4P92A

Crystal structure of dienelactone hydrolase c123s mutant at 1.65 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization of dienelactone hydrolase in two space groups: structural changes caused by crystal packing.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
molecule keywords Carboxymethylenebutenolidase
total genus 82
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2014-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p92A00
2HA2A 4OPMA 3L1JA 3WLAA 4QNNA 5DYTA 3LLCA 4GBGA 3BE8A 2XMZA 5ALQA 3KSRA 5BOVA 4B84A 4DNFA 2JGFA 4ZWNA 3ZLTA 2K2QB 4ZXFA 3F96A 2VQ6A 3RK4A 1QIDA 3FYTA 2XUIA 1GXSA 2WIJA 1TK3A 2YASA 2YXPX 4BAGA 4PF1A 5CH5A 2VJDA 5AICA 4G1FA 2PU7A 1UZAA 4CG1A 5JALA 2WJ4A 2XDWA 3O9VA 2AJDA 5F4ZA 3HLKA 3HSSA 1FFEA 4X93A 5HK9A 1JJIA 3G9TA 4CIAA 3CXUA 3FVTA 2YYSA 1EDBA 2IIVA 2CKMA 3W2TA 1CUUA 4M0EA 1F0PA 1ZD2P 4E46A 1XZGA 3C87A 5C7YA 1U8EA 4J0GA 1EXWA 3QPDA 4PV7A 4B83A 5CBKA 1CUZA 4MYSA 5ALZA 4LYEA 3IULA 4IO0A 1N1MA 3EQ7A 3WL6A 4U2BA 4AO8A 1LPMA 2OLEA 4RE6A 4U2CA 5FLKA 1O6GA 3ESCA 4AXBA 4YX9A 3E4DA 1J1IA 4UFOA 3UUFA 3AZOA 4V2IA 4OUKX 1QIHA 4EHBA 1T2NA 2OGZA 1BE0A 1DU4A 3FSGA 1XZFA 5LIPA 5E4YA 1X2BA 1RP1A 2X76A 3OPMA 4LIPD 3WK4A 4MQLA 2FUKA 3R3WA 3D7RA 4IH1A 3LCRA 3V48A 2GBIA 4EBBA 2PL5A 5IH7A 5AK5A 4ZGBA 5AKJA 2H1IA 4KE8A 1MAAA 3WWEA 1R88A 2V9ZA 3H2GA 5JZSA 3RM3A 2PSJA 3G8YA 1MO2A 2OQIA 1UWCA 2ZYHA 3D2AA 5AKGA 2JGJA 2W22A 4O08A 2R8BA 4RPCA 5JD4A 4Y2XA 5HF9A 1CUEA 1D07A 1R9NA 5A7GA 2V98A 3AINA 3EBLA 2RI6A 4L3WA 2XMQA 4XVCA 3H2HA 1XQWA 1F6WA 3FYUB 4CI9A 1QFSA 4X71A 2GBFA 4AN0A 1VLQA 3DL4A 2C5FA 1ZGCA 4B7ZA 4G9EA 1Q0RA 4Y2SA 2H7XA 3BIXA 3WL5A 2CJPA 1CFJA 5AH0A 3GZJA 4D9JA 3HEAA 3ESDA 5ALFA 4Q82A 2WQZA 3DD5A 4ETWA 2GBCA 5DJ5A 3VDXA 5IKXA 4WCVA 3KWJA 2XMRA 3NUZA 2OPHA 3W9BA 1CUVA 2WFMA 4FNGA 3QPCA 2BCEA 3VJMA 3QM1A 3WK6A 1OCEA 3FLEA 1DQZA 3JW8A 1AQLA 1FSSA 1AGYA 2B61A 5H3HA 5JASA 2AJ8A 2HM7A 1BRTA 3WK5A 2DQYA 3WKDA 1DT5A 3WI7A 3C70A 3TJMA 4I4CA 2ACEA 4WDRA 1XZIA 3R3XA 3C8DA 5D3KA 5A2GA 5AM0A 1HL7A 2PUJA 3C45A 3EIOA 1XRPA 4M0FA 2XUFA 3HYSA 2ROQA 3GBSA 1GZ7A 1ZIYA 4WFJA 1AX9A 3IIIA 5AIBA 1CQZA 1QIJA 3O4HA 3PUHA 1W6RA 2HU5A 1XLUA 2C7BA 1QO9A 4QDXA 2QJWA 4F60A 2ZJFA 5ALUA 3G0CA 3N0TA 1EINA 3WK9A 4BYMA 1CEXA 3DJYA 2RONA 1UXOA 3PFCA 4J03A 4C88A 4PNZA 1BEZA 4KE9A 4LHEA 3O9MA 2QOEA 4Y2VA 2WIKA 4Y9SA 4FTWA 3G0DA 2WFZA 3G0BA 2R11A 1UOPA 4YASA 3UMJA 4EB0A 5A62A 1O6FA 1A7UA 4J7AA 5ALGA 1WHTA 1XRMA 4MWSA 5AO9A 3M3DA 1FJ2A 1DWPA 1C7JA 2PSEA 3HZOA 3WKCA 2WU3A 5K3EA 3M82A 5ALJA 2DHDA 3GUUA 5AK4A 2VF2A 2VSQA 4CG3A 4QDUA 1ODSA 2AXEA 5IVIA 1JMYA 5LYYA 2XQJA 3HACA 5AM3A 3C8HA 5K3DA 4EZIA 1P0MA 3OM8A 1VE7A 5DNWA 3G9UA 1ZD5A 4Q05A 2C58A 7YASA 5JAUA 2Z3WA 3H17A 4J0IA 1DX6A 3BIWA 3HC7A 5D7BA 1B41A 2PPLA 4BAUA 3E1GA 2HL6A 3F9CA 3G9XA 3RARA 3E0XA 1L7QA 5HF5A 3LIIA 4UPDA 2Y6UA 1UT6A 2HADA 2O2HA 5AM4A 4X91A 5E4TA 4IH9A 3AIKA 5FUMA 3R3UA 3VVMA 3HABA 4TGLA 4MYDA 4HS9A 3KXPA 3JWEA 2QJRA 1PV1A 1K8QA 1QO7A 1IUNA 5ALSA 4ZRDA 3V1LA 3FSGD 1CUDA 1GPNA 1UK9A 3NOXA 4N8DA 4LXIA 3HXKA 3IUJA 3G02A 1OILA 3WQHA 4CFSA 1H23A 1GKLA 4X6UA 5CW2A 1QJ4A 2WIFA 2X5XA 5AI9A 2XMBA 2GYWA 1EB9A 3WA6A 4JNCA 2BGNA 4AB1A 1EVQA 4BZWA 4UHCA 2XMSA 5KREA 2WILA 2FJPA 5DWDA 3FCYA 4UBLA 3WJ2A 4C4XA 3WL7A 4JYPA 2ACKA 3DKKA 5IVHA 1IMJA 4OB8A 4K2AA 3O4IA 2GZSA 3WKBA 3BL8A 4KYVA 1E3QA 3BF7A 2ORYA 2CBGA 5BV7A 1PFQA 4GI1A 1EA5A 2WUEA 2XI4A 1WCYA 4J0JA 3IUNA 5JARA 1SCKA 1MU0A 3R41A 1VOTA 2ES4A 2XUAA 2OCGA 1K4YA 4J0DA 3I1IA 1SCQA 4H7EA 3WWCA 4E14A 4HRYA 3WYNA 1JJBA 4INZA 3H18A 3C6BA 1BEEA 2VATA 1X2EA 3KDAA 3QPAA 4H35A 4GLBA 3IB3A 4QDTA 1BU8A 5AKZA 2FJ0A 4Y7DA 3DOIA 4QDOA 2QMQA 1VZ2A 2BGRA 5AI0A 1MX9A 3GROA 1Q83A 4QWMA 4Q3OA 5EIAA 4K6KA 4OCZA 4B0OA 3OURA 1QLWA 1XZBA 4N8EA 3ESAA 4S0XA 2YH2A 2QT9A 5SYMA 5AI8A 4H77A 2IX9A 4GECA 3C5VA 3TEJA 1CIJA 3FVRA 3IA2A 4HRXA 4DIUA 3DS8A 5CT5A 2BJHA 3PFBA 3ANSA 4Y2QA 2GYUA 4UBMA 5I7UA 4PQEA 4L72A 4IH4A 5A71A 2CUTA 3FBWA 4MEBA 4UHFA 3HRHA 2PSHA 4BP9A 3R3VA 5HKAA 1DQYA 1F0NA 4EY5A 2G5PA 2WHRA 1QIGA 2XQGA 3WKAA 1SFRA 3G9ZA 3K2IA 5ESRA 5FOQA 1YS2X 3I28A 4HXEB 2OCIA 3F97A 4BAZA 4DTCA 1DX4A 2J3DA 5FPQA 5ALOA 1QIEA 4WJLA 3IDAA 5AHXA 2RIPA 4W63A 3ZI7A 3VKFA 4NVRA 3IUMA 3F8SA 4KJXA 1AUOA 2HA4A 2JEZA 3DQZA 4FLEA 3IUQA 1TAHA 4J0KA 1WOMA 4EUSA 3WWPA 1J06A 2WM2A 1VA4A 3DCNA 2PM8A 3DL7A 3QMMA 1R4ZA 3QZUA 3ILSA 4LXGA 1NU8A 3BDVA 4FBLA 4G8DA 5CH8A 1ETHA 3WMRA 1VXRA 5ALYA 4PSUA 2ZJ6A 3I2IA 2BAGA 2JEYA 3HI4A 4ZV9A 2C4HA 3STVA 2PKYX 2ZSHA 1ZIXA 1BROA 2EEPA 5EI5A 2J4CA 4FLMA 2O2IA 1TKRA 1C7IA 3KOOA 4BVJA 2ONCA 1NX9A 2HU7A 5A7FA 1GQSA 4AMZA 3DYIA 1UOQA 1ZD4A 1DWQA 5AIAA 3BF8A 2AJBA 4C4ZA 4LXHA 4E11A 3AZQA 3F98A 1FFBA 3DDUA 3STXA 4TVKA 2XUHA 3MGAA 3WK8A 2WKWA 4F0JA 5IVKA 3D5EA 2RGUA 5DYYA 4GDMA 5D3ZA 5AKXA 1DWOA 3A6ZA 1G5FA 1RYYA 3D2CA 4BCBA 2VEOA 4KR0A 5ALHA 1IUPA 3N2ZB 3G7NA 1ZJ5A 2XMDA 1MNAA 1MPXA 1UOOA 1AZWA 5FKJA 5AKIA 2QXUA 3VISA 5J3JA 4Y2UA 1CR6A 4XX1A 5AM1A 2XUGA 1GQRA 5LZ4A 2XUQA 2XUKA 5JZBA 4OB6A 4MJ3A 5JAPA 1VZ3A 2XUJA 4HVTA 3PE6A 1L7RA 3FLAA 2WFLA 