4P92A

Crystal structure of dienelactone hydrolase c123s mutant at 1.65 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization of dienelactone hydrolase in two space groups: structural changes caused by crystal packing.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
molecule keywords Carboxymethylenebutenolidase
total genus 82
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2014-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p92A00
5K5EA 3ZLVA 2WFLA 5ALRA 1SFRA 3I2KA 1XZDA 3PFCA 2DR0A 2JGMA 4EY8A 1VA5A 4DNOA 1EK1A 3O9MA 1LPAB 1R9NA 4OB6A 1DT5A 5I9IA 4BTVA 2X5XA 1N5MA 2WIGA 5IH7A 3E4DA 3WK4A 4UFNA 1FFAA 1T4MA 1EDBA 4BTLA 1JMKC 3C5WP 3WYDA 4HRXA 2VJCA 1JJFA 3WL6A 1YB7A 2CZQA 4DYHA 1FSSA 3CN7A 5AK5A 5H3HA 4B82A 3I2HA 2RAUA 3KD2A 3VJKA 5EHNA 2GYUA 3H2GA 3DNMA 2H7CA 4QDOA 2ZSIA 4OYLA 3QITA 4KE6A 2QXTA 1U65A 4HXEB 3UMJA 2EDCA 1ZIXA 1VLQA 1WHTA 1BROA 5DTIA 3KWJA 3VXKA 1ZD3A 1XRMA 3FCYA 2I03A 3WJ1A 5CURA 1K63A 1NU6A 5FLKA 2I3ZA 2OGTA 1W75A 1WB4A 2WUGA 1THTA 4WFJA 4H7EA 4XVCA 1J2EA 2BFNA 4KYVA 5BWBA 4G8DA 1Y7HA 3H18A 1VXOA 2AJCA 2QS9A 2WKWA 2DHEA 1WCYA 3U0VA 1YR2A 1UKCA 3G0DA 3ED1A 1XZEA 3BJRA 4ZWNA 3D7RA 2XI4A 3HXKA 5ALHA 5FRDA 1GKKA 1DX4A 4BYMA 1NU8A 5ALXA 2HA5A 1R3DA 5LZ7A 4W63A 2JGKA 1DT3A 2XMBA 4HVTA 5FUMA 4K6KA 1UWCA 4J0GA 4WJLA 1BN6A 4HXFB 5HCUA 4GDMA 1MN6A 5CT4A 1IUOA 2R11A 3HEAA 5D6OA 4BVJA 1GPNA 5A7FA 2JEYA 2QUAA 1XKTA 4Y9SA 4EY7A 5ALYA 4Q05A 2DSNA 4OU4A 2BCEA 4FFWA 1L7AA 3ESBA 1JKMA 5E4TA 3W9UA 4FWBA 5CH3A 5HKAA 1KU0A 2OXEA 2HA0A 1H2YA 3BIWA 3HACA 3H1AA 3L1IA 5F4ZA 3FYUA 1E3QA 1CPYA 3GBSA 5IVHA 1IZ8A 5FXMA 5C81A 3F8SA 2ROQA 3NWOA 3A70A 4X00A 4HTAA 2CB9A 3BE8A 2VT6A 4UFPA 3ZI7A 3G7NA 4EUSA 5YASA 2B4KA 2VA9A 5JZSA 1AMNA 5K3BA 2XQIA 3DDUA 6YASA 5KBYA 3A2NA 1PV1A 2CJPA 4FLFA 5J3JA 5LZ5A 2J3DA 3MUOA 1LZKA 2DQYA 2PSDA 4U2CA 4EA6A 3QPAA 4YASA 3BDIA 3IUMA 1DQYA 3G9UA 1VZ2A 5FPPA 3AIOA 3STWA 5C8XA 1ZICA 3MVEA 3WWPA 5D3KA 1EHYA 1DU4A 2QXUA 1QOZA 4BP9A 1R9MA 1SC9A 1VA4A 2WUDA 2QRUA 2W6CX 3HRHA 2OCGA 1RYYA 3G0BA 1UK6A 5CH5A 2XUHA 1MPXA 1QE3A 4UBOA 3WKEA 2GYVA 2HU5A 4PV7A 3HSSA 1YA8A 4W1RA 2ONCA 1MNAA 2FUKA 4LKOA 5KWIA 3GUUA 2HA3A 1CUAA 2C5FA 3W9BA 4H35A 3FNBA 2PU5A 4KEAA 3H19A 3ESDA 2VEOA 4GLBA 2GZSA 4HS9A 2FJ0A 2YH2A 1LNSA 5T4FA 3IDAA 1LPPA 4N5HX 3F96A 3M82A 4PF1A 3H1BA 4QLOA 1UK9A 1FFEA 4LXGA 2D5LA 1QIFA 3W2TA 3JYHA 2ACEA 4U2GA 3BDVA 1MJ5A 5JZ9A 4DIUA 1QFMA 5HK8A 1QGED 2WM2A 3M83A 1O6FA 3WK8A 2AJDA 1RP1A 4MWTA 4J0HA 1F6WA 2PBLA 1DQZA 5JZBA 2O7RA 1MU0A 5JASA 1ZJ5A 1H2ZA 3FBWA 4Q34A 4IH4A 2DHCA 4MEAA 1TK3A 3ICVA 2PVSA 4OD0A 1CUYA 5HFAA 3D2AA 5JAOA 4DM7A 4E14A 5DNWA 3BF7A 5LIPA 4X94A 1M33A 1UZAA 4ROTA 5A2GA 1LGYA 4BCCA 4HXGA 5ALDA 3IUQA 5EFZA 3OM8A 4L3WA 1XFDA 2O2GA 1F8UA 5CT9A 4F21A 3LS2A 3NGMA 4UBLA 2IIVA 1N1MA 3R3XA 1ACLA 3OOSA 2XDWA 1R50A 4TGLA 2QM0A 1GZ7A 4X7BA 4UBMA 3G9TA 4LIPD 4E11A 4BDSA 1EVQA 2HADA 5AKHA 4ZGBA 5CT6A 5HFNA 5JIBA 1MTZA 2HA6A 1KU6A 1A7UA 3DJYA 4EY4A 3QMVA 4IO0A 4J0CA 5JANA 3UUFA 3STUA 3D4LA 3R3YA 2Z3ZA 1W52X 3W04A 1AC5A 3WWOA 5E4JA 5T4HA 1HKHA 1I6WA 2XLCA 4B9EA 1UXOA 3QPDA 1UKAA 1L7RA 2GBFA 1MNQA 2G5TA 1JU4A 4Q82A 3I2JA 3R3WA 3D2CA 4BZWA 2VAXA 4BVLA 2D0DA 5KWJA 5IVKA 1SCQA 4G8BA 3G9XA 1VJ5A 2QJRA 3K2IA 4LXHA 2JEZA 4OB7A 5E4YA 3FSGA 3TGLA 2H1IA 4UHCA 5AIAA 1UOOA 4CG2A 2OAGA 3C5VA 3G0GA 2G5PA 1ODCA 3BF8A 2WFMA 4F5ZA 1KEZA 5JAUA 3TRDA 2WHQA 4QZVA 5K3CA 4GEGA 3JW8A 1CUCA 1XLWA 4J03A 4QWWA 5AI4A 3WA6A 1CVLA 5ALIA 4AN0A 4NZZA 4G5XA 2XMSA 1ZI9A 2E3JA 1Y37A 3I6ZA 1YS2X 3O4JA 4WY8A 3UUEA 4H77A 4YK7A 3O9VA 1MAHA 1SOMA 3AZOA 4AZ3A 4K6GA 1LBSA 5BWCA 2DQZA 1ZOIA 5EI5A 5FP0A 4AMZA 5AKZA 1XLUA 4H18A 1X2EA 1LBTA 2V9ZA 3T52A 3PI6A 2QOEA 2HHAA 1DX6A 3B12A 1WPRA 3DKKA 2BUCA 5ALGA 2OQVA 3I6MA 3WKDA 3NUZA 4W9RA 4MXDA 1K6EA 5BV7A 2HIHA 3IULA 3FYUC 1R88A 2B20A 2VAVA 5C7YA 3WWEA 4BC0A 2NW6A 2VT7A 4OSEA 1O6GA 4JNCA 2HRQA 2WIKA 3RM3A 7YASA 5ALVA 4UBKA 3AZPA 1E8NA 1QONA 2C4HA 2CEKA 1TCCA 2XUOA 4Y7DA 3LCRA 3DS8A 1YAHA 4OUKX 4N8EA 4DSAA 2WUFA 2QZPA 4WCVA 3R41A 4KRXA 1HQDA 1IUPA 3KOOA 4J0DA 3G8YA 4AN1A 4L72A 1CUBA 3DLTA 2Y2VA 5BOVA 3FVRA 3H17A 1QTRA 3M81A 4HZGA 5HF6A 4KAAA 2XUFA 5HF5A 5LZ9A 3I28A 1EI9A 4IH1A 1SCIA 1E8MA 3H04A 2XUPA 5HZGA 1QO9A 3VJMA 3PUHA 4JYPA 1G66A 4LYDA 1B41A 4INZA 5DTJA 4B83A 3VJLA 4FBLA 1TCAA 3GELA 2WFLB 2ZYRA 4BRSA 5AM2A 2OQIA 1UFOA 3EF3A 1Q0ZA 2VJDA 4Y2SA 1TIBA 4FLMA 3WIBA 4AMYA 2J4CA 5ALOA 2GZRA 2OCIA 4B85A 1YA4A 4Q1VA 3BIXA 4Y2JA 3HI4A 1ZJ4A 4J3JA 1GQRA 1P0QA 1BN7A 2WJ6A 4BE9A 4DLNA 1FJ2A 1AZWA 5LZ2A 4DMKA 1C7JA 1EDDA 5JATA 4U2EA 2QVBA 5HKBA 4X97A 4Y2QA 1E8DA 4NMWA 1Y7IA 2H9YA 2BUAA 3AINA 3WIOA 4BAUA 1BCRA 2ACKA 3F98A 4BAGA 5AKJA 4MYSA 1Q0RA 1QIDA 3I1YA 3G02A 4CFSA 4KE7A 2W22A 3E1GA 4C4ZA 4YPVA 5HF9A 1GKLA 5AOAA 1EK2A 3IA2A 2X8BA 4WY5A 1LPNA 1YB6A 1THGA 3N0TA 4NS4A 4UFOA 3FOBA 4JEIA 4UHEA 4QNNA 3ANTA 1C7IA 2VF2A 2CUTA 4UPDA 4JUIA 3K6KA 4DMHA 3QH4A 3STTA 5CT5A 1CUEA 5FOQA 3OTQA 2K2QB 5LP1A 1WPXA 5IKXA 3T4UA 5T4EA 4AX4A 5IVIA 3C6YA 4MQMA 2ES4A 1BRTA 1XROA 4Y2XA 2WILA 3R3UA 3KSRA 3C8HA 2WTMA 