4P92A

Crystal structure of dienelactone hydrolase c123s mutant at 1.65 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization of dienelactone hydrolase in two space groups: structural changes caused by crystal packing.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
molecule keywords Carboxymethylenebutenolidase
total genus 82
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2014-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p92A00
5DLPA 1K5PA 3QBJA 4BE9A 1XKTA 4JYMA 3NGMA 3KSRA 5JAHA 1B41A 4L72A 3B5EA 3HRHA 4H18A 1H2YA 4LIPD 5BWBA 3V1NA 4EUSA 3R3VA 4Q3LA 1TRHA 5A6VA 3QPAA 4Y2UA 2C4HA 3ESDA 3G9TA 2WLSA 1QONA 2G5TA 3BF7A 4AN1A 3O0DA 3FSGA 3G9UA 3WL8A 3I6ZA 1BN6A 3HZOA 3CCBA 5LKAA 4AO8A 2OCGA 2ZYHA 3WJ2A 3C6XA 2WILA 4G5XA 4FMPA 3S2ZA 1GKKA 1USWA 4LKOA 3IULA 2DHEA 2R8BA 4FLMA 4XX1A 4BP8A 3R3XA 1JU3A 2WFMA 1XLVA 4DMHA 4JEIA 2B4KA 4C4XA 3FSGD 4Y2QA 1CEXA 2BUCA 4WFJA 4BAUA 1CUEA 2IX9A 2CBGA 3QMMA 2X5XA 4X6UA 4H7FA 3OURA 5ALPA 1G5FA 4X85A 4X71A 1CUAA 2XMRA 4BDSA 5K3FA 3HXKA 3ED1A 4KE8A 4WCVA 5AKJA 5FP0A 5BOVA 3VJKA 3H2GA 5AKHA 1DT3A 3D7RA 4UHEA 2HDWA 5AO9A 1HKHA 1P0QA 2Y6VA 3NWOA 2WHPA 4W63A 5I9IA 2WHPB 3GUUA 1QTIA 5FKJA 1J1IA 5JATA 1CUHA 3DCNA 5ALIA 1TAHA 3D2BA 3QH4A 4LYDA 3O4JA 4I4CA 4FNGA 3M82A 3HI4A 5T4EA 5AI4A 4C4YA 4CCYA 1QFSA 1SCIA 2QKYA 1QFMA 3C5WP 4IO0A 5K5EA 1DU4A 3W06A 1XZAA 2WFLB 2XT0A 4H0CA 4J0IA 5ALNA 3PICA 3STYA 1X2BA 3L1HA 4CIAA 2K2QB 3WMRA 1JJBA 4U2GA 4X7BA 4JUIA 4UBNA 4M0EA 3AZOA 4MEBA 1G4HA 5BV7A 5E4YA 3BL8A 1AGYA 2VJBA 4BC1A 2FX5A 3A2MA 3H1AA 2Q0XA 4K6HA 1RP1A 5CH3A 3FBWA 3LIIA 1AKNA 3STUA 2BFNA 4TGLA 2CMFA 3C5VA 2V97A 2QOEA 4IHAA 2CZQA 4PF1A 4CI9A 3N2ZB 4XJVA 5DNUA 4FHZA 1BEZA 5AOCA 4WFIA 3VISA 2VSQA 4M0MA 1Q84A 5I8PA 4X94A 2OAEA 1UXOA 1QIIA 3SC2A 1BCRA 5AKGA 5FXMA 4BZZA 3WJ1A 1E8NA 3FYUA 1XRPA 1CRLA 3QVMA 3G9XA 3C6YA 3O95A 1VOTA 4B80A 4YX9A 2BUAA 1XRQA 5FPPA 1IUNA 1UK7A 1MTZA 4JYPA 4WJLA 2EEPA 4Y2RA 3ZI7A 4KJXA 5ALXA 3EBLA 2EDCA 1YS2X 3PI6A 5FDFA 4PV7A 1UOPA 4Q3KA 3DKKA 4DNOA 3VJLA 4IH4A 1CUSA 4QDTA 5C8VA 5JASA 1C7IA 3JYHA 2JF0A 4PW0A 2CEKA 2DSNA 1JKMA 2I03A 3AJAA 2WIFA 3C6ZA 2DR0A 3WL6A 3WKAA 2YYSA 1QIJA 4Q82A 4OCZA 4HXGA 5AOAA 2XQJA 4Y2SA 4UFNA 1CUJA 4ZGBA 5JD6A 2Z5GA 4H7EA 4G8CA 3AZPA 3O4HA 3BJRA 1JU4A 1F8UA 5EHNA 3FCYA 1EI9A 2AJLI 1CUIA 1IUOA 3FLBA 1ACJA 2ZVDA 3C43A 3I6MA 5EIHA 4FKBA 3WK4A 1N5RA 3ESCA 2B20A 3T4UA 1CUXA 2ZJ6A 4DNFA 3BIWA 5A7GA 4XWGA 1Y7IA 2VEOA 2OAGA 1MT3A 1G42A 1DX6A 1VZ2A 2QJRA 3JWEA 2Y6UA 1Q0ZA 1SCQA 5EHXA 2JGKA 5CRIA 2WU3A 5DNVA 1EX9A 5A62A 3CN9A 3WK7A 5AOBA 3TEJA 5ALRA 1UOOA 5AI0A 1XQYA 3ESAA 2GBFA 4H35A 3FWHA 3NOXA 1XZIA 3WWEA 1CUWA 5AKKA 3F96A 2XMCA 4YPVA 1CLEA 2VAVA 5AK3A 2DQZA 5ALHA 5K3CA 1QIHA 4BAZA 6YASA 3PFCA 1UZAA 3DNMA 4GW3A 4XIIA 2WG2A 3I1IA 2JGLA 3IURA 3VXKA 5CXUA 4MQLA 2XMQA 2VT6A 2C5FA 1CPYA 2H7YA 3D2AA 4GWLA 4D9JA 4FFVA 4RGYA 1PJAA 3D0KA 3D3NA 4HAIA 4MYSA 3O4IA 1MO2A 1EVEA 2X8BA 1EXWA 4Y2JA 1CUUA 3R40A 3BE8A 3KDAA 1DT5A 5KWJA 3Q0TA 2WU4A 4U2EA 5K3DA 4O08A 4WDQA 2C7BA 3I2GA 2QRUA 3G9ZA 4X6XA 5AM1A 2GZRA 4LYEA 4QA9A 1F6WA 4DNQA 3B3QA 1Y37A 4HVTA 2OQVA 2G63A 1RYYA 4WY8A 3HABA 3W05A 2Z8XA 1X2EA 5T4FA 2ACKA 1MN6A 2B61A 3P2MA 4J0GA 5ALOA 1ODCA 3R3WA 1K8QA 3N0TA 5EIAA 4ZV7A 4H7IA 4H77A 3WI7A 1XZFA 4GHWA 5AM3A 1OCEA 1XQVA 1GPLA 1R4ZA 5DWDA 5IVHA 4DYHA 4XVCA 4UHHA 2WUGA 3G02A 1WPRA 4X6YA 2DHDA 4Y9SA 2P8SA 2RHTA 2ECFA 5AKEA 2PU7A 3WKBA 1SOMA 2WJ3A 2WFZA 4GI1A 3E0XA 4UHBA 2XMGA 5D3ZA 3R0VA 5AK5A 3AIKA 1AURA 3WK5A 4UBKA 1JT2A 4RPCA 2GBIA 4B9EA 1YR2A 4G9GA 1QZ3A 1A8QA 1DX4A 4BC0A 1MX9A 2JEYA 1OXMA 5HF5A 4QWMA 5EIEA 5EI5A 3K2IA 3H19A 1XZHA 4DIUA 4FFWA 1ZD5A 3F67A 1FSSA 1YB7A 1P0IA 1MNAA 3DLTA 4PO3X 1VA5A 2OG1A 4AXBA 1JMYA 4KEAA 2PUJA 2DFPA 3FYUB 5FV4A 1EHYA 4HRYA 3IVMA 3PF8A 4AMZA 2R11A 4N8EA 3ANTA 1HLGA 5A71A 3F97A 2YXPX 3V9AA 3IUQA 3IUMA 2W6CX 5AKXA 2XLBA 1Y7HA 2BAGA 1HDEA 3C87A 1A8UA 1VXOA 3DOHA 2XLCA 3ZLTA 2WJ4A 5YASA 4AZ3A 2AXEA 2EDAA 1SC9A 5A7HA 1HPLA 1T4MA 4DGQA 1PV1A 4F0JA 5CURA 1MX5A 5ALWA 1XQWA 1ZI6A 1LNSA 1EH5A 1H23A 2O7VA 4E46A 4GBGA 3STXA 2AJ8A 5ALUA 2PSDA 4ITVA 1Z68A 2VAXA 4A5SA 5JARA 3BIXA 1U8EA 3EIOA 1GT6A 2VT7A 3SX4A 5A7FA 2VJDA 2XQGA 1UOQA 1KEZA 3SWWA 4B82A 3RK4A 3QM1A 4J7AA 3IDAA 4CCWA 5E4JA 1XROA 1Q83A 1TIBA 2C58A 2IITA 5ALZA 1G66A 4W1PA 3DD5A 5HK8A 3PDCA 2O7RA 4UHFA 4UBMA 1LPMA 3IA2A 1BE0A 3HSSA 2QJWA 5IVKA 5C8XA 4H7JA 3DDUA 4Z49A 2VTVA 2C0QA 4Y2PA 5HF8A 2I3ZA 2WUFA 4MXDA 1AUOA 1GQRA 1DINA 5D7BA 1LPAB 2O2GA 2XDWA 2XQFA 1XZJA 3V1KA 3FLAA 4KE7A 1P0PA 4TPKA 3OC0A 2V96A 3WYDA 4ZWNA 5CT8A 5AI6A 2HA3A 1WB6A 3RLIA 4X00A 1LZLA 3OOSA 4I3FA 4DM7A 3ILSA 3ANSA 2OCIA 5EFZA 4B81A 1JI3A 1XZGA 4UUQA 3QZUA 1CUZA 2WIGA 2ZYSA 5CT5A 4CG3A 2JGJA 1W6RA 1UK6A 2Y1KA 2HA7A 5ALLA 1FFAA 1H22A 4L0CA 1R9MA 3QPDA 2G4LA 1U4NA 1OILA 4INZA 1BS9A 3BXPA 4KRYA 2XUPA 4AQDA 3GBSA 1VXRA 4B0PA 1K6EA 5K3FB 2WG0A 2XI4A 4OPMA 4DNPA 5DNWA 1CIJA 5A2GA 3WK9A 3G0IA 2QR5A 3R3ZA 4LXHA 5AI8A 5CT4A 5E2IA 1M33A 4X92A 4Q3OA 4IH9A 3BDVA 4PSDA 3GZJA 1ODSA 1ZD2P 2BGRA 4BVJA 2OCKA 3KD2A 4EY4A 