4P92A

Crystal structure of dienelactone hydrolase c123s mutant at 1.65 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
233
structure length
233
Chain Sequence
b'MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxymethylenebutenolidase
molecule tags Hydrolase
source organism Pseudomonas putida
publication title Crystallization of dienelactone hydrolase in two space groups: structural changes caused by crystal packing.
pubmed doi rcsb
total genus 82
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2014-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p92A00
2CZQA 3O4IA 2QM0A 1THGA 4ARAA 5K5EA 4JYPA 1A8QA 1IUOA 1VZ3A 3VXKA 1W6RA 3DOIA 2QJWA 3ANTA 5AKEA 4F5ZA 1QFSA 3PUIA 3STTA 4EY7A 3KXPA 1ZI8A 1AZWA 3U0VA 5CW2A 1YA4A 3DKRA 1CUWA 2XMSA 1DU4A 3FAKA 3E3AA 5HF6A 2PKYX 2Y1KA 3QH4A 1CUZA 4X7BA 1DT5A 3I2IA 1VOTA 4LHEA 4H7DA 5ISMA 1AKNA 4GI1A 4OUKX 5AM5A 3FYUC 4Y2JA 4OB8A 1JJBA 1QTRA 5DNUA 2HU5A 1QLWA 4BYMA 3D7RA 2Z8ZA 3C87A 3V1MA 3ANSA 2ZJ6A 1SC9A 1XQVA 1QJ4A 4GECA 3WQHA 3IURA 3YASA 3IA2A 5KWJA 1ODSA 4ETWA 2H1IA 1E5TA 3WKEA 4FTWA 2LIPA 4G4IA 4N5HX 1UXOA 1BRTA 3DEAA 4CCWA 2ORYA 1TCBA 2OQVA 5HKBA 1R9NA 4Y2SA 3I6MA 1ZI9A 2OLEA 1AC5A 3I2GA 5HF9A 4H7KA 2ZYIA 4UUQA 3A2NA 5A6VA 4AMZA 1H2ZA 3FLBA 5K3FB 2XMQA 4KYVA 5DYYA 4FHZA 3HJUA 2OCKA 4DM7A 1TAHA 3VJMA 5I7UA 1PJAA 2HA3A 3QPCA 5CT4A 2HA7A 1XLUA 4LXHA 1ZD3A 1LBTA 3VISA 3V1NA 5ALWA 3C6XA 3SWWA 1D07A 4WY8A 3C5WP 2GBGA 1E89A 4FDMA 1RP1A 2I78A 4PW0A 5D6OA 3G7NA 1CQWA 3R0VA 5AIBA 1HQDA 3SC2A 5HQ3A 3TRDA 1UKCA 5D3KA 2VAXA 4DIUA 5JZBA 1MTZA 3V1LA 3AIMA 1W76A 1JMYA 2J4FA 2PPLA 3JWEA 2RAUA 2ZYHA 4Y2PA 2GYUA 3STWA 4EB0A 4YASA 2ZJ7A 5F4ZA 4UHEA 4BRSA 1ZJ5A 2DCMA 5CH3A 4IQ4A 1QIFA 3LLCA 3WKCA 5LZ5A 4QEKA 4L0CA 5K3EA 1G5FA 1GPLA 3OG9A 1WOMA 3FBWA 3FSGD 2WLSA 1B6GA 1O6GA 4BDSA 2G63A 1W52X 4XJVA 2GZSA 1LNSA 1LPMA 3SX4A 1EB8A 1UK9A 5EIEA 2WUGA 3BWXA 2Z5GA 2C0PA 4QWMA 1EVEA 3PUHA 2O2HA 4U2CA 2HA2A 3AINA 4Y2QA 3DL4A 3WMRA 3A2LA 5SYNA 4RPCA 4Y9SA 1SOMA 3UUFA 5ALSA 5CXXA 1ZD5A 5IVHA 1TCAA 4MJ3A 1XFDA 4GXNA 4WFKA 2PU7A 2ONCA 1YS1X 1CR6A 1EVQA 2YASA 1MPXA 1QIHA 2CMFA 1ZGCA 1GPKA 1SCIA 2QKYA 4CG1A 1EB9A 5AHXA 6YASA 3QMMA 4Y2VA 1ZI6A 4FLEA 1DT3A 4BZZA 3I2JA 4ZWNA 4BC0A 2QOEA 4X00A 1L7QA 1JKMA 1FSSA 1ODCA 3HLKA 3ICWA 5AOBA 1MJ5A 3VKFA 3QM1A 1IZ7A 4IHAA 5HFAA 4KAAA 2H9YA 2XT0A 3AIOA 2HU7A 3D59A 4V2IA 5AI9A 4ZXFA 1SCKA 5JAUA 4GDMA 3A70A 3R3XA 2AJCA 4XX1A 2BAGA 5AI4A 2VTVA 3I2KA 5EGNA 4K6HA 1H23A 4X6XA 4K6GA 1LZLA 5AI8A 5EHZA 1DQZA 3OTQA 1U4NA 5ALFA 5T4FA 2O2GA 3HI4A 1EA5A 5AK5A 3B12A 5HCUA 4BAZA 2YXPX 4KE9A 3DLTA 1XROA 3O0DA 2HFKA 4K6KA 1I6WA 2BCEA 2CKMA 4GWLA 2FUKA 1C7JA 3L1JA 3BIXA 3GA7A 1A88A 2WG0A 2B4KA 4LKOA 5CT9A 1BEEA 1R4ZA 4AB1A 2EDAA 4ZGBA 2XUQA 4OB7A 1NU6A 1T4MA 2WIDA 5D3ZA 3BDIA 3G9UA 4X97A 4WCVA 4AZ3A 2JGFA 1W4LA 3WWOA 1R50A 4L3WA 5DNVA 1P0IA 1XQXA 2R8BA 4WFJA 5LZ4A 2XMBA 1LGYA 2PBLA 2CEKA 3W9BA 3M83A 5FPQA 1JJFA 3D2AA 3WK4A 4DLNA 3PFBA 3RM3A 2WFLA 1XZMA 2WJ4A 5JIBA 5JAOA 5IKXA 5DJ5A 2OG1A 1QE3A 1CUUA 1EHYA 4BZWA 4E11A 3WZLA 1XZLA 1QFMA 2I3DA 4F0JA 4MEBA 4Q3LA 1CUAA 2ACKA 4IH1A 2V96A 3FOBA 4DGQA 1FFEA 1W1IA 3C8DA 5T4BA 4JEIA 2GZRA 2XUIA 5AKGA 4XIIA 2XQFA 1CUBA 5ALHA 1YB7A 3WL8A 4BRZA 2YH2A 2DHDA 3CCBA 3WKBA 1A8SA 4X94A 3R3WA 5JD4A 2WTNA 1AX9A 4BAGA 3ZPXA 2CUTA 3VDXA 3TJMA 5E4TA 2QMQA 5JAPA 1EXWA 2BJHA 4XWGA 2VEOA 4WY5A 2PSEA 1TQHA 1MNQA 1P0MA 1UKAA 5FKJA 3E1GA 2X8BA 1CUIA 3DJYA 4X92A 4OB6A 1ZJ4A 4GW3A 3O9VA 5CMLA 2RGUA 2XQJA 3O4GA 5ALXA 5JARA 3VVLA 2Y6UA 2XQGA 2XQIA 4GEGA 4HRYA 2VF2A 1X2EA 5AK4A 5AK6A 4AN1A 1B41A 4PQEA 3T4UA 2GBFA 4PF1A 1K5PA 1BROA 1DQYA 1CFJA 1JFRA 4I4CA 2Q0XA 3H1AA 4B6GA 1G42A 2WJ6A 4JYMA 2RI6A 5DWDA 4QNNA 2OAEA 4X6UA 5AKIA 4G4JA 5ALTA 2BFNA 3IB3A 4NZZA 1GZ7A 3RLIA 5JZSA 2XUJA 1JJIA 4C6HA 1JI3A 4ZRDA 5DTIA 1CUSA 4QWWA 4YPVA 4B82A 1MX1A 5AJHA 4HAIA 1H2XA 5CH8A 1K8QA 4J0KA 3WYNA 2VJBA 4UHFA 3O95A 1HKHA 3HSSA 3G0BA 4G8CA 3AILA 5ALJA 3H19A 5HK8A 1Z68A 2OCLA 3UMJA 1A8UA 4JUIA 2RIPA 5DTJA 2XMRA 4M0MA 2OXEA 4N8SA 3W9UA 1J2EA 4WDRA 3OOSA 5CBKA 4D9JA 4G1FA 3KWFA 1CIJA 1ZOIA 2HA6A 1XLWA 2WJ3A 2WIFA 5CURA 1WHSA 5LIPA 3BF8A 3WL7A 5EIHA 1OCEA 3WK6A 4DNQA 4ROTA 2B20A 3PICA 2RONA 1VJ5A 3WIOA 4DMHA 2XMZA 5EHNA 4BBZA 3GBSA 1GPNA 2JF0A 1EDDA 4HVTA 1DTEA 5CXUA 2ES4A 3WIBA 5LP1A 4QLOA 1QO7A 1GT6A 5BWCA 3SK0A 3QMVA 3R40A 2JGEA 5LZ8A 4J0GA 3VVMA 4NMWA 2WFMA 3I1IA 2CB9A 3AFIA 5C8VA 3D3NA 4U2DA 5HFNA 3OURA 5FRDA 5LKAA 1R9MA 1FFDA 2WFZA 5DLPA 3IULA 5BWBA 2HRRA 4P9NA 1LLFA 5ALUA 3IUMA 4H7EA 4HS9A 2WU4A 1C7IA 3M3DA 3IDAA 1LPPA 3H18A 4DSAA 1LPBB 1X70A 4HXGA 1WB5A 4Q05A 2FJ0A 4AQDA 2K2QB 4RE5A 4CG3A 4CG2A 3ESDA 1ACLA 4P93A 2W22A 4KRYA 3I2HA 1AUOA 4BATA 4OCZA 5HQ3B 4QDTA 4MWTA 3QYJA 3R3YA 3RKSA 3JW8A 4Q34A 1A7UA 3UUEA 1HBJA 1VA4A 1YA8A 1CUFA 1H2YA 1ZGBA 4RNCA 4BC1A 2XDWA 4B9EA 4KE7A 2RHTA 1C4XA 4B85A 2O7VA 5ALOA 3E0XA 2WHPB 2C4HA 4J0CA 1UZAA 5LYYA 3OC0A 4WFIA 2E3JA 5AKJA 3VJKA 1PFQA 5AKYA 3K9BA 5T4EA 2GYWA 3C43A 4LXGA 4ZI5A 2H7YA 5I8PA 1H2WA 5IVKA 4LYDA 1KEZA 2R11A 3PI6A 4UBOA 1U8EA 1R1DA 3GELA 3WWCA 1XZJA 