1TK2A

Crystal structure of the complex formed between alkaline proteinase savinase and gramicidin s at 1.5a resolution
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
269
structure length
269
Chain Sequence
b'AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN SAVINASE
molecule tags Hydrolase/antibiotic
publication title Crystal Structure of the Complex Formed between Alkaline Proteinase Savinase and Gramicidin S at 1.5A Resolution.
rcsb
total genus 99
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1tk2A00
1LW6E 5JXJA 4AKTA 4DZTA 1SBHA 2ID4A 1YJCA 1GNSA 1GA4A 3VSBA 1DUIA 4H6VA 1GCIA 1IC6A 2WWTA 3AFGA 1OYOA 3EE6A 2HD4A 1SH7A 5JXHA 1KDVA 3H42B 1TM1E 4CFZA 3CNQS 2TECE 3EIFA 4OV6B 3TECE 1SIOA 1Y33E 3PRKE 1JEAA 1P7WA 1SBIA 4DWWA 5ARCA 3LXUX 1GT91 2W2NA 4FONA 1SN7A 2QTWB 1SPBS 2X8JB 1ST3A 3LPAA 3DE7X 1PEKE 3WHIA 4AKSA 1Y34E 3VV2A 1WMEA 1V5IA 3I34X 4CFYA 1IAVA 2Z2YA 5AQEA 3A3OA 1Q5PA 5JMOA 3QFHA 1KE2A 1SCAA 1TO1E 1SELA 2PRKA 2PYZA 1P7VA 1SCNE 1YU6A 2ZWOA 3DE5X 4ZARA 1MPTA 1GA1A 3D9QX 3GT4A 1BFKA 2P4EA 3I2YX 4JP8A 3TI9A 1EGQA 1BH6A 1SUCA 1T1IA 3DE6X 3P5BA 4WOCA 1VSBA 4Z2AA 4H6WA 3DYBA 1R0RE 1Y3BE 4OMDA 2IXTA 2DQKA 1WVMA 1SBCA 3DVSX 3T41A 3F49S 2B6NA 3VHQA 1SBTA 2W2MA 3UNXA 3CO0S 3VTAA 2Z2ZA 1THMA 2Z56A 1SUEA 1SIUA 4NE7A 1AV7A 1YJBA 5AVJA 1AH2A 2XRMA 2V8BA 1GTG1 4K8RB 1ZVKA 2Z30A 3F7OA 4BWGA 1Y1KE 2Z57A 2ZRQA 4KG7A 1KE1A 1OYVA 2Z58A 1NDQA 3DDZX 1GTL1 3DW3X 3Q5GA 2SNIE 2SICE 4J94A 4NE9A 1TO2E 1TM4E 3TI7A 1R64A 5AVKA 1SCJA 3DVQX 4KB5A 1WMFA 5B1DA 1GTJ1 4B5LA 3GT3A 1PFGA 2IY9A 4GI3A 5JXGA 2WUVA 1SUAA 1Y3FE 1YJAA 3WIVA 2ST1A 3ZXYA 4HX2A 2Z2XA 1PTKA 1SCBA 1XF1A 2DP4E 2PWBA 3A3NA 3DVRX 3EDYA 3Q40A 3LPDA 3QTLA 5FBZA 4H6XA 3SQOA 2X8JA 3WIUA 2XTJA 5AMXA 3DW1X 1ZVJA 5ARDA 1AF4A 1TECE 1UBNA 1SVNA 1AU9A 2E1PA 2W2PA 1C9JA 1C3LA 3A3PA 3QMPA 5SICE 4HVLA 1SCDA 1WSDA 4DJ5X 2DUJA 5JXIA 1HT3A 3D43A 1AK9A 1CSEE 3F7MA 1KDZA 3LPCA 5I9SA 5FFNA 2PKCA 4M1ZA 2ZWPA 1TMGE 3GCXA 2W2OA 4KPGA 1BFUA 2W2QA 1R6VA 2PMWB 1Y4AE 3AJ8A 1DBIA 1GA6A 3BX1A 1C9NA 1C9MA 4I0WB 1AQNA 1EA7A 1SUDA 4MZDA 1TM7E 3VV3A 1BJRE 3DE0X 3DE3X 4ZOQI 1NLUA 3GCWA 1AVTA 1Y9ZA 2WV7A 4LVOA 3VYVA 1SBNE 1TM5E 1S2NA 1Y4DE 1BE8A 2PQ2A 2WUWE 3DWEX 4NMXB 3I37X 3L1KA 1WMDA 4RYDA 1T1GA 2G4VA 1S02A 3BPSA 1PJ8A 3PTLA 1P8JA 4WOBA 1OT5A 1MEEA 4LVNA 2PWAA 1SIBE 1SUBA 1T1EA 1KDYA 5B1EA 4YN3A 3OSZA 3SICE 4C3UA 1GNVA 1ST2A 1BE6A 3HJRA 2SECE 1SUPA 3WQBA 1A2QA 1Y3DE 2SBTA 2HPZA 3BGOS 3DE4X 4C3VA 2ID8A 4OMCA 3AJ9A 3DE1X 1NDUA 1TK2A 2GKOA 5K7SA 1CNMA 5FAXA 3ZXXA 5ARBA 1S01A 3DE2X 5CW1A 1Y48E 1V6CA 4CG0A 3I30X 1TM3E 1Y3CE
chains in the Genus database with same CATH superfamily
1GIAA 4QYIA 2SKCA 2QVZX 1GRNA 2P4HX 3OKFA 3WFIA 5DTIA 4G36A 2Z08A 1F7VA 4HGNA 2ZZKA 3M2TA 1S1CA 3LCCA 4LDZA 4PX5A 4HUTA 1YASA 2XT9A 3AV0B 4XE5A 3CX3A 2Q6TA 1C7JA 3ASZA 4N0MA 1WDWB 3ZDZB 1GNPA 1GT91 2BEWB 5EKXA 3LUGA 3DHEA 1DU4A 1KSJA 1NKTA 3UUGA 1HLFA 4P98A 3T1QA 4BNWA 3PXEA 3NJRA 1ZSVA 4BUJA 3K1TA 1UAGA 2NU7A 4YXFA 3RAFC 1CY7A 4LWZA 2X9GA 4HX5A 1W0KA 2DQ4A 1IWPB 2H63A 2CCKA 2O7QA 4UD2A 5IW8A 5J2UB 4UQLA 1JJ7A 4XYGA 4UHJA 1FU7A 3RVRA 1YBMA 2JANA 1U02A 2CVFA 1VJ0A 1CUWA 2GJAA 1JR3D 2H2DA 1ML4A 2VBGA 4QRDA 4TYMA 4Y2HA 3QKSA 1SBCA 1VG8A 1CQPA 4FZJA 4ILKA 1LJLA 4CKBA 1MXHA 4L5CA 1EPUA 2JI4A 2ZJ8A 4HWPA 3S8MA 4JSRA 1RWMA 4N5IX 4C2UA 1CDDA 1PSDA 1ZNQO 4O4JB 5FUWA 5EMLA 2CKMA 1YQXA 2FSFA 3OM1A 4Y6PA 3U4HA 4YMHA 5FI5A 2VHTA 3SHOA 3IOEA 5LNK1 1VIVA 2ZIXA 1EZZA 4DARA 1PFWA 4J94A 5EIOA 3MGKA 1BXGA 3S2SA 4X20A 5F9FA 4IRMA 1D2NA 4DY4A 5K0NA 4IQ0A 3I6QA 3PJGA 4MITA 4EHKA 2WWHA 1BDHA 5AW4A 1SHTX 4BE4A 1ZA2A 5HDQA 2FU5C 4Q05A 1HQCA 1LCIA 1B41A 1KIFA 4GYKA 3NHJA 1OUMA 2DERA 