4WDRA 1MAAA 4BTLA 3R3YA 2JGIA 4GEGA 2J3DA 1QOZA 4FLEA 1TCCA 3ICWA 3D4LA 4J0CA 4EBBA 2V98A 4U2DA 1C7JA 1U2EA 4G4IA 5ALKA 4UFPA 4UBJA 4KAAA 4E15A 2XUIA 4WY5A 1XFDA 3ESBA 3O9VA 4B6GA 4K2AA 2XUJA 3IUNA 3HYSA 4NVRA 2WKWA 1AX9A 4Y2TA 4BATA 2OPHA 4P93A 1XZCA 4G8DA 2XE4A 3A2LA 5JAPA 1JFRA 1YA4A 5ALEA 5JANA 3QMVA 3L1JA 4F21A 2GYUA 4JNCA 4OUKX 4G4JA 2RAUA 2HRRA 1FFEA 4GECA 2ZJ7A 2RIPA 4QDOA 1ZGCA 3IB3A 4RE5A 1QGED 3LLCA 5J3JA 1S8OA 4BBZA 5JIBA 1J07A 5LZ8A 2HA5A 2QVBA 1BN7A 5JADA 4KAJA 4N8SA 1J06A 4H7HA 1A88A 1AZWA 2JGFA 5AKLA 2D5LA 3TGLA 1N8SA 3H2KA 5ALQA 3E3AA 4F60A 4DMCA 3MUOA 2XMDA 1CVLA 3LP5A 4G8BA 1LPNA 1WM1A 5ALJA 1JJFA 5JAOA 1GKLA 4B0OA 3F98A 1CFJA 1BRTA 5AIAA 5AI5A 1E8DA 5IKXA 1W76A 1D07A 5C8ZA 1YB6A 3TRDA 3G0CA 3LIPA 3S8YA 2QXTA 4BP9A 2WTNA 2VATA 3T52A 3C70A 4ZREA 1L7QA 4YK7A 5DTJA 3RKSA 4KACA 1LLFA 2PSHA 3A6ZA 4AO6A 5LZ7A 4G4GA 2OXEA 3KWFA 4BE4A 4H7DA 2ZYIA 1XLWA 2HU7A 4W1SA 3I2FA 4EY6A 3A2NA 3DS8A 5AK4A 5LZ5A 2VJCA 4ARBA 3YASA 5D3KA 5DJ5A 3GELA 5CW2A 5IVDA 4GLBA 4PSCA 3DYVA 4BYMA 4C4ZA 5BWCA 2XUDA 4IQ4A 1MAHA 1ZI9A 4J0JA 1JMKC 3WLAA 1XZBA 5K3EA 2PL5A 1ZOIA 4Q05A 4DTCA 2HIHA 3F9CA 1QIEA 2IIVA 5LYYA 5AHXA 2QM0A 4NMWA 1QIMA 2BUBA 4B9AA 3CXUA 4E11A 1DTEA 3WA6A 4W1RA 1YA8A 1TKRA 5DYWA 3RM3A 1EDEA 3FOBA 4BCCA 1QE3A 1ZJ5A 3I2IA 1GPKA 1CUVA 3H0CA 5K3BA 2WIJA 4QZVA 4MWSA 2GBCA 4Q1VA 1W4LA 1QIFA 1WB5A 4QDZA 5SYNA 1P0MA 1FFBA 4G1FA 5CH5A 4QE3A 4AO7A 5HQ3B 2C5GA 1B6GA 4HXEB 3C8DA 1DWQA 4B84A 4ETWA 2QXUA 3FNBA 1THGA 3MUNA 4X97A 1WPXA 2JGMA 4BRSA 3V1LA 2DHCA 1NX9A 1UK8A 2V9ZA 4Y2XA 2JEZA 5HK9A 5LZ2A 2HRQA 2WIKA 1Q0RA 1XRNA 3VJMA 1IMJA 1CUGA 1XQXA 1E89A 4MJ3A 5LLSA 5AH0A 3H1BA 4Y2YA 4PQEA 4U2CA 2ZYRA 2J4CA 5KREA 2VF2A 3DL4A 1ZD4A 1VKHA 1A7UA 2RHWA 4TVKA 2PVSA 1WCYA 2PSEA 2OCLA 3WWOA 2AJCA 1UK9A 5SYMA 3SK0A 4C89A 4W1QA 5D6OA 1PFQA 1XZEA 1C4XA 4C87A 5LIPA 4L9AA 1QIDA 3I1YA 4W9RA 3WWCA 4JH0A 1XZMA 1IZ8A 4QWWA 4X95A 3HEAA 4QLAA 4LHEA 4BVKA 1AMNA 4ARAA 3I2KA 4KE6A 5HFNA 1ZI8A 2CUTA 3R41A 4C6HA 1GXSA 1KU6A 3DL7A 4B83A 4N5IX 3PFBA 4UHDA 1ZJ4A 2JBWA 5FLKA 5IVIA 1XZDA 5HF6A 3O9MA 2WTMA 3U1TA 5JZSA 5AK6A 1TK3A 1DWPA 5H3HA 2WJ6A 3WKEA 3B12A 4C88A 2GYVA 4L3WA 5ISMA 5JALA 1DWOA 1YAJA 4QDUA 3X3HA 4OYLA 2XUHA 1LBTA 5EHQA 5ESRA 2QUAA 3EQ7A 4CCYB 5JD4A 1JJIA 4CG1A 5HFAA 2HU8A 2RGUA 1QLWA 1CQZA 5HQ3A 4Y7DA 3U0VA 3WKCA 5CMLA 1N1MA 2XB6A 1HBJA 4AN0A 1CV2A 2PBLA 3KXPA 3G7NA 4MQMA 4N5HX 2GBGA 3I28A 2O2HA 2WG1A 3DJYA 4N8DA 4BB0A 3IIIA 3WWDA 3G0BA 2HA6A 2XUFA 1E8MA 1BCSA 3VKFA 1FFDA 4EHBA 2I78A 1J2EA 2ROQA 1W1IA 3ZLUA 2HHAA 1EB9A 3V1MA 1HQDA 4HS9A 1TCBA 2HM7A 4X90A 3D5EA 2XUGA 1E66A 3TJMA 5HCUA 4QLOA 4OB6A 3FVRA 4OD0A 2VQ6A 4FWBA 2WHQA 1AQLA 1VJ5A 4LXGA 4OU4A 2YASA 4AB1A 5AM5A 4I19A 5AKZA 3DKRA 3UUEA 3WL5A 5ALDA 4C01A 1ZIYA 2DCMA 1UWCA 3HLKA 4QDXA 4UBOA 1H2XA 4UPDA 4FDMA 4A23A 4P92A 2Z8ZA 3M83A 4FBLA 1ZICA 7YASA 3E1GA 4BCBA 4U2BA 2RI6A 4H7KA 4J0HA 1ODTC 2LIPA 2PUHA 3AIMA 4X3CA 1ETHA 3DQZA 5LZ4A 4BTVA 2E3JA 4EY8A 2WQZA 2YH2A 3QYJA 2XUQA 3H2IA 4IH1A 3FYUC 1EK1A 2Y2VA 3FCXA 3STWA 4AMYA 1XRRA 1ISPA 3QMWA 3AIOA 3EQ8A 4X91A 3IBTA 2HADA 5EGNA 5FUMA 2VA9A 2PSJA 3C6BA 4BAGA 4UBLA 1R50A 4G9EA 1N5MA 2QUBA 3GFFA 2C0PA 1CUFA 4DMKA 3WQHA 4EY5A 1IVYA 3HJUA 4GXNA 1W75A 1F0PA 1WHSA 3WL7A 2W22A 4KR0A 3OM8A 2RONA 1VE7A 3WZMA 3AINA 4NS4A 1E3QA 4U2FA 3WA7A 4B7ZA 3WKDA 3AFIA 3IUJA 3HACA 2WFLA 2AJBA 1UKBA 3VDXA 4BVLA 4F5ZA 3G0GA 1CUYA 3AZQA 3PUHA 3FLEA 5AKIA 3M81A 1R1DA 4EZIA 2OLEA 1XLUA 2H7CA 2HA4A 2HFJA 2PSFA 4KYVA 4DSZA 3EF3A 2O2IA 2WM2A 3UMJA 2ONCA 5IH7A 2Z3ZA 3Q8WA 3OPMA 1MJ5A 2XUKA 3LCRA 3ZV7A 1QTRA 2PX6A 3W9BA 3DOIA 4UBIA 4ZRDA 4FLFA 5CBKA 1MPXA 2AJDA 1XRLA 1QJ4A 3WIBA 3MGAA 3NUZA 5AIBA 5HKAA 3RARA 1W52X 1ZIXA 3FYTA 1KU0A 3DYIA 2Y2UA 3UUFA 2OQIA 5DYTA 5JYCA 5K3AA 1BROA 4FOLA 3H2JA 2VJAA 1RWQA 3K6KA 2OGZA 3BF8A 1R9NA 1NU6A 1H2WA 1DQZA 4EY7A 4P9NA 5JAUA 5ALGA 1O6GA 2Z3WA 1TQHA 4J0DA 2D0DA 4HRXA 3ZPXA 1EA5A 5FRDA 3D2CA 3WWPA 4DSAA 4HXFB 5FOQA 1BEEA 1ORWA 1ORVA 1VE6A 3L1IA 2GYWA 2ZSIA 1UT6A 5ALTA 1BU8A 3CN7A 2XMZA 3EQ9A 1L7AA 5AM4A 3M3DA 1YS1X 4CIBA 1GGVA 1FJ2A 3ZLVA 1K63A 3WZLA 3WYNA 1SFRA 2WSLA 2CB9A 2PM8A 4X93A 2WUDA 2ZSHA 5AICA 1EK2A 2ES4A 3W9UA 5AI9A 5LP1A 1EDBA 4YASA 2CJPA 2WUEA 4KRXA 3AILA 3FAKA 2BJHA 3AUKA 1NU8A 2I3DA 1CQWA 1O6FA 1HL7A 4PSUA 4BCDA 2HU5A 5EHZA 4J3JA 2ACEA 4BDTA 1CUCA 5HKBA 2CKMA 3QITA 4UFOA 2OGSA 4Q34A 4J03A 4CFSA 1EVQA 1U65A 1UKAA 2ORYA 2GZSA 1WB4A 4E14A 5F4ZA 3H17A 5CH8A 3WK6A 2XMBA 3BDIA 1WHTA 4KAFA 5AJHA 4FBMA 5AM2A 1K4YA 1R3DA 2X76A 1YASA 3JW8A 5HZGA 5I7UA 1GQSA 2HFKA 4WFKA 2QTBA 3KOOA 3FVTA 3VVLA 1EB8A 2G5PA 3I2JA 2XQIA 3C45A 4GDMA 3PF9A 4OYYA 4HTAA 1VLQA 5JZ9A 5CTAA 3K9BA 5ALVA 1IZ7A 4EB0A 3R3UA 2JIDA 5T4HA 4CG2A 2FJPA 3OG9A 1IUPA 1XZKA 4P08A 5AP9A 1DQYA 1QO9A 4K5QA 4S0XA 5CT6A 1QIGA 3ICVA 5CT9A 3O4GA 1L7RA 3MVEA 4QEKA 1YSCA 1X70A 3PUIA 3W04A 2HL6A 5DTIA 1UKCA 1T2NA 2PKYX 4Y2VA 2XUAA 4KE9A 4PNZA 4DMFA 3W2TA 2OGTA 3G0DA 1R88A 1GZ7A 2FJ0A 5FPQA 2J4FA 4MEAA 2XMSA 1YCDA 1ACLA 5ALMA 5JD5A 1CUDA 4A16A 5E4TA 1UFOA 3I2HA 1CR6A 4RNCA 4J0KA 5C81A 2ZJFA 