4P92A

Crystal structure of dienelactone hydrolase c123s mutant at 1.65 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
233
structure length
233
Chain Sequence
b'MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxymethylenebutenolidase
publication title Crystallization of dienelactone hydrolase in two space groups: structural changes caused by crystal packing.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 82
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2014-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p92A00
3I6YA 3D7RA 1Q0ZA 3IVMA 1HDEA 2QR5A 4FBMA 1LBTA 2IITA 4Q1VA 1EK2A 5LLSA 3QMMA 4B80A 4FFVA 2HM7A 3GELA 3WJ2A 4M0MA 5FV4A 2VSQA 2WHRA 1TKRA 2VT7A 3QM1A 1H2XA 2OAEA 3LLCA 4ROTA 2WLSA 5ALUA 1LLFA 5ALNA 4DNOA 4OD0A 3A2MA 3F96A 1O6FA 2C58A 4CCWA 3BDIA 2OLEA 1TAHA 2XMSA 4WDRA 1BRTA 3T52A 1DT5A 4B9EA 4EY5A 2VA9A 2O7RA 2XB6A 1FJ2A 3AINA 5AKGA 1CUUA 2DFPA 2XUAA 5IH7A 1PJAA 1X2BA 1XROA 5ALQA 4P92A 3V1NA 4BRZA 2GYVA 2XMDA 1MPXA 2GYWA 2O2IA 2HDWA 2PUHA 5JALA 5ESRA 2WM2A 1LPPA 4X91A 4D9JA 1A8QA 3CXUA 3NGMA 4U2CA 4E11A 2OCKA 4PNZA 4KYVA 3CN9A 5AIBA 2JGLA 5HKAA 3BXPA 4KJXA 4PO3X 3H2KA 5AM3A 1XZJA 3HI4A 1XZDA 3RLIA 2GBCA 3A2LA 2WIDA 4Y7DA 5FP0A 3F67A 3G0CA 3HACA 1Z68A 4UHCA 5A71A 1P0MA 1QIFA 2GZSA 2WIFA 3I6MA 1HL7A 5I9IA 3G8YA 2CZQA 2HA3A 2BUBA 2O2GA 5AI9A 1FFEA 5AOCA 2PBLA 1WOMA 2ORYA 4OSEA 3H1BA 4JUIA 1YR2A 2PSEA 4H7FA 4MQLA 1EX9A 3M3DA 1F0PA 4S0XA 3VKFA 2QKYA 5HF9A 2OQVA 2R8BA 1XQXA 2XUGA 4N8DA 4DSAA 1QIDA 2X5XA 4DMKA 1USWA 5JIBA 5DTJA 1FFAA 2XT0A 3BL8A 2ACKA 4Q82A 1OXMA 1W4LA 5DLPA 5A7GA 1F0NA 3I2KA 1RP1A 1XQWA 1MTZA 1CQZA 3LP5A 2XMZA 3AILA 2WG0A 4AO8A 4Y2YA 5CRIA 1A8SA 4IHAA 1AX9A 4J0HA 1G66A 4Q3OA 4A5SA 3WKEA 2I3ZA 2XI4A 1IVYA 2V98A 4BP9A 1O6GA 2I03A 1RWQA 4B81A 4C6HA 4UHDA 4W1SA 5AI8A 1UZAA 2WFLB 2VT6A 3G9TA 1PV1A 2VTVA 2PL5A 2D0DA 2HU5A 4QWMA 1T4MA 2VJCA 4MYSA 1THGA 4C01A 1SOMA 3FYUC 5AM5A 4Q3KA 4EA6A 5LP1A 1I6WA 1MNQA 4JEIA 2G63A 5K3BA 2WU3A 2C5GA 3G02A 3VVLA 5HFAA 4G9GA 3STUA 1J06A 3MUNA 2O2HA 1MAHA 2JGFA 1UOPA 5AK6A 1GPNA 4KE7A 4M0FA 1QIKA 4LYDA 3H04A 5K3FB 4J7AA 4H77A 2PUJA 4CG2A 5AK4A 1GT6A 3ESCA 3F98A 4Q34A 4CIAA 5ALZA 4BCCA 4HXEB 1SCKA 2XQIA 1ODSA 4H7IA 2Y6UA 3PUHA 2JIDA 4AO7A 5AKZA 1HLGA 3QPDA 1LPNA 2VQ6A 4FLEA 4UBOA 2QZPA 2AXEA 2OQIA 4WY5A 1L7RA 4DNPA 1QJ4A 3M83A 1UFOA 3R3ZA 4W9RA 5A62A 3Q8WA 2WG2A 3QPCA 3FAKA 5JYCA 5FKJA 1W76A 1A7UA 1KEZA 3OG9A 3WKCA 1RYYA 3NUZA 3EQ7A 2RHWA 2OCLA 5HK8A 4CCYA 1QO9A 3WL6A 2QS9A 1VZ3A 2WFMA 2OGZA 3WZLA 1VOTA 3AIMA 2WJ3A 4Y2TA 2V9ZA 1CUDA 4DMCA 3O0DA 1NU8A 2BJHA 2WKWA 4B6GA 2JBWA 1K8QA 2XQFA 5HF8A 3QMVA 2HA0A 1CUFA 3ZLTA 5IVKA 1QIHA 1MO2A 1UKBA 4H0CA 5C8XA 4IH4A 2WILA 4QZVA 4AXBA 1CUHA 1T2NA 3ZV7A 1CUAA 1R4ZA 3L1JA 5CXUA 5JATA 2QJWA 5ALSA 4DYHA 3H18A 4C4XA 3SC2A 5AI4A 4DNQA 5CMLA 5AJHA 5ALHA 4LXIA 4YASA 1JI3A 3WK5A 3TJMA 3G9UA 3EQ9A 1IUPA 4UUQA 4H18A 2O7VA 4C89A 4FLMA 2QXUA 4E46A 2BFNA 4G8DA 4U2EA 1Y7HA 3ILSA 4DTCA 4BTVA 3G9XA 1AZWA 3A6ZA 2I3DA 4Q05A 4PSUA 5AKYA 4X00A 4FNMA 5LZ7A 4ARBA 1E8DA 1GZ7A 1XZLA 3BE8A 4IH1A 3KDAA 5DTIA 3FWHA 4J0IA 4QLAA 5DNWA 5ALYA 4ZGBA 4LKOA 1M33A 4H7DA 3PE6A 1CUXA 1UK8A 3STXA 3WK4A 1L7QA 3O4IA 3WK7A 4AO6A 4DM7A 3ANTA 5K3FA 1J1IA 3QMWA 3SK0A 2QUBA 3R3YA 5ALEA 3VJLA 1H2ZA 4NMWA 2WQZA 2ZYIA 4MQMA 3WYNA 4IQ4A 1EHYA 3O4HA 5ALLA 4FNGA 1EA5A 2XUIA 3I28A 2WTMA 5CT4A 5FOQA 1ZGCA 2HA7A 4HXFB 4F5ZA 2RHTA 1CUVA 1AQLA 3WKAA 3DYIA 1VE7A 4C87A 1CUSA 2J4FA 1DWQA 4W1RA 4UHFA 2XUQA 1XZGA 2K2QB 2AJCA 4EY7A 3GFFA 4TGLA 2VJBA 3FCXA 5ALPA 2Z8XA 4MXDA 2AJDA 4JYMA 1YASA 5FXMA 4AQDA 1CV2A 1X2EA 4BRSA 4K6HA 4QE3A 2WIGA 1EXWA 5AM2A 5AI5A 1H22A 4H7HA 3PF8A 4X6XA 1K63A 4ZV7A 1GQSA 3R40A 1E5TA 3DJYA 2FJPA 2WIKA 4G4JA 2AJBA 2HHAA 1ZGBA 1QE3A 1BN7A 4KACA 5A7HA 3WJ1A 5AI0A 3KWFA 3UMJA 1JU3A 5AKJA 2PVSA 4GI1A 2EEPA 4CFSA 1GGVA 1ZICA 3CN7A 1UOQA 4FHZA 5AKXA 4EY6A 2XUPA 1E3QA 3O95A 4RPCA 1GKKA 4X6UA 2CB9A 4W1QA 3H2JA 4J0KA 3C6XA 1EINA 5E4TA 5LKRA 3FYTA 4WFJA 3IIIA 2PSJA 1NU6A 2QOEA 3K9BA 1J2EA 2GZRA 3JYHA 5DYTA 5JAUA 4DSZA 4BE9A 4U2GA 2ES4A 1YSCA 3STWA 2WU4A 2ZSHA 1VA4A 4BZZA 4EBBA 4KE6A 4RE6A 2FX5A 4ETWA 5JARA 5FDFA 1JJFA 4HXGA 3H2HA 1SFRA 3VVMA 4GDMA 5DJ5A 2HFKA 3ZWQA 1B41A 3KOOA 2HA5A 3JW8A 2QRUA 4XWGA 1JKMA 3D2AA 3STVA 1CUYA 1MX9A 1U8EA 2X8BA 1VA5A 1QTIA 2Y6VA 5BWBA 1ZIYA 3DCNA 1U65A 4BE4A 4EY8A 3WA7A 3QYJA 2QUAA 5SYNA 2H7CA 1ZD2P 2XUHA 5LKAA 4Y2SA 3R0VA 2YXPX 4PV7A 5D6OA 1ZD4A 5JAHA 1VE6A 4FBLA 5LZ9A 4ZI5A 4CG1A 2XQJA 2BKLA 4MJ3A 3FSGD 4AN1A 2WJ6A 3H2GA 3HC7A 1ZI6A 5SYMA 4BVLA 1H23A 5AO9A 4QEKA 5KWIA 4BTLA 2XE4A 2ZJFA 2WTNA 3D2CA 5AIAA 1UK7A 5ALXA 4INZA 1LZKA 4EUSA 3DKRA 4B0PA 3ZLVA 4C4YA 1UT6A 3EQ8A 1JJBA 5AKEA 4L72A 5E4YA 3IA2A 2JGKA 5ALWA 1BROA 4K2AA 1LPMA 3HYSA 2W6CX 4QDOA 4OYYA 5JZBA 2JEYA 3W06A 2HL6A 1SCQA 4TPKA 2HU7A 5LZ8A 2H7YA 1DU4A 1D07A 3DEAA 1WPRA 5T4FA 1MX5A 3PFCA 1YS2X 4G4GA 5AM1A 1XRMA 4LYEA 2BCEA 2XUFA 2RGUA 4UHBA 4HRXA 3RARA 1R3DA 1R88A 4OUKX 4DIUA 1BCRA 3O4GA 3DOIA 3RK4A 5IKXA 1FFBA 1GPKA 4G8BA 4BAZA 1UKAA 3CCCA 3GZJA 1QO7A 1QIGA 1SCIA 1DQZA 3DD5A 