4X7BA 4WY5A 4X3CA 2P8SA 2OG1A 1HKHA 2QZPA 4G5XA 5AI5A 4HXFB 1XQXA 2C5GA 3M81A 2C0QA 3JYHA 1CUBA 4P08A 1FFAA 1U2EA 4HXGA 1ZI6A 2VJBA 2H7CA 4U2DA 4UBKA 1MT3A 1E8MA 3S8YA 2JGKA 4FHZA 2WG1A 1GPLA 5T4EA 1EB8A 3K6KA 2OGTA 3AZPA 4GWLA 4UFNA 5YASA 4DNPA 2Z5GA 5LKAA 2CZQA 3D0KA 5ALIA 1XZKA 4ZI5A 3R0VA 3VVLA 3FYUC 5AM5A 5AOCA 3H1AA 5ALLA 1I6WA 1JU3A 3DLTA 3I2HA 4H0CA 1A8SA 4X95A 3NGMA 1QFMA 4BTLA 4J0HA 3DEAA 2ZJ7A 2H7YA 2DHCA 5CXUA 5HCUA 4QEKA 4BCCA 4BVLA 4F5ZA 3R3YA 1DINA 1IUOA 1SC9A 1AKNA 1ODCA 1TRHA 4Y2JA 4QDZA 5LZ5A 1DTEA 4X90A 4UHDA 5DYWA 4DM7A 3QH4A 1XKTA 3SC2A 1H2XA 2VAVA 1ORWA 4N5IX 2JGLA 4DLNA 1ZD3A 2CMFA 4BDTA 4ARBA 4DMHA 4IQ4A 3STTA 2VT6A 2HRQA 4A5SA 1EDDA 5JD6A 3PF8A 5ALRA 2ZYSA 2BUCA 3T4UA 5LZ8A 3W04A 5CT8A 2OQVA 2HA0A 1H2YA 1THGA 4OB7A 1QZ3A 5KWJA 4FKBA 2HFJA 4KACA 5HZGA 1MN6A 4QLOA 3V1MA 1J2EA 5JD5A 3P2MA 1TIBA 3NWOA 2JGMA 1ORVA 3EF3A 1P0QA 1ZOIA 4BVKA 3H2JA 4B82A 3ZWQA 1XRQA 2ZSIA 2XQKA 3OG9A 1RWQA 1XZCA 3HJUA 4GHWA 3QVMA 2FX5A 5T4BA 2WUDA 3GA7A 3VJKA 4AZ3A 4ROTA 1QTRA 4MQMA 4MEAA 2W6CX 4AN1A 4NZZA 2XUDA 3TRDA 1EX9A 3D59A 3PF9A 3WWOA 1MJ5A 1CUAA 1CPYA 1XRLA 5AK6A 3WZMA 3IVMA 1K6EA 2JBWA 1WB4A 1BN7A 1R1DA 1W1IA 4LYDA 1OXMA 1XQYA 1CUCA 5K3AA 2DQZA 1TQHA 1VE6A 4LKOA 3QMWA 4JYMA 1HBJA 4QLAA 1N8SA 1QIFA 4CCYB 2OAGA 4G8BA 1USWA 4KRXA 4BRZA 1J07A 5AOAA 1WPRA 5CTAA 4UUQA 4BE9A 5AP9A 4MWTA 4N8SA 3WWDA 4CCYA 3R3ZA 3V1NA 4W1SA 1P0IA 1DT3A 5EHXA 5JIBA 2QUBA 4G4JA 2D5LA 1R9MA 5DTIA 3ZPXA 4UBJA 4DNOA 4Y2PA 1A8UA 4WFIA 1XKLA 3D2BA 1CRLA 3QITA 1XZAA 4QE3A 5LZ9A 3C43A 2I3DA 1R3DA 1K5PA 4L0CA 2IITA 1VJ5A 5CH3A 4H18A 3BXPA 3H19A 3OC0A 2DR0A 3WL8A 2B9VA 4EY4A 4EY8A 5C81A 3B5EA 4OD0A 2WLSA 5JAOA 1YA4A 2V96A 5BWBA 4C4YA 1UK8A 2WFLB 3EQ8A 4DMKA 2I3ZA 4BP8A 2QR5A 3BWXA 3FWHA 1YASA 4Q3KA 5C8VA 4X94A 1E8NA 5ALMA 4AMYA 1LPPA 1W4LA 3H0CA 4KRYA 4JH0A 2DCMA 2OCKA 2XMCA 4EY7A 1FFCA 4BBZA 1JJFA 2Z8XA 1G66A 4XWGA 1YAJA 2O7RA 2VAXA 5HF6A 2X8BA 4DMFA 5AKKA 4OSEA 4UBNA 3WIOA 4AO6A 5JYCA 4ZV7A 3STWA 2C0PA 3AFIA 3IBTA 3I6YA 1M33A 2VJAA 5HFNA 4QA9A 2BUAA 4HTAA 4OU4A 4P9NA 3H04A 1JT2A 3LP5A 2J4FA 4K6GA 3LS2A 4KE6A 4FWBA 1YR2A 1ZJ4A 5ALNA 1YSCA 1CUWA 1ZI9A 4PSCA 1E8DA 2Z3ZA 4BC1A 2WHPA 4UHEA 5CURA 4I3FA 4YK7A 5K3FB 1XZJA 2WUGA 3I2KA 4BE4A 1TCBA 5FRDA 2Y6VA 4Y2YA 1G42A 1LPAB 3I2GA 4JEIA 5ALKA 3A2LA 1T4MA 5DLPA 2WIDA 5CT9A 5JANA 4NS4A 1XLWA 5CT6A 3SK0A 4BTVA 1CUJA 4F21A 2XUPA 3Q8WA 1CV2A 5JADA 1YB6A 1U4NA 3WIBA 1E66A 3IURA 3DKRA 4Q34A 5CRIA 5EHQA 1KU6A 1X70A 2XE4A 4H7KA 2Y1KA 1WM1A 1K63A 5HF8A 2OXEA 1XZDA 4K5QA 4GXNA 4PW0A 4J3JA 1LGYA 3C6XA 1LPBB 1GKKA 5T4HA 2GBGA 1F8UA 4B85A 3CN9A 4CCWA 1LZLA 2JGEA 1LPNA 4WDQA 5EIHA 2XUOA 2DHEA 3A70A 4I19A 4EA6A 4EY6A 2AJLI 3QBJA 2GYVA 2PSFA 2BUBA 4QWWA 2V97A 1CQWA 4G8CA 3AIOA 3ZLUA 3O0DA 5JZ9A 3G0GA 1VKHA 4W9RA 4H7JA 4Y2RA 3STUA 1U65A 5K5EA 2O2GA 1QOZA 2H9YA 5LZ2A 1YAHA 3WKEA 3FYUA 1UKAA 3L1IA 1QIMA 1N5RA 2G63A 3MVEA 4NMWA 2O7VA 4U2FA 5JAHA 3SX4A 5HK8A 1TCCA 2G5TA 3AIMA 2WG2A 1LZKA 3C6ZA 4OYLA 2JGIA 6YASA 2HA6A 5AKLA 3ICWA 4FFVA 5D6OA 1H2ZA 1GPKA 3A2MA 3I2JA 3W9UA 5C8XA 3QMVA 4MXDA 1TCAA 4U2GA 2JF0A 3YASA 4Y2TA 4BZZA 1IVYA 4UHHA 5EHNA 1EK2A 2BKLA 1XLVA 2ECFA 4BDSA 4C89A 3B3QA 5ALTA 1MX1A 3H1BA 4G9GA 3WZLA 1IZ8A 1MX5A 2QKYA 3M83A 3UUEA 1AMNA 4P92A 3U1TA 5AK3A 1H2WA 1GGVA 4L9AA 2EDAA 1EK1A 2XLBA 1W52X 1NU6A 1PJAA 2CEKA 1P0PA 5FV4A 3WYDA 5FXMA 3I6MA 2WHPB 3G0IA 3PDCA 4OYYA 4W1PA 1HLGA 1W75A 4RGYA 4FDMA 1XZEA 5KWIA 3FLBA 3H2IA 3BDIA 5AM2A 5ALVA 2QS9A 4HAIA 2RHWA 4YPVA 4KAFA 1UFOA 4OU5A 4DNQA 4B6GA 4DGQA 2D0DA 1CUHA 4Q3LA 1YB7A 2EDCA 4W1RA 3STYA 2WJ6A 4P93A 5K3BA 2HDWA 4B0PA 5AI6A 4B9AA 1C4XA 5HQ3A 5EHZA 1UKBA 3EQ9A 3C5WP 1Q84A 3O4JA 1XRRA 2VT7A 2HFKA 1ZICA 2XMGA 4B9EA 2HA3A 2XQFA 3BJMA 1HDEA 3WK7A 2DFPA 5AKHA 4TPKA 5FDFA 5EIEA 1BN6A 1XFDA 2WU4A 4HZGA 4UBIA 2HIHA 1JI3A 5A7HA 3C6YA 5EFZA 4BATA 1ZI8A 2E3JA 1BCSA 2PU5A 1MAHA 3KD2A 4PO3X 3KWFA 1WHSA 4KE7A 2ZYIA 4IHAA 4AX4A 4H7DA 5ALDA 1ISPA 2RHTA 2WG0A 1Q0ZA 3L1HA 1LPSA 1FFDA 5ALPA 2PBLA 3QYJA 5HQ3B 1XZMA 2HU8A 3U0VA 3AJAA 5EGNA 2Z8ZA 3I2FA 3D3NA 3ESBA 1JU4A 5AI4A 1GT6A 2HHAA 4U2EA 4BRSA 1S8OA 3H2KA 2QUAA 1EVEA 2PX6A 5K3FA 5A6VA 5KBYA 5ALWA 3E3AA 4GEGA 1Y7IA 4A16A 4FLFA 4Q1VA 5SYNA 1LBTA 3I6ZA 2BFNA 2QVBA 1W76A 3DNMA 4CG2A 4H7IA 1THTA 1KU0A 2LIPA 4WY8A 1H22A 2WHQA 3MUOA 5C8ZA 1R50A 3FCXA 2WIGA 5E2IA 1KEZA 4AZ0A 3F67A 1WPXA 1LLFA 3FNBA 3A2NA 3DOHA 3ANTA 4AQDA 4X97A 5I8PA 1LPOA 3AILA 3ZV7A 1BS9A 1HPLA 4X00A 3FAKA 2NW6A 2VA9A 1AURA 4KAAA 4X85A 2HA7A 4B81A 3V9AA 1JKMA 3O4GA 4KAJA 3PUIA 2B4KA 1CUYA 3WA7A 5AOBA 4ARAA 1CUGA 4BB0A 1CUIA 1EI9A 3OOSA 1ACLA 4DMCA 1WB6A 4BC0A 3R40A 1B6GA 5K3CA 4XJVA 2ZVDA 4FNMA 5FPPA 4B80A 3B12A 3W06A 1QONA 3RKSA 5CXXA 1YA8A 3Q0TA 4XIIA 4K6HA 4G4GA 4ITVA 2QRUA 2QXTA 5DNVA 2XQIA 1JFRA 3AUKA 5JATA 1SOMA 1HQDA 2ZYRA 2WTNA 4RNCA 1WB5A 4ZREA 5AKYA 2PSDA 2G4LA 5LZ7A 4C6HA 1L7AA 3PI6A 5CT4A 3X3HA 3DYVA 1QTIA 4FMPA 3BJRA 2GZRA 3WJ1A 3ICVA 5HKBA 5T4FA 1QE3A 3CCCA 3W05A 1EHYA 1JMKC 4FOLA 3MUNA 2HA5A 3LIPA 1ZGBA 4GW3A 4DSZA 1G4HA 2WTMA 2VTVA 4DYHA 1YCDA 1CUSA 5I9IA 