1JL3A 1PEYA 4N47A 3EQ2A 3NHMA 6ABPA 1KGSA 5I4CA 3HO1A 5CNKA 4Z9BA 1EWVA 4JASB 4RK1A 5EWLB 1QQAA 3C3KA 1JFSA 2MYPA 4LX8A 3OQOA 3SM9A 8ABPA 5B3JA 2WB4A 4MS3A 4G0QA 5TQJA 5C5EA 3MYYA 1DBQA 1JYFA 3O75A 4RKRA
chains in the Genus database with same CATH superfamily
1K7SN 4TV9A 5JNTA 4LDPA 1WDMA 1SWWA 3KQNA 1PVOA 5B6IA 4I9HA 3R7SA 3OX1A 3IUMA 1YS1X 4LW8A 2SKEA 1TKBA 3EPJA 1A5AB 2NU6A 2GM5A 3U3KA 1IBMB 4B3RB 3AB7A 4IS2A 1GLVA 1XVAA 4Z8XA 2QMYA 2P6UA 1Q21A 1KOJA 1BROA 2WKPA 3KQOA 4RIIA 4NOJA 2ZUFA 4G67A 1QIKA 1U1GA 4TTIA 4UDYX 3QFRA 2F3PA 4V0NA 1Z12A 2QZJA 2MYTA 2ZE6A 3S1AB 2ALJA 1TU3A 5JAOA 2IEAA 3VGPA 2I03A 3BJEA 4MV5A 1DIRA 3EVNA 1IBKB 2EKBA 4L1KA 5EUMA 1E3TA 3C6ZA 3JARA 4J0FA 2O8EB 2P8JA 3GARA 3TK1A 3V8BA 1GRQA 2C9OA 3F6YA 3VTZA 6LDHA 5JBQA 2Z6QA 1Z0IA 3AOGA 3D4PA 4Z4CA 1CNEA 2A9OA 2VJQA 1SCUA 3GDOA 3KWFA 4FGUA 3HP4A 5G0SA 5HIIA 3LWBA 2PMEA 2IS4A 2CCKA 4XOUA 2ZBQA 1NQ5A 4K2HA 5JMPA 5KHLB 2XHZA 1IJKA 1E77A 5JCOA 2BN4A 2OXCA 3K0CA 4Q9KA 1P5JA 2XMCA 4R1SA 2VJKA 1XI2A 4S2EA 5G0TA 3RK0A 2YXBA 3PT9A 4A0FA 3QMPA 4B3MB 3R5XA 2REQB 2KM1A 1QMGA 3GMTA 1QORA 3IEIA 3EW9A 4U6NA 4WD3A 5JJ5A 5JRZA 5DX0A 1JWBB 3JQ9A 3BMCB 1YH3A 3FJOA 2W6IA 3H5OA 4KLCA 1RAIA 2Q3HA 4NK5A 1A9ZA 4B4DA 4BB0A 5FV4A 4FSHA 1HORA 3O8LA 2B5WA 1A76A 3QFCA 4TN5A 2I4IA 2Q9CA 4WY5A 1XBTA 1E3LA 2IPLA 2PUHA 2YWJA 2CBGA 4LPSA 3JQBA 2CUTA 4US0R 2SICE 4EHNA 5CB6A 4EFLA 1T4BA 3OFKA 4L5IA 3HXPA 4WOCA 3TBHA 3ZW7A 1KZ1A 1X1DA 1RAAA 4GAEA 4NMWA 3B1VA 3PNSA 1L5GB 4YQYA 2QMQA 3GUVA 3DDZX 3F49S 4S04A 1GDTA 3K0FB 3Q3IA 4S05A 4DBLE 4XLLA 3GZTB 3NETA 1GRNA 4G4GA 4O2AB 3H3FA 4E08A 1UKVY 2YWGA 2NV6A 4C4XA 5AVUA 1WXQA 1TKAA 1GPLA 2EKDA 4NPHA 4KX5A 2QRUA 5TQ0A 1P4RA 3FHJA 1CXZA 4XWWA 1T15A 2ORYA 3T3GA 3V55A 5TMEA 3RO7A 3ORYA 3QXHA 5BQ5A 4DC9A 3SZRA 5FOVA 4C88A 1JFSA 4UTPA 2YWDA 3GMSA 4C6TB 1U99A 3H97A 2HH9A 4BASA 5E1MA 1IRIA 3I9JA 4EHFA 2QQEA 1A8SA 1PWEA 4JELA 3G0CA 1N7IA 3TKYA 2GNOA 3GAFA 2BM8A 1MB9A 3PQ7A 3QYPA 2VQEB 4X6YA 5C8YF 2IGTA 1PFKA 3OZRA 1Z07A 3PZBA 2ECPA 3IP1A 1CZUA 2OV6A 3C3PA 4HNAB 1DT5A 5JH7B 3SQLA 4D9IA 3RVNA 4P3PA 1PT8A 3FIJA 1TMKA 3OIFA 1I1QB 3T5GA 2EDAA 4A1OA 1VHTA 1CZKA 4WUVA 4KPUB 4IF4A 2PUJA 1FTGA 1VLZA 1JTEA 3VR6H 3K0SA 3DVSX 4LRQA 4F6CA 4QLOA 4GF5A 2QMHA 4MRAA 1N3BA 3CNQS 1HEUA 1P33A 5T8KC 4IS3A 3RGWS 4E11A 5MFPA 3EGDB 3OEWA 3PICA 2YVQA 3SSNA 4A4DA 3T9CA 2V0CA 2ZYSA 3PGLA 4JQCA 5EMLA 4LRSB 5FWDA 5FUMA 2FWBA 1DIBA 1NVMB 1N2JA 1XD2B 1ES9A 2FQXA 3N3AC 3DTNA 3EWNA 3OEEA 4ZEWA 4A0SA 2A9PA 1WLYA 3N0XA 3VBEA 3H1PA 2JVKA 1N8KA 4TXLA 2MMGA 3R7FA 5IASA 3DTTA 3VU0A 4CIXA 2V7GA 1YK1A 2EGUA 4GG1A 3Q6NA 4U2KA 4Y98A 3UV3A 3MBIA 9GPBA 1C1XA 4OJMX 3GEEA 4X93A 4HYTA 1NN5A 5B1IA 3W3ZB 5A05A 1C7ZA 1L3BA 1EUDA 1VKZA 3K53A 3LHDA 3MUFA 2O14A 5EWJA 1JG6A 1VLVA 1XDUA 2V7BA 2VH2A 2XQIA 4RTLA 1BG6A 2I54A 4B2PA 2Q2NA 3FYTA 3HWX1 1NUUA 2REOA 2OHXA 3JYQA 4GGMX 4OFZA 1T0HB 5I7WA 4G01B 1P1BA 2CK3A 2X9QA 3M1AA 2VCEA 2C3UA 2BELA 2AMFA 2QLFA 4G1MB 2BFBA 2GBLA 3W9YA 4L0CA 1KH2A 3WDMA 3X2EA 4BFYA 3S2IA 3N39C 2E89A 4WASA 3UYLA 2AI2A 5IJ9A 1PW7A 3DOCA 4DC1A 3SC2B 3JU3A 1WRBA 3QP9A 3SDZA 3W2HA 4YCCA 1R0LA 2OGWA 3U4QA 5EXTA 1L4BA 2XVAA 3WGVA 1E4EA 1JU9A 1YQUA 1TI7A 3OIGA 4AWAA 2H5JA 1LF5A 1S3GA 3TM4A 3BMXA 4RSRA 4IQ0A 4P4SB 4XWOA 1M1UA 2WUEA 3Q7QA 3UJ6A 1MIOA 3QOWA 9LDTA 1EZZA 3WYBA 3P2IA 4PZAA 1NOIA 1L4EA 1GQRA 1QIJA 1VOTA 3SPXA 4RUKA 4KYTA 4QJ5A 3SGLA 4L6CA 4PX2A 3ZOKA 5HKKA 5KWJA 2WUDA 4N7JA 3O92A 4LSZA 1LI5A 3C3YA 1VKNA 2QLMA 4Q24A 1I7NA 4M0UA 4WZBE 3K0KA 5FR2A 3ROQA 3R7LA 3S1AA 4PYNA 2BKAA 4LRUA 3VC3A 2VDNB 3EZ7A 1PHRA 3CLTC 4EYQA 4MI1A 1H4VB 2PL5A 4MRPA 5HM8A 5L8VA 2H4HA 1XROA 3GWZA 1XRSB 2YV1A 1FDUA 3C0KA 3E1GA 2Y71A 1ECPA 1V48A 4KB5A 4II3A 3ZLBA 3HB4X 3A6LA 3DLHA 2R6JA 1IBCA 1YVDA 5DYGA 5FNZA 4J1SA 1SBHA 3DL0A 1UP4A 3JQGA 4BNJA 4DHWA 3EF0A 1GZ6A 2NZJA 3LWZA 2ZB4A 4UKDA 3WJ2A 3VOTA 1CR1A 4G1EB 4CJXA 2QDXA 4HZGA 3ASYA 1F06A 2REQA 3EVFA 3GB9A 4YQZA 3D0RA 1E6LA 3MFQA 3VMMA 4DGQA 3UMYA 1JV2B 3BMCA 2FEKA 2Q3LA 3MTQA 4TROA 2X9LA 1G64A 3U3ZA 4Z4GA 2RH9B 2Z5GA 3ZPXA 2HL6A 5JVDB 4GC9A 1FVOA 3UVEA 5HJ5A 4RO0A 1XDWA 4UULA 4OIFA 1N2ZA 3UZUA 4DCJA 3H4VA 4N7MA 3H5LA 4Q9JA 4OHRA 3RLFA 3P0JA 5CJPA 1ZD9A 2BEKA 3HEMA 2XV1A 3ENQA 4RU1A 3I12A 5DLYA 3HCCA 5CFOA 3I4FA 4R1UA 4MYHA 4URUR 1O77A 3OEYA 5KHAA 4MW5A 