3X1JA

Crystal structure of phosphopantetheine adenylyltransferase (ppat/coad) with accoa from pseudomonas aeruginosa
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
158
structure length
158
Chain Sequence
MNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLFSLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transition of phosphopantetheine adenylyltransferase from catalytic to allosteric state is characterized by ternary complex formation in Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa 2192
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
total genus 53
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2014-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3x1jA00
3G59A 1QRUA 3TNJA 4ZCPA 4KR6A 4PBSA 1O95C 4KPUB 4EG8A 1YIAA 3PNBA 2D5BA 5HG0A 4ND7A 4S1OA 1NP7A 4MWEA 2DEUA 2PZAA 3UY4A 1J1ZA 3KT8A 3CLSD 4YP6A 5BNZA 1G8HA 1KH2A 4ND6A 4MW6A 1EFVB 2JANA 4A91A 4PY2A 1NUUA 1KQNA 2A7XA 1VBNA 1KAMA 1O6BA 3RHSA 1GTSA 5FO0A 3H99A 1MB2A 4EG4A 1WXGA 1TYBE 4R2LA 3SEQA 2CSXA 3KFLA 2E0IA 3IVCA 3SEZA 5TS2A 1M83A 2PZ8A 4ZCTA 1MBZA 4U7JA 4KR7A 3IH5A 3A05A 4J76A 4DNXA 3ZXSA 1O0BA 1JHDA 1KH3A 3UOWA 2O8VA 3HFJA 3IVXA 4AS1A 1PFWA 1M8PA 4EG3A 1CT9A 2TS1A 3RFFA 1T9GR 3NV7A 3H9CA 2GKSA 4PBTA 3IUEA 1J09A 2CV2A 4HJRA 1JIJA 3IMCA 2IP1A 5J58A 1PFUA 2PZBA 3IDFA 3ZIUA 1VBKA 2RE8A 3P0JA 4ZT2A 4QRDA 4UZFA 1COZA 1IQUA 1A8HA 4EF6A 4KPUA 1TEZA 2OQ2A 4G6ZA 3QTTA 1WJGA 3CA8A 2J08A 3H9BA 1YI8A 1M8GA 1EFVA 3Q4GA 3FOCA 1V47A 4YBRA 3HMQA 5H7XA 1T6XA 2OV4A 3Q12A 2CUZA 2VTBB 5TGTA 1ZH0A 3N05A 3RBAA 4EGAA 1U7DA 3ND5A 3AKZA 3ZGZA 1WY5A 1GLNA 3TZEA 3IUBA 4ZT7A 4F4HA 2PG3A 1LI7A 2PFSA 4I6EA 5K0TA 1IQ0A 3H05A 3CLUC 4MWBA 4MUNA 4NX2A 4EG7A 2CT8A 1ULHA 4ZCRA 1WXIA 2AZXA 1WOYA 2ZUFA 3IMGA 2NZ2A 1LW7A 1H1TA 1N2HA 1ZUNA 3LOQA 4OUDA 5JBNA 1KQPA 1MB9A 3CLRD 1FYDA 3CLTD 2QUIA 2Z09A 3CVYA 1N77A 3L93A 3CLSC 2QTRA 3FNRA 1WZ2A 2QTNA 3K9WA 4JZYA 2E21A 1WXHA 3X1KA 4ZT4A 3RK0A 1EJ2A 3ZJVA 3MLBA 1U3CA 4ARCA 1PFYA 1Q77A 3IOBA 4YP7A 2E89A 4G5FA 1IHOA 3L92A 3ELBA 2CYCA 3IVGA 2DUMA 3FETA 1KP2A 3ZJTA 2V0CA 1IVSA 3UK2A 1OWLA 2QUKA 1XNHA 1GTRA 1ILEA 4ARIA 4K03A 4JXXA 3OTWA 1DNPA 3VU8A 2AKEA 3CVVA 1KKUA 3TS1A 1G8GA 2CFOA 4NATA 2DPLA 3MLAA 3CVUA 2XRZA 1MRZA 1TYAE 2EL7A 2YWBA 3SZGA 4ZT6A 5H16A 1K4KA 2EJCA 4MUJA 4WSOA 4XFJA 5TEVA 3X1MA 4DDMA 4DDHA 1N2GA 2DXIA 3KT0A 1Q11A 1YULA 1IRXA 2GOYA 3NBKA 3VRHA 1QRTA 3FHJA 3S3TA 2A4MA 3FH0A 1O5TA 4NAHA 3QE4A 4MQ6A 2WSIA 4YMIA 2CV1A 3JXEA 4CT0A 2A88A 1FFYA 4PBRA 1U0BB 1GAXA 1KORA 2X1MA 1K92A 1R6UA 1T6YA 4NAUA 1H3NA 3MMXA 4MW4A 1M1ZA 2YWCA 1JIKA 3AFHA 4DLPA 3FG9A 2Z3VA 4MAFA 3KT6A 2IJGX 4MUGA 1Q19A 5EKDA 4MVXA 1QU3A 3COWA 4MW0A 3A2KA 2YY5A 1I2DA 5FO1A 5KHAA 1M8FA 4QBTA 1MOPA 2I1LA 3HZRA 4E1AA 3IOEA 2J5BA 2PIDA 4I6GA 4L2IA 4GRIA 1BS2A 5IJXA 3MXTA 3OP1A 2X3FA 1UFVA 2YXNA 3NBAA 4RPIA 4CDMA 1KQOA 2XRYA 4BWVA 3CVWA 1N2JA 4G5YA 1QQTA 3IOCA 2CV0A 4MWDA 1GN8A 3INNA 3VGJA 1NUPA 5IHXA 1JIIA 4NDAA 1OWMA 1O96B 4JYZA 2G36A 4MWCA 3SP1A 1KP3A 1EE1A 4L2IB 5KCMA 4R0NA 1WQ3A 1MAWA 1S4MA 1O97C 2A1TR 3F3MA 3I05A 1TQ8A 4DJAA 1I6MA 3D6VA 1JEDA 1X6VA 3PXUA 3COVA 4MW2A 4XSVA 3ISJA 1VL2A 5LFAA 4WNYA 4U63A 2H29A 1T9GS 1NZJA 2RD2A 2J4DA 1U3DA 1KR2A 4MLPA 3FI0A 4OUDB 1B6TA 2HZ7A 1R6TA 2CYAA 1NUQA 1QJCA 3HGMA 3MUEA 1EXDA 3N2YA 1Q15A 3CLRC 1G59A 4MVWA 2A86A 2E18A 1VLHA 2O5RA 1K4MA 3E27A 3GMIA 4EFKA 1G8FA 1O94C 3COYA 1N78A 2A84A 1EUYA 2JA2A 2DLCX 3IODA 1JILA 4J75A 4GU5A 3FY4A 4JXZA 1N2OA 4EG1A 2C5SA 1O96A 2QJTA 3UMVA 3LE8A 1MAUA 3LCJA 4NZPA 3U1VA 1F9AA 4MUKA 4ZT3A 2J09A 3CVXA 2DERA 1NI5A 1R6XA 1J1UA 3G6KA 1OWOA 2PXHA 5TEWA 1M8KA 5HUJA 2QUJA 3SZ3A 3IMEA 1OBCA 4ZCQA 4X0EA 1MC1A 1J20A 5AHWA 4HPWA 1I6KA 1WXEA 4OJMX 1RQGA 1EUQA 1H3FA 2V0GA 4U8HA 1KH1A 3N8HA 4I6JA 2QTMA 3UC5A 2JAXA 1K97A 1OD6A 1IQRA 3N9IA 4YP5A 3ZJUA 1LI5A 4MUEA 3P0HA 3RJZA 4MUIA 1VBMA 3FWKA 1NSYA 3D6UA 1O95D 1QTQA 1PG2A 1IFXA 1J70A 3BL5A 3AL0C 1QNFA 1NURA 4Q93A 3A4IA 4MW1A 1PG0A 2X0KA 3TZLA 1N2EA 1WKBA 2WQ6A 4CQNA 2QJOA 1PFVA 4MW5A 3GLVA 4EG5A 3CLUD 2CYBA 4HK4A 2HGZA 1N75A 3SYTA 1GPMA 1P7PA 5KWVA 2NSYA 3X1JA 3ND7A 4KR9A 2QJFA 3M5WA 1ZH6A 1JGTA 1OWNA 1D2RA 2A1TS 3CLTC 3QTBA 3ZXIA 3DLAA 4K0RA 2A1UB 1QRSA 1TFUA 3FDXA 1J21A 1N2IA 1XNJA 2ZP1A 4MULA 2DR2A 4QREA 1V8FA 4H3SA 4ZT5A 4MW7A 4R2MA 1X8XA 4AQ7A 2D54A 5K0SA 2BYTA 3DO8A 3AG5A 1EFPA 4DDKA 3SDBA 3PRHA 2J07A 1F4LA 4MW9A 3FIUA 2D13A 3K32A 4KKVA 1TYCA 1HYBA 1YUNA 1QU2A 4Q16A 1H3EA 2A1UA 2VTBA 1NUTA 1JZSA 1F7VA 1U7XA 1O94D 1OWPA 2QUHA 5F23A 1KAQA 1F7UA 3Q10A 3CR8A 1IH8A 3C8ZA 1XNGA 3KT3A 1EFPB 2B7LA 5DEOA 2DETA 1T6ZA 4RUKA 3AG6A 2IELA 1TYDE 3AIIA 4UZEA 5HUHA 1MJHA 4ZCSA 1Y42X 1JEEA 3GUZA 1JMVA 5DASA 4MVYA 3HL4A 4HJXA 4EG6A 5FNZA 3COZA 4MVCA 2BTEA 4P2BA 1NYLA 1SURA 3P52A 3ZUGA 1I6LA 5DK4A 1N1DA 3HV0A 3PNYA 3PNVA 1YUMA 1NUSA 4DE5A 4MUFA 4F3RA 4TS1A 3TQIA 3RK1A 4CDNA 3H97A 3DPIA 2Z08A 2VXOA 1WQ4A 1JECA 2H2AA 1M8JA 5DB4A 5J5AA 2GM3A 3TQOA 2WQ7A 2X1LA 1WXFA 3ND6A 4MUHA 1XJQA 1N2BA 3G5AA 4FZJA 5J59A 2R5WA 4JFAA 2WB2A 2HMAA 1O97D 1JZQA 3ILVA 1GZUA 2AG6A 1YIDA 3DV2A 5LM3A 1OBHA 1N3LA 3P0IA 4XFDA 5LLTA 3A04A 1O0CA 2ZUEA 1ZJWA