3L1IA 3AZQA 4GW3A 4J0CA 2WFZA 5CTAA 2B9VA 4XX1A 2J3QA 5HKBA 2DR0A 3WMRA 4X71A 2YH2A 3WL5A 2Z5GA 1WB4A 1F8UA 3VJMA 4FOLA 3MVEA 1FFCA 3AZPA 3OM8A 1EI9A 4J0JA 1UOOA 3BDVA 4X3CA 3H0CA 1JT2A 2G5TA 3DKKA 5A2GA 5EI5A 2DQYA 1IUNA 2XDWA 3E4DA 4H35A 5ALTA 5FPQA 1XZAA 1KU0A 4DNFA 5LZ2A 3I6ZA 4G8CA 2ZJ7A 3X3HA 2QMQA 3TRDA 4E15A 2OG1A 5FRDA 2G5PA 1YS1X 2XUDA 1C4XA 4FKBA 4OPMA 2DCMA 2VAXA 5D3KA 4J0GA 2HA2A 4OU5A 4XVCA 1CPYA 3C6YA 2ROQA 3C87A 5ALKA 1BEEA 1LPOA 5JADA 4A16A 5AK3A 2GBIA 5BV7A 1BCSA 4L0CA 4B0OA 1DWOA 1JMYA 1K6EA 4YK7A 3WYDA 3ED1A 3FYUB 4PSDA 4FTWA 5BOVA 4BDTA 2ZYHA 4LXGA 3H17A 1MU0A 2C7BA 2XMCA 4AN0A 3FLEA 1WCYA 3S8YA 5HQ3B 1U4NA 2AJ8A 1BU8A 2VJAA 3OOSA 3R3XA 1XLVA 1ZJ5A 1HQDA 3E3AA 4L3WA 1CUIA 4G5XA 5CT5A 1A8UA 1YAHA 1NX9A 3WA6A 3C5VA 3PI6A 1GPLA 3H19A 3JWEA 4QDXA 2G4LA 3L1HA 1Y37A 1CUCA 3MGAA 5T4BA 4B7ZA 5LZ5A 3GA7A 3OTQA 5LIPA 1FSSA 2AJLI 1KU6A 2EDCA 3BF8A 1EH5A 5CH5A 2DHEA 2RAUA 1CUJA 2EDAA 2FJ0A 5AKHA 4AZ3A 3D59A 5ALMA 1AC5A 3VDXA 4IO0A 5JD4A 1WHTA 4PSCA 1QFMA 4A23A 4Q3LA 2WHPB 3W2TA 2XUOA 3C70A 1THTA 2UZ0A 1QTRA 5D7BA 5CT8A 3PFBA 5CT6A 2WFLA 4BC0A 4N8SA 4GEGA 1DQYA 5JD5A 3E1GA 4H7JA 3BJRA 3V48A 5CT9A 1XQVA 1QFSA 4FMPA 5IVDA 4X93A 4RE5A 1K5PA 1DT3A 4WFKA 4ZREA 1FFDA 1R9MA 5IVIA 5I8PA 4G9EA 3NOXA 2B4KA 2XMRA 5F4ZA 3LCRA 5ALRA 4F21A 1AURA 2Y1KA 1GQRA 4U2DA 4UPDA 4BDSA 2C0QA 4LHEA 3DQZA 4RGYA 1WB6A 4UBNA 4OYLA 2DHCA 1TRHA 2WUEA 2OCGA 4BVKA 3FVRA 1MAAA 4DGQA 5AICA 3IDAA 3HABA 5CH3A 1QZ3A 3O9VA 4Y2JA 2ZYRA 1BE0A 2WG1A 3B12A 5YASA 1TCAA 1ZJ4A 5HZGA 5HQ3A 2ECFA 4UBLA 5AK5A 1UXOA 1K4YA 2WSLA 5ALIA 3K2IA 2HADA 3ZI7A 4KE9A 3B5EA 3NWOA 3WLAA 4ZWNA 2B20A 3QH4A 3OURA 7YASA 1YA4A 1XZKA 3D4LA 3GROA 4BVJA 3G9ZA 1JJIA 1EB9A 3EBLA 5HCUA 2IX9A 1Q0RA 5FUMA 3WIBA 4I4CA 5JAOA 1CEXA 1XZBA 2H7XA 1DX6A 3FLBA 3WL7A 1XZCA 4MYDA 2QXTA 2CKMA 5E4JA 1UWCA 2R11A 1U2EA 5DYWA 5A6VA 2BAGA 3DLTA 2WJ4A 1MT3A 1LBSA 4X92A 3FLAA 5ISMA 1G42A 2WHPA 2ACEA 1H2WA 3E0XA 2CEKA 4YPVA 5EGNA 2W22A 4J3JA 6YASA 3WK9A 1JMKC 1QOZA 3ESBA 3G0DA 3QZUA 4WCVA 4HAIA 3HLKA 5JANA 1N5RA 5CBKA 1Q84A 2RONA 4K6GA 1CUBA 3W04A 3TGLA 4EY4A 4GECA 1Y7IA 1ORVA 3D3NA 1MX1A 1XZHA 1XRQA 1XZIA 2C0PA 4ARAA 3VXKA 4YX9A 1JFRA 2HA6A 3H2IA 4BYMA 4P9NA 4DMHA 2OGSA 4EHBA 3KWJA 1R1DA 1YB7A 3C6ZA 4QWWA 4KR0A 4N5IX 3QPAA 4BCBA 3C8DA 1EVEA 2J4CA 1EB8A 2JGJA 1TK3A 2JF0A 3D0KA 5K3AA 3OPMA 3RKSA 4NS4A 4Y2XA 3YASA 5ALGA 2BGRA 4EB0A 1SC9A 1TIBA 5FPPA 2OPHA 1LPSA 1ZI9A 3AJAA 3VJKA 4X7BA 4LXHA 4BAUA 2XLCA 3N0TA 4K6KA 2WUFA 1XRNA 2WUDA 2Z3WA 4IH9A 5KREA 1E8MA 2Z8ZA 3WL8A 3O9MA 3WWCA 3DS8A 4AZ0A 3G0BA 2OXEA 5AKLA 3ICVA 4WDQA 4Y2VA 3IUNA 4BAGA 4JH0A 1XZFA 5C81A 1WM1A 1GXSA 2PX6A 5I7UA 4UFNA 4RNCA 2DQZA 3G0GA 3C8HA 5K3EA 3LIIA 2BGNA 4K5QA 3EIOA 2OCIA 4JYPA 2QT9A 3FVTA 4WJLA 4HRYA 2GBGA 5EIEA 1C7IA 4HTAA 1P0QA 2PU7A 1G4HA 5LZ4A 2XMGA 5K5EA 1CFJA 1MNAA 1G5FA 2PPLA 2IIVA 3BJMA 4BZWA 2ZJ6A 2CBGA 4EZIA 1BN6A 3BWXA 5EIAA 3DL7A 3F97A 2JGIA 3PDCA 2VAVA 2HU8A 5AM0A 1VLQA 5IVHA 2I78A 1XRRA 5C8ZA 1CUEA 1A88A 3C6BA 1F6WA 3KSRA 4Y2QA 2ONCA 1ZD5A 5H3HA 1LNSA 1XFDA 3WWPA 3BIXA 1DWPA 1IMJA 4J0DA 5ALJA 1IUOA 1QIIA 3G0IA 2QTBA 4BC1A 5JD6A 4Y9SA 3A2NA 4FLFA 1P0PA 5AKKA 3W9BA 4H7KA 4BCDA 4OB7A 2C4HA 2HFJA 3PICA 1UKCA 4O08A 5A7FA 3A70A 2PKYX 4ZRDA 1ZI8A 4WY8A 1QLWA 3R3WA 3TEJA 3WZMA 1LGYA 1YA8A 4AX4A 4X90A 1VJ5A 1ODTC 3W05A 2V96A 5CXXA 1EDDA 3AIOA 4QNNA 1EVQA 3I2IA 4BB0A 4MWSA 3FNBA 3HXKA 3H1AA 3D2BA 3UUEA 1E66A 3LS2A 1W75A 1ZOIA 3W9UA 2BUAA 4U2BA 2DHDA 2WUGA 3FSGA 1CLEA 1HKHA 3STYA 4DMFA 3WWDA 3V1KA 3ESDA 1DINA 1CUGA 2XLBA 4CCYB 3SWWA 1ACJA 3QBJA 4Z49A 3AFIA 5EHXA 4OCZA 4PQEA 4UFPA 4CIBA 4GWLA 3DYVA 2OAGA 2FUKA 5DWDA 2DSNA 1R9NA 2B61A 1B6GA 3FBWA 1TCBA 1VXOA 3IURA 4LIPD 4G4IA 4QDTA 1N5MA 3KXPA 1LPBB 2QM0A 2WHQA 5AH0A 2WIJA 3V1LA 5DNVA 5AKIA 4BP8A 5C8VA 2C5FA 5FLKA 3I1YA 5CH8A 2NW6A 2LIPA 2JEZA 1ZIXA 2PSDA 2VJDA 3C43A 4B84A 4KRYA 5AOBA 1XKTA 4OB8A 3WWEA 1CUZA 2PM8A 5E2IA 3HRHA 1WB5A 2ZYSA 3C5WP 4NZZA 2VEOA 4E14A 1BEZA 1AMNA 1ISPA 1XQYA 4HVTA 2YASA 4QDZA 3VISA 4I19A 1VXRA 5JZ9A 2QJRA 1AUOA 2GYUA 4I3FA 5EIHA 3B3QA 5AOAA 1W52X 5T4HA 4KAJA 3MUOA 2CMFA 4G1FA 3UUFA 3CCBA 4P08A 1J07A 4FDMA 1DTEA 5JAPA 4QLOA 4OU4A 4OB6A 2HRRA 4QA9A 4F0JA 1P0IA 2ZVDA 4QDUA 1QIMA 4B85A 3ESAA 3D5EA 3WIOA 3G7NA 3IB3A 5EFZA 1EK1A 3GUUA 1IZ8A 3DDUA 3I1IA 3STTA 2H1IA 4MEAA 1MJ5A 1YB6A 4PW0A 2XUKA 3AZOA 3I2GA 3WKBA 2VATA 1XLWA 1CVLA 2Z3ZA 2JGEA 4B82A 1VZ2A 5HF6A 1QONA 4X94A 3BIWA 3WK6A 4UHEA 3R3UA 3AIKA 4PF1A 4GXNA 5AI6A 1XKLA 1XRLA 4KRXA 2D5LA 3ZPXA 1YCDA 5C7YA 2HA4A 3SX4A 2PSHA 4FWBA 1ETHA 3GBSA 3OC0A 1ORWA 4X85A 3V9AA 2BUCA 2CJPA 2XQGA 4X97A 1L7AA 4BBZA 1DX4A 4UBJA 1N8SA 4CG3A 4W63A 3R3VA 2Y2UA 3HSSA 1WHSA 3FOBA 5JASA 4M0EA 3IUMA 4MWTA 4DLNA 5AM4A 3Q0TA 2PSFA 1AKNA 1CQWA 3ANSA 1CRLA 1IZ7A 2OGTA 5ALFA 5CURA 3F9CA 3S2ZA 1QIJA 1ZD3A 3ZLUA 4AB1A 2H9YA 3V1MA 1AGYA 1CUWA 4UBMA 4UFOA 1E8NA 5ALOA 1GKLA 5ALDA 4X6YA 3IUQA 1VKHA 2E3JA 3PF9A 4GLBA 4XIIA 4B9AA 3U0VA 3FYUA 3HEAA 4C88A 2V97A 3DOHA 2ZSIA 1X70A 5LYYA 2XMBA 4UHHA 1W1IA 1ACLA 5KBYA 2CUTA 4U2FA 5HFNA 4KE8A 4Y2PA 4ZV9A 5EHQA 