1EAMA 1V26A 2YR0A 4WESB 3ZHRA 1UINA 1LBHA 1H4TA 2NO5A 4P53A 4XXHA 3MILA 3BRCA 1TUEA 1EU1A 3ILHA 2VAMA 1PJAA 3K8ZA 3EXEB 1K5GA 3O1IC 5KJEA 3FB4A 1PR4A 2R8EA 3M3HA 4J2HA 2XTJA 2GRUA 3VSBA 3QTBA 1N33B 2ZSAA 1V5IA 4H0FA 2WRZA 4KQJA 4OV6B 5T67A 2OK8A 3T61A 3H2HA 4IO0A 4J8PA 1E2EA 1B8VA 1XDGA 1E3EA 2W6JD 3R3JA 3VQTA 1YQGA 4DMGA 3ZDQA 3BULA 2P2SA 3H3JA 5LQSA 4BO5A 1EMDA 3BWYA 3OICA 4OEHA 4QYSA 2OLKA 3N28A 1U8TA 3DAOA 4RDCA 4C6TA 4D43A 2X8AA 1ZXXA 2P68A 4G5OA 1FE8A 1IQUA 4I9GA 3OIVA 4OFBA 3BIXA 5EY5B 4CU5A 1T6YA 1G66A 1T13A 2O3RA 3X3HA 1N5OX 4LY0A 2YIMA 4CF4A 1NFRA 3KU1A 3KB2A 4FNGA 5LP1A 3W1VA 2JFHA 4AJKA 3CUYA 5KX5F 1KOGA 3NZEA 3P4YA 2Y2VA 1FFAA 1U2SA 2OBFA 3SAJA 1IN4A 1RPNA 4HNVA 1CEEA 2BKXA 3LY7A 5DWDA 3ZNOA 5JXGA 1O08A 2P1ZA 3FWNA 2JI8A 3D43A 5G3ZA 4PICA 2DGDA 4UFNA 2RD2A 1NX6A 3KAJA 1DC3A 5HKBA 2QJRA 3D2CA 2C61A 4KZPA 3FRHA 4JNCA 4PRLA 4HKTA 4X60A 3CTMA 3PKJA 5K8IA 3VV3A 4DMRA 5THQA 4FPXA 2JAWA 4F21A 5H7XA 4MX8A 1GQ2A 5JS6A 5BNZA 3N8KA 1SOUA 3EGDA 4GR9A 3C8MA 4BGDA 4EEKA 1EEHA 1J2UA 2C4MA 2PPLA 2WEKA 3CJTA 4I55A 4HTFB 3NPMA 4J0KA 4MVJF 2GPNA 4TWAA 4Y1FA 2YQZA 3TIVA 5JI2E 4YMSA 5DO9A 4Q3BA 3UXHA 3NYRA 3DJFA 5IYZA 4BFXA 2VJOA 5AUPB 1ZP6A 3P19A 4HH3C 4HMQA 5HBGA 3VDRA 3P2KA 4QVIA 1H3NA 4OPMA 4URYR 3MJTA 4YJ3F 1OB5A 4JGGA 4M0EA 2NP7A 2ZIXA 3BDIA 1T9AA 5CVEA 1QP0A 3OTWA 4F04A 3VHQA 1CX9B 3I8SA 1MX5A 2IUYA 1P44A 1WM1A 2YY6A 5D6NA 1XXHE 1EVIA 2PMCA 3HRKA 1HNZB 3ESBA 4ODIA 3EXFA 5EZ5A 1HG1A 2A3NA 2BISA 4J4HA 1LVUA 1N57A 3RRJA 4BVJA 3KETA 3M1YA 2WWVD 3GELA 3IC5A 3ABQB 4XUCA 4BX0A 2BZ1A 2PR7A 3OWXA 1WD7A 2WOJA 1DAFA 3COWA 2C0PA 4NJMB 1KZ7B 1P4AA 1PYGA 3WR5A 4DDWA 3N86A 4KG7A 3PT5A 3QEMB 1KI6B 3OPNA 1S89A 5FKJA 1G5HA 1U28A 1BRMA 1N2BA 2FP4B 2WNHA 3NHWA 4KVFA 1VB3A 2IYXA 5JNVA 4DR1B 1P2VA 2GHRA 4U7PB 1JAZA 1JHYA 2YOFA 3O83A 3THRA 3UPDA 4B2LA 1G5TA 3W2TA 1FMJA 1HQCA 1LK5A 4FYMA 3CXRA 4AROA 2OGSA 3L43A 4ZVVA 4MV6A 1KI9A 1Q7RA 4GZ3A 2IZOA 4KWEA 4ASUA 3H9QA 5I3CA 3A58B 5J1SB 1OH7A 2VAXA 4B35A 3K16A 1OU0A 4EELA 1ZPDA 1NXTA 2EZUA 1NF9A 3ZWWA 3IIIA 2NWQA 1EA5A 2WT4A 4QJIA 4RD2A 4CKCA 2Y1GA 1UZLA 1BX3A 1G8FA 1KARA 2IPOA 4MYTA 1P6XA 2P1RA 2GBIA 2V7VA 4W1QA 2NNLD 3DWFA 3D0OA 2NU7B 2MTBA 2WMYA 4RQUA 3CNEA 3HB9A 3T7DA 4IJUA 2WE8A 1K3UB 2XH8A 5EJEA 1H9BA 2AX4A 1EWRA 3K09A 3QA9A 3QKRA 3WQSB 1WUYA 3VJKA 5JD6A 5BV0A 2YOHA 4JBYA 4QUIA 1TJ3A 5IARA 3QUSA 4UZFA 2OG2A 5AJTA 2GGSA 4H2DA 1U7OA 3H6KA 1RABA 1U3FA 4OHYA 4GI7A 4Y0AA 2WSSA 5F4ZA 3U3JA 3L6CA 3IOMA 4RGQA 1FVHA 5F73A 4NZYA 2DKNA 4YV7A 2OP1A 5JSZB 4O4IF 4DA4A 3QVGB 4MARA 4MQ5A 5J63A 1CB0A 1X0XA 4PTYA 4WERA 3H2YA 1S9HA 5IM5A 3PJEA 1SEPA 5EJ6A 2Z6UA 1FOEB 1MVNA 1Z5PA 2Y9MB 3BORA 1FDIA 3D3KA 3ZJ5A 5LN1A 2X1VA 1RLOA 1I7LA 3PHLA 1ACLA 2HIMA 4K8OA 1E60A 3WKAA 5BUZA 1OH5A 2C5BA 1ONSA 1VMKA 1YD7A 3AESB 4PCVA 3SP1A 3ECCA 3OLYA 5KIAA 2G1PA 4OTZA 3UK0A 2C94A 2F43A 1DV2A 1A50B 1ZI6A 4QFBA 5G53C 5TMDA 3AR4A 2YX1A 2WA1A 5IN5A 3DAPA 3TFWA 3CNOA 4RMGA 2GLXA 4L5BA 1G1MA 1UK6A 2HX1A 1VFPA 2QYOA 5MDHA 5JUWA 4WZZA 5K3OA 2IOYA 1KI1A 2WYUA 3R0VA 3K15A 2HCBA 1YFZA 1QQBA 2EP7A 1BVRA 3B5JA 5K03A 4WL0A 4Q34A 3E9YA 4K88A 1DWOA 2ZVQX 3NHFA 3QEAZ 2WF6A 3BCUA 1QCCA 4TTRA 4LWZA 2XUGA 3B1WA 4FYVA 4NESA 3O2QB 5KAPA 4GKVA 5BQOA 1Z38A 1WPRA 2DPHA 1D03A 3AINA 3HV0A 3NQ41 2H1IA 1K5PA 4CN8A 5DGTA 1HDYA 1WSBA 3B7GA 3G2JA 2FB9A 5DWVA 3ZWKA 4B7AA 4ENSA 1ECLA 1Z0SA 4L95C 2ETXA 2BMAA 2FDRA 3ML1A 5TDHA 4LFCB 4CHTA 1TUBA 3HYSA 3SM3A 2MYPA 3CNLA 1SULA 4WKCA 1DKOA 2V7UA 1X38A 1K86A 3KR2A 1RIFA 1WTCA 4MYDA 5DB4A 5BNWA 1OAAA 1DBIA 4MP3A 1G38A 3M81A 1JYFA 2A7XA 5DM0A 4EOGA 2AOUA 3NWOA 5FL7A 4U2CA 5DHFA 3DE0X 2PX5A 5FJIA 1O5OA 1Z88A 5TJHA 4M8KA 3G82C 4GE0A 2QUZA 4V3CA 4YS6A 4HYYA 5K3DA 5GADl 4IQ4A 1W1IA 2PRKA 4ZD6A 3IE2A 2OQVA 4GOND 1KQFA 4TLLB 4PPQA 4ER5A 3RBVA 3CB4A 5C5DA 3OCWA 3WFJA 1I30A 2O5CA 4RL4A 1INLA 1N5LA 1NN0A 2NUPB 3CH4B 1USVA 1EGHA 4ZO4A 1QIDA 3NHJA 1XZDA 4RLQA 1SWVA 1G8MA 2IWHA 2ZRJA 4L7VA 1P7VA 3MF4A 5D8DA 1WPXA 4BVEA 5K0GA 4RADA 4GMFA 2Z4SA 4MEBA 2HO5A 1POXA 1RHRA 3DOEA 4XR4A 3A6ZA 3ROEA 5K6RA 3TG2A 1AK1A 1NNSA 1PIWA 3OPYI 4IUCS 4N3AA 1J24A 1L3IA 4GMHA 3ROPA 5KVSA 4JXXA 3UAOA 3V6MA 2XB6A 3NB0A 3GG9A 4KR0A 4PIVA 3UQZA 3EEOA 1H2AS 1G16A 3CWZA 3N59A 2IK8A 4GC5A 4MKRA 4TYQA 4YN3A 3DOFA 4DZZA 4EPXA 3CT4A 2QG6A 5EJAA 1WOMA 1E2UA 