3O1IC

Crystal structure of the tors sensor domain - tort complex in the absence of ligand
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
298
structure length
298
Chain Sequence
DEKICAIYPHLKDSYWLSVNYGMVSEAEKQGVNLRVLEAGGYPNKSRQEQQLALCTQWGANAIILGTVDPHAYEHNLKSWVGNTPVFATVNQLDLDEEQSTLLKGEVGVDWYWMGYEAGKYLAERHPKGSGKTNIALLLGPRTRGGTKPVTTGFYEAIKNSDIHIVDSFWADNDKELQRNLVQRVIDMGNIDYIVGSAVAIEAAISELRSADKTHDIGLVSVYLSHGVYRGLLRNKVLFAPTDKMVQQGRLSVMQAAHYLRHQPYEKQASPIIKPLTPKTLHDDTIEESLSPSEYRPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Sensor protein TorS
publication title An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO.
pubmed doi rcsb
source organism Vibrio parahaemolyticus
total genus 88
structure length 298
sequence length 298
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o1iC02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o1iC01
4N0PA 4NCBA 2E4UA 4LE1A 1B00A 3H5VA 5JS2A 4TMYA 3CTPA 1QO0D 5EWJB 5GOTA 1TMYA 4LDAA 3CRNA 2MYPA 1NXWA 4JA2A 4PYRA 1QKKA 2L2QA 3O74A 1RZRA 2MSWA 2FMIA 4L85A 1D2AA 1YS6A 3MYYA 4RXTA 3RVNA 4XARA 4YWHA 3H5WA 5C5CA 4TLMB 3LKVA 4KVFA 3EULA 1TM2A 3QLUC 4MS4B 4Q6WA 4MR8B 3TB6A 3HK2A 3NNNA 1U2PA 1DZ3A 1Z2EA 1U2QA 3LUAA 3L6UA 2A9OA 4MQFB 5HKOA 4EVRA 1EWTA 1AB6A 2E4YA 1DP4A 2LIVA 8ABPA 5IEJA 1JF8A 3FGZA 3IPAA 3CFYA 1FFGA 3O1JC 2PJUA 2PE5A 4YRZA 4OTZA 3SNKA 4RXMA 4FB4A 4YO7A 4GPAA 1GCAA 2MYTA 4PE5B 1ZN2A 4G0QA 1E6MA 4CBVA 5KC9A 1W9HA 3H1FA 3LUKA 3R0JA 4MGEA 3C3WA 3LOPA 2JK1A 5EWMA 1Z17A 2JB9A 3HUTA 3QX8A 4NV3A 3KLNA 4PICA 4D74A 4IRXA 1DRKA 4NCAA 2B1JA 2JBAB 2ZAYA 1NY5A 3N53A 1ZH4A 4E7PA 1JFSA 4IMIB 2AYXA 4KMRA 5FWXA 4EYGA 5BQ3A 1YS7A 2CHEA 3F7NA 4JB2A 5EWLA 2HQOA 3OLZA 2P4UA 3D02A 3CHYA 4KZKA 5DTEA 4F06A 3KSMA 3OO1A 3NHZA 4EYQA 1QP0A 3OLYA 5JNVA 2HQBA 4IF4A 2JVIA 1XHEA 3VNAA 4RDCA 2RJOA 1YTUA 1D5WA 1USGA 1LJLA 2RJNA 1YVUA 1UDRA 2PL9A 4KQ9A 4ML3A 5D2CA 1I3CA 2FN9A 1DC7A 2GBPA 4QICA 3CNBA 3KS9A 4KNYA 4MS1A 1TLFA 3EQ2A 2PAFA 1MB3A 1VPWA 3O2JA 4Q7EA 3HM9A 1CHNA 1SXHA 2Q5CA 4MQEB 3VNBA 1RPJA 4RSMA 4S04A 3HVRA 2PUCA 2HJ9A 4Z99A 3ROFA 3SQNA 4UHJA 3TMYA 2IPAB 4HNRA 4MRMB 4B09A 4F3TA 4MAAA 4P98A 2RGYA 2B4AA 5TQJA 1DCFA 4WXEA 5GQSA 1ABEA 4UHKA 1KMIY 3FMVA 4FE4A 4LDZA 4MYRA 2JVKA 3HEBA 5FWYB 2R47A 4TLLB 2HSGA 1JYEA 3LFTA 4P1ZA 5BR1A 1ZGGA 5FBHA 1EHCA 2NZUG 5C5EA 3UUGA 1JFTA 2YHAA 3Q7RA 3KLOA 3S99A 1JL3A 4Z4CA 4L4UA 1GUBA 1DBQA 3HUUA 3JS5A 4MR9A 4RZSA 2JVJA 3CZCA 2ID7A 1URPA 3EGCA 4YV7A 2LP4Y 3UKJA 3MMNA 2IDMA 1ZY2A 3C97A 1C0EA 5CNMA 3QEMA 2YHBA 4EYOA 1QP4A 2A9RA 2JRLA 3K9CA 4H60A 4MR7A 5JNRA 1MAVA 4F12A 2FW0A 5IX8A 1RXIA 3Q9SA 2OQRA 3CKMA 1E6KA 3IP5A 2FTKE 4RKQA 9ABPA 4KRFA 1NXSA 1JDPA 1Z25A 2WY2D 5IUNC 3QELA 1A04A 1L5YA 4LE2A 4MS3A 4YP9A 2R25B 3G1WA 4LE0A 3DLHA 4Z9BA 1T34A 2VUHB 4WWHA 3QEKA 3JPYA 2WMYA 4XASA 5CHYA 4ZMSA 2ID9A 3FFTA 2FN8A 1AB5A 2VK2A 4G0XA 4HNSA 4ETIA 1ZESA 4YS6A 5TQ0A 4Z4HA 5F64A 4RKRA 1FFSA 3KYIB 3QLVA 2NUBA 1D4ZA 1DC8A 2WJAA 3OQNA 3A0RB 1JYFA 3C3MA 3RVJA 1L5ZA 1VLZA 2ZWMA 2PUAA 1GLGA 3RVQA 5TPWB 1JHZA 1JH9A 4E7OA 3OO0A 1NXTA 1BAPA 4RY0A 1YK0A 3ILHA 1HEYA 3CG4A 2F8TA 4Z4EA 1ISSA 4YLEA 1DBPA 3H1GA 3O1HB 2GKGA 2IPNA 3GV0A 4O5AA 5I4CA 3H6GA 5IBQA 4MLCA 4ETNA 3MA0A 4D6YA 3GBVA 5PNTA 5TE9A 4W5QA 4RY9A 4WUTA 3RVPA 5E3JA 3N0RA 4Z0NA 3HCWA 4DN6A 2QV0A 1EWKA 3KG2A 1YMVA 2LUOA 2PKXA 3KHTA 4JP1A 2FLWA 4Y9TA 3O75A 4ZMRA 1A0OA 2H0AA 4DADA 5BRJA 2MYNA 3CZ5A 4WXMA 1FQWA 2NT4A 1P6UA 1Z13A 1SRRA 1MVOA 2X7XA 1JBEA 3OLVA 3LUFA 4ZJPA 3SAJA 4N41A 3IP6A 2PLNA 3OMWA 4YR7A 1BDIA 3K4HA 2MSKA 3G85A 3RH0A 3QLTA 1QO0A 4N0QA 2R48A 3LUHA 3HV2A 1LJUA 4H3KB 3LKBA 4ZYLA 2QU7A 1FFWA 2LPMA 2MYUA 3D8UA 4JASB 4XAQA 2F8SA 2FQXA 1LBIA 1Y1LA 2XDYA 3CG0A 4RV5A 1JDNA 1QQBA 2NZVG 5EWMB 1QP7A 2PMCA 1XHFA 1NXXA 1VKRA 4KK3A 1ZGZA 4EYKA 5KI6A 3LUCA 4OATA 4Z4FA 4KFCA 2GWRA 1DCKA 3M9XA 5TQ2A 5KQMA 4W5NA 3W9SA 2FMFA 5FWXB 3N6VA 3BBLA 5EWLB 1BVHA 4RU1A 2R4QA 3BRQA 3CS3A 3GL9A 1KRXA 4LX8A 3RVLA 4RK6A 3T8YA 4ZPJA 5KC8A 1EFAA 5JNSA 3JPWA 2GX6A 5DKFA 4OLAA 1K66A 4PEVA 1QMPA 2HQRA 3BRSA 3QX9A 4JAVC 5DCLA 3MF4A 5IUJC 1NXVA 2PUEA 4ETMA 5KQGA 2E4ZA 4KREA 4RK7A 3URMA 4MS1B 2BGGA 2N9UA 1RNLA 3OLXA 4Z4IA 1NTRA 4RK4A 1M2FA 2A9PA 3OLWA 3RVRA 5ED4A 4M88A 2WRZA 3E3MA 3OM1A 4LRQA 3C6QA 1A2OA 2QVGA 3F6PA 3DBIA 4NQRA 1JX6A 5KWSA 1YIOA 3P9YA 1BA2A 1SXGA 5IUKC 1JLKA 2CD7A 5JNUA 4W5TA 3T95A 4WZZA 1KRWA 5T7BA 1QPZA 4MPTA 1YMUA 3LMKA 2O20A 3FFWA 3CLKA 3QLVC 4RK0A 3E61A 4MR9B 1SD5A 1Z18A 1D1QA 2FQYA 4IILA 3N0WA 2I6FA 1GCGA 2H3HA 5T3YA 1W25A 1P2FA 2JCGA 2HPHA 3EDCA 5EWJA 5CNJA 1Z12A 2OENG 3HSYA 3RVKA 1H9CA 1ZDMA 3OMXA 3QEMB 1JFVA 1PNTA 1SXIA 3I5AA 1NXOA 1Z16A 3HXMA 5ABPA 3UK0A 3GWGA 1U04A 3HZHA 5JNTA 1CEYA 2IYNA 4MS4A 5DGCA 4MR8A 1E2BA 1EWVA 3QK7A 3JVDA 2IKSA 2PL1A 4N03A 3Q7TA 1NATA 3EAFA 5DLEA 3LUJA 4MQFA 1TJYA 3QELB 4MS3B 4OG2A 2FMHA 4EUKA 2PUBA 3SM9A 3GYBA 4LZLA 3DLBA 1OXBB 4MLDA 3JVIA 3M9WA 3SY8A 3H5LA 3F73A 1D1PA 3N8IA 3SG0A 2FSPA 4G0ZA 1ZITA 2FVYA 5BRAA 2V0NA 1DG9A 2E4VA 3O2QB 1DBWA 1Z26A 2FMKA 2FXIA 3EQZA 1KGSA 4FE7A 3RVOA 4EGSA 5KQPA 1PEAA 5TQ0B 2WWVD 3KTOA 3HDGA 4KK4A 3FFXA 2RDMA 4RK5A 1ABFA 