4P92A

Crystal structure of dienelactone hydrolase c123s mutant at 1.65 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Carboxymethylenebutenolidase
publication title Crystallization of dienelactone hydrolase in two space groups: structural changes caused by crystal packing.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 82
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2014-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p92A00
2ZJ6A 1UK8A 2PL5A 2Z3WA 2C7BA 2V96A 1PV1A 3OTQA 3FYUB 1W1IA 4GWLA 3KWFA 3W05A 4BP8A 3V1KA 4Q3KA 1P0PA 2FUKA 4J0DA 5ALQA 1JU3A 2E3JA 2OGSA 4BVKA 4N8DA 5JIBA 2Z3ZA 4KE7A 5HQ3A 2HA6A 2X76A 3IB3A 3TRDA 4B80A 3V1LA 5HK9A 3IUJA 1UWCA 5AI6A 1VKHA 4JYMA 1IVYA 1SOMA 1QIKA 3IVMA 2XUDA 4B9AA 2WUGA 1Y37A 3WK8A 5ALVA 1QTIA 1PFQA 3D3NA 4AZ0A 1HDEA 5LZ4A 1UZAA 1ZJ5A 3ZLTA 5AM0A 4KE6A 1IUOA 2BGRA 3CCCA 1EHYA 3PFCA 1UK7A 5D6OA 3EQ7A 1U2EA 4BDTA 1L7AA 2HFKA 3C70A 4W1QA 4C6HA 5CXXA 4OYLA 4Y2JA 3IUNA 3WKCA 1H2YA 1P0IA 3VJLA 2HA4A 1ACLA 4FFVA 4BP9A 5JYCA 4Y9SA 4DLNA 3V48A 4PSCA 3WK6A 2J4FA 1ACJA 4CG3A 5JARA 5HKBA 1MJ5A 1JFRA 3M82A 1LPPA 3R40A 1ZGCA 4X6UA 3VVLA 4LXHA 2CBGA 4YX9A 3FLEA 4DTCA 2CKMA 3SWWA 1JJFA 3STWA 3F9CA 1BS9A 4YK7A 5EFZA 4H7FA 2Y2UA 1ZICA 5AP9A 3WWDA 2VA9A 1U8EA 2WTNA 5AKEA 2WLSA 1CEXA 4G5XA 2RI6A 1LPOA 2ZVDA 1EB8A 2OGZA 3HYSA 4GECA 4X94A 1AUOA 1K5PA 3QMVA 4W63A 5CT5A 5ALZA 1CUJA 2WUEA 3D4LA 1K6EA 3O9VA 3GUUA 1IZ7A 4BVLA 2CB9A 3WK9A 4B82A 4BCDA 4J0GA 5KWIA 4EA6A 3I28A 2QMQA 4BB0A 1CFJA 3S8YA 1IZ8A 3B5EA 5ALEA 1XZBA 1SCQA 2CZQA 5ALYA 2G63A 4EZIA 2OQVA 4MWSA 4BAUA 5BWBA 5HQ3B 1CUHA 4XIIA 3ZI7A 4FDMA 1J2EA 4UFOA 5FRDA 5E2IA 2H7YA 1G66A 4MYSA 4KEAA 4W1SA 2ZSIA 3CCBA 4FMPA 1UK9A 4Y2QA 5JZBA 3OOSA 4Y2TA 1QONA 1WCYA 5FPQA 1T4MA 1DQZA 2RHWA 4Y7DA 2VJAA 1LBTA 2QXTA 4OYYA 5AI0A 4QDUA 3C5VA 1DT5A 2BKLA 4E15A 3RARA 1ZI9A 4DMHA 3I1YA 4M0MA 3C87A 1A88A 3E0XA 3BE8A 2GBCA 4BBZA 3BDVA 5JD4A 3R3UA 5EIEA 2C58A 3OC0A 5CT8A 3WLAA 2QJWA 4UHDA 4DNQA 4G8DA 1AURA 3BXPA 4JNCA 1HL7A 2VF2A 2BJHA 4AQDA 1VJ5A 1ZD5A 4K6HA 1ODSA 1CUUA 1I6WA 4OU5A 2GZRA 3DEAA 3EIOA 3IBTA 4J7AA 3F8SA 1NU8A 1MTZA 5I8PA 1AQLA 3ESBA 3RKSA 5EHZA 2Z8ZA 2WIDA 2JBWA 2WIJA 2K2QB 2VT6A 5AH0A 5EI5A 4HXEB 4ZV9A 5T4FA 3IDAA 1LNSA 2WUFA 5FKJA 3DOIA 1XZEA 5C8XA 3AUKA 2OQIA 4YPVA 5AI9A 2FJPA 3U1TA 5JAHA 2ROQA 3WJ2A 3ED1A 2VJBA 4KR0A 1CUIA 1CUEA 1YAHA 2QKYA 1ZIXA 3W9UA 4BTLA 1G4HA 1CR6A 2HRRA 3BF7A 2DHCA 2QOEA 4HAIA 4EUSA 4BCBA 4CIAA 4UHFA 3R3WA 4N8SA 1E3QA 4Y2PA 4EY5A 4MYDA 3WWEA 4AMZA 3AILA 1CUXA 4U2BA 1J1IA 4BRSA 5I7UA 3FWHA 2WM2A 4E11A 4BC1A 2C5FA 4X71A 2PSDA 2I3DA 1WOMA 2JF0A 3PICA 4OB6A 3LLCA 5A6VA 3PF9A 4RGYA 3WA6A 1K63A 3NGMA 1SCIA 3WYDA 4ZV7A 2VSQA 5AM2A 4G4IA 1P0MA 2OCIA 2OCKA 4Q3LA 3WL5A 4B9EA 1WM1A 4LHEA 4Y2YA 5T4HA 2JGFA 3A2LA 2B9VA 4X6YA 1YASA 5CT6A 1FFBA 3M3DA 4J0JA 1J07A 5AOBA 3WJ1A 3D7RA 1MO2A 2XQKA 1CUZA 2JGEA 2HFJA 1JI3A 4X90A 2XUJA 2RHTA 4X91A 5D3ZA 3K6KA 3BWXA 1E66A 5IVDA 1KU0A 3QMWA 3RLIA 3U0VA 4CI9A 5J3JA 4F5ZA 1EB9A 2I3ZA 5ALWA 3AZPA 4WFKA 3WWCA 5HF5A 1ZD4A 1BRTA 1CRLA 2DSNA 3DNMA 1TRHA 4OPMA 5FP0A 1XQWA 1N8SA 3PUIA 2HA3A 3I6YA 7YASA 5FXMA 1DU4A 3FAKA 4Y2UA 3G9TA 1XQXA 1XZHA 3LCRA 5D7BA 4UHHA 2HADA 1THTA 3HJUA 2ES4A 4LXIA 5D3KA 4Q3OA 1VOTA 5FUMA 2PSFA 1DWQA 1XQYA 3GELA 5EGNA 3NOXA 2DR0A 2WG1A 4GDMA 1QIJA 3BJMA 4QDXA 2PX6A 5ESRA 5AJHA 4KAFA 4J0HA 1R9MA 1EDDA 1QO9A 4H77A 4KAAA 5HKAA 2VATA 4J3JA 4G4JA 2B20A 4BCCA 1CVLA 4EY7A 5ALUA 3WI7A 1JJIA 4MWTA 4TGLA 1VE7A 4WCVA 4UBLA 3B12A 4FBLA 3B3QA 4QA9A 4NZZA 1YS1X 2XT0A 4U2GA 3G0CA 2HA2A 2B4KA 2IITA 4M0EA 3R41A 3WA7A 4ZI5A 1ZOIA 3G8YA 1DT3A 3ESCA 2ECFA 4P08A 1CIJA 2CMFA 4EY4A 5ALFA 3KWJA 5CURA 1CUSA 1ETHA 3DDUA 4MQLA 2BUBA 4F0JA 2QT9A 1C4XA 2AJDA 3EF3A 3G9ZA 1ZIYA 1L7RA 4BTVA 3ANSA 1YA4A 3DKKA 3CN9A 3V1NA 2ZYIA 3OM8A 5JZSA 4JEIA 4B84A 1TCBA 3ZWQA 3DL7A 1EDBA 1F6WA 5LZ8A 2V97A 1RP1A 4IHAA 3BIXA 5ALNA 1EH5A 4UBOA 3TEJA 1H2WA 2X8BA 3AJAA 1DWOA 1UOOA 2H9YA 4WDQA 1GGVA 1R4ZA 5A7HA 1TKRA 4AB1A 3G02A 4X3CA 4F21A 5EHXA 5AM3A 1QIHA 4BAZA 3ESDA 4GLBA 4INZA 3V9AA 1EK2A 4UHEA 4CCYA 1DX4A 4OB7A 2XMCA 2PU7A 4F60A 3AIOA 3C45A 1U4NA 1P0QA 3N2ZB 3I6ZA 1E8MA 3GA7A 2HA5A 3IUMA 4DYHA 3DYIA 4Y2XA 5LYYA 1LBSA 1NU6A 1N1MA 2PKYX 1BEZA 4G8BA 2O7VA 1XRRA 1OXMA 5ALDA 1XZFA 3F97A 4N5IX 4P93A 1USWA 1YAJA 1BE0A 1TAHA 5FLKA 2Y6VA 3D59A 1ZD3A 3HSSA 4Y2RA 2Y6UA 1Y7IA 3ZV7A 5E4TA 4AZ3A 2XUQA 2C0PA 1ISPA 1YB6A 3BDIA 4FOLA 4RE6A 2WG2A 1ORVA 1WB5A 1MNQA 4H7DA 3W9BA 3T4UA 1YB7A 3CXUA 4ZREA 5K3BA 2O2IA 4H0CA 3E1GA 2EEPA 1WPRA 2OLEA 5HFNA 1E89A 3FYTA 3PFBA 5E4JA 5DLPA 1M33A 4BATA 1WB6A 5CXUA 1HKHA 1W6RA 2GYUA 1X70A 1B6GA 4WY8A 1FJ2A 1IUNA 5CT4A 3A6ZA 3JW8A 5ALJA 5HF8A 1H22A 2XLBA 5LZ5A 5FV4A 4C01A 4ZRDA 5BOVA 2WJ3A 4W1RA 2HA0A 1MAAA 5IKXA 4X95A 5SYMA 2H7CA 3I2KA 5DJ5A 1XRMA 3FOBA 2AJCA 4RPCA 1CLEA 5AI8A 5DYTA 5CH3A 3P2MA 4L3WA 4UHCA 3RK4A 3WZLA 5A71A 2XQJA 2ORYA 4Y2SA 4LIPD 2RONA 4M0FA 5EIHA 3T52A 3IULA 4ARAA 4PNZA 1SC9A 2QVBA 2J4CA 5DYYA 4D9JA 4FFWA 4WDRA 1ODTC 4CCYB 1UKCA 4CG2A 4DNOA 5AOCA 2PUHA 4G9EA 4B0PA 2CJPA 