3O1IC

Crystal structure of the tors sensor domain - tort complex in the absence of ligand
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
298
structure length
298
Chain Sequence
DEKICAIYPHLKDSYWLSVNYGMVSEAEKQGVNLRVLEAGGYPNKSRQEQQLALCTQWGANAIILGTVDPHAYEHNLKSWVGNTPVFATVNQLDLDEEQSTLLKGEVGVDWYWMGYEAGKYLAERHPKGSGKTNIALLLGPRTRGGTKPVTTGFYEAIKNSDIHIVDSFWADNDKELQRNLVQRVIDMGNIDYIVGSAVAIEAAISELRSADKTHDIGLVSVYLSHGVYRGLLRNKVLFAPTDKMVQQGRLSVMQAAHYLRHQPYEKQASPIIKPLTPKTLHDDTIEESLSPSEYRPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO.
pubmed doi rcsb
source organism Vibrio parahaemolyticus
molecule tags Signaling protein
molecule keywords Sensor protein TorS
total genus 88
structure length 298
sequence length 298
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o1iC02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o1iC01
1E6LA 2A9OA 1M5UA 4MLDA 1QNLA 1Z18A 3C97A 5ABPA 2IPAB 2N9UA 4RWEA 3SM9A 3LOPA 1JFVA 3SAJA 1P8AA 4MR7B 1K68A 1RXIA 1D1QA 1FQWA 4KREA 3VNAA 1ABFA 1NXTA 2KYRA 1ZH2A 3OLZA 3O1IC 1NATA 3W9SA 1R8JA 2FW0A 4IMIB 4LZLA 3QEKA 4RY8A 4KFCA 1I3CA 3NNSA 3CTPA 4XFKA 1JFTA 3I09A 3N53A 2QVCA 2H3HA 5BR1A 3HUTA 2MSWA 3LUDA 4RSMA 2HQBA 2R47A 4NQRA 3N8IA 2L18A 1SRRA 2WMYA 3MQ4A 2PMCA 4F06A 3FFXA 4GPAA 3M9WA 3O75A 2PE5A 1BVHA 2HQRA 4TLLB 4Q7EA 3RVOA 1QQAA 1DG9A 4OG2A 4ZMSA 6ABPA 2GWRA 2JVJA 3NHZA 1AB6A 3KKEA 1QP4A 1KGSA 2OENG 4PZ0A 5BRJA 1S8NA 3GBPA 1CEYA 2E4UA 4KMRA 4KZKA 2FTKE 3UKJA 3OQNA 4D74A 3H5WA 1Y1LA 1MIHA 1JH9A 1IIBA 4JA2A 1USIA 1XHFA 2NT4A 5HKOA 2A9RA 1L5ZA 4RK0A 5TQ0A 2FEPA 5JS2A 5IEJA 1WETA 4RKQA 1GCAA 1Z2DA 3G85A 2HPHA 3Q7RA 3VNBA 5F64A 2IPNA 1W9HA 4Y9TA 5TPZD 2FN8A 3EULA 4JAVC 4KVFA 4N76A 3T38A 2NZUG 2QV0A 4MPTA 5I4CA 4MQFA 5HQJA 4EVSA 2LBPA 2PUCA 1SD5A 3H5VA 3OO1A 3O2SB 4G0OA 1NXSA 5EWLB 4OLAA 1Z13A 1RPJA 4MS1B 2A9QA 1NXXA 3OMXA 4Z4EA 3LUHA 3EODA 4MRMB 3EDCA 1NTRA 2P4UA 2QXYA 1BDHA 3SY8A 5TQ2B 4RY0A 4ETIA 3H75A 3HSYA 3Q41A 4HNRA 2Q5CA 1Z26A 5KWSA 1JYEA 3OM1A 4MS3A 4YGXB 3LKVA 4N0QA 3LMKA 3I42A 5IBQA 5EWMA 4DN6A 3KYJB 2F8SA 2PUDA 3LFTA 3N0WA 3A0UA 5TQ2A 3F7NA 1ZDMA 3IP5A 4MQEB 4E7OA 1ZY2A 1E2BA 2GKGA 3T95A 4O1HA 4LRQA 5CNMA 5TPZA 1AB5A 1LBIA 2FQWA 4Z4GA 3Q15C 1BAPA 2B4AA 2HQOA 3N0XA 2WWVD 2PUGA 1P6QA 1D2AA 1ZGZA 5FBHA 1M2EA 1DRJA 1LJUA 1EWVA 2HJ9A 2JBAB 4JP1A 4HNSA 1JDNA 1YMUA 3JVIA 5IC5A 1PUXA 3R0JA 3RVRA 1ZHHA 4O5AA 5CNKA 3KLNA 2PUAA 3EQ2A 3LUKA 3GL9A 3E3MA 2FVYA 5BQ3A 4XLTA 4Z9AA 3LUFA 2AYZA 4RS3A 3KSMA 4WUTA 4D6YA 3TB6A 3MIZA 2IPMA 2RGYA 4W5RA 1ZITA 4TMYA 2MSLA 3HCWA 5GOTA 1FFSA 1ZH4A 2MYUA 3RVPA 3FMVA 2FLKA 4Z4FA 4N03A 3BRSA 1VRVA 3ROTA 5EWJB 1PNTA 5ED4A 3I45A 5E3JA 2FEWB 4PYRA 4EGSA 2CWDA 3QLUA 4RKRA 3IP9A 2ID9A 3RH0A 5FWXB 3EAFA 5DCLA 5JNSA 3D8UA 3DZDA 3K4HA 3QX9A 3RVSA 3HK2A 3IDOA 3HVRA 1A2OA 1DBQA 3OQOA 2QZJA 4LE1A 3QLUC 3IPCA 1HEYA 2QU7A 2FN9A 5FWYA 4XAQA 2I6FA 3DGEC 3F6PA 4YLEA 3GWGA 2TMYA 2WB4A 3M6MD 4GNRA 5CHYA 3T6KA 4YWHA 3IP7A 4UHJA 4FB4A 4NCBA 1RXEA 1GUDA 3CZ5A 4FE4A 4ZYLA 4G0ZA 1D4ZA 3OMWA 4QYWA 4CBVA 1BDJA 1SXHA 5C5CA 2F8TA 3S99A 3BREA 1NXWA 2IOYA 4KQ9A 3FGZA 1A04A 5KQMA 2JBAA 5CNJA 1DBPA 3CFYA 1F4VA 1FSPA 4RDCA 2PAFA 1NXPA 1D1PA 3L49A 2NT3A 2MYNA 2GI4A 4B09A 2P9HA 1BDIA 4EYKA 3A3KA 1MVOA 1OXBB 3O1HB 5BRAA 3MF4A 4RU1A 4ZJPA 3BILA 1DRKA 3NNNA 4WWHA 4NCAA 4NV3A 2PKXA 2IPLA 4OATA 3TO5A 4RK6A 4MGEA 4Q6BA 5JNTA 4Z4IA 1OXKB 2M98A 3C3MA 3H1GA 2PL9A 1U8TA 4KQCA 1QO0A 4XASA 5EWMB 4F8JA 2O20A 4ML3A 4EY3A 1ZN2A 4QYMA 2WJAA 4G0XA 5EWJA 4KRFA 4JB2A 4TLMB 1ISRA 1JX6A 2LIVA 2PUFA 1LK0A 5JNWA 3N6VA 3H5OA 3IP6A 4KNYA 3JPWA 3N75A 1APBA 3OO0A 4IGAA 1JLKA 5GQSA 5D2CA 3TD9A 1LJLA 2E4WA 5TPWB 1RZRD 5C5EA 1DBWA 4FE7A 3G1WA 1KRXA 4YRZA 4JASB 3RVQA 1JF8A 3LTEA 2FEKA 1SXIA 3KTOA 5CNIA 4LX8A 1PHRA 3RVLA 3H6GA 4KPYA 1DC7A 1PEYA 4Z99A 1EFAA 3RQIA 4LE2A 3SNKA 2L2QA 3KLOA 4RXMA 3OLXA 3LUCA 2R4QA 1Z15A 3HEBA 5KQLA 2L17A 3BRQA 4EUKA 2R25B 3O21A 3F6CA 4QICA 4HYEA 2GBPA 3H1EA 2FSPA 5DKFA 1TLFA 1GUBA 2MYTA 1ZGGA 3GT7A 3RVKA 2XDYA 2PJUA 4G97A 5TQJA 3QEMB 1Z12A 3JTEA 3JVDA 3E61A 4MQEA 4WT7A 4O1IA 4W5TA 3FFTA 1DC8A 2PUBA 1USGA 4YCSA 1NY5A 1XHEA 4Q6WA 5B3JA 3FDFA 3HXMA 4MS3B 4MYRA 1U0SY 3URMA 4ZMRA 2NZVG 4P98A 2MSKA 1YK0A 3DGFC 1ISSA 1PEAA 3KYIB 4ETNA 1YTUA 1MB3A 1KMIY 1MAVA 3OM0A 4H60A 4YP9A 1DJMA 5KC9A 4MRMA 4WXEA 2QSJA 2E4ZA 3HM9A 6CHYA 4RXTA 3H5IA 2LP4Y 5IUKC 3GBVA 3LUJA 2MYPA 4Z0NA 4LE0A 2M1ZA 4RV5A 5EWLA 1YS6A 3CS3A 1C0EA 4MR7A 4RY9A 5KQGA 2DRIA 1U2PA 5DLEA 4MQFB 4RK1A 3GA5A 1Z17A 3MMNA 3B2NA 4OBBA 2BGGA 4TN5A 4JB0A 4IRXA 3SQNA 4ZPJA 3HV2A 3Q9SA 3QELB 5DTEA 3HO1A 7ABPA 2FMHA 1ABEA 1EWTA 4P1ZA 1VKRA 3CG4A 2PLNA 4Z4CA 2FMKA 3ILHA 4IF4A 4N47A 3EJWA 1E6KA 3QLTA 1A0OA 4W5NA 5JNRA 4KV7A 1TM2A 1USKA 1H9CA 1EAYA 1VLZA 5FWYB 3JS5A 4G0YA 2ID7A 4EYGA 1CHNA 5IEBA 1UDRA 5IUJC 1Z25A 1JWLA 5IULC 2L19A 2H0AA 3KS9A 1JDPA 2FQYA 3HDGA 4EVRA 4Z4HA 2A9PA 1EHCA 2V0NA 1GLGA 3CNBA 3NBMA 4PE5B 1QMPA 5FWXA 2ZWMA 4F12A 3I5AA 4RK5A 1QPZA 1XWWA 4HNQA 4EYQA 2QW1A 4RZSA 3ROFA 4YR7A 2AYXA 2WJWA 4PICA 4D6XA 3F73A 3NNDA 3O2JA 1DCFA 4QPJC 4MLCA 1K66A 1YVUA 1B00A 2ZAYA 3N0RA 1JYFA 4MAAA 2FMFA 4JOQA 