4DQDA 3JTEA 4Q6BA 4OLBA 3EJWA 4Z9AA 1OXKB 4XFKA 5IEBA 4S05A 4N76A 1FSPA 3TO5A 1PNRA 1ISRA 1DCMA 2FLKA 3H6HA 1XWWA 4G0OA 4RXUA 4TN5A 1LBHA 3O1IC 3Q41A 2JBAA 4RK1A 4RS3A 3T6KA 2QVCA 1Z15A 2M98A 2E4WA 2QSJA 6CHYA 5TPZD 5HM6A 4G0YA 4Z4GA 3MIZA 3NHMA 2J48A 3MQ4A 3Q15C 3QLUA 1QNLA 2TMYA 3A0UA 3DGFC 3LTEA 4G97A 4PZ0A 5IC5A 4F11A 2VYCA 3KYJB 1ZHHA 3A3KA 2CHFA 1J56A 1ZH2A 2M1ZA 3LUGA 2PUDA 4KPYA 2QR3A 3BREA 3IPCA 2AYZA 4KQCA 4XLTA 3BILA 3N75A 3KKEA 1F4VA 3B2NA 2E4XA 1BDJA 1MB0A 1F51E 3M6MD 1PHRA 3OM0A 4MQEA 4IGAA 5CNIA 4EVSA 2L17A 2QZJA 4QPJC 2IPMA 4YCSA 3IP9A 2LBPA 2GI4A 4EVQA 2L19A 5FBKA 2QXYA 1M5UA 3H5OA 4MRMA 1CYEA 5HSGA 1S8NA 3NNDA 2WJWA 3ROTA 3RVSA 1NXPA 1BDHA 1GUDA 1ZAYA 3OQOA 5FWYA 3NBMA 1JWLA 3FDFA 3Q7SA 3GBPA 3H75A 2NT3A 1QQAA 3MM4A 3OQMA 3H5TA 4IMJB 1ZVVA 1YK1A 4EY3A 5CNKA 4D6XA 3LUDA 3TX6A 3DGEC 3HDVA 1IIBA 4G0PA 2FEPA 4YGXB 3KCNA 2QW1A 4XXHA 2PUGA 3O2SB 1EAYA 3GA5A 5TPZA 5JS1A 3HS3A 5TQ2B 2FEKA 1LK0A 4OBBA 3KJXA 1MIHA 2FQWA 4QYMA 5KQLA 4GNRA 2W42A 1DRJA 2L18A 3IP7A 3A10A 2IOYA 1WETA 4HYEA 2P9HA 3I42A 4G86A 4O1HA 1PEYA 1U8TA 1RZRD 5IULC 3IDOA 1P6QA 2VUIB 3ILYA 4H3HB 4RY8A 3HO1A 3GRCA 3H5IA 3L49A 1USIA 3N0XA 3F6CA 3H1EA 3C3KA 3HJFA 3I09A 2DRIA 4W5RA 3DZDA 4N47A 4F8JA 5HQJA 5B3JC 1M5TA 1DJMA 1USKA 1P8AA 1C4WA 4O1IA 1R8JA 2FKAA 1Z2DA 3I45A 1TVMA 1APBA 4JOQA 2KYRA 1PUXA 3EODA 6ABPA 3TD9A 2A9QA 3NNSA 4QYWA 7ABPA 4WT7A 1K68A 4RWEA 4MR7B 1VRVA 2CWDA 3CU5A 2FEWB 5JNWA 3T38A 1E6LA 5B3JA 5TPWA 4JB0A 4KV7A 3O21A 1U0SY 1M2EA 4HNQA 1RXEA 4NICA 4W5OA 3RVMA 3JY6A 2WB4A 2IPLA 2PUFA 3RQIA 2MSLA 3GT7A 4G0MA
chains in the Genus database with same CATH superfamily
3MUOA 3ACBA 5AH0A 5FLYA 2OE2A 3M5DA 3R09A 1Y5LA 2O5RA 1CDDA 4LJ4A 3NHKA 4ZN6A 2FK7A 4R4JA 1QO0D 3VAYA 4KRXA 4M1KA 4ZZIA 5ILOA 4JI4B 4OYHA 3L0IB 2GHIA 3VUEA 4KWCA 5ALSA 1QF9A 3AFNA 2Q3JA 4GMHA 4TKLA 5AO9A 4REQA 4G0VA 1TFUA 2VS1A 1MFZA 2PSFA 1E4YA 3D59A 4F46A 3H5WA 2GJ8A 2Q3HA 1T2VA 3LX8A 1PNOA 4N12A 4XUDA 5LBIA 3KB1A 4O4IF 3S1LA 4G24A 2BGKA 3CNQS 1HNNA 5LQNA 1VBMA 3IC5A 3UG7A 3AM4A 1JIIA 3S81A 3U44B 4EUEA 2JLQA 2BGLA 3PICA 3RBAA 2QSZA 3DZGA 3ZHBA 4BNMA 1DL5A 3ILSA 4QM6A 3P19A 1VHWA 3P9IA 3VNSA 3EFOA 3RREA 3DKKA 3D3QA 3QH4A 3H19A 1Z5UA 1CP2A 3F5QA 2JFWA 4G1EB 4OA8A 3M5PA 5HJEA 3ELWA 4FR5A 4NECA 2CF6A 4DLLA 1CVIA 2H0QA 4GLBA 4YO7A 1GLNA 2AS0A 1QV6A 2AN1A 3LUKA 3VPXA 1SXQA 3MFQA 1ML4A 4BGUA 2ZBEA 1W581 1ZW6A 4OO3A 3B3JA 4PFJA 3LCMA 4YXFA 3ILVA 3RTGA 4TYQA 3UMVA 2HCTA 1YV9A 4PIVA 1UBMS 4QVKA 4UM9B 1LDEA 1CUUA 1X3LA 3UATA 3DV2A 3PSAA 1EEXB 3PV0A 5EKUA 3VAAA 2AF4C 3IPRA 3R0ZA 4C6SA 5DBIA 2ECFA 3NEPX 4M0UA 1EUDA 5DEOA 4BGIA 5B58C 2QUKA 2Y1KA 4P53A 2BPOA 4RPCA 2VT7A 5EWLA 3QSGA 2J9ZB 3SEFA 1A9ZA 2GO7A 2R1ZA 3MWEA 3ORSA 4GBJA 3DC2A 3TSCA 4DG9A 3D02A 2PA3A 1G18A 4KNWA 1QGED 1AGPA 1EB8A 1OX5A 1MD9A 2CL0X 1C7QA 2H5JA 2IEYA 3KSMA 4DM3A 1LI7A 4D4KA 2UUCB 2XPCA 4KAFA 1QWOA 3N8KA 1QFMA 4HD8A 5JNVA 4AXXA 3IVCA 4MWDA 5JIBA 1TF5A 4LZAA 1JEEA 1YR7A 2RJOA 3CIOA 1NT4A 3GEHA 4HLQB 5L6LB 1Q74A 1PNVA 2P6PA 3IBTA 3DPUA 4ML3A 1ODSA 2PG3A 4YJ3B 1GZDA 1DQRA 1IVNA 3CNBA 4QU8A 2CNBA 3BQNB 4X1KB 1FMCA 4KWTA 3IQIX 4OU4A 3CN7A 5EJMA 4R8KA 4PX5A 4YJFA 3L0SA 1T3GA 1U0OC 5GJBA 2Y68A 1HFKA 2O2EA 2BD0A 3VNQA 3WLTA 2DPLA 4FEEA 4Z99A 1GAEO 4RSRA 3W5HA 2R66A 5F23A 5LQRA 4HNRA 3PQFA 1G8MA 1SIOA 1JEOA 1I3NA 1T1EA 3DFMA 3B7WA 3COPA 2B4AA 2CDCA 4OSOA 4XR4A 1U7OA 2FPKA 2IEZA 4GLLA 2YWBA 1ABEA 1EQAA 4TKZA 4ARAA 4C30A 4EECA 1N2OA 3WNDA 4LIPD 4H7IA 2OAQ1 3SEAA 3MD0A 4MWSA 2HSGA 4MVJA 1U4SA 3TKLA 5BR1A 1LRLA 1NC1A 3NEYA 1NPYA 2R7AA 2IZ5A 5FBHA 4GL2A 4YAUA 1UPCA 3HKCB 1NF3A 4UCXA 5FQNA 2DT8A 4WJLA 4P4TA 4E30A 5J4HA 3I6BA 4YUXA 4PSVA 1LBEA 1JL3A 1KHHA 1NFFA 5IH3A 3RFFA 4C4TA 4Z4CA 3TG2A 3IOYA 5T3UA 3PRYA 1Z2CA 4LYFA 3A36A 4XIIA 2JVJA 4MX8A 2XNHA 3CJTA 3Q3IA 1X7YB 4CLEA 4ZYXA 3EUFA 4B4UA 4PYKA 5EMJA 2J3DA 4GZ3A 3QTBA 3OZTA 4IWNA 3MWGA 4A0QA 1H6AA 4RWZA 3VR6H 5K05A 3SSNA 3H87A 4JL5A 3TCKA 1ODLA 1PUJA 3A4YA 4H3VA 4EY7A 1XRJA 3HSKA 4EYOA 1E5TA 1CVRA 4RJKA 5E3IA 13PKA 4MR7A 3NCTA 3UJ6A 5JADA 2BMEA 4Z2YA 1YGPA 2ORIA 4JGIA 4OQFA 2OQRA 4X60A 2R6GA 1OZ0A 4E08A 4A7PA 2GK6A 1GG2A 3E1SA 3JYPA 2BKAA 3LW7A 4QQFA 3ZJ5A 1H0RA 1E4VA 4D82A 5ICCA 1DADA 2EIXA 3O95A 3QELA 1C0KA 1D2RA 3NHLA 1E99A 1F8YA 1TM7E 3L6BA 1IWOA 1SVKA 4MW7A 5AUPB 3HJTA 4H1HA 3PPVA 4QTTB 3DE4X 1LY1A 3M5WA 4H7EA 4GE0A 4RTNA 5G0UA 2VUHB 4QRIA 2IHBA 1X1EA 4OQYA 4BECA 1LDMA 2X0IA 1C14A 4MKFA 3TNLA 4OHCA 5EZ5A 4LXUA 3UWDA 3LDAA 2PLWA 3KFLA 1V1RA 4ZO8A 4AY4A 1HRDA 1WCXA 1YE3A 4J90A 4KFSA 2CXOA 2JZNA 4K87A 3CLRC 1TUBA 2C7RA 4TMZA 4PNZA 4KUEA 2A84A 2G80A 4HUQB 3TIFA 2PMWB 1CQWA 4G9GA 2PMDA 5KAMA 1OY1A 4IDOA 2G0AA 3C4VA 3K6SB 2VDWA 2O8BA 3NFRA 1WZUA 1XVVA 4C6TA 1PJLA 2AMLA 3DEHA 2YJ6A 4WZBA 3BXGA 4M0LA 3GUZA 4X6LA 3ZV3A 4DSOA 5BVHB 2C4VA 1GTL1 3EZ9A 5KB3A 5IXYA 2DLNA 4R6WA 3PUJA 3FNBA 2WLTA 1OQAA 4DCJA 2WJZB 1AKTA 1DBPA 4IIEA 3I5XA 2VDJA 1WHTA 1RPAA 3O1HB 1TM3E 2AI2A 2BFBB 5KU7A 1UM9B 3D4IA 4P34A 3TLCA 1WSDA 2HMTA 2V4UA 1IUOA 4EY5A 5HR5A 1KZ1A 2B61A 4B73A 1NW4A 1TB4A 5PNTA 1G8JA 5BSHA 1EK1A 4LOKA 1LKZA 1CR0A 4ZYTA 4UU7A 4DN6A 2GT1A 