4DMCA 2PSFA 1R88A 1N5MA 2CJPA 1EH5A 3DOHA 1MN6A 3MUOA 2OPHA 1QGED 2PUJA 4B9AA 4MYSA 2HL6A 3WL5A 2Z3ZA 1XZAA 4BVLA 4INZA 2GYVA 3EQ7A 1Q83A 5KBYA 2OGSA 4ZREA 3F96A 4O08A 2WKWA 3C45A 1R3DA 3D0KA 4G8DA 1QO9A 3H17A 3JYHA 3C70A 1U2EA 2HIHA 3G0IA 1Q84A 4J7AA 4BCCA 1UK6A 5J3JA 4XVCA 2WHPA 4KJXA 1BU8A 3ED1A 1L7AA 5EHXA 1CVLA 1U65A 2ZVDA 5E4JA 4EBBA 2VA9A 2PSDA 2WUFA 3ILSA 4DMKA 4C87A 1Y37A 1JT2A 3WWPA 4ITVA 4RGYA 1J06A 3RARA 1W75A 5ALNA 1XRRA 3X3HA 3I28A 4H7FA 4X71A 1ZD4A 3QBJA 4W63A 5JD6A 2XUGA 1KU6A 3BXPA 1MX5A 4UHHA 5JAHA 1CUJA 2JGMA 1CUYA 1GQSA 3W04A 5FDFA 3Q8WA 4FWBA 1QONA 3KSRA 2Y6VA 5KREA 5K3FA 3S2ZA 3WZMA 1F0NA 4BP9A 5CH5A 4C01A 2NW6A 2OCIA 3H2GA 2DQZA 1EDEA 3PF9A 2YYSA 1CUGA 2VJAA 1VA5A 3AZOA 3W2TA 1DWOA 2B61A 4PSCA 1XRPA 1WPRA 1VXRA 4L9AA 5ALKA 2ZSHA 2XUPA 4DYHA 4H35A 1UOPA 1XZIA 3K6KA 3F67A 4U2FA 1LPOA 2ZYRA 5FUMA 2G5TA 2J4CA 4OU5A 2JGJA 4H7HA 4K5QA 3LIIA 2CBGA 2OAGA 2VATA 5A62A 4FBLA 5EIAA 2IITA 2WUDA 3OPMA 1KU0A 1CLEA 3FVRA 4X95A 3C5VA 5IVDA 1GXSA 3WK5A 4G9GA 2WILA 1EDBA 5FPPA 4BTLA 5LLSA 4CI9A 4MQMA 5ALMA 3STVA 5AOAA 3G02A 3NUZA 3DS8A 5AK3A 2V97A 3GFFA 3MVEA 3L1HA 3O4HA 1VXOA 4W1QA 5FXMA 4YX9A 1CUHA 1G66A 4QDOA 3N2ZB 1F6WA 3EBLA 5LZ7A 4HRXA 2JBWA 5FOQA 5C7YA 1L7RA 1XRNA 1VKHA 1E3QA 1UT6A 4G9EA 1BS9A 1CPYA 1CUDA 5KWIA 3R3ZA 1ORVA 4FMPA 3HACA 3HXKA 1ZICA 3R3UA 3AUKA 1Y7IA 1CUEA 5C8ZA 5I9IA 2AJLI 5AIAA 4E15A 4J0IA 3DYIA 2HA4A 3FYTA 2Z8XA 4EY8A 5AKHA 3HZOA 5AM2A 2DSNA 4ZV9A 3BIWA 1LPAB 4MWSA 2X5XA 4QDXA 1JU4A 2WHRA 1DWQA 2WIJA 3WI7A 3EF3A 1QZ3A 1F8UA 5AOCA 4B7ZA 3WA7A 4MEAA 4DNFA 1DINA 5JANA 4NS4A 2WIGA 3CN7A 4J0DA 4UFOA 1UK7A 4PSDA 2XMDA 1CUXA 5EFZA 2HADA 4RE6A 4IH4A 1J07A 4OD0A 2XUOA 4DNPA 3FLAA 1UKBA 3HC7A 4AXBA 4N8DA 3IVMA 4MXDA 1HDEA 2C5FA 2B9VA 2QT9A 4LIPD 3FSGA 1Q0ZA 1XRQA 1MAAA 4C4YA 2HFJA 2I03A 2H7CA 4BE4A 4UBIA 3ZWQA 3M81A 3D2CA 4FLFA 3I6YA 5A71A 4QE3A 3QITA 3QPDA 3GROA 4BP8A 2QS9A 4FBMA 3P2MA 3DQZA 5AKKA 3R3VA 2DHEA 3EIOA 1QIEA 4FNMA 3U1TA 5BV7A 1BN7A 2AJBA 4YK7A 3BJRA 1ACJA 2W6CX 5AP9A 5CRIA 4TPKA 2IX9A 3MUNA 5C8XA 1TCCA 4EY5A 2J3DA 5ALGA 4PV7A 1WB4A 1QIJA 4J0HA 3PE6A 4CCYB 2QRUA 5AKLA 1BEZA 2QUAA 3IUJA 1EI9A 1XZBA 4FKBA 1QIIA 4JNCA 5ALLA 3BF7A 3WYDA 5E2IA 3C6YA 2WFLB 3BDVA 1K4YA 4Q3KA 2HM7A 4BAUA 5DNWA 4B80A 3QZUA 4PSUA 5A7FA 1OXMA 3H2KA 3C8HA 3WK8A 4FFWA 2DR0A 5AO9A 4MQLA 3FYUA 5JALA 4X85A 2QJRA 4B0OA 4BCBA 1CQZA 5H3HA 2P8SA 1WCYA 3G0CA 1BCRA 3TGLA 4AO8A 1N8SA 3CN9A 4KRXA 1F0PA 4BDTA 1JU3A 4OYLA 4UHCA 1HL7A 2VJCA 5JD5A 3AZQA 4X93A 1XZEA 5D7BA 5LZ9A 2JGIA 5JASA 3I1YA 4KE8A 1THTA 2XMGA 3ICVA 5AICA 2ZSIA 2DHCA 2GBIA 3H2JA 1VE7A 1LZKA 3WK9A 3WWDA 4I19A 2HRQA 3A2MA 4UBLA 5EHQA 5K3BA 3E4DA 2QXUA 1LPNA 2G5PA 1FJ2A 5CTAA 3O9MA 5A7GA 1Y7HA 5E4YA 1VLQA 4J3JA 5IH7A 4GHWA 1BCSA 1P0QA 2HA0A 3MGAA 4Q82A 1XLVA 4BTVA 1GKKA 5ALDA 4AO7A 2XUAA 4U2GA 3WWEA 5FLKA 5FV4A 4H18A 3LP5A 1GGVA 2BKLA 5ALRA 3STUA 3KDAA 7YASA 2PVSA 3ESCA 3R41A 2ZYSA 5IVIA 1YR2A 2HHAA 3L1IA 1T2NA 4LYEA 2XLCA 4H7IA 2QZPA 3KD2A 1DX6A 3DL7A 3H04A 4HZGA 4HTAA 1UFOA 1WHTA 3G8YA 1P0PA 2ZJFA 5K3DA 3HEAA 4QDUA 1OILA 3G9TA 1ZD2P 3T52A 1YAHA 4Q3OA 4IO0A 4UBNA 4W1RA 2QUBA 5YASA 3NOXA 5K3CA 2Z3WA 4HXEB 4AZ0A 5AM4A 3ZLUA 4M0FA 2AJ8A 2XMCA 4W1SA 3DCNA 4H0CA 3WLAA 2PM8A 4P08A 4CIBA 4K2AA 4G4GA 1G4HA 5BOVA 4BB0A 2C0QA 1CRLA 1EK2A 2O7RA 1ZIXA 2Y2VA 2C58A 4UBKA 2Y2UA 4N8EA 5ESRA 3ZLVA 2IIVA 5AI6A 2PU5A 2C7BA 1XQYA 1QTIA 2WG1A 5ALVA 2DQYA 3AIKA 2BGRA 5DYTA 1TK3A 1CUCA 3DDUA 5ALQA 3EQ8A 1K6EA 2QXTA 5A7HA 5EI5A 4WDQA 4EY6A 3HRHA 4F21A 5JZ9A 1DWPA 4I3FA 3STYA 1PV1A 1YSCA 1MAHA 4EZIA 4UFPA 4FLMA 1GKLA 1M33A 3V9AA 1MU0A 4BCDA 1EINA 3F9CA 4E46A 1ETHA 1X2BA 2WM2A 2XUHA 3LIPA 4QZVA 2D0DA 3V1KA 2OQIA 4MYDA 1XRMA 1IUNA 4KAJA 2VT6A 1FFAA 1ISPA 3G0DA 4Y2XA 2HDWA 4EY4A 2FJPA 3IUNA 4W1PA 4PO3X 5LZ2A 2H7XA 4PNZA 1VE6A 3QVMA 3IBTA 5HK9A 1WM1A 4QDZA 5HZGA 2JGKA 4KR0A 3O4JA 4AMYA 3N0TA 4QA9A 4X6YA 3DD5A 3DNMA 3PDCA 5AKZA 4C4XA 3PF8A 3V48A 3G9XA 3NGMA 4CIAA 1QOZA 1CEXA 2VSQA 4KAFA 1UK8A 1BN6A 2BUCA 1XZHA 2ECFA 3TEJA 2JIDA 4G8BA 3HYSA 2RHWA 2PSHA 2HA5A 3ZV7A 3OM8A 2VT7A 1SCQA 2PL5A 4B84A 1DX4A 2XLBA 2AXEA 3G9ZA 3PFCA 3ZI7A 1XQWA 1J1IA 4L72A 2XI4A 4DMFA 1ZIYA 4FOLA 1MO2A 1IVYA 5ALEA 1ODTC 2PX6A 3G0GA 2FX5A 3D5EA 4FNGA 1UOOA 2O2IA 4B83A 1EX9A 2OGTA 3WA6A 4Y2TA 2DFPA 5AI0A 2QR5A 1XZDA 4Y2YA 3D4LA 1E8NA 2WIKA 3F97A 3FWHA 1E66A 4X3CA 1YASA 4BE9A 4KACA 2QVBA 1SFRA 5AM3A 1E8MA 3WJ2A 5JYCA 3ZLTA 4GLBA 1EK1A 5CT8A 4X91A 3DKKA 3BE8A 1YS2X 1QIKA 3C6ZA 2BGNA 3NWOA 3AJAA 4H77A 3BJMA 5HKAA 3AZPA 3FCYA 3F98A 3HABA 4Y2RA 3FNBA 4ZV7A 2OCGA 2XUDA 1TIBA 4Y7DA 2J3QA 5AKXA 4U2EA 1AURA 1AQLA 2XUKA 2UZ0A 3S8YA 4F60A 4OSEA 4A23A 5AI5A 3BL8A 2VAVA 1BE0A 1QIDA 1XZGA 5ALZA 3FVTA 3I6ZA 4UHBA 2BUAA 1IUPA 5AH0A 2VJDA 3H2IA 1N5RA 1TKRA 4U2BA 3WKDA 4A5SA 4AN0A 3STXA 4Y2UA 2C5GA 1XKLA 4G5XA 1RYYA 3M82A 3F8SA 4DTCA 4JH0A 5C81A 1YB6A 1MT3A 1CV2A 1MX9A 4QLAA 2D5LA 3Q0TA 4EHBA 1FFCA 3D2BA 5ALYA 1IMJA 4UHDA 1XKTA 2JEZA 4M0EA 4IH9A 1IZ8A 5AM1A 2QTBA 5K3AA 2WQZA 4P92A 3W05A 1CUVA 3WKAA 3QPAA 4EA6A 4Z49A 5CT6A 4CCYA 4Q1VA 3I2FA 4H7JA 2V98A 5LKRA 