3X1JA

Crystal structure of phosphopantetheine adenylyltransferase (ppat/coad) with accoa from pseudomonas aeruginosa
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
158
structure length
158
Chain Sequence
MNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLFSLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Transition of phosphopantetheine adenylyltransferase from catalytic to allosteric state is characterized by ternary complex formation in Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa 2192
molecule tags Transferase
total genus 53
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2014-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3x1jA00
1WXEA 2J4DA 1UFVA 3TQIA 4K03A 3SP1A 2XRZA 3COZA 3DPIA 3CVVA 2YY5A 1T9GR 1GTSA 1VBMA 4R2LA 4PBSA 1DNPA 4HJXA 5J5AA 2RD2A 1GZUA 2A86A 1PFVA 2DETA 3PNYA 1EFPB 2QTRA 3IVGA 1NYLA 4MW7A 4DE5A 3GUZA 1N2HA 1ZH6A 2G36A 1QTQA 1IRXA 1QU2A 4MW0A 2A1UA 2IJGX 4MQ6A 1NZJA 4ARCA 4QRDA 4ZCSA 1H3FA 4MW2A 3TS1A 1CT9A 3IH5A 1YIDA 2HGZA 3C8ZA 2CUZA 1OWPA 1LI5A 1FFYA 1WOYA 1M8FA 1F7UA 4EG8A 2Z3VA 1G59A 1YIAA 4G5FA 4MULA 4NZPA 3N05A 1F9AA 3MXTA 3UK2A 4NX2A 1JECA 3IUBA 2A7XA 2A84A 3D6UA 3FIUA 3X1MA 4E1AA 4MUJA 4YBRA 1K92A 5BNZA 4XFDA 1I6KA 3CLTC 1N75A 3AKZA 3X1JA 1T6ZA 2JANA 3HL4A 5K0SA 1MC1A 1PG2A 1NI5A 4F3RA 2QJFA 4Q16A 1WZ2A 2ZUFA 3GLVA 4G6ZA 2BTEA 1WXHA 3IMCA 1GAXA 1T6XA 1TEZA 3H9BA 2OQ2A 4RUKA 1LI7A 1Y42X 3UY4A 1R6XA 4PY2A 3P0JA 3ILVA 3HGMA 4JYZA 2PZAA 1XNJA 4J75A 3IVCA 2GM3A 3N8HA 4MWDA 1KQPA 3VGJA 4ND6A 4EG4A 3UMVA 3PNVA 1N2IA 1N1DA 3QTBA 4F4HA 2DLCX 3TZLA 4JXZA 3HZRA 1NUUA 4EG3A 2NSYA 1N2EA 2YWCA 1MRZA 2A4MA 1PFYA 4PBRA 4XFJA 3CVXA 3MLBA 1IQRA 2X0KA 3Q10A 3ND5A 5J59A 2CYAA 1OWOA 1N2JA 3KT0A 4WNYA 4OJMX 1JEDA 4L2IB 4Q93A 4AQ7A 2D54A 2AKEA 1KH2A 5IJXA 2J09A 1ULHA 4ZCPA 3M5WA 4MUHA 4ZT7A 4ND7A 1EFVA 3HFJA 3IDFA 1NUPA 5HUHA 1U7DA 1F4LA 5JBNA 1KR2A 2IP1A 1K4KA 2O5RA 3AFHA 1H3EA 3A2KA 1WXGA 3AL0C 2J5BA 3FH0A 2DXIA 2RE8A 4DDKA 2Z09A 2B7LA 5DEOA 4ZT2A 1EFVB 2QUKA 4X0EA 1IFXA 1MAWA 3U1VA 1O5TA 5K0TA 1EFPA 3ZXIA 4MUNA 1M8KA 2CV1A 2GKSA 1M8JA 2J08A 3FY4A 3K32A 1VL2A 4MUGA 5FO0A 4I6JA 1KORA 1NURA 1PFUA 1KAMA 3P52A 4JZYA 4UZFA 4UZEA 3RK0A 1ZJWA 4H3SA 2WSIA 2WQ7A 2PIDA 3NBKA 1TYAE 1XJQA 4R0NA 4S1OA 2V0GA 2DUMA 1OD6A 3SZGA 2CV0A 2E18A 4MVWA 1ZH0A 1LW7A 1JIIA 1Q11A 4I6GA 2WB2A 3FDXA 2E89A 3D6VA 2HMAA 3FOCA 5HUJA 5KHAA 1I6LA 1N2OA 2IELA 2X1MA 3TNJA 1O95D 4CT0A 2DEUA 2D13A 1WXFA 1QJCA 3KT8A 2YXNA 3P0HA 2EL7A 1BS2A 1NP7A 3L93A 3FNRA 4EGAA 4EFKA 3GMIA 5TEVA 3ND7A 1COZA 1J1UA 2A1TS 1YULA 2QJTA 1U3CA 1J21A 1G8HA 3IMGA 1EUYA 4KPUA 4BWVA 3UC5A 2R5WA 1KQNA 4ZCQA 1QQTA 1JIKA 5KCMA 1O96A 4JFAA 1IH8A 1YI8A 3CVWA 3IOBA 1O95C 1QNFA 4MW4A 2YWBA 3RJZA 1N2BA 5F23A 1NUQA 1U0BB 2A1TR 3CVYA 4KPUB 3IODA 3RHSA 4HK4A 2CT8A 2X3FA 1ILEA 3CVUA 4MW9A 1KAQA 1WJGA 4KR7A 1O96B 4EG7A 1K97A 3PRHA 3Q12A 4EG5A 4MW5A 4DDHA 2D5BA 1I6MA 1NSYA 4NATA 4EF6A 4EG1A 1JIJA 3SEQA 3SEZA 1IQ0A 1OWLA 4R2MA 3LE8A 1JZSA 1ZUNA 4ZT6A 2DERA 2PZBA 1A8HA 1TFUA 4L2IA 1FYDA 4YP6A 3RK1A 2NZ2A 2XRYA 2A88A 4MVCA 4DLPA 1D2RA 1MJHA 3H05A 3QE4A 4RPIA 5LFAA 3CLSD 4MWEA 4DNXA 3AG5A 3ISJA 4MW1A 3CR8A 3MMXA 3KT6A 4ZCRA 3PXUA 1H1TA 4U8HA 2I1LA 2QUHA 4ARIA 1N2GA 1OWNA 4G5YA 1JEEA 1MB9A 1SURA 4HJRA 5FO1A 3COVA 3IVXA 3FG9A 3MUEA 2V0CA 5LLTA 3PNBA 1YUMA 1P7PA 1VBNA 2DPLA 1NUSA 1N77A 3S3TA 1QRUA 3AIIA 1PG0A 1X6VA 1IQUA 4EG6A 2AZXA 2WQ6A 3ZGZA 2QTNA 3CLSC 4AS1A 4MVXA 1TYCA 2H29A 1MBZA 3F3MA 1EJ2A 2QUIA 3H97A 3E27A 3JXEA 4YP7A 4ZCTA 4OUDA 1Q15A 3A4IA 1NUTA 4FZJA 5DASA 3G6KA 4QBTA 3ELBA 3DO8A 2PG3A 3FWKA 2AG6A 4DJAA 1KH1A 4NAHA 3TQOA 3UOWA 3FETA 3VU8A 1M1ZA 4HPWA 1KQOA 3G59A 1WQ3A 3VRHA 4OUDB 3OP1A 1EE1A 2E21A 1O0BA 2ZUEA 1QU3A 1TYBE 4MUFA 1WQ4A 3LCJA 2PXHA 1G8GA 5J58A 1TYDE 1OBCA 2JAXA 3L92A 2GOYA 1N3LA 1TQ8A 3Q4GA 3COYA 1OWMA 1VLHA 4JXXA 2PZ8A 1WXIA 1J09A 1XNHA 5DB4A 2X1LA 4MWBA 2CYBA 4YMIA 3KFLA 4MUKA 2OV4A 4I6EA 1N78A 3TZEA 3IOCA 2J07A 3SZ3A 2QTMA 3MLAA 1JZQA 1I2DA 1J1ZA 1R6TA 2JA2A 3ND6A 1EXDA 1S4MA 3CLTD 3RFFA 1WY5A 2HZ7A 1XNGA 5TGTA 1QRSA 2CYCA 4NDAA 3P0IA 3I05A 3ZUGA 4NAUA 1VBKA 2DR2A 5H7XA 4QREA 4CDMA 5KWVA 2A1UB 4U63A 5AHWA 3RBAA 3AG6A 3KT3A 1J70A 1O6BA 3FI0A 3K9WA 1RQGA 3HV0A 1JGTA 5FNZA 4KKVA 3LOQA 3SYTA 3N9IA 3CLUD 3A04A 2Z08A 3DLAA 3H9CA 3SDBA 4ZT4A 4KR9A 4J76A 5LM3A 4GU5A 3HMQA 5H16A 3ZJVA 1B6TA 3X1KA 2TS1A 1WKBA 3INNA 1KP3A 1KKUA 3NBAA 4PBTA 3IMEA 3ZJTA 1O97D 1MAUA 4K0RA 1PFWA 1T6YA 3QTTA 5HG0A 1EUQA 4CQNA 1J20A 1R6UA 2VTBA 1O94D 1MB2A 2ZP1A 4MAFA 2QJOA 2QUJA 4U7JA 3ZXSA 1IHOA 1V8FA 2EJCA 3ZIUA 1F7VA 2E0IA 3CLUC 1KH3A 1HYBA 3H99A 4ZT5A 2VTBB 4KR6A 1QRTA 1U3DA 1U7XA 1YUNA 4MUIA 2PFSA 1X8XA 4DDMA 2O8VA 1V47A 2CV2A 3ZJUA 1O97C 4MW6A 1JHDA 3CLRD 1Q77A 3A05A 4YP5A 1O94C 1K4MA 4MVYA 5TS2A 4CDNA 4A91A 3FHJA 1GPMA 3COWA 3IOEA 1G8FA 1GN8A 2C5SA 4ZT3A 3CA8A 3DV2A 5TEWA 1MOPA 5EKDA 3OTWA 1O0CA 2BYTA 1GLNA 2H2AA 3NV7A 2CSXA 1M83A 4MLPA 4P2BA 3IUEA 4MUEA 1M8PA 3G5AA 4XSVA 1IVSA 2CFOA 1KP2A 1T9GS 1H3NA 4TS1A 3N2YA 4GRIA 3BL5A 3CLRC 1M8GA 1GTRA 5IHXA 2VXOA 4WSOA 5DK4A 1JILA 4MWCA 1OBHA 1Q19A 1JMVA