5IASA 5L8VA 1B23P 4PW0A 3AY6A 2W6NA 4N3AA 3DO8A 4HXFB 4KQGA 2VZ9A 1ZLYA 4AM8A 3MAGA 5AJXA 1T1JA 4HR7A 3THXB 3C6YA 3GZNB 2LGJA 3RSSA 3ZGLA 1IONA 1E2QA 1D2GA 1BXGB 1H1TA 3DTYA 1KHTA 1JBEA 1RXYA 2BCJQ 4G41A 1XZAA 3D54D 1FA9A 5ALEA 3WYAA 3WKBA 4DJ5X 5HUJA 3GJ6A 1DQPA 1L5RA 3U40A 4EL0A 3HVUA 3OT5A 1L3IA 3IESA 1MVNA 2A58A 1F12A 2B6NA 3IP6A 5F2EA 1Y3DE 5LP6C 4LYGA 4CLRB 3LZ6A 2XNSA 4DCGA 4EGJA 4EGAA 4JYAB 3DMNA 2C5EA 2A1IA 2ZBUA 1JXAA 4EHDA 1YU6A 2BE9A 3GRRA 4DQKA 2GPSA 3IEMA 5TMEA 3ZWKA 1IVSA 2PANA 3NIWA 2F8SA 3HJBA 4UTRA 4B3XA 3LM8A 1CW2B 4LXGA 1O96B 2YZGA 1E1DA 2H31A 5EJAA 1OIXA 5LXTF 3ER8A 1T0UA 1F0NA 1YR3A 1T3ZA 3L7OA 3MLAA 4IS2A 4BN4A 4DSUA 1JTEA 2I3DA 3AR6A 4TYWA 3LRTA 4Z4FA 4WFQA 4JBIA 4RMJA 1S3SA 3M9XA 4K88A 4DTIA 3NASA 2OUKA 4CW7A 2JLVA 3PTZA 4IUCS 3N6VA 5LYJB 1ISGA 2SNIE 3G23A 1N2CE 2ZE8A 2R4QA 1BN6A 2N0SA 2X2FA 1XLTA 5HIJA 3O2NA 5LC1A 2NXCA 2FX5A 3NMUF 1UFRA 2DFKB 5EKDA 3RUPA 1WEKA 5AW6A 1A9RA 3DV0B 1DBSA 4S1NA 2HLDA 4WE3A 1OXTA 4IEIA 2AFIE 1Z56C 3P9PA 2ET6A 2P6NA 3A8TA 3MF4A 3ODPA 1P2UA 5AM0A 1CUDA 1UZNA 5JI3E 3VPBA 2XQJA 2FCAA 4LNUB 3R6WA 4FJ2A 4JWKA 4OGFA 5KQGA 3FCSB 2HK7A 4BO1A 3KHSA 4ZRNA 5FUXA 3LHKA 1XV5A 1U02A 1GNQA 3H0EA 1DT3A 4JKYA 5HBGA 3ZHQA 4HGNA 4PLGA 3PE4A 3AB3A 3H1TA 1QRDA 1NTRA 3C5VA 5AHWA 4COKA 3ZE9A 3DE2X 4RK4A 3OLWA 3ICEA 6Q21A 1E4OA 1Y8CA 3T7IA 3L7AA 4BGEA 4BASA 4ENRA 3JW8A 3IBCA 3AF2A 5CLLA 1M6VA 2NPFA 4C2UA 3A2NA 5CVJA 2EGHA 3BMOB 1V16A 3OX1A 4NQRA 3CLUD 3GD7A 1BA2A 1JLKA 2G28A 1QIEA 1EGVB 2FW7A 3GT0A 2IF0A 3TRFA 1ZCFA 2DH6A 3F9RA 4NY1A 3JYOA 3CGGA 4CN9A 2YV2A 4GZMA 2VDUE 4LKOA 4A36A 2HT1A 3HCCA 1JEDA 4U02A 5BP7A 1F4PA 5GONF 3DXXA 2VNIA 1YB4A 3R24A 5FPHA 4B3FX 3V4PB 3DE3X 3S7TA 3U7HB 3ZIUA 4EGQA 4G8DA 4JT4A 1T0JB 4JN6B 4XQEA 2PH1A 5B64A 3U09A 2OZKA 4CKZA 5DTRA 2C5HA 1Z5PA 2DQKA 4AJLA 3QPCA 5F3RA 4KQMA 2AZXA 3UXYA 2Z2ZA 3QRWA 1GYPA 1SZPA 3QPWA 1XL0A 2GBFA 4WXRA 3TNYA 1NXOA 1UMDA 2Q2NA 5LZ8A 2JLYA 5JNTA 1EJBA 4J1NA 5JYDA 2ZB7A 3H7IA 1NN5A 1EWVA 2UVDA 4J1SA 4MR8A 4YRNA 1SXPA 1ETUA 2HR1A 2HUPA 5DLEA 3PE6A 1GFWA 3SX4A 5DYIA 3JQGA 3H9CA 3KYCA 2Z6QA 4HBZA 1RRVA 1SXJD 2PT7A 2YZ2A 3IDSA 4UXJA 3ZEIA 3A6EA 1SHZA 4X1YB 1AHIA 3SY8A 2F3QA 3F73A 1A8HA 1U7WA 1C30B 2CJXA 1ZJ5A 1YBFA 1N5DA 2FEMA 2P7HA 4TYMA 2XRMA 1TW3A 2ZUTA 4EJMA 5HIAA 2XBUA 1J5XA 3OZXA 5ALPA 4AMVA 1LX6A 1Z26A 1Q17A 2DFDA 4PGMA 5F9MA 4D25A 4MIKA 4UUMA 1WB6A 3RS9A 1TL7C 4WTOA 2A33A 1LS6A 2FETA 2R8XA 2RDMA 4NBNA 4O2BF 1U3VA 1N5OX 1C7ZA 3H9JA 2IP1A 3HFRA 4JD5A 3NT2A 1PFYA 3ACDA 1YA4A 1HV8A 2L0XA 1A5TA 3BH7A 2IX9A 3GPBA 1AXGA 4LY0A 4P4GA 3K16A 1GAQA 4QUIA 4BJ5A 5BV2P 2XRZA 4NYIR 5CCDA 4FHZA 4RS3A 3JALB 1Z4MA 3ET5A 1C3XA 4FEYA 4JLJA 4XD7D 2G72A 1F3OA 1HE8B 1TVKA 2W4MA 2Y9PB 2M98A 2QI9C 2HAEA 4JYMA 4MTCA 4DOMA 1OWNA 1N5LA 3G9ZA 4NBLA 3ZHSA 4OXNA 1K97A 3E5RA 5FPPA 5A4DA 1NMEA 5HVNA 4FCWA 4XI9A 1V1JA 4KAXA 4M4SA 3SI7A 3JWJA 1H1LA 3SPXA 5J58A 1FFYA 3L8GA 3QFTA 4NTZA 3WISA 2ZXFA 3KQNA 1N5JA 3GDWA 3CNNA 1QYXA 4UD6A 2VNAA 1JQ5A 4NBTA 4RCYA 3UK1A 4BQRA 4CKBA 2XD4A 5I4KA 5JRJA 2PUDA 5EXPA 1Y3FE 2NU9A 5FI3A 1CETA 3CZ4A 5DHQA 1UKCA 1L5MA 1WF3A 4AVYA 4E4TA 1ID8A 2WWIA 1UZLA 4QQRA 5J2UF 4OOFA 4B34A 2RKOA 3ZXXA 2R6FA 4I1UA 3JVEA 5LIPA 3ER9A 2K87A 4E07A 4EG7A 4EMBA 4YCSA 3OICA 3U13A 2ZI4A 4QDOA 5CYPA 4CKXA 3PGMA 5EE3A 1PO7A 5A62A 1DAFA 3N76A 1KKMA 2HT6A 1YC2A 3P2JA 3QEJA 1PZHA 4LRYA 4GX5A 4QO8A 3RNLA 1VIMA 1T4GA 4JFAA 4R98A 3UMBA 1YFLA 5JD5A 4P3KA 3OPVA 3TBFA 1P0QA 2I7TA 1F8XA 3O8QB 2VWGA 1JWLA 1A8UA 2KHZA 2OWEA 1JKXA 4A6PA 5I45A 4H1TA 2XWQA 2NQTA 3AU8A 3FNQA 4U63A 4KVAA 3OQMA 1E2UA 4FFNA 5D5HA 4WBXC 3UV6A 5EZ6B 1KO4A 2FJ0A 3H2JA 2R0QC 1SU7A 2HJWA 2E5FA 4REOA 3OCXA 4L57A 4B8WA 1TD9A 4X3CA 1QVAA 4HWPA 2JFYA 4XD7A 1L7QA 2IBMA 2OQ2A 4ZZ3A 2PJDA 3DM9B 1M66A 1SQ6A 4A92A 5BV7A 4V0RA 3M3DA 4RFSA 4C2BA 3T1TA 3CPJB 3BF7A 4PG5A 4C22A 1AGRA 3T35A 1TMOA 3WSVA 2Q4RA 4EQ6B 2V3WA 4CDGA 3Q2KA 4HJXA 4YPOA 3MLBA 4A8PA 1DJQA 4UM8B 3EXFB 5JMTA 1WUHS 4ZGBA 2H2HA 4XEUA 1LSJA 5JZVA 1U99A 5A3SA 2PUHA 4MWZA 4ED9A 4X94A 4MV4A 4BVGA 1J2UA 5GIPE 3ISVA 1K8YB 1ODCA 1ISPA 1P6QA 2OAGA 3SC2A 2Q49A 3WICA 2ZS8A 4I81A 1HL3A 3MSCA 2WJJA 4GMDA 2G1KA 3CLRD 1LF0A 4O8CA 1R5JA 1RM0A 1DTSA 3LVRE 3N0XA 4Q9AA 4H9GA 5THQA 4B6RA 3H13A 4R9NA 3RAGA 4LDQA 3QX3A 1RSZA 3B9RA 5C8VA 2VEDA 1SUSA 3NEAA 3MXTA 4ZEMA 1RLIA 2C94A 4ABYA 1ZGAA 2GVZC 3G8AA 3C74A 3PA8A 4MW4A 3TPFA 4B31A 3TD9A 5IVPA 2DBZA 5JXGA 3MS7A 3OZDA 3BWYA 5IVIA 1MX5A 2EZ4A 3V8EA 2FZ5A 2D54A 2NAPA 2VHWA 2GNAA 4OXXA 4M9XA 2QYHA 2I71A 3O21A 3PZRA 1JGTA 2IYYA 1Q21A 1KFCB 4OUDB 3HPRA 5CUQA 1NW9B 3WKEA 1KJZA 2IXBA 2CJFA 3UANA 3HDQA 3K2BA 3QWHA 3ZJTA 3EISA 3WWOA 2DBQA 1RHMA 2EXXA 5M2QA 1XX6A 1GPUA 1CJBA 2B5WA 1XELA 1H2ZA 1P2SA 3DOOA 3GDOA 3IELA 3V7FA 2PIAA 1XRPA 1SVMA 1B3RA 1KARA 3G0CA 4R1UA 4FR0A 5H68A 5FADA 1OX6A 3PEVA 3BFXA 5GOTA 4MGKR 3JZFA 2AL7A 4PV7A 3W77A 4C1NA 1PKEA 1BFUA 4K7JA 3HMKA 2H8GA 1PFKA 1XFAA 3ICQB 2BI8A 1EA7A 2HD4A 2Y2VA 4ND6A 3QHPA 2YZ7A 1E89A 3IVRA 1XU4A 2F43A 3MTEA 3THSA 2W2LD 3OBIA 3QLUC 3QVLA 3TB6A 3NYQA 3NNNA 5BWCA 5IAKA 2PJZA 4MQFB 1SBIA 4BWYA 3N8DA 1Z22A 2HGZA 2NU6B 4ZQCB 1U3WA 1A71A 