3ZE8A 2VDMB 2QU7A 1Z4NA 1GZ3A 5CXSA 2OYCA 3PUVA 2PLNA 5FOQA 1YR9A 2PCJA 4PCAA 1A7JA 2CHEA 3GW8A 3HKDB 3HWRA 4UHBA 1WQ3A 2AFRA 2QYOA 3CZAA 3OMXA 3WO0A 2YXNA 4OXQA 2VPPA 4FZRA 2VQSA 4LTMA 4G3XA 4XOUA 4EP1A 1XTIA 1Z88A 2AXEA 4FT2A 2FP3A 5DF1A 5FLKA 3I45A 5JI3E 3FPCA 1ZCFA 7ABPA 1YACA 3L7IA 5AHKA 4TTPA 1PWHA 4AX4A 4UTRA 2JLUA 1G0OA 3LBYA 4IZHA 4MR8B 1Q7GA 1XN1A 1FTSA 1XYYA 3FGZA 4I0WB 1XJ5A 1KC1A 2FG7C 1RQXA 1TTPB 4QQKA 4ZQFA 1JRLA 2OV2A 3BMOA 5JATA 4GPIB 2IUEA 1E6EA 4RJLA 1P18A 5EEHA 3THSA 5FX2A 3RH0A 1TM5E 2WUWE 3DLAA 3L6OO 4CCYB 1TT5B 4WN9B 4ZT2A 3D7KA 4JVMA 5D01A 1ZN7A 2IWRA 1PV1A 4WKCA 1SVLA 1VIDA 1DZIA 3BAFA 4YP5A 4HNUA 1U8AA 5DASA 4YR9A 1JFLA 3WQQA 3G8AA 3P9KA 3WLFA 1CR2A 3DMTC 1T8SA 3GRRA 4M8SA 5EGNA 1N4DA 4HVTA 2Z5FA 4K0RA 4CM8B 2XVMA 5BNIA 5HTOA 2ZAOA 4MPDA 1PE0A 4NYMQ 3QP9A 1MR3F 3ACCA 2KS6A 1CQWA 3LCMA 1J00A 4UBLA 3R7SA 2Z5LA 3DHNA 3JATB 3RS9A 3VKUA 1XXHA 4TWJA 3D7NA 2J9FA 1M54A 2IK8A 2CB9A 2G9QA 4JJ7A 5AM0A 5IM4F 3WMXA 4JXJA 4UNSA 2HCBA 3CKMA 3GRUA 5EQJB 4NK4A 1YRHA 2WNSA 1PFVA 3WOHA 3ZEAA 1F3LA 2EYQA 5TGZA 1N8TA 1YF3A 4LYYA 5I7FA 4HNAA 2D1TA 3GRFA 4M99A 4R8KA 3DKPA 2FA9A 5D85A 3FBGA 4CLHA 2GK3A 3WLAA 3RASA 4B6JA 4L50A 1PQWA 1Q3HA 1JHUA 1NV9A 1O6BA 1X80B 3A4IA 3KRTA 4L74A 1AS0A 1GKUB 3TLKA 2VDQB 3PNSA 4JLOA 5BORA 4JLAA 5HP4A 1SKMA 1KO7A 1SCQA 1E69A 1XMPA 1RKVA 2FF7A 3KHTA 2XMGA 3NDIA 5LSAA 2EBFX 3ND6A 3L1IA 1XQ9A 4M37A 4OFXA 5LQDA 3GT4A 2DHDA 4Q00A 5HWSA 1ECBA 1AC5A 3KZNA 4OQQA 2P5SA 1AZTA 1F48A 5HUHA 1E1MA 4QXAA 3HRKA 3EVGA 3MM4A 1RP1A 1Y80A 3FTPA 3HKBB 4XOIA 1RHJA 5ES3A 3WLHA 5AKKA 4G0VA 5DBOA 2P2LA 2UVDA 4YGXB 2XZTA 3PL1A 4R3UC 4YONB 3STTA 1O2DA 4JBXA 3MWDB 4FS3A 3ZHQA 4IVQA 3INYA 3U7JA 3T3DA 4FNOA 4PZCA 4O4LA 4L0MA 1T15A 4B6RA 3E0XA 2D0OB 5MFPA 2AFIE 5LOVA 4O2AF 4AKHA 1AM4D 4JYMA 4QBTA 2WMNB 4DCSA 5BW5A 2J3IA 1PGJA 3KKPA 1G6Q1 3A28A 1HY3A 3SQMA 1OI7A 4OGKA 4YT5A 5A02A 4ND7A 1QIHA 3R1IA 3QVKA 5KX5F 5TSDA 3H1TA 3PDUA 1RZUA 1Y42X 1SCBA 1XF1A 2OM6A 5IWCA 4YAUA 3OIVA 4JLUA 3FKJA 4E09A 5AMXA 2Z1MA 3AFOA 1FW8A 2HY7A 2IL1A 5BMVB 2DETA 1Z4JA 2EFHB 1J2UA 4I1IA 5NULA 3RF6A 2IITA 4WZAA 1GEGA 3QJ5A 4LJ4A 1T5LA 5EZYA 3E15A 3TOCA 4F4HA 2XMZA 4YY3B 2QAGA 1YFKA 2BFCB 2PMDA 2Y1DA 3LPMA 1HC7A 4RSMA 3E3NA 5G1NA 1J1IA 4ZEMA 2D3WA 5TXGA 3C7DB 1A5SB 1FIUA 1W75A 1KHTA 4LXQA 4QX6A 5CVJA 3VKWA 4LZPA 4GZLA 5LZ4A 1X39A 3UJDA 1ID1A 3IR7A 2H31A 3GEGA 1SUDA 3F1KA 1T5OA 4ECAA 5BMVA 3MB5A 4C4PA 4QGGA 1XCPA 1M2WA 2C77A 2CLEB 3ZJTA 3S1AB 1K8YB 1O95C 1QZTA 3K4PA 2PCLA 2LTAA 3DTNA 4KKVA 4QO7A 2PUAA 4G9EA 2DBYA 1NU6A 1BS9A 3ILXA 3QEJA 5FTJA 1C0KA 1CJVC 1E7WA 2VEDA 1MU0A 2BEKA 1PF7E 2WMOB 3VZSA 5AICA 3PDWA 1F1BA 3E5NA 3G0BA 3ZZ0A 4NZNA 5FO0A 1GCOA 3RTGA 3PQDA 4ZPJA 1LX7A 3ZDFA 2WY2D 5IS2A 1E9VA 3C97A 3L6CA 4OHUA 5A6SB 1H3FA 5TE9A 3ISVA 4H27A 3U2QA 1M6VA 2B92A 2DPMA 2OB1A 2V97A 2W5UA 1Z35A 2C5BA 3JYPA 3K70B 1HDOA 1WE2A 2B8JA 2YJTD 2H9AA 3G2IA 4MYDA 4EGFA 1IN7A 1X7ZA 1O5TA 2EKBA 3QFFA 4JYCA 4MP6A 3MS4A 1DKLA 1LBSA 2A1IA 1A5ZA 4M0FA 5DTRA 2GCEA 2GRAA 4ZVOA 3Q2KA 4RJIA 3A6HA 1PJLA 3OI7A 2UVPA 4UFOA 4UM9D 4YT2A 1JIUA 4J0IA 4NDZA 2PUDA 1RACA 3UAGA 1XN4A 4LS3A 1SIOA 3EGVA 3I2IA 3H4TA 3IERA 3K9GA 3LSYA 4EATA 3FPFA 3FUXA 5CNIA 2D6FA 1B74A 2C78A 3R7WA 4HV4A 3QOYA 1HTTA 4G5GA 4JI4B 5GGXA 4IIDA 1KTIA 1K9VF 2WZBA 3BK2A 2IYVA 3KDAA 1U4SA 3K09A 3VR6A 4B48A 4W9RA 1HE5A 5BVHB 2P78A 1GL9B 4WD3A 1YIDA 2ZW9A 4JKYA 2AX3A 3HA2A 4IILA 3REQB 2OXFA 1LI4A 3FOEC 3I5XA 1GAQA 3T3HA 1Z6TA 4Y2UA 4EO4A 2FFJA 2ODTX 1JWAB 2WPDD 1KAEA 2AEFA 2WJJA 5AM5A 4QT0A 1L6RA 1LVGA 3DEJA 2OHHA 1X7WB 3KQVA 4G1VA 4YCAA 3KETA 3FNGA 3JQ8A 4QECA 4ZU1X 5FAKA 3UWKA 2AXPA 1FS4A 3IESA 4JBIA 4F4IA 4E5SA 5JY6A 2GAAA 3D3WA 3OHMA 5CMLA 2B35A 