3O1IC

Crystal structure of the tors sensor domain - tort complex in the absence of ligand
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
298
structure length
298
Chain Sequence
DEKICAIYPHLKDSYWLSVNYGMVSEAEKQGVNLRVLEAGGYPNKSRQEQQLALCTQWGANAIILGTVDPHAYEHNLKSWVGNTPVFATVNQLDLDEEQSTLLKGEVGVDWYWMGYEAGKYLAERHPKGSGKTNIALLLGPRTRGGTKPVTTGFYEAIKNSDIHIVDSFWADNDKELQRNLVQRVIDMGNIDYIVGSAVAIEAAISELRSADKTHDIGLVSVYLSHGVYRGLLRNKVLFAPTDKMVQQGRLSVMQAAHYLRHQPYEKQASPIIKPLTPKTLHDDTIEESLSPSEYRPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein TorS
publication title An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO.
pubmed doi rcsb
source organism Vibrio parahaemolyticus
molecule tags Signaling protein
total genus 88
structure length 298
sequence length 298
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o1iC02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o1iC01
3BRQA 1JDNA 2W42A 1M5UA 1SXIA 3IP7A 2XDYA 3O1JC 1Z13A 2RJOA 3EQZA 2QVGA 4EYQA 4G0QA 4NCBA 2JBAB 4TLLB 3N8IA 4RY8A 3I09A 5CNMA 7ABPA 3RVOA 1D1PA 4RWEA 5T3YA 1VPWA 1E6LA 2IPMA 1USIA 4LE1A 2WWVD 1XWWA 4UHJA 2PL9A 4MQFB 4Q7EA 3LUFA 4MR9A 5CHYA 3JVDA 1M2FA 5IUNC 1TLFA 1JX6A 1LJUA 4KZKA 1JDPA 3T38A 4RK7A 3CG4A 4OATA 4N0QA 4HNRA 1ISRA 1U0SY 3G85A 2X7XA 2JB9A 1A04A 1YMUA 3OO0A 1ZITA 4G97A 3DZDA 3JTEA 3M6MD 3NNNA 1LBIA 1DP4A 3M9XA 1JYFA 2FEKA 4PYRA 3CRNA 5JNRA 5D2CA 4W5RA 5TPZA 4MR9B 1Z15A 3RVQA 1TJYA 3S99A 3FDFA 2CD7A 1JBEA 2E4XA 4P98A 3RVMA 4ZYLA 1NXOA 4D6YA 4XFKA 2ID9A 1DRKA 2E4ZA 1D5WA 4O5AA 4RKRA 4L85A 4O1HA 5FBHA 1PEAA 1QPZA 4RDCA 3VNBA 3TO5A 1NTRA 2R25B 4H60A 4D74A 2PJUA 1ABEA 3SNKA 4F11A 4JOQA 4LX8A 1JFTA 5GQSA 1PNRA 4F8JA 4IILA 3KHTA 4GNRA 1BDIA 5FWYA 1QNLA 3SAJA 2FN9A 2NT4A 4L4UA 4MLCA 2MYNA 1EWVA 3C3KA 1A0OA 3F6CA 2FQYA 5JNVA 4G0YA 4G0PA 4RXTA 4KV7A 3F73A 2JCGA 4RK0A 3O2JA 2V0NA 4QICA 4F06A 1QQAA 1DZ3A 3OMWA 3I45A 3LFTA 4FE7A 1F4VA 3F6PA 4RY0A 1ABFA 4EVRA 2WB4A 2QXYA 3O74A 2WJAA 4RXUA 3KYJB 4YRZA 5FWYB 3T8YA 4YWHA 1NXSA 1R8JA 5IEJA 1DRJA 3HSYA 2GWRA 1H9CA 3G1WA 4F3TA 3O21A 3VNAA 5BR1A 4IMJB 3RQIA 5TQ2A 4PZ0A 1TVMA 1YTUA 4EYKA 1BDHA 5I4CA 3MYYA 2Q5CA 2HPHA 3Q7SA 3D8UA 3O1HB 1E6MA 3C3MA 2JVIA 3A0UA 2FXIA 3QEKA 2FMKA 5TQJA 2PUEA 4G0OA 1ZGGA 3W9SA 4QPJC 4Z9AA 5TQ0A 3HS3A 2HJ9A 4H3HB 3C97A 4XARA 2QSJA 5TQ2B 3UKJA 4Z99A 2L17A 3O1IC 1ZH2A 4ETNA 5HKOA 4E7PA 4RXMA 5ED4A 1PHRA 3N53A 5HQJA 2WRZA 3LUKA 1P6UA 3TD9A 3JPYA 1SXGA 1Z18A 4RKQA 1L5YA 1U2QA 4G0MA 4RK6A 3RVNA 1QO0A 2I6FA 5TQ0B 4P1ZA 2JVJA 3LTEA 3GBVA 3NNDA 2FMIA 3CTPA 4HYEA 4Z4IA 3KLOA 3JVIA 4RK1A 1W9HA 3P9YA 1K66A 3NBMA 2FVYA 4NCAA 1USKA 1VKRA 3QEMA 3OQMA 2E4YA 1QP7A 5TPWA 5IX8A 3IP6A 2IYNA 1APBA 1URPA 1JLKA 4YCSA 1TMYA 4MS1A 4WXEA 5EWLA 4N03A 4LE0A 4YLEA 1YMVA 4ZPJA 3D02A 2MYUA 2FW0A 5JNWA 1LJLA 5CNKA 3KLNA 1QQBA 1NY5A 2L2QA 1JHZA 1FFSA 3CU5A 5F64A 1RXIA 4MAAA 4MS3A 5E3JA 4O1IA 3TB6A 1USGA 4Z4GA 3QEMB 4LRQA 2MYTA 2O20A 1DG9A 3JS5A 4YS6A 1EWTA 5TPWB 5KQPA 3NHMA 4N76A 3ROFA 3R0JA 2MSLA 3DLBA 1SXHA 4ZMSA 3H1FA 4NICA 4XAQA 2LBPA 4MS1B 2IPAB 4G0XA 2P4UA 5EWLB 3MIZA 4OBBA 1D2AA 2M1ZA 2OQRA 4N0PA 4DN6A 1EFAA 4MPTA 1FFWA 1RNLA 4MS3B 2PUDA 1GUDA 2RGYA 3GYBA 4IMIB 4MRMA 3EAFA 1GLGA 5KQMA 2QZJA 2JK1A 2FLKA 3H1EA 4KVFA 5PNTA 3CLKA 2RDMA 1ZDMA 6CHYA 1KRXA 2ZWMA 3GRCA 1JWLA 2FTKE 2NZUG 3QK7A 3GWGA 3ROTA 4OTZA 2H3HA 3HVRA 2QU7A 2CHFA 2R4QA 3LUGA 1M2EA 2A9RA 2PLNA 4JB0A 3A0RB 1Z17A 1D4ZA 2L18A 4MRMB 5BRJA 4S05A 4W5NA 3IP9A 2M98A 2GBPA 3N0WA 2QV0A 2YHAA 3KG2A 1A2OA 1OXBB 5KC9A 1RZRA 4W5QA 1NXPA 2QW1A 3HUUA 4DADA 5BRAA 4Q6WA 1OXKB 4QYMA 1SD5A 5JS1A 3M9WA 4MGEA 3OQNA 2VYCA 4WWHA 3EGCA 1Y1LA 2HSGA 3HO1A 1P6QA 2IDMA 4MR8A 4EY3A 3FGZA 3GV0A 5C5EA 3Q41A 3EULA 1BVHA 1DC8A 3KTOA 1NXTA 4G86A 1KRWA 5HM6A 1T34A 1NXXA 1RXEA 2AYXA 3RH0A 1VLZA 2FEWB 3EODA 3JPWA 4IF4A 4DQDA 1F51E 2IOYA 1K68A 3H5VA 4EVSA 4M88A 1MB3A 2KYRA 2R47A 3MF4A 4ETIA 3NHZA 1ZAYA 5DKFA 1DCKA 1YS6A 5DLEA 3QX9A 1ZN2A 4MR8B 2B4AA 1ISSA 1MIHA 3IP5A 2RJNA 2NUBA 3HM9A 3SM9A 2LUOA 2PAFA 3LUCA 3CZCA 4MS4A 2ZAYA 4EYOA 5JNTA 5DCLA 1ZGZA 1LBHA 3Q15C 5IEBA 3RVJA 5KC8A 3OLWA 4KQ9A 1RPJA 1C4WA 3JY6A 2E4VA 3QELA 5TPZD 4KPYA 3IPCA 2HQOA 4PEVA 1FFGA 4D6XA 4ZJPA 2YHBA 5FWXA 4OLAA 2F8TA 2QVCA 3H5TA 3HEBA 3HUTA 1P2FA 1DCFA 3C6QA 3H75A 3KS9A 4KK3A 2MSKA 4RSMA 5IUKC 4N47A 4EVQA 4MS4B 3B2NA 3T95A 3H1GA 1DJMA 5EWMA 1GCAA 3OO1A 3QELB 1YS7A 3N0XA 4TN5A 1PNTA 5BQ3A 1WETA 3RVRA 2H0AA 3QLVA 3Q9SA 1SRRA 4OLBA 3O2QB 5FWXB 2TMYA 1W25A 4IGAA 2A9PA 4GPAA 4WT7A 1D1QA 1QP4A 2FEPA 1ZH4A 5JS2A 1GCGA 4Q6BA 2P9HA 2PUFA 2PL1A 2VUIB 3MA0A 1ZHHA 2F8SA 3MQ4A 2R48A 4KRFA 2AYZA 1NXWA 3H5IA 3LUAA 3UUGA 1U04A 5EWMB 4HNSA 4JP1A 4EGSA 2DRIA 4NQRA 1E6KA 1NXVA 3EDCA 3LKBA 3QLVC 3K4HA 2FLWA 3RVKA 1B00A 3E3MA 1C0EA 1DBWA 1KMIY 2FMFA 1YK0A 3KYIB 1YK1A 4TLMB 2A9OA 3C3WA 3K9CA 3LKVA 3N6VA 5IULC 4RZSA 4Z4CA 1MVOA 2PMCA 1AB5A 4EYGA 1JFSA 2PUCA 1DCMA 3FFXA 1NATA 1Z2DA 3CKMA 4RK4A 3SQNA 3L49A 3OQOA 2LPMA 4UHKA 3MM4A 2JRLA 5EWJA 2VUHB 3QLTA 1GUBA 2LIVA 1I3CA 1IIBA 1TM2A 3DGEC 4Z0NA 2PUGA 3DBIA 3OLVA 6ABPA 4S04A 3L6UA 4XASA 1FQWA 1YVUA 5KWSA 3HV2A 1DC7A 4MYRA 4MLDA 3RVSA 3I5AA 