1BN7A 5KWJA 4H7KA 1AC5A 1QE3A 1QTRA 1Q83A 2VJDA 1XROA 1XRLA 4GEGA 5AK5A 2JGIA 4BE9A 5AI5A 1XRQA 1XFDA 3I2GA 3Q8WA 5AK6A 5FPPA 1UK6A 2QZPA 2WHQA 3FSGD 3L1IA 1VZ3A 1O6GA 4H7JA 2I03A 2Q0XA 5JATA 4XVCA 1WPXA 4UUQA 5LKAA 1N5RA 1G42A 3WL6A 5HF9A 5BV7A 1EA5A 2VEOA 4IH9A 1AMNA 1AX9A 3EQ8A 4UBKA 4UBNA 4QNNA 3O95A 2YYSA 2VT7A 4ZGBA 1GT6A 2CUTA 4DMKA 4DNFA 1CUVA 3FLBA 4HRXA 3ZPXA 4KE8A 2VJCA 4BZWA 2CEKA 1MT3A 2AJ8A 5LZ7A 1CPYA 3K2IA 1JKMA 4EHBA 3FCYA 4EY6A 3G9XA 4BYMA 3I2HA 4P9NA 4QDZA 1SFRA 4QWMA 3ZLUA 4BRZA 6YASA 2OAEA 2DHEA 4A23A 2OCLA 2WFMA 3WK7A 1TCAA 3KOOA 3KSRA 1QO7A 4MJ3A 5AOAA 1MX5A 3FVTA 3SK0A 5CT9A 1AZWA 3FYUC 3VXKA 5C7YA 1XZMA 1DWPA 1O6FA 5CH8A 3VJKA 3WK5A 1VZ2A 5EHNA 5ALGA 1MPXA 1CUBA 4AXBA 4X6XA 4QDTA 3HXKA 2LIPA 4QEKA 4FNGA 2JGKA 2PSEA 1CUYA 4I19A 3X3HA 3C6YA 4ZWNA 1TK3A 3QH4A 1LZLA 5KBYA 5DNVA 4B6GA 2W6CX 2X5XA 3CN7A 1VLQA 5AHXA 5K3DA 4I4CA 1YA8A 3ILSA 2WIKA 1MU0A 3BIWA 4C87A 1XZIA 5DWDA 4PO3X 1GPLA 4QDOA 1CQZA 2WU3A 4J0IA 1LPAB 3HEAA 4XX1A 1CUFA 1E8DA 1JJBA 4NVRA 1LPNA 2XMBA 5CRIA 3VJMA 3JYHA 2VAXA 1KU6A 1WB4A 3FBWA 3KXPA 5LKRA 3SX4A 2G5PA 2WUDA 3NWOA 4C4XA 2WHPA 1H2XA 1XKTA 3ICWA 1A8UA 1XZKA 3O0DA 3V1MA 3M81A 2XB6A 3WL8A 5AKIA 2XQFA 2QJRA 2WJ6A 4BZZA 3WZMA 3WK4A 4FLEA 2GYVA 3N0TA 1QLWA 1XZAA 1QOZA 2YH2A 5I9IA 3QVMA 4V2IA 3TGLA 1VA5A 3G0DA 3I6MA 1R50A 3DJYA 3S2ZA 3ICVA 3QMMA 3DYVA 3G7NA 5ALHA 4EB0A 3QPDA 3C6BA 1HPLA 2XMDA 5C81A 2EDCA 2R8BA 3H1BA 4I3FA 5FOQA 3AZOA 1EX9A 3D0KA 1QFSA 3VDXA 4A5SA 1FSSA 4BDSA 4PW0A 3ZLVA 4ARBA 3KD2A 3FYUA 5JASA 1EVEA 4OD0A 4UHBA 5CBKA 2I78A 4HZGA 3H19A 5AIBA 2QM0A 2OCGA 2QTBA 5AKJA 2JIDA 4DMCA 1ZI6A 1FFAA 2ZYRA 1Q0ZA 4QE3A 1MNAA 1GKLA 5LZ9A 2WIGA 4U2EA 1C7JA 4N8EA 3UUFA 2J3QA 3MUOA 4HTAA 3H2GA 2XQIA 1MX1A 1VE6A 1XZCA 4KRXA 1CUAA 5A7GA 5FDFA 2WIFA 2OXEA 1XLVA 2JGJA 4TVKA 4HRYA 5K3EA 4RNCA 3DKRA 4L0CA 3BF8A 2D5LA 3STXA 5K3FA 2XMSA 3IUQA 2XQGA 1DQYA 3H2JA 3R0VA 4MEAA 3H2HA 3MUNA 3RM3A 1BCRA 4GHWA 2YASA 3DQZA 3WYNA 4Y2VA 1KEZA 3WQHA 1BU8A 4U2CA 3O9MA 3H04A 2Y1KA 4WY5A 4O08A 2QS9A 1HQDA 4H7IA 2H1IA 2WHPB 1GQSA 1QIEA 5AKLA 4AX4A 3QYJA 2XUFA 5AO9A 1LPMA 3G9UA 3GBSA 2HRQA 4KE9A 3FLAA 5CW2A 5JALA 3IA2A 2OGTA 4X92A 4CIBA 4EBBA 1DX6A 2WFLA 1IUPA 4AMYA 2WQZA 2B61A 2XMGA 3PDCA 3H17A 5DNWA 2WU4A 2XLCA 5EIAA 3WMRA 4UBJA 2G4LA 3AINA 3KDAA 4DMFA 4HS9A 4KRYA 4MEBA 1K4YA 3DD5A 2QR5A 1H2ZA 5K3CA 1UKAA 3C43A 3D2CA 1R88A 2PM8A 2WSLA 3JWEA 3W04A 3BJRA 3BL8A 4DSZA 2C5GA 4W1PA 1GPKA 3LS2A 5JANA 2PPLA 2P8SA 4OUKX 1QIIA 2ZJFA 3HACA 4NMWA 4KYVA 2XUPA 1EINA 2NW6A 4JYPA 1FFDA 2XUAA 2AJLI 3A70A 1EVQA 1QFMA 5HFAA 4GW3A 2JEZA 1UT6A 3I2IA 1XZDA 1IMJA 3GFFA 5JAPA 2BUAA 2QXUA 3DCNA 2EDAA 4A16A 1ZD2P 1B41A 1TIBA 3AIMA 3R3ZA 2ONCA 3A2MA 2G5TA 1N5MA 2GBIA 4FKBA 3H2IA 3O4IA 3H18A 4C4YA 1EK1A 5K3FB 2WTMA 1UOQA 3HZOA 3HABA 1QIMA 4U2DA 3C5WP 4DM7A 4OSEA 3LIPA 1R3DA 2HU8A 2W22A 2FJ0A 4LKOA 4E14A 5ALTA 4Q82A 3PE6A 4X00A 1CQWA 4S0XA 4DIUA 3C6XA 2BCEA 5JD6A 4CCWA 4DNPA 1CUWA 2C0QA 3WIOA 1UOPA 2O2HA 4Z49A 1GZ7A 1MAHA 2WHRA 5BWCA 2HL6A 5HF6A 2IX9A 3WKDA 4LYEA 3GZJA 1XLWA 2WFLB 5E4YA 2JGLA 4X85A 1HBJA 2ZYSA 4AO6A 2DHDA 4BVJA 2ACKA 3G0IA 1BCSA 4ETWA 3QITA 1F0NA 1JU4A 2HHAA 3D2BA 4JUIA 4PSDA 3UUEA 3AIKA 1FFCA 4LYDA 5C8VA 1F0PA 5JAOA 4X93A 3IURA 2JGMA 2XDWA 4FTWA 3EQ9A 1AGYA 1ZI8A 4BE4A 2DFPA 4TPKA 4ZXFA 5T4EA 2C4HA 1L7QA 3DL4A 3EBLA 5AM4A 4G4GA 5LLSA 1QIFA 4UPDA 4H7EA 5YASA 1DTEA 3H1AA 1JMKC 5AI4A 1EDEA 4N5HX 3L1HA 3HRHA 4HXGA 3LIIA 3FVRA 1LZKA 1ORWA 4XWGA 4IQ4A 5ALPA 3O4JA 5IH7A 5IVIA 3R3VA 5ALOA 4WFIA 3O4GA 4Q05A 1VXOA 4C4ZA 4DGQA 2HIHA 5CH5A 2BUCA 1T2NA 1A8SA 1AKNA 5CTAA 1ZGBA 3AFIA 3HC7A 1TCCA 4L72A 5IVHA 1W76A 2DQZA 2GZSA 2XUOA 5K5EA 4PQEA 2IIVA 4IH1A 4B85A 2QUBA 5EHQA 1PJAA 2XI4A 1MN6A 2R11A 4CFSA 4EY8A 5ALKA 3E3AA 2AJBA 3E4DA 3PF8A 1YS2X 2WILA 1GQRA 3WKEA 3HI4A 4MQMA 3DLTA 3VISA 4PF1A 5LP1A 3WKAA 3D5EA 3STVA 5ALRA 1A7UA 2HDWA 1QIGA 1CV2A 1YR2A 4AN0A 1YSCA 1E8NA 1LLFA 4PV7A 5CMLA 2BFNA 5AKYA 1QJ4A 3DS8A 1CUDA 5H3HA 1S8OA 2AXEA 5AKGA 5AKHA 1ZJ4A 5ISMA 1Z68A 1QZ3A 4K6KA 1EXWA 1XKLA 3WL7A 3IIIA 3R3XA 2RGUA 3AZQA 1EI9A 4IH4A 5ALLA 4QWWA 2ZSHA 4KACA 2WG0A 1W52X 4AN1A 4GXNA 2XMZA 1VA4A 1D07A 3HLKA 2GYWA 1W75A 5AKZA 2PBLA 4QZVA 3MGAA 2PSHA 5T4BA 4B7ZA 2BGNA 4UFNA 3F96A 1OILA 3QZUA 3DOHA 5DTIA 3VKFA 1JMYA 4K5QA 1E5TA 1Q0RA 5JD5A 3F98A 3ESAA 2QRUA 4H7HA 5A2GA 5AM5A 4FBMA 2GBFA 4CG1A 4NS4A 1R1DA 5ALIA 1BEEA 2H7XA 2XUGA 3K9BA 2HU7A 5JZ9A 5A7FA 1F8UA 4B0OA 2HA7A 1MX9A 5AKXA 4MXDA 4UFPA 2DQYA 4GI1A 3WIBA 4FWBA 4WJLA 3TJMA 5K3AA 3W2TA 3PI6A 1UKBA 2VTVA 4LXGA 4QLAA 3WWOA 1RWQA 4HXFB 1TQHA 2PUJA 4FLFA 3O4HA 4G1FA 3I2JA 2JEYA 4XJVA 5F4ZA 4W9RA 1OCEA 2J3DA 2RIPA 3MVEA 3QPCA 1K8QA 1SCKA 3C6ZA 3SC2A 4FLMA 3G0GA 4Q34A 5AK3A 1X2EA 1WHSA 3C8DA 1GKKA 4P92A 3H0CA 3G0BA 1XZGA 3QPAA 4J0CA 3STUA 2PVSA 5LZ2A 2GBGA 2XE4A 2ZYHA 3STTA 3YASA 4BC0A 4FHZA 4IO0A 1DINA 4H18A 2QUAA 1UFOA 1UXOA 3FNBA 4PSUA 4YASA 4OU4A 5AIAA 4B81A 1LGYA 5LIPA 3WKBA 1GXSA 5HK8A 3WWPA 2Z8XA 2YXPX 4ROTA 5JAUA 1ODCA 5ALXA 5ALSA 1CUCA 3OURA 3W06A 3H2KA 4KAJA 1R9NA 1XRPA 2Y2VA 2OAGA 4KJXA 5AM1A 