4TT8A

Crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase (wild-type) complex with 10-formyl-5,8-dideazafolate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
308
structure length
308
Chain Sequence
MKIAVIGQSLFGQEVYKELKNEGHMIVGVFTIPDKDGKVDPLAIEAEKDGVPVFKFPRWRLKGKAITEVVDQYKAVGAELNVLPFCSQFIPMEVIDHPKHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFTVFWADDGLDTGPILLQRECDVEPNDNVNSIYKRFLFPEGVKGMVEAVRLIATGKAPRIKQPEEGATYECIQKKENSKIDWNQPAEAIHNWIRGNDRVPGAWAEIDGKSVSFYGSTLLENDHFSSNGQPLEIPGASRAALVTKNGLVLFGNDGKMLLVKNLQFEDGKMIPGSQYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 10-formyltetrahydrofolate dehydrogenase
publication title Structures of the hydrolase domain of zebrafish 10-formyltetrahydrofolate dehydrogenase and its complexes reveal a complete set of key residues for hydrolysis and product inhibition
doi rcsb
source organism Danio rerio
molecule tags Oxidoreductase
total genus 92
structure length 308
sequence length 308
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2014-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 4tt8A02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4tt8A01
1C3EA 5J63A 4TTSA 3TQQA 1RBQA 1GRCA 3KCQA 3AV3A 4YFYA 1GARA 4ZYWA 1FMTA 1YRWA 1RC1A 4EW1A 1RBZA 4NV1A 3R8XA 1C2TA 4QPCA 4ZZ3A 2FMTA 3P9XA 2YWRA 3LOUA 1JKXA 4ZYUA 4DS3A 3TQRA 1RBMA 3N0VA 1NJSA 4ZZ2A 4PZUA 4ZYYA 1MENA 3AUFA 1ZGHA 1MEJA 3DCJA 4YFVA 2GARA 2CFIA 4TT8A 1S3IA 4Q12A 3Q0IA 4R8VA 4IQFA 4ZYVA 4ZYXA 3DA8A 3GARA 5CJJA 2BW0A 4S1NA 4EW3A 4ZYZA 4TS4A 4ZYTA 2BLNA 1CDDA 1ZLXA 4EW2A 4QPDA 3OBIA 3W7BA 1RC0A 4ZZ1A 1ZLYA 5J9FA 4ZZ0A 3NRBA 1MEOA 1CDEA 3O1LA 1RBYA
chains in the Genus database with same CATH superfamily
3ILYA 1WUKS 1UBUS 1X7XA 1Z2NX 2XGGA 5KJEA 1NGSA 1EFRA 2VJCA 2P41A 5LQCA 1NLUA 4P35A 2X6TA 3U7EB 1PJLA 2Z3WA 1I5EA 4OQNA 1NVWQ 3PA6A 3U3XA 2JBAB 1F0KA 1JF8A 2GBPA 4EFKA 2F6RA 3G2IA 4EG0A 1JTVA 3KUCA 4RK7A 2PNJA 1ULUA 4LKOA 4XWTA 4F5ZA 1SPBS 1AQYA 1O96B 1QHHB 4C0BA 4EJSB 5JECA 1RJDA 3BRCA 4M1KA 4TS9A 3QZUA 4MJ7A 1V11B 3SYTA 4JDUA 3W2HA 4PV7A 4EVSA 4QG3A 4COKA 3IJPA 3JRXA 4UKDA 1QV6A 3WY9A 5AKKA 2UXBB 1GZDA 1N2SA 4KGXA 1OFHA 4YLGA 4YK7A 2GO1A 1KI1A 3DGFC 1KI3A 5TR9A 2ROQA 2KWIA 3QOYA 3O4JA 5CT9A 4F86A 4BN5A 2WFLA 3WGUA 4UAJA 1CQJA 1KI2A 3KTFA 4DKJA 2JKYA 1F6WA 4QODA 1CCWA 4B3MB 1KJ8A 1KI4A 2NVBA 4L3WA 5B6JA 1NVGA 2ZCJA 3ADCA 3E8XA 1HLDA 2YBDA 1E77A 5CM2Z 4UXIA 1XEXB 3U9SA 4S05A 1FDUA 3OP1A 1HT2E 4PZEA 4R16A 1COWD 2OV3A 2Q9CA 5LLTA 4JQYA 3VOSA 3N5CA 1C1DB 3EDOA 3ICEA 5D85A 5F21A 2ZG6A 2PFSA 4K26A 4NARA 3RANA 3ZC3A 3VOBA 2X9LA 3GJ4A 4OI1A 3WGKA 3ZUPA 4N76A 4TZ6A 2CBGA 4IIVA 3DVAB 1CDZA 5COBA 3RTCA 4YJ2F 1FE8A 5EP3A 3I8XA 1Q2UA 4JP1A 3V7UA 1G7RA 1UC8A 4IJQA 3ZTWA 1Z5GA 2R6CA 1Q57A 1FS5A 3KZNA 4KI0A 1GPWB 4DUGA 2C83A 2V9PA 4TYYA 1SVSA 1V96A 2ZBQA 4IHKA 3BWEA 4TWJA 4G0WA 1BEUB 3O95A 4X92A 2Q3JA 4DA6A 1T8SA 3HUUA 4KIJA 1D03A 3A3OA 4JDPA 1BOOA 3SJZA 5GTDA 4OB7A 5LJIA 3UPUA 2NO7A 3JQQA 1FNDA 3C6XA 4V1CA 3LVRE 2PUBA 1RHJA 3FUTA 2CNDA 2PUFA 2ZZNA 2XD4A 2PUTA 2G9ZA 2PX3A 3GGOA 1YJCA 3E2MA 4EW3A 5EJ5A 3Q5GA 1LTKA 2PMEA 4EHKA 2PMDA 2CD7A 3CEAA 3LP8A 3TB4A 4FHZA 1E0KA 3WZLA 4ETMA 5HZMA 1OZGA 4UU0A 3LBNA 4XM0A 4EKIA 4I1YA 3R44A 3IMFA 4R7TA 3N59A 2CDRA 4W5OA 3V80A 3W5JA 4I1VA 2H3EA 4NONA 1GLVA 4NYIR 3PQ7A 1HTTA 4X65B 1KU6A 4G8DA 3GEIA 3RH0A 1U0GA 4HDOB 4AN4A 4C08A 3HXKA 2ATXA 4QDZA 2Y27A 1BA2A 3GT7A 4LC1A 4P80A 4QT0A 1ZKDA 2H3HA 4KAXA 4E6EA 1KWGA 3DZHA 3R41A 2YYYA 1PDOA 3R5FA 1ML4A 3KR1A 3HU5A 3Q72A 4I4LA 1HC7A 1QG4A 3BTSA 4QECA 3CUUA 3HJUA 5ESWA 721PA 3O1LA 1IATA 5IBPA 5HJ5A 1W85B 2IYQA 4L6AA 5SY9A 5JXJA 2BM1A 4L7QA 3SJBA 4QEDA 3H1BA 3K0CC 5IFLA 3AUTA 3L7YA 4UBKA 3AUUA 2VRWA 4GXTA 4WZZA 2AC7A 4HBGA 4KXYA 1ZDMA 4K3VA 2GDZA 4YV0A 3MLEA 1SG6A 4YMUA 3MWFA 3FPBA 4MKZA 5DBFA 4HVLA 5JYEA 3RJZA 4CMIB 5BNZA 1QYWA 2D1RA 3QEJA 3GLQA 1F3OA 2MWMA 2HV9A 1QIFA 5C32A 3EIEA 1SA0A 2G1JA 1PNOA 1T36A 4BMZA 1T1EA 4COOA 2GFIA 4ZAYA 1XK6A 1O6FA 4MGHA 4HNAA 1CY8A 3LHKA 4CN8A 2W2LA 3U2QA 3V4FA 4Q9HA 3JAWB 4PGAA 4RKYA 5IK2A 3DDUA 2FF7A 5B1EA 4NJMB 3KOWA 4A9AA 5DM0A 2G08A 1DP4A 1JPNA 3JQFC 1N2HA 5EKDA 5JNLA 1ULBA 1QQ6A 1UFQA 2Q1YA 4K40A 2BKLA 3HFSA 3S8YA 4UD6A 1TTHA 3ZS8A 1J2RA 3JRWA 3C1OA 4RVDA 4W9NC 5CJPA 2GCOA 5G0WA 1OILA 1UZLA 5IYZA 2GYWA 4FYVA 3GLVA 2AK2A 3I9LA 4XVCA 5EXTA 1QCDA 2OEPA 5FNVB 2PH3A 3DE5X 4YCCA 3D0KA 1P1BA 4LI0A 2R8EA 1H66A 4DBLE 1KP3A 1NYLA 3TOCA 4C0QC 421PA 1MH1A 1X42A 2Y1DA 2H11A 3LPLA 2ISCA 4X95A 5KVQA 4WCFB 3WB1A 2EKDA 1M83A 4RELA 2NWQA 1WZEA 1BQ4A 1QC5A 3S2IA 5L95A 1ZW6A 1WW2A 2W2KB 3D5EA 3HBJA 1SBHA 1E69A 1YD7A 2JFPA 4LRSB 4N01A 4X1OA 2FPRA 2Q1WA 5EKUA 5KWVA 3MS4A 3C6YA 1IONA 1XEWY 1YZVA 2GPJA 4ESEA 5DNDA 1ZMOA 4IEIA 1BIFA 2VTVA 4KEAA 4M86A 3UJAA 4ENQA 3BH6A 3WLTA 3AVXA 4G9BA 2G4CA 3U62A 3FAKA 4H17A 3K1AA 4ZT5A 3L77A 3RT9A 5B12A 5C1BA 4CEHB 3CO5A 4Z4CA 3D54D 1E8MA 1NYRA 1D3AA 1Z07A 4WBNB 3PFBA 1YH3A 2POQX 1KJNA 5TPZD 3WZ2A 2JCXA 4NBLA 2YXPX 3DA8A 1C7EA 1ZVVA 3CE9A 2WSIA 3DVQX 3V1UA 1NI3A 4ZQEA 2B4QA 1UMCB 3JQAD 5J2TB 1BEEA 1J0DA 2QTZA 1K3UB 2R96A 2ZT6A 4ZYTA 5JRJA 2GPNA 1AN9A 3IALA 3QX3A 3GV0A 