1JF8A 2AFVA 2CWWA 5KSZA 4K6CA 4RTPA 4I14A 1NASA 3W7VA 4PHHA 4HVLA 3MT0A 2J67A 3O91A 3CONA 1T9ZA 4BO3A 4W7HA 4K6HA 3NYRA 1M8FA 3OPYA 4ASUD 4PZLA 1HLDA 3P9RA 4MA4A 4R7TA 3C8DA 2OOKA 5ALOA 5A9TA 2H7YA 4HWRA 1X15A 4BAUA 1L5WA 3Q8MA 2X0RA 4CMHA 4FOOA 3Q0TA 4LHVA 4FMDB 1UBEA 4NV3A 4CKCA 4RHYA 2GHRA 4MWGA 3ZI7A 5BN5A 4HC4A 3K9WA 4NENB 3I4FA 1P5FA 1P81A 5KNBA 2Q4BA 4UC0A 4KMRA 3QXXA 4LHWA 2B2NA 2VDRB 3HE3A 3G5MA 3KAJA 2GNPA 3KP1A 2QJFA 4I4CA 2V97A 4X7MA 1AZWA 1TKAA 2FU5C 5HA5A 4NU6A 3VZCA 4C87A 2I91A 4E5UA 3UJNA 4R7GA 4K05A 4NV0A 5F5XA 2R60A 3NOVA 1H42A 1PJ3A 5E9WA 3RT7A 4V1CB 2MOKA 2HQBA 3FNRA 2WWXA 4CG1A 4B6PA 1T9AA 2CXUA 4LV6A 1EHYA 3C8MA 3EQ9A 1B73A 1E2EA 1GWNA 5B7PA 4CL0A 4NZYA 4FBLA 1Z35A 5JSZA 1U81A 3OTQA 5D6OA 3RK4A 2ASEA 3NTRA 2W2LA 3CYFA 1DJPA 2F3SA 1CNFA 2H1LA 3KS9A 3PCTA 3QP9A 3GH1A 2EKLA 3W5VA 4QWWA 4HAWA 1VLHA 2QD4A 3F5DA 3QNUA 1V2HE 1ZNXA 1XTRA 2C2OA 2NSJA 2UUOA 3R6LA 4XCVA 5LB2A 4S04A 3RADC 1DX9A 1HQCA 4KBFA 5KX5B 4EEKA 2PUCA 3O8DA 2AG6A 4UHJA 4C0QC 2IPAB 2P2YA 4O2AA 1QQ5A 5HMLA 3G2OA 4Q1FA 5DLQC 1EK6A 4O08A 1NVAA 1M1ZA 1NSYA 4OP1A 3QPUA 5DYNA 4BQSA 1SHKA 1XXHB 3P7MA 3V8BA 3RUHA 5F73A 5FOVA 4A1FA 2CJYA 3QXCA 4X00A 4ASUA 1JXOA 3HEBA 4BXOB 3WK5A 1UJNA 2X4GA 4C06A 3BRCA 2AUMA 1WCYA 4QTUB 1P31A 5C4GB 2CUNA 3F1KA 2OAP1 2RBGA 2GN6A 3FSEA 1I24A 3KLOA 3Q7RA 4MVJE 3S99A 5BW4A 2MDTA 2FHPA 2FMUA 4JK3A 4EA8A 5LLTA 1CR4A 1KKUA 5FI0B 1QPBA 1ELOA 2FUEA 2Z57A 4ND4A 1XK7A 3OCUA 1XDZA 1SRQA 4Q4JB 3OJLA 1R1DA 5CT5A 4B45A 1H0SA 2WR8A 6AT1A 1SAYA 1T8PA 2HFKA 2IXDA 3DNMA 3KPWA 3MOSA 1QB7A 4Q4HA 4Y2PA 1OGIA 3FY4A 4OP3A 1UMCB 3ECCA 2P1DA 3QG1A 3SBDA 1P2DA 3DO6A 1MORA 1X7GA 5TB5A 5CDFA 3TS1A 3BC1A 2CEAA 1YIAA 1ULSA 2XITA 4RETA 2RHLA 2YUTA 2QROA 2CMKA 3ICWA 1TJNA 5I8WA 2FMTA 1H4SA 2CN1A 3DFUA 4JC4A 1JPVA 2YWFA 1FTQA 3FZYA 3G9QA 2X0DA 5EJ8A 2DXIA 3HO8A 3I32A 5JZBA 1BS9A 1QG0A 4KXMA 4AS1A 4XASA 5F2KA 3L8ZA 1BYUA 1HDXA 1N6NA 4CEIB 4KXXA 4DBLC 4YJ2F 2BJWA 3NP9A 4MICA 1H2BA 4P54A 3WMXA 2XVMA 3DAGA 4EKIA 1UKYA 2V9CA 4NJEB 3UWPA 3RVJA 2W0SA 2CJWA 3I4LA 1VJTA 4NHEA 3D0OA 4XZ3A 5E7IA 1WD5A 2QAGA 4IUBS 4NCIA 2HNAA 3NATA 4L07A 5TPWB 1XRRA 3TB4A 2WJ3A 3F7MA 3Q0EA 3L4KA 5CG1A 2G0TA 1BAPA 1J97A 2IXEA 5IAJA 3ZS9A 5JXJA 1A5SB 4NK5A 4WZBE 2B98A 4QNRA 1NI5A 4IJ5A 5CH5A 4CT5A 5KTRA 4NQZA 3NANA 1P4SA 4HXGA 5DIZA 5HRUA 1XMIA 1F0KA 1ODIA 1PT7A 4Y6LA 3HU1A 2AVDA 3OHPA 3CCBA 3T1OA 1N9GB 1ZJYA 2GKGA 4O5AA 4EG5A 5I4CA 3H6GA 3P2MA 4L8GA 4C7XA 2NOAA 4QXRA 3U4HA 3ZBQA 4BFUA 1U0GA 1M34A 3KSUA 5D3MB 3RIGA 2XTMA 4E51A 1CS0B 1KZHA 2DM6A 4BUCA 5E3JA 2QD1A 3EVAA 2HYDA 3FMGA 3K5HA 3SYMA 3UWSA 4ZCMA 3WRVA 5JQGA 3SBXA 4BC0A 2RHGB 1CSEE 3PWKA 5HZMA 4OLAA 2ZIFA 4FLMA 4JP1A 2FLWA 1O2DA 4FGKA 2G63A 2GEFA 5IDQA 3SU8A 3FPCA 1YHNA 4Y9DA 2ISCA 1GNPA 5I5EA 3KOWA 1OWMA 1BRMA 1JSLA 3ERCA 2HIHA 1GU1A 2YOGA 3UW1A 4F7DA 1L5FA 3LUFA 3ZWVA 1VI2A 4J2TA 3FPLA 3C14C 3QU5A 4WVFA 3FUXA 1AN0A 1NBOA 2J85A 2ZANA 3OQ6A 4ND1A 1KDVA 8OHMA 1JG3A 2OZLB 3CZQA 2YFKA 1AUPA 2I0FA 4KLNA 2VQEB 2FE4A 5J2UB 2O1EA 3NONA 3WNBA 1IHYA 3DG9A 3G8BA 3A04A 1YQQA 4HGPA 3D4BA 4K28A 3ZCPA 4DNPA 4I0WB 1XDSA 5TVKA 1K0FA 2R8RA 5KYKA 3V4SA 4DDHA 2V7VA 1DPGA 4L02A 2AXEA 1N32B 1QLJA 1VA5A 3ES9A 4N6GA 4KOEC 4AZ0A 3LCVB 3JQPA 3LRXA 3MRVA 4ROTA 4DY6A 1M2WA 2CNOA 2FPIA 4RNCA 3CBQA 5E7JA 4ZAGA 5EYPB 4YQEA 3I5YA 3X1MA 3WBBA 2EWMA 2Z30A 4B3DA 3KKZA 2ZPUA 1CJCA 3LFUA 1TA9A 1OGYA 4TL6A 1DAKA 2C92A 5LWQA 1N78A 2QRVB 3T3MB 1ZQ1A 2QMQA 2EERA 3RC3A 2QRZA 1JMVA 3DLCA 1RBZA 4N9QA 2VP4A 1DOZA 2EP7A 4Q1BA 3LDHA 1VYVA 2Z9BA 3RWOA 2JH9A 1WMEA 1GUZA 3GLGA 3MMZA 3OU6A 4A2QA 4U9IS 4C4OA 1E4EA 3HZZA 1MJ5A 4R8LA 3AJEA 1Q1NA 4GE3A 3WO1A 5LMUB 2VJDA 1SVLA 5IC4A 1UK8A 2WB2A 5FUWA 5ARBA 2BGGA 4KI7A 4XSHA 2WIGA 1CUCA 1XAHA 2H11A 1ZVJA 2XUJA 3IT2A 4OYLA 3VDRA 1GNLA 3H8JA 2VDKB 4IJVA 4POOA 3PU6A 4BO4A 5ED4A 1RQRA 1UF9A 3RF7A 4CIYA 3ROZA 4EM6A 2E5WA 1C8BA 3UKOA 1MHTA 5B4VA 4P93A 4TS9A 7AT1A 5EXDA 3F6PA 1KYVA 1VKOA 1D7OA 4ZJYA 1CEEA 2BLNA 1PTKA 1BHQ1 2GPBA 3WGYA 1CQIB 1E9FA 1YRBA 3UJCA 5L4LA 1S2OA 3B7GA 1L1EA 4A82A 3UH1A 1VDMA 1YR1A 1FY2A 2GBCA 2J5XA 3PGJA 1L1FA 4DUGD 2DERA 4MW1A 3KZMA 5J5CA 4RD0A 2J7PD 1NQTA 2RBKA 1SD5A 3FNFA 4MR9B 5J59A 4D9GA 1JT2A 5CA0A 4IGEA 5E2AA 1FC0A 4PN3A 1EUZA 4X54A 4QT4A 2JI8A 4EBFA 1IPHA 4E2FA 2A78A 1OMOA 2PNFA 2I1WA 1YRLA 2RAPA 4NYIQ 4P4SA 4W6ZA 5EJ9A 2P75A 2EZTA 5L3RA 2F3PA 3IPLA 2D74A 1P0IA 2AMJA 3GNLA 4ZI7F 4YUAA 1QS0A 5K3CA 3DV9A 5C3UA 4YCAA 3CRW1 5B5SA 5EHZA 2CE2X 1QXSA 4Y9UA 4RTSA 3K96A 1W4RA 3G49A 1XD2B 1GL9B 1YQWA 2PUVA 2QVBA 1NATA 4R41A 4UQPA 3R9IA 2WF8A 2XUFA 5DM0A 1E8DA 4RJLA 3CVYA 1HZJA 1V47A 1QF7A 4JDUA 4MP6A 5FNVB 4L4SA 3MD9A 2HEIA 4KXLA 2CMGA 4R3NA 1OYWA 3M9WA 2B20A 1D1PA 3L7BA 4LQDA 1IHUA 4GX1A 4P2BA 4BFCA 1WP4A 4C7OB 3K0AB 2HO4A 1YKGA 2GZHA 3EGXA 3D6VA 1N5RA 3FTPA 2Z9CA 4HPJB 2QZZA 3O73A 2ZYRA 4GRIA 3PRHA 4PLPA 2BFCA 3UAOA 5KOIA 1WO8A 3ASVA 3FIUA 3M6IA 1EDOA 2BSAA 1MC1A 1ZOOA 1SIBE 4PRZA 3AF6A 3SQXA 1E0DA 2MINA 1ISRA 1R5OA 3A28A 3KUUA 1NBME 1ONPA 1JVSA 1XK6A 3N07A 3SJBA 5GVSA 2XNJA 2JIQA 1TFRA 2ZW9A 2PWAA 1ARZA 3O9MA 4IHJB 1E3WB 3NFYA 1BX0A 5TPZD 5HM6A 4MVJI 3E9YA 