3O1IC

Crystal structure of the tors sensor domain - tort complex in the absence of ligand
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
298
structure length
298
Chain Sequence
b'DEKICAIYPHLKDSYWLSVNYGMVSEAEKQGVNLRVLEAGGYPNKSRQEQQLALCTQWGANAIILGTVDPHAYEHNLKSWVGNTPVFATVNQLDLDEEQSTLLKGEVGVDWYWMGYEAGKYLAERHPKGSGKTNIALLLGPRTRGGTKPVTTGFYEAIKNSDIHIVDSFWADNDKELQRNLVQRVIDMGNIDYIVGSAVAIEAAISELRSADKTHDIGLVSVYLSHGVYRGLLRNKVLFAPTDKMVQQGRLSVMQAAHYLRHQPYEKQASPIIKPLTPKTLHDDTIEESLSPSEYRPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein TorS
publication title An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO.
pubmed doi rcsb
source organism Vibrio parahaemolyticus
molecule tags Signaling protein
total genus 88
structure length 298
sequence length 298
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o1iC02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o1iC01
3QELA 2PUFA 3T6KA 3IPCA 5EWMA 4S04A 2FVYA 2I6FA 1B00A 4RXMA 1M5TA 3NNSA 3OLVA 4W5RA 5TQ2A 1NXSA 2IPLA 3KSMA 3IP7A 2QR3A 4GPAA 1GUBA 4H3HB 3O1IC 3HVRA 4DQDA 1P2FA 3R0JA 5CNIA 4M88A 3KHTA 3OLXA 3RVNA 1Z13A 1P6UA 3DLBA 2AYXA 3SNKA 2AYZA 2OENG 5E3JA 4YS6A 1DZ3A 4XASA 5JNVA 4XAQA 1ZGGA 4G0MA 4F06A 1QPZA 1QO0D 2N9UA 1XWWA 3Q41A 4KFCA 1GUDA 1E6MA 2PJUA 3MMNA 5C5CA 4LE1A 3HV2A 5HKOA 4LE2A 4Z4IA 1QQAA 2PUAA 3N53A 1USKA 3Q9SA 2J48A 3HUUA 3K4HA 1K66A 1LBHA 2FMKA 3H5VA 3LKVA 4RKRA 4WT7A 4NCBA 3SY8A 3EQ2A 3L6UA 1QNLA 2FEWB 3H1EA 4RK1A 4EGSA 6CHYA 3OLWA 3OO1A 2JVIA 3QLVC 4RY8A 2PUGA 5HM6A 2YHAA 2KYRA 4S05A 1USGA 5IX8A 3N8IA 2NZUG 5IBQA 3EAFA 4FE4A 4N0PA 2RDMA 1Z12A 3BILA 2BGGA 1WETA 4RK7A 3DGFC 1JYFA 1YK1A 2JBAB 1SRRA 2VK2A 4UHKA 3TB6A 4EYOA 5JS2A 4YGXB 4W5TA 3VNAA 2HQBA 1D4ZA 4JASB 3GV0A 3B2NA 4D6XA 3MIZA 4PZ0A 3N0RA 3LUFA 4LDZA 5FWXA 4F11A 5DCLA 2IKSA 3RVLA 2CD7A 3FFWA 3C3WA 3CRNA 4MS4A 4W5OA 1QQBA 3NNDA 3BRQA 3G1WA 4ZYLA 1PHRA 1HEYA 3QEMB 1IIBA 3HJFA 3IP6A 3S99A 3SM9A 1ZH2A 3CG4A 4H3KB 5BRAA 5CNKA 1P6QA 1CHNA 4MS1B 4RK6A 1QKKA 1P8AA 2X7XA 5PNTA 2HPHA 1M2EA 2CHEA 1EHCA 3H5IA 2WJWA 3LOPA 2NUBA 1SXHA 4TLLB 2WY2D 1JF8A 3KCNA 3JY6A 3QEKA 4MR9B 5EWLA 4MQEB 4YR7A 3M6MD 1DCFA 4MR8B 4MR7B 5JNRA 1JWLA 4H60A 4KREA 2MYUA 3TMYA 3O74A 3EJWA 5GOTA 4MS3B 1ZITA 4G0OA 3NBMA 2FSPA 2FXIA 3DZDA 3F6CA 1KRWA 5JNWA 2HJ9A 5GQSA 4MPTA 2MSWA 4YV7A 3KYIB 3A0RB 1AB6A 1DC8A 1JDPA 4TN5A 2L2QA 2WB4A 3HZHA 2WJAA 2WRZA 3O2QB 4Z9BA 4Q7EA 5TE9A 4RS3A 1PNRA 4MLCA 1D5WA 3DLHA 4EUKA 3HEBA 5KQLA 1JL3A 1R8JA 2LPMA 2CHFA 2F8TA 3Q7TA 3D02A 2FLWA 4O1IA 4PEVA 2GWRA 4JP1A 2IOYA 3JVIA 2DRIA 2IPMA 1DBWA 1ZH4A 2ID9A 1YMVA 1Z17A 3I5AA 4ETNA 3BREA 4ZJPA 3QX8A 1U8TA 1VLZA 2CWDA 2HQRA 1L5ZA 2M98A 3JTEA 5BQ3A 3CKMA 3UK0A 5IUJC 5KQGA 5T3YA 1PEAA 1EWVA 4MQFB 1TVMA 1XHEA 1ZY2A 3HSYA 1DBQA 3M9XA 4IRXA 3LUCA 3H6GA 3GRCA 1ISRA 2QSJA 3FFXA 5TQ0A 1TMYA 3TD9A 4D6YA 1ZDMA 5T7BA 2P4UA 4WXEA 4RK5A 4JAVC 1Y1LA 2E4UA 5B3JC 4NCAA 1ZAYA 2FMHA 1NXVA 1ZN2A 3URMA 3IP9A 1BAPA 4N41A 3HO1A 4ML3A 2LIVA 1Z25A 3H1GA 1JH9A 4F3TA 3QK7A 1FFGA 1MAVA 4HNRA 1DCMA 4OG2A 3OMXA 1SD5A 3BBLA 4Z99A 2H0AA 3GBVA 2QW1A 3T38A 3O21A 5FBKA 5EWJB 4L4UA 1FFWA 2FQYA 2MYPA 4KQCA 5DTEA 4G0PA 3N0WA 2Q5CA 4RDCA 4YCSA 1YTUA 5FWYA 1BDJA 4HYEA 4XXHA 3KTOA 2PUDA 3CNBA 3JPWA 4RY9A 3RVKA 4MGEA 4Z0NA 4P1ZA 4OATA 4DN6A 1FFSA 4Q6WA 4JA2A 4ZPJA 3NHZA 4OLBA 1D1QA 5B3JA 3QLUC 2R25B 4Z4FA 1ZESA 3RVMA 4QICA 4B09A 2E4WA 5KWSA 1NXXA 2L17A 3KYJB 4ETMA 4F8JA 5KC8A 4WZZA 1YIOA 2FN9A 2JVJA 4MRMB 5TQJA 1H9CA 2GKGA 1VPWA 1YMUA 3T95A 2HSGA 3RVQA 4QYWA 4IF4A 3GWGA 3H5LA 3UUGA 2LP4Y 4IILA 3CG0A 1JX6A 2PUCA 5TPWB 5FBHA 4E7PA 5TPZD 1BVHA 1D2AA 1RNLA 1ZHHA 2YHBA 4MAAA 2A9QA 3TO5A 3HUTA 1JFSA 3QLUA 1GCGA 1ABFA 1NXOA 4EY3A 3DBIA 1EFAA 1E2BA 4IMIB 3RVOA 1NXPA 1APBA 3OQMA 1F51E 3RVSA 3A0UA 1MIHA 3QLVA 1ABEA 2JVKA 2P9HA 1KRXA 3QX9A 1BDIA 4G0YA 2VUHB 1A0OA 4RY0A 3N75A 4FE7A 4RXUA 3CLKA 2FEPA 1YS7A 5JNTA 4TMYA 3SAJA 2QZJA 4KRFA 3FGZA 3H1FA 1W25A 2RJOA 4RSMA 2O20A 1DP4A 2B4AA 3A3KA 4KPYA 1NXWA 4Z9AA 5DKFA 3OLZA 3KLOA 3N6VA 5CHYA 2H3HA 1E6LA 2RGYA 3I09A 4N47A 3E3MA 1M5UA 4KQ9A 3SG0A 1SXGA 4Z4EA 3C3KA 2IPAB 5HSGA 1JFTA 1GCAA 1QP7A 3CZCA 4G0QA 3QELB 2MSKA 3FMVA 3LUKA 2FQWA 3HS3A 4TLMB 5EWMB 1TJYA 3HXMA 5C5EA 5TQ2B 3OO0A 1TLFA 2QXYA 5KI6A 2FMFA 2FTKE 3IDOA 1K68A 4O1HA 5HQJA 4KNYA 3H5TA 4KZKA 1VRVA 3LMKA 4RKQA 3RVRA 3K9CA 2GBPA 3ROTA 1Z15A 3KG2A 2F8SA 2QV0A 4KMRA 1JLKA 2FLKA 3EULA 2JBAA 3O1JC 1A04A 1E6KA 3N0XA 1FQWA 4G0ZA 2B1JA 4EVSA 2ID7A 4L85A 3JPYA 3Q15C 3W9SA 1RZRA 5FWYB 2L19A 3C3MA 1YS6A 1VKRA 1LK0A 2WWVD 4LE0A 3GBPA 5CNJA 5JNUA 3O2SB 4G86A 3OM1A 4Q6BA 1RXIA 1CEYA 3H75A 2A9OA 5KC9A 3SQNA 1U2QA 3LTEA 1DC7A 2JB9A 4EVQA 3D8UA 2FKAA 1C0EA 1GLGA 2JCGA 4LZLA 3GYBA 3QEMA 1S8NA 3A10A 2R47A 1USIA 4N76A 4YRZA 2QVGA 1JDNA 1DJMA 3CFYA 1F4VA 1U0SY 3CTPA 8ABPA 3VNBA 3MQ4A 4MS1A 3GA5A 4W5QA 4E7OA 3JS5A 3GL9A 3DGEC 1A2OA 4MR9A 1U04A 4MQEA 1MB0A 2FMIA 4WWHA 4MR8A 4MR7A 3O75A 4JOQA 2IPNA 3Q7SA 4MS3A 4JB0A 3O2JA 4KVFA 1RZRD 4HNQA 1YVUA 3MM4A 4G0XA 4EVRA 5ED4A 4Z4GA 1QP4A 5FWXB 4Z4HA 3UKJA 1BA2A 1M2FA 1YK0A 2MYTA 4MS4B 4RZSA 1I3CA 5IUNC 1KGSA 2TMYA 3ROFA 3G85A 3LUAA 4LDAA 