5T3YA 2RJOA 1JL3A 3CRNA 2PUEA 3C3WA 5T7BA 2CHEA 3H5TA 3MM4A 5B3JC 3OQMA 1Z2EA 4WZZA 2YHBA 2VUIB 2QR3A 1TJYA 1JFSA 1MB0A 3DBIA 3OLYA 4MR9B 1DZ3A 2IDMA 2PL1A 1ZVVA 3QLVA 3JPYA 5IX8A 4MR8B 3FFWA 3GRCA 4G86A 1Z16A 3CZCA 1DCKA 2RJNA 3BBLA 3T8YA 3UK0A 4EVQA 2YHAA 3QLVC 4G0PA 4KK3A 4RK7A 4W5OA 3UUGA 4G0MA 3TMYA 1RZRA 2OQRA 2FQXA 1ZAYA 2FKAA 4IILA 4F3TA 4LDAA 2LUOA 3K9CA 3HUUA 3H1FA 1URPA 4YS6A 1TMYA 4F11A 8ABPA 3C6QA 3OLWA 4N0PA 5HSGA 3RVMA 4MS4A 1PNRA 4LDZA 4EYOA 2FMIA 1TVMA 2JK1A 4E7PA 3HDVA 5KC8A 3H6HA 3MA0A 2E4XA 3QEMA 4ETMA 3NHMA 4N41A 3KCNA 3A0RB 1FFWA 3O74A 1GCGA 4MS1A 4S05A 1DP4A 4KK4A 1JBEA 3EQZA 1P6UA 1QP0A 1KRWA 4IMJB 4YO7A 2HSGA 1F51E 4G0QA 3EGCA 3A10A 4L4UA 4H3KB 1NXOA 5JS1A 3KJXA 4XARA 2CD7A 2FXIA 3RVNA 4DADA 4MR8A 3QX8A 1M2FA 1T34A 3GYBA 2JCGA 3HJFA 3QK7A 2LPMA 5TQ0B 3DLHA 3C3KA 3CKMA 3P9YA 3L6UA 2JRLA 1YS7A 3Q7TA 3HS3A 1JHZA 5TPWA 2VUHB 4H3HB 1M5TA 5KI6A 5DGCA 2JVIA 4PEVA 3M9XA 2WRZA 9ABPA 2NUBA 2VYCA 3CG0A 1QKKA 1SXGA 1CYEA 3IPAA 5JNVA 2B1JA 3CU5A 1P2FA 3LUGA 5HM6A 5IUNC 1QP7A 3TX6A 4L85A 4M88A 3RVJA 3LKBA 1L5YA 3CLKA 2GX6A 4MS4B 4XXHA 3D02A 1QQBA 4OLBA 1U2QA 5JNUA 4S04A 2FLWA 2J48A 5FBKA 3JY6A 1VPWA 4DQDA 2E4VA 3CHYA 4WXMA 2CHFA 2IKSA 2RDMA 2R48A 4YV7A 4OTZA 3KG2A 3MYYA 4RK4A 4W5QA 1LBHA 2VK2A 1E6MA 5KQPA 2JVKA 3SG0A 1D5WA 1YK1A 3H5LA 3LUAA 4UHKA 2W42A 4RXUA 3HZHA 1QO0D 1C4WA 1RNLA 1FFGA 3GV0A 3ILYA 5TE9A 1YIOA 1J56A 2E4YA 3DLBA 1W25A 1EWKA 4Z9BA 5PNTA 4NICA 2IYNA 2X7XA 3OLVA 2WY2D 1NXVA 1BA2A 3O2QB 3O1JC 2QVGA 3KHTA 1ZESA 3Q7SA 3QELA 1DCMA 4MR9A 1U04A 2JB9A 1YMVA
chains in the Genus database with same CATH superfamily
2P69A 1DUIA 1M5UA 1P2TA 3HKCA 4MLDA 3V8MA 2QE7D 3BWMA 3DXZA 2RCYA 1I7PA 3K1TA 4D8YA 4KDCA 4ISBA 2TECE 3LI2A 4MZDA 1EVJA 1RJEA 4UNPA 5AICA 5BW4A 4R98A 1TIKA 1OYVA 2Q4BA 4JBWA 4QWWA 2CY0A 5DULA 2HYDA 1ABFA 2JBWA 5H8WA 3NWJA 1SQ0A 1U1FA 5GIOE 3ZEAA 4RHUA 2XQJA 3LGSA 1RWWA 2AR7A 2PT5A 4JIMA 3I09A 3N53A 3QBEA 1GPLA 2C5GA 4Y0VA 4DQVA 1E4VA 5JECA 1NLMA 1WPGA 2MSWA 2ZB4A 1XD9A 1N6RA 1PNOA 3BH0A 1R3DA 3WNQA 1H3NA 1EWRA 2NSYA 1RMQA 4L5IA 3TZQA 2GHQA 3TLMA 2Q50A 3OJCA 4GPAA 4WNYA 3DOHA 5CM2Z 2X58A 3IAEA 4BV2A 5EESA 1UP4A 5K8JB 4FK8A 4JHLA 2TMGA 4P58A 2V7VA 3DKKA 2CLMB 2OV3A 5MN5A 2VH2A 4JLJA 4MUAA 4AN0A 4UAUA 16PKA 2EFGA 3M0EA 4FSXA 1VKZA 1ILWA 2NN3C 1X1BA 2RC5A 4G23A 1R6VA 1T2AA 1UH5A 1GL9B 2ZVDA 4IJKA 1IIBA 5EMMA 3DVAA 4K81B 4Q47A 4TT3D 3GUHA 4ZO7A 3D3NA 3UK1A 3F6EX 2V7QA 1MAWA 3WS7A 5A62A 1N3IA 2BPOA 2OYRA 4ZZ3A 3VC1A 3MOIA 3BCSA 4MAMA 1Y4ZA 1CS4C 1JR4A 1QG4A 1W9HA 2JDID 3EZGA 1Y3DE 3GW8A 3PC2A 4NOJA 2QTRA 3EULA 2HHHB 1QONA 1QCZA 1CSEE 2FWPA 2R751 2QQGA 3Q1KA 4H7IA 3QUQA 2LBPA 1SKBA 3NEPX 3I0NA 1CR6A 1NF3A 1Z2PX 2D7CA 4P54A 1Q0HA 1ZRHA 3H4TA 2A9QA 2GETA 1FFXA 4CM4B 1MQ9A 4E1AA 4UTPA 3IFSA 4HS4A 1SXJC 4R0VA 3SXUA 4EG0A 1Z8HA 5AVRA 3EIEA 2WIBA 1H93A 2FPSA 3V1TC 2Q5CA 4TTQA 3ZIAA 4BCBA 1NQXA 5HYVA 4CLEA 3VC3A 1DBVO 3CE6A 2O2JA 5JAMA 1JTFA 3T5PA 5K0BA 3NANA 1P74A 1QIGA 3MXTA 3EZLA 4MQEB 2XKAA 4JLBA 1YRQA 3W2EA 4BU1A 1FXUA 1HURA 4BRWA 1U9YA 1F2VA 1GPWB 4G89A 3JAMA 1OZ0A 5KTKA 4G8DA 4YY3B 2YRFA 3MPOA 4OX9B 4O4JF 2CNLA 4DANA 5AXBA 5D6OA 3DDSA 3IAHA 3C3JA 2HI0A 5EXEA 3CPEA 3FXAA 4C7OB 3DBLA 1MLDA 3PDJA 3GUVA 5FBHA 1C7RA 5JXJA 2HU8A 1CVRA 2NO5A 3U5ZB 4D26A 1DRJA 4OVKA 1VSQA 2J9YB 3GB9A 1EX1A 4TRMA 5A7FA 1Z4OA 3IULA 4LKRA 5EP3A 2Q1WA 2W71A 2BRUC 4MIYA 1RM0A 3V8VA 4CQMB 5K8LA 4R1TA 4M46A 4HGZA 3GNSA 3EG9B 1Z2AA 3AQIA 2F3UA 2LIPA 1JAXA 5BWBA 5BQ3A 4EPRA 5KNDD 1RE0A 3ANMA 4HNGA 5DBGA 1Y1QA 4K26A 1VGRA 3Q8WA 5LP6B 4N3CA 1J9ZA 3GARA 4QJ4A 1RAGA 4HUTA 2BCEA 5K03A 3HDHA 3TGWA 1UBLS 2F1IA 3U31A 4XEHA 5C0OE 1Y6RA 4NENB 1A5SB 1T3LA 1W5FA 3D43A 5GOTA 3ZU2A 1CW2B 1UAYA 3A6LA 3MJSA 5FT9A 5THKA 3X0DA 4C0JA 5IVPA 3QXJA 3HI6A 5L4LA 3TW6A 3VU3A 3VZQA 4ZGBA 2EG9A 4KSBA 2C3UA 3OE7D 5BVHA 5FPKA 2O8DB 1P39A 2H11A 1GFZA 2JJYA 3FUVA 1IUPA 2IY8A 2ZJ8A 4X54A 5AJHA 4UXJA 2FEWB 2LCQA 2YWHA 2IEGA 2VHXA 3CE9A 1KFKB 3B20A 1UPUA 5EQTA 5YASA 3TCXB 4DSUA 1ZH8A 3LT5A 4LOIA 3I5XA 1E0AA 3F2VA 1UXIA 3EAFA 1XZBA 3MJHA 1XN4A 4WLVA 4DJJA 2IBSA 1JW9B 3NT2A 5C4IA 3IUEA 2ZTHA 1FFEA 2WLTA 2NVWA 3G9QA 4MUMA 1A9SA 4JJ4A 3LPLA 3U19A 1PJBA 1GT6A 1Q1BA 1W19A 3DVSX 1JI0A 4XDYA 4IVQA 4FN4A 4RW0A 2P2CA 2P5UA 3ITKA 3KZNA 2SBTA 2ZJFA 2JKVA 4I4IA 2JZNA 3JATA 4NABA 4Y67A 4YWHA 3UZUA 4FE4A 1ZK4A 4PXSA 1NXQA 4Q1DA 2GGSA 2XB8A 2XCIA 4LRWA 1U6JA 1OFGA 3PG5A 4JBIA 1A8QA 4ENRA 4QGAA 4QLAA 4J0DA 1J00A 4PZ9A 2PRIA 5AUNB 1TZ2A 5AHWA 3JQAD 4XIFA 1F06A 1KO8A 3UTDA 4EEZA 1AXRA 2F7SA 1AQLA 4R8LA 3MOSA 3KR1A 4G9EA 1YL6A 1PO7A 2QIPA 1KBOA 1W5EA 3LS2A 3DZHA 5BNWA 1YBHA 2RBGA 4B8YA 3LQFA 4AX4A 4CG2A 4P36A 1AZLA 1HZZC 1OV4A 2OORA 4ZO4A 5CT5A 2NVUB 4RL6A 3SJ7A 4WIAA 2P9ZA 4BB5A 4M38A 3U7QA 4BQEA 2XTAA 1GP2A 1FSFA 1WD5A 4MV7A 4UFOA 2FWJA 2GZ2A 1V2GA 5I9NA 2XTNA 1TKRA 4KAAA 5AD1A 3HLTA 3PCRB 4MPRA 3R24A 3ELUA 4KQCA 2VP4A 1JKJB 3E48A 5EWMB 2Q9UA 4YV1A 3ZOKA 3K09A 1XMQB 1CUZA 2OSBA 4HGQA 4L95C 4TMFA 3UA4A 1HE5A 5BPHA 5BVHB 2AQ8A 4BO3A 4W5WA 3VGPA 1AS2A 2I65A 3ZE8A 2UVPA 1ILEA 1H5NA 1GKLA 5ANRB 3ICEA 2LIVA 1KAMA 1ULBA 5A0VA 3N6VA 2H2IA 