3QPVA 3CT4A 3LPLA 1NX9A 3RVQA 3OX3A 2I29A 4NOMA 4RY9A 521PA 4UBMA 4RYLA 3SZGA 1RSZA 5JHGB 3M89A 3SNKA 3HN7A 1PZGA 3BTVA 5B1DA 2JD0A 1ECPA 2EWVA 1WOMA 4TMZA 1GDHA 3C24A 3SFVA 1W36D 3NFRA 4RPLA 3CLUD 3TSZA 2X9NA 1FFXB 2BELA 1CQIB 1I4TD 1QWOA 2AG5A 2F90A 3G0DA 2MYTA 3KOZA 4PYMA 4TSRA 4DSNA 2X8JA 2GARA 5JPCA 5KX5A 2Q3DA 2AQ8A 4YB8A 3RS3A 4E31A 5KQPA 2VZ9A 4K1LA 2IS4A 4YAKA 5CPFA 1TVKB 4Q3OA 2M1ZA 3NASA 1GFZA 1YIAA 3KEFA 4FGZA 1C30B 3U6KA 2WABA 4CMBA 3HKBA 5GIOE 4G67A 3KJGA 3VOTA 4P4TA 3WLNA 4PR0A 4NZZA 4FGWA 5AOCA 4ZI2A 1R6VA 4HGQA 4HQOA 3MCWA 4UHFA 3TRDA 1AMNA 2GJ4A 2BEJA 2EFYA 1C9MA 1CUZA 4US1R 4YCBA 5AM2A 1L5OA 5FL7A 4DCOA 1KOFA 3WISA 2ECKA 2PSFA 2PL9A 4YXWA 1UMKA 2PQ0A 4EW3A 3GL9A 4HDOB 1Z25A 4KDCA 2BZ0A 3V4PB 2J0SA 3FAKA 3R3JA 1L3CA 2ZDQA 3CLTC 3PDCA 4LDPA 4PLGA 5TQ0A 3VZPA 3HJGA 3LRXA 4OB7A 2EIHA 5KIAA 1THGA 2QTAA 3UWSA 2FWPA 2OFXA 4RADA 1RAIA 1RJEA 3LZ6A 4TV9A 5ICSA 3KD3A 2P1ZA 3SC6A 3VX4A 4ESEA 4LYAA 2WFLB 1VE5A 1LB1B 1S89A 1VL5A 2G3YA 3PC8A 3QKTA 4C76A 4ZVTA 4UTOA 2BMJA 1XZIA 1LC3A 3C4VA 4ZRDA 1NYQA 1SIWA 2LIPA 2PAFA 2DECA 4I4TA 4UNIA 4FNGA 2C99A 1QFJA 1VPTA 3FDZB 4HLNA 2CF5A 4MTCA 4U6NA 4B9EA 3O0TA 3SSAA 5CR9A 4LJKA 3ZV5A 5LQCA 1V5EA 1E2KA 4CLRA 3D3NA 1W85B 1TPZA 1KOLA 4ARAA 1O8CA 2XUOA 2I9KA 2HSGA 2FW8A 2H7YA 2VQFB 3AUXA 2QX6A 3OJ0A 4US0R 2A7XA 1NKSA 1KK2A 1Y33E 3DB1A 3DT6A 4TSKA 5CM8B 3IQZA 3GUZA 3TL6A 1KMMA 3JXEA 2DWCA 5T4BA 5K6AC 4HVCA 4BPRA 3TW8B 1NBAA 2D4HA 2WYVA 3A9WA 4KVAA 4ZYTA 4P35A 4ENRA 4GNRA 3A11A 4EK9A 3VKHA 1KXZA 4CFYA 3SMQA 5I9TA 2H5LA 4ENUA 5B3LA 3N5CA 2ZBUA 3IIKA 3RC2A 2X0JA 4HEA1 4CMIA 4RS4A 4BQQA 4QXOA 4CF6A 4GXRA 3BZBA 3ESRA 5AKGA 1H42A 3SZUA 2CCGA 5KVSA 4UM5A 1DMSA 1KI6B 1LFDB 2PJUA 1OI3A 1KQ3A 3PIIA 3RHZA 4IXMA 2QRHA 5ENZA 2H29A 1NAIA 4DNPA 2BSQA 3O8QB 4GLLA 1LBIA 3JW8A 4TWBA 1QCDA 3B1WA 3R0QA 3T7KA 3WL8A 1V1RB 2D0IA 4HG2A 3ZDDA 5BNTA 1AF7A 4MVJM 4FWIB 4OL0A 4RVCA 4FIDA 2GN6A 1E4VA 2X8BA 2A7QA 2X5JO 4W7HA 3BUSA 3UIEA 3L8DA 1ZU4A 3I9V6 4P92A 4TSFD 1WB4A 4WDRA 1V45E 3WGUA 1L1RA 2XDQA 3JQ9C 4HKTA 3RSOA 3GJQA 3P2KA 4P54A 3U3ZA 1VOTA 2HJSA 3AHFA 1CS0B 3RTAA 2E18A 2ZSKA 4NQZA 4PSUA 4GDMA 2EG5A 2BFFA 2JIDA 3GH3A 3ML1A 1RMQA 2YVAA 1VRCA 1MABA 4D80A 2NTYC 2FWJA 2I71A 1RR6A 3SFTA 4BO2A 5J5CA 1H1DA 3ETJA 3TE7A 5G53C 3NIBA 3GN1A 3ZCTA 1TRHA 1SKBA 2FCAA 3SK0A 5LYJA 4YUAA 1Q74A 2DR2A 4OM7A 1OXUA 4PYRA 4A3SA 2XMRA 4FW8A 4C7VA 3DZDA 3WDLA 3EDOA 1I7SB 2WWGA 2AW3A 3MW8A 1CX9B 3CH5A 2AZMA 5I7SA 2HTEA 2NXJA 3M9LA 4QXMA 3IMEA 2PUHA 4ITUA 3D8RA 5JZVA 3GR6A 4DMUB 1EFDN 1V26A 3QYPA 4BMOB 5JR3A 2C5LA 2IT1A 4MZDA 1P60A 3B53X 2FF5A 1BJRE 4OLJA 3V4VB 3E2MA 4HWTA 4AO6A 1T36A 1YK0A 2J67A 3ONWA 4LVOA 4Y6OA 5DYGA 2DLNA 2FFBA 3G0GA 4PAQA 2ZRJA 1U7UA 4KOAA 2OBYA 1FMJA 3LVBA 1BWPA 5G3ZA 2V3WA 5DW3A 1R3DA 3H4VA 3PCRB 1Z07A 4AP9A 3D6MA 3AH8A 1CQIA 2O0KA 3WS7A 3BHNA 1FSPA 5IYZF 1Y9JA 2SECE 1ZBDA 3B9RA 2QMHA 3FVWA 3GD7A 5EUMA 4I3GA 5HOQA 1Z5PA 5CRIA 4AZ0A 4MKIA 4Q39A 4TVSA 3AINA 4GXNA 2PBLA 1LS1A 3DZKA 3PWSA 2NQTA 3C3XA 3F4BA 5J2TF 3CQ9A 3HZHA 1RJGA 5CA1A 3KB2A 1E9CA 4MUGA 5IK2A 3TG8A 3PXAA 5IK2D 2EBUA 3S2GA 2W6OA 3EUFA 1BHSA 3CLUC 2FZ5A 4A6EA 1C3EA 4Q48A 2C54A 1GZ7A 3B6JA 2D5AA 2YCLA 4ZXPA 1D5WA 4BNYA 3V1UA 2XCSB 2GD6A 3OLYA 4WKOA 2DOKA 1Y63A 2ZI4A 3JPYA 5B7PA 4WLEA 4GEGA 3ZYCA 2KI5A 2KW5A 2YN4A 3IOCA 3KJXA 2ORED 1C80A 1EFAA 4FSHA 2ZTLA 3PHHA 4M1KA 3LXUX 1MHTA 4MB2A 1KAOA 1Y34E 4JEMA 4PYLA 3TQSA 5I6DA 4B3RB 4KR7A 3OM0A 2I1QA 2TYSB 1Z83A 2HHAA 4L76A 2OBXA 4EI2A 1D2RA 1VJGA 3GQVA 4NK5A 4FLMA 4HGOA 2GERA 2CBXA 1U0JA 4RM2A 3BFVA 4QIHA 3U19A 1HGXA 4HY3A 2IIVA 3WK7A 4ZV4A 3A6LA 1G5HA 3C3PA 4DA0A 3NFYA 1GUYA 4CPDA 1UT6A 1F9AA 2GSWA 4AXXA 3TQFA 3C6BA 5IAEA 3BWYA 5BQXA 1ITZA 