3LUDA 3KJXA 2NZVG 2E4ZA 3I45A 3RVJA 2PUEA 2LUOA 1XHFA 1PNTA 4P98A 3LUGA 2M1ZA 5IEBA 3HK2A 3EDCA 1CYEA 1C4WA 2A9RA 3MYYA 1EAYA 2VUIB 1T34A 2PE5A 5JS1A 1MB3A 5BR1A 2FN8A 3IP5A 4WXMA 4PE5B 2JK1A 1TM2A 3NNNA 7ABPA 1NXTA 1ISSA 3OM0A 1PUXA 1MVOA 5EWLB 4RXTA 5IUKC 4FB4A 4EYKA 4MQFA 3HCWA 2V0NA 2ZWMA 1URPA 2R4QA 3HDVA 4GNRA 4NICA 2E4VA 5D2CA 4ETIA 3ILYA 4XARA 1AB5A 4N03A 3JVDA 3LFTA 4JB2A 4KK4A 2RJNA 4PICA 2PL1A 3H6HA 3KLNA 4N0QA 4ZMSA 4YWHA 3LUHA 2E4YA 3CZ5A 1DRJA 2MYNA 3MA0A 4QYMA 3ILHA 1Z16A 4RU1A 4RV5A 3OLYA 1J56A 2LBPA 4LRQA 9ABPA 5I4CA 2PMCA 1Z26A 1KMIY 2L18A 2WMYA 3HDGA 5EWJA 3LKBA 3OMWA 2R48A 5BRJA 4OTZA 1DRKA 3O1HB 3CU5A 1D1PA 1LJUA 3EGCA 1ZGZA 3EQZA 4EYQA 4ZMRA 3GT7A 2JRLA 5JNSA 2ZAYA 3L49A 3F7NA 4IGAA 5F64A 4O5AA 4UHJA 3QLTA 3H5OA 2GX6A 4KV7A 1W9HA 4G97A 4NV3A 1JFVA 4YP9A 3T8YA 2NT3A 5IEJA 4XLTA 1NATA 5TQ0B 2XDYA 2FQXA 3E61A 4Y9TA 1SXIA 4IMJB 5KQPA 3I42A 3OQNA 2QVCA 3KS9A 5IULC 2PKXA 3FFTA 2OQRA 2MSLA 4RK4A 3RH0A 3NHMA 4HNSA 4NQRA 3CS3A 3RQIA 4MRMA 2NT4A 3KKEA 1JBEA 4MYRA 3F73A 1DCKA 3F6PA 4KK3A 1PEYA 5TPZA 4XFKA 1FSPA 4DADA 4OBBA 2W42A 3OQOA 5CNMA 1ZVVA 5TPWA 1Z2DA 4YLEA 4RK0A 1NTRA 1RPJA 3Q7RA 3RVPA 1JYEA 1QP0A 4LX8A 5DGCA 5KQMA 1JHZA 2VYCA 4OLAA 1U2PA 3C97A 4QPJC 5DLEA 1NY5A 3M9WA 2E4XA 3EODA 3C6QA 3BRSA 4Z4CA 3IPAA 4EYGA 1UDRA 3P9YA 4RWEA 3TX6A 1EWKA 2QU7A 4YO7A 2A9PA 2FEKA 1DG9A 1QMPA 1OXKB 1DBPA 2GI4A 2IDMA 4PYRA 1QO0A 2FW0A 4WUTA 6ABPA 1EWTA 4CBVA 1LJLA 2PLNA 5IC5A 1OXBB 1Z2EA 3MF4A 4F12A 3HM9A 4W5NA 2PAFA 1LBIA 3CHYA 1RXEA 1L5YA 5ABPA 2HQOA 3FDFA 2PUBA 4MLDA 3LUJA 1BDHA 2IYNA 3H5WA 2PL9A 1Z18A 4D74A
chains in the Genus database with same CATH superfamily
1G42A 3CW8X 4JBIA 1L3BA 4RMIA 1ATIA 1RQRA 3BFVA 4RORA 4XR4A 3WMXA 4F4FA 3GRZA 1COWA 3S2SA 3TMAA 1B00A 4HVTA 4IR7A 3R5JA 5JXGA 1XAHA 1GYPA 2OTCA 3KPJA 4RHTA 3VJKA 5JI2E 3P9CA 1YCDA 4G4GA 3Q3GE 4GFDA 4KQHA 3IGFA 1UBUS 1WTCA 3C14C 1DELA 4GPAA 1G3QA 3DOOA 4HGQA 4PC7A 2CGEA 2PX8A 5I7SA 1KBOA 3PYMA 4MVJA 4LOHA 1VE3A 5K8JB 3C3JA 5HM8A 5BQFA 5LP1A 1TF2A 5REQB 4XIJA 1UFOA 2AOUA 3EFBA 3Q0TA 4OHOA 2NQ2C 3P5SA 1YT5A 3HR7A 4D44A 4HX5A 3VC1A 3A32A 4JYZA 5AK6A 5HUQA 1T9HA 4XAQA 3Q1KA 1CZNA 4WJLA 4RD4A 3WI7A 1F3LA 1I1OA 1QHXA 1UJ6A 4MLZA 4D4HA 3VYRB 3HJNA 2GO1A 3DKIA 5BR7A 2ERXA 1XMXA 2O3TA 1S96A 5C5CA 1B3RA 4R1TA 5JCXA 3A37A 3OZAA 1UP7A 4Q21A 4E11A 4PQEA 3ISTA 1QQAA 4Q9IA 3GFFA 1XTZA 3GD5A 3RFFA 2YFYA 1SULA 4KBFA 4YNBA 3LY5A 4DEYA 2XXJA 3TINA 3GLFA 3EEFA 3OFVA 4N9WA 1P31A 2R44A 5HGJA 3KUKA 3U7RA 3V6MA 4E32A 3F6YA 3TZLA 1QP8A 2FEWB 1Z2CA 5CM8B 3OO1A 2PUGA 2G70A 1FU7A 1Z5GA 3ZWAA 1P33A 1ST2A 2KX7A 4M60A 1KMMA 4YT4A 5IF3A 5C53B 3UOWA 4LNUB 3E4DA 1NUUA 3RWBA 5IAGA 3N2ZB 3N8IA 3EAFA 1YQGA 1KGDA 3FSRA 1N2EA 3N28A 1T9KA 3O92A 4TWZA 5FI5A 4C21A 1K06A 1J21A 1GU0A 2VUSA 4LV6A 4TS4A 4ZA2A 5JV5A 1WOMA 4CVNA 1DBRA 2RHGB 1Y98A 1GRQA 1A71A 3FM9A 3QI2A 5KOHA 4B3MB 1JKMA 4JSRA 1SCNE 4YGXB 5BWMA 1FXSA 1GAQA 4R7TA 1LPBB 1KPIA 3AIIA 4NMHA 3EX7C 2DUJA 4JASB 4Z3OA 3GV0A 3LRPA 4M21A 5G1NA 1W93A 4HTFA 4BMPB 2OPBA 4PZ0A 4A6DA 2OKGA 3X2FA 4LQDA 4N0EA 2EJBA 2HWYA 3DW3X 3W5JA 1G3UA 1FYDA 4BU0A 1MORA 1UMDB 2HM7A 2VWPA 1O94D 4W5OA 3WKDA 3NHPA 4ZVLA 1J22A 3PEEA 4G85A 1NVVQ 1W29A 3AEXA 4KR6A 1YFZA 3EIXA 3QPCA 4J1SA 3HJFA 1M66A 4JT8A 2YNMC 4QNMA 1ZH2A 1VJ0A 3R7DA 1AKNA 2EBFX 1I6MA 3C7AA 3DVRX 5F1YA 1K0FA 1PR0A 4R8VA 2PANA 4ZOBA 2GCGA 3UA3A 2OV3A 1PS8A 1M9NA 4EJ6A 5EHXA 1LS1A 3T5GA 2HPHA 1M2EA 3GP3A 3A1NA 3JRNA 4A8PA 1AS3A 3P2OA 4BX0A 1Z0KA 3H5IA 3OOWA 5TV2A 4ND7A 3LOPA 1SXHA 1UFKA 3JYOA 3E9RA 1KEZA 3QJGA 1PV2A 4JNCA 5CH3A 5JU6A 4NPCA 1K86A 4JX9A 4C05A 1N9GA 4ZGBA 2G1AA 2KJQA 3OM9A 4CF6A 3K1AB 5FHRA 3IVXA 1E59A 3B6KA 3FLMA 1KIMA 3JRXA 4G0OA 4ZTUB 3M4NA 4IYRA 5I7FA 1Q20A 3R8FA 1HMPA 1YACA 4XWYA 1AY0A 3L4BA 5GINE 1AB6A 3GLHB 5K3CA 2HBZA 4B87A 1U2DA 1ONNA 4PCLA 2OYRA 1U7DA 1HE2A 2P1DA 1EM8A 4KVAA 2H2DA 4MLCA 3A26A 4WA8A 5B6IA 4RA6A 2G1PA 1IB0A 3LYHA 1Y7IA 2C2ZA 1Z0ZA 1W6RA 3ZX5A 3P97A 4KQXA 3S29A 3PT9A 1R6XA 4ROTA 3THXB 2GWRA 3GZTB 1U0NA 2H9AA 3CWCA 3RC1A 4IJ6A 1BH2A 1BN7A 1ND6A 1QIEA 2EXXA 2P2DA 3GAMA 2CWDA 4LRUA 1L5ZA 2VDOB 3LWZA 2A8YA 4CKEB 4AS2A 3UK0A 4UDYX 4Q3OA 1Z36A 2AG8A 4AECA 2V7GA 3O9ZA 2P5SA 3ASYA 2CFTA 4G5GA 1VHWA 3AFOA 2O5VA 4TL8A 1XHEA 2CLDX 2YHIB 5I5GA 3ZI4A 3FETA 1YR3A 1YUBA 1RFGE 4Q4DA 1CPYA 2HMTA 4X8HA 5B1SA 3ZDEA 4TZ6A 4D6YA 1ZDMA 4P0PB 2IXDA 1T8PA 3IULA 3SDZA 1S2DA 3ZXUB 2CNKA 5JAOA 2WD7A 2XNHA 2I2XB 5IAKA 2X8WA 3TL2A 1JHPA 4RD2A 4X5OA 2Q5QA 2V54A 3VC3A 3IQEA 4D41A 3HEMA 5BSVA 3HKDB 4BN5A 3FIUA 4BAGA 1B8VA 1NULA 1FYFA 3IE0A 4NAHA 3BXFA 1B16A 4R3NA 2H1LA 2XZPA 2Z4TA 1E3QA 5EWJB 4LOLA 1B0UA 3DEZA 4FJ2A 2VSOA 3EISA 3ZHTA 4HYEA 3OE5A 1D2RA 4ZKDA 4CXMA 1C9JA 1E6UA 3KTOA 5CB0A 3RVKA 4G56A 4OATA 1N5IA 2ZR7A 4YDQA 2OC9A 5TMPA 3F5QA 2JFGA 1RKBA 3ZDBA 1DSSG 3WKCA 3V9AA 3FOEC 2GEKA 3CT6A 2WM9B 1EK5A 3RU2A 2R25B 3DV0A 1CQJB 4DDWA 1W8IA 2ZI6A 3FX2A 1JHYA 2PZEA 1UOPA 1V45E 1C3XA 1ZJ6A 2JGLA 1NXXA 4F8JA 1BS2A 1VDZA 3FTFA 4GWGA 3FZGA 1ZNYA 1JB9A 1P1HA 1YIOA 2VYVD 1XVUA 3TI9A 2NACA 3CF0A 2JVJA 4A2CA 2H2AA 1S3FA 4J07A 4F2HA 3KD2A 3RVQA 4BBJA 2REQB 5SICE 4BLWA 