1XQVA 2XUKA 1G5FA 4HVTA 2WFZA 2XUIA 2V98A 2XUHA 4OB8A 2XMRA 2V9ZA 1J06A 1Q84A 4J03A 2DCMA 1XZJA 4OCZA 3QBJA 4WFJA 1QIDA 1LPSA 4UBIA 1Y7HA 1CUGA 4ITVA 2HU5A 1HLGA 5KREA 2OG1A 4DSAA 2WJ4A 2Z5GA 4JH0A 5AICA 4AO8A 3UMJA 3I2FA 1WHTA 2RAUA 1THGA 4QLOA 3F67A 2OPHA 3PUHA 2O7RA 3GROA 3L1JA 4C89A 4L9AA 1BN6A 1U65A 3STYA 4K6GA 2PU5A 4G9GA 4X97A 2WKWA 3FCXA 2D0DA 1BROA 3VVMA 3M83A 1NX9A 4X7BA 3QM1A 1GPNA 1H23A 3OPMA 1VXRA 1W4LA 3A2NA 2PSJA 1XLUA 4Q1VA 5AKKA 3OG9A 1XZLA 3ANTA 2BAGA 3NUZA 2HM7A 2UZ0A 2VQ6A 4H35A 5HZGA 5AK4A 1QGED 4J0KA 1YCDA 4BAGA 4C88A 3I1IA 1LPBB 5C8ZA 5DYWA 3D2AA 1X2BA 2XMQA 4U2FA 5A62A 5ALMA 3Q0TA 4K2AA 5HCUA 2O2GA 4GBGA 5DNUA 4G8CA 4B83A 1A8QA 3C8HA 4FNMA 4UBMA 3FSGA 3R3YA 5SYNA 5IVKA 5JADA 2FX5A 2VAVA 1C7IA 5DTJA 1RYYA 4AO7A 1FFEA 1XRNA 4E46A 4RE5A 3LP5A 2ZJ7A 2ACEA 1JT2A
chains in the Genus database with same CATH superfamily
2DWQA 1M6WA 2C2MA 3ANXA 1GQFA 3NALA 2QRZA 3I45A 5FYDA 1V71A 3VVCA 5HS4A 2Z3WA 3ZY5A 4GBED 4Q9LA 1I0LA 2C7BA 4ENWA 1FW8A 1J0AA 5KVSA 2C8JA 1WKCA 3OPVA 4X3OA 2YN4A 2RDMA 4OJQA 4PXYA 2Q41A 2W2PA 4GWLA 4TZTA 4MVJE 3PRJA 4X8LA 3KWFA 4EG7A 1R15A 3TRKA 2ZIUB 3RYCB 3M9LA 4HAOA 2WPDA 3CFYA 1P19A 4J0DA 4S1OA 5K51A 4KBFA 1VMKA 1UZNA 3AVQA 4B8YA 2X77A 4NLLA 1HMPA 4UUOA 4F5DA 5JIBA 1WDMA 2Q6LA 2P3SA 1C80A 2WBLC 2P4EA 3EF1A 3GYGA 3SS8A 2HA6A 4TWRA 4OKSA 3DEHA 3BPSA 3TTXA 1UXJA 1D6NA 2A14A 2IEDA 2VJPA 3HU2A 3LDAA 3OEHD 1SAYA 2LCIA 3OHSX 1R6UA 4RY2A 1W9MA 4HTFA 3AY3A 5B4VA 4Y2GA 3IJRA 2FOIA 1T0HB 4OH7A 4B4WA 4TXMA 5GY7A 5KYUB 1SOMA 1QIKA 1ZISA 4LE1A 4NPAA 3GRZA 3AP1A 2XUDA 4WKGA 1YKSA 2KW5A 1KDRA 2FPOA 3C7TA 4W7IA 1YI8A 2VTDA 2LCQA 2VYVD 3R77A 3L43A 2DY1A 3K96A 3VVBA 5JY1A 4ZK2A 3ED5A 3GQBB 3FIUA 5ALVA 1XAJA 4NV1A 4AZ0A 3DVSX 1T1EA 3H5RA 1QKKA 5KAMA 4NNOA 4OFZA 2GJSA 1NQVA 4UC0A 3FMGA 4X1IA 4YJFA 3ZLTA 1EAMA 2Q3FA 3Q3VA 4A0HA 4CEJB 1NVTA 2G1AA 4ZV4A 2O2DA 2I1LA 3FGPA 4YMGA 1CF9A 1X7HA 5EXDA 1VPDA 1EHYA 2ISQA 3BIFA 1GTMA 1KL7A 3PFCA 4NONA 5JZOA 3KD3A 5K6TA 2WR8A 3CNHA 3MD0A 3FH0A 3FCAA 2C92A 1NC1A 5EZYB 4P0QB 4I55B 2HJWA 4ZJUA 2VZLA 1TD9A 1PTJA 3U4CA 2A4MA 6NULA 5GZ3A 2VIIA 1OFTA 2M6LA 4XOIA 1PK9A 3EDRA 1N92A 3LQKA 4MI1A 5DP1A 1QX3A 1VGVA 1H2YA 3VJLA 1JFTA 1L7PA 1OJLA 2IOFK 2Q0SA 4HWKA 3QOXA 2DULA 3TAXA 1ACLA 1EUCB 1NAIA 2JCXA 1L1RA 1TC2A 3DBLB 2SCUA 4IXMA 5G1OA 2ZJAA 1U2DA 3FBGA 1ZA2A 3WADA 5BWLA 3GVXA 1EK6A 1ACJA 2CD9A 3NORA 2JIQA 3TLAA 4KREA 1CG6A 1RXWA 3LHSA 2Y1XA 4LY9A 4N3CA 2PZEA 1GSIA 2XYHA 3AERA 4QG7A 2J6HA 2P4UA 4QGBA 1YJ5A 3RF6A 3UHOA 3W8DA 5DBFA 1ZGCA 4PPGA 3K32A 5BT9A 3F8TA 4P4TA 3MMXA 5EJ6A 3ABQB 1L4KA 1NBMA 2CBGA 3W6NA 4RTJA 2I67A 4YCDA 2IXBA 3A04A 5JNWA 2CKMA 1G6HA 3JZIA 3C3AA 3SWWA 1SUEA 2RAFA 4PU0A 3GNQA 1J49A 2CNLA 1C1XA 3M0EA 2VXCA 1DOHA 4H7FA 3LWZA 4INJA 2VAMA 2YVLA 3HJHA 3LWBA 3WSTA 2NVOA 1N0UA 3LPNA 5BVGB 5DLQC 5ECDA 3SYNA 1ZS9A 2NAFA 1JLSA 2JFPA 3WE7A 1ZICA 4XPIB 4RV9A 4JLUA 3LUAA 2OY0A 1MC8A 3L41A 4QNMA 1Q3HA 1TA4A 2XWSA 4NBKA 4ZALA 5J63A 3JARB 3WYBA 5D2CA 4UKDA 2JDIA 2R5NA 4KR9A 5H82A 1H3NA 4PYIA 1CEXA 2FPWA 5JXHA 5L7TA 3UJ3X 2RI6A 4AAYA 1ZNXA 4QYWA 4ZVLA 2HF2A 1FEZA 1EB8A 1TAGA 2HK7A 2J8ZA 2JAPA 2OGZA 2ZLBA 4GECA 3HUFA 2PGAA 3QMVA 3A4IA 5LQJA 4KIFA 4FJ0A 1OQAA 3HNOA 1H8EA 1KXZA 2WNHA 4W63A 5TMEA 2C83A 3JSAA 5ALZA 4R3UC 8ADHA 2OD7A 3EHEA 1WE2A 1XNQB 1DTWB 1VMAA 4JLKA 3ZD6A 2QPAA 3H9UA 5SZIA 4TKUB 5ABPA 1IYZA 3PG5A 2BFCB 4XGIA 3MGCA 4KO3S 4M9SA 4UCFA 4M1SA 1H2HA 4GI5A 4IJUA 3K0FB 3CW9A 3CYFA 5JISA 3JQBA 4XX0B 5LBTA 1GRVA 1N8KA 3JQAA 3ZIUA 3GRYA 4RK1A 3BQNB 4ASUD 4F8JA 3I28A 5KQGA 2QMQA 4BXOB 4YRFA 4D2IA 5DW3A 1DAPA 4G24A 4URXR 3A4NA 3KOYA 1CFJA 3CHYA 1AQNA 3S8YA 1VJTA 3EVGA 2WYVA 8LDHA 4RMJA 2B6HA 4ALMA 4BQFA 1Z2CA 2VWPA 1XZBA 3BEOA 4G5RA 1I5OA 1RIFA 3CUKA 3PDJA 2RGDA 3Q1KA 3JQFA 4Q12A 4S1PA 4EZIA 1FNNA 4F3RA 4LKRA 2A9JA 1EX6A 3PVSA 4NH0A 4MGYR 4U6QA 4NCBA 5HDQA 5BWBA 5BV0A 2FG6C 1W8DA 5C9ZA 4BNGA 1JKIA 4GXNA 4KCGA 3ZI7A 3FHCB 1SOVA 5GMOA 3X1WA 5J23A 3OX3A 4BWGA 2FR0A 2PMFA 2H7YA 1G66A 1MDFA 3REQB 3WGVA 3HY3A 1DO8A 3IOCA 2MU1A 5CDHA 4L5IA 2GXAA 5GQSA 1KMHB 1G8YA 2YMMA 3N86A 5A4DA 2X9QA 4PO8A 1ZD9A 3VKWA 5B6JA 2I54A 4OK5A 3CLKA 3M4YA 2DAPA 1I33A 4GICA 2C57A 4Y2QA 5BN5A 5JZBA 5J5CA 3C4QA 3DT6A 3WNVA 5G40A 4OM8A 4RA9A 1A69A 1T4MA 1CY1A 3E18A 3UGKA 3GDFA 4DRXA 4K9SA 1SXJE 4LMAA 4ZAGA 1ZC3A 1YQUA 3A4YA 1U8FO 8ABPA 1PR6A 2WJZB 3M2PA 4HNSA 2QXTA 1D04A 3PQCA 2B30A 4OLHA 2FW1A 3THYA 1H4SA 1CEYA 1YNSA 2B5OA 4MUMA 4RF2A 4MVXA 2HWWA 1SBZA 2P9BA 2JFYA 3WYCA 3FROA 4DADA 1JZQA 2UVPA 4IJQA 4I9NA 4WEQA 1FA9A 3C5VA 3RIXA 4HEQA 4N3NA 3QG5A 4FGSA 1Z2OX 3IT2A 2C1XA 1W2GA 4RK6A 1UEJA 2JIZD 4EFNA 4V03A 1A88A 5BSWA 3E0XA 2L19A 4M8NE 3TPCA 2GBCA 5CDFE 4BBZA 2YOHA 4O4IF 3L0ZA 4Q3EA 2ODAA 5EE1A 3S28A 3BDVA 3H4VA 4D4HA 5JD4A 4F7DA 1YCFA 1VCHA 3E9DA 5EIEA 1M75A 1IPEA 1QBKC 2OZVA 3IDQA 4CMIB 2UZ3A 3BTSA 4BX8A 5CT8A 2ONJA 1A9YA 5JSFA 2O1XA 5HS6A 2QJWA 4E4TA 4D4GA 3TPZA 1UDWA 1LK0A 1X13A 4PZZA 1AURA 4WWHA 5LP6C 3A6PC 3SR0A 1ZR2A 4P86A 3MPUA 5I7SA 1ECPA 1FUYB 4RVCA 4DMGA 2BJHA 3L2OB 4IJ5A 4AQDA 1TCUA 5I6DA 1FX0A 