chains in the Genus database with same CATH superfamily
1LDYA 4XXHA 2P5UA 4EQ6B 3O4RA 1HX7A 4Q3AA 2EWMA 3P9QA 2OXCA 2FG6C 4MWSA 2QSJA 3A1NA 3GBPA 4O2AA 3AY7A 4Q0MA 3EUAA 3I4LA 3GGCA 3KB1A 4IICA 5AJYA 2YQZA 3TJRA 3I62A 4S04A 3L02A 4YCSA 1ND5A 1FDIA 4G8BA 1NKSA 3KT8A 1A88A 2CHUA 2BW0A 3W3AH 2ZIEA 1R0SA 4YXWD 5I7FA 2A7XA 3RNLA 3FW1A 1R4ZA 3K6KA 5FHQA 3DMGA 1N33B 2P2YA 4GR4A 3VSEA 5ER6A 4CCYA 3AOEA 1P4RA 1WXGA 5BVHA 5KNBH 2GJAA 2ZREA 1U8UA 3PT9A 4AYXA 3G9TA 4D96A 1USKA 2ZT8A 3U3ZA 4E32A 4HN4B 3OF3A 3WKBA 1J0AA 4OQPA 1YB5A 3KZCA 4RQTA 5TS2A 2ZUTA 5JALA 4GL2A 1QLWA 3F9IA 4PSAA 5KQSA 3UAOA 3GLRA 4GMFA 5DISB 4KR7A 5LOVF 1VLQA 1IL0A 4AF7A 1FUUA 1ID8A 1MEEA 3ABIA 4LNUB 5AW0A 2K2QB 5T5QA 3W34A 3G2HA 1OXVA 4LHVA 5KNDA 3WGVA 2FW7A 3C7AA 4CLOA 1EVIA 2SHKA 7ABPA 1PNRA 3FF1A 5BN5A 1XQVA 2ONYA 1FBTA 1W49A 1PU2A 2QGNA 1DMSA 3VSAA 4HLCA 3ZBTA 2FWMX 2FF5A 2ZJ6A 2C4KA 2I71A 1UZMA 4P84A 3G8AA 2EKQA 2Y1EA 5F1PA 2C00A 4CTKA 2I65A 2BELA 3R5JA 2VJNA 4G01B 1MAVA 3D6JA 2PZBA 3CRNA 4LF6B 1OI2A 4I9HA 1VBKA 1VPDA 1X77A 3BBPA 2OYRA 2FKNA 4CCSA 2RE8A 2P4UA 2O2DA 1X7YA 3EA5A 3CZ9A 5E8JA 3UM9A 3O31A 5JBQA 1V11B 1RYHA 2QMUA 3M1LA 4RTJA 5KOHB 2EFEB 2ISCA 4OBXA 2GB4A 4IYRA 1V1JA 3RVNA 4I9NA 3QHPA 3KYCA 4WK2B 4OU4A 3D6AA 5CXXA 2LVBA 4RV5A 4RJTA 4FFMA 2R47A 1ZIYA 4O4JB 3IQEA 3G7NA 4OEHA 4ITUA 1E18A 3F47A 1E3DA 1PWXA 3EGWA 3MB8A 4GOOD 2GSWA 2AQKA 2CBGA 2F1IA 2J32A 4WN9B 5HR5A 5I7EA 3OQIB 1ORVA 1G3RA 3ZXXA 2XRFA 1QPZA 2LZ0A 4BQQA 1X7GA 2LE0A 1I4OA 2JB9A 2PL1A 3ZV7A 5GM2A 3EDRA 4UNSA 1OOEA 1F3OA 1QGUA 1V43A 1QVVA 3DM5A 3KTAA 1ZZEA 5A3RA 2HHHB 2ZWIA 2W2OA 2EP8A 3TRJA 1KHHA 4J91A 4KLNA 3BGIA 4NZOA 1QOPB 2JAHA 4ZRNA 3U3DA 4LI0A 4UHHA 3HJAA 3JQ7B 2V7XA 4C06A 2HUPA 2BGMA 2GZ2A 3DE2X 4Q3DA 4M3NA 3RADC 1DX4A 4LRTB 1TTPB 4OO3A 5C8ZA 2Y0PA 4DL9A 1LW7A 3MS7A 4GHWA 1QDLB 3ZCPA 5I8WA 4ZJPA 1KQPA 4LFAB 3AVXA 3TX6A 4C07A 4RZUA 4KFSA 3RAEC 4KO8A 4EKEA 1T15A 3DHYA 1U99A 2XNCA 3F73A 2I76A 2IPNA 5A3VA 1ZBDA 3RRXA 3BCHA 1TLTA 1NSTA 1XHLA 2PEYA 3AF0A 4J0HA 2Y1DA 3DYBA 1Y4DE 3LCUA 5BWLA 4HZUB 1EUCA 2KQUA 4MP8A 3KNZA 3PGKA 4OU5A 4BJHB 2QN8A 1T36B 5SY9A 4ENTA 3O93A 3CC8A 3GFSA 3BJEA 4JLMA 4F8EA 3ZTTA 4INPA 2QVCA 1CY2A 3U39A 3TR0A 1H4SA 3B9BA 1T24A 1V3UA 3EVZA 4NDNE 4BFXA 1FX0B 4KNYA 3EVEA 1QIHA 4B71A 1TE2A 4HB4A 4ER0A 4JY7A 3A0RB 3OWOA 5AOCA 3OPYI 4UE3S 4WVFA 4BGUA 1WMAA 2AEJA 2JJ2A 2VSYA 3PENA 1SIWA 3TPFA 4PLFA 4H4DA 4Z8XA 4DCGA 4JS0A 5GONF 1SG9A 3HJUA 1SOWA 4ARZA 4TUYB 3Q6IA 4WW0A 4E5UA 2XTJA 3ZWBA 2E4AA 1KKUA 1AO3A 1FNSA 3QEBZ 3D7RA 3V4SA 3ZHVA 4C3ZA 2DPYA 2E4XA 4R51A 2K2WA 5DLPA 3N76A 2DBVO 2YRXA 3BMQB 4ZCLA 2G1PA 4X91A 2MMGA 1L5ZA 3MSXA 1G5RA 4FLFA 4N9QA 3DVRX 3ON5A 4YUVA 2QVBA 3K15A 3SC6A 2WMOB 1VE3A 3T4XA 4E31A 4EB6B 1Q0PA 2QLBA 1HEUA 1M76A 1XZGA 3BB4A 3BTVA 1GTMA 3INGA 3HZOA 4BWGA 1UK9A 3BWBA 2O3TA 2VJPA 3JARB 3I45A 2FNAA 3R8FA 3S3TA 1LDMA 1ZX1A 2WDZA 1UBRS 1KZ7B 4AD8A 2VYFA 5JNTA 3MT9A 4OOFA 4DXHA 4XR9A 3TR5A 4EAAA 2IW3A 1W9MA 8LDHA 2XGSA 3NGXA 2O7RA 4P7JA 4DIDA 2P11A 3HPQA 1R6UA 2ZBFA 1U2PA 2GN4A 1PTJA 2NU6A 2Y92A 3INRA 4FKMA 4K5QA 4WNAA 3I5XA 1ZD9A 5GOTA 3RB8A 4A7PA 1BVHA 4V0KA 1JLHA 3RQIA 3KJHA 3B1ZA 1E3MA 2I3BA 2PGIA 2ZRJA 1CEYA 2JD0A 2A78A 4IQ0A 3GVPA 1J9EA 3TSOA 2ZI9A 1S1CA 2AFHE 3C43A 3MMZA 1CQIB 2A9PA 3O7MA 5CPBA 3CS3A 2XUGA 2Q3BA 1OGJA 1VGRA 1LU9A 1VIDA 4P3PA 1JW9B 2QE6A 4XSHA 2HHLA 4YJ3F 1C4WA 4XLLA 1MOPA 1NKVA 4PWZA 4V1CI 3VC3A 1HEYA 2PMEA 4W5NA 2GN8A 2I4TA 1C1HA 1JHYA 3MGCA 4AROA 4DG9A 2XCSB 4HDNB 4JJGA 2ZT5A 2GZMA 2Y2VA 3A7EA 5CJJA 1X74A 3OJWA 3WP0A 3ENKA 4HMOA 1H0RA 1O08A 3PNPA 4PFQA 3ICCA 5CH3A 4G36A 2XTZA 3C1TA 1UFVA 3ITKA 5JCXA 5H59A 2GZ1A 5E9WA 3U37A 1I3CA 2BH2A 4PQRA 3B3AA 1KAEA 4RYLA 4TOIA 5AI0A 4RPIA 2P65A 4QGHA 5FUQA 3PFBA 4F60A 4I8IA 1N2JA 4XYEA 4E1BA 3PQ7A 4G5YA 3EIHA 1HQDA 4MWDA 1CDEA 1IONA 1P31A 3WJAA 1C41A 1H0KA 2RHOA 2Z9DA 3G5LA 4RF4A 3WWPA 2I78A 1EE1A 3N7UA 5IJ9A 3A1EA 3CINA 4R8VA 3T9DA 3SZLA 3RHZA 4JLSA 4CPDA 5A4FS 4H6WA 5HW0A 1LXCA 2C59A 2VH5R 3I05A 3F7MA 1VG1A 4BO6A 3G23A 3P2IA 1H2YA 3W5SA 6YASA 4LJYA 3JYHA 4Z3DA 2J59A 5I51A 4K88A 4N7BA 3RVDA 4CUKA 2G77B 2JLYA 3R2JA 2ENUA 4R8KA 4RMIA 1CTQA 5AJHA 4Z4CA 5L4NA 4N49A 4Q66C 4QXQA 5DTEA 4FHDA 1ZAKA 3WYAA 3A1UA 5AW8A 4X1OA 3PPWA 1SVSA 3FROA 2QAGC 1YQWA 3PEWA 2Q45A 4B4UA 1GNPA 1HQKA 4IOJA 2OYSA 3HCOA 1VE9A 5ESDA 1B0ZA 1XELA 2FFAA 3EFEA 2BI8A 5B3KA 5CEEA 3VR6D 3EQ6A 4LAFA 4NOLA 4Q1FA 4DTCA 3A4LA 3TVYA 3H86A 1ISFA 4XR4A 4XPIA 5CVVA 1JDNA 3EQ9A 5AK6A 5DTJA 4IQGA 4KXLA 4NYMQ 1HLFA 2WJIA 4FNAA 1G8PA 4Z51A 4BMNA 1KC3A 1R9GA 4NZYA 4WK4B 2WTAA 4BKUA 1YS6A 4Y1FA 4MI3A 1GP2A 3NOQA 3GMIA 3FM9A 3N2IA 1ZAYA 1N8TA 5L95A 3PJRA 4DR4B 3F6SA 1NXSA 1CUFA 3DTNA 5HFJA 1BA2A 3P32A 4GQIA 2P1DA 4XVRA 1X15A 2PGDA 3HUEA 3JD4A 4DIUA 4B3GA 1H93A 3DWGA 3FDIA 1LDBA 1PFQA 2OO5C 4DLVA 3VZSA 3TX2A 4CKWA 2NUAA 3LDUA 5EE9A 3DT6A 5E2AA 5AW7A 1T4DA 1NVAA 1K7SN 3LE8A 4ZVTA 3UK7A 4JB8A 2O57A 4DDTA 1XA3A 1V5IA 2HDOA 3BXPA 3JTEA 2X77A 3CNOA 3PPYA 2ZB8A 4Q9DA 1RE1A 4X0EA 5HTKA 4DIOA 3SBDA 4NVRA 3MYYA 4HPWA 4GIBA 5DSZA 1QYRA 3H1EA 