4C89A 4TGLA 3WK7A 3KWJA 4UPDA 5T4HA 3IUQA 4BVKA 2OGZA 4OU4A 1UOQA 4C88A 1GQRA 2XE4A 1TRHA 3GUUA 1E8DA 3C6BA 1MNAA 2XB6A 3H2HA 5ALIA 2AJDA 2HU8A 3A6ZA 1H22A 2WUEA 5HF5A 4S0XA 3CCCA 4OPMA 5JATA 3FYUB 4UFNA 4BVJA 1NX9A 4HXFB 1K63A 2EEPA 1O6FA 3B5EA 3FLEA 2JGLA 2PUHA 3W06A 4B81A 1ORWA 4ARBA 4NVRA 1VZ2A 3DYVA 5DYWA 3WL6A 1HPLA 4UBJA 1YCDA 3EQ9A 3ESAA 1WB6A 1UWCA 2WSLA 1S8OA 2XUFA 1NU8A 2BUBA 2VQ6A 4OYYA 4AX4A 3IIIA 4UBMA 1HLGA 4LXIA 1RWQA 2WG2A 1JMKC 2JEYA 3K2IA 2G4LA 4DNOA 2GBCA 2PSJA 5ALPA 3WJ1A 4C4ZA 2ACEA 2WU3A 3FCXA 1USWA 5SYMA 4X90A 1Q0RA 1LPSA 1QIMA 1N1MA 5FP0A 1FFBA 3KOOA 4B0PA 1XZCA 4J03A 1XRLA 4KEAA 3GZJA 5CT5A 1LBSA 3H0CA 3VJLA 4AO6A 2I3ZA 2ROQA 2X76A 4E14A 5A2GA 2EDCA 1WPXA 1AGYA 4N5IX 2WTMA 5JADA 4WJLA 1XZFA 5AM0A 4J0JA 1XZKA 2XQKA 2V9ZA 3ESBA 5HF8A 3CXUA 2WHQA 1QIGA 3QMWA 4KE6A 4EUSA 1YAJA 4CFSA 4W9RA 4DSZA 3LCRA 1AMNA 3B3QA 3LS2A 3RK4A 4FFVA 4TVKA 3H1BA 4A16A 4GBGA
chains in the Genus database with same CATH superfamily
1FCJA 4ZJZA 4EJ0A 2E4ZA 2CZQA 1SH7A 4Z4QA 2ZS7A 3OD1A 3DC2A 4ZVNA 4ZC8A 4LI3X 4QECA 4F4FA 1OWOA 3N28A 2PWBA 3K0CC 4GX1A 3NBFA 4S24A 5K5EA 2MTBA 1NDQA 1XNJA 4H4EA 3G68A 1QHSA 4RQUA 5I4IA 1NGSA 1SXGA 1KYZA 1J0XO 1GGMA 2FLWA 3OU6A 3ST7A 1BMTA 2AX3A 2ATIA 3NXSA 5BYJA 4L9RA 2QB5A 4EMUA 1JG4A 5DMHA 3EYAA 2CFCA 1DQPA 4MAAA 4RPJA 4XQ9A 1C9DB 4QXRA 2PR7A 2GQ0A 3D0RA 3K5PA 4X3OA 4GMKA 3VFDA 1ZI8A 1AZWA 1MJGM 2QRVB 3B36A 3PDIA 2ZBDA 2VPZA 3PPYA 3PYMA 4HX2A 4JC8A 1A95A 5CW2A 1TO2E 3FROA 3UG6A 4EJ6A 2OQRA 4GMHA 5F64A 4C3ZA 4IUCS 4O4IF 5E0KB 1IQPA 5BMVA 2JLQA 4ZPJA 1VCOA 1OUMA 2YW9A 4BASA 2N1MA 4XWKA 5HF6A 2X1HA 1H4TA 4CCSA 2JFPA 2WI8A 3PUZA 2DM6A 2PKYX 4J2TA 4R84A 4RELA 3GFTA 4H9GA 2L17A 4F1JA 1Z28A 5KVVA 5FTKA 1PQUA 2D7JA 2I67A 1Y9ZA 1K5DA 3UCXA 4XRGA 3UY4A 2CXXA 4P3OA 2JFZA 2GBPA 2ZWOA 1AKMA 1FXSA 1RJGA 4HKTA 2NVBA 4X84A 1GCUA 2XRMA 3TGWA 3TINA 2CV1A 1SD2A 2FRDA 3IUEA 3CKKA 3L7OA 3ZDAA 4HPJB 2XOKD 3EUWA 1Y9AA 3D5QA 2NTYC 5KB3A 2NU7A 2Q6OA 3FYUC 4JASB 2PH7A 2W00A 3Q3IA 5EUMA 3ZWDA 5EIFA 2BHNA 4AKGA 5IM5A 1JJBA 2OXRA 2V3WA 4IGFA 2W2TA 4MKIA 1NQTA 5U4XA 1GTZA 1QLWA 3KTAB 3JQFA 1V16A 3K9FC 2DU8A 2Y9MB 3U3RA 4BYMA 2Y68A 1FRFS 2ZIZA 1B42A 3G7SA 4FC6A 2JGDB 1Q3HA 3L0DA 1IWOA 1X6VA 1Y6JA 1H0KA 4N54A 5HJ2A 4ZTBA 5M3BA 3UHJA 4EJ2A 4Y3UA 3R8FA 1I36A 4YLYA 4CL0A 4UZEA 1C0LA 4ML3A 4L50A 3S5UA 1GARA 5EXTA 2PFGA 4I4NA 4DLZA 4I4IA 1YGYA 1QJ4A 4D3ZA 5AXBA 1J23A 1FQOA 1IQRA 3O8OA 1MB3A 1WZEA 4PTYA 1AK9A 3EEFA 4UMDA 1Y9JA 3NM4A 2KMLA 3DNFA 3LBNA 3IA2A 2PMEA 1RZ3A 2IT1A 3E3NA 3FMGA 3IDFA 5KWJA 2F59A 1E5TA 4B3DA 2ZDGA 4U00A 2RBKA 4MUEA 2JAQA 3FUCA 1CP2A 3F4KA 4OQNA 1ZEJA 3Q8LA 2P9EA 3WMFA 3LKBA 3N2GA 1HT0A 1UXOA 4CCWA 3RS0A 4ESOA 1GKIA 4JP2A 4JS0A 2G77B 5AJZA 1QE5A 4CMIB 5CA1B 5IM4F 1Q50A 4ZVPA 4B71A 3TW0A 2HAEA 3V97A 1I2MA 1TCBA 2IXBA 3GMTA 1HNWB 1R9NA 3UVEA 5J2TF 2ODQA 5AK0A 3HO1A 5LJLA 2VP2A 3RHTA 2QL9A 2O1XA 1G3QA 1D09A 1SCNE 2ZRMA 3Q7IA 3DDHA 3EZGA 4H7KA 3INRA 4J1TC 4LAFA 5TJ9A 3ZXIA 3BK2A 2QR2A 2E4XA 4GPIB 2QVXX 2X7XA 1H8HA 1ZSVA 3Q3GE 3CPSA 4QM6A 2O6LA 1KRHA 4S12A 1H2ZA 2PS1A 2VDQB 3W8FA 2AFHE 4OM8A 3L93A 4IDQA 5DYYA 3QXCA 1NG1A 1BCRB 4LEIA 3QFFA 4LJAA 3S55A 1D4AA 1GTG1 5IDYA 1A98A 1TAHA 3FA2A 3KKZA 2FMXA 3ZDFA 5HHTA 3A6PC 4D4GA 1N2GA 1G20A 2P5UA 3HLTA 4RLFA 2NOAA 3QPCA 5EMLA 4JBHA 4R2XA 3EDCA 2X1VA 3QTLA 4QBGB 2ET6A 2H4HA 4URWR 4NEQA 4GRAA 4LXHA 4FJ1A 5IARA 5LKAA 4J4HA 2NU8A 1P3DA 2GZ1A 3RF6A 1C7RA 2ZBVA 4JELA 1OI2A 1BDJA 4M49A 4TZKA 1Q7BA 3QJ5A 1E1CB 3AVPA 3O8QB 5J2TB 1DCFA 1EP9A 2V7QD 2CFOA 2P9FA 4ZVQA 4O2AA 1D07A 3BDAA 2D5AA 4RFSB 1YKSA 2GCEA 4YTEA 1WZIA 2CYBA 4C4TA 1MB9A 2N1BA 2D13A 2X0EA 4HVLA 1U2ZA 1XDZA 1MH1A 1UP4A 1YQUA 2C8VA 2JCBA 3MXOA 4GSLA 4KHZA 1VB5A 4QLBA 1CQWA 2VVTA 2GHRA 4MHOA 3BZUA 1MW8X 3R0QA 3A1FA 5HS4A 1DAGA 4YXFA 2BEWA 4DQ0A 1KR5A 3BERA 1Z47A 3D1VA 4W4TA 2JI7A 2P0YA 4V0SA 1KE1A 3ZWOA 2UUOA 4AJHA 1IPEA 5K45A 3A3KA 4OHMA 3TRDA 2ZSUA 1SUAA 2WPDD 2XECA 1I0IA 2BM1A 4UVDA 2VAXA 1B15A 1A9RA 3SBXA 3J80A 2LNDA 4KYIB 5B1IA 3SJCA 2EF1A 1D7OA 1JMYA 2J4FA 1AQJA 2AYXA 2SBTA 3JWEA 1U28A 1JAXA 1PX2A 2RAUA 2VJLA 5A9TA 3IAAA 4F86A 3ZQUA 2H65A 3G88A 2J6IA 4K0RA 3JQAB 3WGIA 2Q8QA 2RI0A 1SM4A 4LHYA 2WU0A 3KG2A 1SCUA 4CN9A 3ZOZA 1BFKA 1FDRA 4BV3A 1X7ZA 4GZ3A 4Z1MD 1P31A 2XXJA 4ZVRA 3SZUA 3ND5A 4MV6A 3PIDA 2PQ0A 4TYWA 2KJQA 1R6UA 2UVQA 4KGDA 4BQPA 3AJDA 1E4OA 1KI9A 3KUDA 5LZ5A 2DPYA 5GV7A 3K8YA 2W43A 3SKXA 1YS4A 4II2A 3CEJA 4M9RA 4PC3A 3VU8A 3MA0A 3WR5A 4XCXA 1JHMA 3II6X 4P36A 3FBWA 1YR3A 1ZN2A 4M46A 1PEAA 3ENKA 4PO9A 4ZCPA 2OORA 3O83A 2I29A 1Y5LA 3FSGD 2WLSA 4LDNA 3TTSA 2LCFA 1CDZA 2ZBEA 3W5DA 5CM2Z 5JOQA 1H9BA 1KNQA 4BDSA 1VCNA 4KBYA 4JSYA 4LFBB 2FPKA 2GZSA 1VCIA 4FILA 1CY2A 4CEJB 4BN0A 1UK9A 3CNHA 4WGGA 3WOVA 3I8XA 1B8OA 1SNYA 3E9QA 1KK2A 1PR4A 3HDQA 5DCYA 4DXDA 3L7LA 1FP2A 1T2EA 3HSYA 1NVFA 5IDXA 2ZJBA 3BWXA 4RPKA 4YRMA 2ZAIA 1EVEA 3PUHA 4O2AF 4DEXA 5JS8A 5K05A 1PD1A 2D5IA 1VKJA 1IZ0A 4KLAA 5JJLA 3E82A 4GU5A 2NZXA 1L5HA 1P4RA 3LBIA 1YZQA 2H06A 3V3TA 3ER8A 3IIKA 4ZOBA 3A2LA 2CW5A 3ABOB 3GN2A 4PLHA 1XYGA 1G8HA 2XOXA 4PC7A 3UUFA 