chains in the Genus database with same CATH superfamily
2WP0A 3PKZA 3SVLA 2PD4A 1FFEA 2QYHA 3EUAA 4DBLE 1TKRA 1H42A 3IPYA 1MV5A 4IIUA 4NR0A 3O3MB 4TMXA 4F3CA 2AA3A 4P5DA 3U7RA 3AOGA 4UVIA 5F98A 4RLSA 4CHTA 5BORA 3LC0A 2P2CA 2EQ5A 4HQLA 2FPPB 5FOSA 3TD6A 4KRGA 1P6XA 2WG1A 2D2XA 1VLQA 3HRHA 3OCJA 4OM7A 4U2CA 5J5AA 4DCVA 2F8TA 1IPHA 3PKJA 1IXSB 3ETGA 4DAEA 1ND6A 2D0DA 2GPBA 3E3AA 3GUZA 4N03A 4MJLA 4NJEB 1QTQA 3MTBA 3GFGA 4W1PA 4CTKA 3O03A 5DM4A 2D62A 1HO3A 1X39A 3NTUA 3OFNA 3C6QA 2B98A 1N8KA 3KQWA 4KDRA 3K53A 4R41A 4Y18A 621PA 5A3SA 2NVOA 4OGKA 3TS1A 5C51B 4MV5A 4MP6A 4X71A 5LB4A 3RSCA 1SXGA 4YAIA 1PTKA 2FZKA 2TYSB 2ZROA 1EUCA 1Y80A 2ZSHA 4QSMA 5T8KA 3QNWA 4LYHA 3IE1A 4DKJA 1BO6A 1MZVA 2UUCB 3H7AA 4ZU3A 3F8SA 2HHLA 5AICA 1WW3A 5HK8A 1KMMA 3Q0IA 3FD8A 4KQFA 5FUXA 3O75A 3I92A 2GILA 2P5YA 3A1FA 2RARA 2YZNA 4X95A 3S1SA 4HZUB 5DCWA 2PV7A 4J7UA 5TMBA 2G8LA 1J06A 2CLOB 1I4LD 3M34A 5HF5A 3CLTC 3ISTA 5T57A 1RJEA 1WDWB 7REQB 1E98A 5L3ZA 4N82A 4KHZA 1ACMA 1FBNA 5L51A 1EHYA 4QHYA 3AQ4A 5DT2A 4B31A 1UJBA 2C3PA 4DEYA 4DIFA 4JUBA 1KZ9A 8ADHA 4LC1A 1KOGA 1TM2A 3KR1A 4R2KA 3RHFA 1D2MA 3EIWA 1UPFA 4BMXA 2ZUFA 1BVYF 2Q4OA 2BTEA 4EENA 4MQEA 2JJMA 2ZSKA 3Q0TA 4C4XA 1R6VA 1XMQB 1N9KA 2PUDA 3F6YA 1N5KA 3HNOA 3OECA 3ZLJA 1KY4A 3FPEA 3UY4A 1R0LA 4JP5A 3KLMX 3T5TA 2VR1A 5FJJA 4YPVA 1X1QA 3K2EA 3P0JA 4YXWD 3ZD6A 1BWRA 5BXQC 2WJ4A 4JK3A 2FUKA 2TSYB 3HSKA 1U81A 2Y3IA 2HLNA 1ORDA 2JI8A 4HMOA 4BV2A 2CWWA 5EJ4A 2FCAA 1DHRA 2BN4A 5CAEA 3SHVA 3ZVLA 3EZLA 9LDBA 1N1DA 3Q3VA 4LZLA 4QC2A 2GA9A 4ZOLB 3EZGA 2I78A 4H4CA 2NACA 4R40A 3LP5A 1MFPA 1ARZA 4LDQA 3IAAA 1YNOA 1GJRA 2XMQA 5BNTA 3VC1A 1PE0A 4DN6A 1GEEA 4QGAA 1TRHA 4D9BA 4EDFA 3TGPA 1SVWA 4DV3B 1U7TA 3MQ2A 1OIVA 1FYXA 2A0WA 4Q4HB 2UZ1B 3QPVA 4LSWA 1GFSA 1T3GA 3IIMA 4IWYA 5EC8A 5TJHA 1NFFA 4KXLA 1GTJ1 1U2RA 1E3JA 3F71A 4DA9A 4DVGA 3PHLA 2IEAA 4OY3A 4JT8A 1BCRA 1DIOB 3GK3A 4DQVA 5BR7A 5KYWB 4KLNA 3AM3A 3NEPX 4LKOA 4OHBA 4QSHA 5FF9A 3WK8A 3FHTA 1HLFA 2FN9A 4LZOA 2GN6A 2I6SA 2OO3A 2QGFA 3H6HA 5KX5B 4PO3X 2VSNA 4LNUB 2RAVA 4ND7A 5GV8A 5CVCA 1GPDG 4N48A 2P3SA 5D5QA 2DSNA 4N6OA 4H7JA 4ETWA 1J7KA 2XLCA 2A9PA 5KNCA 4HPXB 1WSWA 4QUDA 4OQZA 1GUYA 1K4KA 3D4BA 3IHKA 5CYOA 2GBFA 3URMA 1OH7A 1JEQB 3QUAA 5DCLA 4YJ2F 1XTJA 2QX9A 1NI4A 1EFLA 5DP1A 1XRNA 3KJHA 5M5BA 2Z98A 4FKBA 3GRZA 1PDWA 2ECOA 2IEGA 2YXBA 4Q7LA 3TIVA 2C4UA 3TLGB 4ZT2A 2H7VA 5E2BA 3UCFA 4CKBB 1UUFA 4Q47A 1PJZA 1K3FA 2B37A 5D3QA 4RKFA 3TOCA 1FU7A 3DD5A 4MJXA 2ZZMA 1M8KA 3NHYA 3IQXA 2V7QD 2OQVA 1WMSA 2J59A 4O08A 4C78A 1ND5A 3KZOA 1P1JA 1PCXA 4QTYA 3M1YA 1E5XA 3K1YA 1VL2A 4PQGA 1P31A 3RDPA 3C3XA 2IUYA 4RSMA 1YE3A 3D7MA 3QVTA 4JB8A 3TSWA 5T41A 4UZFA 4UZEA 1IPEA 3MZ0A 4IV8A 3FHLA 2ZE6A 5ALLA 3ZHVA 3Q6IA 3F2IA 3PKIA 1B3BA 1DMSA 4QKQA 3ETEA 3FCEA 3QXXA 3DYVA 3U4AA 5JC1A 2QMYA 1YQQA 3NIWA 1H4QA 1Q92A 1JKIA 3LC1O 1G2QA 4KPYA 4OHMA 1P17A 1YSCA 2FW9A 1Q1AA 2IEZA 2JIZD 3OJ0A 1WCIB 1XA0A 4GSLA 1B0ZA 3G2PA 2OXTA 1PEDA 4GZLA 5K0ZA 4UDXX 3OT4A 3Q7RA 1H2HA 4JP2A 4C4AA 1KSFX 2WYVA 1HWYA 5CA0F 1MXFA 2JZNA 3U7QA 5JT1A 4IV0A 3HKDA 1VJTA 4JLOA 1NC1A 4N7JA 4OU5A 3FOAA 3M4XA 4EI8A 1NXQA 1IEQA 3CJRA 2HHCA 5ITSA 2ST1A 3FNFA 3GMIA 3FPSA 4EDHA 1RS0A 5K8TA 3QEAZ 1EK6A 2FF7A 3KUDA 4TT8A 4B80A 2DP4E 3H1TA 4H16A 4OFZA 1M1NA 2FR0A 5A7HA 4CLDA 3NRCA 2LXNA 4OV6B 3HB5X 1OTHA 1MP0A 3IMGA 3H3FA 3TRDA 3U4QA 5CITA 1LGYA 1WABA 3SQWA 2ODAA 4PSDA 4XJVA 1XA4A 3OBIA 4KQGA 3S1AA 3T99A 5IDXA 3W3AD 3JAWA 4RTKA 4R2JA 3RUHA 4C0HA 1KJZA 1DO2A 2C2BA 2DBVO 2OBFA 5IM4F 5IVHA 5ESXA 2QTAA 3F3KA 4GX0A 3IP5A 1ZIDA 3Q5GA 4GDFA 3P8ZA 3ENKA 1ENPA 2WTXA 4YJGA 1EVEA 4G4JA 4JYPA 2J4FA 2VJMB 3LT5A 4TV9A 2PUWA 1XSEA 4N8EA 2VUSA 2GF0A 3FDZA 1YGPA 3KDSE 3FPFA 4H7HA 4EY5A 1WA5A 3ORHA 4NEHB 2HXYA 4YFYA 3CWZA 4F9EA 3DAGA 2OQRA 3B48A 4KQKA 1J8QA 2HK6A 4Z86A 5ILQA 2C84A 3VVBA 2RHLA 4CM8A 2YRFA 3SIRA 2G1UA 2VA9A 3PCXA 1NQXA 2HV8A 3H5RA 5DW3A 1VBFA 1A1VA 3K7EA 1ZOOA 1EJBA 1FVOA 3UYLA 1UR5A 4C05A 1NSYA 5ALGA 3W5DA 2VZLA 3N2KA 4Q7QA 3HJHA 4FD2A 3EARA 1B00A 3ZE6A 2O8NA 5D51S 3TTXA 4ETIA 1UDXA 1NVXQ 2GRUA 4N41A 1TZJA 2JFGA 4DA4A 4LHWA 2WIGA 4JFRA 4K9MA 1FYDA 1KJ8A 4GPD1 2NYVA 1GCGA 2UZ3A 4QYSA 5L9AA 1JALA 4DWJA 5JMWA 1T9KA 1EU1A 4CCYA 3FNHA 3NFRA 2R96A 3EWIA 1PWXA 1SVSA 1FXWA 3EMVA 4HDRA 3D6NB 4J90A 4MWEA 4Q39A 5BN5B 3TW8B 4R8MA 1MW8X 3RF6A 4BGEA 4R1TA 3NT4A 3NM5A 3GCWA 4XYEA 1NBIA 3UICA 4AN1A 3IKTA 2PQ0A 1DT5A 1J56A 3HVJA 2ARKA 4NNOA 5KNLA 5ALZA 3U4IA 1W2GA 3L4BA 3ACBA 5H0IA 1CUJA 5LL6P 1NW6A 3ZU3A 3AUUA 5EKXA 4E21A 2HA7A 4RH1A 3NTQA 3WP1B 4X20B 1OJLA 1VIYA 2FQ1A 1N57A 4II3A 2B9EA 3STVA 3ZE8A 1XALA 2P0EA 5A2QA 3JALB 5CA1F 3ELDA 5DGCA 3U80A 1MC5A 5LLTA 3I62A 4WVFA 3JD1A 2FSIA 4C4RA 1LX6A 4CUJA 2E6KA 4IQ0A 1HTBA 2F3QA 4DJ5X 1FLDA 2BDEA 2P69A 3QPDA 5HX7A 4PAMA 3MGGA 4BVHA 1IVSA 2RGCA 4HDOB 3VVMA 3OJXA 3WYNA 3EG9B 1Y63A 2CFSA 3GP5A 3KD3A 1UBGA 3WBJA 1KEZA 2J0EA 3F3MA 3GJ0A 2JLBA 2QUIA 3DE4X 3H97A 5FB3A 4HH3C 4QUHA 4OUDA 2NZ8A 1M73E 4JGBA 4RSRA 1AKTA 3ANTA 3TTSA 3OKCA 4M4SA 4XAQA 2OHFA 4FZJA 5E4JA 4A6EA 3QE0A 1C4XA 5B5SA 821PA 4GP7A 5CG2A 2YOGA 