4A82A 4WCFA 1N8NA 3GHYA 1G6Q1 3EJ6A 4JI8B 4A1FA 3PFGA 3R6TA 4Y0AA 1UOEA 4XJXA 4P4SA 3M33A 1VMEA 3ND8A 4HDKB 1TT5A 3U0BA 4Q7JB 3JSAA 1K7XB 3DDZX 3D4BA 3BD7A 3I9NA 3GXBA 3L8EA 3J81k 2A94A 4NK4A 3QTBA 3WYBA 4XJSA 1ENZA 3IAEA 5K0NA 4BJ6A 1L5FA 4JN6B 1S01A 2NYAA 3LC1O 4PHFA 4QTXA 4WLNA 2ZUWA 3B12A 4G84A 4RLQA 4KPUA 4X93A 1G21E 5BYJA 3V2GA 1MZPA 1E3SA 5JBQA 1JU4A 1MIHA 2IV7A 3X1KA 1ADGA 3DC2A 5F7OA 1ABEA 1R3DA 3LPAA 3UFXB 5LWQA 3A6KA 4IVNA 4II2A 3HZZA 3M6IA 4KUHA 5JS8A 4G0YA 1NMXA 3JQBC 4BQSA 1ORTA 4KLRA 5JZVA 2BHNA 2RGNC 2XRMA 3WY9A 1IN1A 3MEQA 4ENTA 1V96A 4HNTA 1C7ZA 3D5EA 3FYHA 4P7JA 4ZI7F 4KRFA 3U80A 1KU6A 3O2NA 4TZTA 2CHUA 3H2YA 3NT4A 3HYLA 4H15A 1SBQA 4O2LA 1ZNZA 5CHYA 3K9QO 4O4LB 3O0DA 5L40A 2MWMA 3ON5A 1E9CA 1M5UA 3C48A 3E3MA 4LX0A 1IH8A 1NBAA 4HB0A 1P7CA 1O6FA 2JLRA 3K1TA 4EZEA 4S3MA 4P7KA 1G2PA 2WPNA 2XDQA 3F97A 3PQCA 4O33A 1P75A 5KU1A 4PPYA 4DSTA 3GF4A 4B3XA 4CQMA 2OWEA 3P9NA 3ZD9A 2RH4A 4AN1A 1J49A 4PQFA 2QXUA 5HKKD 4RKQA 6ADHA 1WUYA 3GT3A 3P0EA 1CZUA 1W4RA 3ZQ4A 3LT5A 1X38A 3S8YA 2WM3A 2AOUB 3H1PA 2WWRA 2W2LD 1MB9A 2HN9A 1JALA 3EULA 5F76A 4L7QA 2XQVA 3DF7A 3KCQA 2GXSA 1VCIA 3G8BA 2W48A 3HL4A 2RHWA 5JXIA 5AQ1A 4UDNA 4EEXA 1VJ1A 1L5SA 3EZ9A 4LE0A 2WABA 3OKCA 2VL7A 1V4BA 5FD8A 4Q19A 1IWPB 2ZRIA 4DF3A 2AZXA 5KC9A 2XWSA 3P4XA 3V8QA 3N7UA 1DC7A 1O57A 1I2CA 4ZPXA 4B6PA 3S70A 2O1SA 4PYMA 2ZYHA 3GLFB 1DLJA 4N18A 5JS7A 1XTRA 3RU3A 3BG5A 2O7QA 1GCOA 1P3JA 2Q6IA 1JHQA 2ZJ2A 2Y1DA 3MBKA 3O94A 4RDXA 4HYYA 4YMSA 4FCTA 1JDNA 1XZFA 1L4LA 1OKKA 1GQFA 3NHYA 3OE4A 2RHBA 5THXA 1DXHA 2AWOA 4YRLA 3AEKA 6REQA 1R8YA 4NCIA 3RFUA 3SSMA 1HYHA 4HCJA 3FNQA 4LYYA 5EMHA 1UT8A 1SHTX 2JLZA 5TARA 2Q8PA 4O08A 1RBZA 2GN4A 3L04A 2CXQA 2ZANA 3M34A 1POXA 3IBGA 1U04A 4OMUA 3V1UA 4BUZA 2C3PA 3TFOA 4OHVA 1NPDA 1XU4A 2JEOA 1KETA 4FYWA 4MS3A 3ZI0A 3F96A 2I3GA 5EGNA 4HTFB 4YR9A 1RM4A 2F1IA 3JQGA 3ZWBA 3QVSA 2JAOA 2X86A 2I34A 1Q15A 1JAZA 3D2LA 1CLEA 3OY2A 4Z4HA 5CYOA 4D9FA 4YPOA 1PJ8A 1WNTA 2GASA 4M0UA 5DNEA 3UAVA 1XL0A 4I5GA 3U19A 4KWEA 1CR4A 4GBJA 4J3JA 4MRVA 1BQ3A 1E3WB 2F48A 3FUWA 2DX7A 3ELYA 2R8XA 2VJPA 4YRMA 4B3CA 1RRKA 2JEYA 5I8WA 3OCVA 3PUJA 3DOFA 2QUHA 1KQNA 1EFKA 1K9SA 3V1TC 2FPRA 4WGFA 1M2JA 2XITA 3KAQA 1LWNA 2ZRNA 1JTFA 3U7IA 3ZD7A 1XK7A 2P9BA 4P0TA 1NX9A 1WHSA 4HBGA 4D81A 1AMUA 4KE8A 2I6XA 1TM2A 1Z74A 5AMXA 2HZBA 2PZLA 2V4MA 3W77A 1DKRA 2Q3EA 1EFTA 3CO0S 3PZBA 4XB6B 1IXSB 3EVFA 4JBLA 1PUXA 3D6MA 3NXSA 3O3MB 3RWOA 5JSHA 1GFWA 4FB4A 5ALIA 3TTVA 3V46A 5DM4A 3HCWA 1N9GB 1T6ZA 1UR5A 1V8PA 3L0YA 4PC2A 4JBHA 4UOQA 3U39A 1EHYA 2Q4RA 2WU4A 4CM6A 2FSGA 5IAOA 3IUBA 2A86A 4BZXA 4XCVA 4UVEA 5GWXA 1HRDA 2NXJA 4DUZB 4XQGA 4ITVA 3A1EA 1HXHA 2XGJA 3LY7A 3QMVA 5DP2A 1KQGA 3OAAA 5M04A 3JRWA 1EM8B 4CMAA 1GKYA 5THQA 1QHEA 1TADA 2HNKA 3ILHA 3QF7A 2JIOA 4RA6B 2OMEA 3WGIA 1VL1A 1WUHS 4KWIA 4YRNA 3FWNA 3E1SA 4Q5IA 3C6KA 2AC7A 4MA0A 1ONOA 3NPAA 2ECKA 4QO7A 2PH7A 3EK2A 5IM5A 2F90A 1Z29A 1PBTA 4WFJA 2OGUA 3I3SR 1CJKC 1DRKA 3ZOZA 1T0JB 2BFWA 2POQX 4QU0A 1XZCA 2W2XA 3EGCA 4RNDB 1DAKA 1P74A 5EOVA 3TKYA 3X1ZA 4JKIA 3BA6A 3SKXA 1XV5A 1UODA 5AOVA 3F2IA 4M38A 4P9NA 3FHOA 3QNWA 4KNVA 1U7TA 1ODIA 2X1HA 5CW1A 2RG7A 2G17A 3V3TA 3VHXA 1T5IA 4X1OA 1GLNA 2NT3A 2RGGA 4R9NA 3RYIA 5T64A 1I7DA 3H87A 4MK4A 1OZ0A 2ZUTA 2VNAA 3I2JA 1EUQA 4LCEA 4FGLA 2Q2OA 4G37A 2W70A 1ECPA 1SXIA 4ZVRA 1N0UA 3I42A 4DUGA 3KS9A 5F3RA 1J5PA 4A0RA 1C30B 1XDSA 5F33A 1VKJA 3NHMA 4EFNA 2WD7B 1RPAA 4C0KA 2IY8A 2FW8A 1A9PA 1Q3KA 3GJXC 3KNZA 4MI6A 4IXWA 1AOXA 4DC1A 4B46A 4PYKA 4LRXA 3ITKA 1Q3HA 2CLSA 3KJEA 3MD0A 3PCXA 5LDHA 3BSFA 3EB9A 3CPSA 2GCNA 3O83A 2J9YB 1YA6A 1E9BA 2ZWIA 4GKKB 4DLTA 4CMHA 2PRZA 3A9VA 1WMEA 4KQWA 1ZEJA 2ZIAA 4DB2A 3LO5A 2HA6A 3D7KA 2MIIA 1XN1A 3JQ9C 1VFNA 5AYVA 3CNOA 4M1KA 1RAFA 2QTCA 1F7VA 2HTFA 3DV0B 4PG4A 4R1LA 3I73A 4X7RA 5BW8A 3RRYA 3GAAA 1G19A 5KTOA 4LXUA 2FGJA 1PS9A 4M1WA 1I0ZA 1XMPA 2BISA 3ORHA 3SIXA 3HTXA 1OXKB 2V5AA 1QIHA 2BCGY 2FW0A 4KIUA 4ALIA 2SBTA 3ND5A 4EABA 3IKMB 2WIAA 1X8LA 4Z0PA 1DDGA 1I10A 1OXBB 1Q19A 1Q83A 1T29A 4KE6A 4QELA 4D9NA 3RSZA 4W5NA 4AT1A 3AW9A 4ESOA 4KKVA 3WX0A 4XPZA 1Z7EA 1FNMA 4WCFB 1RWQA 2ALJA 3SWWA 4I99A 1VGVA 5JTTA 3H5WA 1Z4OA 3BZWA 3RM3A 2XZDA 1R50A 1SKYB 1GPMA 3MOIA 3MJEA 5I4KA 2N46A 4KX5A 5JCJD 3QELA 4UM5A 1TT5B 2FFRA 1HETA 3AI1A 4RXMA 1B76A 1Q44A 1BKYA 3HCEA 4FJ1A 3W4JA 2QP4A 3TXXA 1WBBA 2J46A 3OCWA 3HVRA 3SSOA 1YDMA 4R7ZA 3L0OA 4KPUB 4DJAA 1P0MA 1H2EA 3WWPA 3ZZNA 2ZYWX 1AV7A 2A5DA 3NGMA 3SZLA 1CYEA 4ZVQA 1Y4SA 2O8NA 2ODNA 2R5NA 3NGXA 3PITA 2XTNA 4GH5A 4IV0A 3B9RA 5LQKA 3K9WA 2CLOB 4IXDA 4W5WA 4ES6A 3DEYX 5IK2D 2ZDQA 1DWPA 2OVBA 3AVWA 3PUIA 3L43A 1PVOA 1DWUA 1P0FA 2PD6A 3RHFA 5KTSA 1D04A 1ORRA 1RTKA 3ERCA 2AOTA 1E6MA 2UUBB 4LE1A 4M7WA 3HV2A 3GFQA 3M4JA 1W19A 2QAGA 3BXHA 5EPUA 3BGVA 3HCBA 4NOLA 3AQIA 4Z4IA 1UPTA 4YACA 4PYJA 1HGXA 2DR0A 1PWZA 1E2JA 3ENQA 3FUCA 3G59A 1LBHA 2O3JA 4QHYA 3ZHYA 2DFTA 1J4AA 1GL3A 4AP6A 2C7VA 4Y6LA 1JVSA 3DF9A 1WNFA 2XDQB 4E33A 3U81A 2PZFA 5EAIA 3NM5A 1OT5A 3AY7A 2YH2A 2A30A 3LUBA 4CQMB 5B2EA 4AY6A 5DNYB 1Z4QA 1PCXA 1USGA 4K9SA 1JJ7A 5F2KA 2JLVA 2UYQA 1E77A 1M3SA 4H77A 1G8PA 1MC8A 2IHJA 