2CK3A 1XTQA 2AUTA 5ALSA 3LHIA 3L0SA 4M88A 4V24A 3WGYA 3N6VA 3KELA 4IZ6A 5KYWA 2I91A 1CJCA 1XJWA 2X5JO 3TGPA 1FMTA 1VLJA 5CDHA 4LRQA 4CDMA 4N41A 5CFMA 4WFKA 4R1LA 5HX7A 5TGZA 1JIIA 3ICEA 4AQ7A 3CZ4A 2FG6C 2I0FA 1AXGA 5AW4A 2UZ4A 1PFYA 5KTMA 4R2IA 2HBZA 4QGBA 1S96A 3DQPA 1QQ6A 5ESXA 1F2UA 1IJEA 1Q7RA 2G88A 2OBBA 1VJTA 1KJYA 2BGJA 2BW0A 3AQ4A 1SCIA 1M0SA 1NATA 2TMYA 4RSRA 2SICE 2QEQA 5KHLB 4C7OA 4CG1A 5H9WA 4JQZA 2AEJA 2AXNA 3EXHA 1HG0A 4MCJA 4X20B 4Y2VA 4BGEA 5JUWA 4LF9B 4FLEA 2R96A 5HCIA 5ED0A 4BZZA 3GQBA 4KV9A 3IVCA 3I2JA 2OSVA 5E0OA 1RM3A 3EGCA 1GG2A 4ZWNA 5BVGB 1TQDA 4BC0A 2NUAB 5JH7A 2QRMA 1YZNA 2VZEA 1T9BA 4OLAA 2FUG6 2QD4A 1YBMA 4E88A 1SWWA 4LK2A 4X00A 5IH3A 5BQOA 3MTBA 4BJ1A 3P9QA 4EWLA 1FSSA 2WP8J 4OK3A 5IBRA 3EA4A 5WRFA 4QUGA 2IV7A 1P29A 3COSA 5KSOA 4A0FA 3GPIA 3H8SA 4NFYA 3QM1A 5IK2D 2FMTA 1ZK1A 2OKGA 2QQEA 1ZC3A 2WM8A 4BFWA 4UTZA 4Z2AA 4Q02A 2RBGA 1PZNA 5HFAA 2H9YA 4ALJA 4P1ZA 4QXQA 3U9TA 2C5EA 4I4TB 5SYAA 3L46A 1HM5A 3KYBA 4LC9A 1SQ0A 4O2AB 4DG9A 1XPUA 4JLUA 5AI9A 5BR4A 4KYTA 1YHNA 1D5WA 1BNCA 2PGAA 2G9RA 2QYSA 2Z1MA 3MW8A 1PJTA 4QDJA 1JR4A 1YRHA 1H4SA 1E99A 4KITB 4IGIA 1U3WA 3P0IA 2P77A 3OE7D 4OJNA 3IELA 2I4IA 1ONPA 5EGNA 3G0HA 3MFYA 4LJLA 1NNUA 1KQGA 4HNAB 4D98A 1PK8A 4X45A 4LJKA 1R0BA 1SA0B 3GRKA 1XDWA 5EHZA 1ISSA 1M7HA 2IGBA 3OTQA 3F4LA 4MS4A 3PVSA 2GKOA 3ZJ4A 1KO8A 4J7UA 2WSSA 5T4FA 3WYCA 2AI3A 2O2GA 5FH9A 4G07A 1XEAA 4LX0A 1L4GA 4YGYA 1P2TA 4FJ0A 3IJ5A 4HNTA 1L6RA 2FXVA 3B12A 3BA1A 4XX0B 4BAZA 3TUZC 1M5RA 2YXPX 1A7KA 1YE5A 2IDJA 3PU6A 4XUCA 1ONNA 4PHFA 1XROA 4CTNA 5TIIA 2CKMA 2BFOA 1PYOA 5JC8A 3ETCA 3IPLA 4GWLA 3HXPA 3OZFA 1C7JA 3R09A 5TX7A 3WYBA 3ZHXA 2PMWB 1EKXA 1NF9A 2OZPA 3OSZA 1SA0A 2V4ZA 3BIXA 1X14A 1J39A 3L1JA 4EEZA 1JHUA 1GTVA 1CQIA 2HNAA 3GA7A 4GI5A 4N6GA 4OYRA 2WMOB 3E15A 3A9TA 2R7NA 5DOZA 2AG1A 2FLVA 3IHLA 2KX7A 3AP2A 1YC2A 4TMVA 1HSOA 1ULTA 4AB1A 2LCQA 1KH3A 5ILOA 2A0FA 1NBAA 1GAWA 3KNZA 3V4RA 3SJZA 3KKLA 3GUVA 2XUQA 2RE8A 3DVSX 4MK4A 2WD9A 1K3TA 2NUTA 1F4LA 1GTL1 1VE3A 5D3ZA 2LDBA 1PQ4A 2VNAA 4XE5A 3PJRA 3TCXB 3T9DA 1Y3DE 3AT1A 1G6HA 3GZNB 3I76A 3TBHA 3C3MA 3WGMA 2DBRA 3PCXA 3K0FB 5DM2A 5DM0A 4WBNF 3PQ4A 4YAOA 5ER9A 4X8OA 4PANA 2TECE 1ZVKA 3EPJA 1XI2A 3NR2A 4H6VA 3IJRA 3T0IA 2KLBA 5KYTA 1RWPA 4NG5A 3M6UA 3NHPA 4FMCF 1N6HA 3CEPB 1R50A 1OT5A 2D2FA 2UXCB 1X8KA 3ZDYB 4WWHA 2I4LA 1P74A 4JT8A 4N18A 3R77A 1NPTO 2FWJA 4GBMA 5EWJA 3AUXA 1BFDA 1G5PA 3AF5A 3VVCA 3JQ8B 3BFJA 2PS3A 2OYSA 3CR3C 4YJ3A 5A9SA 3W9BA 1ZCAA 3BTVA 3C97A 3O47A 3Q87B 4QGHA 4JDPA 3ZK7A 4LXQA 1TMKA 4JMPA 3CXRA 4MUYA 1UZMA 3WK4A 1OH5A 2I80A 2WFLA 1RJ9B 1PR3A 5FULA 2B6NA 3UTCA 2CXHA 2O8DB 2OHGA 2RI1A 3A1CA 1UEJA 4OXXA 4QRHA 5JIBA 1Z18A 2UZIR 2HK9A 3IAHA 3ZV5A 3THYB 3HBJA 4HGQA 3L7AA 4OOEA 1VJGA 1ZAKA 2G72A 1CD5A 2H3HA 2OG1A 2QORA 1CUUA 1PAUA 2XCQA 4GFDA 4IX9A 4BZWA 1ZESA 1ZMRA 3GL9A 4RA9B 1YBVA 3PEYA 3P5BA 1CNMA 1ZKDA 1CSEE 4DHWA 4F0JA 1B0UA 4MEBA 4R41A 4UXHA 2C3YA 1U3DA 4Q3LA 1UQUA 3TVTA 5C32A 2OK7A 4XCQA 3ZDXB 1V47A 3MTEA 3ULKA 2JG3A 3EF1A 4UUNA 1IQUA 3MF4A 4IH1A 1F2UB 3UV7A 3MELA 2F1RA 4NBNA 4PYKA 1QFZA 4CQNA 1MAVA 2NTNA 3A1NA 1A04A 1I6KA 1Y6ZA 3R0XA 5AJVB 1FFEA 5CDYA 4OGKA 3RFCA 1X1BA 3IQDB 1G8GA 2A1TR 4A0RA 2ODBA 4IOJA 5ADUS 1XCGB 1HWYA 5B57C 4AQYB 3MFQA 5AKGA 3H5NA 3EW9A 1UXGA 3OMWA 4YBRA 3IEPA 5F3RA 2W6ID 5FUXA 4P5EA 5CFPA 2KBFA 4J2HA 4ER0A 4QGSA 2DSTA 1HC7A 4FX5A 5TF0A 2O8FA 4C0WA 1U5BB 1W1WA 4QBIA 4RCZA 3VHRA 1O4WA 3TSOA 4RACA 1YB7A 1M1NB 3WL8A 3VZCA 2PT5A 4KI0A 4MI3A 5IAKA 4OKSA 4D3SA 3R5SA 4EFKA 2DHDA 1R10A 2BFEB 3CCBA 4IS3A 1RZRA 3KAJA 2YR0A 1YO6A 1ILWA 3GLHB 5GP1A 2WTNA 1NRXA 3SF0A 3SXJA 3GFPA 4KQXA 1MDBA 4BQIA 3BORA 2RHJA 4AZSA 3AOEC 1SQ5A 1V8FA 1O0SA 4WINA 4DIEA 5K8CA 3ZPXA 1UPXA 2VHJA 3JALA 2IYPA 2NYVA 4MNTA 1XMXA 1QR6A 2CLDX 2CUZA 3B1ZA 3DM9B 3JAWA 4HAZA 5H68A 3TJMA 4K9LA 2GMWA 2OYRA 3LTEA 2QMQA 3ZDZB 4C7VA 4KSCA 5ELXA 2D1SA 1GGKA 3UK6A 2CV2A 2PL3A 2VDWB 4IEIA 2ZUTA 3PFNA 4YDQA 2PJDA 1AKYA 3IB6A 1JIXA 3T95A 5K8IA 1FYEA 2IXEA 2P9GA 5CA1A 1UPCA 2E4VA 1USGA 2JW5A 1TQHA 4EGQA 2X5KO 4YI5A 1SY7A 2WT9A 4Q39A 4EYQA 4EG8A 4ETMA 3ZWNA 2QD1A 3F9IA 3S3TA 3GLGA 3FHJA 3RVRA 5FKJA 4LZWA 2B78A 2X8BA 2R5NA 1CUIA 1JPNA 1CU1A 3VUFA 2JLUA 2ICAA 1BA3A 1PR9A 2P6UA 4HMQA 2YJZA 5LQSA 1OI3A 1MRNA 3FFBA 2FETA 5DXAA 4AP5A 2I4NA 5CMLA 2ZITA 1DQRA 5CLIA 3R7NA 2R47A 2GLUA 2OO5C 2XQGA 2Y6UA 1EUCA 4ZMBA 4R3NA 1U3FA 3FHCB 3KPJA 2P1DA 4TVBA 2XYHA 1B41A 1Q6ZA 1MKYA 2VQ3A 3F2IA 3T4UA 5JAMA 1K5PA 3HJBA 3RUCA 1GVHA 3TZQA 3RYFB 1BROA 3I9LA 4YY3B 2AXQA 1L1EA 4Q9HA 4HYQA 2B8JA 2OFWA 3W6ZA 1PT5A 2Q0XA 3I9V1 3OE7A 1N3BA 1ISRA 4MAFA 5NULA 1QQAA 2HH9A 2WJ6A 5DWDA 1SQFA 3BH6A 1TD1A 2OAEA 4X6UA 1ZVQA 3VSAA 1UFVA 2LR0A 3KQMA 1P2VA 1JDBB 3A06A 1HMYA 4NCXA 5KNDD 2P3SA 1ND6A 2Q3LA 5ALTA 3E5NA 5JTUA 1E1CA 2EERA 3O8QA 3NP9A 3RLIA 1WBBA 2XUJA 2G1UA 4G89A 4C04A 5IG2A 4UOEA 2VT3A 1E7SA 4EYKA 1JJIA 1L9XA 4C6HA 3CVYA 4JI2B 1JI3A 5EVJA 4L9WA 1X77A 4ZRDA 1OGIA 1NT4A 4UXJA 1RJDA 5DTIA 1VMKA 2IUYA 1CUSA 3PA8A 1HQYE 4PXAA 3CX4A 1YL6A 3CF4G 5HR5A 4YPVA 1P62B 3ZC3A 3OJOA 1S0UA 3EA5A 3INTA 4AYTA 