1HI9A 3UW3A 4EARA 4JSTA 2R87A 4ITUA 5CLFA 4K6KA 3JALB 3ZHCA 3OO0A 2WG1A 2DUMA 2FG6C 3UICA 4NULA 5AH0A 5K2MA 3TD9A 2XX3A 1A7UA 1VJTA 3D8BA 1C81A 3BGWA 3UT5B 3P0RA 1E99A 5AR1A 3LP6A 1WXFA 4RPLA 4I0WB 1PNVA 4YIHA 2AOXA 2YDXA 2D2VA 3HHPA 3H97A 4WMLA 1JV2B 3GPLA 4O63O 3UV3A 5TVGA 1SBQA 1S2GA 4FHCA 3AEUB 3PITA 1B73A 4XWTA 5K8VA 1OH8A 3WWOA 4U7HA 2YINC 1S3SA 3BQMB 3RIMA 2V5UA 2W4QA 3RQIA 5BWCA 1FJ2A 1ZVKA 4FYMA 5TMDA 1T0PA 3NJ8A 2ZETA 5JXHA 1V7PC 2I71A 3OC0A 4QYSA 4ABYA 1KP2A 4GRDA 3AI7A 1Y63A 1G291 1IE3A 1UBCA 4MMXB 3HG7A 3SS8A 1UL1X 1Z5VA 5CVUA 5BRNA 2Z6UA 5HZHA 3ZVLA 2XI4A 2W83A 1OE0A 1WZCA 2XMCA 3CNEA 1P2GA 5CRIA 1Y8ZA 4MJ7A 1F48A 4JODA 5EXTA 1RC1A 1ZIYA 3CZQA 3IEIA 1X7WB 1BIFA 4D9IA 4KXWA 4BMOB 4MTLA 5J2TF 3P8ZA 5KIAA 3AKZA 1IVSA 3ONNA 2Q2NA 2IZ6A 2O3UA 2QYHA 1SC3A 3EC2A 3TX2A 5J40A 4YCSA 5HRAA 1NV8A 3RAEC 3QVJA 4ARCA 3Q7IA 1J0BA 4BGIA 1WZEA 1J8VA 1JWBB 1R0XA 4LVUA 1RKQA 3SDSA 4P98A 3KYIB 4ETNA 3LHKA 4LNHA 3OG9A 4UBNA 1NRWA 2JARA 3CY6A 5EHGA 3YASA 4H60A 1E9BA 4ACAA 2J0QA 4D2IA 1J21A 2O50A 4MPJA 3SVZA 4OHKA 1G20B 3WIEA 4HL6A 4JLUA 2Q1UA 4ZKEA 4CM4A 3WLFA 1B1CA 2NQ8A 3OM9A 3QPDA 4PIMA 2P6NA 3QVSA 1K06A 1ZX1A 1JEYB 3GLHA 4DCGA 4BWGA 2VQSA 2QMUA 4EY6A 2CSUA 4KDRA 3QMVA 3TW8A 1WA5A 3MCWA 2PGNA 1EP9A 4HDNB 1VL1A 3G1TA 2OZEA 1NBAA 1VHJA 3HZZA 3NC4A 4KN8A 1F1JA 2ZANA 3KR9A 5COQA 1QGUA 4R0NA 3QELB 1RZ3A 1E2EA 2FSVC 4NV0A 1INLA 3S2YA 4DV2B 2OG1A 2W6CX 4PG6A 1XZPA 1EGQA 4Q3BA 3D0KA 5EHQA 3T3OA 4Y9DA 4X85A 3B70A 3KUXA 4ALKA 4EHKA 1ZA1A 1RBYA 3D81A 1TGYA 4ZVSA 2OO5C 3MJTA 5EE9A 3LKZA 4R6XA 4Z0TA 3UXEA 5HKBA 2VXBA 2PWZA 1XMJA 3CX8A 4BVHA 1DJQA 2DPGA 3L2OB 2WYHA 4KFUA 5EVJA 5LCXA 3TR5A 1II9A 1CHNA 3GVHA 2GEBA 4UOEA 3EGXB 1QH8B 3LOUA 4BP8A 4A1OA 5IULC 2OMKA 4TM7A 2R6FA 5C52B 3SHOA 4BGDA 4LJYA 1NONA 2FU5C 3H2YA 1ZL0A 2F43B 1G21A 1ADBA 2WF8A 3HN6A 1ZK3A 1FSGA 1XWWA 3CUSA 3CZRA 3E7XA 2PHZA 1H0RA 2PLFA 2Y6VA 2XRYA 3NOVA 4PICA 5AOAA 3UFXA 3M6XA 3W7BA 4E13A 5ULLA 3BHIA 3M7IA 1C3VA 4XX0A 1B16A 4QXMA 4XWAA 3ZK9A 4KQFA 4X0EA 1T4DA 1QOZA 1SHZA 3IQZA 2HV8A 3I01M 1VDZA 4MAAA 2PR2A 2FMFA 5A7HA 1ULTA 3IE1A 2OZLA 3GDWA 4FLEA 3WB1A 4ND8B 1JL3A 3U3DA 1PT6A 3DE3X 1J8YF 4CYMA 2YWGA 3GGDA 5KX5F 3UNXA 1N9ZA 3ES9A 3FLMA 2YNMA 4G4SO 3W4KA 1JEJA 2HFJA 3EDOA 4F2GA 2CNDA 4YO8A 3OOYA 2XMRA 7GPBA 4Z1MA 4IH9A 1KO5A 1KJYA 2QTWB 2WIJA 4J2OA 4Q1CA 1U0EA 2Y3IA 2IDMA 4AZTA 5M29A 2Y4OA 4UKDA 1Y4DE 3LF2A 2C3OA 4KL8S 1E3MA 3LRXA 2QS9A 2X9GA 1MTZA 2NU6B 3VPFA 3ZXUB 4Q3OA 3TZ6A 4OHZA 1P5HA 3MB8A 4MKHA 2HRZA 2QG4A 3OU7A 4CE6A 3VH2A 1UBGA 2AC7A 3IMKA 1H2ZA 4HB4A 2WUVA 3R3SA 3UUGA 4DJEC 3FOAA 4BC0A 4MUJA 2XKKA 1T2NA 1TM5E 4LQCA 4F3TA 1LX6A 1MX1A 1Y4UA 2W7TA 1XMXA 1UWKA 5B37A 4LDNA 4A2PA 3I4LA 1EFKA 1I6KA 3PU6A 3E8SA 3R09A 3BICA 3KOMA 4G81A 5DN6D 3CW2A 2AE2A 2G1JA 3KJNA 4MRSA 4EFDA 4QPZA 4ENVA 3R9KA 2BLNA 1J2JA 2A0KA 2JD2A 3L7OA 4KUEA 3W4JA 4YMHA 4L72A 5K3FB 2JBHA 1GSHA 4YRCA 3ZXXA 1CJUC 3W5VA 4WCFA 3QU7A 4DIOA 1NBMD 4TQAA 1EUYA 4JA0A 2BISA 2E4XA 1C3EA 2VEDA 4RPJA 5HA5A 4ZJUA 5FBWB 1IBKB 3VJRA 2Q6LA 1L4NA 2FPIA 4UTZA 3SF8A 1UJ4A 2ZCJA 4B3TB 1NF9A 1DADA 3AHCA 3VNUA 2ODQA 3EQZA 2VLIA 1EFHA 5DTMA 1O87A 4OLFA 1N5RA 4ER3A 1D04A 2O5CA 1PP4A 3NTOA 3OFND 1OH5A 4HFMA 3A9UA 1KMNA 3FAKA 5IAEA 2REQA 3RYHA 3X1DA 1TMKA 2JLBA 4JKYA 3OJOA 3UB2A 3AB3A 1LVHA 3PFIA 2VO1A 5MF6A 4QGBA 1C0PA 5JZVA 4KJXA 3EFHA 4QDZA 4CQLA 5TT1A 3UTCA 1A82A 2OM6A 3ZCUA 5KSPA 1KMQA 1AQ6A 3C8MA 3KR2A 4R51A 2V5AA 1YQUA 3IDSA 1IZYA 3OBBA 1E2UA 2HMAA 3KJGA 3UJPA 4TLDA 1D2EA 3ETEA 3WLIA 4KWHA 1NVEA 1SNYA 1CERA 1A27A 3G0IA 2SCUA 4KGZA 1NW7A 1CZKA 4UCFA 5EP4A 2HMWA 2P1ZA 4N49A 1XRJA 2C88A 3I53A 2HJGA 3VX3A 3PB3A 4D0GA 1E1LA 4G2TA 5C1BA 3LG2A 2GSWA 4CM8B 1EX7A 5A5EA 1FDSA 1YD7A 4OHXA 4M1OA 3ZUGA 3AIMA 1GZUA 5HVNA 1T10A 3RG2A 2PGAA 3GLUA 4CU2A 1WMDA 1B0PA 4MXDA 4W8HA 2NO7A 4L2IA 4NV1A 3JY6A 2ZRIA 2J31A 4C43A 1PVOA 1O6GA 2P3OA 2B5WA 2RDMA 3L05A 5BSTA 4YV7A 3ABIA 3CEJA 1E1QA 3RTAA 3W6UA 1EM6A 2GA9A 1DWOA 4WCVA 4BNFA 4L74A 1FDUA 4YYZA 4ZICA 5KPJA 2XSZD 1K63A 3Q3IA 2ZWIA 1NF2A 3R44A 4UHKA 2DFTA 5BNFA 4ARVA 2P2YA 1T5OA 3U6KA 2V9CA 3EUAA 1HO3A 5EJIA 4CDGA 3F6RA 4BASA 1YOVA 2HMVA 1YQTA 3FN4A 4HDSB 1SOUA 2CWWA 3FPJA 3SF0A 4IDAA 6ADHA 3LK6A 3CKKA 1V4VA 3OPYB 2QVGA 1E1QD 4BMCA 2BGWA 1W96A 4BB9A 4G5GA 2JG3A 2WFLB 4Q34A 4EUKA 1TFUA 4A15A 3G0DA 1SHLA 4IEIA 1PT9A 5EEGA 1X7HA 3GRVA 1SGWA 1NDHA 2HMSA 3RUEA 5KO2A 4F45A 3AINA 3AI1A 1NVMB 3FWPA 1E18A 2EKPA 4CLHA 4A8TA 3UAXA 2J6BA 3TKAA 2A5FA 2PWBA 4Z3OA 4YRRA 5AUPB 1ZH2A 3AY3A 4GX2A 1M73E 3Q1LA 2GDJA 1XVAA 1KJJA 4UHFA 1N5LA 1PJTA 4C4RA 4EQZA 5SV2A 3OHSX 2D2IA 3WRYC 4ZQGA 1OPRA 1GILA 4XUDA 4F60A 1N6HA 3ETCA 1KMHA 1WXHA 1REQB 4YRTA 5LB2A 1Z6YA 4ZI7A 1N57A 1VBNA 1R0SA 1UXJA 1XCGB 5CU7A 3LU1A 1RQLA 4K46A 5DISB 4Q3EA 5F5NA 1KFJB 1GAQA 4BUZA 1JIJA 4DMCA 2X0RA 1CY0A 2G28A 3BMXA 2Q27A 4CN8A 3K6SB 2DPXA 1OA0A 5JBIA 1KA9H 2I2AA 3PHBE 2G63A 4MARA 3PUHA 5JAIA 3AVUA 1PAUA 5F3DA 3IIEA 1JKXA 2NVBA 2AUMA 2JPDA 3L6BA 4V39A 3DHYA 3OU2A 3D2AA 2EFCB 4M7WA 2QG6A 1M1ZA 4WNAA 2CLKB 4JUCA 1G8YA 1OBOA 1THMA 1BGXT 2XITA 1SWVA 3P9NA 4ZT4A 1O57A 2E55A 3LPAA 2ZJ0A 1VYHA 2P77A 