4TT8A

Crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase (wild-type) complex with 10-formyl-5,8-dideazafolate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
308
structure length
308
Chain Sequence
MKIAVIGQSLFGQEVYKELKNEGHMIVGVFTIPDKDGKVDPLAIEAEKDGVPVFKFPRWRLKGKAITEVVDQYKAVGAELNVLPFCSQFIPMEVIDHPKHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFTVFWADDGLDTGPILLQRECDVEPNDNVNSIYKRFLFPEGVKGMVEAVRLIATGKAPRIKQPEEGATYECIQKKENSKIDWNQPAEAIHNWIRGNDRVPGAWAEIDGKSVSFYGSTLLENDHFSSNGQPLEIPGASRAALVTKNGLVLFGNDGKMLLVKNLQFEDGKMIPGSQYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 10-formyltetrahydrofolate dehydrogenase
publication title Structures of the hydrolase domain of zebrafish 10-formyltetrahydrofolate dehydrogenase and its complexes reveal a complete set of key residues for hydrolysis and product inhibition
doi rcsb
source organism Danio rerio
total genus 92
structure length 308
sequence length 308
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2014-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 4tt8A02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4tt8A01
1RC0A 4TT8A 1RC1A 4EW3A 4YFYA 3AV3A 1NJSA 4IQFA 4ZYXA 2FMTA 2BW0A 1RBQA 1FMTA 1ZLXA 4ZYVA 3TQQA 1CDEA 1GARA 1MENA 4EW1A 2BLNA 3W7BA 3NRBA 4S1NA 3N0VA 5J63A 1YRWA 3KCQA 1ZLYA 4YFVA 4QPCA 1RBYA 3GARA 1RBZA 4NV1A 3DA8A 4ZZ1A 3O1LA 5J9FA 4EW2A 4QPDA 2YWRA 3DCJA 4ZYUA 5CJJA 4TTSA 1C3EA 3R8XA 3LOUA 3P9XA 1JKXA 1S3IA 4TS4A 4ZYWA 4ZYYA 3OBIA 3TQRA 1MEJA 4ZYTA 4ZZ3A 4PZUA 1CDDA 4ZZ0A 3Q0IA 1ZGHA 1GRCA 1RBMA 4Q12A 4ZZ2A 4R8VA 1MEOA 4ZYZA 3AUFA 2CFIA 1C2TA 2GARA 4DS3A
chains in the Genus database with same CATH superfamily
1WB9A 1TQ8A 1LSJA 1I7NA 2DBZA 4RIHA 5REQB 1DG9A 2GPSA 4L5IA 1QIIA 5E7JA 4HDNA 1JP7A 3CPEA 4CI0B 3RIMA 3TTVA 3WLHA 3QMMA 1GPWB 4LKOA 2AK2A 1XTPA 2VHUA 3EGDB 4IH4A 2EJWA 1QB7A 4UEOA 3UMGA 1C3OB 2C9DA 1HDGO 3LE8A 3ROZA 1JMVA 2O8FB 1C7ZA 1P81A 2OZLB 1EFPA 2FSPA 1YZ3A 1W1IA 3AFOA 3N2EA 4WXRA 1BWQA 3AKCA 3OOWA 4QRHA 1XDZA 3AI7A 2OBFA 3CEHA 3GK3A 5AKKA 3KSZO 4BYGA 4UTPA 3HXQA 3G13A 5DEIA 1OBCA 2C1EA 4P3KA 3EUFA 4ID3A 4LRSB 1BWRA 4QSHA 5T4FA 4EG0A 3K0AB 2G9RA 2C4WA 3Q9LA 2C5FA 1VA4A 1P9RA 5EE1A 5K5EA 4R6WA 3IERA 3QKRA 1J70A 1M5UA 2PU7A 2R1VB 4CQMD 2GERA 3D6HA 2B8JA 5F1YA 3WGJA 1ONNA 3KYDA 3LX8A 4MRMB 4RY0A 4A1OA 2APJA 1CY1A 4O2BB 3R74A 1NQAO 5BSMA 2DTDA 2PH5A 3HH8A 2AMFA 5AHRA 4ZCMA 4C20A 1WM1A 1DJMA 4MQEA 2XCOA 2E37A 4X63A 4B0OA 5KOHA 4Y6GB 4MYRA 4W5QA 2V0GA 1JHMA 3DVAA 3NYRA 3IS3A 2PL3A 4MWDA 2GTIA 4ZREA 3ZIAA 1TT5A 3AJ8A 2IP4A 2RAFA 3LKZA 4G0QA 4L0MA 4TMTA 2I34A 3WBJA 4EDHA 2V6BA 3F96A 2ATXA 2FSVC 5HUJA 1Z0UA 4K9RA 3LUBA 2P65A 3ELWA 2G17A 4Q4HB 1FFEA 2X41A 1N5JA 2P9ZA 4P82A 1JR3A 3LQ4A 1H8EA 2ZIEA 3R76A 1P1JA 4HSEA 2FWAA 4ZYLA 4XLLA 2R1UA 3CSDA 3LO8A 3QU9A 4R2IA 1SPXA 3OEED 1YVEI 2ANCA 2ORYA 1WXWA 1P77A 2DECA 1VECA 2P9YA 3A3PA 3O8QA 3T3DA 2Q3CA 2JEOA 4LC0A 2PMKA 1ZM3A 4V0QA 3USCS 5K3EA 1Z29A 1BN7A 3LWBA 1XD8A 1RQPA 2NUAB 1SKQA 3UT0A 3PR3A 3GP5A 4BXOA 3AY0A 4DL9A 1QM5A 3K9GA 1Z2AA 2XWSA 4XA8A 1Y7PA 3ND7A 1QO7A 5B1HA 2IDMA 2C2KA 2Q50A 2C1ZA 3BQMB 4W5JA 3NTQA 4PS0A 5FPSA 5LKRA 3M9XA 4K9DA 4CV3A 4EITA 1R4NA 2FRXA 3SI7A 3IOCA 1ZKDA 2IPMA 1PN3A 1Y7LA 2XMQA 3EOZA 3CFYA 1ZITA 2HWUA 3K0HA 3KELA 4FCTA 4BO6A 4CEJB 5K8CA 1GSAA 4Q4AB 2GEUA 1TFUA 4RABA 2VTVA 2B8TA 1UK6A 5JHHB 2JH3A 4BBPA 1FMCA 4CR7A 1E0KA 3DDWA 4ZI2A 5JZOA 1BQ3A 1SO8A 3L9WA 2I55A 1EFVA 2Q1SA 3A0RB 1TZMA 2PX2A 3BMCB 1DTSA 2FV8A 2GI4A 1DIBA 2VNIA 3V8VA 1ADYA 1M1YA 3FETA 3D8RA 4G85A 5CDSA 3PICA 2FSVA 4JHXA 4ZT6A 4MICA 5TIIA 3ANNA 3T3MB 1SELA 1E69A 4URYR 1J8QA 1CUSA 2C96A 3F6SA 5TXGA 2OGWA 2WFAA 1G17A 3QK7A 1UJ2A 1DCKA 2X9LA 5FQNA 2QSZA 5A05A 3FSGD 4JI3B 3TW8B 1KO1A 4GLFA 2NU9B 1EFUA 3UCXA 5CYPA 3MTGA 2ZPTX 5FLEX 4B2LA 2PKCA 2WICA 2FMTA 2VUTA 4KQHA 16PKA 3SK0A 2PX4A 2RDMA 1J0XO 2C7RA 1Z4JA 4FNGA 4RPLA 5KYUA 1ISRA 5JRZA 4AY6A 4OLBA 3SQDA 1BU5A 4HWTA 4PANA 5AD1A 2W42A 1RVDA 4GI7A 1DEOA 4YAGA 2QL5A 1Q7BA 4CKWB 3F4BA 5ADVA 4MQBA 2Z3VA 1P4JA 2PH1A 3GPDG 5BSGA 4G23A 4MEAA 1OLUA 2ZSFA 3PXGA 3W7BA 4S1NA 1GGNA 2AJCA 2WNHA 3UJ6A 1NLUA 1LXCA 4BNDB 1OXKB 2HJVA 3VR6H 3F6RA 2PMCA 3RBVA 1VB5A 4LNUB 4MVJA 2QZZA 4I46A 2WIDA 3VR2D 2W2QA 3AF6A 2P27A 2I3DA 2OHJA 1EZZA 1Q22A 5H81A 3HPQA 2I1LA 3H0CA 1YZGA 5BNZA 5BVHA 1W88A 4N3NA 5CD1A 1RBZA 4RZ3A 4GU5A 4FNMA 1RKXA 1CPYA 2JLAA 3AXSA 1Y1QA 5P21A 1DRVA 2OV2A 4CR8A 5GJWC 2J07A 2VNSA 3ZDCA 1WL8A 2WABA 5AK6A 3DNPA 1LPBB 2YV4A 1L4BA 2XB9A 2OAEA 4UVGA 4YJKA 2IZOA 2Q6TA 2X0DA 4CT5A 4JENA 2GR9A 3FPHA 3ACDA 1CZRA 1JF8A 4E5YA 3AFIA 2CHQA 5LIPA 5HKKA 4OXRA 4UZEA 3P9RA 5F5NA 5IKXA 5B30A 2QVZX 3AJEA 4IMIB 2UZ3A 1AS0A 1U0RA 2CUNA 3JQ9C 3ER9A 3B5EA 1YA4A 2JRCA 1YJ8A 4HH0A 4MGKR 1X6VA 4YTEA 1IPFA 4CF6A 2C00A 1CFJA 3PYLA 4C0WA 4ZAYA 4G65A 3OBIA 1KJWA 2WWHA 1A9OA 4WXPA 5F4BA 3UWKA 3OZVA 1P44A 1T26A 5FULA 1LTHR 4B34A 4PZCA 5K0FA 4Z53A 1KDOA 3OEHA 4NZ9A 2GTPA 1G18A 1VE1A 7MHTA 1K5PA 1JEQA 4CL2A 2ZG6A 4DLVA 1VYUA 3OEYA 4H6PA 2C2BA 2XMCA 2FF5A 1XI2A 3U31A 4O4IB 4C21A 1G3UA 1JLRA 1W0JD 1GQOA 1P73A 1SQGA 3H11A 4G09A 2PZBA 4NRDA 5DTRA 1GFWA 2HWYA 1QH0A 