4FTWA 3C8HA 5KBYA 1GPNA 1LPPA 1LPSA 1LGYA 4ZV9A 5DYYA 1FFCA 1QO7A 3GROA 1ZD3A 4ZXFA 4OU5A 5ALFA 2PU5A 1I6WA 5KWIA 1F0NA 1LZKA 3CCCA 4OB8A 3VVMA 3BJMA 2PPLA 2QS9A 3G8YA 3H18A 3H04A 2H7XA 2UZ0A 5CXXA 4MWTA 1YAHA 1CUBA 4ZI5A 1LBSA 1LPOA 5LZ9A 3BWXA 2QZPA 2BKLA 2H9YA 4BZWA 3DEAA 4NZZA 2WIDA 2QMQA 3D59A 4EA6A 4HZGA 1H2ZA 2HA0A 2XQKA 2H1IA 5JZBA 3ZWQA 2NW6A 4OSEA 4K6GA 1LPBB 3E4DA 2DQYA 4MYDA 3WK8A 4V2IA 2WHRA 5AM0A 1SCKA 1EINA 5ALYA 3HC7A 4OB7A 1MX1A 2XUOA 3I6YA 4QNNA 1MU0A 3STVA 2HA2A 4FNMA 4UHCA 4RE6A 1E5TA 2JGEA 4M0FA 1AC5A 3LS2A 5AKYA 1EDDA 2B9VA 1TCAA 4AX4A 3H2HA 3KWJA 5ALSA 3STTA 2J3QA 1THTA 1A8SA 1WOMA 1XKLA 4BRZA 5HF9A 3A70A 3GA7A 4ROTA 5C7YA 5T4BA 2BGNA 4B85A 4DLNA 1XZLA 4K6KA 3WIOA 3QPCA 4LXIA 2FUKA 5LKRA 1VZ3A 2QT9A 3OTQA 1MNQA 3PE6A 1VA4A 3V48A 1ZGBA 4AZ0A 1XRMA 2BCEA 3F8SA 1QIKA
chains in the Genus database with same CATH superfamily
2D74A 4M98A 5TXGA 3DM9B 4CKCA 1GTL1 2GEVA 2WYUA 1SUFA 3HWSA 4M0PA 5FB3A 1L1FA 4YYEA 4QYSA 1L1QA 1LK7A 5BN5B 5FLXA 2ANBA 1M34A 4LNHA 4M6WA 3H4TA 3DTVA 5AUQA 3UNXA 1KI7A 2XOXA 4R84A 4FYPA 4BFTA 1M2EA 1W46A 4JYMA 4MVWA 3DGFC 1IQPA 2VSOA 1IN7A 3NDIA 3OUZA 5EIBD 3EDMA 3VOTA 3M3HA 4R0VA 3KSRA 4YUAA 2PL9A 4TS3A 3UQYS 1B41A 1DV1A 1XDWA 2H17A 3OMXA 4H18A 2P6OA 2IC5A 4J49A 4AJ9A 2Z2ZA 2A57A 3ORSA 2PGXA 4HYYA 5KYKA 1N9GB 5ICFA 4EUSA 3JSAA 5F9MA 1R64A 4CQJA 3L02A 4ZZ0A 3HU2A 2I7CA 4DV7B 2QY9A 4R1MA 5FHQA 5BMOA 1ZR4A 5FWXA 3C7TA 1QONA 1SKAA 2G5TA 3BF7A 3C74A 1ZWKA 3KV1A 4XOIA 4ZP1A 4XYMA 3ZS9A 4DAEA 5FADA 4GOOD 1MV5A 3B20A 5CEEA 3I6ZA 1G9XA 1EUDA 1Q0QA 3H5AA 3KOZA 1OAKA 3T94A 4WN3A 2BMJA 2QI9F 3AR8A 2V0CA 4CLHA 2NO1A 4NZOA 2CEAA 2EJVA 3DAGA 4G5XA 4FMPA 1KEWA 3PTAA 4OY3A 5H4GA 4IX9A 1YQUA 3ZWNA 4XRGA 1P2GA 4RFLA 3O8OB 1JTVA 3F7MA 1CE8B 4EPRA 4CQMA 2BFFA 2GXQA 2DWOA 2NG1A 4RYDA 1VYHA 3RS7A 1K3UB 3TZKA 2IV3A 2VWHA 3SXPA 4QHYA 2DHEA 3WGJA 5BR4A 2XKAA 1S1CA 3IP8A 4YP0A 1A96A 3ZZTA 5C2JB 3L6DA 4XX1A 5KVSA 2QZJA 4GMDA 5MN5A 3WLNA 1JU3A 2WFMA 1K08A 3QY0A 1CY7A 1T8RA 3V42A 2CXOA 2B4KA 1DC4A 2C77A 3EEOA 1A9OA 3TSZA 3DV2A 3MRSA 2F43A 1CEXA 3MUEA 4NYIQ 3LPAA 1AKRA 4WFJA 5HCNA 1CUEA 2IX9A 1QGUA 3PSHA 4BAUA 5KAMA 4WOJA 3ZCVA 2ISQA 2CBGA 3F4LA 5GTDA 1NM5A 1OX4A 1M34E 3QMMA 4TVSA 1ZSYA 1N3YA 2QLMA 4OQZA 4QBFA 5KC8A 2IBSA 3RTEA 1XV5A 3ODGA 1P0FA 4G2NA 1N2BA 5B3AA 3HXKA 3S1AA 3UWKA 3N8IA 4WCVA 5AKJA 5BOVA 3MCUA 3H2GA 5IT0A 4DLPA 5JXGA 2Q5HA 3D7RA 4EENA 2XGMA 2G83A 2J48A 5AYVA 1LXCA 3HGQA 5GINE 2AOUA 4IOKA 2I87A 3KYCB 2CLLB 5E7QA 2B3TA 2WF5A 3QW4B 3FTEA 1DO2A 1C8VB 2Y1DA 2ET6A 3NBUA 4IDPA 3BH7A 4RTLA 2GZHA 5I9IA 1IDOA 4AW9A 2B8NA 5IH3A 1G38A 1NRJB 3TSAA 1OBHA 4EYSA 4LRYA 2Q21A 4WEQA 3KFLA 3ZDYB 1Z5NA 3NLLA 3KETA 4IUBS 4HAXA 3IEPA 3QLUC 3DZBA 5JHHB 4B6EA 3AHFA 2FWPA 2EW2A 3QJGA 4LDPA 1SQFA 3QH4A 1XO1A 1BO6A 4C08A 5C4MA 7ABPA 2X8LA 3ELWA 1ZM4A 1VRCA 1XR3A 4FNGA 1NI5A 2BMEA 2IHZA 1AK9A 4JLKA 1JFFB 2MSDB 3X1ZA 4DLWA 1PQYA 2QKYA 1OB5A 1T13A 3C5WP 2WU1A 4IZ6A 1NHGA 2HW8A 1DU4A 2LCFA 2WC1A 3AI3A 5E4FA 3W06A 5MGBA 2WFLB 4H0CA 4UMVA 1KYVA 2RJNA 1IG3A 4JR2A 3KEQA 5B6PA 3ZHXA 5JJCA 4BQOA 3LGAA 1C80A 3STYA 5IF3A 1X2BA 3MJFA 1D04A 3B3AA 2V7TA 4JGIA 2EFDB 3DYBA 3H9EO 4YRLA 2I2DA 3GLIB 3TSYA 4JUIA 1K7XB 4UBNA 3D4NA 4F3KA 2R1VB 4M0EA 4WEOA 3FZYA 1TX4B 5KQMA 4LSZA 2GRUA 4TVBA 3TMYA 4QULA 3QXHA 3OTHA 1G4HA 2CUNA 4EFLA 5A04A 2WSIA 2G9VA 1G3MA 2H85A 1Q7TA 5H59A 3ZHQA 4D98A 4HT3B 1CJTC 1B0PA 1FE8A 3E70C 3UB2A 3LVBA 4KG7A 3OSUA 2CMHA 5AVXA 4COOA 1EUYA 4EHHA 2RGEA 4RVOA 2PUGA 4BVHA 3WICA 2CFCA 1JJ7A 5B6JA 1K9VF 1QTNA 1UWLA 5JSZB 4K6HA 1O4VA 4Y1GA 4I6JA 3GPDG 2FEOA 3N2KA 2BFNA 1JLHA 3JS5A 4TGLA 5FOTA 3GPIA 2VNAA 3U17A 2CMFA 2X3UA 4JLWA 1TRKA 2RB5A 1VL2A 2WWXA 3PQEA 4YQEA 1OI2A 4IHAA 2J8ZA 2CZQA 1IK4A 1ADFA 4AICA 1EFDN 2ZSFA 3ICOA 4MNTA 1E99A 5KPDA 1Z38A 1H8ED 3ZHRA 3EIHA 4LRSB 1CBUA 3FI0A 1ZNWA 3A6GA 3DBOB 3JU3A 1HEIA 2QPOA 4CG0A 1HZJA 3LLUA 2O8FA 1GSHA 1ZMTA 1NZJA 2RGWA 3AI7A 3TLMA 2QRKA 4FHZA 5K0LA 4ZYYA 1D2HA 2CF5A 4LN1A 2VSQA 4PLCA 1Z0KA 1PSWA 1Q84A 1VBNA 4CU5A 5I8PA 1I3KA 1T9GR 1OXXK 1U7UA 1T9CA 2OCXA 4KGXA 1CF4A 1TM1E 4H4DA 4YUZA 2R87A 3PWZA 4RK6A 3RT7A 3SC2A 1E5XA 1TVEA 4QXRA 4X8OA 2VRBA 3GBVA 4Q1AA 1D1QA 2NUAB 2CCKA 1ZQ1A 1YI1A 1NTOA 1B1AA 2J3KA 3QY9A 2GZDA 1V1MB 4JXJA 1LV7A 5ED0A 3QX3A 1NXOA 4EB8A 1QWSA 3NX4A 3FBTA 4MPDA 1DAMA 1XRPA 2CHEA 3D3EA 5LQCA 1BKDR 4NFHA 5SZKB 4DILA 1VPVA 2I67A 1PEKE 5DGXA 3VZRA 4AURA 1J9GA 2O0HA 4YMIA 2CYBA 4XDZA 1KBOA 4CV1A 2XY4A 1ZLXA 4KTVE 3OX4A 4I1VA 5J47A 3CR3C 4O4HA 4RPGA 3JATA 8OHMA 1I4WA 3O74A 4R1SA 4YP9A 3ZWDA 2YFHA 3KUUA 1MTZA 1ONSA 1WABA 1UPTA 2OZPA 3NCTA 2QQGA 2EEPA 1GITA 3BSWA 3O94A 2O57A 2WVJA 3QTLA 2XDAA 4LV8B 4CCSA 5IHXA 1GDHA 2D5CA 3DOEA 1RM3A 1HH4A 3CVOA 2ORIA 5F3DA 4KJXA 1R8XA 4IV5A 4JN6B 4YJ2A 4U5XA 3EBLA 4F3NA 2EDCA 2F9MA 2H0AA 4OXIA 2YWFA 3U5TA 1DRWA 1Z08A 3OPYB 3UAZA 5I7HA 4RPLA 1D1PA 2NVOA 1JPJA 2OBFA 1UOPA 1K5HA 3IBFA 5JQWA 4DNOA 2H7VA 1J33A 1S96A 4G84A 2I62A 3H5NA 3ZDXB 1YK0A 1A2QA 2I33A 3HDTA 3OA2A 3HMKA 1MW8X 1JXOA 2QENA 1Q11A 1K9SA 2ZU0C 1C7IA 5JFGA 1REQB 5BSKA 2XF2A 5HW0A 