3X1JA

Crystal structure of phosphopantetheine adenylyltransferase (ppat/coad) with accoa from pseudomonas aeruginosa
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
158
structure length
158
Chain Sequence
MNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLFSLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
publication title Transition of phosphopantetheine adenylyltransferase from catalytic to allosteric state is characterized by ternary complex formation in Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa 2192
total genus 53
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2014-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3x1jA00
1TYBE 2E18A 3FY4A 3CLUD 4MW6A 1V8FA 3L92A 2JANA 1R6XA 1KQNA 1T6YA 4JXXA 4TS1A 1WZ2A 4RUKA 1MRZA 1M8GA 2GOYA 3DPIA 1J1UA 4MWBA 1GTSA 4R0NA 1I6MA 1EE1A 1I6LA 1EFVB 3IVCA 2QJTA 2YWBA 3HFJA 3CVUA 1I2DA 1N77A 3GLVA 3CLTC 1FYDA 3QTTA 3UK2A 1LI7A 1F9AA 4X0EA 3A05A 4G6ZA 2PZBA 2AKEA 2PXHA 3AG5A 1JIJA 1IVSA 3QTBA 1ZUNA 2EL7A 1NZJA 1OWOA 2X1LA 4CQNA 1JZSA 3SEZA 3L93A 4HPWA 2CV1A 4NZPA 3MXTA 3IVXA 1JILA 5DASA 3PNYA 4ZCPA 4XFDA 2PFSA 4ZT6A 1KH1A 1OWNA 4K03A 3FH0A 1XNGA 1PFWA 4I6EA 1JZQA 1VBKA 3E27A 4ZT2A 2R5WA 3IMGA 4Q93A 2WB2A 1KAQA 2DXIA 1KAMA 3COYA 2O5RA 2A84A 4PBSA 1R6UA 1WXEA 1VLHA 1TYDE 3LCJA 4MUFA 4MVXA 4PBTA 4U8HA 4MVCA 1Q15A 3KT6A 3DLAA 3RK1A 2CYAA 5IJXA 2G36A 1IHOA 3FNRA 1O6BA 2J07A 1QRSA 3IODA 1F7VA 3IOEA 1CT9A 4E1AA 4ZT3A 5FNZA 4EF6A 3IUBA 2A88A 1MAUA 2J5BA 1WXHA 2ZUEA 1OWLA 3IMEA 4ZT4A 1QQTA 2H29A 3GUZA 1G8FA 1QNFA 3Q12A 1WOYA 3TZLA 2NZ2A 1PG0A 4RPIA 2D54A 1JEDA 3X1MA 3DV2A 2QJOA 1EUQA 4R2MA 2J08A 5LM3A 1LI5A 1J21A 1V47A 4NX2A 4ARIA 4MUNA 4MVYA 1KQPA 2CV0A 1I6KA 1TFUA 3AFHA 4PY2A 4I6JA 1XNJA 3FHJA 3ZXSA 3CR8A 1O94D 4CDNA 4KKVA 5DK4A 4EG8A 4JXZA 4Q16A 2A1TS 2HZ7A 4EGAA 3AKZA 2DUMA 4ZT7A 1KP3A 3IUEA 3PXUA 4MWCA 1NUQA 1N1DA 2Z08A 3HV0A 2DERA 4ZCSA 2IJGX 4DDKA 2WSIA 5LFAA 1N2IA 1F4LA 3FI0A 1N2BA 3SP1A 4MQ6A 1WXGA 1VBMA 4AQ7A 1TQ8A 4UZFA 2RE8A 3JXEA 2TS1A 1O95D 3CVVA 1UFVA 3IVGA 1GTRA 1WKBA 3FETA 1GN8A 3UC5A 2A7XA 2HMAA 1KP2A 5DB4A 5J58A 3TQOA 4MW1A 2DPLA 3P0IA 1O5TA 4YBRA 1JMVA 1N3LA 2QJFA 3VGJA 3VRHA 2VTBA 4JYZA 2QTRA 3CLSD 4YP5A 5JBNA 1OWPA 3D6VA 2WQ6A 1ULHA 2JAXA 1J70A 1K92A 4MVWA 5TGTA 1GZUA 4QREA 1VBNA 2PG3A 3A2KA 1YUMA 3ZJVA 1MOPA 1U3DA 3F3MA 3KT3A 2BTEA 3N8HA 2IP1A 4JZYA 3RFFA 5IHXA 3FOCA 1K97A 2GKSA 5K0TA 1EFVA 1G8HA 1PFYA 4K0RA 4MAFA 5HUJA 1O0BA 1WQ4A 4DNXA 1S4MA 2NSYA 1U0BB 4EG7A 1NI5A 3FG9A 3H97A 4QRDA 4R2LA 3ZXIA 1N78A 3SEQA 3FDXA 2CYBA 1P7PA 4XFJA 4MUKA 2E0IA 1COZA 1X8XA 1PFVA 2YWCA 3I05A 1YIDA 1MB9A 5KWVA 3ND5A 5DEOA 3FWKA 3S3TA 1NUUA 4HJXA 1O97D 3CLRD 4QBTA 1QTQA 1WQ3A 4EG4A 5HG0A 5K0SA 1NURA 3DO8A 4NDAA 1MC1A 4NAUA 4F4HA 1N2HA 3UY4A 1ILEA 3NBKA 1N2JA 3ZGZA 1IRXA 4S1OA 2J09A 2BYTA 1SURA 4MUHA 3CVXA 3RBAA 3G59A 4KPUB 4DJAA 3BL5A 3M5WA 3ND7A 2A86A 3COWA 5FO1A 5F23A 2DEUA 5KHAA 1YULA 1J1ZA 2RD2A 3K32A 4EFKA 1TYCA 1IFXA 3H9CA 1XNHA 4KPUA 1N75A 1EXDA 1G8GA 4KR7A 3CLTD 5TEVA 2DLCX 3C8ZA 2PZAA 2JA2A 1QJCA 5TS2A 2ZP1A 1JGTA 1WJGA 1JIIA 2CSXA 2E89A 2V0CA 3N2YA 1N2EA 3CLUC 2V0GA 4ZCRA 1GPMA 4ARCA 3P52A 3HL4A 4MWEA 3RJZA 2A4MA 2Z09A 3OP1A 1KQOA 4J76A 1IQRA 1MJHA 2PIDA 3Q4GA 3FIUA 1F7UA 4DE5A 5HUHA 3AIIA 4MW5A 3HMQA 3IOCA 4EG3A 1M1ZA 1WXIA 4MLPA 4MW0A 1D2RA 1PG2A 4L2IB 2YY5A 3CVYA 1LW7A 3TS1A 1T9GS 3COVA 3KT8A 4U63A 5BNZA 3X1KA 3Q10A 1JHDA 4A91A 4NAHA 2A1UB 1JECA 2DETA 4ZT5A 5TEWA 3INNA 1N2GA 4DLPA 1GAXA 3IMCA 1EFPB 2QTNA 4DDHA 1N2OA 1EJ2A 1IQ0A 1GLNA 1QU3A 1H1TA 3IDFA 1JEEA 3RHSA 1EUYA 3IOBA 4EG1A 3IH5A 3MUEA 4JFAA 3KFLA 1EFPA 2OV4A 1ZJWA 2PZ8A 3GMIA 3P0JA 1OWMA 2QUJA 1H3NA 1DNPA 4PBRA 4DDMA 3AL0C 1WXFA 4MULA 3OTWA 1O96B 1JIKA 1QRTA 5J59A 3X1JA 2XRYA 1KH3A 1FFYA 3LE8A 2CYCA 4MUGA 1VL2A 1O96A 4G5FA 4OUDB 1Q11A 3P0HA 4YMIA 3HZRA 4P2BA 2X0KA 1MB2A 3PRHA 3HGMA 1IH8A 3G5AA 3A04A 4GRIA 3SYTA 1Q19A 4MW2A 5EKDA 2QUIA 2CUZA 2H2AA 3ND6A 3H99A 4OUDA 1G59A 1QRUA 2X3FA 4HK4A 4NATA 1Q77A 2C5SA 1KH2A 1Y42X 1M8KA 2J4DA 2CV2A 5FO0A 3ELBA 2DR2A 1K4MA 2QTMA 4I6GA 3N05A 4J75A 1OD6A 4ZCQA 1TEZA 4YP7A 5LLTA 3UOWA 1T6ZA 2WQ7A 4AS1A 1J20A 4HJRA 1KKUA 2VXOA 2XRZA 4EG5A 4KR6A 1M8FA 4WNYA 1O94C 1BS2A 2QUHA 1IQUA 2QUKA 2OQ2A 3G6KA 2O8VA 5H16A 1H3EA 2B7LA 4MW9A 3TZEA 1NUSA 1U3CA 3VU8A 4UZEA 2A1TR 2GM3A 3SDBA 1U7XA 1YIAA 3UMVA 1H3FA 3ZIUA 3H05A 4MUIA 1MAWA 1T9GR 3COZA 3ISJA 3TNJA 2CFOA 1KORA 2YXNA 1HYBA 4ND6A 4ZCTA 3H9BA 1O95C 3KT0A 1M83A 2AZXA 4G5YA 1ZH0A 2EJCA 1NYLA 3MMXA 4F3RA 3D6UA 4OJMX 4FZJA 1OBCA 2X1MA 2IELA 1R6TA 1J09A 4MW4A 3CLSC 1KR2A 2D13A 2AG6A 3RK0A 2CT8A 1NP7A 4U7JA 3MLBA 1WY5A 3MLAA 2I1LA 1M8PA 4CT0A 1U7DA 1QU2A 1OBHA 4WSOA 4MUEA 1B6TA 1PFUA 3PNBA 4GU5A 3ZJTA 3AG6A 1TYAE 3TQIA 1M8JA 3NV7A 4EG6A 3CVWA 1YUNA 1K4KA 1YI8A 4KR9A 1NUPA 1O0CA 5KCMA 2Z3VA 4XSVA 2HGZA 4L2IA 1X6VA 2E21A 3SZ3A 1T6XA 1MBZA 3LOQA 4YP6A 2D5BA 4MW7A 4ND7A 3N9IA 3ZJUA 1A8HA 3ILVA 2A1UA 4H3SA 1NUTA 1ZH6A 3A4IA 3ZUGA 3PNVA 5H7XA 4MWDA 4MUJA 5AHWA 1NSYA 2ZUFA 1RQGA 4BWVA 1O97C 3K9WA 3CLRC 3QE4A 1XJQA 5J5AA 3SZGA 3CA8A 4CDMA 2VTBB 3U1VA 3NBAA