3DXFA 5GVRA 5JDIC 4GWGA 3VYVA 2A9VA 3GT7A 2M9MA 2WSYB 1KIAA 5KQLA 1X1AA 3VR1A 2NSJA 2HCFA 1JR3A 2G17A 3LCCA 4CTJA 1MHTA 1V9LA 2OFFA 1QGYA 5FFNA 5BWLA 4F4DA 1TX4B 3F6SA 2MOKA 2JIPA 3GXBA 4PG4A 4WECA 2QY6A 4PHGA 2Q8PA 3VKFA 2WTUA 3QEMA 2ISCA 5JRJA 5K5EA 2H9YA 2FQQA 1AXGA 3II6X 2VWPA 2VL7A 5H02A 2PX2A 3B3JA 4DV0B 2JJ8A 4M0FA 2AR9A 4R40A 2UYCA 3BSFA 3A05A 1COZA 4KXMA 5ED0A 3DEIA 1LPAB 3L4JA 3BWXA 3KJIA 2VDPB 2G6BA 5FOSA 4JI2B 1W6UA 5E2BA 3SYTA 4FYPA 2VJNA 4HMPA 5HR5A 1XMQB 1PZXA 1V39A 3WLTA 2XMRA 4YRGA 5TQ2B 2GCEA 4CRWB 1RI5A 1OJ7A 2WA2A 3K94A 3TNDA 1H2ZA 3LYUA 1LDMA 4HLUA 3HBMA 4F8JA 3C8HA 3AU9A 1PVDA 3PK0A 1GNRA 4I8DA 5BO5A 3RC3A 4Y6LA 3EUFA 3KR1A 3K5PA 3ACBA 4R9VA 3WGYA 1ZD8A 5BYBA 4MKXA 2FMXA 4UE3S 5IVKA 5JO0A 3BFPA 4M88A 3K1AB 2C1XA 4H7JA 2GR9A 4N0EA 3F9RA 3WIVA 3KEGA 3BK7A 1TF5A 1NC1A 4KU4A 2QU7A 4G9GA 3BBLA 3T8YA 3VO2A 1N6HA 1C1HA 4ZGBA 4GX1A 3HDJA 2NV0A 3R4VA 2IV7A 3BC1A 5I4BA 2HAEA 1T6BY 1Z4MA 1RW4A 1Y1PA 2HRDA 5J2UF 2DB3A 3SZLA 1WZEA 1CQPA 1XCOA 2GF2A 1OFUX 4R1LA 4B79A 1LVHA 1R3UA 3BZWA 3MB8A 1Y9ZA 2CUKA 4QYMA 5IKPA 4BPRA 2OG1A 1Q5PA 2PUGA 4OQPA 3BERA 3PZRA 1FLVA 1M2GA 2G71A 2HRZA 3GLHE 3M4ZA 4HX9A 4BE7B 3AJDA 2R7KA 3SXUB 5B57C 1R5JA 3LRPA 4DJJA 5AVYA 3ENWA 1A5BB 1QRAA 1XD9A 4ENTA 4K6MA 4KSYA 3FNGA 2ZVDA 1T9BA 3M89A 3V4LA 1AV6A 3GEBA 4D9JA 3EFEA 4JITA 3FTCA 2CJPA 4HDNB 2PPVA 3NIWA 3F46A 1ZGBA 2V0GA 3ZD8A 3U09A 2JVJA 2C3PA 2C7RA 1N1MA 2ID8A 2JLCA 3NNNA 4LRTB 4M1OA 3ZLUA 3SMVA 3AYZB 1NVFA 4E5VA 3K9BA 3TX2A 4EW3A 1LRJA 4UPEA 1DRUA 3ZZNA 1IG0A 3SLKA 2VTEA 2ZB2A 3SYMA 3MJSA 3H83A 3NHYA 4TRJA 1FFHA 2YVKA 3I53A 2OO3A 3R3XA 3BAFA 3WKCA 1HFJA 3EUWA 3KQYA 3L9WA 3BB4A 4H9GA 2J9YB 4CXMA 3BICA 4OGKA 1Y8ZA 3BG5A 3WXMA 4KCGA 3IXMA 5LYJB 2V5AA 4PFJA 1GPBA 3JZAA 2A5DA 5EJFA 1D7OA 4CM6A 3FCUB 3UMCA 3JWJA 1DINA 1GIAA 1DAMA 4KTTE 5ALJA 1OXBB 1L7XA 1R6XA 1YA6A 3QSGA 4U2EA 2ZROA 1T35A 3GFPA 3OJLA 5BMVB 1G3QA 1H1LB 4KXFB 4L07A 3ZV5A 3SY8A 5EPEA 2HBQA 1T6XA 3WGMA 5DNCA 3F9IA 5LDDC 5AIAA 4J6FA 4HCJA 4Y1GA 4AFNA 2Y1WA 3L6EA 2H3HA 4ROSA 3IH5A 4E31A 4YPVA 4XZ3A 1CY4A 1NUHA 1XNJA 2NO6A 2QPAA 2UZ1A 4MB6A 4WDRA 5GAJA 3ZK8A 5ITWA 5GVSA 4OD0A 3TTVA 4EEZA 1GWNA 4WXPA 4H0CA 3RYHA 4F1JA 3G13A 3IMEA 1AZLA 2GO1A 2VNAA 4X1KA 5L7TA 1QRSA 1LTKA 1ZUNB 2E6UX 2J9RA 1U2RA 2GO7A 2HTEA 3D59A 3K4HA 3OM8A 2CKMA 3PC7A 3QELB 3WB1A 5GOTA 1UANA 4XKJA 3QXSA 5E6UB 2HLDD 2V98A 3LY9A 2X0EA 4PN7A 1TYBE 2DTDA 5C8ZA 3N9IA 1RXUA 4EAQA 4HL6A 2X3FA 2GCNA 4LYEA 3RCBA 3E3NA 4A8PA 5CA1A 5K0LA 5AW8A 5HKLA 4FS3A 1CVLA 5GPBA 4BX8A 4V0RA 3NYIA 1E9FA 2ZYUX 2IXAA 3JQFC 2R6R1 3LOPA 5G1PA 2VHZA 2CEAA 3EVZA 4X7MA 4B3BA 3KR0A 4AYWA 4MWSA 4CQMB 2ZM6B 4OFWA 3GZNB 2UZIR 2A88A 3ER8A 2J0UB 2BP7B 3PQFA 4FLMA 5JYDA 2JRCA 1TGVA 2W2KB 3G9XA 5FUQA 2D2EA 5AHRA 5LNK6 1BQ3A 3DBLB 3HWRA 4AB1A 3CZPA 4R9RA 4WSOA 4FHGA 2CYAA 2WSLA 4KDEA 4XYEA 4G26A 3ULKA 2O7SA 2Q9AA 5IABA 2F3QA 3TCXB 2ZSDA 1E4YA 1IH8A 2Q2VA 4M9XA 2QUBA 4TLDA 4MVJE 5FPHA 1ATZA 4CM3A 2PT9A 1AB5A 4DEVA 4FQ7A 2NG1A 4XD7A 2WSBA 4NBWA 3K0AA 3RG2A 4OOFA 5T3YA 4LGYA 3GFGA 4UNRA 3H2GA 5KTYA 3HY4A 4CKWB 4PAGA 3JVUA 4KXNA 1DTWA 1XYYA 2VJPA 4ER0A 2PMKA 4FYIA 1XRQA 4BNGA 4EUHA 1PU2A 4FZ3A 4RIHA 1F14A 2NSLA 2FN7A 4ZWNA 3PEVA 1CERA 3M6LA 3PGJA 1R10A 3DMHA 3OM0A 3MMXA 3D6JA 4B73A 1F8GA 3EJ6A 5JBNA 2OSBA 4ZVTA 1OSNA 1MOPA 1SIUA 3BUSA 1R74A 4TRMA 5M5BA 1NBME 4JVOA 2JFQA 5D84A 5HK9A 4YP9A 4MMZB 2YWBA 1QG0A 1UBEA 1DWQA 1UPUA 4MV7A 1BXGB 1KAHA 3UJHA 3H1GA 3HACA 1Z25A 4JOCA 3W8RA 3D02A 1CJMA 1JEOA 2RG1A 5TV2A 1GCGA 1E0KA 4JJFA 2BRUA 4L08A 3RWOA 5AW3A 3OOJA 2ZK7A 3LG2A 5LU9A 3VNUA 1J1UA 3N0VA 4R8RA 4DM3A 1ID8A 2M32A 1JBKA 1A9RA 3ZI7A 2DBVO 1T0PA 1EWQA 2ZIZA 1I3LA 3Q7IA 3A9UA 3EH1A 4YQFA 2PGJA 2O7VA 4FZRA 5LYYA 1UDXA 3EXHA 1RFLA 1RRMA 3AEKA 3MN1A 3RFTA 3F4KA 4IDHA 2WIFA 1BH2A 3W05A 2C1ZA 1MJGA 2AD1A 3R3YA 5JCJD 2QVZX 4QHTA 4YA6A 2XDQB 2QN7A 4JSYA 3FBTA 1N0IA 3FPKA 2FMUA 3E53A 4ZDWA 3VGJA 5HZHA 4DSTA 2X5OA 3I23A 1TKRA 5LLTA 3MVEA 1RHUA 1YRWA 5BSUA 2TSYB 3VPAA 3RTCA 3GFBA 3I3OA 1EYZA 4GR5A 2G8LA 3C6KA 3CZ5A 3PHCA 5AXAA 4E33A 2HHHB 2NVOA 4HDAA 4DUGD 1Y7TA 3FB1A 2GVZC 2QN2A 3VYTB 4BNZA 5LZ9A 1D9ZA 2HRQA 3IQIX 5JTTA 1KGDA 3M33A 1XLWA 4A5OA 1H8HA 4UU0A 1H1DA 1V7QA 4V1CA 5IBPA 3FLBA 4UHFA 3P94A 1LF0A 2JGEA 4Q0MA 4PZPA 1CZRA 3WLRA 3FOWA 4LECA 3IPAA 2VHCA 