4J0KA 4MGYR 4RD4A 2R5FA 3CZMA 3OT1B 3WYCA 3JQ9C 4BKOA 1RI5A 4LAFA 4RJTA 4CG3A 2VTKA 3GJ6A 3RFVA 3TLAA 3PNSA 1GG8A 1OTYA 3OCVA 3X1KA 3B3FA 4IXTA 1HGXA 1W48A 3NEJA 2GAAA 1D2MA 4RS3A 2VBGA 1KXJA 2JGLA 3DHNA 4KYIB 4RA9A 4YP1A 3RRMA 1PYGA 4CN9A 4E5UA 1YDHA 3CH7A 4M9RA 3NOOA 3PBKA 5CFQA 2X8AA 2A7QA 1GJRA 3HCOA 5K6TA 3DBHB 3QELB 5TIIA 5LA6B 3V00A 2PDAA 4A8JB 3EA0A 1MHPA 1HI9A 2E1PA 1G2QA 2QRQA 2J7PA 3ET4A 1H4TA 1E3IA 1QKJA 1TQDA 4US2R 5LZ4A 5JPCA 1KY4A 1H93A 2H4XA 4FDAA 2GEBA 1JFRA 1R8JA 1KBQA 4TMWA 2CFRA 5BOVA 2C42A 4EZBA 1EX7A 2LZ0A 3MLAA 5CVUA 1GG2A 1QIDA 4HD8A 2M98A 3PXGA 1T9GS 1U8FO 3HGQA 1U04A 2F4NA 2FOXA 4MQUA 4Z9YA 1LZLA 2IP2A 3EZ6A 2I5PO 2BJWA 1XZPA 3KL4A 3WK8A 3KDSE 2V0CA 3G85A 1ND5A 3KTAB 4RGVA 5E9AA 1X7YB 3VDNB 4LFAB 3D4IA 3RI3A 3T52A 4TRJA 3W9UA 3OJFA 4RESA 2QTAA 1YQXA 5KYXB 2VSXA 3OUUA 1YBMA 4FJ2A 2I0FA 3NFYA 4P4TA 3SYMA 2AYXA 3HYSA 1JVNA 2X4IA 3WHLA 2VP5A 1N2EA 2OQIA 1NXQA 1MT3A 2IHZA 1U2DC 1LFDB 5CP8A 2OCBA 3HYLA 3NKVA 4RZUA 1CQIA 3HCBA 1CUJA 4DA8A 4JENA 3FF1A 4BEBA 1USIA 4OGWA 4ZAFA 5IM5A 1BMFA 5EUBA 1Q6ZA 3P9XA 3RUAA 4EWLA 2FPUA 1WY5A 3QKSA 1WP9A 3PQFA 4HX5A 3RV3A 4C0JA 4I4CA 1GOTA 1PR9A 4KRGA 2WWFA 2BKEA 3G2MA 2NSJA 1I3NA 4FFRA 1SOMA 4ZDIA 4AF7A 4X45A 4Y0VA 1CHNA 3USES 3L04A 1RKXA 1YZQA 4FBGA 2WTUA 5EFZA 1DKOA 1ZY2A 5HBRA 2FR0A 3L6CA 1VE9A 4WCVA 3H5WA 3LLUA 4FIDA 5CEJA 5FPYA 3E7FA 1KKUA 4JXKA 4PGFA 5ALPA 2YN0A 2IUSA 4P0TA 5DTQA 4DJAA 3HKEA 3UWDA 5I7OA 4IO0A 4JJ8A 2EP7A 3MRSA 4DDVA 1ZUD1 4CLRA 3UOGA 3HBFA 3UATA 1T2EA 3INRA 3PUXA 2HU7A 1QXSA 3ANMA 1U3FA 3K9BA 5C8YA 4RTOA 4XJVA 3ROGA 1M3SA 2W71A 2NSYA 3IUJA 4V03A 4FD3A 4C6SA 3HFJA 4OAOA 1W0JA 2XMQA 4MS3B 3TJZA 3OPYB 1POWA 3WLFA 3FWYA 5CJJA 1TZKA 1XRJA 4R9RA 3VC2A 4GUAA 4ZPXA 1YZKA 3FR8A 2D5AA 4HQLA 1KTVA 1AUPA 5J58A 2Z6UA 5K0CA 4RYDA 1HYQA 2R11A 2YHIA 3S99A 2W4IA 4AECA 2L82A 2BFNA 3SHTA 1YHNA 2JARA 3A9TA 3BRWA 3IR7A 3QXGA 2P0YA 4CIVA 5DTMA 5A02A 5J2UA 2QV7A 2PVSA 3O94A 4LXYA 5AMXA 5L3VA 2QD1A 2VJNA 2C5EA 3MQ4A 5B2FA 5KDOA 4H1UA 4GMGA 2D1SA 3X2SA 4B47A 4CKWA 4V24A 3C8UA 2IPNA 2WNIA 3SVZA 5CB4B 3NIWA 3CSDA 3PNVA 3TPFA 3E18A 5G02A 1G21B 5H4GA 1YMUA 2QW8A 3G2PA 4EITA 3OSUA 2X0KA 5DMXA 5H5JA 4ETIA 2PT7A 3ULKA 4F4UA 4ARCA 1YIAA 2V7UA 3R2JA 3T0FA 5DZSA 5THKA 2DTEA 3PUVA 2PRIA 3N8NA 4NPCA 1HXHA 4J7CA 2P5YA 1UMBB 3AEZA 1ZD4A 5EZYA 3W6ZA 2YASA 4RHTA 2PUAA 2RH8A 1D8AA 3ME5A 4PCVA 3FW1A 1YZLA 3HN2A 1FSFA 3D8NA 2UYGA 4DIUA 3C3EA 3K09A 4BJ5A 2EATA 3A3NA 4PBRA 5CFZA 3K70B 5JZVA 3L02A 4NJEA 4F21A 4J1NA 4OOEA 2NO9A 1DFHA 1XALA 2QDKA 3R76A 3MCAA 4KZPA 3RVBA 4P4UA 3TS1A 1VA4A 4DSUA 2B34A 2OVBA 4K88A 3ZNNA 1C8KA 1LPSA 4QZVA 4JSRA 1NMXA 3ETEA 3DZIA 3DBLB 3QMVA 2W70A 1W88A 4B09A 1XX6A 2XECA 3DLBA 3SQNA 3FWNA 1GGEA 2UZIR 2X42A 4K7JA 1PS0A 4WZBB 3U49A 1G7TA 3QG5A 4LDQA 2ZI5A 4H3SA 4EF6A 2K6GA 1AQLA 3PQ5A 3O4VA 1P5ZB 1N5KA 5JVDB 3BD6A 2FN8A 3OT4A 5IABA 1FRNA 4B3DA 3ZCQA 1YWGO 3BHIA 3MELA 2B37A 4GFDA 1FP7A 4KO2S 4UC0A 2ERYA 1BNCA 1RT9A 2J9XB 3FZQA 1EFVA 2AJCA 2Y93A 4FXPA 4HEJA 2ZB7A 1KPGA 1XTPA 4F5EA 3DTVA 2FX2A 2CJXA 3CEHA 3GUUA 2FW8A 2HTEA 4MJLA 1S8NA 4Q5IA 5LLSA 3D3NA 3UBMA 3W9BA 1NW7A 4P3YA 3R3WA 3S2GA 4CF5A 2LUOA 3OJEA 4LXQA 1FIUA 2YXLA 1T5DX 1E0JA 2NV0A 3EZGA 2GERA 4EKDA 4DR6B 3EVNA 4K0RA 2L2QA 3PKJA 4JI4B 1NKSA 1IFXA 2FSVA 2QL9A 2P9BA 5F76A 1VHLA 5JD6A 4AVYA 3U6KA 4CKEA 4KXUA 1K5GA 2CZGA 3RVMA 4YRNA 3LT2A 3W5CA 1RQPA 2HCBA 1H3NA 1EE1A 5L3RA 2R4UA 5C8YF 1TUIA 1IWBB 2GAFA 2IZOA 3JYLA 3OQHA 4DLAA 2PJRA 4XRRA 3GG9A 5AOAA 1L9XA 1PI3A 2P8JA 2XDAA 4IRXA 3ZGXA 2K87A 4C0SA 3QRWA 3K2IA 4HMQA 3ELYA 4K6CA 3M2TA 4MMYB 3AGQA 5I9LA 1K1EA 3GARA 3A2NA 4RK4A 1FQWA 1NM5A 4C7OB 2G9NA 2EX1A 3GFSA 4QDJA 2JFFA 5JQGA 4UTZA 2DPGA 1C3OA 1JA9A 3QWBA 2GESA 3ZY4A 2FWNA 4CUKA 4DC0A 2L42A 2YCBA 3COSA 4UM9B 5K5EA 5MGBA 4C0WA 4OQEA 2FMHA 1E3TA 1L4GA 3F5FA 4KDRA 2OXEA 4MNTA 1HMYA 2W00A 4JJEA 4RVOA 4E46A 2HSJA 4Y9TA 2YWFA 2IH4A 3L0BA 1WTCA 3M3HA 3Q88A 2J9GA 5K6RA 5BW6B 3RIHA 1SUWA 2YV4A 1RRFA 3CJTA 5I7RA 1JILA 1NULA 3LTNC 3CIOA 4ADSG 3KQUA 4XDYA 4OLBA 3BJRA 4EP1A 1P6QA 3IOYA 3UEOA 4EVRA 2F1JA 2LXNA 5EQTA 5KOYA 5DCUA 5B7GA 3TSCA 3AG5A 4URYR 1Z6YA 2WD7A 3LQYA 4N5IX 2QLJA 4V2IA 4IDPA 4L3OA 5BN4A 1V7PC 4PG8A 3DE2X 1ABBA 2C2BA 2RGGA 4L9RA 3HDQA 4I2NA 3MTQA 2QY6A 5LP6A 2FJUA 3HL4A 4W7IA 3B5EA 2FE1A 5EZYF 3INGA 4YMIA 4C4OA 3KCQA 3IVXA 1ECBA 3T54A 2O2IA 3X0DA 4EPTA 3L18A 1FRQA 3E1GA 4URXR 4ANFA 2C9MA 1M1YA 1O94C 2JH3A 2MMCA 3Q87B 3SQLA 1CNMA 2ZSKA 4G0MA 5DLPA 1XNQB 3RD5A 4BAZA 5LNK6 2ZS7A 3C3XA 2JFQA 1DAHA 1I6MA 1XLVA 1TT5B 2JF0A 2VT3A 1QIMA 1G9SA 3UGKA 2HWKA 1D6JA 4C6RA 4ZI7A 1HEIA 3HVKA 4H31A 5BWMA 3O2QB 1V6SA 2IHYA 1J2JA 4DLSA 4DWWA 5FPKA 4G1EB 1S1CA 4AFNA 2QPOA 2VYCA 3JQBC 1OMOA 1P1FA 2BHTA 2ZBPA 1FYXA 1HPLA 2PD4A 3RBXA 3LBYA 3AL3A 2LP4Y 4M76B 1Z45A 3A2LA 2ZYDA 4QOSA 4HH0A 2ZJ5A 1AUXA 3L06A 4ZYUA 1AKYA 1NP3A 1ADFA 3FTDA 1HQYE 3O3NB 3U0BA 1PWHA 1FNNA 4EW6A 1CKEA 2CUZA 1E2PA 5D5HA 1WVIA 1FF9A 1TX4B 4X8MA 3GA0A 4XCQA 1J23A 2Y1KA 4BFZA 5F78A 2CZCA 3IXLA 3RK0A 4MV7A 3VR6D 2OKGA 5HRCA 1DRVA 1NDHA 4MUIA 5KO2A 5KMGB 3KFXA 4LZOA 4DT1B 4L4UA 5CK5A 4ZAVA 3BWYA 3WYDA 3P9IA 2VSOA 3KG2A 1A50B 4MYSA 1H2BA 4PYIA 