chains in the Genus database with same CATH superfamily
4ITRC 1C8VB 1PR3A 2A4KA 4JBYA 4LDZA 2FEPA 3EBOA 3MN1A 1A2QA 1VZ3A 3NORA 4RTOA 2ZCUA 4P34A 5SY6A 4JU8A 5ALHA 5EYPA 5K4GA 2P1DA 2P1RA 3LWNA 1WZ2A 4RLFA 3WNDA 3Q5DA 1B76A 2ET6A 2Q4OA 3PNOA 4RH3A 1DBPA 3HFRA 1WY7A 4PU0A 4R68A 4JI1B 4CEJB 3T5PA 1XK7A 3PCRB 4EJ0A 3AEQA 1MXFA 1SC3A 3AHCA 2J3KA 3HM9A 1I2DA 4LC1A 3ZE2B 4YUZA 1A1SA 2A9RA 2QX8A 3A10A 4KRFA 3UFBA 5JZOA 3I5UA 4K9LA 1Y98A 5CGQB 4C0BA 1R66A 1Z6ZA 2W2LD 2WMDA 1PYGA 3AW8A 1GM5A 3ZTWA 5A4AA 1SUPA 2DBVO 2FEXA 8MHTA 4D46A 5ALVA 1KZ1A 2XX3A 4RACA 5SYMA 5K0JA 4QYIA 4DXDA 2I91A 4CODB 3R09A 4JCOA 4C6RA 3LFHA 2QQEA 4JC5A 1X74A 2WSLA 3BCHA 4R2HA 3QLVA 4YASA 5JMOA 1A72A 3LTNC 5ABPA 4JSYA 5F12A 2YFHA 2ALJA 5EXSA 4YMVA 1IIRA 4LYJA 3T41A 3U3MA 3QPUA 3MTGA 3NVAA 3G82C 4TL6A 2P4QA 2IZ0A 1J9GA 1AKTA 1QGOA 3R5SA 7ADHA 3OWOA 2CCGA 2QZJA 2CV1A 1JE0A 4BJ1A 3RYFB 3SXPA 3QG1A 4TLCA 1OVMA 2C2OA 4ZT6A 4BO0A 4S0ZA 1KWGA 5ICMA 4DUZB 3WGUA 4IH4A 3MHPA 1ZGGA 4LHSA 2E48A 2HTFA 2QX4A 3DE5X 2XNHA 3TKLA 1YR9A 1NZFA 3H5VA 4ZC8A 1IHDA 1X39A 2GPSA 3X1DA 2RKOA 2WB2A 1OI3A 4Y98A 4F8YA 1IAVA 1TM4E 2WC1A 2Y9PB 3EQ2A 3KV3O 3T9BA 4CLOA 2GBGA 1ISGA 2WJGA 1L1RA 1JB9A 3R3SA 3HUTA 4WVLA 4DSOA 4U8HA 3DJFA 2O7RA 3QX7A 2GNAA 4UEKA 4JKOA 3KQWA 5KQSA 2OV1A 2Y2VA 4OP2A 3I6MA 1ENYA 2CLEB 4D2IA 3FLAA 2Y67A 2HU8A 2HAEA 3MCZA 3N2KA 2C9CA 1XE3A 3ANYB 4F92B 2I65A 2FG7C 1TRHA 2IYLD 3DEJA 3L8ZA 3NIFB 3YASA 5E4JA 1QIJA 1DIRA 3KDSE 2Q62A 4ZT3A 2L0XA 5ER9A 1DARA 4G0YA 1KMCA 1QWOA 2QRNA 2WIAA 4IXNA 5TX7A 4QODA 4ECAA 1NQAO 4NNJA 1PTKA 2AYXA 2C2MA 1T2NA 4AW9A 1IEVA 1JR3A 5DT9A 3VYSB 3LY7A 4KAJA 3HDTA 4JI3B 4EKYA 3GLKA 2NQTA 3HY6A 1QNFA 2ZOSA 4FOOA 4ILEA 2DFLA 2MHCA 1CRQA 2C1XA 4EY6A 4KODA 1PG0A 4I50F 1Z5PA 2HXYA 5DWDA 3OIFA 2IIVA 3LZCA 2XCQA 3T34A 3LAWA 1TJPB 1LQ2A 1Z4LA 5CVTA 2XKJE 2KLHA 2HA5A 3KNZA 4H7FA 4A8HA 4LQCA 1K8ZB 1J21A 2QMHA 5F3WB 3HU5A 3FJ1A 4MPDA 1GPKA 1P7ZA 2ZSUA 5LZ9A 5I4CA 1BRTA 2QTHA 1SOAA 4PZUA 2VKQA 3QHQA 4FQ8A 4UXHA 1NY5A 2HUNA 4ZTUB 2JIMA 3HKBA 1OHHA 3CJQA 5FTMA 2C42A 3WV4A 2WTBA 5TSDA 3MD0A 3RIEA 4JXZA 1TIKA 2UUPA 2V8OA 1UT8A 1OKKD 4OBXA 4FE4A 3FW1A 4FT2A 2MR6A 4ZT7A 4EH1A 3DCNA 3BKXA 4UNQA 3IP7A 4Z4FA 4EFMA 3FCEA 2HA6A 4D9BA 3IEVA 5BW8A 3ICEA 1RJ9B 5F5XA 5H3LA 4ZCSA 5K0FA 1NRJB 2DQ4A 3L5OA 4BNIA 4P2GA 3E58A 3KAKA 2GN1A 2Y76A 2EBUA 3DW3X 3HXTA 2WFMA 3RUIA 2FMFA 3PXCX 8AT1A 4JI0B 2NP7A 2B8EA 4XARA 2B5OA 3TK1A 4KVFA 4MV1A 4A73A 4EWLA 2RE8A 1SFRA 1XD2B 2OLJA 2V1UA 1A8QA 1UFVA 2Z58A 1F2DA 2XE6A 3I1IA 3IP1A 3NC4A 5JS2A 1HZZA 1G4UR 2WM2A 2QZPA 4M0FA 1P39A 3UJ6A 5GVSA 3FMOB 3PIRA 1SVWA 6CHYA 1X19A 4AMUA 4L57A 1KDOA 4X9XA 1PJRA 1ZJZA 1M5RA 1NW3A 1RZRA 5JJIA 4YP5A 4AI6A 2RAUA 5C8YA 4G0XA 4IDNA 1G9TA 4B4OA 2RGBA 3OO1A 4BKOA 4F4FA 3OBIA 2DPHA 4NR0A 4QDUA 4TZTA 4KK4A 3V6LA 3KXDA 4BGEA 4NG4A 1AM4D 3RLIA 1BZYA 1RC8A 3W9BA 4FX2A 5L9AA 1HKHA 4I1OA 3EC2A 3RFFA 5IDWA 2AJLI 1T6BY 2PTHA 2ZVJA 4JLAA 4Q00A 4QG7A 4C0XA 1MAAA 2ZXFA 5FF9A 1R4NA 3KJNA 4KXVA 4ZI5A 1N2CA 2XVZA 3NQ41 3W79A 1T2DA 2ZR9A 5E0KB 4DGQA 1C4KA 2FWMX 4UBIA 1KBZA 4E5PA 3V4SA 2C5HA 4MA0A 3RGGA 4W5WA 2EFHB 3JPYA 3ZD6A 5EWLB 1AHIA 4J6EA 1J2JA 3RBVA 1KY2A 1TJ4A 3A1CA 3BS4A 3KAPA 3SJCA 3W05A 3AHGA 1W94A 1AGXA 3NIBA 2FW0A 1PZFA 1A2BA 3T1TA 4WJLA 2BMDA 4PYNA 1WTAA 4QU5A 4BX8A 2NU9B 5ALRA 5LCXA 4LBWA 3U44B 4GICA 3R7LA 1JHXA 1Y6RA 4Q12A 521PA 3WHIA 4RSHA 4Q02A 1KBOA 1LZKA 3ZGOA 2DQSA 1RPTA 2YBDA 4Y7CA 3VYTB 2R96A 3R8XA 3QELB 4CFYA 5KIAA 1PLJA 2B6HA 2GYYA 1PT9A 3GUUA 4NAVA 3I2JA 3KB8A 4OATA 4BY9E 1Z35A 2OD7A 4HQLA 2AI2A 2D1SA 4OGWA 5DVZA 3SBEA 4ROTA 1JFFA 4MICA 1GIAA 1JS1X 1GQYA 5EZ6B 1JFTA 3Q3VA 5CCDA 3A0RB 3TNFA 2A5DA 4YALA 4D6XA 2JLUA 4YI3A 1XXHE 1EI9A 2IPAB 4IIFA 3JYNA 4WE3A 4U7DA 3KSRA 4UASA 2EWWA 5KEIA 1CZOA 4YAUA 1RFLA 2ZSAA 1C3OB 3KTOA 3P2YA 3CQ9A 3UPUA 4G2NA 2Z43A 1J1ZA 2P9TA 3K32A 3GFPA 2Y1XA 4UUBA 1KFEB 4WH0A 1TZJA 1XZHA 5LIRA 2OR3A 4B3SB 1Y7TA 4RCZA 3TW8B 4BBPA 1Z08A 2VHYA 1Z34A 1DBSA 3BB3A 2IDZA 4RDCA 3RFCA 4AP6A 1GFZA 3RYCB 1N2SA 3MJVA 4X8OA 3CEPB 1ISPA 1JGTA 1WJGA 4BO3A 4UW9A 3GDFA 2C0PA 4KNWA 1W0KD 2JEOA 1KVQA 2FK7A 2OCBA 4LJ8A 1IXSB 1DIHA 1QYWA 2WM9B 3BD9A 3Q2KA 5EZYF 4ARZA 1NJ1A 4LNHA 3LXXA 5D6OA 1PFGA 1OASA 1V1MB 2GCOA 2ZRQA 1SQSA 1C0PA 4JLJA 4RK4A 3OD5A 4IHAA 4DSTA 1E66A 3EWAA 4EVIA 2CB0A 5C81A 2V5AA 4P8RA 3CH6A 1DEOA 5BV0A 4BWYA 5LA6A 4O59O 3WRVA 4WHMA 3AONB 3T7AA 3CUTA 4J76A 4EPWA 4EUHA 1IQRA 1RIIA 4GQIA 2GFHA 4YJGB 3EA4A 2GTPA 4GUAA 3QPVA 2QVLA 2WF6A 3IAFA 1EZ4A 1CR1A 4IIEA 3OHPA 3EFEA 2QLBA 3WB0A 1NVWQ 3S81A 2B36A 2QBYB 1PGJA 1U8XX 1OPRA 2H2FA 1EZ1A 4PCVA 3PWZA 3ZVKA 2ERXA 3R3WA 3GP8A 1PL8A 3BL8A 1LSUA 3DEYX 4YCDA 1MFPA 3ZE6A 4XD7A 1T9GS 3LX8A 5L3ZA 1NATA 2B69A 4W8OA 4X92A 2FWBA 3G0OA 3G8BA 3R4CA 4JVOA 1OJ7A 2QV0A 4YI5A 3T3GA 3E9CA 3M4NA 4IGIA 4UARA 5HF6A 2QUBA 1P6UA 3UHFA 3OY7A 1M6HA 7MHTA 2Z83A 3E48A 3MZ0A 3HGTA 1EFPB 1TKBA 1UWVA 4GOND 4L8WB 5CYOA 1J8DA 4G9EA 3F9RA 3UUWA 1W5EA 3VPHA 4ZYVA 3DBHB 3PITA 2IS1A 3DCIA 3GDWA 3I9LA 2VP6A 3NG1A 7YASA 5IT9A 2O59A 3JY6A 4H16A 3AI3A 4B4VA 2QQ0A 4PRZA 5D7NA 1F8FA 3NM6B 