3QE4A 1T9DA 3CSDA 1OLUB 1E2BA 3RTDA 3U4MA 4EVIA 1TUIA 2RK6A 3KLNA 3G68A 1HYQA 1TNDA 3GGCA 4UU8A 1LZLA 2AFVA 2WJZB 3AFNA 3O21A 2C4KA 3QHPA 1GKYA 4FMCB 4YXWD 1XTBA 4IGEA 1GGEA 2IPNA 1PFQA 2ENUA 4DKJA 3EFHA 1TC1A 2C42A 2IEBA 1QE5A 1LW7A 1QFXA 1AF7A 1KJNA 3C3WA 3HKEB 2C83A 3IBYA 2D3TA 4J0QA 4MIKA 2DE0X 3RYHB 4UMVA 3U3XA 2Z04A 4CI9A 5HJEA 2JG3A 5EVCA 2O7QA 1J56A 2OBMA 2YJ3A 2IDZA 3CPSA 2PL1A 2VDVE 3GRKA 2FDXA 3TL3A 1XRPA 3L7KA 5ILQA 4KQCA 3O3OB 1O03A 3IXLA 3KPYA 5C3UA 4X64B 4PG8A 2OHIA 3OQMA 2E5WA 3LC0A 4FDVA 3KSBC 1L7PA 1WP4A 3OT4A 2FWJA 2PFKA 1WQ1R 3WYCA 4BKQA 5HE9A 5BW4A 621PA 2V6FA 3C87A 4R83A 1DMRA 4PAWA 1WF3A 5IKOA 3EFBA 2V8OA 3FDFA 1W46A 5A4KA 2GASA 5KYWB 1O87A 1P2TA 1G3IA 2WM9B 2OZEA 4GMKA 1ZGHA 4RYLA 4HBGA 1ZMOA 1C1DB 4HDSA 4FB4A 4CDNA 3EWAA 4F3NA 4E94A 1GTMA 3GFFA 2OMKA 3GFQA 4FMPA 2ZANA 4GPIB 3EG9B 4QOSA 5D01A 2X8LA 5UKDA 4KW7A 1NNEA 2P40A 1YCHA 4B1FA 4YIKA 1UL1X 2C99A 2VYND 4RMHA 2WMNB 4K3VA 1YZUA 4FD3A 4FDTA 2B4KA 4G3XA 4PHCA 2V9ZA 4R9SA 1ADGA 4HDOB 2QR5A 3WJ7A 1Q74A 3ZVRA 4D80A 4PHFA 4EIWA 3GLSA 1JZSA 5BSFA 1ZUNA 4OQNA 2HCTA 5F1KA 4QJ3A 5BOSB 2I4NA 2XMZA 2CHVA 3DO6A 4CPDA 4Q4JA 1MRNA 2FW0A 5E6UA 4ZVLA 2J5QA 2IV2X 1X9HA 1GG5A 2JD0A 4QBHA 3OZVA 1CUAA 1YUMA 1DE0A 3A1FA 3MERA 1VBMA 2PGNA 2Q6KA 1R0WA 1QRTA 4X95A 3ZS8A 3ZVNA 4LMAA 5ALDA 2QW8A 1MR3F 4ZOAA 5KOHA 2J0UA 2PO5A 4B7ZA 3HN7A 2QZ9A 5BORA 3AB3A 2W2KA 3BJRA 4YAEA 4DG5A 2AG8A 2PFSA 3E22A 2R6GA 2FWNA 2XKJE 3CH5A 4QBFA 3QF4A 4PTZA 5HUQA 3O2NA 1QYIA 4ZQEA 2EL7A 1TW2A 1Z0JA 2G0AA 3OT5A 4IG4A 4RYDA 2CVPA 2FGKA 5ARDA 4MR7B 3K32A 3LMKA 2Q5JA 4LGVA 3CZRA 4E4RA 1QP4A 4MWZA 2HSGA 2HJGA 4CMJA 4ES6A 4RTOA 1ZW1A 5A2QA 1LDEA 2RB5A 1HNNA 3O6VA 4G24A 3SEZA 1PS0A 2D1RA 3W6PA 4D92A 1XRJA 1O96B 4RHFA 3FRJA 3F7OA 1WTAA 1LBEA 4PC2A 4GL2A 2Z8YM 2XEXA 4EJ2A 5K9ZA 1K0UA 4BDSA 2V96A 3R40A 5CFMA 3PUWA 4X3CA 3QV1A 1R9GA 1Z74A 2B8TA 1O54A 2VDOB 3BZBA 4X54A 2ZUTA 4DQKA 2ZUVA 1CRQA 2XA9A 3A6KA 3HJNA 2EJVA 3O4FA 2LV8A 4U5QA 1HNWB 2D13A 2FR8A 3OOYA 4B3FX 3PJRA 4A9AA 2ERCA 4E6PA 3U62A 3LXXA 3UYKA 5DNDA 1LC0A 3HO1A 3NJRA 3BIJA 3G8DA 3KE8A 3M4YA 1M2OB 1W76A 1EWVA 1D1TA 2J9GA 2QTCA 1S2NA 3HRIA 2HMYB 1TAQA 2YHSA 4TSFD 4BNXA 1I4EB 2H1CA 2P6MA 3OQOA 4XM2A 3WIBA 1JFRA 1N1DA 5CTJA 3T15A 1BMDA 4WGFA 4JKYA 2Z9CA 3W4IA 2V7XA 4KAJA 16PKA 1HPLA 2P35A 5E6RB 1RTKA 3WOVA 5BPFA 3RFXA 4G07A 3P96A 2ZDHA 3QFTA 4KEAA 4EX7A 1XJ0A 3DZDA 1PFUA 3QYAA 1KP2A 3WLEA 2AZDA 2WZBA 4B87A 1N6PA 3BH7A 4YDSA 5K4HA 1CEXA 2O1XA 3I32A 2ASVA 2CHQA 5GZ1A 4JL5A 4Z1MA 1RMTA 3PC8A 2P9TA 2ZZMA 2XDQA 4OH7A 4RDIA 4EJSA 3AVWA 5HF6A 1U3WA 3IOEA 3WK7A 1DBWA 4TX1A 5ESDA 4BQQA 3R3HA 4J0DA 1Y6JA 3R24A 2GHQA 1NBIA 3CZ4A 4FN5A 3F74A 4KQIA 1DAOA 2PBZA 4A0GA 3WBBA 4INZA 3PPVA 2Q3DA 1P31A 3JQPA 1UEIA 1ZOPA 5L4SA 4DNOA 3NALA 1Z6XA 4FDUA 4IIEA 4MJ7A 4QKQA 1WULS 2ODBA 1OQAA 1L4GA 1G3RA 3PYXA 2P8SA 5JAMA 1ZUD1 2EWVA 2RKBA 4CLRB 2UZ3A 3WP0A 2X2FA 2LCQA 1K27A 3H2BA 1GCAA 1Z3IX 2VP0A 3CN7A 3OAAD 4JUAA 5LP6A 1GT6A 1I5RA 1N1EA 1PJ8A 2HGSA 3TTSA 4R3WA 3TUZC 3U2QA 5K4GA 5JVDF 4RTRA 1JXMA 2BEUA 2O07A 4YR7A 4R7TA 1PGNA 2CNDA 3I83A 1ZZGA 2RGRA 1DPFA 3TW4A 4L8LA 3O90A 2EJCA 2C3MA 2WJWA 3M2TA 4WAUA 1SEVA 1Z7EA 3IQHX 2PUTA 3ILXA 3LHIA 2DBYA 1W2WB 2PLRA 1F17A 2FA9A 2QZPA 3P32A 3SLGA 4KPEC 2Q27A 3I58A 1ISHA 2EDCA 2R00C 4GP9A 4DSAA 3W04A 1QANA 2M6LA 3RRMA 4Z7NB 1V8FA 4FS8A 4G0YA 3ZZMA 3R77A 3PUZA 1TA9A 4CKXA 4F8YA 4QUKA 4Q9HA 3ZH9B 1L5KA 3FOZA 1R4NB 1V4BA 1G8YA 4WBNA 1IFXA 5TS3A 1JEEA 1XTQA 4ND2A 4E30A 1PR5A 3I73A 3KZ1E 4Z4FA 2VC2B 1DKRA 3N0WA 1HNXB 2V0NA 5EN4A 4I3HA 3RYFA 5CUQA 2CVHA 3GL9A 5DW3A 5TEVA 1HQDA 1EHIA 2A78A 4FT2A 4HEA1 5LZ8A 3U48A 2QSUA 3S4YA 5A6VA 4Y6OA 1JDTA 4XVUA 4EUFA 5ADVA 3BGWA 5FIUA 3UT5A 2IYNA 2PDAA 1KI4A 1G17A 1SHTX 3DBRA 1KMCA 2CE2X 3LU1A 4RESA 1OYWA 1Q0HA 1BXRA 2QUJA 4ZXPA 2P2GA 3T1OA 1QVZA 1TPYA 1X7ZA 4GYJA 5A4MS 5E95A 3ZY3A 4PU0A 4PLHA 3NR2A 5ARCA 3WLQA 1GN8A 2NVWA 3FOAA 5EKXA 1SB8A 2FPKA 4BPBA 1VCIA 2VYVD 1JHMA 3PLRA 2FLVA 3PQCA 4TV8A 2O0KA 1SA0B 4JN6B 3V1MA 3FR8A 3HXKA 1YL6A 3O82A 4P36A 1JI3A 3L7OA 3RARA 3X1MA 3KQUA 3AR8A 2IEZA 3WGOA 4B3TB 3E3MA 3MGKA 2RHBA 1U0GA 3COSA 3DMFA 4UD2A 4RACA 2BZSA 4V0OA 1C8BA 3DT8A 2DUUA 1UP7A 4RY9A 1UWKA 3QE0A 3FFXA 4BVBA 3PVCA 3WADA 3GBVA 5K3EA 4ZAXA 3T3EA 3BVPA 1ZH8A 3AOEA 3T5AA 4LHZA 2GCIA 3G88A 2B35A 