3X1JA

Crystal structure of phosphopantetheine adenylyltransferase (ppat/coad) with accoa from pseudomonas aeruginosa
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
158
structure length
158
Chain Sequence
MNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLFSLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transition of phosphopantetheine adenylyltransferase from catalytic to allosteric state is characterized by ternary complex formation in Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa 2192
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
total genus 53
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2014-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3x1jA00
3P0HA 4QREA 2DUMA 3P0JA 4K03A 4R2LA 1GLNA 2TS1A 2QUHA 1IQUA 2D13A 4CT0A 2ZUFA 3A04A 1OWMA 3NV7A 4G5YA 4WNYA 3ZJTA 3CVVA 3CA8A 2JA2A 3PXUA 1PG2A 4MW2A 4ZT5A 4ARCA 4R0NA 1M8FA 4EG3A 3P52A 2YWCA 1KQOA 3IOCA 4NATA 2J5BA 4GRIA 2PZAA 1G8HA 4L2IA 1QJCA 1WXEA 1A8HA 1J21A 4EG8A 5HUJA 1FFYA 4J75A 4ND6A 4JYZA 2A4MA 2C5SA 5KWVA 4H3SA 3MMXA 2X0KA 1JMVA 1F4LA 2O8VA 1D2RA 4OUDB 4NDAA 2Z09A 2ZP1A 3ND6A 3IVCA 2QTNA 4MQ6A 4F4HA 1TYBE 4HJXA 4MW6A 1WZ2A 2WSIA 4OJMX 3C8ZA 1U3DA 3H97A 3UK2A 2O5RA 4DLPA 1O5TA 1P7PA 3INNA 1VBKA 2AZXA 1X6VA 5DK4A 4EG4A 3AKZA 1O95C 1V47A 5LLTA 1O96B 4AQ7A 3OTWA 1YIDA 4MVYA 1LI5A 4PBTA 2PZBA 4KR9A 2IJGX 1CT9A 2BTEA 1F7UA 3AG6A 3TQIA 5H7XA 1NP7A 4DE5A 1T6XA 4DDMA 3FNRA 1EJ2A 3G59A 4U63A 2A1UA 1PFUA 1NURA 3COWA 1JZQA 2PG3A 1OWNA 3VGJA 2I1LA 1WQ4A 5IJXA 4MUKA 3DLAA 4RPIA 4MULA 3CLUD 2J09A 3FOCA 3ND7A 5DEOA 4L2IB 3FDXA 3TZEA 3HV0A 3AIIA 1JEEA 1I6MA 2HGZA 2DXIA 1N77A 4NX2A 1TQ8A 1NUSA 3S3TA 3H9BA 1JILA 4MLPA 1F9AA 1I6KA 1T6ZA 4MUJA 1QTQA 1NI5A 3KT3A 4JZYA 1M8GA 1MB2A 3GUZA 1EE1A 2B7LA 1N3LA 4J76A 5IHXA 3K32A 1COZA 5HG0A 4PBSA 5LFAA 3CLSC 5KHAA 1TYDE 1IRXA 1B6TA 1WOYA 4KPUB 5DASA 3RJZA 1N2EA 3KT8A 1U7DA 4DDKA 2G36A 3CR8A 2E18A 3VU8A 1WJGA 3NBAA 1H3NA 4EG5A 1EUQA 2H29A 3CLUC 2DERA 1WKBA 3FWKA 4UZEA 1JEDA 1N78A 1YULA 4MUEA 4EGAA 1NZJA 1WQ3A 3CLTD 3DV2A 3Q12A 3HGMA 1S4MA 4TS1A 2QUJA 1WXFA 1O94C 3CVUA 1EXDA 2A88A 5TS2A 3H05A 3JXEA 3IDFA 4F3RA 4ZT4A 5EKDA 4EG6A 1EFVB 2GM3A 2HMAA 4EG1A 5BNZA 3Q10A 3IUBA 1R6XA 3QE4A 3D6VA 1G8GA 3MXTA 1KH1A 3A4IA 1JIJA 1TYAE 1Q11A 1M1ZA 3NBKA 1MAUA 4QBTA 3SP1A 1J20A 4KKVA 4P2BA 1XNHA 2NSYA 4Q16A 1NUPA 2R5WA 3ZJUA 1O6BA 1U3CA 4Q93A 3F3MA 1GZUA 3IMCA 3ISJA 1I6LA 4CDMA 1Q15A 1GN8A 4DNXA 2OQ2A 3IH5A 1H3FA 2GKSA 1NSYA 4WSOA 5J58A 4X0EA 2XRYA 2WQ6A 2RD2A 2VTBB 2VTBA 1MRZA 2A1TR 4MAFA 1ULHA 1TEZA 1J1ZA 3UC5A 3D6UA 4MW7A 3LOQA 1NYLA 1ILEA 3RK1A 1KP3A 2PXHA 3FETA 2WB2A 1Q19A 2A84A 3Q4GA 4G5FA 2PZ8A 1JHDA 1U7XA 1IHOA 1NUTA 2Z3VA 4MVWA 4ZCSA 4I6GA 1VBMA 1JGTA 1O0CA 1KH3A 3FY4A 4YP6A 1J1UA 3DO8A 1ZH6A 3COZA 4OUDA 3ZJVA 1HYBA 2CUZA 3QTBA 1KAMA 2JANA 4G6ZA 3AG5A 2J07A 4EFKA 2A1TS 3M5WA 2A1UB 3ZXSA 4ZT7A 1VL2A 4XSVA 4MW5A 1YIAA 2H2AA 2CFOA 1OD6A 1M8KA 2PIDA 1TYCA 1WXIA 4CQNA 2EL7A 4S1OA 4EF6A 4MUIA 4NZPA 3SYTA 3KT0A 1PFWA 1XNGA 3MUEA 4EG7A 3DPIA 1OWLA 3KFLA 1YUMA 3L93A 3FI0A 1M83A 3CLRD 5K0SA 4JXZA 2J08A 3FH0A 1KR2A 1GTRA 4DDHA 1N2BA 4U8HA 3LCJA 4A91A 1KKUA 2OV4A 2NZ2A 1G8FA 1JIKA 3ZUGA 2JAXA 4JFAA 3IVGA 4ZCTA 4YP7A 1NUUA 2HZ7A 2IP1A 1QU3A 4K0RA 1F7VA 4E1AA 2WQ7A 3TNJA 2CT8A 4UZFA 1GPMA 3IOBA 4YP5A 4AS1A 3ND5A 4CDNA 2D54A 1DNPA 1H1TA 3FG9A 1GAXA 2QTMA 3FIUA 1I2DA 4RUKA 4KR6A 3SDBA 1O96A 5HUHA 2GOYA 1T9GR 1MAWA 4HJRA 3ZXIA 3U1VA 1V8FA 4ZT3A 4R2MA 4KR7A 1RQGA 1MB9A 1WY5A 3CLSD 2X1MA 5LM3A 1KQPA 3RHSA 3SZ3A 3UY4A 4NAHA 3PNYA 3CVXA 3E27A 1G59A 4ZCQA 3IOEA 5JBNA 1FYDA 4HPWA 1UFVA 1PFVA 2QJFA 3PNBA 4MWDA 3X1KA 3IODA 4MWCA 1JECA 1JZSA 2DLCX 3H99A 3ILVA 2X3FA 3GMIA 4XFDA 3ELBA 3QTTA 1KAQA 1IVSA 3COVA 1IQRA 3HZRA 3N2YA 4KPUA 2CSXA 4NAUA 4MW0A 1N2OA 2QUIA 4MW9A 1QU2A 3SZGA 3UMVA 1OBCA 1ZH0A 4FZJA 4MWBA 3K9WA 2YXNA 1R6UA 1O95D 1QNFA 3COYA 3X1JA 1MOPA 4GU5A 1MJHA 1O94D 1N2GA 2RE8A 1IQ0A 4MUFA 2CYCA 2D5BA 3TZLA 4JXXA 3IVXA 1YUNA 3IUEA 4YMIA 5KCMA 5TEVA 2QTRA 1Y42X 2V0CA 3KT6A 2EJCA 2VXOA 1X8XA 3I05A 3VRHA 1QRUA 1O97C 3N8HA 3ZGZA 2J4DA 1K4KA 3MLAA 1GTSA 2V0GA 3G5AA 1YI8A 2X1LA 3HFJA 2Z08A 5FNZA 4BWVA 4MUGA 1MBZA 4MWEA 1WXGA 2E0IA 1N1DA 1OWPA 1T9GS 2PFSA 1J70A 1N2HA 3IMGA 2DETA 2DPLA 3A2KA 3GLVA 1WXHA 3CLRC 3PRHA 1M8PA 1M8JA 1KH2A 1JIIA 1KORA 2XRZA 1OBHA 3RFFA 1XJQA 2YY5A 5K0TA 3MLBA 3CLTC 1K97A 1PG0A 5J5AA 5J59A 5TGTA 2CYAA 5TEWA 1IH8A 1QRSA 1VLHA 1EFPA 1K4MA 2CV2A 3P0IA 3G6KA 1N75A 4MW1A 1ZJWA 4MW4A 4MUNA 2DR2A 1PFYA 1N2IA 4MVXA 3SEQA 1SURA 1OWOA 2AG6A 3LE8A 4ZCRA 4U7JA 1K92A 2CV0A 3CVWA 4ARIA 3HL4A 5FO0A 2QJTA 1N2JA 4XFJA 5F23A 1TFUA 5FO1A 4I6JA 1Q77A 4DJAA 4HK4A 2AKEA 3N05A 1LI7A 2E21A 5H16A 1BS2A 3X1MA 1KQNA 1IFXA 3RK0A 1XNJA 1VBNA 3TQOA 1KP2A 3L92A 4QRDA 3TS1A 1ZUNA 3FHJA 2A7XA 4MUHA 2ZUEA 3SEZA 4MVCA 4YBRA 4ND7A 4ZT2A 1O0BA 3IMEA 3UOWA 3CVYA 2BYTA 3AL0C 3A05A 1J09A 1QRTA 2YWBA 2CV1A 2CYBA 1H3EA 1R6TA 3HMQA 1EFVA 3N9IA 3AFHA 1QQTA 2IELA 1T6YA 4PY2A 1U0BB 3H9CA 1LW7A 3PNVA 2QUKA 4ZCPA 3RBAA 1EUYA 4ZT6A 2E89A 2QJOA 1NUQA 5DB4A 2A86A 5AHWA 4I6EA 1EFPB 3ZIUA 2DEUA 4PBRA 1O97D 3OP1A 1MC1A 3BL5A