1QWSA 2R7AA 3W06A 1AG9A 3JQBC 4KZKA 1ZGZA 3IQHX 2GF0A 4US2R 1XQWA 5KHLB 1E3QA 5CFNA 4O2RA 4TS3A 1WZNA 4PZAA 4CMCA 2R6HA 2ZBUA 4H35A 5BSUA 5BR7A 4G4SO 2JG3A 1RXIA 2C8VA 3FGZA 4JUDX 4ZQGA 2AIRA 1WB5A 1UBNA 2HSWA 1SG9A 2CNNA 4ZAFA 1O96A 1S2OA 3H17A 1KU6A 2WABA 2C83A 1R10A 2I4LA 3HBMA 2EQBA 2R85A 3SIXA 3OFJA 3GLTA 1EVYA 5JFGA 3K1JA 3PTAA 1C80A 2X0KA 1QVVA 3BWDD 5JQGB 2ZBPA 2BUAA 5J4VA 1XVLA 4KO3S 3MB5A 2F3QA 1ZVJA 4OI4A 1BVYF 1K4YA 2B61A 2FOXA 1YZLA 4J3FA 4Q19A 4RL4A 3TAXA 1JHAA 3GAMA 4X8LA 3GVIA 3GMTA 1V1JA 2P6NA 4EL5A 1ZMOA 3LFTA 2F43B 5L53A 2L69A 1M2OB 5LMZA 1QPBA 4OHKA 5I7RA 2ZUSA 3VDQA 4JEMA 4UPDA 1KAHA 1X86B 1Z6TA 2J4DA 4KX5A 5JCOA 4N6NA 4QZVA 3OLCX 2UYHA 2ZBGA 3L8MA 3RROA 2GJ8A 3WYEA 4W9MC 4ZU1X 3NYQA 5I4KA 4LY6A 3N05A 3H5RA 1TEZA 3HR4A 4TOIA 1FW6A 4MHTA 2QR3A 3GBPA 1T13A 2E87A 3PGJA 4RD6A 4B3TB 1TW2A 5J40A 4AS2A 4A0GA 1TF7A 1B43A 1DFHA 5ADWA 1W25A 2R6R1 1V37A 1O94C 4KQIA 3UJCA 1IIBA 4MQEB 4JJ8A 2WVGA 2V6BA 1KOLA 4IOLA 4CQLB 1CIJA 3HACA 7REQA 3M4YA 4ZQFA 4ZOLB 1JHVA 4MOWA 3HHPA 1OBFO 4QELA 5FNVA 4BNLA 4BATA 1QIGA 2CGEA 4YJHB 5FTNA 3KKNA 1UMCB 2ZREA 1II0A 3GK3A 4D6PA 2GM3A 3A31A 4HYTA 1UZMA 4GW3A 4JT8A 1OIVA 2PD3A 4QDKA 4XOIA 4EL0A 1B4DA 3UIEA 3ZV6A 2IHJA 2SECE 2I54A 5LZ7A 4ZO6A 3G3EA 3TNJA 3HDGA 1G20E 1RLIA 1HYBA 4QWWA 1R8YA 1E77A 2HBRA 3SDZA 2QA5A 1FU4A 4LRYA 3TIFA 1M83A 1TW3A 4LGYA 1VJ1A 4ZA2A 1HF3A 2XEDA 1G5FA 3L3BA 4BMVA 1BDIA 2ZM5A 1JXAA 1Q6YA 1OLOA 1ECBA 3OA0A 2OO3A 4FIZA 4Q3DA 1HL7A 2VN8A 1OBCA 4H17A 1N6RA 5JNSA 3MGGA 3R0IA 5FX2A 2PGJA 3UB3A 4PLWA 2Q49A 2V7XA 2DF8A 2SBTA 4G5XA 2GWRA 3ON5A 4C0LA 2BKUA 4CG0A 3K6SB 2RI0A 4DRZA 3ABQB 3WRYA 3QPDA 4P08A 1W4BA 2IYUA 3LU1A 3GRVA 3B13B 2QMOA 1WQ1R 3DBLB 4HRVA 3G7SA 3JAMA 1ZD1A 3IFSA 4L6AA 1T8YA 3K70C 2QVXX 4OPMA 4UMFA 3H11A 3PNBA 1C2YA 4MNTA 2IZ1A 1JU9A 5GOZA 4DFDA 1G7CA 1K8RA 5FYQA 5CEFA 3V1LA 5TQVA 4MV0A 1ACMA 1IOWA 4BP8A 3VH4A 1EAMA 2AVNA 1VGRA 2P2ZA 3PHIA 4AKSA 3TDMA 3L8FA 4LYAA 1FBTA 2OCPA 3EIQA 3PC8A 1AGRA 1K0FA 4DR6B 3MGCA 2GVZC 1E5DA 5DBOA 3W3AD 3MS2A 4MRRA 2DYKA 2R7KA 3U4IA 4R2XA 3HJNA 5AFSA 3GDGA 1BWSA 1UIRA 3W0LB 1PAUA 1YB1A 5IC4A 3RRFA 1P9RA 4F5ZA 4FDTA 2GPBA 3RG2A 5I47A 3B3JA 5JV5A 4INOA 3EA0A 3QX8A 3VR3A 4IDGA 2V7QD 5I9MA 2ZIXB 1E32A 3CLRC 3QTLA 5DRTA 3WGHA 2J6IA 2CD9A 1BD3A 1V71A 4EY5A 3BX1A 4R71A 4DBLE 1GYRA 1IB6A 3BJIC 1G2PA 1CUSA 3FUTA 3GELA 4K05A 4O5OA 4NI5A 1KDVA 5DSZA 2DOKA 5I7SA 1UBKS 2VYFA 3DD5A 3JPWA 2ASVA 4A2PA 3L92A 1I2AA 3INYA 4BAUA 4X5OA 1Z7WA 2GT1A 1F12A 3TD9A 4UPEA 3FZEA 1BMDA 1PWZA 3SFTA 1ZD4A 3CNOA 3SZRA 1UPXA 3L02A 2C5BA 3PFKA 3N75A 2QOEA 3SE0A 1CUZA 4TKMA 4I66A 3A4YA 2X0EA 3LD9A 1Q17A 3T5GA 1W88B 4QTUB 3LF2A 4RKWA 5K9ZA 4MDFA 4JHLA 2VF2A 1UDAA 1Y3CE 4OMFG 1JP7A 1I5RA 1EFRA 3IPAA 1HFEL 4DLWA 3KHUA 1XZGA 3DP7A 1TMKA 1Z7BA 1KJ9A 3OQJA 1ZW6A 2AR7A 2OBYA 3JRXA 4INZA 4LVCA 4B3MB 1JDUA 5HQ3A 4M7RA 1H5UA 3SC2B 5F2NA 2BI4A 3N87A 4J6FA 2JVJA 3MMZA 4J1NA 3ZR4B 2I4MA 2WZCA 4B3CA 2ACVA 2QAGC 1VJCA 2VDNB 1M34E 1ULBA 3OPYI 1XLUA 2Q3DA 4KI7A 3PJRA 1JAYA 4Q7KA 4ZOCA 5E9WA 2V4MA 2C7BA 2G1AA 3VPCA 5SV2A 5CB4F 1GNTA 2QGFA 1V9LA 2NM0A 2Q0QA 3EGXA 4QFMA 5B3KA 1JKFA 4BVHA 2PFSA 1MC5A 3R23A 4O4IF 4EJSA 5A9RA 3LUFA 4OGKA 1OCEA 4X8MA 3A6FA 1MD9A 2PUDA 3AZPA 3VZQA 1EYZA 2P77A 3GFSA 4OLFA 2F55A 1NQUA 2R5WA 4DJ5X 3NO4A 1NVXQ 2QQFA 4C43A 4JX9A 4M0DA 3NJRA 2UZ1A 3NHMA 4WLVA 3QVKA 4M98A 1SU8A 4PFSA 1UP7A 3FVTA 4JB8A 2BR5A 5DEIA 1P1BA 4BV9A 2OSVA 4Q37A 4IP0A 2OORC 1GD1O 1L4HA 3FR8A 1BWPA 1Q44A 4MVCA 1PNTA 1Q15A 3UHOA 3VO2A 2NU6A 3N5KA 4G0ZA 5EC8A 2IY8A 2IYSA 1SQ5A 4D79A 4CZ2A 4F4IA 4WBNF 2P65A 4RK6A 4G4JA 4TMVA 2DUJA 3AR2A 5AI8A 3WGYA 2W6MA 821PA 3GAZA 4HGYA 2YC2C 3OCXA 2YL2A 3HEBA 4LYFA 2UYGA 4MLZA 4N3GA 4O4JB 3TDNA 5FJJA 2XQFA 4W5OA 1YQDA 5F3RA 3RGWS 2TMYA 5JQWA 3D4NA 4KDEA 1NF3A 3I32A 3IQGX 4E1AA 2QXUA 5FNZA 5CX1A 3IRVA 1P5FA 3STXA 4CQMA 5IJ9B 2B9EA 2Z1DA 2JH3A 2O3QA 1E1NA 2EFYA 2QR2A 5BQ3A 4H7DA 1YRYE 2H5JA 5IABA 1UZAA 3QXCA 2F4VB 1A2OA 2HNBA 2QLTA 4A6XA 4L4YA 1ZJ5A 3G2IA 3MQ4A 1GRRA 1L5LA 2GBFA 1URPA 4YRZA 3PGVA 2GI4A 3GBVA 3KZVA 2IOQA 1T5DX 2GBPA 2YN2A 2JI6A 3R4VA 3DJYA 4FYMA 4HBGA 4ZU6X 8ADHA 3BWEA 1DKNA 4ARIA 4DAEA 4O4HB 3RHFA 4G5OA 5JWOA 1LEHA 3TBFA 1YVRA 3ZDAA 1T5LA 3A4TA 4BPBA 3IJPA 4TT3A 2JD2A 4GX2A 2F9MA 3BTOA 1JEYA 1BJRE 1QH0A 3PHCA 2YZ7A 3VUFA 4CDNA 5U9CA 2W2VA 1QTRA 2OBFA 2N9UA 4DIMA 2WVAA 1ZJ4A 2FUG6 1OY1A 3QFRA 4I9HA 5LP1A 1BGVA 3SC6A 3IEIA 6GPBA 3FIJA 2A1TS 4GC5A 4RSGA 2C5LA 4UXIA 1T35A 3N5CA 1SUBA 4QBHA 1GSIA 2VJLA 5THXA 3EMVA 1M7GA 1Z26A 5KTNA 3EF0A 3PJDA 1P2VA 1SB9A 3MERA 3ED1A 1NBOA 3MG9A 4KEAA 4L3WA 2MOKA 4S1VA 3OOWA 5D51S 3Q11A 5M04A 3EX7C 3ISVA 4RTRA 2PUBA 1B00A 5FTJA 3FI0A 2RHHA 2VZ9A 4HPJB 2ZRKA 4Y6LA 3SP1A 1FDVA 1ZRNA 3IVAA 1A9TA 1WXGA 2JZOA 1JFRA 1PW5A 2BGKA 3AQIA 3ELUA 1RQ7A 4RQTA 1JDBC 5ALDA 4YK7A 1VBMA 3ZXUB 3DVAA 5IJ0A 4REQB 1PFQA 1NF9A 2M1ZA 2TS1A 2YJ3A 5L3SB 4IG4A 1V8OA 4MCJA 5D85A 1GTRA 3HN7A 3AILA 3BSFA 3I9OA 4NDZA 5JSZB 3ZOZA 3H8VA 3K4HA 2OYCA 5JAIA 2JHCA 1H4QA 4B3RB 3I0NA 4QBKA 4DCUA 4BKUA 1W7AA 1A4UA 4U3JB 1GSAA 2QJFA 5HFNA 3ZXYA 3ZCSA 1GAQA 2OHGA 