3P9CA 4Q7LA 3D2BA 5GP1A 2VSFA 3CZCA 4KMRA 4RX1A 4PSAA 2BEWB 5CAEA 5IZ4A 3HA7A 4UQOA 1SQGA 1NQVA 1DAHA 4LCBA 5A71A 3I62A 1GPDG 3NHPA 3ZBUA 4RE6A 1RQPA 4C7OB 4B31A 4LZAA 1E2NA 3A9TA 3SFTA 5DSTA 3TQSA 4DA9A 1QDEA 3FETA 3I2JA 4UUBA 1N36B 2M2IA 1IPFA 4MR7A 3SG0A 2P2ZA 3WMRA 3AY7A 4FYKA 1H94A 1X3LA 1VIMA 2EF0A 2C8VA 3H2SA 1WETA 2PZAA 3EAQA 1I5EA 2Q4OA 3H4IA 3URKA 3ZE9A 2QX6A 3RUPA 2C9MA 1VJCA 1VHWA 3RFFA 1SQ5A 1UAAA 3ITKA 5FWXB 4ZU3A 1O96A 2MSNA 1KQGA 1OF1A 2CLOB 2DPLA 1W8IA 3JTMA 1DXQA 4MKGA 1Y3DE 1RYYA 1W34A 1BE6A 2AS0A 3PD1A 1IATA 3GJ4A 1NMSA 1MO4A 2FZVA 2MSCB 2QTRA 4GSYA 4OHVA 4X45A 3S27A 4IGAA 4WNIA 5JAUA 2YN0A 4Q3AA 4UM7A 2PCJA 4NABA 3DLCA 3OZXA 1IMJA 2WPDA 1A82A 3C6QA 3BZUA 3NM5A 1OA1A 5E7QA 3WWPA 4YYZA 4NU8X 2G70A 4GE3A 4QG3A 2H59A 4QUDA 3WOHA 3DZ8A 1YRLA 2RGNA 3FPBA 4OUDA 4WLFA 2FPPB 2W6JA 2XVZA 1ULUA 1ODSA 3FNIA 1M6VB 3HN6A 1B8OA 3RSSA 1X7WA 2IIQA 3IPXA 3A4TA 4XD2A 2XNJA 5FBWB 3RVSA 1ZAYA 5AWFC 4EZEA 4RL6A 5C32A 2PSDA 3PC2A 4AKEA 4L27A 3FXAA 3B6IA 3AVPA 3CVJA 2FPWA 2C77A 4HK4A 2WAYA 3EVBA 3AV0B 1WZCA 1URPA 1E3DA 3HZOA 4KUGA 2I62A 3CRZA 1W1UA 3MJEA 4IR7A 3WWYA 4CBVA 1VKHA 2HHCA 1DG3A 1M2EA 4WFKA 3N87A 4RSHA 2W43A 4G5GA 1WJGA 1T2CA 2P5UA 3KDSE 3BE8A 4D4MA 5C0OE 5LIPA 3Q8LA 3OX4A 4MYUA 5IULC 1ZZEA 3LFHA 3TI7A 3T3DA 4CV1A 3QJYA 2GH1A 2KX7A 2L69A 1Z29A 5F2EA 2RI1A 1ISGA 2XT6A 5LBTA 5FBVB 4KQWA 1KZYC 2I55A 4YJGB 4PQEA 3LT2A 1N6KA 4LBWA 5BSRA 2CSXA 2QLBA 3CRW1 1QU2A 2UUCB 3OQ1A 3B9PA 1GP2A 4HRXA 4NJEA 3HVRA 3I6IA 2GAOA 3FPLA 1SD5A 2AW5A 5BYKA 4BO7A 4X6UA 1BOOA 1VP9A 2G5GX 4PYJA 1HDOA 3MNFA 4RA9A 3I0ZA 4AG3A 1KAGA 2XDWA 2HO4A 4RJKA 4UHJA 1ECJA 4YRBA 4OHFA 1JQDA 4WGGA 1Z5WA 4LZNA 5EJMA 1H2HA 4WKBA 4YRMA 1QKJA 1IJBA 2D2FA 1ZCZA 3KB6A 3AVOA 2XMBA 1Q92A 4HFRA 4KDCA 4HGOA 1GEGA 3EB9A 3IMKA 3QWHA 4C6HA 2YWXA 1RXSA 3F67A 2Q29A 2WKQA 2VF4X 3N3BC 4M0DA 2H8KA 4QUJA 1VHJA 1SD2A 3G5AA 3MLEA 5J4YA 2FCAA 4V24A 1U2PA 5TX7A 5AKKA 1T9ZA 3HYCA 5IT0A 1ULTA 1R8YA 4PCLA 4G8JA 3UG6A 2XBMA 1BVUA 1US8B 3LKDA 2QQFA 2PRSA 4MQEB 1OXSC 1QV9A 1N5DA 1WXDA 2HXYA 2QI9C 4LHSA 2H57A 4MS4B 4PRZA 4Q05A 3ZDCA 1T1GA 3E1KA 1R4NA 3WGGA 3EC1A 3NH9A 4NPCA 2ZRDA 4KKVA 2PN1A 3U7RA 4TS1A 1U3GA 3DULA 3T5TA 2J30A 3ZI0A 4JB3A 3EGEA 1ZRNA 3SS7X 4HLCA 3C3CA 3WTCA 2YVLA 3ZUPA 1YONA 2GUWA 1K7FB 2NM0A 3I2IA 4O4JB 5H70A 5B3AA 5T4BA 4BLWA 3PDUA 4W5RA 3TEJA 2YYSA 5A0VA 5KYYA 1G20A 4CMKA 1B0ZA 1YI8A 1FS6A 4UOQA 1W5AA 2ZJ7A 3D4BA 3V4FA 5C51B 2BHNA 4PZCA 4RMNA 4YAOA 1VMIA 1Z37A 5EP2A 2C4TA 1ESDA 1EP2B 1P0CA 2B61A 2H51A 3CYFA 1RLIA 1XZIA 2DH5A 1IEXA 2E87A 3DPSA 1ISPA 3QBEA 3FOBA 3ZX5A 4N76A 3G5LA 1P19A 4LTDA 5J4VA 4QPZA 4H59A 1QTIA 3DVLA 3EQ9A 3QMWA 4OKSA 3WG9A 3MWLA 3TQQA 3VO8A 4FFLA 3R76A 3CVVA 2R5WA 1DAKA 1JDZA 4MQUA 1ZJJA 4MHSA 1KRHA 1VZ3A 3RKUA 3VR4D 5B7QA 5JW6A 5C53B 2VK8A 1SCQA 1JLSA 2I6FA 3AKZA 1ADFA 4K9SA 2VDUE 2C2OA 3WWDA 3RVJA 1L6RA 5CA1F 2AOVA 3QIVA 1CJBA 4BN4A 2FSVA 2IIVA 2RCYA 1FUEA 2X5KO 3HUTA 4UC0A 5I8WA 2UXBB 1IVYA 5FI0B 1SKMA 2W22A 2QE6A 4LN1A 2D5IA 3R6GA 3OFND 4CMAA 2XWBF 1R18A 2F1RA 3WZ2A 3DCNA 4MPJA 5HKAA 5ALZA 1CY1A 2G0NA 5FOWA 1RYFA 5KUTA 1XZCA 2QTVA 2H1HA 3QLEA 4J3FA 521PA 5L40A 3KKNA 1YB4A 4Y9SA 3U0VA 2H63A 4UASA 3PXEA 4X1YB 3K6RA 5F4BA 3WI7A 2HQOA 4CKYA 4DVJA 4OHZA 2IHYA 5H9WA 1CDEA 3GHYA 1OV4A 3W90A 4ER3A 1H0HA 4OH1A 3GY0A 2CB0A 2XXJA 2BBWA 3R6LA 4KXVA 5FT9A 1B6GA 1IN7A 4M9RA 5FULA 3KTOA 4G56A 1N3YA 1QS0B 4M9UA 5GWXA 4CLOA 5KREA 3FKJA 3UKDA 1QYVA 4WOPA 1PG5A 1W87A 3IKJA 3LQQA 1KKLA 4QYTA 3QEKA 5SYAA 3JWGA 3BQ9A 1L1EA 5CGQB 1KQNA 1SUWA 2G36A 1ZESA 2GZSA 1SPBS 3KXPA 2XUHA 1R15A 1L7MA 1T2UA 3F73A 1M83A 2ZR0A 2Y0CA 2HV9A 1KMHB 4QXRA 2BR3A 4ANFA 2Q45A 3IBGA 4B83A 2J4DA 3EWIA 3TAHA 2YRXA 1WMEA 3ES9A 4CQMD 4AZVA 2I5PO 1E63A 3H11A 3ZXSA 3MFYA 2BLLA 5I9NA 2GD2A 1L5LA 2FMFA 2AQHA 3JD0A 4NOKA 3KJXA 2QD5A 1MF7A 4FHZA 5F33A 5FO0A 4DIUA 4QU8A 2P9BA 1IZ9A 4QASA 3OE1A 4TTAA 1RAHA 1ZCBA 1G21A 2B1RA 3LBIA 1UKCA 3ETNA 3F6CA 1OLOA 3QU4A 3A1SA 5CLQA 3ZCTA 1H05A 4E1AA 3L0YA 4IDFA 2G28A 3L1VA 4C1BA 1Z2PX 3H1BA 1RKVA 4CWAA 2J3LA 3UK1A 2P11A 3FTPA 1MZVA 2YQ4A 3UF0A 2AJDA 1UQTA 5AMXA 2Q7DA 3GROA 1D1PA 5C1DA 3UW1A 2VCHA 1CZNA 3IDFA 3NHAA 4GOKA 4DCUA 1GUDA 2V9PA 2O8DB 1JQAA 4JJ8A 1LH0A 2CZGA 3IV7A 2FW7A 3KD2A 1WMBA 2QTZA 1X3SA 2RBGA 2XLBA 3AJRA 4PLPA 2CLIB 1KVSA 1KY3A 