1NI3A 3PD1A 1MX1A 3FKJA 3LVFO 4NENA 4R98A 2I1QA 4F3RA 1WUKS 3I9JA 3GLGE 3TDKA 5KNBH 1AUXA 1OX6A 3A6KA 2I34A 3L4EA 1B0PA 2WKRA 3D3JA 2OCPA 2JFUA 4G9BA 2HRZA 1VL1A 2Z2IA 4GPAA 3O95A 1Z5WA 4IIJB 4UHFA 1ZN7A 3FNGA 3L7NA 2GJ8A 1Q16A 4X8MA 2XR1A 2XAUA 3H19A 4TXHA 4LTMA 1MA0A 2P2CA 1D6JA 4HQFA 3THYA 1PSWA 2Z5FA 3JQ8A 4K6FA 1TC1A 4D1YA 2KM1A 3T9EA 2XD9A 2CE2X 3A3OA 3D54D 5MDHA 3HGTA 4G1FA 1AQ6A 3KWFA 3PDWA 1G7TA 5JAQA 3EULA 1YUNA 1QQ7A 1Z6PA 4R01A 1HZZA 3GFSA 4CV3A 3RODA 2WIFA 4NU8X 3L6EA 2YWJA 1C41A 2XZOA 4RCYA 1HGXA 3S2SA 2GPTA 4P7FA 3BF8A 3GA5A 1VM6A 3WL7A 1XU9A 3LPMA 3EXHB 1OCEA 3WK6A 4JJ8A 3BRWA 5FAKA 3NJ8A 4ROTA 1G0NA 1TJYA 3ES9A 1GKYA 4NATA 1G98A 4IVPA 1U0GA 4ZT4A 4BV2A 4FEAA 2C7QA 3R0IA 1WY7A 1Y1TA 2PS9A 3KUCA 1V8ZA 2QGZA 4LRSB 3KQPA 4ZQFA 3U17A 3WIOA 4LF8B 1VMDA 1NBMA 3TW8B 4JD5A 3S81A 3CNEA 2OZLB 3QUTA 1M1YE 2DKOA 3P9RA 4DLRA 2VPQA 3FTFA 3WSTA 1GFIA 4LSMA 3GBSA 1ZWLA 3X2FA 1BKDR 1GN8A 1SUIA 1J0AA 2FX3A 2LBPA 1WDLA 1DTEA 4WT7A 2PLAA 1WKVA 1DRWA 3K9LA 1W36C 2IYQA 2X4IA 4IHJF 5FL7D 3WGTA 2QNRA 3FW1A 3KYJB 4D99A 4LHZA 1EEHA 1E9BA 2QMHA 2CYAA 5CPBA 5EKUA 1E1KA 3SK0A 2JASA 1ZX1A 3JSXA 3RD5A 2EQBA 3GRUA 4B6FA 4EG7A 2O2DA 4JR1A 2HGZA 4BO8A 5KTRA 2CB0A 1DJPA 2EFHB 2JGEA 2ZSJA 3GGDA 3I6IA 4FKZA 1PR6A 4GUDA 3UKJA 3VVMA 1QYXA 3ZTYA 2Z1NA 4ABYA 2VHVA 2VZ9A 2WFMA 4FUTA 3I1IA 4HK4A 3WMWA 5C8VA 4XVUA 3QSYA 1F17A 1XX6A 3TM5A 3O5AA 3UT0A 3IPXA 5HFNA 3D3EA 1ZUIA 5DK6A 5FRDA 2E7ZA 2J8ZA 1FFDA 2WFZA 1RACA 4P9NA 3SVZA 5DI9A 1T5DX 5E1DA 5ENZA 1E0KA 3AEUB 4DC0A 1NVKA 3S1LA 3IV9A 2EEZA 4AP6A 4D5EA 5LB4A 5F98A 5MFPA 2DFNA 3U26A 2FFHA 1S3SA 3MAGA 3TOZA 4YAJA 4CQMB 1X70A 2KHZA 4HXGA 2FMHA 3CEAA 1TEXA 1K8YB 3D8RA 1JQKA 3WV5A 5LYJF 1WB5A 1TOAA 4YWJA 4HC4A 4FZVA 2AC7A 1X42A 3OT4A 2ONYA 3FGNA 4CRWB 4IYJA 3IEMA 4ER5A 2PXAA 2OEPA 3JAMA 4PGMA 3FF1A 4WNYA 2D3WA 4Z9BA 2JFVA 3DDNA 3L0ZA 4KUGA 2AF4C 1ACLA 1PE0A 3CG4A 4UUBA 1EG2A 2ZSDA 3W4KA 2YY5A 3JPWA 4K05A 2F67A 1PFWA 4BNZA 3E9MA 3B1WA 2E87A 2K87A 2P2SA 1U6IA 4R1TA 5F76A 4K03A 2I62A 2QSUA 4PXSA 1OAKA 4QFMA 4TM7A 1U94A 4OCZA 5FT9A 2QN8A 2ODWA 2P0AA 4L4YA 3UGJA 1OIXA 2AEFA 3BCRA 4EG4A 2RBEA 3R3YA 3SYLA 3RKSA 1KH1A 3H11B 3W4IA 3EFHA 1S2GA 2V7GA 3BPSA 2AUNA 4ESEA 5KEIA 3MMXA 1TIPA 3UUEA 3N2KA 1HBJA 4DLLA 4A82A 3RSSA 2K7ZA 2QAJA 4WXMA 4AWXA 3QMPA 1CUFA 1H2YA 2H54A 3FDFA 4YLEA 3GRFA 1KHTA 1MEOA 4WCDA 4UATA 4TX1A 3ECSA 1XZ8A 1YOVB 2H9AA 3PB3A 4B8WA 2AW3A 1A9OA 1Q22A 2RHTA 2H1OA 1DC6A 3JXEA 4FZ3A 2PYZA 4Q16A 2IH2A 1N8NA 1I2CA 5THXA 2IYUA 3WYFA 3PSAA 5ALOA 4N48A 4L6IA 5IANA 3RU3A 2ZWMA 4BO6A 4OG2A 5EP2A 4RTOA 1FNCA 4RHYA 5LYYA 4Q12A 4L4UA 1UKEA 2QN3A 4ZAWA 4WFIA 3CB4A 4K9MA 3FMFA 3FYSA 2E3JA 2XGOA 1YMQA 1Z5GA 2XTMA 3K9BA 5BPFA 1AUQA 4ZYTA 5ELLA 4KGVA 3DXZA 4PVCA 1OLXA 2B3DA 3DO6A 7REQB 2BMDA 3K8QA 4LYGA 4ZI5A 1JAHA 3QEOA 7ABPA 2G1PA 4V0LA 4ZC1A 1JQBA 1H2WA 4U2KA 2B30A 1T36B 4IMRA 1E6LA 1KEZA 2IFTA 4LHVA 3V2IA 1YU9A 3OCZA 4YDHB 2R11A 4UBOA 2H16A 3TI9A 3DAPA 3ZK8A 4POOA 5B30A 3AKDA 5CEEA 4X8HA 2C7VA 1KOFA 1U8EA 3NMUF 2ZXUA 1VHJA 2AWOA 1RP7A 4WASA 4XKJA 2J7PD 5CJPA 3TI7A 1D4OA 3ZE7A 3ZQJA 5LQAA 5H7XA 3NBZC 3WWCA 1FNBA 2I8CA 2OVBA 2Y1EA 4I5DA 3WHPA 2WB4A 1FSGA 5E2BA 1GGHA 4FOSA 1N5MA 2PZAA 3WG9A 1MN6A 3MUOA 3QU2A 4FFLA 2GHQA 2NO0A 1QHIA 4BNDA 3MJSA 4GR5A 3I4CA 1C3VA 3HCWA 2HL6A 2PWYA 3AY6A 1V7CA 3UJ9A 3L4JA 2Q1SA 2R87A 4LKRA 4CKEA 5JNRA 4KU4A 2H5EA 3D3WB 4ZOEA 1XZAA 3OMXA 1ORRA 2XIJA 1OBFO 1G1MA 1IH8A 2P9JA 5JPDA 2QD2A 2R9VA 4JUFA 1REQA 3CLSC 2HQSA 1HT1E 2ZB4A 2YNMD 2NYRA 3AUJB 4U0KA 2GWHA 4B87A 4YAGA 4CQJA 4FGSA 1AN9A 4A3SA 4O4LB 1Q83A 1XVLA 4U39A 5BN4A 2G4VA 5LQRA 5JROA 1YJBA 1SBQA 2J33A 4HDQB 3TX2A 1FW8A 2JLZA 1E6KA 1G5IA 3LDHA 2VWPA 4NONA 2V74B 1RR6A 5AFSA 5LA6B 3SC6A 4EECA 5EMMA 5JH7B 3JYNA 3ZW7A 2P90A 3JTEA 2GZDA 4DYVA 3SQWA 1JB9A 3D0KA 1IVNA 3HP4A 2DBQA 1FFWA 1PNRA 3BCHA 2A35A 4RXMA 1H69A 5CFQA 1QGYA 5CB4B 4ZZ3A 5C8YB 1QTNA 4RL6A 1RD4A 4Q66C 4ZAZA 4CFYA 1BMFA 1F0YA 1JECA 3JYHA 3C70A 3G0IA 1T8TA 1Z7EA 4BLPA 1Q84A 1SIOA 1PZEA 4XVCA 4DAOA 4ZALA 2QYHA 1VP9A 4NARA 2QMEA 2EHJA 4Q9AA 2DY0A 3E9DA 3I39X 4KJXA 4PLVA 5IEBA 4C6TB 3AV3A 3M89A 4JT9A 1J5EB 1E79D 3ED1A 1N2BA 4RO0A 4X7PA 1ZLYA 3TNYA 3U44A 5DPMA 1VRWA 3CLRD 1QAMA 4BTEA 4KIWA 1GCAA 1TDJA 4EG1A 1IPFA 3NOOA 1R8SA 4KFCA 2ZVDA 3TD6A 5H4HA 2X4DA 2AXPA 4KQKA 4B35A 4D0RA 2PSDA 4FFSA 4G4SO 3ILSA 2A0WA 3GY0A 1NURA 1U8TA 1TKAA 3V9PA 3CNLA 3FLMA 2J7PA 3QVSA 4M9XA 4MW2A 5E8RA 4CN8A 2XODA 3PNSA 4A2WA 2YWHA 3F74A 1CY1A 1MGPA 4ITVA 3C1TA 3V80A 1V35A 2FMKA 3E58A 3F3SA 2VDVE 5C37A 1Q0HA 3OHSX 4LJ4A 3HDHA 3NVDA 4GP7A 2I1VB 2R5FA 2XB9A 3RARA 2ZT6A 5DX8A 2C98A 2ANCA 4B8ZA 2CDRA 3SJAA 3X3HA 3AWDA 4CTOA 3HPRA 3EYWA 3PRHA 1YZVA 4H7FA 4KN5A 5BSTA 4QOSA 1KAMA 2IVZA 1P8JA 2IOFA 1RRGA 1YV9A 2JJ8A 3C7TA 5FI1B 4AY5A 2A4KA 3VR5H 4F3NA 4QTUB 2FK7A 1PG0A 1SBCA 4AZVA 2CC2A 1TJPB 2QRZA 5JAHA 1EP1B 1W9HA 4YCLA 4L5BA 3B13B 2JGMA 5KU7A 1CUYA 1GQSA 3B5IA 3W04A 2VXOA 1A9XA 1SVWA 2C00A 2OCDA 2EV9A 3DXYA 2L42A 4OF4A 3DBHA 1V4NA 4XUEA 3ZZUA 1DAMA 3SFVA 1FW6A 3TM4A 5JECA 5CH5A 3OD5A 3TNFA 3DZDA 3T5GA 4AZWA 3IUPA 4KVFA 