4YMGA 2YMLA 1X1AA 3EIEA 4MO2A 2I6UA 3P9SA 4DA0A 2JLZA 5JD6A 3S2IA 4WKNA 3GO4A 1NSYA 1BKDR 1JSRA 1V5WA 2V7XA 5F78A 4DQDA 4LF8B 1QSGA 2GCOA 2JFHA 4TWRA 4GW3A 5EPOA 1PZEA 5JANA 3D5EA 2DUJA 5CLLA 1OBHA 2NO9A 3TEFA 3ERCA 4JXZA 4XYGA 2PWPA 5EQFA 4WCFA 3G9QA 4FS8A 3O0DA 3NBQA 3DT6A 3E3AA 3FX2A 2LUOA 2Y1LA 3NBXX 4G0MA 3TVYA 3RJZA 2UYCA 4MDFA 3FR7A 1NF8A 2XODA 4L76A 3TZLA 1NP6A 4R8SA 3IUJA 5EHNA 5A7GA 4DE5A 4KO2S 4AUKA 2V9PA 5ESXA 3KQHA 1YCFA 3U7QA 3A06A 4C6TA 3DFMA 4BX9A 1JZQA 1UCFA 3R7DA 2G0NA 3NZEA 2WTAA 3WIDA 2WIGA 3PVSA 5HIMA 1U9YA 4L3OA 4TYQA 4P0QB 2PFGA 2H54A 2I6GA 2CC2A 4RM2A 2PX5A 5T57A 5AIBA 4H7HA 4L0CA 3RK1A 1ZUHA 1NVUQ 1ZUNB 1Y5NA 4I9HA 2TECE 3LQQA 1L5HB 2X8BA 3L4SO 2FE4A 2PVPA 1IU9A 2VPPA 3NIBA 1XNQB 5F2OA 4NE7A 2GZ2A 3HZZA 3IODA 1E3WA 1V9LA 2HTFA 3HGQA 1QVWA 1ZY2A 2DH5A 2P2GA 4UM7A 3W2HA 1TMYA 1PR9A 1WPXA 3G5MA 3ZQ4A 1UQRA 4B84A 1JFTA 4EFLA 1VLMA 1X8LA 3E7WA 2V7UA 1QPZA 2PUGA 1FFWA 3WQBA 5T6BA 2AOWA 4YP0A 2Y2UA 1VM6A 2VCEA 1P5HA 3KUKA 4PGHA 5EI5A 4A2PA 5C1BA 2BGWA 3C1UA 2WNSA 3TB4A 1K7CA 2OQRA 2A5FA 2RH5A 3VDNB 4I4NA 2VNHA 4LFAB 1CQXA 2IHUA 5A1TA 2D1YA 1RZVA 1ZK0A 3CEJA 4IDQA 1P72A 4PEVA 4BQFA 3SX0A 4FZVA 3R7NA 4KX3A 4MYSA 2QLBA 3BA6A 2QF7A 3PKIA 2DPYA 5SZJA 3LCRA 1T10A 2VZEA 1Y0BA 3HJTA 1SG6A 1VPLA 2CV1A 1PDWA 1RPAA 2JAQA 3D7NA 1N8KA 2CB9A 2EV9A 3A3KA 3IURA 5I9SA 1WABA 4P38A 4GVLA 4B6JA 4KHPB 4N0EA 4HSGA 1JHDA 3WKBA 1QFYA 1FVXA 3PDWA 4O02B 2V6JA 2FA9A 1U5AA 5FUXA 4EHFA 2C7GA 3OMLA 3QXHA 8ABPA 3HPRA 1QO0D 3MJFA 3PK0A 1OILA 1SU4A 1K6MA 2B78A 1KNXA 3AI1A 5CLIA 1X1EA 3CWZA 4F8EA 4RV5A 5D5HA 4CR6A 3RYCA 5FAXA 4E94A 3AW9A 4AJOA 1BW9A 3UW1A 1QE0A 4R2MA 1XCGB 1ENZA 2ZE8A 3ZZ1A 2XTJA 3MYRA 2XSZD 3M1AA 2V98A 4WNIA 3L0ZA 3PJFA 2NUPA 4IMJB 5EKUA 1YR1A 1RE0A 2G1AA 2PR7A 2AFIA 4JP1A 5B58C 3RGGA 3NM4A 3PWSA 1Y4ZA 2VSQA 2GN2A 1CUBA 2RC6A 5J23A 2QL9A 1HE5A 3PC4A 2VSOA 4IBOA 4IYRA 2WAYA 3RPEA 1V6SA 1B0ZA 4GF5A 4P9NA 5J59A 3RVBA 4AT1A 1QKJA 1X9IA 1PZMA 1RWBA 2WIBA 3DDOA 3PNSA 5LPNA 3LAWA 3ZW8A 2HO5A 1JJAA 2HK7A 2X23A 3KYCA 2O8CA 3REGA 4MS4B 4ZO6A 3RR2A 4JDPA 2PNJA 3K9HA 4D98A 3PYMA 1YDHA 4WZZA 2VF2A 3VDXA 2P6RA 3RGWS 4IXTA 3IAM1 1T2AA 4LRUA 4O29A 5EINA 5U9CA 1YO6A 3PQ6A 1MT0A 1V11A 2G28A 1XDSA 2HCJB 2CL7X 2HI0A 1B4DA 2OE2A 3GEHA 3NNNA 3CISA 2OBXA 2FPLA 2AYZA 3LC2O 1BVYF 3WKEA 4MVJF 2GXQA 2GS9A 1SA0A 2GT1A 4QC2A 3P7MA 4FZJA 2VRWA 1XCMA 1KYVA 4JN6B 3U3MA 2IYPA 1AXGA 2H5EA 3IKLA 2Y0PA 3VO2A 2JK0A 2QS9A 2WHYA 3PQ2A 3NW9A 3VVBA 3AKDA 4L4SA 1NMSA 3DZKA 5SYAA 1KAHA 3ZWKA 1EA5A 2ZR0A 4NS1A 4OAPA 2YZ7A 4MZDA 2GM3A 4FKZA 1JHVA 3T3HA 3UMJA 3NNDA 2CHFA 4K87A 4GOMD 2J8ZA 3EWAA 4FYXA 3ZDRA 1NIPA 3EEBA 1WULS 3RTCA 3G2QA 3UBTA 3KTDA 3A14A 3EZFA 3OZTA 4MS1A 4UREA 3V7UA 5CK5A 1Z35A 2XE8A 5A5DA 5CLJA 4RCVA 5JPCA 3BWBA 5J3JA 2I78A 1UXIA 1UJ4A 3O73A 3GXBA 3ONFA 4JUFA 4U2BA 4UW9A 3ID6C 5ALMA 2XT0A 2YHIB 2EQAA 3AUSA 3G89A 4J75A 4P3XA 3R3UA 3SAJA 3C3BA 3N0VA 1P5RA 2GDJA 3P32A 4KLZA 4XYBA 1RFGE 4FDTA 4HDSB 4ZP1A 2YDYA 4BVBA 5BXQC 2YV2A 5LYJA 3FW1A 5BV0A 3RAGA 2IK8A 3KKZA 2UYGA 5AW9A 2FUKA 2A0YA 2PUBA 4LDNA 2EGUA 4KQIA 2C3UA 2B61A 4BNGA 4KFCA 3FPKA 3G79A 5FXMA 3PQ8A 4YPOA 2F8TA 4D8VA 1FYDA 3C8DA 2VBCA 4K05A 3E5RA 3AOEC 1Z08A 4ZOLF 1AM4D 4E3WA 3IUBA 1YQ9A 1E2FA 2ID9A 5IBCA 2VJNA 4IZ6A 1GTRA 4AN1A 4KGVA 1SURA 3QF4A 1EPUA 1K0FA 4BUZA 2J45A 3VSCA 1PS9A 5EXDA 2ZSHA 5C80A 3OFND 1BH2A 1EBFA 5C81A 1WW3A 2XXJA 2B3DA 4F3KA 2ET6A 2Q6LA 1RACA 5IKEA 4HH4A 1GCIA 2YMPA 4PICA 3B5JA 4YT4A 1WSAA 4NV0A 3O91A 4A8PA 1PQPA 3LYLA 3NLLA 3OZBA 4Y3UA 2ZBRA 4GP6A 3G2PA 5AW5A 4UHDA 5L3RA 2QN8A 1RRPA 4F5YA 5ELXA 1RTTA 5AICA 5JPIA 5AKXA 2VJAA 4OQMA 2IUYA 2ZRMA 5D85A 4TRJA 2QLMA 4JZKA 2EDAA 2M2IA 2WHXA 3AHJA 1ORIA 1XR3A 1K7YA 3CNHA 2WWGA 1XG5A 2V8BA 3FTPA 1KJIA 4B3MB 1H85A 1N1DA 2AW5A 3CF0A 2E5FA 4PN3A 5I9NA 1QR6A 1BCSA 2LW7A 3MF4A 1V1MB 4RA6B 3W5BA 2F59A 2JFQA 4QDUA 2BP7B 4EFKA 4P4NA 4PU0A 2C2HA 2X5OA 3F97A 3O4IA 4RZSA 3SZ3A 1Z68A 3QFHA 4BKMA 4G37A 2IEGA 2GVDC 2HXGA 4WFKA 3H7IA 2B6NA 2IPAB 2ZVJA 3T3OA 4PBRA 1A72A 1HEIA 1Y33E 3D6TB 2DKFA 4WZAA 5E1DA 3KUXA 1NMXA 3OEWA 1JR6A 1Q83A 2HPAA 1E7RA 4CQMA 4HNSA 2CFIA 2P6PA 2VHXA 4QYSA 4XW2A 5TMDA 1GLNA 4D0GA 3PIRA 5CXXA 4OK5A 4C89A 4OQ4A 1FTSA 3ESCA 3NEYA 2VXYA 4K7JA 2B1RA 2IXBA 4QYWA 3BWMA 3EAGA 5AI0A 1ZXBA 1ULUA 4H7DA 1J2YA 1F9AA 5KYVA 4E1VA 4RIEA 5E6RA 2EKDA 3UGJA 4KPUA 3IA2A 1PVDA 2CV0A 4I1IA 2P2DA 3DGFC 2FHPA 4HCJA 3PQ4A 4KKXB 4BKUA 3FTCA 3EC7A 1RYYA 3OI7A 4LAFA 4MSUA 4ND7A 4EVIA 4IO0A 3DO8A 4E51A 2IXDA 1VGRA 3TRDA 2BJHA 4CKYA 1XLVA 1SVIA 3OQIA 5CIYA 2XB8A 2EKBA 4MH0R 2GOYA 2A9VA 3TLGB 1CDEA 1IEVA 3LLMA 2HIAA 2OV1A 3V1LA 1XU7A 4QO8A 1I14A 2O5CA 3OEEA 3EEOA 2UUCB 5T4HA 1RI1A 2GBLC 3LDFA 2GJKA 2HJ9A 3ESRA 4M0UA 3RSFA 3SSNA 2CD7A 1JXMA 5DYTA 3KZMA 5DNAA 1Y3AA 2UAGA 4MCIA 3Q9SA 2JLYA 2RIRA 2EQBA 3NGMA 5KHLB 4YJGB 3T5PA 1ZVVA 5IC6A 1W0KD 1Q77A 5SV2A 2ZUTA 1BNCA 2OKCA 2CXOA 4L07A 5AUPB 2OECA 2X0JA 4J2OA 4Y18A 5EXPA 1Q5PA 2X8LA 3QSYA 1T9AA 1E9EA 1IY9A 1TMGE 3HL0A 3QOXA 4QNMA 5CVJA 4DA4A 3BXGA 2J7KA 1V8FA 4KUHA 3TNLA 2WD7B 3AB8A 5DNVA 5J4LA 4XI9A 5JAMA 2YWRA 1FNDA 1VBFA 2CCGA 2C2MA 1C8BA 2BOVA 3GG2A 3U44B 3WDMA 4QM7A 1Q1EA 