3I2JA 2PU5A 5EHNA 3WKDA 4N5HX 3RM3A 5EHZA 1WPXA 1YAJA 4JNCA 1OILA 4Y2RA 5HK9A 1XRPA 3DNMA 4GHWA 3ICWA 1XZEA 1UK9A 5ALVA 2YYSA 3FCYA 1C7JA 3IUJA 3C45A 1TQHA 1S8OA 4FFWA 4HZGA 4BATA 3I2HA 2XMQA 1QGED 5CW2A 3K6KA 5J3JA 2HRQA 4P93A 4TVKA 4C4ZA 4HS9A 4N8EA 1UK6A 4X95A 4KAFA 2HIHA 3WQHA 2X76A 3KD2A 4UBIA 4L9AA 3AUKA 1MN6A 2QVBA 3HZOA 1LZLA 5BWCA 4GBGA 1XZMA 2GBFA 3EF3A 2Y2VA 3PUIA 4KEAA 1N1MA 4H7EA 3WWOA 4WFIA 2JGMA 4Y2UA 2P8SA 1QIEA 4KAAA 1JU4A 4B83A 1LPAB 5AHXA 1E89A 3T4UA 2VF2A 3IBTA 3LIPA 1W6RA 3WK8A 3U1TA 1XLUA 3QITA 4MEBA 1ODCA 4AMYA 4ITVA 2Q0XA 3DL4A 3O4JA 2XQKA 4J03A 4NVRA 1EDBA 3R41A 3M81A 4W1PA 1CR6A 5KWJA 1H2YA 3P2MA 2RI6A 3N2ZB 3QVMA 3I2FA 1TCCA 3IULA 3F8SA 3WI7A 4F60A 1HBJA 1EDEA 5T4EA 4CI9A 3BF7A 2RIPA 1R50A 5DYYA 4AMZA 5K3DA 2XUJA 2J3DA 1PFQA 1Q83A 5DNUA 4XJVA 1CIJA 5AP9A 5K3CA 4V2IA 1OCEA 1HPLA 5HF5A 3HJUA 1BS9A 5JZSA 5D3ZA 4ZXFA 3M82A 4UBKA
chains in the Genus database with same CATH superfamily
3IUSA 2D8MA 5TT1A 1A1SA 2V7PA 3VM6A 1JPUA 1KMIY 1Q0ZA 2IPNA 3ZQ4A 3U3JA 2V7QA 2R1VB 4BLSA 1HDEA 1JTEA 2QR5A 3NEYA 4FDAA 3D9QX 4C4RA 4JOQA 4Q3EA 1TAGA 3H4MA 1GUDA 2VHTA 1EK2A 3LQKA 1EWRA 1W47A 3OU6A 4MYHA 3LD9A 4ANFA 1EFCA 4M0MA 5F12A 5CX4A 4E5MA 3OCYA 5I7EA 1WXDA 2G0TA 1IOVA 1OZAA 3C3PA 2QTTA 1RHMA 2J0QA 3D8SA 2VAPA 3QM1A 1I6KA 2OAEA 2JFFA 1NL3A 1VSQA 4NU8X 3E05A 1CR2A 3FCOA 5A0FA 3U4QB 1FLNA 5LBUA 4C2BA 4QJIA 5FTWA 3PE3A 5C7IO 4RSRA 1O6FA 4D5GA 4YT2A 1E2PA 2FSUA 3BDIA 2ZS8A 1H2RS 3NC1C 3KBOA 4AKIA 2HF7A 1TM4E 3EOAI 3GD7A 3K5PA 4WDRA 3RRXA 1FP4B 4JGIA 2IPOA 3LC1O 3WBKA 2VA9A 3NAMA 1CNFA 2XB6A 1KMNA 2PMDA 1FDIA 1NZJA 5FNVA 1FJ2A 1GTMA 3AINA 3V4OA 4Q5IA 1W85B 3H1FA 1I5RA 1WDTA 4NY1A 3H5IA 2XYVA 3ZHVA 1QK5A 2FEOA 5H3CA 1UINA 4Z1MD 3DV0B 5KEIA 4DR7B 2VPIA 3B6JA 4L3VA 2PZFA 1OI3A 4OAOA 5TQ0A 5K3EA 3AEYA 3CSSA 3V1NA 4BRZA 1L4YA 1ND6A 1LV7A 3HYRA 3NAGA 3IKMB 3R20A 4G1VA 4HEHA 5K0JA 1UPAA 5TEWA 2QUIA 2EERA 2RAFA 3FTQA 4YREA 3QQ5A 4EF5A 1DAEA 3L77A 4HB4A 1QCCA 3ZHTA 4DQXA 4B2YA 4JMLA 2HDWA 3MELA 3P9QA 1QX4A 3AI3A 4GKBA 1UZMA 4MUYA 2VUUA 3DZKA 1RMQA 2NTEA 3NBUA 4OQQA 2I2AA 3QEMB 1VFPA 5ESRA 2WM2A 1AGPA 1LPPA 3S2IA 1W5SA 4LGVA 4E12A 4M46A 1YRBA 2J6IA 4QUGA 2AYZA 4HFRA 5CNMA 1VHDA 4WCDA 4HGOA 2IKSA 1P2VA 2PUTA 4QREA 3BXFA 3U40A 1DNPA 3LLUA 3EUFA 2J31A 2OCKA 3R74A 2OQRA 4PNZA 4B73A 5KU1A 2AX3A 2ETXA 4GPIB 1PQPA 2CT8A 2JASA 5AIBA 3QYFA 1EGMB 3DZHA 5A4FS 3ERCA 3VC1A 2OBBA 2NUAA 4KDEA 5HKAA 3HFSA 3ZX4A 2QYHA 5LQCA 2JJ1A 4MJXA 2JLBA 4PZ0A 4PX5A 4CKEA 4PWZA 5EQDA 3I0ZA 2QX7A 4TKLA 3ZW9A 1YOVA 3OEHD 5I7RA 1AXGA 1IDOA 4NQRA 3SQWA 3L9WA 4RFSB 3KT6A 2PMKA 4HWSA 2EF0A 3ZCPA 3A2LA 2WIDA 4QUJA 4YV7A 4M0PA 1QU3A 2QIOA 3W79A 1G2IA 3PXCX 1GUBA 2X1HA 5J23A 5J5CA 3HQ4O 5C7OO 1PWZA 2IU0A 3V3KA 1MGOA 3WIEA 1U8YA 2ZIWB 1X9HA 5IKMA 1XALA 3C8ZA 1EFKA 2CXNA 3OECA 4ZYZA 3C5CA 3MILA 4UHCA 3ZJVA 1D9XA 2IYNA 4UTNA 1DRUA 4FK8A 2ZUDA 4I1RA 2CFCA 5IZCC 2C59A 3B8EA 3ODPA 3LP8A 1E0JA 4FJ1A 4MLCA 1MIOA 4WIAA 1QIFA 3S55A 4ZDKA 3KJXA 1I36A 2Q1XA 2RH4A 1IDN1 4PRLA 521PA 3R7LA 1J6UA 1E2GA 1H0SA 4H3KB 1CG6A 1OKKA 1NMSA 5I9IA 3G8YA 4ZO9A 2CZQA 4BYGA 3URKA 2YXNA 5ABPA 4IOMA 4XGIA 6REQB 3UG6A 1JR6A 3AW9A 4NENA 2B8TA 3OWXA 1L5QA 4O4HB 1WZ2A 3SOZA 4QM7A 3LE8A 3DH0A 3ADOA 3KAQA 4J4BA 4M1ZA 3PGJA 4Q4AA 4RD3A 1PVDA 3MRSA 3NNNA 2F9FA 1Z3IX 2PTHA 4R0NA 2G5GX 5AOCA 4AY3A 4AY4A 4GFDA 5D6NA 1YZTA 3ZZ1A 3K4PA 5BPHA 4M37A 4TS9A 4MP8A 3WBBA 1X9IA 1B8PA 2DPGA 2IELA 3FNIA 4JUIA 3S1AA 4MVCA 2LKCA 3RBXA 1J33A 4S0XA 1WNTA 3S2EA 3RVRA 3T7EA 4B5LA 3OZBA 2VTBB 5BUZA 4W5WA 4PIPA 5HF9A 3G1TA 2Z9BA 1JFVA 2EGUA 2R8BA 2BKAA 1Y1KE 2XEDA 2XUGA 1GGHA 3MRXA 5K4AA 4BNYA 2MOKA 4DSAA 4BFCA 1XDDA 3FMIA 4PTLA 2UYCA 5EINA 2V3VA 3P9KA 2WT9A 1R5NA 4RY0A 3LTNC 4JHLA 1Y4SA 4HDMA 3ZHYA 1HT3A 3O3OB 4DOMA 3OLXA 1ZPDA 3GT7A 3TEFA 4TX1A 3D81A 4RQBA 1IIBA 3VU1A 1OXMA 4JU8A 1XZNA 1T13A 2JLQA 1CZOA 2I4TA 3W7AA 3B6MA 1OH7A 1GRNA 1F0NA 1GZ6A 1MO6A 3GRCA 2E4VA 2X42A 3GJRA 5JRZA 1XQWA 1JHRA 2ZB2A 1JDNA 5JI3E 2YV3A 3EXHC 1CDOA 2CXQA 3OQVA 1ST2A 2V6IA 3DXZA 4MLPA 5FTJA 3VOTA 5JPDA 1CXZA 2HF8A 2QRHA 3LP5A 3OIYA 3EGIA 4LDNA 2BDEA 3AILA 4AUNA 2HSEA 1E3MA 2FPOA 1ZD9A 2IEDA 3H2BA 5EESA 1UPCA 4DQLA 3I64A 2GLXA 4CQJA 1QC5B 1AX9A 3E7FA 4J0HA 2X8AA 4AZ3B 1FP4A 3T1NA 1AZSC 3UW1A 1G66A 1P7PA 1G8HA 4S2EA 3VC3A 2ZG6A 4Q3OA 4GRAA 1ZOLA 1NATA 3JZMA 3H3XA 2WUWE 3LL4A 4IRUB 5C35A 3SBDA 2HJ9A 3IMKA 1CY4A 4D43A 1T43A 3G88A 4FT4A 2VDLB 4US0R 3PL1A 2I99A 3DV0A 1IVYA 2V98A 4BP9A 1HY3A 1I33A 4CL8A 1OAOC 3O2SB 3VH1A 1TEHA 2XF2A 1F17A 2I03A 1JQBA 4D9EA 1RWQA 2XXBA 3EX7C 4JASB 1OXTA 4OX9Y 4K86A 3F1KA 3M3PA 5HGXA 3FPFA 5L7YA 1EE1A 2CBZA 4PZZA 2BBOA 1JSXA 5AI8A 1VPEA 4D4KA 2WFLB 3GUYA 3MNFA 3D6JA 5DBOA 3AF1A 2IH5A 3VZCA 2VTVA 4N03A 3RASA 1BEUB 1C9YA 3L40A 3UO8B 4MS3A 4C6TA 1ABBA 4MCAA 3GIWA 4LRSB 4BVGA 3T4PA 2PL5A 4B34A 2D0DA 2Y0PA 4W82A 4B09A 4QWMA 1C9JA 2OT3B 3Q0EA 1T4MA 3IB6A 2EFGA 3KKPA 3LVFO 1PFWA 1AN9A 1IY1A 1EK5A 1Y7TA 2FWPA 1TQ8A 3LBNA 2I9KA 5T6MA 5JQGF 2ZIVB 1SOMA 1M67A 3I6BA 4MIEA 1NYLA 4OJYA 5AM5A 1UKVY 3MBIA 5K3BA 2IP2A 3JZAA 3R0IA 3RKUA 3WGTA 2P3SA 