1H0HA 3JYHA 4D7AA 3Q41A 2P6UA 4O2BB 3ADDA 3ZHYA 2WW8A 3DDHA 4MH0R 3QEBZ 4LCEA 1K0FA 3QBTA 4YRGA 1WSBA 4G07A 3ZGYA 4K9QA 2C1XA 1EMDA 2VJMB 3VSBA 4YXFA 2I03A 4MVJI 1E2JA 3Q0EA 2IHKA 3V9PA 4CN8A 1H9AA 1W2WB 2XEDA 3H6KA 2VIIA 1IB0A 4G0VA 2IP1A 4MW2A 3WKAA 2AEJA 5B36A 2VCYA 3FDZB 1NPYA 5AOAA 4YHBA 4BFVA 2ZPTX 1ZZEA 4MCIA 2RH9B 1R7RA 1EGAA 3I5AA 3S6JA 1ESNA 5C5DA 1EESA 4RY0A 1CUJA 1UT8A 1X80B 1X42A 1Y33E 2X40A 1FNBA 3WQRA 4DM4A 3ZDEA 1QVZA 2UYQA 3ASZA 1WMFA 1UPUA 2GTPA 1SPXA 4Y2GA 3F6YA 4H7EA 1JAZA 4QGSA 1L4HA 3D8HA 2HK6A 2DOKA 1XYYA 4MV9A 5TNXA 1G20E 2YCLA 3TIVA 2ZCJA 3TI9A 2OGWA 3O4HA 3E3OA 4I4NA 2Q8NA 2AN3A 3HP1A 1Z62A 3R6TA 4PRZA 5EHNA 3RUIA 3FCYA 1WV1A 4D0NA 1AO0A 1U8ZA 4N65A 5T6MA 3IMFA 5E9QA 3ZQ6A 1QF9A 3DUWA 5FBKA 1NXTA 2O8EA 4DSTA 4HFRA 2X5JO 4BKUA 4KAXA 1ZGJA 5I7WA 4LMPA 4KR7A 2FE1A 5K0FA 2GILA 4OX9B 2B20A 2C3PA 5JY1A 5FLEX 1AN0A 3F2IA 4CQMD 4EJSB 2XSZA 1SG9A 1NQ5A 3IOCA 4KQGA 2PJZA 1P2DA 1U2PA 2DQSA 5B7NA 4JXXA 1YIDA 4HPJB 1VZ2A 3GJQA 4EEKA 3HH8A 1AF7A 1JT9A 3CUWA 4ZO6A 3W90A 4NJEA 5F9FA 4RKFA 4UDNA 4OXQA 4R54A 3AL0C 2Z4RA 3WLOA 1Q0ZA 4CM3A 4JK3A 1OE0A 5HOQA 1OJ7A 2RGNA 1JN0A 4UULA 1MH9A 4OHYA 1JR6A 2R6R1 4AP9A 4LJ7A 1WR8A 2IW3A 5FHRA 2B6NA 1SB8A 2SCUB 4ZQBA 4GX2A 2X8JB 3PKZA 1B23P 4WVFA 4D79A 2VP5A 3TEJA 4UUPA 1WXIA 2YQZA 1PHPA 3Q7PA 1TAUA 4E4RA 4MIKA 2D1YA 5HNKA 5JJIA 1JAXA 1NXWA 3ESAA 5FBRB 4FSDA 1XZIA 2MINB 1TUGA 1T6XA 4LHXA 4HMQA 1D2EA 3PDJA 4V0KA 1KBQA 3DC2A 4NYMR 4YBZA 1CUWA 2FUG6 5AKKA 2E4UA 3P4YA 4DR1B 4XFDA 3GO4A 1JHXA 1RQ2A 2FWNA 4OHOA 4MI3A 4PTLA 4YPVA 5BW8A 3QBVA 2O0MA 3KLMX 2ZRIA 1HF3A 3WJAA 5KYXA 2DQZA 3PC6A 2Z9CA 1P7WA 1D09A 3CNQS 3N8HA 4GOMD 4OFBA 2XT9A 4ABTA 1NBAA 4FOPA 4AQ7A 1P7CA 3OFVA 2DPHA 3TTWA 1S8AA 4RK0A 4ZT6A 6YASA 3FPBA 4XYLA 1HUQA 2WYIA 2HQ1A 4ARZA 5EZ5A 2YNMD 1QCYA 2NXEA 2IS2A 1VSVA 3OT5A 1UZAA 1J56A 5I9SA 1JG3A 3ZTYA 1TC1A 3IP3A 1W29A 4TV9A 1NKTA 3MJRA 1Y3FE 2WG2A 4EVSA 3QVWA 2JFWA 2JGLA 2AXPA 2ORED 1D7AA 1KERA 2RKWA 2ZJBA 3I1IA 3QENA 4D8WA 4F12A 2X9NA 3BH0A 2ZUDA 4MQLA 4EI8A 3A9CA 5FD8A 2VT6A 5AT1A 1YUBA 2VDRB 2PWPA 4AY4A 1RLUA 3U13A 2PLAA 1YKFA 4IFTA 4FE7A 5CCEA 1CPYA 2H7YA 2FOXA 4V03A 5IRCD 1Y3IA 1KEEA 2K6GA 4R9RA 3EYWA 2L82A 1N3IA 5JI3E 3RPEA 4L2IB 4GWLA 1Y1PA 1Y98A 3S0JA 4B7XA 3U80A 3CJTA 2JIZD 3GGPA 3OKAA 1MRNA 4P4TA 4BIMA 4B47A 1W34A 1K4KA 5BUSA 1O1YA 1OA0A 1PJAA 2BI4A 3DXZA 5EQJB 1R4AA 4HAIA 5H02A 4IFBA 2W2LA 3O4IA 4MP8A 1KOLA 2PZ8A 1MO2A 4X54A 4NCNA 4F86A 5FWDA 1Y6RA 2XT6A 2PUFA 1Y9ZA 4WGGA 5JNSA 4IXMA 5CEJA 3DEJA 4BX9A 3KJEA 5KWJA 1UXKA 5FOSA 3ICPA 4LUCA 4KWCA 3I58A 1VPWA 4NAUA 2YRWA 5CDUA 1GUYA 3ESYA 1B3RA 4RVGA 5I4CA 1PUJA 3PGJA 4HVCA 3HTXA 2PMKA 2H63A 1FSZA 2H07A 1V2HE 3MPOA 2IOQA 4K2HA 4FXPA 1A5BB 1JQDA 1GG5A 3A6PC 2OHGA 4CMEC 3AM5A 2Y67A 2VHVA 3LW8A 1NG9A 1UBMS 1ID1A 1W30A 5JD3A 4INAA 1NBIA 3QIVA 3UPTA 2GZRA 4PGAA 4RMGA 5E9AA 2OL4A 4INPA 4AG6A 1M1YA 1Z75A 3CJRA 1T3ZA 3LHKA 5FAXA 4B6PA 4FZ5A 4K0KB 1DG1G 5GAJA 2OQVA 1XMXA 2NXCA 1CYDA 1T34A 3N8DA 3SDBA 3U7JA 1CZOA 3HABA 2ZAGA 2XCRB 2BTEA 1WUKS 3LYAA 1E6CA 2VN8A 4QATA 3SEAA 4ZCPA 1AUPA 2WKRA 4GKVA 4QXOA 2D3TA 4LMRA 5F2OA 2WBLC 1X2EA 2R1TB 1YL7A 2WNHA 3CJQA 3CZQA 1EFCA 1MIOB 1TA9A 4RKQA 1YE8A 3HCNA 5BRNA 1KDYA 2PK3A 3C3PA 3NIFB 3Q4GA 2WYHA 2OWDA 1ODCA 2QDXA 2ZSUA 1ZH0A 5E8JA 5CA1B 3FX2A 2HMAA 1K8QA 4HYEA 4YEDA 5TSDA 3VU3A 4D0RA 1EYZA 2E89A 3PD7A 3DWFA 4H7IA 3NBKA 3SM3A 4WINA 5BQ5A 2XRFA 3MQFA 4ZT2A 4WBNA 6REQB 2XWPA 3GB9A 5KHAA 1UPAA 5HKKA 4Z0TA 5K1ZA 4WA8A 2QN6A 3MT7A 4F6RB 5CM2Z 2LCIA 1A4XA 4M9CA 1GPLA 1M6NA 3URMA 4MI6A 4TWRA 2AOUB 3E81A 3QEMA 1N7IA 4PS1A 5E3HA 4H9GA 1P17A 3PD0A 1QX4A 5T57A 3G02A 3UAXA 4V3CA 4WCFB 4JLAA 2AYZA 5BPFA 1Y8QB 4G67A 2RB4A 3DT9A 2GFHA 3I6IA 4X63A 2P8SA 2CUKA 1E1DA 2MYTA 4NYIR 1BXGA 1L9KA 4CKYA 2ECFA 1UBUS 2JIQA 3MJEA 2PU7A 3U48A 4CLOB 5KSZA 1YKGA 3AH8A 5CLIA 4ZCLA 1Y1QA 2J9ZB 4ZAVA 5K0TA 4JV5B 3M6WA 3MYYA 1QCCA 4Y1FA 5DIFA 5F7XA 3U16A 2R65A 2I3GA 2WFZA 3E0XA 3GCDA 4UHBA 3DBIA 1M34B 1RLTA 2R96A 4FOSA 2AH5A 2R7KA 2Y1GA 4P35A 2ZIUB 1O6ZA 3MN1A 3R0VA 3SX0A 1IE3A 4D4IA 3DVAB 5TVKA 3HHEA 3PXAA 4AL4A 3I1FA 1AURA 1CY0A 4QTTB 1HDYA 3HYCA 4IGKA 3WK5A 3OMWA 2A0KA 4E2FA 4Q16A 2C9ZA 4HUQA 3GZNB 4MWDA 4NU8X 2VQEB 1K75A 1DBWA 1UC5B 3B9RA 5CITA 1YR2A 3REFA 1C3XA 1ULHA 3L0YA 4DDHA 4KNWA 1YFJA 4EUNA 2YXEA 2JEYA 2IHUA 5JT1A 2FMTA 3B5IA 1PU2A 2IEAA 4LE1A 1K7EB 1TD9A 2FZCA 4PFSA 1NQVA 3RTGA 4TSFD 1II0A 1US8A 3UXYA 3MCZA 4P3PA 4Z1MA 1F51E 1MVOA 3SKVA 3U9SA 2AX4A 1OC2A 2UAGA 4EAAA 2ZYDA 3ECAA 2VP6A 1D5WA 4HQFA 4KHZA 5LQDA 3BREA 1OW3B 2WAMA 5DM70 4FFWA 4B3IA 4CKBB 3RV3A 5F21A 1FSSA 3UF0A 5DEOA 4LBVA 1J0XO 4OBWA 4P0PB 1VSQA 3QKSB 3U9TA 3DLTA 2OK7A 3CZPA 4ZJUA 3EPHA 1QR2A 2OG1A 1MIHA 3FCUB 4NBSA 1EBFA 2XTJA 4TS9A 4IVQA 4AXBA 2OXRA 3SYTA 1V71A 2FF7A 3P9KA 1JHPA 2PUJA 1UPBA 1F0YA 2ZB3A 3ONDA 4PZDA 1ADJA 2R5WA 4QRIA 3FNQA 5JXIA 1P9OA 3K30A 3RUFA 4NG4A 3TTUA 4R5MA 4I0WB 2CFRA 3K0HA 4DKJA 7REQB 1OOEA 4I1RA 1JSZA 1QDEA 2XYHA 4KPUA 2FDRA 1QYDA 1EHYA 1JF8A 4KYTA 4X1IB 4CLEA 2QD5A 3IVMA 3LKZA 3TNDA 3L05A 2ZTVA 3HB0A 3R8CA 2R11A 