5FPYA 3TM5A 3NORA 1NVGA 5GVRA 1G8GA 5CG1A 4FC7A 3QPUA 1HSOA 2RHDA 5T4EA 2P6UA 4GP9A 5SICE 3GLFB 2LWIA 3K5WA 3T5GA 2H3EA 1L7MA 4MLPA 1COWD 4QRIA 4NMLA 3IUYA 5ES3A 3WSVA 1USGA 3EDOA 3EK2A 2X1LA 3UMFA 1PWXA 4GKAA 5DJ5A 2A5DA 3G9TA 5ADHA 3ELBA 3NONA 3CRW1 3V4ZA 5GV8A 4KWIA 2F1JA 2GCEA 4IIJF 5KX5A 1UBOS 2ZBGA 1TIBA 3CLRD 4Q47A 1QAMA 4CYMA 1Y63A 3DMGA 3FSGA 1EH5A 3BH6A 4B6PA 4BAUA 4BL5A 2JG3A 1E9AA 4I0WB 1G4HA 4NP6A 1E5XA 2DX7A 3STUA 3FB1A 4QWMA 4RVNA 3O0TA 4C07A 5KWEA 3O7MA 2VPQA 5LWHA 3DNMA 3OOHA 2VJBA 4P93A 2GCIA 1R6VA 2I2DA 2V55B 5K3FA 1DCFA 4Y2TA 1MXFA 2JJ1D 1UFRA 2E48A 2ISQA 3ESZA 1UXKA 1XAIA 2Z4SA 3O3CA 3W5HA 3EGXA 3BWCA 1M1ZA 2JC3A 4J29A 3ECCA 3JATB 2QB5A 5DYIA 1UR5A 3K0KA 4HY3A 3UGQA 1C9JA 2DR0A 2XWPA 4F4CA 3I5XA 2FJPA 4DNFA 4EDFA 3TM4A 4HQKA 1RWPA 4DV7B 4R2WA 4MVJH 4RSGA 1D2EA 4IJVA 1LBIA 2YZ2A 4EEKA 2OLJA 4G86A 1Z12A 4I5FA 4KFTA 3DM5A 3PG5A 1RP7A 3JQAD 2B8NA 5EZYB 2W5UA 1GHTA 4DLBA 4M1MA 2BGRA 1VKJA 5FKJA 1BA3A 3V46A 3VR2A 5K0NA 4N01A 3A9CA 4H0CA 3W1EA 1DIOB 4RZHA 5IU6A 4F3RA 5BW5A 2WRZA 3PFFA 1N2CB 2YOGA 2C9YA 2SKDA 3AMVA 3OPYI 4TYPA 4Y6PA 5CM2Z 4EP1A 1EUQA 3QP9A 4V38A 1DX6A 3F4LA 4A8HA 1QNFA 3HGMA 2Y4NA 3KG2A 4Y6OA 1ZOIA 2YL2A 2I2XB 4IQFA 2IDZA 1GDHA 1GU7A 4X8LA 4MZXA 4D9MA 4DBLE 1WMAA 5TGTA 3UK1A 4JQZA 5DM0A 1XEXA 3MOGA 3FHOA 5ABPA 3KKMA 3M3HA 3U6KA 1CEQA 1DTEA 1W6RA 3SEAA 4EPWA 3NHSA 5JO0A 3JD1A 1SVMA 1XXLA 2AFHE 2WMDA 4W6QA 4OHZA 5KTTA 3IEMA 4QOJA 4RGBA 5FUQA 2HWWA 2I3ZA 4MULA 3W6UA 4B71A 5IJ9A 4TUYA 2PMBA 5AO9A 4C6SA 5TX7A 4RTMA 2Z4RA 3C7CB 2BI4A 2GD0A 3SSMA 3L84A 1JHYA 3HXMA 2G09A 3E9DA 4A15A 3IUPA 3KCQA 3NXSA 5IZCA 2K4MA 1R0WA 3OCZA 1SBHA 3A58B 3IT2A 3N1UA 2Q29A 1KZ6A 2PBLA 3AJDA 1LGYA 2KJQA 3LT1A 3R6LA 1DC7A 1PJCA 4MJLA 1A82A 1II0A 1PFQA 1HRKA 1D7AA 2P91A 4ZKDA 2CMHA 4Y2UA 2V7EA 3D6AA 3PBKA 3HVUA 4QVIA 1W75A 2P90A 4RYDA 1X1RA 1A27A 3Q88A 5CXUA 5IDQA 1A5ZA 2YRWA 4YWHA 2VP0A 3L4KA 4OHVA 4F4FA 3OCWA 3A6PC 4QU8A 4N3CA 1N8TA 4ZYUA 1DXHA 1I7PA 1W0JA 2YVUA 3C5EA 4JLSA 1XEFA 4KIUA 4BY9E 3N3AC 3Q5GA 5EE5B 2FSIA 4DJEC 2J87A 4Y6LA 1NXSA 2FU5C 3EB9A 3MHPA 2CCKA 4GIBA 4KEAA 2OXIA 3IMEA 4B6EA 3UFXA 3MMPA 3SE7A 3F47A 5TEWA 1JKXA 2WJVA 2BGNA 2DHDA 1UWKA 1G5QA 4CG3A 5KJ6A 5HCIA 1VGQA 2BI7A 4UNRA 1HE1C 1WMBA 3SVLA 3L1KA 1JIVA 4IXWA 3RHSA 3SJUA 2EJTA 3NPMA 2QQEA 3O8OB 4HAXA 5LFAA 1U6IA 4MWTA 4TYYA 4H6XA 4ENRA 2IS1A 1U1DA 2NVUB 3G2LA 4GC5A 1I3LA 1C0KA 3MTAA 4YCNA 1VMDA 3S70A 5IJXA 4BGDA 2QE6A 2MYPA 4TV9B 3SHWA 4EY7A 1NN3A 4UU0A 1II8A 3TPFA 2D1TA 3AFGA 2JCXA 3D3NA 3JSXA 4JT4A 1RM3A 1V39A 4R4JA 3EFOB 4CJXA 4M46A 1GLGA 4Q05A 1WW8A 1LI7A 2AC2A 3L6BA 4M9RA 3RRFA 3RSGA 2BE7A 1R2QA 4HS9A 1FYWA 2JFYA 3RTGA 4JY7A 3EIXA 3MJTA 3O1JC 4HQ0A 1DNPA 4LQDA 1T3LA 4QO7A 1H42A 3BCUA 3H42B 4CUJA 3NNSA 3V1UA 2WLSA 4EG5A 4BQSA 4NCHA 4RK1A 3K2EA 3LBIA 1VE7A 5EVJA 5IG2A 3U7HB 1JR3E 4C2UA 1KGSA 2ZBQA 2HMSA 1S1MA 1JHQA 2X8AA 3JQCA 3WGKA 3LXMA 5KYXB 1DXYA 1TQDA 2ZVQX 3B48A 4QUEA 5FR2A 1E7WA 4W5WA 3JQ8B 5ENVA 4L9RA 2C31A 5DGDA 4BNFA 4MRRA 4QKQA 3QZUA 1GPH1 3UG6A 1ZCFA 1Q21A 3H2YA 3TTWA 1LSSA 2IY9A 3KD3A 3AEYA 1ZUWA 2MSEB 5C4GB 1P91A 3MPOA 4HWKA 1M2VB 1X9HA 3H2GA 3W9SA 3WGHA 4BQRA 3HYCA 1LQTA 2BGIA 2FW7A 3H19A 3R1IA 4TLMB 3WL4A 4QD3A 3GH3A 4BMDA 5FL3A 3GDFA 4PLVA 2EU8A 2I91A 2AD1A 4FFRA 4KH1A 3U39A 4ZN6A 2VT3A 4WERA 1ZWLA 1QO0A 4HLUA 1JZTA 5IFLA 2YCLA 4ZK2A 1ZHHA 3KKQA 3I5YA 1T4DA 2R48A 3DLAA 3SF8B 2PRIA 4D3XA 4E21A 1XUOA 4OJTA 4ZARA 2PSJA 3AM5A 3UJ3X 2AWOA 4U1RA 4QG3A 3ES9A 1FFDA 2XSZA 4IDDA 1S2GA 1M1YE 5KX5F 4NMXB 4OD0A 1O1YA 1QIJA 5D86A 3KVVA 2B2NA 2C8VA 3MCZA 3O4GA 4JVLA 1H6DA 2QDKA 3LCMA 3F3KA 3QVTA 2OV8A 2WA1A 4LMAA 2OTCA 3KB2A 3I8SA 1VBMA 3W34A 2HZBA 3ZV7A 1GTJ1 1U3UA 3PD0A 3W79A 2BGKA 1PR0A 1S01A 1PUIA 3RS7A 1BOOA 2OP0A 3CWQA 1YASA 3O47A 5BSVA 5H8WA 2A59A 4W1PA 1BMQA 1QCCA 2V7PA 1WF3A 1YI1A 1ZH6A 4JVOA 5M2QA 1E9RA 3CNQS 4X0EA 1NMYA 1T5SA 3EVZA 4K2HA 4Q7MB 1K5HA 1N6HA 1V25A 3B13B 3IC5A 4MDHA 1HDOA 3CZRA 1NUSA 5J4YA 5IASA 4UMEA 2AOVA 2EC5A 2RBEA 3B3AA 1IH8A 4QGFA 2HA7A 1HQCA 2ZW9A 3NEJA 1XEAA 1LEHA 5EIFA 4OI0A 1K0UA 4X1OA 5C1OA 1VMIA 3OE5A 4MTLA 1E7MA 3ZHOA 2XV1A 3AONB 2H92A 3ZHVA 4BCCA 3D6MA 3LVBA 1JDBC 3U37A 1HDEA 2JJYA 4EBFA 4XUDA 4DDUA 2RGRA 3JVDA 4JGBA 5K0JA 5CW1A 3OURA 4RTNA 5E38A 3ZWBA 1Y1KE 2VXOA 3EG5A 1GFZA 2PRSA 2GAOA 2Y8EA 3CTMA 4MVJE 1R9NA 5CX4A 5A3VA 4RHXA 3VTZA 1EB8A 1U7DA 2AG5A 2ID4A 3HDYA 3O4VA 1SKBA 2H1RA 5B1YA 1UDXA 4AIRA 4R5MA 2W6JD 3HUEA 3HVHA 1JNYA 4JGIA 4JVNA 5D8DA 3ABZA 3AXTA 4E5DA 4J0JA 1KBOA 3EDCA 1GFSA 2OBLA 2WKQA 3A9TA 5BQFA 1GPNA 1T15A 4HXYA 4AO8A 3V4RA 1YVPA 4JU8A 2OXRA 5D3MA 3FCEA 4EKYA 2F55A 4DQKA 3GJ3A 2DSNA 4TYMA 1Q7EA 1CE8A 5FUWA 3FYUB 1VJRA 1N36B 2AEMA 2GPJA 5HW0A 2ACEA 1CU1A 1OWLA 3IP3A 4JB2A 1BX0A 4UDXX 4UBOA 1HA3A 3N9IA 3VR4D 3WK9A 3RVJA 4B9AA 1B74A 1OOEA 5ALIA 3IRUA 5JFGA 1MFPA 4PY2A 5ILOA 4KZPA 3FYSA 4QPJC 5AW8A 4RZIA 3SPXA 4QT4A 2D00A 1A9YA 2PR2A 2IOFA 5HE9A 4G25A 1UKEA 4DJDC 3SHQA 1EVZA 5TQ2A 1QGAA 1QDLB 4FINA 2IGBA 1WXHA 3CINA 2TMDA 5JH7B 3LSYA 1PG5A 2JVKA 1PLLA 1UBHS 1ENPA 2PSSA 2VHCA 1IOLA 2ZTMA 3N05A 4AMVA 3G88A 3HJNA 3WLTA 1UT8A 4Z7QB 2UUOA 1YDEA 5JSHA 2G1KA 3ND6A 4PZAA 1XDBA 