2QTVB 4AECA 5ENZA 3ZCUA 1H4QA 5FTKA 2RD2A 4AG6A 3REGA 4LC1A 2B1QA 2BRUA 4BQOA 2HHJA 3H8WA 2JAQA 1ZMRA 1SHKA 1QM5A 4NJEB 1WW3A 4B5KA 4DLVA 4DWOA 4AJIA 2BY4A 3OAAA 1NBWB 3PQ6A 1QYIA 1MVLA 1LJLA 4RM3A 3STUA 1ZONA 1NSFA 3C41J 1HQCA 1VHLA 3MUNA 5FYQA 4C76A 3IVXA 4HT3B 1QQ6A 1QYWA 2HDNB 1CZLA 3THOA 1TLTA 4E2WA 2CXPA 1H5NA 4NNOA 4BMNA 2D5IA 5K3FB 2OUIA 5EP4A 3EDRA 1O94C 2POQX 4BMZA 2QL7A 1F06A 5AK4A 3NPMA 1GT6A 3ESCA 3OJWA 5A5DA 1QQAA 5DK4A 2VH1A 1I3KA 4BKMA 1TVCA 3GDWA 3HCAA 5BQ3A 1IN1A 3DFUA 2X8WA 1WMSA 1FBNA 2C9MA 2GEVA 5BT9A 1Z06A 4I5FA 4PHFA 3PUHA 3FJOA 3LQRA 2JIDA 4W5HA 4C0KA 1RT9A 3QTTA 1GGKA 2WV7A 3QPDA 2R6JA 4CKZA 5LVAA 4O4HA 3MT9A 1FDWA 2GNAA 3KKMA 2IUUA 3E18A 2PL3A 2VQ6A 2I7TA 4W99A 1D4OA 5B5SA 3I61A 2BEJA 4UBOA 2QZPA 1ISJA 2AXEA 4H6XA 4K3VA 4WY5A 5HBGA 5FBRB 3JAMA 1L7RA 2WZBA 4KQWA 4DSTA 4URUR 1XGKA 4LFAB 4DNPA 3QJGA 3SLKA 4FDLA 4HQ6A 3L5OA 3BEDA 1S01A 2CUKA 2JFYA 2JD1A 2P65A 1OBVA 1SUDA 4ND1A 4P0TA 3HCCA 3Q8WA 4W9RA 1ZVQA 3R0XA 3L7OA 2BJWA 2RCNA 3IIMA 5SZIA 3FAKA 4OOFA 4RHTA 4CUZA 5JYCA 1ADGA 3PHIA 5D3MB 4M22A 3OG9A 2J3KA 5I7SA 1XK6A 1YDHA 2HX1A 5G0UA 4ALMA 4G56A 1DBWA 1KE2A 3OBIA 2SCUA 3KVVA 4XZ3A 3ZV6A 1YMVA 4OA8A 1DADA 1UFQA 3EMDA 3LFTA 4FM9A 5KNCA 4GI2A 4N6NA 4AIRA 1SC6A 2VO1A 4QFBA 3P2JA 4QU0A 4FR2A 1PQ4A 2H31A 4WCFC 1NQ5A 4Q9KA 4HL6A 1VOTA 3IIEA 4ND5A 4PLYA 3E48A 1PP4A 3ZUPA 4BNDB 2P9ZA 2QN1A 3FYDA 2WJ3A 1EWTA 2OBYA 3N28A 2WP0A 3EDMA 5I9NA 2AN3A 3Q8KA 1XMJA 4F04A 4EL0A 1EJ6A 1UKZA 3GAZA 4G5GA 4B6GA 4AUMA 2YZKA 3B9PA 3ESXA 4HDAA 3PHLA 3AWIA 1K8QA 1PO7A 1N0IA 2NXNA 2XQFA 2GESA 1C9DB 4CM1A 3F4KA 5C7LO 1E9EA 1BOFA 4Q9LA 4BEWA 1UBGA 1QC5A 4Q1FA 1QIHA 2NG1A 1MO2A 2SICE 4CM3A 5C2JB 1JSLA 5C8XA 4FYMA 3RK0A 2XCRB 3ILYA 4IOLA 2RCYA 2R62A 2Z8YM 4QOSA 1XE3A 3AF5A 2I4MA 3VRHA 4WNIA 4EKYA 3W8EA 4DYHA 2LR0A 3QE2A 2QP4A 1KDOA 1M0EA 2IS6A 3FB4A 4QXMA 2XRMA 3PCRB 2EYQA 4WA8A 2ZRIA 3SC2A 5KNDH 5AI4A 3LCUA 2F90A 2LCIA 3LZ6A 3Q87B 5ALHA 3IT1A 4WBNB 3C5HA 1YDGA 2B4YA 2VXYA 4O2LA 4I08A 1QDUA 4MZXA 1BW9A 3ZN2A 1IUPA 1Z2EA 4UUQA 1BXZA 1O95C 2ZR7A 3GFOA 1R5BA 1VC2A 4NMXB 5CFLA 4ZTBA 1II8A 3S99A 5BSKA 5M34A 5EZ6B 3T8YA 1VSUA 2QXUA 3EXIB 1ML4A 3JD2A 3KUCA 3MC1A 1RYZA 3KG2A 2RFLA 2W4MA 4QICA 5GOTA 3UHAA 5DKFA 3HXOA 3EZFA 3I3SR 3ILVA 1AZWA 4HQKA 4KO1S 1O7JA 5ULLA 3AGPA 3ELYA 1P5ZB 2Z2YA 3OFVA 3K0HA 4MYUA 4NZOA 5HKOA 4UZSA 1PK8A 2KBEA 3D02A 1E8DA 1ESDA 2BMVA 4KQHA 3UENA 2GERA 2IU3A 4DJDC 4BMDA 4ZMBA 4IMIB 2BFBB 1J99A 5EA2A 3V8EA 3GJXC 4QPZA 4IH1A 4P82A 4KGVA 2PGJA 2H5JA 3ER6A 4HQRA 1HDYA 1C1YA 1R6DA 2LW7A 3EISA 3G85A 2ATVA 2PZAA 5CCEA 1NMYA 3HO8A 3ZHOA 4LNUB 3NBAA 4YJGB 3LF2A 1FYVA 4LF6B 4J7UA 1G1MA 3LBIA 1E92A 3CC8A 1ACMA 3P97A 4TLMB 5HQJA 3UJPA 1KF0A 3WK7A 5KDDA 3MWGA 1L4UA 3DWIA 3CSUA 4W7HA 1V95A 5LMZA 2FSVA 3ANTA 4BNLA 4R98A 5K3FA 2MYPA 3SK0A 5L6MB 4P4NA 2QUBA 3ETNA 1W4AA 5E1OA 3VJLA 4S1PA 4TUYF 1N8TA 2P9BA 5JSUA 1PUIA 2ZUCA 3FDZB 2NYAA 1QFXA 2BFDB 2J9GA 1PDWA 1X7ZB 2O6LA 3F6YA 3ICCA 3K4HA 2JIRA 3LCMA 3ZWAA 4MV1A 1R0XA 4KLZA 4C0HA 5EJ7A 1KHTA 1RRMA 3AUTA 3P9ZA 3PKZA 4P35A 2IIBA 3I28A 4DM4A 3KB6A 4DNXA 5DISB 3QYPA 5FOQA 4Q02A 3FTNA 5GMOA 2PWZA 4HXFB 4QM6A 1JIKA 1G63A 3IP5A 4Q7EA 5DM4A 4PRZA 4Q16A 2JANA 3EYAA 3KEQA 3OBBA 1T3GA 5CA1B 2J5BA 3DYIA 4IXTA 4ODIA 3UXYA 2WMYA 1B0PA 4UAUA 3A6GA 5JPIA 2J4FA 5TXGA 3TDMA 1DWQA 1PBTA 2QJOA 4R51A 5CB4F 1PVOA 2DBQA 5DP1A 3U3MA 6NULA 3NVKI 1ULZA 1NF8A 2P8JA 4Z9FA 3ZW8A 3U9LA 3E9EA 3LU1A 2K2QB 1G60A 2AJCA 2H6EA 2OM2A 4EI9A 1OFUA 2F8SA 1XTJA 3GFFA 1SUFA 4M88A 2X5JO 2ZETA 3O38A 5KO2A 1UT5A 4I4IA 5EMNA 1XMOB 3M4JA 5LM3A 5K45A 4D81A 4QGFA 3U37A 4E31A 7AT1A 1FQJA 4JZKA 2FQWA 3O8LA 3RGWS 2GDJA 2Z8XA 4JFAA 4MXDA 3T9CA 5A3JA 4MYTA 1VE1A 4XA8A 4DIEA 3KFVA 2FH5B 4RVDA 1T2EA 5FTMA 5FXMA 4AQDA 1C9NA 4K6HA 5CVVA 1ATZA 2AC4A 3FNRA 1T9AA 4BNDA 4RLFA 4YROA 2ZEJA 3UTCA 5C5CA 7GPBA 1YHNA 1P75A 4E7OA 5GVSA 3GFVA 3PXDA 1J0AA 4JP2A 4L85A 5HA5A 4H7HA 3PF8A 1ZK4A 2IDZA 5FA8A 4Z4EA 4NABA 1KJYA 3E1SA 3WHIA 3I5YA 2G4VA 2WM8A 4LJ9A 2HI0A 3NGLA 5E9WA 1KY5A 1X13A 5IDYA 5JCOC 4OLJA 4X54A 3ZZ0A 3DHNA 1CW2B 3EFEA 3R40A 4JC0A 1YQWA 4YT4A 4B87A 2A5DA 4HN2A 1E98A 4C7XA 1X1AA 3BQMB 4K6MA 3K32A 1SRQA 1RPTA 4G4JA 1WLYA 4OI1A 5KJCA 3UBTA 3NIWA 3NVDA 4MA4A 4CTMA 4MVWA 2C2HA 2EZ9A 4XWTA 3ZY2A 1WZEA 3IQDB 3F8WA 3DZIA 5TGZA 3WJ1A 2EKQA 2C04A 3CNBA 4UE6A 1EX1A 2G88A 2KI5A 4K40A 4ML3A 3ETJA 4RY8A 1QRTA 1W96A 3VNVA 2NOAA 1I2DA 3HJAA 3MIZA 1SPBS 4GI1A 1W9HA 2IP1A 1T9HA 4K9KA 2CHFA 1HORA 1JTFA 1HZJA 4WBNA 1GGVA 3HU5A 3VTKA 4EHLA 4INJA 4M6WB 4PLHA 1ZICA 4HNTA 4RHFA 1MV5A 3MWJA 1NYQA 1YA6A 1T4DA 1OBOA 2PJZA 3GRAA 1NG9A 1O89A 4WNAB 3CZAA 4Z4IA 4X6UA 1E3SA 2H18A 3LCCA 4JT4A 4AP9A 2W4QA 4F9GA 1KI7A 3JD1A 5EWJA 1PR4A 3U7HB 2WD8A 5LKRA 3ANLA 3EXIA 5EP2A 5F76A 4OHMA 1WVGA 2C77A 2PSJA 3GJ8A 3WOVA 4DJEC 6PFKA 5I8WA 2XWJI 1ZQ1A 3DHEA 2HD4A 4UTRA 4Q6BA 1XCOA 4PZAA 4Y6OA 3EVDA 1R37A 1SMKA 2QZSA 3I5MA 4OHRA 1GFSA 4I1PA 1KI6B 3JYHA 1WXFA 5TRTA 3EZNA 4Z3DA 1T5SA 1XTUA 2AQHA 3P71T 1R18A 2GPTA 3QUTA 4X20B 1SKQA 4MYRA 2VDVE 2BFBA 3OTHA 4OQXA 3MTJA 4DSZA 4L74A 2PFKA 3WB0A 1RBZA 