chains in the Genus database with same CATH superfamily
4YAIA 4UHKA 2M32A 2P7HA 3GZ4A 3H1TA 4PSDA 1G5PA 2HO5A 4ZZ0A 1E0SA 2CB9A 4K6KA 1W36D 2XLBA 5B2ZA 1L7XA 4UEOA 5EQJB 1VXOA 4RVNA 3BTUA 2O2SA 4CM3A 4F0JA 5C5IA 1R9GA 4CT0A 2NAPA 1TUEA 1B6RA 3C3CA 3LUCA 3FAZA 2J5KA 3ZXXA 2IIPA 2XPCA 4FMDF 2OXFA 1FMTA 5CNIA 5HOQA 4E13A 2H8KA 1DMSA 1DDOA 4RPCA 1YNSA 3DL7A 3PDCA 4FFBB 1WSBA 2C8LA 2L0XA 2OBYA 1G5HA 4FFPA 1TZBA 3IQWA 1D09A 3OECA 4HWGA 4ND5A 3H04A 4XIFA 3RBZA 3TLYA 1PEAA 4EMUA 1JQAA 1RHUA 3IOCA 2XEXA 3GOHA 1YBVA 2DBYA 3EEIA 4R2JA 3U7EB 4ZICA 4EHLA 5KTOA 2P4EA 5EHNA 4YCAA 3T52A 4MVJE 1NULA 3ZY3A 3IAAA 1JJBA 1XTUA 2IYFA 2KSQA 1P5FA 3IHKA 2I34A 4YB8A 3E5HA 1QCZA 5CURA 4MVJA 3VUEA 4BUCA 2I6SA 1FJHA 2P8SA 2REQB 4Q9NA 3SSMA 2DX7A 4AN4A 3CBGA 3GJYA 2UUPA 3CX3A 4O0MA 1QB7A 1RHQA 2IY8A 2QSJA 1K06A 1NU6A 2VBFA 2VYQA 3H4TA 5AW0A 4Z4QA 1YVUA 1R0ZA 5EXEA 3TN7A 3WJ2A 3NDBB 3GRVA 2BR4A 3HXLA 4BNNA 4V0NA 3UFXA 2FVYA 5JRZA 2ZFUA 1U6JA 2NTEA 5EI5A 1J7KA 3QX7A 3TPFA 3CC8A 4WOPA 1RRGA 5K3EA 1X6VA 5DN6D 1KAOA 3HXTA 3AKZA 3MUNA 3HU1A 2P9JA 4JX9A 5HF8A 2Y1CA 5LXTA 1AA6A 3BHNA 4AMBA 4AZSA 1JBKA 3D6AA 1F3LA 1YONA 3WMRA 4XPIB 3BFJA 1DRKA 3DWIA 1WDMA 3TL2A 1V37A 3UGQA 2EJTA 1U3UA 1CT9A 4ML3A 5FPSA 4F93B 4CG1A 3O4IA 1KI4A 2VHEA 2H4HA 1SEVA 3A31A 4ME6A 4RMGA 2QI9C 4CI0B 2NU7A 4Y6RA 1OPXA 1XVVA 3NIGB 4PTZA 3Q0IA 4R54A 4DE5A 4DRXB 4E5SA 4QTYA 3OKCA 1RXVA 1XJWA 2WIBA 3EZ2A 3OLZA 1RRVA 4GXQA 4U63A 5DTQA 1AZSC 1CETA 4I2NA 4GPBA 4P22A 2F90A 4B47A 1TUBA 2RB4A 5MHTA 4B3HA 3W2GA 1YU6A 1NX9A 3HA7A 1C9KA 3DLAA 3F5QA 5IT0A 4W8GA 1GUZA 2C97A 5LZ7A 4OHVA 1IN8A 4NMHA 3N2GB 1JHZA 1KZ1A 2RH5A 1NM5C 1I5EA 1MDFA 4GKAA 3LGXA 2GCOB 1THZA 2O0JA 2AZTA 4EVQA 3ZE0B 3GF4A 3K0KA 5B4VA 5I9LA 1HK7A 3WWYA 1P0MA 2BEJA 2BFFA 3FXAA 2FN9A 1HYGA 3RVDA 1ZR4A 5JD3A 2OORC 1TF7A 2QMHA 1CQJB 2SKCA 3AQIA 5CCDA 1WUYA 4BX9A 1WKVA 3TIGA 3BMCB 3QXXA 1NVFA 3RSCA 4D56A 3AESB 4EYOA 1H2HA 4JC4A 5DHTA 2VL7A 1X15A 1X38A 1P9NA 5BV2P 2YASA 4B3DA 4ACAA 3ZZUA 4PC2A 2EZ4A 4HNRA 2XVYA 1TI7A 4OJTA 2EBWA 4C7OA 3CR8A 1JB1A 4HEJA 4LYDA 4BRUA 1VDMA 4X24A 3K09C 4YREA 4X8MA 2GTPA 1XXHE 3WMXA 3VU0A 3A37A 4BEBA 2BMJA 4OA5A 3SQLA 3CLUC 9GPBA 1WKBA 3KJHA 2Q99A 1TYZA 4UZEA 4X85A 1CBUA 4M98A 5IJWA 4EKEA 1V8DA 2JKZA 1LK5A 2QM7A 1DC4A 2KX7A 1Y1LA 2VSXA 3ITDA 4OQLA 1PT9A 1K8YB 4UOEA 1JWAB 3BXZA 4YV7A 3G02A 2NZYA 2PKCA 4I4TB 4X8OA 3CH5A 4YCDA 4ZAWA 1CHNA 5B36A 5BORA 5TIIA 2IPMA 4RAOA 1D5WA 3BERA 1XALA 1BQ3A 4MR7B 1ZJJA 1ISPA 3LBIA 4RTJA 1O6ZA 1UXKA 4F97A 1MRNA 3OA0A 5EMNA 3MTGA 4MWTA 3U0BA 4OIFA 3B85A 5D7BA 5IASA 3TOVA 2DPGA 1RZVA 2XT6A 4RNCA 4U2KA 4DGQA 3A58B 4DDVA 2DHRA 1II8B 2C3MA 3B9RA 3F78A 3GPDG 3GQBB 3NORA 4UVGA 5JBQA 1NY6A 4PWZA 1B4DA 2G76A 5FBKA 2RHDA 3ENNA 4L8GA 2G4CA 2ZIXB 4GC5A 3PGXA 1C5KA 4Q9IA 4DUPA 1XHEA 2ZJ7A 1E3WB 3E1SA 1A8PA 4KTTE 3IQHX 3NBQA 2O3TA 2PCLA 1NHGA 4EHIA 1F5SA 3Q5EA 2QW8A 5A4FS 5DI9A 1L9KA 1RKQA 4YO8A 4PPFA 4KN9S 1G7SA 1WDWB 4KAXA 1C8VB 2QD4A 4ZVVA 3FE2A 4S1NA 2AEJA 3EWNA 4PYRA 4AZVA 4E5UA 1WM1A 2PMWB 5A3RA 1Z12A 3WLOA 3QBTA 1EP1B 2VBGA 3KLPX 4WVFA 4XVQA 3AZPA 3V4PB 2YINC 2NU6B 1IZ8A 2C4MA 3ZWCA 2NXCA 4C4AA 1A8IA 3VR5A 3PUIA 1UFRA 3H2YA 5A5GA 5DX8A 3PXBA 2IZ6A 5CEFA 5LA6F 4D26A 4BO1A 1XDSA 2Q2VA 4MS3B 3O0TA 3KAQA 4XWKA 3KETA 1NJ6A 4DJDC 3HS3A 3EOBI 1DC5A 5LD2B 4DDUA 4PX9A 3LPDA 1O03A 4BFVA 1GQQA 2IP4A 2W2KB 4IVNA 4YALA 5JOQA 3FKSD 3RV3A 3ZLVA 2PQMA 4YS6A 3B20A 4NZYA 1NQVA 5CRIA 3UG6A 2IYXA 2OGSA 1NMXA 1MKYA 1XQYA 2GCEA 4LXXA 3ZHSA 1UBUS 4UOZA 2VWGA 3EVGA 1K4YA 1JZTA 4LNUA 4CIXA 2X58A 4FC6A 4OHRA 1DAEA 2C3YA 4AWXA 4Z7QB 1VBMA 3H6HA 1PL8A 3R7AA 3CR3C 3SI7A 3LKBA 1O0CA 2JHAA 3UJCA 3CONA 2QAJA 1J7JA 2XQKA 2NUPB 1GXSB 2Q3JA 1T1RA 5IJ9A 1JFFB 1LDMA 1IBLB 3M5WA 2IW3A 2ZUTA 3ZLUA 3OCXA 3UTCA 2EKLA 1L3BA 2TMGA 3AEUB 1G42A 3TTXA 2EZ8A 2AGVA 3KSUA 1FQWA 2PIDA 3NLLA 2FFQA 4JJEA 1GVHA 5AKEA 5IDXA 1KPIA 2JFXA 4IM7A 3WDSA 2EFJA 1ZXLA 4BUJA 4AG6A 3CYFA 1L7DA 4Z9FA 3B89A 3JWGA 2GD1O 2IRWA 1EX9A 3MG9A 4NEQA 2R0QC 2I29A 3WY9A 4HMPA 3WK7A 2O7NA 3KDPA 2C9BA 3B38A 1X2BA 2OLJA 2FZWA 2HK6A 2QL5A 1YZYA 3COSA 1Y4UA 1HL7A 2R1TA 3EXG1 3LQFA 3OTHA 2FZ5A 4FE4A 4G4SO 4KO8A 1RQXA 2RKOA 3L7OA 5AJUA 1KK0A 3X3HA 2A5DA 2ZYIA 3NV9A 3WQBA 5GONB 3ZHYA 3ZU5A 1TA0A 1ZNZA 3N2IA 3NOXA 1KSJA 2HN9A 3QA3E 4IL5A 3GAAA 2H2HA 3CBQA 3E03A 2AYYA 2Q6TA 3LVFO 2XNKA 2EBHX 3PNOA 4MQ5A 1VI6A 4TMKA 2QN7A 2H7VA 4BQPA 3DFKA 1NKTA 2GAFA 4DTCA 2Q50A 4PYNA 3WB1A 3D43A 2OD7A 2VJMA 4FS8A 1UBRS 1PV4A 3AR5A 4KBGA 1BJTA 4J94A 4JLJA 3TW0A 2AOVA 3IJPA 4HKTA 5JLAA 3H11B 1DKRA 4YRTA 4RCVA 5GV7A 5EJ8A 1CV2A 3L9WA 5AXBA 2RKBA 4AIRA 5KJ6A 3F8WA 4LHVA 3MJFA 1OAAA 4LS3A 3U7QA 2YJ3A 3HA5A 4M4SA 1C7ZA 3E22B 4KQEA 4MI9A 2H54A 3R3XA 3JZMA 3Q6IA 4XSHA 3V7NA 4F8YA 4LX8A 1H1TA 5AUNB 3G5LA 5I8PA 3EZ6A 2ZJ4A 3PDHA 4GZMA 5K99A 3GOQA 5AI0A 5JFOA 3EVBA 4QVGA 4O29A 4CKEA 4UDNA 1RLTA 4DJFC 3BZWA 2QR5A 4EB6A 1CVLA 3SSNA 3GP8A 1QF7A 1QK3A 2Z2YA 1YRWA 2XUIA 3DT8A 1JJAA 2GJAA 1W2GA 1IJBA 3KKNA 3PQCA 4HSGA 5EZ6B 1NVVR 3H16A 5AI9A 3RVNA 4MVJP 1RWXA 1ARZA 4N3CA 3WL3A 2JKYA 3QPDA 