3ORFA 3OZFA 3GRKA 1RRCA 1E4YA 1KKMA 1FZQA 2Y05A 3NHAA 2VP9A 2O6LA 1QCZA 5FPQA 2B9EA 2P2CA 3A9TA 3TTUA 1QHNA 1Z3IX 2IC5A 16PKA 4HLDA 4TQGA 3EOZA 2COUA 3QOWA 4N40A 1ADCA 3U7FB 5EJ2A 1MJNA 3HYRA 5KVAA 2FY8A 1TE2A 2A67A 2ZS7A 1YE3A 5AJHA 5JZBA 2R8EA 2VDNB 4I66A 5IRCD 2HA3A 4S1PA 4IIGA 5M3BA 2RC5A 3WL5A 5AD1A 4M87A 4O4JA 1L4KA 3CLUC 3ZC3A 3U3DA 1JA1A 1GZSA 5H83A 4TLBA 2DPHA 4CGZA 1XMSA 2FFQA 5JLJA 1FF9A 2HF8A 4YRCA 2PYZA 2GOYA 2VJCA 3OE7A 2WU3A 1CERA 1IIBA 3QXCA 4R2WA 4TL9A 3L4BC 4KXUA 5E1MA 3HR4A 2QUJA 1U2DC 4FFDA 3G9XA 4NYJR 1GP2A 2NW6A 1IBKB 3L7OA 3G2LA 4OOEA 3AEKB 2F1HA 2XMRA 6REQB 4WVFA 4NH4A 3HU5A 4BLQA 4XLTA 2XYVA 2Q5LA 3V4PB 5IFKA 4H6XA 2Q3BA 2V98A 5CDTA 3AVVA 3EGIA 2E48A 3ONDA 2Q5OA 5C35A 2QWXA 2GPTA 2VXCA 1BX1A 4BNLA 4Y2VA 4INZA 5C80A 3B7PA 4I1IA 1LV8A 1SIWA 3DTVA 4MS3B 2W5UA 1UAAA 4DWWA 3F5DA 2GZMA 1W5SA 4DZTA 3JQGB 3CNEA 1CZKA 3FOFC 3MGAA 4TUYF 3PGJA 3A4LA 5ALJA 2A3RA 2PY6A 4GSLA 2DHDA 3RCBA 4M1ZA 3TZKA 4DJJA 2FUG1 2UZIR 5BSEA 1PL6A 2Q2WA 4RS3A 5EESA 5KYXA 1G60A 2F4NA 3LF1A 2HL6A 3OIYA 1XRPA 3FRJA 4ZU1X 2V55B 4Z1OA 3PUHA 4MQ6A 2CF6A 1KBQA 1Y1KE 2QJTA 2BM1A 2IITA 3ZW7A 1W96A 3D8TA 2G36A 2IPMA 1DBWA 1ZD2P 4UNRA 2GZ2A 2ID9A 4NE7A 5BQXA 2OAGA 1WHSB 3KZXA 1XROA 4GBGA 4U9HS 1EXWA 1K7FB 4YXWA 2R5FA 2V6IA 2XUHA 4PSCA 1RLTA 4IDAA 5IUJC 1D2EA 1SUPA 3JTMA 1QFZA 1R0BA 4LN1A 4QHSA 3S2GA 4BZZA 3G2KA 1O0BA 1GOTA 1U4NA 4C6HA 3V4RA 3RWMB 3TQQA 3LQ1A 3WK7A 3OT1A 2GBGA 3KSAC 2DHCA 1RHQA 2ADOA 5KSYA 2QZPA 1KIFA 5D1HA 1N78A 3MXOA 4D3FA 1U8ZA 2EFCB 3BWVA 3BWXA 3UAGA 4LFAB 3VYVA 3UMVA 2ZJ7A 1ZIDA 2C7RA 3N87A 2ILTA 4FFBA 5LA6A 4RDIA 2C7BA 1MQSA 4R40A 4AYTA 1E9DA 2GBCA 5DBGA 1Q0QA 3DM9B 2XGGA 3H86A 3QPDA 3RARA 1I94B 5KWIA 2V65A 4OM8A 3MC1A 2VDMB 5JDCA 3Q2KA 4PX9A 1SCIA 4L9RA 3PS9A 2BUBA 1OSNA 4ZV7A 4RKYA 3HCFA 4NULA 3EZGA 3ANYB 2P2SA 2OFWA 1BVRA 4BMZA 1ONBA 5L8VA 4WCFC 1JDVA 1NW9B 2VO1A 1QQ5A 4YXFA 4I7EA 1D4OA 2GJ9A 1G21A 1R4ZA 2IW3A 4HWSA 4WUVA 2H85A 3DHEA 5FWDA 1UWKA 4TSFA 4AB1A 3T5CA 4GD3Q 5AOCA 3JR7A 1KJ9A 3VHXB 4QUHA 5JMTA 3FI0A 3K0KA 3RYIB 4Z4FA 1P9LA 2V4ZA 4F91B 4QICA 4B09A 1OPXA 1KQFA 1Q14A 1PTJA 3B9PA 4MDYA 2HIHA 3EEIA 4DC9A 2JA2A 2HLHA 4H7HA 2FPSA 1RHKA 4P7FA 1HNWB 5CB4A 3R7SA 3JQ8A 7GPBA 4EHDA 1WQ1R 2JJQA 2WVAA 4TYNA 1KAOA 2ASVA 5AVZA 1H9CA 3I37X 5LPNA 1NVGA 4I4TB 3BL5A 3KJHA 1FYXA 3KB8A 4NEQA 1VP9A 4RL4A 4QYWA 1RQGA 1SB8A 2H5EA 2R6DA 4XCQA 1QV6A 3KTFA 3EWNA 1G98A 1ND5A 3ZHRA 2YBDA 3RJ5A 5AM0A 4WQMA 1IPEA 1D2AA 4MAAA 4ZOCA 2XYGA 1WV0A 3OOSA 1G4AE 1U0GA 3BFXA 4HWRA 4JITA 1AK9A 3HY3A 3HI6A 3OCXA 4FSDA 4AKEA 1LLFA 1NXPA 3RIXA 4S12A 3IVMA 1R15A 3HCPA 4HNVA 2C4NA 1CY6A 3FKSD 2FDRA 3ABZA 5CH8A 3GCDA 2ZJBA 1FL9A 3D6FA 2PBZA 3I1YA 2IHTA 3VVLA 1H4VB 5J2TA 2CMGA 1E2QA 2RE8A 5JBNA 4WOBA 2Y67A 4C5AA 5B6PA 1G8YA 3WB2A 2QZJA 4IUDS 2CVPA 4BOYA 2OHJA 1CUSA 1CUEA 2JATA 4NZPA 2GAJA 3WGYA 3RSFA 1W25A 5KNBA 2XCUA 2IU3A 2F3RA 1DPFA 4WDQA 4ZHQA 4A73A 1UK7A 2PX4A 5K09A 4LGMA 3QVMA 1Z22A 4LZAA 4O4HA 1E6LA 4NCKA 4Q3KA 1NNEA 1CD5A 4QUDA 2A1IA 2NO6A 2CFSA 2D1YA 1BD4A 1JNYA 3C3KA 3KKQA 3LVBA 5SYNA 2IYOA 2WMOB 3DAFA 3QELB 2C3OA 3UTCA 3ZD6A 1CY2A 3E58A 1DQPA 1O8BA 2OV6A 4UREA 2O4UX 3HXMA 2WUVA 4ZC1A 2QW0X 3T7JA 4UVGA 1T1EA 2J08A 1RXCA 5K3BA 2C61A 2MDTA 2NV0A 3AKDA 4ZRMA 4CG0A 3IVRA 2B82A 3LMKA 3LYAA 4AP9A 3Q8MA 4LRTB 3GJTA 3Q0IA 4B6EA 4IIEA 1HF3A 4MCAA 4EHHA 3DR3A 3ZWCA 2BGTA 1XLUA 2Z08A 3W34A 2JFHA 4HVLA 1H3NA 1HYEA 2YIVX 4A0HA 4HMPA 6GPBA 3HFGA 1HQYE 4HQNA 4RACA 1IJFA 3MJCA 1JIKA 4FX5A 4PO9A 3RUIA 1YGYA 3R75A 5C18A 3UVEA 1TXGA 3L4EA 5LMUB 4CKBA 2DXIA 5JYBA 5AO9A 2WWVD 2AOTB 4X44A 1TJPB 4HPWA 2QAGB 3PFIA 4PYOA 2DQ4A 3AF6A 3P2KA 3PXEA 1P60A 4FEGA 1D2CA 3I0NA 5CM9C 4AJKA 5C5DA 5CYPA 2D7CA 4LGYA 3AKCA 2FKAA 3MPOA 4Q0MA 5AOBA 1NT4A 1QR2A 3AJDA 3MRTA 4CIBA 4RF2A 4OX9Y 1LEHA 1C1XA 2XNJA 2R47A 2XWBF 4G63A 1AHNA 3AL2A 2EARA 4F86A 2C77A 2P5TB 3FYSA 5B5SA 1NP3A 3HLKA 4BFWA 3IIIA 5CM2Z 4J75A 1TI7A 1U1DA 1O03A 1DIBA 2WA2A 3DBLB 3FNGA 3KQQA 121PA 1ZD5A 1T3HA 3CX3A 4G07A 4OCZA 3G8YA 4Y18A 3TW6A 4BP8A 4UNSA 5B7QA 3TECE 2O5RA 1IY9A 3DBRA 2O19A 1XEAA 2RCYA 3D8SA 2ID4A 1Z5VA 3QZUA 5AW3A 1XVTA 3IHLA 3W04A 4BP3A 2G7ZA 3NV9A 1P9NA 4EKIA 1CUGA 5JCPA 1XJCA 4DCPA 2FEXA 1WS6A 5ER6A 5ED4A 1IVNA 1RM0A 3EUEA 3VO1A 1QP4A 1L3IA 4O4JB 4OIFA 2SNIE 3I12A 5EMNA 2HC9A 4FPXA 2Z6QA 3F47A 1P0PA 2H07A 2SECE 1A1SA 1SD2A 2J6HA 4PPFA 4P98A 1DXOA 2ZU6A 3JVVA 1U0BB 1PDVA 4NEGA 4AIRA 2DR2A 2FVXA 1KEKA 2D5CA 3MYYA 4YAEA 4ZOQI 1DKMA 2OCAA 4HPXB 5T67A 3DFUA 3PICA 4FN5A 4OQQA 2VWGA 4NBVA 4PFQA 1BCSB 2LDXA 3Q8XB 4FMDF 4NECA 3SBXA 4C3OB 4C08A 4RGVA 2W6OA 2X0RA 2G1JA 4ZFNA 3B9BA 4GI3A 3UWOA 3WXMA 2KM1A 3QFHA 2JLWA 3A1TA 3PDJA 1VE5A 1E5TA 2JGIA 4MB6A 4A2WA 4DCGA 2FX3A 1DCTA 3AZPA 3DTVB 4DQUA 3R7FA 1T36A 2OCIA 2OESA 1FS5A 5DYYA 1LVUA 2IHKA 4TYQA 5CCDA 5KTKA 4G5YA 2BJVA 3K15A 4RE5A 4I9GA 1ZJ4A 1FMJA 1G8HA 4QPCA 3QVUA 4B3JA 3ETHA 3KVOA 4GMKA 3VOTA 1VL5A 1KEVA 1L4UA 1Q1NA 3EAGA 2OGWA 2RJNA 4G9EA 2PL1A 3ZWXA 5C7YA 4YP6A 1SQ0A 2PHZA 3DKKA 5IKXA 1EDZA 4BO7A 1S2OA 1ARZA 5FQOA 1DARA 1OVGA 1QQ6A 5KYXB 4Y67A 4KITB 2BI7A 3SJCA 5JIBA 4ZC8A 1H2HA 2XA1A 4GLFA 3L7MA 1PFWA 