3B13B 2YJ4A 1R5OA 3ER6A 1XU9A 2MSWA 3UICA 4L4UA 4FJ2A 3ZJYA 4GICA 5ALUA 1DP4A 4INJA 3E9ZA 3UTCA 3UY4A 3W2FA 3WIDA 3O47A 3M49A 1WHSB 1E18A 2X2PA 1INLA 4P83A 3ZD6A 2BW0A 2W83A 4II3A 3L4BA 4IWXA 1EE9A 4Q3AA 3LUCA 5K01A 3DAGA 1N3LA 4GSYA 1NXVA 1V9CA 1E7MA 4KZKA 4NULA 3LPDA 2WHPA 2W93A 1KI7A 2QL9A 3FHLA 4RK0A 4X44A 2Q0QA 3NTLA 1Z2CA 3HDTA 2Z83A 3VPBA 1SVNA 2NADA 1H22A 3L7OA 3RM3A 5JD5A 1GPNA 3ZWYA 3DDNA 4DDUA 2QW1A 2IYNA 3K2BA 3LBFA 1SC6A 4O59O 4P5EA 1A96A 4KR9A 3RKSA 5GIPE 4DR5B 4J3FA 2ZYDA 1C1XA 2INGX 4HEA6 4O4HB 5G4LA 3TZ6A 3ZBPA 4ZZIA 5K4GA 1BE1A 3JVUA 4YFVA 2VUUA 3MLBA 4DSAA 1P9NA 5LQSA 3LQQA 1E99A 5AHXA 4ZAXA 1C9NA 5ECWA 1DIAA 1W29A 1GPMA 4UEWA 1JDPA 3GCWA 3VYSB 5FWXA 2VTBB 1I4OA 1DFIA 4D79A 4CHTA 4N54A 3OE7A 4KVFA 2YICA 3HDGA 4I4IA 5HZKA 1H8ED 1XR3A 2JKZA 5I45A 4JFRA 3IVRA 4R9RA 4D57A 3RIGA 1N8SA 1XK6A 2OBFA 2JIRA 2V6JA 3EGEA 3L0DA 4XEUA 4S0ZA 1W2GA 4Y2VA 4YAGA 2YIVX 1H94A 3MUFA 1SUPA 2GK7A 3OPYI 3QU4A 3KE8A 3KXLA 2CNNA 1I13A 1H93A 1CETA 3K9CA 1GUAA 3N53A 2MTBA 1WZIA 5ULLA 1JA9A 3ZI7A 2QVBA 4KPYA 1D2EA 1QGUB 3I04A 4R1SA 4XGQA 1F8YA 3W05A 1D2GA 5CJJA 3MOGA 1V47A 4G1FA 3W1EA 4DR2B 3A6JA 3ZU5A 3SX4A 2XCIA 4QDKA 3OWHA 3FN4A 3DXZA 1PKXA 1U2PA 5J9FA 5LR6A 5DXAA 4J0GA 1NQXA 1FP1D 1EJ2A 4UEKA 3GZNB 4IO1A 1NBWB 2IHJA 1E2UA 1EVJA 2GTPA 2QVLA 4F6RB 5K0JA 3G3EA 2BP7B 1JU9A 2JZCA 4H1TA 3OOHA 4KXQA 1HE3A 4QFCA 4R16A 1AKEA 4XFKA 3KKNA 5E6RB 4ACBA 2MCFA 3C98A 1FOEB 1T6NA 2ONJA 3UGTA 4YUVA 1ZU5A 4OBXA 4G84A 2JK1A 2HA6A 5C1IA 1GGJA 3TN7A 3F4LA 2EKDA 5JCJD 4MIOA 3U9SA 1YVUA 5B1SA 3MPOA 4ZJYA 2DQSA 3LT4A 4EVSA 4BKOA 4IIGA 4DY6A 5IDWA 2H1OA 3RRZA 1SPXA 2R8ZA 1UFKA 3K9HA 1IMJA 2GNOA 4U0JA 2Q62A 4AZ0B 2HWKA 1BKYA 4B33A 1XCBA 2G04A 3V1TC 4WDQA 3Q88A 4X8OA 1U2QA 4DM3A 4UPEA 3ZXUB 2IYRA 3B8EA 3BF7A 3F49S 1QO9A 3O90A 4DBZA 4G4GA 2PUEA 3THXA 1S3FA 4PTZA 4OHCA 4FB5A 2QUAA 4V38A 3W3AD 2PX5A 5IN5A 3W3AA 1L8QA 3OVMA 5GJBA 5KYUB 3LP5A 3NB0A 1L4MA 2IPOA 5CXXA 3DYIA 4JL5A 5EE5B 3LVQE 4TN5A 5DM70 2V3VA 1KTVA 2ENWA 3DJYA 4O2BF 3GLIB 1U3UA 3EVBA 1FYWA 2QRUA 5HBGA 3JQAA 1AHIA 2COKA 4GP9A 3RRMA 5M34A 4YMSA 2W0MA 5K8VA 2H2AA 3HYLA 5CB4A 4D9MA 1YS1X 1YJ8A 5FBZA 4ZI7A 3E9YA 2JEOA 3DEHA 3GFOA 3IELA 2C84A 4J7XA 4KQ9A 2PMEA 3ONDA 1ZH8A 1G59A 1XVVA 721PA 1AE1A 1J8MF 1XU7A 4ABYA 4DLRA 4EUNA 5KTYA 4OXRA 3Q8KA 2WZQA 3JYLA 2PS3A 3P0FA 4BB5A 1EFKA 4R05A 4YPOA 2ETVA 3H8SA 1K98A 4FBMA 3PDIA 3OZIA 3HVRA 2E4VA 4UATA 4YAJA 1BD4A 5IBRA 4E1AA 2C7OA 3WLMA 1XDGA 2AW5A 1OVGA 1IQ0A 4I1VA 1T9GS 2ZRKA 4KQIA 2IYZA 3FE2A 1M2KA 1MRNA 1R0ZA 2HXGA 4O0MA 3JWIA 3P0EA 3TBHA 1P0IA 4QTYA 5FR2A 1OROA 2YW2A 3OZRA 2DTXA 2C2YA 1NLMA 1KYIA 1GZ5A 3F9CA 3K0EA 3U39A 1XLVA 3WQHA 3UCXA 2RAPA 3P9CA 2JHAA 4K9OA 4WWHA 3DHYA 2G9VA 3AFNA 3G2OA 4HAWA 3TWOA 1JPVA 3JS5A 4QPJC 3ZLVA 4IPTA 1BVUA 1EK2A 2Q3FA 4Z4HA 4MI6A 3E9EA 3O0DA 3AM3A 3SE0A 1BXRB 1ST2A 3TR0A 1EWQA 4K05A 4QEKA 5FUMA 5I7EA 5IJ9B 1E2HA 1C41A 2F8LA 2JCGA 3NUQA 1NR5A 4LXGA 4OLHA 3RREA 2AB0A 3OTQA 2W6JA 1SQ0A 2VYCA 4DPMA 1W2WB 2HPHA 1JLMA 4QSMA 4A8JC 1HXHA 3ZLTA 4IYJA 3RJTA 1G19A 4PSAA 3RNLA 1N2HA 1PEAA 4UZFA 3AEKB 5ITVA 3OQHA 3L7YA 2QRMA 2ZYHA 1AZLA 2HJHA 3B85A 1O95D 1O6CA 1CR4A 2AG1A 3NHUA 1KIMA 1OU0A 1S5PA 1BWRA 3BRSA 3AR8A 3KNZA 4LZZA 1DEHA 1EFPA 1KJNA 1R6AA 2QMEA 2YY5A 1MN6A 3IJRA 4G23A 4L15A 4V0SA 5F7JA 4QASA 2PEYA 5FUVA 4XSHA 5IAAA 4EGQA 3E22A 1F2DA 2VHYA 1N3IA 3FVTA 4CIDA 5CNMA 4YRTA 5I47A 1JR6A 2O7VA 1G8HA 1I2ZA 4XWOA 1ENZA 3DTTA 3MLAA 4P4UA 4YGYA 3RT7A 1CE8B 5FA5A 3KZVA 1CIVA 2O6LA 2C5GA 2E4AA 2W37A 3RC3A 4A73A 3R5FA 1ZOLA 2P1DA 3D0KA 1MC4A 5KOIA 1F8GA 1Z62A 4BO5A 4KIUA 1P5FA 1PZHA 4X7MA 1JAHA 4BU1A 4MULA 2V54A 1WNTA 4OHRA 5J4LA 3KOMA 4KBFA 3IVGA 1V95A 1K68A 2VTDA 3PFKA 4Y6RA 