5AJHA 1ZGCA 3CXUA 4MQLA 1FFBA 2PKYX 1X2BA 2B61A 3V1MA 5AKIA 4EBBA 4KJXA 5DLPA 3HJUA 4W1QA 1ODTC 3EQ9A 1X70A 4BVKA 3B3QA 1DWOA 3R3ZA 1CUSA 1VE6A 3D3NA 3WK6A 5AH0A 4BZZA 4CG3A 2FX5A 1P0IA 1CEXA 1BS9A 5K3FA 3IIIA 3I6YA 4KE9A 4QWMA 4F60A 2AJLI 2O7VA 3EBLA 3QVMA 1U2EA 1VE7A 1Z68A 5DYYA 2WJ3A 3BL8A 1LPMA 4RE5A 3H2JA 1XRLA 2BAGA 2HA2A 1JFRA 5AKYA 1XQYA 5ALZA 1QIIA 1CUGA 3WL7A 1GPKA 2PX6A 3PF8A 3H2KA 1XZIA 3U1TA 3WWDA 1XZBA 3IUNA 3OC0A 1A88A 3SK0A 2EDAA 3MGAA 2AJBA 1CUJA 3WQHA 3WWCA 2WG1A 2HU7A 3O0DA 3RARA 4ARAA 2WIFA 2C58A 5ALEA 1TQHA 3QMMA 3S8YA 2XMRA 4ZXFA 3O4GA 4HAIA 3VISA 3ZPXA 3OPMA 3WL8A 4MYDA 3D59A 3DYIA 1QLWA 1G5FA 4ITVA 4MEBA 4I19A 2XLBA 3PICA 5C8ZA 2JGEA 1XZHA 5I8PA 1QIGA 4BB0A 4QDZA 2PU7A 2JGJA 4UBJA 4W1PA 4RNCA 1WM1A 1EXWA 1MX9A 4XIIA 3HZOA 3PF9A 3WMRA 5ALPA 4C6HA 2WHRA 4I3FA 5K3EA 4FHZA 2H7XA 2ZVDA 3E0XA 4TVKA 2UZ0A 3MUNA 4UUQA 4N5IX 3CCBA 1J07A 1QIJA 3RKSA 5FKJA 4X3CA 5AOCA 4B0PA 1B6GA 3X3HA 2Z8ZA 3GA7A 3AILA 4BATA 4G4GA 4G9GA 1S8OA 1G42A 2OLEA 1YASA 3GZJA 4WFKA 5AIBA 1JI3A 4OYYA 4X95A 5K3FB 3I2GA 2XUQA 3A6ZA 4PNZA 5CXXA 3WK9A 5CXUA 5JYCA 4FNMA 3QMWA 4IH9A 4H7HA 4J0JA 1IUNA 2XMCA 2ZYSA 2JF0A 1PFQA 4P93A 1K8QA 4C01A 5A71A 1XZGA 3QPCA 1N5RA 4AO7A 1GGVA 2AXEA 4N8DA 4I4CA 4H7DA 2ZJ7A 1UOPA 2BJHA 4QLAA 4P92A 4ETWA 5CH8A 3PUIA 1W1IA 1UKBA 2XMZA 5AM4A 1XZMA 2YYSA 4LHEA 4AQDA 1ZD2P 4OCZA 4CIAA 1MO2A 3WJ2A 3A2LA 3D5EA 2DCMA 5AKEA 2G63A 2PSHA 1ZIYA 1ZI8A 2VQ6A 3G9ZA 1ETHA 2C7BA 1EVEA 1XRNA 2PM8A 1LPOA 4FOLA 4AXBA 3B5EA 3IURA 5AKLA 4CIBA 2VSQA 2J4FA 5JALA 3EQ7A 1LPBB 4B80A 2ZYHA 3ICWA 1QJ4A 1P0PA 4K2AA 2RHTA 5AM5A 4UHDA 4EZIA 2QT9A 1XZCA 3RK4A 1AX9A 1UK7A 3C6XA 1BEEA 4M0MA 5AOBA 1BU8A 2XMQA 3AFIA 1CUZA 1XRPA 1XZJA 1G4HA 1BCSA 3HYSA 5AM1A 3VDXA 2OGZA 5ALTA 5CTAA 2WG0A 1CUWA 3WYNA 4AO8A 2PUHA 2LIPA 3FSGD 2PSJA 3HLKA 2Q0XA 3GFFA 3K9BA 2ORYA 5D3ZA 1MX1A 1XKLA 1CQWA 4OU5A 4EY5A 3C8DA 1H22A 5CRIA 5ALWA 2WFZA 5A7HA 2GYWA 1UK8A 1HPLA 4IQ4A 1XQWA 2QR5A 2RGUA 4U2DA 4E46A 2WLSA 3FVTA 4UBIA 2OCLA 4FKBA 4BCBA 1R1DA 3C87A 4W1SA 5AI9A 3FLBA 1WB5A 1CLEA 5E2IA 1GQSA 4C87A 3WA7A 2JGLA 5I7UA 2I3DA 3QYJA 5A7GA 2XMGA 4CCYB 4FTWA 1U4NA 2IX9A 3O95A 1QIKA 4A16A 2BKLA 3C6ZA 1USWA 4X90A 1CRLA 5JARA 3AIMA 4FBMA 2C0PA 2X76A 3L1HA 4UBNA 5LZ4A 1L7QA 5ESRA 3LIPA 4J0KA 4UHFA 3AZQA 5CW2A 3WLAA 3WK7A 5AKXA 4G1FA 3FCXA 4Y2RA 3STXA 5AI8A 4CCWA 4BDTA 4C4YA 4IHAA 1E5TA 4B7ZA 3C6BA 4A23A 4KAFA 3PE6A 5AI6A 3DD5A 2XUKA 5LKAA 3C43A 4AB1A 1HBJA 1FFCA 1YAJA 3LLCA 4GHWA 4Y2YA 2BGNA 2HFKA 1EA5A 2FJPA 4KE8A 3P2MA 2PPLA 4GW3A 4G9EA 4DNFA 5EIEA 2QTBA 1JMYA 1QIEA 4Q3LA 4X92A 4C4XA 2V96A 1TRHA 1DWQA 5JD4A 1OILA 4PSDA 5K3AA 3VKFA 3FYTA 1E66A 2CBGA 5EIHA 4G4JA 5ALLA 1OXMA 4M0EA 1YS1X 3BWXA 1UOQA 3DYVA 5IVDA 1UT6A 3CCCA 5EIAA 3FAKA 1QZ3A 1CUXA 5ALKA 5AKKA 3V9AA 3ZLUA 5DNUA 1DINA 2RI6A 1HLGA 3FLEA 3PDCA 3ZLTA 2PUJA 1SCKA 2WJ4A 2QMQA 1K4YA 4Y2UA 1IMJA 3ILSA 3IUJA 1CUHA 3DCNA 3SX4A 4CCYA 3DQZA 1R4ZA 5LLSA 4ZI5A 1ZGBA 4NVRA 1CUVA 5AK6A 1ORVA 1P0MA 3NOXA 5A6VA 4ARBA 1CUIA 5ISMA 2PSEA 4XX1A 4KRYA 3QM1A 3W05A 2JBWA 4Z49A 3W06A 4Y2VA 2ECFA 1WB6A 4DSZA 1K5PA 5LKRA 4WFIA 1TAHA 5JD6A 1XQVA 2ZYIA 2XUGA 3H0CA 1LPSA 3V1KA 5EHQA 1XQXA 3DKRA 4H7FA 1IZ7A 1TCBA 1A8SA 4DMCA 5ALQA 3O4HA 5CMLA 5EGNA 3DL7A 5ALSA 3VVMA 3HC7A 4X93A 1QFSA 1BEZA 2J3QA 3ESCA 3STVA 4P08A 1W6RA 3WK5A 4A5SA 5AM0A 5SYNA 2WTNA 4ZV7A 1A8UA 2OGSA 1IVYA 1EINA 3ESAA 1FFDA 2JGIA 4JYMA 4CI9A 3V48A 1MT3A 3LIIA 2GBGA 3IBTA 2PSFA 4BC1A 1JU3A 3HABA 2XB6A 1JT2A 4U2BA 5AKGA 4QEKA 1CUFA 2HRRA 3LP5A 2OCKA 1GT6A 2XQJA 4EB0A 4V2IA 3R0VA 1U8EA 1NX9A 1ISPA 3PFBA 4EHBA 4DMFA 5D7BA 2WQZA 1XZKA 5HF8A 1GXSA 4H0CA 4RGYA 1YCDA 4S0XA 1ODSA 4H7KA 1BE0A 1ZD4A 4X85A 4DNPA 2O2IA 3IVMA 3H2HA 1QIHA 3QZUA 2JGFA 4QDXA 1CFJA 4GECA 4PSCA 1OCEA 4LYEA 4L0CA 3BJMA 3SWWA 3I1IA 2WSLA 1MAAA 3WKAA 3CN9A 1DWPA 5LZ8A 4C89A 1PJAA 4QE3A 4QA9A 3L1JA 3D2BA 5AI0A 1MX5A 1T2NA 3EQ8A 4FNGA 4KR0A 4KAJA 4PO3X 4F0JA 2EEPA 3C70A 1JJBA 5AK3A 2RIPA 3FLAA 1AURA 4KACA 2WG2A 2Z5GA 3AIKA 2VATA 3I2FA 4P9NA 1EH5A 1H23A 1F0PA 5HQ3A 4X71A 4ZV9A 1TKRA 5DYWA 2HDWA 5ALMA 1F0NA 4BE4A 3WKBA 1LZLA 4OB8A 1EDEA 4FFVA 4TPKA 3G0IA 3F97A 2HM7A 3KDAA 4MJ3A 1AGYA 2VJBA 4Y2TA 2V97A 2Y6VA 1XRQA 4QDUA 4UHBA 2DFPA 2C5GA 4YX9A 3R40A 3R3VA 5LYYA 3OG9A 4FDMA 3TJMA 4DTCA 1J06A 1RWQA 2HA7A 5AHXA 2XQGA 3Q8WA 3STYA 4GI1A 1AUOA 5ALJA 3C45A 3BXPA 1H2XA 3DOIA 2QUBA 5FV4A 4J0IA 1QO7A 4U2FA 1CUUA 2XQKA 5AO9A 1CUDA 2XE4A 4JH0A 5K3DA 2R8BA 4X6YA 3FYUB 5DJ5A 4XJVA 4QDTA 2GBCA 4PQEA 1EX9A 3TEJA 2XUDA 1XZFA 3S2ZA 1QTIA 5EHZA 4Y2PA 3IB3A 4DNQA 4D9JA 4K6HA 3A2MA 4ZRDA 2CMFA 3D0KA 4BAZA 1E89A 4PSUA 5ALFA 5AP9A 3KWFA 1EB9A 4X6UA 3OURA 2V98A 4EY6A 2WHPB 2WU4A 4WDRA 2PL5A 1DTEA 5AICA 1EB8A 2OPHA 5CT8A 4MWSA 1AQLA 5ALNA 4O08A 4AO6A 2JIDA 1A8QA 2RHWA 1WHSA 1VKHA 2I78A 5C8VA 4BRZA 2OAEA 1YSCA 4Q3OA 4N8SA 4DGQA 2VTVA 4B6GA 3WZMA 1ZD5A 4BBZA 2Z8XA 2HFJA 4E15A 3G0CA 2BGRA 1H2WA 5DWDA 3QBJA 1W76A 4H7IA 2XUAA 2GBIA 4BP8A 1LLFA 5FPQA 3DL4A 1ZI6A 4B0OA 3Q0TA 1CR6A 4PW0A 4RE6A 3WL5A 5AM3A 4XWGA 1D07A 3WZLA 5EHXA 2DHDA 2WUEA 3GROA 2HU8A 