1V5FA 2UXDB 1FYXA 1T5IA 3LP5A 5K05A 1G9SA 1WR8A 1GR0A 3EVAA 4LJYA 5T4HA 4D45A 4DMFA 4NAHA 4G0ZA 1EDOA 2NPIA 2REXB 1EJ6A 5AUQA 5HX7A 1UM9A 1MABA 3N8NA 4ZEMA 5JAPA 4LXIA 4X8HA 2JFFA 1F3LA 1CR2A 4EBFA 1LX6A 2IUTA 4IHKA 4YT4A 3EIUA 5AVTA 5IT9A 1KFJB 3IEUA 2P79A 4P7GA 1ECBA 2XUZA 1NMXA 1GZ4A 1V2GA 4LOHA 4NI5A 4OHXA 4LE1A 5IPFA 5FOQA 1XWIA 3QTTA 1JA0A 5E6SB 5B3JC 1Z5GA 2AFHB 2PBFA 2GN8A 2WTXA 3SJ7A 1C3JA 3UAZA 1C0IA 5E8JA 3ADKA 4XCQA 1CJVC 1L5RA 5CDSA 3O93A 3DPUA 1A4XA 1Z75A 4IVPA 3RTAA 5K0ZA 2WU3A 3FROA 3W2EA 4I1SA 1PV2A 4KXLA 1YR1A 4NZOA 1VIDA 2I6TA 4LSGA 1FSPA 1VG8A 1MD9A 1ZX1A 4XGRA 1EM8B 3PSAA 4N40A 4BXOB 5JD3A 3T6KA 4MQLA 3RSZA 2EEZA 5DLDA 4DXAA 5JZMA 4TXJA 5LWHA 3PXGA 1TCCA 1U1FA 3ZKWB 5IDYA 1FRVA 2OKGA 3RUHA 2NYUA 5SY9A 1XZAA 4QARA 4OSEA 3QKIA 4LOJA 5IN4A 4E5UA 5AW1A 3G0DA 3SVZA 4IWYA 3PCXA 4BS9A 4LRYA 4N0PA 3PQ8A 2ID7A 1ZBDA 4PANA 1Z28A 4ROTA 1DOAA 5KKNB 4DV6B 5IJXA 3K70D 2QUAA 5I7RA 5IJZA 4Z8YA 3VOAA 4AZ3A 4C04A 2X40A 4CN9A 4F71A 4BY9E 1VCMA 2E6KA 3K1TA 2ATVA 3HJCA 4GT1A 3VBCA 5IANA 1MOQA 1ZH6A 1VI6A 1DCFA 2FMKA 4QLAA 2GAFA 3KQHA 2PKXA 1XDZA 2PQ6A 4GPAA 3A36A 5LYJF 5TMPA 1TJ4A 3AUAA 1G8PA 2BJWA 3NANA 4NYMQ 4DNXA 3W77A 3G0OA 1BTOA 2OC9A 4BNKA 3HLYA 4JLWA 2XQVA 3USCS 5KOJA 1GZSA 1HL7A 1PTJA 1XFDA 4O8ZA 1Z63A 1JALA 4I0WB 3ZWNA 1RJFA 3O9MA 4N49A 4BEBA 4DYVA 2RGBA 6ABPA 5BMVF 4MGKR 2HFKA 4OBXA 3F3MA 2XOXA 1BD4A 1TVKB 3M5CA 4G8CA 1F2TA 4L5CA 4PRYA 2WQ7A 4CEJA 4R2KA 4XWGA 2R7LA 1ZSYA 2B0CA 2VJDA 4U5XA 3OUUA 3QVUA 1T6ZA 2IJGX 2WP0A 4IHJA 4LTMA 1I7SB 4BJ5A 1UPCA 4J90A 2BIFA 1LLCA 2KW5A 3MYYA 4BQRA 5JFGA 4GZLA 3O5AA 2W6CX 2X0NA 3WLLA 5KNDD 4DZRA 4G0MA 4TSRA 5FCDA 3ZCPA 4BX3A 3A4IA 3OUZA 3SD7A 1UDCA 4DMKA 5A5DA 4EPTA 1QWOA 2VZEA 3AEYA 4B7CA 2D6FA 1NJ8A 4OGGA 2J3JA 5L4NA 1Z5OA 4HNGA 5AVKA 2R2AA 1UMCB 3D6UA 5JSUA 3GW8A 4MR9A 4UVGA 2JI6A 2AOWA 2PA0A 1FTQA 1N9GB 1Y1LA 4MSUA 2JEOA 3SMQA 4URWR 4BWYA 2QRJA 1K97A 1W4RA 3OTQA 3EG5A 5BR4A 3MHPA 1Y3AA 1RD4A 3V4ZA 4B75A 4HAUA 3I4LA 4XGKA 4PQGA 4HOYA 5AH0A 2CLFB 2FFAA 2O4CA 3OCVA 4XH9B 4FWTA 2H16A 3AVQA 4PLWA 5EGSA 4DANA 4EY8A 1YB2A 3BTOA 4JJAA 5HQTA 3ZJTA 3DOUA 3V7NA 1JTVA 1R4AA 2ZYHA 1DLIA 3G0GA 4CEHA 4OX9B 2ERXA 2C7GA 2OORC 4C4SA 1AMUA 2BBSA 3ZDYB 4AW9A 1YR9A 4GO1A 4WN9A 4IKOA 2BE9A 4ISBA 5A2GA 5TF4A 1ARZA 1L8LA 1C9NA 1ZU5A 4O2LA 3TAUA 1X8XA 2P9HA 3B7WA 1Z34A 4UUQA 4NBNA 1FP4A 4A6EA 2JBWA 1L4FA 1U7UA 2OC4A 3A70A 2Q2OA 4GZ5A 3NRCA 4EF5A 3HS3A 4NF2A 3WGJA 3I5MA 3LLVA 1ZK4A 3Q2KA 1NBHA 3CMMA 3QHAA 5JSHA 1GEEA 2D1QA 2ODEA 3PI6A 4R16A 2NQ2C 1RYMA 2B0JA 4NV1A 4FGJA 1JR3E 1KI2A 1PWXA 2DWUA 1CF9A 4LEIA 4CU2A 5LXTA 1RCUA 3K0BA 3TQOA 1JVBA 2ISSD 1J8QA 1QV6A 3PNBA 1KI3A 3PYLA 1CR6A 1NKSA 2RGYA 3AR7A 3KC2A 3VKVA 5B7GA 3VUFA 4EA7A 3I52A 1L7OA 1Y33E 3DDHA 3HXLA 1B2RA 1F8FA 1A88A 4MVWA 1T36A 1CPYA 3QOYA 1PDVA 4ZVKA 1JEYB 2X86A 4ALNA 4DCCA 1N3LA 3IA2A 1OX5A 3IPYA 1ORDA 1T25A 3AUXA 3EY4A 1MAAA 3GCGA 1NVVR 2GN2A 2MHCA 4GUDA 4JSRA 2IYWA 4N3BA 3KHTA 1IUNA 4QNMA 4JI6B 2WWFA 3KKPA 2WWWA 2G3YA 2QTGA 3PCTA 4IIHA 1KO8A 2X8JB 4JBHA 4K81B 4BFZA 3I9FA 1CRWG 1NE7A 1SFRA 3OUTA 1JFTA 2OT3B 2WUVA 1BX1A 2GKOA 3NBXX 4NDNE 3SYRA 3UICA 5KQGA 5EIXA 3M8KA 4C1NA 3KVRA 2IYAA 2B5VA 4YBZA 5CVDA 2W70A 2DR3A 3NBAA 3ZWXA 1RWWA 4ARUA 2WTBA 1CUXA 4IJQA 4MVJH 3RV3A 4Y2QA 4FBMA 4TUYA 1D8TA 1DJQA 4RANA 3W7VA 5CFPA 2W42A 1EK2A 1JHDA 2QDKA 5BWMA 2HLDA 2CBZA 3QI7A 1GLGA 5E4YA 1PSZA 1WS6A 3PNQA 5G0WA 1WP9A 1E20A 2BTQA 1EFVA 3DEJA 4KX3A 5F3RA 3MWFA 1DQZA 1EDDA 2PS3A 3HM2A 1NN3A 2X5JO 2HT6A 2WP8J 3LA6A 5CPBA 3DYBA 4F46A 2XCUA 4HVTA 3AR3A 3IBCA 5F5LA 3WK5A 1RKUA 1R3DA 3H6GA 3PFBA 1X8KA 2DUWA 2Q9UA 1GV0A 2ZULA 1AXEA 1E1LA 2OUKA 3A2MA 1PGPA 2FKAA 4L50A 2A1IA 3M3PA 5HCNA 4D0NA 1ISFA 2PK3A 1E7MA 2BKVA 4QDTA 1Z2AA 5E1BA 5EZYB 3E1SA 4X1IB 4CI0B 1EH5A 1QTQA 1QJ4A 5FTKA 2BI8A 4J1TC 2C2ZA 1DC8A 4HVAA 3TAXA 4HVCA 3W6UA 4FCVA 2CFTA 4AJLA 4FMCF 5HPYB 1TCBA 1KWKA 2ZWVA 1LV8A 1RWOA 1I2MA 5F1OA 4H18A 3PUIA 4UHHA 2BFDA 4PR0A 4WKGA 1IEVA 4KV9A 2EJTA 1GPMA 3QPCA 3VYSB 4W9NC 3L4BC 4GEKA 4LJ5A 4BQOA 1QF6A 1O0SA 1Z0AA 1BDIA 5GGYA 5G4KB 4DB4A 1S2MA 4MHOA 5I8PA 4YAKA 2ZBFA 1Z15A 3IUYA 3ZNPA 4ZI7B 4C6SA 3ZIAD 2GN9A 2EGGA 4PWZA 4WBNF 3F78A 4MUNA 1Y63A 5CVJA 1GGKA 2ZIAA 3C4JA 1IHUA 1KFKB 3CRMA 3HJTA 3OA0A 2AEMA 3HKBB 1FPQA 3T4PA 1DDIA 5BQFA 3JTEA 4EYKA 4MB2A 