5ALEA 4RE5A 1ODTC 4X6XA 1AC5A 1CVLA 2I03A 4Z49A 2Q0XA 1UK6A 2Y2UA 2DSNA 3T52A 2B20A 5LP1A 4WFKA 1XRNA 3VJLA 3VXKA 2OGSA 5ISMA 2WJ3A 4A23A 3TGLA 1IZ7A 1XZLA 3FOBA 1A88A 2Y2VA 4J0CA 5ALXA 1VA5A 2JIDA 4W1QA 4C01A 2VJCA 2WSLA 3GFFA 3O95A 1SCIA 4N5HX 2XB6A 2OCLA 4C87A 4G4IA 2QM0A 4AO7A 1VXOA 3SWWA 2J3QA 2PVSA 1EDEA 1E5TA 5E4JA 2RAUA 4H7HA 5IVDA 5LKRA 1EH5A 1Z68A 1MNQA 4KEAA 2HRRA 1UK7A 4H7FA 1XQVA 3CCBA 1QIIA 2XLCA 1QIKA 1CLEA 2PUHA 1ACJA 3PICA 1LNSA 2XT0A 4FBMA 3D4LA 3CN7A 1XZHA 4UBOA 2UZ0A 4PSDA 2AJCA 5DTJA 1N5MA 1XROA 4E15A 1LBSA 2OAEA 4CIBA 5CMLA 1Y37A 2WUFA 1CUXA 1Y7HA 3RLIA 3ED1A 4UHBA 2CB9A 3GELA 3K9BA 1UKCA 1A8QA 5HFAA 5BWCA 5LLSA 4QZVA 3V1KA 4BCDA 5AKEA 1BCRA 5FP0A 2I78A 1YS1X 5AJHA 1MTZA 3OTQA 4X6YA 4DSAA 3I1YA 4M0MA 1CUFA 1E89A 3S2ZA 4FFWA 3ZLVA 4UFPA 5DNUA 4X92A 2QTBA 4JUIA 1QGED
chains in the Genus database with same CATH superfamily
1UZLA 2XT9A 2P9BA 4G9BA 3K0CA 3BB1A 3L1JA 2JASA 1JLSA 4MPPA 5DDIP 3WLAA 2QTLA 3ONDA 4GBGA 4KR6A 3F5MA 1JFSA 3BE8A 1JLMA 3L8CA 3KSRA 5BOVA 3JRWA 3KYDA 5JXIA 2CXTA 2H59A 2I4RA 2GHIA 2H1OA 2Q62A 1E79D 4ZWNA 4YYEA 4ZXPA 1R0WA 2JBAA 1RLOA 3P19A 5KUTA 1XHEA 4EJ6A 3A36A 3C4VA 4NV0A 2AGVA 3LPAA 3PUVA 5JY6A 3H1FA 1P4RA 1SCAA 4QGFA 1L5LA 2CLCX 4Z4CA 2QLTA 2QN2A 5IC5A 4Q7QA 1QIDA 4HNHA 2DWUA 2RMKA 4NZOA 5A5FA 1VCHA 3V4OA 4DWOA 4DY4A 4IGAA 1RVDA 2QAGA 2RHOA 3A3KA 3ESRA 3P45A 2Q3HA 3ADKA 3R6GA 5AW9A 1RZUA 5K0NA 6ADHA 4DEYA 2VJYA 1O87A 1OFVA 3BXGA 4PF1A 2VJDA 5CH5A 1KEEB 2FEXA 1TECE 3UM9A 1U7ZA 3TVTA 1PR3A 3KKMA 3N3AC 1UZAA 1USUA 2ODTX 3I9LA 1MIOA 5JTTA 4MITA 4B17A 1PQ4A 3V1YA 2R1VB 3ZY6A 8AT1A 5JALA 2WJ4A 3BEOA 2ZRIA 4KHZA 1YUNA 1T1GA 1XMPA 4OQFA 1FFEA 3NWJA 4K87A 2WHXA 1WXXA 2ZKIA 1CC1S 5CDHA 1O0SA 2VH5R 4OHRA 1L5FA 5HK9A 1URPA 2EJCA 4YJ2A 1FMFA 4P3OA 1JJIA 1IXSB 3X1ZA 1DJNA 3FVTA 5JRJA 4V0LA 3OTOB 2JGDB 3UTCA 1W36C 1BXKA 3FMGA 2DE0X 5DIZA 3WE7A 4GDFA 5K0LA 4XUGB 4NONA 2J3KA 4CV2A 4E46A 1QWSA 2D1YA 3GYGA 3BD7A 4Q9JA 1PV4A 1NV9A 3THWA 3FXAA 1QWOA 4KMSA 4PZ0A 4PWZA 5BVHB 2XZDA 4OIFA 1NX6A 1BNCA 1HFKA 2AZMA 1YXMA 1Z6QA 2D7JA 4I1OA 4OXKA 3ZJTA 1UDRA 4JXZA 1EXWA 2A2ZA 2B8NA 2AOTB 3WGYA 5G0UA 2WM9B 3NIDB 3P9NA 4NH0A 3M4YA 5CBKA 3RFFA 4R8SA 2V3CC 3LMKA 5IM5A 4PZZA 3GEBA 1PJ8A 4IMRA 1AZLA 3CONA 2E82A 1N1MA 3EQ7A 1Z4OA 2IOQA 3G6KA 2VTDA 4TTVA 4U2BA 3VR1A 1K8XB 1M10A 1GZSA 2PT7A 1XKXA 3Q9NA 4HGRA 1LPMA 2QNRA 421PA 3IVCA 1IB0A 4NOKA 4WI1A 5JVDF 4U2CA 1O9GA 2EGGA 3LC1O 4DEXA 4DIKA 4F2HA 1O6GA 1V43A 2QR3A 4NATA 2H0QA 4UARA 4TLBA 1L8XA 2C4TA 3E4DA 4UFOA 2O8CA 5K3OA 1YRBA 3KQTA 3L49A 3H8WA 4CMCA 4OUKX 1QIHA 1KL7A 1WL8A 1YZHA 2CLIB 2FPUA 2O50A 2ZAOA 4HNGA 4MVCA 5CCDA 4RY2A 2O14A 1EUYA 1JWBB 1T2NA 2R65A 4PE5B 5CHEA 4HJXA 1FTSA 1YR1A 1T9DA 1OWPA 1XMXA 1Z6ZA 3FG9A 3G8AA 3PWSA 2UUCB 2VNJA 4GPIB 1CSEE 1DAPA 1I1QB 4KDFA 2FN9A 1C29B 4KDEA 5LIPA 3CNQS 3W2EA 1O54A 4CU5A 1X2BA 3HVRA 3K7EA 2H1SA 1PKXA 1D2NA 2J67A 4LIPD 1L3CA 3MHPA 1GQOA 2H07A 2FUKA 3BULA 4JQYA 3LWNA 1JDUA 4O1IA 1N34B 3IVGA 2IHBA 4YJGB 2GBLC 2VBCA 4R2IA 5HKOA 4DLUA 4NCIA 2LD4A 5BT8A 2PLFA 2GEUA 3MCTA 3MLBA 4ZZ2A 5CITA 1COWD 1GTMA 3ANMA 1PX2A 2PL5A 1OAAA 4GMFA 3RBAA 2YW2A 5AK5A 4ZGBA 5IH7A 2FN7A 2JFUA 4KLAA 4A92A 3FF4A 3OUZA 3KR2A 4ZVUA 3ICCA 4IPTA 2X0JA 3DE6X 3OCUA 4QAQA 4ROSA 4TWZA 5B4VA 2GAAA 4IDQA 1NZJA 3DUFA 2Z56A 3O84A 3FIJA 3O91A 2V9ZA 1E59A 1ZL2A 2ZB8A 3OZRA 4XXHA 2EU8A 2BBSA 3PE3A 4DDKA 3DWFA 1YJAA 4I6JA 4IV8A 3VNQA 4CCAA 3L0OA 1TVCA 2H16A 2OQIA 5B12A 4DDVA 1UWCA 1Z33A 4IMJB 2GZAA 2QZZA 5FBRB 1FS4A 4H0NA 3IP1A 3AJ8A 2YJNA 1I4WA 1AY0A 4XYLA 3C85A 1DIHA 5EXTA 1N9GB 2FGKA 3GK3A 4LF8B 2GEVA 2C2GA 1TKCA 1JDBC 2G1KA 4L2IB 3B89A 3E15A 3PNMA 3RIEA 2DBRA 3NBAA 3UV3A 4P82A 2VSOA 5CGZA 1ID1A 5A7GA 4MKXA 4L3WA 4MOWA 5JWRA 4M60A 1Q91A 1QCCA 1YL6A 2G09A 4IR7A 4KO2S 2DAPA 5HWSA 1F6WA 2YJGA 3K0CC 4C22A 1ONOA 4HJRA 5TPZA 5CG2A 3BGDA 5EC8A 5FI0B 1CIPA 3W3ZB 2O3RA 3IILA 4W5JA 1V3QE 4W4TA 3U48A 4HEHA 2QV7A 1VLQA 1Y6ZA 2VRBA 4ID9A 4PNHA 1D2AA 3BE6A 3SZUA 4NCXA 2R47A 4IUCS 5HRAA 3R7WA 5H9WA 3DE0X 3JQEA 5AXAA 2C5FA 2YC4C 1O0CA 2NYVA 1M2KA 3LY5A 1IJEA 2Q2OA 4B7ZA 4TLEA 4WK4B 3SIWA 5BR1A 3M4ZA 4BNKA 2H7XA 4CF3A 4CUJA 3K70C 1L4KA 4O25A 3GLUA 1IXRC 4O5OA 3PA8A 4YJKA 4C2BA 3ZDAA 3GW8A 3DTVA 4UUBA 2IYAA 4X8LA 1AKWA 1Z4QA 2ZUCA 3GZJA 4UUAA 4J9VA 5EXPA 3U7JA 4D9JA 3TLKA 3HEAA 2JLUA 3K3PA 5ALFA 1E2HA 4Q82A 2AYYA 2HCBA 5DZSA 1ZVJA 1PT9A 4P3YA 5TARA 3CPHA 2ZBVA 1X7ZA 4M87A 3RS7A 3RYIB 5BYKA 3IQDB 1WPQA 5B30A 4E6PA 5U4QA 1WUJS 3KWJA 5JLAA 4BZPA 4CHTA 2V0GA 4JC8A 1NN1A 3TRIA 2P79A 3FGNA 1Z06A 1WCXA 3FPKA 5DBHX 1HMPA 2HJHA 3LZDA 3RNOA 5D3MB 2YN2A 2C4UA 3EAQA 4FNGA 5DBFA 4Q18A 3L8GA 4Z6KA 2Z2XA 3QM1A 4WOJA 5CA0B 4YBZA 1OCEA 1CTQA 3FLEA 3BKXA 5HS6A 1DQZA 1O8BA 4EUHA 3EW7A 1J70A 2ZIZA 1FSSA 4UEQA 1S2LA 1DIRA 3K1TA 3PGXA 4NHEA 3MG9A 3QFCA 2B61A 5H3HA 2PR7A 4KPFC 1TJPB 3DV9A 2AJ8A 1F8FA 3DF7A 3SBOA 4NBUA 3M5CA 4LXYA 1J9ZA 4QOFA 1REQA 1Q57A 3K9QO 3N39C 2O8FB 3SZMA 3HKEA 3KTDA 3OCXA 2E5FA 2QL5A 1OC2A 2W2TA 3G7SA 1ZHFA 2O4UX 3IS3A 5BSTA 1W8IA 2CEAA 2HHLA 3D8UA 3GUZA 3MRXA 3C70A 4V0NA 3TIIA 