1LJLA 4U00A 1WD7A 4FHGA 1HLGA 1PQWA 5A71A 4KBFA 4UTXA 3K9NA 4FI3C 5GJBA 4MCHA 2A1IA 2BKVA 3V9AA 4A91A 3Q3CA 3RNLA 4BFCA 2UU9B 1H0SA 4EPWA 5IUKC 1X9HA 1P8AA 2Q46A 4MS1B 2FN9A 2XLBA 1NW7A 1Y7HA 2HJHA 2R7NA 3C87A 3EZ9A 4UU0A 5K4AA 3VR6H 2NU9A 4YPOA 5ESWA 4QVIA 4BJ6A 3WRYA 3ZLTA 1YR3A 5DHFA 4AUMA 1Y3CE 3F5QA 1C9MA 4W8HA 2DWUA 2Q8QA 2X0NA 3OEYA 4Y1RB 3L5KA 1U04A 1XJWA 5CLGA 3I5XA 4RYLA 4HATA 4NV3A 1Q0HA 4YALA 2BGJA 4QPCA 1QG4A 1AKTA 2J0UA 3P9SA 2IWHA 1E63A 1HPLA 2HWWA 2VHJA 3JD2A 3JQQA 4NBNA 1T4MA 1Q57A 3KTDA 4PQFA 1OI7A 4TYPA 1YTLA 4ENQA 5C1OA 4B3SB 3TD2A 3E2MA 3IV9A 3TQSA 5LD2B 1Z39A 3UGJA 5ALWA 1D4ZA 1CEQA 4N9QA 3CB4A 3A4NA 3AWDA 3HZRA 2G09A 1GNSA 3PBKA 1FYEA 2JGDA 4IEEA 3PR1A 3USZA 3ML1A 4MW7A 2GN4A 2UKDA 3NS7A 5F1OA 5E9WA 4YHHB 4W5RA 4D6XA 1H23A 1D9ZA 4FHDA 4QU5A 1K92A 2O7VA 1ZNXA 2CKDA 4GBGA 1X8XA 2YRXA 3STXA 3EVNA 4RD6A 2YJNA 1Q44A 4C6RA 4JB0A 5CR9A 2AJ8A 2NT3A 2BZ0A 3IO5A 3NP7A 4ITVA 1HQKA 1PT8A 4II7A 2HCBA 4P4SB 4R05A 5CLQA 1TZ2A 1H2HA 4MDHA 3ZKWB 5K4GA 2B34A 4OXXA 1FP4B 1L4NA 2QRPA 4V2UA 4JLVA 1UJ4A 5TMPA 1QUFA 3O90A 3ZBTA 1J23A 3IIMA 3LOPA 5HBRA 5A4JA 2VT7A 3SX4A 3MWDB 2Z6VA 2CBZA 3V7YA 4ND8A 4QBHA 3TW0A 1T0IA 2FWIA 2VJDA 4B4UA 1QC5B 3CX4A 4DC9A 1T2AA 4TMTA 2VTBB 3Q7QA 2AHOA 4YO7A 3MLAA 1HK7A 3GY0A 5H0IA 3LH5A 3CW9A 2WPNA 1SHKA 1QH8B 4RL6A 2WSBA 2AZXA 3V2HA 4O29A 5ERGB 2VTDA 5ITSA 4RTPA 3LJKA 4LC0A 1XROA 3OZFA 5AHKA 2C9OA 3H5LA 1SUPA 3QV1A 1P2BA 4IXNA 3GOQA 5FNVA 3TRJA 3VU9B 4XA8A 1G66A 3TD6A 3FVQA 1P5HA 2YC2C 3B1ZA 2A84A 3KG2A 3R9KA 4RESA 3F6PA 3WHLA 2C42A 1L4MA 3LL7A 4DDUA 5LU9A 3PDCA 1C3EA 2O7RA 1TT5A 4UHFA 2XVMA 3ROEA 4QODA 3UCEA 1G6Q1 1BH2A 1D2AA 1CY6A 1DCMA 1QMPA 2PGDA 2BHRA 2VHTA 2YYYA 2ZDQA 3PDIB 4DCMA 4D26A 3KELA 4KR6A 4ZQFA 5C8XA 1NVVR 1NVWQ 1U0TA 3O26A 2NPFA 5I7RA 3THYA 2YS7A 1WG8A 4YI3A 3H2ZA 1ZR2A 1U7XA 2H1VA 1Z5GA 1JYEA 4ZRNA 2W2KB 4CIXA 4Z49A 2D13A 4J7UA 1OTXA 5KSPA 3NHWA 3FGPA 4MV1A 1VSTA 1H5UA 3VBEA 3ORHA 2X77A 5L51A 3GDFA 4O25A 1R6BX 4GO1A 4LFCB 1BIFA 4OSOA 5U1PA 3M6FA 3L82B 1AUOA 1C1HA 2B98A 2NZ8A 2OHFA 5IBRA 2P2CA 3WAKA 3JARA 3JAKA 1LPAB 5KSYA 1N9ZA 1XZJA 3U7QB 1JQ3A 3CRMA 4GRAA 4B7CA 4EITA 2OUKA 1M7BA 3FLAA 2PV7A 3PYXA 5JSYA 4EO7A 4A5OA 3AM4A 4YNBA 2NYUA 2FVYA 3ADKA 4QDJA 5DHQA 4D3FA 3THWB 4ZYWA 2NTVA 2WSSD 5JR3A 4KUGA 1JIUA 4L4UA 3OC0A 4W5OA 2V96A 1AY0A 3R7LA 3A3PA 4QC2A 3ZX5A 3OEHD 3N2LA 3I01A 4RPJA 3WYDA 4DEYA 4RADA 5GJVC 2AUTA 4GC5A 2YJZA 5AI6A 4JUDX 3HKDA 3RNOA 4NZNA 4WKBA 5GIPE 3R5TA 4A8TA 3LGSA 4UU8A 4M89A 1PZXA 3D8RA 4X00A 3RLIA 4RAQA 2BM8A 1NLZA 3DO6A 4YJGB 1RYEA 5E6SA 3P0JA 1YBAA 3BD8A 1OAOA 2PX0A 3S8MA 2XTNA 1PZEA 1XZGA 2QYHA 1SCNE 1GL9B 2WTEA 3BSYA 3OFNA 5PNTA 2I4RA 2FPLA 4UVIA 4X20A 3CEPB 3R74A 4B34A 3HDGA 2FR8C 1YCHA 2OMEA 3CONA 4NEQA 3LLSA 4G23A 1N6KA 3B1FA 3MILA 3L6EA 2JGJA 3SOZA 3EUFA 3U7EB 1L5LA 5I47A 1IC6A 4ECEA 1M3SA 3A14A 2HH9A 4IXDA 5D00A 4BVAA 2HIGA 2Y1KA 1P2VA 5ALLA 4ML3A 4XQCA 1H22A 1MO5A 1ZOOA 3DEIA 1SVNA 221PA 2QQ5A 5JTUA 1QAMA 2C9MA 1BXKA 1X7YA 1U4NA 3GGJA 3MFYA 3Q87B 4AU1A 3C3AA 9LDTA 1JXMA 4YUWA 5HP4A 1XNRB 2GJ9A 1XEWY 3BXPA 4UEJA 4DE5A 2PNFA 2Z5FA 3DHNA 4Q21A 1FXWA 4KRYA 4CEHA 3BGOS 2DULA 1KZ6A 3EUWA 4KDCA 4QAQA 4WKGA 3EDQA 5CX4A 4XASA 4P38A 5BSMA 1DO8A 5CFZA 3G13A 1TQ2A 3EZGA 3NAGA 5JVDF 3DC7A 1RHMA 5HM6A 3CO0S 3FNFA 1TMKA 3FDXA 2WG0A 2JJ1A 2FSSA 2HQSA 2XI4A 5IEBA 1LSJA 2EYQA 4YCBA 3WGLA 3HJCA 1O96A 1T6YA 2R9VA 3OKFA 5BP7A 1Z0IA 4I5DA 2E0IA 3L4KA 3A3OA 3BB4A 4ND3A 1CKEA 2W4MA 2PA3A 3MB8A 4I9UA 3I9OA 5A2GA 3IMCA 4JZYA 4B44A 2Z83A 3GP5A 3HEBA 4IO1A 5CYFA 3L1VA 3GRKA 2FLVA 2INGX 1B0AA 2OLJA 3OJFA 2PT7A 1VMEA 2IGTA 4IQGA 4NZPA 1YACA 2GA8A 3A37A 4HNGA 3RFTA 3IR7A 3FFBA 5KNCH 1I9GA 1SVMA 1V43A 5C7IO 1CDOA 2QVLA 3PNMA 3THRA 2HK7A 1T3SA 1MC1A 1Q6ZA 2XWSA 3BDVA 2W58A 3L4JA 4P3OA 3BCUA 3SQLA 2CBXA 3GZJA 3TCNA 4DY4A 2QD2A 2OESA 3U6BA 1DX9A 3LPMA 1JQ5A 4N3GA 1VTKA 3AF4A 3F8WA 2IYRA 4BMNA 2R60A 4OHFA 3PP8A 1NFRA 2PA0A 2R66A 2JK1A 4H6PA 2Q4BA 1NE2A 4B3DA 1XALA 1MAAA 2NSLA 2ZBQA 1TXGA 3LT2A 4AY3A 4BTLA 5C3UA 2JFBA 3HUTA 5KPJA 1IPFA 2IRWA 4FLEA 1TCCA 3W1EA 3GI1A 3NEPX 3P27A 2ADFA 3ICWA 4YAGA 3D4LA 2H54A 4J0CA 2PRSA 3NUGA 1EHCA 1NMSA 2V98A 3BIJA 3IOBA 3PHGA 1U2EA 4P0QB 2GEJA 3RU2A 2ZE6A 2WZDA 1P81A 1RQLA 4B6RA 4IS3A 2GN8A 5ALKA 2WUVA 1N5JA 1T0UA 4KAAA 4UBJA 1RPAA 4UUBA 3T35A 4E15A 5IXYA 1XBTA 3I9JA 2PFKA 3CX7A 2A58A 3NHZA 3RKRA 1YVPA 2JLWA 3V7NA 4KQWA 3ESBA 1QRSA 1WV0A 5E0OA 2YDXA 1ORIA 1EM8A 1NVEA 3RSCA 2Z3VA 5CNMA 2YDYA 1KFKB 4A0GA 2AUMA 1ULBA 1YL6A 2FMIA 1C9DB 4B6GA 3KDPA 5DCYA 1NVMB 2AN5A 4MZDA 3S1AB 5JQGB 1B42A 4GMKA 1SBHA 4US0R 3EGWA 1BMQA 3LOUA 3VH1A 2YHIA 5GJCA 1QZZA 1KWGA 3IVRA 1J2YA 2AR0A 1H2RS 1J0DA 1DKQA 1L4BA 4Y2TA 5HILA 4ESOA 1WPQA 2VXOA 3O1JC 1XZCA 1ZBQA 2H0QA 1I6KA 4QUDA 2I91A 1C8KA 4U2KA 4KQEA 1QDUA 1C7QA 1KP9A 4G0ZA 1AQJA 1C9JA 1FB5A 1U8CB 3I37X 3L1JA 2GMWA 4KSBA 5ES3A 1ZCAA 1PLLA 2GYUA 5DV9A 1F9EA 4HXYA 4ZT3A 3PNOA 1KHHA 4WZBA 2P62A 2R6CA 3BQMB 3NC0C 1GCOA 2WF9A 4YJFA 1PTJA 3RUHA 5C46F 2P9ZA 3O1HB 4FINA 4GECA 2WF8A 2TMKA 2RIPA 1T9BA 3B36A 3I52A 4QDOA 4UQLA 1ZGCA 