4Z4HA 4JASB 9ABPA 4H3KB 3EJWA 1DBQA 1KGSA 5IBQA 5CNJA 4NV3A 3H5LA 1Z25A 4PICA 3LMKA 1Z12A 4N41A 1JL3A 4RK5A 2CWDA 3Q7TA 1EHCA 4RY9A 5GOTA 5EWJB 1AB6A 3TMYA 4YP9A 2PUBA 3H6GA 4FE4A 3IPAA 2WY2D 5CNIA 1QO0D 1Z2EA 4RU1A 2CHEA 2L19A 3CZ5A 2QR3A 5T7BA 4JAVC 1JH9A 3A10A 2MSWA 3KCNA 3URMA 4XLTA 2GX6A 2IPNA 4WXMA 3KSMA 3HXMA 4Z4EA 4Z4FA 4ML3A 2VK2A 2A9QA 3QX8A 3OM0A 4ETMA 3GT7A 1ZESA 4HNQA 4MR7A 3O2SB 5KQLA 3OLZA 1CEYA 4PE5B 2IPLA 3GA5A 4LDAA 4YV7A 3HJFA 1CHNA 4Z9BA 3FMVA 2BGGA 2HQRA 4TMYA 1PEYA 3N75A 1MAVA 5DGCA 1JF8A 3HDGA 4WZZA 3BREA 3LUJA 3FFTA 3CG0A 4YR7A 4LDZA 4MR7B 5FBKA 2OENG 1ZY2A 3CNBA 4ZMRA 2MYPA 4G0ZA 3DLHA 2WJWA 3OLXA 2PUAA 4YGXB 3LUHA 3Q7RA 3QLUA 2GI4A 4Y9TA 4KFCA 4QYWA 1DBPA 1U8TA 3T6KA 3HK2A 4KK4A 3NNSA 3H5WA 2E4UA 3CHYA 3KJXA 1S8NA 3A3KA 1Z26A 3OLYA 5B3JA 8ABPA 4LE2A 2N9UA 1JYEA 2FQWA 3ILYA 1U2PA 1LK0A 2WMYA 4LZLA 5JNSA 3FFWA 4E7OA 1UDRA 2NT3A 4JB2A 1MB0A 1L5ZA 3UK0A 3E61A 3H5OA 1M5TA 1P8AA 4MQEA 2NZVG 2FQXA 2LP4Y 1FSPA 3DGFC 3QLUC 5IC5A 5TE9A 3KKEA 2IKSA 1PUXA 3I42A 3OM1A 5JNUA 1QP0A 4KREA 4RS3A 4KNYA 5HSGA 2FMHA 3BRSA 5B3JC 3LUDA 2HQBA 4IRXA 1EAYA 4KMRA 1XHEA 5KI6A 1Z16A 3BILA 4RV5A 1HEYA 3LOPA 4XXHA 3N0RA 1CYEA 1JFVA 1XHFA 2PKXA 4CBVA 3EQ2A 4KQCA 3RVLA 4B09A 3GL9A 1RZRD 3IDOA 5KQGA 1QMPA 2JVKA 4MQEB 4WUTA 1BAPA 2FN8A 3GBPA 1QKKA 3SY8A 4EUKA 3CFYA 5ABPA 1ZVVA 2FSPA 3BBLA 2B1JA 3HDVA 1BA2A 3RVPA 2E4WA 2GKGA 3O75A 4JA2A 1BDJA 3SG0A 2PE5A 3HZHA 2FKAA 2J48A 4W5TA 1EWKA 2JBAA 3TX6A 1E2BA 4OG2A 3H6HA 3MMNA 3CS3A 4YO7A 5C5CA 5IUJC 5DTEA 3F7NA 3OMXA 1VRVA 4FB4A 1YIOA 3ILHA 4W5OA 2ID7A 4MQFA 4F12A 1J56A 3HCWA
chains in the Genus database with same CATH superfamily
2X8BA 3OCCA 4C4SA 4HLNA 4DANA 4MYHA 2BP7A 3PTAA 5ADWA 5AM0A 3IP7A 1FYFA 2XDYA 1H6BA 1U4OA 1SAYA 4TRNA 3CVJA 1Q11A 4CM9D 4EPXA 1JHQA 3PTLA 1EE2A 3N8IA 2PSHA 3BGIA 3G1TA 4FSXA 1HNXB 4FYJA 1M66A 5EZ6B 1RQNA 3SR4A 4NHOA 3M6FA 1EFKA 1WKVA 4PAOA 3FPJA 3ZXYA 2GAAA 2QL6A 4M86A 3JZMA 3KP1A 4Q7EA 4WJKB 2NUTA 3ZWCA 5K8IA 4OQEA 5CHYA 4HEQA 3GNTA 4FYKA 4JJ6A 2GO1A 4D4JA 1UZNA 2A5DA 2WYVA 3CG4A 3ZE9A 5EJ4A 3USZA 2ZXUA 5B5SA 4KN9S 2VRCD 3B6ZA 5HIAA 2ZM5A 1EXNA 3QPCA 5JMOA 3T4UA 2ETVA 4UTZA 2DSTA 3ONEA 3RTDA 2GXUA 2QENA 1HNZB 3L8ZA 4HDCA 3GG2A 3ZV6A 3A3PA 1LS6A 3TDNA 1YDMA 2FEKA 3K2IA 1PJLA 3S2EA 5K09A 2AFVA 3VR5A 1EK0A 4UEQA 2XKJE 4KQEA 1SHKA 2ZPAA 2Y1OA 3O4HA 3QOWA 3V9AA 4CLHA 1YDWA 1DTWA 2Q5OA 4DTCA 1XMSA 4LV8B 4KE7A 1Y6FA 4HYTA 1FNDA 3AZPA 4Z4QA 1E1KA 5BSWA 1D5WA 1SXJB 3KK0A 1DO8A 5JXIA 2WPDA 2HM7A 4H18A 3COSA 1IQRA 2UZAA 4LKRA 4D46A 2E37A 3PXBA 3ODPA 3TLZA 3LWNA 3GU3A 3UHJA 5JLJA 1PQWA 4M0UA 2JGNA 2MSDB 3RC2A 3RT1A 4AX8A 2PS1A 1XAJA 2REXB 4LHEA 3CGGA 2IYWA 5DHFA 4NABA 2AI2A 2HDNB 2A1UA 4IFBA 4HAYA 4N6NA 3WZMA 4GICA 1J2TA 2JCGA 1ARZA 3RF6A 5I9MA 1Q6ZA 3QKIA 2QIOA 3V5NA 3VPCA 4DSUA 4HDRA 1ADGA 1EXVA 2ZUTA 3RBXA 1MB4A 3Q3IA 2QJTA 1Q0UA 4G9EA 3C7KA 1KO7A 5EXPA 3HJHA 4AJLA 4JNCA 1PFYA 1WHSA 2TMKA 2Y0BA 3T52A 3D5TA 1N8NA 2DMRA 2Q1XA 4PHHA 1D2EA 1DUSA 1GA4A 1K0FA 1ZYUA 4UDYX 4PYQA 2OE2A 4X1KA 5ALFA 1M2JA 1K2WA 3I3OA 3VOTA 4ATNA 3KQTA 1FMCA 1FRQA 3O4FA 3RQIA 2BVNA 1Z06A 3IBYA 4JITA 3FMOB 1XE3A 1K9VF 1Y9DA 3PHBE 1NIJA 2WINI 1UC5B 1XYYA 2HPHA 4YACA 3G88A 2H85A 4EKYA 5ARBA 1SBIA 1IJKA 1XZIA 4PLZA 4PLFA 4ZYXA 3G8YA 3O4IA 3FZGA 4F8YA 1M75A 5JH7A 4UCWA 1ORTA 3N9IA 3JQGB 4M53A 4G1MB 4E4YA 2PKWA 4UNIA 2RG1A 2JLSA 5K5EA 2OOKA 4IYJA 4JI0B 1TVKA 5BV0A 1XCMA 3X1MA 1QIGA 1SEPA 1U7TA 2C2BA 3BSSA 1MN6A 3MTQA 3PQ2A 2C97A 5JWOA 1LNZA 2BMVA 2D1FA 2R68A 1E2JA 2GOYA 1YQTA 3KKMA 1JA0A 2B6HA 1BWRA 3M7IA 1OC2A 4P92A 2E5FA 2W7TA 1U2GA 3DM5A 3L0SA 3L1KA 3Q85A 2XVXA 3AR7A 3GZNB 1OLUA 2DC1A 4Y8VA 4C7JA 4QTTB 4ZDIA 3OWHA 1V2HE 4P1ZA 4AQYB 1M6WA 1WF6A 2VHQA 4IXDA 4LWZA 5E7JA 1EHIA 1YJAA 4D9NA 1N8KA 4LWQA 2J3LA 1L1QA 4WAUA 1BRMA 3P9YA 3V8PA 5ICMA 3L7DA 3I28A 3ICWA 3VU9B 3SMVA 1K8QA 1NULA 1FNSA 2B30A 1JMYA 4XH9B 4B8YA 1QP7A 2F43B 3THYB 2AOTA 1T3TA 5FHRA 1QDUA 4PC6A 3LP8A 4V1CB 1QVRA 1E2DA 4LA4A 5CXXA 5TB5A 1Y89A 2H2AA 4MHOA 4ZPJA 4D7AA 3OJOA 4ZZ0A 4A03A 3RTBA 3GMTA 5KB3A 2JIPA 1UKBA 3P2KA 4Q16A 3PFNA 4EQ6B 2YYZA 1FVHA 1QO7A 2CLOB 5FOUA 1CC1S 4ZVRA 3E2IA 3TPCA 2D3TA 2V03A 2WHRA 3QEMB 5BV2P 2DYKA 3AVYA 4BVLA 1FP6A 1HI9A 3UTDA 2CUTA 3P9CA 1VE9A 3FKSD 4IDOA 2BF4A 4GR5A 1AUPA 2MSLA 4HK4A 4P2BA 4HZGA 4QXMA 1CUVA 3I01M 3AJAA 4XQEA 1UXKA 1WDWB 2XAAA 3A70A 3BHNA 3I83A 4HPWA 5REQA 4HYQA 1JDVA 1CR2A 3IVCA 4IIJB 4UVIA 4F2PA 2P4UA 2C1EA 1GKIA 3F74A 1SXJE 1A9QA 2ENWA 3MJCA 5E6SB 2V54A 1SU6A 1YQDA 3HC7A 2D4AA 3A4VA 3QKUA 3VXKA 3G2HA 4NZ9A 4A8JB 4D3YA 4F5ZA 4X1IA 3PENA 3RS7A 1OWPA 1XKQA 4AY4A 4H4CA 4WN9A 5FTNA 3W5SA 3EOAI 4KSYA 2FEMA 1OB2A 1T5BA 1V1MB 1Z47A 4IAOA 3IT0A 4E4TA 2J3HA 5LIPA 4TSFA 1BH2A 3H1EA 4LZWA 1MEEA 5L6MB 2DR3A 2Z5VA 3EZLA 3THSA 1LWNA 3TM5A 3LQFA 5KNDH 2NZUG 3LO8A 2CB9A 3HYNA 2C4NA 4PIPA 1EX9A 5A9TA 2QTGA 1IXKA 1ZUD1 2HQSA 3H9BA 4LXHA 3C3YA 1X2BA 3DE7X 4HRYA 2V1XA 4TX1A 3D6TB 3R7LA 2Z3ZA 3ADCA 1JLSA 4MTCA 3RRJA 4R7TA 3LUGA 1N5LA 1DAEA 1QDLB 2A9RA 1ZK0A 5LA6F 1V48A 2XOEA 1DOZA 3RIGA 1VGQA 1Y5RA 5HG0A 5LUBA 1YQEA 1U9CA 1IHOA 3GFTA 3VR6A 1NU6A 2XPCA 4QQKA 1YR6A 