1Y8QB 2XWPA 1CK4A 4PZEA 3UMSA 2CMDA 5DGHA 2RGCA 3L6RA 4KFUA 4KJXA 4YH1A 1WY5A 4RS3A 4IFBA 4U7GA 3IQZA 2PRKA 3QVXA 2CL6X 1BEZA 1Q0UA 3HR4A 3ME5A 5A0TA 1AUVA 5JMTA 5FORA 1K6EA 4MR9B 3GZTB 2CWWA 3BJZA 4XGRA 5CDTA 2J30A 4NV1A 4QFBA 4EB0A 4X1KA 2BSAA 1HTBA 4O02B 3NHAA 5EJGA 1DOZA 1SQFA 1JZSA 3FPAA 5CVVA 3H99A 4PRLA 5LMCA 5A4JA 1E3WA 2I4OA 4IOJA 1CF9A 2RGNA 1BMFA 3P9IA 2HHAA 1PF7E 2W0MA 3NEYA 4CF4A 4DC0A 3COVA 2VRNA 4EF5A 1QHIA 2G04A 1II8A 1E6MA 4DLRA 3THWB 5HIJA 1OZAA 1BO6A 2RHGB 1KZYC 3TRIA 5IZ4A 1CZOA 3VXKA 1DIGA 1HT1E 2WU8A 1VG0B 2JIZD 3IP1A 4Q9KA 3ILHA 3ICVA 1O94D 2VHCA 3W3AA 1Z2DA 3RFXA 3DOUA 3IJ5A 4MIKA 2LP4Y 1BYIA 2HJVA 1KI9A 4UFOA 4DYHA 4G2TA 4M1MA 2WYHA 3D0RA 5AOVA 5FUWA 5FEUA 3FBWA 4QJ4A 2HMVA 3MK31 3TM5A 1XC7A 2IF0A 5KCMA 5LQJA 1O95A 1T9ZA 4L51A 5ALNA 2QTRA 4IGFA 4E1BA 1DFGA 1I4LD 3DJYA 2XGGA 3MINA 1UF9A 5BN3B 4KWEA 5FOTA 4AECA 4M1TA 4TV9F 1D2NA 4NCJA 3OZAA 4CV0A 2VHQA 5CDUA 4H4EA 4YRZA 4CLRB 3FNIA 1Z73A 2CXXA 2WDPA 1XP5A 4RA6B 4ARUA 1K63A 2EYQA 3S99A 5EHZA 1B7GO 5A3VA 1XMJA 4EABA 1XROA 3OFVA 1J6UA 4MCIA 1WXGA 3A6ZA 1T8TA 3Q5GA 1A50B 4HRVA 5LOVF 1T4CA 3WLTA 5BMVA 2YXEA 4M6WB 1MVNA 3OPYA 2X3YA 1RABA 2IVFA 3HQ4O 2ZAOA 2CJXA 1C7EA 5A4MS 2WNIA 1QFZA 4L07A 4QOIA 4MUXA 4MNTA 4XDGA 1BGVA 1IEWA 2Z2ZA 5HMMA 4YV1A 4ER3A 2OFFA 4OHFA 5A9TA 2G80A 3PB3A 5K0TA 3MLBA 2VJOA 3H65A 1YQEA 2YZMA 1SVOA 5DNYB 3HY3A 2UDPA 3ED1A 1AUQA 1NM5A 3VC7A 5FADA 4ALIA 2Z4SA 1DXOA 2R60A 3NTRA 4IIEA 4BZPA 5KNBD 2O2YA 4DIUA 3F6PA 4OB6A 3ABQB 4MW1A 3A28A 4FD2A 4OXRA 2CL5A 1YRBA 1VPEA 3K9LA 4HN9A 5G02A 2O06A 3AHEA 4OYLA 2Q1XA 2WAYA 4TN1A 1OLXB 5AMXA 4Y2PA 5EZYF 4BRZA 2VUSA 1E2JA 1K92A 1VJRA 4I81A 4O4LA 3ZWQA 1ZI9A 4M7PA 5THXA 1SKQA 4PG5A 2R8XA 2H51A 1A7KA 1G2QA 2B94A 3JQQA 4I6JA 4M9XA 4KPFC 2NU8A 1G20E 3N53A 5HNKA 1NN3A 1G5FA 2PLRA 4IDNA 4RK1A 3I9NA 5BWNA 3PIIA 4QXQA 3C16C 4OJKA 5P8WA 9ATCA 1XNJA 4KXUA 4KMMA 3BORA 4ZJUA 2YQZA 3TS1A 4YXFA 4GQIA 4C2BA 5L4SA 4D4LA 5KVVA 1U28C 3HYSA 1OI2A 5DTEA 1DU4A 3K09A 1KPGA 2FPLA 4E2WA 3MGBA 1RDFA 4OXIA 3RB8A 4XPIA 5AUOB 1GL6A 3MMPA 1F14A 2X5XA 3G82C 4FZVA 4BNLA 1B8PA 4EI7A 4QLAA 5I6DA 2XADA 4X9XA 1GCUA 4E12A 3MSCA 3H4VA 1BD4A 1NOJA 3K5IA 5BW6B 1S2NA 3R9WA 3V1KA 3WJAA 3KOXA 1JKJA 2OILA 2DY0A 5JNUA 1VGRA 3Q85A 3MYRA 4BU1A 1U0SY 3DC2A 2HLPA 2JZOA 1NSFA 4FYXA 4H31A 4KACA 2PT5A 1RQLA 1T6YA 4RMJA 4Y98A 1XHFA 4XEHA 1J23A 5J5VA 1XEWX 3DE2X 4X60A 5AD1A 2OP1A 3C8UA 3JAKA 5JTTA 3EPJA 4JUDX 5B1YA 3AV3A 1IY8A 5GQSA 3RC2A 4ZEMA 3L1KA 1P31A 4C04A 3F6EX 3LFHA 1JQBA 3ZYZA 4JP8A 5DO9A 3UUEA 5K4GA 4RJJA 3DTTA 4YGXB 3DOCA 1ZH2A 2BUBA 2P0YA 2ZRMA 5BSTA 4S2UA 1YZNA 2NVUB 3LZ6A 4J0EA 5FPQA 5JC8A 1J56A 1HDGO 3JSAA 3GH3A 1JTVA 2K4MA 2X8BA 4GUDA 4NE7A 4I55F 1M2KA 4EDHA 2KI5A 1QCYA 3ADOA 4G81A 5E3IA 4JLWA 4DWJA 2P2YA 2X2PA 1CIPA 1KJWA 4PFKA 2B36A 2Y0PA 4L50A 4B17A 4ZHSA 1TTPB 2FR8C 2R66A 4MYDA 5AJWA 3ASZA 2EDCA 1C7FA 3IUNA 4E15A 4X94A 4DV5B 3KJXA 2GPJA 4TKUB 1KBZA 3K1JA 1JKIA 1AX9A 3F67A 2PGDA 2B3DA 2JJ8A 1IULA 4LOJA 4JC0A 3UUFA 4RACA 1PG2A 4YMSA 2I3AA 2EFEB 1KARA 1QRDA 2DG2A 2DTEA 3CNNA 1SC6A 4JXJA 4E4YA 2BH2A 3OMWA 3VOBA 4G1VA 1E18A 1LWNA 2X7XA 2YYYA 3U17A 3AJ8A 4QASA 5K3FA 3FNQA 3EB9A 4HH4A 2B21A 4MRVA 4AQDA 4V0SA 2VKTA 1YGPA 2COEA 3P2JA 3P2KA 1EVZA 2FFHA 3RT1A 3UW3A 1GCIA 4Y2TA 2ICAA 1H4SA 5J1TB 4CQMB 1ST2A 4PLVA 1HF3A 2B1IA 2C4HA 2PL1A 5E9AA 3DTVD 2OQVA 3UENA 1M2EA 4WWHA 1S2OA 2WKWA 3OJLA 3VSBA 3W1VA 4BVAA 3NC1C 3TOSA 1BDMA 2D0PB 1W35A 3RTEA 1F4LA 4LYJA 1N9ZA 2P4UA 4UFNA 3K0FA 2W8BB 3E4CA 5IPFA 1AHHA 1SVUA 4ARSA 1L5OA 5F1YA 3LZCA 4BV3A 1JPUA 2XWJI 2BGIA 3V8NA 1RKVA 4UULA 5B58T 5BQPA 3AV0B 3VKVA 3VZSA 3CX8A 1WCXA 5K4AA 4F85A 5IZCC 1WZ2A 1Y37A 1P7PA 2P75A 2KLHA 2V3CC 4ZEXA 3R7LA 3KL2A 5GVRA 2NOAA 1U0JA 1OASA 5EIBD 2IL1A 3FRJA 5K45A 3R7NA 5CJJA 5IC5A 5KB3A 2AG8A 4KGZA 3VR5D 2R9VA 3KUKA 1GCOA 4C07A 4TOIA 1CZKA 1Q91A 3KZMA 1OT3A 2AEMA 2CXPA 2IJGX 2YOHA 4RK0A 4E5PA 4EG0A 4DMRA 3LY7A 1ZITA 3SR4A 1UZLA 2FJ0A 2Q9BA 1V26A 2NAFA 2P7IA 2O50A 3THXB 4BP8A 2YICA 3QLUA 4L5IA 2H5EA 1U5BB 4NENA 2QTGA 1SMKA 3N2KA 2HZBA 3QVOA 2HUNA 1T6XA 4QHSA 4UBMA 4BVGA 2GKGA 4GR5A 3K2BA 4LJ8A 4ZOLB 1LSSA 1EJ2A 3O9ZA 3RS0A 3KPYA 5LMZA 1KHHA 3TUZC 2VDRB 1JZQA 3COWA 5DULA 4ZVRA 2PG3A 3VGJA 1F8XA 2H4WA 3D8BA 3G8AA 4DEXA 3ADKA 3MCWA 3FOEC 2JLWA 5KS2A 3A7DA 5J4LA 1YC5A 1OH7A 1VLZA 1ICEA 3FZEA 3OUUA 2OK7A 4LA4A 4C0BA 5DNCA 3PGLA 2X6TA 3QZUA 4HXGA 3IURA 1GLVA 5ED0A 2QE7D 2WAMA 3WL4A 3E9RA 3HFRA 5FV4A 3E22A 2ZM6B 2J7PA 3G0OA 1HTWA 3HWRA 1T6ZA 3LIIA 2YXDA 1JFSA 3QMMA 2HJSA 4GMKA 2ONKA 1BMDA 1J49A 4TTQA 2GLXA 3TD9A 4IF6A 4B4OA 2HMYB 4K86A 3GV0A 4HB2A 1ADBA 4HGQA 2ZYWX 1LBIA 5TF0A 3TAUA 5IG2A 3BB1A 3CLSC 3RLIA 3ZTWA 1QBKC 1MP0A 2P68A 5A7HA 5J3JA 1TYDE 1J22A 4RTOA 2FE1A 4PVDA 5BQ3A 4AG3A 4UTRA 1HUQA 1XPUA 1FLDA 2BZ1A 2I62A 3FPLA 2ODAA 3LYAA 1B1CA 1WTCA 4HDMB 3TOZA 3EGEA 3WBJA 2W43A 2P77A 1T8YA 3UWDA 3WB0A 3CT6A 3HEMA 4LXTA 4UHBA 2XYPA 2DERA 4MJXA 3O92A 2ZUBA 1XJ5A 4MP6A 2CJWA 1RJGA 1TVKA 1HEIA 5JRDS 2B4RO 5I7RA 4AY6A 3WLMA 1RHRA 2IGTA 3EZ9A 1E8NA 3FKQA 1J8VA 2BEVB 2OMKA 2WD7B 3AIOA 3HRIA 2REBA 1J1IA 1M5UA 4G5XA 