3TWOA 4AURA 4W5NA 1QIFA 1SC4A 4G5OA 1G5RA 4NAHA 3KKQA 3FGOA 4FUTA 4JQCA 2PBFA 1R0BA 3MOGA 2AYYA 3JQAB 4K2AA 5DFAA 3B7WA 3KU1A 2JJ1D 4W5JA 2MJLA 3C98A 3LG2A 1R8QA 2A5GA 2GASA 2Q3DA 4DLVA 1ZAYA 4GSYA 4FTWA 4LBWA 1IMOA 2OB2A 2XCIA 3DO6A 3F5FA 3JS5A 4NENB 2AN5A 2F64A 1GN9A 3IR6A 4YCCA 4B3FX 4UBNA 3Q7SA 1V4BA 5EKTA 2QR5A 4KAXA 5JSYA 2ZWVA 2OZLA 3ANYB 2JGRA 4ZN6A 4R7ZA 3VYSB 5IJ9A 4B6JA 1W88A 1P91A 1YB2A 2V97A 2X2OA 4QLOA 4HWGA 4RH0A 3KQKA 1VL1A 1ONBA 3ZYZA 4J0JA 1OXVA 1A9XB 4HDKA 3A06A 3N07A 3HJTA 4JI3B 1ZM7A 2HT1A 2Q28A 4ZZ2A 2DU8A 3GA7A 3KFLA 1P1IA 1U0RA 1GUDA 2EBUA 3PFCA 4PS1A 4WOBA 4NXMB 5IAOA 3M6VA 4ZVMA 4IGAA 4L4UA 1G3UA 2AG0A 1DQPA 4B6EA 2GESA 5T4HA 2GXAA 4U39A 2WNSA 2BFBA 1PJQA 2ERXA 3IE0A 1BWQA 4RXTA 5K4HA 4MVJE 5G4KA 3VTAA 4KPEC 5F3WB 3OA0A 4Q19A 4O0MA 4PZ0A 4YBZA 1UH5A 3JWGA 4JBYA 4BBAA 2HGSA 1WY5A 1XG5A 2YHUA 3QFHA 1FFSA 1YQTA 1CVRA 5ENVA 3OOWA 4D3XA 2XCTB 4L6IA 1XPRA 4NDAA 4YHHB 5DBEX 4EI2A 2GPWA 1ABFA 3OKPA 2AMYA 4DARA 3PUHA 4M7RA 1QK4A 3A58B 3WNDA 2XT0A 1JE1A 1WY7A 1PK9A 2WWRA 3G5UA 1Y6FA 1SZPA 3UWKA 3VHLB 2Z2YA 3UUGA 1Z68A 2R4UA 5C1IA 3GT0A 3SS9X 1U2EA 3L9XA 3IEPA 4J16C 1NL3A 1R74A 2KI5A 1I7PA 1IY1A 4HB3A 4Y2TA 1H4VB 2OYRA 3IHTA 1AGRA 4BGVA 5H4GA 5JY1A 4G1FA 1C8BA 1PGJA 4Y1GA 4BWGA 4E32A 4G25A 1BFKA 2ODWA 4QPCA 3VPFA 4ER0A 4MPPA 1NG1A 1FSGA 4LWQA 4LXQA 5C4IA 3PC4A 4M0DA 1DOAA 3HABA 1Q14A 3N86A 5JE8A 5EE0A 4KR9A 4D97A 2A14A 1M2GA 1CDZA 1CFZA 1QYRA 4CDRA 5H16A 3AR5A 4HVLA 1B6TA 4TS4A 1IC6A 1UK7A 4JR0A 3SS8A 2DF8A 3LZCA 1ZD5A 3DTYA 4BPRA 4BNKA 1I2CA 2X9QA 1O97D 1YR9A 3G89A 3PF8A 4Q82A 3T5BA 3ZWQA 4XRRA 1V39A 3ETNA 5ENZA 2Z4RA 1E2UA 1SUAA 3EDYA 3A6GA 3JVUA 3NO4A 1MB2A 4PLYA 3W1EA 1NG9A 4URWR 1NVKA 3R2JA 1T0UA 1IDN1 4PO1A 1IM2A 4MAFA 1Z83A 3UHOA 5L95A 4MGYR 2H57A 5I01A 3UC9A 1SXHA 3AETA 1PQUA 2HMVA 4DCMA 1NDUA 1GPBA 4UHKA 5E9AA 4MMZB 3NQ41 4ZOBA 5B2FA 1VKRA 4ZKDA 2KPOA 2Z9BA 4K26A 3M6LA 1RKBA 4DLYA 4RSGA 3ECCA 1FU4A 4IIGA 4Q1DA 4TMZA 1ZSVA 2PO7A 5GOZA 1NBWB 4A9AA 5KNDD 3RS9A 1RT9A 1U7XA 1V9SA 3F98A 4EARA 3OQMA 2XYVA 4Y6QA 3I9KA 1PFQA 1WTCA 5BSGA 4ALLA 3F47A 1GTMA 4ZEXA 2QRKA 5C1DA 2R48A 3AXTA 3KPJA 5DWQA 5LXTA 4DLAA 4L4ZA 4A8JC 5FORA 1AK9A 1XTTA 3H2IA 4CDNA 3IV9A 1NFRA 4Q3EA 3RNLA 2W6ID 2HAEA 3IPLA 3WDSA 1B0PA 4EKYA 4DV7B 1E1MA 1SH7A 1DKRA 1GN8A 2C5SA 2HO4A 2K87A 3IX7A 3N0VA 4WDQA 4RACA 4R98A 1U8EA 2BDTA 5FUVA 2C9YA 3ZDEA 2NU9A 4LZZA 3KCQA 2C0CA 4CM9D 4ZEMA 2JJQA 2QL6A 3B1KA 4RDHA 1BWPA 4X92A 1UIMA 5LQDA 3R4CA 4FWBA 1CB0A 4P3YA 4DXDA 4EVRA 5K6AC 4DR1B 2IW1A 1HFJA 1Q5PA 3R3VA 5LU8A 4D8UA 3SM9A 4MUEA 3N7UA 1RRPA 3TKYA 2O3SA 2VHYA 2DT8A 1KP2A 4JB3A 4AN0A 4C20A 1YTUA 1HV8A 1TFRA 2EYUA 1ZVKA 2EP5A 3B1JA 4M37A 5K09A 1JPUA 5EY5B 1XIVA 4LHXA 2F8MA 3BXOA 3G23A 1JLLA 2VF7A 2Y92A 2UZ0A 4IHQA 5AJTA 1OPXA 5DK4A 1A2OA 1OBHA 3BAFA 3VHQA 2ID8A 1UPCA 1QHFA 4NI5A 5D7BA 4B1FA 4QRHA 3KSDO 1QMGA 3LRPA 3M89A 3HV2A 2J4DA 3LCCA 3OY2A 4HGPA 1SBTA 4WESA 4B35A 3NAQA 4GUAA 1IEWA 2CFTA 2XRZA 4R8RA 4C3UA 2VNKA 3I76A 2WMNB 4QA9A 4TRNA 3PQ8A 4B6RA 3E5HA 3V3TA 4F4FA 4CEHB 2EKLA 3R44A 2JGMA 4R2LA 1IEXA 4QQNA 4BLOA 3DB2A 1P1RA 1QF9A 1CK4A 4L9WA 1XP5A 1YRYE 4JYBA 1Y4AE 3H3JA 4K3UA 3ZZ1A 2ID4A 5DTMA 3RC7A 3IRUA 3OQ6A 1LVUA 1ICEA 5JS6A 5TIIA 1V43A 2Q3FA 4DLBA 3DQPA 3ETHA 1JEYB 3GGDA 4TMYA 5DNYB 3CVJA 3T3DA 3RC8A 4Q5IA 2AZDA 3LHKA 1VZ2A 5GV7A 2GEKA 1WNFA 2YC2C 1IE3A 4XSGA 1NE7A 4L9RA 2JAWA 2W22A 4LV5B 5JU6A 1PNOA 3VGPA 1MIHA 1YZUA 3BSSA 1Y48E 2PX6A 5JFOA 1M8FA 4EG8A 1X7WA 1OROA 3UOGA 5TPZA 3NC1C 4KBYA 4RORA 5LVAA 1K2VN 1Z6GA 1IN6A 2FZGA 3NATA 4I55A 4B6GA 3LA6A 2AFIB 3T9FA 2JIRA 3QRWA 2WAOA 2QLFA 4KIUA 1ODLA 1VFNA 3BF8A 3EYWA 3RBVA 1XP8A 2XCRB 2YZGA 1NMZA 5BRAA 4WBNA 2ORWA 3NUZA 1XL0A 3DXXA 5BMVA 3U2QA 3GG2A 2HXSA 2P4EA 4IMRA 5ICGA 1P4AA 2D1RA 5ECYA 2QG4A 1T6ZA 3UJ3X 2IODA 3KWJA 5K0SA 3L1UA 2CMDA 1HETA 1ZM4A 4D3YA 1AUOA 4Q3KA 1J33A 3GEGA 3TNYA 5JAPA 1Z7EA 2FPIA 4R9NA 1TCVA 4YAJA 4MUXA 1GARA 2IYTA 3OLVA 1RAAA 3T4UA 1E63A 3G2MA 1RKQA 4UHEA 2BD0A 5A2GA 1D7AA 3H9BA 4I19A 3GA0A 4M0KA 4D4JA 3JAKB 2XMPA 3ZGLA 2IOFK 1SPBS 2D7CA 3JD0A 5EIFA 3DLIA 3QP9A 4JEHA 5GJWC 1VYHA 3O8CA 1I9CA 2VXCA 2C1ZA 3F4LA 3U7HB 2Y77A 1WNTA 3LBNA 1QDUA 1P7VA 3OKAA 2IH5A 1F8XA 1XNJA 3IVCA 2JBHA 2XMBA 3MFQA 4IRXA 1KQPA 2C5AA 3SYLA 2JFBA 1QM5A 3VO9A 1JS1X 1J2JA 3NBQA 2VP6A 4CCAA 3QTBA 3RAEC 1BN7A 3I0NA 3GLFA 3RYHB 5CB4B 2O06A 1E89A 2B36A 2BW0A 4V03A 4OLAA 1CY7A 3CY6A 4H7PA 5EZYB 3WK5A 2QVLA 3IXMA 4LXYA 1E99A 4OH7A 1FRQA 1GPUA 4NMHA 1CR6A 2E2WA 3PD1A 2Z58A 4A6PA 2VF4X 3K0FB 3K9NA 3MLBA 4F4CA 3LYAA 3SIPA 1QVWA 1QQBA 4MWSA 3OPXA 4CV0A 5C7LO 1SD5A 3PSAA 4G1MB 3VJMA 3HLYA 5CCEA 2R86A 3WQQA 5B4UA 2XF2A 4QYMA 4DRXA 5A5GA 3EOZA 2D2IA 2BEWB 2GWHA 4EJ0A 4Q93A 1U4OA 3DEYX 4JROA 2CLHB 3OC6A 4ETMA 4FX5A 1MOQA 5ANRB 2VLIA 3IA7A 5IJXA 1ZJ6A 2JRLA 4IW3B 3AFMA 2V4ZA 1VL0A 4KV7A 3PL1A 3A28A 2ZRLA 5CFMA 2BFWA 2FR8A 2OXIA 4ANFA 2GA8A 1TIBA 1SC9A 3H2YA 1ZNWA 2ZGVA 2WAXA 3QKIA 1YQDA 1XTUA 1UXKA 3D6MA 2OYSA 2DXIA 4MYSA 5BOSB 4DS3A 4KFUA 5ALJA 1TUIA 4PYOA 2GSWA 3W6UA 1MXHA 4LDAA 3Q5DA 3DF9A 3QFSA 1CVLA 3WSTA 2QUKA 1RW4A 1GNLA 2J30A 2PZLA 