1WPRA 5K2OA 4QRHA 2JAWA 2VJAA 1O54A 2AFHA 2I5PO 3UMMA 1ELOA 3NAZA 1AV7A 3N6XA 1QAMA 3KSRA 2JFNA 3RYIA 1W6UA 2QM0A 5LB4A 2O8FA 2VUSA 1FNBA 1Z0JA 4JBNA 4YJKA 3SS8A 1T1SA 1PGPA 4Q9NA 4ZZ1A 2YV4A 3GFPA 1IY9A 1EINA 1ZIYA 2X5NA 1N7IA 1OIXA 2VTKA 1M74A 3HDYA 3Q5GA 4MVJP 1TO2E 3LECA 5HQJA 1QF6A 5E4FA 8ADHA 1EX9A 1LZLA 3DR5A 4KVZA 4ROSA 5L4SA 4JI0B 2JNWA 2N46A 4LJYA 5CEEA 1KMNA 1D9ZA 4UAJA 3RS5A 3S55A 3EQ6A 1GVNB 2W8BB 3ZXYA 2WIFA 1PX2A 4YAOA 1TU4A 3L46A 2O8CB 3R77A 4NPHA 3GLHB 3GGSA 5C46F 1JDTA 3IEPA 5JH7B 2X7HA 3NHWA 1P0CA 3L0IB 1C3LA 3PR1A 4C3ZA 3U7FB 3M6AA 1Q7BA 5SZHB 4D9KA 4F21A 1KYTA 1WPGA 2AJLI 2XR1A 1U2GA 4REOA 1Z5OA 3SBOA 1U5BB 4CV3A 4HZGA 1IQPA 4AKIA 4INZA 4C4XA 3HXMA 2JD1A 4EFNA 1Z2PX 2YY6A 3HV0A 2YWXA 4O1HA 5IT5A 3IBSA 3T3NA 2PKEA 5IVIA 1U65A 3MQFA 4LXTA 5EIBC 3W5IA 4D8XA 1YGPA 2MSCB 2VDRB 1F14A 2YYZA 1UR5A 3EULA 1H5UA 2QTTA 5ECGC 4EJMA 4Z7OB 6REQA 3H2SA 5KYYB 4COOA 3SU8A 1U4OA 2M9MA 3MS7A 4BX2A 3GUUA 4JB0A 4F2PA 3O6VA 5B2EA 2OCBA 1Z0UA 1E1LA 2ACKA 4FFPA 2Z8YA 5AVZA 5JYEA 1J99A 5DFAA 2IEDA 3ZVRA 1U5AA 2XT6A 1O5IA 2Q21A 4R31A 3SYNA 2WNIA 3DZJA 2J5RA 4D9GA 4CQLB 5AW3A 1E2NA 2VJBA 2WYWA 4IL5A 2AI3A 1IZ9A 5CVTA 1QYDA 4F46A 3KBOA 2AHOA 4KEAA 2XMBA 5IYZB 1RLIA 4S24A 3D4IA 3JQEA 3JD3A 4OHYA 2ZAMA 4V0LA 4C0QC 1FLVA 4YRMA 5F7XA 3QSGA 1GL6A 3CE6A 4O08A 5ABPA 1XD2A 1K5GA 3P5SA 2QRVB 5I4BA 1YVPA 1UMBA 4H6VA 1NNSA 1VKNA 4AICA 5PGMA 4X5OA 1MX5A 3L06A 4HAZA 4XD7A 3FOAA 3UKDA 1U1IA 2FW7A 1C14A 1KQOA 3NEYA 3W04A 2N0SA 3ORSA 4MIKA 5JCOA 3JD1A 5EUQB 2IEYA 2PIDA 2QN1A 5IHXA 3GCDA 2I2XB 3S2ZA 4DIBA 2NT4A 5BVGA 1QIMA 2J9YB 3HYNA 4P33A 4PR3A 1OX5A 1GPAA 2CFIA 3TB6A 2QDXA 5THXA 3O91A 5LMNB 2OFFA 4I36A 3T9DA 1SB9A 3KUXA 3EQ7A 5BYAA 4KTTE 4MA4A 5SZIA 4B7XA 2C07A 4OHOA 5FI0B 1SM4A 3SZLA 4UPVA 4JLWA 2Z6AA 1TO1E 3H9GA 4B74A 1DBRA 4NCBA 1R37A 1O96A 1EK5A 1E2PA 2O3UA 1BXZA 3MRXA 3PFFA 4KE6A 1BU8A 4NQRA 4XA8A 3V2GA 5LJLA 4RK4A 2Q3CA 2EWMA 2X0RA 4JQZA 4EUKA 4F86A 3PQ2A 2GN4A 5DM1A 5KHLB 1IDOA 2GPSA 2CK3D 7REQA 1PEYA 4J0KA 2QBYB 4OUKX 1GAJA 1R6TA 4KFTA 3R74A 5KUTA 2Y1EA 3GBSA 4BXOA 3W77A 3JQRA 2FUG1 3JYQA 1RZVA 1M34A 2REQA 4QG3A 4Q9LA 2QD5A 2P6PA 1JLLA 4D4KA 4JELA 1P39A 2QUBA 1QO0D 3C5VA 4LNAA 3HUUA 1KK0A 4QU9A 4Q7JB 3MGCA 4ZGGA 2A9KA 1DDGA 4PBTA 1THTA 1HEUA 1Z18A 1B8OA 3GY0A 4OAQA 5AVRA 3LWDA 3LP8A 2HYIC 1OYYA 2FZ4A 3EYAA 1KZ1A 1A95A 1NHGA 1EE2A 1PLKA 4YJHB 5EE0A 1O9GA 2C9BA 1V96A 4CKWA 3COZA 4UHCA 4ZREA 4ZT3A 4ZT4A 4EJ6A 3T5TA 2D7CA 5LQAA 1K3TA 1PJRA 3IIMA 4KQHA 3LYHA 5B58C 1YQTA 1ZR4A 1QB7A 1IOWA 1IUKA 2VQ6A 3FCAA 3AZPA 3DNFA 1MUUA 4MVJH 2OKCA 3OZCA 4S2UA 2PKCA 2RGXA 3JZFA 3BORA 3LI2A 5HFJA 1AKQA 4DSTA 1VCHA 5CPBA 3TKYA 4DG8A 1NV8A 4D26A 4EI7A 2V5UA 4CIVA 1JB9A 4N8SA 3SAJA 4ASUD 3ZK9A 4MUFA 4H17A 3CZCA 4DCCA 3ZWXA 2ISQA 4JYPA 4F9GA 2OENG 3ZWKA 3TLZA 4RTNA 3R3HA 4JC8A 3FH0A 1OREA 2EX4A 2QTVA 3PI7A 4X1IB 2NXWA 1WVGA 5T5QA 1UM9A 4Q9IA 2DLDA 5AKIA 4F1KA 3A2MA 3PKJA 5JNUA 2QXUA 5EJ5A 1F2TB 1Z08A 4GMDA 5JZSA 1KWGA 5JMTA 5JANA 4OD0A 4RABA 3U3DA 1LLDA 1JJAA 1Q0LA 2C3PA 3AQ4A 5A6VA 4NJOA 1ZUNB 4NEQA 2NTNA 4YTEA 3WLRA 2GD0A 2PNJA 4YS6A 5LLDA 1KZ6A 1N92A 2FW1A 3KCQA 4X61A 3C1TA 1L2TA 3TNDA 1C0LA 4I1UA 5TF0A 1BYUA 2C9ZA 2X4GA 4OTZA 1IJKA 2IYWA 1M2GA 5C2JB 2GEVA 1JN0A 4XGNA 5K6TA 8OHMA 3C1OA 3VAYA 5C8YA 1U0GA 1QCCA 5IAJA 4DL9A 2VT6A 4Q6BA 1N2CA 2JFPA 3TQRA 3IRUA 3GRKA 1DFHA 4BNHA 4LWOA 3QVUA 1L4NA 3HO6A 3VC3A 2PZBA 4S1NA 2AJ8A 3V00A 4F7WA 4J43A 3QUTA 4HNRA 1N0WA 4RELA 1LDMA 2WWRA 2NZUG 2WFLA 4JL6A 4AS3A 2XCLA 2XB4A 4CG2A 3CRNA 4R68A 4ESOA 2IH5A 3VR5H 2RIPA 3IP3A 3KLBA 5T4HA 3FMVA 3GEHA 3VU9B 3K9WA 1I2DA 1KKUA 1VXOA 3I2YX 2BUBA 4AW9A 1BOFA 4WAUA 4B46A 4DNQA 1KR5A 4QBIA 3PEUA 3ZKAA 1JKIA 4EWLA 2V7BA 