3QU4A 3TJMA 3JAWB 4XCXA 3X2SA 4DQLA 4WDRA 4BFLA 3GAZA 1RC1A 3DLIA 3SKYA 4TTIA 3E9RA 4WADA 1BU5A 3B8HA 4LW8A 1XZIA 5TPZD 4DSTA 3N76A 1LNZA 4P3KA 1OAKA 2AOVA 4WNCA 1ZD8A 1HL7A 2XB8A 3C45A 3KVOA 4HP8A 4XDGA 2GQ0A 1V41E 3LHIA 2JFVA 1EVJA 1A9OA 4M0FA 2XUFA 3AJEA 1A9SA 1YULA 3IELA 4RVDA 3VPAA 1JHQA 1G8SA 5KWVA 1GZ7A 4EPYA 3VKGA 3JZMA 1COWA 1D1TA 2BMWA 3CZ9A 4N3GA 4LZWA 1QGAA 4KYTA 4RA6B 5BSUA 3W2HA 4XUCA 3UJNA 2D5CA 5AIBA 3OJ0A 4QU9A 4A0QA 3L7IA 4G41A 1I4LD 1TVEA 5I6DA 2XCIA 3UZUA 3DOEA 3HB5X 3PUHA 4R1PA 2B6HA 1JLRA 1O9HA 4WGFA 1KPIA 2FHPA 2A5LA 1XLUA 2IDMA 4I0WB 4FR5A 1SG9A 4M83A 2QJWA 1DXQA 1IEQA 4L8WB 4CMKA 2WWVD 1CVIA 5JV5A 1QTQA 1E18A 1XTVA 3DBRB 4JI3B 3W1WA 5CBPB 1P7WA 5K8VA 2AG6A 2VS1A 1MB0A 4DLKA 3EF1A 5C4GB 2YVAA 4QIHA 3WK9A 4RSMA 1PJCA 3PSAA 3VSBA 1HTTA 1E3EA 1N75A 1I0IA 2PFSA 8OHMA 5MF6A 2RONA 2WJPA 5TS3A 1CIVA 1CY2A 3IKTA 2IT1A 4R1MA 3L8ZA 3P8ZA 3PFCA 1AO3A 3QFFA 3ASUA 3DGEC 1GQFA 1LQUA 3N2KA 3K15A 3TIXB 5KX5B 4FFMA 4KE9A 1G3QA 2CUKA 4BTEA 3KX2A 4UVHA 3U62A 1RR6A 1FVHA 4NDNE 5CCBA 4NCJA 4Q4LA 1YS7A 2ZRBA 4GSLA 1JLLA 4FHCA 1A9ZA 3ZCPA 3DQQA 4MI3A 1Z4MA 3AFHA 1U0OC 2HXGA 4PG7A 3UMJA 1TQ4A 5J40A 4E3WA 4QXAA 1SXJE 4FJ1A 4EB0A 4L8YA 1XSEA 5A62A 4M1QA 3B6MA 4BX2A 4EZEA 4D4IA 4G36A 5AVYA 5DNEA 1PW5A 3W6OA 1P0CA 4CRWB 3ITNA 4N3BA 5CYOA 4HWPA 4C5BA 5ALGA 1J9EA 1DRVA 3TQOA 2O2CA 3OOJA 4B34A 2ZRJA 4FOPA 4MSUA 1ZLXA 3QUCA 4LNHA 1Y5MA 4CR7A 1KBQA 3G82C 4BOYA 4GU5A 4EGAA 2PSEA 2Y1DA 3GGCA 3KTAB 4INAA 4B4OA 3CRMA 5KNDA 2X4IA 3WKCA 1OZ0A 4R1UA 4PYJA 4CEIA 1FFHA 4M53A 1NQWA 3SYTA 3WGVA 1UC5B 2ZT7A 1U0RA 3M82A 4HNSA 3EWAA 3ICPA 2IODA 2L0XA 3ZU6A 5ALJA 2DHDA 1FYDA 3KE8A 3EF0A 5F21A 2AZTA 5AK4A 4MEJA 4EQ6B 3A28A 1AH2A 3DLAA 2VSQA 3FRJA 2IZ7A 1L1RA 4CG3A 1ODSA 5ADHA 2AXEA 2QQ5A 4HDCA 1E3DA 2IH5A 3I9V6 5IVIA 3MLEA 2CLSA 4HRVA 1ENZA 4LKRA 2B1GA 3JZFA 4OGFA 4P4TA 4PIMA 2XQJA 4DA7A 4YV1A 2C1ZA 3CKMA 4DC9A 3G89A 3LPDA 3WO1A 2YDYA 3HACA 4OI0A 3T7IA 3L46A 5AM3A 2YJZA 2FV8A 5C5EA 2AOTA 4TYQA 1B0PA 1Y9EA 2JI6A 1KR5A 3NBUA 5J2TB 3BG5A 1U99A 1TAQA 2C04A 2CVHA 2VIIA 3QW4B 5EVJA 5DNWA 1RWVA 1OFHA 2JJ1D 3G9UA 2VZ9A 5EP4A 3M6LA 4CM9A 1NUUA 3H5IA 1HKUA 3IUEA 2VA8A 4G85A 2PJZA 4G24A 2Q9UA 4I4LA 4RV4A 2R4TA 4M9XA 4YHBA 4ZT2A 3OHPA 5IC4A 4OHKA 1EBFA 4K7JA 3H17A 1DJLA 1QC5A 5DK6A 1DX6A 3PKJA 1FLNA 1D1SA 4XM2A 3LQ4A 3IEMA 2WMDA 2P0AA 1OGYA 4LSZA 4BQQA 3H1EA 4A36A 1Y8RB 3TIFA 2A1UA 3N5KA 1CZUA 3CGWA 1B41A 2QRVB 3LLSA 2LIVA 3E1GA 4I5FA 3WDKA 3IHLA 2DCUA 5DX1A 2ISQA 3EIQA 3F9CA 2OBBA 3G9XA 3H6HA 3O2QB 3UKOA 3RARA 1EAMA 4ND7A 4JR2A 3U39A 3A9UA 3ODGA 5F51A 1T29A 1WRBA 4QYMA 5JDCA 2XYVA 2FUG1 1MEEA 4H15A 4E0BA 2XE7A 2F3SA 3DVQX 3PFWO 1D2EA 2HADA 1Q7CA 4PPFA 4Z9YA 4HUQB 4EPRA 1IPHA 3ZD7A 5JDIA 2IHJA 4BN5A 3CEJA 4M8SA 2W0MA 2WJHA 3P9CA 3VVMA 1RVV1 2ZSKA 2AX4A 1GZVA 4LSMA 1N8KA 3U3DA 2F8LA 2P9QA 4CKEB 1Y4SA 4GKVA 4PYRA 3RVLA 2QJRA 5LDGA 4P3NA 4EGFA 2RD2A 1PV1A 1W29A 2GUWA 3KFLA 1K8QA 2PZJA 2X5KO 3CVJA 3ELBA 4FZVA 4EEZA 2ZJBA 2IYEA 4F93B 2QV0A 4YAKA 3Q8MA 3WGQA 2H5JA 4MIEA 4ZRDA 5DCUA 1OUMA 1CJVC 1HDCA 1X7YA 1CUDA 1FXSA 3FSGD 3NXKA 4J9UE 1RQNA 4GS5A 1NW9B 2ETXA 2PKCA 4ZOLA 4Z4EA 2PIDA 4CZ2A 5HSGA 1UJ2A 2OO7A 3G1UA 2H63A 3N0VA 4CF7A 3AEXA 3ILVA 4Z0TA 3WL3A 1VP3A 4J2OA 2G28A 3K5WA 2BTQA 3GLTA 2ZITA 1OV6A 1OILA 5CFPA 2EIHA 4PAMA 4EVQA 3QUSA 4II7A 4CFSA 4G89A 1ZS9A 3DJFA 4AUEA 5CW2A 1QRUA 2W70A 4ID3A 3ROGA 4BVBA 5IDYA 3IKLA 3K1AB 1IN4A 1HEYA 1A3CA 2AFRA 4XOIA 3K1AA 4JXKA 5EIFA 1OKKA 5K6AC 5FIUA 3OE4A 3ZY2A 1NDHA 2Q4TA 1EB9A 4G25A 3WA6A 4ABTA 3CEAA 4PCAA 4AB1A 4EFDA 3V34A 2QVLA 2BM8A 4AMGA 1H8EA 3IH5A 4UHCA 1PJ3A 3DO5A 1D03A 1TYEB 2QX4A 2XMSA 1TM3E 2PGAA 1JIVA 4QO7A 2XXBA 1O6ZA 5C9ZA 4R69A 1U9JA 5DWDA 2VHXA 4C4XA 2GR9A 3FY4A 1N2ZA 3WL7A 4JYPA 2LR0A 2IFTA 1TNDA 3IIJA 4NLLA 4KIGA 4IHKA 4WKGA 2KX7A 3ENWA 3KKKA 4JLWA 3F5QA 3FI0A 3RVPA 4N4AA 3G8BA 2XCLA 2XX3A 3BL8A 1VPLA 4YS6A 1DS6A 4KYVA 1IBMB 1YE5A 4KXLA 3ETEA 1GXSB 2F1OA 4CMIA 4EYKA 1MQAA 3GJ0A 3ISJA 3LZ6A 3QXGA 3SC4A 4ZCPA 3VU9A 3COWA 5M3BA 2HWXA 1GUFA 2ORYA 2QN7A 5JT1A 3M3PA 3OFKA 3I8SA 3WGGA 1EA5A 2WUEA 1K4KA 1E1YA 1GL6A 1WABA 1RQXA 1X7XB 2XITA 4LVOA 2D2IA 4KI7A 4MW5A 4UMFA 5IF3A 4QM6A 1UKZA 4PEVA 4W8OA 5TF0A 3W3AD 5KX5F 5G1PA 1OMOA 1ZC4A 1RHJA 2VDWA 1VOTA 4MCAA 4B35A 2QRJA 1IJBA 4BJHB 2YV5A 2YWJA 3J81k 2OCGA 3LOUA 3OVMA 4OEHA 3HQ4O 4H7EA 4HWRA 1GL9B 3WWCA 5KTOA 2TMKA 3JQ9A 2C99A 3K16A 3K30A 4KIWA 3A6EA 4L4XA 4L7QA 3WYNA 1JJBA 2W6PA 1E5XA 2DECA 4INZA 3H18A 3C6BA 3D3WA 2GB4A 2VATA 4H4DA 3PRKE 4IDCA 4H35A 3JQFC 4ITRC 4IIGA 3T9FA 1RXWA 3RYCB 1CF2O 3BHIA 2WTXA 2HCJB 5JCJA 1BZYA 3K2EA 4E21A 1BU8A 1U2TA 4JC5A 2PMEA 5MGBA 3GG2A 4ND3A 1R9JA 1EGMB 5TJ9A 3MWJA 3VR4D 1DJPA 4CMHA 2ODBA 1D4OA 3TBHA 5C53B 1PFUA 4NNPA 1NY6A 1VBKA 1JN0A 1T0IA 3H13A 3OKPA 3OX4A 3PRYA 4R1LA 1D2GA 2W58A 3PGMA 3UWSA 1KY3A 1K3FA 5K45A 1QVWA 1B43A 1GPUA 5B1EA 4EPXA 4YMHA 2MSEB 3MXOA 2XODA 5LWHA 1SZPA 2B5OA 3AR9A 5AI0A 2IXBA 1PNQA 2HAEA 2CNDA 4Q3OA 4F45A 1OVGA 4PYNA 3RUIA 4B0OA 3JQ6A 2DFTA 1N2EA 5CVCA 1VL1A 3CVXA 3AWDA 4N8EA 1XNJA 2IYZA 5TB5A 4BFSA 3F6YA 