4KGXA 2ZYHA 3R3VA 1N4AA 4J0GA 4LJ7A 3OJWA 4V3CA 2RIPA 1AXEA 3QLUA 1KOLA 1O8CA 5H02A 4RELA 1PJAA 3SBEA 4ARIA 4MYDA 2X8WA 3KXDA 2DFLA 2Q46A 5HNKA 1TKRA 1QPGA 4E0BA 2BCGY 4WV3A 5CP8A 3BREA 5B1HA 4TUYB 2AYZA 1L5QA 1WDLA 3W34A 3N75A 4NL4H 5G0WA 1UKVY 4ZO6A 1NW6A 4BX2A 1UC9A 3G13A 2VA8A 2GN2A 2HM7A 2OQIA 3KZNA 4MVJM 2BFWA 2DMRA 4XX0B 1N75A 1OGJA 2D06A 4MB6A 1KU6A 1V6SA 4Y1FA 3VKVA 1FFEA 1Z4QA 2GI4A 4M37A 4BWVA 2V7WA 3NVKI 1YVDA 3CNLA 2DPHA 3GLIE 1JHUA 2GM5A 3TGWA 2PGNA 2XOKD 4G2NA 2GYVA 3C3CA 4DHWA 3EGDA 4AP5A 4G0WA 1SUFA 2EGUA 4J03A 2VJBA 4O4LB 4PC1A 3AL2A 1XR3A 2HGSA 3D2CA 2JEZA 3DHEA 1E58A 5CCBA 3ZNOA 3DCJA 5EVJA 1KI4A 1GZSA 3KJZA 2I80A 2I1VB 5CDTA 2I1QA 4S12A 1Z82A 2REQA 2ZR0A 1FYXA 3W2IA 3TX6A 3DGEC 2CVFA 5MN6A 3G17A 2RGEA 4G0PA 2NUPB 1AV6A 1DKOA 4N0EA 4KSBA 2D3TA 3RLIA 3KCNA 1I1OA 1JDBC 2WTAA 4BEBA 4PNEA 2FSHA 1LCIA 1DDOA 4HMOA 1Z06A 3C48A 1VPTA 2YV5A 1E3EA 1IHPA 5AVJA 5TPZA 2J0UA 4MUNA 3C1OA 2YYZA 3FCAA 1XRNA 2XNDA 4HNUA 2LCFA 1MGPA 1OBOA 2YQZA 2VTDA 2VRNA 4L4ZA 3SS8A 3BRWD 2FQWA 3LY9A 3PRJA 1AMNA 3B5EA 1H9AA 2K2WA 1DIRA 3FPAA 5C37A 4BEJA 4QVIA 2RAUA 2IOYA 3CINA 1V8ZA 4HT3B 2E5LB 5DB4A 2J3MA 4LOIA 5FYQA 3GUYA 4I1IA 3VSEA 1A82A 1YFZA 2OT3B 1LPAB 3U3OA 5AOAA 3ANXA 4ZQGA 1J1ZA 1J7KA 4F5YA 4YT4A 3K8ZA 3WYCA 3PD1A 4KN8A 4Y67A 3UJAA 3H5IA 1E61A 1X7WB 3QWBA 3VOSA 5AFSA 1WL8A 4L9WA 5HFAA 1SUIA 1IBCA 3UTCA 3EHDA 4CEHB 1DKQA 1Q44A 4CODB 2I3GA 2X40A 1L7MA 4D9FA 5DJ5A 2DE0X 3V4LA 1A9SA 4Y6OA 2XOKA 4WX2B 4OK6A 1DJMA 1M5TA 1QC5A 4HH4A 5ECGC 1NYQA 4N0DA 2JH8A 2FUG1 1ZM3A 2PQ6A 3PWSA 4U6NA 3UC5A 1Y4AE 4BO6A 1V7ZA 1XVLA 2FJPA 4MQBA 1M7GA 1SZCA 4FYKA 1DMRA 4OQNA 5JMOA 1AH2A 3R77A 4MA5A 1YQTA 2RGWA 1S9DA 2ZUWA 4FXOA 4G4IA 1Z5VA 3KQKA 2P27A 3BH6A 1E6LA 2QTBA 3AKCA 4HNQA 1RXEA 2J33A 3GEMA 3AEKB 2XGMA 1FDSA 4PU0A 1G4AE 1K6MA 1YZGA 3FWKA 3MCZA 4TZTA 3RQIA 4HAUA 5AW4A 4YJ2B 5HKBA 1YVRA 4LE1A 1B00A 5JCOC 1K8RA 3H11A 5JY1A 4LRUA 2PK3A 2IEDA 3CTPA 5EWJB 3HDTA 5DH9A 2JA1A 2MYPA 1CUBA 1NXWA 1PE0A 4NJMA 1AK2A 3NAZA 4IFBA 5CCEA 1SUCA 4P5EA 1HNZB 3RS2A 4HLUC 1I14A 4LYYA 5AKXA 3V8MA 2R87A 5AM3A 4BGDA 4A8JB 5KPDA 2C9DA 2H29A 3EULA 3V42A 3AQ4A 2B78A 2IZZA 1YIDA 2W2MA 5JSYA 3HK2A 2W6ZA 4U2KA 3FPJA 4BYMA 3FNIA 4JFRA 1VL6A 1AC5A 1XROA 2PBZA 3OWXA 3JQAA 4GPEA 2FY8A 1AB6A 1C9JA 1IZ7A 2AA3A 2X5NA 4C07A 2GCOA 5FBWB 1T24A 1I30A 1X1DA 5IEJA 4DMRA 4JR0A 4N5HX 5KHOC 4YRKA 4UMVA 1DO8A 3L77A 2VHJA 1VOTA 2HRZA 2OB1A 2WWHA 3H5NA 4YRZA 1R0KA 3ZZMA 2C0CA 1SUEA 2Z6VA 3FCYA 3WZLA 4AUEA 3M83A 1VMKA 1VSQA 2HSWA 4GPAA 1GCAA 4PC6A 1W35A 2B4RO 5EJIA 4WDQA 1RRGA 4I19A 4QASA 4ND5A 3CNHA 5ICEA 4JI3B 3R7WA 1LSOA 3R6TA 2I5PO 3W3ZB 5KVQA 2ABWA 5PGMA 2IIVA 5J5AA 4NCAA 1KR2A 1R0RE 5H80A 1XO1A 1XXLA 1TRKA 1IJFA 1BH2A 3Q7IA 4N82A 5CT6A 2KQUA 2XA9A 4ZDJA 2V7TA 2XA2A 1KVQA 1BGVA 2HWWA 4RSGA 5A4JA 4GPIB 3K15A 3D5QA 2C5AA 2C9OA 5AWFC 2I78A 2BHRA 3AFIA 4XVUA 4TTRA 2JIMA 3PIIA 6YASA 1SN7A 1DXOA 1JA1A 1G6KA 1PZNA 3M0EA 1QP0A 1RFGE 1PEDA 5EHNA 2UVPA 1Q3HA 1KY4A 2P62A 3WJ2A 3DDSA 4KHPB 2G17A 2P79A 4KZPA 3OIWA 4G26A 3VNAA 1PG2A 2XTZA 5KJ1A 1M75A 3GF4A 1H6BA 2WSBA 3G8YA 3PNLA 2CXXA 4NZOA 1OH5A 4L9SA 4Q82A 1T35A 1G16A 3G0OA 4CQJA 5B6JA 1I1HA 3K0FB 2ZUSA 4NABA 4Q16A 4I1RA 3TMKA 1QU3A 2EGGA 4ZRDA 1NKVA 2ZRAA 1V2GA 4Q7EA 3IKLA 3TD6A 5IHPA 3M3PA 4CNQA 3KOOA 3MEQA 2A59A 1VE7A 2RIRA 2RARA 2JANA 4AK9A 4NFLA 1ZWKA 3RTDA 4D96A 2OXIA 1EHIA 1IXRC 1DRVA 1ODKA 1UBHS 1V6AA 1FDVA 3DNFA 4FBGA 2YWGA 4RA9A 4U4AA 1TD1A 3ZN2A 4DMMA 1DV2A 1DV1A 4KO8A 2XUIA 2V7QD 2O3UA 2R8EA 4D8YA 3HBJA 2CLSA 1L6IA 3ADKA 3T52A 4ANFA 1A4IA 2HPZA 4WNAA 4DM4A 3KV1A 4NHOA 1OAOC 2JHPA 5MGBA 4JLNA 4E88A 2Q1XA 3S4YA 3S8MA 1TQ6A 2V3CC 2BTEA 3A6GA 4AN4A 4A5SA 2XCSB 1JIUA 2J31A 4BQOA 3KQTA 3LQFA 2GZAA 4FE3A 3A4MA 1ISFA 3TQCA 4OJQA 3RBVA 1WTCA 5YASA 2QTWB 4GKBA 3PXGA 1H9BA 1RLJA 4M1QA 5I9SA 4G1MB 2ZI5A 3LVQE 4IVQA 4UHCA 4V38A 1OYOA 4FFDA 2Y66A 4XLZA 3U1BA 1J23A 2FW0A 3KALA 4E94A 5LJIA 2R751 3PKIA 1E6KA 4TV9F 3IPXA 3PF8A 3D3WB 2VDNB 1UEJA 3KR0A 4JBGA 4JLPA 5CDFE 3UJBA 4CMBA 2W6QA 1T2AA 1UK6A 1X13A 3F46A 2AZTA 2C2BA 4OYRA 3HXQA 1ADBA 2HNBA 5F5LA 1BEZA 4QJ4A 3BMNB 1TCAA 2E6KA 1A27A 2WLSA 3F4KA 5CFLA 3WC4A 4L9RA 1ZNZA 3ETLA 3IB3A 3RTEA 3R6GA 4L4YA 1AB5A 1J0CA 1XMVA 2G9NA 2QQ0A 2YC4C 3ZD6A 2BBOA 5TQ0A 5K09A 3AJ9A 2X8JB 5AK4A 7ADHA 1YTLA 3FDJA 1YUMA 4YAOA 2CYAA 2GLTA 2VT2A 2BFPA 4FB5A 2QAJA 3HDJA 4QEZA 4W8GA 1SU6A 1LZLA 1VYUA 3DLPX 3TPZA 3TW6A 3UXMA 3ZVNA 2R85A 3U5ZB 3ANLA 2O2JA 4O2RA 3OSZA 2W7TA 4JBXA 5D3KA 5T5QA 4RY0A 2FSIA 2SKDA 4ZK6A 5F2NA 3A1EA 2QMOA 1KY2A 3CZ9A 5DN9A 3T99A 3BQMB 1FJGB 4AMBA 5IJ9A 2AIRA 2Z3ZA 3G6WA 3ORQA 1RYNA 4ALJA 2OESA 4TS4A 3D8TA 4L27A 2SECE 4IH9A 4AP6A 5JAUA 3WX0A 3A06A 3KVVA 3EIHA 3NBXX 3S1AA 4E6PA 5DNUA 2QY9A 4BS9A 2MT9A 1M1XB 3BTUA 2HNKA 4QUDA 1CRLA 3OZUA 3NJ8A 3S2YA 1M6YA 2JGEA 3IQZA 3OTIA 5F33A 3U61B 5EGNA 2DC1A 1JR4A 2BM9A 3BXOA 3JWIA 3GLTA 2PKXA 1KIMA 4F8EA 4IAOA 4EJ0A 4Y9TA 2PZGA 3D43A 4GNKA 1D2HA 5DGDA 4DADA 2YJ5A 2CT8A 4B6GA 3CZ5A 4YAJA 4AZTA 4E5NA 1Y8AA 2W9XA 4AMYA 5TIIA 5TGTA 1SRRA 2GD2A 3KPJA 2K7ZA 3VPAA 1L7OA 1BMTA 3ISTA 1KR5A 4IIXA 1GRCA 3U7QB 3VZDA 5A1JA 3UAXA 