3UA3A 4BAUA 1XIVA 5K8VA 3WGLA 1NZDA 3RC7A 1RRMA 1P0QA 2A0YA 1Z0FA 2VQEB 1KJIA 3LC2O 4HPWA 2CKDA 3MMZA 3S81A 2RAUA 2JI7A 4Z1OA 1R6TA 2PU5A 3FNBA 2ZBDA 1N5JA 2B1JA 3GLHA 3OI7A 3PK0A 4ALKA 4LYAA 3G2HA 4C7MA 4RULA 2JJMA 3M9XA 3W8DA 2ZWVA 3DP7A 1BAPA 1HT0A 4FMDF 1OX6A 5KU1A 2PWBA 3U7RA 2PD6A 4RD1A 4OXKA 2WMNB 3S8EA 1HBJA 2WA2A 5LU9A 2C4NA 3FOEC 3C0KA 4NVRA 1YTLA 4L6CA 4RHXA 5BSMA 1N36B 1T9BA 1I0IA 3A26A 3BZWA 2Q4DA 3RPEA 3ZE9A 3H65A 3M3DA 2FQQA 5CDUA 3FYSA 4GI7A 4K8OA 4OHPA 2PZGA 2OA0A 2EL9A 5TB5A 1J0BA 2CVHA 1KS9A 3DBOB 1DTWA 2X6QA 2ZLBA 3EGDA 1YV9A 3SX0A 3WB9A 4B3JA 1N34B 3MB8A 1J5PA 4KFUA 5EPEA 2XKBA 3IA7A 3ZLJA 1Z34A 2F48A 2C8JA 5DLQC 2HK9A 4MWOA 3WGTA 4U9IS 4CMJA 1UQRA 1F51E 2XCSB 4PNEA 1ZN8A 4A2WA 2PX2A 3RIYA 3TFOA 4QOGA 3L0YA 3EUFA 5CIYA 3C4QA 2XZLA 1R10A 3BMOB 2EU8A 2G6TA 3EWAA 3R20A 4FW9A 3NJ4A 4D80A 4EABA 5JC1A 5GAJA 4UDOA 1TD1A 3SC2B 1DRKA 1R6BX 2Z04A 3F3KA 5B3AA 3D6HA 1R0YA 4BVKA 4C43A 5ADUS 3KT0A 5ALUA 3N6RA 4G1BA 5AP9A 5CDTA 3GAZA 1YOBA 1W4LA 1QGZA 3HE3A 4GXNA 1UPAA 4UW9A 5IC6A 1MMFB 2IXEA 3H87A 4QUGA 3T06B 5CG1A 1LRKA 1JLLB 5IJWA 3NTOA 4NBTA 2QROA 3T99A 3DM9B 5A9RA 1OV6A 1U0RA 1JLHA 4NEHB 2HQSA 2XCQA 1T0PA 2A1UA 3BDAA 5AM0A 1U2TA 5AKXA 4QUBA 4E5DA 1YKSA 2BCEA 1OLUB 1XLTC 1J8MF 3HZHA 4IS3A 1XYYA 2RAFA 4JR2A 4RVUA 4LYDA 2NIPA 4RIIA 1YU6A 1EH5A 4MVJH 1FMTA 4UTNA 3S2YA 4KACA 3C24A 4BB6A 3KZVA 2F9MA 2V7WA 1DO0A 1OB5A 4O4HA 3CT4A 2Q0XA 4OI0A 3FYUB 4ZI7B 2NT4A 1NVXQ 1XCPA 2GRJA 5CVVA 2OOKA 4HB2A 5IH3A 1RLJA 2OZKA 4E12A 1VHDA 4RMGA 3AEQB 1NU6A 1OLXB 1PV4A 1M7GA 3NRCA 5AI5A 1CE8B 1RE1A 1VSTA 1ZWKA 2ZRNA 1KDYA 3SOZA 2ZIVB 2BTEA 3OLWA 2QYHA 4BDSA 5KX5B 3CXRA 4MAMA 5JAMA 2IHKA 1PO7A 4JLKA 5A7HA 3SEZA 3WFJA 3BS4A 1QIGA 1X92A 2QNIA 2DFTA 5ESDA 2OCKA 4BNKA 5IJZA 4KL8S 3W9YA 3H75A 2AFVA 2Z2KA 1GRQA 2AI2A 5EUQB 1BJRE 1W73A 4MI6A 221PA 2OHGA 4TL9A 3GC6A 3JY6A 1XELA 2B8TA 4W8GA 4AC9A 4GKVA 4E5VA 2O05A 2F43A 4PLPA 2OHJA 4LKRA 1AKWA 1GZ6A 3CVWA 4MPDA 5KU7A 1ENYA 1U0BB 2Y0CA 3W1EA 3TZHA 1YCDA 3EF1A 4PLHA 4RJLA 2BI7A 3ETGA 4B2LA 3K9NA 1EINA 1C9KA 1RYMA 1IG0A 1OREA 1BCRB 1BWPA 2C5GA 3QI7A 4D9KA 1T6BY 1X1AA 1EXNA 2XUFA 3QE4A 4OBXA 5BVGA 3THXB 2NZXA 3JQAB 3JWEA 3H2KA 1PFVA 5AOBA 5UKDA 3LVBA 3J80A 1KMHA 4O08A 4N9QA 2GBIA 2RG7A 4IIYA 1Z4LA 1N9KA 1NPDA 3SR4A 4NOLA 5KYWB 4ARBA 4BB9A 1CDDA 2EZ9A 2Y71A 2H1WA 2OXTA 3OY7A 2IHBA 5EXDA 3STHA 1QZTA 3K92A 2TSYB 1OKKA 3MAAC 1ZONA 2R9VA 2HBRA 4IDQA 5H82A 2C3PA 2RIRA 1A71A 3WSVA 5MN4A 2AWNA 4C01A 3ESQA 4DJDC 3ABIA 4TYWA 2YQZA 3TRDA 1ISPA 1QS0A 4EJSA 2QGNA 3LL7A 4MTLA 2Z5FA 2R25B 1OC4A 3DVLA 3IP6A 3K6SB 2YZ2A 3RAFC 3VPBA 4CKXA 3DUFB 1DX4A 2GS9A 4H7JA 4LV8B 2EZ4A 4CQMA 4NU5A 2G82A 3C3AA 5F51A 3OO0A 1K0FA 3EQ7A 3WIDA 5DYGA 2JGJA 1FU8A 4D81A 4FJ1A 2YOFA 2R66A 1NC3A 3CLTD 5CNJA 4K86A 3BMCA 4WNAA 3T1YB 3D6MA 3GUZA 3TJMA 5JOQA 3U3KA 4TTRA 5JXGA 1AGNA 3AOEC 1HRDA 2G17A 3E5RA 4J49A 3QP9A 4NK4A 3HRIA 2IUTA 3T1VA 3UKOA 3ZV7A 2ZEJA 4R1SA 5BT8A 2IH5A 3QGMA 4M0EA 3D02A 2REXB 3FJYA 2X1LA 4QJBA 2ZB2A 4WUTA 1SC1A 4XYLA 4ZOAA 4B4OA 1XMPA 3GH3A 3IOCA 3QVLA 5DHUA 3DV9A 1LV8A 4KK4A 5ENZA 5FOWA 2P3LA 5BQFA 4BIMA 1O6CA 3JARA 1X8LA 1C1XA 4XR4A 3COVA 1T35A 1V5IA 5H02A 1XNJA 3I9FA 1BMDA 4N03A 1EWYA 2YY7A 1E8DA 4E3ZA 2VKQA 1YQGA 1TPZA 2ZSAA 4QOIA 4O4HF 5KSYA 3IIEA 2WIKA 1U1IA 3NNDA 5CM9C 1ULSA 3TOVA 1YVPA 3QVGA 5H7XA 1ZP6A 2WTNA 2AOWA 4FZVA 5LU8A 1KMMA 3AF3A 5E9JA 1J0CA 4RY8A 3ZWKA 2IWHA 1PBTA 5IU6A 4UDNA 3R0IA 4IDAA 2BELA 4ZHSA 2NU8B 2IVZA 2B8NA 5AUPB 2GCNA 3HY3A 5FOTA 1PL7A 2O2XA 4N0MA 2PANA 5CA1A 1T29A 2BSQA 3GLFB 2R1TA 4CI0B 1M2JA 2UDPA 3D7MA 3FG9A 4DIKA 2H2WA 2Q4EA 2GOYA 1C30B 1GNRA 2R62A 1YDGA 2VHUA 3ANNA 4G63A 4J1TA 4P6VF 1B3BA 1GVHA 2FMUA 4Q3NA 5I9TA 3V8NA 5KQPA 2VRCA 2WE7A 4YRBA 1UJNA 3GT4A 2Y1EA 1R7RA 2J3JA 3N0RA 1DELA 2ZJAA 4X91A 3NV9A 1PGNA 1G42A 1UMDB 2HA4A 3ER6A 3BL6A 4FR2A 4O4LA 4TRMA 1VMAA 1W4RA 4HNGA 3B1FA 3L1VA 3LPAA 1E60A 4DNOA 2D6FA 1N6OA 2VNJA 3L82B 3WMFA 2FUNB 2XRYA 3D1VA 5C34B 2GSDA 5H80A 3GEMA 3QQ5A 4XFDA 3TLBA 3E7PA 5KCZA 1S2IA 1I1HA 3AUXA 4JK3A 5A3RA 2EBWA 2ZYGA 4YS6A 1HZZA 1KZ6A 1NF8A 1RM0A 3UT0A 2GN6A 1XMQB 4HDMA 4OQFA 1UXOA 1ZNWA 3KOUA 5IS2A 4ZDWA 1VC2A 3LIIA 5ICGA 2P1ZA 5L45A 4FGUA 1N32B 4M2LA 2JI6A 5AR1A 1UBOS 2NPOA 3H2SA 1U7DA 4FSXA 2PMBA 3O8DA 3RARA 3CZ5A 1KOGA 4M89A 4D02A 1XOIA 5F1PA 4RTMA 3GGPA 3S1AB 3ZDXB 3GRAA 2OZVA 2TMYA 3P0EA 1WU7A 2R6JA 2WVHA 3G5LA 2UYCA 3NYRA 3NPMA 4L4ZA 1QANA 2XVZA 2EF0A 5JNVA 1GCUA 3M33A 5IWAB 2EBFX 2QX8A 3DZKA 3MWEB 3OLYA 4NBKA 3V4OA 2ZSJA 4MKGA 1YRBA 3IV6A 1QVRA 1N2CA 3QITA 1BX1A 4OFXA 4UE6A 1EVYA 5F4ZA 5HTKA 3RS4A 2O59A 3BQ9A 1VE3A 5L7TA 1M6WA 1TL7C 3E9RA 5T8KA 3WRWA 3OF5A 4CM9A 1QQ5A 3IT1A 1FP2A 5K8JB 3KSUA 1D4FA 1PK7A 1WMSA 3UB3A 3TKAA 3F0TA 2CHEA 4UUMA 3KJHA 5GONB 5HCUA 5KOJA 5LYYA 2B3DA 2I2DA 1ODCA 1P75A 4GO1A 5AM5A 2XTJA 3SE7A 5BUSA 4AJEA 5KHOC 2FSPA 3Q1KA 4QUHA 3AYXB 2O9JA 4IICA 1I6LA 4PZ0A 4YI5A 1J33A 1JBKA 2NACA 3B8HA 2DTDA 4YJDA 4LNUB 3OD5A 1PT6A 4ZN6A 1GPNA 3PRYA 3E3AA 5AKEA 4DYVA 2YWCA 3DB2A 1UPBA 2EBUA 2N1BA 1F7VA 2PX6A 4GM0A 1HYEA 3F6YA 3W8NA 1LW6E 3RGGA 5D01A 5GJVC 1EZ4A 1BJKA 4R05A 1Z2DA 4I50B 4MEJA 2ZETA 3AERA 3R7NA 4EKNB 