4G8CA 2HA4A 1HDEA 2XT0A 2XUIA 5CBKA 4J7AA 2YASA 5JADA 3ZV7A 3F67A 3ZWQA 4HRYA 4CG1A 1CQZA 2VJAA 1WOMA 5T4BA 4GXNA 1W4LA 2O2HA 4H7JA 3I2IA 1Q83A 2Y2UA 3AJAA 5A62A 5HQ3B 2ZJFA 3DEAA 1CV2A 4G4IA 4RPCA 3EIOA 2XUJA 1N8SA 5SYMA 3M3DA 3V1NA 2WHPA 3DOHA 1QIMA 4UHHA 4LXIA 1J1IA 2Y6UA 2ZSHA 4GWLA 4ZREA 3YASA 1ACJA 3WKCA 3ANSA 2HL6A 2G4LA 2Y1KA 1GPLA 1XZAA 3AUKA 2ZJ6A 3JWEA 5JAPA 2WIJA 2WU3A 3F9CA 2QJWA 1ORWA 4FLEA 1XZLA 4B84A 4WDQA 5DYTA 4B81A 2Z3WA 2CKMA 2XMDA 5AI5A 3RLIA 3N2ZB 4B9AA 2IITA 4FMPA 4C88A 2BUBA 4X6XA 4OPMA 2AJ8A 3WI7A 1VOTA 1AKNA 4Q3KA 2RONA 3FWHA 4BCDA 2H7YA 2QKYA 4X91A 5JD5A 3O4IA 2B9VA 2XQFA 3E3AA 3H2IA 3VVLA 1VZ3A 5HK9A 4AZ0A 1XLVA 1VXRA 5FDFA 1Q84A 1HL7A 5ALUA 3V1LA 1C4XA 1CIJA 4M0FA 5DNVA 3KXPA 2YXPX 2OG1A 4K5QA 2P8SA 5KREA 2C0QA 5JAHA 4L9AA 2WIDA 3SC2A 1JJIA 5AK4A 4GBGA 1XRRA
chains in the Genus database with same CATH superfamily
2P77A 1EX6A 1OU4A 1YL5A 2AFVA 1BE6A 2X8LA 3T5AA 5K5EA 1UBGA 2AB0A 3IOEA 3DEYX 1X8LA 1PFWA 1DRJA 4G9BA 5IUKC 3SCZA 2HDNB 1Z3CA 1JWAB 3TECE 3ETLA 4X66B 1FK8A 2CXQA 2Q41A 3KAKA 3PFCA 4OTZA 4C14A 2DR0A 5TVKA 5ILQA 2V1XA 4QEDA 1VA5A 3ACCA 3I58A 2ZWIA 1PSDA 2R00C 3QBDA 5EHIA 5G02A 4DNOA 4F8YA 2WU1A 1J2UA 1HG1A 3O9MA 4ODIA 4Q1DA 1LPAB 2AS0A 3SJ7A 1PJ2A 3PTZA 2PJUA 2IBSA 4V38A 3GJ6A 1O5IA 2VHJA 4RD0A 1RRKA 2YFKA 1ZK4A 3TTTA 4DUGD 2O2XA 3KZOA 3TSYA 3I32A 1N5MA 1PT8A 2E5LB 4AY4A 1L4BA 3OLCX 4MW2A 3A7DA 1PQPA 3L7BA 1BXRB 4GI5A 3HUFA 4ZYLA 5HFJA 1YS4A 3DMYA 2AG6A 2O2YA 4K40A 2C95A 4UU8A 3JQAB 4NCBA 4Q02A 1T6YA 3C5WP 3FNGA 4M99A 3HVKA 1JEAA 3AH8A 1O6CA 3OQJA 4P7GA 2LD4A 2VJCA 4PYMA 4X8OA 3QEBZ 4A73A 3W3AD 4ENTA 1I7NA 3EG9A 2OOKA 3NASA 2YZGA 7MDHA 1NP7A 2PTGA 3FUTA 2PUDA 3HSYA 4HLUC 1AB5A 3K7EA 1X92A 1N3LA 1SRRA 2FX2A 3EYWA 1XAIA 3K1AA 4G2TA 2ERXA 4JI1B 1VIVA 2BEVB 2CZQA 3OX4A 4B2IA 4UTZA 3T5BA 5IF3A 5C3UA 1ND5A 4C4OA 1ZN2A 1U2RA 3DKVA 5DZSA 5H3HA 4KXQA 1MB3A 4JLDA 1MQSA 1NNEA 4TTIA 4BFWA 1NGSA 1Z0SA 2X0DA 2X0EA 1Y5LA 4C4TA 3ZDFA 5EHNA 5IDWA 1GRRA 4LRYA 4IQFA 4GLOA 1I2BA 4G5GA 3RS5A 4LNUA 4O4IB 3KR0A 2ZRQA 5DF1A 5IEJA 3BE4A 4TTTS 2AOXA 1E2PA 3H5IA 4G37A 5E8JA 3IA7A 3EBPA 4PZ9A 1JDTA 4OQQA 1H05A 2IOHA 1G60A 5ADHA 1VLQA 5G0WA 2OFFA 2J3JA 4GC9A 4UJ3A 3FHTA 2DPYA 1HORA 1NXPA 5DTIA 1MC8A 1CQXA 2F17A 3TTWA 2OHXA 3WNBA 5A3JA 5JFTA 4KMRA 3LGSA 3N8KA 5TMEA 2FRVA 1FBNA 2HRDA 3L4EA 4R69A 2F3SA 1YQ9A 2X15A 3ASVA 3D6HA 3IVXA 4KQXA 1LX7A 4MCIA 3O21A 3R7FA 4YHHB 3ICQB 1K63A 4JU9A 3HCWA 4B6OA 4QJ3A 5JCZA 1CR1A 1IXYA 4MLZA 3GEEA 2DY1A 2C94A 1T9KA 2H2AA 1PD1A 4Z9BA 5JV5A 1OGJA 4HDQB 2ADMA 3ZIDA 2P3SA 3UIEA 1E2DA 4XVCA 3HLYA 4A5OA 9MHTA 4OHXA 1V1JA 4KYVA 4TL8A 5SY4A 3VBCA 4JUFA 3WGGA 4YQEA 4P36A 5FUXA 4ALKA 1QK5A 1N32B 1N0HA 3A27A 4TTPA 3W4JA 2N0SA 3FWYA 2WKWA 2HMYB 3CISA 4HEA6 5JSYA 3TAHA 1Q14A 4P5PA 2OBXA 2WC1A 1YR2A 2G07A 3ETJA 3PYXA 2GCEA 4IJWA 4WZAE 5T8KA 3WP1B 4CMAA 2OFPA 5J4KA 3BH0A 4LJ5A 3ED1A 2C7VA 2O3SA 3FRJA 1YONA 3PX3A 1E0AA 3M6IA 1E2JA 3A7EA 2SBTA 2W71A 5LU8A 1O9BA 2Q5JA 3ODPA 1P45A 3IDOA 2XIJA 1DX4A 4HWTA 4Q4HB 4QBFA 2WWVD 4HNAA 2VP9A 3SS9X 3VZSA 2PRYA 2DECA 2I3AA 2OO3A 1EFVA 1R3DA 1T0BA 5LZ7A 1KS2A 1TU4A 3O8CA 3KKQA 1ZMOA 1MW8X 4CFYA 2HN9A 4K6OA 4OQMA 4EFMA 4F1KA 2NMVA 4WCFB 5A4FS 1Z62A 3U09A 2E4WA 4G24A 2V7PA 3ZJ5A 4TRNA 3AB7A 5MF6A 5MN4A 2E48A 3AWIA 4IFBA 3PKIA 2VCYA 3VHQA 1DT3A 5BSFA 1VSQA 1GGEA 2FQ1A 1SVUA 3NRBA 4HVTA 3T3OA 4K6KA 3ZTTA 5BVGB 1Z0KA 3M6FA 2EFGA 2PZ8A 5H3CA 4JXZA 4J0GA 1KY5A 1BN6A 3KXKA 1EK0A 2D7CA 4K03A 5EY5B 2W4MA 2W42A 3NFYA 3DD1A 5HCUA 4GDMA 2JFWA 3ZTYA 4I50B 4G5SA 3K9CA 3QVOA 1HUQA 1TVMA 3QW2A 1ZC3A 4LZZA 4PAMA 5HS6A 3ZKWB 3MS4A 5L40A 3O92A 4OMFG 2A0YA 1GPNA 1VL2A 2MJLA 4FYPA 2EC5A 2QUAA 3ZR4B 5BN1A 4Y9SA 1T4CB 5J2UB 1NM5A 5E7MA 1YFJA 3OE5A 1XJ5A 2VL7A 4W8GA 4Q05A 5DDIP 1D8AA 4JMPA 3UAWA 1OB2A 1CZKA 3RADC 1R00A 5HIJA 2R8ZA 1WQ4A 3V1TC 4AG5A 3I5YA 2BCEA 4AUNA 5ILOA 2KYRA 2XZDA 4D4GA 1V1MB 1Z17A 4K9LA 1HTBA 3EEFA 1XTVA 3JQ8A 1NMSA 2R85A 3OY7A 4Q9DA 1JDPA 3JQ7B 5CH3A 3UMCA 4EPTA 1ADFA 1KU0A 1O0SA 2PWPA 3S40A 2VJOA 3KLMX 3OKCA 1JF8A 3ZUPA 2YJ6A 4LHWA 4DQUA 1KSJA 2ZT8A 3ZHXA 5L9AA 4MCJA 1DL5A 2VH5R 4NSNA 2HCBA 1DV1A 1IBSA 3MLEA 3EUWA 1A9SA 3HR7A 4Q1FA 4B79A 5HMLA 4E2WA 1DHTA 5JS7A 3FFBA 4CUKA 1SQ6A 3SM9A 3FYUA 4QAQA 1E3QA 3GBSA 4TZTA 4OLHA 4D45A 5IVHA 3DTVB 4LZNA 2R6ZA 1IZ8A 1KVRA 2NZXA 3K9GA 3FCSB 3IAM6 4L28A 5FXMA 5CFPA 3UGJA 4MVYA 1B76A 4KDRA 3N2GB 3QVUA 1IU9A 2HNBA 1YBVA 2JLSA 3AIIA 4WOJA 3BH7A 1TU3A 3BE8A 2A58A 3GRVA 1GUAA 4A82A 1GTVA 2YHIA 3F6YA 1ZK3A 4JK3A 5D85A 5EJMA 5YASA 2PLRA 5J47A 4GSKA 4Q37A 5JZSA 4MR8A 1KPHA 3MTIA 5FUWA 1AMNA 5I7OA 5P8WA 1RT9A 4IDNA 4G0VA 5FI5A 2RJOA 1GD1O 1J8YF 3VKHA 4S2UA 1UKYA 3TR5A 4NFSA 1M75A 4Q4CA 1BH6A 5K3SA 1J6UA 4RMHA 4KO4S 6YASA 5KBYA 3NEPX 2OESA 3A2NA 1B26A 5HKOA 4F2GA 3OTOB 3CPSA 3AR3A 4GQBA 3F71A 3E9MA 5LQSA 4BWVA 3WA7A 1PR1A 2JFGA 3KB8A 2C96A 1T5DX 1G9XA 2VOJA 2NVUB 5E0KB 4QPZA 3FWPA 2ECQA 3DO5A 3SS7X 4GOMD 2BRUA 3UMFA 2PUEA 5GVSA 1TGYA 2J3DA 5J4LA 1LZKA 3S6JA 3RYTC 3OZGA 1NG1A 2JAPA 2PSDA 3HA5A 4GOXA 3UJ8A 3L7MA 1D7OA 2AN1A 2V5UA 3GEDA 