4O8CA 3WNQA 1LNQA 4V38A 5A4IS 2UXCB 1BCRB 2FWBA 2ODBA 1CG6A 1FVFA 3CXUA 4UCXA 3H0KA 4DQLA 3AHHA 2IHUA 1FW6A 2A0KA 2N3ZA 3FCSB 4PRZA 4MUXA 7YASA 4IKOA 4LC1A 3ANMA 4Y2QA 4DCOA 4DMFA 5CCEA 5BSMA 4DLRA 3FFXA 1ACLA 1I5OA 5AK5A 4H15A 4G89A 4HX5A 1O95D 2C9CA 1PT7A 2I3DA 1HGXA 1QFXA 1PHRA 3FMOB 4ZTBA 4DNQA 2JF0A 3P2YA 3OFNA 3OT5A 3REGA 4CMIA 1OX4A 4YMVA 1T1RA 3KETA 3VDNB 3QMVA 2FEKA 1PEYA 1D4ZA 2I8AA 1OJLA 3UNXA 4A15A 1IPEA 3KUCA 1XPOA 4RXMA 4X94A 3EJ6A 3ZDBA 3SIPA 4WEOA 5GWXA 2V7TA 3IT2A 2OZLB 4C2BA 2X3YA 4C05A 3MRVA 2HA6A 4L28A 5IJ0A 1FA9A 2GHIA 1RAHA 4MYSA 5C7LO 2NAPA 2C4VA 4KB5A 4TTRA 5JVDF 2PKEA 1GPDG 4A73A 4X9XA 2KX7A 3I3OA 1LFDB 1UOOA 3X1JA 4J2OA 5AVVA 1SHTX 4KODA 3AFIA 4P4SA 5DGCA 2Y1FA 2JFNA 2A1TS 1ADYA 1C30A 4ZYVA 4CGZA 5AO9A 5A5FA 3WGZA 1LPOA 3WGTA 3GJRA 5LWQA 1HDEA 1LY1A 1Z88A 2FZVA 1UT8A 1UXGA 2A30A 1ZNXA 3B9RA 5CXSA 1T5IA 5BYJA 4AS3A 2I66A 3PFHA 3KKKA 4N7JA 4RZ3A 3H0EA 4WGGA 2IGTA 3UMBA 1CIJA 1VP9A 1QP0A 2QVGA 4N76A 4ZT5A 2IDZA 1X8LA 4L02A 1R0YA 3CKYA 4RPKA 4F5EA 3DBHA 4KUGA 5BWMA 3DE0X 3AF2A 3HWRA 3P19A 3PUZA 4FTWA 4KO2S 4KV7A 3RROA 1CFZA 1VL6A 4B35A 4B3HA 4ZDJA 3LU1A 2AC7A 4P4SB 4H0CA 5C34B 3PUYA 3PDIB 4LXTA 3T7DA 3IX7A 5JSUA 2JLBA 2YJ5A 4W8HA 3VYVA 1X92A 1GSAA 2A5JA 1JSRA 1X7DA 1UODA 3JASB 4IDEA 4LYYA 3S5JA 3UTDA 3AVVA 1MH9A 1H3EA 1BX1A 1DCKA 2VDWA 4PZCA 2VNJA 3JWIA 4DJEC 5F2NA 1RAAA 2IHTA 2LD4A 5EY5B 2BI4A 1BKYA 3H2ZA 3QPUA 4JJZA 2WPNA 4MPTA 1WM1A 2AFHB 3L8HA 3WQBA 5A6SA 3W5UA 4HZGA 4XIFA 3RUPA 3AMVA 5B1EA 4LJ9A 2X6QA 1E61A 4H4EA 4FXOA 2R84A 2BFEB 4XD2A 2R6CA 2XD4A 4ZOCA 2JGNA 1MO6A 2R7LA 4PG6A 3IERA 3AJEA 1QP4A 3ZQJA 4DA7A 3M9LA 1BJTA 4TSFA 1I3OA 5J23A 2Z6VA 5LMCA 4JLDA 3C6ZA 3KHSA 1XEXA 5AVOA 4M53A 1U2ZA 3NHBA 3ROTA 1SHJA 3VO9A 1MAAA 1N7HA 1RFGE 2COUA 2P30A 3EXIB 5FKJA 4F5DA 1YVPA 2P68A 4FMCB 1MFZA 1VOTA 3FVVA 2F7SA 4XM2A 3H1TA 5TJ9A 3STWA 1POWA 1FX1A 2WM3A 4DE5A 4FB5A 1E5XA 2F90A 3ZNPA 2Q1YA 1BE8A 3GDHA 2XCIA 4NZZA 1RCUA 3U5TA 4AL4A 4BNMA 3WMFA 2PVSA 1WQ4A 4GZLA 1JECA 2YS7A 4EYOA 3PKIA 4IXDA 3I5UA 4IGKA 5F5LA 1TGYA 5CB4B 2CVFA 4D0RA 1W52X 1C50A 3CR3C 5AKIA 3RV4A 5ICGA 3WBBA 2XNDD 3KQHA 3HSSA 2FOIA 1N5LA 2RB4A 2KSQA 4E22A 2F1OA 4C5AA 3TI9A 1JZQA 1SR8A 4HH4A 4I36A 4LYFA 1TRHA 2A9RA 2AEMA 2ON6A 3ENVA 4F8JA 3F90A 2O0HA 2QVXX 5F2KA 3PU6A 2B92A 2Q07A 4CLEA 2GPBA 1Z7YA 1H42A 2IHBA 4E7OA 5KNBA 3WAGA 2AWOA 5DKFA 1Z4KA 3K0CA 4W7HA 1I94B 1LVUA 3I12A 4R41A 4WPGA 4P2GA 5EHGA 1A8PA 2PZAA 2E7ZA 4AKTA 3SY8A 5JNLA 1JFTA 3HNOA 3SI7A 3CW8X 1NATA 1J0CA 3FUTA 4ND6A 3AT1A 4RWEA 3AVPA 5AXDA 1RXVA 1QTIA 1XTBA 2UYHA 3T9BA 1H0SA 5A7HA 1DV2A 3KELA 3MINB 1L7EA 4P36A 4IPTA 1ZJYA 3LY9A 4D42A 1D6NA 4XOUA 4WZAA 3DFZA 4DN6A 1IBSA 3WL8A 4ALJA 3M4NA 5AI4A 1Q44A 2QM7A 2CSXA 1IOLA 1IMOA 1ZVKA 1WZNA 3DAOA 3FCAA 4QJ4A 4WWHA 5B3JA 3L79A 4L51A 5DMHA 1W46A 1WA5A 3G49A 5JEDA 4XIJA 5JW6A 3I53A 2J33A 3WVNA 4GXQA 3FKSD 3LX6A 1OYVA 4CQJA 5CTJA 1UBLS 2C0QA 4G41A 4TX1A 2QTHA 1L8AA 3HLYA 1JSLA 1WZCA 2NO0A 2ZJZA 3BK1A 3OSUA 1W2GA 4D0GA 4HBGA 1O0BA 1BKSB 1R8SA 3IKMB 1WUTA 5GPBA 1YT5A 5J63A 5TQ2A 2GD0A 1M8PA 1NLFA 1X70A 1KGSA 1Z6ZA 2WWRA 4GLJA 4NJMB 2M98A 3CV3A 3F96A 3U13A 4C29A 3RFFA 1OB2A 1ZD3A 2GZRA 1LTKA 3KJGA 3VR5H 2P8JA 3KBBA 3WBKA 2HX1A 3TMAA 2AOTA 3QBDA 2MWMA 4CIYA 4JJ7A 2VJMB 3FSJX 1JIJA 5DYGA 1E3EA 4PANA 4YAEA 1YB6A 1JKJB 4I5DA 5JD3A 1U5BA 2AXNA 3QVWA 3KQKA 4RQAA 1JKMA 3O2JA 4I4TB 1SKMA 4RGVA 4TSKA 4P35A 1HZJA 1V1RA 1XZPA 3DMPA 4X8HA 4YT5A 4O2BF 3Q6MA 2YWEA 1A8HA 2Q9AA 1I6WA 2BI7A 2GCNA 1DAGA 4RMGA 3G0DA 4QXOA 5L4LA 3AW8A 4JQCA 1B8OA 1Z7WA 2J9YB 3G9ZA 2NADA 4KK4A 4UU8A 1WJGA 4BC0A 3M2TA 3KYBA 3IBFA 5EHIA 4O4IB 4MITA 3I2FA 3M5CA 3VUFA 1GOTA 3IXMA 3PEEA 3PFGA 1MRSA 2HWKA 1K0UA 1M34B 1RWNA 2PUTA 3KXDA 2CY0A 3N8NA 4KG7A 5LA6B 2XT6A 3ZXYA 3QE9Y 3CMCO 5CD1A 1N4DA 2PAAA 1FDTA 2IZOA 4R5HA 4EVQA 1JSCA 2Q5IA 1RM0A 4W7IA 1PJQA 5IAOA 1XBTA 5CK4A 2EBWA 4YT2A 1SBHA 1EDZA 2JJQA 1XTSA 2YXDA 2BFCA 4KE8A 1B0PA 4ND5A 4S0ZA 3U40A 4FNMA 3ORFA 5AK0A 3ZDRA 2HMUA 3H2HA 3BDIA 4WEQA 2KBFA 4BLOA 3A1FA 5LBIA 1YZGA 3EC2A 2P91A 3JQBC 3MMPA 1C8LA 4PZUA 1L1QA 1M2GA 4C0BA 5GJBA 1P2SA 2J3EA 1V95A 2BEKA 4KC0A 1GG5A 1O1YA 4XDGA 2IEAA 1E2EA 4L4XA 5D5PA 2J30A 1VG0B 4QQFA 4DDWA 1OVMA 3TEFA 1DLJA 4DYDA 3R6DA 3W3AA 3J81k 4GPZA 2A0YA 4Q00A 3FVQA 3II6X 3WYNA 5HSGA 1V2HE 3CLSC 5SZIA 1XR3A 4JZYA 2FUG6 1E0AA 1TXGA 4AO6A 3FX2A 1V8PA 1ZR2A 3LG2A 3P9ZA 2XDAA 1QH0A 4Z86A 2V7VA 1DWQA 5IWCA 5LR6A 4OI0A 1Q77A 1VHLA 5CLGA 5TRTA 2XDQB 2JDID 3BXXA 2ECPA 1KDRA 5FPYA 4G5FA 1C7ZA 2AJLI 1JSXA 2ACVA 2YUIA 3AHFA 4MVJG 5J5CA 1ZMXA 4D9CA 2M1ZA 4KK3A 4DB4A 1S2OA 1EP3B 1M7HA 4TV8F 2R65A 3FYSA 5TF0A 1BU8A 1UJBA 4WD3A 2PMBA 4ZWNA 5GINE 1KP2A 2QBYB 1YJAA 4X1YA 5ADWA 3LL4A 1HV8A 3O1LA 3AUXA 2FXVA 2XMBA 3MWKA 3QV2A 4N47A 1XNHA 1M1XB 5JMWA 4ARIA 2PT7A 4HVTA 2BZ0A 1SUIA 1ISJA 3D0RA 2XCRB 4J3NA 2C83A 5T3YA 5I5EA 3KJQA 4EQ6A 5KB3A 3DOJA 2R00C 5AJWA 2N9UA 5LU9A 2P9BA 3H5OA 1XQWA 3RRNA 1DELA 4F84A 2VJYA 1WPGA 3V7WA 3CZ4A 1YRWA 5E7MA 4NMMA 4FGWA 2NGRA 3CRRA 4X66B 1HNXB 4BEJA 4KQ1A 2BFFB 3B53X 4D45A 3M6XA 2CVPA 5FUVA 5BMVF 2YWBA 2WT9A 5E0OA 3UCXA 2G08A 