2DR2A 1UFVA 2P3LA 3GMIA 4NZZA 4KIWA 4HUQB 4TM7A 4BRWA 1GRVA 1K9SA 4PPGA 3AJ8A 1NPYA 3AZOA 3GPLA 1OAOA 1EB9A 4WVFA 3VHXB 1EZ1A 1WZIA 5AW9A 4QIHA 5CX1A 3UANA 1JWAB 1TVKA 3D3EA 4INPA 4IDNA 2YH2A 3LT1A 4ND4A 1E6WA 1GPKA 1JAXA 4QG7A 2EF1A 3RBXA 3OO1A 1OFTA 5LR6A 3GFRA 4CFZA 4DLSA 4Y2GA 3TPFA 1X7DA 2GCOA 5JZSA 1PKXA 3UCFA 3RVOA 1ZI8A 1GPJA 2ZYTX 3N74A 1KMIY 5B1EA 3KUKA 4EY3A 1AA9A 1Q22A 5EAIA 3M1LA 4CHGA 2P3SA 1VBFA 4TV8F 4ZA2A 2ZB7A 1QG6A 3CKYA 3IR7A 1AKYA 5JCJA 2Q6TA 3NRJA 3QUAA 5BPHA 3TF5A 3C1AA 5GIPE 3NV7A 1U1DA 3DCIA 3DW3X 4LYGA 4P31A 5A0TA 1QE0A 4MUBA 4U3JB 3IA7A 3KWMA 1KAOA 2FRDC 3AW9A 3GRRA 4W9RA 1AJEA 1Q0RA 3BCRA 1YMQA 2FJUA 2VF8A 4G5HA 4OL0A 2W2LA 2H52A 4JLDA 4BE9A 5EJ4A 2JDID 1XTTA 1VSBA 5K3SA 1HGXA 1UMCA 2BMJA 4EY5A 5JZVA 4DG8A 1TJYA 3TFQA 1UBGA 5ETJA 2VT2A 1O89A 1IY8A 2J5XA 1KOFA 2JZOA 3KOOA 3NEJA 2C98A 4HQLA 1L5MA 4Q4AA 4DUGA 3DEYX 5IC5A 3T0FA 4HZIA 1Y98A 4FKMA 3QIAA 1IG3A 1YK0A 3AH8A 2IF2A 4KQ1A 4QGHA 1KU0A 3I37X 5ECWA 1DARA 2HIHA 1DC4A 3JAKA 3ZGLA 3ZTYA 3MGCA 5JEDA 3LV8A 1YBMA 1Z7GA 4X71A 2J9FB 2XQGA 2YZMA 3W8DA 1HE4A 2A1UB 4NG4A 2XMQA 4O2BB 3TQCA 4U4AA 3A9RA 3WKEA 1TOAA 4RIEA 3VJRA 4NRDA 2CJYA 2H0RA 2KYRA 1JDPA 3FYDA 4C3UA 3O4RA 5AT1A 4D4JA 1J9ZA 2PYDA 1NSYA 2ZBEA 1J22A 1IJFA 3TI9A 4DLBA 3A14A 3PDIB 4F6RB 1D2MA 1PWZA 3VO1A 4JUFA 4QQNA 2QXTA 4EJ6A 4IRUB 4L2IB 5FLKA 1RXIA 1U98A 1V5WA 2F90A 3IV6A 2Z1MA 3CBGA 1NIPA 4HDMB 1U8YA 3TIIA 5IVDA 4C6RA 3NT2A 4CCSA 5ICSA 4QM7A 4NCBA 2A94A 2BFEB 3EVCA 4OQ4A 5I9TA 4F4IA 1G8GA 3HKDA 1XKTA 1SK8A 1BWPA 4ZQBA 1ZD3A 5K1ZA 2ZUCA 1LQ2A 1XMIA 3H17A 1V8PA 4ZREA 5FPSA 4Z0TA 3NT5A 2EQBA 4Q4LA 1NXSA 5L7WA 2JFZA 2XWQA 3RBAA 1AOXA 4XARA 2ORIA 3PUHA 3EHEA 4I66A 4D5GA 4JP8A 1LPBB 2H07A 4BX9A 2FJPA 3W5UA 5ITSA 1MH1A 4HXYA 3NH6A 5A1JA 1R16A 3J81k 5BNIA 4I9NA 4MP8A 5CH8A 4TQ9A 1QK3A 3G49A 4F3TA 1XRNA 1WCXA 2X8JA 4I8IA 3EXAA 1EGAA 1KEEB 1ZKDA 2XJ9A 4OM8A 2QAIA 2VYNA 3W5CA 3P45A 4A03A 4M1YA 3I2FA 2VZLA 3GFOA 1RZVA 4JFAA 3PDCA 2Y1XA 1PNRA 3VYRB 4P0QB 1E1NA 1P1JA 4HEJA 3SEAA 1SC3A 2VI5A 3F8SA 3L0IB 2COUA 1USGA 1PVVA 2OCAA 3LX4A 2XDYA 3MGBA 2YJNA 3EFOB 3OE7D 1NFQA 5AJZA 1WWKA 3W5HA 5J4HA 4U2GA 4AN1A 4QBTA 2MMCA 2HSDA 4B2IA 5EFOA 2WW8A 1A9PA 3DMTA 3ZEAA 2RGXA 2G9QA 2PRJA 2VJMA 1G4UR 2IVFA 2YBDA 3QPWA 4JJ4A 3K9QO 3WRXA 4MB0A 4P0PB 3Q5DA 2OFWA 1BGVA 3B52X 3M82A 5DKFA 4B46A 3GT4A 3QVOA 1VHQA 4ER6A 1WV1A 3HXMA 1CE8B 3I6YA 5HRCA 2I8CA 4MQMA 2OHFA 2YN4A 3P20A 4BUZA 1YBHA 3G7NA 5DTIA 5GY7A 5FADA 3BL5A 2RC5A 2GERA 2X4LA 1F8XA 2FEOA 1R6TA 3DOOA 5HFAA 2I67A 4R1MA 4BLVA 1NC3A 2B1IA 2FF5A 4GNKA 1I4DD 5E4JA 7REQA 1T8WA 1EDBA 3ADBA 5DOVA 4LDRA 3P27A 2C97A 1UPAA 4U2DA 1KYQA 4DMLA 2NXNA 4KSCA 1ZEJA 4UM5A 3UN1A 3JWPA 3ZEIA 4EB3A 1AX9A 5HZMA 4FE4A 4LF5B 5CK4A 2D7CA 3SR3A 4EVQA 4RNCA 1DO8A 3ZCVA 4ILEA 5DP2A 2GTPA 1BKSB 2VNHA 4FIZA 3GJ8A 2QSJA 2B21A 2XJ4A 4GBJA 4CF5A 3VZQA 4OSOA 4EECA 3ILSA 5IKMA 2HBRA 2JANA 1ZYUA 2P6NA 3OZDA 4L4SA 2IUUA 2A5LA 3OFSA 1E0JA 4S12A 4YP1A 5CDTA 4B3CA 3IFSA 1EVYA 3OF3A 5LLSA 1R50A 2CVQA 4I1OA 2MU1A 1LSOA 3CE9A 3DHWC 5D85A 3DZGA 4ZQGA 1ZS9A 2IHKA 1XZEA 4QT4A 2VDLB 2JIOA 2R86A 2ZU6A 3U6BA 2AUTA 4XUGB 2OAGA 3WX0A 2QN1A 1KNQA 2I2WA 3OJXA 2GPJA 3UWKA 3V1KA 3KAPA 1QV7A 3PXXA 4WXYB 1AIPA 3BMQA 1A7AA 5DI9A 2VTBB 5J5AA 1MZPA 1QBGA 2C07A 1OASA 4F8EA 4JP3A 3DTYA 3EQ6A 3P5BA 1U2DA 1NXWA 4HG2A 1TM1E 3HK2A 3DHYA 3M0EA 4TL9A 2IS1A 4JJ6A 2Z09A 2HU2A 3OM9A 3RNOA 4CNBA 6Q21A 5K7SA 1GM5A 3DEFA 4KN9S 4Y8VA 3FIUA 1BHQ1 3NGXA 1AQUA 1JEDA 2O20A 1NL3A 2H1LA 1Z2DA 2ZE5A 1KE1A 1ECGA 4HNRA 3WB0A 1ZK3A 2B8WA 3Q7SA 3Q0TA 5F1YA 3UJ7A 4UBJA 3QLVC 4XJSA 5JSKA 5K0CA 4FUQA 4BQFA 4CKBB 3CVOA 3QMVA 1OIVA 3U81A 3BOSA 3OIUA 1QCYA 1DQNA 4L78A 2AN3A 2EBFX 2RKWA 4QSMA 3VPSA 1NXOA 5IJ0B 2G9RA 1QIEA 5CMLA 5F5XA 1XWWA 1E1QD 3AKEA 3NOXA 4XX0A 5FUWA 4BX2A 4HWPA 4L16A 3BFVA 1LEHA 1XDSA 4GZMA 4RJLA 3TJZA 4BVGA 5L51A 1E2JA 4DLVA 2H1VA 4YT8A 2IX3A 1YF3A 4B3GA 3EGIA 4XGIA 1CDZA 1DUVG 3E2PA 2QD2A 1NV8A 3IS3A 5DGDA 1M8JA 3C3XA 3G2HA 5C4MA 3JY6A 3KXIA 4JL6A 5K0FA 1UXHA 1ECFA 2I7CA 2OK7A 2H4YA 4WY2A 4D6PA 2O9JA 1E92A 3QWIA 2J5RA 4IV8A 3FKSD 3HTXA 5DCUA 1FQJA 3WC4A 1V1RB 5BN3B 3M3DA 2P6RA 2G76A 4TL7A 3S8MA 1IULA 1KZ9A 4ALLA 1AKMA 5I6DA 3L7CA 2UYQA 2XD4A 3E7PA 2XUIA 2P6OA 3NWPA 4RPIA 3AI2A 1SRQA 2OZVA 4LC0A 3HNRA 4RHEA 1KJIA 3FYSA 