5B53A 4DARA 3MCWA 1SULA 3IDAA 4LJ8A 4PWZA 3BMNA 4P4LA 1XVIA 2XIJA 3L0SA 3G3EA 3OFNA 4JUIA 3RQSA 4ZJYA 2P4HX 5JD5A 2GBFA 1G98A 3T7CA 5HS4A 3WMRA 2R00C 1L2TA 1TC2A 4MB0A 3GX1A 4KDCA 1GQRA 3FBWA 3P9IA 2E4AA 3B6JA 3Q3JB 3MS4A 5ERXA 4LBWA 5AESA 4B6SA 1GPJA 1XZFA 1Y89A 1Y1LA 3REFA 4DA9A 1RJ9A 1NJ8A 1I4WA 4LOJA 2VQ6A 3T7RA 5GADl 3EXEA 4TKZA 2PCJA 5F2EA 3I6QA 1GCGA 4WBSA 3X44A 3SS7X 1H4TA 4CZ2A 5DHTA 1K7EB 3IMCA 4YUZA 1RRGA 1N9GA 1DJOA 1QTNA 2BMAA 3LRPA 2HRDA 3A9SA 3IAS1 4KXLA 2QPOA 3TZHA 1VE9A 2PYZA 1KOLA 3HSYA 3LA8A 1WVGA 3F3SA 3IIIA 2XT6A 1T9BA 4YP6A 4QEDA 2HREA 2ZWOA 4Y98A 3WGOA 3DMPA 1L8XA 4A27A 2ZAMA 5KMGB 4ARIA 2H9AA 1VIYA 2P69A 2GO7A 2ZR8A 4F6LA 3UJ7A 1GT91 4CG1A 2DCMA 3ZWAA 4TL7A 1HT1E 1QV7A 1SVKA 3FRJA 3JD2A 1L4FA 1W4BA 2QRHA 4W9NA 3DM9B 3BL8A 3HNPA 3WADA 1P5JA 4M8NE 1GL6A 2OCXA 1YRQA 4ZT5A 5KU1A 3CVXA 2IY8A 4CM3A 4HG2A 4GFDA 4D92A 1Z33A 2JK1A 3HCNA 4EKIA 3U16A 2VDQB 3F9IA 1DOAA 2JGDA 3FHJA 4DLTA 2VTKA 1OIWA 1GN9A 3LGAA 2OORC 4NICA 4V39A 2E4WA 1Q92A 4MUAA 5CT4A 2XYGA 3RFXA 3COZA 4N7JA 3D59A 1WHSA 2R00A 1C7QA 1ECBA 5AYVA 3WWYA 1IZZA 1WDLA 1XAHA 5L3SB 4RIIA 2ZRAA 3D8NA 3FFBA 2IZ5A 4PGGA 1PGNA 3GGDA 2OHVA 4ND3A 4QLBA 2R4QA 3ICQB 3CNEA 3K6KA 2P11A 1SUCA 3ZTYA 3U7FB 1O6CA 5H82A 4DAOA 4P1ZA 1FFXA 2VCHA 2YXDA 2OZEA 1ZGAA 3DWFA 2ODWA 2Q07A 4IGKA 2O8EB 3SFZA 1CUEA 2O48X 1F8UA 4L6AA 1TYEB 1RQGA 1IXRC 5TMEA 1CUGA 1OWNA 4B47A 1W0KA 3F49S 1E77A 1GGVA 1SK8A 1UK9A 2FMKA 2R97A 2XNKA 4Z86A 1KMQA 4QYXA 1H2WA 2GETA 2AUMA 3GA7A 4WEOA 4EBBA 3URMA 2VZ9A 5EJ5A 2XXAB 5T6MA 5BNTA 1FFAA 2PAFA 4YRIA 4R1QA 4M3NA 3KSBC 3T1QA 3IAS6 4HGQA 4YJHB 5JSQA 1LK0A 3ICWA 4CDRA 3B3GA 2ODBA 3T61A 3PUZA 4LBVA 2HJGA 3VV3A 3A1DA 4DY4A 2BW0A 2QQGA 2X4IA 4KLAA 2ZIZA 5AQEA 5AR1A 4HZGA 5F98A 1B3RA 1P17A 1YI8A 2TMKA 1NW4A 2QE7D 3DBIA 4LEIA 4W99A 1OGJA 4QUHA 1M3SA 1JDUA 5ICCA 4WZBA 1UDBA 3FOBA 1COWA 2AFIE 2WOJA 3KOZA 4TRNA 4TSRA 5LVAA 1M75A 1EM8B 3AIKA 3VJKA 4E4RA 3ADOA 3QWBA 1SHTX 2DC1A 2PZKA 2YWXA 3T1YB 3T34A 2C4VA 4B8WA 1S6YA 1XZAA 4AQ7A 4JEHA 2PLWA 1P2VA 4E09A 1IHUA 1ZGJA 5JXWA 1X0VA 4KQEA 1E7QA 1G4UR 3PPIA 3OX3A 5AI4A 3KFXA 1KC1A 3HDQA 4YT2A 1D3AA 4YFVA 3GBVA 4URWR 3HFRA 4CIAA 2UU9B 2YYZA 3BS4A 3UAZA 1JDSA 3DEHA 4Y1GA 1HYQA 2JFPA 4LK2A 5EZSA 1XJ0A 3BQNB 1Q15A 3H5LA 2Z1DA 3L0BA 2M32A 3O03A 3ZI7A 5A3RA 4MUIA 2PWZA 2Q3LA 1HFKA 3FZYA 1E1MA 1XJQA 1OA0A 1X1CA 2JJ1A 3OAAD 4J0KA 5C5IA 1LNZA 1Y48E 4DA6A 4EA8A 2CBZA 3NT2A 4RKRA 4ZV4A 3G1WA 1Z5ZA 2YZNA 3I1JA 1MOSA 1PJRA 3CJRA 3BWDD 4M99A 3MFQA 3WGYA 3WKCA 5JXIA 5LBIA 1XQVA 3UH0A 3HHEA 2EFEB 1JKJB 4GLBA 5DSZA 4C1NA 5L4SA 4I14A 1M5RA 1PQYA 3JQAA 1LH0A 4QOIA 3TVTA 4X65B 1KS2A 3HCCA 1N0HA 3WWEA 1CQJA 3QV2A 2VHWA 4RHUA 3GEPA 1EHIA 2O3JA 4NAVA 1ZI9A 3HB4X 3DEIA 3FGOA 1J21A 4J0IA 1TO2E 4B1FA 5IDVA 3TNJA 1V5EA 2X4DA 1RYNA 2WJGA 3KSDO 5AHKA 4A8TA 2OAGA 4BMCA 2QYOA 1JLLB 3RUPA 121PA 1U28C 5DNWA 3GI1A 3R9IA 3DW3X 2X2EA 2PXCA 4QHTA 3KETA 4B43A 3DL0A 3UMMA 3FSJX 4KAFA 1GQ2A 3H5IA 4KPEC 1DC5A 1LDGA 2XDAA 5DB4A 5EJGA 4ER3A 4HVTA 2ORWA 3PC2A 3FZGA 3OQVA 4X3CA 3JSAA 4IJWA 4PX3A 3ANTA 3DQQA 3I12A 3I9MA 1JB9A 3MINB 4HTAA 4AJJA 4C4XA 4DG9A 1RZRA 1DO8A 4CUKA 4F1WA 2X19A 2Z6UA 1T4CB 1NFFA 2GRAA 3N07A 4OKIA 2I6TA 2EZUA 4BWVA 4CMBA 2ZS9A 5IRCD 1B8VA 2J9FA 4XGIA 4R3UC 3S40A 4D4HA 5ES4B 5J2UA 4IWXA 1T9KA 2BFCB 1YRLA 3ORQA 5FBWB 2WUFA 3N7TA 3FLAA 3NTUA 1U2TA 1ZX1A 4C7KA 1R6TA 1QQBA 5HQ3A 4RAQA 3O1IC 5ER6A 3OJCA 3VQTA 4MVJI 4FGZA 3C70A 2FR8C 4L4UA 1IJBA 1LDNA 2BFBB 2F1KA 4PC6A 4ZD6A 2ARKA 3K4PA 4GPBA 5COBA 3WKDA 3AZOA 1R0BA 3FTNA 3HKCB 3MT0A 1RT9A 2C7QA 4CIYA 3QUBA 1LBSA 4QBHA 4C4SA 2JIDA 4X66B 3AWDA 1U5BA 4K40A 4ZQIA 1D9ZA 4ZVQA 4EAAA 4Q3DA 5DSXA 3VJRA 3COYA 3H18A 3AGPA 2WYIA 3MGAA 4C0LA 4V0LA 1JBEA 4Q1CA 4LYGA 5ERYA 4W9MC 3TMAA 1M0EA 4R1UA 4MYTA 5HG0A 1R16A 2QSUA 2YX1A 4FE4A 4QUBA 3C8MA 4KXNA 1E66A 1E7SA 3CLSC 2BEKA 3IVAA 4QASA 5REQA 2O8BB 3HMQA 2QIPA 1I4LD 3UUWA 3T7DA 1IATA 3R0ZA 3NHFA 3P5BA 2O4CA 2Q6KA 4A7PA 4RUKA 4JLAA 3VOAA 2XIQA 4NBVA 1AV6A 3LCJA 1CVLA 1C3OA 5J63A 1QLWA 3RT1A 3GFBA 4YQZA 4ZI5A 4AZWA 1I1QB 1AN0A 1YS4A 1EVJA 1U6JA 1OGYA 2OZLA 4NVRA 4DIEA 4YUYA 3QOFA 4PLPA 1JJIA 2ORVA 1YBFA 1HNXB 3OLXA 3GJTA 1OTHA 3U9TA 1E89A 2FZKA 2WWIA 3C3KA 3FGZA 1GNVA 4ITRC 5BYKA 1SVWA 1SXJB 2NAPA 2WMYA 3DBHB 3ECSA 1FBTA 2KHZA 1VPWA 1QP7A 1CZKA 1B76A 1XEWX 2FQ1A 2MINA 4GKVA 1U9JA 2QRQA 3FYDA 3I39X 3K0AA 4MW9A 1GXSB 3PFCA 4KITB 2CJXA 1T29A 2D7CA 2WHPA 3DTVB 3UV6A 1L4KA 4G9EA 4U2GA 2N9UA 2IJGX 3HL4A 2GGSA 3H5VA 3QKSA 2RBGA 4CLRB 2FR8A 4YXWD 1R8SA 1CY0A 4O2BA 4WN3A 2Q5FA 3NIFB 3DXXA 5CNIA 1VDMA 3BGOS 3DOCA 2I4NA 1MH1A 3ENZA 4FOPA 3QPCA 5EP2A 3V1MA 2WIAA 5L6MB 3T1OA 2M1XA 3QKWA 3KVRA 1G8FA 4DABA 4JOBA 3BBLA 4C4PA 2J3HA 2FUCA 3L06A 4HC4A 4LZPA 4DYDA 4NSNA 4KR7A 5JS1A 2HA2A 3D2BA 4L8LA 3ZY2A 2WTUA 3A32A 5EVCA 4A4DA 1NBWB 1SBQA 1NY5A 2UV8A 3M6AA 5DXJA 2YXNA 2OFFA 4BHTA 1KWKA 4TTJA 2I3GA 3BA1A 3GNTA 3NXKA 1EP2B 4KBGA 4C7XA 4DF3A 4Q4HA 3QENA 3OECA 3HLTA 4F6RA 2ZSEA 5HFNA 1I33A 2X2FA 2LZ0A 3T5AA 1W5SA 3G2MA 5CURA 1NJ6A 2Z43A 2J3IA 5K09A 4MKRA 1J8MF 2XKAA 1I51A 3O8BA 2EFJA 3BKXA 1TAHA 1VIAA 4UHKA 4M9SA 2VPYA 1IBKB 1ZC3A 1NC3A 2HRZA 5F5LA 2NUAA 