4MZXA 4HAOA 1I80A 2GXUA 1K4KA 5M3BA 1UPFA 1X94A 5E0KB 4RZXA 4MUJA 4BO1A 3O8RA 1Q0TA 3WWOA 4M9CA 1QBGA 4YAGA 3I9OA 4ZOLB 4YLYA 4DS3A 2DXIA 1JJ7A 4MLZA 4RLFA 4B6RA 1PWYE 5CB8A 1EU1A 1NYRA 3DEKA 3JQ8B 3FUCA 1BFUA 1ARZA 2ZAIA 2ZYRA 1TM2A 4QIHA 4YCDA 3HH8A 1XRRA 2H48A 4DG8A 2GK7A 5B58C 5ES4B 5F7ZA 1B14A 1P62B 1U1DA 3ES9A 2F00A 4D3SA 1NBEA 4AX8A 4ND3A 3KTDA 2CL5A 2CKDA 2A88A 1XTQA 4KBYA 1N6OA 2HLDD 4LI3X 4EY5A 2PX5A 1QS0B 3DNFA 1U6IA 3FYTA 5UKDA 4BEWA 5B5SA 3R75A 5LD2B 2QI9F 5TE9A 5BSKA 3HBAA 4H7HA 5LSAA 2OOSA 1QHNA 3CUYA 3R0IA 4OYHA 1NX6A 5IU6A 1QCYA 5ITSA 3NM5A 4LHYA 4EPRA 1KDVA 3DO6A 3L7JA 4CLOB 4S1NA 3U81A 3DTTA 6GPBA 5BN5B 2YRWA 1LK5A 5K3EA 4PQGA 1FC0A 3BS4A 1XLTA 4XH9B 1KRWA 5HIMA 3OIWA 4RK0A 1GUBA 1TF2A 4XX0A 1KY5A 4YCLA 2G8NA 1QVWA 1V5GA 1UOQA 3EZ7A 3OQPA 1XJ0A 4KXVA 4QTYA 5HCIA 1W5FA 3GUCA 5JXGA 2BZSA 4E08A 1T5BA 1OX6A 3BQMB 3JY6A 1ZW6A 3GRVA 4OLHA 4NONA 2OBFA 5IT5A 4E4TA 3OSZA 4UBLA 3CZMA 2B6NA 1Q3HA 4GX1A 3WL6A 5CB4F 3ZGYA 3FTFA 3RUCA 4N40A 4B2LA 1XAGA 1TM4E 5YASA 3SN6A 1FE8A 1K7EB 2GHQA 1GPBA 3G13A 2C7OA 1Q1GA 1YO6A 3ESDA 4LOHA 1NUPA 2GAIA 1VG8A 2J48A 2A9OA 3CZAA 1JDTA 2LCIA 2QR2A 3THSA 2D2EA 2G36A 2JAWA 2ODNA 4X84A 2EKDA 3NM6B 1V39A 1XT6A 3CHYA 4E6PA 5K09A 1MB3A 3BMCA 4L6AA 5DI9A 2E5FA 5CYPA 5TT0A 2HTEA 3F3MA 5BT8A 4KZPA 5CVDA 1SKYE 5FX2A 3LXRA 3ZZ0A 4BJ1A 1T5TA 2EC5A 1IATA 3LFUA 1RRGA 4OSOA 2GKGA 1JYEA 3QX3A 1NBMD 5HFAA 4FFRA 1IJFA 2UYYA 3Q7RA 1Z4OA 4NJEA 1SKBA 1D2NA 2C7RA 1UJ6A 3C6BA 2NZVG 3EY9A 1DWUA 4DV6B 1OMOA 4IJKA 4D4LA 5IC6A 2R86A 3R3UA 3WOHA 1NYTA 2H4FA 5IVKA 1B8NA 1RWVA 3HA3A 3O73A 5JWOA 1KPIA 2DHEA 3NRCA 3RFTA 2WIKA 2VJLA 4TQGA 5LBTA 3UB3A 2R7AA 3ZHYA 1QIGA 2P2ZA 3I6ZA 3HGMA 4CEIA 4P4NA 3BFVA 3U7JA 5HCNA 1P1FA 3DAPA 2NNWB 5JCOA 3GDFA 1RKBA 2OP1A 4K6GA 1L7NA 3GNTA 5IK2A 2GARA 3UQYS 1ZH8A 1V9SA 1EM8A 2FG5A 3GCWA 3MQ2A 4U02A 5ICSA 4V0ME 5JRDS 1N3YA 3P9IA 3IP1A 3V4LA 3UW1A 2ZIGA 5JJIA 3TTSA 4N65A 3MB5A 1XAIA 3C1OA 4MS4B 1TQ2A 2G28A 1G8FA 1O94C 4IUYA 4CM1A 5LWHA 3RTCA 3OEWA 2ZDGA 1EEHA 2FDCA 4DLZA 4DC1A 3H0CA 1G41A 1LLFA 3QIAA 3PHHA 2ZUVA 3VKHA 1RT9A 2QY6A 3NNDA 3LRXA 3DM9B 1HKUA 1QGAA 2O3UA 1W88A 3FB4A 3FDZB 3NO4A 4LCBA 4O5AA 5EMJA 4NZPA 2R6HA 4F86A 4JWTA 2HBZA 4DQXA 3KUUA 3JALA 2J09A 4RABA 3W6UA 1IULA 1R9NA 3IUJA 3WGUA 4ZOQI 2P9EA 1OWOA 3NXKA 3SMVA 1M8KA 5M34A 4X7MA 4FZRA 5JQWA 2D2IA 2AG0A 8ABPA 3TOVA 4FYIA 3A58B 5DGIA 1JPNA 2PKRA 3PQ5A 1XDZA 4OXXA 1IEQA 1J6UA 4EJSA 5IZ4A 1DXHA 4BZWA 4GGPA 2NZJA 3MCUA 3U4HA 2BF4A 4PIVA 5BW8A 2O3QA 4OAOA 4U8HA 2LWIA 1SBQA 2Z2ZA 5F1YA 3WRYA 2QAGB 4BXOB 1M0TA 2NYVA 2JBHA 3DTVA 1MGOA 2V98A 5EI5A 1B73A 1JHVA 2FVYA 4ND8A 2PZLA 4WESA 5CFQA 5K2MA 1E5VA 5K45A 1NQ5A 4IOLA 4MUEA 2AQ8A 3P0HA 4MQEB 1H8ED 1SXJC 3VPFA 4MJ3A 5D3MB 1RYFA 5F9FA 1PW5A 2RGEA 1KEPA 2DPXA 1IFXA 5JUWA 2ANCA 2FP3A 2DHRA 4HNAB 4QYSA 1FDSA 4N3GA 1NC3A 4MW1A 4UUAA 3P5SA 1CVRA 4MQ4A 4OQYA 1DG3A 5BUQA 1QWSA 4YROA 2FQYA 3HRIA 2WPDD 2XCQA 4F21A 4PF1A 1RLJA 2EW2A 4R9NA 1FMFA 4QFBA 3GJSA 4IIFA 2IV3A 4V0LA 5KNDD 1PD0A 2CFSA 3IOYA 1UM8A 1U81A 2MYPA 4GH5A 3KOOA 1YHYA 1V8OA 1HLPA 2H2HA 3WB2A 4LF4B 4G0MA 4H3VA 4UKDA 3RUFA 1U0SY 4NCJA 1RWXA 1LEHA 1FTGA 3AZPA 1H22A 2V58A 4NXNB 5ERYA 3LHSA 4ABTA 4DBZA 1RIFA 4N12A 4PPQA 4B8WA 1KVUA 5SY4A 4A5OA 4TQUS 1WUYA 1IG0A 4OGGA 2IEIA 3FOFC 1ZD4A 3O2SB 1SPXA 1Z5PA 3KIPA 1PDOA 2CXRA 2JI8A 4HFMA 4PX5A 2DR2A 5TPWB 2H0AA 3M1IA 5BVHB 3EASA 3R9IA 1UZNA 4BJ3A 1QHSA 2Q6OA 2REQB 1PV1A 5A5EA 1IOVA 2Q62A 3EDOA 4OCZA 4DWWA 2RI1A 4NMXB 4TRJA 3PX3A 5LVAA 3MHTA 1MCZA 2HADA 2VPZA 3GPCA 5FLYA 3BXOA 1P2TA 1Y37A 2C3UA 3K8OE 1KARA 4KQGA 4YAOA 5ERGB 3WKEA 4ZYLA 1P7YA 3VJLA 1U31A 1DXOA 1YVDA 1Z38A 3ENQA 2WABA 3KQSA 3RIEA 4U2DA 1OLXA 3PHLA 4G1UC 4O02B 4GI3A 3C6MA 4F3CA 2Q1WA 1ZOOA 2G6BA 3OZSA 4WCDA 5AM5A 2PUHA 4B3FX 2FPIB 2ZKIA 3MZ0A 3L8ZA 3OTOB 3EEIA 2QL7A 3PR2B 4RUKA 4LCJA 1OAKA 2D59A 3OE7A 3GEEA 3T3PB 2O7NA 3L6DA 1XJ5A 1DKMA 1D7OA 1UBCA 4QBHA 4XKJA 1QHIA 4CM9D 4KR6A 2FJ0A 4LVUA 3TL6A 3IPCA 3N59A 1DKPA 1X7YB 3EF1A 1XXHB 4P7FA 4P3XA 5DOZA 5F73A 3RAJA 3RS2A 4ECAA 5CLLA 1A4IA 3K1ZA 2CNLA 5JBIA 3A0UA 1BDMA 3NUZA 1O9HA 1Y4AE 2PWZA 2FHSA 2ZANA 3VTKA 5A2QA 3AIKA 3HCPA 4QXMA 4IEEA 3H5RA 4PX3A 4DMRA 3Q8XB 2H2FA 2W2VA 5H9WA 3G0IA 4Q15A 5CH8A 4NBRA 2FQQA 3IQXA 1N5KA 3LOUA 2ZSAA 3K0FA 1KI7A 4OHKA 3DPIA 1NONA 1ZP6A 4EENA 3IB3A 4OQ4A 2PD6A 4LUCA 1MQAA 2CXQA 2H2AA 2HPHA 2IC5A 4W1SA 1MC5A 1RLTA 4JVLA 3W5AA 3H42B 4IDQA 2D4HA 1Y6RA 1ZNQO 2YTZA 5DB4A 1YJQA 2K87A 1ONBA 4BEVA 1KYWA 4CL2A 5BUCA 3PF9A 2BOVA 4INAA 2CHEA 1H6AA 1A97A 3G0GA 2R5NA 4WQMA 3PL1A 4CMIB 3QX9A 4NABA 1DAMA 5TXGA 3NFRA 4TVOA 1QRDA 3HBFA 1GZUA 3TLJA 5G0VA 3QU4A 1VL0A 3ZHRA 1VYHA 3P0IA 4DIBA 4M37A 1S1MA 1YS7A 5A9SB 4XQCA 1WCV1 1QZUA 2V6BA 3WJ7A 3VPXA 4LXXA 4CF4A 3I0MA 5AM2A 4FDVA 3BE8A 2JKVA 3HQ4O 3UMCA 4CTOA 1UBKS 4LTDA 4KTVE 2AZDA 3AJ9A 4WZZA 3D3JA 1HG1A 2LRHA 1JEQB 1BMTA 4MWEA 4YWHA 1XQ9A 3GEIA 3UY4A 4YRZA 1IBKB 3QUCA 4FYKA 2VG8A 4GBED 1GPNA 3UMGA 3VR5D 3RF6A 2UU9B 1XEAA 2JASA 3KAQA 3V1YA 3S1AB 2C84A 3VPHA 1Q1ZA 2R62A 3ZWAA 3BERA 5K3SA 2ZJAA 1K8QA 2L82A 3KPYA 3NG1A 3TW0A 3KZNA 4R2LA 4B46A 