3ZJVA 2R6DA 3QELB 1RJEA 4KPUA 4G81A 7ABPA 2AR7A 3RVOA 1CUUA 2XOXA 3VKGA 1HE4A 3EIOA 2JIRA 1EE2A 4MTCA 4BRWA 3IT0A 4ZI7A 3LQYA 1M0WA 1XEAA 2NO5A 2CYBA 2HY7A 3FWPA 4DV5B 1M2VA 5BMVA 2XEDA 1E7YA 1ULZA 2P35A 3C48A 4J90A 3L49A 3CH6A 3ZCVA 1D8TA 2Z9CA 2FSIA 2CLFB 4O4LA 3ESBA 1QMPA 2ZXEA 1T4DA 3NPMA 3R9XB 1RRCA 1MQSA 2IYOA 4A0GA 4BN5A 3BSSA 3TLMA 1E1MA 2DWUA 2ZTMA 1WVIA 1L3IA 1AD2A 2FKNA 1QXSA 2JBWA 2XGGA 4DDHA 5KPDA 1XHFA 4RKFA 2DETA 1LWOA 1NOIA 4MWZA 4GI3A 1DO2A 4B76A 1XEFA 4EOGA 1X1SA 1LCIA 1YV9A 3E4CA 2X0JA 1ZUWA 2WKQA 1E6UA 1C1DB 4IAOA 3ZE1B 1LNSA 5F3WB 5FBZA 1L7DA 4N0DA 2AI2A 3ZU2A 3W3AA 1NMSA 3OI7A 2E4VA 3QA3E 4RM2A 2FQ1A 5B3AA 5BWMA 2I22A 3DOFA 4KH0A 1XZEA 1R4NA 1XCJA 3EDQA 1YD7A 5HUQA 3LY8A 4YRTA 3V8NA 1DJNA 1LC0A 1NN5A 4MKRA 1TEXA 4JKYA 4BFTA 4CUKA 4C5CA 3AXSA 2FUNB 4YRAA 2V1UA 4AQ7A 1PCXA 4BO7A 1WS6A 2VPYA 2ZOSA 4OJYA 2NUAB 1CUEA 4L8GA 4PHHA 4GEKA 1MTOA 4HQ6A 1CDEA 3WGLA 4DC0A 4YEDA 4DIEA 4BQSA 2E4UA 3PJFA 1UXGA 1ZIXA 1SOWA 2D74A 3AW8A 3PQ3A 3RBXA 2ZJZA 5GOTA 3UTCA 5DGHA 2WWHA 5B7GA 3CX4A 1UKZA 1QLHA 1PW7A 1T3LA 1THMA 2QR2A 3UAOA 3VNRA 5ITWA 3AONB 3UBMA 5KJ1A 4QXQA 2AZ4A 4L28A 2DHCA 2W48A 2GF2A 2PE5A 3IAAA 2O2SA 2QJOA 4EKIA 5TMDA 2BHTA 1XELA 3D1JA 3RUFA 4C3VA 3UBTA 1P74A 3ZJUA 5CAEA 2ZRDA 2FHPA 4GSLA 4AKGA 1VECA 1I2DA 1JQEA 5THQA 4EUFA 1Z56C 4ECAA 1OBCA 1P9RA 2H08A 4U3JB 4ZEXA 3TD9A 1WVGA 1DXYA 4BCBA 5CYFA 4UHFA 2Z43A 1WP9A 2ZT8A 3GJ3A 2YHIB 4N8SA 1T9HA 1E3QA 4LGVA 1JG3A 1PO7A 4MYDA 3M6LA 4QOEA 4GZMA 5HJ7A 3SQXA 4JOCA 4AC9A 3E2PA 4HOYA 4ZVTA 4D4JA 2IVFA 3CB2A 4H3VA 4U2BA 2VQFB 2ARKA 2ZU0C 1WF6A 4POOA 3K0AA 1AKEA 3ADPA 1DKMA 5EJEA 3TTVA 1ILEA 5KO2A 2OV4A 2Z98A 2FP4B 2C5FA 2AXNA 3T41A 2A67A 1PVOA 1FDTA 1AN9A 3PICA 2GA9A 3GJ6A 4KQJA 2WT8A 3HBJA 3MCUA 1JS1X 4OFWA 2FEWB 3LLCA 4HPXB 2YWRA 5H02A 1K3FA 3KPWA 3RUIA 3ZZNA 5G0SA 5JS7A 1PKEA 3G8DA 4AY6A 5A6VA 4XVHA 4QREA 4RGYA 4B87A 1T5OA 2AOTA 2ICAA 4FZ3A 4PGGA 5IUKC 2CHUA 2ZUTA 4M6WA 2PKXA 4IIJF 1X7GA 2OORA 3AR6A 4F2HA 1G20E 2FSFA 5J47A 2H92A 4ZV7A 4CPDA 1SQSA 2C3YA 3HV2A 4BO6A 3HFJA 2GAIA 4JP1A 1BKSB 1A8PA 3SYLA 1ZOPA 1DIAA 2ZAOA 4YCAA 2OCKA 1J21A 4Q3LA 3DKIA 2HLDA 2O2JA 4B9EA 1WM1A 3LWNA 4EHNA 3QXXA 2GRUA 3ZWVA 5BO5A 1KYVA 2VC2B 1HE3A 3GFSA 4WK4B 1O96A 2CKDA 3R09A 1HF3A 4HAZA 1CJKC 3D1LA 2W70A 1FQKA 3M4XA 3AHCA 1NL3A 3ESRA 4L4ZA 3TQOA 1GDHA 4EA7A 2NU6A 4LNAA 2PRIA 1F9AA 3CF0A 1OZGA 1R0SA 5GOZA 2DM6A 3EASA 3GDOA 2DZDA 1HI9A 3H99A 4ZD6A 4LWQA 3WB2A 4IF4A 1M1UA 3RRNA 3LDUA 3PWTA 3IA7A 5IK2D 4NAUA 2FFBA 4O3MA 1YH3A 2B2XA 3H84A 3LKBA 1J07A 2P7HA 3TVYA 1NJ1A 4D8YA 3AUFA 5AOBA 1B15A 1PQPA 2AG0A 4EMSA 3D7RA 4JDPA 4LSMA 1R8YA 4WLVA 5LD2B 3IVAA 5FIUA 3EG9A 1K1EA 1K5DA 1E6WA 2C4KA 2XF8A 2XQKA 3PC8A 4QATA 3EDYA 5IW8A 1ZK1A 5KQLA 4WN9B 3CNNA 1QSGA 2GPWA 3SQLA 1GU7A 4O4IB 2J3KA 1P2UA 2QI9C 2NZ8A 1JI3A 1Q21A 1TA9A 4RSRA 4WNAB 3WGMA 4F2PA 5LLDA 4XYLA 5HGXA 2F8TA 3GRUA 2CK3A 4JBWA 4JB2A 4BNLA 3KVNA 4OGFA 3BWXA 4YAJA 3QFHA 3E7XA 1KU0A 3LI2A 1LW6E 4ZDWA 3S1AA 2GVDC 3QMWA 3C6QA 3KEQA 3U0VA 2V6FA 1M7BA 5J3JA 2R6CA 1R12A 3BB1A 4F5ZA 1A9XA 6ADHA 1OI7A 1VYHA 5HMMA 1DC4A 4YRJA 4BU0A 1NTRA 5FTNA 4JL6A 3LW7A 4KPFC 4F93B 4BO9A 2Q0QA 3KUKA 3I3SR 3WWCA 5FT9A 1Y8ZA 3DDWA 3DNMA 1BRTA 3I9FA 1PQUA 2QLJA 4OPMA 2ZR8A 5DSXA 4C2BA 3JALA 4HUTA 1G6Q1 4F7WA 2VYND 1BHQ1 2R97A 4RZHA 1N8SA 5KKNB 4PN3A 3HP4A 2HA3A 1YBHA 1FXWF 2MR5A 2ZVJA 3NI2A 2OENG 3P9SA 3RWOA 1G7RA 4TYQA 3UHFA 1D1QA 1OW3B 2QMHA 2X5OA 3H1EA 1CR4A 5E6UA 4ZU1X 10MHA 4QECA 3MXTA 2AR9A 3MQFA 4Y2UA 3IGFA 1YMVA 5L3SB 1VLZA 1XQXA 2ILVA 3SZLA 3LCUA 3SS7X 1DBVO 2VNJA 4TWZA 4KMRA 3NFYA 4OFBA 2C2XA 3JQ9C 5FOUA 1YUBA 1IXRC 1SCUB 1XZNA 3HJUA 4FS8A 3F6RA 4LXIA 3ANLA 3U13A 1U0EA 1OFVA 4Q3OA 3JASA 3PC7A 1BEUB 2RC5A 4MRMA 1Z5OA 3THWB 1F38A 3PDUA 4AIRA 5ARDA 1NLUA 4KMMA 3MCTA 5EMMA 1DWQA 4K9PA 1DE0A 4Y6GB 4CIXA 1FP6A 2NSHA 2XZDA 121PA 1G8GA 4ZAYA 2NVUA 4JCCA 1QIJA 3LHKA 4UMVA 4L6CA 5K0CA 2IXGA 3AL0C 4DDMA 1J5EB 4ZICA 5JS8A 2Q5FA 5ESRA 2RGEA 2Y1FA 4WFQA 5AJHA 1JV2B 4RK0A 1ZUNA 3QKUA 3VC1A 3NOOA 1ULHA 2A5FA 1S7GA 2I5PO 2YXNA 1USIA 4KAFA 1V7QA 2ANBA 3GZNB 4P7BA 3LCVB 3G2HA 4IWNA 2NACA 3LX4A 4WKOA 1GVNB 3WGKA 1EWYA 1RJ9A 4XAQA 4YRDA 5FL7D 1CYEA 4TXNA 4KAAA 4LSZA 4D9GA 3P26A 4GQIA 3KLBA 5DN9A 3VO1A 1U0NA 4PLYA 1DCFA 1QO0A 5EPEA 4QYXA 2B20A 1Z6QA 5F5LA 5UKDA 3T1NA 4BAGA 4BCCA 4D46A 2IE8A 2BFFB 2VFAA 3FYDA 4G1UC 5KYWA 3O1LA 2ZIWB 4E1BA 2WZQA 2I66A 3OO1A 4TTPA 2Q3DA 4UM7A 4D41A 4NE9A 4ZZ0A 3TGPA 4UAVA 1RQPA 1U7ZA 2F4NA 3TXYA 2VHXA 4TGLA 3X43A 5D1NA 3EXHA 1RYNA 4G67A 2G08A 2ZS7A 2EL9A 2YMPA 1Q19A 5EP3A 4Y1EA 2YS7A 3GI1A 1G8PA 1X92A 1YKFA 2MYUA 3B12A 3I32A 3C24A 1U0JA 3ONEA 5I7HA 2HN9A 5MN5A 1EAYA 4C7BA 3ZD8A 5AW3A 4Y0NA 2RHJA 3AY0A 3IAFA 3O92A 1AH2A 1Y33E 3BB3A 2C9DA 4TV8A 1E1YA 4KHPB 4BQOA 1YBFA 5CCEA 1U90A 3VBCA 1ZNQO 3ACDA 2OFOA 2IITA 3IQHX 2GI4A 4DV3B 2FN8A 3OPYI 3RABA 5EWJA 1UT5A 4FJ2A 3RT1A 2I80A 1PIWA 1A9SA 1TIKA 4LY0A 4W99A 3E3LA 2BBWA 2IP4A 4F1WA 4EP1A 3PC2A 1SWWA 4ZO7A 5ELMA 3VR1A 1B6RA 2RBKA 2V7PA 3LL4A 3MTEA 3H3JA 3D7SA 3PPXA 3NH6A 3SGLA 2C0CA 3G2NA 3JQ8B 4IDAA 