2I66A 5F7OA 2C2ZA 1CDOA 1AN0A 1GV1A 5B1HA 5FA6A 5IULC 4TYYA 2HL6A 5SY9A 1BD3A 1KNXA 1DBVO 5D00A 1PJQA 1BE0A 2C20A 3FYTA 2GCNA 3RSFA 3KKMA 3KJQA 1WP4A 2OORA 3BGWA 3QVLA 3QTTA 4FEGA 4D8WA 3LDAA 4GHWA 4MKFA 2HEIA 5ALKA 5C8DA 5IT9A 1YHNA 4WK2B 1G64A 2X8AA 2ZM6B 1WZUA 4EFDA 2FPUA 4R9SA 2D5BA 4V2UA 5D8DA 4F3TA 1SBYA 3MJSA 4LOHA 3LLMA 4XB6B 4YDRA 3Q8MA 2M1XA 1LF0A 1TZBA 1AHNA 4R9NA 3CRW1 2C88A 1NVAA 4RA9A 2YW9A 4KO4S 4AY5A 1Z6PA 2NZVG 1E9EA 1ZW1A 2IUFA 4A6PA 1L5FA 4ZT6A 1M7BA 1IIBA 4BRSA 2LD4A 2Q2OA 4D8YA 1MIHA 4H31A 6GPBA 1OFVA 3FCYA 3FM9A 5BWBA 1OPXA 1TUEA 3NHMA 4BCCA 4JT8A 4P8RA 4UDXX 2MU1A 3LUHA 4BLWA 2JATA 3PGMA 4I8IA 4W5RA 5AIBA 3GLGA 3PPWA 5AK3A 3HS3A 3SOZA 4EITA 5LNK6 2AEJA 2EP7A 4PVDA 4YRRA 5JQGF 1U1CA 4R6WA 1BXRA 2XNDA 2JEZA 4MUMA 4HRXA 1PBNA 1V4NA 3DF9A 4DDMA 2WUFA 3CCFA 3O8OB 1X7YB 5C52B 2R00C 2RC5A 3AR5A 4G0NA 3CVVA 2OESA 4NMXB 3BKXA 1G5IA 3HGQA 5AJHA 3KFLA 5JSKA 5LXTF 5A3RA 4WSOA 4N1AA 2FLWA 2XQVA 4JIGA 3TW6A 1X9HA 2CYAA 5GZ6A 4YCDA 3GPBA 1WJGA 1QPBA 1G3UA 2PGJA 4IICA 3FZGA 4CTNA 1RAGA 4NFSA 2VHCA 5KVVA 3NTRA 3JY6A 4XQCA 2WJAA 3KXDA 4PLFA 1DC3A 1TK2A 2RGWA 3DWGA 1WUYA 4C7BA 2FUEA 5H82A 1W44A 3MOSA 4YUZA 3RU9A 2ZTMA 2CYBA 2QRVA 1K7FB 1K5PA 2CLLB 1MVOA 2GPYA 4TRRA 3AUFA 2QMQA 2BIFA 4C4YA 3Q9NA 4E2YA 4H3SA 1U0RA 2ZS7A 3TEFA 3UMBA 3E9NA 3SXUB 1Z4KA 2DPGA 2YL2A 1ULBA 2ORYA 1CLUA 2GI4A 5FO1A 1JEDA 3OFVA 3VM6A 1I14A 2O5CA 1Q83A 3BWCA 2KBFA 4OV6B 3RQSA 5G1OA 4R8VA 4OJKA 1ZOSA 2O50A 4JWKA 2NU7B 1E96A 2GF2A 3KC2A 3PYMA 4JLSA 4MHOA 3GP8A 3SQXA 4U2FA 3V2HA 1CWUA 2B78A 2O0HA 1HT1E 4Y1FA 1WNFA 1RJWA 1U2RA 3R0JA 4CVNA 1UOQA 4LJLA 4E12A 4GXQA 3BMQA 3IALA 3HH8A 2BOVA 2H2IA 3HSSA 4E1BA 3RCBA 4P1ZA 3M6VA 2PY6A 3MYRA 2AN9A 3ODGA 3WYNA 4NBLA 1B73A 2IGBA 3CEAA 2ZUUA 2C4TA 1R8QA 5AOBA 3WYBA 1QYCA 2BFBB 2IYSA 4F5WA 4FYJA 2XHEA 4MXDA 5TVGA 1XKQA 4GP7A 1FP4B 3RVPA 2H2HA 1FNCA 5E9JA 1XMXA 3SYMA 4MUJA 2LDXA 3AP1A 1PS9A 2VF4X 4IV0A 1I30A 1E32A 4BWGA 1XEXB 2AKYA 2HMWA 2VSYA 3F7OA 4RD4A 4UMEA 2OK8A 3ELUA 2JW5A 4XGRA 4PS1A 3H3JA 4RDCA 1G66A 1CUVA 2IUUA 3V4OA 2JFWA 1ZRNA 3KTAB 4KAXA 4OFZA 5EI5A 1OJLA 3C5HA 4D8UA 6PFKA 1GTJ1 2OHFA 1UXGA 3KQUA 3OU6A 3CUYA 2WTXA 4DXDA 1PR4A 1ADFA 2RHDA 1A9TA 4BFSA 3IPAA 4EVIA 3D8NA 3FFTA 2PFSA 3ZWBA 4EG1A 1P3JA 5FCDA 5K05A 5DGXA 4GR4A 3F2VA 4N18A 4F2WA 4DAEA 4UD6A 1EWTA 3P9IA 4O63O 2BM0A 4QUHA 5LDGA 4DQKA 1XA4A 3JD4A 5LDDC 3ZE2B 1A97A 4TLMB 4GVXA 1P61B 1XTVA 2ZG6A 1L9XA 2O3JA 2W2XA 2WJZB 5B3KA 2YZKA 3I5UA 3BIOA 5JDIC 4ZEVA 4M0UA 4J07A 1YULA 2GBCA 5DSZA 4MGKR 3QPUA 2A57A 1JT2A 1MB0A 5HRUA 3PR3A 4HJRA 5HUQA 1LF5A 2NYVA 3QVGB 2CLSA 4PX9A 3H2HA 3VU3A 3LY9A 4Z8XA 3U9LA 1LKZA 4W6QA 5M7EA 3P9PA 1E58A 4ZO9A 3D7SA 5E3JA 1IDN1 3ROGA 2ODQA 3KP1A 3ZDYB 1S2NA 2WVAA 1X70A 1ODCA 1BO6A 3DM5A 4UM7A 1V9LA 5ITWA 2AR0A 1XT6A 1SRRA 2Y9PB 1ZK2A 2PZEA 4B3SB 2R8XA 1SIBE 1TJYA 2X3YA 2R0QC 3MT7A 2VG8A 3FR8A 4LDRA 3L9XA 4Q3EA 4UU1A 2SCUB 5ALXA 4D9IA 5H8WA 2PJZA 1VGVA 4NDAA 1M6YA 3PVSA 3NYWA 3QKRB 5IDQA 4S04A 5J63A 5B6PA 3UFXA 1WBDA 3GFVA 4HO1X 1QHSA 1C1XB 2PZGA 4O4HA 1PG5A 2PFGA 4II7A 3N07A 2POQX 4D3DA 1W88A 3KKZA 5BQ3A 4F91B 1NUSA 4M0KA 5K3CA 1DIHA 1ENPA 1YJCA 2YMMA 1SUIA 3EGDB 3VZRA 1IB6A 2HWWA 1YVRA 4H59A 5B3AA 1K06A 3WTCA 4D44A 2CBZA 2COUA 2OVBA 2GEFA 5C37A 3G5UA 1H0KA 2IVFA 2O7SA 2VQEB 2X8LA 1QTRA 1G16A 1FYXA 5GV8A 3VR4A 1WCIA 2X5KO 4EPVA 4ZMRA 3BICA 4OKIA 1JEAA 4DWWA 3BWMA 3MELA 1HMPA 2IOYA 5EP1A 1EK0A 1TKBA 5FB3A 1Q12A 5SZKB 3U7IA 4BV9A 4BECA 3PHJA 3OG9A 3DZGA 3K92A 1ISGA 3IJPA 4S1VA 1KK1A 3AJAA 3X1YA 3IKJA 3DOFA 4TGLA 4YP0A 2H51A 4ND2A 4E7OA 1B2RA 4YIKA 1NLZA 3LJKA 4ZAWA 2BF7A 1Z4LA 3PNOA 3SSOA 3AF0A 1LUAA 4EARA 3H5VA 1W59A 4BJ5A 1E9FA 5FWYA 4PHHA 1CIJA 2Z8XA 4Q7LA 1OXSC 