1KI2A 5A9RA 1O5TA 4E22A 4EY8A 4L73A 1L0BA 3A6LA 4MKXA 2R751 2F1JA 5HCUA 1NW7A 1IBSA 1WUIS 4M9CA 1JW9B 1L3BA 1OZFA 2XZTA 3KHTA 3KVNA 2WRZA 2Q5CA 2ZJ2A 3FY4A 5LZ2A 3H0CA 5IRCD 3RU7A 3X0DA 1X7DA 5D1NA 1HFKA 3X1ZA 2NXJA 4YRCA 2KYRA 3CUUA 2VNSA 3BZBA 2HJHA 5DBGA 5ABPA 5J4YA 1MFZA 2WG0A 5CEFA 2JKZA 2JBWA 1VXRA 5I9NA 2ACVA 4HAWA 3CN9A 2P65A 1S7GA 2BELA 2B0CA 4JGGA 1OD6A 2WHPB 2XJ4A 4R1QA 5K0LA 4D3SA 1QQAA 3WRXA 2NPFA 2O8CB 3HU1A 4CF4A 3S28A 1Q11A 3JQEA 4YPFA 3DBLA 3D6VA 2HMAA 1WX1A 2QW1A 5KTSA 2ZE7A 3GLGA 3GLIA 1IK4A 3RSQA 5KJFA 1F8UA 5K5EA 1HNXB 1WXXA 4DDVA 2ENUA 4KJXA 4NRDA 4OJTA 1IB6A 1O95D 2XNKA 5A6SA 2D13A 2JARA 3ZKWB 2J3JA 3H11A 4IUDS 3UIEA 1CZNA 3CV3A 3L5OA 4L0CA 4FKMA 2HWXA 1KAOA 3CNQS 3VV2A 1SBNE 2GERA 4PFSA 5EL0A 1PZEA 2ZEJA 4JP8A 4BNDA 3IKMB 3WGKA 3G68A 1J1UA 4AJPA 4XQCA 3MT7A 5DTRA 8LDHA 4QXPA 2JJ8A 5E2IA 3HXTA 1XT6A 4CV2A 1RXSA 1PR0A 3O95A 4NZNA 2IOQA 1BFUA 1PHPA 1OZHA 2B4TO 3V7UA 3I9MA 3B5EA 3WGMA 3QGMA 2FMFA 4C3VA 4OI4A 4ZHQB 1UXIA 3JSAA 3KWLA 1FPQA 4FMCF 1Y7TA 2O2GA 2XTZA 5DN9A 1KQNA 2IYZA 2C2HA 2W2KA 4G1BA 1YZNA 3EQ7A 4LXHA 3DOFA 4R8LA 3WRVA 3K0SA 3H5LA 1XXLA 1YU9A 5F77A 1DQSA 1RI3A 1RU3A 4XDZA 4D43A 4D4GA 3MAJA 4EKGA 2YOFA 3IVRA 2VJDA 3ONNA 4U2EA 1XCJA 5I4KA 5KNCH 2O19A 1CUEA 3NC4A 1E2GA 1JHVA 2YVLA 3BVPA 1DTEA 2C2MA 3IHLA 3V46A 4GO1A 4G8BA 4LY9A 3BGIA 3ZIAA 2X5XA 1L5OA 4DAOA 3GQBA 4Z3KA 1T10A 1UEJA 2GD1O 1UJ6A 2QTVB 3L6RA 3LWZA 3PT5A 4BIMA 2ZBEA 2CKMA 2ZI6A 4PN3A 1Z36A 4FEGA 4KWIA 4Z51A 2C96A 2H31A 4I4TB 2ZCJA 4W9MC 4TSFA 4X1OA 2HXGA 3MWLA 4EG5A 2WOOA 4MW5A 1CP2A 1ZVQA 2NUPA 2P2LA 1QVAA 3SWWA 1KMQA 4UU7A 2QR2A 5HGXA 1AQNA 1T36B 3BMOB 1KKLA 5AOAA 4HNQA 1G3MA 1BW9A 3KQTA 3DZ8A 1I13A 1IIBA 3IAS1 4A92A 1QHHB 3BQMB 4DPKA 2BGUA 2GXUA 4O4HA 4A73A 1ZZEA 3ROPA 2WWWA 1MZPA 2EFJA 2Y8EA 2CNLA 2R8PA 2R8ZA 4RU1A 1BDMA 2QVZX 3H05A 2NTNA 4XGIA 5KDDA 2Y0CA 3U9LA 3PQEA 2HC9A 4QOFA 4ZRNA 3UVEA 3ISJA 3M5DA 3R8CA 1OLXA 3H42B 4LTNA 1SM4A 3UA3A 2YRXA 4MRVA 1G63A 2VF8A 5EEHA 4ZO8A 5LD2B 5B6IA 4HQOA 4XKJA 1IZ9A 2HMUA 3EEFA 2PSDA 2A9FA 2YJ6A 3PGVA 4ENRA 2D2VA 3AWIA 4QXMA 3BHNA 1KHTA 3L6OO 4XQ9A 3WZLA 4F2DA 2QV7A 2J33A 3W04A 1IWPB 2H0RA 5MFPA 1A95A 3CT4A 3MUEA 2W98A 4LJRA 4YRLA 1MG0A 1GVHA 1IXZA 1FVHA 5IKOA 2BM1A 1DTWB 1H0KA 3MIIA 4M38A 3CONA 3ZGOA 2VATA 3F9RA 3VU9A 4XGRA 1IQUA 5DRYA 4J4HA 1G7CA 5C8YF 5K8LA 3FSEA 4N8SA 3WRYC 3OIUA 3BKWA 1G2OA 3OMLA 1YZTA 2HF9A 3FNEA 2GARA 4ZU1X 1P5FA 4B3BA 1XZCA 3NWBA 4ZV4A 1IY8A 5A4KA 1CJTC 2AG5A 4YV2A 3IUYA 4JVMA 4ABTA 1QIGA 2ZJOA 1PWEA 1DX6A 4D9MA 4A1FA 1VSUA 2H1WA 2X5JO 4NMMA 3NKVA 4WDRA 2NYAA 3A9RA 3CRZA 1KAEA 2HOQA 4TS3A 1XEWX 1PL7A 1ZI8A 4ZVKA 1BN6A 2O3TA 3I9OA 3GGCA 3IIIA 4FOLA 1SPXA 4WLNA 4ZK2A 1H0RA 2BH9A 1QE0A 4PRLA 1JXOA 2J67A 2VZ0A 4XM0A 5CDHA 5TS3A 4HPWA 3PJGA 4J2OA 1YJCA 2PH5A 1YD7A 4JLMA 4WFIA 1NW5A 4BP1A 4DPLA 1FJXA 4HS4A 2GSDA 1EE1A 1K4YA 3MRXA 5BQFA 2HU2A 4MUFA 1GL9B 3JSXA 4HTAA 3PX2A 2XE7A 5J4KA 1QFXA 4RBNA 2GYYA 1Z47A 5AOBA 4D41A 4NCBA 3OWXA 1IRIA 3OJFA 4MHTA 1GRNA 1CW2B 2WUFA 3S8EA 1E3LA 4A10A 4K86A 2AKYA 2FXVA 3COYA 2JEZA 1CFJA 3NG1A 2A5LA 4PQYA 4ITUA 3AM5A 5K45A 1Y1RA 1MNAA 3O1IC 2HSDA 1E9RA 1ZCJA 2CYBA 3QPWA 4RKWA 3UMFA 4F56A 4MUKA 1XZGA 2Y76A 4R5HA 3LLVA 4LXUA 3G1WA 3G8CA 3D5QA 2Z56A 4LYGA 3EEQA 1NNI1 3DD1A 5I9IA 2FH5B 4MMXB 5EI5A 3DZGA 1R5OA 4L76A 1XL1A 4NYJQ 4L8YA 2X5OA 3HKEA 4YIHA 4ZVUA 5G0SA 4CM4B 3BICA 3K8ZA 4K6HA 2CBXA 5FHQA 1Y82A 4PX2A 3AUJB 2PU7A 1YJXA 5AJVB 2J7PD 3BFXA 3ZGXA 1XNGA 4YQFA 4K9KA 1FYFA 2AUMA 1K6JA 1PV2A 4LGYA 5HFJA 4IDPA 4P82A 4X3CA 4B7ZA 8OHMA 3B6MA 3I5YA 4CEJB 1BMFD 4KWTA 4ZTUB 1O6FA 3NVDA 3A2NA 5TF0A 1PWYE 5ITZA 1RC8A 2ZT8A 1G3RA 4XD7A 3AG6A 3ID6C 3DFUA 1A8PA 3KT3A 3BL6A 1WOMA 3VSDA 3NASA 1NF8A 3B70A 1PK8A 1J2UA 2UUAB 4JOSA 3ORRA 5FA5A 3PK0A 1RQLA 5KQRA 1G8PA 4XLZA 1ADCA 3L82B 5GM2A 2R87A 1MQAA 5BRNA 3L49A 2DX7A 1XKLA 2A0FA 4X8LA 1JGTA 1MW9X 2PPLA 2NZVG 3KKOA 5CA1A 4BZPA 3EPJA 4ML3A 3KLNA 4EYQA 2WJAA 1A8SA 3V97A 2HO5A 4HQFA 3AJDA 4QTUB 4TVBA 3DSRA 4HSGA 2FVYA 4O4LF 1Z63A 3R7DA 2G5TA 3ZJVA 3FHOA 3M9LA 1CRZA 1XZDA 1KKUA 3ZBUA 3NBAA 5EMKA 4YV7A 3S99A 3IMEA 2P90A 4X24A 5DLEA 1AOXA 1KMHA 2GK6A 4K0RA 4TYNA 3D3QA 1BHO1 4X6XA 3LDFA 3M1AA 1NLUA 2JGDA 2Q2WA 1H6CA 1T4CB 2HMSA 4QO7A 3S55A 3IEVA 1NW9B 1P7ZA 3BIWA 4IXTA 3DS8A 5KCZA 4V0ME 3O8BA 3LPLA 3IUPA 1WVMA 2XUPA 4YROA 1T34A 5KUTA 3KB6A 1Z6PA 3CTPA 1H22A 3QU7A 4YLYA 2FFAA 4GC9A 2FLKA 3H1GA 4QU8A 5EGNA 1VDZA 2QAGB 4F5EA 1F7VA 4DQUA 1DRKA 1HYEA 3THYB 4PX5A 2VQEB 3DA8A 3GBPA 4YGXB 5FDFA 5K8IA 4OI1A 2Q3EA 2WZQA 2VTBB 2QUZA 4C4PA 1GG2A 3TM4A 2ZSIA 1WPQA 5CEEA 1NJ6A 2O8DA 4E2XA 1OOEA 4XLTA 3A4LA 1H9CA 1EJ6A 1V47A 1I7NA 3WS7A 5IC5A 3ZJUA 4GMFA 5DWDA 3I04M 2H06A 2NZXA 1GYRA 1VCMA 5LLSA 3LGXA 3MEQA 4OHYA 5EAIA 1N6LA 2QD5A 3HVRA 4EPWA 4AJLA 421PA 3KHSA 2V7QA 2VEOA 1Q0PA 3DHYA 3VHXA 4EJSC 1SOUA 2WF5A 2GEJA 3M7IA 1GPMA 1OV4A 4ZZ1A 4E13A 4BFSA 3UN1A 1YR3A 4Y2SA 3REOA 2R00A 1ZJ4A 2AK2A 3NH6A 4QGBA 4Q9NA 2QI9F 4QXOA 2C29D 3QUCA 4PZDA 2O8BA 3BWYA 3CSSA 1V26A 1B16A 4UTNA 2CUNA 1AHPA 3OTWA 2IYPA 4FOOA 1Q2UA 1QO0A 3L0ZA 3E3OA 4W5WA 5TE9A 1YJQA 1QGYA 