2BFFA 1CERA 2CMDA 5K4HA 2RCNA 5AI4A 5AVXA 1NYTA 1OXBB 4LOLA 1FA9A 4W5QA 2IYRA 3PNKA 3AF6A 5DBIA 4X20A 3CEAA 4U9UA 2H1LA 3DAOA 1V0JA 3BQ9A 4J0DA 3U56A 4WBNF 3BL5A 5EGSA 4AW9A 3EG9A 3N1UA 1PQPA 1LEHA 3EW7A 1Z8FA 1ODIA 3GLIA 4N65A 3W34A 2AI3A 3EGCA 2QYHA 1I36A 3GEMA 4A27A 3ZY3A 3JXEA 1AHPA 5A0FA 1TRHA 1D07A 2C82A 2QV7A 3CINA 4HXGA 1OR8A 1KP2A 4PSKA 4CEJB 3MBIA 5E1MA 1MC1A 2Y1FA 3LX8A 1M0WA 4JZKA 4KNVA 5HM6A 3WYCA 5IBPA 4BZQA 5K6AA 3R9XB 1HNNA 2R1UA 3J80A 1N9GB 3DE2X 5JADA 1X1EA 2JGJA 4DRXA 3IL2A 3QTLA 4M88A 2F9MA 3H2HA 1KETA 2X13A 3SQWA 3AF4A 5TF4A 4ETIA 5BV1A 2Y1DA 1WUYA 1MO3A 3ELBA 3FF1A 1S4MA 2HY7A 3LCVB 2VCHA 3QX9A 4OP3A 1IZ0A 4XM1A 2RJNA 2NUBA 4N3NA 4BCDA 2VKTA 2W6QA 2FP3A 3PC3A 2WWFA 4KE8A 5CLLA 1JJBA 1DX9A 5EIFA 2V3CC 4O08A 5AKJA 4GOLD 1Z6PA 3X1ZA 1XAHA 3LU1A 5ICGA 4LHVA 3I2JA 4EL5A 1GZUA 1F5SA 5FTMA 1DG3A 4LJ6A 3MWEA 2DU8A 3AJDA 1OV6A 3E05A 3L6OO 3MHPA 3NWEA 1W29A 4M37A 4PEVA 4Q7JB 3ZD8A 3UOAB 1FVOA 1BDMA 1ZNZA 1AZSC 3PGVA 1CRZA 1KI7A 3PWSA 4CNBA 1X92A 2QVCA 4G4IA 5LP6A 3NV7A 3QV1A 1SURA 2V7PA 1JS1X 4ZAXA 1E1CA 2KB0A 4WD3A 2C5SA 3Q9NA 5B3AA 1E7YA 2VXOA 1HTTA 4OJMX 4OYLA 4F38A 1K8XB 4Y6RA 3WLAA 4DV4B 1XLTA 1GCAA 5AVWA 3CT6A 1CQIA 2QE7D 1N0UA 1G0NA 3LSYA 3QMWA 3E03A 4YRCA 2XIJA 3QLVA 3GYGA 4JJ8A 4LAFA 4LKOA 1B0PA 1GP2A 3EDYA 5BN1A 3SFTA 3ZU6A 1WUIS 2JHCA 2JCBA 2VCYA 3ENKA 1ZH4A 1EK6A 2GGSA 1U2GC 2E7ZA 2J4CA 4J7UA 2JDID 4P9NA 5FO1A 3LCJA 4BX3A 2FZGA 2CLFB 3HSKA 4D25A 2I3ZA 2B2XA 4XA8A 2BM0A 5FBLB 2HHJA 1DNPA 3RD5A 3L6RA 3N7UA 4N5IX 4UJ5A 1P1IA 5AM4A 1MVNA 3TXAA 2Q1SA 5KHOC 4K8RB 3WNVA 1RRPA 1EVIA 3HR4A 4LGVA 1NOKA 4QG7A 3VHRA 2BGWA 1P33A 2NNLD 4LHWA 4G65A 3WWYA 4OQXA 1X9HA 2ZRBA 4LPKA 1ZEJA 1I4DD 2FMFA 3E8XA 4L28A 4OHWA 3R7DA 1J8VA 2A9OA 1U3WA 1GGVA 1B2RA 4KQHA 1A77A 4O2LA 4DCVA 1OZ0A 5JAUA 4IJ5A 1CJSA 1GRNA 4TRMA 2GK6A 1W0JA 3L02A 3MCVA 4FEGA 4KQMA 1LVUA 3EUFA 3CNOA 4KG7A 3W2FA 3NHAA 4X62B 1II0A 1HOXA 1UBLS 2NO6A 4DLUA 5CH3A 4EX6A 3GH1A 4YAEA 4YXFA 4YXWD 5JAMA 4TMXA 1M6VA 4B44A 3CKKA 1F06A 4J49A 4QFBA 1DC7A 1G8SA 5F77A 1NI3A 4FZVA 4MYRA 5B7PA 1NM5A 2J7PD 4QEZA 5G40A 2HDHA 2QI9C 4DA4A 3BJZA 1KGSA 3ECSA 4WFQA 3AMVA 2E82A 3R7BA 1IN1A 2J0UA 1XI2A 1ND5A 2AN1A 2AJCA 1VE5A 1C9KA 2X6TA 4PHGA 3UM9A 1ZD4A 3WOHA 1FFYA 3WY9A 4BNTA 2O8VA 1SXPA 3K1AB 1SJ9A 1TNDA 1XIVA 3STXA 2VJMB 1VP9A 4FMDB 2E18A 2BBTA 2XB6A 4QVKA 3YASA 4CQMB 4EFLA 3DE4X 2CT8A 3A1NA 1H85A 4OB6A 1C7IA 3OX1A 4RAOA 4TMZA 2G5PA 1J0CA 2VJYA 3CZ5A 3P2JA 4NPHA 3DNMA 4CMHA 4DXAA 5C3UA 1P9LA 4XLTA 4BIIA 3TE7A 3EQ7A 4F1JA 2FW8A 2D0IA 4TTAA 4HADA 4W5WA 2IU6A 4PCLA 4R1TA 2JGDA 1AZLA 1R4AA 3B6KA 1Y8QA 3OLQA 4U1RA 1GWNA 2IYPA 3IUYA 1GLNA 2WIAA 2A59A 4K28A 4YASA 3RYIB 1P29A 2B8WA 1ZR2A 1GHTA 1E7SA 5SY6A 1RRVA 1BHQ1 5DN9A 5P21A 1FF9A 1D09A 4LDAA 5DOVA 3P0JA 5LXTF 5DNDA 1LI5A 2JJ1A 2OD2A 5DHSA 2YZ7A 3LW7A 4MVJP 4UM7A 1FTNA 4GVXA 5G0WA 4CGZA 3HKEA 3NHJA 3PPIA 3J7AC 2WJJA 4CW7A 4PG8A 2VH5R 4PLCA 4W8OA 1KI4A 1YB6A 5LNK6 1GO2A 2QTZA 1WY5A 3O8QA 3DVRX 3WL8A 1GL9B 1ZY2A 4I8IA 2BR5A 2EXXA 2QVYX 1TFRA 5F1KA 4EABA 1GU7A 4E2YA 4GMHA 2AQKA 3QVUA 3HTXA 3AI7A 3NH9A 1R0KA 1FFXA 4QIHA 1W75A 4BWYA 4G8JA 2FK8A 4ZRNA 2DY1A 1NKSA 2PSDA 5AUPB 4MW4A 2EERA 3GDFA 4V0MA 3KZ1E 4Q4JB 5FT9A 1ESMA 4OL9A 3EHEA 5IC6A 2I1VB 4G5QA 1WPRA 1H2BA 4PFSA 1R0RE 3ZCSA 5LM3A 3AGQA 1EEHA 3C70A 4ZIRA 3ABZA 5HBGA 4BEJA 3K9QO 2V97A 3UK0A 5AI5A 4N5HX 4TVSA 1P8AA 5LQNA 4RTMA 2FQXA 4DLBA 2I3GA 4CUZA 1R74A 5EXSA 4IHQA 2W6NA 4WOKA 1N6LA 1BN6A 2Q4EA 3L84A 3L8CA 2PA3A 4A26A 2H4ZA 2PX5A 4WFJA 5IJ9A 5EL0A 5CYOA 4AF8A 1TQHA 4RQBA 4Z0PA 3BJEA 1L4FA 1N75A 4YP1A 1JPVA 3EQ2A 5HK9A 2LCIA 4ID9A 2P2YA 3F78A 3JATB 2EBFX 5KQGA 3ZCQA 3SHFA 1Y80A 5HOQA 5ABPA 1SQ0A 3C3EA 4XGIA 1TF7A 3RVPA 2G5GX 3F2IA 4DDMA 2I3AA 2QLNA 2WFMA 2BFPA 3HCDA 3I2KA 3TTYA 3WDKA 1RWWA 1V6CA 1VKJA 2ANCA 3FBWA 1IATA 1P18A 3L9WA 5CT6A 5CDGA 5ARCA 2GLXA 1QGOA 2AC2A 3MD0A 2CFIA 2I2XB 4Y0VA 2VJPA 3TMKA 3UJ3X 3WV5A 4BAUA 3T7EA 1I5OA 5JYEA 3D8SA 4H1VA 4PFQA 4EEZA 4C6TB 4FMCB 2WD9A 2B98A 2ZIUB 3AILA 2W11A 4W8HA 1J56A 4NE7A 3CUEF 4ZICA 2NXEA 4KSCA 2NUPA 3LCUA 3WBKA 2C03A 1CNEA 5KWIA 4Y2XA 3L1IA 4GECA 5FI5A 5BOSA 4ND1A 2RJOA 2VT7A 1GRRA 5CH8A 5FYDA 3LUPA 3WIUA 3BAFA 5L6LB 3F4KA 4TYQA 2BH2A 4RY8A 2GCNA 1YD7A 3PWZA 2MTBA 1U8YA 5T3YA 1VL0A 3TINA 3AF5A 5AICA 3RG8A 1JLHA 2RGBA 3I8OA 1QGAA 3CNNA 3DOEA 1UDBA 3G2LA 4MWOA 4MQFB 2Q07A 4YTEA 4EGFA 3A37A 3ABSB 3QY9A 2FOLA 1TLFA 2BFDA 2XYPA 2K6GA 3INYA 4FKMA 3W77A 2OFFA 5MGNA 1JVNA 3G1UA 1MW8X 2QLJA 2HBQA 2PGJA 3H1TA 1GVNB 4OQMA 3V1MA 3V1NA 4TYWA 2GCPA 1MRSA 3AEYA 4HNRA 3PEFA 4NBVA 4CCYA 4D9KA 2OYSA 4ZAWA 3KBBA 2IOFA 3MS2A 3WXMA 1VSTA 3NYRA 3SHOA 4JH0A 3VU1A 1EJ6A 1NM5C 3HZRA 2J87A 5D2CA 4EPRA 4CKZA 5B58T 1GZDA 4Y1EA 4RKWA 3FVVA 5K7SA 1YAHA 1JIJA 3NI2A 4RKEA 3K5WA 2XMQA 1X7YB 1C3OA 2YKGA 1GYPA 4Q7QA 5FUQA 1ZLXA 1BYUA 3D7RA 1M3SA 5FNVA 2ZJBA 3R5JA 1XJQA 1HT3A 3OQ1A 2V8OA 5LJIA 2C8JA 1Z33A 3D5QA 1SOMA 2AK2A 4IINA 2Q49A 2GCOB 3IOEA 4FSHA 5FV4A 3AKYA 1E63A 3LXMA 5CFLA 4NC9A 4F2GA 3TZLA 3CM0A 5KYTA 2ENUA 4JX8A 4F3RA 2CL6X 1KMQA 2FN9A 2JRCA 3M4ZA 5A71A 1M1YB 2B35A 2CLDX 2UYHA 5KNDD 4B3MB 2AE2A 1NN0A 