3VPSA 1VFPA 4BO7A 1A9YA 1QF6A 3JRWA 1G8AA 4I6JA 2IBTA 1ZRMA 2D5BA 2JFYA 3E7XA 1OZHA 2YYSA 1CUGA 1KMHB 1NN0A 1XTTA 3DHEA 4IX1A 4B2LA 1HYGA 3AHFA 3ITNA 5DV9A 2FRXA 3U56A 2B61A 1NVDA 3B7GA 3DBOB 3ZNNA 1X1SA 1ODKA 3JV7A 3QBVA 1SXJE 2GZ2A 2BE7A 4YCCA 5EIOA 3GFGA 1WJGA 4F2WA 4JX9A 2H2WA 2IYTA 3QF4B 4L9AA 1GLGA 4US2R 3PCRB 1MO3A 1IOWA 1VIVA 3DYBA 3WMXA 2XCSB 5GMOA 4ZARA 5L3QB 2Q41A 4HEHA 3THOA 4A2QA 4MUAA 1YE8A 1RS0A 4DYHA 1S1MA 5K0BA 1YF3A 4WKPA 2EW1A 2BD0A 4JT2A 3FJ1A 2V03A 1C2TA 3F67A 3HDJA 3OUUA 2ISQA 3RSHA 1V11A 3BA6A 3GDGA 3OIWA 1QGOA 1QYVA 4UE2A 2PQ2A 2ZYRA 3I42A 5FUMA 1PS0A 2GO7A 2H1RA 5DHAA 1XTZA 3DV0B 3TDMA 2J4CA 4CETA 2JGJA 4K5QA 3P0RA 4WESB 3UQZA 4LHSA 2CBGA 3LPAA 4AYXA 4PSKA 1YRLA 2PD6A 4QREA 5K4AA 3RVLA 4NBUA 3I9NA 3WMEA 3C48A 3J81A 1RWMA 1D2AA 2A9PA 2FE1A 2VSNA 1DHRA 3AB3A 3EQ6A 3FVRA 3QKSA 2PWZA 3LCCA 4UEWA 5FOXA 3SLRA 5CA1F 3HJTA 4WZBA 1GXSA 2QP3A 1J6UA 3FKQA 4FOPA 5EP1A 4ONEA 3WQRA 2L82A 1IYZA 3IAFA 3QVOA 4ZAVA 1GU0A 3CMMA 3NT5A 4Q21A 4F9GA 1V5EA 4OY3A 2EWWA 3H65A 2DYKA 2HSJA 2O52A 2PKRA 2PANA 5KVCA 1I7QB 2ZTMA 5FPPA 3VPGA 1RPJA 3MS2A 3CKYA 4Z9AA 2VOEA 2ZJ0A 1GPMA 2CJFA 3KQQA 2R6HA 3NUZA 4HH4A 3U61B 1IVSA 1E9AA 1WPGA 2FQWA 4HGRA 4LVNA 3UKOA 4HGZA 1PX0A 1UDCA 3AJEA 1A27A 1Y81A 3FFXA 1NW5A 3FCUB 1LSOA 1UBHS 1P4JA 4Y67A 5EOVA 4MW6A 3FFWA 5A3RA 1PJ2A 2O0KA 5DBGA 5GY7A 1GL6A 1IOZA 3S2GA 2PXHA 1IRXA 3UPUA 6AT1A 1CUHA 5MGBA 4EO4A 1NL3A 4IJMA 3KR0A 4QDOA 4ALNA 4OM7A 2CFIA 4NV0A 1KGDA 1QUFA 4A92A 4HRXA 3N75A 2XNDD 4CMEC 5DBEX 1S7GA 1ZNQO 4RIIA 1ODLA 1Z2EA 2VRWA 4P6VF 4PE5B 3SC2B 1Z29A 3GJSA 3M5WA 4EKGA 3ZS8A 1U0HC 1J90A 1ZO8A 2IE8A 3MCWA 1O54A 1NYQA 2REXB 3R3ZA 5H59A 4Y1EA 3D7LA 2FDCA 1DKMA 4QXPA 3DZBA 1FTGA 4NDZA 4TLEA 1YZ3A 4NP6A 2OOSA 4D96A 4NKRA 3T7AA 1U99A 5KX5A 3JQGA 4UPEA 1NJSA 5FB3A 5AVVA 2DH5A 1JSZA 4E7OA 2JFBA 1JWBB 2QIPA 4CL8A 5DSXA 3UB4A 3C3YA 4NI5A 3IOEA 4AP9A 5C8ZA 3RIYA 3QF7A 1ZCZA 2Y71A 1NVWQ 3D8NA 3BD8A 3BULA 1GCIA 4WAUA 5AIAA 4F7DA 1O97D 1S2DA 2O3SA 3HWWA 2B0JA 1X9GA 1YZGA 2Y0CA 3L8CA 4H1TA 4WLFA 5FTLA 3LRTA 1HTWA 1KYTA 3UG7A 3WGUA 1XEFA 1WTCA 1UFQA 3DYIA 1F8FA 5I7FA 4PO1A 3O3OB 2NPIA 3LD9A 2QX8A 3IBGA 3K0BA 2ZUDA 4IG4A 4IJ6A 3T0GA 2PN1A 2IUFA 5J4HA 4Y2GA 5HBRA 1X86B 3X44A 1EGMB 1X7WB 3EVEA 4XB2A 4LZAA 4O4LA 2NG1A 3ET5A 2DMRA 5AKHA 2AOTA 3DBLA 4R5MA 1BWPA 4MQUA 3DEJA 4UUOA 4CZ2A 5AM2A 3UA3A 3DVAB 3IMEA 3ZUPA 1REQB 3EVNA 1NMSA 2LKCA 1TFRA 2L19A 2CLFB 3IAS6 1GA1A 4N40A 3NFYA 3FZYA 3LBHA 1TCUA 3PWZA 4O59O 4QDXA 5LBUA 3A4NA 3UHPA 4JXJA 4BRUA 3MCUA 3AR2A 2ZU6A 3OEHD 3WBJA 3EF3A 3T54A 3GJTA 4TTTS 4R2HA 3WJ7A 1FRQA 4PHHA 2BFCA 1JLHA 1P19A 1R8JA 1SB8A 1QK3A 2N3ZA 2QRJA 2VRNA 1NXWA 3FB1A 4JL8A 1AG9A 1I10A 1DINA 2C5AA 3TAXA 4Z3DA 2FEAA 1WZNA 4OJTA 4QGGA 4NS4A 4E51A 1X7YB 2OD7A 2VYFA 2WIGA 4YQFA 1TJ5A 4K9SA 3JD1A 4F8JA 1NXOA 2IF0A 3QEJA 4NBRA 5IMBA 2ZTSA 3A9CA 2ARKA 2Q0HA 1RRFA 1USVA 1XV5A 4BBPA 1Z6XA 3B9RA 3O2NA 1VGQA 3JQ7A 1Y4UA 1CUXA 3LVRE 4DB4A 2HADA 3Q7PA 3LUDA 4IL5A 3MJVA 1VSTA 2CHGA 2YHBA 4RE6A 3QIVA 3PV0A 3TTWA 4BXOB 1A5AB 4XB1A 1J07A 4OD0A 1MTOA 3LUKA 2BCGY 3BH7A 4KFSA 3FYCA 3HC7A 1M1YB 2KI5A 1V11B 4N9WA 3SBEA 1MC8A 4TLLB 1EESA 1U4OA 2NZJA 3P9KA 3DMPA 3GVHA 3IVMA 3QXJA 5F1KA 4MXDA 3UAYA 5IZCC 2ZM6B 1VC2A 1SC6A 1T8PA 2NZ8A 5CHEA 3LOPA 2FZKA 5L4LA 2ABWA 4I1VA 3N59A 3CVWA 4J2OA 3AKEA 3G1UA 2EJUA 2AFIB 2V4UA 3G79A 3EA0A 3UBMA 2O1SA 4LIPD 3JQ7B 1M2VA 2VQDA 4GMDA 3G8CA 1ISHA 4BV8A 1M6NA 2OXCA 3T7CA 5BSKA 2L2QA 1DEOA 5TDHA 2BSQA 2ZZMA 4X0EA 5DX0A 1OTYA 3OEYA 4NZ9A 1RSZA 2I03A 3EZ7A 4RF5A 3MTAA 3KQOA 8MHTA 1BJKA 3PGXA 4B43A 3QWAA 3M81A 3D2CA 2JGNA 3K2IA 3TS1A 3PUVA 4UM7A 4A4DA 1NVBA 1L3IA 3NUGA 4PFKA 3MZ0A 2FPIA 5CLFA 3E1KA 1FPQA 4MVJG 1NR7A 2BGKA 2I3AA 1E4YA 3DWFA 2E49A 3TTXA 1UEXC 1KQOA 4K26A 3MWDA 1HQCA 2GEUA 4JJFA 4URUR 4DJFC 3WYGA 2HF7A 2EKLA 2CF6A 4BP8A 1ZIPA 2CNNA 2XIQA 4FBMA 1E60A 3RU2A 4EZEA 2JIOA 1X0VA 3HB1A 1WTAA 2CNWA 1JPVA 3BE5A 5A5VA 4KPFC 4F4IA 4YPOA 3U1TA 1OOEA 4JVOA 4L74A 5BV7A 2P2NA 3JQEA 4O3FA 2PT7A 3CVOA 2ZDQA 3JD4A 4YK7A 1ACJA 2GWRA 2W6CX 3M49A 1JX6A 4NCJA 4XWWA 1KBZA 3JCZA 2H4XA 1RWKA 1XO1A 1JZSA 3JZFA 2CXNA 4WXRA 1XHLA 1W49A 1FY2A 3DOOA 4OJYA 1JLKA 2WLTA 4KP7A 3BD9A 2G28A 2AJTA 2ZWPA 5JWOA 2MYPA 2JJMA 1R15A 3ZYCA 5K4GA 5C8XA 4EY5A 1BXRB 2BKEA 1N2SA 2H2FA 1U3TA 3RJTA 5EJGA 3PE6A 3MQ4A 5J1TB 1S3FA 1U7TA 2B4TO 5PNTA 4A03A 4D5GA 3AHEA 4DPMA 4P32A 1GGNA 3VR2D 3AGPA 5DDIP 5BSEA 2ENUA 1PJ8A 4O4JA 2JRCA 1F9EA 2QP4A 4XIJA 1T1SA 4B33A 2VEDA 1QIIA 3ZE0B 2ZUBA 4A6EA 4KR6A 2QTWB 1L4FA 3X1WA 3IP3A 3VX3A 3KJXA 3N0RA 5LC1A 3EZXA 1TZCA 2Q5EA 2Z2YA 4HAYA 4XEUA 1QMPA 1IHPA 1R0WA 3OZAA 1GSHA 2FSHA 2OP0A 2R48A 3LPDA 3OZBA 4GVPA 4RD4A 2BDUA 4CMCA 3F73A 1A4IA 2HNKA 3DEYX 5IKOA 3W5CA 1J2UA 2Y0EA 1SHKA 4CNBA 3LP8A 4MR9B 3KVYA 3RYFA 1FYVA 4EPYA 4U6SA 1PVVA 4RGVA 4TS9A 4MWGA 1OH6A 1Z8HA 1N5LA 3G0OA 3H9EO 3SSAA 1GL3A 4A73A 2R6GA 1MV8A 3ZVKA 4U7PB 3C6QA 2DR0A 1OF1A 1XXLA 3M5PA 3WLIA 3MMNA 4U02A 3UW3A 1KSFX 1NF2A 4CQLB 4A27A 4M54A 2FU5C 1UJMA 3C3JA 1EP2B 3H1PA 4PO8A 5E9QA 4B0OA 4DPKA 3MT0A 2JL1A 2JD2A 2R1TB 4YQEA 3K53A 5H3HA 4BCBA 