1NN1A 3EXIB 2NP6A 5I7HA 3JQBA 3TFOA 1D2HA 3M1AA 2HGZA 4F9TA 1BMFD 1UC5B 4HBGA 5TPZD 4KVFA 3V97A 3QOFA 4MPTA 2QV0A 4DV0B 3K7EA 3ZCTA 2J9FB 2ODTX 1LS1A 3AF6A 4M55A 4RIIA 2Y92A 4X24A 4JX8A 4C88A 2BYTA 1D0SA 3AR7A 2WUGA 2OQVA 3PNVA 5AKJA 2DCMA 1NL3A 1RYZA 3DMDA 3UEOA 2HV9A 4E4TA 4R2JA 4UTRA 2W6NA 2X4LA 2VHCA 3EMBA 4I9UA 1NUTA 4WDRA 2P4UA 2NTJA 4V38A 5HF5A 2H31A 4X6XA 4ETIA 3E9YA 2XGGA 1BS9A 2JAUA 2BR4A 3HSYA 1RPZA 5KWEA 1ZMRA 2EJBA 4QTUB 3RU2A 1DBSA 3P26A 1PS0A 2G4VA 5FTKA 1XN1A 3PXAA 2CLOB 2GN2A 1CB7A 2RK6A 3IC5A 5FPSA 2F8SA 3E7PA 3KUDA 4E7OA 1NVXQ 5EIXA 3COVA 3K1AB 2ECQA 2NG1A 3I34X 4ZODA 2GXAA 1EQ2A 1FF9A 3A6DA 4URZR 1FBTA 1B41A 1RXUA 4HSGA 5ED4A 1EBUA 1VI2A 1LBIA 3H11A 4KLRA 4CG3A 4V0LA 2NVUA 2VDJA 1MPXA 1FBNA 1G5QA 3LPDA 2XHZA 2A86A 4DC1A 3ADCA 4YACA 3TE6A 1D2AA 2ACEA 4G4SP 4NJMA 4HSEA 2QUBA 5DNDA 4FFLA 4G5SA 1O94A 4TS4A 5AIBA 2IL1A 1YO6A 1Z07A 1MX3A 5KEIA 1YMUA 4HAOA 3FPBA 1EK5A 5FJIA 1L5KA 3VU8A 2WWGA 4HEA1 2R8ZA 4K6GA 4QEZA 4RY2A 4M0UA 4JL8A 1TVEA 1EGAA 2ZIXB 2C29D 2D00A 2PWPA 4XFJA 4XLTA 5HF9A 4PNPA 4IRMA 3KFVA 1ESMA 2GKSA 4NVRA 4Z4QA 1YZNA 2GCIA 4D6YA 1O0BA 3HJUA 4HAWA 3IT0A 1BXKA 4NAUA 4ID9A 1P0PA 4J94A 4N5MA 3OCWA 1Z5PA 1I0IA 1A50B 1G18A 3VUEA 5CLGA 5TVKA 1CIJA 1QV7A 1RHKA 5CYFA 1U0NA 3KDPA 1RMYA 2OXFA 2C5LA 4OQEA 4UJ3A 2HU5A 2XT9A 2YWBA 2V54A 4EJ2A 4LHXA 4CWAA 1NBME 1JUDA 5EJ7A 4Q03A 3OT1B 3RC3A 2ZYGA 1TUBA 5HBGA 2XQFA 3RH0A 3RV4A 3ZDZB 1L7OA 3ISTA 3ZIDA 3ZN2A 1ZGHA 3D8UA 3C48A 4J3FA 3IDOA 4GC5A 1AKNA 3J7AC 5U4QA 3KXDA 4QT0A 4WEOA 4L51A 5TF4A 1Q74A 2ECKA 4Q7QA 5DHQA 3TF5A 3TGLA 3RBXA 3D6JA 2W6JD 5TARA 7YASA 3L8ZA 5JWRA 4HEQA 2ZCUA 2CV2A 1NU8A 1SXHA 3CLUC 1T13A 2E4AA 1JIQA 2CB9A 1A96A 2C4TA 2DTDA 3FDIA 2WAXA 2IOYA 4N01A 5TGDA 3VHRA 2H57A 1CBUA 3ICQB 1TEVA 2VF7A 5FPPA 3FGZA 4YRLA 1B8PA 1E61A 5CFQA 3CFYA 1DAHA 1BMDA 1KH3A 3L1KA 1R0BA 1VG9B 2X9QA 4GKAA 4DMKA 4EZEA 4ZYUA 2GVZC 4M0DA 4PTLA 2XD4A 1C4OA 1SELA 2O57A 5SY9A 3O1HB 1MQSA 3RAPR 1PBTA 4BNTA 1DINA 4IUBS 5DNYB 4MDYA 1KVSA 4ZJPA 4QYXA 5H83A 3HB5X 4JYBA 1C7IA 3G49A 5IT0A 1OVMA 2D74A 3FVQA 2VF8A 3C3MA 5FP0A 3FMOB 4C21A 1NOKA 3K0SA 1UOPA 2GEDA 3LBNA 4EY3A 1O6BA 4HNVA 1Y33E 3AB8A 4BN0A 1FK8A 4PVDA 2PXCA 3T3MB 4XVHA 1JHDA 3DPSA 2YY6A 1FZQA 1W9MA 2JD1A 4LRSB 2PUFA 1KAEA 2WD7A 3ER6A 1IY1A 3AUSA 4KNYA 2QTZA 3T52A 1AJEA 1PEKE 4XJVA 4FFWA 4F7DA 1V8BA 1JR2A 2VZ9A 5KYNA 2IP4A 2GF2A 4LVNA 3KIPA 3TL6A 5BN3A 1A9ZA 2RHDA 4NYJQ 1U9IC 4GG1A 1ZBDA 3D6UA 4EHBA 2YTZA 3TK1A 1ZN7A 3EXEA 4YRZA 5A2GA 1N6KA 4G41A 3EPKA 1KI4A 2XVMA 4PYIA 1ID1A 1ADCA 2I3AA 4RA6B 1OI4A 4W99A 1SCJA 2VOJA 4QFBA 3L1IA 1SKYB 1W1UA 4G09A 4AT1A 1OXSC 3IJRA 3N2IA 5A9SA 2HHLA 1U0JA 4MGIR 2G3YA 3EVEA 4LE2A 4PC6A 3T7TA 3KLOA 5ER9A 1XKLA 4YAOA 5KQLA 4C7OA 1KEPA 2FSHA 3AUUA 3O8OA 3JYPA 1KY3A 1HE3A 1KI1A 2QX9A 4I4TF 5LMCA 2R11A 3OMLA 1NNI1 3R77A 2XOXA 4JYCA 4RKWA 1CUAA 4ICIA 5IKEA 2GD0A 2G7MC 3EOZA 4XTRA 3HKDB 2ONJA 1E3QA 3IHKA 2I99A 3AR9A 4G97A 1O54A 1HTBA 3W90A 4RTRA 3VXKA 1VLMA 2GXSA 3HQ4O 3HBMA 1PR3A 4LQDA 2VPYA 1J25A 1P4SA 1KEEB 2FQQA 2VSFA 4H2DA 2BM8A 2X1MA 4GBED 3DHVA 3CUUA 3HKEA 3URMA 4RVNA 2EF1A 4BNHA 1ECBA 1ZNZA 4US1R 4ZHSA 3KQYA 5CCXA 3JASB 3O8LA 2D62A 3WGTA 4CUZA 5FLYA 1GGFA 4MRMA 2Z2IA 1CXZA 1M74A 1X15A 4GL4A 4XVRA 5FWAA 3A9SA 5JSZB 3PHCA 2JLVA 1F5NA 1S2MA 2MYPA 1C2YA 1VCHA 2RGDA 2RMKA 3DHWC 2NYAA 3IOMA 2WAYA 3Q9LA 3OEHD 4FOOA 5EWLA 4JCOA 1ESNA 3F74A 4DKXA 1YOBA 4OAQA 3BTSA 1U2TA 5DLEA 2AFRA 4YA6A 5AM5A 1Z45A 3RARA 4S1WA 1NQTA 3P5BA 3U16A 3ZGYA 4E3WA 2NU6A 2QRNA 4MCJA 1RJ9B 4E2ZA 4Z9FA 4X60A 2M32A 4LDPA 2GJSA 1J7KA 2PX2A 2ZIUB 2XLBA 2ZTUA 3IS3A 4HH1A 2IITA 4D0LB 1XTBA 4BO5A 2JIMA 4GX5A 4YP7A 3DCNA 4DQKA 3BBPA 3QGMA 1E79D 2Y05A 2H59A 4MB2A 2G6TA 2XQVA 2JHFA 2HF2A 4WPGA 4XRRA 4ZAGA 1UFQA 1EDZA 1VLZA 1RS0A 4EYGA 2NMVA 4FNGA 3C7CB 3NLLA 4MYTA 3PBKA 1TKCA 4PNZA 1LPSA 2BFFB 3UIEA 1U1CA 5CEJA 2WYWA 3LBFA 3UMJA 1MT0A 1KDVA 4OFWA 3RT7A 3T5BA 3VH1A 3W1WA 1UP7A 2HWXA 4F6LA 3MEQA 3LP8A 3AVXA 5DCWA 1EHCA 1NT2A 3LT1A 1ODCA 1H65A 3DOOA 2JLRA 2O0LA 3AVPA 3TVYA 4EYQA 4G1BA 3NM6B 3VO2A 3VPBA 1XNJA 5BV2P 4HWPA 3GFBA 3NTRA 4MITA 4R7TA 1HL3A 2PUTA 4BFLA 4CMCA 2Z0MA 3NRCA 3JZMA 1TQ6A 1QQTA 1W94A 2P5SA 3AXSA 3WL6A 4I55A 1HT0A 2PJDA 1U80A 3HUFA 4R5MA 4R7GA 4F96A 1A1VA 1CF2O 2WTBA 4JOQA 1MGPA 2OKGA 3FTCA 1HDCA 2PSEA 3QQ5A 1XRNA 2NTVA 3WMWA 5C18A 4FZRA 4P0TA 3DZCA 2C00A 4AIRA 2CDAA 5ARBA 5HNKA 2QN9A 3EWIA 2YJ3A 1RZUA 2RH8A 4UXIA 1YS1X 2ODWA 4REOA 1WDMA 5E1DA 1PKXA 2QL7A 2FZKA 4PZAA 2UXBB 1PQPA 4XOIA 1L0BA 1PT5A 1YVPA 1DFHA 2ZJ2A 3NHYA 4LI3X 5BYBA 5EI5A 1WOMA 2PN1A 2YZ7A 2ZE6A 1WHSB 4EJSA 1Q7TA 3DBIA 1EEHA 2OV2A 4G07A 3NJ4A 2UZ1A 1DZ3A 4MR9B 4NBNA 4QOGA 5ALWA 3RLFA 4HV4A 4F4UA 1ZVVA 2IUFA 4A10A 3VOTA 3VO8A 1XCBA 4LK3A 1DJOA 4W1RA 3U3OA 5AK5A 3ZWMA 3FYUB 2O48X 2EL7A 3H0KA 4BPBA 1CVIA 5J23A 4EJ0A 1E79A 4AZ3A 2IZ7A 3RRZA 4DV7B 3WNCA 1G9SA 3LDAA 5FOTA 2ZZNA 1Z0FA 3SEAA 3TI7A 2XYGA 1U63A 2FKAA 2WE7A 2ZUWA 2R5NA 4IILA 3BCHA 2RB5A 4JJKA 1SQGA 5TXGA 2Q1TA 4MQ4A 4UQPA 1P9RA 2Z5VA 2QD2A 1C1YA 3C14C 4KBGA 3ITNA 1K8QA 3F67A 3DMTA 2INGX 3K0AA 3NUQA 1F5SA 3AT1A 3GJ4A 1Y8RB 2H51A 1N5KA 3GT3A 