3QU4A 5JTUA 4LJ7A 1Y3CE 4RKWA 1TCVA 3KHUA 1TJPB 4LWZA 1YVPA 1I01A 4X64B 2OEPA 5B1HA 1QU3A 2IOYA 1DDGA 2WWGA 4UREA 1H1LB 1KMMA 4YCJA 2PQMA 1WUHS 4Y6RA 1CIJA 3AM5A 3LNTA 4EY4A 3U9SA 3JQGA 5ALFA 3Q3CA 2FLVA 5CG2A 5KUTA 1JLHA 2ZBEA 2G7MC 3EEBA 3PFWO 3DDUA 2DLCX 4L3OA 2PGIA 3ZW9A 3BWDD 2EJUA 3MWJA 5BRJA 4HN2A 4LXUA 4B79A 2EWWA 4B71A 1I1HA 5AK0A 1KYXA 3AUTA 1ZU5A 3DH0A 3PGVA 5A1TA 1JR3A 4HX9A 1HYQA 1A4RA 1L7RA 1X1BA 2OFXA 3G1WA 3QU9A 3AYXB 2MSDB 3PFNA 4DZTA 5EIXA 1QZTA 2EKZA 4IOKA 4BTVA 2EARA 1IY8A 2CF5A 3L1VA 1QR6A 2XSZD 1NYRA 3CIFA 1K9VF 3HUTA 1Z38A 1UMDA 3E9CA 1RKBA 3MC1A 4OQEA 3ZXXA 3WBJA 4RD4A 5JZSA 3ZCPA 4HAUA 2ZQZA 4JEIA 4Z7OB 1K66A 2ODPA 2WW8A 3WB0A 4KIUA 1EDBA 1V0JA 3NNDA 1F6WA 1O3YA 2H29A 3KE8A 1N3YA 1SQ6A 2MSKA 4H1HA 3OP4A 4WT7A 3FETA 1P9LA 3UHAA 5KU1A 4X61A 2NUBA 4UBOA 1CZUA 2BTOA 5FV7A 3RFUA 5BR4A 3TEJA 5IF9A 2EIHA 2BGLA 3CM0A 1HNWB 3DJFA 1T25A 3AJAA 4HNHA 1A04A 4ZTBA 2H9YA 1O5TA 3B6ZA 3WP1B 4WDQA 1GGVA 3OLZA 3MWEA 2G72A 3NB0A 4BFZA 5KYYB 1AXGA 4AW9A 3QYPA 4FCTA 1VRWA 2XXAA 1M83A 1GDDA 5JAQA 1I7NA 2WB4A 3SZOA 3BWBA 3QVGB 3SKXA 4UJ5A 4BAZA 2NV0A 3WLTA 2AMYA 3MTAA 4MP6A 5DHAA 3KQSA 1BAPA 1SUBA 4ZMBA 1XJCA 3S2IA 2QM3A 2CWWA 1Y7PA 1KEEA 2QEQA 2A1UB 4PZ9A 4HEHA 1RI1A 2IYNA 4UHEA 5H0IA 2J07A 1DX4A 2YV3A 4KNVA 4BN4A 4BV2A 3SHWA 1HEIA 3AIOA 4JB8A 1ZMXA 2MTBA 2PZAA 4BNHA 3QE2A 4QULA 2GK4A 3C45A 3GT0A 3ZU3A 1Q77A 3OOYA 4EYOA 1WSDA 3U6KA 1P0QA 3EFBA 5A1JA 3RUDA 1ONOA 5CGZA 3BB4A 3CSDA 3JQRA 3N2ZB 4RCZA 2WUVA 4TV9A 1ZK4A 5I9BA 3GA7A 5KOHB 1LVUA 2AQIA 3SJ7A 1RI3A 4GNKA 4RV5A 3VKHA 1L4GA 1NBOA 1JIXA 1U1IA 1N1MA 4R1LA 4MRVA 5CK4A 1VFPA 1X1EA 3TRFA 1NNI1 3AKYA 3E2MA 5JR3A 3OX4A 2ZYGA 1WZUA 4WMLA 2AHRA 2Z57A 3D8HA 5C5IA 1F06A 3ICOA 5CYGA 2QTZA 2CFIA 3ASZA 4PSAA 4EMUA 4JY7A 3K1JA 3JYPA 3DMDA 4HK4A 1SUSA 2HLHA 3P8ZA 4RSMA 4DZRA 3NEAA 5DBHX 1E60A 2OD9A 4G0MA 2QVLA 1USWA 4G01B 5GAJA 3VR5D 3ZKWA 4QFDA 2WKSA 2CNBA 2BFEB 2IEBA 3LPCA 5C1DA 4DY6A 1KBQA 3D59A 1DO0A 4M88A 3RYFA 2QL9A 1CJMA 4JBNA 2J9YB 4CEHA 5JZMA 2R6R1 3VO8A 1V3VA 2PUTA 1HFKA 2Y6UA 4OHKA 4Y2RA 3W8NA 5AJWA 3RD5A 3ZV7A 2GH1A 2JIBA 1GGNA 3RSQA 4C3ZA 4QXRA 4J4TA 2C0PA 1RQLA 3QEMB 4Q4DA 3BIJA 3H4MA 4IICA 1B0AA 2HQRA 1YB6A 4RWZA 3QBTA 3TRIA 1SHLA 4CXMA 4AJPA 2WG2A 4I1SA 5KVVA 1VCOA 1WB5A 1XK7A 3I05A 4R2XA 1GKIA 5G53C 2EXXA 1SXJC 3UHPA 4QC2A 2DWOA 2PQ2A 3F6SA 1U9YA 1IJFA 4TVBA 2C96A 3VR3D 1PS9A 2GZAA 2Q99A 1YB7A 3CXUA 5IAEA 5K3BA 2O2IA 4FHEA 3GAMA 2I4LA 2EEPA 3KAPA 2IVZA 3DGFC 2V7XA 1BD3A 3TLXA 5BYKA 4OOFA 2P67A 4P31A 4RVOA 4XH9B 2DQ4A 2PYIA 2UYOA 3F5FA 3PX3A 5HFNA 2GTHA 3NEJA 5B1YA 2YRWA 2QTGA 4X65B 5L6LB 5ADVA 2P6MA 3OT4A 3A1WA 2AWNA 4CI0B 5E4JA 3KOXA 5IC4A 1JIQA 3UJHA 2JH8A 4GG1A 4ND4A 5DCUA 5DDIP 1XTKA 1RACA 3QTLA 5CXUA 1HKHA 1W6RA 2SNIE 2BR4A 1VJRA 2WRZA 4LZOA 5D3MA 3OQOA 4IOLA 1QG2A 2DTXA 1XMXA 2NU9A 3AEQA 1ENYA 4HWTA 2B92A 2VHVA 2APJA 4L4XA 4QQRA 3SQDA 3TW6A 5FAKA 2IBTA 1IUNA 1H94A 2O3TA 3A6ZA 2HPZA 5DOZA 4RHYA 4R2MA 1H6DA 4J1NA 1FPQA 4EDFA 3K5PA 5J58A 2QAGC 3RHTA 2WTXA 1O89A 2X22A 3BD6A 3HCOA 4PYKA 4QYIB 4X1YB 5BOVA 3QVVA 2A0FA 4WASA 3W2FA 4KQEA 1JIKA 2HA0A 2A5YB 1NQWA 4O3FA 4WSOA 4X95A 3K70C 1SQ5A 2IY9A 4P34A 2AJCA 3GEMA 2UXCB 1KI9A 3RROA 3IKLA 5DXJA 5AI8A 4DB2A 3DXZA 3DONA 2HSEA 3UXEA 2JZNA 1QGAA 4UUPA 4DDTA 4LRQA 1DCKA 2ECKA 1URPA 3OICA 4KKVA 2AG5A 4AJ1A 4ABYA 2EZUA 3G79A 5BP7A 4L3WA 1E6KA 3OTGA 2B0JA 1N6KA 4GRAA 4LPKA 4UHCA 1OA1A 3WZLA 5FV4A 1EDOA 2EFEB 2G82A 3ABOB 4CL0A 4Y2SA 3MWLA 2ZRCA 5JBNA 4ZYUA 4TSRA 1M2OA 4JI7B 2IYSA 1KK3A 2XBMA 2HOQA 3QBEA 4NU5A 3SHQA 4RK5A 2D8MA 4OQMA 3IULA 4ARAA 2FVYA 2L0XA 3GFVA 3U4QA 1E4OA 4PNZA 1WBBA 4R7TA 1B23P 3ZGNA 1SHUX 2CNKA 4B4DA 5JQGA 3C7DB 4LTNA 4MARA 5TSDA 2CT8A 2GXUA 2O0JA 3MCWA 2CLMB 2WYIA 3OFND 3PHIA 4X1KA 5DYYA 1XYGA 4PICA 4F12A 2O4CA 1OXBB 4JVSB 1WW2A 3NFRA 4D9JA 2ATCA 3MTGA 4O1MA 1EVKA 2QW0X 2IJGX 4ARCA 3VNAA 2V9PA 3PSHA 4CG2A 5CD9A 3HDQA 4QFBA 3R3HA 5IKPA 3FWZA 2H1OA 4P98A 1N2ZA 4MR9B 2CJPA 5LMUB 1YMQA 5CVTA 2GHQA 4L16A 4KUHA 3RYHB 5CVVA 1H85A 4MLZA 4CKCA 5IG2A 5JJKA 2Q49A 3NIGB 3THXA 1BVYF 1UJMA 4AZ0B 2PWYA 5IANA 1VLVA 1DC7A 1T3TA 2O07A 3CURA 3DMTA 3SIXA 3EWNA 1XT6A 1DARA 4YJFB 3ENZA 3UMVA 3BRSA 1DEOA 1XROA 3AQIA 3AVVA 1L4FA 1A5TA 3CR7A 4GEGA 4HMOA 5AK5A 3FFXA 1ZVMA 3TZBA 4PXSA 5HIJA 4BHTA 5LDHA 4UTXA 2W6PA 1OC4A 5AI5A 2A0XA 2CWDA 2WYUA 3B5IA 4GR5A 3EULA 1JE1A 5FTWA 2FW0A 3RREA 1XFDA 3HP7A 3TQIA 3GEPA 2KX7A 3GW8A 2HREA 1DHRA 4KDCA 3V34A 2MIIA 4L5JA 3Q8WA 2R4TA 4B32A 1FFGA 2QR3A 1E4VA 1DP4A 1E6EA 1ISRA 1H0RA 1SUPA 2IHTA 5FPPA 5GONA 4ZI7F 1X39A 1CIVA 2AYZA 4X5OA 2ZXUA 5BMVF 2NPOA 3R24A 1TYEB 4EO4A 3NHBA 1O6GA 3D02A 4V2UA 4WXHA 2I03A 3AF2A 2Q0XA 2SCUB 3AI1A 4M49A 1WPXA 2I6QA 1X8JA 1CZOA 2X4LA 4NFYA 4GPIB 1K6XA 3Q5EA 4DABA 3KSBC 2ZYVX 3IP1A 3KJEA 2LDBA 2HMUA 1DS6A 5BV7A 1EA5A 3G2KA 1IH8A 4IH9A 5JYBA 1U3VA 4R9UC 4EH1A 4YJ3F 2Q4RA 2FW6A 3QEBZ 3R8FA 2HXSA 2UKDA 1Z8FA 4EG8A 1ORTA 4OUDA 4P22A 1R8SA 3HO6A 4Y6OA 2W6JA 2I2BA 4FDUA 4URYR 3T1VA 3PYLA 1J2UA 1P5JA 2XB4A 1G2QA 1JQLB 4YAFA 4IFBA 5A4JA 4M22A 3GJ4A 4N5LA 2IEAA 3REGA 1IK4A 