2XNDD 2JAXA 4KH1A 3RVJA 3UJAA 1G7SA 1TYDE 4RPHA 5IJ9A 2JLCA 1Z0JA 2VSNA 5F5NA 4I55B 3IDQA 5CDFA 1QQTA 2ST1A 4K1XA 1P77A 4JIGA 2Z56A 1QE5A 4LNUA 4YJGA 4HZIA 3ZYCA 1SVMA 1X15A 1Q0HA 1VJTA 2ZSHA 5IUKC 5T67A 2HSZA 1V8DA 1PWYE 3I0MA 3TH5A 1WETA 4MUNA 2IZZA 4QBTA 3WMGA 1U7DA 1SC4A 2OD7A 1T1GA 3DVSX 4ACAA 1WCV1 3E9DA 3UJ3X 3A0RB 3K73O 4LXTA 5EFOA 4DCTA 2FEAA 3D3WA 4B8ZA 1SCJA 3RYFA 2VBGA 4A5OA 3BS4A 2DULA 4QOHA 1OTHA 3G8DA 1ONBA 4M9ZA 3BSWA 2WJIA 1AJEA 1JJFA 4MDYA 4FMDB 3ZE7A 3THXA 1R64A 4M9SA 1X7ZA 2R87A 1KZGB 4QDKA 5IARA 3QJYA 3SLGA 4IIJB 1GR1A 3Q41A 3EIQA 4L5IA 4TSFD 2DBZA 2JAHA 4KYUA 3VVMA 3FNEA 5L4SA 1AS3A 2DGDA 4WLVA 1FX1A 1SUPA 2HFKA 4RPGA 1RVDA 3EIWA 3IPRA 2IS2A 2Y93A 1VG1A 1B41A 2VH2A 4L6CA 1L5YA 1N2HA 1P1BA 1X42A 3AHJA 3CNEA 3JW8A 3FYCA 4A2CA 4ZN6A 3KEFA 4CIYA 2QRUA 1H66A 1B15A 2VUSA 1WAMA 5CA1A 2EZUA 3H9UA 1OX5A 1RADA 1CUYA 1V26A 3L7DA 1J42A 2H2AA 3F8TA 3OZFA 2VAWA 3TRKA 5KWVA 1J09A 4P5DA 3CRQA 4M8LA 1PW7A 1R6UA 3CW9A 3K31A 1G8PA 1OIXA 1WG8A 2N46A 3WLLA 4DG8A 1VB5A 4F9EA 4CW7A 4EECA 4FMCF 1MQAA 4GF5A 4QOEA 4EFMA 2OYCA 3IESA 4WY2A 1ZHFA 5IT0A 5B1IA 3ZNQA 3NBXX 4IQ8A 1QWOA 2DYKA 3C3DA 3VAZA 5CDFE 4L8VA 3EZ6A 3HKEB 2VT3A 4EZEA 1NW6A 1CD5A 1OD6A 4WK6A 5LOVB 4JGGA 4ZVQA 3ZDZB 4EOGA 3QX3A 2YC4C 2RBKA 4L28A 3MJRA 5GJBA 1EP2B 5A4DA 4G1UC 4R84A 4YV2A 3LKDA 2YXPX 4PV7A 1FBTA 3LF1A 1AB5A 3OLCX 3EEBA 3LZCA 4H16A 1V8ZA 3PNMA 3RCBA 1W36D 5EJEA 3DMGA 2XQJA 1R4AA 4FGZA 3ABRB 2OTCA 2PZJA 3P9SA 4CKYA 1D0SA 2C4VA 1TFRA 1TF2A 2PBRA 4AN1A 3KOZA 2WU1A 3H2GA 1ZI6A 5SYMA 3FFWA 1U0JA 1Q1QA 3O2NA 1ZGAA 2D00A 4L6IA 3VOAA 3JQAD 3UK6A 4NLLA 2Z2KA 1Z83A 4Q3CA 4RSMA 1M75A 3EIUA 3EGWA 1PR2A 3HJRA 2GPWA 5KWIA 4BIMA 1Z07A 1JZSA 2XE4A 5IULC 2WTNA 5L3SB 1QRUA 2O50A 1KS9A 1UK7A 1M2KA 3DPIA 2X0KA 4LI3X 5T5QA 3ZWMA 1GDTA 1LZKA 3E5HA 2BISA 3NTXA 1T9BA 3DKRA 4EUSA 4LECA 2QT1A 3MMPA 2G06A 1LSUA 1NV9A 1UT6A 1GPYA 1RRGA 3U60B 5AKEA 1GDDA 1XEWX 3PVZA 3IBCA 4NZNA 3GCZA 4L72A 1BE6A 2EFHB 4M6WA 4OBBA 4OMFG 5E6UB 1XYGA 4TRNA 3D6NB 4CM9A 3V4LA 1D1PA 4WNAA 2IEZA 5C8DA 4NZMA 5E0OA 3K5IA 3T06B 1IK4A 3BB3A 4OXRA 3X2SA 3HFJA 5CA0F 4CKWA 2W6CX 1CDDA 3TRIA 4OYYA 4LDJA 5ARCA 4PYJA 5F33A 2QPTA 2JEYA 3AFGA 3DHYA 4HVCA 1UJMA 4WASA 2EXXA 1JLKA 4BX9A 3H9QA 4DZZA 1BWSA 1R0SA 3DEAA 3IE2A 1KI6A 5JJLA 5T4FA 3HY3A 4X6LA 1GZ3A 1S96A 4AJOA 4L95C 4RORA 1L8AA 3WX0A 4JVSB 4PS1A 2BCEA 3AP3A 1LC0A 3EQ2A 3FOAA 1SUBA 4GG1A 5TC4A 1Q22A 3QTBA 2SECE 4BB9A 4I55A 4A26A 2PWYA 2QV0A 2FOIA 3RARA 4QQRA 1YJ8A 1QS0B 4JODA 1R3DA 4I4TF 3DVQX 3RRZA 1RIIA 1R88A 2AH5A 4N41A 1G9XA 3O4GA 2GBPA 3K9GA 1IC6A 1XNJA 2EFCB 4QBGB 4LRUA 1BVHA 1NURA 3EAQA 2H1WA 2OG2A 1HA3A 2DPLA 4F2HA 2ZWOA 1P8JA 1SWWA 3OU2A 4OFXA 2F8MA 3CT4A 3FHJA 2NNLD 1ZH6A 1U0NA 3CCCA 3BTVA 4F45A 3DTVD 1UBLS 1RLMA 1V9CA 3IMEA 2FDRA 2X4DA 1Y6FA 5FYDA 3MTQA 4BZPA 3SKVA 4A0RA 4S12A 2YJTD 4IIJA 1YVEI 4LOJA 3ROKA 2HUNA 5CUQA 4TYNA 2JB9A 1P3Y1 2AWNA 3MFYA 2ZANA 4LQLA 1G5RA 1GRQA 1WS6A 1EYZA 2ZRNA 3LDAA 2JFPA 4QT4A 2E4WA 1M76A 1QORA 4I1YA 5CDTA 4WAUA 1TU4A 2JAOA 1TCVA 1Q1BA 1IMOA 3PDIB 5HX7A 4FQ7A 1SUIA 3TTTA 1M6HA 2XCSB 1YDMA 2B9VA 5BSFA 1ZIPA 4AWXA 1VL6A 1C9MA 3L0YA 3K1AB 1I80A 1CB0A 5IMBA 4U39A 3TR0A 4WKGA 4I5EA 4R6WA 1GU1A 3HS3A 3WLKX 2HPVA 3FWKA 4RZUA 4X60A 5L45A 2G4CA 2D4HA 1JQ5A 3BDAA 1WB4A 4TXJA 2FMIA 4XCVA 3DF9A 5EPUA 4CLRA 3I8XA 2I91A 2RGAA 4RIEA 1F8UA 3IV6A 4AY6A 1KRHA 3R7DA 4Z1MA 1Z7YA 3EDCA 4BQSA 3ZXSA 3PFGA 1HSOA 2EQBA 2FTKE 2RKWA 1F3OA 4O63O 3WV5A 3SS7X 4QUIA 2HIAA 4X7RA 2VYCA 1GTL1 3OM8A 1T4GA 2VCEA 4C6SA 1ULAA 4EYKA 3HU1A 1IHXA 3HKEA 1V39A 8MHTA 1GSIA 4YMIA 4P36A 3TLMA 2Y1XA 5LOVA 1AMUA 3IQWA 4G5YA 4MV8A 3VMMA 2FQYA 5F35A 3WGIA 1MG5A 4DDTA 3K9QO 1C4KA 2IBTA 4UU8A 5JWRA 5LD2C 4CGYA 4Z6KA 1BHO1 2DQYA 2P9TA 1DLJA 121PA 2XDWA 3NEJA 4MRSA 5EMLA 5SICE 3SEAA 3TCKA 2P9CA 3UV6A 2IOQA 3EMBA 3IA7A 3VOBA 3VTFA 5JC1A 5KSWB 3MCVA 1KQFA 4N9WA 1FJXA 1XWFA 1IHUA 2FY8A 2QVYX 4AL4A 3BFJA 4B6JA 3NKFA 1GARA 1D4ZA 4TT3D 4YS6A 3ZWPA 1BFDA 5BUSA 3MCUA 4U0KA 1XF9A 3MT0A 1ZGGA 4RJJA 5F52A 4DVGA 5NULA 3TOCA 1E2BA 4HAXA 5J4HA 4G1CA 5LZ2A 3I6ZA 4K26A 4DV3B 3GT0A 4JT9A 4G8CA 1ORRA 4I1IA 4J1TC 4QEZA 2BHTA 3EXHB 4IDFA 4LTMA 5L3SA 1AH2A 2WAMA 3REQA 5JPCA 3MS2A 2DECA 3E3MA 3OEHA 4GP9A 3ASZA 1FLVA 4P5EA 4ZU3A 2GNOA 2Z95A 3TAXA 1D0VA 1OT3A 1VBKA 2C82A 3FUWA 3EASA 4JK3A 5KTYA 2CSXA 1Z37A 3KB8A 2C5BA 4LWZA 4C7BA 2R8OA 1ZMOA 4E15A 3B1JA 5BNFA 4IY1A 1XELA 4BMYA 4HNUA 1MLDA 4AIIA 3OMWA 5E6UA 3BXEA 1UPBA 2G5PA 4O4IF 3T1OA 2XGJA 3WAGA 3AC0A 4M1EA 4UVHA 4NZPA 3ZVLA 1L5SA 5EIXA 4JU9A 5ICFA 3VX4A 1C4XA 4MWCA 1ODFA 4P3PA 4QSMA 4YP1A 5JO9A 1JDTA 2QP3A 5AMXA 4MKZA 1TVKB 2JW5A 4G5SA 4W6QA 4XVCA 1T2FA 2D2EA 5IAEA 4FFDA 4DM3A 2CEAA 2IPLA 3I5UA 5D01A 2OWDA 2WJGA 2YBDA 5DSXA 2QLBA 5DM1A 3W5UA 4EJ6A 1YU6A 4YWHA 2M1ZA 5TVGA 1RZ3A 4H6WA 2VT2A 1KQGA 1OI4A 2PX8A 1AKUA 3LW7A 2P90A 4Q4CA 2WICA 5CM9C 1AXEA 4B3XA 3E5NA 4IV5A 4D5EA 4F4UA 2FEWB 4RJTA 1I4LD 2GHQA 2CYAA 1K8RA 2QTFA 4L27A 1RD4A 4ZDWA 4AF8A 4IGKA 4XWWA 1NBAA 1RLJA 3A27A 3FCEA 4YJ3F 2YIJA 1QS0A 3IP9A 4JWKA 3SSNA 4DAEA 1QPZA 5H7XA 3UOAB 4YEDA 1BWPA 