1F0KA 1FP4A 5FUXA 1KDVA 2C9BA 2Y0PA 4QICA 4ENTA 4OA8A 4ZCIA 1RKXA 4WK2B 1Q1QA 3ONEA 5IC6A 1IJKA 6NULA 1N6NA 3A1FA 1A97A 4RA9A 4RE5A 3WGUA 3H5TA 2VBGA 1FU8A 2J9GA 3EGXA 2GZ2A 3NWPA 1ZCZA 5KNDH 3X1WA 1FX1A 4AK9A 4Z4FA 4C3ZA 4ZTUB 3SDSA 4M7OA 1O0BA 5LZ8A 4JQOA 1CF9A 3ZE6A 4R83A 2YTZA 3RB8A 4WKNA 4FFPA 5EHGA 4F5DA 1PYDA 2FR0A 4E7PA 4KWEA 5SZIA 5I4IA 3KVRA 4GSYA 4TV9F 5E6SB 5JADA 3GBPA 1NJ2A 5TV2A 4G0PA 4V0OA 1XKXA 2FI1A 3F6BX 4N8SA 1IY9A 2IU6A 2MMGA 3TIGA 3CU5A 3EOZA 1YQQA 4AVYA 4CKWB 2WUWE 2J0SA 1J06A 3OX3A 3OIGA 2QE7D 1PGPA 1TT5B 3IR5A 5AKLA 4YMVA 2PG3A 1ZUD1 3GJ5A 5KKNB 1JDZA 2FPRA 3K4PA 2D5LA 3LI2A 2H2AA 1ZHFA 1CQJA 1GZSA 4GMXA 5BN3B 3W6NA 4UOEA 2BYTA 3E3AA 2JA1A 5IKPA 4DMCA 4URZR 3MUOA 4K40A 2QGFA 4NMLA 5GZ3A 5EQDA 4QEDA 1ZJZA 3DDCA 8ADHA 1XTRA 3H9JA 2IEDA 3KVOA 3LP5A 1Y8ZA 1QLHA 4G8BA 2VDKB 1M73E 1Z34A 1SA0A 4DCSA 3OQVA 1GKLA 4BNKA 3TB4A 3OZIA 1T3TA 1Y63A 2NN3C 4LK3A 4B0OA 1CFJA 5IS2A 3I45A 1BRTA 3KXKA 1QRTA 1YO6A 4J2HA 5IC5A 2PR7A 1E4VA 2F17A 4M4SA 3CLUC 3VGJA 3QLJA 4D3DA 3K32A 2R85A 1KA9H 4HGZA 3WIEA 4WKCA 1YB6A 1C8LA 5L9AA 4NYJR 4DLVA 4MVYA 3Q9SA 1EZZA 2WR8A 3LIPA 3QWAA 2UUOA 3D6FA 3DLAA 1XHLA 5CLLA 4BP9A 3ZGZA 2FPGB 4JB3A 4PG4A 4YGYA 1N7GA 1ZVMA 1QGAA 1MAWA 4QDKA 3T52A 1E2KA 13PKA 1I6MA 4D42A 2ZT7A 2O5RA 1H4QA 1YRYE 3OFSA 2F3RA 2DFKB 3ID6C 3VR2A 3W8EA 5DTJA 3HQ4O 4XGNA 2DC1A 4KQXA 4CMAA 4ESVA 1N36B 3WMFA 2PANA 1DG3A 1P1IA 3R44A 4HL6A 5FCDA 3UWSA 3WLIA 4GL2A 1C9EA 2E85A 2QR3A 4QSMA 5H7XA 4YMLA 3CEMA 1VE5A 1R6UA 3DF7A 1P1HA 3KT6A 4Z86A 3ZD8A 4JY7A 1SUCA 2ZYIA 5EZYA 5FYDA 2WJVA 1ZG3A 3VV2A 1ZIDA 2ATXA 2HU7A 1A27A 3K6RA 1P18A 2EVWX 3MS4A 4FS8A 4WCDA 4BNWA 4CR7A 2J0UB 1UMBA 1DRKA 2IHYA 3HO8A 3GP8A 4PICA 1W49A 3A2NA 3ZK9A 1QOQB 3MJCA 1XIVA 5AK4A 3UFXB 5KU1A 1K7YA 4MKIA 5BORA 1FYXA 1JXQA 5BO5A 4ARBA 4X1IA 4MPRA 3IKMB 2FFRA 4UNRA 1RMTA 4A2CA 2JFZA 3UMCA 4Y67A 3L0BA 3GFPA 3IL2A 1IOWA 4GOKA 4GX5A 5IWCA 4FILA 5K0JA 4OOFA 1JEJA 2H65A 4GOJA 4WECA 4YWHA 3ENKA 2E48A 2P9FA 5KJEA 2DEUA 1FDTA 4IQ4A 4O0LA 3BYZA 3C3KA 4RF4A 4WPGA 5DU2A 4R69A 3OO1A 3W34A 4BB6A 2I7XA 1WU8A 2HT6A 3HVJA 4LRTB 4RK7A 4DTIA 5H5JA 1HQYE 5KNBA 4MUYA 3FMOB 1ISHA 1DFHA 4Q05A 3T12A 1E2PA 3WYAA 1OX6A 3A0UA 1RYFA 5DH9A 4J1TC 3F9CA 2H11A 4L15A 2AOVA 4YLGA 5LYYA 2QMOA 2OFWA 3MJTA 1QHSA 3ZN2A 3KR1A 4A26A 3O7WA 4HB3A 3OPYA 1QIMA 4M9QA 4KGVA 2EX4A 5FA6A 1W581 1PBTA 1I9CA 1XCOA 4NBLA 4V3BA 1KARA 1MA0A 1ZN8A 2Q1WA 3TIIA 3WGKA 1ZH8A 1KRXA 1SQ6A 3BMNA 3VPCA 2YWHA 4UHJA 2QG4A 3L41A 3IDFA 4LMAA 2NZYA 3LVFO 4A0HA 4A1FA 1KJ8A 1IBSA 1FP2A 4I9HA 1Y6FA 2XNDA 4H59A 1IZ0A 3OM0A 1EDEA 2JCVA 3FOBA 3OKPA 4YI5A 4D4HA 3RKUA 1RZRA 3WHKA 3VYWA 2QYOA 2ORVA 3ELDA 1GGHA 3DMGA 4OL0A 3ZVNA 3TR6A 3H0CA 3RUDA 1CXZA 2HDNB 3WLTA 1X80A 2OC9A 4JGBA 1Q1BA 3HB9A 3WNVA 4B7AA 1BRMA 5JNTA 2ILTA 1Z2AA 1XL1A 3QVGA 1YONA 4NL4H 3RYIB 1JLSA 2YMMA 1FBNA 4MUMA 2OV2A 4XM2A 3PXXA 5EUBA 1R0ZA 4QARA 3H3XA 2GDJA 3F5SA 4PX3A 1Y8RB 1Z22A 5LB2A 1OGJA 1ATZA 1BJRE 1RKBA 4GLJA 2P78A 3FOWA 4MITA 3BRWD 4HUTA 3E53A 3LU1A 2JVJA 3HVUA 3NKFA 4NIMA 4PAQA 3Q7IA 5CB6A 3OAAA 5E38A 2J85A 4BQNA 4AF7A 1APBA 2P68A 5BMVB 2YJ5A 2JJ1D 1C3OB 3EDRA 1P72A 1SCJA 1NG1A 3JQ6A 3GLHE 1JB1A 3BJZA 4NZYA 4PZ0A 4ZA2A 1UK8A 1UODA 3WRWA 3ZNOA 1SVWA 1KI9A 5TQ2B 4EG6A 1B8OA 2P1RA 4WUVA 4BBJA 1Z4QA 1NJ8A 1D8AA 2WIKA 1NXPA 1R0RE 2LWIA 3V8VA 3W7BA 4OKSA 2D7JA 1I1HA 2A3NA 1I6LA 3E8XA 3LKDA 4TYMA 1M7HA 1CUGA 4DDTA 1ZUWA 1ONBA 1EP2B 5I6DA 3IQXA 3T61A 2BKXA 3OFJA 1Y89A 1Y1SA 5IXJA 2H2HA 2A59A 1GAEO 3CUYA 2J0QA 4Z2YA 2WZBA 1FVFA 2D4AA 1CZKA 2J4CA 1HO3A 2IDZA 4LHWA 4N3AA 4O5AA 8MHTA 2CV2A 3OTOB 1ZD4A 3FPEA 1EP3B 3MGCA 3PT5A 5ICSA 2Q2NA 3EAQA 1NNI1 2M98A 3IEUA 3LHFA 4PPQA 2AG5A 5GWXA 2LGJA 4ANFA 3WSWA 2JAHA 3TINA 1WXQA 2HHLA 2FW8A 3SEQA 1P7YA 2NACA 4DEVA 1OA1A 3Q6IA 2PRKA 3T5TA 3LDAA 3DA8A 2XXAA 3U4GA 1JAIA 2ZIGA 1DFGA 3DXXA 4ALIA 5GZ1A 3H6GA 1UK9A 3TQQA 2BJVA 1HNXB 1PR2A 3ZWMA 3L6RA 2NGRA 3A2KA 3EEYA 1C3VA 4C89A 4KNVA 3OZEA 3P9IA 1L5SA 1PFQA 3EIEA 5C80A 1E0AA 1KQ3A 2NAPA 3JSXA 4DR3B 1TYBE 5IXSA 1HURA 5BQOA 1WVIA 1J0BA 3BE6A 1T0BA 3FUCA 3VO2A 3KZKA 4DV0B 3PQ5A 1G5QA 1NF3A 4CF3A 4Z99A 2BFDA 4MYHA 2UUCB 4DYDA 2ZU6A 1U1DA 1Z4JA 4Z9XA 3KSMA 2OB2A 2PO5A 3GLSA 1I2CA 4KMSA 4NDNE 4TTSA 2JJ2D 5FR1A 1VYTA 1A8PA 2DH6A 3OIDA 3NANA 4GYYA 3I01M 1VCNA 4QWWA 3NU1A 2C7OA 3PEFA 3VTKA 3KQTA 2CSUA 1ZMRA 3G17A 4V39A 2C04A 2PCJA 4ARAA 2JDID 3TF5A 2XR1A 4E1VA 3ZJVA 4HAOA 5J2TB 1ZI8A 3KD3A 1RJFA 2HQRA 3BD7A 3QX9A 4YJHB 4PLGA 5FIUA 3W5DA 4C7VA 1KU6A 2SKEA 3GU3A 3JVEA 4B83A 1DBRA 1WKBA 2WVAA 3KKOA 4G65A 2P91A 1DJNA 4HGPA 1KEEB 4N5IX 4GF5A 4UCWA 4XYGA 3T3IA 5L40A 3U7FB 1YA6A 2ASEA 1TYDE 4M8IA 1DTSA 1MMFB 4O63O 3LQKA 2XZPA 2IYEA 2FN3A 1SBQA 4ZI7F 3AKCA 4TV8F 2AS0A 3TPFA 1FTSA 3N75A 3V4SA 1RMYA 4LXUA 1SCDA 5FBWB 1WP9A 2QRJA 3Q9UA 4XDGA 1MGPA 3KBBA 3QF4A 3RIMA 3GK3A 1M2VA 2XHZA 3QU7A 1V39A 1BMFA 4KN5A 3THSA 1MXFA 2H1CA 2GD0A 1EIZA 3EARA 3OLYA 4KIWA 5JZSA 3TE7A 4KRFA 4NK5A 1XUOA 1TK3A 2I4OA 4HD8A 1DWPA 3K6JA 1Z5UA 4KSYA 1D1SA 5H3HA 2XSZD 2G0AA 1KH2A 2CVZA 2X4DA 2VTKA 4EGSA 4MUXA 3NC1C 1U2ZA 