4QNNA 4GSKA 4URWR 2VHQA 2WWXA 4FFPA 2PXXA 3A4VA 4JIMA 4CU5A 1ZW6A 4HGNA 3EUFA 4GLLA 4F9FA 3K73O 4PYQA 1RWWA 1Z4MA 2BJWA 1MB3A 2X6RA 3QHPA 1KS2A 4EGAA 3PHLA 4GKAA 4CV0A 1Z12A 1QK4A 5A5FA 4FD2A 2WV9A 2AWOA 1DJOA 3EGCA 2Q3EA 3NBFA 3OMXA 1FUUA 3BMOA 3FVWA 4FPXA 4MVJH 4REMA 1DG1G 5FR2A 4XVUA 4RTRA 1MKYA 2HK8A 4CLHA 4EYKA 4BLQA 1G5IA 1KO7A 3EGEA 4DCTA 1YJXA 2XIQA 2NXCA 3K2IA 5E9QA 3RIEA 1JKMA 2QUIA 3A1DA 4ZAXA 4BOYA 1WDWB 1KZ9A 3FCYA 5CA1A 4K2HA 2CXOA 4DSTA 3NOQA 4KGDA 4XDGA 3PGXA 2IUEA 2JEOA 1RBYA 2NTVA 4EDHA 4Z54A 3CRQA 3LVBA 4DJDC 2ZRMA 1SFRA 1YQEA 2IDJA 3FVQA 2ZUUA 1U0LA 2JLWA 3F71A 1DAHA 3I0MA 3OJWA 2ZIEA 1W581 1UPXA 3U81A 3RVKA 3H5OA 2XYVA 1SCDA 4K87A 3E7PA 4A23A 4IUYA 4AD8A 4IHQA 1TCAA 3HHPA 2AN5A 1SN7A 4JR0A 2G3YA 3WMGA 1DTSA 3T3NA 1EFCA 4WJZA 1YJBA 3VNVA 1EVLA 1XD8A 5TMBA 1JEJA 2B8TA 3AY7A 3TZQA 1U28C 3VPDA 3OPYA 3JQAB 4QBTA 4BEWA 2IKSA 3U3RA 3LDGA 3VXKA 2GTIA 4XD2A 3Q8LA 1KVQA 5C7YA 1F60A 4RH0A 2G04A 5H16A 3KQWA 4PX3A 1F51E 3PDIB 4Q4AB 2IYFA 3UMCA 1PG5A 3TS1A 1O95C 1TYZA 1OLXB 3KZ1E 3E9RA 1XMJA 2ZSDA 1SVIA 3A7DA 2EBWA 5T8KA 3SI7A 3LUGA 3FRHA 1CVRA 4DY4A 2G5CA 2A9OA 3JD0A 3LXXA 5KVQA 4X6XA 3TLBA 1ADBA 2KJQA 1U1FA 2RHMA 2W4MA 4X7PA 1JVSA 5CNJA 3NTLA 3F90A 5IYZA 1T9BA 3DT8A 2E5FA 4OSOA 4BX2A 3C14C 2Q8QA 4GPZA 1SMKA 1H6AA 4NEQA 3D8NA 5DWVA 4BKPA 4DSOA 1QYXA 4YN3A 1YL7A 4BB5A 1M6HA 1OH7A 1QYRA 2BTEA 1LV8A 2GZ2A 4CWAA 1ISSA 3GLGB 4HB2A 4FNGA 2HWKA 4I4TA 1RTKA 1Y34E 4AF6A 5DB4A 1O6CA 5C7IO 2EX1A 1YS9A 1GYRA 4P2GA 5CLLA 1MAWA 3ICPA 3DTVA 2Z6AA 2OXFA 3R6LA 3U4DA 3X3HA 2AH5A 1R0BA 1XRJA 4D8UA 1FRQA 5SY4A 4NK5A 1TK3A 1JJAA 2Y76A 1T5BA 4EKDA 2FW7A 2XZPA 3RGGA 2W6MA 2C29D 1D8AA 3CZPA 4D43A 3ZBQA 4B7CA 4CLOB 5HMLA 3GVPA 1MF7A 2MYNA 2ECQA 4KNWA 1VKRA 3FWYA 3JD1A 2H2AA 4B6GA 4D92A 2VP6A 1NXSA 2G1KA 3TX6A 3DO5A 2W6ID 3O84A 1CB7A 1FX1A 1SKUA 2E37A 3DFUA 1MD9A 4GMFA 1DNPA 2FUCA 5K3DA 1JALA 4ZT6A 3CG0A 2DMRA 1YA8A 1MU0A 3GEIA 5AVJA 2VH2A 3H1GA 5E7MA 4C87A 5IABA 2N46A 2X3UA 4MYUA 5DWDA 2RIRA 1TRKA 2REQA 4QT0A 5EE5B 3OU6A 1U1EA 3UAWA 2I7DA 4IKOA 5ER9A 4YYEA 2VF7A 3WL4A 2OSBA 4UOEA 2DRIA 1QDUA 4LC1A 4J0IA 4EG3A 3ELDA 5K01A 1CR1A 3LDHA 2VPXA 4EL5A 4DRYA 4G1MB 1DRWA 1E8DA 2PUVA 1NXQA 3LTNC 1LPNA 1V8BA 2DR3A 3SZ3A 2XMBA 4FW9A 4D26A 3STHA 4I81A 3MAGA 4DJTA 1EHCA 5K2MA 1FX0B 2AFRA 1KU6A 2FXVA 4C7KA 4CQNA 2H1HA 3BTUA 4YGXB 2B34A 2OV1A 3L9WA 2CVPA 3AR8A 4C5BA 2YNMD 4TLAA 1EZ4A 2G5PA 2WUDA 5FNVA 5WRFA 3NWOA 2C98A 4UATA 2ZTSA 1PFVA 3QUQA 1H2XA 1YHZA 1XKTA 2ASVA 3ICWA 3NCHA 2BH2A 3CRVA 3RG2A 4HNAB 4B3TB 4GMHA 3AFHA 2P2ZA 4OYHA 3NHAA 3FDFA 1HX7A 4LECA 4B44A 3WL8A 4OSPA 1QAOA 3AJ8A 3IILA 1OFUA 3RIMA 3IEKA 1M6VA 1FMFA 1JEOA 1GTZA 3O3OB 3A6EA 1H2AS 2DVMA 3F0TA 5AKIA 2QJRA 3ONDA 1RBQA 3FPKA 3PYMA 2AXPA 5JJBA 2GN0A 4YJ3B 3K8YA 5D01A 2P0YA 2JVJA 1J2JA 1NNLA 4UZEA 4W5JA 2EV9A 3W9YA 1RC1A 2I99A 3VHXA 4F6RA 1QLWA 4AKIA 1PTKA 1X8KA 5IEJA 5G02A 4BKUA 4KW7A 5I9IA 1QRAA 4MPDA 1Q6ZA 2ZAGA 3QX7A 1GKUB 4K6CA 3DAFA 4RK7A 2OHFA 1YB5A 2Q7XA 1OTYA 3BWYA 3CVOA 2QYHA 4IZIA 4WKPA 2FETA 3UAXA 4F2DA 2JLVA 1FJHA 1IN8A 2IHVA 2IZ1A 3G0DA 1CY8A 3QIVA 1NRXA 3H5NA 4ENTA 2IYVA 2CLEB 3BMCA 3M70A 4IO1A 2VOEA 4RHEA 4CF3A 3DJYA 1QCDA 3S2ZA 5I3ZA 3PNQA 4KRFA 3QMMA 4YMSA 1V8PA 1ZCZA 1ZKDA 1W73A 4ZOEA 3G7NA 3HMQA 2GXSA 3HCWA 1JHUA 4GWGA 4KVZA 4EB0A 3C6BA 5JI2E 4PZCA 1HPLA 1JHPA 5C81A 3BSFA 3OWHA 2AKAB 2JFZA 4I3FA 4LDJA 1ZZGA 3W5BA 2GN4A 1RAEA 2KE5A 5FPTA 1E6CA 4BFXA 3AFMA 4DBVO 3AWDA 4A5SA 5C80A 1QS0A 3DV0A 1S0UA 1VG9B 1E61A 1A0OA 1OZFA 1U1CA 2I8AA 2XOKA 1FSSA 3CX6A 3GD7A 4J8PA 4OMDA 2DKOA 3O4FA 1PWHA 3FYUA 1G2IA 5CAEB 5JASA 1FVXA 1OBVA 4IRXA 4BNJA 3QPWA 3DEZA 4EM6A 2B5VA 2OC4A 3I04A 1OFGA 5GM2A 5CB4B 5EHGA 1LSSA 4OD0A 3RAEC 2PR7A 3IE2A 1TO6A 3A37A 4ESEA 1I30A 5KJ6A 5CBKA 3ADDA 3FPLA 4ACAA 2E1PA 1E62A 1K7SN 2WMYA 4HZGA 2UYHA 1P39A 3RU2A 4D0NA 5K8TA 1LNZA 2QM0A 1J42A 1J23A 4Q24A 2Y0DA 2VJLA 2RGAA 3SG0A 3TG8A 1V5IA 1YZYA 3IJPA 4RULA 1O03A 4NWIA 2QZSA 5AKJA 4LZWA 2J3LA 4OBEA 5EUQB 2VHZA 3RHFA 4OATA 4MYTA 3ZHXA 4CQMA 4A15A 4D4LA 2IH5A 2B3DA 1VJCA 4GX1A 3K0AB 2H48A 1GKLA 3B51X 4I1VA 4TV8F 2B4RO 5CM8B 4BLTA 3F1LA 1A5SB 1CX9B 3BHNA 4N8EA 2J3QA 3UUFA 1IQ0A 2JA1A 3N0VA 1GHTA 1SD2A 2OP1A 3VC2A 2VL7A 2XQIA 1ISMA 1KY3A 4UPEA 5EQDA 1MJNA 3IL2A 1XZCA 4XVQA 5A7GA 2Q45A 5FDFA 4QDKA 4N48A 4URHA 4L85A 3HDTA 1BDJA 4DZZA 2DH6A 2HMTA 2AOTB 2V55B 2W2TA 2GQ0A 2JGJA 3SQMA 2VNIA 3I12A 2QRKA 4ITRC 4QFCA 4RVDA 2FN9A 5K3EA 4J7XA 2BKVA 3AF4A 4M9RA 4CVNA 3DKRA 1TLFA 1CCWA 1GGJA 5FL3A 5AYVA 3FR8A 4YCLA 2Y4NA 3JQ6A 1IRXA 2D5LA 6PFKA 1NT4A 5DSTA 3STXA 1N5KA 1WRBA 2W6OA 3L93A 3PRHA 1CULC 3IKMB 1P7PA 4OHCA 3CLTD 5DBOA 1DQYA 3H2JA 1Q2UA 4R81A 5IC6A 2NNLD 3VDMA 4ALIA 3H2HA 3EVZA 4L9RA 2KMLA 1WVMA 5LXTF 1HNNA 1R4AA 5CLGA 3AY6A 3H1PA 4H6XA 1J24A 5T6MA 1BCRA 1GU1A 1JSZA 1ZZEA 3I09A 4JLBA 4CZ2A 4OX9Y 4ZOQI 1XF9A 3LBHA 1KEZA 3LBNA 2PJZA 3L7IA 5C34B 4U2CA 1CHDA 2FWPA 2VUUA 5ERGB 1MGOA 5D85A 1Q1BA 2RGXA 2Y1KA 5EUBA 4ZC8A 2Q2OA 1E2GA 4J1TA 2ZROA 4O08A 2QB5A 2QF7A 2FX3A 4X7RA 1QNLA 3VTZA 2HCRA 4ZMRA 2EFCB 4F72A 2EU8A 1WDLA 1B8VA 1A82A 