2FMIA 1RWVA 2AVDA 2JIRA 2OGTA 5D87A 3VH1A 5BQ3A 4KREA 2PZKA 3VVCA 4N5MA 2ONCA 3AKCA 3F3SA 5LQRA 3D4NA 1BX3A 3GFOA 4CI9A 3B3QA 1Z7WA 3MGKA 1ISMA 1UBLS 3NI2A 1VSQA 1XNGA 3Q7EA 1JFVA 4JJZA 5F64A 1WJGA 2QP4A 4KMRA 5EINA 3OQIA 2EV9A 1JEQB 1NNUA 1Y8ZA 3AR6A 3OEYA 1Q95A 4WZAB 1JQBA 4BU1A 1DBSA 2VUSA 4K9DA 4L85A 3PWTA 2DWOA 4Q3CA 4US1R 3GYBA 1JKMA 2HWWA 5DPMA 3DZ8A 3R6DA 4I8DA 4RTQA 2RGRA 3P9CA 2M6SA 2B35A 2FCRA 3KIPA 2J0SA 2OG2A 3GGGA 3L7DA 4MQBA 4X90A 4CFYA 3CN9A 2O57A 4M8IA 5AKGA 4EYSA 3KOYA 1C1YA 5JCOA 2YIMA 1P62B 4CHTA 1OPRA 4YV1A 1X1TA 4TT8A 5H9WA 1C3XA 1QFSA 3OE1A 4HYQA 1ISJA 5C7LO 1KO7A 4KFCA 4OB6A 4KWEA 3PCTA 1FY2A 4V0KA 4X8OA 3ST7A 3WK4A 3MTDA 1RFGE 4DRXA 3EJ6A 2IYUA 4LXXA 4MIKA 4RY2A 1Q14A 4Y9RA 5JHGB 1SWVA 2ZUWA 4RTNA 5B55A 3CX6A 3JYOA 2FWIA 4JLOA 3VUFA 4X54A 4EM6A 1EHCA 2IPLA 2PE5A 3NXKA 3LDUA 2EZ8A 3U7QB 3OE7D 3C1TA 3OIGA 1R0XA 2Y76A 3OPMA 1AOXA 2Q3DA 5CLIA 3SF8A 2H5LA 3I53A 4Q48A 4JKOA 4C05A 4Q3DA 4DR2B 1GILA 1L5ZA 3AHDA 3VU1A 1L7AA 4LDJA 1T4CA 3ZWXA 1PFQA 2CXPA 3C3WA 1DUIA 4MX8A 1SVKA 4ZOQI 4K9OA 4U02A 2H5EA 2FLVA 3LHSA 4INPA 4ER6A 4IEEA 1CX9B 3PFFA 4ZRDA 4XW2A 2BGJA 4E03A 5L3SB 3DMNA 4EA6A 1V25A 2VJAA 4YRAA 1NUAA 2JHPA 3EUWA 3MXTA 2CK3D 2H2FA 5T64A 3TNLA 4J0EA 3UGJA 1E66A 1FFYA 2PPVA 4ZU3A 3O8RA 1UZMA 2OORA 4FYKA 5TSDA 2XQVA 1UFOA 3WGNA 1EVJA 5ICSA 5F23A 3QFRA 2GN1A 3KOOA 4UUBA 2J0EA 2OGZA 3O8QA 4ZOBA 1T1SA 5DCWA 4E13A 1JR3E 1TC1A 3DAHA 2IPMA 2WUFA 4YJ3A 4ZJZA 4E4TA 3D64A 3AFNA 3CKLA 3PNQA 1US8B 4FKZA 1O8BA 2ZPTX 3OZXA 5K20A 1NDUA 3CLHA 3LOPA 2IW1A 3P9KA 3QHPA 3I5AA 2O8DB 1WXQA 2XJ4A 3T7JA 3C3MA 2JLXA 2FWPA 2Y9PB 1T34A 4FCWA 5AJUA 4BKRA 1RNLA 1YBAA 1DIHA 3IB3A 4IIJB 4HN4B 1C3VA 4Q6WA 4IHJB 3BAFA 2XB9A 3O47A 3PQ2A 4L5IA 4CV0A 4UTVA 4IJ6A 2WK1A 1OX4B 4JLBA 4QLBA 3MYRA 1Z2CA 5GVRA 2G5CA 3MQ2A 4RFSA 1A9XB 5DXFA 4N47A 4HMPA 4Q3KA 3TZCA 3UXMA 5FWXB 5JXWA 1DFIA 1G6KA 5GIOE 2QGFA 3ND5A 4IWNA 4WY5A 5EKXA 2B4AA 2QXUA 3MD0A 1H0HA 1RRVA 3L0DA 1FSZA 1XAIA 3GEPA 5EIAA 3KPVA 1QQ7A 1JZQA 4GOXA 4W5WA 3EUEA 3HRKA 5AW0A 1OFGA 5TY0A 5JBNA 1E1LA 1G3RA 1WHSA 2CNOA 2ZWOA 3CMCO 4BLTA 3O91A 1OASA 3MHPA 3AVUA 4ZK6A 1PG2A 1YUNA 4E08A 4FB5A 2CE2X 1TK9A 3MWDB 3QA9A 1JH9A 2WHPA 1XEFA 3M6AA 3ZU4A 1Y6ZA 3N8IA 1Z3IX 4HH1A 2A9FA 2JPDA 4HWPA 4OO3A 5CR9A 1GUBA 2C82A 4B87A 2OCYC 5J1SB 4I1OA 5PGMA 4BCBA 3C3BA 4G5QA 2YJ4A 2ZRGA 1MC5A 1NUUA 1OH6A 1IVSA 3TZBA 5C8DA 3DEHA 2J30A 4ZARA 1IK6A 2G70A 2WU3A 3BXHA 3KT6A 1YKFA 1Z0ZA 4YFVA 5GJCA 2IIQA 3LG2A 4BU0A 4GD3Q 2OAP1 1S1MA 2JEZA 2OWDA 3NBYC 3HB7A 5H1YA 5LZ7A 2X0FA 2GHQA 3SG0A 3DZCA 3E3NA 1A2BA 1FFWA 1U1EA 1E2DA 2AFIB 2HBQA 2HRZA 2VF2A 1ZM3A 3EA4A 2HT6A 3K5WA 1DS6A 2O8BB 3DQQA 4MDHA 3PYMA 4UBIA 3O1HB 4TMTA 3F9RA 3KSBC 3BFJA 4N54A 3CO0S 2ZJFA 1KJ9A 3NP9A 4QM7A 1NY5A 3Q7IA 4XTCS 1SK8A 4HB0A 2NUAA 1RR6A 4ODIA 5CX1B 5TV2A 4DC9A 2WB4A 3DAGA 4HAUA 3IULA 2DBRA 5ISMA 2K2WA 3B5JA 2PR7A 3KD3A 2AG1A 4BRZA 1T9CA 1G41A 3KEMA 5SYNA 4AKIA 2PS1A 1H85A 2F1RA 5DGHA 3IL2A 3GZJA 4G9GA 4EB8A 3NASA 4D2IA 4Q24A 4MPTA 3UT6A 1K7CA 4NNJA 1K4KA 4YJGB 4D6XA 3LLMA 4XVUA 4TMZA 3KL2A 4R3UC 4KR0A 1A82A 2YHAA 4V02A 2ISQA 4Y2QA 1U7XA 1NUQA 1ZX1A 1HNZB 3TKLA 3W3AD 1J7JA 3HWWA 2W42A 4MOWA 2FPIB 2VLIA 3O2JA 2CWDA 4X62B 5DIFA 3PR3A 2XVYA 2VHXA 5JD3A 2WTXA 1P2VA 4KQKA 3G68A 2X0EA 1ES9A 1AKUA 2IUYA 3C4JA 3DKRA 1GPYA 3PXEA 2EJBA 4DV7B 1II0A 1JSLA 2FZGA 3NM4A 4J90A 4F3CA 4GECA 1FLNA 2JGEA 1FDSA 2AE2A 5AI9A 5HTOA 2WKSA 3F5DA 3WL4A 3DC2A 1Z5OA 1JQLB 3H0CA 4MUHA 1U3DA 5F1YA 2WWRA 3WLEA 1Z16A 1CS0B 3VGJA 3ZV5A 1JXOA 4EUHA 1P1JA 5MF6A 2HHJA 2RHBA 1DKRA 3Q3EA 4Y18A 3W4IA 5K9ZA 1U4NA 3OOSA 4AP5A 5JLAA 2XEXA 4WJZA 4AIRA 5F7JA 4YROA 3T3NA 4B6JA 2GUWA 3CLVA 2Q2OA 3RAJA 4FXOA 3DEAA 4NECA 4XUEA 5CA0F 1GUYA 1RJ9B 2WZCA 5DYTA 3RODA 1PGJA 3N2KB 1LPNA 2C97A 2QX6A 4DIOA 8ABPA 3MJSA 1FDRA 2BGWA 1QHEA 4QBHA 5A1TA 4QPCA 2MYUA 1DC5A 2GPYA 4XFJA 4XWOA 2GXQA 3F49S 1B8OA 4G36A 4II3A 5IKPA 4E30A 2GAOA 3B8EA 4E4RA 4Q47A 4ENTA 2BFEB 4GIBA 1P5RA 1CBUA 4XGIA 3IKTA 4RKEA 2HD4A 3U3OA 3M9WA 2R87A 1PTKA 2GA8A 2L18A 3MGBA 1H9CA 5A9SB 4M0LA 3HFRA 1NWHA 1SR8A 4IGKA 1H5NA 3ZHBA 4EZEA 4ZDJA 2XUKA 2GBFA 3A6DA 2FFAA 3GVXA 1VG0B 3G9QA 3DCJA 4DEVA 1XRRA 2WIGA 4M87A 5JQWA 1RZRD 1TF7A 3BA6A 4LJLA 2J3QA 4OQXA 1HE4A 5CNKA 5IXJA 4NCNA 1Z9BA 5C8VA 2ONYA 1XZDA 3CUEF 4G5HA 3RREA 1A4UA 1PSDA 4D1YA 2WP8J 4DOMA 3RM3A 4MA0A 2WYWA 4GP9A 1CRWG 1JLSA 1S3IA 1H6BA 2A8YA 2X2EA 3PJRA 2ZT7A 4OJQA 2WHEA 4XB2A 2JGFA 5AW1A 5L6MB 5LYJF 2G36A 4IF4A 1AS2A 4IM7A 5BYAA 2CXSA 5B1IA 4WVFA 3JWPA 1Z0DA 4MP6A 1NVBA 4Q9NA 3OZVA 3BCUA 3OQPA 1UM8A 2PQ0A 3O8OB 4IZOA 1HSOA 3FB1A 1JDUA 1ZU4A 4CDMA 1M7HA 4OFBA 3WMRA 4OLAA 1NYTA 3N1UA 4URZR 4W7SA 2JG3A 1XPJA 4A73A 3DNPA 3L9WA 4OXYA 1J9EA 4TSFA 5FTJA 2WJJA 3QEBZ 4A5SA 2GNOA 2HUPA 3QUBA 2C7RA 5LP1A 2AOUA 2I8CA 2NQ8A 2PZAA 5DHQA 1DLIA 3TTSA 3SNKA 1IY1A 4GMFA 3UAWA 1WBDA 2QE7A 1L1RA 5EE5B 4AG5A 1F2TA 3OZAA 3R7AA 3F71A 4W5JA 4L0MA 2YH2A 2RB4A 3CUSA 4Y9SA 5SZJA 1RW4A 1AA6A 3MD9A 1Z6TA 3UK1A 1P8JA 2BMFA 4JC5A 1NJ2A 1C50A 5BRNA 1RKVA 2AN9A 2GJKA 2WV9A 4ZGWA 1N92A 1Z5NA 2ET6A 2K5UA 3DYBA 3PWSA 4MRSA 4PFKA 3QOWA 4V0RA 2FSUA 4E2WA 4BTVA 5KNCD 1LQUA 1E63A 1PVVA 4UEQA 