4QXPA 2I6GA 5CX4A 1BRTA 2QUJA 1UMKA 3K1TA 4KNWA 5KYXB 1KRWA 3PUYA 4NABA 1DJMA 4OQYA 2XTJA 4KI0A 2LW7A 3WQRA 2RD2A 3UJ6A 1KU6A 3L8MA 3TLGA 2FW0A 3ZR4B 4K9SA 4KBYA 4NZMA 1S02A 1SVMA 3PVCA 2FWNA 3WOHA 5CCEA 5CVTA 5KTRA 1RT9A 4JI1B 1GNVA 4YUXA 2Q8PA 3PKIA 3TJRA 1XYVA 4R9SA 3A32A 3QE4A 1HLFA 4RCZA 4YJ2F 1XZJA 2V55B 4U2BA 5F64A 1JIJA 2FSFA 1O77A 3R9KA 2E82A 5IZCA 1Y3HA 2P2NA 4KKVA 4P2BA 2B78A 3D3JA 5CK5A 3N6XA 3ZDDA 4IUYA 5DKFA 1ECJA 3K2EA 5JATA 3FYHA 4NI5A 1Q83A 2JAUA 1O6BA 1NDQA 2BDEA 2BBTA 2FSPA 3LQKA 2BI4A 1KJJA 1N7GA 4Q18A 1NBWB 1JDBB 2YBEA 2L42A 3R44A 5CXQA 2VH1A 2UYCA 5AVSA 5CCBA 2BPOA 2CLCX 3HDYA 5EMLA 4D4HA 1ZVVA 2FG7C 2FPGA 3BAZA 2X4GA 3C3PA 1TIKA 3WICA 5ALXA 5J58A 4NYMR 2ACVA 2ZIAA 4X0EA 2ONCA 1NY5A 3EUFA 3PFIA 4G1UC 4LE0A 2XDQA 5IC6A 4I9NA 4XLZA 4AUMA 3TZCA 1T10A 1XX6A 2DSNA 1X0XA 5EA2A 2O2IA 2QQFA 3FROA 5LP6F 3G0GA 3V46A 1XXHA 2L19A 4U7WA 4F2DA 3M2PA 3H2SA 5B1IA 2X86A 3NCTA 4UPDA 1DBPA 3BDVA 1DT3A 4FINA 4DQKA 5BR8B 5H3HA 4XJVA 4QKQA 4C4ZA 4OLAA 2CN1A 3NYIA 3K71B 2IC5A 3QLVA 4D9BA 4FT4A 3GI1A 3KJFA 3H1BA 4C30A 3K9NA 2C5GA 3ZX4A 3F9IA 1OU0A 1QAMA 1SBHA 3AWDA 3QKIA 3SQOA 4E70A 1X2EA 1PIWA 2C2GA 4RBNA 1QWSA 1KH3A 3PITA 2NW6A 2WAXA 5ALPA 4NMWA 2PEYA 2H1IA 3FPBA 1HYBA 1P3DA 3RNOA 4NYIQ 4IMRA 5EJ9A 4Z0TA 4C9BA 2F3QA 1W6RA 4XUGB 3RK4A 3W8EA 4G56A 4MR7A 4EKGA 1LA2A 5JLJA 3G5TA 1RPAA 1EKXA 2WMOB 4IHKA 5DOVA 2H2AA 5J43A 3T9FA 4E6EA 2DFTA 1TYCA 3SXUA 3GVCA 3NM5A 4ZYVA 2DH6A 2E5FA 2EL7A 1X94A 4UUQA 3P5BA 4S1OA 4E09A 4J0IA 4BN5A 2XVZA 4KLNA 4MUIA 5ALSA 3ORHA 4OKIA 1U1IA 3HPRA 4YMWA 2YWXA 1JG3A 4IQGA 3CRMA 4EG7A 3GGDA 4B3CA 4G0VA 4FQ8A 4FFSA 4ZIRA 1UP6A 4LIPD 5K0SA 1X86B 3JALB 5AUQA 4R31A 1DRUA 3NJRA 1KR2A 2J6IA 2P2LA 2HPZA 3NOQA 3DQZA 2XTAA 3OQJA 4KYUA 4B81A 4E5YA 1C3EA 1MEEA 4E88A 5BSRA 4ER7A 3U7FB 2HMSA 4LWZA 1E4VA 4JGBA 2FZEA 4BNHA 4BO2A 2Q3HA 2XUQA 2XMPA 5D8DA 2HQSA 4IILA 1RXEA 4V0MA 3ZXUB 1ZAKA 4OBBA 5KDLA 1F20A 1OUMA 3GEIA 3GH1A 4IXNA 4BNWA 1FU7A 3SOZA 2FFAA 1TAHA 5B55A 1A69A 5C7OO 3PX2A 2APJA 3LQ4A 4JODA 3BUSA 4AUKA 1NUUA 4B1FA 1SY7A 2QD5A 4I50A 5TQ2B 1SXJA 1UC9A 2R6CA 3I6BA 4LBVA 4N1AA 1Y1PA 3BHJA 3VOTA 5A4KA 3I6ZA 5JYCA 4K0RA 1TT5B 3BGOS 3DW1X 1SXJE 4ZYWA 5ITZB 1ZISA 3KD3A 3I6MA 3G2OA 1U5BA 4NENB 1SRRA 5LBTA 4D25A 3OPVA 4PFQA 5A4IS 4JI5B 2MTBA 3T1TA 1M67A 3E05A 2R2AA 3Q2IA 1SXJD 4EI2A 3AFIA 1ZJ4A 5AKIA 3UMBA 4N0PA 3I30X 4BWGA 5SY6A 3HN7A 3V33A 4NESA 4WXYB 1I2DA 4KQFA 3OY2A 3SDBA 4G5OA 4RKEA 4YJKA 3NKLA 2ZYUX 5LQMA 3EEQA 3E1KA 3IILA 2B37A 5JZVA 1BEUB 1BKDR 1Q16A 1KHTA 1VHQA 2JGJA 1H23A 2NV0A 3LBAA 3TQCA 4DBVO 3IBSA 5B7QA 1NLYA 4Q9HA 3CLSD 2CLLB 5LM3A 5L45A 2QEQA 3RHSA 1YSCA 5F2NA 4CL8A 1V11B 2IYNA 2M9MA 4DRXA 2JL1A 3H8SA 3SC2B 2IYPA 4NE2A 5L7YA 5L7TA 2H5LA 2ZXFA 1EB9A 4ZCQA 4FW9A 2W5UA 2ZCUA 3WGTA 1JNYA 1OI7A 1SU4A 3IBCA 3EJWA 2CW5A 2AN1A 2DLCX 1RS0A 4EGJA 3ILVA 1IN5A 2Z4TA 3WQHA 4B3BA 4DIBA 2AFIE 3Q0EA 2EW2A 2CVOA 3AF3A 2W6OA 4GPIB 1HE8B 2HXYA 4HEHA 4WK6A 3QTTA 4R0MA 2A9KA 4I4TF 2R5FA 3EBOA 1H9CA 3KVRA 4IR7A 3MGCA 4AQYB 3OHMA 2O3SA 2ZWIA 2ETVA 2HA0A 3GA7A 4RK5A 3HEAA 4IRUB 4X1YB 3PEEA 3UUWA 2HQBA 2DBVO 3EMBA 2EBUA 1LRKA 4TTSA 1T4GA 4OYYA 4XEUA 5JWHA 3O8DA 1MOPA 5L3QA 2F4NA 4K81B 2GZ3A 3GLHA 1TCCA 1ZD1A 3D4PA 3OZVA 3QXHA 3AEZA 4FP9A 4EGSA 1DUVG 5EKXA 1TYEB 4YMHA 3OCVA 2RFLA 3B7GA 4MUFA 4JROA 1BOFA 1OKKA 2UZAA 3BBLA 4N54A 3EVTA 1MFZA 2F43A 3T0IA 3HJTA 4TSRA 1BRMA 4WZAE 4QPJC 5KWEA 3O8RA 1Z6AA 2O7RA 4H17A 4P4SA 3W5DA 4HMQA 2Y8EA 2IHTA 2ZAMA 3OMLA 1EX7A 3QWHA 2C04A 3NGXA 1WB6A 1MTOA 2RI0A 3AEQA 3GMTA 3O2SB 4UOQA 1O97C 3LSYA 5G0VA 2MYTA 3E9ZA 4R0VA 4WQMA 4F9GA 2BLLA 2VHYA 1KEUA 3MLAA 1DIBA 2D4HA 1AK1A 5ALFA 3WQQA 4IG9A 3K3PA 3AM1A 4A16A 1JEAA 3DMYA 4HZUA 1Q3HA 5I7UA 2NO4A 3X2SA 5L95A 2BD0A 2PH5A 1RYDA 5BUSA 2FX2A 1U0TA 1YK0A 5FNZA 4PW0A 1Q7GA 4CCYB 2E0IA 3IB3A 1TTTA 2MMCA 2JI8A 3PQEA 4IJ6A 1UZAA 1L4KA 3L3BA 1QO7A 1U65A 3FTEA 1Z6PA 1V35A 2F1OA 2XGMA 4MKIA 4NDNE 5FIUA 5H9VA 4FDVA 3TQQA 3PRHA 4D4JA 5C1PA 3G88A 3BCUA 2YWHA 3I5YA 3W5IA 3TW8B 3JASB 4UM5A 5G0SA 1G4UR 4WIAA 1OBHA 2AMLA 2GKOA 4F4JA 2QKYA 4BNJA 5K3OA 5SZIA 5F9FA 3MQ2A 3G49A 1OW3B 4DLYA 5LDGA 4KXXA 1DAFA 4UNSA 5IAJA 1UFQA 3WB9A 4LF9B 4PZ9A 3USCS 1G7RA 1D1PA 5SYNA 4C7VA 5TMPA 1RMYA 1GQFA 1TCVA 3NFRA 5EP1A 3W9UA 4BLTA 1IU9A 2GXUA 3L0IB 3ORSA 3I5MA 3VSCA 1N75A 3WB2A 2DPXA 3N75A 2WE7A 1ZX1A 2HLDD 4QQNA 5ER6A 2RHJA 4RMHA 1JR2A 1SURA 1PNVA 2PGNA 2PVPA 5EWJB 3DDWA 3TEFA 3ZCVA 5JDIA 4J49A 3OOSA 4GI2A 2CUTA 1P74A 3OZGA 1EM8B 4QUEA 5EZ5A 1AH2A 3GFTA 1QOZA 1XLUA 5IANA 2ODWA 3DONA 4JH0A 1VYHA 4DJAA 1BDHA 2O2ZA 4RHEA 1ZU4A 1SUSA 1Q3KA 3AW8A 2VHUA 3FGOA 4TWJA 1JDBC 3G85A 3N8GA 4KCGA 3TGWA 1BS2A 2PUWA 1XTVA 2M6RA 2VZEA 3IQEA 4WH0A 4UTVA 1WO8A 1VBNA 3EW9A 3W7AA 4Z1OA 1BDJA 2GZMA 3JQDA 3PUKA 1Y1SA 3MT0A 3UHOA 3VPXA 1VE9A 1SVWA 1FFBA 4D44A 1TF2A 1Z06A 3K7EA 4AJJA 1OYYA 3IT1A 3HCCA 3CY6A 3CN7A 4TT8A 3RDPA 2GPSA 3OH8A 5E3JA 4WOKA 3BWYA 3FTQA 2LCIA 3SEZA 1P1KA 2DBQA 3U7GA 5CCXA 4OLHA 5BNIA 5F5LA 1EXWA 4GKVA 1KI3A 4ZYYA 3LC7O 3CUUA 4NECA 1GDTA 3AL0C 3A05A 2QLFA 3L8CA 5HF9A 2WM3A 3IR5A 5KHOC 1EQ2A 5HFAA 1GGEA 1DCKA 