3N2GB 1IEXA 2NTJA 2CJFA 2D0OB 3L79A 2ZJ0A 2I1WA 3QVGB 5E95A 1EMDA 1DIAA 4EA7A 4YUAA 4MI9A 2R3SA 3H2JA 1ZX1A 5SZIA 4H7FA 1Q19A 3MN1A 5LB4A 3OURA 4Z0TA 3KJNA 4BFCA 1E5XA 2V9ZA 4LXQA 1KMNA 5IG2A 2QYOA 3OTOB 2A9KA 3TZ6A 2J08A 2YV3A 2WJAA 1W9MA 2XEDA 3MT9A 3BSYA 3R40A 1FMFA 1R8JA 3ZLVA 4K03A 3WXBA 2GWRA 1X6VA 5K6TA 1ISIA 2WE8A 5ELXA 5DW0A 1VIYA 2FUG6 1MX5A 2I7TA 4KXXA 3RC1A 2NPIA 3NOQA 1Z6TA 3OU6A 2X7JA 2X6RA 4HFJA 3E8MA 2ACKA 4LPSA 3NJRA 2B21A 1BOOA 1ZH6A 3FWPA 3G59A 4TS1A 2OUIA 4MQUA 4CQNA 2RC6A 3IXQA 3Q5DA 2GRAA 3R6GA 4R3UC 4XM0A 2P9QA 1FDOA 4FMDF 1UL1X 4OYHA 4M8KA 2BUCA 3ITKA 3HJAA 3C3MA 1NI5A 3MTGA 4JELA 3OTQA 2P3LA 2P69A 4OUDB 3PKJA 3KSUA 4TVBA 3T3PB 4DRYA 2PUEA 2WV7A 5CLGA 1JPNA 4X85A 3M3HA 2JJ8A 4HL6A 5K3OA 1KJWA 3VR5D 1B16A 2R60A 4TYNA 3C1UA 2QN7A 1BKSB 1THGA 1T9GS 5ADVA 4B6RA 3GLGA 1EM8B 5DYNA 1THZA 2Q6VA 1OI4A 4DG9A 4J2OA 5CFRA 3L4BA 421PA 3MT8A 2XUKA 1M6EX 3VH2A 4UPDA 5L4LA 4LV5B 3BAZA 1I0LA 5BN4A 4D3SA 1YJCA 1PL8A 2WPDD 1G6OA 4Q3EA 1W35A 5BSMA 5TQ0B 4FUTA 1OPRA 5H16A 4BJ1A 2O8EA 2DHEA 1SCDA 5CA0B 1DEHA 3P9ZA 4LDJA 2BGIA 2R6CA 1FNBA 2BJHA 3HN2A 3DZJA 3JVIA 5EIXA 4AKHA 4DA8A 3A9SA 5D84A 3RFVA 1KY2A 2H59A 2WU4A 4KTTE 4R9VA 4RUKA 4BP9A 2P6RA 3H3XA 2O8FA 3A04A 1JHAA 2GYUA 1Q2UA 1N5DA 1CY6A 1VYHA 2YMLA 3LLCA 3TLKA 4R01A 4RVDA 5FFFA 1T0UA 4L8WB 4OU4A 4C78A 1URPA 3LGAA 1MOSA 3OEHA 3PUZA 4XSHA 1T6ZA 4C21A 2QSZA 2GPYA 4MS1A 5AI0A 1YR1A 4CTKA 3IJ5A 3SLGA 2V7XA 1ZVQA 3CUSA 3D6UA 3K5PA 4I5DA 3UNXA 3V8BA 4REQA 4F92B 1O89A 1E8MA 3DS8A 4R69A 3TLGA 4BBZA 1RYZA 3PDCA 1E3WA 5I5EA 3PFGA 1GAEO 3GEPA 5CD9A 2CXPA 4YS6A 5KQPA 3DV2A 4R5HA 1Z88A 2CMFA 1KJIA 4QDXA 5E2AA 3QIAA 4WJZA 4MUHA 3NOVA 4EKNB 1KMMA 5ALDA 5TMPA 4FW9A 4XFJA 5C81A 1UKYA 2C83A 4G81A 3TRJA 3VPBA 1WCIB 2G63A 2Q9AA 5T64A 1G2IA 2CFCA 4HVAA 4OKSA 4P2GA 3R41A 1BEZA 3K70B 1NIPA 1WJGA 1PDOA 3PDIB 5ISMA 3WWEA 1I6MA 3GUVA 4TL9A 1N0WA 4J94A 2ODWA 5GVSA 2ZJFA 4R05A 2EW1A 2QZJA 3BQMB 2MIIA 2XOXA 3AP1A 4UM9D 2C4HA 1S8OA 5DF1A 3MRXA 1ZOIA 1SKUA 1M1YE 4LJRA 4I66A 3WBJA 1WQ1R 2HF9A 2WUVA 2CNNA 4JSRA 1W6UA 4OHCA 4EVIA 2CKDA 3IEIA 4NJMA 3RC3A 5K8LA 1ZM7A 2NZ8A 5K3FB 5DNYB 2J31A 2DZDA 5E1OA 2I9KA 2AF3C 4GOXA 2UZ1A 2FN3A 2C9YA 1GPWB 1NX6A 2ZIVB 3FPEA 4CDNA 2AFHB 2RBGA 4II2A 3OZRA 4OKNA 4DGSA 4DUYB 1G4UR 5BVGA 3OE5A 4KO2S 4RD6A 2COEA 3A4YA 4AVYA 5L7WA 1R0XA 1SKMA 2HWUA 4WLVA 2OFWA 3EQ9A 5FA6A 1UBFA 1VLMA 2KE5A 4LYGA 1F60A 1C1XA 1ZJYA 5GVRA 3NTRA 2I22A 5A6VA 4PYJA 1P2UA 3GX1A 2VH1A 2CNBA 3FFAA 1C81A 1U9YA 4AJPA 2DBRA 2O6LA 3DKRA 3IAM1 5KVVA 1Y7LA 2GO7A 2EG5A 3FCCA 2H1VA 4LRYA 3E81A 4QYMA 3CWCA 1GG2A 1XGKA 4K6KA 4UAJA 3FTNA 2ZRGA 4C3OB 2VYCA 3UZUA 4DYHA 1TU3A 1XKXA 2RAFA 4OMUA 2QT1A 3VFDA 1PLKA 1ZPDA 1FQOA 1P6QA 2A86A 1A8SA 2HRRA 2OFXA 3PR1A 4C06A 5BYKA 5TR9A 4Z53A 3Q41A 1ZUNB 4L4SA 3PDWA 3QE2A 4WKBA 1LZKA 3E1KA 1OLXB 2BTOA 4UNPA 1K8RA 3RH0A 2BC9A 3IODA 4WNCA 1P4RA 1K68A 2ZJ1A 1KYTA 3DA8A 5CRIA 2HPZA 3V33A 3W6NA 1TW2A 3RYCA 4LXTA 1HORA 1R9GA 2X22A 5DM4A 5ALZA 3PJEA 4OQPA 2Z8YA 3HUEA 3T9DA 2RK6A 7ADHA 3NT2A 4BY9E 2PG3A 3ZDAA 1AJEA 1W1IA 4ZC8A 1RJGA 1J1IA 3B6EA 4DNOA 4BYGA 3HM9A 2YFHA 4QUHA 5EHQA 3M5PA 3SJ7A 1Y4SA 4IKEA 1V5FA 3C16C 3LC0A 1RM4A 2H08A 1BU5A 4MQBA 3K94A 4GQBA 4HMPA 3C8HA 4M1EA 1HQYE 1ZUHA 2QTBA 1JNXX 3QFFA 1IY1A 1C4WA 2GVNA 2NSHA 4MRPA 4TSFD 2KM1A 2HQOA 3ZDZB 3AFMA 5B1YA 3E1GA 3CCCA 5LU9A 4YJ2A 2H1IA 1SKAA 5THQA 4HH3C 1S2MA 1E3MA 3TVYA 2JLBA 4B3HA 3UGJA 1GTRA 2ZUSA 3DSRA 2VDMB 1A9PA 1N5OX 3C6QA 5HK8A 2W2TA 4B40A 2WJHA 4LSZA 4MVJE 4CM5A 3VZSA 3ZK8A 1O95D 2A0FA 3PC4A 1V1RB 5CB6A 3PB3A 5EWMA 2KMLA 1C4XA 3QELB 4UQLA 1TTHA 4LF5B 3DBOB 3W6ZA 1IHUA 2OBNA 3FTDA 2HWXA 2PQ2A 1W4LA 2VHYA 1UADA 5LQRA 4BRSA 3L4BC 1A4RA 1QGUA 4TT3A 4ZKEA 1MHTA 3DPUA 1QH8B 4O1MA 3RHTA 3FYHA 4HSGA 5BVHB 4HVLA 3N05A 1LSSA 2QNIA 1WWKA 3LZDA 7MHTA 2R48A 3ITDA 4KRFA 1E4EA 4GKJB 3L7OA 5FBWB 1AKQA 1KFEB 1YCFA 3JQCA 4KXNA 1ORIA 3EXFA 4MJ7A 3D7SA 5U4XA 2XVYA 1OA1A 2PMFA 3CZRA 3S40A 3E35A 1TLLA 1W4RA 3EDCA 4GPD1 3UJ6A 5IXSA 3K4HA 1O6FA 2IYSA 3ZEIA 2ZI9A 4ZMBA 1O9HA 3KCQA 4RQAA 3KYIB 4L5IA 4ARSA 1XUOA 1I0ZA 1IBRA 2FPIB 2RB4A 3JD4A 5IULC 1EFAA 1E59A 1L8LA 2C3MA 2SCUA 3LGSA 1QGZA 1AMOA 4KE6A 5BT9A 4DNXA 2DFVA 2W9XA 4MOWA 1UBGA 2GCEA 2OBXA 4WLFA 4BCBA 2I7XA 3M4YA 3MM4A 1T1IA 2O1XA 3S55A 1XVVA 5CVTA 2AD5A 2EFEB 4C3VA 4CKYA 4GM4A 2GK3A 1B23P 1FU4A 4D3FA 2RAVA 4WCVA 1DAIA 1R00A 4KWCA 4XASA 5JJLA 1OI3A 3KUXA 4ZV7A 3WB9A 1JEDA 4H27A 2D2FA 2HBZA 2IE0A 5B6JA 2GEJA 2FDCA 4ZAYA 3NQ41 2BT4A 4MMXB 3VA7A 4MJ3A 4I46A 1L9KA 2TSYB 3GJ0A 4G1BA 5BY2A 1JL3A 3TZEA 4QULA 1TJ4A 3Q7TA 4FOSA 2FSVA 1NV8A 3T1VA 2YRXA 2OBMA 4BUZA 4Z86A 1J4AA 1QO0D 4S35A 3FUXA 1XU7A 1IIRA 1A9TA 5CA0F 1P3DA 3P2YA 4TWJA 2BZGA 1GGEA 2C7QA 1E79A 3F67A 4OB7A 3C1OA 4URYR 3OI7A 2DQ4A 1EVYA 1TEVA 4IIFA 4B82A 4D3XA 3OD1A 2Y1CA 4LJKA 2BYTA 2P4EA 1P1JA 5L3SA 5LD2C 4RZHA 4ZI7A 3I58A 4ZCMA 2LV8A 1TECE 3DB1A 4M9CA 3T9AA 4BN5A 4JXXA 4YJGA 4YDRA 4N3CA 2X3UA 5J59A 4YMGA 3AUAA 2V45A 4DMMA 3SQOA 2CHQA 3H4VA 3IDQA 4EA9A 4W9RA 4KO3S 3EXIB 4TXHA 4E3WA 2HQRA 4HH0A 1BSVA 2QRZA 1JQDA 5FOVA 3NCTA 4NJOA 4A92A 2HW8A 1YBFA 1I51A 2G6TA 2ZETA 4FLFA 