1W85B 2FV8A 2YDYA 4KZPA 4MPJA 4MUGA 2FOXA 5J43A 4EHJA 1RRPA 1KYTA 3QKRA 4IUCS 2ODQA 3W2EA 4QUJA 2ZUVA 4KP7A 3CW8X 1M1YA 5L95A 2E4WA 2C3OA 5CCBA 2XUFA 4LOIA 3AHFA 1O4WA 3EFHA 2CLHB 4ENQA 5H81A 4RLFA 3TM5A 3AESA 2JGAA 2QTVA 1I3NA 1GG8A 2HRBA 3WWZA 1LTKA 1I3CA 2VHUA 3I9LA 5EIBC 4KE9A 4ZT4A 3JZMA 1M2FA 2WIAA 3MRVA 2D4HA 1WF3A 4BV9A 4HBZA 4X92A 3Q3JB 2X0EA 5C4MA 3M89A 3NKVA 3RODA 1DX6A 4JQOA 3CV3A 2ETXA 3WLOA 2FUEA 5LDGA 5LMCA 1NVWQ 4WLUA 1XJQA 1CQJA 2WQZA 3AU8A 2PRKA 1XPRA 5T64A 3PDCA 1ZGGA 3H17A 4IFEA 1QCZA 1RQRA 2WU4A 2W2LD 5EIAA 1T5IA 1CSEE 1NBAA 1ORIA 3MINA 2BRUC 5FA5A 5HIMA 3N28A 2ECPA 4Z4HA 3ETLA 3EPRA 2OCDA 1O87A 2QTWB 1RI5A 3AINA 3KLPX 3KXLA 4WKBA 5CNMA 4DMFA 2O0KA 1DMRA 2B94A 4XI9A 1A2QA 1C7EA 3ND8A 4X41A 3DD5A 1KEUA 1V4VA 1ZN8A 2B7CA 1OFHA 4QUDA 2PKQO 2QR5A 3QSYA 3N2GB 5LOVA 3GJ5A 4I14A 3OT1A 2Q3LA 3D2CA 3DAHA 1GNLA 1UWKA 4D6PA 2BGWA 1L4NA 1MQ8B 2PM8A 4Y67A 2ZTVA 3ZE0B 4GKKB 1TK9A 2BDEA 3NYIA 3ZDQA 3HDYA 1NW3A 3Q72A 4OQZA 4DSZA 2QIPA 3BJZA 5M3BA 3SR4A 3OE1A 3EMVA 4NKRA 4ENRA 2CDBA 3LCJA 5B3LA 5K45A 3KQOA 1X1RA 1GA6A 1XRSB 4P3NA 4WKCA 3O3MB 1AKYA 3HYCA 2PPLA 1SULA 3I1FA 1ML3A 4P7FA 5DXFA 3RS7A 2J6BA 4R84A 3RR2A 1SBTA 1QIIA 2JJQA 3H0KA 5ED4A 3JASB 2WWFA 4MRMB 3C1UA 1E3JA 1NG1A 5T57A 4HF7A 4RACA 3PB3A 4HG2A 3HA2A 4XUDA 4NMWA 3TIXB 2FDRA 2IPLA 2ZIXA 4C4SA 4TMWA 4JGGA 5TF4A 1C9NA 2CZCA 2FU5C 4MYHA 3O74A 2WSMA 4I46A 4JYPA 4OXQA 5FTLA 3NVMB 4UAJA 3KKZA 2QGFA 3K53A 1UANA 1U31A 2FK7A 4JLPA 2GVNA 1MJGA 4WCFB 1YQGA 4OBWA 1ZUNB 4GW3A 4HS4A 2Z04A 3RS5A 1UT6A 4CKXA 3IAS1 3I5AA 2WOJA 3EA5A 1Y5IA 2W83A 1A27A 1IMJA 3GFFA 3B1WA 1YULA 4DQVA 4RPHA 5JPDA 3UKDA 5I7OA 2GARA 2I2WA 1M7GA 4MQ5A 3ILYA 3QLUC 5FCDA 4BIMA 5BRAA 3I3OA 4UD6A 1VJ1A 1ZCFA 2KI5A 4B8WA 1OYOA 3DOCA 1Y4SA 1L7BA 2Z9BA 1TIBA 1PL7A 3CO0S 3GFOA 4J16C 3EXIA 2QPLA 1PGQA 2H1LA 4IW3B 3HA7A 4DV2B 3HYLA 1NW7A 3PD1A 1KQNA 3T3IA 4CMEC 5KSOA 1HNZB 1F6BA 3GARA 5DN6A 1WV0A 4BP1A 1ZN2A 4LOLA 2OFWA 3U17A 3FNFA 4P83A 4CM9A 3EXHB 4S05A 3INNA 4Z1OA 2D1QA 2J5BA 3PZBA 4BO4A 1N7GA 1SQ0A 3O4IA 3R7WA 3TQQA 1BXRA 4C4YA 1SM4A 5K3FB 3SBOA 1XE3A 3B9RA 5A3QA 2AT1A 3HZOA 1TLLA 3Q6MA 3ZHUA 4TV8B 3TCKA 3ZNQA 3QE9Y 3L5KA 3MWFA 2WAMA 3PQ8A 4DM7A 3EGDB 4AMBA 2QD1A 2QXYA 1WEHA 1TZBA 3NHLA 5DNDA 2C4TA 5HTOA 2HU8A 4CTKA 4ANFA 2RHOA 4DR2B 5KB3A 2W22A 4CETA 4CLDA 3K5WA 1TQ6A 4LZLA 4MWDA 3IP7A 4K81B 3IAUA 3PE6A 4AJ9A 3UM9A 3E9NA 4DCPA 2JFVA 1KZ4A 4HO1X 4S0XA 4DIUA 4ZTZB 5B3JC 5JD6A 5G0WA 4P4SA 3EZGA 1IHDA 3TOSA 3GCWA 2QRPA 3JVIA 2C0QA 4C0HA 1MENA 4I9HA 2JHCA 3L82B 4YREA 2ZQ5A 4DV6B 1E1RA 4XVRA 3T5TA 1DBQA 1ZD8A 2OD2A 3JPWA 3K2BA 4NESA 1UBLS 5FQOA 3ZDZB 4Z1MD 2A35A 3HKDB 3L0OA 5LXTB 5JCZA 3S2GA 2GX6A 1KJYA 1QTNA 1IEVA 3ID6C 5IM5A 1Y3DE 1BG6A 2XTAA 2GHTA 3E15A 3JTEA 3GP8A 2VSFA 4Z3OA 4FT2A 2O2ZA 5LCXA 2Z2ZA 3OZVA 5BWCA 5GINE 5HF6A 2LPMA 1Y82A 4NDAA 1JQ5A 3SZRA 3ZWNA 3U3DA 4HHEA 2WEKA 2WFLB 3MJRA 1P45A 1U7HA 2GPAA 3I0NA 1N5OX 5JQGF 4R16A 4E70A 1PNOA 4F4JA 1W5FA 3H7AA 3L7YA 2VNAA 2YR0A 3QOYA 4FR0A 1HBJA 1NC3A 3I9MA 1B4DA 1YVDA 3H42B 2GF0A 3I8XA 4LRTB 3W77A 3UK6A 3T1TA 4JP8A 3GWZA 3MMNA 3EF0A 1KY5A 3QG1A 3AF3A 4QVKA 4LV6A 1M2WA 1WLYA 1YZTA 4RYLA 2BEWA 2H3HA 1GFIA 2O0HA 4ZI3A 2EP8A 2ACKA 3HE3A 2HMAA 2NIPA 2HXYA 4FOPA 4UQOA 4WOCA 5EKXA 3K71B 4DLVA 3V2GA 3VDRA 1Z0FA 1UMBA 1OLUB 3U2QA 3MM4A 2EYUA 3KQMA 1B3BA 2WVAA 4LNHA 3VNQA 1XTQA 3LSYA 4TLCA 3KU1A 3F6CA 4O2AA 3VOBA 4DG9A 2XXAB 2RHDA 2C84A 4IVNA 4JUIA 3RU9A 5BUZA 4G5HA 4R8VA 5JSUA 3TINA 1LDYA 1X9IA 4P3PA 4LOHA 1NUTA 4QHTA 4PSDA 5F9FA 4PRZA 3AIKA 4RS4A 1IG3A 1TZMA 4WZZA 2PLRA 3A6LA 5C8VA 1F0PA 2ATIA 2P9FA 4X93A 2JGMA 2XDWA 4FYIA 4I2VA 1XCLA 2WJGA 1OR8A 1U8UA 1AGYA 1P75A 1JLLB 2ZRHA 3F47A 4M1MA 4LV8B 2DFPA 3WGJA 3VOSA 3GOHA 5T4EA 5GONF 2PZGA 4I08A 1L7QA 1ZCAA 2YUIA 4P7KA 4Z7NB 3EBLA 5AM4A 3VYTB 2G88A 4R01A 1V7PC 3RVRA 3BFXA 4EJ2A 1L7OA 2X5NA 3DOEA 2H00A 2Q6IA 4ZJYA 1PS8A 4F56A 5KEIA 2QL5A 2ISSD 1JMKC 3D7LA 3HKEB 1EDEA 2G6BA 3NDIA 4QOHA 1FVOA 3ZJ4A 1AK1A 3RSHA 5KSZA 2EERA 4WAUA 4GSYA 4RGBA 5IASA 4P3XA 3MQ2A 3VKUA 2YZGA 1XTTA 1E7SA 3QBDA 3PGKA 1NJSA 1C4KA 1R0RE 3IVXA 1MFZA 3SZUA 4HATA 4GVLA 5COAA 3LYLA 3RG8A 3ZCXA 1K2WA 3ZY2A 1H6CA 2A84A 4GP6A 1NFQA 5JC8A 3ZKWB 1II0A 1P2VA 1JR6A 4RU1A 4N40A 3P9QA 4Q05A 4C4ZA 1BIFA 5BNTA 4NAVA 5P21A 1C4WA 2HI0A 4OQYA 1JZTA 1MRZA 2EQAA 4OQNA 4CUZA 4W6ZA 3QKSA 1PV4A 4TRMA 4Y30A 1YHYA 4EW1A 3FFAA 3NTUA 4JX9A 2NO9A 4MHSA 1MC1A 1ZGBA 3LTEA 4B2YA 2BR3A 3C3KA 3R20A 1XPJA 2I1WA 2Y3IA 5JZVA 2QENA 1J4AA 2IBSA 5CFMA 1T2UA 1HDZA 3UN1A 1NUQA 2DQZA 2ZTUA 2ODNA 3ICEA 2XUOA 3E5RA 4C76A 5CA1F 5K5EA 1PL8A 4MICA 1Z33A 1JSXA 4NCAA 5T3UA 1KEWA 4TUYA 4E32A 1W94A 4DHEA 5ENVA 1SK9A 4DXDA 3KQLA 4BVBA 5JAIA 3IUBA 1C8BA 4GX5A 5H70A 1T15A 5CCXA 4BY9E 1PJAA 1Y1QA 2IDKA 2XI4A 4WN3A 2QLBA 4K9RA 1E2EA 4KODA 4EY8A 2GSDA 5ALKA 2WABA 2CMGA 2WPDD 2UYCA 2FK8A 5KAPA 2YRFA 4NYIQ 2QN1A 2IU4A 3RFVA 3E82A 1SIBE 2QGZA 4MV6A 1HWYA 4Q3CA 4CN9A 4DIOA 3PNBA 3EBPA 3AX6A 4U7WA 2EQ5A 3V2UA 1ZL2A 2R6GA 1DIOB 1RMQA 1VL8A 3GUVA 5D3MB 4PF1A 5DIFA 1ZRSA 2PZ8A 3GT7A 3VISA 1N6NA 5DHSA 4E5PA 