1N78A 3CLRD 4IEFB 1LI4A 3IIEA 1DQYA 3IUMA 1U0LA 3BD7A 3M5WA 4HWOA 4IDHA 4J6EA 4J94A 1EEHA 3H5NA 4RF3A 5FPPA 3ZHYA 1FP1D 3O8OB 2FQWA 1G5PA 4L8FA 3STWA 5C8XA 3EX7C 1QF6A 4YREA 1BOOA 1A72A 1QG4A 1RYMA 2LUOA 1GZUA 3GEPA 4PS0A 3W7BA 3B7GA 1Z5WA 3EQZA 3KVYA 2RG1A 4NF2A 3U1VA 3WSTA 3DR3A 3CC8A 1N4DA 1R2QA 5ESXA 1ECFA 4IIVA 3TNJA 1XQ1A 2NUBA 4EGAA 1GZDA 4RFLA 1NNI1 2XGMA 3A6EA 4XH9B 1EUDB 1ZMRA 4UULA 4BO9A 2OCGA 1BDMA 3U3MA 4IW3B 2BTQB 5GJBA 1IQUA 1UK6A 1Z0AA 1DKMA 2QT1A 2ZS7A 5CH5A 3VZDA 4DARA 5JI2E 2IXBA 4RKYA 1PL8A 4FSXA 4MP6A 3BK2A 2P6UA 3AEKA 3BSYA 3A6KA 1MEOA 1B2RA 3KZXA 4ND8B 3OOEA 2P2LA 1R27A 3L7NA 4Q66C 4IXTA 2HU5A 1JG6A 5BQ3A 1ADCA 2Y0BA 1BGVA 1YIDA 1C9DB 3BIFA 2DLNA 3BN3A 4F04A 1JIKA 1G9SA 1X8JA 1ISRA 2VK2A 3HSSA 5EJIA 3UZUA 2ZB8A 2ZJZA 3QWBA 2ONCA 3E61A 4W1RA 2IGTA 1X94A 4LDQA 4V0QA 3SC6A 2FUKA 2ON6A 2HWKA 4AROA 3GLTA 1T3ZA 4H08A 3G8DA 1KE2A 3GUUA 1CUAA 3IXQA 1ESCA 3DNPA 1RYEA 3EHEA 2C29D 1KO8A 4Q16A 2PT6A 2OXTA 1S1CA 5EWJB 3UB4A 2VDLB 1H6AA 1FDIA 3QE4A 5E0OA 4J90A 2VEOA 2YUIA 4Y9DA 1NUQA 3A9SA 3QKRB 3HL0A 1PV4A 4DSTA 2OK7A 4GR4A 4NFYA 1L7PA 3UXYA 2WZCA 1T36A 3WGKA 3LV8A 4I6GA 1QLJA 4RXTA 3DB1A 4KV7A 3RIXA 1YJQA 4D82A 5L7TA 4UW9A 1UM9B 1V71A 4N9QA 5CM9C 3A04A 1D7AA 4G1VA 2QR2A 2AL7A 2CXSA 2AOTA 1DMRA 3A14A 3EXHB 4K9OA 1HXHA 2XKAA 3WGYA 5BSKA 3U4DA 5JECA 5JRJA 2JCXA 3H1BA 3WICA 1EM8B 3R8XA 4B3IA 1M1NA 2IZ5A 5D3QA 2QENA 1KOJA 4AAYA 1NQ5A 3IE2A 5HRAA 2IYYA 1EVZA 5ESWA 4DZRA 3KFLA 4ACAA 4HNRA 4MUNA 1VBMA 1G5HA 1O5TA 3AETA 1LS6A 3AEUB 4E3ZA 2IIPA 4BJHB 3W2TA 1Q16A 3VR2D 3EIEA 1DQSA 2EJUA 3OPYB 2ACEA 3QX8A 4OXKA 1PJTA 4U2GA 3VZQA 4N82A 1E1MA 1EFTA 1Z2PX 5K8LA 1I0ZA 3OHPA 1IAQA 1MJ5A 4L16A 1R5JA 5KVCA 3R7AA 1S8FA 4FGLA 3O2SB 4AKSA 2ZBGA 1VCHA 3BZUA 1KBQA 3HB0A 1RDFA 2JCSA 5AMXA 3GLQA 4ZHQA 2WP8J 1L7EA 2AKAB 3T9AA 5KSYA 4YUXA 1U3TA 3A10A 5JZBA 2ACWA 4JLKA 1MU0A 1ZW6A 4TUYF 4IHJB 3VNQA 4JBNA 4B4VA 2YN2A 3FBWA 3O6VA 3VV3A 3Q1LA 4AX8A 1QHHB 4MEAA 4TT3D 1TK3A 1ECBA 2D2EA 4H1TA 5KNCD 4M0LA 3T41A 2IF2A 4YJKA 2D00A 1CUYA 2C97A 4BKQA 2GGSA 2Z57A 3D2AA 5JAOA 3TZBA 3DW1X 2C8VA 3K1JA 4U39A 3LUAA 4JV5B 1SA0B 2F4NA 4GAEA 1VLZA 5LIPA 1QP4A 1M33A 1UZAA 2OVFA 3P0RA 4FW9A 2B34A 1OAOC 1I01A 3ZVMA 2AE2A 4P4SB 4S0ZA 4J43A 1FX0A 5A2GA 2WJGA 1SOWA 3ICCA 4PU0A 1JQAA 2BT4A 2B21A 2PGJA 2ZPAA 2FW1A 2NVUA 5HQJA 2FDRA 3IUQA 3SY8A 3D0OA 3UYLA 2GKOA 3H84A 1PJSA 2PRKA 5C18A 1DPGA 4TYMA 1UC8A 5BRNA 4ZPJA 1O97D 2HX1A 4UM9D 4DLZA 4L3WA 3E22A 4RV5A 1ZR4A 1V11B 2JLQA 2O2GA 3MIZA 5EYPB 5CT9A 2VTBA 1WUJS 3LS2A 1SUAA 3JQFC 4UBLA 2AZXA 5DI3A 3UW3A 1N1MA 2Q5CA 2QN2A 2R9VA 3R3XA 1N9ZA 2GCNA 2QTGA 2NU7B 2JGDB 3A1TA 2C57A 3R5JA 4J16C 3G2LA 4YCAA 3SC2B 2MYUA 3W2GA 4CETA 4O8CA 4OOFA 4U7WA 2A94A 1YQGA 1Y6GA 1RZRA 4LJAA 1JDSA 1U2DA 4EA8A 2GB4A 1FL9A 1JDNA 2ALJA 2B1IA 3O9ZA 3SVZA 2P6RA 5JJKA 1W19A 4R84A 5DTRA 2EKBA 4G36A 4NENA 3PC3A 3BGWA 4LIPD 1ABBA 4PTLA 3S2IA 4HV4A 4E11A 4ZCPA 3PS9A 4HNQA 4JUCA 3GJXC 4TWZA 3RC3A 2AUMA 3W8RA 2HK8A 3RTGA 5I7FA 4KLNA 2EGHA 5CT6A 2MINB 4IO1A 1OFGA 4OHFA 1Q21A 4W7HA 3OETA 3KSZO 2R6R1 3CF0A 1MTZA 2RK3A 3JR7A 5DGXA 3UJHA 4DBVO 5EWMB 2RB5A 4BO7A 2QP3A 4Z53A 1M6EX 4DCTA 2IIBA 3T7KA 4BPRA 1P2UA 5JANA 3UUFA 3D81A 1KAEA 1L1RA 3DWGA 1GAJA 3R3YA 4WVLA 1Y9EA 4OF4A 3GFBA 1W52X 2W2PA 3EGXB 5EKDA 3K0BA 1E4OA 1QJCA 3O8BA 3D1LA 3WWOA 3JWPA 4OKIA 4KHPB 1R74A 5E4JA 4NL4H 5HSGA 1JGTA 2AI3A 4EM6A 1ZHOA 4JEMA 2I91A 4YQZA 4P4NA 4H4EA 4ZO8A 2GZHA 3CRW1 5MHTA 2N47A 3OU2A 5CDHA 1J33A 4DG9A 4CQNA 2RHJA 3WG9A 3IERA 1UKAA 1IOZA 2GBFA 3MG9A 3QPDA 1MNQA 5E3HA 1JU4A 3OT5A 1FQKA 3A1DA 3D31A 2NZUG 2Z5VA 1Q0PA 4Q82A 5JOQA 1G3MA 2C0CA 2A0WA 3B52X 1JW9B 3DDSA 3D2CA 3QVGB 4HYYA 4B35A 3EGOA 1D3AA 2VAXA 2Y27A 5CCDA 4BVLA 2M2IA 2D0DA 5J4VA 5DE3A 4H27A 4YRJA 4EYQA 5KWJA 5IVKA 3V7UA 3FPCA 1MD9A 4Z8YA 4CU5A 4DBLE 4YAFA 5KX5F 3RU7A 1WEHA 2YWRA 4WI1A 3P5SA 4AVYA 1E9CA 2H92A 3G0OA 4NE9A 4GOOD 4NU8X 4S1PA 3UWSA 1F6BA 5EUBA 4B6SA 4BTEA 4D9HA 2GF0A 3UMSA 4RZ3A 1YS7A 3FSGA 2QM8A 5HBRA 1ORDA 3A6PC 2I55A 5K9ZA 1W4BA 4ZT6A 1UOOA 3TLAA 4CLOB 3C5VA 3G0GA 2G5PA 4KIJA 2X0JA 1CLUA 2P5UA 4JYBA 4HDOB 3BF8A 4Z9AA 1T8PA 2WFMA 8ABPA 1N2CA 1BQEA 3NBZC 2YNMA 3ACDA 1KEZA 3ABZA 2H0AA 2ZYDA 4MB0A 4RAQA 5G1PA 3PXBA 4EEKA 5ECWA 3I5XA 5J2UA 2ZJ4A 5FNVB 1H69A 2V45A 1ZOOA 4M2LA 4RJKA 5DVZA 1YVPA 2RH8A 3B9BA 4GEGA 3H11A 3L0YA 5EC8A 3TTVA 4XSGA 4EAQA 1BIFA 1JQBA 4NDNE 3C8UA 3VNVA 2Q3EA 3TZQA 1PLLA 4Z1MA 5DH9A 3AEYA 3WA6A 1MDFA 2YHUA 3CNNA 5FBHA 3KR2A 3PCXA 1J5PA 1EGHA 1YOBA 4JJFA 1DAIA 4G5XA 4AN0A 4L4RA 5ES3A 1ZI9A 5F5NA 1A5AB 1Z34A 2YFQA 2ZU6A 4KWHA 4GOJA 5LBTA 3ZDRA 5JNSA 4XXHA 4RQUA 1XTKA 3NHWA 1W94A 2AG0A 3G5MA 3GUYA 2CYCA 2X0NA 5FV7A 5ILGA 3PEYA 2AC7A 2WZDA 3FPBA 4DJJA 1GAQA 1U3VA 2QQ0A 3DDCA 4WY8A 3VR3D 4CL0A 1WW3A 1PNQA 4MZXA 3CNLA 4HZIA 3CIFA 4CT0A 1KSGA 3WYFA 3OUZA 4B6JA 1BU5A 2A0UA 3TLJA 4CDRA 4DL9A 2QP4A 4KFRA 4UEKA 1X87A 4J9UE 4YK7A 3O9VA 4PYKA 5JDIA 4FZRA 5CGZA 3WFJA 3W5CA 4AZ3A 3AWDA 4K6GA 5LDDC 1CHNA 1YZGA 3MBOA 3I01A 4M87A 4UUPA 5U4XA 3EEIA 2Z6VA 2Q50A 2RD2A 4JT4A 5K8VA 3ABSB 2JCGA 5EI5A 3RFTA 