2I2DA 4K88A 3WLJA 3EXG2 1DWOA 1IM5A 1EMDA 1W9HA 2VP6A 3A36A 1R64A 1NV9A 3KNZA 3OHSX 1VJ0A 1NRJB 3OSZA 1TKRA 4OBWA 1VPLA 3QEMA 2H7XA 1QHHB 1K3TA 5FBQB 2P4HX 1EUYA 2XNDD 2MSNA 2PD3A 3FDFA 2JFWA 4JP2A 2QJOA 2WVHA 3KU1A 1FXUA 2W93A 4GDMA 2XJ4A 1ULSA 2VSOA 3HSYA 4LYYA 4O4LF 4FEYA 2A86A 4NQZA 3EDRA 4Z86A 3UMGA 3D1LA 2OHJA 3QXCA 4IDGA 3U19A 4KXQA 3C0KA 4JVNA 1C14A 1J4AA 1JIUA 3AUYA 4EH1A 1MC1A 4UNPA 1VMAA 1PO7A 2O0MA 3EODA 2HU2A 3L4JA 2J9YB 1KAGA 3OQIB 1WOMA 1RE0A 1L1RA 2VCHA 3IC5A 1LTKA 5JCXA 5U9CA 4D8YA 4EVRA 1V7CA 3OPMA 2G5TA 2VH5R 4ABYA 3KDAA 5REQB 1IQUA 1U9IC 3J80A 1VZ2A 1B76A 1ENOA 1X7XB 5A6SB 5C4IA 1Z4JA 3QHPA 1B8VA 2ZUFA 3O2NA 1WU8A 4KHPB 6ADHA 1OWMA 4I9FA 2LBPA 4UNNA 4DV7B 4N48A 1RFGE 2CNDA 1M1NB 4ALLA 3N1UA 4BMCA 4IRMA 4GLJA 5E8JA 5IVHA 4OX9B 1VJGA 4IKOA 3O90A 2PZFA 3DYIA 3PXUA 2G5GX 4JEUA 3AETB 3IQFA 4LRXA 1XU7A 3T9EA 1Q3TA 1A1SA 4R0NA 3WMGA 4Q24A 1ZGBA 1AVTA 5G40A 4XSGA 1A4IA 1RWVA 2JHGA 2YWCA 4HLDA 4ZVMA 1IZZA 1IBCA 2O2JA 4YUZA 4TMTA 5BYBA 2EXXA 3PEWA 1Y9EA 2ZI3A 2V59A 3CWCA 2WY2D 5LDDC 2A8YA 2VTKA 3RI3A 2HI0A 4MGIR 4ACBA 1AUXA 5CXUA 4K28A 5LKAA 2CLKB 3AEUA 2EJWA 2X5OA 4FDMA 4I5GA 5FOVA 1WRBA 4TQUS 5IUJC 4C4SA 5IUKC 4D3YA 4LI3X 5A6VA 4X93A 2I3BA 4Q7LA 4RVSA 4UBLA 3VYTB 3ND6A 2I8AA 2WV9A 4BV9A 2QTNA 1T2FA 2VP5A 3G0DA 4GP7A 1QVWA 4IBOA 3EAFA 2N42A 2O2GA 4XTRA 3KZ1E 2BLNA 1M9NA 2ZJOA 1KZHA 3B8HA 3NWJA 1ULBA 3REOA 3UBTA 5JU6A 1OSNA 3QKUA 5DHUA 5EXXA 4PINA 1CSEE 1BE8A 5DT9A 4YR9A 4KAAA 3FNFA 5IYZA 1O2DA 2HY7A 4OHKA 5H9WA 3PDIB 3ZGNA 2HJ9A 3TQSA 1A72A 1CFJA 2VPXA 1M1YE 4JT8A 5ECGC 3E81A 1ONNA 3A6JA 1ZCJA 2CNKA 4BLRA 3IESA 4HDCA 1JEJA 4FMPA 4RESA 3RS2A 3HA3A 3O3OB 1JEQB 5ANRB 1W85A 1VL5A 1BE1A 1NONA 4R1UA 4X71A 2BFCB 4NV3A 2YRXA 5LYJF 4HMOA 2Z8ZA 1PFUA 3OIVA 4MA4A 1A0OA 4WEQA 4JENA 2I6QA 3LHSA 1SWWA 1OWNA 2XZPA 4Y6GB 2WNSA 5GP1A 4TL6A 3LKDA 1GITA 2VT2A 5JBIA 5CYFA 3QVVA 3UAXA 2HPVA 4UU1A 3RSFA 4DSAA 4OD0A 5HK8A 1H2ZA 1I01A 4RLSA 3FCXA 2HXGA 2EAUA 5COBA 1KDVA 4CF6A 1I6MA 4AMVA 1JQLB 3DMGA 1N33B 4JJFA 4DY6A 5HDQA 4ENWA 5C1OA 3MRTA 3AHFA 1N4AA 5DHSA 2GTHA 4ITRC 4ZMBA 2PL3A 1CNFA 4C4YA 1F9AA 1BOOA 2WM9B 4J0KA 3V8EA 4ER5A 2FCRA 5KOYA 3GLIB 4E07A 1Y6RA 1EVEA 3Q3CA 5EL0A 5L4LA 1Z4OA 3KE8A 1ZUHA 2WILA 4DA4A 1JV2B 1L6IA 3BKXA 4I0WB 1Z75A 2PH7A 1DWQA 1COZA 3QRWA 1ADCA 2GYWA 2O2HA 5AT1A 2AE1A 4L27A 4CJXA 4UHDA 1R5NA 2PKWA 1TK9A 3EWIA 3JU3A 3P5SA 1JTEA 2B4TO 3ZWVA 1GL7A 2QT0A 2AR7A 2M98A 2Q9CA 3KB6A 3WYCA 4EX7A 1VIYA 1IBKB 1CZRA 3QVKA 1V3QE 2GK6A 2I87A 3LC2O 2FA9A 3RQSA 3OQIA 3LLSA 5IXJA 2IYVA 3OPQA 4ZANA 3NEJA 1BWSA 1Y6JA 3E7WA 4KITB 4O2AB 2I8CA 3ZLBA 5JY1A 3AF2A 3EGIA 2G8NA 2QNIA 5EERA 3ZWWA 4CN8A 5CA0B 5LIPA 1VHLA 3GELA 3QENA 4MZXA 1I51A 2J9XB 2WUVA 5LQNA 4RABA 1BCSB 3PUJA 4JVOA 1KIAA 2WZQA 4UATA 1P0FA 2OMEA 4YIHA 1B3RA 4ZJPA 1Y81A 4X6UA 4G8BA 1TDJA 5TS2A 5T6BA 4HUQA 2GLUA 2DYKA 4RHYA 3AJRA 4GX0A 1T3GA 2NIPA 4LKOA 1XTQA 3MJCA 1BW9B 4FGZA 3N07A 3S40A 1SU7A 1ZNQO 1BFKA 1AKRA 2AYZA 2Y2UA 2Y4OA 4MYSA 4P86A 4QVKA 4PSVA 4WX2B 1UADA 3WV5A 2EFGA 3EEFA 4BMPB 2J0SA 1L5ZA 2AMYA 2IIVA 1UEIA 4N5HX 1PL7A 2XB2A 1GSIA 1ZJ6A 2WZCA 4Y2HA 2VOJA 4TWAA 1JNXX 2PQ2A 3CF2A 2WWFA 1KVQA 3PHIA 4G8JA 3K5WA 4KDEA 3DH0A 5KNCD 1IZ9A 1E0JA 2CFRA 4MYCA 1YKFA 3CW9A 4J7CA 4LCEA 4AX4A 4BKOA 4H18A 3HADA 3ELUA 4RF4A 1PT5A 4ZJYA 1E64A 4G9GA 3KKLA 1YQUA 2Y77A 3MRSA 1E2KA 2H9IA 3RYFB 1AKNA 2H1RA 3S1LA 1V4VA 1U3CA 1L5YA 1QYWA 1RAAA 1OXKB 1T8RA 4QGSA 1C7QA 3K0AB 2IPXA 4QOHA 3HCOA 5CLFA 3LBHA 1Y5IA 1XA4A 2REXB 4A26A 3GVXA 2I3ZA 4CDMA 3NHMA 2O8EB 1M5TA 1IL0A 3GQBA 3DA8A 4JEHA 2OQ2A 1CIVA 2LPMA 3IH5A 2B4AA 1EM8A 1PJ2A 3T9CA 3K0FB 3M6IA 4UJ3A 1AN0A 1VKOA 3CVJA 4OGFA 4KMRA 2A0WA 3N2EA 4BQOA 4EFMA 5IFLA 4EEZA 2UUBB 1TQHA 1J1ZA 4Q3AA 5D3MB 5GZ6A 3PQ8A 4IZ6A 3WC4A 5K0JA 2ZS7A 4YAOA 5GM2A 3SU8A 2BSQA 2RGEA 3LA8A 5AK4A 1AHIA 3ZV6A 1ZA2A 2XT0A 2I4IA 2IGBA 4LHYA 3W78A 4HYYA 2C9MA 3GAZA 3R76A 4AJOA 4DILA 3PE6A 3KXLA 2FLWA 4PCLA 4CM1A 1XAJA 5IWAB 4LK3A 2ODBA 1KYTA 4WCFA 2QP9X 4ZEOA 3EPRA 4A2WA 1KI6B 1UWVA 1XDZA 2JFYA 5BUCA 1CS4C 4L3OA 4YRDA 1FFEA 3PBKA 2IEIA 4J0JA 4KVGA 4BNYA 3MAGA 1E1CB 2FQ1A 1ZVQA 2YWFA 2SKEA 3NH6A 4ZQGA 2GCNA 4FEAA 1JQEA 2H1OA 4ZI7B 2VQFB 1D5CA 3QTBA 3DVLA 1L9XA 1U2QA 4AN1A 4Z3OA 4UM8B 1C3LA 2UYQA 4NCIA 2H4JA 2A1TS 3I6QA 3ZX5A 1JDJA 4BNVA 1E5DA 3L82B 3DZCA 2IS2A 2RK3A 1XZMA 4KRYA 1AMUA 3SWWA 1OYWA 2ORED 3R3UA 2GNAA 1UBNA 4FCWA 4HZUB 4INPA 5FBWB 4ZC8A 4UEWA 1J0CA 1TAUA 4ZWNA 2P1RA 2ZWOA 4JEMA 4QXAA 1T2UA 4B85A 3L05A 1Y5NA 4CXMA 2JCBA 1XTRA 1JLHA 2C77A 3DE4X 4RKQA 3SHFA 1BQEA 3VR4D 4A82A 3RVPA 2G7ZA 4PYQA 4P4SB 2HMWA 3L93A 2Y1EA 4F6RB 3K0AA 1QMGA 1VCOA 1IPEA 1N2XA 1WXXA 2PBRA 3RJ5A 4QJBA 3U3ZA 2C4UA 4KXVA 5AQ1A 3DEJA 1BYUA 3LT4A 4YRMA 3RYCA 3G8CA 2F1IA 4TLBA 4BP1A 3HO8A 2Y67A 4JL5A 4X7PA 1XCMA 2YWDA 2OVBA 1Z5PA 1WG8A 2AOUB 3FFBA 4HLUA 1GOTA 2G06A 2QTFA 3WWOA 3HVJA 1JU3A 3MS2A 4OGLA 2C54A 2RGAA 4UCFA 3F8TA 4BE7B 2EDAA 2G1KA 3K05A 1FNMA 3NTVA 1FVHA 4L74A 3FPHA 1YBFA 1Z7WA 1C9JA 1BKSB 2YV3A 4QG7A 4NPCA 3ICEA 1G3QA 3QOXA 4AJ4A 3GLIE 1RBZA 2G9VA 4QOJA 3URKA 4FONA 4E5NA 5HJ7A 4YP5A 1UIMA 1AKVA 1QKJA 