1YCFA 4C04A 4QUIA 2VK8A 4FS3A 2FW0A 3NC1C 3CH6A 3GPLA 4TTSA 2H4YA 1WOYA 4Y2YA 3IBSA 5T3YA 4I46A 1GZVA 3PYXA 1L7NA 2QDXA 2PS0A 5AW4A 3BBLA 1A76A 1RTTA 2QN6A 1C7RA 2YS6A 1OI4A 1U7PA 3CPJB 2YMLA 3QQPA 1NVEA 2X3YA 3ZXIA 1VI6A 2XGJA 3V46A 2P0EA 2CC2A 4L5CA 3EFHA 4WY2A 4YRDA 1AU9A 5K2OA 3ESDA 4DLUA 3BTUA 2I34A 1HQDA 2PFGA 1B0UA 3JQGB 3CR7A 3JD3A 3TB6A 2ZZMA 1U0SY 3DL4A 2HIGA 1A1SA 4A0RA 1FTWA 1RTKA 1P7VA 1ZRMA 4IHQA 2O8EA 3VTFA 2IK8A 3G79A 4P5EA 3RS9A 1E6KA 1DQYA 1NSYA 6YASA 4OX9Y 1GDHA 3K09C 3KU1A 2ODTX 5K6AC 3S68A 3DCIA 4N5DA 4XDGA 2PU7A 3CNOA 3W3ZB 2P65A 4BNDB 1KFCB 1UZUA 1H5QA 4IV5A 3SSOA 3O26A 4ZXPA 5BMVB 3L8HA 4RL4A 5AI0A 3ROQA 4C88A 3A36A 2EQAA 4U00A 3NRJA 3FPSA 4KE7A 4E22A 1XCLA 5GY7A 3SEAA 2W4MA 4HDNB 2AZDA 1BH2A 2O2CA 4G0ZA 2WY2D 4E5MA 2GXUA 3THSA 4I9UA 2F90A 4TXMA 2WU8A 4XRGA 1MENA 4GF5A 5AW8A 1P1IA 2HV8A 4HI0E 3OWOA 5DWDA 2I66A 1H65A 1CIJA 1D0SA 5KYYB 4B83A 4D56A 1Z33A 4BFCA 1NY6A 2IYTA 3A31A 4RHCA 2IU0A 3FPGA 1XPOA 4G8CA 3PF8A 2H9AA 5NLLA 2YRXA 1UH5A 4EG6A 4CEJA 2BGIA 1R9MA 2F1OA 2G9QA 3S2ZA 5K0TA 3QEAZ 3RS3A 1VPLA 1RADA 2WSSD 1B15A 2G83A 2ZXFA 3AK4A 4FFOA 3UMFA 5C7YA 5DVZA 3ZEAA 3NDBB 3MBIA 3CQ9A 4CMBA 1XYGA 2UVPB 3OHPA 5JAZA 3H1TA 1NTRA 2EWMA 3UGTA 4HLNA 4CT0A 4RTSA 4PYNA 2FTKE 3C5CA 4AWBA 5FDFA 2QMOA 5LKRA 3K73O 2C2ZA 1OXVA 1JG3A 2FSVC 1JP7A 1XE3A 1ZK0A 2IYSA 4NBSA 4A6DA 2F59A 1HLPA 3A6ZA 1EDOA 5DM1A 2GYYA 3OG9A 4REQA 2HK8A 5AXAA 1GFSA 4RDCA 1BQ3A 4HQNA 1ZGGA 2F3QA 4KODA 5E7IA 3UQZA 1ESDA 4MGEA 4X1KB 1O94D 2BVNA 1PQWA 4XWGA 1Q0SA 4YAGA 1C0LA 2ZUTA 2EGHA 2CFCA 5A06A 4H0CA 1R74A 1V3TA 3R4VA 4BUZA 1OYWA 2OAQ1 5I5EA 2CL6X 4YMTA 2E2WA 2M1ZA 5LB2A 2R00A 2IT1A 1U8TA 4BNXA 4GSYA 4LJ9A 4NOJA 3F67A 5F3DA 3REQB 3SVTA 1V4VA 5G4KA 5LUBA 2HJGA 1GKLA 3SIXA 1CF9A 5F7OA 4IW3B 2WEKA 4XIYA 1C7JA 4AL4A 4KQHA 4TTQA 2O0MA 2PBLA 1GCAA 1O5IA 3UOWA 1TU0A 1VJRA 3ICVA 4B44A 3OQNA 1VECA 3HI4A 4JWTA 1T1JA 5AM1A 2C3MA 4CJXA 1PR0A 4Y6SA 3TLXA 4B4KA 1T24A 1LBSA 3G2QA 2CMKA 2A3RA 4G8JA 4UBLA 3FJOA 2CCGA 5DHFA 5DHAA 2PMKA 1ZPDA 3ITEA 2RD2A 1PL0A 1D1TA 4Q34A 3P4UA 3JALB 1R1DA 2CVFA 2R6GA 4PF1A 4ZU6X 4PC6A 1YDFA 1J90A 3AV3A 3PKZA 5CPBA 3C2QA 4Q39A 3SHFA 1VLLA 2JK0A 4KQEA 2OCIA 3LDFA 1V1JA 2C20A 1IYZA 3AKYA 3PDIA 4FZ5A 3VJKA 4CGZA 3UUFA 5K0LA 3LWBA 2GJ9A 1G9XA 3R9XA 1F4LA 4EGJA 3ZTTA 3EQZA 4PPGA 4LZJA 4ZIRB 3WQHA 2WTBA 3AEKA 5C1OA 4ZODA 4KLZA 3JAKB 2OLKA 9LDTA 3WC4A 1GG9A 2OENG 1W5AA 3Q41A 1L8LA 3P7MA 1D6NA 3E3OA 3TTWA 1GCIA 2IC5A 5I47A 2JJ2A 3SYKA 5HKKD 3HN6A 2X19A 1SCDA 3KQNA 3I0MA 1SBCA 3TBKA 2QRUA 4M7PA 5E3IA 3LOUA 3FSJX 2VLBA 4WKPA 3QJ5A 1T3TA 5LMCA 3F7NA 1YE3A 5CUQA 1E4OA 1IVNA 1X70A 3DT9A 2P9EA 4JI5B 5ALVA 1GGKA 2H1OA 2AN4A 1WSDA 2CMDA 3GT3A 2F00A 2I1QA 3VR6H 3OFND 2JI8A 3ABRB 2GNPA 4P31A 2Y68A 5J1TB 4Y67A 1GA4A 4R83A 5KSPA 3DT8A 1NLMA 2IEDA 2GEJA 2JZCA 2P9CA 1E7WA 3P20A 4M21A 5KJCA 3BEDA 5HSGA 3WTBA 1USWA 1PLKA 4ALIA 4BVBA 2VXOA 2GVZC 3LUFA 1RHRA 1VBNA 1SD5A 3AO0B 3OE5A 4WLUA 3OTOB 1THZA 2MMGA 4MUEA 4ARIA 1RP1A 1WHTB 3NC0C 3G13A 3RF6A 4OQ4A 5B30A 2R8RA 4I9GA 4TYQA 3UC5A 5A6SA 1WETA 4YMWA 3V1KA 4Q12A 3RLFA 1LJLA 2HMYB 4ZVQA 3R8CA 4JI3B 1KEEA 4C2TA 4OI2A 3ROZA 1FP1D 2VCHA 1QCYA 2ZUSA 1I8TA 3SX2A 1ZM2A 1GTG1 4LW8A 1Z7BA 1E94E 1EK1A 4RQAA 2NU9A 3RYTC 4TZ0A 1WZIA 2ZJYA 2Z1NA 3C70A 3FFAA 3LUKA 3CNBA 3LW7A 2PQ6A 1I24A 1NVMB 3UH1A 4PYOA 1K8XB 1UXKA 2ZIEA 1LFAA 2P7IA 2GHIA 2FGJA 1OZ0A 1N2GA 1UEXC 3HVUA 2UV8A 3HYTA 1DV2A 1GNTA 4CR7A 2XY4A 4ARAA 4D44A 1EG7A 1MGOA 2Q45A 2WMDA 3MAJA 2NTJA 2DHCA 2PO7A 4FCVA 4Q1BA 4QTZA 4Z49A 1A97A 3KKOA 3HEAA 4X3PA 3HKCB 1NVVR 5A5FA 1M2OB 5C1PA 1QZZA 5IZCA 2XT6A 4XLTA 3EGXB 2ATCA 2BTQA 1SHKA 3R6LA 2V74B 3GG2A 1E1RD 1H3FA 2E5WA 3JZDA 3DV0B 3KO8A 4Q1VA 3KC2A 1F2VA 4BQRA 5FBVB 4PX5A 4DMLA 4RY0A 4OLHA 4ZT4A 1SCBA 1YL7A 2MU1A 3CURA 3DZFA 2YJTD 4G07A 3FHJA 2HDHA 3D6AA 5E4JA 2R1VB 4TLDA 1N8KA 1Z0JA 4OKIA 5CX4A 5KTPA 1R5BA 1G0NA 2XLBA 3F7OA 2ZRDA 3FLAA 4KQGA 1M6YA 3HRHA 4P4GA 2LIVA 3HYNA 3VZDA 3F9IA 5EEGA 1KDOA 3FUXA 4H7EA 4MVJF 3WJ7A 2A84A 3ZHTA 4D3SA 1IUPA 3OZCA 5B6IA 3MT8A 4ZHQA 2P4HX 1QG6A 1S4MA 2IEGA 3PT5A 3GZNA 3B3AA 2X77A 1XSEA 3GCXA 3UTDA 4D0NA 1WR8A 3E7DA 5HFNA 1Y4AE 4W82A 2AZMA 2ZJOA 4N40A 5BPFA 4DB2A 2NU6A 2OYCA 1I3MA 3N2LA 2XCOA 4DB4A 2FKNA 5HK9A 1E64A 1A27A 1V9SA 3CRW1 4IP0A 1D9ZA 3QUTA 4GZ5A 5ALRA 5F2KA 1ZM4A 3JD0A 2DKNA 3SBOA 4TZKA 4A91A 5T7BA 1E3DA 1GL9B 2CUNA 2OBXA 4NPHA 3F6PA 3H83A 3OOJA 1IUNA 4WX2B 1U2PA 4GR9A 4LXIA 4M4SA 4EUKA 5JAPA 4F85A 4QFMA 2A0UA 4RIFA 1I9CA 2ACEA 2VDWA 4NE7A 1MF7A 1NURA 4RWEA 2B30A 3ZNOA 1AQIA 3FNQA 4B2YA 4DXHA 4EO9A 5KINB 2XE6A 1Q0TA 3ZDQA 2H5IA 1UBTS 2XOKA 1RRGA 3AM3A 2EDCA 4NXMB 1KGDA 3Q2IA 2ZVDA 2JIZA 3NC4A 1Z6AA 4ALLA 2PXXA 3AI1A 1SULA 4ZVMA 3II6X 1WDMA 1BZYA 4KQ9A 4ZYYA 1EB8A 4Y6LA 4E7PA 4RQUA 4EQZA 4XX1A 3KJEA 5E6RA 2QI9F 4L6IA 1EUDA 1Z36A 5TPWA 4C7XA 2CLCX 1SCUB 3HLKA 4U6SA 3QBJA 1G8JA 1X7ZB 1PZFA 5IAOA 3D7RA 3MINB 2B5WA 1CVIA 1AQ6A 1UKCA 5FL3A 4ESOA 1GRVA 4JKYA 3IUQA 3IVGA 3CKMA 3O4FA 4PY2A 2QUAA 5EOVA 2OLJA 1Y8QB 2WG2A 3WIOA 3JQEA 4CF7A 2JGRA 3FPFA 3DEKA 4Y3UA 1EXVA 2HXYA 3P2MA 5A4MS 4FNMA 1MC1A 4KLCA 2VK4A 2ZSHA 1QK4A 4INAA 4L78A 5GZ3A 4RJ2A 1JW9B 2WQ6A 