4ZODA 1EBUA 3TKYA 3D5EA 4Z51A 5DPMA 2HHLA 5JFOA 2NU9B 4ZCLA 4JI0B 1AKRA 3O4VA 3KKQA 1USKA 1LTQA 2YMLA 4B40A 4DPMA 3L05A 4INAA 3RADC 2FSGA 2DPXA 3DHWC 1JBQA 4OBBA 4C6TA 1E8NA 4IZHA 1XLTC 5CMLA 3ZY6A 3B82A 4R6XA 2NU8B 2J9RA 4UE2A 3CZ4A 3BXOA 3R5KA 4XDHA 4YIKA 3Q7PA 3NWPA 5IYZF 4IF6A 4C05A 1D4ZA 1M9NA 4XGNA 4MIEA 4PPFA 4KPEC 3NO4A 4RESA 4EKEA 1ZGZA 3LGSA 3WL7A 3V3TA 4BL5A 2NSJA 3MGBA 2W90A 3R3XA 2G70A 4L02A 4AVYA 4E88A 5JQWA 1TFUA 3FMOB 4I4TF 1J09A 2AN4A 3AZQA 5ALLA 4CKBA 3RYIA 4QWWA 1M5RA 3B6KA 3QVXA 3H8VA 4AN1A 3GZ4A 1ORHA 3WIEA 4DLKA 2XMZA 2IPMA 5TQVA 3H11A 1FDIA 1D07A 3HLKA 2P5YA 3KVVA 3NHZA 4A0FA 5AKZA 2NTJA 1U81A 2HH9A 2PBLA 3CO5A 3E27A 5HRUA 4BRUA 3ROGA 5A4KA 4H16A 5JQGB 4B7ZA 13PKA 4UFNA 2C8VA 5MGBA 1TT5B 5JJIA 2WTBA 3HNPA 2AHOA 5DTIA 1EG2A 2IH2A 3ESQA 1RXEA 1Y9JA 3G13A 3NQ41 4NHOA 4RK4A 5DHTA 4YO7A 3UXMA 5ERXA 3ZW7A 5LU9A 1XF1A 3DE7X 5EQTA 3T5CA 1BYUA 4CIWA 1VBMA 1U3CA 1NBWB 5AT1A 3I61A 4RFLA 4H7HA 1XNGA 5A2GA 1CP2A 1DKRA 5AM5A 4FBMA 3N74A 2YCLA 2GBFA 1RABA 4J07A 3PKJA 1V43A 2GCOA 2MOKA 1R1DA 4QD3A 1M5TA 1JRLA 5DX8A 1SWVA 1MC5A 3RAJA 2O8BA 2B36A 3K9BA 5D5HA 1NBMD 1XV5A 1FW6A 1G8KA 2NGRA 3BA6A 3THXB 4LEIA 1PZFA 1FRNA 2XEXA 3Q3HA 3RF7A 3UOGA 3GUCA 1MIOA 3OE7A 1DSSG 1HYEA 3QFSA 3ZK8A 5LQDA 2AJTA 1YVUA 2O23A 2IL1A 2PWPA 1WQ1R 1MX9A 5AVWA 4YRQA 1BOFA 2OBBA 4ISCA 4FI3C 5AKXA 4OLAA 5IN4A 2CCJA 4GI1A 4W8OA 1WWKA 1JDNA 2IIPA 1BRMA 3HSKA 3KJZA 3PENA 4PZDA 5IKOA 4BECA 3QE3A 4DV0B 3Q8MA 4CODB 1S4MA 3EE6A 2EKQA 5IM4A 2WF5A 1GCIA 1KRWA 3W2TA 3PI6A 4URZR 1MP0A 1UKBA 3CZ5A 4IQGA 2FMTA 2VDNB 4DLLA 1HOXA 1E1NA 1H93A 4LY3A 4EB8A 2PX2A 1O9BA 1S2LA 3W5AA 1RCTE 3P9NA 5IKMA 2C4NA 4X54A 1E2LA 4G1FA 3W1EA 3FZYA 4FYKA 1SIUA 3UW1A 1G21A 3L7KA 3W5DA 1W0CA 2KBFA 1UZMA 1WPGA 4PG6A 4OIFA 2JEYA 3GRAA 3JD3A 3HL0A 2EG5A 2F3RA 3GNSA 4R2WA 3LCCA 3UANA 1H8ED 1L8LA 3NAZA 1ZESA 3BK2A 4MQ4A 4DUPA 2Y1WA 4JBGA 2P11A 1UC8A 2OILA 2BCJQ 2RIPA 3LHFA 1TX4B 1Y9AA 4HAXA 4Y0AA 3MVEA 2XT9A 4YRGA 3QPCA 5T6BA 3OMLA 4DAEA 5F7ZA 5KNCH 3WSWA 1FUEA 4MI9A 3HR7A 2IP1A 5F76A 1WCWA 4KK3A 4R8MA 3G0GA 3GXBA 1GL7A 3JQAD 3C8DA 1WHSA 1F2DA 1RP7A 2WJHA 4JELA 3ZGLA 4DLXA 4DUYB 3JQ7A 3V32A 3KSDO 3GRVA 1PN3A 4RZUA 3UATA 3HKBB 2DQSA 5EE0A 5E7IA 1MABA 2OE2A 3H0CA 1QH8A 4WERA 1C3VA 3G0BA 3HDHA 3SJZA 3GN1A 4N5MA 1P62B 2N75A 4L0DA 4BIIA 5E8JA 1E92A 1KORA 3QPAA 4J0CA 4PIMA 1TTHA 4XE5A 4L75A 3O2JA 5DI3B 5FBKA 4CNBA 1M0EA 5IZ4A 4JC5A 2BZSA 4JUFA 3OKCA 3REOA 2YWXA 3BMOB 4GMKA 4QPJC 5EZ5A 5F21A 2GUWA 1SVLA 2PXAA 2XE4A 721PA 1ODIA 2ZYHA 3RAGA 1QP8A 3FOCA 3CMMA 5CDTA 3CNOA 3QWAA 4JFAA 2Z2IA 3AKDA 4X60A 5KOIA 1DINA 3OCWA 1EFKA 2NM0A 4NS1A 1SXIA 3FPBA 3T7SA 2VKQA 1VI2A 4P3KA 1GO2A 1KI6A 3O75A 4D0GA 2H8KA 2XNJA 3DTYA 3BC1A 2R44A 1UXOA 5ICCA 3FNBA 2J9GA 2ENWA 3IXQA 5JOQA 5L9AA 4HDKA 3ZLJA 3V7UA 5BW5A 4ZPJA 1FYXA 5KJFA 1RKVA 3L6EA 3TBKA 2GPBA 2IA5A 4GXQA 4OU4A 3CH5A 4LN1A 1YCGA 1Z7EA 2ATXA 3WKBA 5LIPA 4RL6A 4B6JA 1Y7TA 5B1DA 1DQPA 4EMTA 5HK8A 1JTVA 4OHVA 2Z8XA 4ARZA 1SC4A 3NHWA 2FSVA 3AKCA 1Z36A 3LYHA 1U99A 4D9NA 4TYNA 4DLUA 1TPYA 3OPYB 4AY4A 3BX1A 3W06A 2CFOA 3SY8A 1LVGA 2VUIB 2WVHA 3W5VA 3ETGA 3P2JA 1D0IA 2P40A 5T7BA 2C04A 2WHYA 1Q11A 5DNYB 1XQVA 3TOZA 2JLXA 1OT3A 1NW8A 4US1R 5FUVA 3WJAA 4TVSA 3KQNA 4JI2B 2IDMA 3PJDA 2XUKA 3LT1A 3OZRA 3EUEA 4YCCA 1AKUA 1T9CA 4C0BA 1N36B 4BYGA 2J33A 3L3BA 1EFLA 2XODA 4M1OA 3N2KB 2V98A 2XUHA 5DOVA 3UGQA 1PT6A 4BS9A 4PYLA 4OB8A 3IRUA 4MB6A 3FNRA 5IHPA 1QYIA 2CVQA 2P41A 3L8FA 2HIMA 2P7IA 4J1QA 1GLGA 4JA0A 4J03A 5BWNA 3SCZA 1IY0A 1Q3TA 2O05A 4OCZA 1CQPA 3QBJA 4XYBA 2Y27A 1QIDA 4ALNA 4AP9A 2J41A 4QX6A 5FWYA 4AG3A 5E8RA 3OOWA 5GVRA 1FZTA 2IEYA 4RO0A 3ZOKA 4V02A 4ITVA 1T6ZA 5MGNA 3H2ZA 2VHEA 1IB0A 3RUEA 4JWKA 5KREA 5TPZA 3D6UA 2UZ4A 1CRPA 4OJKA 1SA0B 4H15A 3G5MA 2FMUA 3RSZA 1RFLA 3DTVB 3ILXA 1N3LA 3HJAA 3LGXA 4A03A 2G5GX 4X1OA 5AICA 3GA5A 1GITA 4HYQA 2QSUA 4KNYA 3EAQA 5E0OA 3ZQUA 3EODA 1CETA 3E2IA 1WHTA 4NCKA 4CG0A 5CJ2A 2D7JA 2BELA 3NUQA 1F14A 3R4CA 4HLUA 3MYRA 1GUZA 2Y0PA 2Q21A 2O5VA 3D0RA 2B1RA 3O8OA 1ICEA 5CJJA 2OPHA 3PUHA 4W7SA 3TM4A 2BWJA 2XNDA 3CH7A 4E30A 2JAQA 1GPYA 2IY7A 3LUJA 2C9CA 4LBWA 1QV9A 1AGPA 1BN6A 2X40A 3KSMA 1N7JA 1T36A 1Q1NA 2PJUA 4QQFA 4D9FA 1QP7A 1FQJA 3MTQA 2CLLB 2FMHA 4KYIB 4QPZA 4O25A 2F4VB 2REQB 3JR7A 3WLMA 3FCOA 1N6RA 5JD3A 3EEFA 4EHFA 2D0DA 3KQYA 4C08A 4A2PA 5FA8A 4QO8A 4X7BA 1DRUA 4JLVA 1H4QA 2HHCA 3T38A 3F7NA 3QM1A 2XVXA 1YQDA 1H23A 3JVDA 4YCSA 2ZR0A 5E6RB 3GGPA 1XLUA 4LUCA 4NBSA 5AW5A 1XN1A 1D6SA 2HO5A 3L8HA 3P9YA 4OAPA 4Q1VA 4CCAA 4DWWA 4EI2A 4QGSA 9LDTA 5I51A 4LRYA 3NUZA 5KQSA 2NLOA 3I01A 4MV1A 4TS1A 3HMKA 4JBYA 4NFSA 4H35A 4AUMA 1M6NA 1EU1A 1VL0A 1TEHA 2X0KA 3HB1A 1BH2A 4F3CA 5DVZA 1P2SA 1G6OA 4KLCA 1Q91A 1PE0A 4YUYA 4J0KA 3EQ6A 1M8FA 1QFYA 4L2IA 2W93A 3OTWA 5JLAA 4PC1A 2DWPA 3TD2A 3SXJA 3ZIAA 2BMEA 4EF5A 4TTTS 1EBBA 2R8EA 2Y9MB 4WOKA 2IYUA 4EMBA 1JDZA 2BFDB 5C8ZA 1KDVA 4MUYA 3ET5A 2EJCA 1OROA 3NONA 3QF4A 2XVMA 1M6VB 3D2AA 1VYTA 5LOVF 3AHGA 4LHXA 4RFSB 5GV7A 1NOKA 1T6XA 1YU6A 4U2FA 3C41J 4WCDA 2FZLA 1L5ZA 4JR1A 3IPLA 1MQAA 1I7PA 1QQ7A</