1YDWA 2GILA 1VXOA 3A14A 1J97A 3RSLA 3QWIA 3KHUA 1U9JA 2VNJA 3Q3HA 2Q3MA 3SQWA 4GDFA 4HNTA 3R5TA 4YMUA 2VP3A 3OY2A 1FDOA 2LNDA 2WF5A 4UHBA 3A0RB 3LHDA 1L7XA 3OOSA 1JU9A 3CO0S 3GRPA 3DCYA 3NDPA 1E9AA 4KK4A 4MPDA 1KRWA 1M66A 1T9DA 3A7DA 3ASVA 5DI9A 2R1TA 2YXDA 2A0WA 3GFTA 3B7WA 4B3XA 5AJYA 3QE2A 1QIKA 2JGIA 4FHZA 3HRKA 5AKHA 2F59A 1NWCA 1V9SA 1YVEI 2PBLA 2JCVA 4KYTA 1OROA 2JAXA 1T6NA 3IIKA 3QK7A 4PM4A 1I5RA 2ZYAA 3CPHA 5DDIP 5C8XA 3DMTC 3AUJB 3CKMA 5IJ0A 3KCQA 2AT1A 1PX2A 4GQAA 3FF1A 4OUDB 1RKVA 4RFLA 1I2ZA 3WJ2A 1AH2A 4PONA 1YR8A 3G9UA 4PXAA 3I2FA 4FCCA 1RE1A 5T5QA 1SUPA 4IYJA 5EQDA 4H18A 1CIPA 1WUIS 5EIAA 4DEYA 1MFPA 1J2RA 2G1UA 4L22A 3SYTA 4YJ3A 2XODA 2GERA 4X91A 3T1OA 1SXGA 2D0IA 4C5CA 3WRWA 2GCNA 3QIVA 4GXNA 4O2AB 3TRKA 3FDJA 1WLYA 2XKJE 5HM6A 2YJTD 1LCIA 4KQJA 1RAEA 2OGSA 2C2KA 3ESAA 2ZE7A 2DTXA 3NAMA 4KWCA 4P33A 4RF4A 1W5BA 5FTJA 5K8UA 1I0ZA 1U8FO 4CL8A 4KR3A 1B3BA 4HZUA 4FGZA 4Q3KA 3D02A 2IS4A 5DIZA 3FCCA 1S89A 3PUVA 4KO8A 2PT6A 1UJBA 3PDWA 1M1NB 4M1EA 4AJ1A 4Y2QA 4WECA 5C35A 2F2TA 1MXHA 3SC2A 1NVDA 2FF7A 4OKIA 1KEWA 1QJ4A 4NAVA 4B44A 4IW3B 4WZAE 4DAOA 3N0TA 4YROA 1XG5A 2DM6A 5FNZA 4JBGA 2VWHA 3TSCA 1O94C 4E22A 1K8ZB 3K70D 2BJHA 2H4YA 2QUKA 2QWXA 2BUAA 1HTTA 3SYRA 1YA6A 3PUZA 3E3LA 4HHEA 3W2TA 1E77A 2DQKA 2E4YA 1RHMA 3KYBA 3NMUF 3HCNA 1DDIA 2I2WA 3P0FA 3DAPA 5UKDA 4CIXA 5KNDA 1NXVA 1XOIA 2GBFA 1KHTA 3QV1A 4BWVA 4CKBA 4U5QA 5A6SA 2VJQA 4IUCS 4Z53A 1KZ6A 5CFMA 4ABTA 1ODFA 4IDNA 4DCNA 1DCMA 1LQTA 4G4JA 4JOBA 4OREX 3GGPA 3I01A 4CIDA 3EW9A 3DQQA 2A9OA 5GMOA 2VA8A 4F8EA 1L4EA 3H8WA 4P34A 4O5OA 4IGFA 3TPCA 3GDOA 1LLUA 4LJSA 721PA 3AETA 1E3EA 4YJDA 1U0GA 3I9V1 2D8AA 2HBRA 2YX1A 3HJGA 2KYRA 4L08A 2ZYVX 2XF2A 4D42A 4I55B 4CLRA 1IY0A 2BCGY 2Z8YM 3DDUA 2GPYA 4BYGA 2EKQA 3ZWWA 3DZFA 3TTSA 1Z5OA 2H3HA 2WNSA 4TMTA 4Q82A 2A4KA 3JQEA 2NUAB 3WYBA 1XXHE 4B35A 4YVFA 4FMDF 5TX7A 4I6EA 4EH1A 1K97A 3E9EA 3SFVA 4DV3B 3BB4A 3EGVA 1NJFA 1Y3AA 2R65A 1Q0PA 1Y7TA 3M9WA 4M9ZA 3PFWO 2HQRA 3GRRA 2ZATA 1NW5A 4A2WA 1AQYA 5D87A 1MA3A 2BFFA 1TQHA 1W87A 2MSDB 5HDBB 1DSSG 1MQAA 5ENDA 1RT9A 2B1QA 2PX6A 4L8FA 3OEEA 1KE1A 4QDUA 1XP5A 5K9ZA 4Y2JA 3SK0A 5I7EA 4YCDA 3ZY5A 3QYPA 5G0TA 1GIAA 2M6SA 1R5NA 1USIA 5DSZA 4CCYA 3G0OA 3E2PA 4X7MA 4RK0A 4AMYA 1EK0A 2DPYA 4O1MA 2CNBA 3G23A 3W8EA 4RLQA 1TGVA 2WJIA 1P2DA 3REQA 4BX2A 3K94A 3ZYZA 3CLSC 2V7QD 1WP9A 5DB4A 1RYNA 1YT5A 5FPHA 1NMZA 4EEXA 3ADPA 3PGXA 3UC9A 4IZOA 3N2YA 3T5GA 2EZ8A 4EELA 1GO2A 3DDHA 3H5VA 5BN3B 1ZGBA 3AW9A 3HU2A 1P62B 2X5JO 4URWR 1DKMA 1EG2A 2IC5A 1KR2A 4K1LA 1QH1B 4D6PA 4RTPA 4R16A 1PD1A 4HJXA 1ORRA 1GAXA 1HKUA 2HOQA 4YI3A 3PTLA 1A5ZA 1JTEA 2GZDA 3SY8A 1M9NA 3D3JA 4BMVA 4HNRA 4BZWA 4KI7A 2VHEA 1H5UA 1A9YA 4J7AA 1UPFA 1P80A 4Y0NA 2NYRA 3D7NA 1M6EX 4E5UA 5KWSA 3K70B 4P4SB 1J90A 3LMKA 3O8DA 4MA5A 2GAOA 4XA8A 2FP4B 2OXCA 3AWDA 3ZGNA 2DHEA 1J49A 5H7XA 2YJZA 5BV7A 1Z73A 3MK31 2PUDA 4ESEA 9MHTA 3RSHA 4C3UA 2V7GA 1ZY2A 3K05A 2YJ6A 4U8GA 3M3DA 5I4IA 1TIPA 4RAQA 4NCHA 3T95A 4O1HA 3DE2X 4IJWA 1IU9A 5CNMA 1IJBA 1D2CA 3OZVA 1E9RA 4KRXA 4LCEA 5AKEA 3N07A 1TM1E 4RMGA 1KK2A 2WJVA 3FJ1A 3UK7A 3D59A 4LMBA 3L1UA 4BDSA 4PCUA 1RWVA 4GKVA 4GO1A 1Q95A 4BBPA 1FNNA 1M1UA 3PNLA 2HJ9A 1K98A 2VJMB 3B60A 2VIIA 3ETNA 4IWNA 4JP1A 5LQUA 3F5DA 3ABRB 3I2IA 4XGNA 5JCJD 2QDKA 4C7KA 9LDBA 3H4IA 3HWWA 4ZAZA 1I9CA 2WYOA 2DETA 3DNPA 3K2IA 3QBJA 3GL9A 2PUAA 1U2RA 5FOVA 4PPQA 1U28C 1N6PA 1G21E 1IHXA 3NC0C 3K2QA 1DB3A 4GGPA 4RHTA 3ESCA 2NXNA 1GQYA 3I5YA 3NBKA 3HADA 4M7PA 3C7KA 1H0KA 4UVDA 4ER6A 2HA4A 2GHRA 4X5OA 3KOYA 4D9KA 3AESA 3IQGX 4MYCA 2XMSA 1NA5A 3VYTB 4DWOA 2PX8A 3KBOA 3L0YA 2CKDA 1UODA 4WOCA 4G2NA 4EHNA 1T9KA 4J1NA 2E89A 1AKUA 1GXSB 3RW9A 3OSZA 5BMVF 4R1PA 4ZVMA 3WFJA 5E4YA 4Q02A 1ECGA 1EJ2A 4ZU3A 1AK9A 3R20A 5CK4A 3ROEA 1NSYA 1PWYE 3GUCA 4TYWA 1V3VA 2D5BA 2V6GA 2WV7A 1Q0ZA 3DV0A 5E3JA 4D96A 3OPNA 1A4RA 2ZEJA 5JYEA 4MROA 1VA5A 4Q05A 4QSMA 4UATA 2ID9A 5DCLA 1JE0A 2Q6VA 4PO1A 3L6CA 4BLSA 3LVBA 3L8HA 4WBSA 3QU2A 9ATCA 3HVRA 1G3UA 1P5JA 3KQKA 1MB2A 2I67A 4LVCA 4PZPA 4EX7A 1CTQA 5K6TA 1KQ3A 1LEHA 4R83A 4YJHB 4ZK6A 3IPYA 3NDRA 2Y0DA 4NU6A 2AZDA 3CMMA 3OESA 1KY5A 4WDQA 2VVTA 4YLEA 1LB1B 2JJ1D 2JC3A 2Z3WA 2ZS7A 2V6FA 5F7ZA 3UAVA 3RRBA 4D3DA 4ZGGA 1UWLA 3ICCA 1QK3A 2VS1A 2E18A 3DH0A 3DLCA 2H7XA 2H5JA 2YHUA 4FW9A 4IDHA 3S99A 5JE8A 1QVVA 4S1OA 2B0JA 2Q0XA 2GM5A 5LYJF 3HRHA 1L7MA 2I0FA 2I6TA 3UJ8A 3IOEA 3PCXA 4RH0A 4V0ME 5DYNA 1AGNA 4GPEA 3GGOA 3IBFA 3W3AA 3RJTA 5B64A 5CYPA 1A97A 4NJMB 1H6AA 3P2IA 5BRAA 4TL8A 5BSWA 2O8FB 2C9YA 3CF4A 4WOJA 4CM5A 2GFHA 3IKLA 4O2AF 4EHHA 4OATA 2G07A 1Y9EA 4WX2B 1XZQA 4O4JA 4QFCA 4B71A 3K1YA 3NXSA 4D9CA 4L9RA 5JNTA 4DWWA 3I30X 2IYOA 4OHRA 2AYYA 2X8AA 2GCOA 1YMQA 1MO2A 3NEJA 3B5EA 1KYIA 4MKGA 5DEIA 2JLXA 1X7YB 4P8RA 1QIJA 2XSZA 1ACMA 3E5NA 4G0XA 3ZJ5A 3GO4A 1SCBA 3G2OA 3FVRA 4JLPA 4LWQA 4MGKR 1EFRA 2R6DA 4ATNA 1Z4LA 1XC7A 2J5RA 3TR0A 2ORED 4I5EA 4K2HA 3DDWA 1F6WA 4NJOA 4YMVA 1JLHA 1NYQA 3BMOA 3GGGA 4CKZA 4GEGA 3Q3GE 2WFAA 4RNCA 3F46A 3VZCA 4LEIA 2P6OA 4LY3A 4FONA 4IGAA 1JG2A 3NH6A 4B7ZA 2JI9A 4EI7A 3O4GA 5CA0A 4ZHQF 1IN5A 1B42A 2ZJ3A 2WSSD 2YICA 1NJ5A 4ZV7A 