1S8AA 3X1MA 1Q77A 1YFLA 2WDPA 4BVLA 5CB4F 1JHOA 3EF3A 4AUMA 3OIFA 5ER6A 3N2EA 4B8ZA 4EY8A 4D3YA 1CFJA 1QUFA 5C8XA 1T3SA 3QOFA 3NG1A 4FYYA 4UEWA 2CHGA 1IWOA 1XT6A 1Z5WA 3G0DA 2J6CA 4K46A 2HEGA 1T2DA 3R3JA 1K2VN 1NXXA 4C4YA 2HA7A 3I58A 4W8OA 1NW3A 5KBYA 1X1CA 2ZU0C 4WHMA 3MNFA 2VTDA 4O5AA 4R1LA 4AKHA 2VCYA 4PLZA 3FHTA 2WJAA 4HS9A 2YYZA 5KI6A 4H27A 1AQNA 4XGKA 2XGOA 3SQMA 3BMNB 4NOMA 1YT5A 1X1SA 5EJ6A 1UIMA 4F6LA 4BFTA 1K7XB 4PIMA 1U02A 3VUEA 2V97A 2VNAA 2FG7C 3IPCA 5LPNA 4H3KB 2HJVA 4HVAA 2J9FA 4M55A 3FYCA 4QEZA 5HIJA 3V1NA 5HFJA 4CLOB 5I01A 4ZHQF 1J24A 1M73E 2MSDB 2V7VA 5IF3A 4N41A 4LBVA 1SOUA 5ALKA 1EZZA 2PXHA 4QGAA 3BCSA 4YP7A 1JQAA 3IKJA 2GD0A 4IYJA 2BEUB 1EWVA 1GUDA 1PR2A 2BGMA 4XASA 5HQ3B 1U4SA 4JKIA 3RAGA 1ESEA 5JVDF 2JFWA 3OX1A 2FHSA 3RTDA 3LFTA 4WPGA 4WZ6A 1D1SA 3FMVA 3Q6NA 5B3JA 4EGQA 3TG2A 2H59A 2OV1A 4PX2A 2WYVA 3CPSA 3I73A 1T6ZA 4RCYA 2G09A 3R9IA 3ZV4A 2O07A 4DLKA 3IQFA 2WKRA 3K4QA 3ZOZA 4HADA 4LPKA 4MLZA 2NO5A 1CUSA 3EDQA 5CLFA 4N1AA 1VJGA 1QIKA 4B71A 5A3VA 3ZZTA 5TS2A 3R75A 4BCDA 3K0AA 2D1YA 1ZG3A 1RWMA 1Y3BE 2C84A 3IODA 4H3HB 3AL0C 1C14A 4O0LA 2Y4NA 1Z68A 4ZA2A 4CMEC 1ONNA 3LDAA 2I1VB 2HHAA 3E0XA 1B74A 1U94A 1TAHA 1GZ3A 1DDIA 3C8MA 4F93B 2GYVA 4D97A 1NXVA 1JBEA 3LLCA 3CF6R 3PVSA 2VZEA 4WK4B 1G20B 4M36A 3JWHA 5I4KA 2X76A 2PTHA 2HR1A 2BFCB 2PSHA 1M8PA 4JUDX 3CLUC 5BNFA 2E48A 2JCBA 1JHZA 3P8ZA 2PH7A 4JB3A 4MRMA 1YVEI 1J20A 4H7PA 2XE8A 3H1FA 2EEZA 2HDNB 2VZLA 3GEDA 5FTWA 3U16A 10MHA 3KZOA 4C87A 2P30A 3AC0A 4FNAA 4RH0A 1CVRA 1LVGA 1M7BA 1P7WA 3Q0TA 4K81B 4MR7A 4NBVA 5E6SB 4AY3A 2R79A 4C1BA 1F2UB 3A4YA 3IJRA 3RUHA 3DD1A 1P9WA 1YOVB 1XP5A 2QTVA 2CB0A 2FN4A 3ID6C 4M8NE 4QQRA 5CFMA 5EMKA 2WFAA 4RTLA 3BTVA 3QPVA 1K9VF 4HQKA 4ZEXA 5DT2A 3T1OA 1Z06A 1ONBA 4HEHA 2JB9A 3L8FA 1IHOA 4LRXA 3HUFA 4IIDA 3FSRA 4UMFA 1UJBA 5BVHA 5AI4A 4WQMA 3KQQA 5IULC 1KF0A 4JBLA 4KKXB 1UT6A 1VKZA 3IPRA 3K6KA 2C7VA 1Z13A 3PSHA 4LQ4A 5DBOA 3AM4A 3RBZA 4BB0A 2VQ6A 3VDRA 3U09A 1F6BA 1T2VA 1GLNA 4YA6A 2BFWA 2JJ1D 4I66A 5YASA 2ZVJA 3HU1A 1JIUA 3JWJA 4NZ9A 3EEYA 2VHZA 4O4IF 4PCAA 1YS2X 2W2NA 3BWDD 3EZXA 1BRTA 4RACA 2Q5IA 5I4BA 3VR4D 2PTGA 2FW1A 1EFRD 2A92A 2X4LA 3ZH9B 3IQZA 1MQ8B 1Y1SA 2X5NA 5CD9A 3FOWA 2IXFA 4M0MA 1E2BA 1TVKA 3EXFA 1T9GR 5DLEA 2DMRA 2ZYSA 2C2YA 3GL9A 3B3JA 3FRHA 3PXAA 4WOCA 1I6KA 2P9QA 1PUXA 3IQWA 4JUBA 3I76A 4RU1A 1DXHA 5C8ZA 1P2FA 1TOAA 3GUHA 3PCRB 4QBFA 3K1JA 3TRJA 1NXSA 2ABWA 2EIHA 4FFSA 4AS2A 3MT0A 4EA9A 4F84A 3C7CB 4ND8B 3TMYA 4BBPA 2QRLA 1UOPA 1YQDA 2C5FA 3RVDA 3TQQA 2DUJA 2B8EA 3E1KA 2RBGA 4MWEA 1IEXA 1Z6PA 4P81A 3ZTYA 1GUFA 1QMGA 1UPUA 3ONWA 3N7UA 4C3VA 3ZX4A 4ZCSA 1EXDA 4R2KA 5FBQB 3TXYA 5LFAA 5EJ8A 1ULHA 4Q3BA 1SCQA 1JIJA 2HXGA 2QZ4A 5C4GB 2PGIA 2WSMA 3TWOA 1T2UA 4C7BA 2W6IA 4ZQHA 3HBMA 4HLQB 1Q50A 2A57A 3VSAA 2IXDA 5I45A 3L6RA 2IXAA 1K66A 3Q3CA 4W7HA 3C39A 1Q3HA 5GGYA 4TSRA 4E0BA 1L5GB 5AFSA 4W5NA 3UY4A 1RHQA 2W6QA 1U2SA 1RACA 1MJGA 3GVIA 3M1AA 3RW9A 1OA1A 3GFBA 3LT0A 5EJ2A 3A4NA 3VQTA 2XMDA 3S7ZA 3NOXA 2IEBA 5C3MA 1F3LA 2CWWA 4Z0NA 1D4ZA 1AKMA 1HQCA 2ILTA 3W5AA 1G21E 3E35A 2GMWA 3PUHA 4DCNA 2V45A 4D4JA 1K8YB 3HCWA 2Z95A 1GL7A 2FSSA 4WNIA 5JW6A 1DIRA 1N8SA 1V2GA 2G7MC 2ZIFA 3EFBA 4JGGA 3L05A 2DPHA 4J9UE 3KWMA 5EHIA 5AJTA 4MCJA 1NHGA 5IAJA 2Q28A 3M1YA 3WRYA 1GYRA 1JQJC 1MEJA 4RE6A 4FZ3A 4M1OA 4FNOA 4GL2A 4M1TA 2H7YA 1M75A 3IKVA 3ABSB 2BTOA 5H3LA 4GBGA 3GOHA 2ZATA 1HY3A 4NLLA 4B5KA 4MV0A 3U3JA 2J4FA 4OK3A 2JL1A 4POAA 3BULA 3QKTA 4LNAA 3NMUF 1CRPA 2VYFA 4O3FA 5CB6A 3AKEA 5EKTA 3AESA 3KZCA 4YUYA 4WN9B 4ZV9A 2D8MA 3KQTA 1R0CA 3H05A 2IODA 4HP8A 4IV8A 4OD0A 4OXIA 2FKAA 1BCSB 2WIAA 3VNAA 1A9TA 1BVRA 2DC1A 5FX2A 1IOLA 2BE9A 1CJTC 4TMXA 5FPPA 3V1YA 1HH4A 3FNEA 2M32A 3I5XA 5M5BA 4WZBE 3FJ1A 1R0KA 5BN5B 16PKA 3A1FA 1KBZA 5IW8A 3HNPA 5JS6A 2P68A 1F5SA 2QOEA 3ZQKA 3OU2A 1Y1PA 1MZPA 4ZCLA 2VDVE 1PJCA 4X0EA 5IPFA 1K8ZB 2JHCA 4X1IA 1QLWA 1QRUA 1LPAB 2FMXA 2D5BA 4UBJA 3EWNA 1DTEA 3DMPA 5D84A 5KJFA 3ANTA 2JD0A 1AXEA 3NHRA 3PEFA 1HL7A 5C7OO 2ZAYA 3KS9A 4Y9DA 3R3HA 4BRSA 4CHGA 4DZTA 5CFRA 4WESB 2DF8A 4ZVNA 5ELLA 3FTEA 1XRSB 2WC1A 3ZWOA 1QGUB 3KOXA 1NFRA 4NENB 1E2UA 4L4SA 5ED0A 1ADGA 1PJ4A 2EX4A 3I01A 5FTLA 3FBWA 1U5BA 5LC1A 1G0OA 2KW5A 4G4SO 4LOIA 3ZCUA 5GJBA 2VJQA 4ZRNA 4OHOA 1DADA 1Q84A 3F5MA 3D43A 1XNHA 1BQEA 1ISIA 1Z83A 2W2LD 4JBWA 4WKCA 2QP3A 4F1JA 4HX2A 1OI2A 1FUEA 3ZWAA 2QUZA 3C5VA 3DAFA 2NM0A 1CQZA 4FGJA 3WAKA 4CIYA 2TMKA 1VE5A 4V3CA 4JX8A 2NXNA 3RTGA 3VU9A 2GLXA 1I2MA 4N0PA 2XNDD 3MWYW 3K2QA 2D06A 4NJOA 5HM6A 3V8QA 2OBLA 1X3LA 1MX5A 2QSJA 3C8ZA 3EPPA 3F6BX 4FC7A 3X43A 5CAEA 2WG0A 3P9PA 1CRLA 3H9GA 1E99A 3WO1A 1XTRA 4RQBA 4QOJA 1A72A 1V1MA 1PS8A 3NAMA 5EFOA 1NVUQ 2FJ0A 2QAGC 3DAPA 5AHXA 5ERXA 4JI6B 4U63A 1TM3E 3FCAA 4EB3A 6ABPA 4EUNA 2I3ZA 1VIDA 4N0QA 4DARA 3KQPA 2GJ8A 3HY6A 2R86A 3A58B 2VQSA 5JSZB 3HA5A 4LK2A 1T4BA 3IIIA 1N2JA 2V54A 4TQGA 5IDQA 4OTZA 5ITSA 1LTHR 1U2GA 2WKQA 2PKQP 2AMLA 4MRAA 2NT3A 4WE3A 4Q3LA 1IEQA 1SEPA 5U4QA 1RPZA 2CXTA 1NF9A 5CVJA 2WHRA 5E7QA 3DYVA 1B1AA 3PT9A 4NBUA 4X1YB 4B4VA 5IFKA 2GJSA 4AT1A 5E38A 4EY4A 3C98A 2R44A 2WWXA 4OOFA 4ZI5A 1Z82A 2FP4A 4P7FA 1O5OA 1KXZA 4LSGA 1EQ2A 4RK6A 