4M0EA 3TLAA 2QDXA 3IIEA 3L5KA 5IJXA 3ILVA 1FP1D 5FORA 3C85A 3HCNA 1X7ZA 2Y1GA 1GARA 4F1WA 2PK3A 4QGAA 4X64B 3GXBA 1JDZA 2H3EA 4G0ZA 2IKQA 4UPEA 5I7OA 1GKUB 3Q7RA 5HFJA 2E21A 1W0JD 4HHEA 2CMKA 5BNWA 2WHEA 3LBAA 2IYOA 2V7QA 4Q4DA 4EKGA 4NJEA 4LBWA 2XSZA 1RRFA 4KK4A 3T3EA 8ATCA 1AGYA 1YL7A 5G1OA 3ITNA 3CRZA 3A3KA 1A9YA 1E61A 2B7CA 1SBNE 2CVFA 4WASA 5L51A 2F8MA 4H7EA 1UBMS 1YOVB 1ML3A 1GTVA 3RI3A 1W4AA 4DVJA 3L9XA 1X1CA 4R2MA 1UDRA 4GZ6A 5HA5A 5IYZA 4QTYA 1CRWG 4X24A 3EPJA 1ZD1A 3FOBA 3ZJVA 3SQMA 1JAZA 3MTDA 4ZQCB 2BZ0A 1T1RA 3FZEA 2NZVG 5TT1A 2WZCA 4HGPA 1QE0A 3QLUC 1VJRA 5AVZA 4N0EA 3WSVA 4MO9A 1T5IA 4NBNA 4E32A 3JCZA 3E22A 3VJKA 2RFLA 3DYVA 4Z7OB 3DXYA 2GBCA 3LDGA 1OBHA 5IVIA 2CE2X 4Z2AA 3KZVA 2FW6A 1TJ5A 4XXHA 3OOWA 5COBA 3P0FA 3LUBA 3S1LA 3ANMA 4LBYA 1ZG3A 5AJHA 4MGIR 2GEBA 5HKKD 1OUMA 2DG2A 1P1KA 3UOGA 5DX0A 2EL7A 1L5LA 1LX7A 1TA4A 3PQDA 2UVPA 3VPSA 1F6WA 3JAKB 3LLUA 1W87A 2BGNA 3DXFA 5EPOA 4YRPA 1WS6A 3IELA 1UKZA 4GC9A 3BQNB 3ZWAA 4YAWA 1Z5WA 4P58A 5DGTA 2Q8QA 2G0TA 4JBXA 2JD2A 4WZBE 2FMXA 3VPDA 1TTPB 4UFPA 3MFYA 2CVQA 4JGGA 1NWHA 4ZYUA 1RCTE 1W2HA 4WLOA 4PZAA 2WSSD 1PG0A 5L40A 3U4QB 2X15A 4Q05A 4GOOD 1PNOA 3DBVO 4S3MA 4ZAFA 4LXXA 5C5CA 2P9EA 5KWVA 4U7PB 1NQOA 1F2VA 1PJ3A 4JJGA 4TLCA 3USES 4IUCS 1VRVA 1E9AA 2AOWA 1VHTA 3NBKA 1QUEA 4F12A 1K1EA 2FZ5A 2VPTA 1CB0A 3F98A 1Z0FA 2DTEA 2RKOA 3HCWA 4IDPA 5EUCA 3SC2B 2C2YA 3U3KA 1U28A 3I5YA 1Q0TA 1EH5A 1HE3A 2H6EA 3MLAA 1CQWA 4OCZA 5HEKA 4YUYA 3CLUC 4XUDA 1AKUA 1EB8A 2G9ZA 1T5HX 2NLOA 4H7DA 2JBAB 4CF4A 2YVQA 3ZGOA 1XVIA 2JIMA 2F3QA 3SOZA 4CV3A 5AVRA 2QT0A 3NYWA 3P9XA 4BFWA 3GZJA 1Y7TA 4RVCA 3WGVA 4NEGA 1BEUB 5H02A 4ZK6A 3K09A 4BLTA 4C14A 1EQUA 3VSCA 4AKSA 2C9ZA 3JVDA 3UHOA 1NQWA 2ZRDA 1KJNA 3IFSA 3DE3X 1X1SA 4TZTA 3PI7A 4KZKA 1UCFA 1V3VA 3ND6A 2GHQA 5H59A 1D4AA 1PBNA 1KK3A 1DAOA 4DJEC 1X3SA 4MUMA 4Q1EA 1SXJA 3ZR4B 1DQRA 4G97A 4L4RA 1YVRA 2BHNA 1ADFA 3H3JA 1V95A 3U9SA 1JXQA 2PSSA 2QWXA 3EVEA 3W3AH 1E0SA 2YY5A 1TKAA 2G7MC 3E2MA 1H0RA 1ESEA 4Y2PA 4QOEA 2J1LA 3IB6A 2O14A 3UEOA 2NP7A 3S99A 3PXEA 2J3QA 1OXXK 1K7FB 3QEJA 1JBEA 1SKYB 3E7FA 4KGVA 3P20A 1M34E 2FSVC 121PA 3RJTA 4BZPA 5A9SB 2H2DA 4YAUA 4PC2A 3PFKA 3K16A 4MUIA 4EF6A 3KKNA 5KDLA 4IV8A 1W5EA 2A5LA 4MMZB 1N0IA 4RHFA 1QZUA 5T4EA 3OZSA 3PFIA 1NTRA 1YHZA 1MV8A 3OIGA 4LZZA 3V7NA 3GK3A 4ENRA 1EVZA 5K0JA 1N9KA 3BYZA 3M6IA 3NHPA 4C6RA 4PC3A 4KWHA 2WAMA 5E4YA 2FAXA 2YWEA 4HQOA 2HCFA 4UBNA 3ICEA 3UGTA 4J2HA 3WLKX 2X0EA 1R2QA 3R5SA 2HRQA 3BE5A 3I37X 2X1LA 4X3PA 1XTBA 4G0PA 5JNVA 2UYCA 3ND8A 3U60B 2PWPA 4RK0A 2WG2A 3I5XA 1M1NB 1M5RA 2OLKA 2V0NA 3EJ6A 3HACA 3CH6A 3FTCA 1NOJA 4F06A 4RTSA 3OMWA 5G4KB 3RU2A 1NR1A 2O2GA 2ZRHA 3A6JA 4YT5A 5EERA 2EKPA 1NZDA 4V1CI 1N33B 2H5JA 3B85A 1P19A 3GPBA 5J4YA 1P9OA 3GAZA 1V2GA 4GRIA 3NX4A 3JYNA 4NH4A 3E58A 1N2ZA 4JQOA 1NXSA 3JQGA 5A4DA 1VG1A 5KZMB 3TQIA 3U48A 4R2IA 3ITEA 5EJMA 4L8FA 4I1UA 1M67A 4UXJA 3E6AA 4DCGA 2NTNA 2IZ1A 4WFIA 1R8SA 3LCCA 3MRSA 5B58C 1I6KA 1VIAA 3MMPA 1KGDA 3W5HA 1T4BA 1TE2A 3P9KA 3VO2A 2B5OA 1TVMA 1HE1C 4BASA 1NT4A 2FF7A 3KC2A 5I5GA 3MYYA 2WF7A 4FNAA 1S2NA 4KQ1A 4E5MA 1L7EA 2O1EA 3U3ZA 3H2ZA 2X40A 1Q7BA 5EPUA 5FUVA 1J0DA 2W48A 3BMXA 3BXZA 1A8PA 4PTLA 3W9SA 5LDHA 3GZNA 4MYDA 2FFAA 3FYSA 5GJVC 4CT5A 1BHSA 3WNDA 1WA5A 1LLDA 4ZHSA 4Q48A 5KTOA 2JAOA 4B4OA 2BELA 2QSJA 4YA6A 4BMZA 1PQUA 3JQ7B 5MN6A 4E03A 1P1CA 1Z7YA 1E2UA 1I4LD 5ALUA 3N5KA 3UKJA 3ADOA 4O63O 4PYMA 5BSUA 1CUHA 1NONA 1W2WB 4AMUA 4DOMA 4E7PA 3VU9A 5JO0A 1ZNWA 2PRSA 1SD2A 1KYWA 5M2QA 2F43A 4PXSA 3VOBA 2D13A 3D0KA 2FI1A 3THYA 1GTL1 1SHZA 5JYCA 3BFJA 2G4VA 3N2LA 4K6HA 4RK6A 1TAHA 3VO1A 1SO8A 4QGSA 5IW8A 4V1CA 3L05A 1N7IA 2W58A 3VZDA 3LTEA 1E1RA 4ZODA 2V74B 1ECFA 4D4IA 2XDAA 3VH4A 4RGVA 2IHNA 4RTQA 4Z4IA 5A0VA 1MH9A 4EQ6A 2AJDA 3O3OB 2IBSA 1P4JA 5EIOA 5IJWA 2ZWIA 3QVLA 1JEQB 4EHIA 3M89A 3TM4A 4NCAA 1YQXA 3QEMA 4BWFB 3L46A 3LGXA 4H1HA 2YY7A 4AB1A 4B9EA 2FDRA 3RKRA 4HFMA 5BW4A 3ZHOA 2DQKA 4MX8A 2G0NA 1QM5A 3M5DA 2GKSA 2PU5A 3HKBB 4HLQB 4IIJA 2WP8J 3E5HA 1ZW1A 1S3FA 4OF4A 3ZWPA 2Q5LA 5AVQA 5MFPA 2DWUA 3JQDA 5E6SA 1PG5A 1YZGA 3WSWA 4BFXA 2Q4TA 2JJ2D 1NY5A 5EP3A 4A8JA 1E3SA 1II9A 2GF0A 3QPDA 4OUKX 3SE7A 2C0CA 1XR3A 2ZJZA 5CPBA 1E2HA 2B36A 2WSIA 3KT8A 5KJFA 2VFAA 3U4GA 1AS2A 1V1MA 3K71B 3VUFA 4KH1A 1BXGB 4YR9A 3U3DA 2P9TA 1WPQA 4IVQA 2A2ZA 4J6FA 3IQGX 2OM6A 2UYOA 3G5MA 5G41A 5SYNA 1JMVA 4CFSA 3MIZA 2ORYA 1T1SA 1M73E 2C2WA 5EE0A 2ZAIA 2JIDA 1U8UA 3BRWD 3LCRA 4UHFA 5J1TB 4AMBA 4RD4A 3NO4A 4EQZA 4FDVA 3ENWA 3E9RA 5ECDA 3O8RA 3OECA 4WXYB 3ZXSA 4IDHA 1GLGA 2R00A 3K09C 4WCFC 3ZTWA 4HQ6A 3TMAA 1WMBA 1QFJA 2QUHA 4PYNA 3BWDD 4KVFA 4G2NA 1A4UA 3K4QA 1RQPA 5BMVB 1USVA 2AUNA 3QZUA 1SRQA 2FSUA 3K1YA 5BSFA 2RH4A 2VP2A 3IO5A 2Q6IA 3O3MB 4PFKA 4B3BA 1YA6A 1A5ZA 1SC3A 5J63A 1IBMB 2VYVA 1GPUA 3F47A 3B7WA 2WD8A 3QW2A 5BWNA 3M33A 1PFVA 2Q5IA 3K0CA 3GGPA 2HMYB 4KDFA 4UBKA 1WDMA 4MUNA 4ZOBA 3HXLA 3KPWA 1ONBA 2DECA 3NZEA 4M1KA 4HS4A 4X9XA 3AERB 5JSKA 4WNAB 4DJTA 4DMGA 3MJVA 3TG8A 1HR0B 4W5NA 2GBPA 3ETJA 2CXUA 3GLHB 3S27A 3F4BA 4CEJA 1U8ZA 1JUDA 3W90A 3IV9A 4NF2A 1E64A 3EVGA 4HQRA 4QRDA 2ZGVA 5BNFA 4LSWA 3R9XA 