3OJEA 1SZCA 1SGWA 2X7XA 1M73E 1T5DX 4KIFA 4OATA 4TS3A 3THYA 2A5FA 3A3NA 1ISGA 4DANA 5DHSA 1NRIA 2FEXA 2RBGA 5AVZA 1Z2NX 3GHHA 4GOMD 4X6XA 5BYBA 1HE1C 3VNAA 5BSHA 2Q2VA 1WNFA 4ESVA 2Z6AA 2FSPA 3P2KA 2JEZA 2Z5GA 1MX9A 1BQEA 1V8BA 2O8VA 3TXAA 1R8QA 1PQPA 1HYEA 3PUHA 5AI8A 3TLXA 2D0PB 2OZLA 1T8WA 1YUBA 3RRYA 3GLIE 4N3CA 3RVRA 3THYB 5D8DA 2XQFA 1KO7A 3ZY3A 1Y1TA 1FDVA 1IN4A 3EVNA 4RLHA 4Y2TA 1KJJA 5FWNA 3IUEA 2RMKA 2VA8A 3IKTA 1ULBA 1SIUA 3OUUA 1WL8A 1FDOA 1X1SA 1N2CA 1RWBA 1U28C 3KZ1E 3UWMA 1NWCA 2PT5A 1Y3DE 1WHTA 2AMYA 2RHRA 2EW8A 2ZJYA 2ZW9A 3GD5A 4KZKA 4LHEA 4XE5A 3RABA 3WGIA 2PX2A 3HB0A 3QVGB 3W9BA 2VJDA 5D2CA 5B7QA 2I7XA 2P77A 1U7WA 4OI1A 4Z7NB 1G42A 2PZEA 1KA9H 3NHKA 1Z7BA 2WUWE 3AUTA 1P8JA 3CA8A 2J08A 4LKOA 5MN6A 1JIQA 1Z5GA 1JS1X 3WWCA 1IBMB 1AJEA 1TTHA 2P9QA 4LYJA 3LYHA 1J1IA 3FTNA 4E2ZA 1RKQA 1V35A 2GVDC 3AM5A 1JR3D 1WW8A 5H7XA 3MCAA 3LSYA 3RG8A 3W8EA 4YJFA 1E79A 3PIIA 3LY8A 3B7PA 3GH1A 1SO8A 2YCLA 3GJZA 3P94A 2VHCA 3QU5A 4P53A 1NVVQ 3KWMA 2O8FA 2EEZA 3H2KA 2NAFA 2XCUA 2EBHX 3QNWA 2QY9A 5ALJA 4Q24A 5ULLA 3WTCA 1YTLA 4B3JA 4TYQA 4JLNA 5EIEA 5FUXA 2PG3A 3WMWA 3OE4A 2P69A 2SKDA 2P9JA 4LE1A 5CURA 2X4GA 4EJ6A 4KLAA 3I6IA 1E2JA 4KQMA 5IKXA 2CT8A 1XRJA 5FHRA 5L7YA 1JUDA 5CLJA 1JEYB 4KDFA 2V45A 1A3CA 1T0BA 3A1VA 4OUDA 5H68A 4QYTA 1KBZA 1A9OA 5ARCA 1UBOS 1EWYA 3CLTD 4IXTA 4Y6OA 5BXYA 4HAXA 5IDXA 4P92A 5AICA 2MSCB 1QHEA 4YRAA 1ZO8A 2Y71A 2QN3A 3I6YA 4J1TC 2Z6QA 3L7KA 3ZWDA 4D4IA 3K9WA 3ZEIA 3PGA1 2HCFA 1XU4A 2M6SA 4JCCA 1N1EA 4WT7A 1Y7HA 3K4QA 3D3WA 1XKXA 3ZWVA 4BVGA 3KBOA 4E07A 4HAIA 5BVGA 2FWIA 1OLUB 1ABFA 1SOUA 2AFIA 3ETHA 5DXFA 2DHCA 3GELA 3I61A 1AOXA 1SHZA 4EFDA 1U1GA 2A14A 3U09A 3K70C 2N42A 4MEAA 2AGVA 3ESYA 4DV5B 3KL4A 1TC2A 4FOOA 3AJ8A 2VAMA 5TMBA 3H5LA 1KBQA 4UASA 1SHKA 1DGQA 1DXQA 3H2SA 1E8NA 3QFTA 2XPCA 4H7KA 4MYTA 4LK2A 3DZBA 3PQFA 2PZMA 5HZMA 4W5RA 2AS0A 1WTCA 2IYSA 3KDAA 5FR2A 4LZJA 4Z2YA 1F4PA 1AHPA 3DDWA 1G6OA 2R6JA 4D92A 3FMVA 4PNHA 3IFSA 2V54A 4N39A 1OPXA 1G4UR 1FYFA 1L7BA 2EBUA 2XCLA 3HADA 1R2QA 5ALEA 3MLAA 5DTRA 5MN4A 3JWJA 4UEOA 1ZKDA 3DCYA 3NWEA 4KGVA 4KTTE 4LDZA 3JQEA 3GBVA 1AG9A 1K08A 4HQRA 1RRFA 1J0BA 2I4NA 3EAQA 3S8EA 1WUHS 1LD3A 1T2UA 4W9MC 1Z4IA 2CL7X 3C16C 3NS7A 3HVHA 1XTKA 1KEWA 2PXCA 4FMDB 1I2MA 3N8GA 1K98A 2I6QA 1QNLA 2XUJA 4MV6A 4A6DA 4M7RA 1YULA 3BTSA 3FMFA 1DVRA 4HN2A 1FJXA 2KLHA 3GD7A 4G97A 3BK7A 4EX7A 2CN1A 2AN1A 1MTOA 1OZAA 3F5MA 4R1UA 2RK4A 3TO5A 1Z15A 5AW2A 2ZPAA 4MICA 4ATNA 1P18A 3ILSA 3C14C 4MR7B 1A72A 4ZREA 4P6VF 3LY5A 5LA6A 2W6ZA 2IY7A 1YKFA 3EIOA 1UK8A 1W73A 3GDWA 3BJZA 3GQVA 2RGAA 3MMXA 2BSQA 1FRZA 3DL0A 1W36D 4JQZA 1SPBS 2C0PA 3L0SA 4C9BA 4EY6A 4QL3A 4BO9A 3SZRA 4C04A 4ZZ0A 3W7BA 1SKAA 3TGWA 3BREA 4RTRA 3NH9A 2QF7A 4DMKA 2HFJA 5JZVA 3GQBA 3LX8A 4FWBA 3WLRA 2IOHA 1V96A 2ZT6A 3HYRA 4PPGA 2O7SA 4CN8A 3A2KA 2XGJA 5FO1A 3L8MA 3WNBA 2QMHA 2QTWB 4HS9A 3IOEA 1Z33A 2LW7A 3WMXA 1NQOA 1A5SB 1NN1A 4U7TB 1UIMA 1RADA 1VCIA 3K0KA 2QW1A 4UXHA 1AHNA 3UC9A 4G4GA 4DFDA 1DC7A 3TEJA 3TXXA 2W0MA 1G2QA 1MB4A 2RGGA 5DU2A 4BB0A 5KYYB 4FDTA 1DBIA 2GPJA 3VHXB 3Q85A 5BR4A 4WCFA 2P40A 3I0ZA 1PUJA 2WJJA 1OAOA 2A7QA 4IUBS 1KQOA 4M38A 1CUBA 1VCOA 3VNSA 4BWVA 3DZ8A 3TD9A 5I7RA 2QSUA 4CLRA 4RXTA 4TRNA 3H3XA 1PG5A 1NI3A 3INNA 3DPUA 4JB2A 5FNVF 3O3OB 3SEFA 4N18A 4NDAA 4CV3A 4HX2A 3NPMA 3A6LA 3NC1C 2ZM6B 4UPEA 2RKWA 1P4AA 1P7CA 1QTNA 4LOJA 4QYXA 5A7FA 1HDXA 3B60A 4ZDWA 1BH2A 2A1TR 1RLMA 5AM0A 4KBGA 2HMSA 1EVLA 4P81A 1PJRA 3N75A 4FW9A 2DH6A 4XASA 5FH9A 3KZVA 4CFZA 4ZGGA 2F55A 3IILA 3FYDA 3AU9A 4L8WB 1AKNA 4AJJA 3R40A 5IYZB 3G2NA 1AY0A 3PT5A 4MS3B 5JU6A 1B8PA 5KTKA 3NHRA 3CBQA 4JT9A 3QMPA 4M7OA 2HK7A 1LSJA 4MUBA 5KC9A 1YBAA 4I9FA 3C87A 5HDBB 2HU7A 3OQVA 1CHDA 2ZJ1A 1ULZA 5IRCD 2NTEA 3SD7A 1NZDA 2PQ2A 4NZMA 4CM9A 2HT1A 1NUQA 4QD3A 1Y1RA 4NCKA 4QSHA 3TSZA 2PBRA 3TIIA 3S5UA 4TRMA 1CE8A 3EQ2A 4BNIA 3DZDA 4QOFA 4WTOA 3T1TA 1R64A 3AGPA 4BVFA 3OZFA 4Q3KA 2PCJA 3IALA 5B30A 1ZIXA 2X8AA 4QVKA 2IKSA 2PANA 4L74A 3I37X 1UR5A 2O8BB 5BW4A 1MIHA 2QSZA 3QMWA 2DR3A 5BN1A 1ZD1A 1EUZA 2G7MC 3O9VA 1I1HA 2WD9A 2AZ4A 3COYA 2JA2A 2ZYIA 2NXEA 5ARBA 3ECCA 2FUG1 5DZSA 4I55F 4B47A 4ZP1A 3HG7A 5EZQA 1PZHA 3FY4A 6ABPA 1KO5A 4F3TA 4MCHA 2IH4A 3WLQA 2IV7A 2Y2UA 2JFZA 3KVOA 2FPUA 2UDPA 2Y68A 4BN4A 5JH7F 5L6LB 5ALOA 1XNRB 5TB5A 3RC8A 4MUKA 3ITEA 3U5ZB 2FDXA 5CRIA 5HA5A 4PYNA 1G4AE 2PXHA 5LDHA 1G38A 4UZSA 4BOYA 3HFGA 3LVRE 2G5GX 2Y67A 4QUAA 1ZUWA 4E2XA 1YCDA 5FOQA 3E3LA 3GYGA 1FVOA 2LV8A 4V3BA 5IAJA 5JASA 4KPGA 1R0LA 1EUQA 2B8WA 1ZS9A 1Z8HA 1RR6A 4YRFA 2EV9A 3FRIA 4BDTA 1MABB 1EI9A 2OAEA 4ZOLA 5L3SA 3GRCA 5KMGB 1EA7A 1XZFA 2JLCA 1K89A 3HA7A 5CEJA 1ZRSA 2OCIA 1K86A 4PICA 5J4VA 3MOGA 3W5BA 4US0R 2EZUA 3HR4A 2JAXA 4U6NA 4NYJQ 2OHGA 5CD9A 2IBTA 4EF4A 1FOEB 3WGOA 1ONOA 1FFEA 5CFRA 4EVRA 4DR3B 3ZQUA 2NU7A 3E05A 2H4ZA 5F77A 3WTBA 3CLVA 3MRXA 5J2TB 5JHHB 1XZJA 3EZFA 4TYMA 3HRKA 3AL0C 1ZISA 5KAMA 4YMSA 2VXBA 4FVTA 2EU8A 1VIVA 3UAWA 5LD2C 3EULA 1SCIA 5J47A 2WJ6A 3FYCA 4D4KA 1VJRA 4FIZA 1KI1A 1UJNA 3ETEA 4UTVA 4O63O 4JDUA 5JOQA 2QV0A 2GBPA 4FBMA 1NASA 1FFXA 4MCJA 2XOXA 1X8JA 4A0GA 1FFGA 