5D6NA 2A4MA 5FI1B 4NJMA 3O8OA 1ISIA 1JFLA 4KB5A 1BWQA 4LRWA 1YR9A 4WTOA 4ID9A 1XLUA 4TKVA 3MD0A 2GUWA 1JEQB 3JQQA 2YUTA 4KDCA 4PQRA 1I2AA 1DWUA 5B58T 3ZN2A 3K15A 4LJ4A 3SZLA 3B1XA 3HMQA 3U49A 3V9PA 2BHRA 4COKA 1EK5A 3T1TA 1GCOA 3CKLA 1NJ1A 4GGOA 3QKIA 4CN9A 2HHAA 2P78A 3GD5A 3EVBA 3B12A 3P9KA 3QKTA 2ADFA 3EDOA 1JWLA 3DKKA 2BUCA 3E3MA 2C7OA 2Q6KA 2WKQA 4YRTA 2Z5FA 4B09A 5ADVA 1H0RA 3TW8A 2OQVA 5DYGA 2PX2A 5ITZB 1E60A 5BV7A 2AW5A 2AFIE 4KV9A 4R3NA 5GZ1A 4QQKA 4XASA 2AF3C 5G2OA 3MSCA 3WGIA 3T3PB 3BA6A 2HIHA 3IULA 5FBWB 3FYUC 2ZI9A 3KJXA 3ZGNA 1F2TB 4UAUA 1XDDA 3DZGA 2B20A 3HKCB 4LJ6A 4M1EA 3K1AB 3LF2A 4K05A 2VAVA 4M54A 5EP2A 5LCXA 4UNPA 3M3HA 3IKVA 4BC0A 2ZSDA 2VT7A 3EW9A 2X2PA 1SHLA 5FI0B 1XDBA 2IZ6A 5F33A 2WIKA 1ZGHA 3F7NA 4PHFA 3T5PA 1D2MA 2CJXA 4JOQA 4EO4A 3J81k 5IMSA 4UBKA 1Z56C 3EG9B 1VG9B 3JAKB 2IYSA 1SOAA 1QONA 3DAOA 3IP6A 2JB9A 5DHUA 2YW9A 2OFWA 3BHMA 4LDRA 5JRZA 4YCSA 1DJLA 1E3IA 1DQPA 4WLUA 5DBIA 2F90A 1I4LD 5I9BA 3LY9A 1Z28A 4U9HS 1EVIA 1RAGA 4P4UA 3DBRA 4C6TB 2BYTA 3WLSA 4PLYA 2HMTA 3S1AB 3NPAA 1UJBA 3QUTA 1C8KA 3TQRA 5M2QA 1BMFA 4MHSA 3RHSA 4EI8A 2PFKA 3VU3A 4IX1A 3NAMA 5AJWA 4B87A 1GQOA 4JXXA 4GLLA 1C29B 3UJAA 4ZZ1A 1S4QA 3I01M 4W5JA 2Q4BA 4MRVA 1G1MA 2PHZA 4QNRA 4MWGA 4WOKA 4N7JA 2O0LA 2W6IA 4LHYA 2RCNA 2B8TA 3SX2A 3VSCA 2H1CA 3ZK8A 3H1GA 4WUTA 4D4MA 4HNSA 4AN1A 1WCXA 4YIHA 3GI1A 4G0MA 1CUBA 1DBPA 4RS3A 2Q1WA 2Y2VA 2CXNA 3A6GA 2CHFA 5G4KA 2Z3VA 2FPPA 2CUZA 1CJMA 3H17A 1C0LA 1IN6A 2CXPA 2CNBA 1UDCA 1Q0SA 1YO6A 2RGEA 3M81A 4XLZA 3V6LA 1IY1A 2C03A 2YCLA 2PUGA 3RSHA 5IJZA 1MJNA 5HF5A 4YS6A 3M4YA 3CF2A 4TM8A 4QJ4A 3EDQA 1ORIA 3OE7D 4R2IA 3KR9A 1Q1AA 1XF9A 5DCWA 1R18A 4UPEA 1DG9A 2KMLA 4NESA 4NV0A 4IRUB 3OJCA 3T1VA 3ZWDA 4YMLA 3OM1A 3TR0A 4N1AA 1G55A 4LF6B 1NMYA 1YMUA 3B1VA 3GPDG 3LVFO 3PEVA 4IHJF 1KEKA 5K4AA 4P22A 3EWNA 1VIAA 3H04A 3AQIA 2PN1A 2ATVA 4ZDJA 2DTEA 3NHPA 3NPMA 4O63O 2HIGA 3O03A 1M76A 3AJ8A 5A05A 3K92A 5E1MA 2OQ2A 4FINA 2W8BA 2GEKA 1C7ZA 1QCZA 2FN9A 4H0FA 4C7JA 4Q24A 3UXMA 1ZIOA 5H5JA 5DTJA 3L4BC 1G8GA 1EXNA 4L9RA 4WOCA 3CLTD 2BGKA 3KZMA 3OZDA 1GL6A 4JI6B 5B3JC 2ZYRA 3PZRA 1BA3A 2OQIA 2ZG6A 1P7CA 4QC2A 1A4RA 4ZRNA 4RD1A 4RO0A 3PJFA 3N76A 5B57C 5JZOA 1ZUHA 3LQYA 2QRLA 4FHDA 1IXSB 4JC5A 3C2QA 5IT9A 2XDYA 4Y2SA 4FLMA 4PG7A 3GZTB 5BYKA 2FPSA 3NC4A 1WTAA 2R79A 3PFHA 4KI7A 4R1OA 2GZRA 1NYLA 2WJYA 1J70A 3G2IA 4WPGA 4YJHB 4ZP1A 3EY4A 3UF0A 3A3OA 1E94E 1HI9A 1Z18A 2FMIA 5T57A 4E5VA 4G3XA 3BTOA 4FFMA 4Q1VA 3RT9A 4AY2A 4PXAA 4ARSA 4N7MA 4Y2JA 4BX2A 4J3JA 2DSTA 4E32A 3IR7A 2ZRKA 1RD4A 4HDNA 2R6DA 4D4LA 2FFAA 3GP5A 4IIJF 4OQLA 4AFNA 1BX0A 3DL2A 4BE9A 4QM6A 3IUSA 4F9TA 4DLNA 2R97A 2IV2X 2GS9A 3ZU3A 3P2EA 1ONBA 4C4SA 5E6UA 1XI2A 2FB9A 4PZUA 5E95A 3TFWA 1AZWA 3OIDA 4IS2A 3W5SA 4ESHA 2DKOA 4CR7A 1C7JA 1EDDA 1XVLA 3S1SA 4U2EA 3CR3C 2WV7A 1PO7A 5HKBA 3KZCA 5KSOA 1R8XA 1SCNE 4XQEA 4D8VA 2I2WA 1Z2CA 1NLMA 4JI0B 2FR8A 2QTVB 2HHHB 3JZAA 4P4TA 4RK1A 2ZBVA 2J7PA 2JJ2D 3ROFA 4OJQA 1E8DA 4NMWA 1QV9A 4HLQB 4XEUA 3CNQS 3NXKA 3BXFA 4FCTA 3E3LA 5CVJA 5KTRA 3VOBA 4EYKA 1HE8B 3A06A 3R20A 4P6VF 4CXMA 1A2QA 1Z35A 3LX8A 1M0SA 3NNSA 2OO5A 4A2PA 4U4AA 3G02A 2WDZA 3SZRA 4P31A 5P21A 4NZNA 2OM2A 3KT3A 1K5GA 4MUXA 5GVRA 4CV3A 2AOTB 2DKNA 3GLKA 4L76A 3VZPA 4B3SB 3K9QO 3PQ4A 1VC2A 2CN1A 3C3YA 5AOAA 5EE0A 4QFBA 4A2WA 3AM5A 4AJKA 5A5EA 3IA2A 2JBAB 2P2SA 3TVTA 3KQUA 3KQPA 2EW2A 4WY5A 1KAOA 1LPNA 1YB6A 1ZO8A 1BKSB 3AKYA 3AB3A 3D9QX 3N0TA 3OZFA 3PYMA 4FJ0A 4JR0A 2EF1A 4MTLA 5GM2A 5ITSA 2C92A 5IDYA 2AV6A 3BHJA 4QNNA 3CWQA 4I55F 3QKRA 1KFBB 3S1LA 3RUCA 4JUIA 1OTXA 2GHRA 3CEMA 2O0MA 3L9XA 4FGJA 4Q0MA 2P6PA 4E70A 2DR2A 5CT5A 3X2SA 1EZ4A 5EWJA 3N6XA 2K2QB 1U90A 3WDSA 4EL0A 1P18A 1XLTC 4TSKA 3ONVA 3E23A 3T4UA 1C8LA 2H07A 3ADPA 4AX4A 4C29A 4CCSA 4MQMA 4OAQA 3JARB 5LB2A 3AX6A 2XB2A 4Y2XA 3TG2A 1VRWA 2WILA 2ARKA 5JI3E 1QHFA 4BQRA 1UMDA 3LYLA 3VOTA 2HEGA 1Z2EA 3VJRA 1P9WA 1M1NB 5JJ5A 3ZI4A 1QKIA 1DELA 4GGMX 1L5HA 4EITA 4UASA 3EVTA 3K0CA 5JWOA 4MQLA 3CXUA 2NP7A 4Q4LA 1MOZA 3OKFA 2HF9A 1JU9A 1HEUA 4D4IA 5JHHB 2VQSA 4TMTA 1ZW1A 5FOTA 2O2EA 5DLPA 4JI2B 1F60A 2E37A 4O4JF 4YMVA 3TMAA 2WJWA 1V37A 5HKLA 1ULSA 1YUMA 1M2OA 4JB8A 3INTA 2C4NA 3QTLA 1FF9A 2G71A 3NS7A 4WN9A 5JCOA 2ASEA 1KOLA 1SQ0A 4BFZA 4BVKA 3ET4A 1SKUA 3RR2A 4YDHB 2OT3B 1W4ZA 4B17A 1Z4MA 1ZBQA 3B3QA 3MMZA 3R3ZA 4I8DA 3VNUA 1U1FA 1NIJA 2V58A 5BSUA 2WFAA 4NZOA 3LUHA 3REOA 2ODEA 5BWLA 3KJQA 4R1TA 3E9YA 3VYRB 4BKPA 3X44A 3WK6A 3ZBUA 4OYRA 3GGSA 1R16A 2ZR9A 4NLLA 5AH0A 1DV2A 4HXYA 3REQA 3Q10A 4F2HA 2ZRCA 4BZZA 4IMJB 2ZVQX 2GUGA 1OI3A 4LJLA 3JATB 3LECA 1P0IA 2GRAA 3LDUA 2XIQA 3ISVA 3PU6A 5IX8A 3WQSB 2WJZB 1S9DA 2WOJA 4KLCA 1G64A 4BBAA 3MTJA 5IMBA 4CF7A 1DC8A 2D59A 4YJ2F 1RXIA 3RFCA 5FOWA 3X1YA 2CB0A 4QWMA 2FUCA 4FDUA 1HG0A 4ZO4A 4HQNA 3EBLA 5G0VA 3QVMA 1E2KA 4G09A 3DTTA 2NUAA 3OPNA 3QE3A 1MOPA 1JHAA 2V4UA 3GPCA 3H2JA 1YFKA 2H8KA 4RE5A 5I48A 3AGQA 1E6UA 2VBFA 3A3NA 3DE1X 3KNZA 5DEIA 4KR3A 1XQYA 2CXRA 2Y1OA 1R12A 3OCJA 3RS9A 3SE7A 2XF2A 1T1JA 5HCIA 4GPTA 3GFVA 3AGPA 2ZT7A 1OAAA 3MN1A 4MPRA 3WL7A 3GCDA 1Q22A 4JX8A 