1N9GA 1RP1A 4DADA 3VNVA 3SS8A 3V7UA 1LD3A 4A0HA 4RGBA 2CXTA 2R6JA 2UVQA 5LKAA 1DJPA 3ZCUA 4MGEA 4ZOEA 4DABA 1RJ9B 2J0SA 2J6BA 4QAJA 1K88A 3TSWA 3S0JA 4F84A 2AQ8A 2A14A 3F9RA 2VZ8A 2Q46A 3PS9A 1Q17A 1KDZA 2FJ0A 2H2IA 4HEJA 1LRJA 3EVBA 3UK2A 3EULA 4WK6A 2ROQA 5EVCA 2XCUA 4TYPA 4HRAA 3LVBA 1QCZA 4QGBA 1YRQA 2RAUA 4TQAA 1FSZA 4K9KA 1TPZA 2GJ8A 4G01B 5DH9A 2XGJA 3GJZA 4DLXA 5KSPA 2JLVA 3E4DA 4OHZA 3UOWA 1DRWA 1KOFA 1E89A 2K7ZA 4ERXA 1IJEA 4ZI7F 2YJNA 2XE8A 1QH0A 3Q2IA 3U16A 3DR5A 3ZV7A 4ZTUB 4L3WA 4PPGA 4QAQA 2ZJ4A 3DW1X 3NHBA 2H7CA 2FP4B 1KAQA 4IIVA 2PH7A 3FPCA 3IP5A 1SIUA 4KYUA 4OI2A 4X1OA 1Z63A 3NTLA 1WD7A 2QK4A 3OKPA 1CUIA 2VJNA 3RSOA 1L5HB 3I1JA 3WIOA 2C5LA 2AFRA 1HQDA 1XMIA 5JNTA 1VCNA 3FYTA 3LZ6A 2ECOA 2XXJA 3OZIA 2NUAB 1O94D 2JA1A 3KAJA 5DNUA 1JIQA 1PR6A 5LZ2A 1PR2A 2YFYA 4I99A 1DIBA 3SK0A 3OIVA 1T10A 4CL0A 4E1AA 4ER3A 2Z5FA 4ZCIA 1O58A 2XWSA 4EG1A 1U6KA 1FLVA 3PIDA 4NMXB 5TEWA 1QU3A 3GRKA 1I14A 4U5XA 5FQNA 1DBVO 4DCPA 4FFVA 3VISA 1AVTA 1YQ9A 4PXAA 2V7BA 4YJFB 1BE6A 2LNDA 4UHDA 1VI2A 2OGUA 2QL5A 3A31A 3AR5A 2JEZA 4LGMA 3HU5A 2EP7A 3ANYB 4EM6A 4F3KA 2X41A 5U9CA 1KDOA 1PNTA 4X71A 4ECEA 3O93A 1W0CA 2W43A 4I9UA 2H0AA 3PEEA 4LQ4A 4UVEA 4G0UA 2A9FA 3U3JA 3TRDA 3ANTA 4GDFA 1R5BA 4QDZA 1P3Y1 2VHTA 1RWQA 2VAMA 3BB3A 5JS2A 4NNOA 4DLKA 1RHKA 4DAEA 5KPDA 1I7DA 3SD7A 1MD9A 2HU8A 2VUIB 2XT0A 1Y3HA 3IULA 1Z08A 3W4IA 5CITA 5CX1B 2IVZA 3AI2A 2QROA 3K3PA 2QVZX 2CXXA 4DC0A 3EN0A 1UM8A 3RUPA 1NXVA 1P7VA 3GN2A 4IL5A 4Q9JA 3INTA 1T0JB 1Z5OA 1X1BA 1SPBS 2ISCA 2XB9A 3E3MA 3LC2O 3K8OE 3PFBA 4IOMA 3T35A 1G6HA 2XX3A 3EY4A 1EVQA 3L06A 1QQTA 4OP2A 5CLJA 3HDJA 1JQLB 4ZZ1A 1ZD5A 4NZOA 5D3ZA 4DWWA 2ATXA 2ZCUA 2BEUB 3KOYA 3WISA 3RGGA 3ZY6A 2PUCA 2ZRIA 3H4MA 1Z83A 3AEQB 3I3SR 1H4QA 3K1AA 4FYPA 3TR5A 1RZUA 2VJMA 2NU8B 4CQMA 4ND7A 4MUYA 4ZEOA 2WT8A 4UNNA 5AW0A 2I2AA 3ZY4A 2DCMA 5BPHA 5AVKA 4W9NC 4KPEC 3SLRA 1FQWA 3GLHE 1WLSA 5H1YA 1E2FA 3VSDA 5KWSA 4I4TF 3C6KA 1ZC4A 1CNFA 4RDXA 2P11A 1WXFA 3OVMA 4NNJA 3QKWA 5DOZA 5GM1A 1VCMA 2CD9A 4C22A 2AEFA 2BSXA 3H9UA 4V3BA 2AK3A 1DXYA 5CNJA 3V32A 4KSBA 4RGQA 5JJBA 3HVKA 2P75A 1Y6GA 1BCSB 4N49A 4F45A 2V7UA 1AB6A 3KXPA 4KIGA 2E87A 4J4TA 1KZYC 5A4MS 2R1VB 3RYIA 5FPKA 5FTWA 3SZOA 4XVRA 3IPAA 1Z2EA 1TX4B 1VJ5A 2IT1A 2R00C 1T6YA 2YJZA 1DLJA 2N1BA 3BKXA 4Y9DA 3ZE1B 1TCUA 3HADA 3RUFA 2MSWA 5B12A 2P27A 4DM7A 5LU8A 4H16A 3ADDA 1U0NA 2IPNA 5EE9A 4EARA 5AFSA 1KI6B 3GI1A 4D42A 1L1FA 4ML3A 3VR0A 3QX8A 4BOYA 2X5KO 2WICA 4N54A 4YUXA 1RE1A 4LDQA 1WCV1 3COVA 3UAVA 2FWMX 1GOTA 1YHNA 3KE8A 1WZCA 1NBOA 1KI2A 3K0CC 2HF2A 3K6JA 3RFTA 4V0RA 5JR3A 4FGZA 1JXAA 3KSRA 4M1WA 3G7UA 4YK7A 3UT0A 1E0DA 4YMLA 1F14A 3KXIA 3DTNA 3L01A 4N9WA 3O5AA 4RFLA 1VMEA 4RO0A 3FMVA 2BGGA 3GRUA 1ZH8A 3F7MA 4EGCB 1FPQA 2D1YA 2PZGA 3KLMX 1QFSA 4GE0A 4LMPA 2PU7A 1AX9A 2J9YB 5KCMA 4AJHA 3IP8A 5JCXA 1MQ9A 1TM4E 4FCCA 4Q4JA 3ZW8A 4FR0A 2IZOA 4QODA 3VDMA 3C3XA 4F4IA 1WU8A 4R1QA 2G82A 3CNBA 1Z7GA 4PG6A 3SHTA 3D6AA 3AFGA 4JYBA 4C0SA 3T5CA 4BC1A 2PUAA 3P8ZA 3MT7A 3E7DA 2XT9A 2QX4A 3KFVA 3L1UA 1AKEA 3AETB 4RZ3A 4LRTB 4B4DA 3ED1A 3H5WA 2E4UA 2HD4A 4R1NA 5EJ7A 1S8NA 5ERXA 1E3QA 1O6ZA 2VXBA 2PGXA 4I36A 2R96A 1RJFA 1QK5A 2G5CA 1FS6A 1E2GA 3EA0A 2PX2A 4KAFA 4LZLA 4Y98A 5BMVF 2IW3A 2BY4A 3IKLA 1VFNA 3W2IA 3I9V6 2DFDA 4ZEMA 2DJIA 4JB2A 3PPWA 1MTZA 3CJQA 3OP1A 5EKDA 4CG1A 5KDOA 1VPDA 3DHVA 3JATA 3KJFA 4XW2A 1FYDA 1TOAA 2WYWA 2JGIA 4JJKA 3B3FA 4L73A 1O4VA 1BMTA 1PUXA 1Q83A 3AFNA 4J0JA 2QZZA 4F6RB 1S7GA 2OKCA 1MNQA 1W581 1XB2A 2YHSA 5JJIA 3A6GA 1XCJA 4IRXA 3QFTA 5DT9A 4QXPA 4LC1A 4UUBA 4RH0A 1SD1A 2Q2OA 3TS1A 3OEYA 1E79D 1NW8A 4KUHA 2R8ZA 3GEIA 3IEPA 5EJIA 4Y2SA 4BFSA 1BH6A 1VC2A 2WAXA 1IVYA 1UZUA 3FZYA 1N7GA 1PU2A 4PU0A 4WJLA 2NO0A 4J7XA 4PLHA 1LVGA 1LI7A 2JATA 3UFXB 3AOGA 3KYBA 4YJ3B 4C6TA 2DEUA 2PIAA 2H1WA 3ER6A 4PQRA 1XZCA 1CUCA 2YW2A 3K5HA 1S6YA 1Q44A 1EVEA 4BTEA 2GM9A 3K6RA 4COKA 1N36B 1Q0QA 1RR6A 3A3NA 3HZHA 5ALKA 3ZIAD 3H0EA 3RKSA 5J47A 4UVHA 2J48A 3KKZA 1U8XX 3FRJA 1C14A 2L0XA 3A6HA 3N0VA 3TX6A 2O8DB 1I94B 3WO0A 3LT4A 2R6ZA 1EFCA 2ZUBA 2D00A 4R98A 1G16A 3A4IA 4XIGS 3V8RA 2VDOB 1QKIA 3HH8A 1FDUA 3WGOA 3LHFA 4CMJA 1K06A 2ID7A 2XRMA 4MQFA 3V4ZA 5KBYA 2CHVA 1V5EA 3AHJA 1UPCA 2FDXA 1WPGA 3K8ZA 5IVPA 1XWFA 2QSYA 5EZ5A 1HUQA 5K3EA 4RA6B 5KNLA 1L5WA 2JLCA 3P7MA 3LY5A 5CPFA 2FEXA 4JLOA 2CUKA 3MS7A 1BXKA 4DEYA 3H83A 4ECAA 4EYQA 2V7QD 5KYWB 2OOSA 4FFSA 3T1TA 1M8KA 3E1SA 1PZGA 4KN8A 4LYJA 3RVOA 2WKWA 1BE1A 4DYVA 4AS1A 2XZLA 3AFIA 4JY7A 4Z5XA 1NMXA 3SYNA 1IQPA 1QLJA 4MRVA 4PS1A 3W79A 5A5GA 1X1QA 4BNDB 2O2YA 3WLOA 1RYDA 1IM5A 4FD3A 5EJEA 1JX6A 2VK8A 4AG3A 3DVAB 1X7YA 2MWMA 2XCOA 2VPWA 3I1FA 3IUPA 2DSNA 3JQFC 3SEFA 1TDJA 3PUIA 5H70A 4I6GA 1H3FA 3WNBA 2RGAA 2MR5A 4FLMA 2P3QA 5JYBA 2D2VA 3OFSA 4GWLA 1ZITA 3EF3A 1X7GA 4R7ZA 2HHLA 2IF2A 3JAWB 4FN5A 4BQOA 4BLPA 3C5CA 5BR4A 2GCOA 4B32A 2BM8A 4LF7B 1EGMB 2WE7A 4QOFA 4W5RA 4URVR 2KLHA 2NW6A 3B6JA 3UAXA 4BVFA 4KQWA 3RVQA 2HRDA 3DTVB 1XPOA 2F59A 3FTEA 1EK2A 1Z4PX 2C1ZA 2P4SA 4NXMB 1M1YA 4E88A 3M82A 1JB1A 2LZ0A 1IY9A 2QJWA 4QKQA 5LMZA 3N2GA 3L77A 3V6LA 2Y0PA 4XEUA 5BNTA 2QL9A 1ANKA 3QVGA 4AJKA 4RF3A 