2QVZX 5BMVA 1X1TA 2HGZA 2YHAA 5H81A 5F3RA 1B76A 3VAZA 4WBXC 3EXIA 1HG0A 1DBPA 1QOQB 1YRAA 2W4QA 3M70A 2UYGA 4G0QA 1G5FA 4POOA 5LDDC 4IJUA 5EE5B 1GZVA 1RD4A 2ZI5A 2JBAA 5JISA 3LPDA 4H4CA 2QIOA 3DHNA 2C1XA 4IO0A 2B94A 5EQTA 4M9RA 4QDKA 3WSVA 3D5TA 1P77A 3CLTC 1NNLA 3A1CA 3VZDA 2VWHA 1QYVA 2FOLA 2X41A 3VKWA 3OT1A 2ZS7A 4BU1A 3AWIA 3BE4A 3R5KA 3JQFA 4KV9A 2WUVA 2VSOA 4B74A 1TFUA 4ZYTA 5JFOA 4BNUA 1JALA 4R4JA 4LRUA 1RC1A 2V8BA 4FSDA 2YX1A 2C58A 1AGNA 3HNRA 1P3Y1 3KYDB 4HQ6A 1XMQB 2ZBUA 1CUUA 3IP5A 1CQXA 3GEDA 1DUSA 1Z56C 4N5LA 3M34A 3FB1A 4KXXA 4XWOA 2V55B 1MEJA 4YIKA 1RAIA 4UTRA 5EHNA 3A27A 4EFNA 4QVIA 1JN0A 1HNZB 1GXSA 1SXJB 4N01A 3ZN2A 3SKVA 3V4ZA 2BBWA 2FZ4A 2D13A 5FOTA 4HP8A 5BR8B 4DPLA 1MPTA 4Q9JA 5BR1A 3VH3A 3WE7A 1L5FA 3LP5A 3ZNQA 4CKBB 521PA 1A04A 1JZSA 1LTQA 1MPXA 1ZSVA 2PLFA 4TKVB 3ROPA 1T8RA 2R60A 1YK1A 4FZVA 5F23A 5HIIA 3IURA 5J1TB 4Q4CA 5HKOA 1NNSA 4TS9A 5E9JA 2C78A 4PG8A 5DX1A 2CMHA 2EKPA 1DOHA 3KTFA 3TB4A 4CKEB 3GCXA 2WRZA 4PLCA 1Y98A 4CMEC 3QF4B 4GPAA 3VPCA 4YJKA 1X7WB 4HFNA 4XTCS 4MR8A 1K5GA 5EXSA 4BMYA 621PA 4OOEA 1MOSA 3MINA 2UUOA 4OXNA 1PQYA 3ZBUA 3MUNA 2P4EA 5CAEA 1DC4A 1I1NA 2Q6KA 5JCJD 5AM3A 1JQ5A 1T5SA 4D6PA 2PU5A 1HL3A 1YQ9A 3IRVA 1BNCA 2ERYA 1OFUX 3JCZA 1Y1LA 3N74A 4RFVA 3WO1A 4MV8A 4PFSA 4V1CA 4Y0AA 4I1SA 4QQKA 4C3OB 2YZNA 1I32A 1V2GA 2WSSD 4FHZA 1SURA 5A0FA 4CQMB 4BNDB 4ERNA 2PGAA 3RSZA 4TXNA 2HWUA 5HRCA 2CDCA 3G2JA 1RPJA 3T1NA 1SCNE 4NNJA 4QJ3A 2BC9A 1JI0A 1G3MA 1E58A 1K8YB 1LW6E 1NUSA 1VE6A 3NBYC 1EM8B 4KQXA 5G53C 4U2CA 1EK1A 3AFOA 4GLFA 5H5JA 3MCTA 3ME5A 5HOQA 1A2QA 2CLOB 3L1UA 1CULC 1E63A 1ZW1A 3JTMA 2OKGA 5CNMA 1NRWA 4HXEB 5EYPB 2YV2A 5ED4A 4ZC8A 3PEYA 5B36A 2WJGA 2XNSA 5JDCA 2LDBA 1Z7GA 4XQEA 4MB0A 2AFIE 4I8XA 2BFCB 2REXB 2I7CA 2SICE 2FPMA 1BH6A 1UBUS 2OHVA 1W1WA 4TMTA 2BHLA 2CVZA 4GBGA 4UAJA 5FBRB 3R7AA 3TD2A 4CM8B 1MOQA 5JSHA 3DFKA 4M6WA 4HDKA 1C3XA 4JB0A 4FIDA 1NG1A 3M4ZA 1CEXA 1KFKB 4WE3A 1W93A 1C7FA 1G20B 3WRVA 2H11A 2WIJA 4JHLA 2X0FA 3PHGA 3QVXA 5AVKA 4WZBE 2RAVA 1Z4PX 4R0MA 3JATB 4N0PA 4DM7A 4E5YA 1QRUA 4WZBA 4KAAA 4BLSA 2I1WA 1KI6A 4R01A 1YIAA 1WP9A 3HVUA 1JAYA 3PNBA 4F7DA 1OPRA 4FNGA 3SDZA 2VZLA 4L07A 4X7BA 3SSOA 2YOFA 3IIKA 3W1EA 4F5YA 4YP6A 2O7VA 3GUVA 3FLMA 4XJTA 5EXPA 2ZI4A 4G4IA 5FA8A 4IMJB 1HT1E 1UMBA 2XA2A 4DLLA 1BCSA 2QG6A 4B1FA 4OJYA 3A1WA 4IL5A 5DYTA 4QRHA 3TTWA 5HIKA 3QU2A 3DV9A 3DMHA 1T26A 2ZK7A 4X20B 4Z99A 3DOHA 4M9SA 1LFAA 2Y66A 3N87A 4HB2A 5DX8A 4LQCA 2E82A 2RKOA 1L4GA 5GAJA 1XCPA 2XOKA 2BF7A 1B1AA 2ZYWX 1JU4A 4MLCA 1U3WA 4G81A 3E15A 4S2EA 1QP8A 2UKDA 1Q16A 2QNRA 3GPBA 3TDNA 1DWOA 3CEHA 4XEHA 2VH1A 2YH2A 5ECYA 1Z37A 5ECGC 4DA0A 3ZE2B 3EIQA 4TZTA 3FGPA 1JHQA 4HVCA 1PFWA 4IG9A 4A82A 5B2EA 4EG3A 3Q72A 1UPBA 4IVNA 5IXYA 4KGZA 2B25A 2X5XA 2XYHA 2PSFA 1NY5A 1XVAA 3NV7A 1C81A 3W3AD 3ZI7A 4DJJA 4H77A 4PYKA 3UOAB 3ZOKA 1ETUA 2BFFA 2FSVC 2HQOA 2Q4BA 2C42A 2VUSA 1Q20A 2FR0A 3HU5A 3IP6A 4TVBA 4O4LA 2QN7A 5GJCA 5BSUA 3ZH9B 4A10A 1JU3A 4FFBA 2PL5A 2XMSA 5TC4A 2HY7A 5EJFA 1PFUA 2EIHA 1G3QA 2CUTA 1KY3A 4KACA 3ZIUA 3B3FA 3T7TA 4O4HA 4HEA1 4EGFA 2CFCA 4GVPA 4P08A 1KAGA 2V7QA 3F6YA 3ZNOA 5JMTA 1KK0A 4YXFA 4RC9A 2DTXA 2BKUA 3NTUA 4I8DA 4BLUA 2LNDA 2DY1A 1KMQA 1ZXBA 4RHEA 3WK7A 4GLOA 3QSGA 4EA9A 4MQLA 3D4IA 3R41A 1TEXA 3H9BA 1WXQA 3ANLA 2NW6A 5D01A 1P5ZB 1VE1A 2B1GA 4J43A 3QG1A 4LDAA 3P4YA 2HN9A 1D1SA 3A6FA 2Y1CA 3E9EA 3HMQA 3HCDA 2I2FA 4W5WA 3TI7A 4QM6A 2P3SA 4KBFA 3SMQA 1T0PA 2CUZA 4ZDKA 1FTYA 3SSAA 3T1YB 1HFJA 3KPJA 2OORC 5CLIA 1L3BA 1T9KA 3ZWQA 4ZVMA 1EFLA 1DEXA 2GWRA 4RK4A 2X42A 2JEOA 2EJVA 4FMCF 2JCYA 2OVFA 1XLWA 4XW2A 2KM1A 4C0XA 2PX3A 4ZT7A 1SCJA 4U4AA 2I6FA 4RY9A 2Q4OA 5CG1A 1AHHA 3ILYA 5B12A 2BFDB 1YJ8A 2RC5A 4CFYA 4LZLA 4ZEOA 5LQRA 4JWKA 2HMWA 1F2TA 3CLUC 2RHJA 2Q46A 4QGGA 4EG7A 3ACCA 3MTAA 4I14A 4M0PA 4MP6A 1B6SA 1XXHA 2H07A 2MYNA 2R7KA 1DCTA 1V1MB 2HF9A 5K7SA 2E1RA 2RFLA 2QRGA 2XQJA 4DHWA 5KJCA 3QELB 4ARUA 4HRVA 2WE7A 3Q7QA 2YOGA 4MQ5A 4OPMA 1KYXA 4DV4B 2P78A 3B7GA 1JQJC 3MBIA 4L75A 4KIJA 4QDTA 2FG7C 5ALQA 4WCFC 1H5NA 1O3YA 5FR1A 2H1SA 5ALXA 4X64B 4EVIA 4QM7A 3U26A 2XUZA 2QTNA 3UQZA 3NU1A 3ONDA 1O58A 1GUAA 1THZA 2FKAA 1UL1X 4LJ7A 5A7GA 4FFPA 1FP7A 2RHMA 3ROKA 3BEDA 4EABA 3QXXA 4XSGA 4JAVC 1QV6A 1TM3E 4CV1A 1JR6A 2XB6A 4XD7D 3R8XA 1A9PA 2CXTA 1SVKA 2AMVA 2ZE5A 4IJ6A 3WL4A 2WEKA 4MI9A 3PS9A 4NZNA 4DGSA 2BMEA 3DDNA 2ORYA 5D84A 5DMXA 1EDOA 2QTAA 4D9KA 3E61A 2O8DB 4EJMA 5HKKA 1I7DA 5E6RB 2DLDA 2AJCA 3BZUA 3IAM1 4LZAA 5I7HA 1BU5A 1UFKA 1QR2A 3B70A 3LLSA 2B1QA 2J3MA 4ITVA 4L8YA 1RI3A 1IVSA 2IL1A 5IC5A 2GBLC 2JFFA 4LE0A 4Y2GA 2QUKA 4B43A 3PD7A 1QFJA 4NFSA 2GI4A 3HA2A 4LRXA 3BMNB 4ZMRA 2ROQA 4HQ0A 4CMJA 3DC2A 4D4MA 2VWPA 4P9NA 3GDOA 1CF4A 4XUGB 3TS1A 4LJLA 4KI7A 3DT8A 1E5LA 2F3SA 3QWBA 4TTJA 3E5NA 4M0CA 2BH9A 3CISA 4PPFA 1TM7E 1XV5A 3JD1A 4BATA 4V0OA 1U3UA 4X24A 2H4WA 4ZT6A 3SIXA 4WFIA 3P71T 5H16A 4UQPA 3TBKA 3ZK7A 4YO8A 2EJUA 4CM7A 1Q2UA 4WDQA 4DDMA 3ABRB 3EIFA 4AK9A 1M2HA 2J4CA 5DSXA 3KT0A 1YE3A 3HC7A 5IK2D 2F67A 2WD7B 3FHLA 5BV2P 1XO1A 5JT1A 5AR1A 5B53A 1J39A 1G5HA 1NW6A 2QG4A 2HU8A 2B0JA 2FEMA 2Q2NA 4UHBA 2XTNA 