2SCUB 3N07A 3ESAA 3LQQA 4H1UA 3V8QA 4EBFA 1B76A 1BX0A 5SYMA 3SJUA 1Q0UA 4M38A 3U80A 1U8ZA 1AOXA 2O0KA 2J9YB 1JJAA 1ZMRA 1IBSA 5G0SA 2HUPA 3KQOA 1CIJA 2XYGA 4HY3A 1AN0A 4QREA 3NFYA 3I62A 5BUCA 1FOEB 2PS1A 3DS8A 1Z12A 2BDTA 2P35A 3QE3A 2YV2A 2PS0A 4HLCA 4E5PA 2QTZA 4NYJQ 5BW6B 4YIHA 3AVPA 3U4DA 4I6GA 4UJ5A 3PFBA 4Y2QA 3WNCA 2FLVA 5HUQA 1MX3A 5LQJA 4RY9A 3BSFA 4JC4A 5GY7A 3A7DA 4UAVA 2VI5A 3KPJA 2CT8A 2RH5A 3CH6A 1GNSA 3SEFA 1U2DC 4QTXA 5A71A 3FYDA 1YFJA 4ALLA 2GHTA 2CUTA 5D6NA 3GY0A 5I9MA 1YH3A 3NEJA 2I4TA 4GD3Q 4R9SA 1XTRA 2A5JA 4MEBA 2I6SA 1NNLA 2BEUB 2FCRA 2C83A 4MGZR 4LHVA 3KS9A 3CS3A 5COAA 3IPAA 4DA9A 4MV8A 3E7PA 1JQ3A 1LS1A 1UBNA 1ABBA 2P8JA 2N3ZA 1ZU4A 2YIMA 3HCNA 1OI2A 1XVAA 1Q1ZA 1L7BA 2B9EA 1JMVA 2GNAA 4KRGA 2GTHA 1PNRA 3RCBA 2DLNA 3LVRE 2DFNA 1DQYA 4GQAA 4M1MA 5D3MA 3SZ3A 2WUWE 4CKZA 4FD3A 4YX9A 4EY5A 2XAUA 3FZYA 3DV2A 4MO9A 1TT5A 3AKEA 1E7MA 4HB0A 4L0MA 1FFYA 1DEOA 4L4RA 4NAVA 3W1EA 1E1QD 2O7NA 1EESA 5EOVA 2NU7A 2O4CA 1P44A 1V9SA 2C2HA 4RCVA 1WO8A 4JU9A 4O4IB 3CEMA 4J94A 4XD2A 2YY6A 1VM6A 3CNNA 1SIUA 2RARA 1YS2X 4O4IA 3E7XA 2QN8A 5FOSA 1G8KA 2NPOA 1ZRMA 2ZEJA 3GFPA 3IO5A 1Z2AA 1TFRA 2EL7A 3M6MD 4IJ5A 4IJ6A 4TTQA 4Q7JB 2YWEA 5LWQA 4FDVA 1JEYA 2Y77A 3ENZA 5KTKA 2FSVC 2NZYA 1RU3A 3IGFA 3VKHA 3HKBA 4FEYA 2AL7A 1UP4A 2VYNA 5FPQA 3FTNA 2G9VA 2Y66A 3DZGA 5TV2A 3FJ1A 2IELA 1IBLB 2YJTD 4DLBA 1GAXA 4AI6A 1RCTE 2OTCA 4OH7A 2J9FA 3C6KA 4CN9A 3NRJA 6LDHA 1HRKA 2LKDA 1FC0A 1US8A 1L4YA 4W63A 3C6MA 4EYSA 1V7QA 1TU4A 3GCDA 1NR7A 3OQOA 3VKFA 2CXSA 3VZSA 3IUMA 2RE8A 5BQPA 1Q6YA 4FOOA 4I08A 5FUYA 3UWMA 1GNVA 7REQB 3E9CA 4INPA 4X1KB 2MU1A 4BNJA 3A6PC 3JAWA 2REQB 3NC1C 4L9WA 4QSHA 4C05A 5JS6A 4DG8A 3DQZA 3MCVA 4MTLA 2OZLA 1GSHA 5GINE 2I2CA 2D59A 3DDZX 2R00A 3A1WA 3OA0A 4MAFA 3S4YA 4TLDA 2OA0A 3ZI0A 4EUSA 1BH6A 2X1MA 3MCWA 4P6VF 5FPSA 4P53A 1J06A 1UDCA 4KLZA 2WM2A 1VA4A 3CSDA 3QEMA 1DC5A 1PZGA 1U0BB 3DL7A 5JY1A 4NG5A 1U9IC 4JZYA 4AUMA 2BC9A 1OFTA 1UKVY 5SZIA 2W71A 2J3EA 2Q3FA 4BQNA 4LXGA 4YLEA 1WULS 1GG5A 3SFTA 4F5EA 2PCLA 3MS4A 5CH8A 3LRXA 4DCTA 4I9NA 4U9HS 3WDLA 2GZ3A 2H4WA 3Q3EA 3QKWA 5JSYA 3HWWA 4LF5B 3GF4A 4H08A 1VXRA 2O8NA 3BA6A 4F96A 8MHTA 2OGUA 4A27A 4CKCA 5AUNB 4FDLA 3PCTA 3K92A 3TLJA 3OUTA 4NV1A 4FGJA 1LFDB 1M2WA 1GPJA 2Q1YA 3ZV5A 5BYAA 1OLXB 4OHBA 2QZ9A 3W6ZA 4EHIA 2O8BA 5J2UA 5HOQA 1R4MA 3KHKA 3BGVA 3A25A 2PUDA 4QXRA 3ML1A 2EZ9A 2BAGA 2VHVA 3C39A 2HGSA 2OQ2A 2ZRHA 3PGKA 2PWYA 4HQRA 4YCJA 1BCRB 3RV3A 3STVA 3HLTA 3REOA 1GPMA 3W2FA 2VSFA 3V5NA 1YI8A 2TMYA 1SOVA 2Z9CA 3ESQA 2B8TA 2E4XA 1YU6A 5EJGA 1UMCB 4CEJA 4W7IA 2FXIA 5EG5A 1TKRA 4RABA 3BTUA 1IWOA 4X8MA 4TKUA 4MR8A 3AVWA 4H1HA 5IABA 1H69A 4WJZA 1IZZA 5GAJA 3UXMA 4R4JA 3JQDA 2HMUA 3CTMA 2DR2A 4EDHA 4FCWA 2WYHA 4GQBA 1S3IA 3GBPA 1MB2A 2YOFA 4H0FA 4KQKA 3P4XA 3UAZA 2J4DA 1HDIA 1QHHA 2F00A 2OFXA 4D0NA 2C84A 5A0FA 1OH6A 1UAYA 3EE6A 4AD8A 3AK4A 3JQGB 3I0ZA 4J16A 4BLUA 3GAMA 4OATA 4UNQA 2P78A 2ODAA 2RK4A 3OLWA 4PHGA 1ST2A 1T8WA 2IPOA 3DZCA 3LG2A 4G56A 4OFWA 4EKGA 4C4ZA 1TUEA 2AN5A 3N0WA 1PGPA 1NOIA 4YRJA 3ZBPA 1T9CA 5CA0F 2HCFA 1WB9A 1NQXA 3CPJB 3LPLA 3NAZA 3PP8A 3TAUA 2VRNA 4ASUA 1TM4E 3PT9A 2B4QA 5CEJA 3ZGVA 2EX4A 3IXMA 1BW9A 1JTEA 1YUMA 1ZRHA 3F98A 3GOQA 3JVEA 1MOPA 4G0OA 1P1RA 1NR1A 3HMKA 3RNLA 1MAWA 2GN6A 3MFYA 2YRXA 4BX3A 3IQWA 1WTCA 3KQVA 1Y6RA 3B20A 4OGGA 2YZ2A 5IPFA 5B5SA 4DCPA 3FZGA 5IVKA 3PGJA 2DFVA 4NC9A 1ESEA 4F5WA 4GDMA 1O94C 3JATA 1TLFA 3BHNA 4K9MA 4L8GA 1Y1SA 4BLSA 4C4PA 2V9CA 4BECA 1A04A 4ECAA 5D3ZA 5AKXA 4PTZA 1SU7A 3L7JA 3MTDA 3AL0C 5A3SA 1NPYA 2BFEB 4JEMA 4FZ5A 2P4UA 1UODA 1XJ5A 1GD1O 2VUSA 5HOEA 2VEOA 3G9QA 1Z25A 4H31A 5LBUA 4BGEA 4KIJA 1IUPA 1E7WA 1PJRA 3G7NA 1W5EA 5GONA 2CYCA 3JZDA 3FF1A 4EKEA 1ZJ5A 3D6TB 2RDMA 2XMDA 2FE4A 2IF2A 1I01A 1MPXA 2O0LA 3FE2A 3GRFA 3OFSA 2VRWA 4H6WA 5DISB 5G0TA 4AJOA 5AW8A 2E5LB 1YK0A 1I2AA 2BFPA 3FKSA 3FYCA 4BEWA 4MAAA 4Q66C 3P32A 1CS0A 1F12A 4LQDA 3K94A 2FPGB 2V7QA 2FSVA 2GRAA 3BGSA 2ZDQA 1SUIA 2NUTB 4V1CB 4D99A 3NBFA 1SEPA 2N1MA 4YP1A 5J3JA 2V0NA 2QWXA 3OSUA 5EZQA 1CR6A 2BMEA 3WYEA 2DMRA 5IC6A 4UOEA 2QG9A 3E53A 3T5PA 4W5QA 1C1YA 1ODJA 3QFSA 4AZTA 1GQRA 1D2RA 4WOBA 5LZ4A 4KNYA 1O5IA 2XUKA 1Q21A 3EULA 5U1PA 2VPIA 4R71A 3UIEA 2OK7A 3EUAA 4M1SA 2H2WA 3GQBB 1SQGA 2W37A 4A73A 3I2YX 1NXPA 3F7NA 2JFOA 2PA0A 1VZ3A 1WXHA 3PNPA 3W2GA 4QUEA 4RLSA 4D4KA 2VPXA 4E6EA 1IUKA 2BELA 4HVTA 2TRSB 2A35A 2FOXA 2R1ZA 3QF7A 4BO3A 4O02B 4XA8A 3RAGA 3CG4A 3J7TA 3R5FA 4ZICA 5EUQB 2WFLA 3NHSA 2GESA 4IFIA 5GQSA 2VNHA 5IT4A 1F20A 3KVVA 4X3CA 4UJ3A 1RMQA 5JSUA 4B79A 1IIBA 3RR2A 5KNCD 3NHRA 2GGSA 4D3XA 3H9QA 1M2HA 3D4BA 3MWEA 4ZCTA 2ISCA 2PBFA 4E07A 4MWBA 5KINB 4FBGA 4IIBA 1XQXA 4MUNA 5CIYA 1II0A 2NMVA 2C0QA 2WIBA 1JHVA 2X4LA 2HSZA 3EXIA 4FVTA 4HXGA 2UYCA 5IK2A 1ZI6A 3OCCA 1XEAA 4OXNA 2PUTA 3IV6A 4U00A 2CMGA 2CK3D 2OAP1 4MQEA 2AG0A 2YHAA 4ZVRA 5LQAA 2VDVE 4U2DA 1D6MA 2PY6A 4RHEA 3Q87B 4GO1A 4PLGA 1L8AA 4KMMA 1BYIA 3C1AA 1SXPA 3AHGA 1JEJA 2LDXA 5J2UB 3NAGA 4P0TA 4QATA 3D5QA 2YWCA 3PJRA 5DM0A 1CEQA 2DVMA 3TEFA 4IIVA 4TT8A 1KJZA 3EFEA 5KWEA 3U4QA 4M7PA 3AZPA 4XJTA 