2BFPA 3KPYA 3M2TA 1RQ2A 4AYXA 4QTUB 2D1SA 1Q6YA 4JX9A 4R8KA 2GH1A 3LPAA 1C9EA 4NJMA 1L5MA 3RSLA 4B3BA 1GNRA 5B57C 3FTPA 421PA 2YQ5A 1ZRMA 2P5TB 3DW1X 4GKAA 3LC7O 1QCYA 1NF3A 2VP6A 4BHTA 1LBEA 4HNAB 1RXEA 1KI8A 2WTAA 1A50B 2EVWX 1YZ3A 3UAGA 1WJGA 3VNQA 4K87A 2JGDB 1RRFA 1P1FA 5BNWA 1E1NA 5K51A 3CLUC 1BU8A 3O4VA 3CLTC 2E18A 5U4XA 1JGTA 1H42A 4IDQA 2PKEA 4PAGA 2I4OA 3PS9A 1K75A 1GPDG 1N8NA 2R5FA 4V0SA 1XKQA 1VL0A 3D4NA 4Y9TA 1XLVA 3WDMA 3A1FA 3HFGA 4L3WA 1DXYA 1N2ZA 3A3NA 1C3XA 4CKXA 1CUIA 5EMJA 1GZ4A 4G81A 4DMGA 2P6MA 5JBIA 3BBPA 3UJ8A 4QU5A 2RH8A 4HWPA 3RRNA 4YMVA 1EQUA 1A4RA 3HDQA 3K1AA 3UAXA 1GLNA 2F1HA 3F74A 3L6CA 4DCGA 2C4KA 2E49A 2XE8A 4LYHA 3JWEA 1N36B 2GA9A 3I5XA 1OV6A 2PV0A 4TV8B 2BZGA 5I9TA 2FMXA 3NJ4A 3OD5A 1J22A 2BHSA 1RFGE 3LPMA 1CUCA 4GZ3A 5T4BA 3ZQUA 3BMNB 4B7ZA 1YR6A 1ENOA 3K0FB 4MUHA 3GA7A 5AVQA 4EWLA 3QE9Y 1VG0B 2GVDC 4U6NA 9GPBA 2QBYB 1EP3B 1NVMB 4DF3A 2NYUA 1JKXA 5JSFA 3PJRA 4QARA 3WE7A 7ADHA 2Q6LA 3NDPA 8OHMA 2IZ1A 5CH5A 5EUMA 4BUCA 3VHXB 1DJOA 1Z6ZA 4IF4A 4UVIA 4E09A 4TLCA 2BFMA 3WFIA 1K89A 4E51A 1EQAA 1ENYA 3HHEA 2GTPA 3B6IA 3IX7A 4HH0A 4OH7A 1UBKS 3TR6A 2ZW9A 3QLJA 4ARUA 1FSZA 4R1NA 2O5EA 3PPXA 1A2OA 5EJ4A 3WRVA 1W0JD 2ZYAA 4E5NA 5JD4A 3SM9A 4RD6A 1FJHA 2E82A 3UOGA 3OSUA 2ON6A 3GZ4A 3RFFA 5CXQA 3DKIA 3PVSA 5FA5A 4LPSA 4BGDA 4MB2A 3T9BA 4C3UA 1QQBA 1KL7A 2WHPB 1RSZA 1SVWA 4WCFB 1G41A 3ROEA 3CLTD 1THTA 3OY7A 3VPDA 4HADA 4MRMA 2J0SA 1KJ8A 1N57A 3W2EA 3IAXA 2AEJA 1LLUA 1EP9A 3Q7EA 1LA2A 4H3VA 4S1TA 1E6CA 4V2UA 2HMTA 4PQFA 5P21A 1JH9A 3T9DA 2FN9A 4GEGA 3ROQA 2C9DA 3DLPX 1TZJA 3LUKA 1BWQA 2CLOB 2ZKLA 3D6TB 4BJ5A 3BJRA 1LCIA 1KSFX 2F3SA 3DZ8A 4CF7A 1XQVA 1X19A 3HB5X 5FUWA 3RNOA 2BDTA 3MERA 1NOKA 4RE5A 1K5PA 4IZOA 3SBOA 1O1YA 3I76A 5HUJA 4WZZA 1ONOA 1AQIA 1E2MA 2RKBA 4E07A 1VBMA 3HB9A 3OICA 3HZHA 5B2EA 2XNKA 8GPBA 1OFGA 2XMRA 1TVKA 1FUIA 1TT5A 1GA4A 1YQUA 3GCDA 3UV3A 2BDUA 2CUZA 5ALRA 5DXJA 3IQEA 2TMDA 4O25A 3PD1A 4OJNA 1Q1ZA 1SO8A 3ZWYA 1NVKA 3EN0A 5MFZA 2P2GA 4LQ4A 1A82A 2QX8A 1SZJG 3GYBA 2ASVA 2FP4B 1GPUA 4JKIA 1ZCZA 4II2A 5HZMA 2BGGA 4BPRA 1VMEA 1XR3A 1MB9A 2J0VA 4UPDA 3TQHA 5GZ1A 4FOOA 3T34A 3I45A 1N0VC 4M0LA 1PDOA 4NP6A 4HHEA 4Y0VA 3U44B 5BMVF 4CMEC 1R0RE 1RRKA 3TLYA 2HHCA 3UT6A 4C0SA 2IHKA 4DKXA 2W2LD 1EX6A 4RCZA 3HB7A 4GP7A 2OV1A 2X2PA 1WB6A 4JYBA 4UBNA 4PTZA 1TKAA 2BGMA 1KK3A 2WUEA 2B83A 3OQOA 1ZN9A 1B42A 2G36A 2UYQA 3FVRA 2C4TA 1X9GA 3KR1A 4FHDA 4KMOA 3OIWA 4BVKA 4DPKA 5LB2A 4DGQA 4BY9E 3ENVA 3QFCA 4HC4A 4WACA 1B16A 4Q19A 5AICA 2O2DA 3RPEA 3MOSA 4G0QA 5CH3A 1QZ3A 1XVLA 3O9VA 3DE4X 4E5PA 3O74A 3O1LA 3O26A 1OROA 3Q12A 3V7WA 2AE2A 1BE0A 3JQBC 3U3ZA 2PJDA 1FP2A 1KR2A 1D5CA 2J9ZB 2NSJA 3DVRX 5IABA 3ZJ5A 2V5VA 2XB9A 3ETLA 1ZJ4A 1JEEA 5H5JA 4MMYB 1EFPB 3OA0A 1P6XA 4J2TA 4MLDA 5KC8A 5TIIA 2ECFA 3I9LA 1K4YA 3IRUA 2VQEB 1M2HA 2JGDA 1QQ5A 5DCUA 1YQXA 4HS4A 3UXEA 1XCJA 4CWAA 4NG5A 6AT1A 1HG0A 2XYGA 3CUVA 3NWOA 4QGAA 5HRCA 3LH5A 2V7GA 2DEUA 3TBFA 5DRYA 4BFTA 2J7PD 4XAQA 4XLTA 4QQKA 4WINA 2JFHA 3ZH9B 4GLFA 3GMIA 1DKRA 1MA0A 2FA9A 3JR7A 1T5BA 3QPWA 3VZDA 1EB9A 3K8OE 3HVHA 3ZK8A 4BVJA 4EEXA 1J1UA 5KUTA 4BFYA 4EW3A 1U3VA 3T3MB 4BVEA 1SN7A 1H2EA 4R2KA 5HCUA 1RPZA 2ID8A 1XHEA 3DL0A 5EJ9A 4I9UA 3MYRA 5FFNA 3RJ9A 1Q0RA 1U9YA 3TF5A 1U8XX 1YB1A 1N7IA 4D82A 5CPBA 1I2MA 1NLUA 2Q21A 2H11A 3BMNA 4P22A 3K0FA 3PDWA 3WL4A 5IDQA 2Y71A 4FQ8A 4KIGA 3KKNA 1XBTA 2IFTA 1CEXA 2IHZA 2VHWA 2H7XA 1AQ6A 2LXNA 2PT9A 5H83A 5GONB 3FLBA 4GPTA 3WL7A 2YY5A 1M0WA 5IM4F 1TAUA 4H08A 4YRIA 3C8MA 4BMPB 4DMLA 2DFTA 4DR3B 1JDUA 4MYDA 2AMFA 4PC3A 3GVPA 2EP8A 4OBEA 2QXTA 1IAQA 4TS1A 1LK0A 3TDKA 3VHXA 5K0CA 1LDGA 3DEFA 3GJ5A 1C7FA 2ECOA 4I50B 1G6HA 5KQMA 5MN5A 2EV9A 1XDGA 1EVKA 3DOFA 1JAYA 2VWHA 4JUDX 2CV1A 3RAPR 1U2EA 4FONA 3N8DA 1JIQA 5A6VA 5EIBC 1YVPA 3U2QA 2BAGA 1NVGA 4EL5A 4YHBA 1N5JA 1PYGA 2CV0A 3FPJA 5KTMA 1KPHA 2FZ5A 2JEOA 2C4WA 1LLDA 1ECBA 2FX3A 2GF2A 3A3PA 4DSOA 4RVNA 3CVXA 4TV9F 1MP0A 3GT3A 2ZQZA 2A0FA 2ACEA 2WHPA 5ITZB 3KO8A 2PIAA 4PPNA 2PMWB 3E9YA 1H2WA 3UBMA 1NOJA 1YZLA 3C24A 5LMNB 1YFLA 2F3RA 4IMPA 3ZVKA 3AG5A 3N3AC 4F8YA 4HMQA 4QVIA 4DPLA 2J3MA 1JMKC 4FZ3A 3UWMA 3G0DA 4HAIA 3HLKA 3I8OA 3FZGA 1EESA 2JFZA 3SYMA 2EBUA 4LZJA 1TTTA 3LGAA 4HLNA 2FVYA 4HAUA 3HUEA 1UF9A 1D1SA 2J8ZA 2OGUA 3H1EA 1AKVA 1WTAA 4HPJB 3FFAA 3PK0A 3TD2A 3AL0C 4B6FA 4ZOCA 3PNYA 3GPDG 4IINA 3ROMA 2WHYA 3I01A 3H2YA 4ISBA 2IYTA 2PZBA 4OHVA 1GFZA 1ECFA 2QE6A 1T9DA 3IC5A 5BR8B 3U3OA 1CF4A 2BTEA 1I5EA 4AKGA 3HKDB 1ZVJA 2L17A 2WJHA 1TB4A 1Y3CE 3RS2A 3ZV3A 4IYJA 2GD2A 3AEZA 3DFKA 1FMFA 1V43A 3DMRA 3W77A 1DKNA 1H5QA 3MD0A 1K8XB 2DQ4A 4IS2A 1ZK3A 4RYDA 1XRQA 2WJWA 1TZKA 3TK1A 2NV6A 3E5RA 1Z6QA 5CJPA 3D7MA 3GUZA 4IOJA 2A9KA 5DXFA 3RANA 4YX9A 2Q50A 4AKTA 2FZEA 2JHPA 4WOPA 5FIUA 3KUKA 3ZU5A 2PRIA 3RH0A 3RIXA 4B45A 2FP4A 4DL9A 1AKMA 1O95A 3P9YA 1UQTA 3KWJA 4YCJA 1R1DA 4ZZIA 5CVUA 2XCLA 1F8XA 1HFWA 1YDWA 1TMKA 2KX7A 3FX2A 5HMMA 4AMBA 3U44A 1EZZA 2WJZB 1XU9A 1DO0A 2LZ0A 4HGNA 4KR0A 4ZEXA 5BRNA 4N0PA 4N5IX 4YLYA 5KB3A 4EAQA 3AV3A 4FFLA 1A7JA 3IBYA 4LYYA 1Z6YA 3AFOA 4ZU1X 4UTVA 4RKEA 5DV9A 1E0SA 