1Y9DA 5JALA 2WJ3A 5L4LA 1GVHA 5DP1A 4DA0A 4NBTA 1PQWA 2HK7A 3P2JA 2PKYX 1WXHA 5HZKA 1O3YA 2ZJOA 4OHRA 3NFYA 1TUBA 3DD1A 4KG7A 2C92A 5A04A 1PFVA 3LT4A 4Q4AA 2VP2A 4NV1A 1EWQA 3KR2A 1Z38A 4YV0A 3KOYA 3IMKA 1PK8A 2QVYX 5FNZA 2AG6A 3AESA 2HIGA 2W71A 4IFEA 1PSZA 1X6VA 4AZ3A 4EG6A 1TPYA 3T8YA 3MG9A 2O0LA 3OT1B 3LX8A 3SLKA 1OD6A 1C3VA 3HNRA 3CXRA 1HZZA 4ZKEA 1SZDA 5J63A 2BL4A 1MKYA 1P4SA 2PKQO 1GYRA 3OQPA 1AQIA 4JEMA 4LYGA 5KQPA 1VBNA 4L8YA 2Z8YM 4HLQB 3ZW8A 2JJMA 2XZLA 1N0IA 4QLAA 3IPLA 1LSJA 5LA6B 1E3LA 4JP2A 3VH2A 4CMEA 5M2QA 3IJRA 3K0AA 1P2VA 2KE5A 3D8HA 4KRXA 1VKNA 2JJ1A 3HDJA 1A4RA 3QM1A 3PE6A 4LXIA 4YJ2F 2HU7A 4XFKA 4C3VA 4IVQA 1V5WA 2ZIFA 3U1VA 3BICA 3M83A 3RRXA 5BP7A 4V1CA 1IG0A 3V8PA 2P77A 3Q7RA 4EZBA 1PJBA 2BE9A 4MA5A 2ZS9A 3KOMA 4GL2A 4Z2YA 2AQKA 1G21B 2JFVA 4D79A 1U5CA 1XNJA 5F5XA 5DXAA 3EDRA 3RANA 1B4DA 4M1QA 3ICEA 1TKAA 4LDQA 2VP0A 2AEMA 3ZWOA 1UQRA 1OX4A 2H2IA 5LVAA 2XHZA 2Z3ZA 3FGNA 2LCIA 1X80A 2RBGA 5HJEA 2DF8A 4FOTA 3PEFA 3U4GA 4M37A 2FPIA 3K70D 5CB4B 1OXMA 1EWTA 3GUYA 3JQ8B 4R1UA 4JK3A 4N82A 4PANA 2J9XB 2I3ZA 4XD2A 3T7EA 4OHXA 2RHTA 3PIDA 3UJ8A 4OHPA 1AQNA 2ZCJA 2NZWA 1BNCA 3BD9A 2H1VA 3Q1LA 4IO1A 5ALWA 3GNQA 3KYDA 4K7JA 1YZGA 3R0IA 2QTVA 2A1TR 3VO9A 2IYAA 3U4IA 1E5XA 2IYNA 2ZTMA 4GP6A 4IHQA 2PL9A 2Q46A 1UZNA 3CVJA 3DL0A 4R6XA 5DTRA 1A1VA 1Z5WA 4P3XA 3PPYA 1FDUA 5EWMA 3B6JA 1H8HD 2OXEA 3JQAA 5TQ2A 2QAGC 2W22A 5HG0A 3AP1A 4QTUB 5LDDC 1QV7A 2DKFA 1XLTA 2IYZA 3CR7A 1IULA 3HWWA 4PHTA 2EL7A 3NIWA 1DADA 1A98A 4WCDA 5CJPA 3ZWYA 2DUMA 5CNIA 4D8TA 2D2EA 3BE5A 4D98A 3BK1A 4J0HA 1UJMA 5J2TB 1KVUA 2UYGA 2VDLB 3CINA 5IAEA 3SNKA 3T9FA 3TD6A 4JC0A 2XCRB 4XYGA 1PZGA 3SHFA 2MINA 4UTPA 7YASA 1MFZA 1GGEA 1U8FO 1MJ5A 4GSYA 5GVSA 1HR0B 2DTEA 3CLVA 1TO1E 2C5LA 3HACA 3F7OA 3HBJA 2HRRA 2QX6A 4G0MA 2H5LA 4ZHQB 3WYEA 5ALEA 3I1FA 1XQYA 1QHGA 3Q41A 4O4HB 4MNTA 4EF5A 4E14A 3L7KA 4C4OA 3EVZA 3ZCTA 2PGAA 1FPMA 4WKBA 4ZAYA 1SUEA 4AZWA 5EJ8A 1QDEA 2ECPA 5BOSA 1GSAA 3D6UA 3IILA 2CE7A 1RR6A 1T2UA 1OC4A 2Y0PA 3L0DA 4ENSA 5GIOE 1PFQA 1BMFD 1U1EA 4IO0A 5TVGA 5KNLA 2RAFA 3ODGA 2QMOA 4HDAA 1GTRA 2XV1A 4IFBA 1QG6A 4B5LA 1FLVA 2OD2A 1WPGA 4PAQA 5B7NA 5A2QA 1SOWA 1MOZA 1TAQA 1I2DA 1SNYA 1C4XA 1NQOA 3KOOA 2CVFA 2QTRA 3WJ2A 2NZUG 4C78A 1R5OA 2WYHA 2HREA 2RDMA 1OFIA 4RLHA 3SBDA 1Y7TA 4F60A 1FCJA 521PA 2P11A 3HFSA 1NPYA 1JDTA 2J45A 2GERA 2IYVA 3OZWA 3QVKA 4HYQA 4W7IA 4P3OA 4YUVA 3KO8A 2B83A 5A7GA 1NBEA 1SBNE 4UQOA 1HI9A 1R5NA 2C42A 3KL2A 3ZHVA 1TZ2A 1HKUA 1SK8A 1H0SA 2HQBA 2GK3A 4CKBB 2YKGA 4B4DA 4E5DA 2KBFA 5IKOA 3L2OB 4KNWA 4UCWA 4C0QC 3WDMA 1KHTA 3DTTA 3QPVA 4QTTB 2IEDA 5H70A 4DAEA 2D8MA 5B1YA 3NGLA 1QQBA 3DV9A 3TZHA 4NU6A 1OWNA 4DLXA 1K75A 5KPJA 2H11A 3GN1A 3UO8B 4IIYA 2GK4A 4JSTA 4KR7A 4HUQB 1MZVA 3ZGZA 1E9VA 1C1XB 3P9PA 4KMOA 3WWCA 1AH2A 3VOSA 2QUAA 2OKCA 1SU6A 1A7UA 3DL4A 3QLEA 4BS9A 1QQTA 5H7XA 3VZRA 3FHJA 3LBYA 2XTAA 4F6RA 1ODKA 1EHCA 2IS2A 4QUGA 4XWTA 1MQ8B 1RJEA 5CDSA 2V45A 1M2NA 1S4MA 1GWNA 1ZYUA 2CDNA 2G8NA 1SVUA 3DBRB 3L7AA 4HAIA 5EWLA 1F0NA 2VN8A 1Q0TA 2BTQB 1UJ5A 1N2CE 1V41E 2VQ6A 1EIZA 1KI4A 3FDXA 4GI1A 4WOCA 1B6SA 5FUWA 4DG5A 4QTYA 3LUPA 5DBIA 2IBMA 3Q88A 4GEGA 2JRCA 4RKEA 3R5KA 5BN5A 2WNHA 2Q4OA 3AHHA 4P2BA 5HK9A 1FUEA 2PKRA 4LK3A 4C0XA 5JC1A 1DJNA 3ZYZA 5LBTA 4CN9A 1U4OA 1WV1A 2RD2A 4EY6A 3QPUA 1YWGO 1KDTA 3M5WA 4ZK2A 5JT1A 3JYHA 3TS1A 1E2PA 4QFMA 1T3ZA 4RVFA 2J3LA 2DRIA 4TPKA 4XQ0A 2HHJA 3QE4A 5CJ2A 2F3PA 1QIFA 1FQJA 3EYWA 3WICA 4P5EA 3B1WA 3AB7A 3SZOA 3F3KA 3ZNQA 3QXSA 4B7XA 5JDCC 1C9KA 3LZDA 3ICVA 2Y1LA 2ONYA 3BRCA 4KPGA 4CEJB 1ZIXA 1FDVA 3M5DA 2QL7A 4B35A 2YVAA 1MG0A 4E0BA 2NU9A 4UHBA 1T36B 2IYSA 5HRAA 1E8MA 2HSEA 4XZ3A 4CT0A 4D6PA 3ZX4A 5DYTA 1KY3A 2VTBA 3ORRA 2BMAA 2IOQA 3TD9A 4BBZA 3VH3A 2WJIA 3EFOA 4IKPA 2BEVA 2R7AA 1QKJA 2RK4A 4Y0VA 2MMGA 2FMHA 2QPLA 3JWHA 4P80A 1HNZB 3TRHA 4K3VA 1WBDA 1WZCA 2B21A 4NEHB 4M0MA 5EKUA 2YNMD 4F6RB 1IB6A 2GKSA 3UT6A 4L50A 2P4SA 4XVUA 3LNTA 3GCGA 4L0DA 3PHCA 5AVOA 1F9AA 2GT1A 3E35A 1OCEA 5L4NA 4TZ0A 2YTZA 1WA5A 2BZGA 2EOAA 4Y2UA 1TUBB 1YXMA 4FMCB 2FR1A 1ZGAA 2HXSA 4Q4AB 3CNBA 3JPWA 2A5YB 1UKEA 1AGPA 1YIDA 1BOOA 1X1DA 1YRLA 4UU8A 4JA2A 3AESB 1W5FA 4Q9LA 4ATNA 4B81A 4C6TA 3MCVA 1G66A 4MUJA 5FEMA 3RFTA 4AZ3B 2JEZA 2W43A 5L53A 3W5VA 1U9IA 3CGGA 3IIKA 1R0XA 3D4LA 5B3JA 4GXQA 3UH0A 1H85A 4B7UA 3R3SA 4FVTA 4F93B 1ZL2A 3QYFA 3KUDA 3I2KA 5K3OA 2XVZA 3KEMA 2QTTA 4I8DA 3H4TA 2ZBUA 5FIUA 1I3KA 1TEZA 2P1RA 5D8DA 4YV1A 3IHKA 2HTEA 4D57A 4I1SA 3FSEA 1E98A 2CB0A 2B69A 3K0AB 9LDTA 3H5RA 1BEUB 3G1TA 1LU9A 4XGIA 4ACBA 3PGVA 3EQ8A 3L8CA 2JCBA 2CEKA 2DUUA 4FTWA 3WNVA 3HCAA 5CAEA 5CDUA 3MAGA 3TZ6A 2CKMA 5FBHA 3CB2A 3QKSB 4XLZA 3BDVA 4K2AA 2ZIXA 4R1PA 4V1CB 4TWIA 3F6BX 4J1TC 4MUBA 5B30A 1HE3A 1TF5A 1CS0A 4DA7A 1NWHA 2HCFA 2XQGA 3C2QA 4C1BA 4HWPA 4TX1A 4HN4B 3RSGA 1PFKA 1JQKA 4CTMA 4ZO9A 5C1OA 5KTMA 1RAEA 3F4BA 3RSHA 2GHQA 4DEVA 3QHQA 3UJCA 3K6JA 5K0GA 3ZGYA 3B1ZA 3ESAA 1AM4D 1BGXT 1FP6A 1OX4B 4ARBA 2ZR9A 4EUNA 1X80B 2PLWA 3KAKA 2VHZA 3NYIA 2OQIA 2FI1A 2FPIB 1U9ZA 1QYVA 4I55F 4LDRA 4NX2A 2OXTA 1OH8A 5EERA 3RV3A 1CDOA 1LQUA 2X2FA 5ALDA 1ZGJA 4FB5A 1XZQA 2FH5B 2Q3FA 4Y9RA 