3KFVA 2AC7A 1Q1BA 1T43A 4BFWA 2OCGA 2Z6QA 4NV1A 6REQB 4Y2JA 1K92A 1SKYB 1XX6A 3TSCA 2P4HX 1N25A 1VBNA 2BI8A 2HU7A 1AK1A 2CK3D 2PQMA 4C22A 4TTAA 3MRTA 1UMKA 3MHTA 1U3DA 3GAAA 3KQKA 3Q8LA 4HADA 3FSGA 2R9VA 3EMDA 3WGMA 2H07A 1SRRA 3FWZA 4IWXA 5E6SB 3ZWWA 4CEJA 4B7AA 3SKYA 2Y3IA 3JAKA 3CR3C 4OSPA 3DE7X 3N7UA 2P91A 3ELYA 3AY0A 2CNDA 3CSSA 3DZKA 2WT4A 2JI4A 2O4UX 3RVNA 3L8HA 5BW6B 2BVNA 3HXPA 4QDTA 4E1BA 5DBIA 4TLLB 2FEMA 5SZHB 2LXNA 3X0DA 4R2LA 5JAZA 1VE5A 4NK5A 2F62A 4YCNA 2VPIA 1OAAA 3S99A 3K70B 1PJ2A 2X2PA 4MV3A 4XFJA 2JBWA 3T1YB 2K7FA 4Q3BA 3HY3A 4MARA 2WF9A 3KZXA 5NULA 2B4KA 2BFCB 3JSXA 3NHZA 2VPXA 1X8KA 3BIWA 2IPXA 5IAAA 3QNWA 2D74A 1X2EA 3PFIA 5KMGA 5T3UA 3L7OA 2YFQA 3GLIA 1YK0A 1O54A 3V1KA 2IV2X 3SE7A 4J1SA 4ND8B 4WBXC 1GSHA 4KITB 5K0SA 1ECGA 3RYFA 4CR7A 1DT5A 3LQYA 4R2WA 4F04A 1E1CB 2IHBA 3NATA 3OZUA 1E6EA 2AOXA 1SRQA 1WW2A 2JJQA 3LIPA 3AK4A 5IAGA 1G1MA 2HUPA 3Q3GE 5DOVA 5IM5A 4G89A 1ZIXA 1CDEA 2QQGA 4DDVA 4IQFA 3VPDA 4FDMA 4D44A 1C1HA 4H7KA 4M60A 5NLLA 2NPIA 1LVUA 4U2FA 3Q8MA 2FUNB 4I3FA 5BQ5A 2H2WA 1D3AA 3E9MA 3Q0EA 3VPSA 4E08A 3WWYA 3PRJA 5L45A 4Y1RB 2ACKA 1Z2CA 3UUFA 2I7XA 3QQPA 1SIWA 4YXWA 1V2HE 2UV8A 4QM6A 2VKTA 3R40A 2OBMA 3PF8A 1HNNA 1Z5OA 4FLMA 3DBIA 3UK1A 3EVBA 4F3CA 1ILWA 1Z83A 2DPXA 3LXMA 1BKYA 4JLPA 4UAGA 3RTBA 4PICA 2GAIA 1T36B 3T0FA 1H9AA 3KPYA 4BECA 5JMTA 1JSCA 2C03A 2H17A 5FOVA 5J9FA 3EGVA 2I3AA 4MVJM 3IAAA 3N2YA 4LC9A 3U9TA 4ZKDA 4ZGWA 4L8YA 1XC7A 3DR3A 1N7IA 2DQZA 4D5EA 1MDFA 1FDUA 2ZRCA 3A3YA 4JBNA 1PGPA 1H0RA 1XMVA 1WB9A 5ULLA 5IFLA 2WNSA 3L6UA 2OSBA 4J3JA 4EYSA 1IXYA 2C04A 3TEMA 2J0UB 1VI5A 2ZUTA 1E4EA 4LMAA 2UXCB 1FLVA 2GK4A 3ORYA 3PDIB 5IW8A 1VLVA 1WBJB 1QIIA 4DWVA 3MJSA 5CCEA 4AZ0B 4Y2QA 2QX9A 3NJ8A 1S96A 3KKLA 1Y5NA 4JUAA 4YRRA 3QKWA 4WECA 1QF6A 4F2GA 2V7GA 3M49A 2HADA 2PH5A 3SC4A 3QF7A 1MH9A 4D8UA 3CVYA 3LNCA 5JS8A 2G9QA 2V6JA 1I0LA 4JNKA 2OZVA 1UAAA 1NDUA 1P3DA 1EUZA 2I76A 4U7PB 2VQ3A 3VR6A 2ZDHA 3VOTA 3GO4A 4F71A 1JECA 3N6VA 2Q21A 2VA9A 1QV6A 3KOZA 1KK3A 4I0WB 1IZ8A 1POWA 2XMQA 3AKYA 3M9WA 4Q21A 3ZLJA 2WUFA 2D7JA 1RJ9A 4GLBA 5EXEA 3VR5A 3WZ2A 1K88A 3KJIA 4PLTA 1WSDA 2H11A 4CKWB 4DDHA 4KQHA 3A2MA 2R1VB 2ZAGA 3CX4A 1TRKA 3CZPA 3U80A 2HA0A 4DV2B 3FTCA 2FJ0A 1EWRA 3H1PA 4AJPA 3KYDA 3IDFA 1Q95A 2PXCA 1JEEA 3OM9A 4JP1A 3WSVA 5BR8B 3Q8WA 1TT5A 1XD2A 2QM0A 2J6CA 3DP9A 1OU0A 2XUPA 3GMDA 1ZH8A 2QRUA 2RCNA 1KY5A 4K9MA 1M2HA 2IYRA 1Q1ZA 5JAQA 3SSOA 1H3NA 2GFQA 3ILXA 3D3QA 3W3AH 3TZKA 3GJ4A 1Y9EA 2BUBA 2VWHA 3ANXA 1WDKA 5FOTA 5ARCA 1EDEA 5EWJB 1CJMA 4B31A 1E7SA 1LTKA 1OAOA 3IPYA 3VBCA 3CN9A 121PA 1ZVVA 2GK6A 1U2ZA 1G21E 1U90A 1X1AA 2VUUA 2ZZNA 1FVXA 1NBMA 4KIUA 4Q15A 4QNRA 1DEAA 5ADHA 4DABA 1KH3A 1CUXA 5HDBB 2E4YA 3C48A 1XEXB 3ILSA 1N3YA 2WD7B 3LE8A 3NBYC 4JBLA 4N3CA 3HDHA 3SM9A 3VOBA 1P74A 3I4CA 3L8DA 1Y4DE 5B1DA 1CZUA 5ERGB 3R5HA 4DV0B 3ORHA 3CPJB 4HDNA 4ZQEA 5IK2A 4E51A 3A04A 3U48A 4E07A 1ZEJA 5AK4A 6Q21A 1PJLA 3RAFC 5B1YA 5JMPA 4D8TA 1HSZA 1PE0A 4UUAA 2REOA 5THQA 1B8NA 1L9XA 3V3TA 1W34A 2GERA 2A8YA 5TIIA 3UG6A 5AM1A 4RPJA 1C5KA 4FMBB 4AJ1A 3TTWA 5H80A 1B0PA 1V4NA 1AXRA 3O73A 3OEWA 4QBFA 3UT5A 3OKCA 5FORA 3JZDA 3QE3A 4OKIA 4C5BA 3BXZA 1PGQA 4E5UA 1HTWA 2W2KB 1MO6A 4Q4AB 4B3GA 3PDUA 1IMJA 5FUBA 2ZYRA 1ZI9A 4RGVA 3RKSA 2NU9A 1E3TA 4QHYA 1BS9A 2P90A 1S1MA 1CUWA 1UQTA 2AI3A 2RK6A 4AF7A 3E9NA 3CUUA 3ICOA 4F91B 4S2UA 1JHQA 2ORVA 4JDPA 3TJMA 3UJDA 3WMEA 5ALWA 1T24A 1EBBA 3N2GB 3ITKA 2FW6A 2O8VA 1PV1A 3KLMX 1Y5LA 3KG2A 4RFSB 2XT0A 1E61A 1U1IA 2YFYA 4JL8A 5GAJA 5IZCC 4FZ3A 1GITA 1THTA 2FMHA 3L7BA 5HRAA 2X4DA 2WU1A 3ZYCA 4KK3A 2PGLA 3BE5A 4M9QA 2R00A 3FBTA 1QP8A 2AJDA 4WCFB 5AJHA 3VPFA 1I7NA 3LVQE 4PR3A 3W5UA 4IRXA 3S1SA 3Q9LA 5I9NA 1PR6A 2ZRGA 5C8XA 4F4CA 3K6JA 2CEKA 2GDZA 2ZQ5A 3EDCA 1SKYE 4RS4A 4ZHQB 3BB4A 5EJGA 4ME6A 4PPGA 5AVUA 3O9ZA 5A7HA 4MDHA 5CDSA 3K0BA 3JATB 1OLXB 5E7QA 3QV1A 3DV9A 3D2BA 4Q3NA 5J63A 1NOJA 4OKSA 3ESYA 4OHXA 5IJZA 1Y5RA 2ZIGA 4QTTB 2ZU0C 3KL2A 3FNGA 1WV0A 1ZAKA 3K2IA 4QPPA 1WCYA 4URXR 2OVBA 1E2QA 4PG4A 1XPJA 2LZ0A 4R9RA 1Q74A 1XIVA 1D2MA 3D3EA 4TQAA 1UUFA 3PQ3A 1C30B 1U8TA 2FRXA 4FNOA 4KWCA 5FOUA 3SQNA 3ZNNA 4BMZA 4PHTA 2O57A 2GTHA 4CMJA 4QTYA 1FFCA 3IV6A 1WUIS 4EUNA 2D13A 2GCGA 2WINI 3PHLA 2FX5A 3RK0A 3SR0A 3SQXA 3E3OA 2YJTD 4R40A 4YDHB 4KUGA 3SD7A 4CT0A 2WEKA 1P0QA 1E4VA 2DKOA 3EZYA 3FNEA 1RW4A 5CURA 2ZDGA 3S27A 3BM5A 3WOVA 1N7HA 4IOKA 3LX6A 1UBHS 1NQVA 1ZQ1A 2WAYA 2BFNA 3OTOB 2UZAA 3ZYZA 3FUCA 1C1DB 1Y82A 4BZZA 5DP2A 3O26A 5J43A 1I6WA 2ZE8A 1TTTA 2XDWA 4R1PA 4FCCA 3AUUA 1C9DB 5IYZF 3UHAA 3TFQA 4EHKA 1OI4A 1SWVA 4KFTA 1A5ZA 5FAXA 5CIWA 5I4IA 2R8RA 5BW4A 1L8QA 2D5BA 4YHBA 3C74A 1UPAA 3N9IA 1XU4A 1D4OA 2JFZA 5DHSA 3GLFB 1X1CA 3U81A 1IXZA 2ENWA 3ENKA 4RZUA 1V39A 3K5PA 3MLEA 5CVDA 4B81A 2VPQA 1HUQA 1ZNXA 1ZVQA 3OEYA 3SIPA 3T0GA 3P19A 3BK7A 3LL7A 4PS0A 1JDPA 4AUMA 1AN9A 2GZAA 3LRTA 3NHBA 1JR3E 3ZY2A 4K9SA 1XZBA 1XDUA 1Z75A 1XJQA 1ZFNA 3UBMA 1Y6QA 2KPOA 2P4UA 3IULA 4GXNA 5D01A 4AU1A 1Y8ZA 2JFUA 3E8SA 2F90A 1NXVA 2R4QA 1BMQA 2YVKA 3JALB 4NJEA 2E4VA 4WZAE 2O1XA 3TECE 3EULA 4JJKA 5LOVF 4HXFB 1WMDA 3DWGA 2V7PA 4H7PA 