1SHZA 3H8WA 4JQSA 4H27A 4BOYA 4C04A 5K6TA 2CSXA 4B3GA 4BNGA 4DXHA 2H2DA 4JJZA 2CFOA 1DBWA 4Y2PA 1T1SA 2P2NA 3I4CA 1LLUA 3E5RA 4QYTA 2DC1A 3GP8A 1FJHA 2HEIA 4UEJA 5F21A 2HSZA 1KIMA 2QV0A 1KDZA 9GPBA 3Q7TA 4L08A 4TKZA 3EF3A 1XQXA 2V98A 4O5OA 3A3NA 4RJTA 1B8UA 1Y8QB 1JMVA 2VIIA 1CIPA 3GMTA 4MW0A 5E3IA 1H94A 1SVLA 4X60A 3BJEA 2J9GA 1BE0A 1QG4A 3VPAA 4RANA 3LA8A 5AW0A 1B0UA 3EC7A 3K0AA 3AONB 1I24A 3B2NA 1T4BA 2D4HA 2B61A 2HRQA 3KG2A 3VR6D 3ZPXA 3CVVA 1TZ2A 1XDDA 3KL4A 5LZ4A 2YJGA 3K1JA 1DC6A 1L2TA 4BMSA 2QYSA 5JZVA 1HOTA 3JV7A 3U4GA 3F6RA 1S01A 5DVZA 4UXJA 5IX8A 1IJKA 4PNHA 4RJKA 2GQ0A 1W75A 3W3AA 1JQKA 1GU7A 2COEA 4FQ7A 2WWGA 4GQAA 3BGSA 4AJ4A 3O73A 3A6KA 4BO7A 2YS6A 3KOMA 4HXYA 3WNVA 1AS3A 2I7CA 4LYEA 2PT5A 1VDMA 3ONEA 1NKTA 4EHKA 1SZCA 4BLTA 5H02A 1SA0B 2J85A 3G88A 3TXYA 2YN4A 4CBVA 1NVVQ 3C8ZA 1XWIA 1Z29A 3HHPA 1JVBA 1LI5A 5L4LA 4WZBE 1V41E 4NU6A 3PDIA 4AZTA 2QKYA 4EBBA 1SUPA 4BC0A 4D7AA 2GN1A 4QT0A 4S05A 1VA4A 4CL8A 4G5FA 1UFKA 1BG6A 2OFOA 1ADFA 1D8TA 2X77A 3B78A 1VECA 3N05A 1CS0A 4Y2QA 4Q6WA 1LEHA 1WCXA 4BV9A 4CV3A 4KXYA 4DNOA 3FTEA 1NU8A 1YZVA 3O4FA 2WYWA 4M1QA 4ZEOA 3ZH2A 4YJHB 2DGDA 3PD0A 1NV9A 4L75A 3ZY2A 5CR9A 2WFLA 3G1UA 4YASA 1JA0A 1XI2A 5EIWA 2CD7A 1I6KA 1P2GA 1KERA 2QQ0A 3KSUA 1NNSA 2G76A 3F7OA 4J6EA 4QOGA 2WICA 3QVGA 4XD7D 2VP2A 2IGTA 3A3YA 3SKVA 2Q5IA 1H2BA 2QRMA 3AVOA 4JJ7A 2QRZA 5A9TA 3BA6A 2JGEA 2PT9A 3E81A 5CGQB 1VKHA 2W6JD 1E4EB 3GJ4A 2NO1A 1QZTA 2OESA 2DTXA 2CNOA 3DWIA 4G6ZA 4OMCA 3HJBA 4P4GA 4EF5A 2CNDA 2VQFB 4PLFA 2UUPA 4L5JA 3PGKA 1R00A 5C31A 4AQYB 3GFSA 1C7ZA 2G0AA 2IK8A 4G41A 3EVGA 2K7FA 2NUAA 2VFAA 4XIYA 5FLYA 2OPHA 1R6XA 1UMBA 3V1UA 1AKRA 3BFPA 2ZQYA 3FA2A 1XHFA 3P9NA 1KIFA 4Z99A 4JYZA 2X7XA 3RCBA 3H87A 1P9LA 3CZ5A 2BHTA 4LN1A 3A0UA 4O2BB 5HFNA 4B6PA 3S70A 3JWJA 3UMVA 5CCDA 4JDUA 4J1TC 1NMXA 5EZ6B 4O4IB 3TR0A 1SBYA 2LDBA 4I08A 4TOIA 1FNCA 1Z2CA 3WLAA 5LQRA 4DB2A 4LC0A 4RQTA 2DOKA 3QBJA 3K5PA 3QSGA 1Z0KA 1G21A 1NMSA 2NV0A 5DBOA 3SFVA 4AJNA 2CEKA 4DR4B 3RKRA 3DR3A 4WNAA 3QVJA 4N5DA 1HFWA 1FRVA 2A59A 2VYQA 3OCCA 1MT3A 3QTLA 3CHYA 4DCTA 2VAXA 5H3HA 3NNSA 2ILVA 2OXRA 1A7JA 1FDOA 3BRCA 3CN7A 3EGXB 1H1LB 3FWZA 3HXLA 1R0WA 3N8GA 3W4IA 3ZNOA 2QTGA 3ONDA 1YHYA 3X2EA 2AOUA 1AF4A 5FP0A 1L5NA 4C0AC 5IYZF 1USKA 1Y3CE 4D6PA 2GPAA 1D4ZA 5D8DA 1X7GA 3P2KA 4DLXA 4PWZA 4ASUD 3O4VA 1C1XB 5DBFA 1HI9A 1O5OA 4PXYA 1Y33E 4S2UA 1AB5A 5J3JA 4B71A 3EVZA 1NZDA 5KTYA 3OJCA 1I7DA 2W9XA 1BMTA 4D5GA 3ZC3A 1TU0A 1ZVVA 4ARVA 3UJ9A 4FB4A 3AVTA 1PSDA 3BMNA 1JVSA 4MRMB 1ZNYA 4EZBA 1U7DA 1JU3A 5H59A 2XZLA 3OQHA 2ECFA 4TMKA 5AQEA 1GSHA 2QW0X 1HEUA 1R9NA 5DTJA 3S40A 1XRJA 1K9SA 1TMGE 2WWVD 4WFJA 4DLLA 4HH0A 1AUPA 1A5ZA 2CVOA 2FK8A 4L95C 3HEBA 4MROA 3OQJA 3RIYA 1WEKA 1L8LA 2SKCA 1C80A 1IBMB 1WSAA 4OREX 3FFXA 3AY6A 3MK31 4MKFA 3X2FA 5DV9A 1NQOA 5SZIA 3KRTA 4M76B 3K0BA 1N3BA 4J2HA 2G04A 5CLLA 2GKSA 4XPIA 5AP9A 3E3LA 3PQCA 4RM2A 2J08A 2FFRA 2SECE 3VH1A 1P1FA 4PTZA 3W5VA 2E4AA 1T9CA 2J9YB 4HUQB 4H59A 4IG9A 3WIDA 3KK0A 3OC0A 4II7A 4DQXA 1CZHA 4M22A 3PJEA 3L0CA 4M9QA 3NV9A 3VKFA 1JWLA 5FOXA 1MPXA 5G3ZA 4Y6LA 1NAHA 2B34A 5AKXA 1PW5A 1U6KA 2GAAA 2AB0A 1CDOA 4DLWA 16PKA 3KPVA 1XQ9A 1G4HA 3VTKA 1C3XA 4QRIA 1PR6A 1MABB 3GRKA 4F4DA 1RKXA 3IAM1 3FKQA 2Q1SA 2FWMX 2QLMA 1CR4A 2GHQA 3MXOA 3W1VA 4UUNA 4MVJD 1T5TA 2IPAB 3WRWA 4TZKA 3OWHA 4RPJA 1TYEB 1ZU4A 3CW2A 5DN6A 3DDCA 2A5JA 1FTGA 4F86A 1CQPA 2JIMA 2A5FA 3HVKA 1C8LA 6NULA 4JUCA 2R6FA 2JASA 3Q3JB 4EY3A 5C37A 1DPFA 3V80A 2A1TS 3PVSA 1ETUA 2CXQA 4ILEA 3LGSA 3TH5A 1ODIA 2BZGA 1ZKMA 2YNMC 3WMEA 3A6HA 1H66A 5SYAA 3OTHA 3ZTWA 1AKVA 1MRNA 1PR5A 1Y37A 2UDPA 4GEKA 4MDFA 3K05A 3T7JA 2E82A 3UC5A 5A5EA 2PKXA 5HDQA 1R3DA 4YO7A 5B12A 4ZCQA 2VP9A 5FKJA 4FB5A 1UBOS 3RAJA 3KVVA 1PSWA 5H82A 4MH0R 5ECDA 2J1LA 5TY0A 4TSKA 3UJ8A 4XYGA 4Q9DA 3LUFA 2PGNA 3IOBA 1WUHS 5BW6B 2YXEA 3K2BA 3I0ZA 3RR2A 4DT1A 5LJIA 1XZHA 4RF4A 1N2ZA 2ECQA 3H8SA 1Y8RA 2VSOA 2X5KO 4MQFA 3WFJA 4DR3B 4OUKX 3L6CA 5E7JA 1XZIA 1A69A 4G07A 1JG1A 1XCLA 3H1FA 3VSEA 4HRAA 4G5QA 1UJ5A 3D7SA 2O20A 1SO8A 2H3EA 5GMOA 4AXXA 2YWHA 2CNBA 2NLOA 2ZRQA 3WIOA 3H16A 1UMCB 2I62A 1K97A 1HDRA 1X7HA 2QYOA 4X85A 3T1OA 4LS3A 4RKEA 3QMVA 5CXSA 3U17A 4BFUA 2AOVA 2XOEA 5KNDA 2IKQA 2EAUA 2WWIA 5F7XA 1KK3A 1HL3A 3JVDA 4CR7A 2FDXA 3WL4A 3HJGA 3KE8A 2EKDA 2BEUA 2BSAA 1I0IA 3D1VA 4EA6A 1BVRA 3SEZA 5PGMA 1FC0A 2JHAA 3W2HA 5A5VA 2V9ZA 1JZSA 2IPXA 5DNCA 5BWOA 2C78A 1K7EB 1ZUNA 2ZIGA 4C2AA 1U98A 5LQKA 3FOZA 1PT9A 4FXPA 2W6IA 3T7KA 1Q1QA 4HB2A 1J9GA 5CM2Z 3UAZA 1FTQA 1QRAA 5AM0A 4KDCA 3I45A 4JA0A 4DNXA 4GI3A 2XIJA 1G41A 1U5AA 3SNKA 1KJJA 2DFKB 1WCYA 4OHCA 4PINA 4X1YA 3V2GA 2WSSA 3VTZA 3FE2A 4CKXA 3PXUA 1QLHA 4V02A 4TLAA 4N8DA 4U8HA 4JH0A 5F7OA 5IBCA 1P5ZB 4YUAA 5BVGA 3CUKA 5EERA 1Y4UA 4AMBA 3U44B 5IVPA 1DC8A 1JU4A 2YRWA 1E59A 1Z4MA 1JEEA 3AP3A 3A6ZA 2XADA 4YRRA 5HRCA 4WY5A 4BZWA 2CXUA 2P4UA 5P21A 2GTHA 1NI3A 2FMKA 3L7DA 3DAYA 2X6TA 3QU4A 3WMRA 2ZSEA 2G9ZA 4B84A 3FG9A 5B1YA 2HR1A 1PFKA 3A4YA 2FZVA 4YGYA 2GZHA 1WVIA 4MI1A 1J25A 4A0QA 4BLSA 2WPNA 1P7PA 1TVCA 3B3AA 2CLIB 2QEQA 3NP7A 3U9SA 2GPNA 1CUDA 3CZPA 3VQTA 2XMGA 