1FTGA 4LYEA 2ID7A 2P4QA 4ZI7B 3AUUA 3ZWWA 5A4JA 4CLOB 5C7YA 4GNRA 2MMGA 3W0LB 2F8LA 2PWYA 2ROQA 3RE1A 3R3WA 1FNSA 2ZT6A 3AEKB 1VIDA 4KNVA 4BLOA 1D2GA 2DPXA 2D74A 2I2WA 3ZBPA 5C8DA 5KYGA 5IABA 1JRLA 3QKIA 3P0HA 4HYEA 1R27A 4B6OA 4E2FA 4Q7EA 3SN6A 4EX7A 2I3BA 3H8VA 5JS6A 4JI7B 2EP8A 2ZTLA 4Q4AA 1IJEA 4GP7A 2MYUA 4NYMR 1FK8A 1YIDA 1H1TA 3WAKA 5EIEA 5CGQB 4MS3B 5JADA 3PJRA 2O1SA 4J1TC 3AIIA 2H8GA 2D4HA 2FUG1 3EDRA 4URHA 3VSEA 1UXOA 4OLJA 4FMDB 4B8YA 3T1TA 1ZOSA 3BMCA 1AMNA 5KTMA 1P1KA 1UFVA 1YKSA 2XEXA 4M4SA 3U3ZA 4XVRA 2FWRA 5D5QA 4IDPA 4II7A 2BFFB 3GGJA 1ZU5A 4OHYA 3P2YA 5ALDA 3FJOA 4XDZA 1D0IA 5ICGA 5K3OA 1GL9B 2E55A 2PUFA 2ZYSA 1D1PA 4GM4A 3S2SA 4J03A 1FCJA 2Z2KA 4MYUA 3BXPA 4P6VF 3I61A 1UFKA 3JCZA 5AM1A 4RD4A 1KI6A 3HFGA 4A8JC 5C37A 1KE1A 1JVSA 1U81A 5T64A 5FV4A 1P1RA 2WD9A 4WNAA 4D5GA 2H63A 2D0PB 3EXFA 4B3GA 2D1FA 1IUOA 2W6JA 4CKWA 4J1SA 4EH1A 2VP4A 2Q5EA 3MB8A 3N2ZB 2XNJA 3TR5A 3GAAA 1IPEA 2Q3BA 1WG8A 4JR2A 1BA2A 1R0YA 3LTEA 2JAWA 3EEYA 2Q5HA 1GVHA 2OEPA 2IY7A 3ONNA 2EFHB 5C3MA 3AP1A 8MHTA 4F6CA 2I4TA 2MSKA 4BNDA 3LDUA 4OGLA 4NHEA 3G9XA 2A0XA 1YB7A 3JQDA 5EKXA 3E48A 4I66A 3ANLA 2FP3A 5AVRA 2QJTA 2ADOA 4FYVA 4GL4A 4B81A 1N1GA 1M2FA 1S3GA 3LPDA 4ZXPA 3VR4A 2PGJA 1XKXA 2VQDA 4LMRA 4J1TA 3RLFA 3B85A 4JKYA 5J2UF 3FPBA 5BT9A 1DFIA 1W0CA 1PL7A 2Z98A 4D41A 4MV1A 1SQ0A 1KI7A 3H97A 3PPYA 4Q7QA 5K2MA 3CUTA 2HHHB 4QU0A 1JE0A 4ZCSA 1K5GA 3KXIA 2DM6A 4KIWA 3D02A 3GFSA 5DSTA 3VDRA 2O2JA 2A5GA 3THXB 3BFJA 4RGQA 3AW8A 3TOXA 9LDTA 2IZ6A 3S27A 3E5NA 1FOEB 2FUG6 1ATZA 4NF2A 1RHUA 4LXXA 4QGGA 5CFQA 3BULA 3WB9A 1X1SA 1S7GA 2HA5A 4GOND 4LJ4A 4UCXA 1RBMA 5ARDA 3SU8A 2BR4A 4A8JA 4BEBA 1EP9A 1ZEJA 2ATIA 2REQB 3CKKA 3EGVA 1YQTA 4IV8A 4XARA 1C0PA 1VA5A 3F8WA 2QLTA 1FSGA 2B9EA 4BO4A 3IR7A 1VG0B 3LI2A 2QN7A 1Q0RA 1O87A 3NHAA 4I1UA 4L3WA 4TQGA 3PEWA 3IQFA 3IDOA 4L22A 4HNGA 3T4EA 5IUNC 3GT7A 2Z95A 2OFWA 4LHWA 5L6LB 1JDPA 4F5EA 1PDOA 3LQ1A 1JEYB 1NL3A 3AR8A 1VLZA 1JJVA 2CZGA 4I8DA 2IU3A 3I64A 2O19A 5JYBA 2A0WA 3DVQX 3LP8A 4LYHA 1NZDA 1PRYA 3AV3A 4WUTA 2FWNA 4YRFA 1OH7A 3BIFA 4I81A 1QS0A 1YBMA 1ZMOA 2P67A 3HGTA 1M2JA 1JT9A 4Q1FA 1FJ2A 1RW4A 1SWWA 5TQJA 4UE3S 3ZWOA 4ITUA 1PX2A 1ACMA 4I50B 1OT5A 2XCTB 3ZZNA 2WU3A 4D79A 4TXHA 4ESOA 4TMZA 1CUUA 3G6KA 1Z7WA 3A1TA 3D4BA 3E7XA 2H4ZA 5FI1B 5C1DA 4XB2A 1YGYA 4IDNA 1QFXA 2B82A 2CLSA 3C7KA 4O2BF 1WQ1R 2IXGA 3DDNA 3L7YA 3PRHA 5EAIA 4MLDA 3ZDYB 3BE6A 1MQAA 2QX4A 3EG9A 2RGXA 2F43B 4NBWA 2RH8A 1EKXA 5ETJA 4YCLA 1Q0QA 1W5FA 2IZ1A 1T9GS 1WXQA 2EYUA 2YFYA 521PA 1CR6A 1N3IA 1TE2A 1WB4A 4EY3A 1EWKA 5KAPA 2Z8ZA 1EYZA 1MG0A 2JD0A 1RBYA 2PUJA 1LVUA 3KFVA 2OLEA 4NV3A 3SHFA 3PI7A 3PX7A 3RU9A 4HDRA 1L5HA 3WOVA 3DZJA 4RK4A 1JDNA 2IYAA 3HNOA 3SQOA 4OX9B 1NVBA 3AX6A 3H2KA 5JMOA 1BHJA 1PX0A 1D6SA 3RU3A 1HYHA 4KRGA 4EFMA 2QRVA 5LOVA 4MAFA 4O2AA 5EE0A 4ESHA 4PYNA 4NFYA 4LJLA 4UNIA 4DLYA 5CG2A 1X8XA 2CF6A 4V0RA 4Y2RA 1N5MA 1JS1X 3TNYA 2HR1A 2HXYA 4PC1A 1MOZA 3E58A 2HRQA 1UFQA 1CZLA 1SEVA 1U0SY 1EQ2A 2FWBA 2IEBA 4WACA 3T95A 5LQAA 2ZYGA 4MA5A 1I7QB 3N58A 4NIMA 4K9NA 4UFOA 3OU7A 3AT1A 3ETEA 2JASA 1E1YA 1D4ZA 1LPSA 2COKA 3NM6B 4X97A 1NV8A 1KPGA 1WOMA 3SIXA 1SGWA 2JGKA 3AWIA 3VOTA 2O0MA 4ESEA 4B7ZA 1ECCA 1TQ4A 4D6YA 2ZJ1A 3VAYA 2H85A 3DOJA 3I92A 3U5ZB 4RF4A 4Y1FA 4DVJA 2V9ZA 1W35A 2PA0A 3F2IA 2QE7A 3PS9A 4QECA 3TRIA 4BCBA 3QU7A 1P2FA 4JHLA 1Y3IA 4HWRA 4FYWA 5FEMA 1V35A 2R6AA 3MWKA 4B7CA 4CM9D 2RGNC 5IEJA 3CLUD 3V42A 3WNBA 2PJRA 1KSGA 5AK5A 2C77A 3KQUA 2IU6A 3C24A 3G0IA 1SKAA 3HLKA 3JZMA 4MP6A 2BTEA 5I9BA 4QNNA 3HCOA 3HU1A 1JA1A 4QBGB 4X62B 3ZHQA 2VQ3A 2ECKA 2BBOA 2IHVA 4XSVA 5E1MA 2C5GA 3D3KA 4HAUA 3AY3A 2QQ5A 3BTOA 4CBVA 4I1VA 4IL5A 3IXLA 4KQCA 4X41A 4MLZA 3V8MA 4RD1A 1E8MA 3MJEA 4HWOA 1NMZA 1HZJA 3C7DB 2V3VA 3NBYC 3TZQA 2LVBA 1ECFA 1VKOA 4N49A 1EIZA 4IUYA 4WRRA 1JBQA 2AR9A 1LJ8A 4TM7A 1MX3A 3SJZA 5BR7A 1EEXB 3V8RA 1J22A 1QRDA 3OZCA 2HY7A 1S2MA 3K8ZA 3LLUA 3OAAA 3ADBA 2ZTUA 3GEGA 5I45A 3R3HA 4AMYA 4E5NA 4TMXA 1LVHA 5E4YA 1QF7A 5JNTA 2FPPA 2W6OA 3BERA 1YCGA 4YASA 5DULA 2GLUA 2OCBA 3C98A 2BEVA 1Q20A 2CHUA 1A97A 2SECE 4WOJA 5EKTA 5F52A 3KJXA 4JX8A 4TL8A 3GFPA 4G3XA 4Q18A 4EOGA 4GPTA 4IKEA 1MW8X 4NXNB 1FXWF 4ND5A 4J76A 5F1PA 4F3CA 1AS3A 1GKUB 3RSOA 1CUIA 5EJ2A 1LRLA 4DLKA 1GARA 1NC1A 2D1SA 1F6BA 2OILA 4L75A 1G3MA 2NLOA 3JWHA 3A70A 5AJWA 4CTNA 3G5LA 4P7FA 5I8WA 3V1TC 2CLLB 1U1IA 4KTVE 4UU7A 2WMNB 1UF9A 3K20A 1EP3B 2K6GA 2BV3A 1BS1A 3P94A 4MW7A 4DIOA 1A95A 5TY0A 4PQFA 5FTJA 3R9KA 3K4QA 3TRKA 1W48A 1UWLA 3RVSA 2ZKIA 2YWFA 4GM1A 5K0LA 1AQJA 4FZ5A 1N6OA 5DO9A 4Q24A 3ZDQA 1GVNB 2V5AA 1NT4A 1P0PA 3W2TA 1KTIA 3ZGNA 1QH8A 1RYDA 4L51A 2AF3C 1OLXA 2AJDA 3AM4A 1ZH8A 3GF4A 4HX9A 3EF0A 4JBXA 3BT7A 1QDEA 2QYTA 4ZGWA 4RVUA 1NDUA 2BZGA 4BNMA 4ENWA 2OC9A 2YNMC 2F8SA 4TZ0A 5GJBA 4OBWA 3NHZA 4C05A 1WLSA 1BXRB 2EFYA 5JZVA 3R23A 4RTKA 3MSCA 2XCIA 4PXYA 1N6RA 2C94A 1X80B 4EFNA 1U8EA 1ZGGA 3I28A 9GPBA 5ERGB 5LZ5A 4KMSA 3EH2A 2O3RA 3D6JA 1BXGB 1Q7GA 1VLQA 3N2IA 4Q5IA 5B1EA 3E9NA 5D7BA 1XPJA 1MW9X 3W7VA 1J4AA 1NVFA 4AZ3B 3A2NA 4DJFC 5JLJA 3VA7A 1CDDA 1GZ7A 2V1UA 4ZICA 5JAHA 3K15A 5KPJA 5T5QA 4KAJA 5C8YA 4NJMA 3PSHA 1XK6A 5IDWA 1YFKA 2GZHA 