2IODA 4NWIA 3HFRA 5DKFA 5L3QB 2Q3LA 1G9SA 3KYDB 3L7BA 3N6VA 5AI6A 2NUTA 2QTVB 4QDZA 1QLWA 1CY0A 4TVBA 2E6KA 4XUEA 5E6UA 4LGCA 4D97A 2WA1A 3OKFA 4TUYA 4BZQA 1B8OA 4AULA 3CZCA 4G0QA 3MZ0A 5T4EA 2Y76A 3NUGA 1DHTA 5EWMB 1IMOA 3JQAB 4EJMA 1KO1A 3B13B 5TQ2B 2Z5LA 3OO0A 1KJYA 2QPOA 1V5GA 3DHNA 4Y1RA 5TXGA 3G9TA 1E1NA 2BONA 2VPXA 2X4DA 3OTQA 2GF2A 3I5YA 3IVCA 3U3ZA 2VAMA 1JKFA 2P9ZA 3S27A 4F21A 3HXOA 3JD1A 3MCWA 2HDWA 3NDBB 3DTYA 2G5CA 4P34A 4AROA 4OHZA 2IQIA 4IXTA 4IDHA 1QWOA 2C07A 4FK8A 3PR1A 4TMTA 1W9MA 1SEPA 4DSOA 2MINB 3G0IA 2ST1A 4LW8A 4OSOA 3I8SA 3IAAA 4OU5A 2W2MA 1E62A 1T25A 2BFNA 2O6HA 4I19A 4D25A 1LDBA 4FEYA 2DETA 2DHRA 1AQUA 3GT4A 4PX3A 3NTUA 3PXCX 2Z5VA 4NMMA 4ZTBA 1LK0A 3WR5A 4HSEA 2YQ4A 1BEZA 1OROA 1JG2A 4IDOA 1BU5A 1L7NA 4NARA 2YOFA 3SS7X 2DR3A 5BOSB 1LDYA 1XDZA 2J5XA 1QYIA 1WQ4A 1S1CA 1Y1QA 3EMKA 3FF4A 4FQ8A 4DMLA 3PC7A 3PXDA 4WK0B 1B6RA 4LWZA 1AK1A 1V1JA 4GI2A 2QRMA 2ZI5A 4J0CA 1F4VA 1FX0B 4JJ4A 3TDMA 1ZISA 2I6TA 3MQ4A 3UICA 4QU8A 2ZRBA 3BGIA 4GLJA 4GLOA 5IYZF 4DCUA 5FPKA 3I01M 5LOVF 4G5QA 1ZOPA 2G07A 4INAA 5JROA 2D6FA 2PO5A 1MC1A 1GQRA 4D8WA 1EVIA 3FOCA 4MQEA 3BK7A 4K9RA 3B1KA 4MUYA 3FXAA 2PM8A 4ONEA 4PHHA 5AW6A 1VJCA 3PEWA 1B8UA 1M34E 3U13A 2Z8ZA 4KL8S 2ORIA 1JECA 1KDOA 1DBSA 3GJ0A 5DW3A 2BHRA 3MINA 4B6JA 3N76A 2IS1A 4ENQA 4WXPA 4KIJA 3BGSA 2PD4A 3EZYA 3MMZA 4H7DA 4MW6A 1D8AA 2ZIUB 3B51X 4RSGA 2I3AA 1R9JA 1P18A 3T15A 3G85A 2Z2JA 4AICA 4C03A 3GGGA 2A1UA 1ML4A 5CA0F 2E4ZA 5JEDA 1XHFA 1Z83A 1OE0A 2BELA 5GM2A 2O9JA 1YQTA 3W3AH 3CZMA 1ZOLA 3P0JA 1QZTA 1I3NA 5KVQA 2VUIB 2RKWA 4DLZA 2VXYA 3RBZA 1GPUA 1KEEA 1U3TA 3CEHA 3MUEA 2CYBA 2IOHA 3HB9A 4WXMA 2JK1A 3KBBA 3NNNA 2BP7A 1NA5A 3IE2A 3DMTA 4FYKA 1Z5UA 5JOQA 3ML1A 1ISSA 2R4UA 3QITA 4J49A 2FMXA 2VDWA 5EWLB 5KYTA 1J09A 1C9DB 4IJWA 3FPEA 3K71B 4QL3A 2Z3VA 2CCJA 3C16C 1UDWA 5BPFA 3FOWA 4KWTA 2NYRA 2BN4A 3V34A 5D2CA 2Y2UA 5JPDA 1TAUA 2P30A 1OWOA 4BLRA 4D0GA 5BN5B 5JNLA 2X5JO 1WMFA 2HSZA 4GOOD 3KLNA 4P33A 1M72A 4I8IA 1HZZC 2E4YA 3MA0A 4X6YA 3T9BA 3W5UA 3WL4A 4YIHA 3RGGA 1DFHA 4QXOA 1UXGA 3ORSA 4RV5A 2I8LA 4RJKA 1FP7A 3S2FA 5B57C 2P6MA 1A95A 5CIQA 4I4LA 5ILQA 3ZXIA 3FTEA 3VKHA 1TK2A 1K7EB 3LKBA 4CMEC 3N07A 3BB4A 4JJ7A 4LQ4A 4QXRA 1BMDA 2H06A 4MRSA 3L7LA 2FWAA 3DZCA 1SG6A 1OFUA 1VIVA 1ZKDA 4B3FX 2JRLA 5AM4A 2DFVA 3NTRA 5HF8A 3U7GA 4PBTA 1DMSA 3AP2A 3BDIA 2J6IA 1U3GA 4OB8A 3TW0A 3UENA 4FNMA 3H8WA 4R68A 1ILWA 1JDBB 1R0WA 2C7QA 2EGGA 1DAPA 1J24A 3K0EA 4FZVA 2NU9B 5J1TB 1UUFA 3H4IA 3LC7O 4AU1A 1JT2A 2PTGA 4FBMA 1NXQA 2NSHA 4COKA 4OAQA 4Y9TA 4DR6B 1X9HA 3EFOB 3T1HB 1EFHA 2BEVB 2XTJA 3IR6A 2ZITA 5IN5A 1TGVA 2V6MA 1AGRA 1BFKA 2M6RA 4P7GA 5C1IA 2IKQA 2I1VB 4J90A 3VSEA 3ZU5A 2YC4C 1J7JA 1F4LA 2G71A 4EPVA 1WZNA 2OB2A 4O2BF 3QUCA 3TQIA 3RGWS 5CP8A 3TPFA 3A1WA 4KK3A 5ETJA 1KAHA 6YASA 2M6SA 2UUAB 5IU6A 2K2QB 3VDQA 4AMZA 4B32A 2G3YA 1R66A 1Z08A 1EZ4A 3MT0A 5A5EA 3OQOA 2PWZA 1Z2DA 4CCWA 1U3WA 1ZR2A 1U94A 4I2NA 3TUIC 2C4VA 1YZQA 2WJPA 3VX3A 2Y1KA 4IOJA 5DXJA 4Z2AA 5CB8A 1BHJA 1RPJA 3NDIA 5MN6A 3OCUA 2ZW9A 1P81A 3E1KA 1HE1C 2O1EA 4UULA 4C6TB 2Q5JA 2EW8A 5DLEA 2ETXA 1AXEA 1SCJA 1WG8A 2GZ1A 3D5TA 3EXG1 2O8FB 2TMGA 4I4NA 1R4NA 1K5GA 1XLTC 2BOVA 2IUFA 2XNSA 3BXOA 1JFTA 3P9YA 1UKBA 5IDVA 4B4VA 4PINA 4PIMA 3BZBA 2YY6A 2CXTA 3T7CA 1RADA 1J8DA 3KKPA 4KPFC 1X74A 2AR0A 3IOMA 4MWGA 2LZ0A 3A7DA 2XAUA 3NEYA 1CP3A 4BFZA 2FP3A 1QK5A 3A9WA 2RFLA 3DOUA 3SCZA 3SDSA 3UNXA 4FLEA 4OGKA 1RAHA 1U98A 3NEAA 2HQOA 1P4AA 3HMKA 1A9ZA 1HC7A 4N8DA 1DAOA 4YBZA 4ZVKA 5CAEB 3AHEA 3ZDRA 4A5SA 1E99A 2ZCVA 2ZIXB 1WCV1 4JNKA 1XXLA 4LTDA 5HIJA 3RS3A 3T6KA 1B42A 4YJ3B 2H57A 2PUFA 1YU9A 4LMRA 4BQQA 1CRLA 4Q82A 1CS0B 1RKUA 5DM70 1UKYA 3M89A 4L8FA 1S6YA 2X4LA 4XIGS 4BJ1A 3IP7A 4D8YA 4GMHA 621PA 3QJYA 4AJEA 4KYVA 3VUFA 3I72A 2C5AA 4B75A 1Q0LA 1VIYA 2A9KA 4JB8A 4BQRA 1E8NA 1DKLA 1F7UA 4OYHA 1G7TA 2PLRA 2GTHA 2JFNA 1IMJA 3AK4A 3GH3A 3CH6A 3KWMA 1FYEA 5E3JA 3EUFA 3O8LA 3THOA 3DQZA 2Y1EA 3EOBI 3EPPA 2OQVA 3L1UA 2FW6A 2JL1A 3CZQA 4LBWA 4RKFA 2PD3A 2R86A 2XKKA 4UEWA 1PUJA 1L3CA 4WZ6A 2N9UA 4EJFA 5L6MB 5HZHA 1VSUA 3WYGA 3ACDA 3OU7A 5HF5A 2QX7A 2EU8A 3OESA 3DR5A 4KAXA 2QLTA 4MWSA 4QU5A 3DAOA 2JG3A 5E6UB 2PUAA 4CCYA 3FOBA 3FZYA 4NKRA 5BWNA 1T26A 4JJIA 3FSGA 4ZP1A 4DMCA 1JLLA 4CFYA 1WMSA 1CFJA 1TCUA 1WXIA 2PZKA 2WFZA 1R27A 2W83A 1U2GA 2WJ6A 4PLFA 5NULA 1NVVR 5EL0A 3T5BA 3V4OA 2HDHA 2J59A 3EGVA 4HX2A 2VTEA 1BXKA 2AX4A 2HCRA 1COWD 2NNWB 1QNLA 2V7EA 4Y1RB 4BQEA 1JIVA 1S89A 2HK6A 1HE8B 1PJ2A 2A9JA 1I2MA 1QE0A 2NZ8A 3LPMA 4MV5A 4Y6SA 5GONB 1YJCA 4RAQA 4ZD6A 4OQMA 2Q27A 5EJGA 3V7UA 2R3SA 1D8TA 5FBLB 1YF3A 4N3CA 4X7BA 4B8ZA 3PDUA 4MVJD 1CY4A 3DDSA 2IF2A 3CVOA 5ADWA 1ZA2A 5JCZA 4C7MA 4HUTA 1G8FA 1P4RA 1YK1A 3TIFA 2BPOA 3GLIE 4UC0A 4P7BA 4UHKA 1N2CA 3V8VA 3BZUA 2PR7A 5IBPA 2C2OA 4M54A 3LBNA 2PJRA 5LQRA 1SQSA 4HQRA 5MF6A 2Q3DA 2D74A 2JH3A 3C1AA 2FV8A 1G9TA 2GH1A 2NSYA 4URFA 3TL6A 4NG5A 2XQIA 3I2YX 4L72A 5DV9A 2FR8C 1HUQA 4P4TA 3LLCA 5CA1F 4L8WB 1UKZA 4GYWA 1SU8A 1J1UA 4MS4A 1OLSA 3D6HA 2XVAA 2FN7A 1QFSA 1RYEA 2GA8A 1T9BA 3A3OA 2IBSA 2WJHA 4GVPA 3F7MA 3URKA 3G0DA 3E05A 3L84A 4K81B 5F51A 3SM3A 4BIMA 2X0IA 