4FMPA 4UCFA 4ZJUA 1R4NB 1UODA 1CY2A 4JSTA 4AS1A 1C3LA 1PR4A 2BE7A 3F0TA 4UU1A 1C5KA 5ICFA 3WYGA 4F6CA 3ZDAA 5EXDA 3ZVNA 2XQJA 3QYPA 2XBLA 4Q4JB 4I4CA 2AZ4A 4MA5A 3ZTTA 4FGJA 1CDDA 3TL2A 1XMPA 1VOTA 4YMSA 5EHZA 3T1HB 3SJUA 4AP9A 2DFNA 3Q8LA 3KWFA 4YJ3B 4UNSA 3T06B 4C21A 4WZAA 3LH5A 1ISHA 3CXRA 5K3BA 6GPBA 5HTOA 1GT6A 4R9SA 1QNLA 5U9CA 4RD2A 5EHGA 1YRQA 1X77A 1W8DA 1OTYA 1ZAKA 2Q8NA 3TIXB 5LZ5A 3A32A 5CJ2A 3V5NA 1E60A 4FK8A 3H18A 4DY4A 3H04A 4H7DA 1L4HA 3QUQA 4ZO7A 1XVTA 2DTDA 5K51A 2WMDA 3W5JA 2P9GA 1K5DA 4FHCA 4LSMA 2H9IA 2OHOA 4KO4S 2Q2VA 3V4FA 3EOBI 2IHBA 2JW5A 2G9RA 4HDAA 5BY2A 1K08A 1NHWA 2HSJA 4LTDA 4MQLA 1MUUA 1CUZA 3JR3A 5HZKA 1SC3A 1V1RA 1LFAA 4AT1A 3MG9A 1CYEA 1XGKA 4E0BA 3D0OA 1L4YA 1XCGB 4R01A 4V0KA 1WV0A 4CLRB 5LP6C 4IIFA 1GTVA 1Y89A 1TKCA 4HDNB 4OQQA 2IYQA 1WHSA 3TR6A 2F3TA 1MQSA 2QZJA 3BCRA 3GGGA 4LJ9A 1ODCA 4FC7A 4NBLA 1LK0A 4RHFA 1JF8A 3V4SA 1KDYA 1R0CA 3IPCA 3EXFA 2EHDA 1GZ4A 4WECA 3RREA 1CKEA 4F92B 1UFRA 3CX8A 5JHGB 1JIXA 4B3XA 5F9MA 1AKMA 3JASB 1J1ZA 1SU7A 3KHKA 2ODTX 3PJRA 2XR1A 1YJ5A 3OCYA 4G5GA 2GAFA 3ZCSA 4CG3A 4J03A 3TBKA 4RXMA 5DT9A 3GFQA 2VHJA 4PIMA 4WK6A 3AEUA 1US8A 1I3MA 1RJFA 4X6LA 5DW0A 1FDTA 4OI2A 2CYCA 2D5IA 3R6TA 4MO2A 4QGFA 3UZUA 3WL6A 5EJEA 4QU0A 4MVJF 4JLAA 4LOJA 1DXOA 2DH5A 4QU9A 4D44A 3KB2A 2O2SA 2B5OA 5DK6A 1OFTA 4CMIB 1QFJA 5ESRA 3NWPA 3HJAA 4RCZA 1Y98A 1YJ8A 1J1IA 5JH7B 2WKWA 1KVQA 1YBHA 5IEJA 3DDNA 4LXXA 4LZJA 2AQHA 3DFFA 4UFNA 2X0DA 5GADl 3DOCA 5AXBA 2PS0A 3L3BA 1U11A 3IPAA 1ODSA 1ZMBA 3TXXA 2FSGA 3UKJA 2PAAA 3QMPA 4AX8A 3A70A 4RFSA 3CEJA 4QJ4A 3ZY4A 4V1CI 5JD6A 3QI7A 4X63A 2PNFA 4EF4A 2LZ0A 3C6KA 4N0DA 3BIOA 2ZULA 3ZU5A 2XTNA 4ZT4A 4U3JA 5AOVA 1K0FA 3R0QA 3ASVA 4OHVA 4TQAA 1C30A 3O21A 4PCUA 4AKIA 4WKGA 2HLPA 5FOTA 3WMFA 3EDRA 4ONEA 3AF2A 4UARA 3ANNA 5D6NA 5NULA 1OIWA 2RJNA 3T3IA 4PBTA 2FPSA 4RPCA 4AKEA 4E5UA 5JJIA 4GG1A 4REOA 4ZVNA 4IYJA 1TIPA 1T6YA 1N3IA 2HDWA 2C1XA 3PYXA 3PZBA 4PXAA 4M8SA 3KALA 4TMTA 3ZXUB 5ADWA 1XTVA 4X3PA 3OEHD 2FWJA 1VGRA 4XJSA 2ZP1A 1DELA 4A0GA 4Z4EA 4UXIA 4YI5A 1ZMOA 2QJOA 5TSDA 1TC1A 2BKVA 5IFLA 2OORC 3ZY5A 4E5PA 3LFUA 1X9HA 2C3MA 2FKAA 4Q66C 3NWJA 3CT6A 4XRGA 1TW3A 1KH3A 2AWNA 2IEYA 4M7WA 3QELA 1EEXB 4MI9A 1B3RA 1WBDA 1HKHA 3IALA 2B1JA 2PA0A 3LY7A 3OU6A 4UREA 4KR6A 4WOCA 1JQBA 1G6OA 2C95A 4CR6A 3G7SA 1X8XA 4DDMA 2Q7DA 4PGFA 2VTBA 3O74A 1SCJA 4HL6A 3IMFA 4P7FA 2XYRA 2AIRA 3WHLA 4KHPB 3OZBA 3N5CA 4ZI7F 4INZA 2FY8A 5AHOA 1T29A 3SF8A 4EGCB 4MVYA 1X42A 5JCOC 1SCDA 2DAPA 2ZUUA 3V4ZA 1CP3A 2E5LB 2ZTLA 3HS3A 2AJTA 2V7XA 3NEJA 1POWA 5TRTA 4F4JA 3VA7A 1PIWA 3PQ6A 2D2EA 4KQJA 4HADA 5E6UA 3LDAA 1LZLA 5AO9A 1THTA 4B6FA 4AECA 5CG1A 1XDBA 1U8XX 1JHPA 3O8LA 4R1PA 1RPZA 2JG3A 5BT9A 4KE7A 3TI7A 3R5XA 1W5BA 3MWDA 3VPDA 5FTNA 2CNWD 1AO3A 1YQUA 4ZKEA 5JSFA 2L0XA 1O0CA 1JDUA 1B2RA 2OV6A 3LZDA 4YEDA 4GEGA 4BNNA 1BU8A 1CUIA 1KO8A 3FUCA 4E6EA 4XSVA 3ROTA 3RU9A 4Z1OA 1GQQA 4ZQHA 5IUKC 4GQBA 3QY0A 1K88A 2W58A 5G53C 4HH4A 4N3CA 2EEPA 3WLSA 4A1OA 1JKJB 2ONCA 1CY4A 3VUEA 2IDKA 4KN5A 3T7EA 5I3CA 1M6VB 3HEMA 2WT9A 5FOUA 4PHTA 1U28C 3VBEA 1NBEA 5K0BA 1KU6A 1VKOA 1Y7IA 3AOEC 1ZDMA 2GCOB 5BWLA 3SR4A 2P9CA 3R3ZA 5YASA 2I8AA 3B1VA 4ZPXA 4ZVOA 3AESA 5I9TA 4HSEA 4DHEA 3IHWA 1OQAA 4L0MA 3K0CC 5CP8A 4UDOA 3T3GA 2QTCA 1DCMA 3RAFC 3SM3A 2HU8A 3AW8A 4XR9A 5EIBC 1DO8A 1NN1A 1OI7A 1OLUB 1V96A 4WLVA 3TRJA 2JK0A 1TADA 3KQLA 2G07A 4RVSA 4Z0HO 4BNVA 1GA4A 2OAP1 3Q0EA 1D5WA 5IANA 4NSNA 2FWRA 2H7XA 3C3CA 3GPDG 4BNJA 1EZ1A 1TF7A 3BDVA 3LM8A 1M34E 1LUAA 3K94A 4CM3A 1RMTA 1YHZA 2PJDA 1DRVA 1QAMA 1L6RA 3BXGA 2LIVA 3UJ6A 4TV8B 4RAQA 3O91A 3DE2X 4KKXB 5DIFA 4NYIR 3VU1A 5KIAA 4IMPA 4LG1A 4QM7A 2VJAA 2I3BA 1KK1A 2MR5A 4Q03A 4QECA 3H5TA 5KNBH 1YOVB 3H2HA 3S68A 1SXJB 3KLPX 4FFBB 3RJTA 2XB8A 1DXHA 1W6RA 3KS9A 3T3PB 7REQA 4TLBA 3I2GA 3WXBA 2WUWE 3CLHA 4I9UA 1BZYA 1G20B 1V25A 3GC6A 1D6JA 3E15A 3NHUA 3P19A 1KPHA 1L9KA 3VX4A 2NPOA 1ZBQA 2MCFA 3ZR4B 4BHTA 2IYRA 3FSGD 3KEFA 5LBTA 1RLTA 2YYAA 2GB4A 1NBMA 2HCFA 2K4MA 4IIVA 4YRZA 1GDTA 2BBTA 3EMKA 5CLGA 3WFIA 1Q0TA 5KB3A 4D9JA 2R6CA 3DVLA 1BDIA 5F9FA 2OUKA 4C5BA 1FK8A 2CF6A 3SCZA 1LPBB 1JNXX 4F3RA 3V2IA 1O94A 1W85B 3S8YA 3C5HA 1NLFA 3LPAA 2IUSA 5JPIA 1VLMA 2SCUB 3OX3A 1Y3HA 2XNHA 5IVDA 1LDGA 2CHUA 1TEZA 1FYEA 1UKBA 5K3FB 4MSUA 2R1ZA 4ZOLA 2WAYA 1P60A 2OCLA 4BVEA 4H17A 3WGQA 1DFHA 2CVPA 3EGDB 1N92A 3E9QA 4RKQA 3UA4A 4AS2A 3VVCA 2QS9A 3MOIA 3GGJA 2UAGA 4KYIB 4H08A 1Y8AA 2VPXA 1BH6A 1V5GA 4ND6A 3VGJA 4A7PA 2II6A 3GRPA 3CMCO 2UZ1A 4Q4HA 1PTJA 2HJ9A 3RSOA 4QEDA 3UPDA 4URZR 4ZCLA 4ZMBA 2JATA 3HSYA 2G1PA 3CRW1 1CE8A 1XMXA 2XHEA 3RUFA 4Z4GA 2VJBA 1TA4A 1PYOA 1RAHA 2OZVA 2WM9B 1ZGBA 1L5HA 4HNTA 5KYWA 4EH1A 1JQDA 1UZNA 1SQ6A 1F9EA 3AUXA 2P35A 1AK1A 2X0KA 4LNUA 5KQGA 4Z9YA 3RRFA 4E1BA 2ZS8A 5AK5A 1IY0A 4D8TA 5CVEA 2F8SA 2AD5A 3GR6A 4LVCA 1RM4A 5DCYA 5CD1A 3WAJA 1WB9A 2O2XA 4J1QA 3KT0A 5AW5A 5KKNB 1TMOA 1JEDA 1JEQA 2WM8A 1N5DA 13PKA 1PW7A 2AMFA 3FDJA 1BWSA 1E1RD 2IV7A 3QJGA 2IEBA 1OLOA 3UHAA 3ICEA 1VQ1A 2RHBA 3OKFA 1F8GA 4MUHA 2CL5A 3FCCA 2N1BA 1YS6A 4ND4A 4CKBA 3HFJA 2YUTA 3IDFA 2RGBA 1VP3A 2JLZA 1IUKA 4FINA 