3DPUA 4QNNA 3KPUA 4FYKA 4ZYYA 2Z8YM 2O8CA 1NVVQ 1RKQA 1W73A 1P4SA 2GXQA 3CONA 3EZYA 3W3ZB 2V1UA 3T1VA 1NATA 2B1GA 1IUOA 5DHTA 3W4IA 1CFZA 1YBFA 5LD2B 1Z68A 2BHNA 5EL0A 1T24A 3F3KA 3FYCA 3TR6A 3TZQA 3GQBA 2YWJA 1N6HA 1DQPA 2ZLBA 3R4CA 1OX6A 1A7KA 2I76A 2I8CA 3PIDA 4H7KA 1FFYA 3SC3A 1XV5A 4O4JF 3P45A 2FSSA 4ML3A 1V1MA 4GI3A 2FPLA 3MWGA 4PGHA 4RPGA 1X1CA 2M6LA 2VATA 3SBDA 4C5BA 1Y7LA 3H16A 2XTZA 3LUJA 3RFFA 3ENNA 3O1IC 4HAOA 1PAUA 4DIFA 2EHJA 2V7WA 1A7UA 2WINI 3IT0A 1LRJA 2H4WA 2MWMA 1UANA 2Z9CA 1JXAA 3HXTA 1KL7A 4IJ6A 4UUPA 2QIPA 3W5DA 4NZPA 1DKQA 1SXJD 3LCUA 3UUFA 3BE5A 3CEMA 2P3QA 3IT2A 5LUAA 1WSDA 3DQQA 2GPBA 3HN2A 3K1AB 4M9CA 4BLQA 3OAAD 2B8EA 4MV0A 4KSCA 1UJCA 1DO8A 1WTCA 4RZ2A 4PXYA 4M88A 2K5UA 4U7DA 5TT1A 3MTQA 3MNFA 2D06A 1QP8A 5JS8A 4KAAA 1HH4A 5KMGB 1U3TA 4QHYA 5TEWA 5K9ZA 4WFKA 2BFEB 4TXLA 3MJRA 3BA1A 1XQVA 2EJTA 5AUQA 4ZCPA 5IC6A 2W6NA 2CFCA 3AEZA 4M9ZA 3SS7X 1SBNE 5L3SB 2WTAA 4ZQHA 4ZCIA 4TTAA 5CYGA 5IVKA 1T1GA 1ZYUA 2GBLA 2OC9A 2WSMA 2PZKA 5F9MA 3ROPA 1JIIA 1U81A 4TMFA 1N32B 1YDHA 4JU8A 2G36A 2HOQA 3OY7A 1EZ4A 3PSAA 2ZRPA 3AGPA 2HU5A 3OSZA 1J90A 3KAKA 2OBMA 3H1GA 1VBNA 4HAIA 4KACA 5CHYA 4QU5A 4Q4HA 2YVLA 4V03A 4J7UA 3RSCA 4X1KA 4L5JA 5CFZA 2G8NA 4MB0A 1UC9A 4TYPA 2ZBQA 1OXMA 4V0NA 1GTZA 1U28C 4CUJA 1V7ZA 2UU9B 4DNXA 2B9VA 4OREX 1QR6A 2UZAA 3KOOA 4OQPA 5BQOA 1DBSA 2JFVA 3H1AA 4QYIB 1GTVA 4R2LA 3WIVA 4G85A 2KHZA 4CNQA 1SXQA 5K8TA 1X8KA 2EEZA 3VDMA 4Q3CA 3THRA 4X97A 1JI0A 2EF0A 1T0PA 1O9BA 2H07A 2J6BA 4IP0A 3N3AC 5L6MB 3EG5A 3HZRA 3SQWA 5DK4A 4L9WA 2E3JA 3X2FA 4CODB 4BMCA 1YB2A 3K70C 1VC2A 1E3IA 1GNRA 1IEWA 3I83A 4ALMA 5A0FA 1H1TA 3D5EA 3GBVA 4MWDA 4N03A 1U9CA 3OQPA 3WK8A 3A8TA 4Q4DA 2BWJA 2CGEA 3BL6A 3TO5A 2Z1DA 3QXCA 4JJZA 4LY3A 5T4FA 3LT5A 3OZGA 3P9QA 4I9HA 2FRVA 2Z6VA 2E0IA 4IFTA 1EUDA 1OZ0A 4ALLA 4HRVA 1TCCA 1RQRA 2NWQA 2JH9A 1VLVA 2IZ1A 1M2OA 4J0EA 4C6TB 1T3TA 1YS6A 3F46A 1LPMA 4WK0B 1C9DB 2W2MA 3ESYA 2A8YA 5KAMA 5UKDA 2FXVA 5A9RA 4I7EA 1E1DA 5T8KA 1EGHA 5KYXB 5KYKA 1E2GA 3UUWA 4I5GA 2BCEA 2QQ5A 2XRFA 3G88A 1G4HA 1NONA 5JI2E 3T3MB 1NTOA 1QORA 3PA6A 1DHRA 3DAYA 4IHKA 2JA2A 4YECA 4DBLE 4NI5A 4NENA 2QD1A 4JD5A 1DTWA 2WJGA 3REFA 5L3ZA 3AVTA 1BEEA 2I2FA 2ORWA 1IXZA 2GEUA 4EGAA 2FI1A 3WIBA 1U7TA 1FRQA 2Y05A 4BO7A 2HUNA 1J5XA 3NEJA 2HU2A 3ZHYA 3CZ4A 3VPGA 4GUDA 5GINE 1UODA 1OC4A 3CKLA 2FMIA 1EWRA 3VSCA 4EDFA 3G8DA 1E66A 1PW5A 1N33B 1C4XA 4XB2A 4R41A 5KO2A 1I10A 4U63A 2NTVA 4J49A 5DZSA 1E1CA 3GYGA 4MKGA 3UFXB 1ZVMA 4P82A 4QUBA 1PFQA 4D3SA 4WY5A 1C3VA 1PNOA 2DF8A 3BRCA 4C0WA 1WD7A 1IOVA 1CQJB 5I7UA 1IPEA 5A3JA 1NG1A 5ICCA 4IOJA 3U1VA 4YRSA 1PDOA 4EQ6B 3WGIA 1DBPA 2C9DA 5JC8A 5EHXA 4K8OA 5IAKA 5IMBA 4NECA 2Y3IA 2B25A 3JAMA 2PZJA 4RANA 3CLVA 2OUKA 1XVIA 1DQSA 3KTAA 3A32A 1AA6A 4WY2A 1T5BA 4MQ5A 1U6KA 2Z98A 1JVBA 1NX6A 4H3HB 3CPSA 3E1KA 3UJ3X 4F2HA 5J2TA 4E15A 2Q1WA 1OC2A 2XI4A 5AXCA 1IVYA 4C5AA 3CG0A 3JQGB 2AF3C 3TX2A 2WSSA 3CF0A 4RENA 3IUQA 4RY2A 3Q8WA 4WW0A 3VH4A 5HIIA 3IEIA 4B0PA 1Q7TA 1XWIA 3GRZA 5LBTA 3GLIA 4KFCA 1ZUWA 3BD8A 4Y9SA 1KYVA 5D3KA 1CEYA 1FXSA 2XAAA 3H4IA 4IIUA 3DE2X 3GVHA 3QTBA 5DCWA 2VJMB 3ESCA 2A92A 4UAGA 4ZC1A 4ZEOA 2F62A 1YOVA 3D0RA 4EJ0A 4RTRA 3K4QA 4N3AA 4DMFA 3BULA 5CFRA 3SYRA 2J45A 4BFLA 1YC5A 2FG5A 2G71A 4NOJA 1PNQA 1E1QD 3CPHA 2G1KA 2HMAA 5A7HA 1UXIA 5EVJA 1XHFA 4R84A 1M6NA 1P7WA 3VDRA 1R0CA 4M8IA 1ZWLA 2J48A 5AI6A 3RHSA 1CKEA 2R5WA 2HADA 3CHYA 5EG5A 4LFBB 2XJ4A 5AJVB 2E37A 3MJTA 3K8OE 1AQ6A 1XRQA 1JHOA 2JLCA 5BWOA 2BMVA 1QP0A 4RZHA 5DN6A 5KJ6A 1A9ZA 3IXQA 3EQ9A 3FYUA 4C05A 1QHEA 2QENA 4ZO6A 1N4AA 2J3LA 4EY6A 5KJFA 1R7RA 3UOWA 3VI4B 2RHBA 1PKEA 1J0DA 1II8B 2QX9A 2GPWA 4LJ7A 1V8BA 4PGGA 4U7WA 1U04A 4DREA 3ZGXA 2F3QA 3DM9B 4RJTA 