4EG7A 1NXQA 2JHGA 4GOJA 1TK3A 6LDHA 2CB0A 3DFFA 4II7A 3D0KA 4CIVA 4BLOA 1PIWA 4RL6A 2JAPA 4KFUA 4EGFA 1LX6A 3BULA 5CFRA 4K9LA 4R2WA 3UFBA 5JSQA 2G1PA 4G65A 1DG9A 1YUNA 2FP3A 3I23A 3E2MA 3PQCA 1NBIA 3RFXA 3F3YA 3YASA 2HO4A 2BFEB 2IY9A 5ALGA 4EB0A 3BRWD 4EKGA 3S27A 3O8RA 2FVXA 3PNKA 4BO6A 2W2MA 1EFPA 3TS1A 1WRBA 4MRRA 3TB4A 2EFDB 2FOXA 2OILA 4NHEA 1NR7A 4MITA 1M7BA 1P1CA 2WHXA 3RU7A 1MHTA 1JWAB 2J5XA 4MRVA 2FPGA 3FHLA 1DJNA 1ZSNA 4YRAA 1W36B 1B8UA 3VBCA 4K6KA 5C3UA 3W5CA 2WUFA 3ZNPA 2GEFA 1XRNA 5F7OA 3OCZA 4IH9A 3HCPA 1I9GA 4GOKA 3SJBA 3X1JA 3M6VA 5AJTA 2QMOA 3C39A 4R40A 4D74A 2E85A 3ILHA 2C3OA 3PLNA 4LVUA 4Q3AA 1RM0A 4R1LA 3X1ZA 5ADWA 4GXQA 2GF9A 1OVMA 5AKLA 3JQAB 4Y2VA 2XE7A 1GCGA 3C2QA 3IUNA 5CTJA 2IX3A 3QFRA 2QAGC 4BAGA 4RTNA 2Z6VA 1RC8A 1ZMXA 4R7GA 5CXSA 4KFRA 4FWTA 5C81A 1E7RA 1WM1A 1Q7GA 3F5QA 2IYPA 4KUGA 1U7TA 1N6RA 4UFNA 5IJWA 2YWFA 2Y66A 1S3SA 1PWXA 3A4MA 3WGNA 4MZDA 5I7VA 1II0A 1A9QA 2X8JA 1MH1A 4OIFA 3LIIA 3VTZA 2DKFA 1EVZA 2BGNA 4EVIA 4MVYA 4YVFA 3STHA 2QUKA 2OV3A 2IHJA 3PIDA 2QRQA 3R7AA 4CLXA 3ASYA 4M7WA 3A6PC 1TMYA 2C7VA 5K0EA 4I50A 2IVFA 4WJLA 5EIEA 1A8IA 2VJMB 1TI7A 1D2RA 2VKTA 4DR5B 3EA0A 2PU7A 1E5VA 3UH0A 2Q2NA 4IXDA 3FSJX 4CLOB 3H2SA 1NUPA 4WRRA 4L08A 1CFJA 2H85A 1ECCA 3INTA 1JJ7A 3VMFA 2JZOA 4FT2A 3IXMA 4B6RA 3W90A 3I92A 5ITZA 2PR7A 3UPTA 2IIVA 2WFAA 4I6EA 1NPDA 3SIRA 3RTGA 1KH3A 1YB5A 3H1TA 2FGKA 3OJ0A 1DB3A 1GTVA 2LBPA 4ZQGA 1BJTA 2G72A 3ZZNA 4TUYB 1F7UA 3W0LB 5AVZA 3BWXA 4JEUA 4MKRA 3USES 3BT7A 3NEPX 1Q21A 2JGIA 5M3BA 1OJ7A 1ZDMA 2XNDA 3N2IA 3OHSX 4CKCB 1GTSA 4MVJD 5E9JA 2HU8A 1GQYA 1L2TA 3JARB 5KJ1A 1NT2A 4LJLA 2FFJA 3DZBA 3R9XB 4R8VA 4G3XA 4TKUA 3T5CA 1J2UA 1M9NA 1V37A 3A6JA 5BYJA 5JJ5A 1FRNA 4Q4HB 3VO9A 2YYZA 2I78A 4HAWA 3OU7A 1Z34A 2ODAA 1P4SA 4KRFA 1M73E 1B0AA 1TVEA 2C78A 3U1BA 3HBNA 3HKDA 2VDOB 2R4QA 4PC6A 4DTIA 3R8XA 2GOYA 3NJRA 3DLHA 4MI1A 1VGVA 3I3OA 4KR9A 2ZWIA 3ND5A 1F6WA 2Z6AA 1L7NA 2C1XA 2RJ3A 4J7CA 4RIGA 3TLKA 3LGSA 3S70A 4TYWA 1GGFA 1M8JA 2V8BA 2BP7B 3Q85A 1Y6GA 2YWCA 1DWPA 1E7YA 3H9GA 3L43A 1IMJA 3DBHB 4NBNA 4UW9A 2HBRA 1RACA 1E0DA 4FFPA 2VN8A 2FKAA 4YUWA 3DE7X 1CULC 1TZCA 1P17A 4RMGA 5B6PA 3K1YA 5JD6A 2IYUA 1JBKA 5TEVA 3OX4A 3A2NA 4FLFA 4E2XA 4AQYB 5IJXA 1Z16A 3KELA 2A7QA 3W7BA 3W9BA 2I9PA 1VL8A 4DQDA 3OZSA 1UXJA 4ZRDA 1ZI8A 2HBZA 4KXUA 4WY8A 3TEJA 4DDMA 2V3WA 4LVNA 4M9RA 1BDBA 4V0ME 1YA8A 4BQIA 1IJKA 4E94A 5C53B 3EY9A 3RHZA 4DV2B 1X6VA 3BG5A 2CVFA 1RABA 4Q3BA 5KTOA 2HNKA 4KL8S 1XCPA 3QBTA 4F84A 3ABIA 2NUTB 1T0JB 1ZL2A 1XDSA 2H16A 3FCAA 2V96A 1EDDA 3HHPA 3SZ3A 1PUJA 2G3YA 1VE3A 2BFEA 2GBLC 2IHTA 3DCIA 5FOSA 2VP2A 1XMIA 1Z74A 1NBMD 5FTNA 3UF0A 3HO6A 1EVQA 1RM5A 2FI1A 2R47A 2H9AA 4OH1A 3GDGA 2GS9A 2NYRA 5K8UA 1Q1EA 3D6VA 4ZDJA 4E0BA 1HE5A 3HXKA 4MQ5A 1DBPA 4U7PB 2Q6VA 2W98A 3UUEA 1E66A 2QWXA 3LS2A 3WVNA 3FNHA 3W34A 5BN1A 4BUJA 2NP6A 4LX0A 5K8IA 1JXAA 1IOWA 1O87A 2AOXA 4DBZA 2MYTA 2ZE7A 1W29A 3TXXA 1YZYA 4U2BA 3Q11A 4PQGA 4BX2A 2XHZA 4C0XA 1DCFA 2ZVQX 4Z9XA 1UC5B 2DHDA 3MXOA 2WUGA 1RAFA 3OH8A 4KLNA 4WXYB 7MHTA 4WV3A 2G76A 1KTVA 2PBZA 1OC2A 1OX4A 2LNDA 1TGYA 3M1IA 1G9TA 3HA5A 2FWNA 3CFYA 1X14A 1L7BA 3UEOA 3JQAA 4QRHA 2XLBA 3L8EA 5ADHA 2XHEA 1PJLA 1V48A 5ITSA 2EBFX 1Z2OX 2QE7D 3V2HA 3TG2A 1F7VA 1A5TA 1SBIA 3TTVA 2X9VA 4KWCA 5F3DA 3ZWCA 1GGEA 2QSYA 3G6KA 3MA0A 1I51A 3F73A 4UFPA 4B79A 4GWLA 4CIBA 5HM8A 2AHRA 2OAGA 2CL7X 4P4UA 1NQVA 2Q5LA 3QG1A 5DWDA 2XWPA 4P4LA 2ASEA 4M55A 4FEAA 4RENA 2F1OA 3GEDA 5HG0A 1KE1A 1B6GA 3CEAA 2EP5A 3FE2A 4JKOA 4YMSA 4PCUA 2F8TA 1SVUA 1LFDB 4C2TA 4G0YA 1VXOA 1XLTC 3K4QA 3KRTA 4FFRA 1IJFA 1GCUA 2O2XA 4G4IA 3ETEA 3LFUA 3MT7A 1N5MA 3KXPA 4IHQA 1LPBB 2QM0A 1PF7E 3MMSA 4IWNA 4BV9A 4C1BA 5AH0A 4DCVA 4H3HB 2GRJA 1RI4A 3RHTA 3V1LA 5DNVA 4Z2AA 4ZZ1A 4P2GA 1PT6A 2HXYA 2IYWA 1R6AA 3PYXA 1LH0A 2VSOA 2JH3A 1JE1A 1W0KD 2V7TA 4FC6A 4R1PA 4W8HA 3T1HB 1ENZA 2Q8PA 3U3RA 1FYXA 5TY0A 5LD2B 3KZNA 4WADA 1A9XB 1RHQA 1TEVA 5CH8A 4TUYA 3KAKA 3PR1A 4WBSA 3EAGA 1ZX1A 2N3ZA 2QD1A 2IY8A 3S40A 5DHSA 3ZNOA 3OJXA 2QPLA 2YFKA 4JHXA 4QTTB 1Y98A 4WHMA 4CU5A 2JEZA 3PYMA 4A8TA 1OT5A 1ZIXA 2XOKD 3IEXA 4KQIA 1J00A 1KVTA 2FEMA 3KM0A 5E95A 4J94A 3TMKA 4LBZA 1LI4A 2O2SA 5EZYF 2ZLBA 4P38A 3JARA 1E2IA 5THXA 3BWVA 3P45A 5B64A 2IEBA 4UC0A 4NAUA 1VHWA 4UQOA 5JFTA 4F1WA 4Q4HA 4ZD6A 3Q0IA 1VJGA 1IL0A 1BE1A 1JX6A 4BEVA 1EVYA 1HYQA 3N0XA 4Z2YA 1SVIA 2HMWA 1I13A 2PX0A 4L02A 2PNJA 1DC6A 1SURA 2PM8A 3G9QA 3NNDA 5CB4A 1WO8A 2QTNA 1ZKDA 2P6RA 2TSYB 1NMEA 2C7GA 1WMEA 3DDCA 1VIVA 1TA0A 1D6SA 2RGGA 2X4LA 3DTVA 1SG6A 2Q41A 2BP7A 2GB4A 2W11A 4FMCB 3U4AA 5B12A 3DBHA 2A94A 1G18A 1RPNA 3EVNA 3KJQA 1GJRA 1ZINA 3VKWA 2NO5A 1P39A 3X1YA 2D13A 2E48A 4YRJA 4PFSA 3UPUA 4RZIA 3QVOA 1YJCA 2F1KA 1IBMB 2XCIA 3CR3C 2VF7A 1U28C 2YASA 5T41A 2ZJBA 3N3BC 4F8JA 1Y8CA 1GYPA 2YHBA 3VISA 2OK7A 1D7OA 1NJSA 1V7PC 1PNRA 1KXJA 1JEYB 3KSUA 2IVZA 3D6HA 2CL5A 4EHAA 3NCHA 1NIJA 2GXQA 5G0VA 3VO1A 4PO1A 2H57A 1R6BX 1U0OC 2X23A 1F4VA 3B3QA 5AOAA 1L4HA 3CIFA 5FF9A 3DV9A 5LNK6 1Y4AE 4LK2A 4EJMA 2CMFA 3WGUA 2NXWA 1H8HD 4IRMA 2NUTA 2J1LA 5ICGA 1K3TA 3WAJA 4HEA6 1VI5A 3PEWA 