1ILEA 4EHJA 2P8SA 4W5OA 4EFMA 2J0QA 3KBBA 3AR9A 4ILEA 1W5FA 2WPDA 1E0JA 2NV0A 3JAKA 4YREA 1TM1E 3HBFA 2DUNA 1FMCA 4NHEA 1BCRA 5BRAA 1GEGA 3D64A 1QKIA 4XUGB 3IKVA 1C80A 4CV0A 2W98A 3NV7A 3A9SA 3VU3A 1JDNA 2D4AA 2PZMA 2IY7A 5EE3A 2JPDA 3PGKA 2H2IA 1F1BA 2WVGA 1KO4A 1DC5A 3BH0A 2Q6IA 1C30A 4TSFD 2WUVA 3GEMA 1N8SA 4OH7A 3CN9A 4FYPA 4DRYA 1MORA 1SULA 5CXSA 1RQRA 4BDTA 4JI0B 2N42A 1R0XA 2ID8A 3SQLA 1NVAA 4N12A 2Z3VA 1MXHA 1K1EA 1H4VB 3LMKA 3T9AA 2SCUB 3LTNC 4LFAB 1R6TA 3KUXA 3PTZA 4GLLA 2NADA 2BSXA 2GD1O 1Z8NA 3DKVA 3JASA 4E12A 1TKBA 4WGFA 4X93A 4DYDA 1Q3TA 2AFVA 2OMKA 5LZ9A 4WE3A 2RK4A 1P7ZA 2FNAA 3FYHA 3H1TA 4EYOA 3HYRA 2BFBA 3AMVA 2VDRB 1KVUA 1G9TA 1KI1A 2IJGX 1UFKA 3P19A 5DISB 1Y6QA 4D6XA 5L6MB 4OQZA 1H85A 1YJCA 1O58A 4L3OA 1H6CA 4QHTA 4YCJA 3ICVA 3ZDEA 1UR5A 4J76A 3IQEA 4D0NA 1RC8A 2G5CA 5DH9A 1YCHA 2R1UA 1N92A 3DMYA 3GLKA 1G2PA 1NNSA 2YJGA 3HY6A 3L43A 3PQ8A 3UAZA 3W2EA 2E37A 1H6BA 1MENA 4TV9A 2I55A 5EMKA 2WQ6A 4M89A 1B1AA 3A2MA 3KXIA 3VOAA 3WNBA 1SUSA 5A7FA 3PRKE 5LMCA 2FTKE 3GNTA 5J2UA 2EX4A 3NYWA 4JLKA 4OBWA 3RRXA 2Q5IA 4AJLA 5B3JC 3DGEC 2GFQA 4R6WA 4CLXA 1E3IA 2VNJA 1Q7EA 4TSRA 2WWTA 3QWHA 1MVNA 2P6RA 5C9ZA 2FEMA 1ENPA 1RXCA 4ZRMA 3K3PA 4BVFA 2ZTVA 3AERA 1NNLA 5LDGA 4JV5B 2R6FA 4QPJC 1PCXA 3ORRA 4EFDA 5GJCA 3DD1A 4OHVA 1E20A 1N6IA 2GHTA 2XWPA 2ZUSA 1Y7HA 2DWCA 3DA8A 3IR7A 4LV5B 3SZLA 2J46A 3U3XA 4KXLA 4ZEMA 5IKMA 1AU9A 3DZCA 1C14A 2BJVA 3JATA 2O4CA 3W9YA 1P1HA 5K0LA 3JU3A 4Q82A 4UAUA 1P4HA 1XLVA 1VHTA 3A3NA 3O1JC 5BNFA 2AI1A 2I7DA 2WWHA 3CZ9A 3DDWA 3HDYA 4KI7A 8AT1A 2JAOA 5HZKA 4OFWA 1CZRA 4K9NA 2OXFA 1VMIA 1KZ7B 1YR9A 1HOXA 4ODIA 4RIHA 4U2GA 1MB4A 2PZLA 5CLLA 5FLKA 1DKOA 1WULS 2DJ5A 1RQ2A 4R2MA 2EW2A 1S1CA 3UJ7A 3GNLA 1T9GR 2Z95A 4UVGA 2R84A 4HAOA 4CEJA 4JOBA 5B2ZA 5K6AC 4IGAA 2PVSA 4TV8F 1JXMA 3R41A 2WF7A 3P9XA 4EA8A 3S99A 5FLYA 3PD7A 4BJ3A 4ZO4A 3PQ7A 4NDAA 3V33A 1UL1X 5GGYA 4A8JA 3OE5A 4C07A 3HDVA 2YMMA 3MT7A 3KD2A 1CHNA 1XDUA 1P6QA 2M6LA 3IS3A 4QATA 4ER3A 5J9FA 2X40A 2ZUWA 3AUAA 4W6ZA 2AYYA 4HZGA 4PRYA 2HU2A 1EFLA 1PW5A 1GPDG 2R8RA 3ET4A 4HTAA 3O92A 1LK7A 3RUIA 3NVKI 2HF9A 3U5ZB 3GHYA 4D4LA 3R9IA 1VSQA 3HWSA 4DA6A 3QX9A 5UKDA 2YC2C 4Y6QA 4MIOA 2KYRA 5K3DA 4CR8A 4N65A 5IN4A 3NBUA 4OP1A 4Q4AB 1VI6A 4DSOA 2YYZA 4MV1A 1CTQA 4FDUA 2BZ0A 3VMMA 5CDFA 1NKSA 2YJ3A 3JZDA 5IW8A 3WRXA 1I94B 1TU4A 1XT6A 2UUBB 4FQ8A 3U7FB 1ECCA 3EXG2 1ZZGA 2QUBA 4K3VA 3U4DA 1X80B 2X8JB 5A4AA 3L5OA 2GN0A 4DY4A 4B31A 2BF4A 1ANKA 2DLDA 3QFTA 2Z3WA 5EUBA 4AZ0A 5AM4A 4V0RA 1VMEA 3W3AD 1JHZA 1UP7A 3OFND 4K9DA 4MVJE 4TSFA 4G0PA 3RNLA 5F5XA 3KHUA 4D26A 3I01A 2PM8A 3MTQA 4ZAFA 4ES6A 1UT8A 2PZBA 1S2NA 5DBHX 5EHIA 3DO5A 4P08A 5EIXA 5BY2A 3CC8A 3OE1A 3Q5GA 5BOVA 3GLVA 5CBPA 2R8PA 2PGOA 1ULHA 5KCZA 1EXNA 2HRBA 5KNBD 2W6MA 2C0QA 1CRLA 2ZRHA 4ZZ0A 1ZIXA 2GTHA 2PNFA 3S2YA 1LS6A 2C58A 1W4AA 2DWPA 3BGVA 4EM6A 3I9FA 2F1HA 2ZJ1A 2ZBQA 3GD7A 4MIEA 4QBFA 1BSVA 4N8EA 1RCUA 1S01A 2EZ8A 2HK8A 3HJRA 4QFCA 1F12A 2ZI7A 2IIVA 3JALB 2XCRB 4RVNA 3B3JA 3ANLA 5DBFA 3RH0A 1EDZA 2H18A 4BKMA 1KZYC 5CJ2A 2Q29A 2BGRA 2CDCA 2I6TA 3EHEA 2EZUA 1J21A 1Z4LA 5IC4A 5ALQA 3EQ8A 2QXTA 2V9PA 2HLDA 1AVTA 3BD7A 1NONA 2ZRPA 5JHGB 3D5TA 4WPGA 2BL4A 1RWXA 1FNNA 2WVAA 3HRHA 3K4HA 1KEWA 1WBJB 4WDQA 1E98A 5JI2E 2FPSA 5FR2A 5EJ9A 4KR7A 4I3FA 3STYA 3ECCA 3TCNA 3BGOS 4D4KA 1LVHA 1KP2A 1MAHA 3EOZA 2GSDA 3FUUA 4HFRA 4BX9A 4ENSA 4ZPXA 5ADHA 1Y8CA 3O8LA 1I0ZA 3C7DB 3WAKA 4DG8A 1PT6A 4MUBA 4HEA6 2X1MA 2ZYTX 3T61A 3BILA 1IXKA 1PJCA 4GEKA 5ENVA 2C20A 5CNKA 1KC3A 4YROA 4CBVA 1T43A 2R4TA 5A4IS 5AW2A 5E6SB 3L05A 4J3FA 1Z75A 1EINA 2ZATA 4JQCA 1SXQA 1F2TA 3DTYA 5H3LA 4DA9A 3F9CA 4BMZA 3ANYB 2XXBA 1FE8A 4EJFA 1FNMA 1WXFA 3D6JA 2XUHA 2X9LA 3NPAA 5CHYA 3ORQA 5DEIA 1I2DA 3CLSD 3V1KA 5IXYA 5U9CA 2NVUB 1W46A 2VTBA 4C7OB 3AERB 2FSGA 2PUGA 2RHMA 1QNLA 4BOYA 8ADHA 3STHA 2XWQA 3FSEA 4XD7A 1Y1RA 4XI9A 1UFRA 5KYUA 2QIOA 4FK8A 3ZCRA 4BFZA 1JQAA 4RH0A 1Z22A 3FPLA 3SIXA 5ARDA 3U48A 3RFFA 1P2GA 2FSFA 3A6LA 5A05A 4NG4A 1II0A 2VPPA 2JS7A 2XZTA 2Q07A 3G0DA 2AHRA 3WLKX 4BP3A 4C21A 1DLJA 5JNUA 3HJFA 1MD9A 2VSXA 3AI3A 4HDRA 1UBOS 1WXGA 5L9AA 2IZ6A 3MB8A 2I6XA 2ODAA 3P7MA 2V7EA 1F7UA 1RYMA 4LJ7A 5A6SB 1LTKA 5LUAA 3CNBA 3C0KA 3L07A 3ILHA 3W79A 2NYUA 1DBPA 4HUQA 4PNZA 5TJHA 2YZKA 3N58A 3QVMA 1R66A 2GUGA 2PZKA 3NDBB 1ULAA 4E08A 4D45A 4LK3A 3N87A 3O6VA 4BEWA 1N2CE 3U62A 4KR0A 2WINI 4ND8B 3UHAA 2CLHB 4XDZA 1NBOA 1T5TA 4LNUB 3ND6A 2RJ3A 4X6YA 4H3SA 3JVEA 2EP8A 3DNMA 3FOWA 5EIBC 5FOWA 3WLSA 4A91A 2FWMX 4XR4A 3RGGA 2P9BA 1N25A 3HNRA 4DKJA 3G9XA 3ZHRA 1GNTA 2YVKA 3TAUA 2DG2A 2QXYA 5KINB 3BOSA 2ZT8A 2R65A 2IPXA 1CS0A 3M3HA 4KWHA 5IT4A 2QTCA 3R76A 2E55A 5DHSA 2GKSA 4F6LA 1XZHA 4BQOA 2ECFA 4JL6A 3TEJA 4R7TA 2G0NA 3EX7C 2JIDA 1BXKA 1DBWA 5C3UA 1S89A 2FQYA 2FR1A 3B2EA 1GZ4A 2HA5A 1CHDA 4RU1A 3ZV7A 1SCQA 2PL5A 3C7KA 3SAJA 3KQHA 1VIYA 2PKEA 1DX4A 3SYNA 3FPBA 4N3AA 4Z8YA 5EMNA 2Q7DA 1Q1QA 2BI4A 2XLBA 2AXEA 3Q2KA 1CR0A 1U6JA 3KWMA 2ODEA 3ZE1B 4BVAA 1JEOA 1KNXA 4R7GA 1XQWA 3HADA 4QPPA 4BQQA 1J1IA 2HN9A 2PX5A 2FZEA 1ZJJA 5EXSA 3A7EA 5BRNA 5LP6A 2HDHA 1H2FA 4MYUA 5ALEA 