4MW6A 3L0IB 2RGRA 2EGHA 2R66A 4AY4A 1UXKA 1GPUA 2FFRA 3PIIA 4UMEA 4ARSA 3RSFA 3OI7A 4O25A 4US1R 5IARA 5IHPA 5AVXA 5AO9A 3D0OA 1W4CA 3WK4A 2BCJQ 1RWWA 1GTSA 4IJ6A 2MU1A 4ESVA 4R1UA 4ZVTA 1DHTA 3CVUA 4UEJA 1QYXA 4MWGA 4HGNA 3I39X 4I1YA 4G41A 2QP3A 4I8DA 1VIVA 3KUDA 1I10A 1HFJA 4PSAA 1KO4A 1LFAA 2KI5A 3LW7A 4JOCA 4LJ6A 1LNSA 4B2PA 5FHQA 4WCVA 1O8BA 5DNYB 4NY1A 2WP0A 1I4LD 2HRDA 3WL8A 4C5CA 4TXMA 4MGHA 1SR8A 5KQPA 1ZP6A 2COEA 1J24A 2AXNA 2QLMA 2BV3A 1UF9A 5CDFA 1MN6A 2C3UA 4R2KA 4BZPA 3WGTA 1CUGA 1JHZA 1XLTA 4YRKA 2I6FA 5FWNA 5B57C 3VPBA 1GHTA 3IVXA 4TLDA 2P2GA 2FR0A 1YNSA 3ISTA 3O2NA 1OWNA 2C7QA 2JGDB 1VPEA 4IDAA 4IGAA 4V0MA 4M8SA 5TRTA 2EJWA 2M2IA 4HT3B 1W5SA 1JZQA 1RYEA 3EVZA 1F6BA 1XFAA 3MTDA 4MUYA 3TQQA 4RTMA 3HH8A 5L7YA 3ZLBA 2IHYA 2W42A 1J23A 5BSTA 3BMQA 2JH9A 4W7IA 2XGJA 1NL3A 1XZEA 5IBQA 3T5BA 4YMUA 1BE8A 1I9CA 1KIFA 1MA3A 2WLTA 1BCRB 6ADHA 1O4WA 2GD0A 1IZZA 1FTQA 1YCGA 3IEKA 2ANCA 2NTYC 4RIGA 5EE0A 2JGRA 3ZTYA 2XUDA 2IF0A 3R3JA 2Q7DA 1UMCA 3R5TA 2ECKA 2G9UA 2PBLA 3W5HA 2PV0A 4G4SP 3ITDA 1SU7A 2WJVA 2BCEA 2J9YB 3A37A 3LBHA 3OVMA 4ZO9A 4IV8A 1V3VA 1IHOA 2JJ8A 1V16A 3HLYA 3OOSA 2I6TA 4FZ5A 3HYSA 3LQKA 4LFAB 1ZONA 1KI2A 4QLOA 4IRMA 5JT1A 4H77A 4LZJA 4RZXA 3AL2A 4K81B 2RK3A 4DWOA 3BRWD 4WOJA 5FPTA 1OFIA 3MCVA 2VHCA 2A88A 2XZLA 3M82A 4FFPA 1H8ED 4QG3A 4QKQA 2ZUEA 4MR8B 5AKIA 3ULKA 3ZQ6A 3GVHA 3PNSA 4KE7A 4ED9A 3FHOA 1QF9A 5T8KC 1G8FA 5MFPA 1CY6A 1NV9A 1EE2A 1U8FO 2ADMA 5IT4A 2Z5LA 1BC5A 4RCVA 3ECSA 3IXMA 4RJKA 1OH6A 4C29A 3X1MA 4BB9A 4E2FA 4G23A 1NTRA 4OI1A 4AMGA 5H4HA 4ZI2A 1MQSA 5I8WA 3V6MA 1EWTA 2VC2B 3HBJA 3DBLA 2AFIA 3E9YA 3IKJA 3N8IA 1JEOA 3NTLA 2BJWA 2KHZA 4O3MA 3RUFA 5KNBD 1Z63A 1XZMA 13PKA 4PG5A 5SZJA 1DRJA 3VR4D 4EY7A 1Q7TA 4KKVA 1FTNA 3D9QX 4TV9A 4G65A 4J0QA 3H5OA 5AIBA 3T0IA 1QUEA 3LVBA 1J25A 2ZS8A 4II2A 3HJCA 1W5FA 3T5AA 1ISSA 4Q16A 4ZAYA 5LZ8A 1PWXA 3NT2A 3BE6A 3ZNPA 1MW8X 3GUVA 4WKBA 2Y0DA 1R74A 3L0CA 3ZZTA 2B2NA 3KSBC 2V3CC 3IUEA 3CW2A 3F9IA 3QX3A 4F84A 4Z49A 3KLOA 2JFOA 3LPDA 2R7LA 4CT5A 3SQDA 2ZJ1A 1N2IA 1MNAA 2WWGA 3A6LA 3B6KA 3KU1A 4FMDF 3U0VA 2ES4A 4CV1A 1YGPA 2P62A 3EDQA 3T99A 4BUJA 2FZKA 3LLUA 4N82A 3HXQA 1J5EB 1Y48E 4BFZA 4Z7QB 4KSCA 1TL7C 3AB8A 2ZIXA 2OBNA 2OQRA 3MPUA 1TZKA 5LLSA 3U19A 2OAP1 4C04A 1FX0B 4HMPA 4PYQA 2P3QA 3U37A 3G1WA 4ENTA 4M86A 1HETA 2Y1DA 4ZI7F 1AGYA 3WLIA 3H6GA 5AJTA 3EXEB 4JUIA 4LZPA 2PKCA 3FFXA 1HE8B 3MC1A 2JIDA 1JDZA 5DM70 1OWPA 1I7QB 3AUTA 5AKYA 3UAXA 4M3NA 4D6YA 1CP3A 2IYEA 3A26A 4D42A 3FYUC 1JU3A 2QYSA 4O5AA 3QY0A 4XVCA 4HUTA 2PV7A 1KOJA 2GKGA 2OCKA 1K7YA 3HPQA 5AQEA 3RC2A 4E0BA 3ZZ1A 4GYJA 1R18A 3SR4A 3ZC3A 1ZESA 3I0ZA 4YJKA 2O8FA 4IJ5A 1OTXA 1RLOA 3EAFA 3GROA 4X20B 4ALMA 2BTEA 3F78A 3INGA 5DNUA 1PSZA 1YXMA 2GYVA 2QTTA 1NW4A 4UD6A 5EN4A 4BP9A 4TKVA 2FFAA 1J07A 4MHOA 1MENA 5IVIA 4M4SA 5E8JA 3Q9NA 1E2EA 2XSZA 1P1JA 1WQ4A 2PH3A 1UDWA 1G64A 3IUMA 2HPVA 2P67A 4BU1A 3L4JA 2BEWB 1LLCA 1NX6A 2G5TA 2KSQA 3C15C 3F7NA 3E70C 1LH0A 3LBFA 3LG2A 1J00A 3PR3A 3QBTA 5KKNB 1N1MA 3NWBA 2A6PA 3G1TA 4KQMA 4OXXA 3FDXA 4DCCA 5GONF 1TA9A 3P2JA 4MK4A 1X14A 1ZXBA 3CFYA 4QSMA 3Q6MA 1E92A 2IYXA 5I5GA 2OWDA 2GXSA 3G7UA 3I05A 1QCDA 3WZLA 4KLRA 4W7SA 3OZGA 1K6MA 4KRXA 5FLYA 4BV2A 1K9VF 2BLNA 4QPCA 5AW7A 3GGJA 4RNCA 1LVHA 1YBFA 3C98A 6PFKA 5TVGA 4BNNA 1JKJB 5KC9A 3HV2A 1GU0A 1S9DA 3AM5A 1F0KA 2QHXA 4CM4B 3UGQA 3K20A 5JJKA 4RL6A 1UZNA 2OQIA 1SBIA 1E3DA 2EG9A 2Q2VA 4G67A 2BH2A 1S8AA 1IPEA 3JD0A 4LF9B 3IBCA 1U2QA 3ETLA 4U2KA 4Y2GA 4AZTA 4ZYWA 5G1OA 4ZZ0A 5JNUA 1DXYA 3L8GA 5T67A 3HDQA 4XPIA 3T12A 2IYWA 3I9V6 2C2GA 2EKLA 1DUIA 3DO5A 3QKTA 3KPWA 4X94A 4AO6A 1U3UA 3IVRA 1IUKA 4NZNA 1PS8A 4WKNA 2PCLA 3F5QA 1I9GA 4IQ0A 2DJIA 4HB0A 1FUUA 2VTDA 1EAYA 3REQA 3ZCUA 3QU9A 2EFJA 3U7RA 1N3BA 3OURA 2RD2A 2VP5A 3FPLA 4DQVA 1QYCA 2BGUA 3PKIA 2EIXA 3JVUA 4NFLA 2ZLBA 5FQOA 1Z6XA 3JQBA 3OKAA 2CLFB 2VFAA 4PHCA 4QSHA 5DMXA 4B47A 1DTWB 3A9WA 5C5DA 1HEIA 3G5LA 4W4TA 5AR1A 8OHMA 5LIPA 2WHPB 3GRRA 2CLKB 1E98A 3BN3A 2QLFA 3RSCA 4XGIA 5K0LA 1SK9A 4BJ6A 5IJ9A 3RVOA 4YJ3F 4EARA 1E9CA 2DWPA 1WU7A 5K0NA 5JUWA 5CJ2A 1A3CA 4NYMQ 1U3TA 3RS8A 3DDZX 5H70A 3WJAA 4TYQA 4V0NA 2V5UA 2WSSD 4RKEA 1UPUA 3WHPA 2YWXA 2JGLA 1OW3B 1MO5A 1WCIA 3EODA 2PIDA 4LPSA 2PGDA 2XY4A 4GOXA 4NPHA 5LYYA 1MPTA 4K6CA 5D8DA 1ONOA 4MWOA 2IPLA 3IP6A 2R8XA 5EUBA 2EP5A 1YS6A 4PC2A 1G7TA 4WGGA 4RMNA 4YRMA 5AHKA 4DV6B 1LI4A 2AMVA 4FUQA 4W7HA 1W4AA 4ZK2A 4J7CA 1ZA1A 1OA0A 4U63A 5ERYA 3O4GA 4UUMA 4DIOA 3VVBA 1JHDA 5E95A 4ENVA 2ZFUA 3W1WA 1BH2A 1SCUA 1ZCZA 3QZUA 4DA6A 4TYWA 2OXCA 5I9IA 4Q82A 5AVWA 1CJKC 1JA9A 1E2LA 2W6NA 2ISQA 1Q21A 3ZD9A 1IHXA 3NHKA 2ZZKA 2JBHA 4Y6PA 5K8LA 1HRKA 1O94A 3TW4A 4EQZA 1SVNA 4MINA 2H4ZA 2JLXA 1GAXA 2AFHB 2VPTA 5BRJA 4C0WA 1P18A 5IUJC 2NPOA 4FZRA 3RD5A 5KQLA 4DR4B 2D59A 3D4BA 1Z4QA 2R1TA 3JTEA 1UKCA 2H0QA 3KSDO 3JR7A 3GEDA 4REQA 3KFLA 3RE1A 1ZXXA 5EE3A 2P2SA 4D41A 4EI7A 2XLCA 3TL6A 3ES9A 4LXGA 1RWOA 2PSHA 2QNRA 3OKPA 1BOFA 2XT9A 4TUYF 3WK8A 3CF0A 1T0IA 1S6YA 5G3YA 2VH5R 4OJYA 1EVQA 4PYIA 4NTZA 1ECPA 3ZHQA 3J80A 4K87A 6REQA 1U8YA 5BVGB 4LVNA 5EKSA 3WE7A 1BTOA 2H1LA 2Q1UA 