3WDLA 3S8MA 1W8DA 3PJFA 3ETHA 1N8NA 1L7DA 1B0AA 2O3RA 2P91A 1V41E 1N0HA 3U4DA 3NDIA 4DJTA 5BOVA 1T35A 1SC9A 2JLQA 4K1XA 2ON6A 3B5JA 4RCZA 1DC7A 1XQWA 3KEGA 1QHNA 3OTIA 3AF1A 2X0EA 4TXLA 2NUTA 3SZGA 5I8WA 1MOSA 2OKCA 4JT2A 1Q15A 2ERCA 1QFSA 1WSBA 2POQX 3NIBA 1GGJA 3P0JA 5BR4A 4RQTA 2CJWB 1AKYA 1TAGA 3N6RA 1LBEA 2CL6X 5ADHA 1W5TA 4JU9A 2ZYRA 2GPBA 4IQGA 1TLFA 3I9OA 3PQ4A 1DO2A 1SVLA 1J99A 1P75A 1U99A 2BGNA 4RD2A 5ILQA 1YNSA 1NUPA 4RH1A 5ICGA 3JVDA 2NZXA 1RRMA 4WOBA 4Q9JA 4ZGWA 1XRPA 3BG5A 3V2HA 1Z39A 4HLNA 3DFZA 4A8JC 5BUSA 2PJRA 3WL3A 3V1KA 1Y6FA 4EF4A 2IEYA 3JWGA 3NM4A 4I3FA 2ZR9A 1GQOA 2ADMA 2QIOA 4UMFA 5BORA 2H1SA 4ZO8A 4ARZA 1SUWA 3QUSA 1JLMA 1NPDA 2OAQ1 4ITVA 5H4HA 2GCGA 1U98A 3IJPA 3OM0A 4JYAB 4KSCA 4B6PA 4IV5A 4ZXFA 3O82A 3EK2A 4C03A 3QJ5A 4RTOA 4C20A 4BWFB 4IAOA 3O3CA 5JMTA 3DLPX 1LWOA 3LUJA 1AV7A 5E8RA 4TSFA 1SKQA 1T0BA 5F3RA 2PZAA 3G0GA 4P3KA 3ZIUA 1CJKC 4RDIA 1IHYA 1EZ1A 1GV1A 1ZOLA 2FR8A 1LX7A 2P9FA 1IY8A 2QTNA 4UM9D 4S3MA 4YRDA 4Y6RA 2J9FA 1JLLA 4RK1A 1UZMA 1I2BA 1KDTA 2HB6A 2VF5X 3L04A 3D9QX 4K5QA 4LRYA 4R3WA 4ZEXA 2O2IA 4WESA 2P2LA 5FNVF 5ELMA 3TCNA 4MUEA 4Y6LA 4XZ3A 1AXEA 1E3TA 4DBLE 1DTWB 3LO5A 2Z2KA 1OCEA 2ZAGA 5DYGA 3TD6A 2P68A 1X1SA 2FOXA 4Z4CA 2PMEA 5GM2A 3R0ZA 2VFAA 4DG9A 1EFLA 1TJ5A 4XX1A 3HVIA 4XH9B 2HPZA 4FDAA 2DQZA 4HOYA 5KPDA 3N8DA 3MHTA 1GKUB 3WXMA 2ID7A 1YJBA 2JFVA 4TVSA 3TG8A 2FQ1A 5IJZA 2YJGA 4MUYA 5IKOA 2R8YA 3RUHA 5SY6A 1L5RA 1W35A 1GT91 3I1JA 3HB4X 4BPRA 5ITZB 5FV7A 1G60A 1XI2A 2V0NA 4AM8A 1YE5A 2J4FA 2W2OA 3EHEA 2Q1YA 4FS8A 4JJZA 4L2IB 3ZCVA 5LZ2A 1SA0B 1QFMA 2UYQA 3I9LA 2QL9A 2QNBA 1KHHA 1J6UA 2DJIA 2WDPA 3FPLA 1SUBA 2RGUA 2VHWA 3KBBA 1N6IA 2HU2A 1FJHA 2YASA 3KEFA 3EZXA 3BAFA 2ZJZA 3MG9A 3PWKA 5BWNA 2CXHA 2J0VA 1RRFA 3KKNA 4DLWA 5H81A 1VE9A 2A5YB 2PEZA 3WGKA 5JSUA 5ITZA 1JYFA 2ERYA 3IKTA 2JW5A 4F3NA 1RU3A 1GWNA 1DQRA 3S5JA 5JNLA 4NYMR 3E9QA 7MHTA 4PQYA 3OA0A 3TMKA 4PFQA 2C4MA 2Q4OA 3AKCA 3DBVO 1XZHA 3CQ9A 4XD7A 5T7BA 1NSFA 2CHEA 1AQIA 3H42B 3I58A 4G84A 4IHJA 4QBIA 4YBRA 2ZYSA 1GQFA 3CEAA 3VPHA 2WZBA 1FQOA 1GUZA 2NSLA 3GGCA 3PNYA 1T4BA 4LCJA 1KPIA 1CJCA 1VGQA 1L2TA 1YDFA 4KHZA 4PFSA 2ECOA 1EP3B 2QX4A 4CNQA 1CF9A 3LK7A 1DEKA 3OU6A 4PLFA 5KMGB 4L9SA 3ZE1B 3CNLA 5CD9A 4U0JA 3WLEA 3GRUA 5IJ9A 1YOVB 4HDSA 3VAYA 1BX3A 3PPIA 1QFYA 1QGED 3AQ4A 3A4VA 4G0PA 4OBXA 5AIAA 2H5IA 3LY9A 5EC8A 4A23A 5C2JB 2YR0A 4LBYA 4DIDA 1EUDA 1D6NA 1GZDA 2E2WA 2ZREA 3A26A 3GN1A 1IXZA 3FI9A 4KE9A 2VK8A 3O84A 5LD2B 1YB7A 2ZI5A 3H1TA 3NVDA 4YASA 4DV5B 1J39A 4G01B 5FXMA 3EGWA 5IN5A 3SI7A 1RBMA 2RCNA 4KDFA 4N0PA 1QIDA 3MMSA 3UK2A 1YULA 2CDNA 4CTMA 1HDIA 3WLSA 3K9BA 1KSFX 1P0MA 3DAFA 4WKOA 4FFNA 2MSCB 4S24A 3D4LA 4GE3A 1L7RA 2X0JA 1QE5A 3DXXA 3N3BC 1J8MF 3R5KA 4QOJA 5FIUA 3USES 1TVMA 5LQJA 3K0AB 4KMSA 3BJIC 3BORA 2P6RA 2G36A 3I1YA 1ZLYA 2F1KA 4BE9A 4FVTA 2WW8A 3KCNA 1EGMB 3KJFA 4MWSA 1XDUA 2CXXA 2BE7A 3L8FA 1JDTA 4HGNA 5C1IA 1X6VA 4FFOA 1VPVA 1RI2A 3IAXA 4QM7A 3S29A 4R2LA 2NGRA 1TDJA 1GTMA 1H3FA 1IDN1 2YJ5A 3PNMA 3IAFA 5TGZA 2ZPUA 4BX0A 4RTMA 3EGCA 1E2MA 1H6CA 1OZFA 1QZTA 1CR4A 2ZRMA 3BWVA 2PIAA 3ENZA 3LY8A 4LFAB 2QY6A 2QLLA 5JXWA 1JHOA 1QSGA 1Y8CA 4P93A 4GXRA 5I7SA 2QU8A 1WP4A 4P7FA 1EK1A 5CVJA 3R76A 3SIPA 1M0EA 2WUDA 2OO5A 3RU3A 2GD1O 3KKOA 3T9DA 1ZRNA 1JB9A 1XNRB 4IZ6A 3NHSA 4N8EA 4WFQA 3B6IA 2LCFA 2FRXA 1X13A 3ABOB 4WZBB 3DL7A 2JRLA 4FXPA 5G41A 4CN9A 4NEHB 2FW1A 1T6YA 2HH9A 4PG4A 1V11A 5JG7A 1A95A 2XE4A 5EE5B 2V6IA 3HY6A 3I3SR 4HCJA 4HR7A 1BFDA 3CG0A 3QFFA 3FTFA 1YHZA 1FNMA 2Q1XA 3BE4A 4ZAWA 5JNVA 4XVUA 4AG3A 3R9IA 1G42A 1T15A 1XRMA 2KB0A 3IBCA 2C3YA 3O03A 4TYMA 4U4AA 5H9VA 3V9AA 5AVXA 4NZPA 4JMPA 3KB1A 2C77A 5EJ8A 5L3VA 4Q24A 5HMMA 3KJQA 5TMEA 2QSZA 1QVZA 4A27A 1MZVA 4DXDA 1QQBA 1QBKC 1FYWA 4L8VA 4C78A 1NTOA 4GI1A 5AKKA 5EPOA 2YYYA 2IKSA 4IF6A 1NE2A 1WXIA 3EEBA 3MB5A 4O4IF 4TRJA 4OTZA 3KG2A 4P86A 4X94A 3ZV4A 1CU1A 3OZGA 1I4WA 1ISHA 1MP0A 4FGSA 4ZQHA 3VPXA 2P9BA 1AOXA 3ENKA 4B0PA 3KXKA 1OHHA 1RQNA 3QVTA 1Z6XA 4HUJA 3EIHA 3HJNA 1YC5A 1HORA 1T29A 4EKGA 4BKPA 1E94E 2V7PA 1TM4E 2AI2A 3ZD8A 4B7AA 2ZR0A 2WY2D 4Q37A 2HSDA 1BA2A 1IHPA 5L6MB 1NP6A 2EGUA 3G17A 1A2QA 5ALTA 5DU2A 2JB9A 4GSLA 3KFLA 1WY5A 2WU3A 2VNSA 1NVTA 4E5YA 1CJVC 4QSHA 1C0LA 2KQUA 1XIVA 2CVOA 3TW8B 1E1DA 3QJGA 5DVZA 1FFHA 4KFRA 3BRCA 2JH8A 1FYDA 2OOSA 5LIRA 2ZRQA 2OZLB 2R6GA 5C1DA 2ZYHA 4DCTA 3O1IC 4K9NA 1Q22A 1LWNA 2H1VA 2QLTA 3W9SA 4IMIB 4LZLA 2P2SA 2PQ0A 1KYXA 2XE7A 1GPNA 2YYZA 4HFNA 1P4AA 4GSKA 2WIFA 4XFKA 3OQHA 2VEOA 1OILA 3P19A 2PPLA 4I4LA 2HIMA 4PTYA 3U9SA 1KKUA 1MJHA 3N3AC 4FNAA 4CEIA 2WWHA 1TX4B 1C3OA 2WG0A 3BEDA 1R6DA 3OCCA 1UBFA 4L76A 4M6WB 2ASEA 4PQFA 1OWMA 4N5LA 1RFLA 2OORC 2J6IA 1WG8A 3PQCA 4KQEA 2NZYA 3MWYW 4LRTB 1CF4A 1A98A 4B5LA 1POWA 4DCVA 4LSMA 2IHBA 1X1EA 1QFJA 5GJBA 3Q9UA 3PXCX 5FOXA 1Z4MA 5KYYA 3SYNA 2Z8XA 4E15A 3LQKA 1LVUA 4DMHA 2RHBA 4EHDA 3FZGA 2J3QA 4D74A 3OQNA 4CMKA 4ENUA 2W2QA 3WKCA 2J5KA 4KO4S 4MWBA 3SHQA 3QP9A 2B2NA 3HE3A 1XHFA 2HCBA 3VO1A 3T3PB 1RFGE 1CZRA 1L7NA 2Z98A 1VG1A 5LXTA 3RAGA 4WD3A 3K96A 3JRXA 3O4VA 4Z5XA 3Q2IA 5IF3A 1MFZA 4KN9S 1W48A 3L01A 4C0KA 4UU0A 3WIOA 3LVFO 