1LNQA 3MNFA 4PFJA 5CFLA 5KC9A 4CODB 1V1RB 4C6TA 2H06A 3HP1A 1DNPA 4C6TB 4DJTA 3KYDB 3NHKA 4P36A 1QF6A 1IHYA 3ANTA 1BCSA 1GQYA 2QTMA 2FUKA 5ICEA 5CEEA 1KGDA 4B35A 4DANA 4Z7OB 3DZBA 1YOVA 1K9VF 1MOSA 4Q7EA 3KALA 4C3VA 2GNOA 3MWFA 3DEAA 4HJRA 5CA0A 4EJFA 5LXTB 1GY8A 5AHOA 3PU6A 3U1VA 2E4AA 2ECPA 4NZOA 2YMMA 1Q20A 4PNPA 1DKNA 3N5KA 3FFWA 5ES4B 2B20A 4R71A 1P3Y1 1FS4A 1QOPB 2GETA 1S3GA 3EQ8A 3SBXA 4A7PA 3HXKA 3C85A 4PHCA 5AP9A 4D99A 1CF4A 3D2LA 2WZDA 5IFKA 5J40A 3DBLA 4O4JF 1X80B 2OD9A 4IWXA 1WW8A 4LW8A 4S12A 1MIOB 4XGQA 4ZU3A 3EUEA 4BDSA 4QGFA 3HXQA 4KREA 1LRLA 1Z2EA 1HFWA 2PK3A 3DZ8A 4MWCA 4IPTA 2GM9A 3OLQA 4KYTA 2M6SA 3U2QA 4BB5A 5LLDA 4HWKA 3WDKA 3DMPA 5CG2A 5GPBA 4N5NA 2RHBA 3ELBA 3LVQE 4WAUA 4UUOA 3KQKA 2B9EA 3N2YA 1RLUA 1ZQ9A 3AUUA 4HNAB 2ZDQA 3VBEA 4MW0A 5FUMA 2IYQA 4D3SA 2JH3A 4MMZB 2P30A 4YUWA 3NM6B 4R3NA 3TVTA 4RTMA 2N47A 4JOQA 5JIBA 3LL7A 1UEXC 4ENVA 3CG0A 4N3GA 3AM5A 4HAUA 2RIRA 1R6UA 2WJHA 4GI3A 5KYKA 1RACA 4J7AA 4G63A 1RYMA 3V1TC 3L0PA 4JVSB 4POAA 2BMFA 2CCKA 2Y05A 4G0MA 4IIGA 3I34X 1RPNA 1R4ZA 4YUVA 1E9BA 3H19A 5IBCA 2RE8A 3P26A 4G41A 3TZLA 2C31A 2NTNA 2YCLA 3G5MA 3G2LA 4YQEA 4S24A 4EHJA 4I2VA 4YMIA 2QVXX 5K6TA 1ID8A 2IU6A 1XAIA 5BWBA 2V0CA 2GM5A 2YV2A 3DMTA 3I05A 5FTLA 1JIXA 1L5FA 3G9UA 3SZMA 3UXHA 3LH5A 4AZWA 1N6LA 4L6CA 3N8HA 4LTDA 4FLMA 1X7WB 3LK6A 2G07A 2WJAA 4JT9A 4KG7A 5D84A 1L1FA 3T3PB 3ZW9A 1CY4A 3W06A 5DM60 4LOKA 1IIBA 4JI4B 4ODIA 4HQOA 4C0SA 5BW8A 3PD1A 5KU7A 3ZWBA 4FTWA 2FWJA 4MS1B 16PKA 2PZEA 2Z08A 1LK0A 1TOAA 2RK6A 3JQ7B 2VF2A 1T3LA 4G0YA 4HQ0A 4Q03A 3L79A 3K0SA 2VQEB 3O9MA 1EB8A 4BCBA 4YRBA 2PFSA 1J70A 4PAOA 4QX6A 3TQHA 4B40A 3K6SA 1E2EA 3ANMA 4LDQA 5KX5F 2NSHA 3TR0A 5KTKA 3MWJA 4P92A 3SMVA 3TE6A 2YYZA 4B2IA 1Q50A 1RWWA 1GZ4A 1DPFA 3MCTA 1MO3A 3HDJA 3OC0A 1T9DA 2HEIA 4B34A 5EHIA 5IEBA 1PE0A 2CC2A 4HY3A 4BTEA 1SRQA 1WUKS 1QRSA 4FDUA 3CZCA 1QIFA 4KVZA 4L15A 3ZWPA 2BV3A 3TF5A 2I2CA 4RZSA 2W58A 1E4EA 1I2AA 5ADVA 5EYPA 4MW4A 1QVVA 1H6CA 4LRWA 4Y9TA 3RARA 5C9ZA 1ZD5A 3BB4A 4K8RB 5E0KB 4Z4FA 2WUGA 5EIXA 2O5EA 2PWBA 5HA5A 1GKKA 5EP3A 2Z04A 3CVWA 1KEPA 2V9PA 3U4HA 3BX1A 4H7KA 3K9HA 1WMDA 4LY0A 1UKAA 1TFUA 2V0NA 1TU0A 2EP8A 2RH8A 3I0MA 1FPMA 2C83A 2P4SA 4MS4A 2PGXA 3ZK7A 4BJ3A 2AXQA 2Z6UA 1O54A 3E18A 3PFKA 4CKEB 1FPQA 4WKOA 3QVWA 1TLTA 1PGNA 3PGKA 3ZJYA 5A6SA 2PUEA 4N3NA 3LO8A 3H9QA 1EFCA 5BNWA 4Q4HA 1ZUNA 2LGJA 1U9IA 1EAMA 4DSZA 3R7WA 1SU8A 4TTPA 1SG6A 4WXHA 4L4UA 3ZCQA 3QF4A 5BQFA 1QDLB 3LECA 4QEKA 4ALJA 2WG0A 2W2TA 3BGSA 3G0BA 4CQMD 4Y7CA 3J7AC 3RIGA 3ZOZA 1GRNA 4B31A 2CJYA 3E8MA 3WHIA 2G0NA 4CKWA 1PLKA 4H27A 1DFIA 4QRHA 2PL9A 3JQAD 5AYVA 4Z54A 2H1WA 4AURA 4U39A 1MZVA 3ER8A 2XF8A 1F1JA 2Z9DA 2BP7B 2O4UX 3V3KA 5CA1A 3BG5A 1WPXA 2VJKA 2Z3WA 4Y9SA 2WKPA 5IBPA 4C01A 1DO8A 2FPRA 4HTAA 2FSHA 2IUTA 4CM6A 1WSDA 2QMUA 2E89A 2JI4A 2ASVA 4YWJA 3MGKA 2WIKA 3A1WA 4E5MA 4YP0A 1JPVA 2I4TA 3R24A 1WL8A 4HDSA 1E59A 1OZ0A 3H2KA 2QMQA 3HCFA 2VPPA 3NKFA 5LC1A 1Z5WA 5FWDA 3SQNA 5FPPA 1XVUA 4BNKA 2ZKLA 3IOMA 4RLQA 3GLFB 2QVBA 4ERNA 3F9CA 1N57A 3NALA 2O3QA 3IP3A 1ZNYA 1D6NA 1FFGA 2VDWB 2Y6VA 4RD4A 2PYDA 4LSZA 2Q27A 3B1XA 4BNDB 1DTSA 4O4IF 4CMEA 5KC8A 3RSHA 4L8WB 1OLSA 3AL2A 4HNUA 5JAQA 5YASA 2JVJA 1FDUA 2ZR9A 5D85A 1W25A 3FTCA 4RKRA 4CKWB 1P2TA 2BI7A 3E61A 5IM4A 1P73A 4XJTA 2RIPA 5B7NA 4XUDA 4DCGA 1TM2A 4JWKA 4A0RA 4EYKA 3W34A 2ZYGA 5ALLA 2O8DB 3I4FA 3SGLA 1I4TD 1QG6A 3CPEA 3UJ9A 3WIUA 4GXTA 3AEKB 3ORRA 4C7XA 4FHFA 2PMBA 4Q4HB 4FUQA 5FAKA 2RGBA 1XEXA 5A7FA 5L3ZA 1LX7A 2XTMA 5LP6B 3TB6A 1JXOA 1FP7A 1U1FA 2JLQA 3RJMA 5EVJA 5A3SA 3GRFA 1Z45A 1O6CA 2G63A 2HO4A 3W4IA 4RJLA 3ESXA 3RLFA 4E22A 5KYNA 4Z9BA 3VU9B 1M33A 2O8FB 1ZXXA 4RENA 2XGJA 1PZFA 2BTQB 1P2BA 4MK4A 1Q7RA 3WNCA 1VP9A 1E5VA 2ZAYA 2HH9A 1HV8A 2Y1DA 2ZBQA 3OT5A 4MIOA 2Q29A 2WYVA 4WY8A 2E6UX 4HAOA 5LA6A 2ZP1A 3U61B 1K8RA 2I3DA 1MO2A 5KYYA 4IF4A 4KP7A 2EF1A 4L6IA 5HF5A 3LJKA 3QG5A 3OSUA 2VK1A 1FDVA 2AG5A 2OR3A 4DT1A 3RVKA 4IZOA 5DW3A 3IERA 4RSGA 2VN8A 3DFMA 1YVEI 4I1OA 1SO8A 3ZGVA 4KOEC 2W2XA 5E3HA 3O94A 2FW6A 5IT5A 3OTWA 4C7KA 4MVYA 3EGXA 1PGPA 3PX3A 5MN5A 1E0KA 4KR9A 1TRHA 4JI3B 4NJMB 4AJIA 1JG7A 1L7QA 3UT5B 1TQ2A 4NG4A 2HSJA 2JCGA 2PH3A 2ZE6A 4B6FA 3ETJA 1UJMA 3PJDA 4FX5A 2IUFA 4M36A 3FZNA 3Q72A 4GDFA 4MV1A 2YX1A 3H3FA 4M7OA 4YRJA 4AKGA 2OXEA 3F49S 1NFQA 4PG4A 4DR3B 3AR4A 1C7RA 2FEOA 2BGMA 2TMKA 2PWAA 3G59A 3A11A 1USIA 1ZI6A 3E0XA 1G9SA 2A5JA 1VE6A 4AF6A 4HCJA 1JHUA 3DKRA 2EERA 2J3JA 2RHHA 2WUFA 1WPGA 4H0FA 5EUBA 3KR1A 2N1BA 2NTYC 2P78A 2WJPA 3IV6A 4DS3A 3BMNA 1JKFA 4GBED 2BMDA 3SYLA 2WC1A 4CM7A 1RP1A 4XD7D 4XLTA 5JJ5A 1N7JA 2H3EA 4HLQB 2ZAGA 5FULA 4B2LA 1N77A 1JH8A 4K7JA 5BYJA 1CUDA 1U94A 4KJZA 1FIUA 2II6A 2QZJA 1GUAA 3NC4A 4U0JA 3T95A 2PAFA 3LLUA 2GZSA 4CV3A 1Y7LA 5M3BA 1GJRA 1WVIA 1U1DA 4ER6A 4YY3B 1JEYA 1M8GA 1T5TA 2OHFA 1GTG1 5F1OA 1G63A 3P20A 3WGHA 1IN1A 1H9BA 3IBFA 5AK0A 3TNLA 4CTJA 5IHXA 1CUBA 2JIDA 3KOYA 3L5KA 3OLWA 1MD9A 4MV0A 1B6GA 1D9XA 3AESA 3EISA 3BMCA 1JFVA 4YYEA 4WNCA 4UCQA 1B6TA 1JE0A 3K5PA 4D43A 3GNTA 3CH7A 4LAFA 2C8JA 3KT8A 3PIDA 2PZMA 3R3VA 2MIIA 4H7IA 2XXBA 3AI7A 4E4RA 3RIMA 2YS7A 