1IWBB 4BLTA 1C2TA 4YK7A 2BEVB 3T95A 1W5BA 4NEGA 4UREA 2Q6LA 2UZ4A 4R2XA 4CTMA 1MC8A 4MS1A 4O5OA 2BFEA 4B40A 4D46A 3MWDB 4CCYA 3IDZA 1KY5A 1CHDA 5HIMA 1Y5IA 1YASA 4B4WA 3HU3A 2BDUA 2I4MA 1SJ9A 3E4CA 3B78A 4PX5A 4BP3A 2AOTA 4PSVA 1CY0A 5H81A 2I65A 2OO5C 1MP0A 1VE7A 1TYAE 4MVXA 4P8RA 5LU8A 2XXAA 2P4UA 1D5WA 1U4OA 2XMPA 2XQKA 3LLMA 5FBQB 2GA8A 1QH1A 5E2IA 4PEVA 4EHHA 4ZAZA 2B8EA 2FX3A 4IG9A 2WR8A 4E5KA 1PD0A 4UXJA 1YIOA 2CD9A 4TKLA 3T7JA 4HWTA 3VOSA 4AK9A 5EHGA 2C59A 4LWQA 3V2GA 1KRWA 1GA6A 4MKIA 1JL3A 5AK6A 5ALWA 2YJZA 3D2LA 1KGSA 2IC5A 2JLSA 1PLKA 4FWIB 3N07A 3GVXA 4A2WA 1O6ZA 2FZEA 2JH3A 3FFBA 4Z9BA 4CDRA 4BKUA 1YOVB 4ARAA 1HETA 2IRWA 2VYVA 3C3KA 1G9TA 2B83A 2GQ0A 5HFJA 4H1WA 1E9SA 1ATIA 4OHBA 3ZE2B 1EB8A 1XA4A 1XO1A 3NEYA 3GCXA 3CPHA 5HDQA 4ZVNA 1J0EA 4MS3A 3AIMA 2YHUA 3EWSA 2YCBA 4Q1BA 5BNFA 1A4RA 1QIIA 4YUVA 3TOXA 4BNNA 3WMEA 1LB1B 1NP7A 3PHHA 2FP3A 4J16C 4XW2A 3VVMA 1ZRSA 4AKSA 1QGOA 1W47A 4TL8A 4C5BA 1FXUA 2QZ4A 5H80A 2J45A 1SUEA 3LT4A 1XVIA 3KAKA 4PQYA 1F9EA 1CULC 1EINA 3CF4A 1ML4A 4I5EA 4Q3KA 2FY8A 3OVMA 5T5QA 5L95A 3E7XA 1L7RA 2H11A 5H1YA 1FZQA 4KH1A 4D56A 4JI4B 2G1JA 3KG2A 1Q7CA 3TYXA 1L4YA 4J7CA 1Y4DE 2JB9A 4HN2A 4DR5B 2OQ2A 1NVWQ 3ZNNA 3ZDFA 1NG9A 4AS1A 4U7GA 4K05A 2FMTA 1DB3A 1SXGA 2DJ5A 3HFGA 3IVGA 3FKQA 4IDAA 4EPRA 1OR8A 1Z4LA 1E1CB 2XB8A 3BD8A 3UHPA 2DLDA 2ZPUA 2JLZA 2NP6A 1MXHA 2HBZA 5C1PA 4OYRA 4LCEA 3WYNA 4F06A 3VPXA 5JZOA 1HMPA 4RY8A 3T1TA 1BCRB 1G41A 2XUPA 3AI7A 1UDWA 4O02B 4QYIB 4KQ2A 5KDOA 3V8EA 1NYRA 5JSFA 4HD8A 3F98A 1XTZA 2TMKA 1UJCA 3DLIA 1YHNA 2Q2WA 4I5GA 4CIYA 5LMZA 1OAKA 2F6RA 5CB8A 2JLWA 2O0MA 1CQIA 1BGXT 1CJKC 4FGKA 4Q37A 4AJIA 1C0KA 3F6EX 3GEGA 3CO5A 1KR2A 2GPTA 2QTFA 3IOCA 1DKUA 5IT5A 2BGMA 3T54A 1G7CA 1AHPA 4PRKA 4JJ7A 4U39A 3VMFA 4M8IA 1IQ0A 3ZU2A 1Z73A 1Z4PX 2NXCA 1L8QA 2C92A 2J32A 2QNRA 3KTAA 1G7SA 1E7RA 3NAMA 4OHKA 5TC4A 3RVLA 4DS3A 1JGTA 4ENWA 4BNVA 4DDTA 4V03A 4BP1A 3ZQJA 1V11B 1QCZA 3HDGA 1C9DB 3ICWA 1B0AA 4MRMB 3HU5A 5AOVA 4LBVA 5F21A 1G19A 4EGAA 5A5VA 2BC9A 2WU1A 4X44A 4MPRA 4XQ9A 1EFPA 1XSEA 3K8OE 2JJ1A 4V39A 3WE7A 5F9FA 2QRZA 3FI0A 2A5GA 4IHJF 3I64A 4OQQA 3R0QA 1VL2A 2VSXA 2NOAA 4JEIA 2X5XA 3DP9A 3ZDAA 1N2HA 1JXAA 3CEAA 3TXYA 3WMGA 4F2HA 1U65A 4IXNA 3I5XA 3PWZA 4GXRA 2JRLA 2WWXA 4P1ZA 5CFQA 2H2IA 1MRZA 3AL2A 4K9LA 4BCBA 3S2UA 3BREA 3LZ6A 4YJKA 1GL3A 1SBZA 4M22A 4HXFB 5AKXA 5KYGA 1LDYA 2H1SA 5B7PA 1KJZA 2CW5A 4WK4B 1EFHA 4ETWA 4MIOA 3DQQA 2R7MA 3UMFA 4N9WA 3CVXA 3BRQA 4L8WB 1DEHA 3B12A 2HIGA 2VDJA 3GEDA 3V48A 1IDN1 2AN9A 3RD5A 5CFZA 4OBEA 2IBSA 1UIMA 3ORQA 4PVCA 4RXMA 1YNSA 2JCYA 3QH4A 5DYIA 1RM0A 1OD6A 1Q2XA 2W6OA 3IB6A 4YP0A 3IPRA 5BN3A 4LUCA 5ALEA 2VDRB 2UV8A 2VHQA 2EV9A 1LSSA 1UMBB 3NGLA 5BR7A 4S0XA 3K31A 1WPQA 1ZICA 3IP9A 3CSUA 4N54A 1VCNA 5EKSA 1KZGB 2O48X 3HSSA 2QE7A 4FFDA 2RHTA 2P6PA 2BEVA 4ZYTA 1LS1A 3MXTA 4BMVA 4ZANA 3ZDXB 2CF6A 2R5FA 1EZ4A 2HJ9A 2IXBA 2WHYA 2XPCA 4LI3X 1LPMA 1EX6A 5M3BA 1KDZA 4EJFA 2HM7A 1TW3A 1YULA 1ZIXA 1ESCA 2F00A 4YI3A 4E2YA 4PGMA 1RJGA 2ADFA 3LC7O 2I91A 2H7YA 3LOUA 1NUSA 1Z5NA 4CLDA 4PCAA 1ID1A 4J2TA 4FCTA 5LXTF 2CXPA 2OCKA 1KS9A 1T2DA 4NE2A 1X92A 1JA1A 1VE5A 1VG9B 1VSQA 4TWBA 4CTOA 1FX0B 5CIYA 4TYPA 4L9SA 2PZKA 3BWVA 4K03A 4K9NA 3DE5X 3MJFA 2XWSA 1PT6A 1WV0A 4DBVO 4XYGA 1ZO8A 3DT6A 3DUFA 2JAXA 2CL0X 2H6EA 4KVAA 3CUSA 4RLFA 3L6OO 4Y9TA 1KAEA 4AN4A 4CF6A 1II0A 4B4UA 2EIHA 1XEXA 1M1YB 2GHTA 3GUHA 5THKA 1WSWA 5GV7A 2A33A 5HM6A 4BJ3A 1A4IA 4ZKEA 3U5ZB 3R7AA 2P77A 1VL1A 1IEQA 2I8LA 4HZUB 4N5HX 2W93A 5AP9A 3VVCA 3GP3A 5ESXA 2EP8A 1NM5A 1ZK1A 4BWVA 4JYMA 2Z3VA 3OLCX 4ZVQA 4Q7KA 4ENQA 4AQYB 2J3IA 4WZ6A 4YJHB 3ESCA 4BEVA 1COWD 3VR0A 3I2HA 1T29A 4OLAA 3KQSA 5I7SA 3A4NA 2NU8A 3WB2A 5LP6F 2R7NA 2JIMA 2QXYA 2I4RA 2R1TB 2D5AA 4H1TA 3QBVA 3BE5A 3MUOA 2OTCA 1RYHA 2IPXA 3ISTA 3MG9A 3RVMA 4A16A 4Q4HA 2ADOA 3ET5A 4ZI3A 4F2WA 4ZZ1A 1TIPA 4OQMA 2GWRA 1UBSB 4J91A 2J85A 2IFTA 4M98A 1XAHA 3NC1C 1IBLB 3NP7A 4I81A 1JLMA 2BFCB 2OCXA 2ORWA 2X77A 4HQOA 3BGVA 2Q7OE 3IVXA 3OFNA 4B3JA 4URZR 1N6IA 1M6WA 1HQYE 2I99A 4PSUA 4BO4A 2GDJA 3MWEB 3OTOB 5KDLA 3DWIA 3IP7A 3HXQA 1NUQA 1X7XA 4FK8A 3DEHA 1UZUA 3G02A 2QBYA 4LC9A 3CUTA 4RZHA 5JECA 1AQYA 2P9EA 1F3OA 1T3HA 3TG8A 4C0WA 2IHBA 4KE8A 3C7CB 4QXMA 3DAFA 3LPNA 4NCAA 4CT5A 2DT5A 4N0MA 4R05A 1YFLA 1Y3HA 3I1JA 4F5EA 3CISA 4TKZA