4WXHA 1QPZA 3B51X 1OF1A 1DKOA 3TO5A 4UAVA 4YAIA 5BR8B 1VZ2A 1UEJA 3BUSA 4LMBA 3UMYA 2HYIC 2GBIA 2Z2YA 1U2TA 4XD7A 2B1GA 3RGWS 3HCRA 1CYDA 3HR8A 4FP9A 5F2NA 4KKVA 1XMOB 4RV9A 3EPHA 3SF0A 3R7WB 3KQHA 1MQAA 4I50B 2AUTA 3WTCA 5C32A 5EAIA 1YXMA 2EF0A 1A0OA 1OX5A 4ZQHA 2FQYA 2QAGB 2W4IA 1CY7A 2W22A 4NCIA 5KX5B 2LD4A 3HKDB 3H1BA 1PR5A 2ZBRA 2O8NA 4MKFA 3AB3A 4AI6A 2BZSA 2OZPA 1V6AA 2FH5B 3KO8A 1DJLA 1PV2A 3MGCA 3V3TA 3KJZA 1W4CA 4EVRA 2G36A 4NDAA 5DHPA 3W05A 3FYUB 4MUKA 1E4YA 1HT1E 4RDHA 3ZDQA 1O0BA 4M8LA 2RAPA 4OUDA 4XIIA 1ZAKA 5H3HA 1YOBA 5M3BA 3RTGA 5CEFA 3STWA 3L8EA 2C9OA 1XLUA 3EZGA 4Z9YA 2RGRA 1QOPB 3G1WA 4JR0A 3B9QA 1N2CB 4KQ2A 3A36A 4LBVA 5LC1A 4D79A 4RD1A 4JI5B 3JZAA 4BNYA 2W90A 3CRMA 1EM8A 3B8EA 2POCA 2O3QA 2CF6A 3GRYA 5ADUS 1NE2A 1PFUA 3RBVA 4ZO7A 1E6MA 1U11A 2EKZA 1VSBA 4R8RA 1IMOA 1SXJD 3KTAB 4G0OA 2WVJA 5B57C 2BMEA 1G9TA 3GT3A 1MXFA 2MMGA 2QYTA 5TQ0A 4Q24A 3GEBA 2AG0A 3V97A 3JAMA 1SC1A 4LZAA 2G04A 4N48A 1MJNA 3C97A 3MWGA 2F55A 5CA0A 1LB1B 4K5QA 5I9NA 1V4BA 3TI9A 3ED5A 2ZWPA 4X0EA 4ETNA 1S2LA 3ZOKA 3WFIA 2CZCA 2B8JA 3ZGVA 5CFZA 2ZJ6A 3DOFA 3N53A 5IJZA 2WSYB 3NBZC 2XKAA 4M21A 5C0OE 4DZZA 2F9LA 2O50A 3SHVA 2GYYA 5TVGA 1V25A 1G98A 1U4NA 3LWZA 4JQCA 3PHIA 1G2PA 4G5RA 4IFTA 2PT6A 3L7KA 3OP4A 4FJ2A 5IKXA 3DE5X 4GYYA 4MVJA 5A3SA 4E2ZA 1IRXA 5AKIA 1T3ZA 3JYLA 1OMOA 4LRUA 5KSOA 2CUZA 3WVNA 3DV9A 3NBMA 1T9GR 2VPXA 3KAQA 3IE0A 3BSFA 3D2CA 3WMWA 5JY1A 4QOIA 1E9DA 4OMCA 1ZICA 1K7EB 1J0XO 1YZYA 1ZSNA 2CV2A 4BV8A 5IC4A 1JLKA 2F1HA 1G66A 2Y1WA 1GGMA 2Q4DA 3GW8A 3VPGA 3ZEAA 1E92A 3DZKA 2FK7A 1WCIA 5FWDA 1DQYA 3V55A 3IP1A 3BCHA 2X76A 4R9UC 3NRBA 3PUJA 3GDWA 1FXWF 2BUBA 5J2TB 2VR1A 5ALGA 2B20A 2GN9A 3PDIA 5JZ9A 1Q3KA 3OX4A 4KLRA 1DC3A 3UJHA 4NS1A 3IR6A 1YZNA 1RXVA 1C8BA 1DG9A 2O20A 3C24A 1D6NA 3MK31 3NHMA 4MPJA 4OHOA 3QPAA 3FAKA 3L0BA 3IUNA 1N2BA 5E38A 1QVVA 2XB4A 2XGSA 4JL5A 3A6KA 2G5TA 2PKYX 3SP1A 1J6UA 1JLLB 3GVXA 1R6BX 1NPYA 4PW0A 2XUIA 1GEGA 4GMDA 5EVJA 1TFUA 3NLLA 3QFSA 5K3FA 4ED9A 4A6PA 5FAKA 2OQRA 2M1ZA 3R4CA 3A6ZA 2QTFA 2W83A 2AFHA 2YDXA 4MPTA 3S5UA 1H05A 3JQ9A 3WBFA 3CR8A 1K7CA 3V2IA 4IPTA 4KQIA 4F8EA 1DLIA 2GK7A 2RDMA 5ALLA 3ZYCA 3TJRA 3CMCO 3FNEA 1ECPA 4J3JA 2H4WA 4DZTA 3DUWA 2ZRMA 2ZTMA 3OBBA 5EEGA 4F85A 3ROTA 4YPOA 1C3XA 2IXAA 2XH8A 2ISSD 2QU7A 2HSDA 5IXYA 1IAQA 2F2TA 3HRKA 4GPTA 5LDGA 1CXZA 3FAZA 4M3NA 3T4PA 1OGYA 2X8AA 2VP6A 2QN6A 1E1RD 3ETGA 3IP3A 3REOA 3KU1A 1FXUA 1THTA 3OX2A 4OBXA 4OXQA 1B6GA 1ZUNA 4OXIA 3WL5A 2OQ2A 2NVUB 1OLXA 3AJEA 4G4SP 1I3OA 1ZIDA 3EWAA 4RSHA 5T8KA 3H04A 4OXKA 1MV5A 2HMSA 3TXYA 4NPAA 3VUEA 3GFVA 4E11A 4E2WA 2W4QA 3U4HA 2PGIA 4JLWA 2G9QA 5J4VA 1GKLA 4EFMA 2IVFA 1G63A 4C7XA 3BA6A 3GO4A 3PPVA 2AB0A 1NQ5A 4U6NA 3CE6A 4PIVA 3ELDA 1PFGA 2C4UA 4J16A 4MYUA 3RUAA 4MLZA 3RUEA 4NOJA 4DLRA 4RPIA 4PSAA 1DEKA 3STYA 1SZCA 4J7CA 3ONNA 2IWRA 1J8FA 4UNQA 3IRVA 1DDOA 3K6KA 3ZQKA 4EHLA 2O0MA 5HOEA 4X6UA 1G8MA 2EFYA 4YQZA 1E3EA 1E6CA 3NASA 4HZIA 5FI0B 4BO7A 3W3ZB 1H22A 1T3GA 5B4UA 4LMRA 2FUNB 4KQJA 1LV8A 4KMOA 3VVBA 2LUOA 2PAFA 1E18A 4R8MA 1Q50A 2C2ZA 3IKVA 2UUCB 5AW1A 1D1TA 3VPAA 1TYCA 1G55A 1JSZA 3LQ1A 3Q8XB 2OYCA 4CV1A 1V1RA 3ESXA 5KU1A 2JGEA 3QELA 4AF7A 3H5RA 3DDSA 3ORHA 1T0IA 1R88A 3K0FB 3Q8WA 5B1DA 4ZJPA 2A1TS 4Q21A 5KIAA 2BMAA 3IH5A 5HX7A 2E6KA 3O4GA 4NYIQ 7MDHA 4UE3S 2O3UA 4BPRA 1G5HA 1H23A 1ZRMA 1QH8A 2VYVD 2EFDB 4M7OA 2WILA 4E21A 5BVHA 3ACCA 5TJHA 2MSKA 2YTZA 4DJDC 1NP7A 4IZ6A 1G59A 3IO3A 5EIBC 3THXB 1KH2A 2IZ6A 2P5SA 1H93A 1R3UA 3G2KA 4RFSB 5F1PA 5LMNB 1VG8A 3RJZA 5BPFA 3NKLA 4I50F 2J33A 3R3UA 4NZPA 2W2MA 2ISQA 2ZTLA 1SRRA 5FWXB 4GPAA 4I08A 3GNLA 2FPIA 1SVOA 5JAHA 1W30A 1X2EA 2HIAA 4D9FA 5KX5F 1D3AA 1RVV1 2WVHA 3EZ2A 2OV4A 5AJXA 3UC5A 3IESA 5BW5A 1SVNA 3TGWA 4OYRA 3UMSA 4PLWA 1MOZA 3MA0A 4LJ7A 3DEYX 2DQYA 5AI8A 4NYMR 3ZCTA 2C3OA 2C29D 5BQPA 2J9FB 2BLLA 1RSZA 2WJ6A 3TRIA 4FOTA 1R4NB 4PX9A 1R9NA 1MHPA 4PPFA 1BGWA 1PQ4A 2DFTA 4XB2A 3U81A 4MK4A 2QP3A 3NEJA 2HJSA 4ZYZA 5IK2A 5C5DA 1I4TD 4X5OA 2YXEA 5EQDA 4HDKB 2EP8A 1Y4UA 5DI3B 4GBJA 2EKDA 4RS4A 2ZREA 5KCZA 4EDFA 3C43A 1NMSA 4HGNA 2AEEA 1AQJA 3IBCA 1TADA 1KRHA 4C2AA 1ZU4A 1BX1A 4B6PA 1CUJA 3AJ8A 2WKPA 2XT6A 4BKUA 3HXPA 3TB4A 3U4CA 4QBKA 4XZ3A 3ROGA 4S0ZA 4PPYA 4GEGA 3VVLA 3K70C 3ODGA 2ZUFA 2EJUA 5A1JA 1N4AA 3SJAA 1R10A 4J0FA 3UJCA 4A1FA 6ABPA 1ETHA 1P45A 3EDQA 4NULA 4WX2B 1FUUA 2H0QA 3IA2A 3U3MA 1I9CA 2P3OA 3AU9A 2I91A 1XL1A 2YHIB 2ZYSA 4H2DA 5JQGB 2J4DA 4OQLA 3I5UA 1QG0A 3I39X 1BU8A 4FMBB 4U7FA 4AN0A 3NEPX 4EMBA 5GMOA 1VSUA 4AWAA 1YRAA 4QHSA 1FP2A 3V42A 4ENSA 5JSHA 3PXUA 1E4OA 5DGXA 3JQ9C 2GTIA 2CHEA 3TVDA 3KTFA 4R8VA 4EI8A 1TAUA 2I4MA 1NUPA 2FF5A 2PNFA 3ROZA 3EXIA 4MMYB 3ZWMA 1F9EA 2UYQA 3G0IA 2HYDA 2ZBFA 4BZWA 4Z4EA 1PL6A 1NI4B 2XYRA 4JUCA 1U6JA 3HP1A 3AKEA 1I5EA 2VOJA 2ZBUA 3GT0A 4MINA 1PRYA 5FA8A 4AO8A 3DXXA 3CA8A 4Q39A 2IPLA 4PLTA 5AJWA 3DP7A 4L0DA 3N8KA 4Q01A 5ALJA 4HXEB 3GBSA 4JJZA 1QTIA 2I1QA 4WCDA 4HAXA 3TRHA 4GRDA 4BNGA 3PXCX 3ZWNA 1Z5PA 4B3CA 2FPXA 4C7BA 2BGMA 1QV7A 1LPPA 2IX9A 4N5LA 3SR3A 1JF8A 3CV3A 1X8JA 4Q9AA 4WK2B 1YOVA 2A6PA 1KHTA 2PH5A 3KIPA 3P2OA 3PT9A 4LDZA 5DNCA 1KFKB 3ZI7A 2JAUA 3GRAA 4ZMRA 