3HBAA 4MZDA 3RTEA 1AX9A 5FBRB 2JF0A 3ROKA 5DM2A 3AFHA 5IKXA 3GUHA 3KM0A 3C3AA 3OAAD 1M0TA 1NVAA 5BW5A 2YV1A 3LAWA 3OFJA 4L7VA 2KLHA 5J2TB 4K81B 3LCVB 4MRNA 2Z5LA 3MHTA 1EFVB 1JR6A 1KPIA 4B7XA 4F71A 2JLYA 3NDPA 2O8BB 2BP7B 4EABA 5IUNC 4LDNA 1VYTA 1G2PA 1YZ3A 1L5GB 1XRPA 1FTWA 1KVTA 4BCDA 1MJFA 1UDCA 2AFHB 4W7HA 2PJUA 7YASA 4KFCA 2B83A 3IQIX 2QTFA 3TSYA 2XMSA 2BRUA 3U09A 1WCIA 1DU4A 2RGDA 3II6X 5AJZA 5FBVB 1HY3A 2OCIA 3Q7IA 4JZYA 2P9FA 4XTCS 3RK0A 4Y2JA 4EL0A 3SDSA 4B3JA 1YS2X 2ALJA 4NARA 3NBKA 3UGJA 3D59A 1HLPA 3JYOA 4S1OA 4BMYA 1DZIA 2PTGA 4YT4A 2XCLA 4G1CA 1YIOA 2DUNA 2QE7D 1NC3A 2VZEA 3CR3C 4WKOA 4ZANA 3VNVA 4XVHA 1SNYA 2AN1A 3FDXA 1H0SA 5F12A 3NHKA 3MILA 5EFOA 3V2HA 1CEYA 4AJKA 1CZLA 1MVLA 3BB4A 5HMMA 1QPZA 2NTYC 4MI6A 1RBQA 5DYNA 4PE5B 1J8FA 3F5SA 4M1YA 3K96A 3PQ5A 4OH1A 4BX0A 2ZZNA 3VR5A 5C53B 3ROMA 3KQUA 3MB8A 5CIQA 1DP4A 2OMEA 4FW9A 2NQ8A 4EGAA 3D6TB 2FMTA 3FN4A 1SHUX 2Q21A 5EP2A 4EP1A 2BJWA 1ISIA 3SEFA 4KR2A 1IHYA 5AW8A 2QJTA 1M2OB 2QQ5A 3GHYA 4MWZA 1JAXA 3OIDA 2VJMA 3HGQA 3GRUA 4AWAA 5I7HA 1RCTE 4UVGA 4GMHA 2GZMA 3ADPA 1RKVA 4KAJA 3JWEA 2NSJA 5DKFA 5I47A 3UKOA 2J9RA 1IAQA 1TTQB 1YJBA 1UC5B 1QIHA 2BGKA 3DQZA 5G2OA 4BNYA 4Q3BA 3CLVA 1AIPA 3GXOA 4JC5A 3VZPA 3PV0A 1NF3A 2AOTB 2OM2A 2QL9A 3BJZA 3KZXA 3WNCA 5JEDA 1RXWA 4JFAA 4QDXA 2GEUA 2X86A 4EMSA 5JXJA 2Q7OE 1XN1A 2O52A 3G9TA 3P0RA 4HY3A 2NWQA 5JCXA 1B0AA 1JFVA 3IJEB 1XAGA 5KWEA 3T35A 5BQXA 4GVXA 4CKYA 2Z5VA 3OZFA 2BFDB 1UBTS 5A1TA 2OFFA 1E2PA 3HFSA 3HYCA 1KAQA 3K6RA 4AZ3A 4EG7A 3FTNA 1EWYA 1ORWA 1ENOA 2DR0A 2VZ9A 3OPQA 3ZLVA 4CGYA 1QYXA 3NB0A 4MV3A 4EF6A 1GO2A 1IEVA 4GKBA 5BN5A 1FW8A 2C3YA 1JFTA 1DKNA 1WCWA 1XWWA 3R20A 3KZNA 4JJAA 1JI3A 1IQ0A 5DWVA 1Y5MA 1VJ0A 2WYIA 3DKIA 1QGDA 5IAEA 3RANA 1PDOA 3UB2A 1H8HD 3PXGA 4DLTA 5BT8A 2ZYWX 2PUGA 3ZNPA 3W5SA 3I53A 3K2IA 4PC3A 4DIBA 1SCKA 1SCUB 2HLDA 4KODA 3AI2A 2EXXA 3RS4A 2YWFA 3T9DA 3IBYA 4MVCA 1D2RA 2TMGA 3T7SA 2DFVA 2ADOA 4X20A 4P5PA 1D1PA 3U37A 1Y3IA 5G02A 3VOSA 1W44A 4X7BA 1VPEA 3CLSD 3JALA 2DB3A 2WF8A 3F7NA 3YASA 1FW6A 5AW1A 2GR9A 1Z82A 1SY7A 2R1VA 3HY4A 3ROFA 4DM3A 3C5WP 4AZVA 1ORRA 4DIDA 4U7WA 3HCOA 1AO0A 2BGGA 4ARIA 1XKTA 3GBSA 1UXOA 2PWAA 3EG9A 2FPUA 4BZZA 1PYDA 3C85A 3K8YA 1Z26A 4H4EA 2O6HA 5IT5A 4PPYA 5KQPA 2LKCA 4EB3A 1PKXA 3EHEA 1I30A 3EW9A 4MRPA 5DNDA 1JR3E 4IVRA 2POCA 5GOTA 4V1CA 2DYKA 4KX3A 1P62B 3EWNA 4JBIA 2FX2A 2MHCA 2FW8A 2HWUA 2IIBA 2VK8A 3DEFA 4PHFA 4UE3S 5IPFA 4AMGA 4NCXA 5GIOE 3K3PA 2ZB2A 2CC2A 4ZOEA 1V2HE 2H29A 3BE4A 4XFKA 3T6KA 2VJLA 2WLSA 2M9MA 3JQAA 3OZCA 2Y1XA 1RWBA 4ZCTA 3UTCA 3F9CA 4ES6A 1Y6ZA 4BFCA 2TECE 2OG2A 1NP3A 4NENA 4UHHA 5ALMA 4EZIA 5F9HA 2OB1A 1HE8B 2OR3A 3ECSA 2IT1A 2G9VA 4N7MA 1QFSA 2MDTA 4QBTA 3NTXA 4DV4B 2GZ1A 3FWKA 6Q21A 4N47A 2YHBA 3GPIA 3AVYA 3VU8A 3IJRA 2FE4A 3IDAA 1TCBA 2P11A 3C5VA 5CDFA 1WQ3A 4FDTA 1A9XA 3EZYA 3R5SA 4MHSA 2E21A 4JBWA 4QWMA 2ZUEA 1W0JD 4INPA 2W83A 3TVTA 4B47A 5BURA 4MDEA 2JIDA 4X7PA 2I2AA 5AIBA 4YWHA 1YDEA 1SHJA 2H16A 5IBRA 1HFEL 3I37X 4NS1A 3HCRA 5IAKA 3UT5A 3TGLA 4KXFB 1RJ9B 5IM5A 5TQJA 1U2DA 2RHGB 1X8LA 4EQ6A 3DBOB 3FYCA 2P6MA 1BU5A 1E58A 3DB1A 5AVSA 2XDAA 2EERA 4B87A 4J7XA 2ZXEA 2EWVA 3K2QA 4GYYA 4AY2A 5KOYA 4W82A 1KY3A 3PFIA 4I66A 4YMIA 1U8TA 4W1RA 5FLEX 2NO4A 2JCBA 2R0QC 3H5VA 1ULUA 3M33A 3ZLBA 1LJLA 3SZ3A 1DX9A 1K7YA 4HDQB 3KE9A 4BNLA 4HN9A 3BWEA 1DEOA 8AT1A 1BSVA 1I01A 2EFEB 2JA2A 2PUTA 2YW2A 4KO2S 4MKIA 1USVA 2CFRA 4I3FA 1NW4A 4J0KA 1Q7CA 1PJBA 4R1OA 5B3AA 2JAOA 4F93B 1USGA 4X8HA 1HC7A 4DDWA 3C6BA 3I2YX 3U3MA 1MEOA 1UBEA 4E09A 3HB4X 3T7DA 3UW3A 3FAKA 2F9FA 4C1NA 5JEEA 4RELA 4LGVA 4QVKA 5BYJA 5JJKA 4NAUA 4LHYA 2BGJA 3SQLA 1NQVA 2OHXA 4LX8A 3D7KA 2QX8A 1G66A 4P53A 4RD1A 1E6WA 3SOZA 5B58C 2ZRJA 4UVHA 4YAWA 1T9HA 2LWIA 2YFQA 1A4XA 4DSAA 2FB9A 3ANMA 3AM1A 3GEIA 4E2YA 1LDBA 2JLAA 3KQVA 4HOYA 5B58T 1EUCB 3E1KA 3SKXA 3PEWA 1KXJA 3HV0A 2QY9A 3PQ2A 4UM5A 5E4YA 2Y9MB 3ROZA 3ESXA 1Q0HA 1JYEA 3GGSA 4HDCA 4E2ZA 1L7MA 3TOSA 1G42A 4CF6A 3M3DA 3FBTA 1E1CA 3W8EA 5JR3A 5LM3A 2KBFA 5MGNA 3EASA 4BRZA 3DULA 1KEPA 1JKFA 3ZXXA 1S3GA 2PRKA 2ZR9A 4R05A 1M10A 3CFYA 1XLTA 1JFRA 5FV7A 2QT1A 2QLBA 5KYGA 2D3TA 2DHRA 5I51A 3GLRA 5I5GA 2QMQA 2JLWA 4W8GA 4DCGA 1K8XB 2PRJA 1QHXA 3BWDD 4OLFA 5LQNA 5LYJF 2DKNA 3PIDA 3ZDCA 2PRSA 1GPYA 4FOPA 1S1CA 4NJMA 2XUFA 2Z57A 4PIVA 4CKCA 4FNOA 3B1YA 6ADHA 2C5GA 3WZ2A 3WGOA 2YKGA 4B82A 3C3PA 2FX5A 4MQEB 5E6RA 2G71A 1H2EA 3TDKA 5MDHA 1KY2A 2ZS7A 2ORYA 3HCPA 1MRSA 3IUQA 4K9PA 3DWFA 2IX9A 1TCAA 5F52A 4BLVA 3AL2A 4ZT5A 4DIOA 1T5HX 4N3GA 4PGHA 1E2FA 5AVTA 3KDPA 3GNSA 1CDEA 1THGA 1ZL2A 1AXRA 1U3DA 1CWUA 2PT6A 2ZTHA 3WYCA 3CINA 4BKRA 4B8YA 5JNSA 4G9EA 1L4BA 1CULC 1DJNA 1XOIA 2R65A 4XM1A 4C14A 2CV2A 2IUTA 2KSQA 2Q4TA 2WJWA 2DT5A 3K9CA 3OIVA 1WSDA 3A05A 3LK7A 4X45A 4B85A 5J2UF 2AGVA 4YC7A 4Y6RA 1AS0A 2EZ4A 1JG3A 2P8JA 2D74A 3F6SA 2ZJ5A 2R3SA 3G2IA 1YDHA 4JEUA 4NECA 4CL3A 4YA6A 2X2EA 2VT7A 1JEJA 1LLDA 1GPNA 1V16A 2FZ4A 2RGWA 3L06A 5DHFA 1I1QB 4GMXA 5CFZA 3VDNB 1DCTA 4G0OA 1AGXA 1Z2PX 1C4WA 1MO5A 4O2AF 3K71B 2NW6A 3GUCA 5T3YA 3RC9A 1P2VA 4LFAB 1ZEJA 3IV7A 1N2CA 4RMGA 3IURA 1NXPA 