5DI3B 1ZRSA 1XCBA 2GZ3A 3ZU6A 4GMXA 3LFTA 5CCEA 1ZBQA 4JBIA 3WOHA 4BO0A 1PR3A 2M1ZA 4X84A 3ZDDA 1ZHOA 2M6RA 3CUEF 5E4JA 1QGZA 2PN1A 3K09C 1J07A 1N8NA 2WTXA 3P9NA 1VJCA 3U80A 4BFUA 1DRUA 4FSXA 4X64B 2HN9A 3G59A 3UF0A 1MEOA 3B20A 4GZMA 2W7TA 2DUMA 4MV5A 4LVUA 3E9QA 3BDAA 3ZD7A 1X0XA 1K7XB 1JIUA 2COEA 3P0EA 3M82A 1EWVA 1H8HD 1ML4A 4RA6A 1V1MA 1XQYA 4MV0A 4JUAA 2MMCA 4DS3A 1AUQA 3HR7A 2BP7A 4LSWA 2HV8A 4N1AA 3X3HA 1DARA 1KH2A 3DCYA 5MFZA 4QQFA 4E2YA 1TU3A 3GCZA 5C53B 1UBFA 3CLKA 1QAOA 3WJ1A 2Y99A 1V8PA 2JD1A 2QNRA 1XC7A 2EGGA 2QW8A 3EEQA 4AYTA 3RRNA 1NLYA 1WU8A 5KQRA 2IL1A 1TVKA 2P6OA 2WB4A 4O25A 2WHRA 4RD2A 1W4CA 3WNZA 5CA1B 2MWMA 3B38A 2I33A 1A4UA 1KMCA 2FSSA 2QVBA 3PEVA 2P2LA 3QJYA 1PK7A 4YXWA 5HOQA 4OXXA 3Q11A 3WICA 4H3HB 3BX1A 3GU3A 4KH0A 3H5RA 2R65A 3L8CA 3RV4A 5BPHA 5HK9A 2I4RA 5LOVF 1G20B 1Q57A 4O2AF 4AS3A 4XCQA 4RETA 3KDPA 2I29A 1QGOA 5IT5A 1TIPA 2FZWA 1XQ9A 1E9CA 1YJXA 1ZIYA 2ZYTX 4XSHA 5CB4F 1JFFA 5JIBA 4LX8A 4XZ3A 5AHOA 3GVCA 4Y2JA 4RAOA 5L8VA 5SY4A 4Q1BA 3U3DA 2J85A 4IX9A 4K28A 2CF5A 4NOMA 4UHHA 4DV5B 2DUNA 4TYWA 1I4EB 3TLGA 1ZNQO 3GEMA 3EXHB 1QHEA 2E6KA 3HU3A 4RJ2A 3UAOA 2ABWA 4HB3A 3ORFA 3P8ZA 5I4IA 5LMNB 1XOIA 2Q5IA 2Q9CA 2AN1A 1HTBA 1A77A 3RABA 5ALFA 4KSYA 1W4LA 2EBUA 3HN7A 1W9HA 3I42A 3BM5A 1FLAA 4JFRA 1F38A 4X1YA 1DVRA 1F2TB 4YJGA 4DWWA 2WYVA 2JH9A 3BIOA 4BIIA 4ECAA 1BC5A 1PNVA 4G8CA 1PG2A 1R4ZA 4UMDA 5JEDA 3WA7A 3EPRA 1QFJA 4EHDA 5K3SA 1SUAA 3EVAA 4RADA 5DOZA 1Q6YA 4NCXA 4WZBE 1JDJA 4C4YA 1O96B 2BWJA 4NHOA 4U39A 5KUTA 1N25A 2TSYB 3JQFC 4K6KA 4R31A 2WU8A 3JS5A 4CF3A 3Q8KA 1DQYA 1OC2A 3A1SA 5GZ6A 1T4MA 1G9XA 2IQ5A 1PZXA 3U44A 4MA0A 1XD2B 4BO3A 2XVYA 2AJLI 5COAA 4H7EA 1P61B 3H5AA 3RQIA 4H6WA 3E7PA 4K88A 4LPKA 3L8FA 2H29A 1U0LA 5EUBA 4IXNA 1G21A 5KKAA 3HP1A 3GLFA 4PZUA 1KI2A 2O2HA 1NU8A 4ZCIA 3VNBA 1CUZA 1G2IA 3GIDA 2D2FA 4GO1A 2SKCA 1VMAA 1E3TA 3WJAA 3TSOA 4Q4LA 4ZVUA 1OFGA 4YIKA 1M2OA 4IH9A 4JLKA 4S1VA 3RIGA 4AW9A 5JV5A 4R8VA 3EUWA 1YQWA 1H6AA 2Z1MA 3E9RA 3K4HA 2HSGA 4DXHA 1WKVA 2YV3A 4MPRA 1GCUA 3UJNA 1JFRA 1ZN7A 2AEJA 2AWNA 3PC6A 1YZHA 1JA0A 3LXXA 1U99A 3RVPA 2AG1A 1GUDA 3LT4A 3IHKA 4XCVA 1OXSC 3IAUA 2RBKA 2YC4C 4PHGA 2FW9A 2HKIA 3DE7X 4TWAA 3R40A 5E9WA 4DDHA 1YBHA 4YONB 4UTRA 3IX7A 2FRDA 1DBPA 4LHYA 2JFFA 3L7BA 4YCBA 1DTWB 1QFMA 2J48A 1YZLA 3GRRA 4Z9AA 3JATA 2JKVA 2WQ7A 2Z9CA 5ITWA 1EESA 2WHEA 1BMFD 2E4VA 4K8RB 3EZ2A 1MORA 1SK9A 2RGBA 2YRXA 3FUCA 5K3CA 4E5VA 3UXMA 3U19A 1IBMB 1MC1A 2IKSA 2VT2A 5EZYA 2ZWMA 3FHLA 3MUEA 1RAFA 3P9KA 3VR4H 3SFVA 4DEVA 1HE2A 1B16A 2GXUA 3WLKX 1OXMA 3SKXA 3TJRA 4DLXA 2D62A 2RHCA 1HKUA 3MAAC 4P0PB 1N2CA 4MTCA 3IB6A 4HDMB 2ZYHA 1QMPA 3LUFA 8OHMA 2R1TA 4RHFA 4N5NA 2A1TS 1X94A 1SY7A 2IIBA 3SSAA 5AUNB 1EWYA 1ZN2A 4GDFA 3FVTA 3KQPA 2HNBA 1G3QA 4FFMA 3LKDA 3RKSA 1F5SA 1F4VA 3FI9A 3CM0A 2CLOB 3A6EA 1NVVQ 2IGTA 3BQ9A 3C74A 2V6IA 3ESYA 1X7ZB 2VHEA 2BR3A 1QRAA 4QJBA 4TX1A 4QHSA 2TRSB 5AP9A 4DYVA 3VU0A 4D6XA 3QX3A 3HACA 2VK1A 4KPGA 2HXSA 3VX3A 4K1LA 3EEIA 4DILA 3DCIA 3LW7A 1FMFA 1ZZGA 5K7SA 2V6FA 3W6NA 1KZ1A 2OM2A 3T7IA 4UFPA 3IJ5A 5G0UA 1EFDN 4WOPA 2WM8A 1WB5A 5LQRA 5CH3A 2AMLA 4KQ2A 2FMUA 4MPDA 5C8YF 3U7JA 4GVXA 2HQRA 2X6QA 5I9IA 3I9JA 2X0EA 2HPVA 1MAHA 1R12A 3EQZA 2V0CA 3FUUA 2VXCA 1X1QA 1C9YA 3OTHA 1TCCA 1F3OA 1KI8A 1ULAA 1XMIA 3DVSX 5EIBD 3QUAA 5CBPB 1OLSA 4FK8A 4EPTA 2H16A 5IAKA 4A3SA 5J5CA 1GQYA 4B46A 4KXYA 2HK8A 4I99A 4BFTA 1Z6TA 5JAOA 1N7JA 3WK8A 1U7OA 1XU4A 5EPUA 4KODA 5BW8A 2OCGA 1Y3CE 3QY0A 5KCMA 4ASUD 1U98A 5BO5A 4BV9A 2VYVD 3EJ6A 5HZKA 3U6BA 1JUDA 2HHCA 3OC6A 4RHEA 4FWBA 3KALA 4F4DA 2GCPA 4F0JA 3VPCA 3TQRA 1KK1A 1G291 1SXPA 5I7AA 1ABFA 4F72A 3S44A 4CM1A 4PIPA 3CVYA 4G0VA 1X86B 1YR8A 5AJHA 1KI3A 4KRXA 1SC1A 3HG7A 2BHSA 2G36A 5JZ9A 1Z0IA 2PGDA 4OPMA 4PONA 1G9TA 3I01A 5IF9A 4DCUA 3VTFA 3L5OA 1XZNA 5BUCA 2QSYA 1BMTA 1EXMA 3OM9A 2PGIA 1AO0A 2HM7A 4OYLA 1WCXA 2NVUA 3TTYA 1STOA 4E30A 4JEMA 4DMGA 4HQNA 4QU9A 3T9EA 5GMOA 3O92A 4AF8A 4ZJPA 4RD3A 1FSZA 4PHTA 1H66A 3MCVA 3FMVA 1SXJD 1PU2A 1S0UA 4Y30A 3CLUC 1L7NA 3HY3A 3BK7A 5AM0A 4G89A 2W2LD 4L8GA 3SDBA 1DUSA 4DJAA 1UBLS 3BJRA 3I37X 4D8UA 4LXYA 4RC9A 1T25A 3GR6A 3KAJA 5GONB 3VJLA 3DTVD 5BVGB 5C4MA 1V3QE 1ZM9A 4M54A 2GUGA 5B2FA 5EZ5A 1BWPA 1E6LA 4BZWA 4LTDA 2ZBUA 1GR1A 2QMHA 3R3VA 3HWX1 5IBQA 1WXIA 4ALMA 1QWSA 2AMYA 4RESA 2CFSA 4EARA 4O2RA 1JDTA 3ZWMA 4YCMA 2AG8A 5MGNA 3K3PA 2QW0X 4LJ5A 4V0MA 5D1NA 3V8EA 3F7OA 4F2HA 3STTA 3DZFA 1J1ZA 3FUXA 4DM4A 1THGA 3GFVA 3H17A 1K3FA 3MJ4A 2WPDD 2ZE6A 3EQ9A 2VT7A 2VNAA 3MWFA 1ZL0A 5TF0A 1XLUA 3UC9A 4BVJA 3TIIA 5KYWB 4KBYA 1O6GA 4B3SB 1R4AA 3STYA 3PGLA 4WN9B 3MD0A 2WKWA 1G41A 3IUSA 3P4XA 4S1OA 3G2JA 3HWRA 2X3YA 1YHNA 1RE1A 2N42A 1JHRA 3DWEX 3EIFA 4C4ZA 2WZDA 1RLMA 3L18A 3BFKA 3ELUA 3KB1A 5JSFA 5C3UA 1L5YA 3OJXA 3PC3A 1L4EA 3NHRA 5H83A 3CSSA 4LBZA 6GPBA 1LFAA 1Q1AA 4ON9A 5JEEA 1W5TA 3AINA 2X2PA 1JEEA 3LT0A 3VUFA 1ZCJA 5JCXA 2R4TA 2BKVA 1VHTA 1F8XA 2ORED 2PFKA 3IUMA 3FOWA 3LCCA 4FYYA 4CM9A 4EGSA 2QQFA 3KYBA 4QFMA 4M1YA 3RJ5A 2XF2A 1TADA 2A0KA 5HRCA 1A8IA 1V8ZA 4JYZA 1RXCA 3DL2A 3SF8A 3VM6A 4PZYA 5JNRA 3AR5A 4ZU6X 5JNLA 1B23P 1Q0SA 3DFKA 3HA5A 3LOUA 4EGAA 1RI3A 4CTKA 3GDHA 2Z09A 