3GP8A 1DC5A 2CB0A 3R9WA 3GJQA 2FFHA 5DN6A 5BPHA 2Q4EA 3NAMA 4WLUA 1PQPA 5K20A 2HQSA 4G0NA 4JUDX 1XCOA 2R97A 1AKRA 3PHLA 4BLOA 4GPBA 2VP3A 5FHRA 2XXAA 2OG1A 2P9YA 2MYUA 3MYRA 5CFNA 4YRAA 2G07A 4LZPA 1D1SA 1NF8A 1B0UA 1SCBA 1CIPA 1QB8A 1V3TA 2D5CA 2IE8A 1TYEB 3CB2A 3B2QA 1GFIA 5B4TA 2XNKA 5HJ2A 1MEOA 4IGKA 3H16A 5CH3A 5J2TA 4W5NA 1LGYA 1PR3A 1S1CA 3GYGA 3ZLBA 1JZTA 1HE2A 3ZNQA 2ZCUA 1B76A 4OFXA 1NUQA 4JUAA 1QGUA 4G23A 3GL9A 4OBEA 3T8YA 4E46A 2ONZA 2FG7C 4G01B 1PSWA 2P40A 5DP2A 4QHTA 4QELA 3H84A 3UJPA 3EPHA 2VOJA 2BGIA 4PO3X 3VOTA 3ZI0A 4AYXA 1H8ED 3TQFA 4B2LA 2W00A 1V11B 3ITKA 5JATA 4IMRA 3N8GA 3GLGE 1VFPA 3MCAA 4PZPA 4RK7A 2J6HA 2D6FA 4ER7A 3FBTA 4QYIA 3GEDA 5FTMA 3FNGA 2J87A 1FNCA 4DC9A 1LWNA 1OZAA 1U7TA 2P9TA 1AIPA 2ZRNA 3CEHA 3EXG1 4Q7MB 1YUNA 2IDZA 1FE8A 4GAEA 5JO0A 3K70C 4KP7A 3D3EA 2QTHA 5DM60 1XMJA 4X91A 1E7SA 3ETDA 3UPUA 2QVGA 4BZXA 3ZGZA 1SOWA 2PD4A 2I65A 4L8VA 4EEXA 5IUKC 3HFJA 1KWKA 1J8DA 2AQHA 2REOA 3P0FA 4R2MA 1S3GA 4Z6KA 1PDOA 1T6BY 1ZIXA 1ISMA 3UMMA 4J1TC 2BT4A 4G5HA 3I1YA 3ESBA 3E15A 1TPYA 4GXQA 4X84A 5KOHA 1FPQA 4I3GA 3FGPA 3BSSA 2J9GA 2ZJOA 3QUSA 1KTVA 1F1JA 3OPYI 4JHLA 3UGQA 4ILEA 3FFWA 5HTKA 3IAXA 4DIFA 3S40A 1X1QA 1U3DA 1WUYA 3CW9A 5BORA 4Q3BA 2VL7A 2HA0A 1K3TA 5CVVA 1GQFA 1MUUA 1VMIA 3WGLA 3WK7A 3CO0S 1IMOA 2GDZA 2QM8A 2X2EA 3CSDA 3IBGA 4FD3A 4L8YA 4OAQA 2ZWPA 2Q9BA 4M86A 2XUAA 3CNEA 1Q0QA 2Q2WA 4QEDA 3K1TA 3T5DA 4DPMA 1YZQA 2P35A 3PVCA 2PV7A 5KMGA 3VYRB 3ZIDA 5LU9A 4L0QA 3HI4A 4CIBA 1DGQA 3ENQA 2J3QA 2G3YA 3RYHB 4N3NA 3WVNA 4UNQA 4DNXA 3UAZA 3IP3A 1JR3A 2DWQA 1E2BA 3QK7A 3OHMA 3LHIA 2IKSA 3IQWA 4FKZA 4MQMA 2Z8XA 4N03A 1E9RA 3NKLA 5ESDA 1J49A 3TQOA 3W2FA 5JY6A 1QGZA 5LMZA 4GSKA 3HLYA 2D00A 5ILQA 3OD5A 2PUBA 4UMEA 3ZVRA 4ZO9A 5DW0A 4XYBA 4LPKA 2I62A 3SZOA 2HFJA 3N0VA 4Q3LA 4MI1A 2O14A 3IAUA 2VYQA 1CZLA 2FSPA 4GOXA 3M34A 4M0DA 5FBVB 5K4AA 4MUFA 1T2CA 1XF9A 1FFCA 3N2EA 4F9GA 3CW8X 3UOWA 4NBSA 1OLSA 2DBRA 5LUAA 6PFKA 1G7CA 1E5QA 1GSAA 1EP3B 3PXAA 4N39A 2VRWA 3VR2A 4Q6BA 1EB9A 1DSSG 3JARB 4N76A 1OXKB 3K2QA 3LBHA 5AOBA 3CLSC 3GNTA 5IEBA 2WKWA 2CXNA 4QAQA 4OKIA 3PC6A 4HDSA 3TECE 3Q41A 5KCZA 3JASA 3BWXA 3FX2A 4LQLA 4DHEA 2BY4A 2QRQA 1GGKA 3MGKA 3NHUA 3RWMB 3RUCA 2GWHA 4E4YA 2VNHA 5KVCA 4BP1A 4TTTS 2GXSA 4QYTA 4S0XA 4WY2A 1XTTA 4HLUA 4Z4GA 4DMLA 3RYCB 1T43A 2J48A 4WK0B 1V5GA 3WDLA 1G98A 3C3DA 4XIJA 4CGZA 2O7NA 5E7MA 3II6X 4KQ1A 3BAFA 3THRA 3LVBA 2QU8A 3AJAA 1FMJA 3HN6A 1QJCA 2CLFB 2GJ9A 3HH8A 2HRCA 2HN9A 3TTUA 3TVYA 1A98A 4KQCA 1WUKS 2IYSA 1XFDA 4G4SO 4QJ5A 2C57A 3BIFA 4NENA 2R1TA 1PJ4A 5JH7A 4MKHA 2EEPA 1AK1A 1G8PA 5BMVB 2CSUA 4CQMA 1XKQA 4LY6A 2QQGA 5H9VA 3NBYC 3KAQA 4EVQA 2ZJ0A 2L19A 4EZIA 3Q8XB 1OIVA 1ZM7A 3BORA 1WXIA 2YJGA 4NAVA 4MXDA 3WRWA 4I1YA 1PD1A 1MO6A 2H2FA 1CY4A 3HYSA 3NNDA 4N40A 3L0OA 1C1XB 1QHHA 2NV6A 4ZGGA 5EY5B 5C8YA 3ZU4A 1P8JA 1NV9A 3EVEA 4I5EA 4V39A 1KNQA 1ES9A 4UTZA 2WJVA 1XRQA 2HF8A 4LZWA 2B4QA 4IMJB 4UBIA 2Q21A 5G53C 4HEJA 1QH1B 4I1SA 4O29A 5IMBA 4BEWA 3A9TA 5EMNA 2XGOA 1P44A 4GLFA 1JT9A 2BGMA 4NFSA 5ENVA 4C78A 4EFKA 5BRNA 5IKEA 2ZM6B 1RC1A 3D4OA 2ZIGA 1FUYB 1R5BA 3GFBA 1MW8X 2J07A 2JGRA 4GM4A 2HA5A 2FPRA 1KSJA 1GCUA 1JSZA 3A1NA 3NGMA 2X9GA 3RFUA 3ABRB 2JKYA 2QRGA 4RJJA 1NNSA 1NR7A 5KQLA 4EHKA 4BO7A 1G1AA 3BAZA 3KOYA 4NPHA 1KZYC 2NYAA 4ALMA 2OBLA 5ALGA 4O1HA 5ER6A 3NRJA 4RKYA 4BAZA 5EIXA 1RZRD 4DILA 5CB4A 5IULC 1YS4A 1D03A 1MAAA 3FN4A 1L4LA 3ILYA 3LPMA 4H3HB 3W8NA 3WFJA 3SXUB 2O8NA 4HWTA 3CLHA 5BPFA 3GRCA 4F6RA 7GPBA 2VWPA 5KYWA 2JHGA 4YK7A 3AR4A 3C3BA 4IX1A 1FJ2A 3UIEA 4JJEA 2ZIWB 1X7DA 2WFAA 3L7MA 3KSDO 3E0XA 1FMTA 1OAOA 2B8EA 5SZKB 2HDWA 3S68A 1DRWA 1JDZA 2HB6A 2Z1NA 1LJ8A 3LX5A 3SYNA 2ICAA 5DI9A 1U0TA 3ZHVA 3C1TA 5H3HA 4BZWA 3HBNA 4RTQA 1O03A 5C2JB 1YC5A 1N0VC 1SULA 3VR3D 2DLCX 1BSVA 4NBWA 1AF7A 3EODA 3C98A 4R31A 6ABPA 3NNSA 3PG5A 2F1OA 2GVNA 2IU6A 4D0NA 2QPAA 5JROA 2XCIA 3CU5A 3N2GA 2VPPA 4ECAA 4HRVA 1G41A 3F47A 4W1RA 1ORTA 3PQ3A 3ZVLA 4OMUA 3UUEA 1I1NA 4Q3AA 3T4XA 2OKCA 1OLUA 3WNZA 4YCBA 1MRSA 5B55A 3NUZA 3DWIA 4PAGA 2BSQA 1RJEA 1E6WA 1WP9A 4WUVA 2G40A 1RW4A 1RRFA 5AUNB 5DULA 2X3FA 3VR4H 4ZYUA 4CMAA 4OQZA 4E5YA 4Y30A 1T36A 2YJ4A 4Y2RA 4OQDA 3HY6A 5BNFA 2II6A 2QV7A 1YQGA 4LDAA 3LXRA 2IL1A 3COVA 1NHGA 3GWZA 3HJUA 3Q6NA 4GC9A 1SVUA 3TZEA 3W8DA 4D5GA 5KNCD 1RZRA 1MOSA 3MYYA 1T4BA 2ZUFA 1RLOA 4G8BA 4J3NA 1MU0A 2HBRA 3RS5A 2CV1A 4JKIA 2GEDA 4PC2A 1ECFA 1EUCB 1CU1A 2J32A 5E6RA 2RI6A 1U2QA 1OZGA 3LUAA 4H6VA 4YCNA 1IY2A 3TTVA 5CW1A 1NVVR 1UOEA 1W5FA 1GTVA 3E8MA 3IJRA 4DBLE 2B8TA 8ABPA 2WVJA 4DCSA 5A7FA 3E7XA 5HMMA 5CM2Z 3UMYA 1FFGA 1QK5A 2CMFA 2R8PA 3T1VA 3B13B 1SA0A 3GBSA 4CQLA 1PR1A 3DD1A 4MLPA 4KXFB 1V5EA 5EJ2A 2BFEB 4FOTA 3VR3A 1DC4A 5FDFA 3U19A 1GJRA 3H1FA 2E21A 2IYXA 4NZPA 3C3WA 2QG6A 4BVEA 3I61A 3JAWB 5LZ4A 2VAXA 1R0CA 1QH8A 4FI3C 4J9UE 4JVNA 3GPLA 2WABA 4PHCA 1ZH0A 4HYYA 5BQOA 2B1JA 4HMPA 4JVMA 3E1GA 5TJHA 2P8JA 1N34B 1SVNA 1HK7A 2AYXA 3SICE 3RSCA 5BQ3A 5F76A 1BX3A 2IPXA 3KXKA 3L7JA 2ZZNA 1J21A 5K0TA 2QKYA 1OPXA 4YT5A 2I4LA 2XZLA 4Q1VA 2FPGA 3AETB 3P52A 3OZWA 4GWLA 3SMVA 3GU3A 2AFRA 3KKOA 3A1WA 3E7FA 4CDRA 4EHIA 1CV2A 3R8FA 