1R9GA 3GXOA 2F59A 4FWTA 4LK2A 3EZNA 1XWWA 2BFWA 2IY9A 3BPSA 1XHFA 5FNVB 3Q2OA 3U61B 4QDUA 4XVHA 2ODQA 2EZUA 3PE3A 4JOQA 1VHQA 2CN1A 4P0TA 2Q2OA 5ADVA 4DCCA 3GLFE 1E2QA 1LDGA 1OSNA 5EJMA 4EA8A 1TO6A 1AH2A 1WZCA 4JYCA 4RF5A 3DE6X 1LBTA 1ZUNA 4IHJB 4E1BA 1ONPA 5LQRA 4KO1S 3AIIA 5EHQA 5ESRA 5F5NA 3WIDA 3FG9A 2V5VA 5TX7A 2JCSA 2HV8A 3FRJA 5DEIA 3RHZA 2RARA 1EGMB 1ZK2A 3AVQA 5FTJA 4QKQA 2OCBA 2XKKA 1BG6A 5IDQA 1P80A 4CCYB 2H4YA 3SD7A 4BMXA 2CJXA 4WTOA 4XIJA 4KBYA 2ARKA 5EOVA 3IIKA 5IDWA 4D9CA 4NDZA 1RWKA 2VSYA 3EK2A 2EARA 2HCRA 5LP6B 2OV1A 3U44B 9MHTA 2HREA 1I3NA 1BNCA 1NVFA 3ONFA 5ULLA 3AF5A 1JPNA 2GNOA 3BIFA 1LDNA 3O5AA 3AVTA 2TYSB 1PTJC 4R0MA 3LYHA 2QL5A 1U3TA 1Y9AA 3D6NB 4Q7MB 3WKCA 5LDDC 1O57A 4PS0A 2QVYX 1RXWA 3X1YA 2C0CA 4AN0A 2F8MA 2PBLA 4HAUA 4PYOA 3WI7A 1WSWA 3SHQA 4OJYA 1TM2A 2WHYA 4P32A 1NUAA 3K0FA 4EHNA 5BVGA 4IZHA 4FE3A 4KR9A 1Y4DE 2JGAA 1PZGA 3W4IA 4CMEA 1SC1A 4I9FA 4QJBA 2Q5IA 2V9PA 4DB4A 1R8JA 1K68A 1YZQA 4BWFB 3BRQA 3KUDA 2I6TA 4KZKA 1XMIA 4XD7D 3P45A 5BOSA 2J0EA 1PEAA 2KBEA 4NCJA 3BSSA 2OC4A 1WCIA 1GZVA 1KZYC 2OENG 3VKFA 4CLOA 1GSAA 1E1LA 2R44A 1P2UA 4HVAA 2N0SA 2XGSA 5I9MA 1FFDA 2I78A 1JG4A 4OOEA 1DHTA 2H1HA 3T5CA 3ZLUA 4DL9A 5K09A 2WMOB 2ZRBA 2AG6A 3O3OB 1EB9A 3C16C 4IRXA 4ZVKA 4OUDB 4BUZA 4HS9A 1TVMA 3KO8A 2CW5A 4H08A 4ZU3A 421PA 5I9NA 3ZHCA 5G4LA 4UM9B 3EZ6A 1ODKA 4TUYF 4GLLA 4Y9UA 1IHUA 1RR6A 1WA5A 2IK8A 2VSNA 2YBEA 3FH0A 1UBRS 3L7IA 3N0VA 2OYRA 1RVDA 1SM4A 1SD2A 1SU7A 3EH2A 4GR5A 4J3FA 5HCUA 1RJEA 3L8MA 2UZ3A 3OCJA 5IMBA 1SG0A 3T0GA 3ZXXA 4B46A 4J0FA 4DV5B 4RQTA 3ZZMA 1CERA 4B5LA 3FVRA 1QGZA 1RHKA 4XUCA 4KU4A 5F3RA 5F1YA 4OD0A 4ZOBA 2H4XA 2I9PA 4P98A 1AQLA 2G0TA 2W2MA 1V3QE 1EP1B 4WLOA 1W85B 4I46A 4AB1A 4UATA 3ZWKA 2VNIA 3ZDRA 4MUJA 5CIYA 1S2LA 1U6IA 5CCXA 4A92A 4BRWA 5ES4B 3IAM1 3EHDA 4L73A 4ZOCA 4BEJA 1J0AA 3HLKA 5HGXA 5J4KA 1RYDA 4WERA 2MHCA 2E4ZA 2P3SA 3RAGA 2K5UA 1IQ0A 5EMNA 3IJRA 2QQ0A 3VZPA 3BMCA 4FDMA 4YECA 3JD3A 1R4MB 1ZUIA 5B7GA 2BF7A 4BQPA 2ZYTX 2CMDA 1WBJB 1CJSA 2HWYA 1JQKA 2EU8A 5KX5B 1HNNA 4W8OA 3S1LA 2D5AA 3BGIA 5JLAA 3E1GA 3ETJA 1DVRA 1AS2A 4Q4AB 3FSRA 1W8IA 1X9GA 3VKVA 3ZJYA 3Q5EA 1G3IA 3BL5A 3T1VA 2IXTA 2LW7A 1PWZA 2Z1DA 4ER7A 4RTJA 4J0HA 1ODTC 5DE3A 1NURA 1O6CA 1OPXA 2H1RA 2PUHA 1F4PA 2NSJA 2ZP1A 3GRAA 6ABPA 1JIQA 1XVLA 4GPAA 5EIWA 5FFMA 3DQZA 1G291 2VDOB 2VJLA 1UIMA 1XTQA 3UOAB 5AVTA 4BTVA 4IIGA 2IGBA 2XHEA 4I14A 1DDGA 4X8LA 1JE1A 2VHZA 4IMJB 5EPUA 4NF2A 4OEHA 4Q3AA 3FY4A 2YH2A 2I4MA 1PNTA 1J42A 2CL6X 2IUTA 2NO5A 2Y0DA 3CKYA 4JIMA 3HPRA 4R1PA 3GT4A 4RSRA 3FPKA 4EGCB 5JQGF 2VNSA 2WZCA 2PE5A 3DPUA 2ZSDA 2UVPB 4KXUA 1W4AA 3DMDA 1P74A 4FJ1A 1KY3A 4OYRA 3RS5A 4F1KA 3STWA 5C1BA 1XMQB 1UXJA 1P4AA 4YRTA 1AA9A 4WOPA 1HT3A 3DFMA 1XRRA 1QHIA 3WQBA 1BMTA 4IIYA 2QYTA 4JWTA 3NOQA 3QMWA 1G0NA 1GNRA 1XZNA 3AOGA 3EQ8A 4MQFB 4OK3A 1BWSA 1QOPB 1WMAA 5CGQB 3HLTA 4BBPA 3C1OA 4J07A 4P3YA 5EGNA 4MUBA 3IAEA 4OFZA 2QSYA 2XGOA 3IMGA 2E18A 4CI0B 5BXYA 4KQKA 3U31A 4A27A 2H6EA 2IYPA 1JHOA 3G85A 2I5PO 2D1QA 2VA9A 2PSJA 4QYWA 3ND5A 4YXWD 1T9DA 4MINA 2VDJA 5B53A 1R50A 5KC9A 1OY1A 4RLSA 4G9EA 3G2NA 2R00A 1FYWA 2GAAA 2QG6A 2CLEB 3GMTA 4KUEA 3AGQA 3ON5A 4URWR 1RXVA 2LDXA 1G60A 4DMKA 1ILEA 5FORA 4F2WA 4EY5A 1O58A 5FOVA 4Q39A 1O9BA 4CM8B 1S2OA 4BV9A 3S1SA 5JRZA 1IBMB 1VBMA 3N8KA 2BN4A 2PGNA 1C1DB 2MT9A 2UVDA 2FSIA 4RMNA 2AYYA 1W75A 1W5EA 1WHSA 1XDGA 1VFPA 1AZSC 5JSKA 4F6CA 3WL7A 2W22A 2ZUVA 3H1PA 1PFYA 1H6CA 2PGOA 3I0NA 3NALA 5A0TA 4FN5A 1RLOA 5LBTA 5JVDB 1ZK0A 2IUSA 2ZITA 5T6BA 3U4AA 3W5JA 4XVUA 3FUUA 5MN6A 4I2VA 3PC3A 3UUGA 1P75A 2N47A 2P6MA 4U2FA 2GVDC 2G7ZA 4V0NA 1HT0A 5JCXA 2J3EA 4PTZA 1ORTA 1LF5A 4TT3D 3N05A 2CXSA 1QGYA 3O83A 5EP2A 4Z0PA 1P44A 2KJQA 1EXMA 1TJNA 4OLFA 1Z8NA 4TMXA 2J6HA 3CW8X 4I81A 1QC5A 2FPOA 3NASA 3PQ6A 3UICA 5CNKA 5KTMA 2ZGVA 2C2KA 4J75A 5SY6A 5EE9A 3B6ZA 1F06A 1R0LA 3G0GA 4WNAA 3SHWA 1FNDA 3VVCA 4E5KA 5KDDA 3T1TA 4YB8A 1V4NA 2GLXA 4RM3A 1NVTA 2C9YA 3PUHA 3B1KA 1M66A 1JQEA 3HGTA 1K3FA 4U7HA 1E3WB 4TWAA 4D81A 1YNOA 4LVUA 1FL9A 2MSCB 2OLEA 3EUAA 4PZCA 5A3JA 2VF5X 3MCVA 4U5QA 1WX1A 4E3WA 4R71A 2AOTA 1B6TA 2XIQA 1EPUA 1A2KC 3NYWA 1FVHA 2EFHB 1EHIA 1JDUA 4GIBA 3WGOA 4DSZA 5HVNA 3AFMA 3DWEX 4X20B 5F9HA 4L08A 3GGCA 2ONCA 3DONA 5IH7A 4HDCA 5IARA 3Q8WA 3OPMA 4KPEC 4DW8A 2O3JA 1M6EX 1MJ5A 2VZLA 3CZAA 2XUKA 2KHZA 1W4BA 4KLCA 3R75A 3VHLB 3LCRA 4M3NA 3AEQB 3ZV7A 2PX6A 4MW4A 3VYRB 2QSJA 2P1DA 2C82A 1CJUC 1SUAA 5DTMA 4GSKA 4UXJA 1JR3A 5GY7A 3VZCA 1I4LD 3O73A 1MPXA 1I4OA 2KE5A 3TL2A 2IH4A 2AJDA 5UKDA 1QXSA 4LSGA 4BFWA 1U0FA 1HZZA 4Z2AA 1IWOA 4FD3A 1Q22A 3AM1A 4WLUA 3MGAA 1I01A 2FFQA 3A9UA 5DOVA 3LUAA 4LOKA 3NJ8A 3RARA 4FGKA 4GM4A 3UTCA 1HX7A 1KY4A 2KM1A 2ZOSA 2BSAA 2MYPA 4UVHA 2PL3A 1P19A 2OCAA 2Y2UA 4MKZA 3CVYA 1Y7TA 1JWBB 4JVLA 1JEDA 2CWDA 1RIFA 2Z43A 1M6VA 5K3AA 3K1ZA 2O3TA 1Z4MA 4ZPJA 5ED4A 1XMOB 4FP9A 2VF8A 2Q4DA 1WBBA 4DR7B 3K6KA 3K9CA 1STOA 1R0KA 4QL3A 1SWWA 1H3NA 4LF4B 5I7FA 4XX0A 5GONA 3N2KB 1GUFA 1R9NA 1H2WA 3A26A 3LK7A 4C6TA 4YIKA 3EXHA 3FJYA 3IVXA 5ALGA 3ZU5A 5CDFA 4CKEA 1RI2A 1O2DA 2Y0EA 3PFIA 