5HIKA 2I6GA 4ZI2A 3TCKA 1K6MA 5TT1A 2RBEA 1M0TA 3WQSB 5AVYA 2Z98A 4B7UA 1VLHA 2NZYA 2YWEA 3JVEA 3GJ5A 2YVLA 4P4SA 1KFBB 1UP7A 2WPNA 2QQFA 3KTDA 4MWDA 2FFQA 3T1QA 1ID8A 5BOSB 4L9AA 3P2EA 1X2BA 5D1NA 2ZE6A 3KSRA 1N33B 2B5OA 5JH7B 2PX0A 2QZ9A 1W8IA 3D8HA 3G17A 4TLLB 1KR5A 3HB1A 1ZCAA 2BFBB 1MO3A 3FKSD 1AGYA 4R2JA 4DNQA 2E7ZA 3ODPA 4UAVA 5DM2A 3LUGA 4UUQA 1C0EA 5AK0A 4L8YA 5KVCA 4AJPA 2IX3A 4PPNA 4R2MA 1V5FA 4FQ5A 1ZFNA 4CM7A 3OHSX 1MVOA 2NO4A 4QLAA 1EVQA 2DFKB 3G2OA 2XUAA 4KUHA 2HZ7A 1IRIA 1IM2A 2OSBA 4BX2A 4YT5A 1WF3A 2ZM6B 3O03A 4LJYA 1RZVA 4U3JA 3WLNA 1S2GA 5ESRA 4EHNA 3BN3A 4P32A 1QV7A 3Q3JB 4G86A 4TQUS 3B60A 3DMDA 1SVIA 5DYNA 2E89A 2Z56A 4FX2A 2J7PD 2HGSA 3RUIA 3V7WA 2OO7A 3HJGA 3HDTA 4XLZA 4FK8A 2I22A 3C3KA 3T38A 4F7WA 3VYWA 4EVIA 3W3AH 4XOIA 1WCXA 1Q1ZA 1NF3A 1NP6A 4M53A 4YEDA 1ZJWA 3AVPA 2OBBA 4MAFA 1ZUNB 3NAQA 1FW6A 3QKIA 4X94A 2XKKA 2VPWA 4BVEA 2FY8A 3QF7A 4MWCA 3WB0A 3H2GA 4F1WA 5LB4A 3U7HB 2CHVA 4JLJA 1PFGA 3CN7A 3QU9A 1JR3A 4LA4A 3QY9A 5A03A 1IAVA 4M0FA 1N4AA 2IS4A 5J63A 1CJMA 1QUEA 4CM5A 5DM70 4UTXA 3HADA 1L5RA 4US0R 3EVGA 3BF7A 4M7RA 4TM7A 5U1PA 1GQQA 1BWRA 2FPSA 2IKSA 2ZUBA 3DFKA 2BAGA 4JOSA 1OJLA 2QX7A 3USCS 3UG7A 4N4AA 1Y1LA 5CLJA 3ZGVA 5FI3A 2AL7A 1EFPA 2XUDA 2X0NA 3CE6A 3F78A 3I8SA 1JHYA 5ALDA 1IHDA 5B1SA 3WVNA 4PN7A 2VP6A 1SCJA 3AVOA 4PAWA 5CLHA 1JAYA 1BMQA 1JLRA 4WLOA 5DISB 3FPJA 4HAWA 4DCOA 1X19A 2W93A 4P83A 2Q6TA 3NWEA 2X40A 4PQGA 1C2TA 2BSXA 2ZT5A 1SN7A 4H08A 4OREX 4GX1A 1LA2A 4PG5A 2ZJ3A 2OM2A 1Z4OA 5JADA 1M6NA 4HRYA 2SBTA 1OGYA 1GP2A 2ADOA 2B61A 3QEOA 3OZEA 5T4BA 4OVKA 3H7IA 4ZALA 1FVXA 5B7QA 3ZKWA 3Q8XB 4MUJA 3TAHA 2C2WA 3BORA 3EVTA 3OIVA 4UDXX 1CP2A 1L3BA 2J5RA 1NR1A 1VSUA 3ADDA 1LCIA 1WMAA 2UZ0A 3A7DA 3ABOB 4NYMR 1BE0A 3MS7A 4EAQA 4HNHA 3AUFA 4NRDA 1SFRA 1JIIA 4IJKA 5CGQB 3ICQB 4Z1MA 2IOHA 5L40A 2A5JA 4LQDA 2IITA 3A6JA 2RHCA 1XTBA 5A05A 1ECCA 1HURA 3TTTA 4BMSA 1XHFA 3N7AA 5FL7A 1VG9B 4HGOA 3VU8A 4W5HA 2E37A 3WQBA 2R8YA 4IPTA 4JOQA 1EM8A 1UFKA 2Y8EA 3FOAA 3RHTA 4WXMA 4RMIA 4FGZA 1JFFA 1LJUA 1SEVA 2ZYWX 3BRWD 1YULA 2OMKA 3G2JA 2BDTA 4IUDS 2C9OA 3F8SA 2EJCA 4EJ6A 3EX7C 1UL1X 1L5HB 1CR0A 2YNMA 5BSRA 1NWCA 1AKRA 4RVNA 3VZQA 3GA7A 4YRJA 3TEJA 4CFSA 1VSBA 4RAQA 4R7ZA 4UM5A 2X0JA 4Y1RB 3N70A 3ESXA 3TDMA 4AZ0B 1XU4A 3CG4A 5KTYA 2YVKA 1M54A 1R9JA 4MPPA 1ODLA 2N75A 4MW9A 4HR7A 1EEHA 2AA3A 4TM8A 1V7ZA 4CW7A 1UBNA 1Z35A 3OLCX 4RZXA 2Q5QA 2P6RA 1N2BA 2EF1A 3PC8A 4M1SA 3ZGYA 4KV7A 1OFIA 5BQPA 2JLAA 4TKVA 2XBUA 3MBOA 5BYBA 3GGDA 4MQ5A 3BRQA 5EZ5A 4HNTA 1BEZA 2JIPA 3QBTA 1B3RA 2YFHA 2HC9A 3UFXA 2H85A 3B78A 5KNCH 4JP3A 2HSZA 4DZZA 2F3UA 2LR0A 3D6NB 4WXYB 4DCCA 2C1XA 4ZMRA 1KI8A 4YDSA 4TMVA 3ASZA 3I42A 2RIPA 3LFHA 3D81A 4D8YA 5DE3A 3BE5A 3I1JA 5F7XA 5LM3A 5A0TA 2YXNA 5AVVA 2JLVA 5TXGA 5JNSA 1JEYA 3RS7A 5IKMA 3TPZA 3MGGA 4QTTB 4YECA 1U11A 1W93A 1Y9ZA 3IB6A 3LX8A 5FTMA 1T25A 4Z9FA 3I9OA 2J32A 3RJ9A 1E4YA 4TVKA 3IT3A 2P6OA 3I2KA 2J3IA 4JUAA 3GAMA 1TQHA 3AP2A 3EAFA 4D4IA 2H0RA 2RMKA 2OGWA 2D13A 1M8JA 2QAJA 2ZRKA 4FHCA 2JFXA 4IDDA 2B69A 1MB3A 3C7AA 1AO3A 1QTRA 1V95A 3C3DA 3ECSA 3FVQA 4E5YA 4WWHA 1RQRA 4D7AA 3ACDA 1ZMRA 5BQOA 2HNBA 2JFZA 1W6RA 3I2IA 1JVSA 3OHMA 1DZIA 1A95A 4ICIA 1KQ3A 3M9LA 4I4TA 4ZO4A 3B6ZA 2QTMA 2ZRQA 3P26A 1SB8A 1XVVA 3IBTA 4AN1A 2VAXA 2UYQA 3DTVD 3T95A 3AETA 1KDVA 5IBCA 3A4VA 5K05A 1FTYA 1V71A 2QMYA 3IAAA 4K87A 2IQIA 4H6PA 2EP8A 1TKAA 1FUKA 1GQFA 4IKOA 2BKUA 1IQPA 1SK9A 2EW1A 3PJFA 4NCHA 4F91B 5BSKA 2PLRA 4XB1A 2UZ1B 1R8QA 3LL4A 3H9JA 2WMYA 4GRAA 1JI0A 1ZD3A 2C7BA 4WNYA 5CGZA 5JRDS 2QRPA 4CMGA 3GLIA 1F8YA 3TD6A 3LS2A 3R7BA 4URVR 3AUAA 4YP9A 3AJ8A 3PHJA 1IQRA 3Q11A 5MFPA 3WGGA 1FYEA 4HQOA 1CZKA 1XXHA 2BFOA 1NLYA 1DG9A 1XTKA 3NT4A 4EYEA 5JWOA 5DNVA 3TDKA 3PGJA 1NNI1 1VRCA 4XYBA 2HAEA 2P5UA 1B6SA 2IDZA 3LHIA 3FROA 3NEYA 3A7EA 5KKAA 4D8TA 4B0PA 2A5YB 4PCUA 1WXDA 1XJ5A 2QRJA 9LDBA 1VQ1A 2BFPA 5AHKA 3U1TA 3WL7A 1H2YA 2W2XA 1K7EB 1U9YA 1EBBA 2G67A 1DB3A 2KPOA 3E9CA 3K4HA 5ERYA 2O06A 4A7PA 4YT2A 1NRWA 4RJJA 2C7OA 3PPVA 2G72A 2G80A 4L2IA 4XGRA 1FP4B 3WWEA 4A6XA 1J99A 3F4BA 3V4SA 3GRZA 3QMMA 2FUCA 2BEVB 4MQEA 2XMBA 1GGMA 1E9EA 5E1DA 3RRFA 1XD9A 1Y7TA 2Y1GA 3VKUA 2ATVA 3KKLA 3L5KA 5LQSA 1KK3A 4CL2A 3F97A 2ZBUA 4KPUA 4H4CA 4UAGA 4MYTA 2ZR9A 3R0XA 2ZDGA 1MNQA 2HCRA 1ZC4A 2I4MA 2JCGA 3H9CA 2V6GA 3R5KA 5T4FA 3ZJYA 1ORTA 2PYDA 2WAOA 3A1UA 4RDHA 8ATCA 3GLFE 1T8RA 3A6PC 4TV9F 1OBHA 1X7XB 4Z4FA 1XV5A 3BF8A 3P4YA 1F9EA 4QJ3A 5K3EA 4BZZA 1DJPA 4BV8A 3IXMA 1EPUA 5HZKA 5EQFA 4DAOA 3WYEA 1P44A 4ZTZB 3QKWA 1KQFA 1LBIA 1ZMBA 5ANRB 3USZA 4S0ZA 4LV5B 3A27A 2FN7A 2X8JB 3FCYA 3OEWA 2WRZA 3PFCA 4KQ1A 4A8JC 3BZBA 3K96A 5CCXA 2ZIAA 1VFPA 4IIJF 2OHIA 1YS4A 4A8TA 5KSZA 3DTYA 1XR3A 3B48A 1NZFA 5K3FB 1NMEA 2WHYA 4AKTA 4BO7A 3QIVA 3GVPA 2JASA 4J0IA 1Q7BA 1FFXA 4ARSA 4WLVA 2QR5A 1FS4A 1ZCBA 4E1VA 3VKHA 5C7IO 5HUJA 5AJZA 3KXKA 4FINA 3VKFA 3VTAA 1GRNA 1OH8A 1QGOA 4AY5A 3U13A 2WFLB 3U5ZB 3KZXA 2H4HA 5KAPA 1CQJB 4TVSA 4B3TB 4J6EA 1ZHFA 1MA0A 1VE1A 2BZ0A 2C9BA 2ORWA 3QBVA 4NICA 4P53A 4M9QA 1GNSA 1V26A 4F2GA 1VCNA 5C1DA 3RU3A 3KB8A 1Y5MA 3T9FA 1T5OA 3WYGA 1CJKC 4O8CA 3P9RA 3AF2A 3UMMA 4FOOA 2ZSEA 3E9ZA 5DI3A 1F06A 1USUA 