4CMHA 5JCOC 1WETA 4I36A 1X80A 2OA0A 3T3MB 2R00A 1M6WA 1NIPA 2R6GA 2ZWPA 3HP4A 4Q3DA 3H2KA 2A59A 2N46A 2VA8A 3UPTA 1HURA 4BGDA 5GTDA 1M8KA 1XZBA 1SIWA 3DMFA 4JL8A 2H51A 3IUNA 3C5HA 2ZUDA 1I1OA 1ZQ9A 3AVVA 2DBVO 1BGWA 1KRHA 1A88A 2EWWA 2JLZA 4MI3A 4HN4B 2BZGA 2UVPA 3W2FA 3LQ2A 3MZ0A 3LC2O 4HGQA 1IIRA 1JJAA 3KV1A 1W85A 1JI0A 1SKQA 1KO5A 1T8TA 2VP6A 3SM3A 2HOQA 1G8JA 2ESRA 3RTAA 1NJFA 4G1UC 3AVYA 5GY7A 2YWJA 1M72A 1IK4A 1WP4A 3WWCA 2QI9F 1O58A 4IMPA 3ZIAD 1VJDA 1WD7A 3THOA 1K7EB 3HV0A 2PGDA 3FPSA 3FIUA 4RKEA 2SCUA 1CB7A 2V5AA 2XKKA 5ENVA 3T5TA 2WIFA 2JLXA 5ALEA 1TQHA 3OAAA 4PO8A 3S8YA 1SUDA 2AH5A 1YJ8A 5A9SA 5J2TA 5I7SA 1KOGA 2LIVA 1H8HA 1HETA 3HYRA 3FTNA 4IUDS 3M4JA 3VNRA 3UCEA 3T8YA 2WJVA 2WMNB 2D2FA 3KAPA 4OQYA 3UBTA 2HLDD 3D59A 3VO9A 1C4OA 2IA5A 4UD2A 4QTZA 4YBZA 4CTKA 2OVBA 1L3IA 3ZI0A 3QHQA 3JWHA 3KUDA 4RWZA 5DBEX 3RT1A 1DUSA 3UAZA 1CD5A 2HNKA 5FWYA 2X7HA 4Q9NA 3LHDA 2GI4A 2GKSA 3I12A 4OI2A 4QDZA 4KKVA 4UBJA 2V7GA 1KQNA 2QGZA 3ZHRA 3M49A 1CQIA 1YBFA 2P2GA 2YWBA 4G85A 3FDXA 2A1TS 3R8CA 1SK8A 5AYVA 5BQOA 4Y1FA 1BDBA 1N0UA 1X3LA 2G08A 3EIQA 3H8JA 1P31A 1QVRA 3FVQA 4Y6SA 4E7PA 4AKGA 3AR6A 2GD2A 2JLBA 3LWBA 5JNVA 5IS2A 3W5JA 1Y8QA 1PL6A 2JAWA 4KXUA 2VPPA 3I04M 4N3NA 3PF9A 3HKEB 2ATCA 2IXTA 1ZK2A 1MH9A 2X9GA 3E9ZA 3FMIA 3HJTA 4NBSA 5JG7A 4CEIB 4DIOA 4CLRA 1X86B 5F35A 4DDWA 2JI4A 1JFFB 1D4OA 3H9QA 3PYLA 4OFXA 3NR2A 2HO4A 3DBLA 5KVAA 3ZXIA 4N3AA 3LUCA 5KNDH 1P2SA 2UZ0A 1N4AA 3HBFA 1RKXA 2VRBA 4X84A 5HM8A 5JAZA 1UZNA 2OCAA 3HFRA 1Y1PA 2DUNA 4L2IA 5FYDA 3E1KA 1SURA 4UUQA 1LQTA 3PGA1 3LC0A 1N2EA 1B16A 4N5IX 3CCBA 1H9CA 3IMCA 3KETA 4M6WB 4R05A 3EXIA 1AN9A 1X42A 2B0JA 2E4ZA 1CR4A 4LBVA 3FOAA 4MMZB 4RCZA 3QU7A 5FKJA 2QAJA 4ESOA 3X3HA 4GKKB 1VMEA 1Z0ZA 1FBTA 3IS3A 4ML3A 4WN9B 1Y9ZA 3RIYA 1E9EA 2H7VA 3GA7A 3URMA 3MFQA 5E6SA 4FYKA 1MFPA 1HYHA 1EDOA 1JQKA 1KK3A 2WWIA 3HCDA 4G4GA 5HG0A 5DWQA 3AXSA 3KYJB 5CA1B 4ZVUA 5IYZA 1P75A 2X1VA 4U5XA 2POQX 4HATA 2FWNA 3DF9A 4EHKA 2UVDA 9LDTA 3VR3A 1JLMA 1Z5NA 2AYZA 2ZE6A 3H1EA 1V8DA 4EVQA 3U6KA 4WFKA 3UO8B 3ZBTA 2NT4A 3EA5A 5H0IA 5BP7A 5JHGB 1IXRC 2X41A 3TW0A 2XUQA 1QF7A 2IHJA 3A6ZA 3PNYA 2VP2A 2QZ4A 3ACBA 3EIUA 4WT7A 3K4PA 1KMIY 4HK4A 3UQZA 4CZ2A 3H75A 4BNMA 1WTCA 1NVEA 4IH9A 3TOCA 4NG5A 1EUCA 2DQ4A 1HFKA 1KFEB 2Q5LA 3UCFA 4KXMA 1UT5A 2LP4Y 3M4NA 4Q39A 1CP2A 4CPDA 1WCIB 1GUDA 2QPAA 1TQ2A 4EQ6B 1PYOA 5IKPA 2P91A 1W1UA 1X13A 2A30A 5IAKA 1JIVA 2O1EA 2HUNA 4PZCA 1EGMB 2WWTA 3OP4A 4XVRA 5LLDA 4V0ME 4XTCS 1TYEB 2P4QA 3DYBA 5GMOA 2OORC 3P96A 4XIYA 1SVMA 3PJGA 2BR5A 1SUSA 4C01A 4IHJA 3ZG6A 5AVWA 3LXXA 2O3JA 5DNYB 1ZNWA 2O19A 3LY8A 3HV2A 4BKRA 4I9UA 3UVEA 4QT0A 4YT5A 1T2UA 2ZPUA 4L5AA 2OZLA 1W46A 2FEKA 3G8CA 4TMVA 3U3RA 4RTLA 2H5LA 3WRXA 2D3TA 1E63A 3A1VA 4EDHA 2DFLA 1ZUD1 2J9XB 3KQVA 4M7PA 1ZKMA 1LLUA 2BZ0A 1JDBB 1AS0A 2BJHA 2IZ0A 3B6ZA 4IIYA 1YVUA 4ETWA 1QE0A 2RI0A 3GIDA 4HY3A 4B5KA 1L5HB 2XHEA 1U2DC 3PUIA 2H2GA 2I0FA 1N75A 4C0QC 2ILTA 5KJ6A 1YTUA 2XMZA 5AM4A 4QUIA 5BSMA 4AQDA 1YDWA 1ZD2P 1PJLA 4BMPB 4CM8A 2NSDA 2CJWB 3AFOA 2IDMA 3V1YA 5CA0F 4M8SA 3FWNA 1HRKA 3EXEA 5JAMA 5ESDA 2QHXA 3ASUA 1RXYA 3D5EA 3HKCA 2QY6A 3SNHA 3NVMB 4XYLA 2O20A 3QIVA 3PCTA 1MZPA 4QUDA 4Q9LA 2G63A 5DHQA 1QC5B 1E1RD 1PG0A 2VQ6A 3A3YA 3G9ZA 5EJ4A 1ETHA 2IHBA 3AVXA 3ZLBA 3ZY6A 1EVEA 2F4VB 4UMEA 1IJBA 1DIAA 3NDPA 4DPLA 1E1CB 5IXJA 3DPIA 2LR0A 4FNAA 4AXBA 4TKUA 2XTZA 5F98A 4CIBA 2ZT5A 1OMOA 3NTVA 1I1QB 1PT7A 3JPWA 5J23A 1BFDA 4I7EA 2NXWA 1ODIA 5CB4A 1IM8A 2HBZA 5EKSA 2G6BA 1NLYA 4HWPA 3NX4A 2VVTA 1KAMA 2JG3A 3G5TA 4BUCA 2ECPA 2O8EA 1E6LA 1N8NA 3WGNA 4C78A 1WKBA 4A0HA 4IJUA 3VPBA 1B00A 2D06A 1DXQA 1XVAA 3KPJA 4WMLA 4CMCA 3ZDXB 1N2SA 5FL7D 3U39A 1JALA 1ZL2A 3BERA 3K2BA 1JG4A 1PWEA 5EQJB 3LMKA 3HEMA 4IWXA 2JLYA 3PENA 4L3OA 3SXJA 5FOXA 2A9JA 5JO9A 1SU8A 3SNKA 3DF7A 1M2JA 3FBTA 3RSSA 4V1CB 2D4HA 1X1EA 3ZGXA 3QUQA 4JDUA 4R2HA 4NEGA 1ZCZA 1WDMA 1OTYA 2JBHA 3PQDA 2IXEA 3OFVA 1O8BA 5JJCA 3THYB 2TRSB 3M70A 1SWVA 1TIPA 5AHWA 3REGA 1XZJA 4BVFA 2G1AA 1BCSA 4ND6A 4PG4A 4BZXA 1W0CA 1SWWA 1RWBA 1JNXX 2KW5A 3OIYA 1VI6A 1U9YA 1AKYA 4EO9A 2WG0A 3N5CA 2GX6A 5BT9A 5EXEA 2IZ1A 4WERA 5I51A 2EF0A 3BSSA 2RGXA 1V6SA 3I4LA 4Q6BA 1GJRA 5HKKD 3JD3A 2PSJA 3HLKA 2Q0XA 4TQ9A 1EM6A 3F7MA 1C1HA 1ZXLA 2OP1A 1VG0B 2PLWA 2O54A 3U80A 3P0EA 4OHCA 3TB4A 1E2EA 4J1TC 1OB5A 1XKLA 1CQWA 2HIAA 3VTZA 3CLUC 4DREA 1KDPA 1P44A 3ELUA 3ZCTA 3IIJA 5DULA 3O8QB 5TT0A 1ISSA 1QV6A 4WKOA 2VDWA 2O9JA 5AVQA 2R25B 2G06A 4DJDC 4CEIA 2ONKA 3IO3A 2DFDA 1XCGB 4MKHA 1EBBA 4D02A 5JDCA 2GD6A 1HPLA 1OGIA 3Q2KA 2JVKA 3GWZA 2HBRA 2HWUA 1P2FA 2C59A 2NV6A 3AJRA 3JQ7A 4WHMA 5CDFE 4FUTA 5F2OA 2CXHA 4IWYA 3VR4A 2RGUA 3UHFA 4KXWA 3NIBA 2J0SA 5AW5A 1L7BA 1VHLA 3E82A 3N39C 3FVTA 2M6SA 2OP0A 4A36A 5K99A 2L42A 2GNOA 3CX4A 3ORYA 1XXHE 3FLBA 3ND5A 4XAQA 5AI9A 3ZH9B 4DVJA 3TLZA 1ZNXA 3W79A 1DI0A 2JGLA 3Q40A 1V7PC 1LC3A 3QELB 3H99A 1QP7A 3KYCA 1NBME 4CR8A 3WAJA 1QAMA 4BPBA 5KOIA 4CCYB 4FTWA 4GPBA 1V9LA 5DHAA 3R9IA 4TUYA 4RCYA 3HDGA 3O95A 5LMZA 1NWHA 3TTYA 1PZFA 2NTYC 3LVBA 5FL3A 1QU2A 2B35A 1K66A 2H0QA 3FXAA 4FT4A 