2YCLA 3CVJA 3R7SA 3WMWA 2CYCA 1EVKA 3DMHA 1W29A 2IXTA 4HDKB 2PL5A 1WD5A 4YMIA 3E7DA 5DZSA 1QS0B 4JKYA 5D7BA 4E22A 1E96A 2O2JA 1NHWA 1OZ0A 3HN2A 4UHDA 4GRIA 3SYTA 1TM5E 4EQ6B 3REGA 4BFVA 3H99A 5I48A 2RJ3A 2O48X 4YECA 1Q5PA 1VKHA 3R7BA 5A0VA 3HB0A 4JBIA 1EM6A 4D9CA 3CF2A 3B82A 5JMWA 1M72A 4N5MA 1VFNA 4N39A 3B9PA 5DTRA 2OOSA 3RKUA 1CF2O 1JQAA 1RJDA 1Z06A 3RVDA 5JPCA 3A1TA 5LXTA 2BZ1A 5F9MA 2BFCA 4ZALA 4N18A 5DM1A 3VC2A 4BXOA 4AS1A 1LRLA 3UWOA 1ZSNA 1ECLA 1VCMA 2OLEA 2Z2JA 4XWAA 1KQGA 1PS9A 1GGKA 2QP4A 2RI1A 1TMYA 4NL4H 4R7ZA 3BUSA 1M8FA 1ZM9A 4BMPB 1KF0A 3I92A 4ND8A 4B76A 5HK9A 5JADA 2XNSA 3LQFA 4M88A 2GHRA 1G3UA 1IQUA 1QH1B 2XMSA 2ZCVA 3UMFA 4NYIR 1OI2A 1SHLA 4G1UC 2AEFA 5HE9A 2BAGA 3KSMA 5C32A 1G16A 1RIFA 2PJUA 2RAFA 3M3HA 4XIIA 2VQFB 2AZDA 2O05A 2WTXA 3HJBA 4XQCA 4PFJA 3ROMA 1DIBA 2VK2A 3CF4G 1ZU4A 3OE7A 4L9SA 3VVMA 4P83A 1N7JA 1VYUA 4RMHA 4OXRA 1RXVA 4KOAA 4LTDA 4RAQA 3HGQA 4ZEWA 2EU8A 1QMGA 1ZICA 3TR6A 1RP1A 3GH1A 3U31A 2C54A 3ISJA 2MDTA 1PR4A 2BHNA 5B3AA 2G5GX 4ON9A 2JFXA 2J0EA 1EU1A 4LFCB 2B35A 2EKQA 3REFA 2ZTMA 4QEDA 1QYIA 8ABPA 1VL5A 2XA9A 4G5YA 3P9IA 2IXEA 2G63A 4UNIA 5DN9A 4A0FA 1JHPA 4ZVSA 1MJFA 3AUAA 1LW6E 4BU0A 2VJQA 4TLMB 2HU2A 4UNPA 3FDZA 3MJDA 3R3YA 4MW4A 1GUBA 2FRDC 2Y77A 4E7OA 2VG8A 4UHJA 1E20A 3BRSA 3DL7A 3ELWA 3UFXB 2CT8A 1QH8B 1N7GA 2Q1XA 3L6RA 1WY5A 3A2LA 1JR6A 3E8XA 2HCJB 2KQUA 4L85A 1FNCA 5A05A 3HVHA 4ER5A 3ADKA 1TLTA 1M2GA 3WKBA 2QW8A 1UDCA 3T9EA 1YDMA 2L19A 1XZ8A 5HHTA 2A78A 2J0UA 2O3JA 4MQFB 5AVOA 1JKIA 3H2SA 4YGYA 4ZV4A 3KM0A 4NBLA 2O2ZA 1M8JA 1XGKA 2QJWA 1WUHS 3AMVA 1RM0A 4YUVA 5TMPA 2J87A 1BAPA 4AZ0A 1G66A 5IC5A 3MTEA 1N4AA 3ZBTA 2QW1A 5TMDA 1T6XA 3D2LA 3KIPA 3PUJA 1IULA 4Q5IA 3QUAA 4NCIA 1MGOA 1Y3DE 2QAGA 3NRJA 4RIIA 1VJTA 2OCLA 1I36A 1KEEB 2AX4A 4PYOA 2SCUB 4LQ4A 2NT4A 2QI9F 4FC7A 4RY2A 2E6KA 3ILVA 3QMPA 4H3SA 3UMBA 1WS6A 5JPDA 3CNBA 3LC2O 2NPFA 4IILA 1SJ9A 2W6IA 3HBAA 4C0KA 5KNBH 4V1CI 2IKSA 2WJPA 3VR4H 3OZVA 2D06A 2HLPA 1O6FA 2M6SA 1W5TA 1BQ4A 1F5NA 1N0HA 1FMCA 3L04A 1Q0TA 1U7TA 3Q98A 3SNHA 4ZDKA 5CJPA 2WF8A 2OORA 3NHJA 1FDSA 1EFAA 5B30A 3WVNA 2W71A 4C3ZA 4Q1CA 2P41A 3ROPA 4CETA 4ZVMA 4ARAA 3WLAA 4IJKA 4PLVA 3OUUA 2GVNA 1OB2A 2WUVA 4IIUA 4GFDA 4P98A 4QUEA 5I7AA 3S2ZA 3R7FA 3ZHVA 4YCMA 1WHTA 3UCFA 3V00A 4BNVA 4MJLA 5E9AA 2GOYA 3WRWA 4CI0B 5HVNA 4ZOBA 5GVRA 1UKYA 2JL1A 3KQTA 1U8EA 5F98A 3BA6A 2YWDA 1XEXA 3L40A 4BN0A 2W2XA 1QRDA 3SJ7A 1GVHA 2B2CA 3AHJA 1BU8A 2ZAOA 3AOEC 3B1FA 4Q47A 1W30A 2OV8A 3K73O 3V9AA 4WL0A 5JCPA 2VUSA 3UK2A 4C20A 4DCMA 3GCGA 3B8HA 3D7RA 3C16C 4LWOA 1CSEE 2X6QA 2YDYA 2AMJA 3OTIA 4OFZA 4GM4A 4G6ZA 5TMBA 4F4UA 5C18A 4PX9A 2VT3A 1YBHA 4LRUA 3EIEA 4ESEA 3INRA 4NBSA 3A36A 2QRLA 1KSGA 1QCYA 2COUA 1CUBA 3WK5A 2BE9A 2Q0HA 4YMLA 1C14A 1Z8NA 1F2UB 1HE1C 1HORA 1W76A 3LUGA 4BGIA 3NBMA 4CF3A 1LBEA 1ULZA 3LK7A 5HKKA 4Q4AA 4G1EB 5BN5A 2XADA 5ALEA 4XE5A 5IANA 3ZU2A 3P9CA 5L3QB 1SIBE 2RBGA 3Q0TA 1DZ3A 2IEYA 5CPBA 3VFDA 3VZRA 3ZLUA 5L40A 1BVHA 4WQMA 4ZCPA 5LB4A 1OXUA 1E7WA 1L5RA 3I73A 1N3IA 3WTBA 1DP4A 1L5FA 3LUBA 1K6IA 2PZKA 3E03A 3DOIA 1YBMA 5F1PA 2YKGA 4WT7A 3IO3A 1OFVA 3N2GA 1W36D 3L9WA 3KE8A 4UOQA 4NXMB 3M1LA 1JAHA 3C6MA 5KOIA 5LMNB 5CK4A 2VXYA 2PKRA 4Y2UA 5T5QA 4HH1A 4BVAA 2PMWB 1Z4OA 1A8SA 2BFDB 2QTCA 3LCJA 2LKDA 3KP1A 4FYYA 4HAIA 4WCFA 2R5NA 4BQPA 2PM8A 4GWKA 4WKOA 2GLUA 4LZOA 4ND1A 4MIKA 3U3OA 1MHPA 1U81A 4TN1A 1TCUA 2Z5VA 3KJGA 1ZMTA 3PVSA 3OQOA 4L75A 2G09A 1T4GA 4KXLA 5IF9A 1O6BA 2ZSFA 1ZVMA 2VOJA 3ZHTA 1T29A 3JATA 1JAZA 3PFFA 4HMOA 5EKTA 1F7VA 3IOEA 3MBIA 3C3MA 4Z54A 1W0JA 3O03A 5ILOA 2DP4E 1BKSB 1DELA 2PKEA 2JNWA 5BNWA 3H5WA 1T1SA 4D0NA 5CM8B 4EI2A 2OHVA 3C41J 4KTTE 3GEBA 1G291 1EWKA 5H81A 4MR9A 3K53A 2H29A 3FKQA 4RA9A 3RV4A 1UK9A 3FYSA 3GLIE 2R8ZA 1C30A 1M9NA 2YHUA 3DE2X 1ZC3A 5TGDA 1XBTA 3O8DA 3H5IA 2DT5A 4NZ9A 2D54A 5ELLA 3TB4A 3WNBA 3BEDA 1XJ5A 2IYTA 3UPDA 1Y34E 3DXYA 4Q66C 4L0MA 2VHTA 5DH9A 1BXGB 1DO0A 2C9DA 3NGMA 3RVJA 5CH8A 5AWFC 2PJZA 3A6EA 4CMHA 1EGHA 4UEWA 1AKNA 3DG9A 1L4GA 4I6JA 5BWBA 1APBA 1LDYA 3OCZA 4WLEA 1SXJD 2R6JA 2JLQA 4JP3A 4MIOA 1SUDA 4OCZA 4B7UA 3E35A 1N2ZA 4BEWA 2HK7A 3O9VA 3MJTA 2X3YA 3IR7A 4EG8A 5FPQA 3A28A 4Z53A 1COWA 2O5CA 4HAYA 4JI4B 1NG1A 3QXHA 4B40A 1FP1D 1GUFA 4R01A 2OO7A 3T3NA 2UUAB 3KWFA 3OAAD 2BMJA 4QUGA 3ZHOA 3SG0A 1FTWA 1BWRA 2Z08A 1XZCA 1TUIA 1QHIA 4RY8A 3DZDA 2QDKA 4YCJA 2DERA 3A6ZA 3LDHA 2VBGA 2WSIA 3KOXA 1HQDA 3N0XA 1QB8A 1D0VA 1XO1A 2ZJ6A 5DFAA 4Z9XA 3S8MA 4K3VA 5CBPB 2Y1OA 1RLJA 4IH1A 1C8KA 1ZNQO 1EXNA 3TZBA 3ZDXB 4CN8A 4OL0A 4QJBA 1W8DA 2XCTB 1X13A 5BVHA 4BC0A 3TAHA 4H6WA 1R4AA 1WKBA 2H7CA 3DEFA 3FETA 4XVQA 3UC5A 2H85A 4HGRA 5B3LA 1DJNA 1W44A 1GAWA 2DPLA 1X92A 1XVIA 2HREA 1EXVA 4RHYA 3JQ6A 4YBRA 1CP2A 1HQKA 2WIKA 1HOXA 3OSZA 2KMLA 3JALA 2PZMA 4G9BA 4IW3B 4M1SA 2QM8A 1EDDA 1LQUA 2VVTA 3DOHA 4F5WA 5JBNA 1KGSA 1T2UA 1STOA 1ULHA 1QIFA 2YHIB 4W9NC 3AIOA 3HP7A 2E5WA 4FGZA 1T2AA 1TCVA 3WJ1A 2G04A 2ZYVX 1QKIA 3BYZA 4B4DA 3EG9A 4TWBA 5F7OA 3RPEA 5ITVA 2OG1A 3KAJA 1DI0A 4URUR 2G6TA 1VPLA 1I80A 1ORDA 2Q2OA 2ROQA 3NM5A 1Y9JA 2MYTA 4MI6A 4KPYA 1PN3A 4DANA 3H3FA 1Q0SA 