3B1YA 2V58A 4LCBA 3WLNA 4DBZA 5ITZA 3PA8A 2QT0A 1LSOA 5C2JB 2OCPA 4QSMA 4UNPA 4GMKA 4QOSA 2HHJA 2Q3DA 4MINA 1X8KA 3BF8A 2MU1A 4NEGA 3R0VA 3G9UA 1Y1RA 4RNDB 3VSDA 4BC0A 4F4IA 1TEHA 4UTXA 2PVSA 3K30A 4EX6A 3I5UA 1TDJA 2VZ0A 4U2DA 4CL3A 3WMEA 2AN5A 2QX8A 3IILA 4JT2A 4EKNB 3QEAZ 4LDPA 3DMRA 4F2WA 2YR0A 2ATVA 3CONA 2HC9A 1R64A 1XELA 2JGIA 3EXAA 3KAQA 2B8EA 1NULA 4X20B 3RWBA 1X7HA 3FD8A 2V65A 5FEUA 3KDSE 1XFDA 2A9QA 3ZZMA 2FZLA 4FMCF 1QKIA 3NETA 3UTDA 3ZLVA 1NXTA 5EWJB 3WHIA 2J30A 1JLHA 1GLVA 3GHHA 1QNLA 5EWLA 5FWAA 3UQYS 3V7WA 1DB3A 1KMNA 1NW6A 1RQRA 3BMOB 1KETA 3EODA 1CNFA 1N7IA 2D0DA 3DT9A 4ZQBA 1VI5A 3TLZA 5EZYF 4BOYA 4B33A 3KR9A 4GICA 4TVKA 5FBVB 5JCJD 5FLYA 2OGUA 1AZTA 4RZXA 3VHXA 5FAKA 3FR8A 2PIDA 3O38A 3AFHA 4UHJA 3UWPA 3QYFA 3A4LA 4ZDIA 1P2TA 2OMEA 1IZ0A 4ZCRA 5M04A 4KO1S 2ZQ5A 3V34A 3A4TA 3KB6A 4TS9A 4OOEA 2EGHA 1VHLA 4ARVA 1NONA 1GV0A 3JWEA 4MVJG 5H4HA 3R8FA 4ZIRA 4CF5A 4OHBA 2O6LA 1RJGA 1NLZA 2P0EA 4HQ6A 1Z13A 4BU0A 4QPNA 2C5HA 1D6MA 2ZJ2A 1NHWA 4MCHA 1T6ZA 5WRFA 5L4LA 4TN1A 1QV9A 2R68A 3IV6A 2ZSUA 2BRUA 5AJYA 4PZ0A 1UMKA 4FYJA 2VJYA 1MO6A 1T0HB 3FNGA 4FONA 5KEIA 5B3KA 3HCEA 3BCRA 1E7YA 2PUEA 1JNXX 5TQ0B 5FCDA 2PUCA 2JL1A 3NWJA 3QHPA 3KWJA 3DOHA 4BNTA 3VR3D 1M76A 1U0NA 3W5UA 1O7JA 3K5IA 5TJ9A 1D4OA 2W93A 1XYYA 1Y4AE 4DJTA 4DLSA 3UY4A 3GT0A 4L72A 5CCXA 4YXFA 4P33A 3WYAA 1T5HX 2ZIFA 4LJYA 3VPSA 4L1KA 1KFCB 1SBZA 2J5XA 4XDGA 1QE3A 1VJ5A 1I24A 1KDTA 1UC5B 1XO1A 4BVGA 1UIRA 2CMGA 3DW1X 1XZLA 2ZVPX 1WE2A 4CVNA 5A7FA 1YZVA 1E2BA 4D9KA 4Q3KA 4CDGA 1XJCA 4OLHA 3PHCA 1RJFA 2LP4Y 4ND8B 4GR4A 5FT9A 4BO5A 3I04A 3ZVRA 4CETA 5HIIA 5CU7A 4CM8B 4N03A 3SQWA 1JE1A 2R60A 2QL7A 3ENWA 3I5MA 5JMWA 3FPGA 1E5QA 3G2HA 2CXXA 3L8GA 3LLVA 2I6FA 2VZLA 4GX5A 1WMEA 3JQGA 3VC3A 4DLZA 1L8AA 3SWWA 2VYND 4P80A 3VNUA 3D1JA 3QUSA 4FQ5A 1GR0A 4K9MA 4L0QA 3ZGOA 1UFOA 3BYZA 3PSAA 4I2NA 3CR8A 2C2ZA 3G8AA 4J0QA 1KWGA 4NL4H 1SUFA 1ML3A 3A7DA 1BQEA 5FLXA 3ND5A 2Z5GA 1QJ4A 3H83A 4H35A 2OPHA 2IDKA 2UUBB 2C4UA 1RQ2A 1H8HA 4U2FA 1X8JA 2NO1A 3P9CA 3UA4A 2WSLA 3KL4A 4EYEA 1P39A 1G3RA 1X2BA 3THWB 1Y8RA 2XTAA 1YU9A 4B8ZA 3AP2A 3FGNA 1WQ4A 3E22B 3QE2A 4AZTA 4B73A 2IOQA 5KMGA 5LQNA 4I7EA 1QB8A 3GWZA 1L5VA 2IC5A 5AVUA 1VOTA 3FOFC 1SCNE 1YDGA 3VGPA 2G40A 3WFJA 1D04A 2BMDA 3MUNA 4NH0A 4WUVA 4AF7A 1VL0A 1CQIA 3MRVA 2BFDB 4E31A 2GASA 1BDMA 3WRXC 1Z8HA 4I4IA 4LYDA 4CN8A 2HV9A 1DKMA 1ST3A 1K5DA 1RWXA 2JBAB 3W2EA 4BRSA 5BR1A 5EIOA 5FOWA 3SJAA 5BNIA 2QTRA 2ACWA 5JAZA 2CMFA 4FGJA 1OI7A 4MGYR 4Q6BA 1G2PA 1RNLA 3W90A 4XYLA 5EJIA 1ZUD1 2OENG 1P4SA 2X42A 3AF5A 3CCBA 4NWIA 3ZWPA 2AG0A 2I1WA 2XQFA 4YDHB 3TIGA 4IOKA 4MGIR 3WFZA 2CKMA 1KQGA 4W5OA 1COZA 4KO3S 3SM3A 1VYHA 1Q1NA 3EN0A 1EVYA 1KAMA 1F4LA 3S55A 1AN9A 4QBTA 4YRDA 5JATA 2F62A 2FEOA 1IB0A 2H6EA 4FJ2A 5L3SA 5MN5A 3VOBA 3NEAA 1AXEA 3BSSA 1SHKA 2JZOA 3CHYA 1KFEB 1MA0A 4UTZA 3RKRA 5IXYA 4N48A 4I5IA 3TR0A 1RU3A 3NTXA 3NWPA 2UXDB 4L08A 1C7FA 2IYFA 2ODPA 3NO4A 2ISSD 1LK7A 4K9KA 3HKBA 4XD7D 4I5GA 3G7UA 4RGYA 2PS0A 1I3OA 4P86A 1UT6A 5F9MA 4RPGA 1Z5PA 1PEDA 4CG0A 1CYDA 4BP9A 4JUDX 1RKUA 3L0CA 3ZNPA 3QX9A 1XMVA 4YRBA 1N92A 1YJCA 5ULLA 1T2EA 1MHTA 4BPBA 1K97A 4C14A 3O7WA 2JCGA 3OJLA 1I6MA 1B8PA 3UWMA 2DWOA 5FTKA 4ZEWA 4MVJP 4OHCA 2I9KA 4DRZA 5IAJA 4ER0A 2O1XA 1FPQA 1P9WA 1ULBA 2NXWA 1SG0A 4J6EA 4QAJA 5CR9A 5LYJF 1AKQA 3RAFC 1UBKS 3W5AA 4N0QA 3UJDA 5EWMA 2F4VB 1MIOA 2RJ3A 1CEEA 3ZC3A 3DYBA 1SRRA 4GMDA 2A9KA 2FY8A 4EKEA 3I2FA 4IIYA 4JYBA 3TL6A 1CZHA 2RHHA 4G1VA 5G0TA 3F7NA 5LQDA 1TLFA 2G4LA 3I0NA 3PNPA 1PFUA 3BUSA 2OM6A 4Z3DA 5DNEA 5B4UA 1YWGO 1EDZA 4DT1B 3ZIUA 4ZCPA 4WL0A 4KIGA 1EM8A 1F2UB 3T99A 3GLQA 4B4WA 5F3WB 5CJ2A 4LYJA 4REQB 1EXNA 1ZA1A 4DHWA 2ZSAA 3T15A 1W94A 3TLMA 4CKCB 2IW1A 1L5GB 1GGEA 2PGOA 3M1LA 5JRJA 3NWBA 1NKSA 5KKCA 1GPMA 1LDMA 4EJ0A 1BU8A 3NAMA 5K0EA 1SU6A 1W1WA 1H5QA 4RNCA 4F9TA 7AT1A 2AGVA 3A1UA 4FMPA 2BSAA 2AKAB 2QRJA 2Z5VA 3AETA 3OJ0A 2EZ4A 3DE4X 4WLFA 4UAVA 1OYYA 2G82A 4LWOA 1ZAKA 3GFQA 4MMYB 3T54A 3VKVA 5HKBA 4KVAA 1Y9JA 1TW2A 4KFRA 2UVPA 3OTWA 4P92A 4X71A 4YCJA 1UKYA 2LPMA 5CFMA 4OX9Y 4EG8A 4OHRA 4IMRA 2P9GA 4PRLA 4BLSA 4JB0A 3W04A 5HJ2A 2GLXA 5FHRA 2IXEA 1N2OA 1EGAA 3M4XA 4WK2B 4AIIA 1BDHA 1GRRA 3U4HA 5ISMA 4RKWA 3BF7A 2DBQA 1BMFA 4WSOA 5ECGC 5HVNA 3QLUA 1TM5E 1V6CA 5HILA 5E3JA 3DLHA 2WTNA 2ZBPA 1JKJA 4CF7A 2NSJA 2FHSA 2Z04A 2C3YA 4N7BA 1FQKA 4X8HA 2XY4A 3ZD8A 2I54A 4Y2HA 3EPKA 2WMOB 3DDSA 4ENVA 4DTCA 5BY2A 5JCOC 2NQTA 2OGZA 2P6MA 2DLNA 3BJIC 1DIRA 3GGPA 4CKEB 1Q17A 3MD9A 3QKTA 4TS3A 2QLLA 4JODA 4L9WA 3OKAA 4UUBA 3B3QA 4IJUA 3GRKA 5DBFA 3ZCTA 2QRUA 3LO5A 3OSZA 3VZSA 3PHBE 4LYAA 2J0VA 1AZLA 4HZUB 4GPEA 4I4TB 3LZ6A 3PD7A 3TDNA 3G17A 2RAUA 2W00A 4LJ9A 1JZSA 2OT3B 1RYBA 2XHEA 3LC0A 3CC8A 1E2UA 3MINA 3P9PA 1V96A 4YR9A 2GBIA 4WGFA 2KMLA 3CX4A 2XZLA 2FZEA 4O3FA 5FNZA 2M6SA 2P5YA 3DP7A 2ZRLA 3PEEA 1PKXA 3S1AA 3V7YA 1K4YA 2Z4TA 4F8JA 3WLAA 1Q7TA 2AOTB 3B89A 2WJIA 4X6YA 2P1ZA 3DD1A 3NV7A 4Q39A 2BFCA 2Z8XA 4KAXA 3IT0A 2ZRPA 4DCSA 5KTNA 5ECYA 3ND8A 1Q74A 2VSFA 3L1IA 4WV3A 1HM5A 4RU1A 2FW8A 3WQQA 2Q2VA 5TPWB 1MEEA 3CF4G 4RJLA 3L6UA 5DYYA 4CCSA 5AK3A 2RHGB 1UJMA 4TKUA 1YFJA 2HDOA 3UK6A 1SC6A 4AG6A 1Z18A 