1TQ6A 4DNPA 5IAAA 1Y42X 2Z5GA 4ZK2A 2CZQA 2D2FA 2ZI5A 5PNTA 4OM7A 1JV2B 2IV3A 4PVDA 5ALIA 2Y1EA 5KJEA 1JSLA 4DLPA 4LPKA 4IIUA 4V24A 3NJRA 2BGIA 4KV9A 1WSAA 2G72A 4KR9A 3CRVA 2GAFA 1K9VF 1R8QA 4NE7A 4P58A 4R7TA 2OYSA 3BWBA 4EB8A 3ESYA 3CLTD 1GAEO 1MC1A 3FNEA 3JYPA 3RJMA 3VKWA 3L43A 2PMDA 1U98A 4AUKA 1I6WA 1JU3A 3NALA 3RADC 3I2HA 4JJGA 5HX7A 3IEUA 1GZHB 2Q4BA 1YCGA 1QFMA 2JAPA 1B26A 2XTAA 3COYA 4MRAA 1ZUWA 3MN1A 4KSCA 3QU5A 4TT3D 4ZVNA 1YRQA 3JS5A 4BMXA 1T0JB 3K6JA 3KVNA 1FS6A 1ZSVA 3QI2A 4J0HA 3QLTA 2QMYA 2VP2A 3IDQA 5LDDC 4OHCA 3KZXA 4O5AA 5TVGA 3BE5A 4QGAA 4A6PA 1J0BA 5KYNA 4XDHA 2FSSA 1NFFA 5DN6A 5L9AA 1YOVA 5JH7B 2CLMB 1JXAA 4MKFA 1HG1A 1GIAA 2WJIA 4RHTA 3H7AA 1NQUA 2O2ZA 3BGIA 4EVIA 2B3TA 4Y2JA 3S6JA 5L7WA 4P83A 1BGWA 1TUGA 1CRZA 3QVJA 2E4YA 5CAEB 3NHBA 3RWOA 1I4TD 1AXEA 2QNBA 2HN9A 2IP4A 5DYWA 1PEKE 3FUCA 2NIPA 3LDAA 3C16C 2B0JA 5AUQA 2B94A 1HSZA 1ZD1A 1R12A 4DBVO 3SR0A 2B7LA 2OV6A 1N2IA 2JGLA 1GQQA 2A33A 1YJ8A 1K0UA 1ZD3A 1U3GA 4DLNA 5JHHB 4V0MA 3HKBB 3EGEA 3T38A 4C7XA 4ARBA 2OECA 3MGCA 2A5DA 2J3MA 1K6MA 3UJDA 2A1UB 1M72A 3AVQA 1ZITA 4GP6A 4YQYA 3SC6A 4Q4CA 1Z8NA 4Y6SA 4HD8A 2XDQA 4QU5A 4HSGA 4XW2A 1CRQA 3AF6A 1Y0BA 4UXIA 4Z7JA 1EDDA 1U81A 3LC0A 4FFSA 3H9BA 1Y7PA 2YXNA 4R68A 4R7GA 1CK4A 3BSWA 3Q12A 1IEXA 1R7RA 1I24A 1F4LA 3DW1X 2KYRA 3T4UA 1UR5A 3N8KA 1E2MA 4CL3A 5LZ8A 4BQPA 3AY3A 1Z47A 1Q3KA 1XVUA 3ESXA 3QWHA 5I3CA 3ZDBA 3R6LA 5J4HA 5H83A 2ZBGA 1LX7A 2HFJA 4KACA 1C50A 5C18A 2R3SA 1N78A 1G5PA 2RC5A 1FTYA 3PR3A 2XZLA 1P2DA 1TFUA 3LPMA 5F2OA 4J0FA 4N3CA 1JKFA 4HRAA 4RZQA 3NWOA 3IMKA 3PDJA 1ORVA 2RFLA 1JPVA 2LWIA 4GOLD 4YO7A 3R7NA 3W5UA 1PJSA 2FMFA 4BFTA 5EJ6A 2ZRQA 4ZI7B 2CHUA 2GDZA 4GUAA 4W5TA 2WQ6A 3NVAA 1U3VA 3GJQA 3FKSD 3H5AA 3LNTA 3HXQA 2C4NA 4YR9A 1NBMA 4BLPA 1M1NA 3BH7A 2X22A 3L0CA 4RHCA 1JVBA 4YCLA 3R8XA 1E6KA 3NBMA 3OI7A 4B82A 3HXOA 1G5IA 3IQEA 5C32A 4WCDA 1MZVA 1E2PA 4TL8A 4XWAA 3U7FB 1LCIA 3QVKA 3OG9A 1Q1AA 2Q8NA 1RWQA 2JS7A 2QUKA 1IH8A 1XZCA 3HA7A 3IXQA 3MWDB 1PF7E 4QELA 1KO4A 4TKVA 5BWOA 3QEAZ 1KK3A 3A0UA 5TMEA 1Z3CA 3QA3E 1K98A 1VBFA 2C4MA 1UXGA 5IULC 5L4LA 2H5EA 1QFZA 2BGKA 4FKZA 4GHWA 1R9GA 4NENA 1K89A 1QV9A 3BZBA 2P68A 4M86A 4MWDA 5H8WA 1M1ZA 2FX5A 3E7DA 4EY4A 2X7XA 1UAGA 1R16A 3R74A 3WK4A 3UQYS 1J7KA 4IV0A 4Q16A 3BCUA 3I01M 3MJVA 2Z9BA 2IZ0A 4MQMA 4MRPA 1CD5A 4PX9A 5CJJA 1T4GA 1CG6A 3A6KA 5TGTA 2V7GA 3RTEA 1CJMA 2C42A 4HWGA 4Q4DA 5TPWA 4BO9A 5CB4A 1FLVA 4KIFA 5JNVA 3U44B 4D9CA 3T3EA 3PXGA 1ZOOA 3QOWA 2XUDA 4NZZA 4X41A 3U9LA 2EATA 4B2PA 4WQMA 5CA1A 1D9ZA 4H2DA 1EX9A 4AULA 2D54A 1HDGO 1M2OA 1PQPA 1RJ9B 3O0TA 4YJFB 3WWOA 4INJA 1CUAA 1K8YB 4IIHA 5HM8A 2B7CA 3OJWA 1C0EA 5JQGF 3CLUD 4Q4JB 1U31A 4CM6A 1PWXA 1XRLA 3WGOA 4KN5A 2NO7A 2PUCA 5DNYB 3WLJA 4WD3A 1SXIA 3IVMA 4Y67A 1JQLB 4XWWA 4PGAA 1WB4A 1ZBQA 1BN7A 1OY1A 4QDKA 3LA8A 4Q6WA 2BGGA 1TU3A 3BMQA 4FFLA 4TKZA 2QTGA 4LYDA 5BSKA 5CX1A 2Q50A 2QVZX 1G4UR 4GYYA 4ZI7A 5CDFE 2P4HX 3TSCA 4ZCRA 3GJ6A 2Z6UA 5BV0A 1H6BA 2YOGA 2FMHA 4ALMA 3LBHA 1J23A 1TO1E 2OFPA 2WTAA 3UW3A 4I1PA 4GRDA 1TQHA 3L8EA 1U8UA 4F06A 2NU9B 3TNDA 3NGXA 1OKKD 3ZHZA 4E4YA 2WB4A 1DMSA 1OT5A 1VE6A 2OCBA 3IXLA 4G07A 2BKAA 4WCFC 2TECE 5DU2A 2GK4A 3WIVA 5LVAA 4YRRA 3IKJA 2WU8A 4OI2A 3D81A 4EZBA 1V9LA 5LQUA 1R0XA 3HVHA 1V3VA 4YT5A 4QLAA 3L07A 3L8HA 3FMPB 4P22A 3TTYA 3MGBA 3X1WA 2X4DA 4LTNA 4D9IA 1AT1A 2OL4A 1T5HX 5TF4A 4TZ6A 1I36A 5DGHA 4WT7A 1YQDA 5HMMA 4DQUA 5AOAA 1WPRA 4DV1B 1FS5A 1RWBA 1OWLA 3S2IA 3TI9A 1KK0A 3O1JC 1R4NB 2C5AA 4JITA 3GDGA 3NB0A 4LZPA 4UUQA 3TG8A 3D6UA 3HYCA 3LD9A 2BR5A 2GEJA 4MCHA 3P9XA 4QLBA 1ZUHA 3VHXA 4K9RA 4RUKA 2OBFA 2NVOA 5EIWA 1MDFA 1NRWA 4MRRA 5BWMA 1PJ2A 3GRAA 3EYWA 1P0IA 3P9YA 1PNTA 3B70A 4HQNA 3ZGNA 1N4AA 1RI5A 4YAFA 4QT0A 4MB0A 2H57A 4HZUA 4BP3A 1YNOA 3AGQA 3L6UA 3D3JA 1KJ8A 4D2IA 4FX2A 2YYZA 3JQRA 4ZT7A 1Q14A 2JHAA 2QA5A 2KI5A 4FNOA 3WISA 3ZPXA 4Z4GA 2FPWA 3W90A 3LUAA 1YZNA 4ZVOA 2PGXA 5FI1B 4QFDA 4EW2A 3DLHA 3O8QB 3T3NA 3HE3A 3ZJUA 1DC8A 1UQRA 1C80A 2FPOA 2X1VA 4OXIA 3ZWWA 4Y9RA 3QITA 4HVAA 1M83A 4RFVA 4C2UA 3TOZA 4IXWA 2JJMA 3IDSA 4QOJA 5F3DA 1EXNA 3JQAA 1NI5A 3D0QA 2Q5CA 3H65A 3VYSB 2I3DA 2OESA 4I4TB 2JAOA 4CKWB 1W0JD 2IITA 3NDPA 5F4BA 3TFQA 4ZN6A 4KVAA 1QJCA 1D3AA 2VYQA 4R8RA 1T4BA 4AG3A 4OV6B 4L4YA 1VPTA 4C6TA 2DEUA 3QG1A 2FZVA 4H18A 2BR3A 1CJKC 4RLHA 4E70A 4HEJA 4X6LA 3OC0A 4MLDA 1EJBA 4NCBA 3TLBA 4ZOQI 5EN4A 1O94D 1LDBA 2AC4A 4XDYA 1KE1A 2B9VA 1K06A 3HY6A 4JSRA 4O2AF 3H42B 5LYJA 4NCKA 4OD0A 2QAIA 2RKBA 3Q3GE 3CX3A 2ZI3A 3A1VA 4HEQA 1SBZA 5JAOA 5KC9A 5IEJA 2X0RA 4TN1A 3I09A 3KJNA 1IB6A 3N8GA 5IEBA 1BWPA 4C4YA 5AHKA 3IHTA 3OLQA 1U94A 2M1ZA 2VLIA 3O5AA 1U1EA 4F4HA 2PMFA 1ZNZA 2PRJA 3BWXA 2H51A 2QQEA 1CX9B 3RWBA 1YASA 4Q3KA 5C8VA 1EKXA 3ZD8A 4IDBA 4X94A 3FD8A 6REQA 2Q49A 1NOJA 2W0SA 1VCIA 3EGDA 5BSGA 1WD5A 2WYVA 4OL9A 8GPBA 4AKHA 2C7VA 3LA6A 2Q27A 4FKMA 4LTDA 1OH8A 3H0CA 2GFHA 1I3NA 1ZWLA 2X0NA 2RAPA 4O4LA 4FZRA 3W5IA 1HDRA 1UC8A 2ZR7A 2G9ZA 4V0ME 4N1AA 5CEFA 1GEEA 5I4BA 3KYCB 1I3CA 2XMCA 1U9CA 1S5PA 2OENG 5B4UA 1RP7A 3ZHOA 5DXFA 4JASB 4B43A 2G70A 4EG4A 2XR1A 