5KSZA 4MGEA 2FPWA 1QUFA 4Q4JB 4NDAA 1Y3AA 1L9XA 1UFVA 4RDHA 1TO1E 1RKBA 2O52A 4AJ9A 3P1JA 1HZZC 2IEGA 2NPIA 3WB2A 3ZE1B 2PN1A 2CZCA 3ZDBA 1U8FO 2HC9A 1EFLA 3CZPA 2QL6A 3PNQA 1GPJA 3KOUA 4OQDA 2ZJ0A 3LX4A 2OB2A 3RUIA 4BNZA 4AQ7A 1H93A 3CX3A 1TU3A 3H65A 2XUZA 1AHPA 3I9V6 3V55A 3WRYC 3WIOA 4EARA 3CRVA 5JAZA 1CRQA 3I53A 3E61A 4L5YA 1TK2A 3W9YA 2PX4A 1X92A 1S2LA 3GUUA 4JJIA 3U6BA 4LSZA 1M1UA 4TT3A 1DTWB 4X62B 1IZ8A 3GFGA 4O29A 1X38A 3W5IA 3K9WA 3HN6A 4BMCA 4HDCA 5EUBA 1DJQA 5CA0B 3V32A 1SBZA 5ENDA 2JFXA 1HSZA 4EPTA 1YJQA 4M1WA 3LLSA 4UNSA 5AJYA 3IDZA 3PR3A 5DDIP 4YP9A 1P81A 1PHRA 3TW6A 3GVXA 3WKBA 4H1TA 4D3XA 1WXGA 2Z3ZA 3BWMA 3F6SA 3ADPA 4EGQA 1RWKA 2CXSA 2NZJA 4D8VA 5FJJA 1JI0A 1S1MA 2R6R1 2ZCUA 5CM2Z 5HF6A 4AS2A 1J4AA 1Y5NA 3S2GA 1RJEA 4QUEA 4EO9A 1V3TA 3VI3B 1WUTA 2YVAA 5LNK1 4NQZA 2ZPTX 4UHEA 4ZVUA 3QPUA 2XXAA 3KZMA 3ET4A 1NQAO 4H0NA 3DAPA 4BXOB 2YRFA 4KK3A 4AJEA 4F4CA 5DX8A 2KS6A 2OWEA 4OV6B 2YNMC 2HJWA 4V1CB 4GOND 4L7QA 1JG4A 4NMHA 3MSXA 1BKYA 2D5LA 3DCJA 1I5OA 3GGJA 5E3IA 3UMMA 4N7BA 4F6LA 3ADBA 2HA4A 3FBTA 5FFFA 3SX4A 5K0BA 1RWPA 2OQ2A 1DAPA 2PSHA 2WU0A 3DL2A 4IFEA 1FZQA 4L8LA 2J87A 4N01A 1AQNA 2O8EB 3HK2A 3HB0A 3ORQA 4BNWA 4A10A 1L7AA 2G71A 1G19A 4UKDA 1U7OA 3QKIA 4US1R 2GEJA 3GP3A 2OCDA 3MMNA 2WAYA 4OI4A 4KUEA 1GA1A 1A9XA 3HBLA 4IX9A 5KHOC 2OFWA 2CE2X 3UPDA 4M0EA 3I4FA 3HVIA 3PIIA 1XJ0A 4QTXA 2OV4A 2VP4A 4FUTA 4O4JF 4BQRA 3BMXA 3IQIX 4NV3A 5D5HA 4JLNA 1LRLA 4HYYA 5FBZA 4B4OA 1NYTA 3KQQA 3ORRA 3T9AA 1EA7A 1E96A 1WUHS 4QO7A 3WIDA 1ZXLA 3ZVNA 2FQXA 1DVRA 3KAPA 3U13A 1CIPA 2V45A 1P62B 3F9CA 1GQOA 2Q4EA 1Q7CA 3DE1X 3EEYA 1IUKA 2HLPA 1ZD3A 3EUEA 4J1TA 4JFRA 3ZLUA 1Y9AA 3EUAA 1AXRA 1G16A 1F2UA 3R9KA 1LTHR 3RROA 4UFOA 1GKUB 1WQ4A 5DXAA 3KD3A 1T3ZA 3GEHA 4R3UC 1HE4A 2XYRA 3TOSA 4Y98A 2A9OA 721PA 1V35A 4PG6A 1RRVA 1UAYA 1VE5A 1NKSA 3MHPA 5AUNB 1JXOA 1C50A 3HYNA 3SJ7A 2ZJZA 2FZWA 1CZKA 2R1TB 3PEVA 2A1TS 5DGXA 4OHOA 4TTTS 1A98A 2XKBA 4X6YA 3WXMA 4RZ2A 5I4CA 1JQ3A 4Z9BA 1PJSA 2PCLA 1P9NA 4ZMSA 1TO2E 1EVLA 1JKIA 3IDOA 4KQJA 2X22A 2JARA 3HEAA 4S0ZA 4FCWA 3OOWA 5JQWA 3DOHA 2ERCA 3P2OA 1X70A 1PT9A 3G68A 3TQOA 2XMBA 4G01B 3AL2A 1A9OA 1ACLA 1RKXA 2D1RA 2GAFA 3C7AA 4INPA 1XD8A 1D2MA 4NPCA 1KPGA 1U1DA 3NFRA 1QF6A 4Q00A 5IC6A 1UP4A 4U2FA 1P1HA 3T7AA 1TJ5A 3GNQA 3SHWA 4Q6WA 1GT91 1YC5A 2DAPA 4MGIR 5EIFA 5EHQA 5I5EA 3WLJA 2VOEA 4Q9AA 5HZKA 4X65B 2G67A 4EIWA 4ZO7A 3G59A 1Y1PA 3TGWA 1Y8ZA 4GI3A 2IXDA 4HUQB 4OI0A 3GEGA 2IL1A 1ZUNB 1RI3A 3PENA 5EHZA 2W37A 1WPXA 4BJHB 2NU6B 3JVUA 2QM3A 1Z62A 1UJ4A 4JNCA 1DBIA 4ZP1A 5LSAA 4XRRA 1R0KA 2WRZA 2ISSD 3DFIA 4L5JA 4QUKA 4Q4JA 3KVRA 2JCVA 3LG2A 4I0WB 5DW3A 1U63A 3C4JA 4PANA 1YVUA 4FZVA 5B4VA 1PEKE 1XZEA 4L7VA 2PWAA 1UK9A 5ALVA 1E9SA 3V6LA 1NUUA 3FCYA 3NS7A 4A3SA 1X7XA 3IUJA 5C8YF 1CY6A 2UXBB 2AQIA 1SKMA 1Q74A 2FUCA 2N9UA 1PJCA 3DO8A 4IVQA 1W0JA 3DW3X 4JLOA 4KSYA 3PQ4A 5KCZA 3JRXA 5BN5B 3L2OB 4GYJA 5EJ2A 4OXIA 2AG1A 3LT4A 2G08A 1DTWA 2JCSA 3CGWA 4O4IB 5FD8A 3TX6A 2Z6QA 2JS7A 4J9UE 2M2IA 1E99A 2SKEA 3S2UA 1KXZA 1C3LA 3BZBA 5IJ0B 4DLYA 3L04A 3ZIUA 2HRQA 4TVOA 4V0NA 5CA0A 6Q21A 4MDFA 3F0TA 4Z4FA 5KKAA 1TCUA 1ODJA 3KQKA 1YBFA 4ETIA 3OFSA 1YUMA 2JVJA 4NXNB 3C1TA 3OFND 5KCMA 3L18A 1C1HA 3B3FA 1G3RA 3ADDA 4C4ZA 1OI7A 4ITUA 4RWZA 5HCNA 1J70A 3CNOA 4NBLA 5KSOA 1PFVA 2F1RA 3LQ2A 3RS8A 2OBMA 3L0OA 4X95A 1HFKA 3WRXC 1PJTA 1BA3A 1GLVA 1ZBDA 1IPEA 4ALJA 2Q5CA 1KFCB 3AFNA 4JYCA 2NV0A 5BW4A 2IE8A 4FGWA 3AUKA 3MCAA 3HGTA 4OUDB 2QVBA 5DYIA 4BXOA 1XYYA 4YCBA 1SRRA 2LDBA 4M8NE 3O31A 3LHSA 4K46A 1R0LA 1Q91A 3E3OA 2YZ7A 4PHGA 1O5IA 1QQ7A 2V0NA 1Y63A 5JROA 3ME5A 4ZT4A 3VPFA 4G24A 4DJFC 4DLPA 1ESCA 1OAKA 3VYWA 2GBFA 2XAUA 4G5OA 3MPUA 1Z5OA 2ZB3A 3QWBA 2Y2VA 1OMOA 2W2KB 3PUIA 1J0EA 3PJFA 1A2KC 3CZ9A 2O8EA 4FILA 5E1MA 3SDSA 1EMDA 1Z22A 2FDCA 4URYR 3KSAC 1JIUA 1M8FA 2OSVA 4Y2UA 1ANKA 1RXWA 1U1CA 2DM6A 4R0VA 2VDRB 3T95A 1LBHA 1OGYA 3FYHA 3VR4D 1V25A 4EK9A 2J3LA 4UOZA 2DUMA 1JU4A 3UMBA 3OTOB 1LPAB 1C2YA 3Q3HA 3RSOA 5AHXA 4R9SA 4UUBA 2NSYA 4F3CA 5KU7A 3UC5A 4YXFA 2CL6X 3D43A 3U1TA 3QITA 1AD2A 3R76A 2RIRA 3NT5A 4MEBA 3B9RA 1K08A 3GLUA 1SNYA 1BKDR 1DUVG 3LLVA 3R3SA 1Y5MA 4JJAA 3T1VA 5F78A 2Q0XA 1UIRA 4RANA 4E30A 2X2EA 4U6QA 2ZI3A 5LIRA 4NNJA 4S05A 3PUVA 1NQWA 3WMEA 4BOYA 3NC4A 3UM9A 2CXTA 2GN2A 4TTVA 4KO2S 3QNWA 4YA6A 1N3IA 1CR6A 4ESHA 4PZYA 1OLOA 2AXQA 5FWYB 2UUOA 1JIJA 3JQRA 1IIRA 3M1AA 1EPUA 3K0BA 4F96A 3P2MA 4ZCPA 5DE3A 3N2ZB 4JCCA 1HFJA 2PWBA 4JT2A 2CVOA 2WP8J 2H5IA 3Q72A 1DL5A 4Z5XA 4KQFA 2H5LA 5FLYA 3ZJTA 2WD9A 5IWCA 3ZDDA 3M9WA 1ZM7A 1KRXA 3F8SA 2JAUA 1SHUX 2XVAA 2BI8A 1EDEA 2HT1A 3AF4A 2CE7A 2Q9BA 3H42B 3RUPA 1R50A 3FPGA 3RW9A 2KW5A 3IBSA 4UTZA 3PQ2A 4IMRA 3U7JA 4A92A 4BTEA 4D0LB 1AV7A 3D6FA 4K8OA 5K3DA 1JTVA 1F48A 3K9CA 3AQIA 3EHEA 1H2FA 3OCWA 1BX3A 2J3DA 1GEGA 3N1UA 4DR4B 1SR8A 1ZY2A 2YXBA 5INTA 1JG2A 1GVHA 1UBCA 2RHJA 4XJVA 3UYLA 4CNBA 3OX1A 4V2IA 4HUQA 5K3OA 1KGDA 1O4WA 1OCEA 1ZUNA 3LVQE 4NJEA 1X1QA 4CMEA 4RK0A 5DTEA 1TJ3A 3DO5A 3L4SO 5TE9A 2NU6A 2OHGA 3SE7A 4YRMA 1B6RA 1DDIA 1OFTA 1X7WA 1NW7A 5D51S 3H9BA 3PC8C 1ONPA 5D3ZA 2B30A