2PMWB 2X6TA 4Z7NB 3O4HA 1ZOOA 4K9MA 4B33A 4HRAA 1I1OA 4F86A 4CEHB 3IAS1 1SD5A 2ORWA 1GL7A 4IXNA 4QAQA 5AW4A 2A84A 1L6IA 4L1KA 2JHGA 1RPJA 2ATEA 4PW0A 4H7DA 1JPJA 3IUQA 2IP2A 5M34A 3F3MA 1GGNA 3PHHA 3RJ9A 1RYHA 4R3NA 1Z2NX 3O94A 4I81A 4OXYA 1TC2A 3U17A 3B3JA 2WWWA 4MVJA 4EUEA 2Y66A 4ZOLF 1MJGM 1JLRA 1E3IA 4XIIA 1AG9A 1Z26A 1QV6A 2AJBA 1EI9A 4IS2A 1KDZA 2B3DA 3PDCA 1XZIA 1IZ8A 2B35A 3LKVA 3T15A 4PPGA 1VLJA 5JMPA 5JFTA 4MOWA 3MQ2A 1QM5A 4MVXA 4PZEA 4DARA 4M1SA 3N0WA 3U3MA 1WPQA 3HJTA 1OD6A 1RI1A 1Z5UA 2ZSAA 3GP3A 4H1WA 3QKRA 1VJ5A 3PX3A 3QOWA 3T1VA 3O47A 3KD3A 2X5KO 3P9KA 4BIMA 1IBLB 1PE0A 3NCHA 2WLSA 2V6MA 3E4DA 4MJLA 1OGYA 1QZZA 5HM8A 4WADA 2QRKA 2R5WA 4PS0A 1JIKA 2QRHA 2B4AA 3R0XA 2FRDC 3TIFA 4AP5A 4RADA 2I62A 3N0XA 1WOYA 1JSCA 1WABA 1YL7A 2C2HA 1P6QA 3ZIAD 4EA6A 3KWJA 2ZB2A 2G9QA 5E1OA 3GLFB 1X92A 3ER8A 3PWSA 1M2EA 2GDZA 1XTIA 1MJ5A 3I2JA 5JI3E 1FSSA 1AHIA 1VHQA 2TMKA 4WE3A 1DELA 1ZKDA 4CL0A 1T0UA 4GDMA 4BVJA 4MIEA 5CLIA 2XUDA 3KLNA 2C2WA 4ND4A 1SPBS 1L5NA 4G56A 2MWMA 2ZVQX 3OZCA 1XRSB 1R9NA 1HQDA 3BK7A 4AY3A 1OFTA 2CXOA 4FE3A 5D3KA 4JI8B 1QWOA 3QF4A 4MV6A 2EV9A 3RI3A 1T6BY 3WFZA 4XGQA 2A5JA 5CURA 4NP6A 1OU4A 4CGYA 4GI2A 5G53C 3R7SA 3ZS9A 2B4TO 2G82A 1RRVA 1PS9A 2J0UA 3IJ5A 2D59A 3NOOA 4M83A 2C8JA 5HKAA 3QU5A 3GLGA 4TS3A 3WOHA 1F14A 5MN6A 1YB4A 2YFKA 3AVQA 2F1OA 1IJFA 1BKDR 4KB5A 1W0KA 4BVBA 4CV0A 3L0PA 2VDVE 3ZE9A 1F7UA 1PNTA 2HCRA 5KYUA 4DJFC 1TLLA 4F3CA 2FFQA 4JLNA 1RI3A 3F4KA 3GDHA 4RQBA 4RX1A 3B36A 1ZNXA 3WWEA 4Q3AA 4Q4LA 3SYMA 5C7IO 2A2ZA 3R0QA 2P0EA 2FW8A 3LD9A 5BYJA 3QX9A 5JY6A 2I6UA 3GCZA 2XQGA 2VP6A 1G41A 4K86A 3RUFA 4EQ6B 2X4GA 2I5PO 4DDTA 5A4DA 1S1CA 1SUEA 3GUZA 3ZWVA 4CM7A 3TNYA 3LQ1A 5FWDA 1QO9A 1NHWA 3GXOA 3VPAA 4AURA 1P33A 2D7JA 2PPVA 5AOCA 1N3YA 3VU9A 4HX5A 3UAGA 1SCUA 2IZ5A 5LN1A 4RETA 4RVFA 4FB4A 1WUJS 1Z6GA 4J4TA 4LX0A 5P21A 3IJEB 1BDJA 1OWPA 2AMLA 1TKAA 3Q10A 5ALLA 4TRNA 3GEEA 2XA2A 3Q7EA 3ZPXA 4J29A 3V1MA 2IP1A 4O2RA 3T7AA 4QQRA 4LHYA 5LLTA 4BB0A 2D2FA 3IBGA 5JRDS 4MZXA 1E0KA 1UKVY 4QXRA 4FKZA 5E4JA 2IHVA 3L49A 3GLFA 1SQFA 1XEWY 5HP4A 3Q0EA 2G9NA 2IOFK 3PKZA 4M54A 1CUIA 1ENYA 4PCAA 4V1CI 1YASA 2JKYA 1OXBB 5AXAA 3SHFA 2BONA 2R6R1 2ZI9A 3MF4A 2X41A 1TE2A 3BILA 3HA7A 1GRNA 4KPGA 4YMIA 3TJRA 4CQNA 1G8PA 3ZXYA 3CT6A 3NTVA 4RK6A 2AKYA 1J7JA 4INPA 4DY4A 4PANA 4NE7A 1W73A 4Z4IA 1J2TA 2J6HA 2M98A 4L0DA 4P4TA 1LDNA 1PDOA 1W46A 2V4ZA 2VRCD 2FWBA 2WKRA 3ILSA 3NWPA 1N2SA 1W8IA 2DUJA 1SQSA 1XDBA 5BSMA 3H3FA 4FBMA 5K51A 4NNOA 5EWJA 3UJCA 1N2HA 2FWIA 3O2NA 2PUHA 5TF0A 3QXHA 5IC6A 1HUQA 1LK0A 2COUA 1OIXA 3OZXA 1J0CA 4O2AA 4D4MA 3AVVA 1N92A 1TJNA 3JPWA 3TEJA 4EMUA 3GAFA 5JAZA 3IPXA 1DRUA 4PSCA 4XE5A 3KR0A 5EVCA 1IFXA 4ARSA 5IT9A 2PKYX 3A05A 3OICA 1KY2A 1R4ZA 3KXPA 4UBLA 3RYCA 4JT9A 1EFPA 3IAS6 1UPAA 3F90A 3KZXA 2N47A 1RWQA 4WTOA 1CZLA 1TYBE 3BJMA 2P90A 4HXFB 4I8DA 1Q0RA 2R66A 3H9JA 2QNRA 3KTOA 5L3RA 5LDDC 3RVLA 1VKJA 4EHLA 2ATCA 2PANA 2REQB 5LPNA 5JTUA 4Y6SA 4ZDWA 1UANA 1WXEA 2C7GA 2OP0A 2IUUA 2Y1OA 2AKEA 1KVTA 3BRQA 3IOBA 4JUBA 1Q0TA 3AP3A 5KYXB 5E4FA 2F1JA 2ORYA 1ZHFA 4EAAA 2ZTVA 4GXTA 1UR5A 1QB7A 2MYTA 1ZGGA 2XRZA 1A9XA 2WB2A 2WUEA 3AL3A 4WN9B 5AVYA 3QEMB 3HEMA 5JYDA 1PG5A 2Y67A 4JIGA 3R23A 1I6WA 1H2WA 5CH5A 1XWIA 2VT6A 1M8FA 1OBFO 4NBLA 3KKQA 2HNKA 1R9GA 2I33A 2PMKA 2BFMA 3L8MA 2P9CA 5K1ZA 1KK1A 2C20A 1QRSA 2CLHB 4H15A 1RQXA 4QM6A 3GBSA 3RRJA 3IYLW 1S3IA 1Z0KA 2DG2A 2ODEA 1FDRA 3I12A 3L43A 2V7UA 2XH8A 3NIDB 4IM7A 1OLXB 2FB9A 2HDNB 3FWHA 1Y6JA 3PHLA 1KU0A 1BOOA 2Z09A 4GS5A 3IR5A 1YDEA 4QJIA 3BF8A 4QUKA 3RJ5A 4I5GA 1WNFA 2E82A 2M1ZA 4QUAA 4CEHA 1OFHA 4QDJA 4C5AA 4D82A 1AF7A 1HEUA 1PCXA 1ZCZA 2HFKA 3CGGA 3KEMA 4Y9UA 2C8KA 3VPDA 4BNWA 4X1KA 1V0JA 2JLAA 1AQNA 2H08A 4REMA 2PSFA 4PVCA 1N0UA 1R8QA 4LMPA 3CSSA 4EM6A 4I3GA 2BDTA 2PNFA 3HFRA 5DEOA 3UCEA 4DNPA 3WVNA 3I1FA 4ZARA 2QVBA 3BH7A 3ONDA 3ROPA 5KVAA 3A1FA 1TUEA 3OPXA 1IQRA 1O89A 1GNVA 2QG9A 3E1GA 3OD1A 1H8ED 2V4UA 1XCPA 1E6WA 4IWXA 3R7LA 4DFDA 1A5BB 2FZEA 2WM3A 3G2JA 1EUQA 1KJZA 4HT3B 1FRVA 2XRFA 4W5JA 3MC1A 4H1UA 2Z6QA 2FZWA 1G5IA 1Z2OX 3VR2A 3E9NA 2PWYA 1Z56C 3JAKB 5F73A 1JDBC 4MLPA 3QF7A 3NBMA 5FUQA 5L3SA 3C8DA 1DXQA 2LRHA 3A4YA 4JKIA 4NRDA 2DBRA 5JJLA 3LYLA 1Q1EA 1AGRA 1RRKA 2Z30A 1PJQA 3VOBA 3DFMA 4I50A 3V4SA 1RXCA 1JG7A 2UYHA 4CM8A 4D6XA 1YQ9A 4IJ5A 3D2BA 3EXG2 4RPGA 4UMVA 3HBJA 3IB6A 2F43A 4EB3A 2WKWA 1K66A 3JQCA 3VR4A 2B9VA 1B00A 2WJZB 2VJNA 2ZAYA 4OP2A 3LUBA 2ZI7A 4KOEC 3T1HB 4I4CA 1RADA 1TVKA 3O3MB 3L8DA 2C95A 2UZ3A 3B3FA 4Y6GB 2M9MA 5HOQA 2PUEA 2JGDB 3GNLA 2HCTA 3GFGA 3GCGA 4YUVA 3IEMA 4Q1VA 3BDIA 3IPLA 2CUKA 4C6TA 4RJLA 2J4CA 3VMFA 3AVTA 4KC0A 4GKBA 4E88A 4HAZA 1CUVA 4J76A 1Q16A 5HJ7A 3LFHA 4IDQA 2JGEA 2WABA 1FMJA 3T7CA 5IX8A 3HJRA 4L3OA 3L41A 2XMDA 3L4JA 1SBCA 4MB6A 4UZEA 3Q72A 4I9GA 3JRNA 3IR6A 1G8JA 4QNNA 1IUKA 3K0HA 5F78A 3W1VA 4ALJA 3JR3A 1P3JA 4KYUA 3UUFA 4MCIA 1A7JA 1Z6AA 3P0IA 4D43A 1JFFA 4HS9A 2CK3A 4Y2VA 4RPKA 3ETGA 4XD7D 4MP3A 1K7XB 1AHHA 2JGNA 4OLHA 3TE7A 4Q4HA 3IUSA 1Y7PA 2BC9A 4MA4A 5J4LA 3L5OA 3PT5A 4JVOA 1Y9AA 5A6VA 5BWMA 4OIFA 1TMYA 4B9AA 8ABPA 3ZW9A 1FCJA 5JSHA 3EIFA 4WCFB 1G66A 4V0SA 