3IP7A 2PUFA 3RUDA 4QUJA 2E5WA 3HBNA 5KNDH 2ZIUB 3EQ2A 4B4UA 2OEPA 2R1UA 1RHQA 3VAZA 2WTUA 1C8KA 3LY7A 4YFYA 2XF2A 1R15A 2VQ3A 2Y4OA 4WAUA 2FF5A 1YV9A 2TS1A 2UVPB 3BB3A 4JKOA 3WYAA 2O2SA 4F38A 3ZWOA 5IASA 5KNBH 2GEBA 1KS2A 2OV4A 1T5DX 5IM4A 5TVKA 5IFLA 2YJ5A 1WVMA 1TEHA 2WFAA 4HBGA 3DO8A 3GLSA 1M6VA 4OSEA 4RDIA 5K6RA 1FIUA 4AJEA 1GP2A 1LLQA 4AO6A 4K03A 2RHGB 4L8FA 3FOZA 2IPXA 3ZHQA 4ESOA 4YMIA 3CX6A 2CLOB 2WSYB 2NSJA 3A37A 3JAKB 1BH2A 2WV9A 3JASB 2XNHA 5LB4A 3MIZA 3IBTA 1DKMA 3CJRA 2BUAA 2GVDC 1YL7A 3EAFA 2H18A 3T9BA 1E4EB 1TPYA 4XTCS 3H04A 5I5GA 4HH4A 2O48X 3KQQA 1PTJC 2ZI9A 2BMAA 2XOKD 2J4FA 3LP5A 3D8BA 3X1KA 1LRKA 1NUPA 1WU8A 4K6GA 3DZHA 3LS2A 4BNFA 2H1WA 2IZ6A 3TUJC 4ZCIA 3BWEA 3W5DA 1R5BA 1S89A 1K3TA 1YSCA 1CUWA 1ZI9A 2M98A 3PV0A 5SY6A 2VJQA 3VO9A 3Q7SA 4MYTA 3KETA 1E8DA 2Z3ZA 3NO4A 1LI4A 5DCYA 1P5RA 1RM3A 3E1SA 4QUIA 1ODFA 4Q7LA 4N5MA 3KJXA 1JU9A 1XZJA 4NBTA 1MC8A 2D06A 3JARB 1J2YA 1K7XB 1NFRA 2FSIA 3B3GA 3HU2A 4OMUA 4Y2YA 5ENDA 2IWRA 1G42A 3S8EA 3I30X 4H59A 2BHSA 4Q9NA 2YN4A 3B3FA 4X5OA 4ZZ3A 4YWJA 4LN1A 2HQ1A 1KOJA 1VP9A 5KZMB 5TX7A 2DYKA 3CLKA 5JANA 5TDHA 2UUBB 1U8TA 3CF0A 1DKUA 2ISSD 3CVVA 1K08A 2C2OA 1TGVA 2H85A 2PSSA 3OP1A 1IQUA 1HFWA 3L93A 2G4VA 3B1KA 2QD4A 1YS4A 4P3PA 1SBTA 2J6HA 1OFUX 4HC4A 2BH2A 1AUQA 2Q3LA 2XWSA 3BERA 2X5OA 3Q8WA 1NWCA 4MYUA 4DQKA 1OIVA 4M2LA 1T2DA 2YBEA 3KLBA 1YO6A 2AD5A 1CV2A 2ZBQA 1VLJA 2IXTA 3BSYA 3JSXA 1M6EX 2JHGA 3ASYA 2C57A 2ID4A 2VQEB 3ZEAA 5JADA 3MB5A 1YB6A 3WIBA 2I22A 1E66A 3AM4A 3HFGA 4K28A 3OJXA 3FBGA 2VAWA 1YQGA 4XFKA 1PZNA 4F2GA 4RJKA 4HLQB 1F14A 2WJGA 2IUFA 1KU6A 4K46A 4XQGA 1T9GR 2H4HA 2AV6A 2FR8A 3HCEA 2ZJ4A 4Q9KA 1S2NA 1KNXA 1X70A 1UANA 1YZFA 1DC7A 2YXLA 2CVOA 3QUAA 2DJIA 4MKZA 4P7GA 4PGHA 4RVNA 3ZKAA 3AR2A 3P5BA 3WIUA 4KKXB 1Q22A 2ZFUA 1K63A 4I4NA 5HF8A 3UJ6A 3SNHA 4GXNA 4PW0A 5F33A 1PWEA 2OLKA 1LGYA 3NBQA 2I65A 3DVSX 3DXFA 3EG9B 1QPGA 3IP9A 3LQ2A 1L4HA 2EFYA 1CP2A 1E7YA 3C7CB 4WK6A 1RWPA 5DIFA 3CN9A 4CCWA 3N8IA 5JSQA 1LZLA 2JGEA 3WHKA 2OD7A 4A0FA 2PS9A 3WAJA 2FMXA 1R00A 2AJLI 3U13A 2Q0SA 1QZUA 3L82B 2BUBA 2QL7A 1F1JA 2G80A 4L5JA 1CQWA 2TSYB 1XMOB 1VKJA 1L3IA 3KRTA 1HRDA 3R4VA 2IP1A 1GRQA 4NRDA 1RAGA 1IIRA 1XL1A 2UUOA 3G0GA 4QRHA 1JA1A 4CT4B 1VKHA 3E9ZA 4RVHA 4XGIA 1DWUA 5EFOA 3N53A 3KL4A 2IRWA 1ZISA 1NXQA 4Y2RA 3STUA 2O2GA 2AHRA 1UC9A 3MCAA 3NV9A 3P9ZA 2JLXA 3C3YA 4G86A 3CZQA 4ZFNA 5CB8A 5LZ2A 3E05A 4XRGA 1N5RA 2G63A 3WQQA 5JS8A 1MB4A 1YVDA 2NQ2C 1XYVA 3TNJA 4R2JA 3ED5A 1LA2A 5M2QA 3AIMA 2RGDA 4JLKA 2W8BB 3IB6A 1VL5A 2JGIA 1LXCA 3MBIA 2ZYAA 4TSRA 6YASA 1JG6A 2HA6A 3AP2A 3R6WA 1EWYA 2QUZA 3W9UA 5C8XA 1SQ6A 1M8KA 3OEWA 3HP4A 4JYCA 4MXDA 3IKMB 3TXXA 3GUHA 1UM9B 5JC8A 2GVNA 2INGX 3BJZA 1AVTA 4POOA 2FEMA 2A1IA 4IKEA 2LTAA 5FAKA 3EC1A 4MUHA 5EHNA 1PVVA 4RVFA 4BWYA 3I0NA 5I8WA 2EJVA 2HCTA 2HJGA 1U2PA 2RIRA 1DFHA 4XWYA 3UICA 3R3SA 4YCMA 5ITSA 4BDSA 2CHVA 4TV8F 1W5SA 4LFCB 2DT8A 1MX1A 2EBUA 4A26A 5NULA 1G7CA 2C2KA 2OE2A 2Q0QA 3OX1A 4UREA 3R7WB 4G9GA 4E5DA 821PA 2EQ5A 4IVPA 5E9WA 1W44A 2CY0A 5F7XA 2NNLD 3M83A 3OE5A 2AQ8A 2X3UA 3BBLA 1G1MA 3PPWA 4J1TC 3RABA 3ROFA 1QB8A 4IDPA 4MKGA 4NTZA 3U1TA 1EX7A 3W5HA 3ZE8A 1XDWA 2EDAA 4L9AA 3QWFA 1EK1A 3OAAD 3ZI4A 5AVZA 3BORA 1ISSA 1NU6A 1VPDA 3PQFA 3ZCSA 3DZIA 1QKIA 1YC5A 5CM8B 2OV2A 2IQIA 3MUFA 1DAHA 4C4TA 3IEXA 1QORA 1I10A 3CLHA 1Z8DA 2GJAA 1QMGA 3BHJA 2WEKA 4TSFD 4KFUA 1SQSA 4EARA 1EE1A 3OFND 3PUXA 4CKYA 1JEYB 4YAOA 1W75A 5HILA 4Z4FA 4O63O 1G20A 1YRLA 2GASA 1XZEA 2DY0A 1JLKA 1WCV1 1F2TA 1PD0A 2CCGA 2JD0A 1WQ4A 3NWPA 2NUAB 3S2YA 2XKKA 3H2IA 5DHFA 3VNVA 1N2CE 1UPFA 4GAEA 1L5WA 1OC4A 2NYRA 3BRQA 5FR1A 5D87A 1D6SA 1EP2B 1J7JA 2VTEA 3GGDA 4WUVA 3ZHBA 2RHWA 2Z2ZA 4G0QA 4PAGA 3GJSA 5JEDA 2CNBA 1TUIA 1ZM9A 2OBMA 3WDSA 1ZEMA 3RSCA 2ZXUA 3K6SB 2P1RA 3EZ6A 3QTBA 1XEWY 1MD9A 3HJHA 3L6OO 3KUUA 2EJUA 4B6GA 1WIWA 3FFBA 3ZTTA 5CD1A 4KH0A 2G7ZA 1RHUA 2IYNA 2Q2WA 3EBOA 2DTXA 2EFJA 3DE5X 2EDCA 2BPOA 4IZIA 1OOEA 3KBBA 521PA 1GCOA 4A8JB 3TPCA 2BEUA 2W5UA 3ONVA 2VBFA 4JP2A 4TTJA 2V45A 3OQJA 4S1PA 1KVQA 3QFRA 4I50B 1IJFA 1P1CA 4P93A 5K3BA 1IONA 2HDWA 3A9WA 5JZVA 1P62B 5AJYA 4MW0A 3CX7A 4EG0A 5AI6A 4FN5A 1JIJA 2Z83A 3GPIA 2W6IA 2ZG6A 4L27A 3OTWA 3R5JA 4UU8A 3VGJA 2A88A 1C4XA 2VNIA 5GADl 1FNMA 1YFZA 4EHFA 1T3ZA 1Q84A 5DGIA 4C76A 1OXSC 4FS8A 1EJ6A 3OH8A 4RIHA 4US0R 3HZZA 2EJWA 1ZGAA 2XMGA 2QL6A 5TR9A 3KQYA 1WLSA 4O4JB 2A0WA 3GGPA 2XQFA 3JVIA 3VV2A 4B4WA 4BGVA 5K4GA 4NU6A 5I9BA 1M8GA 3PHJA 4FNAA 4ENUA 4Z2AA 2EC5A 1PFGA 3WR5A 1HDEA 3WGKA 3HU1A 3I5AA 3WK7A 1T2CA 1QS0B 3KZ1E 2PZEA 2WVGA 1D6JA 1DRWA 4RHUA 4QUBA 3I45A 4RQTA 4Y6LA 5AKHA 4MH0R 5BN5B 3VR3D 2J0SA 3RBXA 3NU1A 1LH0A 3UTDA 3UCEA 4S1VA 3DEIA 1BN6A 1KH2A 4ZOEA 1XFDA 1MT0A 1Y1LA 2J3IA 2W4MA 3DUWA 4POAA 5A4MS 1QGUB 2JI7A 2VHYA 4AICA 1IHYA 4JGBA 4QFCA 1W7AA 3GUVA 1JQJC 5JBIA 1MJNA 4AECA 2POQX 5CDYA 1XPOA 3C6YA 1E62A 2I2FA 3TXAA 4BATA 5C7OO 4D46A 4PPQA 4AJLA 2B2NA 2HEGA 3B9BA 3G49A 4Y1EA 4ZMRA 2WZCA 4J0QA 3TB4A 1MAHA 3QVVA 4GX0A 3GPDG 3VPSA 3A14A 3AVOA 4ESHA 1OHHA 1ZOLA 1UJBA 4PC6A 5JLJA 2WIAA 3IHKA 1E9SA 4LMRA 