5CLJA 4F2WA 1G8HA 1XLWA 1TZCA 4HR7A 4CF5A 3QF4A 2R60A 4LMBA 3Q3HA 1P72A 4UZSA 1XNQB 2Y6VA 2C58A 1S4MA 2Z6UA 1VKRA 1Z8DA 1R1DA 2NSYA 3GA0A 1IQPA 2YJZA 4MVJE 1TOAA 4PLGA 1QO7A 1NI5A 2LW7A 5F1OA 3AESA 5LSAA 2JPDA 3E9ZA 3GHHA 2XUQA 5BNIA 1X9IA 3QVSA 1A9SA 3BMNB 5K3BA 1NI4B 1X42A 3HXKA 1MORA 5DLDA 1Z2DA 5DNVA 1A9OA 3UYKA 4GPEA 2PS0A 4XWWA 2BHTA 1RD4A 3VSDA 4ZZ1A 1YIDA 1UWCA 1V8BA 3PEYA 2OFWA 4NXNB 2NVUB 4Q7EA 2RIRA 3ENVA 3FWYA 3THWB 3C3DA 3G0BA 3IILA 2W2LA 2WG0A 2P9YA 4KN5A 3BDAA 1G5HA 1F2VA 3HYLA 4B9EA 1JNYA 1JT9A 2DFDA 1L7XA 3AJDA 5HG0A 1NXQA 3B70A 5CAEB 4WESB 1ONSA 2FQXA 2JGDA 1E9EA 2X8LA 3Q6IA 3NBKA 3UV6A 5FPYA 1ABEA 2IBSA 2CJWA 1ISHA 1IRXA 2XIJA 1EQUA 1QAMA 4YP9A 5FDFA 3MCAA 3WAKA 1U5CA 1GPLA 3PBKA 4HWOA 1A9PA 4LNUB 4YACA 3Q7TA 2J0SA 3PXGA 2XF2A 5CA1B 2ZCJA 4DA8A 4KPUB 3B6JA 2GCEA 2Q5CA 4M1YA 4JUFA 4O2BA 5DIFA 3M5WA 4LX0A 3ZBQA 4CFZA 1BCRA 2GHQA 4C14A 4KFCA 1JNXX 1RAHA 3H1AA 4YHHB 1WOMA 3KKZA 2XVMA 2VYCA 1TE2A 2ZB3A 1O03A 2GN0A 3CIOA 3HP4A 2NO0A 3QOFA 4YX9A 3F3SA 2V9PA 4UMVA 3BH7A 3E7WA 2OP1A 4YO8A 4ZN6A 4TVBA 4W82A 3MWLA 5TEVA 3CB4A 4QT4A 5KYYB 3EHEA 4H31A 5FI0B 1GXSB 1QHHA 3NTUA 4X1IB 2CBXA 5G1PA 3UTCA 4BFXA 3I5YA 1KVSA 4P38A 3K2BA 3NUGA 3CJRA 4A2QA 4KPEC 3HXLA 2GM5A 2OZLB 1W75A 2HCBA 2ZIFA 2PUGA 4PTZA 4BQFA 1NLMA 3DEIA 4TVOA 1I0ZA 1XCLA 1C1XB 1WMFA 1ZHHA 2Y4OA 3EZ2A 4R1SA 1W96A 4L6IA 2VSOA 4TL7A 4JJZA 1DX9A 4PZCA 1EX1A 3OTHA 1Y8RB 3KJHA 2A0YA 2KBFA 1KSJA 1V11A 3B1XA 3QXJA 1JEQB 4H59A 1R88A 5EZSA 2P0AA 5ALGA 1U6JA 2N1MA 4G36A 3DV0B 2KBEA 4AJ2A 3GLRA 3LUDA 1CB0A 3E5HA 4P84A 4KGZA 3EEBA 1DBIA 3O8QB 4Q01A 5E6UA 4GBGA 4NPAA 1WXIA 1T5SA 4MLPA 4NENB 3IHLA 1Y4UA 3AR8A 4LK3A 1P31A 2FFJA 1HDEA 4JYCA 3S2IA 2H92A 3GARA 3SHQA 5A3JA 2AFRA 4BKPA 4LYEA 1QAOA 3FLMA 2P0EA 4JBGA 4DLKA 5KX5A 2X2EA 3S5JA 3WYDA 3AUJB 1IY9A 3LKZA 3M6FA 4NE9A 4GKBA 1J2YA 1Y1LA 3FMVA 3KXLA 5D87A 1ZJ6A 3G79A 1U9IC 2WJ3A 2Q4EA 1CNMA 1JKMA 1YK1A 2A35A 2EHJA 5GOTA 5P8WA 3TZHA 2RHWA 4GPBA 3U4QA 2PX8A 4LJYA 4RX1A 4UM9B 1SUFA 1Y6JA 1MJNA 3HEMA 3O47A 2Q4BA 1DKOA 1JHOA 3TEFA 4DJTA 4E5SA 1BJTA 4PYMA 5J2TA 2G80A 5BN3B 4N5DA 4JR0A 1DOHA 3KZKA 4TRJA 1QU3A 2C3MA 1K9SA 1OKKA 1Q7GA 3IOBA 3H2ZA 2R25B 4KTVE 4TWZA 4OHVA 3VHXA 4ALIA 3KD3A 4KUHA 2QM3A 3LOUA 1TTPB 1S7GA 3K0FB 1NNSA 2GEKA 2PD4A 4DG9A 1ENOA 1JR4A 2VSYA 3O8LA 4YQFA 1Y37A 3GCWA 3QE0A 4PBRA 4UREA 1QGZA 4C7BA 2OXRA 3OX3A 4G97A 2NADA 3TLGB 4MI1A 4IIBA 1VE6A 1DXOA 3O84A 1YJQA 1VMIA 2XCRB 4YJ2F 4Y8VA 3W2EA 3E53A 3GWZA 4HCJA 4HQFA 4OF4A 2O20A 3WV5A 4U0JA 5JE8A 2BHSA 4RABA 1G8JA 1KXJA 5ICGA 4H3KB 3OHMA 2OA0A 4G5FA 4AJ4A 2QRJA 3CEMA 4GF5A 5BXYA 3R24A 1YZGA 4FEEA 1H4SA 4GWLA 3ZNOA 1EFDN 1RADA 4PC6A 2R44A 1JDSA 3FMFA 4WZBB 1WLYA 1E3IA 5F21A 2TSYB 1Q19A 3UWDA 1R64A 1K1EA 4F45A 4ZZ3A 1USUA 3VO8A 2OXIA 1FYFA 1G59A 1F1BA 1GA4A 2O52A 2PQ0A 4HUJA 4N49A 2JHGA 2BEWA 3CEHA 1T3TA 1YMQA 4LYGA 4WA8A 1TA4A 3S7ZA 2C5SA 4BEVA 4DC1A 1C7ZA 2OAEA 1BVUA 1NV8A 1E6LA 1Y42X 2H4HA 3FVWA 1WA5A 3GI1A 1I1HA 2XE7A 5DYWA 1OT3A 1IU9A 3BXFA 4L9WA 3AP1A 5EP4A 5JS6A 1L5HB 3I0MA 5AK0A 3SSNA 3I61A 1GNQA 4M0CA 2VJDA 1OC2A 4A23A 1NR5A 1K4MA 1E3WB 1PJTA 2AXPA 2G71A 1IBRA 1MQAA 1L4UA 3ZWOA 1HV8A 2WQ7A 3HXMA 1P0CA 1VCIA 1A04A 3H6HA 1XRRA 5U1PA 2GVDC 3WWOA 1RYFA 3Q8XB 1JKJA 3D0QA 2H1FA 3IT1A 3TL3A 5ENZA 4LRWA 3D4PA 3B3GA 1AN0A 2HK6A 3PEWA 1NQWA 1H9BA 3BXGA 1J6UA 1XROA 2YQZA 4JVSB 2EATA 4ZZ2A 4EKIA 3PQ6A 1UDBA 2PAAA 2XTJA 4FX5A 4M1OA 4Q0MA 1MNQA 4NMLA 2XKAA 3R3ZA 4LV5B 4MXDA 2IHTA 4YRFA 3P0RA 2BY4A 1UAYA 2IWRA 5J2UF 4R3NA 3NOOA 3W9YA 1T9DA 4JLBA 4YTEA 3SDBA 3SLGA 1LJUA 1ZUIA 3I28A 1WHSB 2PX4A 2XBMA 2I4NA 2EF1A 1JZTA 5HQJA 3U56A 4JGBA 1ZAYA 2GEFA 5EHXA 1DG3A 2DTXA 5TY0A 4R54A 2C1ZA 4UBLA 2YXNA 4LOIA 3NCTA 2NZXA 1SGWA 3CT4A 1YDWA 2NO6A 3FCSB 3GU3A 3VNQA 3AR7A 1DTWA 1MZVA 5FBWB 2RH5A 2WHPA 3ZK8A 4CXMA 4NE2A 1IN6A 2CJPA 2O8DA 4YAIA 3HK2A 5HRCA 2X1MA 3M3PA 4L5BA 1J09A 3ZE9A 4V03A 2PL3A 4CYMA 3E8MA 2PYIA 1JQ3A 5B6JA 4EEZA 1JXQA 1T8UA 1GQ2A 3A1UA 3NM4A 1J33A 2FE1A 3C5HA 4HQKA 1OZAA 5JO0A 4BMXA 3ONFA 1V8DA 3C14C 4BQQA 1UQRA 3RAJA 3HZHA 2CXUA 3B48A 4NYIQ 1FYWA 2C8KA 3FSEA 4INAA 4QE3A 3F73A 1OB5A 4CGZA 1E3LA 1P9NA 2YJGA 1W0KA 2F17A 1Z56C 1XOIA 4Z9AA 5DE3A 2MT9A 4RH1A 4U8GA 3F4LA 4YP1A 4LJRA 4QPZA 1DAEA 3WGKA 4AN1A 1AUOA 1XDZA 3P20A 2Z0MA 5LVAA 4ZO7A 1WMAA 3AW9A 3QVUA 2E21A 4V2UA 2ZWIA 1X2BA 4KGDA 1P5HA 1PEDA 3BIXA 4MR7B 3RFVA 3FZYA 3EIUA 4K9DA 3VNSA 2D5CA 5G02A 1UJNA 1CQXA 2YIDA 3K8YA 1Q14A 3GT7A 5TPWB 3WNZA 1CZKA 3ACCA 4QFDA 3PNVA 2RHGB 2IUUA 5KPDA 4QJ4A 2WJ6A 3PPIA 2XHZA 1PZGA 3UKDA 2R4UA 1L7MA 3WHKA 2AFHA 3NAQA 3K9WA 1M66A 4I4IA 5IMBA 5FPPA 3L18A 3L4EA 1RE0A 1BGXT 3DPUA 2CL6X 3WNQA 1Z4NA 3LLVA 5CM9C 3TJZA 1DDIA 2Z2YA 2BP7A 2NTEA 3MWFA 3OO0A 1HZJA 3DKIA 3PCTA 5F35A 2QE7D 2R8OA 1G2IA 4IV5A 1UH5A 3AHIA 1ZK3A 4FNAA 3U1VA 1K6JA 3HUUA 3QA9A 3T52A 2AFIE 5A5DA 4FK8A 1G8AA 3HRHA 3ZY3A 4J4BA 3NGLA 1RFGE 1XCOA 1VLLA 2WPDD 1M2VA 2AX3A 3GR6A 2OILA 4B17A 4JBHA 1YJ5A 3EUWA 3FPGA 1A77A 2XLBA 4M8LA 3W6NA 4B48A 4EABA 4EHAA 3DLHA 2PXXA 5JZ9A 5CUQA 1FC0A 5CU7A 2ZE6A 4U7GA 3DOEA 3LXUX 2YY6A 3V7FA 2R47A 3QW2A 4CUKA 4C78A 