4J0DA 4WKGA 1VL6A 4X3CA 4I81A 4E3ZA 2HWXA 3T1QA 5FOTA 4Q12A 2AD5A 4Y3UA 1H5QA 4U7DA 2WPDD 4Z7NB 3VZCA 2W2KB 2JI9A 3PQ6A 4I1UA 4L78A 1P17A 3GW8A 4BKPA 5CDFE 1T8YA 3CSDA 2R6ZA 2ZYSA 2BZ0A 3L05A 2YMMA 1THTA 4NNPA 1QLJA 3WGZA 2PFSA 2PH5A 2JFFA 2R62A 4MQEB 3ZKWA 4B4KA 1JH8A 4A23A 2AKAB 4I5EA 3LP5A 1LS6A 4DMHA 1IEXA 1XNHA 2O48X 2D0DA 4MB0A 3GBSA 4RKWA 3CMMA 2H54A 4Q1BA 4OY3A 5GOTA 5ILOA 1QGYA 4CU5A 4F8EA 2WMNB 1OVMA 2WV9A 3HJHA 3OX2A 3QJ5A 1OYYA 1JDBC 1U7UA 1U0EA 9LDBA 1VPLA 4RESA 2WSIA 2I7TA 1P44A 1JDPA 2FE4A 1OLUA 2HO4A 4TRMA 1VHDA 3PFHA 4ZO8A 5HILA 4H3VA 1YIAA 3O2QB 4RFSA 2FLVA 4W82A 3VJMA 4B9EA 3DLHA 4E09A 3CZ4A 3WLEA 3GJ3A 3CF4A 1R8JA 5EVCA 4E2ZA 2A1UB 5DSXA 3HJUA 4B40A 1WDWB 4X7PA 3WK8A 2R85A 3LXXA 4PEVA 4QJBA 4JP1A 5EJEA 1KMCA 1DRVA 1VDMA 4C5CA 4EPWA 1NNSA 1V0JA 3DBHA 3ENZA 3PRYA 4BMSA 1KEEB 1Z17A 1KU0A 1D1SA 2IFTA 3S68A 2BP7B 1LCIA 2VZEA 4RMHA 3UT0A 2ZBQA 1ELOA 1HPLA 2M98A 3RADC 1SHZA 1XUOA 5G4KA 4WXHA 4LSGA 3M1LA 1MNQA 2VDWB 3GIDA 3H05A 2BJHA 4IPTA 2JW5A 3SYLA 2E87A 3T4EA 3WLQA 3WJ1A 4H3SA 1ZY2A 3HSYA 4JP3A 4LI3X 3M82A 2CXUA 2FSHA 5DN6A 4LFCB 3REQA 2ZM5A 1NC3A 3SQWA 4N0MA 1WF6A 1XDUA 5CTAA 4GZLA 2ZJAA 3AO0B 2I0FA 3CLUD 4GU5A 4J0QA 4BN0A 1KVTA 5JRJA 2ZI3A 5B3JC 5F3DA 4GR4A 4Y7CA 2XYRA 5D5HA 1CF9A 2R00A 2COKA 3RK1A 2B3TA 5FR1A 3PLAE 4YCJA 3QYPA 1AE1A 1T5DX 3OQIA 4OG2A 3FHTA 1NL3A 4YJHA 3NVMB 1AO3A 1OHHA 3D31A 1XPRA 1QAOA 2HJRA 2ISQA 1B6TA 2OZKA 1HMYA 3KSRA 3WXBA 1I24A 1MA3A 2JANA 3HCNA 3IXLA 3FVWA 3N58A 3NOXA 5DGXA 4RSHA 1EPUA 4M0LA 1BYIA 4CIXA 4K26A 1Z5OA 2AW5A 1DKOA 3O4HA 4IW3B 5IARA 1SVSA 3Q5EA 5FFMA 4CG3A 4DN6A 4B3SB 1EVEA 2GN6A 1F38A 2VRNA 4JI7B 2EV9A 2CN1A 4CHTA 1YJ8A 5IHPA 3NEPX 1PEDA 2X8LA 3NHFA 5ECYA 2QTGA 3LA8A 3U3XA 5ANRB 3CEPB 2MTBA 2QRPA 2ZUFA 3I2FA 3WWDA 2ZJ0A 4MO2A 3WLTA 2WOOA 4CV2A 1NVFA 3AUFA 3HP1A 1S7CA 3ND9A 4UU7A 3R3XA 2G0TA 3AKYA 1UMKA 4B2PA 5EZYB 1ZGCA 1VIAA 2BMEA 2V6GA 4GDMA 4PGAA 2PT7A 4QQNA 4ETMA 2EG9A 1TMGE 1Y89A 4AZ0A 3UJNA 5EIEA 1T3TA 2OFXA 3PD7A 4NYIQ 4XX0A 1I80A 3ETCA 3EEYA 1TKBA 1ULUA 4BFLA 3L1VA 1H1LA 2QSUA 3M3HA 3ZBUA 2Z2IA 1T8UA 1YSCA 1T2NA 2FG6C 3LC2O 3R7AA 3R7WA 2C3YA 2PUVA 4WKOA 4UU0A 4LJ6A 1EGHA 4BBAA 1NQTA 1UBLS 3VKWA 5FEUA 2LWIA 3E48A 4MIOA 1GZ4A 2BFFA 2XSZA 4YREA 3I39X 2I2WA 1XFAA 2P5YA 3V7NA 2W7TA 5HS4A 5JLAA 4KR9A 4EY3A 3DBIA 1GUAA 5H3CA 3SXJA 4LMBA 5AIBA 1W7AA 3AR7A 3LFUA 1M8JA 1PZHA 1Y3AA 3QLVA 1NBOA 4M0DA 5A4KA 3MPUA 2C98A 2II6A 4J9VA 1E6CA 3GFTA 1PKEA 3KZNA 4E94A 4ZYZA 1LBQA 3B8EA 1T2AA 3C1UA 4FINA 2CJXA 1N5DA 4IVPA 1GPDG 1E1LA 3EDQA 3GJ8A 3QVVA 1WEKA 2EFJA 4YASA 4RANA 3H1FA 2FQ1A 1EHIA 1QAQA 4OP1A 4EUSA 4QAJA 1OYOA 1NXWA 3HCDA 4YJDA 4S1NA 4Z9AA 2WTXA 5EUQB 1ZK1A 4JI4B 1K2VN 4G4JA 3TG8A 1PGPA 2PK3A 3LIIA 1V16A 3WE7A 1D5CA 5I7OA 2PT6A 3EZXA 4KQ9A 4V0MA 4F2GA 1Q5PA 4I2VA 4DCTA 5JSUA 4II3A 5JAIA 1F6WA 1YZFA 4MWEA 3VPSA 1G8KA 5G53C 5WRFA 4TS3A 1IN8A 1XTTA 1HFKA 2EG5A 3HJTA 1IQUA 2HMAA 2GXAA 2NIPA 5JYDA 1W75A 2R6FA 1GADO 3EWIA 5KJ1A 3FOZA 2AN3A 3R1IA 3ICQB 1MV5A 2CVHA 2KMLA 4FSXA 5GJCA 1JAXA 1SU4A 3DEFA 3I76A 4YT5A 3ILSA 3K9CA 3O47A 5A4DA 1GN9A 4QZVA 4C0JA 2F8SA 2D7DA 5K6RA 2OBFA 1CWUA 1Z2AA 3FJYA 4KMRA 1WD7A 5EPEA 3IQIX 2JBAA 5BN1A 3V1YA 1M34A 1J2JA 4H59A 2VNSA 2FUNB 1KQ3A 1GTMA 1Z7YA 1DQZA 2B1JA 5AW5A 4ZTZB 3PA8A 1PQYA 5FWYB 3KLPX 2OP1A 1FSFA 2A4KA 2BMFA 1E1CA 1YR8A 4RPJA 1Z4MA 2WHQA 3GBPA 3BD6A 2Q8NA 3ELDA 4I50F 5CNJA 3ZPXA 4EFDA 4TVOA 3IH5A 4AY4A 3FNEA 3BIWA 3J7TA 1RXIA 3LT1A 4JOSA 5AJXA 3VPDA 4CCYB 4Y2YA 3R5SA 1JLLB 3GPDG 4ZYXA 5DX8A 4K6GA 4FLMA 5K20A 2C9CA 3KPWA 4EHFA 1NMYA 3W6UA 4ZT6A 2TMKA 3LL4A 3HB1A 4P4LA 1QC5A 3CFYA 4WGGA 2X19A 3IPYA 4LGVA 2DWUA 4MJXA 3WA6A 1TUGA 2B34A 1D6NA 4MS1A 4CQMD 1XMVA 4BKQA 1BMTA 1KOFA 221PA 2JAUA 3N39C 4BNGA 2CL7X 5C8DA 1B15A 1J2RA 2QTWB 2V0CA 4OJNA 1AZWA 1LGYA 3DGEC 4ZO6A 1YE5A 2LNDA 2PFGA 4G01B 1SBHA 5I51A 2OHIA 3R5HA 2GS9A 1IY2A 5D00A 1WVMA 3O8QA 2FOXA 5BR4A 1J90A 3SYRA 4DV5B 1QXSA 2A6PA 2PCLA 1PQPA 3L1JA 3OA2A 4OHMA 4EB8A 2VJLA 3ZY3A 4FOPA 1FJGB 1TDJA 3H2JA 1DKUA 3HM2A 1BS9A 4YFYA 4Z4GA 1ENPA 4YMUA 1YRAA 2IQ5A 4FGSA 3VHRA 1DQYA 4PLWA 4MS4B 3VNQA 1OLSB 3ZGOA 3ZXYA 1TYEB 2GFHA 1UJ4A 2NO9A 3O4VA 3IMGA 4BNZA 3CRMA 3GGDA 2X3UA 3C45A 2P65A 3KZCA 2NVOA 5EKSA 1JPVA 3AUKA 3GVHA 2RAPA 3N8GA 4WECA 1Z6TA 1PNTA 3ROXA 1GTZA 2GEJA 5A3SA 4RF5A 3UH1A 2PFKA 1DPGA 2CV1A 3X1YA 4D4IA 3HK2A 1SC6A 3GP5A 4KDEA 3D4NA 3U3MA 3CPHA 2PE5A 3C4VA 2F6RA 4PO8A 3QPWA 3C98A 1RYYA 1C5KA 4P4NA 4GZ6A 1ZN7A 1X87A 3WGKA 4JI2B 5H82A 4DDHA 1M10A 1LPOA 4YPFA 2QA5A 3ZKWB 2YW2A 4RXTA 3W3AA 2YVLA 4A26A 1ZXBA 1P91A 1VA5A 1EDDA 1KZ7B 4WK4B 2WUGA 5DHTA 3ZOKA 3HU1A 1XWFA 3DB2A 2V7UA 1EM6A 3QX3A 3IEPA 1AB5A 2QN6A 2V9ZA 2Y0CA 1YH3A 3RBXA 3SVZA 3CVUA 1OLUB 1EDBA 3E9EA 1O9GA 3ONWA 4RFSB 3WZLA 2MYNA 3UANA 1X39A 3CZAA 4QOSA 2VBCA 2ZBVA 3ZBPA 1J56A 3LLUA 4RZUA 4QEKA 3TQSA 2EZ4A 2PMCA 1CR2A 1VKHA 1Z26A 2I66A 3MTBA 4ME6A 1MU0A 4YQZA 5AKIA 2QDXA 5JQGF 3GPCA 3OMWA 1V48A 3A7EA 3DBHB 4OTZA 1KDYA 4MV8A 1UDAA 3TZCA 1RWNA 3BORA 2O2GA 1CY8A 2G77B 2EKQA 3T99A 3E9CA 4ESHA 1CUUA 4OQZA 4JJGA 4RTMA 4WEOA 3F7NA 1L1QA 2DY0A 2WAXA 2PS0A 4Q1AA 1Y9JA 5IBRA 2G83A 1F6BA 