1NRXA 1KMMA 2W2KA 2WF8A 1NYTA 4KE7A 3GJRA 4ND8A 1XAIA 2H1HA 2ZIAA 2YCBA 1PJLA 1CQJB 4NJEA 5I9NA 3O8QA 16PKA 3LDUA 1P0FA 1L7NA 2NZVG 2W2QA 1JHYA 1PJ4A 4HYTA 1YZUA 4HDNB 2B1JA 4DIOA 2HQRA 2Q5LA 1FFDA 1II8B 2PBLA 5ALPA 3QVSA 4KOAA 4UPEA 2JLVA 1EFPA 3U37A 3MJDA 3VPHA 2DRIA 4LVUA 1Y48E 4ZEVA 2OFWA 3Q85A 3GEHA 3DEFA 1PL8A 9LDBA 4Z8XA 3PJEA 3PJFA 4M54A 5KOIA 1CQJA 1GV1A 2SKCA 1LQ2A 1GRVA 2LCFA 1IAVA 2R6GA 2IP2A 3IUBA 5IUKC 2QLFA 3MWDA 3USZA 2Z2YA 1RLIA 1W5TA 3JQ9C 1FDWA 4JEHA 4IZOA 3QNMA 4NEGA 4AQYB 1U2SA 3I2FA 1N6PA 3D3NA 3IR6A 4JQSA 1VHQA 1FQJA 1JU4A 2HMTA 4U2EA 4BRSA 4EYOA 3ZGYA 1QP7A 4OJQA 1KVRA 3AR4A 4N0PA 1NVXQ 2W6OA 3JALB 4A4DA 1PI3A 3RVQA 5K3FA 1K4MA 3GT0A 1OX4B 4I1SA 4JY7A 4J76A 5DULA 5A6VA 2R6JA 5FUQA 4HLDA 3TTXA 4NOMA 4QBFA 4O4HA 3UUGA 3EY4A 5AVUA 2VDQB 4JMPA 2EERA 1MO5A 4FLFA 2IXGA 4GPBA 3EHDA 3WBBA 4R9UC 3CNLA 2WWFA 2F4VB 2NTYC 1E0KA 4REQB 1PUXA 1UPBA 3PXAA 5U4XA 1O4WA 3KK0A 3PWKA 5ETJA 4JD5A 1GRNA 3LH5A 4Y0VA 3AEUB 4EGJA 4EX7A 3ZH9B 5KVQA 4TL9A 4YVFA 3PHGA 5FULA 1JQAA 221PA 2D0OB 4H7IA 2IL1A 4HOYA 5DGXA 3NHUA 1ZIPA 2FCAA 2G40A 4PSKA 3QEJA 1V1RA 4OHYA 1DEHA 3OHMA 5C8ZA 3FGZA 1A9QA 1TJ5A 1SVKA 2ONJA 1DFGA 1F17A 1TJNA 4MDEA 3HWRA 2AC2A 3WB0A 2ZWAA 3RJ5A 1H0RA 4CUZA 2IOHA 2O05A 3UK2A 2Y27A 3F67A 1U3TA 1AHHA 1NBMD 2ONKA 2FTKE 2ATIA 2NPIA 3L6CA 1H94A 4QU0A 1IU9A 3D4OA 4JX8A 4O2BA 3DVAA 4AQDA 2VKTA 4ICIA 4X97A 4ER6A 5C3MA 1UFQA 2I76A 3VX4A 3MIIA 3OIVA 3MTGA 4LOKA 2R6DA 3FCUB 2UUPA 1HPLA 3FOCA 3UQZA 3ELDA 3LUBA 2VJKA 3IEVA 3O3MB 1G2OA 1VIMA 5BRNA 4AMBA 5CAEA 4OGLA 4UE3S 4A6DA 4H1TA 3ZVKA 2I7VA 1G3UA 3EZXA 4LDAA 1Q12A 4YEDA 5E2BA 3TZLA 3OO0A 4AK9A 5CFMA 2ID9A 4PGMA 4CF5A 5IXSA 2XEXA 3RT1A 5FTJA 4CU2A 4FW8A 4LPSA 1VECA 2G9RA 2B2XA 2VH1A 3PFGA 2BFOA 5J4YA 4B6RA 3SFVA 2OO3A 1U0NA 1AGXA 3Q0EA 1LTKA 3DBVO 3BMOB 1LWOA 3ER6A 4S24A 5FTKA 1P1KA 1EUCA 2V4MA 3MJFA 1EI9A 3UMSA 2GUGA 3GXOA 1RMYA 4P34A 5BN3B 2XV1A 3T5AA 1MIHA 1NDUA 1X1DA 5J47A 4ND1A 3R40A 5H3LA 1JDTA 2QYHA 4H3KB 5FPTA 2QIPA 1EFCA 1DIGA 4JVMA 3NC4A 3THWB 4PX5A 2IPNA 4OYHA 1E2BA 1TEZA 2VSNA 3T61A 3QELB 3T3IA 4C7BA 5K3SA 1L7PA 3I9FA 2GM4A 2HQSA 1OLSB 4I9UA 1LBIA 1B93A 2HH9A 3JD1A 3ABQB 3T9EA 3ZIAA 3W06A 4MARA 3P2EA 3EXFB 4RTJA 2OORA 1QONA 3RKSA 5GV8A 3GRYA 4TUYB 4J91A 4EA6A 4G5OA 1KEUA 4TYWA 2NVUB 2FMUA 4MWZA 3A9TA 1NJFA 3NANA 1ZN9A 3OLVA 3GFGA 4K6HA 5JXHA 5LNK6 2EFCB 1VBNA 1KETA 1WXFA 2RKWA 4D4LA 3WLNA 3IUSA 1C9MA 5BN4B 1UBRS 5F2NA 2CDAA 3QI7A 3IAFA 1T5IA 1JFRA 3Q6IA 1T24A 2DF8A 3NQ41 5DSXA 1AE1A 2O2DA 2DP4E 3OZTA 1P5FA 4WNYA 4OL0A 5BQ5A 2ZSJA 3INNA 5A4FS 3PHLA 1V1MA 2X2PA 4IXNA 4RZ3A 2ZYRA 1H1LA 4ADSG 1DUIA 1XJQA 3ROEA 1X0VA 4WUTA 3I9OA 5AKYA 4MQFB 3PC4A 1DEKA 4ER0A 4JOBA 4G0PA 6Q21A 1C30A 3SF8B 4IUDS 5LZ7A 1KSGA 5KMGB 2BEWA 4G65A 4B76A 1NJSA 1GM5A 3R0IA 1EWKA 2FUCA 1AUVA 2L2QA 3X3HA 4MA5A 3DYVA 3TTWA 5BXYA 5HJ5A 4JC0A 4URFA 4DR2B 3LYUA 4F3RA 3CNOA 4CFZA 2GKGA 3LBYA 4MUGA 3SHVA 3NUQA 3K9WA 1ZA1A 2VUIB 4JB8A 2XYPA 1AQUA 2RBKA 3VNSA 4R9NA 4RORA 3W05A 3CZ4A 1KAMA 2J5RA 1EHYA 1LLUA 1JMKC 2XKJE 4FOLA 5K2MA 5TLSA 3V00A 1R8XA 4QPCA 5J5AA 3R5XA 1EUDB 2UYHA 2V6IA 5EJAA 2JDIA 1ZGBA 2HBRA 4GW3A 2SNIE 1HA3A 3CZPA 4DR1B 3KR1A 1MH9A 1R4AA 2VTVA 1NZDA 2GCGA 3HWX1 2E55A 4EQZA 1YCDA 5H0IA 4PZUA 2YUTA 3QFHA 1E2IA 3ZWVA 3UJ9A 5H4GA 2B37A 4GYKA 2FSUA 4ALNA 5I9IA 5ALEA 4YXWD 3DAYA 1H9BA 3PDUA 1UFVA 2X0DA 2WF5A 1A9XB 1PWZA 5JU6A 5EUMA 3GGSA 2E4ZA 3V46A 4EW1A 2EGHA 2QHXA 2I03A 3MOSA 2H2DA 1A4RA 2HREA 3IKVA 3SS7X 1WF6A 1CR4A 4NOJA 2VYFA 1JE0A 5J9FA 2E4VA 5JS7A 5LP1A 3U6KA 1Z18A 2IS2A 2C92A 3WGMA 3H4IA 2RGCA 3DFZA 4LF9B 1Z4NA 2HNAA 1MUUA 1SUPA 1XUOA 3T7KA 3VJLA 1GWNA 1NW7A 2WJ3A 4JI2B 1PZXA 2HCRA 3R0XA 2AKYA 2KPOA 1S4MA 1O89A 1AK2A 1O95A 4YRLA 5A9TA 4PN3A 2OC9A 2YQ5A 3OCZA 4PO8A 3HJTA 2HF2A 4N7BA 3LZCA 5DW0A 5J2TF 3VH1A 3WJ7A 4CMEC 3WG9A 4D6PA 1SXJB 4YWHA 5AVVA 2X2EA 1WDWB 4G37A 4Z1MD 2Y2VA 1RD4A 2XBMA 3WX0A 1RJEA 3DBLA 3G5UA 4ETMA 4PHTA 3AKZA 3AI1A 4F7DA 5F35A 4CT0A 2AE2A 3TIGA 3IAEA 4L5BA 5DP1A 3WRXC 4C0WA 3TVDA 4CMAA 3KEOA 1GKYA 4H4EA 2H6EA 3PRJA 2FG7C 3SQDA 3VZRA 4N5HX 4EUEA 5EYPA 4O4IF 1KGDA 2FK8A 3JR3A 3GVHA 1IN1A 1UDWA 1GTG1 4V0OA 4LDJA 4PXSA 3VU1A 4AO7A 4FI3F 4GZ5A 4CM3A 4NH4A 2X15A 4C0XA 2Z8YM 3SWWA 2EARA 2QW8A 3L2OB 1C1DA 4BO8A 2NPFA 2GERA 2Y71A 5H9VA 3TX6A 2OCXA 5BWLA 3BICA 1UBGA 4M8KA 4YCBA 2RAUA 4F1KA 3EVNA 5EPOA 1WX1A 4RXMA 1X3SA 4Z86A 5FNVB 2MSNA 3SSNA 2VJLA 2RC6A 5LKRA 1N2CB 1KPGA 2HT1A 3NHZA 1ONNA 1MNQA 5HQJA 2NAFA 4KEAA 4LAFA 1TJYA 4R1TA 4R2HA 3OCWA 4JJ7A 4CJXA 2VYVD 4DUGD 4EJMA 1X42A 4FFBA 1XQVA 1AGNA 3PXXA 3CBQA 2DU8A 1T1RA 1OW3B 4GX2A 4ESEA 2CWDA 3U3KA 3B6EA 4MWCA 2DX7A 4JHXA 5IHXA 4HH0A 2ZK7A 2PUHA 4KQCA 1LY1A 1EQUA 1VMDA 4Z4HA 4JB0A 1JH9A 1UFRA 3A6GA 4BX9A 2DY1A 4RD2A 5ILGA 1DGQA 2I8AA 3THXA 3UH0A 5BYBA 5DF1A 2EL9A 2RHHA 1S7GA 2NZJA 1DSSG 1IJKA 5KOJB 4QTTB 4YV2A 1XZHA 2DPYA 4UTZA 3PITA 4ZAXA 2UU9B 3KQKA 2YCLA 4D8YA 4DG9A 2GWHA 3DFIA 2QMOA 3Q7PA 3DFUA 4HMOA 1PS9A 1VL0A 1TVKA 1BO6A 1N5MA 4D41A 3UJ3X 1XROA 4J49A 3SVLA 3V8VA 4MV1A 3A1FA 4IIJA 4CIBA 2XIQA 1RRFA 4H3HB 4NZMA 4CE6A