4JBHA 1GGNA 1COWD 1NT4A 2B4AA 3HU3A 4BCCA 3JCZA 2FMUA 5ALTA 2FW0A 3NYIA 3N2YA 1SRQA 2Q9UA 1MX3A 1BCRB 1IZZA 1VCOA 3HB1A 3KSMA 4FT4A 1OXXK 4RV4A 4WV3A 4NFLA 4FEEA 3WI7A 4YV1A 5AK4A 4TVSA 2AX4A 5IZCA 3DMTA 4JLNA 3O83A 4L57A 1ZI9A 4AZSA 4BNTA 2J0VA 3PEUA 3MGCA 4J4BA 1F4PA 3DLTA 2R6HA 3R3SA 1U8YA 3QE2A 4DPMA 1ZIPA 2G09A 1OHHD 3EDOA 2MSCB 3VOBA 3L8DA 4GOOD 1QH9A 3RJ9A 1EI9A 1OSNA 2YY5A 2XEDA 1UEXC 4OLHA 1ZW6A 2XXBA 5JYBA 1VP9A 4UE6A 4OQEA 2CJPA 4EJ2A 1P0MA 3C3YA 3PENA 1D1TA 3LLUA 2RD2A 3HK2A 3PICA 2BKAA 4JHXA 1EM6A 4MGHA 3FOFC 2VPQA 1RRMA 4H7FA 1ZK2A 2QTBA 1N2HA 4MCIA 5KTMA 2AFIA 4LE0A 4MQ6A 3KJZA 2ISCA 2BJHA 1IUPA 1ZJJA 3RROA 4D4LA 4BQFA 4AMVA 3CF4G 3TSOA 3ZGNA 3AIOA 1OU4A 4P08A 1GNQA 2NM0A 3FWYA 1NNUA 1IBCA 4Q00A 2WSYB 1L1FA 4WH0A 5LWHA 1G2IA 1EWVA 1JH8A 2GK3A 3GN1A 4U2GA 4X54A 5IT0A 1J9ZA 4I9NA 3THOA 5ALIA 3EDCA 5H4HA 2Z3VA 1RFLA 2GD2A 4YB8A 4R0VA 3WAKA 1HA3A 2J48A 2VYVA 3DZDA 4S1VA 4XWWA 3U61B 2NP6A 2Q0XA 3HR8A 5FD8A 4YMTA 5LQUA 1IJEA 3MRTA 3PDJA 1V35A 4E5KA 1RWVA 4RTSA 1R0ZA 5CM8B 2UXDB 3OD1A 3LT2A 1HOXA 5AVWA 2DWQA 4RMNA 4UCWA 3QX3A 3MELA 4O1IA 2Z30A 4WIAA 1GWNA 2HBZA 2AMLA 3K0KA 5JUWA 2MSWA 3HKDB 3PHCA 5LA6F 2ZVPX 3N58A 3U3RA 4H4DA 4EBFA 5CD9A 3CB2A 2L19A 3R0IA 2Q2NA 2Q9BA 1Y6RA 3W9SA 1USIA 1R0XA 2PMKA 3V3KA 3QV1A 1EK2A 2QJFA 4PLZA 2VDKB 1M1NB 2ES4A 2OECA 3H7IA 2BCGY 3HN7A 2YCLA 5SV2A 3UAVA 4KE9A 1ZKDA 1W9MA 4ZCIA 3Q72A 4X7RA 2IS6A 1L4MA 3EIFA 3M70A 4I99A 5AKKA 1SIOA 5AKGA 3RYHA 1U0EA 3IUNA 3OZVA 5CB4A 1RPTA 1M75A 4ZD6A 5EZYA 5HKKA 2IW3A 2V4MA 3V42A 3HGMA 3I9V1 4I9GA 4BAZA 2BBOA 4IEEA 4YJGB 5AM1A 1R3UA 5L3SB 3V9PA 4YCMA 3G7NA 2GM3A 4WRRA 4MWDA 1SQSA 3K0FA 4YMWA 1KY5A 4N4AA 3UNXA 1JG7A 3D8BA 5GWXA 1VMKA 3DO5A 1Z12A 4MV1A 5EHNA 5H3CA 4MEJA 5JZOA 2Q9AA 3F8WA 1ZN9A 4RL6A 1Z0JA 3DJFA 1KAHA 1XAHA 2IHYA 4BFTA 1JBQA 2BKLA 1B1CA 1CUSA 1QP8A 2BEWA 1JR3A 3M3PA 2NSYA 4IXMA 3K70C 2V8OA 3R40A 4QFBA 5LB2A 4PSUA 1YVPA 2J9XB 2VAVA 3D43A 3JVEA 4G0QA 1AT1A 3L0IB 3UUFA 3Q10A 3H1PA 4FZVA 4TLDA 1RQ7A 4EVIA 4G65A 1EWTA 3IKLA 3EUFA 1M1YB 3W05A 2OHVA 1ECJA 3ACDA 1O1YA 1PR1A 2WJ6A 2EATA 4AG3A 3RWBA 2Z8YA 2FRVA 5AT1A 3HJUA 3RSFA 2HK7A 3BXEA 3UH1A 5ICCA 4TZ0A 1LWOA 2W90A 1PGNA 5BOSA 1DJLA 3OLQA 2ZIWB 2EJUA 3ONWA 4CCYB 4XEUA 1LC3A 1BNCA 3M5WA 4HDRB 4XGNA 5I7EA 3SF0A 2GDJA 1NXVA 2VDVE 4MPTA 4HFRA 3R41A 2HJVA 1BXZA 1D2NA 2Q8PA 3AUTA 5CNIA 1JSRA 3W4JA 4BMVA 5JQGA 3V7NA 3QFRA 2WDPA 4R1UA 3QF7A 2WFAA 1JBEA 1Q1GA 3JATA 4JGIA 5DGHA 5A03A 2J5BA 4C4ZA 1PL8A 5LQAA 2HPZA 4K1XA 3ZU2A 4BLQA 3RI3A 3ER8A 1VPVA 5ARBA 2BM9A 3Q8KA 2QXUA 3VI3B 4X0EA 3IT1A 2VRNA 4UQOA 2FFHA 4S2EA 3FGNA 2C8JA 2O8CA 1G8KA 2FR1A 3QVUA 4E5DA 2QPLA 3G0OA 1Y7HA 3LUBA 2BLNA 1OFVA 2X4DA 3NHAA 5JCJA 3WICA 2O7NA 5FO0A 5JZSA 2PT7A 3MJCA 1JV2B 1KI6A 1T3ZA 2XODA 3DBRB 3SKYA 5BUCA 2D1FA 1Y6GA 1AV6A 2X2PA 3F4BA 3DYBA 4KZPA 4MKHA 3L4BC 1UC8A 3B38A 3R9KA 3UK7A 4JOCA 3ZKWA 1QYVA 1QH8B 2QTWB 3EN0A 5CW2A 4FBLA 1I2BA 3UB3A 1LTKA 1ZHFA 5JJBA 5I7UA 2HKIA 3WGVA 3B3FA 1JIIA 4LJSA 2IPNA 4MYHA 3KBOA 3Q1LA 5D00A 4B3IA 2V3WA 2Y68A 2GK7A 4KOAA 4DADA 1H5UA 1Z06A 3MT0A 3DXFA 1I6LA 1N2OA 3BMXA 5JAUA 5DU2A 3HUUA 4FEAA 4HWRA 3FCSB 1WXFA 1WF6A 4XEHA 2HW8A 3VO1A 4F91B 1QJCA 4B7UA 4KVFA 4JC8A 4BYMA 2YIVX 1M5UA 3KOZA 1NP7A 4EB6B 3Q8WA 4IOLA 2LRHA 1AMUA 4NY1A 1M7BA 4HAZA 3VDRA 1GRQA 1RBMA 1U04A 1NDQA 1AQLA 3WHKA 3B9RA 1A4IA 1C0KA 2BJVA 2AW3A 3L5KA 4JX8A 4LOKA 5AKLA 2WWYA 4JJ4A 2Q99A 3JPYA 3L05A 4P54A 2J0QA 1ZIOA 5DBIA 3ASUA 4PZ9A 1BCSA 4HLUA 2YWGA 4GH5A 1JBKA 1SXJD 1SU6A 1KYQA 2R5WA 1NRJB 2WJVA 3A9SA 3E1GA 2XRMA 2J0SA 1QE3A 1WD5A 5AMXA 4ABYA 1DQYA 2Y93A 3T5PA 1QYIA 3H1AA 4I4TA 2WV9A 4TM7A 4ZC1A 4OKSA 3EXEA 4HKTA 3QHAA 2BFBB 1DINA 2QTHA 1N2BA 4RFLA 5FWYA 2J46A 1U0BB 1T36A 4Z7NB 1X1TA 4CG1A 3C15C 3GY0A 3KHUA 2VDLB 4IGEA 4R2WA 4TTTS 4EUEA 1BX3A 3KUCA 2Z9CA 4CLHA 2GS9A 3OCWA 2H7CA 1QHHA 5LQJA 1NVUQ 2N42A 5B37A 1PJLA 2H2IA 4S1PA 3RARA 5JTUA 2ZB8A 2D1SA 4ZI5A 1E66A 5BP7A 1RI1A 1RWMA 2Q41A 5JRZA 3T54A 3DZJA 2ONKA 4FFMA 3U7IA 2D5BA 3WA6A 1QTIA 2Y1OA 2GJ8A 4U7TB 2HX1A 3BT7A 3WVNA 4MYUA 3RJMA 3OH8A 2Q49A 1PN3A 1Q0UA 4QIHA 4WERA 3HZHA 2VAWA 4RS4A 3EEOA 1DXQA 2GCGA 3QVSA 3FROA 1CRLA 2ISQA 3MWYW 4ZAWA 2PDAA 3DZFA 3UAXA 2IWHA 3EF1A 4H0FA 4UBLA 3ZJ5A 4DYVA 1RHKA 1FFWA 4W5TA 2O23A 1RXUA 2CK3D 3SYMA 5JXIA 2C92A 4XX0A 1TQHA 1ZUD1 4L5IA 3TYXA 4P4LA 3B1ZA 1QX3A 3C5EA 3VNAA 1L1QA 2PYDA 3AJ8A 3P0EA 3E58A 2R4TA 5DXJA 3RKSA 1DTWA 1RWXA 3MIZA 5TJ9A 4CQLB 5TT0A 1E96A 3OVMA 4FDUA 4GPZA 1T0BA 2RKOA 2WT8A 4A26A 1RI5A 6YASA 4FGLA 4KO1S 1FP7A 3VR5H 1U6JA 3AHDA 4UXHA 4OQMA 4D3ZA 3MTAA 4E5NA 1DRUA 3S29A 1R5NA 1K9VF 2WP8J 2FZWA 3IVXA 3WL3A 2ZRBA 2R84A 1EE9A 4HUTA 4JJFA 4M6WB 5TMDA 2DPYA 4G0PA 1OXKB 1U7WA 2CBZA 3ZZUA 1HDEA 4CTNA 3JQGB 3C3WA 1XQYA 2Q6OA 1WLSA 4DJDC 4EG6A 1NJFA 5DTIA 2OO5A 1ZA2A 5A6VA 1WUKS 4IIBA 2I8CA 1G5QA 4MVXA 3Q9UA 3D2CA 3VR2D 4W1QA 1HPLA 3QPBA 1M6HA 2JVJA 5A5DA 4OK5A 5DE3A 3L1IA 5ALYA 2YZ7A 5KX5F 3CH6A 2J0UB 3N0XA 1SCIA 4CGZA 2OC9A 3SZMA 1YFZA 3DO8A 1OUMA 1KBZA 5IWCA 2AG6A 4FGZA 3PX3A 1E2IA 1BEEA 1W5EA 4OP1A 4ZA2A 1MX9A 5JAIA 3U6BA 1GL3A 3QW4B 8MHTA 1GXSB 4X1K