3GQVA 4RD0A 3OX2A 4HDKA 5D1NA 3WICA 1N77A 3GFVA 4PAQA 2HR1A 3CCBA 1QS0A 1T0HB 4I4NA 3RWBA 1T1IA 5T8KA 2B37A 2VBFA 5ALXA 3IJEB 1W9HA 3IIMA 1JYSA 1ZOOA 2HJVA 3IJRA 4FHEA 4Y6SA 4C4ZA 1VJDA 2CFTA 2ODNA 1XCGB 5I9SA 4P54A 2HF7A 3DLCA 2XXBA 2WQZA 3D1JA 2VPPA 4IQ8A 4Q7MB 4RVOA 3GJ8A 1E79D 1RRFA 5K2OA 1L7EA 5A02A 4AY3A 5KI6A 3NHPA 2W00A 4ZRNA 3VYUB 2JAOA 3KJZA 3M5CA 1CFJA 3PVZA 3OQBA 4TSFD 4EPYA 2EJUA 2QSUA 2WBLC 1JZSA 1KK1A 3EZXA 2ZB4A 4L0DA 3QA3E 3UJ7A 4FDUA 1FFBA 3X1XA 1SU6A 3CU5A 2OYSA 3HWX1 2J4CA 4QGFA 4UVGA 5JISA 1VL8A 5ICSA 1XDWA 4MWTA 2FWRA 3B20A 5HIKA 2PJRA 3X1WA 3UMCA 2J85A 1VBKA 4YCSA 2I2FA 4BLUA 1BCSA 1Q7EA 5AW3A 4AZWA 4DM4A 4F2DA 1PQUA 2Q8PA 1X1QA 3ZCRA 2YFKA 4QUAA 2Q2WA 4YAOA 1Z36A 4BNZA 5HP4A 4A0RA 5K03A 2A84A 1LNZA 4H3VA 5BWLA 1UKAA 3SQLA 1GCOA 1GZ5A 1NXPA 1WXEA 2BZ0A 3R6LA 2WOJA 5ICEA 3QK7A 2XQIA 1WDMA 1LNQA 2ABWA 4ZVLA 2LCQA 4CLHA 4D5GA 3ZVNA 1JJVA 1H2AS 4LW8A 2NO1A 2O4CA 4QPNA 4R1MA 1CUCA 2C7OA 4WTOA 5B7PA 5JXIA 1DBWA 2PD6A 5I9BA 3VMFA 3BTVA 5K0GA 2CFIA 2OAGA 3M4JA 3RNLA 1Z6AA 5ECYA 4D97A 3MMNA 1CT9A 4N01A 3PE3A 3RABA 1YOVB 5IJWA 2FCAA 1ZRHA 2DHRA 3FYUA 3VC1A 2QT9A 2W83A 3BMOA 5G0VA 3PC3A 1RI5A 3TQTA 2HHLA 3IA7A 1X1EA 1QM5A 2H1HA 3GUCA 2E6UX 2PIAA 1EDOA 2VT6A 3K9QO 1T2EA 4Q1EA 3DE1X 4IHQA 4ZT4A 3LXRA 4D02A 4OQDA 1Y4SA 3S1AA 5J5VA 2E9SA 2PYZA 5ICFA 1SKQA 5CLGA 1UJCA 2VF5X 5IKOA 4HEA1 1SBZA 3E7FA 3BFJA 1DTEA 1HLGA 1Z74A 3R0QA 4KQFA 4RPIA 1CBUA 1LWOA 1XCJA 4G63A 4WDQA 1I2ZA 1QH8A 4GGPA 3TQSA 2XCOA 3UFXA 2OTCA 5UKDA 3VKUA 4BCDA 3IYLW 1OH8A 5LZ2A 2I7CA 2PRSA 3N28A 4OYRA 1MC4A 3JQ7B 5B1EA 2J3HA 2YVQA 2B78A 3UA4A 5MGNA 2YXDA 1E0SA 1K8QA 2QF7A 3CUYA 3FHJA 4MQFA 1HT3A 2LBPA 4M7OA 2NG1A 2XQVA 3L7DA 1XFDA 3FF4A 2ZKIA 3NDRA 2GN2A 4XUDA 1EDBA 4U0KA 2W43A 2LR0A 1ZN2A 3M1AA 3DS8A 1PUXA 3OIGA 3U0BA 4UU1A 5DHFA 1H4TA 1EX6A 4IDBA 4EGAA 3AKZA 4I50B 1AS3A 4WNAA 1AO0A 5IBPA 5JS1A 4M54A 2YW2A 4ZAGA 2IK8A 2DQKA 2DX7A 4MVJP 1BGWA 1T9HA 3DTTA 5FADA 1LA2A 5GMOA 3AV3A 3VR3D 4BX9A 1KEEA 2GB4A 1Q2UA 4EAAA 1QTNA 2FJUA 3M6MD 3R7DA 1Q12A 4Z0TA 3RK4A 2WWIA 4F85A 1Q20A 3WAGA 5BORA 1EB9A 2LD4A 1P62B 3K1TA 4NWIA 3SVZA 4DLZA 1LKZA 5DTJA 4MPRA 4EHHA 1EBFA 4YDSA 2RHDA 1U0EA 1Z3IX 2I1VB 2YBEA 3OCUA 4F6LA 1MC8A 1E2MA 3W3AA 5C51B 3H6KA 3NBQA 1BDHA 4PZEA 3CVOA 2WDPA 4MW1A 3E82A 1AH2A 3MAJA 2PU5A 2QN9A 3EZGA 2IGTA 1BEEA 1T6NA 1YI1A 3V7WA 4ZTZB 3UENA 3L1KA 1RQPA 3TZCA 3VNBA 2WWHA 2ZYGA 4JYZA 1PZXA 4IGKA 3H2KA 2W6OA 4XYGA 2BM0A 4XA8A 1J70A 2RGYA 1W1WA 4E33A 4XYLA 3H0EA 2V7QA 3ET5A 1TQHA 2IEZA 1ETHA 3NU1A 5DLEA 2XRMA 3RARA 4M38A 3BGIA 1KOFA 1L5YA 4UDOA 3NHFA 4GPIB 3N2EA 2UUCB 1Z47A 3EWNA 2V96A 3KT3A 4CM6A 3TGLA 4LXXA 1RNLA 4J43A 3DONA 1JH9A 3V8PA 2JVKA 2PUWA 1T10A 3KQHA 1Y1TA 4K0RA 3OZBA 4MROA 1KSFX 1TB4A 3AWDA 3IELA 4C30A 2AEJA 1SCAA 1O0BA 3O3CA 4ZIRA 5E1BA 4ZEMA 1TGVA 3LVRE 3A06A 3SXUB 2O2DA 1RWVA 4W1PA 2GAAA 5HMMA 1V2GA 4IDQA 2BCGY 3FSRA 2A3RA 2ZIWB 3WDLA 1JQDA 3LGXA 3WLLA 3WGIA 1FS5A 4R98A 3ADPA 1NJFA 3KR0A 4UFNA 5KYGA 3OZDA 5L51A 4IG9A 3RVBA 2FN4A 1LCIA 3ABZA 2NGRA 3NONA 1FRVA 4F21A 3FWKA 4MKXA 1FZTA 3S3TA 1NUUA 2P9ZA 3R0XA 2UUBB 3KHKA 2ZI7A 4B6EA 5A03A 2Q28A 2G9RA 4FDLA 2VF7A 2QRVB 3IDZA 3EG5A 3KYBA 4OU5A 5P21A 4L1KA 3ZU3A 4QOSA 1JYEA 4EHNA 1DC5A 1ZCJA 1E99A 2LVBA 3I12A 4GE3A 4NAUA 1CKEA 1VKZA 3FHLA 4OVKA 2VK1A 3RJTA 3EFBA 1W59A 1N2JA 2F3RA 5JXHA 1U9CA 3MA0A 2AOWA 4IDFA 4OREX 1Z22A 4MUHA 4YMWA 5KOHA 1TECE 2MCFA 1XTZA 2Q6VA 3QOXA 3W7BA 2OEPA 4KWHA 2BISA 2DFTA 3WZMA 5IPFA 4ZYUA 2GILA 4KQ1A 3ZWDA 3SMQA 1Z4PX 1VPTA 4FFSA 5LA6F 2D8MA 2IDKA 3C6ZA 3IQXA 3L4BA 5J3JA 2QYOA 1PEAA 1BW9B 2WK1A 2IF2A 2VJKA 1F8UA 3LQQA 2QK4A 3Q88A 4JLDA 4W1RA 3RS4A 3AI2A 3SJBA 5I9LA 1KI8A 4HGPA 2AH5A 5FI3A 5DHQA 3ZJYA 1PK8A 4RLHA 4Z8YA 2WJAA 1FXUA 5DCLA 3NUQA 4HYEA 1W85A 1VYVA 4DPLA 4D0GA 3LYLA 1TM3E 4LSWA 3JVIA 3V7NA 1Z4JA 3K0AB 2JVIA 1NN5A 1FRQA 1SCJA 3MT8A 3ST7A 3CPEA 5CFQA 4YRDA 4US0R 3ENQA 4X7BA 1SVIA 3LPMA 4ZMRA 4B5KA 4FFOA 1RHMA 3WYNA 4RKRA 3SY8A 3UQYS 1U9YA 1XZFA 1IM2A 4OG2A 3PD0A 4IDEA 4RK1A 1XJ0A 2H1SA 2X5KO 3G5UA 4BNJA 3P52A 1C1YA 4Q39A 4YMGA 1GPBA 4LHZA 1JX6A 3RJZA 2KLBA 2A4MA 5JECA 4JJFA 4PS1A 4RXMA 1PT5A 1X1RA 5AVJA 2NN3C 1GRCA 1O58A 1QX4A 2Q9CA 3F8WA 4ZYXA 2IS2A 4LX8A 4PYJA 1B0AA 5IEJA 3W78A 4FYXA 2AG0A 4RTJA 4L22A 4HZIA 5ECWA 3BWCA 3ROTA 5JXWA 5GIPE 2W8BB 3CBGA 1T25A 2VYVA 2OOKA 4JU9A 4XKJA 1X7HA 2VEOA 4GP7A 5EZYB 2JFVA 2I7TA 2ZRFA 3MOSA 4B6GA 1P7CA 1K66A 3PLNA 4AUEA 3FR7A 5I45A 2P9EA 4ZP1A 1T3ZA 5ES3A 3ICVA 4X64B 1SUWA 1NI3A 4M0EA 5TNXA 1L9KA 3TS1A 2WA1A 1TKAA 5L4SA 4GBED 4IIDA 1N5MA 1P2SA 4MI9A 5JSKA 4C6HA 2ZIAA 1LK7A 1YFKA 2BEKA 2HT6A 3HFSA 1NVMB 2EGUA 3I2GA 4M53A 3VYRB 4BB5A 4ZT5A 3WLMA 3CRNA 3IURA 2H6EA 4YAJA 3UK7A 1SC1A 2C07A 3C7DB 1HE4A 2YV2A 4TTVA 2G0AA 3WNCA 4DLPA 3NT5A 1DOZA 1E18A 3SYKA 3ESXA 1ZIYA 2Q99A 5JSHA 1U8ZA 5FH9A 2WV9A 3REOA 5AQ1A 2X0DA 5CBPA 4O0MA 1GLNA 1QSGA 5ESDA 1JPNA 3WYBA 2YR0A 4TKUA 3RSQA 1YZVA 2WTMA 3B2QA 4U2CA 1HH4A 4EW3A 3F0TA 3OD1A 1U0FA 5ALIA 1QP0A 4GQBA 3PGA1 1N5DA 1LSJA 3GRUA 3UJNA 1W36C 3AL0C 1WXFA 2AJTA 3QW4B 4BL5A 3DAGA 3FSGD 1V4VA 1C3VA 1ID8A 3RUPA