3G0GA 1TIKA 2E4UA 5AW7A 3COYA 2J7KA 2RHDA 4PIMA 4GYKA 4PLGA 1Y6GA 1HMPA 4P5DA 4TQAA 2VKTA 3DP9A 4DA0A 2XTJA 4Z4GA 1V5GA 4IWXA 5E6RB 1SKYE 2CLKB 3IEKA 2W8BB 4RVHA 1G8SA 1BFUA 1SVOA 3DHYA 2YY6A 3SEAA 1QP8A 1Z5NA 2DFPA 2FEOA 5AJUA 1FB5A 2QR5A 4P3PA 4GIBA 1XZDA 1XQ9A 1OZ0A 1YACA 3CF2A 2C7RA 2WBLC 3T06B 1U6KA 5FCDA 3SZ3A 3UMVA 1R8XA 2WIKA 3KL2A 2QX7A 2BEKA 3FZQA 1YWGO 3PHGA 4CXMA 4IRUB 1IPHA 2XMPA 3RF7A 4BE9A 4DM4A 3CLHA 3LQ2A 2VP9A 3OKAA 3WSWA 2HI0A 2WE7A 5KJCA 2O48X 1NMQA 4YCNA 5A3QA 1QBKC 5IF9A 5FTMA 3ZD7A 1EZZA 2YJ5A 5FEUA 3AF3A 2GEKA 1C0KA 3DEHA 5DSZA 5BV1A 1WVIA 2CFSA 3KO8A 4P53A 1NFQA 3SKYA 4QU9A 1KOGA 2FA9A 1Y1LA 4FOTA 2AVNA 1KPHA 1QX3A 2IYAA 3DHNA 3P2YA 4UE6A 4X1OA 3MWJA 4AF8A 3ZLTA 4KOEC 2PTHA 4BJHB 5FWYA 1I24A 3ABZA 4W82A 3IEUA 5CT8A 4MDFA 4ZJUA 4X91A 1E2NA 5TEVA 4ZQHA 4DJEC 3W2IA 4ON9A 3UJPA 3HPQA 1ZVVA 1XA4A 3ONFA 4II3A 3LUCA 1V4VA 1E2MA 2A59A 3C6ZA 3E27A 4L16A 4DDMA 5K0JA 1RM5A 3TF5A 2BGNA 5ARBA 2W0MA 1BX3A 1DXHA 1ML4A 1VBNA 2MIIA 3PR2B 5LQUA 2JH8A 1X1DA 3EWAA 3RR2A 3E7WA 3KOZA 4LOKA 3HVKA 4UUAA 4A8TA 4IMPA 3C5EA 4UREA 3MJDA 2OFOA 3CUVA 4FI3F 2IEDA 2PA3A 1BW9A 2YRWA 1DUVG 3AZPA 3GP3A 4B4DA 1IU9A 3PNMA 1NSYA 3HABA 5COQA 4AG6A 2D8AA 1RZRD 4QRIA 3G5LA 2OCGA 1OI4A 3RRYA 3RC7A 1FFSA 1U8FO 2P35A 3WGJA 2OA0A 5LDDC 2PMBA 4FNOA 2VQEB 1J8YF 4HNVA 2J3QA 5KDOA 3KPYA 4HWPA 5F9FA 4G0WA 3SR4A 1C8LA 5JC1A 1CQXA 4DC1A 2YKGA 2FCRA 1NX6A 3HWRA 3B52X 4JJZA 5I3ZA 2C8JA 2E82A 2P1ZA 2UZ0A 4K9OA 1N3LA 3SS8A 1XDSA 4BB9A 5GWXA 4EK9A 4KPYA 1CE8B 2BH9A 2XSZD 3LBFA 1FJHA 3EY4A 3ZYZA 3TN7A 6GPBA 5KTYA 3W5AA 2ZIVB 2Q99A 2ZE5A 5BOSB 1E3MA 1OHHD 3OU2A 1KMQA 4KDRA 1SUBA 5I7AA 5AI5A 3NHMA 2PD4A 3A1WA 4PLWA 3KKMA 3EEIA 2A9OA 1A2OA 3EPHA 1KARA 4R05A 5E8JA 2P3OA 3A4LA 3H2ZA 3IBFA 4XDGA 4IBOA 3L49A 3FXAA 4Q5IA 3ETJA 4CCAA 2GCNA 3HI6A 2I8LA 2VJDA 4OHOA 4ZDWA 3H2IA 3L4KA 4FWTA 1Z0FA 3WHLA 2XHEA 1IULA 1DKNA 5L95A 1TKCA 1DJNA 4I46A 1U5AA 3N2EA 1LUAA 4NZMA 1GUYA 1LRLA 2AEEA 3IMKA 4PZ9A 1VG1A 2OZVA 1OWPA 4DQVA 4S1TA 4W5HA 3GUCA 3O0TA 2F1JA 2DWQA 4GMGA 3RHZA 4EL5A 1PDWA 3HY4A 3AEYA 4V0KA 1Y4SA 3M82A 1CE8A 1LSJA 1WXDA 2FKNA 4MROA 5F9MA 1NLYA 4UKDA 5C81A 3VR4H 1F7VA 1DGQA 3IVXA 5AMXA 3EUAA 2AQKA 3Q3VA 2CYCA 4I1OA 2H1SA 2ZBPA 4DCCA 5K0NA 3D2LA 2RC5A 1UMKA 1KJWA 4QC2A 3UATA 1Q2XA 3D2BA 1Z33A 5ALYA 4ZT5A 3PJDA 2O2EA 4LMBA 1JQ5A 5EMJA 3MJCA 4CUJA 5LOVA 1OYWA 1ESZA 4M0EA 2WIBA 4IH9A 5DWVA 1EWQA 4NXNB 3CW8X 1EX6A 1NIJA 1N4DA 2IEGA 4ASUA 3KOYA 3D4BA 1F2TB 1FEZA 3BAFA 4QL3A 1RM4A 3HVRA 4O63O 3ZDBA 3OTWA 2A1UA 2FK8A 4MQ5A 3OOEA 3SGLA 1STOA 5KYXA 5F35A 3RVDA 4CM4A 2GEBA 1RI1A 1T4BA 4OFBA 1MG5A 1VI2A 4EA6A 4Z49A 3I34X 1NJ2A 1GL9B 2CXTA 1D2GA 3B5JA 1I6LA 2F8LA 2FHSA 1T0UA 2PWAA 1MW9X 2HHLA 2R6CA 2A9KA 3KR2A 1H1DA 4HRAA 5ES3A 1UMBA 4J8PA 2P2DA 3TR0A 4C89A 5LKRA 3BHIA 1SN7A 4LXTA 4NSNA 4EHLA 3OQVA 2A5GA 1NQVA 4NPAA 4P0QB 3KWJA 1H1LA 1A3CA 2A58A 1OH7A 3IUQA 1RYHA 5AYVA 2ODPA 5A9RA 1QOQB 5EZYF 1DIBA 4I1YA 3EZYA 4OU4A 4FSHA 1V9SA 1S9HA 2R6ZA 3OH8A 4ZOLF 2OHOA 4YRGA 5KAPA 1LF0A 1RU3A 4ZD6A 2GN6A 3GUUA 1PD0A 1E8DA 3D6MA 2HBRA 1NVVR 4JYZA 1MX3A 4RCVA 2HU8A 1P18A 2D62A 5THQA 16PKA 4DZTA 1OLSB 2OG2A 5J2UF 4WZZA 3IALA 4QBHA 2ZJ4A 3KV3O 4S0XA 4TMZA 2JHGA 2P62A 2HXGA 2XTZA 3PEFA 1KZ1A 4PS0A 3W5JA 2FPOA 3B6JA 1O6FA 4D9IA 1K66A 1CVIA 4AAYA 1E3SA 3WHIA 1DC7A 4YRLA 4FXOA 4L7VA 3OIUA 4RBNA 4Y7CA 1ORWA 2ZPUA 1T0HB 1VZ2A 3PT5A 1J33A 2QPAA 4RZXA 5FWDA 1Y8QB 1PKEA 4FCTA 1F6BA 1IIBA 1KEEA 1QYCA 1HPLA 3PHJA 3W8EA 2FUG1 1L8LA 3EQ9A 5AQEA 4YQYA 821PA 2X4LA 4Z99A 5BURA 1FK8A 4TSKA 1Q0LA 4CHGA 4TRJA 1Q5PA 4DLUA 4J43A 1MIOA 3LT2A 1S8OA 2P78A 3HUFA 1DG9A 4LJ8A 5BQPA 1WSWA 2J9FA 3R9WA 1PFUA 2O5CA 1NXSA 2HV8A 5J40A 3S1SA 1XCPA 2BMJA 4EW3A 3SP1A 2OFPA 3VPAA 3NANA 3PSHA 2FGJA 2HTFA 3EK2A 3W3AA 2B7BA 4DIKA 2O7SA 4R1SA 4B3MB 1OXSC 2XPCA 3O8CA 4GS5A 4FUQA 3GLQA 4KO8A 4ND3A 4FMDF 1V6AA 5EESA 1MJNA 3CH4B 3JQBC 1OXKB 1Z7WA 2G4LA 2I2FA 1FUIA 1NDHA 1U7PA 2PSJA 2Z0MA 4G65A 4RVGA 4M0CA 1N36B 3SOPA 3LUHA 5NLLA 1FMLA 1HTTA 2JFOA 3KJQA 5TF4A 3U39A 4P34A 2VUTA 1N0IA 2JK0A 2B4YA 2PX2A 4BO5A 4X7MA 1NPDA 4ZKDA 1U9ZA 4UEQA 1LPSA 1QIMA 1YBAA 2C3UA 4F2HA 4LMRA 4BMDA 4RM2A 3K1JA 4XARA 5AXCA 3FOAA 1XEWX 2Y0DA 3LLMA 3LGAA 4KEAA 1DLIA 5CT5A 1LBSA 3FZNA 2FEWB 4G5HA 4BO9A 3IEVA 1E0SA 2ILVA 2ROQA 2GZ3A 2X76A 4MUFA 4E14A 5A2GA 4IIYA 5JFOA 2CMHA 2EDCA 4Q19A 3KT0A 1QS0B 4OGFA 1UPTA 3GJ4A 3GNQA 4AJPA 1QLHA 2OV2A 1X94A 2WTMA 1NM5A 2RMKA 3D6VA 1V5WA 1ZJWA 1XZFA 1KMHA 4J0JA 5TVKA 2C2OA 2SKEA 4JJAA 2A0YA 3V6MA 3GPBA 3NV9A 4H1UA 4C5CA 1PN3A 5BYBA 5HF8A 2R2AA 4WY2A 1JR3D 2XADA 4NR0A 2QL6A 2AKAB 3ZZMA 3BWYA 4FFMA 1SR8A 3E7FA 4BGUA 1A7AA 1W29A 1DXOA 1MGOA 1E2FA 3CXUA 1QIGA 2OP1A 3QMWA 4IQFA 1YAJA 4UAGA 3V7YA 4EUSA 2A33A 2SKDA 4L5AA 1HA3A 4R8VA 4W9RA 3BJEA 3M6VA 1ATIA 2FF7A 2YWEA 4ZQGA 4BKPA 2ZJZA 3L79A 2C1ZA 3WY9A 4PC2A 4UZFA 4IIFA 4C1BA 3LDAA 4C4PA 1JA0A 4E6EA 4TVKA 3RUHA 5DHUA 3A11A 1F4PA 1U8YA 3WGLA 5H83A 1T9KA 4YMWA 3QVXA 3R74A 4AWBA 4QYSA 3AM4A 3B6KA 2PBZA 1A5SB 4UVHA 3F7NA 1PR1A 2J3KA 2AZTA 1XTJA 4YHBA 5EEHA 4JYPA 1KOLA 4F72A 1KAOA 2Y66A 4ARIA 1PJLA