4HI0E 3H6HA 2JAXA 3OQJA 4ASUA 1GYRA 1I0IA 2IEDA 2R8EA 2VYVA 3ZOKA 3RJMA 3KWLA 3CEAA 5CMLA 5AQ1A 2C5BA 3SZUA 3KXDA 1KU6A 2PSEA 3DE5X 5EMJA 1RQXA 1ORHA 2CNNA 1HYEA 2I65A 3CZ4A 1ESZA 2W2PA 3B2QA 3CBGA 1T2DA 2W6ZA 3K70D 1TLTA 2WYUA 3DMTC 1HQDA 3BWXA 3SX4A 4EHJA 1U8YA 1HG0A 3RK4A 2VBGA 1D2AA 2C7BA 4DPKA 1NVMB 3NHKA 2H65A 3G5TA 3MRTA 1R8YA 3V6LA 2Y2VA 4NDZA 4FFOA 3OD5A 4D56A 3KYJB 1P18A 4XWGA 5G3ZA 2YVKA 3KTOA 3VH1A 2DSTA 2HEGA 4N6OA 2VPZA 4RF2A 1PLJA 2IHZA 2QZSA 4LE0A 2ONZA 4GGOA 3W1VA 3OE7D 1DXOA 3C3YA 4GRDA 4BN0A 1GTZA 1SXJA 4C5BA 4BLQA 2GUWA 2ANBA 3T6KA 5DK4A 4F92B 3QG1A 5KYKA 1MN6A 3OIVA 2W2LA 3MJCA 1OH6A 4TS4A 3S6JA 2AHOA 1C7JA 1Z3IX 4S2UA 2NYRA 3DTVA 3OCUA 3PFKA 5KIAA 4HGZA 3JAKA 4RYLA 1YDFA 3L7NA 1V7ZA 4EMTA 4CLRA 3NQ41 2X5XA 4D7AA 3VFDA 1G8MA 3MTBA 4O0MA 1E2QA 3B3FA 2H18A 4Y2QA 4UQLA 2QZJA 3ODGA 4B4VA 1NNEA 2X1MA 1DINA 1UUFA 2XYRA 4IS2A 3F5FA 4X93A 1E4OA 2FSGA 5DZSA 1OXTA 4GEKA 3WAGA 2HOQA 2J67A 4XIGS 3ETDA 4BS9A 1I1HA 5BQ3A 1M2KA 2JLUA 1SCJA 1DC4A 3LS2A 4HYQA 4OGFA 2VTBA 3KAKA 5DCYA 1F9EA 1GGJA 4BAGA 1L4UA 1RS0A 2WPDA 4QDOA 3ZCVA 4DREA 4AF6A 3DZGA 1A7JA 1E4YA 3ZDAA 2BJWA 5A5VA 2P4SA 5B7PA 3HSKA 1J9EA 1FXUA 5IZ4A 3Q98A 2GAJA 3N0WA 3OIDA 1EVIA 1I5OA 1RRVA 1V3TA 1Y9ZA 2O4UX 4IEIA 3C5CA 2IW3A 2OFOA 1RYHA 3INNA 5D3ZA 3WB1A 3F9RA 4NZOA 3FNHA 1D2NA 4GR5A 5A6VA 3PIIA 2J3EA 1SCUB 2XQVA 1XZHA 3JV7A 4C0AC 3ZVLA 4I8XA 3C3JA 3TZCA 3SBOA 4FNOA 5KC9A 4RHYA 4Y7CA 4CLOA 1QANA 2JFWA 3JWGA 5IT9A 5AM3A 1XTTA 1FSPA 2GN8A 3REQA 1RAGA 4J7AA 2FPGA 1G21E 4MGEA 4O5AA 3GLFE 1Y80A 1LLFA 1PCXA 1V95A 3MN1A 1P0IA 5GAJA 2P7HA 2G4VA 4ID9A 4PIMA 5EKDA 4XTCS 4B3FX 4U3JA 3IQIX 2O2YA 2AZTA 4J6FA 4KHZA 3TGLA 2I87A 3TDKA 4O8CA 3QU2A 4H7FA 3SXUA 3T0GA 1SWVA 1YS7A 1NQUA 3WZMA 3VYWA 3JVVA 1Z6AA 3KLMX 3KOOA 4W1RA 2PRJA 1GUYA 4FSDA 4EF4A 2GFIA 5B7QA 2IBTA 4J43A 5DWVA 1SKYB 3JQ7A 2LD4A 3EHEA 2AG6A 3PKZA 3O2JA 4KUGA 3NGLA 1CEXA 1NVDA 5C1IA 2PGXA 1L7RA 2Q6IA 3BZWA 3QQ5A 2IBMA 4JOSA 5L7TA 4KAAA 1U3DA 3BXOA 1PVOA 4GG1A 1VG9B 4NMWA 3RUDA 4NESA 1FJXA 2X0NA 4OFZA 3WMWA 1BDBA 5A4MS 1QGYA 3AERB 1OI2A 4FOTA 1ZESA 2A9OA 2XWBF 4G5XA 4B7AA 1PVVA 2DZDA 1Z0ZA 2QENA 1XZDA 4YIHA 4PHHA 2PSDA 1Z82A 2W48A 3B9QA 2YIVX 2B2XA 4KTTE 5JCJA 3W8FA 3IIMA 1KZGB 1ZVMA 2OR3A 3TTSA 3WXBA 5LP6B 1S1CA 2H2IA 4JQYA 4PLZA 4OREX 1ZIPA 4NFLA 5E9QA 3KSUA 3WLFA 4I19A 4YMLA 3CQ9A 3PFIA 4O5OA 2JFVA 4PQYA 3QPWA 2C29D 2G9ZA 2GAIA 2IXAA 3E9EA 3L1VA 1GUFA 3MQFA 3QWIA 2JGEA 1CC1S 1I2CA 4J49A 3L4JA 3R7WB 2QTTA 4FX5A 4RQBA 3G6WA 4KXVA 1KVTA 3HKDB 5D84A 3CRRA 3EVCA 3ISVA 3HADA 4HEHA 5GV7A 4LV6A 4JLOA 3HRIA 4FGLA 2WUEA 3TSZA 3ICVA 2ZREA 8ATCA 4MRPA 2XNSA 3ZE9A 1GEGA 2ZVDA 3ETJA 3L82B 2W2KB 4MROA 3ZE2B 6AT1A 2R8OA 5IM4A 1AH2A 2UYYA 2OYSA 2A92A 2AI3A 5JSZA 2P3QA 1EX6A 2RHOA 4XWWA 4G5YA 1XALA 2O5VA 3IVMA 5K03A 1U8TA 2VXBA 3H3JA 1MU0A 2R6HA 2G04A 3L8MA 2D7JA 3B1KA 1YNSA 4TVBA 2NU8A 3F78A 4KN5A 4Z49A 2X7HA 4Q19A 2ZTHA 3VR3A 1LPMA 1UDAA 2G5PA 4J0HA 1JAYA 1W52X 1WMFA 4G4IA 3SS9X 2NUBA 1GG8A 1EX9A 3KPWA 3OLWA 1E1CB 4H7JA 4AP5A 4B85A 4J0GA 1C8VB 1XT6A 1U65A 4IHAA 4LXGA 3THXA 3KTFA 2RAVA 2H4XA 1U2EA 1PNTA 1F7UA 4IHJA 1MPXA 2AI1A 2OHXA 3A8TA 3JQPA 5ILQA 5BN5B 1N33B 4V0NA 4ACBA 2Q0HA 1XTQA 4BZZA 1AQNA 2PT6A 2JFNA 3O2SB 1EFLA 2Y9MB 4FCCA 2CXUA 5IYZB 3K16A 5MN6A 4US0R 1UDRA 2QTAA 2ZZKA 2DHRA 4LVCA 1C1XB 4HDAA 1QZZA 5DASA 2QOEA 2REQA 5DIFA 3U4DA 4EW3A 1ELOA 1B14A 5CRIA 5AVWA 2VH2A 3TN7A 3ZLUA 1N7HA 1RQ7A 3KVYA 3ZHRA 2JZNA 3IP8A 2NZUG 3AUTA 3GNLA 3M6WA 5DX0A 4ZAGA 4EB8A 3OPNA 1HG1A 1S2LA 1DE0A 2VYNA 2XVXA 3T3GA 3LLCA 2FPKA 4AKSA 3UAXA 2C20A 2QVXX 1HFEL 1SHZA 3ZTTA 1NW8A 3B6EA 4F2DA 2R44A 5B36A 3BTVA 3MYYA 1ILWA 4LFBB 4WASA 3LRTA 4IVPA 4BX2A 8GPBA 1JEYA 4LE1A 2AL7A 1QHGA 2IWRA 3DHVA 2RK6A 1V71A 3LQRA 5BSFA 1ISGA 4E88A 2IS2A 2GJAA 1D4AA 4RPHA 2BFNA 3WHPA 4UEJA 1TJ3A 4C3UA 4EECA 3L5KA 3L92A 3NRBA 2AXNA 4EZBA 1S2OA 4OUDB 1KY2A 2GJ8A 3M5DA 4P3YA 1GWNA 2D5LA 4L78A 2CNKA 4CF4A 3R6TA 1V6AA 2JLXA 2R66A 1WUYA 1ISIA 1RLUA 1E99A 3DMYA 1L5RA 1MNAA 3AHDA 3WZ2A 3LVRE 5IKPA 2AOUB 2R7LA 2O1EA 1H2BA 3PT5A 3UATA 2B1QA 3VNVA 3LWNA 4IQ0A 4JJ8A 1O94D 3RC1A 4XYMA 1T1IA 1RXWA 2B3TA 4BWYA 3OT4A 1YS6A 4HEJA 4RH0A 1UBJS 5GGYA 1CJBA 1J8FA 1W87A 1N2ZA 3MQ4A 4EW1A 1TYZA 2DUUA 2YUIA 3C3MA 5L9AA 2P68A 1FNBA 1XA0A 1VPEA 2XW6A 4LOKA 4XWYA 4Y2GA 2PZEA 3DYIA 1ODTC 1U3GA 2QU8A 3FUVA 2YASA 4D9BA 1US8B 2D13A 1QHSA 3GLUA 4MQFA 4ALLA 4AY5A 3M3PA 3MWGA 4UU1A 1O89A 4V0ME 1V4BA 5E6SB 2H5IA 1YDWA 2O14A 3U7IA 2FN3A 2ZYAA 3KT8A 4NU0A 1FBNA 1PHPA 1U11A 4F84A 3E2IA 2Q3HA 4H2DA 3C7AA 4Z8YA 4Q1AA 3SMVA 3LJKA 1XRMA 4ERNA 3NVKI 2Q3EA 1CLUA 4OJYA 2WJZB 1KMHB 2HPHA 1DV2A 1MO4A 4B17A 3L7OA 4XD7A 3TO5A 3RC7A 1L5NA 4OQNA 4MXDA 4OHWA 1P4AA 1KOGA 1VRWA 3GGGA 4ZHQB 2Q5OA 1JG3A 2QN1A 3HJUA 5LSAA 3DCNA 4OJMX 4RVCA 5E9JA 4NYJQ 4X92A 5CT9A 1RI4A 4BO9A 4JSTA 3ZS8A 5B64A 2EL9A 1SXGA 1URPA 1UMCB 3IBSA 3HCBA 1K2WA 1KMIY 3JAWB 2QG6A 5BNWA 2ZIXB 3GYBA 3GUVA 1ZIOA 2H7VA 5LQCA 1OSNA 1KY5A 1N0UA 4MCAA 2OB2A 4AJ1A 1ZQ9A 4N18A 4QBIA 5IS2A 1OW3B 3DUFB 3IDFA 1A9XB 1PDVA 1BVRA 2ODEA 4FEGA 2ZBVA 4ABYA 4KR6A 3R5SA 2GYYA 2NACA 5IEBA 1OT3A 1QKKA 1T0PA 2IX9A 4NQRA 2LRHA 2ZSKA 1KJ8A