1PJBA 4EARA 4LYEA 2ZR9A 3SHVA 3L7MA 4AJLA 2DU8A 3PUJA 2AA3A 3LKBA 3QVVA 4I99A 4JL8A 2WWXA 1H94A 4RTOA 2I4LA 4DLNA 3TTUA 4CV2A 4ADSG 4YPVA 1ZD5A 1EH5A 5JDIC 2UYQA 2ZAMA 4C4RA 2YJ4A 1XEWY 3AR3A 4X00A 3OEHA 4F92B 3VAAA 3J80A 1M6EX 2OAQ1 4OLBA 2OO5A 2QXTA 4H0FA 1OJ7A 4G4JA 2HV8A 3AFHA 3LAWA 5TQ0A 4FYMA 2BCGY 2EZ9A 2Q4TA 4OHMA 3OQMA 4ONEA 1XMVA 5AUNB 3RYCA 4D43A 2PL9A 2H1LA 4X1KA 5DO9A 4L50A 4RD0A 1GL6A 1DTSA 1JA9A 1JT9A 1Z0JA 2P4QA 2QR5A 4Q4JA 4LJSA 2NU9B 2Y0BA 2WVAA 5C37A 4YAJA 3VX4A 2YZKA 1R4MA 3ONEA 4EJSB 3QVKA 3ZKWA 2VYVA 2ZSHA 1TVKB 4DUGA 1DBSA 2MSEB 4WNAB 4Y98A 2DPMA 2EJTA 2J5BA 3T5PA 3DTVB 2WQZA 5E9QA 1BS2A 1OLSA 2C9BA 1L0BA 3QFFA 3SEAA 1Q95A 3WGMA 1UH5A 1PRYA 2CDAA 1VKNA 1NV9A 3QKRA 4GVXA 2QUZA 4YONB 3OIYA 4AG5A 4ZKDA 5F7OA 3BWMA 5F98A 1T5OA 3NKFA 2DULA 4Q4AA 4C7KA 2C1ZA 5TMDA 2ZIXB 3KOXA 3TOSA 4QU9A 4L9RA 1QQ6A 1A2BA 1GPLA 1C9KA 1T9ZA 3NIGB 2CV0A 1J4AA 1R4MB 4K46A 3ORQA 4RESA 1TVKA 3TL3A 2ATCA 4BKQA 2AZMA 3OO0A 5EJ4A 1ULTA 5DRYA 3ZOZA 4YMUA 2RAPA 2QD4A 3JALB 2QX9A 2ZCJA 5DSTA 4DSNA 3MD9A 1E1DA 2V7QD 3NWPA 4N7MA 4OM8A 5CLQA 2HNBA 1XCLA 2YIMA 3A6ZA 4AJ2A 3BMOB 5ADUS 1Z5ZA 4FYXA 4B6JA 4NBNA 2ZYDA 1IYZA 2QX6A 1USVA 1XRMA 1TZCA 2YASA 3O9MA 1I5RA 3TCXB 2B4TO 1T9GS 1GQQA 2VQSA 2PZGA 1XFAA 1U3DA 4LDJA 2VOEA 4ZO9A 5IJ9B 2OTCA 3IDZA 1OH5A 4RORA 4ES6A 2FW0A 4OP3A 1SOVA 1RTKA 3OUZA 1E8DA 1P0FA 4XJXA 3GJTA 5E3JA 2G4CA 2C7BA 3MOSA 3QWFA 2F4VB 5H80A 3DBRB 2R97A 3E3NA 1EINA 1CJTC 5EIHA 4QQNA 4OAQA 1U6KA 1PSZA 2CD7A 3A9TA 4Q6WA 1JR3E 5KWEA 4RE5A 2VP9A 4MVWA 4URZR 3SLGA 4RSRA 2WOJA 3T5BA 1NAHA 4FYJA 1LJ8A 4UFPA 1WVGA 4DIMA 1HSZA 2O19A 5E2BA 4CQLA 1GV0A 2ZBEA 4AFNA 1TCBA 1ZI6A 4E88A 1IUOA 2AQIA 2CCGA 2YIJA 4QNRA 5HZHA 4GMHA 1CLUA 2PH5A 2YC4C 3W2HA 2RH8A 5CA0A 1OTYA 2WV7A 1JDSA 1R0CA 4DMHA 4HDRA 1EE9A 1J2RA 1VFPA 4DCJA 3IAHA 5EFZA 3HY6A 3ZQ4A 5CA1B 1BWQA 3QLVC 4GRAA 4NENB 1XHEA 4V0MA 1CZOA 3HVIA 1RZRA 3R77A 4ZAVA 3IHKA 4EO7A 3BN3A 1SUAA 2ZKLA 3K09A 4XGRA 1B15A 5JQGF 1O8BA 1HOTA 1SVMA 4PINA 4M8IA 2RSLA 2VUHB 4L0MA 2O54A 2WAAA 2ODEA 1CQJB 3B1VA 1ODIA 4U6SA 1T3TA 2QTVB 2R8OA 4J3JA 1PNQA 3SR4A 3R3WA 5IP5A 1KYZA 3L6OO 3ZXUB 5CX4A 1B93A 2ZTLA 4V0NA 1GA1A 4S0XA 5AM4A 5E7JA 1RQGA 3C5WP 2X2OA 3CH5A 3VKFA 2O07A 1D03A 1NQAO 1ZNZA 4B8YA 5A4MS 1IXYA 2NIPA 3NTLA 4ZI5A 3CKMA 2XUIA 4RDXA 2CUKA 1Z0UA 2UYOA 1KWKA 1ZK0A 3UC5A 4UBKA 3GBSA 4LZPA 3M3PA 2EZTA 1CYDA 2QUAA 1LPBB 1IU9A 1JVNA 4OXQA 3WG9A 1K97A 5CHEA 3O3CA 3UHOA 2W8BB 1NUAA 2QTVA 3K8ZA 5D87A 2OXTA 1QQ5A 5KBYA 3I72A 2V65A 1ZHFA 4YAKA 2GK3A 1E59A 3CUWA 2WKRA 4OMDA 5AVWA 2VRCA 3U61B 3CZ5A 4IFTA 2PSHA 1UP7A 4UBNA 4NK4A 1MX1A 4GZ5A 3ELWA 3MTQA 4NFYA 4WY8A 3LPCA 2PS0A 5KVQA 2BBOA 1E6WA 1DRVA 5C1IA 3T0FA 2MR5A 3KAJA 4IVPA 4TV9B 3C85A 4RMJA 4CTJA 1A9TA 3OO1A 2WU3A 1RIIA 4IHKA 4RS4A 4ZVQA 6CHYA 1U3FA 2VA9A 1GRNA 1GPAA 5A04A 1XUOA 3QITA 3K3PA 5KTMA 2GMWA 5HS4A 5KWVA 3JYNA 4I0WB 4UUBA 1IN5A 1T1SA 3NIFB 4MO9A 2EP5A 1F48A 1WOMA 3IAM6 2FPPA 2E6UX 2C9ZA 3ND7A 2WOOA 1OWNA 3LZDA 4DIKA 1Z2PX 4HVAA 1YJ5A 2IOFK 2RKBA 3AI7A 5HDQA 3LQQA 2QRZA 4UBOA 1GQFA 1JTVA 1NN0A 5ESXA 1L2TA 3MMSA 1REQA 1ZM4A 3TZCA 2R3SA 5C4GB 1L5HA 1ZINA 3RC9A 4E1VA 2BKAA 3CRZA 5JVDB 1GCOA 3QKSA 3ZCXA 3QP9A 1N2IA 3RS9A 3CKLA 1HE8B 2O6LA 1NW4A 3HO6A 4F45A 5ALTA 1PF7E 4MW7A 4MVJI 1LS1A 5G3ZA 4WOKA 2DFNA 3ML1A 3ZUPA 1N2SA 1KYTA 2I7DA 3TQTA 5KKCA 3PNQA 5B3JC 2V7EA 4WLVA 4BZZA 5CFMA 3STXA 4G5QA 4KVAA 1DC6A 1J2YA 1XZAA 3GAZA 4N5MA 5DIZA 1XC7A 1XL0A 3FNFA 3KVVA 1O77A 1XEWX 1Y9EA 4EY8A 3F8SA 1JXAA 4UXIA 2XHEA 1YQXA 4CR8A 1W7AA 3DBHB 1QX4A 1GGHA 3OVMA 3KJIA 2WF9A 2YXEA 5EN4A 3SVZA 2B7LA 2JLVA 1TYDE 1ZXLA 1ZNYA 1G6HA 3B6MA 5HUHA 2YMQA 3L5KA 2A4KA 1NXXA 1H65A 2VATA 4OVKA 4QA9A 4UHCA 1B0AA 1AUVA 1AZSC 1DKQA 1S3GA 1X3LA 3DW3X 4EY4A 5GIPE 1Z3IX 4BE9A 3Q9SA 1BEZA 1JEEA 1I4DD 1Y63A 2YN0A 3E9NA 5JSKA 2O52A 5ALGA 3UJ8A 3JYOA 5K0ZA 3C1AA 3V8BA 3N2KA 3TBHA 4MVCA 3AWDA 1C0LA 1MO3A 1ZY2A 1I36A 1W6UA 3PFWO 4ZVKA 4MARA 3MJTA 3HNPA 2E4VA 4IZHA 1ZJZA 3QVLA 1IZ8A 1D2GA 3NOXA 2EEPA 3HWWA 2VWQA 3FPFA 1D2AA 1DFGA 1WMBA 1KFCB 1GQ2A 3R74A 3LTEA 1BMFA 4W1RA 1CDZA 4R2IA 1IG3A 2ZTUA 2Z08A 2ZQYA 3M83A 2RGUA 4MVJH 2W93A 4OXYA 5AXCA 3J7TA 2IDMA 2AD5A 2J5XA 5EUQB 1H9AA 1WB5A 4GO1A 5DLQC 1WDWB 4B80A 4MDEA 3CJRA 3RE1A 3DEIA 3WIUA 4E15A 4PNEA 5KPJA 3F97A 1DJMA 4LGCA 2BFWA 4O2BA 1BS1A 1KTVA 3LHDA 1H5UA 3MPOA 5KTNA 3OKAA 1LTHR 1Z0DA 5JSZB 3EDYA 4K2HA 4WACA 2NVBA 3HZHA 1SC6A 1G8KA 1MAHA 3DV2A 4BCDA 4QFDA 2HUNA 2Z2YA 1Q50A 1NMQA 4MI1A 2AE2A 1NLZA 1QVAA 2ZJ4A 3A06A 5K3BA 3W2FA 1TJ3A 2FQ1A 5FA6A 4JI7B 3G2KA 3HCCA 3QVGA 1JQDA 1TUEA 3N6RA 3O8NA 4TKLA 1O0SA 5CB4A 4QUIA 5IAAA 2WK1A 3TTXA 4PX9A 2I34A 2HM7A 3H83A 2VDJA 1AIPA 2A58A 2PD4A 2X5JO 4ZICA 2BRUC 5A6SB 1ML4A 3TZ6A 3AVYA 4Q3LA 3NOOA 4BB6A 1YS1X 1UBNA 3Q88A 3T4EA 1L6RA 2R5FA 1EE2A 5IUKC 2G82A 2IHYA 2VLBA 1M1YA 1NW7A 1XF1A 2NVOA 1GG9A 2PDAA 2WM9B 1Z5WA 2QQEA 3IE0A 3LQFA 4FZ5A 5CLHA 4AO7A 3ET4A 1PS8A 2ZUCA 1O6BA 2W2LD 1SQGA 3UKJA 1P33A 1UUFA 2AR7A 3Q7IA 4NU5A 1J42A 1NWHA 1QPBA 1WMFA 3DE1X 3MQ4A 4KOAA 1Z13A 1DB3A 4HNTA 4R6WA 5G2OA 4D74A 2WFMA 1XCJA 4M0LA 5EQDA 1M83A 3C45A 