1UZNA 5JYDA 2FMUA 4EYEA 1KIAA 3DTVD 4HRXA 1C3JA 2RAVA 3FPLA 4E12A 2MINA 3SU8A 1RWPA 3T0FA 5LQAA 3WOVA 3CVUA 1AQUA 4PWZA 4OM8A 4KYIB 5A5EA 3L7OA 4ZVTA 1TYAE 1Y80A 4BN0A 2WD7A 4PPYA 2Q3BA 3FB1A 4JT9A 4D82A 5FOQA 2IE0A 3LK6A 5BQPA 3RH0A 5GV7A 4AJ1A 3MRTA 5TIIA 1BE8A 1LRLA 2IZZA 1LI7A 1Q7BA 2JLBA 2PX4A 4MWCA 1OU4A 1YZUA 3D6HA 3GUVA 1S2MA 2W98A 2QSUA 5IFKA 1MHTA 2R00C 2QNRA 3VNUA 4R3UC 3MLEA 1UT6A 3HKBA 1VKZA 3ZNNA 1BU8A 4JXZA 1TT7A 2AG8A 1EFHA 3EN0A 3FJOA 1KDZA 4ACAA 3O3NB 5KX5A 4PINA 1DUSA 4GP6A 3QU4A 1CLUA 1YS1X 1OROA 2VBFA 1YDMA 1Q17A 3IP6A 5GONB 3ZVRA 4ERXA 1CZUA 2WIBA 4KXFB 2ZWOA 1K63A 3QVXA 3WZLA 3PTLA 4KKVA 1TDJA 2CB9A 3L6BA 2HK8A 1XF9A 3G2QA 4LXYA 4MQ6A 2ZSHA 4LVOA 4O3FA 4X93A 5BV0A 1VKRA 2QJTA 2YV3A 5D8DA 4N0DA 2QP9X 5EXXA 3FUXA 4KLNA 3H1EA 3KQHA 1PL7A 4KL8S 4WADA 3H9GA 1CP2A 4X6LA 3X1KA 4PGGA 1IH8A 4E21A 4MJ7A 2QY6A 1U7ZA 2CJPA 1F5NA 1F8YA 2EIXA 3CHYA 1KZGB 5DCWA 5D5QA 5KX5F 5CJJA 4RY9A 5ANRB 3HCOA 2X5OA 3KKMA 3T7KA 4JFAA 3FAKA 2RK4A 4HH4A 3OZ7A 4RTOA 3PX3A 3V1UA 3H1GA 3L8FA 4J91A 2I4TA 5F4BA 5HKOA 2X41A 3PT9A 5LMCA 4HFNA 1YVDA 4AJJA 1EK5A 9ATCA 3VAZA 1CQIB 2BFEA 4I99A 1HL7A 4TQUS 1RFLA 2XCUA 3I04M 3F71A 3GLGE 1W96A 1NXQA 4GBJA 5EHZA 4IIVA 2ACEA 2XOEA 2PVPA 4J3JA 4F92B 5LNK6 3WL3A 1L8LA 1U90A 5HKBA 2CXPA 3VPHA 5CFQA 1IXZA 1Y4UA 2X8WA 2Y8EA 1UAGA 3JZDA 4GRIA 3JV7A 2PX8A 4J7XA 3VPFA 5K0CA 2FKNA 4CV0A 2PRZA 2XNKA 5EWLA 2F3PA 1XD2B 1E77A 3H4MA 1FQWA 4RNDB 4CFSA 2E7ZA 3BRSA 4FONA 2AQKA 5EESA 1T4DA 1MJFA 1KK2A 3PHBE 3IEMA 1U65A 4W9NC 3S40A 4WZBE 1E2LA 4D9NA 3OQOA 4IVPA 4S1VA 3QW2A 3GCGA 4V0MA 1E2DA 1G16A 3VU8A 3DEZA 3QFRA 1Q12A 1QH8A 4MMYB 2XAUA 3FTFA 4BUJA 2E5FA 3WK6A 2ABWA 1NT2A 1CY1A 2QLBA 4UM7A 5D84A 5H16A 1B2LA 2H0RA 2JIPA 5AJZA 1XP8A 2ZQYA 3BDIA 1SZPA 2BVNA 4L0DA 4TMZA 3HGMA 5IWAB 3ICCA 4ON9A 5AW4A 5AM2A 5DX8A 4LJ8A 3AVVA 1K4YA 3ZD7A 4QFCA 1S3SA 4HEHA 4DS3A 1FNSA 1LVGA 1T5DX 1YASA 4FHEA 5JMOA 1L7BA 5I7UA 3T5DA 2PIDA 2P2SA 4PC2A 1BVHA 4ZALA 4F06A 2Q1SA 1GQSA 1TTQB 3EWNA 1GYRA 2IS6A 3W5VA 4KQ6A 4WFKA 1S89A 3IRUA 3VVLA 5IN4A 1EB8A 3CO5A 1YD7A 1U5BB 1WS6A 4KB5A 3DG9A 4M53A 5JMPA 4N3CA 4ACBA 5SICE 1O77A 3ZD9A 1NPTO 1T2FA 2EV9A 2UDPA 1OLXA 3N2NA 1Q19A 1VLQA 4I3HA 1IXKA 4RSMA 4K1XA 2FAXA 4ZOLB 5ALVA 1V3UA 3RABA 1PFKA 3K1AA 1IZ7A 3LQQA 4QUHA 3ZY4A 4RVUA 1M8PA 4PLHA 2B7BA 3BMXA 4YV2A 4WASA 2IF0A 2JLUA 3JQGB 4L74A 2G1AA 4MB2A 3LV8A 3RYFB 2BHTA 2FJPA 2BGUA 4P4NA 4REQB 2CXNA 3R0ZA 3L84A 1SOAA 1VL1A 3AG5A 2JJMA 1N32B 5EERA 2BEVA 2FPWA 5DN6A 1OLSB 2JHFA 3P2IA 1GZ3A 4JOCA 5DM60 1V0JA 1UDRA 3MCAA 1N2ZA 4J4HA 3HVRA 4KH1A 1ZN7A 3AK4A 3COZA 3BFKA 4KDEA 3HY4A 3IOYA 2PBFA 1I2AA 3A1WA 1XB2A 1QO9A 2OMKA 2YWDA 5LNK1 3U3JA 1OYOA 1TLFA 4JSTA 1W8DA 2VWGA 2WOJA 3FW1A 1KE2A 4ILKA 3ICVA 6LDHA 3O4GA 2PXCA 1ZH6A 2YJGA 2YL2A 1U0GA 3EGIA 4KPGA 4U0JA 4LI0A 3E05A 1DAHA 2X0IA 4QEKA 3WYBA 4U3JB 3NDRA 4E2YA 2C31A 4DCUA 4GU5A 2J3HA 2RGRA 2WKSA 4N54A 1X70A 5JO0A 2PUEA 3BA6A 3OF3A 5HEKA 1VLLA 1EXVA 4Q37A 3H9CA 3OHSX 1WUHS 2BFBA 1I3OA 3NIWA 1UKCA 1E9SA 4GOXA 1WJGA 2RHJA 3BHNA 4WA7A 1IZ9A 721PA 1BW9A 4UQPA 2JLCA 2FRXA 3IMEA 1HZZC 2J45A 2BDEA 2VR1A 3K0CA 3SJBA 3BM5A 3VPGA 4KE9A 2V55B 3OPXA 1LBIA 2C2HA 1N2SA 3RSOA 5B2FA 5JMWA 2W6PA 1ZXXA 2PKEA 5DWVA 4DMFA 3LCMA 5LM3A 1R88A 4P4LA 3RUEA 2OOSA 1M2KA 4F4JA 2C7PA 1GZ7A 2X0KA 5AVKA 2P65A 1TPZA 3UXMA 1V5GA 1ENPA 1X86B 2FV8A 5AW1A 4RZQA 3PSAA 5DRYA 5ERXA 1YBHA 1POWA 2P69A 5EE5B 4BNJA 5BN1A 5L95A 3LO8A 3R1IA 1I3CA 3PDWA 5I4KA 2BONA 2FWBA 1K8RA 1LFAA 1A2OA 1Q0SA 3ZCTA 1LDMA 3IV6A 2KBFA 2DTDA 4K9LA 3NHRA 4MVJA 1AGPA 5A5GA 5DYGA 1GV0A 1TZJA 4DIDA 1UBKS 3OOWA 1JH8A 2YXDA 2ZWIA 2R8OA 2DQKA 4ZCMA 1L1EA 4QBGB 3N86A 2ZE8A 3ZZ0A 4B73A 1COZA 4TVOA 1B1CA 4XOUA 5E4TA 2ETXA 2BFBB 1WU7A 3SZMA 4J0KA 3TZBA 3C8HA 5KBYA 3V1YA 4RZIA 2WT8A 1U2SA 1Z7GA 1LPSA 3OJEA 4RZ2A 5TDHA 4QJ3A 3NAQA 4ZV9A 1VJ0A 3BAZA 1KSHA 1QO7A 3OJ0A 1SULA 2HMWA 1ZD3A 1TM5E 2AMLA 2CLIB 2H2WA 5EZSA 1OLUB 4M1TA 4MVJP 2WWFA 4DAOA 3CGGA 2PRIA 2X1VA 1M2HA 1JG7A 3HYNA 3TEFA 2NO7A 4D56A 4IRUB 5E3JA 4EP1A 3GRZA 5M34A 1BX3A 2PU5A 1I6WA 4K9MA 5JMTA 3LBYA 4FR2A 4M83A 1W88B 4QBTA 4FC7A 1RQ7A 4Y9TA 3VVMA 3BJMA 4PZLA 4KRGA 1XJQA 2A9PA 4CL3A 3DNPA 4JXKA 4NNPA 1NQAO 3O8LA 1HOTA 4FYVA 4HOYA 4ZQGA 3SC4A 3UFXA 4FSXA 1A7KA 1N9GA 2PQMA 2ZIVB 3OIUA 4MWTA 4URHA 4X84A 5L6MB 2MR5A 1K4MA 5TPWA 1U2RA 1IK6A 3QJ5A 4WESA 5CPFA 1H65A 2H9YA 4Y1RA 2X22A 3KB2A 4NMHA 1FSGA 2GPSA 2NXNA 2XBLA 1M1NA 3HV0A 4NZZA 4N6OA 2PZLA 4FI3F 1FUEA 1TMOA 1YDEA 2Z1NA 3JZMA 4BO2A 4EA6A 2JFFA 4HZGA 3ZE2B 1UDAA 4GGOA 5LD2C 1M6WA 3PVCA 3IPCA 3NM6B 4KO4S 4F4HA 5A9SA 3WO1A 3EVAA 4AZ3B 5LA6A 1DHRA 2WJWA 4B3BA 1E9CA 4QVGA 4YT2A 1IG0A 3NIDB 2XQKA 2SICE 3FFWA 1Z5OA 3TNFA 3TKAA 1VE3A 2X2PA 3QEJA 1KL7A 2GA9A 5EWMA 3TVDA 1XU9A 1VI2A 4OJKA 2QPLA 1Z29A 3KVYA 3OBBA 4M87A 4PPNA 4K6GA 3K8OE 3D6JA 3E4DA 4KKXB 4WBSA 4XTRA 2FLWA 2RGCA 3NAMA 3B3JA 2JFVA 4MQ4A 3EGDB 4IDFA 3ETEA 2WYOA 4YONB 5BSRA 1FFYA 1IYZA 4PHCA 5AM0A 5IANA 1SCKA 3OQIB 1KMIY 2OKGA 4BB9A 3GYBA 1OT5A 1EINA 1WE2A 3DVLA 3EDCA 4XJXA 3MRXA 4A9AA 4C06A 3T3HA 5ENVA 4FR5A 2WWIA 2I6FA