3QOYA 5J2TA 4W9NA 2WE8A 1HQDA 1YRQA 5L8VA 3P96A 2VQ6A 5I7SA 3PEUA 2R8RA 4JLNA 1XD2B 4EUFA 2QUAA 2X22A 4ZV7A 4L4RA 3PCTA 2RBGA 1ZIDA 4S35A 3FPSA 3PVZA 3SZUA 1HBJA 2IK8A 1E1RA 1LLQA 4BFWA 4D2IA 1NZFA 1BHQ1 1S4MA 4TS1A 3S2UA 4KHZA 1A8UA 2QX6A 1Z7GA 2Z56A 1V2HE 2QL7A 3H05A 4MKHA 1AXGA 4P3NA 3RTAA 1CY0A 1S01A 2G82A 2H52A 1GR1A 2X1VA 3OZSA 1P3JA 3GHYA 4P5DA 2QUBA 4GM0A 1WUTA 1M54A 5ELMA 1G4HA 4OHWA 2VQDA 2C92A 4BC0A 4ZGWA 4RJ2A 5AM2A 1DGQA 2AH5A 3T0GA 2ZTUA 1CPYA 3EVCA 5C3MA 4R3UC 1TYAE 4HBZA 2OCDA 3GG2A 1T15A 1J2UA 1GNQA 1UINA 3HNPA 4GOND 4XWTA 3VKHA 1Z7EA 1P5ZB 2GYUA 3BICA 3IT3A 4E5KA 3EGVA 3KVNA 1D2EA 2JJQA 2F9LA 1QGAA 1DBQA 4KLAA 1CQPA 2H9YA 1WB4A 2HPHA 2GEFA 2X5NA 3GT4A 4H2DA 4JQSA 4Q00A 5JNWA 2F4VB 3MIIA 3KB1A 2C3UA 4O2BF 4FS3A 1O9HA 1H8HA 1PJAA 3CB2A 3DE3X 3AHJA 3SXPA 3RT7A 2DOKA 2OCXA 3D7NA 3I28A 3IUQA 2AJLI 2DWUA 4PAMA 5AVKA 4YHHB 1E79A 4KO3S 2XWQA 1DJLA 1R1DA 4UMVA 1QG4A 2VIIA 1J2YA 1CE8A 1DRVA 2QRUA 2Z30A 5KNLA 5F9HA 5DYNA 1ML4A 3G0IA 2IFTA 4IEIA 1JHAA 3KCNA 1OPRA 3QU2A 3SLGA 1W29A 3DAYA 1NUHA 1UOOA 3LNCA 1C8KA 3LOQA 3C87A 4DXHA 2GYVA 2ANBA 1UC4B 1NF8A 2WINI 1K0UA 3CRVA 4QC2A 1QIKA 3AERA 1RJ9B 1QZXA 4U6SA 5ITZA 5EQFA 1V95A 1NLUA 3ISTA 2LCQA 1S5PA 3SE7A 4E94A 2BFPA 1OX6A 3M6WA 3TK1A 1SXJB 2ZSJA 2A1IA 5AJYA 2WIAA 1XGKA 2WWIA 3I23A 4YMTA 4RTRA 4L4XA 1IXYA 2RJ3A 3AVOA 5LMUB 2IH4A 5AESA 2F3TA 4G85A 4PONA 1KMQA 2IEYA 4PSAA 3TEJA 1GTL1 3OOJA 2NPFA 3JQ8A 3KYIB 2I22A 5JAUA 3FKJA 3KSDO 1P29A 5BMOA 3ZIDA 3ST7A 1LLCA 1HRDA 1VYUA 2C42A 2IIBA 3D02A 4RWZA 3X1DA 3EBPA 5KWSA 4BRWA 2B4KA 3CIFA 4ZI7A 1IK6A 3AG5A 4NCHA 3A3YA 5U4QA 3IR7A 2C96A 4ECAA 4PO1A 1DQZA 1ZJYA 2H6EA 2QE7A 3R1IA 1KSHA 2ZSBA 5EQDA 2XXAA 3EGWA 1OD6A 1JLLB 1ZMBA 5FWXB 2FSUA 4P93A 1M10A 2CY0A 2GJ4A 2Q5HA 3V7WA 1UKEA 4EF6A 1G21B 3SBOA 1R4MB 2FY8A 4ZI2A 3TRDA 1VJ5A 3PKJA 1YVDA 4LMRA 4BYGA 1Z13A 2OEPA 2EX0A 5FR1A 2ZETA 1UWLA 1PJ4A 3CEPB 3IKVA 4FEEA 4HEA1 3EY4A 4LJYA 5CT5A 4DARA 1ZSNA 3U6BA 1G4AE 5EZYA 4JV5B 2QTCA 5PNTA 1GTRA 1PK7A 5E1DA 5KNDD 3BMQB 3LBYA 5M34A 5IAKA 1CUSA 1SD1A 1GP2A 2YDYA 4CM8A 1FDTA 1E1QA 3B12A 2BE7A 3JYNA 2PMEA 2GD0A 4QTTB 3DS8A 3GCGA 3HACA 4XIIA 1MN6A 3BFVA 1XZPA 3E35A 3QY9A 3GA0A 3OCUA 2VF4X 1CR1A 1BN7A 1OYVA 3A10A 1HTTA 2AI3A 2QT9A 4KL8S 4NOKA 1W96A 4O0LA 4HQ6A 4OHOA 4GM1A 4CMAA 4L0CA 4TLAA 3FSGA 1H0HA 2R87A 3EQ6A 1AHPA 1F7VA 1YZUA 3BGWA 1Q22A 1FLVA 3THRA 4YRIA 1GAJA 2XD9A 2CLEB 3D31A 3QEKA 4Z2YA 3LTEA 2N75A 3AL3A 3EPKA 1TU3A 1ZP6A 1GFIA 1SVNA 5A3QA 1PHPA 4XVCA 2ODEA 4FX2A 3O31A 5EAIA 1FYEA 1IPFA 4OY3A 5FLYA 1HR0B 3DDHA 3KJQA 3KTAA 1JHMA 3U3JA 2HK8A 4W1RA 4MRSA 1UR5A 4Z4CA 1AN9A 1SQ0A 4D8UA 4JKYA 5I01A 1K6IA 4RFLA 2P9BA 2PMDA 1O96A 4UHFA 4YK7A 1QE3A 3QKWA 3RFTA 3WK5A 3ER9A 5C4GB 2IS1A 5LXTF 5IX8A 1WEHA 5HRUA 2FRXA 2K87A 2F67A 2FWIA 2W22A 3KXDA 4RZIA 4GXNA 3BZBA 3ZHUA 4BYMA 3GIDA 1RQGA 5CB0A 3ZGYA 1YR6A 1B93A 1DUSA 2WRZA 3V80A 3O7WA 2H31A 1AS2A 2UYGA 5IVIA 3AI1A 1Z47A 4LTMA 1U9YA 2YJ6A 1I8TA 1RJDA 3IEKA 1CZNA 3IKMB 4HYTA 3ZHZA 2X0EA 2DSTA 5EGSA 1TECE 5JASA 1W88A 2WPDD 5EJAA 1AGYA 5KEIA 2ECFA 3GNSA 2IODA 5A71A 3PNBA 4UBJA 5B6PA 3FJYA 1LFAA 1JECA 4AX8A 2O23A 2JLRA 2V7QD 3ILSA 4CL3A 3O3MB 3I2HA 3MF4A 4W5JA 2OYRA 3DLIA 1KJYA 3NBXX 5K1ZA 3QLEA 3RS8A 3BZUA 2YIMA 4DZTA 1H1DA 3AZOA 3ESCA 5CFRA 3DLHA 1ESZA 2PA0A 1E1MA 2C82A 3R0XA 3W90A 2PTHA 3WDLA 1VLLA 2CLMB 4CU2A 2QBYA 3EPHA 3ZHOA 3R3ZA 2X5KO 2FF5A 2UVPA 1B8UA 1JVBA 1HNNA 1YQGA 2R85A 4DABA 4ISCA 2QG4A 4LVOA 3MOGA 4QDJA 2Z58A 4RGQA 4QPCA 2WD7A 2AN9A 3HGTA 2X5JO 2VK4A 1SCUA 2ARKA 1ZOOA 2OZPA 4NHOA 5A1JA 5JEEA 1FW6A 3D1VA 4KVFA 2AFHB 2FF7A 4LC1A 3KQUA 5TQ0A 2PUFA 5GONA 3SYRA 1DPGA 1IQ0A 2GEVA 1SOMA 1DJNA 2H8GA 3EXAA 3FZQA 3Q3IA 4FBMA 4LGVA 1XMXA 1R4NA 4MGHA 1M1UA 4ZOLA 4YDRA 121PA 2GZRA 1N0HA 3PD7A 4RFSB 3K4PA 2OFWA 5AVWA 1I0ZA 2FW1A 1T2EA 4YRPA 1BTOA 1PFKA 2B7BA 3P9PA 3TEMA 3AXSA 4FILA 2R1VA 1Z7YA 4NC9A 5G0UA 3ZGZA 4WXMA 1WV0A 2ZBVA 3FDJA 4F45A 2QG6A 4CFSA 2OVFA 2DHEA 3MJDA 4NU0A 2QRNA 3P9SA 4H7EA 4LJKA 4UUAA 1IXRC 2ZAIA 1GRQA 3IAHA 4GWKA 4O4HB 5ICCA 4IJUA 3UAVA 2HRZA 3A4NA 4DF3A 1RJWA 1WBJB 1X92A 3HFJA 2KW5A 4IO1A 5BP7A 1ENYA 2W2LD 2VCEA 3OX1A 4C0LA 2IYWA 4IYRA 4F3YA 2QIPA 1I7LA 1SOUA 1WMFA 3LM8A 1NVWQ 1Y3CE 4KW7A 3S1SA 1KH2A 1TZCA 2QU8A 3QA9A 4MUMA 3VVBA 2G70A 2AHRA 4FT2A 4JVMA 2XRZA 2HA7A 1YJ5A 1GFZA 2LTAA 4FCTA 4IX1A 4I1UA 2W6MA 4YN3A 5T3UA 4CKBA 1B43A 4OMDA 3HYLA 3P2OA 1QP7A 3AXTA 2OGTA 2BM1A 2N46A 5EWMB 2Q5LA 3VMFA 1WW2A 3TXAA 4FYMA 4C0KA 3DFZA 3DDSA 4BEVA 2CV2A 2VVTA 4BMDA 2BR3A 2G83A 5JV5A 1F2UA 3A9SA 1E3JA 1WZIA 2O20A 2Y1FA 2Z43A 1PJLA 3IBYA 4BFSA 2WSSA 4ZYUA 2W6QA 4MS3A 1Y0BA 1N2IA 4E2ZA 2OO5A 4KRFA 1DSSG 4JFRA 2Q9UA 1UAYA 1H66A 1L7RA 5E95A 3EFBA 1NC1A 3U09A 4BJ6A 2Q5EA 4HGPA 3IOYA 2EWVA 2PQ6A 1CR6A 3NHJA 4YPFA 5LCXA 3T1VA 4J16C 5FO1A 3RTBA 5JAMA 4I1RA 2JW5A 2XCQA 4L02A 1ORWA 3ANYB 3KKZA 3H75A 3M81A 3N05A 1VE7A 5KSPA 3ZHQA 4BNMA 4Z7JA 1O0SA 2ACEA 5IAOA 1XKQA 1RYNA 3V2GA 1IFXA 2VPTA 1G3UA 1USVA 3DNPA 1DOHA 2QV7A 3I2KA 4XVHA 5JG7A 4UBOA 3DP7A 1Q6YA 3JPYA 1WXWA 1XT6A 3WYAA 3IP5A 2OSVA 2P2DA 2J3DA 5FUYA 4BC1A 3T1HB 2A7XA 4GKJB 