2P69A 1SELA 3Q3CA 2L82A 3AHFA 2JVIA 2ZRBA 3DO5A 3F78A 5H5JA 1O8BA 1ZHFA 1D5WA 2Y99A 4DWVA 2G5TA 1E1CB 1AS0A 1AHPA 5H7XA 3A3OA 1DC7A 3PDIB 1EX9A 1BXRA 4MS1A 5IW8A 3VC1A 5IARA 4YCJA 5HRCA 1P7YA 3VNBA 4CDNA 1WW2A 3JSXA 2C31A 3PUXA 4RSMA 5K0JA 1RI3A 1HLPA 3TZKA 1J42A 3GDHA 2GZ1A 3HCDA 5LYYA 5EIEA 5JJ5A 3GEPA 1MTOA 4MRMB 3TJMA 3L0ZA 3MAAC 1E0AA 1SEPA 2VJCA 1FBNA 1RIFA 3OX2A 4FSXA 2OYCA 4Q66C 3CIFA 5JWOA 3U16A 4NXMB 3I62A 3FPGA 3KT6A 2ZQZA 4AURA 4G1VA 4LDZA 1PF7E 3RJ5A 5A9RA 3GA0A 4BTLA 2JPDA 3GDFA 3GUCA 1NT2A 4YIHA 1JYEA 4DRXB 1KVUA 1FLNA 3PNQA 2BFDB 2JI9A 1WZ2A 1RWNA 4GVPA 4BWFB 4QODA 1KK2A 3MOIA 3U3ZA 3WA6A 5DSXA 4OM7A 5AXBA 3FVWA 1GUBA 1DBQA 4K6GA 5DM2A 1YMQA 4R68A 3ULKA 2BGTA 3WIBA 3QI7A 2ZSEA 4GM0A 1B0AA 1WV1A 4ZCIA 2IXFA 2XMCA 3BK2A 1ZY2A 4XIFA 5J43A 2D5IA 1F7UA 1Q83A 1YF3A 4P83A 1FS4A 4FVTA 1TAQA 2GZ3A 3R6DA 3RFVA 5FX2A 3T5AA 3HY4A 1CE8A 4J3JA 4RPIA 5F51A 2G5CA 3AUAA 1G5HA 3B53X 4U8HA 1FS5A 4E33A 3U60B 2NZJA 1QOPB 2PWPA 5DHSA 1NBIA 1ZMXA 2NNWB 3LPAA 4QXPA 1P75A 3TZHA 4NE7A 4KRFA 3IHWA 1L5YA 3D2LA 3I5MA 3P2YA 5EIFA 4YJKA 2ZRKA 1C0LA 4YP9A 3BB4A 3T54A 2C5LA 5IT4A 3AFOA 1MRZA 5TDHA 5ELXA 1VMDA 1A9YA 1AM4D 3BVPA 2JIBA 2BKVA 2WPNA 1N5MA 3NO4A 3QEKA 4FYJA 2WMYA 3OTGA 4YQZA 1AT1A 1A5AB 2Z08A 3CLSD 3MJVA 4W99A 5AJHA 4Q3KA 5DTMA 4ZMSA 1KEKA 2VDOB 4MPRA 4UAJA 1N8SA 4YRDA 4LJ8A 3PYMA 1MZVA 1O6GA 4JLVA 1PYDA 3EDYA 4TROA 5E9AA 3X0DA 4HFMA 3NBQA 3W5UA 3N2KA 2JAHA 4BLSA 1RJ9B 4DCMA 1FFXA 1NMQA 3BF8A 2YN4A 2I6QA 4ZPXA 3T1YB 3QEOA 3OEWA 2BEVB 1T9GS 2Y2UA 1C8KA 1E1MA 3DVAA 2PUAA 3SZ3A 1JHZA 3IDAA 4TLBA 4BNZA 1G2PA 2BBSA 3Q12A 4FYIA 4X1IA 5JS7A 1ZN7A 4DR6B 3Q9UA 2KI5A 4B84A 5U4QA 2QRLA 4GX0A 4HRAA 3T9EA 1NZFA 3W5AA 1CULC 4NCNA 4C9BA 3X1DA 1EINA 3FZNA 5IJWA 2IPNA 3ET4A 1I6MA 4TRJA 1DJNA 2XT6A 4I5DA 6REQA 3C15C 1IEQA 4ARZB 1BC5A 5LD2C 1QYVA 1OHHD 1N1EA 4MRNA 5LU8A 3EMBA 3T3EA 4RENA 1K4KA 1MAWA 2DQ4A 2GAAA 4QQ8A 1KDTA 4JIMA 1NQUA 2QN2A 3D0KA 5A5VA 4PINA 1QQTA 2BYTA 3FCUB 1LI5A 3ZVMA 1E0SA 3MINB 4EMUA 1VM6A 2O3TA 4CM4A 2YVLA 4U7JA 1Z62A 4HHEA 5H59A 5BOSB 4GI5A 1F2TB 1SCAA 1XC7A 1VIAA 5JXWA 5FOSA 1EVYA 3RABA 1P6UA 1G38A 4BUJA 3VUFA 5A3RA 2VCEA 4ZV9A 4UTOA 4DDWA 2A8YA 3GGOA 4QQKA 5CA1A 3I9MA 4PZZA 1T1SA 1TEVA 1X2BA 1XTVA 2VP9A 3OJXA 5L95A 4N41A 4O4HA 1AN9A 2W0MA 2OBXA 5FV4A 1ILEA 3TPCA 4B3SB 5EA2A 1E2HA 3E1KA 5KYXB 2Z4SA 2EAUA 2MSKA 3OE4A 1R5NA 3PQ8A 4YUZA 2W2VA 1VPLA 3HXTA 2QBYA 4D3FA 3OY2A 1SCDA 5EXXA 3RODA 2WMNB 3JQBC 1T4CB 4EW3A 1HQKA 1VA4A 4H3KB 4KQIA 4XB1A 1VHDA 4OL0A 1JJVA 4JASB 1Q0UA 2XSZD 4JLDA 4KNVA 4UHHA 4LRSB 4ND8A 4ZOAA 1HT3A 2FDXA 2P4HX 3HBLA 1JQDA 3FKQA 4KLAA 3K9LA 4E15A 3C87A 4XW2A 4WBNB 1XHFA 3G5TA 1QNFA 2XMGA 5KTNA 1QRRA 3HCFA 5LN1A 2HXGA 2QB5A 2WM3A 4NU0A 3SWWA 3Q8KA 1T6NA 2G25A 3ABZA 5KNCH 4E32A 3KEOA 1BVHA 2JLRA 3AG5A 2G1PA 1T4MA 3BXPA 1X1BA 4QL3A 4RACA 1OHHA 3JZMA 4K3UA 2H16A 1SKUA 3P4YA 5G41A 2NACA 3HXOA 3PQDA 1IUPA 2GX6A 3F97A 4PBTA 5KTPA 1K66A 2G1JA 1WXGA 3P0RA 4A4DA 4FWTA 3GRFA 4GOOD 1R0ZA 2RHBA 4P4NA 2B3DA 5E3HA 1BGXT 4R81A 4LF9B 2DB3A 1NDUA 4NWIA 3GCGA 3ENWA 1LQUA 4Q93A 4W9RA 4BZPA 3OE7A 3PFHA 3U6BA 3O8BA 5LOVA 3CNOA 3FSJX 5EHIA 2HZBA 4UTXA 2GHTA 5DFAA 5KO2A 4JEIA 4Z4IA 1EM8B 2NO1A 3TIGA 4L95C 3C1UA 3ZWXA 3AG6A 3FNHA 3W1EA 3E3MA 3EGVA 2XR1A 1JKIA 4QTZA 2W6IA 4Y7DA 1ZN8A 4A15A 5CXUA 1RQXA 1TQ2A 4MITA 4LC1A 4PRYA 5B3LA 4PQRA 2HHLA 3UT5A 1A50B 3IOCA 4FHGA 4QULA 2FW6A 1MOPA 4FN4A 4PGHA 4TMKA 1KRWA 2XUPA 1LFDB 3ECAA 4GOND 2COKA 4Y18A 1V37A 5EOVA 5ALLA 2FWJA 2FF5A 3AKZA 1MG5A 3FI0A 3E5NA 4WLVA 1W2WB 4JEUA 3JZDA 4TV8B 3ZDQA 1T6ZA 1F38A 1N9ZA 3NXSA 3TIIA 3KJIA 2I6FA 4OHXA 4KLZA 4EKYA 2VXCA 4DA4A 3GPDG 4MWCA 3FI9A 3FSGD 4G84A 1W93A 3QA3E 1Q3KA 1X7XB 1JDSA 3QPDA 1EU1A 1MGOA 2OENG 2QTAA 4GI7A 4AWXA 1W5BA 3JRWA 3SC6A 1KJ9A 3PQ2A 5TC4A 4DFDA 4E03A 3DONA 1XG5A 4J8PA 1JG6A 1Y4DE 4EKNB 3SKVA 2IEIA 3FHJA 5A4IS 1CRQA 2P3SA 4PO8A 4O3FA 3AUKA 5JJIA 5DGCA 4XDGA 3U44A 2WU8A 4ZDWA 3WWPA 1YT5A 5BSGA 5CGZA 4Q0MA 1OC2A 4US1R 1VZ2A 3GJ8A 3N9IA 4BLTA 1NR5A 1JR3E 1IHOA 4EUKA 4NJOA 2YRWA 2XQIA 1CY0A 3OFSA 1GD1O 4I7EA 4PPYA 4PS0A 1DUIA 2V7EA 3U80A 5HXAA 4M1OA 4M83A 3N8IA 4RD4A 2C7BA 1EAMA 1KJQA 1AQUA 2V0NA 4ARVA 1Q0LA 3DLAA 1WMBA 4HQLA 3WRXC 1U0BB 2K6GA 4WW0A 3BK1A 2F4VB 4HDCA 2JW5A 3PUIA 4YO8A 3BICA 1Z0AA 4CMCA 3I1IA 2IHVA 3R3WA 4TWZA 4BO0A 1XWFA 2B30A 3GGGA 3HJNA 1H94A 4RVDA 3FZQA 2CDAA 3C5WP 4RH3A 2CFCA 4WRRA 1JQKA 4GG1A 2ZTHA 3OKFA 4M87A 3TTSA 2FFBA 4Y1GA 2FLKA 3BTVA 4FIDA 4N49A 2C3OA 2V6MA 5GIOE 1V9SA 1Z0JA 1W85A 1GTG1 3DHNA 2ZULA 4RHEA 1O3YA 3ORRA 1U63A 4O4JB 3IILA 3STHA 2YKGA 1DQYA 3KK0A 3GFTA 3ZWNA 1AJEA 4HX5A 3GZ4A 3BBPA 4IIYA 2VRBA 4RQBA 2C5BA 3EIEA 1N1GA 4ZYWA 4B9EA 2GM9A 1COWD 3SKXA 1DAIA 1RCFA 2EARA 1FDUA 1W59A 4TT3D 2VF5X 1VHTA 4IDFA 4Q05A 4ES6A 3VYSB 2CHFA 4KPYA 3H9BA 4URXR 3IEXA 1KPIA 2A1UB 4YJ3A 1QIDA 2XH8A 2QR3A 5L7TA 1E79D 3LT0A 1WX1A 3NV9A 2AX4A 4EHAA 5B57C 1YDMA 3X3HA 1ZR2A 1Q12A 4X1KA 1GAWA 2E4XA 2V9ZA 3NEJA 4GVXA 3IMGA 3ZGOA 3FWZA 4UEOA 4LXYA 2YOFA 1YAJA 4KR2A 5DCYA 5EZYB 4URWR 5B2EA 1EJ2A 2CLKB 4UHEA 3WK9A 1BG6A 5EI5A 3RFXA 3X1XA 4ON9A 2EJUA 3F6RA 4WBNA 2IQ5A 2YASA 5BNZA 