1I2MA 3FPGA 4H1VA 4N0MA 1DRKA 3VH3A 3QYFA 3N2KB 2H6EA 3C6ZA 2MHCA 5H1YA 1RZUA 4X90A 5H70A 4A6PA 4B5LA 1LQUA 1CRLA 4ZZ2A 5BRAA 1OI7A 3ENZA 3R6LA 2CK3D 4PXYA 4Q03A 5I7RA 2DU8A 3PWKA 2W2XA 4GOLD 3GGDA 5C51B 1LC0A 3AIMA 5MFZA 4DMUB 3HGTA 2C0PA 4DDUA 5IAGA 1RC1A 5HZKA 4B47A 4ZYWA 3OPVA 5AW3A 5LZ4A 2YQZA 5ESRA 1NG9A 3MTEA 4TWJA 4AIRA 3FTFA 3OQMA 2JARA 4D6XA 3OTGA 5K0ZA 3N7AA 2F9LA 2IQIA 2BFMA 3QUSA 4FXOA 2HJHA 4KLRA 4Q3CA 5DRTA 3SYRA 3M34A 3BOSA 4G8JA 5HJEA 1X7ZB 4M7RA 1U7ZA 4IVQA 4C4RA 2FPXA 1JXAA 2G5CA 2J0VA 1E1LA 1X1SA 2MSKA 3MLBA 4HDSA 2IWRA 5EIFA 1YJCA 3NMUF 2WI8A 1XF1A 2G72A 4BS9A 4EA7A 4FS8A 5K0NA 1PNRA 1GAWA 1UBUS 2IS2A 3EPLA 1R4MA 2COUA 4BO3A 5LOVB 3LKVA 1GN9A 5FLXA 2H31A 2VSYA 3ME5A 2UUCB 3W5DA 4UNRA 4RPJA 4D96A 1UAGA 5WRFA 2QRNA 3JVEA 1XVTA 3GLHB 2ZQYA 2X3UA 4JYCA 5LLTA 2FEOA 4UXHA 4KMMA 1HZJA 1XRSB 1N2OA 4TX1A 3BICA 5ICCA 4CEHB 4EJ6A 5LKAA 2A84A 2IYXA 2Q45A 1YDMA 4AB1A 3E18A 3QSGA 3RBXA 3EVEA 2FSVA 4IOLA 1V48A 1YAJA 1FIUA 3TVDA 1BE8A 4BKMA 2IS4A 1I3KA 4UJ5A 3I0NA 3N0RA 3ORSA 4MOWA 2QSJA 3TR6A 5FFFA 5EWLA 4DEXA 4QBHA 5F1PA 3TRHA 1HDIA 3GJZA 3IP3A 4KQGA 2FJPA 4KE8A 1Q3TA 1M7BA 4GT1A 4DNFA 5EIEA 1MRNA 1BMFD 1UC9A 2YV5A 3ZGVA 2Z2JA 4YAIA 4K81B 1XK7A 1UBNA 1W59A 2HU2A 4TMWA 1QIEA 3TUJC 4C7BA 2P30A 1XKXA 2XDQA 4G0UA 3R5FA 4NZYA 2G83A 3EH2A 1ES9A 3RH0A 2OO7A 3B3FA 3WLPA 4D8XA 1J21A 5CB6A 4MDEA 3W6OA 5EMMA 3UHJA 1Z0DA 3RVBA 4QX6A 2CNNA 3VKFA 3GJ3A 2JGNA 1KI9A 5JFOA 2CBGA 2PUTA 3GT4A 2Q1UA 3MWJA 1F7UA 3IHKA 4G67A 4HH1A 4MWDA 3CEAA 1CZHA 3AJ9A 1E2HA 3B51X 3LFUA 2A35A 1VP9A 2BFBB 4XQGA 3SR3A 3OQPA 2ZUFA 1XA4A 3MTDA 4OXQA 3IDFA 1YS1X 3BWXA 1DXOA 1UOQA 3F3SA 1CEYA 1Q5PA 4DB4A 2WD9A 1JFTA 4I50F 9LDBA 3DYVA 1G4AE 1YK0A 4IL5A 1YS6A 3PR2B 4XD7A 2H48A 5IVDA 2IP4A 1EWTA 1Q0UA 4JBGA 4MV8A 2D1QA 3CCCA 1DXYA 3IAEA 3R9XA 2I62A 5C53B 2YWDA 4C3ZA 5FWYB 3GLHA 3UWPA 4DYDA 2W6ID 2OPBA 1K7FB 4MGHA 1G0NA 1PQYA 1HE5A 4CN8A 4MZDA 3MB5A 1Z2AA 2VP3A 4PCUA 3FOEC 5JNLA 1B0UA 3ANNA 3PDWA 2FU5C 4RH0A 3QVJA 4EI9A 2QA5A 4BNVA 1HLGA 1J8DA 1CULC 1I3MA 2ZYAA 3CH6A 3RT7A 4AYTA 4L0MA 3QUCA 3PDCA 5AJXA 2GBLC 4JSTA 3RG8A 4YHBA 4CLRB 2B82A 2XCIA 4MQ4A 3T7IA 1E18A 3F6SA 4CLOA 2WJ4A 3EGXA 2FW0A 2HJGA 3MTGA 2I8AA 3D7LA 1NA5A 2QMQA 4MTCA 2LRHA 1BQ4A 2PLFA 4NFHA 5I7AA 1HA3A 3C3PA 1CUHA 4U7FA 5C5CA 5C8DA 1LFAA 3BHIA 3N2KA 4TTAA 4MIKA 1IXZA 5T41A 1JR3D 4OHPA 1WLYA 5LUBA 4D3ZA 5CR9A 2O5CA 3OQVA 2V6GA 1F2UA 3CLUD 1GZ4A 4HSGA 3T3GA 3G2PA 2F00A 1I9CA 1CUVA 5IT5A 3Q9UA 1PIWA 2D13A 2O23A 2G5GX 3CR7A 1ZD1A 4QU0A 4WNYA 3RUDA 4EG1A 4EG6A 4EZBA 3GVCA 3VDMA 4Q47A 3VPDA 3BBPA 1CUIA 1FMLA 1NVAA 4O8ZA 4QRIA 1FP4B 2J85A 2ZTUA 2N75A 2OMEA 3FJ1A 3MPUA 4YP9A 4FE4A 1EX1A 1GZHB 1QRSA 2X4GA 2R8EA 2C99A 2MSDB 2GFIA 2Z8YA 4L85A 2JIPA 2OYSA 1EE1A 4IHKA 4IIFA 4PX3A 1MB9A 2ZIZA 1JMVA 4Z4IA 1WULS 1OA0A 2AMYA 4UAJA 1WB6A 2OFXA 3IP1A 2BI7A 1DAPA 2HSEA 5CLQA 1IN8A 4JKYA 3SBOA 3EXHC 1GPBA 1AK2A 3MEQA 2QX9A 1K5PA 2CNWD 1Q2UA 1TB4A 2Z9BA 1HYQA 3T9FA 5CYGA 1OASA 4WFIA 5LKRA 5JD6A 4P0QB 1U2GA 3V7FA 4E2YA 4J76A 5B4UA 1SXJB 1X0VA 1XQVA 2UUAB 5IP5A 5GZ6A 3NOQA 3H0CA 3UTCA 1LPSA 4Y7CA 1A50B 1Z74A 2GJ4A 1KXJA 3JWJA 1YQWA 4R31A 5CNJA 1RXUA 5LQUA 2ZM5A 1C4KA 1TYDE 1VIDA 3QWIA 2ZUEA 5C4GB 1ZD9A 1CE8A 1RYZA 4UMDA 1Z2NX 4Q9JA 1W96A 3MWYW 1XU4A 3SU8A 1M66A 4Z7QB 3TOSA 2VDWB 3CNOA 4LC9A 3H5OA 1UZLA 4EVRA 4BB6A 4ZJPA 3HM2A 3QA9A 4DMCA 3L04A 4MUBA 5EGNA 2ZVJA 3ER8A 2OV6A 1YACA 3DMDA 4EJSC 5DFAA 1MJHA 4Z7NB 2GAOA 1XNQB 2XNCA 1FVFA 5DLYA 2VYQA 2ADOA 4O2BB 4YRSA 2DR3A 5B7PA 2KX7A 3CW2A 1KZ4A 3NHLA 1CRZA 3GIWA 1K8XB 1HZZC 1TEHA 1MENA 4KFTA 1QFSA 3KQKA 1BEZA 1E3MA 1T9HA 3CZMA 3GFQA 1NM5C 2JFYA 3CUKA 3N6VA 3JQ6A 4NC9A 4A5SA 1U0FA 2J67A 4TV8A 2V3WA 4B74A 1LFDB 1VLJA 2ZTVA 3OMLA 1RWOA 1FTYA 5FHRA 3PWZA 4H9GA 1KY3A 2XAUA 5HEKA 1HDYA 1A8UA 2YIDA 5FIUA 2VQDA 2BGTA 1M1YA 2WMYA 5KKAA 4ZRMA 3NIWA 1E69A 3VR4D 3DW3X 2E4UA 1Q15A 4JYMA 4D6YA 1E9VA 2I3BA 1H1DA 1FSFA 3V48A 4DA9A 1H2RS 1YXMA 3LIIA 2B3TA 5DNDA 1SCBA 3LZ6A 4HMOA 2GA9A 3HABA 3RGGA 1O3YA 4ATNA 4N0EA 2IEYA 3OF2A 2XB6A 3B20A 2AJTA 3OZTA 3LY7A 1PJ4A 3ENVA 4S1VA 4JR2A 4R3UC 5COBA 3DOCA 4B46A 4LDAA 5FA6A 3DXFA 4QEKA 2Q8PA 1PTJA 3UNXA 2KS6A 1W2WB 3CKMA 5J40A 3GDFA 4UE3S 2HRRA 3DEJA 3LQRA 4EB0A 1QTNA 3KQNA 1KI2A 1U8EA 2WB2A 1BD4A 3OLWA 4FFOA 5EMKA 3TLGB 4KPEC 1Z8FA 1M6HA 2RAPA 2CNLA 1M2OB 1GLNA 4G56A 4HAYA 5IXSA 4DMFA 2PMBA 4R8LA 1HZZA 2WQZA 2GASA 4BB9A 3A37A 3E58A 3DFZA 5HF8A 4MHOA 2HYIC 3COSA 1Q0TA 5TT1A 1Z8HA 4MVJI 1O57A 1IM2A 1YCDA 1HDOA 1FDTA 5B4TA 4HDCA 1KYZA 3QJGA 4GL2A 1ARZA 1QRUA 3KJGA 4FMDB 4XA8A 4H7KA 4ZCMA 3NHBA 3Q6NA 1JKXA 2RHRA 3TTSA 2C8JA 3JAKA 3D64A 5EESA 4NV3A 3ZXSA 3AHIA 3F5QA 5JSZB 4MRMB 3C39A 1GYRA 3ZEIA 1SQFA 1F4PA 4DCPA 5J4YA 5EJ6A 1XELA 3PFGA 2BKAA 4DV7B 1OYYA 2H4XA 3NNNA 2IW1A 3TJZA 4DCJA 1JTEA 2WNIA 3GLIB 4BLOA 3RSLA 4ZPXA 5D3MA 3ZWXA 2NSJA 3IKTA 3PLAE 4FFSA 1NQUA 1QNFA 3H1FA 4M21A 4PNHA 4CDNA 3A6LA 2ZLBA 4J7CA 1TM7E 2Z2ZA 2WSLA 1H8ED 3H2YA 4MB6A 2CD7A 3R5HA 5DSXA 2PDAA 4RD6A 3UV7A 5DI9A 4B3XA 1MAAA 4E31A 2WJJA 1DWPA 4PC6A 4Y8VA 5I8ZA 3ZKAA 5KOHB 3QXGA 