1EVEA 3IFSA 4I7EA 3FIJA 3JD1A 1U0JA 2LE0A 3GJYA 1JKXA 1XL1A 1ZK4A 2ZK7A 5GOZA 5HDBB 5HJEA 2R0QC 4HY3A 5DYYA 3G9UA 1L4HA 3O3CA 2R8ZA 2VXYA 3EIHA 3RSZA 3A0UA 3VPCA 2JLQA 4ZOLA 1KOLA 5AM2A 3CNQS 1HRKA 1SBNE 4GP6A 4PSKA 2XADA 2OPHA 1D1QA 2VHEA 3HCPA 1DPFA 3S44A 1FMJA 2I7VA 4Z99A 4MW1A 1PNVA 4Q1AA 4QRIA 1XWFA 4QE3A 4V1CB 1XAHA 4OJTA 2Y2VA 3DFZA 4MYCA 5I9IA 4L8VA 4KN9S 5AJHA 4B7ZA 1CR1A 1ISSA 4OV6B 4YP6A 5T6MA 4D8UA 1ZAYA 2TRSB 3HKDA 5BMOA 3V4PB 5EZQA 3FZNA 4IJWA 4Q6BA 3Q7SA 4FLMA 1E0AA 4FGKA 2RH4A 4ENUA 3EAGA 3K72B 4PHCA 2AUTA 1KR2A 4GGOA 1IDN1 2BHLA 5J4LA 2QI9C 3FDFA 4MP3A 1KO5A 5K99A 3ZYCA 3DE4X 3F5SA 4F06A 2A33A 4QTUB 4XB6B 1NUTA 4YACA 1GSOA 2WLSA 1VGQA 5DGXA 2Y0PA 4LDZA 2IH2A 5GV8A 2JA2A 4RF2A 1NJ1A 2P91A 3IR6A 5ARBA 1Z26A 5ITWA 4MUYA 1J8YF 2P7HA 2X8BA 2Z83A 1B0AA 3D8BA 3H1EA 1TA0A 1Z5UA 3OBIA 2HTFA 1DBPA 1XZFA 5F35A 2X1VA 3PU6A 2QG9A 3PNLA 4WZAE 3I2HA 1E5DA 1I2DA 4LEIA 4LNHA 3VFDA 2YMPA 2I6QA 4BNMA 4MV6A 3D3JA 2VHJA 3E9DA 1EWRA 2GPTA 2P5TB 1QF7A 3PC3A 4AYXA 2B7BA 5JBQA 4NEQA 4GI2A 1SCIA 4DDMA 2HMWA 2J45A 4D9BA 5LKAA 1QH8A 3BJMA 1PGOA 4C9BA 5B3KA 3RU2A 1LBQA 3PQ6A 1VLJA 2PAFA 3E1SA 1I6WA 4A0GA 5C5IA 1ZIDA 1L8OA 1DAEA 1SA0B 1IY8A 1XA3A 3DTNA 5BV8A 2ZOSA 2IHNA 2DHDA 1LDMA 3K8ZA 5HW0A 3PYLA 1L7DA 1UAYA 4J0CA 1A4IA 3DLHA 3EW9A 4BQNA 3HJBA 2J0VA 1XFAA 2FVYA 1GRCA 3EGEA 4UZEA 4DQLA 5I7HA 3PPXA 1EFKA 4TLAA 4YREA 3TAUA 3ILVA 2P77A 3OTIA 4QQ8A 6GPBA 4PYLA 5GIPE 2FG6C 4R2WA 1Y9AA 1E20A 2HPHA 2YXEA 3D3EA 5I7AA 2J3MA 3CT6A 3RHZA 3I34X 3PGA1 3GVHA 1NRIA 4RF4A 4WOPA 2ODAA 2GCOB 2BMEA 4FE7A 3ZE1B 3ZV3A 1K75A 4EKYA 2JFBA 4XJTA 1W0CA 1P5FA 4TVBA 5FUVA 4UFPA 4Q02A 5K01A 9ATCA 4F9EA 2DR2A 4GKAA 1ELOA 1JRLA 3H19A 3WJ2A 2IELA 3FM9A 3KJZA 3JQRA 1PJZA 5CLGA 3UVEA 2CT8A 2XMZA 2B2NA 4AB1A 2CLEB 4EH1A 2GO7A 3B82A 3T12A 4HDSA 1VKHA 3CU5A 4G25A 3W9SA 3G5MA 3BMQA 3PHHA 4A3SA 1AZSC 2YWDA 5JYCA 4DV6B 1MN6A 1PFYA 1QC5B 5B7NA 1HV8A 1FX1A 1PWZA 5FFMA 3ZVLA 3JATA 4UQLA 1NPYA 1D2EA 3G5TA 3KHSA 4L5JA 4R1MA 1ODFA 2PKCA 3GROA 4QL3A 4OQMA 1TO1E 4R2XA 2RDMA 5TLSA 2P2LA 5HPYB 3R7WB 3VSCA 1XLWA 5K3AA 1VJCA 4JB8A 4RVFA 2JBAA 5D7BA 1JALA 1ULZA 2BDEA 1KVSA 1P17A 3C87A 1K4MA 5TARA 3A1SA 2F1KA 3SY8A 1QGAA 5TDHA 4X7RA 5ALXA 4AULA 2GRAA 5LQJA 3EXAA 3TZ6A 1VHJA 2YVAA 4EGFA 1KORA 4EFLA 4BV2A 4UHEA 3WLSA 4DE5A 5A2GA 1JXMA 3U3ZA 1IN8A 2D1QA 3OMXA 1AM4D 1Y6QA 1XLUA 3A06A 1OGIA 3P0FA 4FFWA 1F8FA 2ATIA 2HU5A 4YTEA 2VL7A 2WOOA 3CPEA 4FYJA 2N46A 4UXHA 3WISA 4BMDA 2P90A 4EVQA 2XZOA 1OKKD 1YASA 3R7FA 3PRJA 3ZNPA 4M99A 3T3EA 1CXZA 1Y8AA 3WL5A 4XVHA 5E3JA 2XNSA 4F6CA 4Q7LA 3D3KA 1FEZA 1E79D 5FULA 3WK9A 3ZQUA 1SD1A 2HWXA 4N3NA 3ML1A 3AF4A 3WKBA 4RA9B 1D8TA 4A1FA 3ZQJA 5LDDC 1ZXBA 3ED5A 4C7VA 2R6R1 2VHYA 3M6UA 2J0UA 3KQSA 2B1IA 3FXAA 3ETCA 3RO7A 4CQMD 621PA 2LW7A 2P78A 4GYYA 4KTVE 2VN8A 3O4IA 4MUFA 3WWDA 1GTRA 1JEAA 1TAGA 3DOJA 3DVAA 4YRMA 1GD1O 1KK1A 2O5EA 1YKGA 5FFNA 1C8LA 5DRTA 1FFGA 3IAXA 3OZGA 2G9RA 4JBHA 3KB1A 3L1JA 1YB6A 1W76A 4QYWA 4GM4A 4P98A 2AF3C 4PCLA 2BGLA 3ONEA 3WLRA 5MGNA 5HNKA 3JZFA 1GFZA 3N2GA 1MAAA 2NQ2C 5F2NA 2PA3A 1NRJB 3WNVA 3QHQA 3EZ9A 1MRNA 1SVUA 1KHHA 1Z3CA 3L7LA 4S1TA 2XA1A 3WLIA 4A26A 4R7GA 3JR7A 3LC1O 4BBJA 1BWQA 4XSHA 1TT7A 1DEHA 3D4OA 4K9LA 3QSYA 1F6DA 1EKXA 4FDLA 1DJNA 1LKZA 1V0JA 1FZQA 2CFSA 4RZ3A 3X1ZA 1XJ0A 4PGHA 3LQ1A 3MTBA 2NUPA 3AP3A 3GUCA 3F73A 1GLGA 1X94A 3ENKA 1OJ7A 5G1OA 1E2IA 1P6UA 5IVDA 3SEFA 5JTUA 1R5OA 1INLA 4HAIA 3CLUD 1ZITA 4KWTA 2PSJA 5TQ0B 3TECE 1JEEA 2FFHA 2BGRA 3EASA 2BLLA 3PTZA 2AHRA 1KAGA 1DQNA 1T8YA 4QO8A 2H48A 5P21A 5JQGF 1KEKA 1C3LA 3ET5A 2A1TR 4IFTA 2JHGA 4QDXA 1OE0A 4JJ6A 4AY4A 2QLBA 3PUZA 2J33A 4WFKA 2JAPA 3PD0A 4ZV4A 2DBVO 2DT5A 1IN5A 2VUUA 4JIMA 3ZDZB 2SECE 2V7PA 2GBGA 3MQFA 4QGGA 4JX9A 4D3FA 5AVRA 3P2IA 4IG4A 1YR3A 1T5HX 3AJRA 2GM9A 1A0OA 2VF4X 4HEA6 1J49A 1C29B 3LXXA 4JEHA 2VH1A 3BKWA 3OFKA 3PUKA 4IQ4A 1H8EA 2VRCD 4DBVO 2VHVA 3H04A 5B3JC 4Y7DA 2FRDC 1EXWA 2BH9A 4Z9XA 2Y1CA 2Q0QA 4WXHA 4B3RB 1YJ8A 3EC2A 4IDOA 4BP3A 5BQ5A 1QRTA 4IJUA 1N25A 3D31A 1EFDN 3PZBA 1ACLA 1T3LA 5REQB 1PHPA 2VXBA 4XIGS 1F8XA 1TI7A 1FFBA 1PR5A 3HHEA 1ORWA 2QM0A 3QTTA 4OL0A 1ZH8A 1E59A 1HEUA 4YRIA 1YTUA 5C8YB 4ZD6A 4B85A 4JGBA 3AYZB 1PYDA 2V6FA 4MLCA 3F4LA 3ZWMA 2R6HA 2I54A 2OD2A 5JS8A 5DNYB 2AXQA 4FE3A 2IDJA 4F3TA 3HZRA 1X0XA 3HJAA 5L51A 3T7TA 2B4RO 1QNLA 1VL6A 4HGNA 1O57A 3ZG6A 1UJ2A 2ODWA 1QX3A 1WEHA 1U2QA 2ACKA 1A96A 3GCZA 1E3QA 1QGED 1WO8A 3ON5A 4X6UA 5JO0A 2IHUA 4AI6A 2YWHA 1Q1BA 2DQYA 4DIFA 2ZRHA 3WGJA 1Z5VA 5LNK1 1KI7A 4O59O 1R4MB 4FGSA 4GW3A 4KVFA 1DOHA 5J2UB 3ONDA 2CLKB 1RWWA 2BMJA 5PNTA 1IY2A 1Z2AA 4L50A 4EB0A 3ZCPA 3M6MD 3C3PA 5EE0A 4UHDA 2P2CA 3KXLA 5TVGA 2VEDA 4BE4A 3AW9A 1V4NA 3CUWA 3LYHA 5FNVA 5JXHA 3ZDDA 2EX0A 3KB2A 3BGOS 1Y1TA 4MGZR 2VZ9A 4G5RA 3LUJA 3NYQA 1UDCA 3R3UA 1P4GA 2FEMA 3LUHA 1JNXX 2HL6A 5C5CA 1CZLA 2R5WA 4PLGA 5IKOA 3UJHA 3VR4H 1J1ZA 3P9SA 1MC8A 2CL0X 1Q7TA 2F3RA 3VDQA 5ECGC 1ZI9A 4JELA 1DKQA 2W2KA 3RVKA 2CN1A 3P9NA 4DCTA 2UUAB 2CYBA 2NZWA 3P5BA 5HF6A 5E6UA 4BB5A 1XKLA 2G8NA 5ALNA 1GUZA 2AS0A 4C06A 2BEWB 3BIFA 3BREA 2FZEA 5EZYB 2CSUA 2H63A 2P9ZA 3E9NA 3F4KA 4OYYA 3UIEA 4TOIA 3HFGA 3G49A 4U2FA 1I3CA 4ZKDA