3C15C 1I0LA 2FB9A 2IEYA 3O03A 2QLJA 3L0SA 2EHDA 3I53A 3REQB 1E64A 1V39A 2ZRPA 3O1LA 4UQLA 3JCZA 2V5VA 1ZVMA 1BQ4A 1GTSA 2ZT7A 3BCSA 2WAYA 4IMJB 1N6HA 5IBCA 3G5AA 5HIIA 3WK5A 5J2UF 4JSYA 5J58A 4KUEA 4PQYA 4B44A 3SC6A 5KNCA 3VPXA 2NX2A 2Z1NA 3GEPA 2DP4E 4E88A 2PT5A 3OQIB 4JQOA 4YJHB 3T9DA 3GR6A 3ZU2A 3U17A 3B6MA 3H1AA 4QJIA 3GFVA 1MX9A 3ER6A 2WUEA 5F7ZA 3U40A 1NURA 2OVFA 2QT0A 1TNDA 1WUJS 2ZUCA 1XDBA 2ZVQX 2WWHA 3GGJA 3PP8A 4N9QA 4Y2HA 1DIHA 3SPXA 4ZYUA 5ADHA 2AUMA 1P77A 1V25A 3B1XA 4IIVA 1XKXA 5DGCA 1ATZA 1CG6A 3S55A 3WV4A 3ZGLA 4BLUA 4DNOA 3QEBZ 2AJTA 5CTJA 1AUQA 2PWBA 3E3AA 4MWDA 1QGDA 4EF4A 2FSVA 3K2BA 1FDTA 1M2HA 2GPBA 2P8JA 1YUMA 4FNAA 4M8LA 2IHNA 1K8QA 2PZMA 5LOVA 1PN3A 3WC4A 1JHRA 5IYZA 1VP3A 4R5MA 5D6OA 1DB3A 4GX1A 5F73A 1QMPA 1SC1A 3O38A 4AY3A 1R12A 1F2VA 4RZHA 3SHQA 2GZHA 2I99A 4BYGA 4AZ0B 3QXGA 1RJFA 4CYMA 1FRZA 4DUGD 2B7LA 3DOEA 4XX0B 2JIDA 1X7YA 2QE6A 1H1LB 1GRVA 1N0VC 1U7HA 4FW9A 2EEPA 3PUYA 4IJMA 4WE3A 4Z1MA 2PVPA 1QZXA 2Z8YA 3R7WB 4B4WA 4IXMA 2FN3A 2V8BA 1G8AA 2OL4A 4CL0A 1S3IA 1GM5A 4CU2A 1FFBA 4YRBA 5AKLA 5K6TA 1QE3A 3AILA 4HXGA 1YQWA 2BDEA 2VAXA 4KMSA 2BFFB 2XT0A 3AW8A 4R9RA 1CUHA 1JEAA 4K5QA 4NHEA 2AHRA 3OWXA 3DULA 2ZIGA 4KTTE 4OXQA 5E7JA 4JD5A 2YWDA 1XCLA 3UT5A 4BNJA 4XQCA 1EINA 3UOGA 1U2GC 2CY0A 5CFZA 3IO3A 4EG3A 3T0FA 5KKNB 1VZ3A 2P1ZA 2G6BA 3M2TA 2J0VA 4KJXA 4Q4LA 5AK0A 2Z2ZA 1XD2A 4UMDA 5B58T 3GLIA 5KAMA 1NBHA 2FSFA 4UNNA 4KSCA 4RABA 2IEGA 4WDRA 5D7BA 3KEQA 4G0NA 1TRKA 3WYAA 3LDAA 1G1MA 5JNVA 3E15A 1N1GA 1JEJA 3GDOA 3X2EA 2FPUA 4LJ9A 4AN4A 1A77A 2ZIVB 1GUYA 4MRAA 1C8BA 4PY2A 1HORA 4AKGA 2BEWA 1GUDA 1TJNA 1Q0HA 2PJUA 1PGJA 3MMNA 1CJBA 1Q95A 1V16B 4MYCA 4R2XA 4R51A 3SDBA 5KVVA 4B6SA 4ZAGA 2RSLA 3RC3A 2V9PA 1ESDA 2WDPA 4TXHA 2Z04A 1RM3A 4RKRA 2O0KA 1ODCA 4F1KA 3WHKA 4RV4A 2R6R1 3PB3A 3TFQA 4FN4A 2RB4A 1H3EA 3CBQA 1YOBA 2HU5A 1OH5A 3FPKA 2RMKA 4G26A 3V1KA 2HHHB 5EYPA 5TDHA 1ISMA 2GLUA 4QT0A 4RK1A 4LEIA 3T7SA 4ZYWA 1A8IA 4RY8A 2Q0SA 2GK7A 1QTRA 1C2TA 4FKZA 3ETGA 4PYIA 2YS7A 1U3UA 4YAFA 1B14A 2FWRA 5CDFA 4S05A 3AF0A 4DLPA 1G3RA 1SWVA 1D2MA 5IBQA 4K9LA 1Z12A 4S24A 4XQEA 4E4YA 1N5MA 2QBYA 1XWIA 2QRLA 2PUHA 4FR0A 1RM5A 2JBAB 4FFNA 1QJ4A 3HN7A 2P6UA 3OZCA 4IOMA 1UPCA 1M34B 1ZPDA 3OPNA 3I6QA 1B43A 4W7SA 3TB6A 3WSVA 2RGBA 2XADA 3WJ7A 1DDOA 1DL5A 1O89A 1MRZA 3E9MA 1E1CB 4KODA 4RFVA 1VL2A 1H66A 4EPTA 2DPLA 4HC4A 1HDEA 3DL7A 3CVXA 2HLNA 1NW8A 4RBNA 5BMVA 4W5JA 4LDZA 1S2NA 1L5RA 2IZ7A 1J7KA 3R5TA 1A50B 4XDYA 5HUJA 1ZBDA 1ENYA 1QH8B 1SXJE 5IKPA 1KI7A 4EKGA 2QX4A 1YL6A 4NMLA 4ZYLA 1ITZA 4O2BA 4OXKA 1ORVA 3BKXA 1FNDA 5AQEA 2PBRA 3S1LA 4S0XA 1DJLA 4J7AA 4A15A 5BNFA 2Y1GA 4F9FA 4DB4A 4WBXC 5DISB 2BEUA 1QC5B 1AK2A 1E1YA 3GD7A 4X6XA 3AKZA 2BCEA 3KLBA 1ZK3A 2C8LA 2X5KO 4MS1B 1L8AA 2O2YA 1YL5A 1R6TA 3WB1A 3CRW1 5EHQA 1KK2A 1WPQA 3CVYA 1EE2A 4BVAA 2I8CA 3FY4A 4XYMA 1JF8A 4DLSA 5FYDA 2VNKA 4EW3A 3H4VA 4K6OA 2GNAA 3B89A 3M81A 4H60A 2XB6A 4HFRA 3NQ41 4MJ3A 1DFGA 1N2ZA 3RPEA 4M2LA 3NB0A 2GTIA 2ZKIA 1N57A 4AS1A 1E2MA 1PZMA 1AVTA 2C5HA 5L9AA 3OZDA 1R8QA 2QSZA 4BP9A 2VDJA 2LW7A 3PC6A 4ZAXA 4H27A 4FGZA 4Z9YA 3D59A 1OZAA 1D1TA 3E7PA 3I6YA 1XTKA 2WJAA 3ZK8A 1CJSA 4Q3BA 1D5WA 4DLYA 2D1FA 5KQLA 2XH8A 1L5HA 3OZIA 4AC9A 1JPNA 1YCHA 3QE2A 2BW0A 2HF7A 2YC2C 3OUZA 4ZALA 1VE6A 2B1GA 3P52A 3UJ6A 5LL6P 1N0HA 2IOYA 2R00C 3MMSA 3OE7D 3AEYA 4JVNA 5ESRA 4RMNA 2OAQ1 3LXUX 2Z57A 2C4MA 4ZYTA 4CKCB 2JGFA 2Z4SA 1A9RA 2XE7A 1ANKA 1GAXA 1ZX1A 4IH1A 2BY4A 4EKNB 4AN0A 4X63A 1E79A 1F17A 3D0RA 3F5SA 2C7OA 1K8RA 1NQWA 4AI6A 1UM8A 1EK0A 1Y80A 3M9XA 5DN9A 3ZWKA 1RCTE 2JLBA 2VF4X 4P3NA 3NFRA 2JCYA 2YW9A 5GOZA 3T1VA 3UW1A 3W0LB 3N6RA 1O9HA 3NRCA 2L69A 3DTVD 4AO8A 1EFDN 1L4GA 3AP3A 1ESMA 3P2MA 1TTPB 1J6UA 4PZAA 3U48A 4D3YA 2AEJA 2XEDA 4U63A 2YOGA 3HUFA 1XGKA 3UYKA 3D3NA 4LV5B 3WP0A 2VQ3A 3L93A 3PFCA 4KB5A 1AUPA 5CFOA 1W48A 1KZ1A 3H1GA 4NFSA 1TMOA 2EJUA 3RR2A 1FFGA 3DMRA 3TBKA 1TO6A 3E5HA 2H2FA 1IXRC 3BBLA 3X1JA 4BEJA 3WRVA 1JVNA 1SHKA 3OQHA 1IJEA 1JEOA 1W5BA 2EDAA 1GRNA 5ESDA 5GJVC 1Q7RA 4UBMA 4G0PA 4RMJA 2P4EA 3ME5A 4IZHA 1C1DA 1QH9A 2R4TA 5H02A 4DZZA 4ZREA 2AN5A 2OCBA 1ZCZA 4LC9A 3G7SA 3U9LA 3FA2A 3STVA 1AF7A 1N36B 4YXWD 5FUVA 4BDTA 1M2WA 2POCA 3HV0A 4Q6WA 4US1R 1N6RA 1L7DA 5IN4A 4QRIA 4X45A 3D2CA 1UPUA 1CIVA 2M32A 5HA5A 2DQKA 2M2IA 3JWIA 4JVLA 4CV0A 1RWOA 2OCXA 3AR9A 3GH1A 5AR1A 4C7BA 3T1YB 4Y98A 2VT7A 2VSYA 1XZIA 1USWA 1Z62A 3TBHA 5I7VA 4DAOA 4X6LA 4QULA 1QCYA 2FZWA 3K05A 4YLGA 4DBLE 1FRVA 1SCKA 2VCEA 4JEHA 5AP9A 2B6NA 4XOUA 3M70A 3BN3A 1JN0A 1LI5A 3UUGA 1XPOA 4R2LA 2OBYA 3WBFA 3WHPA 1I01A 4L4RA 4OJTA 4TV8A 4DHEA 1O96B 2Y9PB 2WM2A 3ZCVA 3L4SO 3O7MA 2YHBA 5JS6A 5EKDA 1P6XA 4JLKA 3HUTA 1PS0A 1CZLA 5JWRA 2QTNA 4TMXA 1H23A 4LJKA 4FZRA 4M3NA 2ZE8A 2A5FA 5FWAA 4L74A 4X8MA 1U2ZA 1FJ2A 2AQHA 1DQNA 3COVA 3Q5DA 2V7XA 3Q2OA 1K8YB 3PFBA 5LLDA 2H1IA 1SVMA 3CZPA 3K6RA 4JLUA 2ACEA 4TSFD 2FJUA 4YGYA 4D80A 1T9GS 1A9QA 2GCOA 4I1YA 2HBQA 1BDIA 5AUNB 3NDPA 2DKOA 3BXXA 3LI2A 5L45A 2I6GA 2X2OA 2H18A 3TQCA 3TLXA 1V9LA 4G81A 4K9NA 4ZK6A 1QGED 2G1UA 5CLQA 4EJSA 3FGZA 5GADl 3WBBA 4XOIA 4PFSA 3A3KA 1X7YB 1A9TA 1SFRA 1MDBA 4FZ3A 4MYTA