4HR7A 4QXRA 5LOVF 1SKMA 4YV1A 2VDMB 1F4VA 1KK1A 1SZPA 2NQ8A 4DG8A 3KEGA 2NO9A 5FEMA 3RFXA 3LA8A 4PBRA 4KRFA 4CT5A 4B3TB 4DFDA 1MBZA 1TRKA 3D2BA 4M22A 1I36A 1NBHA 1UAYA 1ZAKA 4IDCA 5AI0A 4ZJUA 3U60B 1TK2A 4MQFB 5I4CA 2QYOA 1GL9B 3Q1KA 3GRZA 3EEQA 3L7DA 4ZQGA 1V47A 5IFKA 3LOUA 3NHZA 2EEPA 1B8VA 1DVRA 4QQNA 3ZNOA 4AJNA 1SC6A 1VBKA 4MDYA 3GFPA 2WG2A 3IEIA 2MSEB 4DA6A 4Q3EA 2ZROA 2OG2A 3C16C 3INYA 4H6PA 5C32A 3WNQA 1TJ3A 4PSVA 4KJZA 5A5FA 4RSGA 5K0LA 4DLKA 3L18A 4X71A 2IIQA 1VM6A 5A0FA 4LYGA 1P1FA 5ELMA 4DILA 1Z6YA 3F3KA 2IV3A 3K53A 4TZ6A 3AI1A 3GEMA 3FG9A 5HJ2A 1HK7A 3SF8A 2RK6A 1S3SA 5BV2P 1N1EA 4X1YB 4G0PA 4AG3A 4OB8A 4FFVA 2P9EA 4TPKA 2ZB7A 1UOEA 4PINA 1JEDA 2B30A 4UQLA 3DGFC 5I45A 3EPKA 3G0IA 5LUAA 4J1QA 2IPMA 3KDAA 4F45A 2BGWA 4YONB 2YRWA 4ZDIA 4JI7B 4GZ5A 2HZ7A 1U2SA 4O5AA 3R7WA 2BBTA 1AGYA 4E5YA 4BXOB 1YRHA 1Z2DA 3T7DA 1ZL0A 5FD8A 4JXKA 3IMKA 2J30A 4O2BA 1CZLA 3SXUA 5JC8A 1XRQA 4H6WA 3IJPA 2XJ4A 2LWIA 3UH0A 4ASUA 2UZIR 4TMYA 1RWNA 4RGBA 1AQYA 1I2CA 2DFPA 1XWIA 1N1GA 1TD1A 1T5LA 2Y0DA 2W43A 2IBTA 2YBEA 1P72A 3O75A 3QBVA 4D44A 3ZVLA 1JZQA 1OF1A 2PQ0A 2WAYA 3ZWWA 2VLBA 3OSZA 4DXDA 1FRFS 4YIKA 1TAUA 1RWQA 2HA7A 5EXTA 5F7OA 1JX6A 5AHXA 3HY4A 4IWNA 1RQRA 4FCWA 1RE1A 2FX3A 1H2XA 3OQBA 1CDDA 1ML4A 1UMCA 2AR7A 5F51A 1UJ5A 1W9HA 2O14A 5CCBA 1KR5A 2IUUA 1W49A 4JITA 2O1WA 2R6CA 2JFVA 3UH1A 1W2HA 1HT3A 1OWMA 4HL6A 5LA6B 3TLEA 5F52A 3VOSA 1GPJA 4DY4A 2IHVA 4R6WA 1WE2A 3UOWA 3RFFA 3EPJA 3FDJA 3BD6A 4Z3OA 3NALA 1GT91 4DS3A 3I04A 4IIDA 5L4SA 2DBRA 2XRZA 2X8AA 1L9KA 5AO9A 3DONA 3KE9A 1JHQA 2VHUA 4LY3A 3TNDA 3B38A 3JQAA 4Y2HA 4Q4JB 4ENQA 2DWOA 4HWKA 1YMVA 1GGHA 2IBMA 3NWBA 3UG7A 3U16A 4JD5A 3E9RA 5AW1A 4PRKA 3JQFA 3WV5A 5JYEA 2WWFA 2CHVA 3ZQUA 2V1UA 4XJVA 3UK7A 1CRQA 2A9QA 5DISB 4B7AA 2G6TA 4DC9A 3ILYA 1ECPA 4PQEA 1JEYB 2BI4A 3TEJA 1MRSA 3R0IA 1JIIA 1XZFA 3S2ZA 3SOZA 3GBVA 4ESEA 3ID6C 3DT6A 3A9WA 1AUQA 4CM4A 1V5EA 3GZ4A 4KGDA 3ZE8A 1ISGA 5CG2A 1ZCJA 4PNPA 3U44B 4ZALA 5TQVA 4FHCA 4C0LA 4FGZA 1EPUA 4DNQA 3JQ8B 2JKVA 5A0TA 5EG5A 4D9JA 3A2MA 4N5DA 2CMFA 3LPLA 3WB1A 2CK3A 1E89A 1NR1A 1ULAA 3T5GA 2D2IA 5FHQA 1R6BX 4F3YA 1FLVA 2P4SA 3V7YA 3BORA 5ALFA 4NYIR 5AP9A 3PGXA 2IU4A 2DT8A 3AHJA 1B93A 3ONNA 1J39A 1G63A 3O93A 1LQ2A 1J1ZA 1WXFA 1N6KA 3DMNA 3PG5A 2XGGA 3FMVA 3TSZA 1K3TA 3NBFA 1NKVA 2Y4OA 4NAVA 3BAZA 2RBGA 3NHJA 2WHPB 2X4DA 3WRVA 1Z83A 3PNKA 1UANA 3VC1A 4YYZA 3LY5A 3PSHA 5AICA 1FDWA 1FP7A 2HMAA 3M1IA 4FEEA 5C1DA 3MTBA 4EFLA 4G5YA 4CM5A 4XM0A 5EE5B 3GNLA 4XI9A 4D98A 5ALNA 1S01A 3D3EA 1OT5A 1ZYUA 1D2CA 1WF6A 3K05A 1PU2A 4FEAA 4LZWA 4E5PA 1HX7A 3NJ8A 2PZGA 3HBAA 5AW9A 3SOPA 5C8VA 5K0BA 2C4MA 1GSIA 2FEWB 3F9RA 3OCXA 3HU5A 1MJGA 1P33A 1GARA 1Z16A 4EKNB 3W3ZB 4M9ZA 3W8DA 4AZ3B 1ZD5A 3QX3A 5HPYB 1W36C 4OXYA 3ETHA 4L50A 3G0CA 4QQFA 2BGRA 4AQYB 5HM6A 2C8KA 2GZMA 4I1PA 1H2WA 4YAUA 1EP2B 1N2GA 4BVBA 2ATIA 4EG7A 4H7IA 4BQOA 4FFPA 4FB5A 4BNIA 1RJFA 2DG2A 2QTMA 3SHTA 2I87A 3SKXA 1WDKA 2PJDA 4H1WA 5B58C 4UEWA 1M1XB 5DXJA 1BZYA 2I2FA 3MWDA 4E1AA 1N2IA 1ABFA 1QP8A 4XD2A 3B89A 3ZJYA 5TE9A 3OQOA 4CVNA 3E8SA 1PJQA 4PW0A 4ZT5A 3BPSA 5KYVA 4LJYA 4Z9YA 3TZLA 4F4UA 4BKUA 4YRNA 3BC1A 1S2GA 1P61B 3C7KA 2WUEA 3OEHD 2H57A 1KL7A 2HA4A 2MU1A 1UQRA 1XEAA 3ZUGA 2ETVA 2X8JB 3V4SA 3QP9A 4BP3A 3PGLA 2H1RA 1W5AA 3RJMA 1US8B 1URPA 2IDJA 2EGGA 1P62B 4J7AA 2GWRA 4NMXB 13PKA 1L5OA 1U3WA 1U0GA 2YASA 3H6GA 4P2GA 4W9NA 1ESNA 4KAXA 3LFHA 1D2NA 4CUJA 4QQ8A 2B83A 1GNVA 1WXQA 2A67A 1VMDA 2FRDC 3D6NB 4JKIA 5ELXA 3R7NA 2XOXA 4UZFA 4PONA 3VVBA 3NHMA 1U7TA 1WOMA 5T4BA 4XJTA 2OM6A 3VPFA 1EA7A 4HB2A 1R0YA 4QFDA 1RW4A 2GERA 2TMKA 1G20B 2FEPA 4RK7A 2O2HA 2DT5A 5AXBA 2RE8A 5BY2A 1H65A 3AY7A 1QOQB 1WA5A 3PXAA 3T1OA 3I2IA 2GKGA 3BSFA 1UP7A 4QGGA 2FUEA 2MR5A 2QQ5A 4RY0A 2B1GA 1FXWF 2CLEB 1DGQA 3NWPA 3GP3A 1RLUA 5HQ3B 1DKPA 4Q00A 4RZUA 1OWNA 1U1DA 4XJXA 3FZQA 2BFWA 3GHHA 3P20A 1JKIA 5K51A 3VR6H 2Y1EA 2ZJ2A 4IS3A 5B36A 2BPOA 4JBLA 3LWNA 1QBKC 4P35A 3EIOA 4A0QA 3CVXA 2EBUA 1N8SA 4HADA 4NAHA 4Q4AA 3M3DA 1T9DA 2GHTA 1JPVA 2HY7A 1YZQA 1U2QA 3H9BA 3PTAA 2VTEA 3M6LA 4L75A 2R5NA 1K7YA 4HDSB 3U19A 1JIJA 3DAFA 2O2SA 2GEUA 3K8ZA 4NQRA 2FEMA 2XB4A 1H2BA 1U7WA 2A1UA 2DFVA 2CLCX 2JIQA 2Q6OA 2VWGA 3IHLA 4GI7A 4G1MB 3WSVA 3OEEA 4F3NA 2C9BA 2CJYA 4BOYA 1ACJA 1HSOA 3F8TA 4GU5A 5FA5A 1OREA 9ATCA 1O54A 2HL6A 2I7VA 2OK8A 3ROKA 1GPLA 2HC9A 3AUKA 3U3DA 2MWMA 2TYSB 2H4HA 3WS7A 1XPUA 1UR5A 1YR3A 2EFHB 2QSZA 2V55B 2X1LA 1Y5IA 4KC0A 4D8YA 4ENUA 1SCUA 3LQFA 3UKDA 1SVWA 3KLBA 4QYWA 4OFZA 2XY4A 1CERA 4EFDA 1C80A 4FD3A 3VKWA 3WP0A 5HYVA 2Q5QA 2OTCA 5BOSB 5JRDS 4YRAA 2HW8A 4W5RA 2ZE5A 2MYNA 4EARA 1GRVA 2B5WA 2R2GA 1EXMA 4WKGA 4EF6A 4WDQA 3P2YA 5DRYA 3IE0A 3I5UA 4RESA 3JYLA 1JXMA 1FDRA 4GIBA 2J08A 2CVOA 3SKVA 1C3EA 2DYKA 2XMDA 3D8NA 5DNAA 4WOPA 3RLIA 3TXAA 1FTNA 1KVUA 1UPBA 1BVHA 1WXHA 1RWKA 3NHAA 4H2DA 1D0IA 4ZYYA 3A32A 3JPYA 2DLDA 1GNSA 2YL2A 3DEZA 4X6XA 1AKWA 2ZRBA 4OPMA 5AUPB 4F06A 4OATA 3GJRA 1VOTA 1AKNA 1RPNA 3KQOA 3U7QA 1ETUA 2ZRFA 4JVLA 4QARA 1R7RA 4RTJA 1U5AA 3H5AA 4DB2A 4ER5A 2UXBB 5KJ1A 4WGGA 2H7YA 1V7QA 3C3JA 2XNDD 3FTDA