1Q1GA 3T7IA 2O7RA 1CQXA 1T9DA 5F52A 4YGXB 3DKVA 2GBLA 3AQ4A 3EGWA 2G06A 2EWWA 2FRXA 3KXKA 3OIDA 4GI7A 4GMFA 2WU3A 5DYIA 4B48A 2GYVA 4WZAB 2PV7A 4DIUA 5A3QA 3PTZA 3NNSA 3NOOA 4CQMD 3KJXA 4J16C 3TTSA 2I6XA 4YCDA 3LK7A 5FUBA 4R41A 1WMAA 3AXTA 4JJIA 1JHUA 1OOEA 1W59A 1FFDA 3GVCA 3OG9A 2PT9A 3SQLA 3L41A 3R7NA 1LA2A 1MR3F 4YMWA 3T94A 4MKXA 1SQGA 2XF2A 3IQHX 5KOHB 1EIZA 4N0DA 1RWKA 4ENVA 2BW0A 4TTPA 3TPFA 1W47A 1M5TA 4N8SA 3W1VA 1ZKDA 3FPGA 1G2QA 4JEHA 5AM5A 3I4FA 3PI6A 2RH8A 3KKEA 2GZRA 3JAKA 5JNUA 1THMA 3TUJC 3UHPA 5DM70 1SVSA 2GEUA 1JP7A 3NR2A 3EC7A 3QW4B 2R7LA 4IS3A 3GLFB 1Q15A 3LUDA 3G9UA 3B8HA 3PJDA 3EXEB 5EHNA 1LPNA 4MRAA 3KJIA 4P33A 4LF6B 3SE0A 2XQJA 1SQSA 1IOZA 1C3EA 2ZJAA 5FP0A 4HO1X 2GARA 1JFVA 3DMTA 3U4QA 1GJRA 1CKEA 2ZPUA 1MO2A 1SCIA 3MUOA 3BL8A 4YRJA 2JHPA 2IHTA 2XD9A 3UWDA 5AVVA 4UOQA 4TS3A 4LNAA 3K96A 1YZHA 2CL7X 4UCXA 2QRUA 3CLSC 3SC2A 1GUAA 4FYHA 1B26A 2E55A 5CJ2A 3TGPA 3HYRA 1J7JA 3TGLA 4A2QA 1T8WA 4RD0A 1IN6A 2ZUWA 1BYIA 2A78A 3PVCA 3V6MA 4KXFB 1DKNA 2JBAA 1F2DA 1DBRA 4OD0A 3MJDA 4PG4A 4B34A 3GELA 3HV0A 5ANRB 1KMHB 4E4RA 4MCAA 4RZUA 1B41A 4RNDB 1TPYA 4K3UA 3IA7A 5T4FA 1GCIA 5JROA 4N18A 3TE6A 3AJRA 1NC3A 4U0JA 3TLBA 3QF7A 3Q9SA 1RXSA 4NZNA 4AZ0B 3S28A 3LNTA 4DKXA 3N07A 4UAUA 5AJYA 2MJLA 3U7RA 2WFZA 2C04A 2G17A 3A1EA 1WMDA 3FPFA 4WESB 2GESA 4AWXA 2JW5A 5BN3B 3D7LA 4IZIA 4FILA 3GJXC 1Z4JA 3R9KA 1R16A 1KPGA 2OAQ1 2O1WA 2P40A 1CJUC 2AHRA 3SOPA 3TLXA 3BWEA 2G88A 4LE1A 3K6SB 2CLEB 3O0TA 3K1JA 1RS0A 1OGIA 4OFXA 3C1TA 4P5PA 1Q0PA 2GERA 2UAGA 2ZIAA 2Z58A 4FQ7A 3TG2A 1NJSA 1EWQA 1XU9A 3KWMA 2V3WA 4UDXX 4RK7A 4KQ6A 1OWLA 3CW2A 1W49A 3V8NA 3PEVA 5A9SA 2GXAA 1T5SA 1XTUA 2A0XA 4OLFA 1ILEA 2C7OA 4YGYA 2QTAA 3O0DA 2ATIA 3WK6A 2R7NA 3COYA 3ZNQA 1FC0A 1L4GA 3NNNA 1DBSA 2VF8A 4KC0A 2NU9B 3AEXA 4KBYA 1XD2B 3FLEA 3DC2A 3UT5B 1IN7A 2I4LA 2FG5A 1N2SA 2YRWA 4MQ4A 1NW6A 1S2GA 3SGLA 3CX8A 1JIVA 3DWIA 1NUTA 4H17A 4Q9IA 3T41A 4BMCA 3ZLJA 3HNOA 3RR2A 1NXOA 3STUA 5AW6A 3U5TA 4JDUA 4BE4A 5TT0A 1QPBA 3BA1A 1AUOA 4R1SA 4RKRA 1M1NA 1U65A 3U2QA 4E5UA 4C4ZA 5JJCA 4RDCA 4WZAE 3F6EX 1BZYA 1DOAA 5G4KA 5E3HA 2Z09A 1XTIA 1SH7A 4J0HA 3ZD9A 3F97A 4NCXA 1HZZA 2I8LA 3TIVA 4F11A 1EZ1A 5GQSA 3CW8X 4HGQA 2YMMA 3WB2A 4HJXA 2ZJ3A 4XM2A 3BPSA 3LBFA 1OAKA 2GN1A 5E9QA 4MLCA 3TI7A 5I7EA 4L0QA 2ZSBA 4J1TA 3PPYA 1OH6A 3A25A 2J3MA 1YHYA 3PCRB 4CM8B 4XE5A 1O3YA 3R75A 3DMFA 3I6YA 2WNHA 1IPFA 1UPFA 4BQIA 4ZKDA 1XK7A 3DXZA 1U63A 5FH9A 1H2RS 1NP3A 1W96A 3E9MA 3R5KA 3D2LA 1CDEA 2WB4A 4B3FX 1OVGA 2QG4A 3ZZUA 1H6DA 2II6A 2BI8A 2V4UA 2VTEA 4ZOAA 1BE8A 1IONA 1KO8A 1G3RA 4IY1A 5B6PA 3LV8A 2J59A 1K86A 1FX0B 2PTHA 3ND9A 4QE3A 3GVIA 2ZDQA 3CUTA 3JQ7A 1SC9A 4ZRMA 1LZLA 1WSDA 2WJGA 1OW3B 1VG9B 4Q47A 4RETA 1E62A 4L5CA 2GBLC 4EYKA 1NFQA 3VH3A 1Q1AA 1XXHB 4MKZA 2N0SA 3D54D 3DPIA 3A9RA 3HU1A 3Q7SA 5E6UA 3GROA 5GADl 2W2NA 1JH8A 2IC5A 3EQ8A 3EVTA 2AC4A 1GNRA 4H6WA 3DCIA 4WKGA 5CG2A 2C2XA 4Z9AA 2HJ9A 3BFPA 4P3KA 4TLAA 3JX9A 1GPMA 3LHDA 1T9KA 4W1RA 2XUAA 5GAJA 3T12A 2VI5A 1VPTA 4Z99A 4K0RA 1U5CA 4YT4A 2W6JA 1QYCA 3MAJA 4TVKA 1JEQA 1NZFA 3I01A 3PYXA 1NVBA 3G2NA 4EA8A 3QUAA 3FZNA 4F7DA 1XJ0A 5GZ6A 3ZWBA 6Q21A 3D0OA 1GNTA 1GPBA 2MSCB 4F5WA 2BBSA 1KKUA 1UZMA 3HKBA 5JXJA 3ZBPA 3IQZA 3N8GA 4MDEA 1WDTA 2CF5A 3GWZA 1NNI1 1D04A 3ZU4A 3DMTC 4DDUA 2O7NA 1YACA 3KLOA 3ROFA 1CUDA 4H7JA 4KGXA 4AM8A 1J0EA 4B1FA 4P4GA 4LF8B 1ICEA 2E4YA 2XMCA 4G36A 4PTZA 3ESYA 3N0TA 3T7JA 2HX1A 3DL4A 1Z2CA 2ZRAA 1GV0A 3RB8A 4M60A 4NFYA 2OA0A 3UVEA 4D1YA 1BXGA 1KO1A 3PVZA 4G8CA 3E9DA 3JD0A 5DP2A 1EIWA 1N6NA 2RH9B 2Z95A 2WWTA 3DP9A 3MGKA 4OLJA 1WBBA 3DQZA 3NFYA 5C4MA 2MYUA 2FW0A 3UTCA 3WLJA 5CNKA 1QQBA 4LK2A 4PYKA 1H2HA 1E3IA 2NAPA 4JI8B 5E3JA 4UATA 5TEVA 4II7A 1XA0A 3WSTA 2A57A 5I4BA 4BLSA 3MNFA 4FSDA 4YRRA 5BMVA 5JXWA 5JTTA 1TEHA 3ISVA 5U1PA 1Z82A 4K0KB 4PBRA 4BDTA 4AJOA 2VNIA 4HXYA 3SWWA 1XNRB 3UW1A 4D8WA 4DJAA 4CUKA 1HO3A 3BE6A 4E07A 3D1VA 1UWLA 4CDMA 3MJEA 1MJFA 1F4PA 4IUYA 1I3MA 3H42B 2IPOA 1R6UA 1FFWA 1UANA 2ZRQA 3FR8A 2RHOA 3H1PA 4X6YA 1BIFA 3T9EA 4ARIA 3AO0B 2J0VA 3PWKA 1ZL0A 4CF5A 4D97A 4IJVA 2XXAB 1SUWA 3R5HA 4FKBA 3AERA 3U7IA 4WNAA 3IDAA 3HJCA 1RBQA 2YFKA 5EE5B 1KPHA 1ZDMA 2CWWA 3GLHA 5PNTA 5HRCA 1YB4A 4NE2A 2ZQZA 3OPXA 1QRTA 1O03A 1QORA 4EZIA 2JCVA 4J9VA 1HY3A 2WTMA 1E2NA 3C4VA 4X7RA 2H3HA 2RGGA 1JKFA 1AUXA 1R0LA 4RTLA 4UUQA 4Z3DA 2G25A 2X5NA 3KJGA 1RJ9A 3EEOA 2XUGA 4JB0A 1Z17A 1SZJG 5K8VA 3I6MA 3FIUA 2OVBA 1M8GA 2O7VA 2DXIA 3QVXA 3H99A 4MVJD 4NS4A 2YWCA 3KOZA 2GDJA 1SCBA 2PWAA 4TMWA 3ZXXA 1RZRA 2HMTA 3AKZA 4LTMA 1CP2A 3LM8A 5CJPA 5ELLA 3WYGA 4BO0A 2OY0A 5HZGA 1UBJS 2YIJA 4DBVO 4A36A 2OCLA 1GQFA 4PC1A 4I55B 5KTKA 4UFNA 4OHVA 1IXRC 2LKDA 4X91A 1JQJC 4DV7B 3GDOA 821PA 4NESA 2VJBA 3LI2A 4RBNA 1VXRA 2PVSA 1II8B 4JVLA 3MB5A 2QUIA 1EFLA 1MENA 2FPRA 1L7VC 2FP4A 4Q18A 4DQUA 1ZOSA 2ERYA 1L5HA 5FOWA 3JPWA 1H69A 4GU5A 4HUTA 1W44A 2GJSA 2HAEA 1DX6A 1FOEB 1JDTA 1XNGA 2NUAA 1QXSA 2VK4A 1EFVB 2R47A 1XZJA 3A1WA 1JFFB 3GN1A 4J4HA 3NHZA 4L6IA 5FF9A 5FDFA 1KY3A 3F7TA 4MV4A 3WV4A 4Y9RA 1RWMA 4GKKB 3OT5A 3O31A 5EJ9A 2HIGA 4FHEA 1LDNA 4NNPA 3D4PA 2IV7A 1I32A 2OESA 1J8QA 1ESCA 1N0HA