1PAUA 1BJRE 2ZLBA 3ROMA 1KMMA 1TJNA 3A6EA 4JDUA 4MVCA 2CJWB 3C98A 4ESHA 1X8JA 1MXFA 2LZ0A 3AB8A 3FYTA 1PYOA 4GWLA 2L69A 5DZSA 1HDIA 4LFCB 1GG5A 1RJ9A 4HDMA 4NS1A 1YZTA 4FKZA 3AR6A 4N0EA 4ZZIA 3J7TA 2GYYA 2OHHA 4XE5A 1GN9A 1MT3A 2VP3A 3RU3A 5AO9A 3KZKA 5M7EA 3RREA 5EIFA 5L3QB 2O59A 1QQTA 2WA2A 1Z0KA 3K1AA 2P67A 4X20A 4X6YA 1HORA 2IEBA 221PA 2AXEA 3F6BX 4RPKA 4B82A 4QECA 3AY6A 3SF0A 4DLXA 3B36A 4DAEA 5E9JA 1EGVB 1OJLA 3C8DA 3KLMX 1YS1X 5CT8A 3LUGA 2VHZA 4I6EA 3QKSB 4I55B 2VP4A 4TGLA 4ZVTA 2QRKA 4ZQEA 1FRQA 1O6GA 4BNIA 1GYPA 2ZS9A 3MOIA 4K6GA 1TU4A 1G5QA 2QTVB 2ZYAA 1KVSA 3OP4A 3OQBA 4JQZA 5KDOA 1QHHA 3CIOA 4WACA 3KJZA 3NTUA 3VC3A 3R0JA 4L85A 1Q44A 3DB1A 1KSFX 1J42A 1QHNA 3G6WA 5LVAA 1H5NA 4XB1A 1CU1A 2DBZA 3DNMA 3G8YA 1KMCA 1VM6A 2H0AA 1ZM3A 1SUBA 2NVOA 4P98A 1TVCA 4C4XA 4M9RA 5F2KA 5H59A 4BX0A 2VLBA 2QY6A 1V96A 5CT6A 5I7WA 5JS1A 1MU0A 2I1VB 3DOOA 3NTOA 1QZTA 5KOIA 1H1LA 1N5OX 3OZDA 3TTVA 5BR7A 1RM5A 1XDWA 2FSGA 1W5BA 3W6OA 1EH5A 3PTLA 3QBVA 1E7SA 3HM2A 2GD6A 5C51B 4V0OA 3QVUA 4L0DA 3R7BA 3HB1A 1GQ2A 1VMIA 1KGSA 2A67A 3GEBA 5HCNA 3OETA 1JR6A 3NMUF 3LT2A 1KJNA 2OGZA 4QICA 3AHGA 5ILQA 3LP8A 4DR1B 1DC7A 4CU5A 2J7KA 4S04A 2ERCA 1EE9A 3SZOA 3BAFA 3NGLA 3N0XA 4HGRA 4K6MA 1SXHA 4JJAA 4DQVA 1A96A 3ROQA 2AFHE 2C5SA 2H07A 5K8VA 2J5QA 1OXVA 1ZOPA 4FU0A 3C3YA 4WFQA 1Y6QA 4GLBA 4TZTA 3DEIA 1TJ5A 3DZFA 3GNLA 3FUCA 3OWXA 4F4HA 5KPDA 4HJXA 5IK2D 1PX2A 5EUMA 3WK9A 2BFNA 5SZJA 1WCWA 3EYAA 1SULA 3L8YA 1ZJ5A 3WL8A 3SBDA 3ILYA 4ALMA 1ZOLA 2HNKA 4H16A 4RCYA 3GDFA 3I9MA 2CMHA 4GM4A 1YHNA 1BGWA 1GPH1 1QC5A 1KQGA 4KUHA 2QN3A 3UH0A 4AQ7A 3TE7A 3AVWA 3O91A 4XB2A 3KZVA 3IBTA 3RNLA 4PBTA 4HDOB 1NT2A 2FMUA 2BTEA 4JOSA 3L9XA 1F7UA 2QX8A 2H2DA 2ZRHA 5IM5A 5EP4A 2TRSB 1NP7A 5KSZA 4JB2A 3W5HA 5ALZA 4E14A 1SZPA 1E96A 2C88A 2J9ZB 1KIMA 3PGMA 2GS9A 2GVZC 2VRCD 2ZRBA 1XD9A 4KWHA 4NARA 4OFZA 1JQDA 4G97A 4GP9A 2V4MA 4A73A 1FK8A 1GV1A 3B8EA 1KERA 2OG1A 5ALVA 1WMBA 3A4VA 3OCYA 5F73A 1SD5A 1LB1B 1Z4LA 2P3QA 3CU5A 1E9EA 4XCQA 1INLA 1AKTA 3NIDB 5G4LA 4PICA 1YWGO 4QODA 4H35A 2R6DA 3H5TA 4RHXA 3CSUA 1LK7A 4FXOA 1DX4A 3W3ZB 3JRXA 4MYHA 4F72A 4LRTB 5KX5B 1ZM4A 3OESA 2OPHA 5GJWC 1H94A 3E6AA 3QIVA 7GPBA 3VH4A 3OX3A 2JLAA 4FBGA 4D7AA 2W2LA 3QUBA 4HX2A 3PZRA 4KO4S 4KIWA 4C14A 4G09A 3MWKA 3X44A 4PX2A 8OHMA 1FDWA 2M1XA 2G0AA 1I7NA 3ZDYB 1NVTA 4MR8B 3WLKX 4C06A 2Y68A 4DCMA 2F62A 2V6JA 2GTIA 2P9FA 3PT5A 3UK6A 2VQSA 1EDEA 4D74A 4ARBA 3ACBA 1R8SA 1H4VB 5EXDA 3Q88A 1U2ZA 2HU8A 3HA2A 5F4BA 2RK4A 4I19A 1KEEB 5FA8A 4IDEA 4FGJA 3RYHA 1N5LA 4FDTA 5AQEA 5KTYA 1MABB 1WOYA 1P7VA 3EWSA 2KM1A 3DBHB 3GFPA 4B76A 3JD0A 5JD4A 2VNJA 4PYKA 2CVHA 3FWZA 2ZT8A 3CUTA 4TV8B 3SJBA 1H22A 4CG3A 4KU4A 4CVNA 2QLJA 1BD3A 1QC5B 4LXUA 2QRZA 3V8RA 3ZI0A 3ZBQA 2ORYA 3EXEB 1H3NA 1PGOA 1RYYA 3FTNA 4YRFA 2DP4E 5GGXA 4CDRA 4BMVA 1JEDA 4FFLA 3O1LA 2QTTA 2PX0A 4UFPA 2H9AA 5AVZA 5DNDA 4OHMA 1DUIA 4I5EA 2OXCA 2JH8A 3NONA 4S05A 2O8CB 3CVUA 3WZLA 4P7GA 4QU0A 1ZUD1 2FLVA 3U7QB 1L5SA 2V3VA 3L0SA 4F46A 3FR8A 1T29A 2ZS8A 1XLTC 1D2MA 2P27A 4OSPA 1ZR2A 1N9KA 2RC5A 4FZRA 3W2FA 2YY6A 1EESA 1FNDA 1EM6A 2W6PA 1MPXA 3PIRA 5KJ1A 1P1CA 3L46A 1ORTA 5I4CA 1V9LA 1R0YA 3TKLA 2ONYA 1OLSB 1MV5A 3IBGA 1XOIA 4M1WA 2EU8A 3ZWMA 5JNLA 5KYWA 3PTAA 3KPWA 5EN4A 4EY4A 3HXPA 2O07A 5JSKA 5TGDA 3B1VA 5DMXA 1JAXA 1XTSA 3ECCA 4RA9A 3THOA 2CJFA 4UD6A 4GD3Q 1RD4A 4C22A 1I7PA 4P82A 1NXTA 4DQ0A 1DAMA 1Y1KE 2Q6VA 2BC9A 3GD5A 2CZGA 3IAUA 1VMKA 4JKIA 4KNVA 4M0KA 4TRJA 2Z1DA 5TQ0B 1KDYA 2WWWA 2WICA 4DBZA 3F6CA 5DYYA 4AYWA 1A9PA 3A1TA 1OV6A 2V7WA 1KZ4A 2AIRA 4E5DA 1ATIA 5B6IA 5JSHA 5C8DA 1E99A 1KC1A 1YR8A 3CB4A 3O4GA 4W63A 4V0QA 1RNLA 1T4CB 4B3IA 2NUAB 1MX1A 2AMVA 4YVFA 2WOJA 2Q2OA 3N0TA 4MW7A 4B4UA 4G86A 1CXZA 5KYUA 2VHWA 3KTFA 3SVZA 3TIIA 3GJTA 4JELA 4DUGA 1KP3A 1YB6A 2FPOA 3IEXA 4IFIA 4R1PA 4EUHA 4DUZB 4NDZA 5B12A 4AU1A 5FI0B 1ZICA 1TK2A 2CLDX 3LPLA 3AZQA 2FWPA 3GCDA 3N7TA 1E9FA 3QFCA 2G0TA 2B61A 3DVAB 1X9HA 3A3PA 3GAMA 3AFOA 1P2FA 2JNWA 4I6GA 5FR2A 2XNDA 3Q8XB 1YT5A 5TLSA 2BJWA 3H3XA 4Q3KA 1UOQA 4H7HA 3A9UA 1DAHA 2YVUA 1YE3A 1FBTA 2QW0X 3KHTA 3M4JA 2VDPB 3I52A 3MILA 4XKJA 2WWYA 5K51A 1N6NA 3U3OA 3WIBA 1NC3A 3PPWA 4JBIA 4EFKA 3SEFA 4ZT7A 2VJAA 1XVIA 3I64A 3EXHC 2A30A 1TTHA 3JWJA 2TYSB 1C3OA 4YJHB 1D4AA 2FSVA 1MX9A 1SK9A 2WLTA 4ROTA 3GUCA 4BJHB 3W5AA 1EGMB 4CEIA 3Q7RA 4RNDB 2IYAA 3C6QA 2AN5A 4ENUA 1JDNA 1Z2CA 2OHOA 1M2VB 5ESRA 3KT0A 1E7QA 2GESA 2DFNA 3DPIA 4PWYA 5G0WA 5IW8A 3QF7A 3OKFA 1GSAA 1PZMA 2EFYA 3W5VA 5E6SA 5DWDA 2YYAA 1GKYA 2VFAA 3F5SA 1D0VA 3NC0C 4L75A 2XWBF 1R10A 3L49A 4H6WA 1MENA 4J2OA 1ZSVA 2HLNA 4L73A 1BVUA 2QLLA 4HS9A 4EMSA 1XA3A 1M7GA 3TI7A 1L4EA 2R11A 4LDRA 5CIWA 5C8ZA 1BC5A 2NLOA 5K0BA 4LWQA 3UEOA 5FYDA 2HREA 3P9CA 4QU8A 5K7SA 5FPHA 4H3HB 5FOWA 3TR6A 2PUTA 1B41A 4A23A 1Y33E 4KSBA 2QROA 1NNEA 3F7TA 1Y6GA 1X13A 1EZ4A 1SKYB 3VR0A 3BSFA 1C0PA 3CRW1 2ROQA 4EJSA 1PVDA 3RRJA 2HCRA 3KB8A 3E5NA 3N28A 1FNCA 3G2IA 3I61A 4RDHA 3MT8A 2W6ZA 3QK7A 2P6NA 3PHLA 3AR7A 2Q8NA 1FSPA 4OGWA 3PV0A 2JGLA 3F4LA 1X7WA 2VJNA 2PMCA 1P4GA 1UBGA 3TDMA 2UXBB 2Z5VA 3OD5A 1LD3A 1JE1A 2PX5A 3FIUA 2P6PA