2O59A 3MT9A 2WSSA 2PYDA 3VI3B 5KYTA 1J07A 5HF5A 2GXQA 4Z3DA 1Z2OX 3PYXA 4FW9A 2HXYA 4DSAA 2G08A 4PFSA 3ZJUA 3GBPA 1EFVB 5DZSA 1OJLA 4HATA 2Y1LA 3T7RA 3HKCA 1ZYUA 1BZYA 4NXNB 3Q5DA 4FZ5A 1NP7A 1IOLA 4IJUA 4YXWA 1CBUA 2XXJA 5I9NA 2FEPA 1K8QA 4UBNA 4HI0E 3INGA 1D09A 1Q92A 5IF9A 2QORA 1OFVA 2WKPA 1X7YA 1EAYA 2PGJA 3G89A 1NURA 2FSSA 1I2BA 3FH0A 3GA5A 2I3BA 3ITEA 3MK31 4UXHA 1UZMA 4OGKA 4CIXA 2C2MA 3KDAA 3H2KA 3QGMA 4PYQA 1DELA 5DVZA 5FEMA 3GOQA 5CFQA 1LK0A 3HP1A 1CWUA 3F74A 1COWA 3F7OA 5B3KA 5AESA 1H0KA 2F55A 1FDRA 3IE1A 1JEYB 2XBMA 1H6CA 4TQ9A 5COQA 3RK1A 3A10A 1UDAA 3PL5A 4K40A 1GUAA 3PXEA 2QTVA 1PEYA 1E79A 3K94A 5E4YA 4L2IB 1FTYA 4YN3A 3C6KA 3CO5A 2M6KA 2OB2A 4EFMA 5JZOA 2JCVA 3HA7A 5JV5A 3RPEA 1WDWB 4B6QA 1CEXA 3K0CA 3IUQA 3O4RA 2AJCA 2R9VA 1G2OA 3QVUA 2RH5A 721PA 4F8JA 3EGEA 5F21A 3WL3A 2YINC 3FLAA 2A5GA 1TM5E 1H5QA 2WHXA 1FCJA 1QHNA 2FZGA 3GIDA 2F9LA 1TU3A 4G4SP 5AOCA 3TTWA 3RAEC 1MH1A 3K9GA 5EJ7A 4JOQA 4HUQA 2GD6A 3SC3A 2I1LA 3VDQA 5JAHA 1K68A 4YQFA 3K6SA 1VRVA 1SEVA 1ZSNA 2CWDA 2FEWB 4CMKA 2GKOA 5JVDF 2Q6LA 4PXYA 5B3JA 3L6CA 2YYYA 1JALA 3QFSA 3IA2A 3FGNA 4NNJA 4HDNB 5BVHA 2WWRA 4I4TB 3I2HA 5KYNA 1B42A 1E3DA 2QXUA 1GPDG 5F4BA 4W5OA 1TM1E 1WUTA 3F6YA 2HWXA 3L3BA 2XMDA 1TZCA 3NKVA 1LVUA 3FIJA 3LRPA 4X61A 5C1IA 3W2EA 5EIHA 4KE6A 3AVQA 1FFDA 2XKAA 3FOAA 4F3NA 1E92A 2HY7A 2BFBA 3AM1A 3DDHA 1UM9A 2WSMA 1L4YA 3FF4A 4GLJA 3ZDEA 1PJTA 4AQDA 2YYAA 4FNMA 4YUWA 2PX3A 2OXRA 4BE7B 1QIFA 1RBYA 2JBHA 1CK4A 5IBRA 4XOIA 4KMOA 1WW3A 4B46A 3P4XA 1K7CA 4B6OA 3ORHA 1RWBA 4AZ3B 3I76A 1G0OA 4GZLA 5I7AA 2ZRDA 4MUKA 4CN8A 3ZK8A 4OK5A 5AI6A 4CQNA 2DGDA 1RRKA 3THXA 2WIJA 1GILA 2KPOA 4AF6A 5IAAA 4X6XA 3D8RA 3N74A 4ENQA 5JJLA 1BXGA 3JATA 3RTAA 4RLFA 1LDGA 1Z6GA 2SICE 1H22A 5AVUA 1JHAA 4FYHA 3KQWA 3EIFA 3KSBC 2BMWA 5JD4A 1MXFA 3ELBA 1WPRA 4R0NA 3ZV5A 4CLRA 5K0GA 2A9KA 4OTZA 2AQKA 3GDGA 1EDDA 3NX4A 1DU4A 4S1OA 4M99A 1KF0A 2VNJA 4EG4A 3ADCA 3MILA 2QT0A 2Z3VA 2Z4RA 4I4NA 1C4KA 1NJ1A 1ZUIA 5EE5B 3M49A 3R0JA 1O96A 2GJSA 5JAQA 4D9IA 1Q7TA 1ZG3A 2JK1A 5AKIA 2WJ4A 2X15A 3L6RA 1Z6YA 1T15A 2JB9A 4EJFA 1UBFA 4D74A 1ECJA 3TSWA 1U80A 5HP4A 1DRKA 2DQSA 1V43A 2DU8A 2Q8QA 3IE0A 5J4LA 5NLLA 5IWCA 4KXQA 3DE5X 3A14A 4X63A 3VC3A 5LYJA 4OAOA 4B82A 3SZLA 3I5UA 2RD2A 3MXOA 1JFLA 2GLXA 2WNIA 2Z5VA 3CF4G 5DTEA 3SDZA 1YACA 2C99A 5CGQB 2YICA 4EYQA 2B8JA 3UICA 3OQHA 3ZYZA 3K32A 4XUGB 1R66A 1QRAA 4NF2A 4YMUA 2YMPA 1KQOA 1YA8A 3GUVA 3T41A 3QJ5A 5CX4A 1MH9A 1USGA 5KCMA 1UXOA 2WPDD 1MDFA 3COZA 2X9VA 3LT4A 2LDBA 1FXWF 1SOMA 3A7EA 2ZJZA 4LNUA 4J2OA 4LYAA 3U31A 2ZAOA 1CUYA 1T4DA 2HI0A 2WTUA 3PT5A 1P7CA 1ZA2A 4Z7JA 1DAMA 4RZ2A 1R4NB 2ZIZA 1CFJA 1X70A 3R5JA 4OB7A 5BT9A 5CG2A 2Y0DA 4YMIA 3SYKA 3AVVA 4B3RB 4IQFA 4DNQA 3QVJA 4TVKA 3TMYA 1Y48E 1KQGA 1ZIDA 1E1QA 2BHTA 3O6VA 5AVVA 3B2EA 4JXJA 3T34A 1BD3A 1XDUA 1A7AA 5A2QA 3AOEC 1HZZC 3IEPA 2XB6A 3BMOA 4BFXA 2AOTB 3SXPA 1LS1A 4U2EA 1YQDA 3BIWA 4A27A 3I2IA 3SLKA 3DF7A 1EMDA 2X5JO 4LDPA 3LFTA 4CRWB 2UAGA 3HJAA 1XGKA 3RK0A 3UUGA 4NYJR 1JFTA 5DXAA 1Z2NX 2OXCA 5KJFA 1PZEA 2RGXA 3GP5A 1P2VA 4HK4A 2C9CA 3AEZA 2O23A 4B0PA 3MTAA 4V0LA 4DEXA 2JFBA 2Y1EA 3SVZA 3P9KA 5JMWA 1FVHA 4D56A 4AN0A 3QY0A 1XDGA 3WTCA 1T5BA 1OWPA 1PUIA 4K9LA 4LZJA 4QUBA 4J7AA 1XKTA 2EWWA 1BVUA 2VWHA 4JNKA 4UNNA 4DR4B 2ZP1A 5BN4B 1S8AA 2BFFB 4AKSA 5C80A 1RPTA 1RXIA 4K5QA 1JA9A 2HDHA 2F8MA 2QENA 3NVMB 4CDMA 4WJKB 1Y82A 5CYOA 1IN1A 1TI7A 1Z25A 4FMCB 1VCOA 4QM7A 5LBUA 4DT1B 2JGFA 1A95A 1XJQA 2J3KA 4HXEB 4IGIA 5HZHA 1Y6GA 1XCPA 2RH4A 3CX4A 4YB8A 3R7FA 3WGNA 2H4YA 2QRHA 3ZI4A 1ZSYA 4PZEA 5IG2A 2I87A 1C30A 4UUBA 3S2GA 3CR8A 3NOOA 4OGWA 1E9AA 4HGZA 4RPGA 1STOA 3GNQA 4BAGA 1KOGA 3KSRA 1RM3A 2DJIA 1N6KA 1VPDA 4MI6A 3SN6A 4QOFA 2PWZA 2ZJ3A 5EP3A 5F64A 4DGQA 4RKRA 1A4RA 1GRVA 3T15A 3GELA 3KYIB 5FTLA 4HEQA 1YZTA 1VI5A 1KNXA 4R2HA 4MV1A 5C32A 3OQNA 4BTEA 1PYOA 5I48A 1IJKA 4ARUA 3FCOA 2JAUA 1QUEA 1BU5A 4YI5A 2GJAA 4ZC8A 1DWQA 2HU7A 3JALA 3PC3A 3PEEA 3PHHA 1L7BA 1A77A 2VHVA 3DAHA 1EFTA 1TGVA 1Q15A 2BR5A 5EIOA 1CUWA 1N8KA 1U1EA 1WU7A 2IXAA 1RE0A 3D3JA 3VKFA 3AVXA 4RADA 4BJ3A 2O3JA 1EFLA 3AESB 4HWKA 2QT9A 1YQEA 2UKDA 3FM9A 3G0IA 4P5DA 1QUFA 4PLYA 5DWVA 7MDHA 3EASA 1VFNA 5G2OA 5TE9A 3LD9A 2ZS7A 5KDLA 1IG0A 2KW5A 4I50F 2O8CB 1P5JA 3R3HA 4IDGA 1QRSA 3U7FB 3FG9A 1ZMBA 1W5TA 4ZV7A 4J1QA 5JD6A 3KHTA 1GGJA 4XDZA 3QE4A 4MARA 1U0EA 2VTBB 4Q9NA 4C29A 2G76A 2HADA 3WRXA 1QYIA 1A0OA 1TRHA 1Z4OA 1P1HA 2H0AA 1FYEA 3VO2A 1EFHA 3SZRA 3KUXA 5HYVA 3ETHA 4A8TA 1Q1GA 2CXRA 5BSVA 1LC3A 3OLVA 4UBJA 2Y0EA 5E1MA 2BUAA 1XQYA 2F9FA 4NZNA 1C9EA 3URKA 4JI0B 1T0BA 2TRSB 3U1VA 3X1JA 1Y3CE 1ZAKA 2H8KA 1V71A 4KAJA 1UIMA 1P9WA 4ID9A 4J76A 2YXEA 2Q4OA 3A4IA 3O8QA 3K7EA 1ZIPA 1K0UA 4RZIA 1ZCAA 3PFIA 4AJHA 4MO9A 5COBA 2IXGA 1FFWA 3EZ6A 3LOUA 3UBMA 4NH4A 4TLCA 5LPNA 3GY0A 4AQ7A 5KUTA 3W6UA 1T2EA 1U65A 4D92A 4I9FA 1ZQ9A 3IUYA 2V8BA 3QBVA 4BNTA 1CCWA 2NO0A 1RYBA 1QOQB 4H4DA 3VBCA 3ZZ1A 4EYKA 1PJSA 2QTFA 5EERA 4ZQFA 1QRTA 2VJNA 2K5UA 3E35A 3I9LA 3VR5H 4EQ6A 2QN1A 1Z4IA 2J3HA 4XVQA 4M9SA 1NJFA 1TECE 4Z9XA 2TMGA 5FRDA 1HQDA 1GDHA 3EXFA 4C7JA 4I8IA 2I7XA 3H1PA 1AS3A 4LX8A 4GT1A 1IUNA 2E6UX