4CM9A 5FEMA 4DYVA 1RKBA 2YNMC 2VSXA 1FP1D 3RO7A 2C9MA 2P2DA 5TSDA 3ZBPA 1GNSA 4JYPA 1ODLA 2VDKB 5I9BA 4E7PA 3BUSA 3MWJA 3DSRA 3EMKA 4MYHA 4ZDIA 2VAVA 4GECA 3O74A 1C8LA 3ORYA 4LOLA 3FMPB 4CKWA 1E6EA 2G4CA 1XZNA 4C89A 5IYZA 2XBUA 3BGIA 4JP3A 1VA4A 3RUAA 5I01A 4Q00A 2F64A 3EFOB 4GUAA 3QMPA 4Q48A 4F6RB 5LD2C 3KJXA 3GVCA 4MVWA 3JZFA 1Y3BE 4DEVA 4QPCA 2C61A 2JIBA 1RXVA 2UUBB 4IICA 3WHLA 4QFMA 4W8OA 5REQA 2EP8A 1U7ZA 2W00A 4JROA 1L4FA 4HDMB 4U00A 5AO9A 2IEIA 5E8JA 1Z0UA 2ORVA 2XOKA 2ZULA 4BLRA 2BI8A 3JTMA 5HF6A 4CPDA 3L0DA 4LA4A 2NYVA 1Q92A 2WT8A 2HK8A 3WAJA 4LYAA 2DFVA 5FUXA 3PRHA 1IL0A 1AXGA 2DFPA 4A2QA 2J45A 2WRZA 2A35A 4UVGA 1ZA2A 1RI5A 2O3TA 4KDEA 2PLWA 4C4SA 1KO4A 2BV3A 3IDZA 4IPTA 3DT9A 4KG7A 2WD7B 3QBTA 3E22A 2ZYWX 1P2FA 3LUGA 4XX0B 1DAGA 5DIFA 2UDPA 1IAQA 3LL4A 3ROQA 1M8GA 3G2MA 2VH1A 4EVIA 1VBKA 2X13A 4G4IA 4AB1A 4CKCB 3RB8A 1U2GC 2PWAA 1V1RB 5JRZA 2J3JA 2RAPA 4NZYA 5AM4A 4J03A 1MVLA 4B3GA 1O97D 2XVAA 4LC1A 2AXPA 3TIXB 5B1IA 1DO8A 4Q1FA 1C9JA 2Q3DA 1G38A 1KEVA 3JWJA 2A7QA 1YK1A 1R8YA 3LUAA 4B48A 1EUDB 4KCGA 4BV8A 3HVUA 3S3TA 1JXOA 2B5OA 3KWMA 1U0RA 4OUKX 3WL7A 1PJLA 4QTXA 3QKWA 3MWEA 2GM3A 4N8DA 4TWAA 4X7BA 5BOSA 3O8NA 5CLLA 2J0EA 3KSZO 4CNBA 2FUEA 2QY9A 2X7XA 2AFIA 1YBAA 2AZ4A 1QK5A 1V5WA 3NQ41 1I4EB 2Q0QA 5CT6A 3O2QB 2PLAA 1IUNA 3KHTA 3RBVA 3J81k 1YC2A 3AR4A 5JXGA 4RANA 2YV4A 1HYEA 3PIDA 3RANA 2VDRB 3UJ9A 4CHGA 2X8WA 2B4YA 4U3JB 5EOVA 4TWBA 4TXMA 5DGXA 3QPWA 3WTBA 3WMFA 2FPLA 2LV8A 4LJ4A 4CL2A 5JAOA 5BN1A 3L6DA 1G0OA 4ZK2A 1NE7A 3S7TA 5AJVB 1XPUA 1J0XO 4RAOA 3FDXA 4XJTA 3CV3A 3OCJA 1NZFA 2FW0A 4XDGA 5NLLA 4KFCA 4ZEOA 1KXZA 4TVOA 1XLVA 2QRGA 3CGWA 2IHUA 5JQGF 5JO0A 4IDDA 4OSOA 4UM5A 2X42A 1YRWA 2UYGA 4PLVA 2JAHA 3NTQA 4LQ4A 4C3ZA 2C9BA 4HQRA 3ZZMA 1TFRA 1WR8A 4N3GA 1TTPB 2PMCA 4WCDA 3VPGA 3FKJA 3VKUA 2RGNC 2CVFA 3FVVA 5KX5A 1ZD8A 3B1VA 4Q1EA 1W34A 3D6TB 3FGNA 1U9CA 4TLLB 4MVJG 3JQDA 1ZJ4A 3LLMA 5HHTA 1CEQA 1TOAA 2A58A 3AVOA 4FYWA 3UMGA 1DVRA 1O5OA 1SG6A 1VCOA 5EMJA 3RASA 2E5LB 4QKQA 2DX7A 4P7GA 1FNSA 1TEXA 1W6UA 2JS7A 1UBRS 1P3Y1 3N70A 5EIOA 3WLQA 5I9IA 4OUDA 5LP6A 1E89A 4IKOA 8ATCA 1DC6A 4M1MA 1WXQA 3THWA 1JH9A 1U3WA 2XNHA 3FM9A 1W5AA 3OOHA 4ZU1X 5HKOA 1JHRA 5JAHA 3ZCQA 4CG0A 3FROA 1VL0A 4KACA 1GAEO 5LDGA 4LRUA 3N2EA 3FGPA 1QHYA 4LZZA 2P30A 2CFSA 3C6YA 3EFOA 3TQHA 3VAAA 4EB8A 4JLKA 2NZUG 1R64A 4D3FA 5LQNA 3A37A 3HB9A 4E2YA 1AUPA 3DTTA 5CP8A 2PUCA 2XWQA 4BE4A 1FRNA 3CX6A 1U0FA 5GV8A 3AJEA 3WLKX 1B93A 1E1CB 4GPZA 3WYAA 5BW6B 3FSGA 4XWOA 1OH6A 4C9BA 3MUFA 3AIOA 5KDOA 1SC6A 4YQYA 4D57A 3LTNC 5MDHA 1WHTA 3C6XA 3LXMA 4JR1A 4UBOA 5EIWA 2X1VA 4ZDJA 1N9GB 1CY1A 2HK7A 4CGZA 4AS1A 4FDUA 4YUWA 3ZHRA 3WLTA 4TQ9A 5A4MS 3C6KA 2P35A 4C2UA 4J07A 1BCRB 1QTNA 3BFVA 4GC9A 4BGVA 3UWPA 2LGJA 1M2VA 2ASVA 4ONEA 3UJ7A 4INJA 4QASA 1F2TB 1OU0A 1E6UA 2B8EA 1DBIA 2HBQA 2QV7A 4GMFA 5TPZA 1SBZA 3D6NB 2BHTA 2VI5A 4H17A 3TTVA 1QNFA 3K5WA 3FOFC 2ZRHA 5I9TA 1UMBB 1I24A 2A1UA 4I14A 1JFFB 1L6RA 4L50A 4JVLA 2DEUA 3A4TA 5HQ3B 3CUKA 3JZAA 4DKJA 2H4ZA 3HJCA 4H6XA 3CB2A 4KXVA 3U4HA 1IQ0A 1KC1A 1LSJA 2O2ZA 5KSYA 3GRYA 1UKBA 5NULA 1ZRMA 5F51A 5K6RA 4OJKA 2XOEA 4AJJA 3V5NA 3EXIA 2NSHA 1Y3CE 3CLRC 5JD5A 2JFHA 4P4NA 4GYYA 4QUIA 3LUKA 1P1KA 5CDUA 2ZBVA 3DE4X 2GK3A 3HR4A 5I9MA 3P4YA 2LWIA 2VSOA 3BXOA 1LPAB 1Q7RA 3IQIX 3PD1A 4PTZA 3LWBA 1ZITA 3VFDA 5KVVA 3HCWA 2GFQA 4C4AA 1R7RA 1VZ2A 3L5KA 1R6XA 1E9CA 6REQA 3K35A 4ND7A 1AF4A 1E7QA 2QKYA 5AVOA 1LFAA 5JH7F 2P79A 5M2QA 1H3EA 3BE6A 3ZHSA 1E8DA 5H82A 3A25A 3Q40A 3NTUA 3H5NA 3RF6A 3U5TA 2OLJA 1G8MA 2VHZA 4JOSA 1HOXA 1LPBB 3ZZ0A 3I6IA 3GH3A 4KPUA 3O4FA 1NNUA 4M9SA 1Y82A 4DLLA 2CWDA 3AUTA 3DE0X 3W9YA 4YXWD 3U2QA 3AO0B 1QHSA 2O2DA 3QTLA 2EYQA 1PWZA 1Z4QA 1E60A 1U8ZA 3DZDA 2Q3FA 4HTFA 4YRAA 4JI0B 1L5WA 2GZAA 2NW6A 5B4UA 2AOWA 2QZJA 3Q0IA 4ILKA 5KNBA 1SXJA 1J4AA 2QU7A 4PXYA 4B6OA 1WUHS 2IUYA 1SQ5A 2BFEA 2VDQB 3TAXA 3GWGA 821PA 4WRRA 2I7TA 1SUDA 4FOSA 1YZLA 3VR2D 3JQ8A 3OH8A 2G5GX 4HNAA 5BV1A 2Z2XA 1XROA 3CWCA 3FWZA 1L4UA 3IE0A 4X6YA 4XKJA 4EGCB 4F92B 4E32A 3DTVB 4LJ5A 2HLDA 2VHQA 5L3ZA 1GTJ1 3RTCA 1XHLA 1E9VA 1ZCBA 5ALGA 1JMVA 1H8EA 3ISVA 2PMFA 3X2EA 1ZIXA 2I3GA 4C22A 4HEA6 4JXXA 3LHIA 4MLZA 4RSRA 3TQIA 1JP7A 3KO8A 4ZYZA 3GMDA 1QVRA 2JIPA 3DYBA 4PS1A 5DK4A 4CIVA 4JR2A 4KO2S 4U2EA 4PZDA 2G9UA 1XVLA 3GJXC 3QVOA 4WWHA 4Y1EA 3TOXA 4AD8A 1T2UA 2BFCB 4Q3DA 3N74A 2QSUA 5HUJA 4F91B 2ZCVA 1E3WA 1EFTA 3I9MA 1T2CA 1ZUNA 3EBLA 3QE4A 4O4LA 1L4MA 1ARZA 2WHQA 3SX4A 3H1GA 1F6DA 2H1WA 2PL9A 2PO5A 3EZYA 1XDSA 3AERA 4FNMA 3I37X 3PNPA 4ML3A 1OXXK 3UJHA 4FM9A 1CWUA 4I66A 5C46F 3DVLA 3FTNA 2WJAA 1ZCAA 1BVUA 2JFYA 4YJGA 1M1YA 1ZYUA 4EY7A 5ALOA 1B2LA 3LZCA 2QOEA 3M81A 2HM7A 5G3YA 1PT7A 5LWQA 4ZYYA 1SG0A 3X44A 2AQIA 1KS9A 4FHDA 3IX7A 3V8PA 3BGOS 1MJNA 4TTTS 1VYUA 1KMMA 2GR9A 5DHSA 3UJAA 2HAEA 4GP9A 4W7SA 2B1IA 1KRXA 4ZZ0A 4JASB 4BVFA 5GIPE 5JFOA 3PL1A 4K9KA 3M3HA 4CV1A 3AF4A 4P9NA 4AZ0B 1R88A 4BNLA 4CXMA 1Y1PA 1NW9B 1PHRA 1BNCA 4L5JA 1SUIA 1QGAA 1EFAA 2AZTA 2DR2A 3SNKA 5E2BA 3C39A 1M7BA 3DZIA 4RXMA 2ZJAA 3GEIA 1NQUA 5AI9A 5HRCA 4QAJA 1PGNA 1IN4A 2ZXFA 4GMXA 2BF4A 3R5JA 2YQZA 1D2MA 1LTHR 1NBMA