1R0ZA 1YNSA 1GU7A 1MBZA 3QX7A 4FOSA 4DDUA 3UENA 5DBHX 5LMZA 3JAMA 4JP3A 4I5GA 1M1YB 4PZAA 2D1QA 2NU8A 3A4VA 2Q7XA 5DBIA 2GEDA 4DM3A 3N53A 1RTTA 3ABSB 3I1YA 1Z82A 1JU9A 1OZFA 3DC7A 4Y1GA 1GIAA 1S7CA 4F4IA 2Z8YM 1T25A 4RL6A 1KVRA 1UPTA 5C8VA 1RFLA 2GKSA 5AOAA 4O0LA 4TT8A 1CPYA 4A0QA 5KVVA 3KAPA 1A9XB 3RUAA 2PAFA 2CV2A 4JBYA 1I2AA 1A7AA 1HK7A 1ZKMA 3SJBA 1MP0A 1JXQA 5FBLB 5JZBA 2F1JA 3FNEA 4RHFA 3RHTA 1M54A 1R8JA 2RJNA 2VDQB 3PQ6A 1E7WA 2CK3A 3HUDA 4ZT2A 5FI1B 5CFOA 4QT4A 3F6RA 5CM2Z 3D0QA 5BWNA 1IPHA 1H0HA 4XLTA 1GILA 3WK9A 4KPUA 4G6ZA 4PGFA 1GN9A 3HTXA 5K01A 4N5DA 1NKTA 4DR5B 1UQUA 1SKQA 2TRSB 2ZU0C 3LFHA 3MTIA 1KNQA 3W6ZA 2JKZA 3I64A 2OM2A 2I6GA 3ANSA 3H5VA 4LF5B 4MI6A 1Q0LA 3R0XA 3GP8A 4LEIA 5BN3A 5HE9A 4E7PA 5JMOA 4XWWA 2C92A 5AHOA 1R1DA 3D9QX 5A71A 3SZOA 5F7XA 2OD7A 2X6TA 4B6EA 1P2DA 3RSCA 3PUXA 2EQBA 1M6WA 1ZK2A 1ORTA 2VAPA 3ANYB 2JGDA 3D54D 3IHWA 3NTRA 4WOCA 1HDOA 2WAXA 4K3VA 1T3LA 3GQBB 1EA5A 1RLIA 1LQUA 4QJ5A 2R8XA 3RUHA 3PC8C 4A2QA 4BFVA 4JJKA 2VYVD 2JGIA 1MDBA 2ISQA 1U8YA 2XXBA 1U98A 4FDUA 2V0NA 1YR9A 3JPYA 3M33A 1B2LA 1XL1A 3CF2A 1SRRA 4NBUA 3DDHA 3CRMA 4CGYA 1Z29A 3ZU3A 3IMGA 5AUOB 1T4GA 1KIMA 2BEVA 3KC2A 3L6UA 3PE4A 5FPHA 1JAXA 3HI6A 4LJ5A 2CJFA 2V3WA 4HX9A 1RJ9B 4BNGA 2L0XA 2YFQA 4QECA 4L08A 2NQ8A 1OIWA 2ADMA 2G40A 2I5PO 3FF4A 4JC5A 4E94A 4FFVA 4H1HA 2G25A 4WDRA 8OHMA 1AB5A 3TVDA 2E1PA 2C57A 2VBIA 4LFCB 5ITWA 4UULA 5F52A 4BFWA 1B43A 2VT6A 2I54A 4J0FA 1F8UA 4EKIA 1M2VB 2ATVA 1EWRA 3DBLA 1Q1NA 2PT9A 4DLAA 5IX8A 2E89A 2F1HA 2Y6VA 3V1UA 1Y3FE 3JQBA 3K30A 4KLZA 3L4KA 2RHGB 3IIMA 4WXHA 5CCDA 1CQPA 1D0IA 4OMFG 4ZAZA 3EPJA 5IASA 5JADA 4MPDA 4DJFC 4E3WA 4MRSA 2AW5A 3L1IA 4FNOA 3RGWS 4K9KA 1VRWA 5ALMA 3LRPA 4C2TA 3W4KA 4FK8A 3BFJA 5I9BA 3HEAA 2VAVA 2GKOA 3OTWA 4E2FA 2Z5VA 3U3MA 1L1RA 5FUYA 1RXEA 3LO5A 4PXSA 1C3EA 3UV6A 5AVUA 4O2AF 1YU6A 1NW3A 4NH0A 3RJ9A 3CNQS 1QF9A 1T91A 1U7HA 1N0HA 3DL2A 3FWHA 2W0SA 3RUIA 2XRZA 1JKFA 1XFDA 3VI4B 3MTBA 5TVKA 2BFAA 4ZYXA 1TYAE 3IP7A 4H7FA 2QBYA 1GZ6A 1WP4A 3SZGA 4YJ2A 2DUNA 4IIDA 3A26A 1VJCA 4Q9LA 4XOIA 1IN7A 2EJCA 3SJZA 2MT9A 3DXZA 4QAJA 4CVNA 5JCZA 1XDDA 1JYSA 4V2UA 4QJBA 4ZQIA 3LX5A 1Q6YA 2BFNA 3OF5A 5E1MA 3WB9A 4CU5A 3GWGA 1PGJA 4HTFB 4QC2A 1BDJA 2A4MA 1OE0A 2L18A 4QG7A 1O5TA 2O9JA 5ANRB 3RVSA 2L2QA 3T1QA 3RYIB 1ECCA 3H16A 1XVTA 3V46A 5EE0A 1UXOA 5LYJA 4L3OA 3S28A 4FYVA 2WVGA 2QTBA 5F4BA 2AFRA 2X1MA 3P9RA 4GI1A 2P27A 3E9QA 4QDJA 4IYJA 1VYUA 2W6ID 1BMFD 2VK1A 2DMRA 3EBLA 3RC1A 3M1YA 5IFLA 1JIKA 1RPAA 2NQTA 3DZIA 3HDHA 4MAFA 2XB2A 1JPVA 3PKJA 2WJZB 2JH9A 3X3HA 3NB0A 5EKDA 2AXEA 2W2LA 5EP2A 3OD5A 4C43A 3HI4A 2YOHA 3N28A 2H7CA 2Z3ZA 4RVNA 3TNYA 1YDEA 2P41A 3IQIX 2IF2A 1XRLA 3GGJA 5IJ0B 1JNYA 1OFGA 1FNNA 1PL6A 1GM5A 1QQAA 1OA0A 3MCZA 4E1AA 4QUDA 4QPZA 3WMRA 2PLRA 4YGXB 1E7MA 2FP4A 1N0IA 2ZUUA 4I6GA 4DKJA 4RWZA 1EX6A 4YQEA 1E2KA 3OCYA 3F3SA 3UAXA 2X3FA 3REQB 1UPCA 2TMDA 3V4OA 5FDFA 2ZIUB 1Y5MA 4X3PA 5GZ3A 2BTQB 2HCTA 3HXMA 1C5KA 3C3JA 3JYQA 1PL8A 4R05A 3STYA 1JJIA 1X0XA 5TR9A 1C9JA 1ODTC 2PRSA 3DWFA 1L5MA 2IQIA 2OV8A 5U9CA 1OWMA 1PR3A 4JSYA 4IJ5A 1CUYA 1PT8A 3IVAA 5BSRA 4YNBA 1TT5A 1USGA 2WYWA 4MKXA 4RZ2A 1PGOA 2CKMA 2Y1OA 3PJGA 2H1OA 4KRFA 1WQ3A 3EWAA 3IPAA 1BHO1 3JASA 1SVWA 3PTZA 4D44A 4IILA 4PGAA 4KRYA 3WLIA 5FI0B 2RH5A 4G2TA 5HP4A 3D6VA 3AVWA 3DPSA 2BTQA 5E6RA 5T3UA 1XX6A 3TFWA 1MNQA 3OZTA 2FUNB 3ZIAA 3HUTA 2CMKA 4E21A 5LFAA 4KVFA 5JS8A 3CGGA 1G21A 1UMDB 4RA9B 2WAYA 5DP2A 2B2NA 3ICPA 4A2WA 2YDYA 4NE2A 5B1DA 1BG6A 2E49A 1OYOA 4R1PA 4B6QA 1OR8A 1EBBA 1MIOB 4Q03A 5DCUA 2IBMA 2OILA 2RCNA 3GRYA 2CYAA 4GPTA 4HF7A 4IFIA 3LVBA 4JVNA 1Y9AA 4OQXA 4REQB 5CVJA 2VJBA 2BJVA 3EPKA 2QM0A 4Z0NA 3ZW9A 2QMZA 3BIWA 1RP7A 4DBVO 1QX3A 8ATCA 3AINA 3GPIA 3FYUC 2YW9A 3E84A 3C7CB 3HU3A 5TSDA 3V2HA 2J5QA 3T5AA 3PLAE 3KB2A 1UMDA 3J81A 5P21A 4R40A 2OBBA 1E66A 3B52X 4ZV7A 3M4JA 1QK5A 3LIPA 3QI7A 3BWXA 4HBZA 1KI4A 5ENVA 1TKAA 3GP3A 3KRTA 3FOWA 3TAHA 1LCIA 4AXXA 1FXSA 5C7OO 1E1MA 4JUBA 1S9HA 4LMAA 3PX7A 2NSLA 4C0LA 2AB0A 5HVNA 2F3RA 2BMFA 2ZPTX 4TKVA 1DMRA 2C4WA 1WPXA 4FS3A 2JGAA 4D97A 1JILA 1G63A 2OV3A 2X86A 1P80A 4OHYA 4NBLA 3KSZO 2DBYA 2VFAA 3PQ8A 4KE6A 1G5QA 3DDSA 1ADCA 3PD1A 4H3KB 2GAOA 2ZRHA 2M6LA 3UUEA 1HURA 3NCHA 4RAOA 4B31A 2R7NA 4LTNA 3QF4A 3WL7A 1TIPA 1R4NB 1WZEA 2NACA 4R2KA 4BU0A 4D5GA 5FI5A 2XUDA 2VQ3A 1VE5A 2GFIA 3BCRA 4BB9A 3UANA 2B21A 2DHDA 2XDYA 2QUJA 1SVUA 1THTA 5FT9A 1ODSA 3UTCA 3L4EA 5LMUB 3OMXA 2XYPA 2X9NA 3NRJA 4OFWA 4UHEA 4AN0A 5LIRA 2H92A 4KI0A 2EZ8A 1Y6ZA 1CNFA 2FZ5A 2P9GA 3GEGA 4R3UC 4AUEA 3IEVA 1CQZA 1W0JA 2JI7A 4K9RA 2QR3A 1NV8A 3N8HA 4MJLA 5T8KA 3ZHQA 4F9FA 5F5XA 4E6EA 4AG6A 2RH9B 1ZSYA 2PUVA 4MGIR 3IAFA 4FONA 3HXQA 3LT5A 3T7JA 4Z49A 1ZSNA 3FMIA 4HDOB 4K05A 1DIGA 3IEMA 1NI4B 4KL8S 4BP8A 4E51A 4FQ5A 1Z12A 3TF5A 3ESXA 5J4HA 2QPTA 1THGA 2CE7A 2R8BA 3TK1A 1RXIA 3PTLA 2E4ZA 3VJKA 1ZMTA 3CPHA 2UVPA 3V6LA 4A6PA 1SXPA 5KYTA 1ADJA 1O89A 1QNFA 2AL7A 5KHOC 1J5PA 2D5AA 1X9GA 4N03A 4XI9A 3ZHTA 4HZIA 4XDHA 1RYDA 2X0KA 1QYDA 2GRUA 3U0VA 3UWPA 4KQKA 4XWYA 1SC4A 1UXJA 4N9WA 5H70A 2G5CA 2OG2A 1RJFA 3CLUD 3LQKA 3PCRB 3LECA 4JJIA