1BGVA 2R6FA 2A5JA 1E2LA 4U8HA 1P31A 3NWBA 3N2GB 2HK8A 4YMUA 1DMRA 3DEYX 4NR0A 5BUCA 4Z53A 3A1TA 1ABEA 1RTTA 5CK4A 1U9IA 3QPDA 2YS6A 1EXMA 2C9CA 3BEDA 4E3ZA 2C7QA 5HKLA 5T8KC 1JP7A 1MVLA 3OZSA 1XJQA 1RJ9B 5KU7A 5CB4F 3CH6A 1H4SA 4GWGA 4UQPA 1K63A 1KSFX 4IS2A 3MWDA 4IQ8A 3E7FA 1Y3AA 3LY8A 5AKYA 5F5NA 5BV8A 5HQ3A 2PX2A 3VOAA 2E85A 3HO1A 2K4MA 4PPFA 2BCGY 2ASEA 1AQYA 2Y9MB 1U98A 3NIFB 1T43A 4R6XA 2PGLA 2PUJA 1YXMA 3H0CA 4EL5A 2X3UA 2UZ1A 4TXJA 4B73A 1PR1A 4HYYA 1R0SA 5K0EA 2PWBA 4FKBA 3T3EA 1VJ1A 1VG9B 4UVIA 3UT6A 1PIWA 3FROA 3KVRA 4Q1AA 1KFJB 2Q29A 2QDKA 3CUSA 2BFAA 4CMGA 4DS3A 3L92A 1B6TA 1L1EA 2W90A 4N5MA 4MW1A 2MINA 1GAWA 1U4NA 1A88A 1JHVA 4ID9A 3QH4A 2H65A 3IULA 4EW2A 2JJYA 3QE3A 1PI3A 3K70D 3A10A 3GU3A 4BNMA 4A8TA 1JQEA 1RQPA 3H18A 1OA0A 1A77A 1PV2A 3OX2A 3LY5A 4JS0A 1M8KA 1Z7WA 4J29A 1D8TA 1QX4A 5A4KA 4WHMA 3PKIA 1Q0TA 2VA8A 3WRXC 4BQFA 1DAMA 2QRKA 2BDTA 1KFEB 2QTRA 1GR0A 3JZMA 4ZHQA 1X80A 2Q3JA 4EUFA 4I1OA 4LDAA 1RE1A 3QU2A 2Q7OE 1W9MA 1RYHA 4KRYA 3HMQA 4MYSA 3RKRA 2ZSAA 4BKUA 3H8WA 4IRUB 1VRVA 1OT5A 1CF9A 3KUDA 2V7GA 2X41A 4BMZA 4PNHA 4N01A 2NN3C 2X8WA 4WKGA 3DEFA 4DC1A 1DBQA 1K66A 1IBSA 4X7RA 2Y1XA 3I2HA 2CXHA 3HB5X 1G8GA 2D13A 4Y9UA 1RC0A 4G2NA 2QG6A 2BGLA 4S0XA 3GGPA 2FHSA 5AK4A 3U3XA 3THWA 5K7SA 4ZU3A 2E87A 2NXEA 4GT1A 4A10A 1QTIA 4PCLA 4BIIA 2NZJA 1J9EA 1FEZA 5HKAA 4IDEA 2O6HA 2Z0MA 4Y7DA 3SXPA 1P74A 1JVSA 3FI0A 5JXJA 3W5BA 1XAGA 4MK4A 3T15A 4M9UA 3VSBA 4ALJA 2D4AA 2RG1A 3NCHA 3EC2A 1PP4A 4XIJA 1GCIA 5CT6A 5IBQA 3VR5D 1T2FA 3KJHA 3BHIA 2GZ1A 1USWA 5KC8A 2PXXA 3O03A 3RS7A 1LV7A 3RBAA 1X13A 4WZAE 1I5RA 2B99A 1GZUA 1JLKA 2VRWA 3QPWA 1JFRA 4GPEA 4RO0A 1I7PA 4AL4A 1TUBB 2X2FA 1QAQA 2CLCX 1UBGA 1FFWA 1U2GC 2HLDD 3NBFA 4NBVA 2XWBF 5LVAA 3HM9A 4H0FA 3GRPA 4JJEA 1U0FA 3G68A 5LQJA 3CLSC 3WHIA 3GT7A 4Y3UA 5IN4A 1GYRA 2QI9C 3HPRA 1WMSA 1EWYA 2KYRA 4OOEA 1REQA 2Z2YA 4F5EA 1W5SA 3KLNA 3OA2A 4K26A 4CQJA 4DV4B 3NOXA 3NM5A 2WJ6A 1F6DA 1NM5C 3HNPA 3D9QX 3TD6A 1GN8A 2UUCB 4OI2A 1CUJA 1D09A 4RTQA 2Q6IA 1DAPA 2EERA 4GM0A 4B47A 1O0SA 2JVJA 2WM8A 3RUIA 1PK8A 1IBMB 3DVSX 4AP5A 2DBZA 3IEUA 2JAUA 5EE1A 5THQA 3VO8A 2V59A 2QD2A 5BQ5A 2GN0A 4ZAVA 3PTZA 3QFCA 1GG2A 2P35A 1YCDA 4C22A 1JJFA 1DL5A 2B20A 2N75A 3KE9A 4K8RB 3VJLA 1O0BA 2XB6A 2RGBA 3OUZA 3LDHA 1JKXA 2ODBA 5G0TA 1ADGA 3I0MA 1QLWA 1LBHA 2B4KA 1T3LA 2AFHB 3ET5A 3M3HA 4HWKA 3SSNA 5HMLA 4A8HA 2VL7A 1SHKA 3SLGA 3OLZA 4ROTA 1KORA 1MV5A 2GA9A 4RLSA 4Y0NA 4AZWA 4ZQEA 4PYQA 3KUKA 5EWMA 1YCFA 5DHQA 1DKMA 2V96A 4L8FA 2UZ3A 4COKA 2ECOA 4GR5A 3N7TA 3O84A 2ZM5A 1DELA 4GX2A 1DIRA 5DT2A 4CDNA 1COZA 5CVUA 2X40A 5B4TA 3QLEA 1LPBB 5IUJC 2BTQB 3T1OA 3AR3A 1YFLA 4G9BA 3DFKA 3HP4A 1VJDA 4PBRA 5JAUA 1ZM7A 5BP7A 4JENA 3RLFA 1GY8A 1QWSA 3TGWA 5BSVA 3LM8A 1JAXA 4M0PA 3GFFA 3LMKA 3HI6A 4TTJA 3H65A 3O1HB 4MVJA 4MWCA 1KRHA 1NRWA 2Q9CA 5A04A 1BC5A 1RLJA 4D0GA 1ISHA 1MCZA 1ATZA 1U80A 4QVKA 4B4UA 5KWSA 1L4BA 1A27A 1RLTA 3A6EA 3HYRA 4LRXA 2RHCA 2VDKB 2E4ZA 4UE3S 4OQYA 3WNQA 1D1PA 2PR2A 3H6KA 1BOOA 1QH8B 1W94A 1CJSA 1U9IC 1LU9A 1Y8CA 2JGKA 3F6EX 3KTDA 1Z3CA 3OLCX 4IGIA 3TPFA 4UM9B 1UWCA 2C1EA 2P5UA 3TW8A 4WXYB 2FMFA 5A0TA 2PZLA 2OAP1 3DV2A 5CAEB 4EH1A 2GD2A 4HK4A 3PE6A 3CKKA 3VSDA 1ZESA 4BCBA 5ARBA 5F7ZA 4DLBA 3TOSA 3C3CA 2VAVA 5DBFA 4BNLA 4B3MB 3NDRA 3UWOA 1VMKA 4MGIR 2SKDA 1OMOA 1ZBQA 3O73A 2DWOA 2AIRA 2OHIA 2WUDA 1QDEA 4KMOA 3DZBA 3OCUA 4LMBA 4MVWA 3AKDA 2OGTA 3K5HA 4PCUA 3AONB 4DVGA 5EVCA 5CFMA 3PHIA 1KO4A 1RMTA 4MICA 3A1VA 4X6YA 4BAUA 4Q03A 2R7NA 3AL2A 5CT8A 3SR3A 5JAZA 3BYZA 1BAPA 4CLXA 1D5CA 1X14A 2HCTA 3W06A 3WYAA 2FW0A 4PGFA 3FJOA 2VPYA 4EVQA 3GLGE 5K0CA 5KYGA 1E3EA 3EVAA 3WLQA 3U3OA 2ZCVA 2EOAA 2C59A 3DWFA 1ZGBA 5KNBD 4CM4A 1J70A 2PLRA 4YLGA 2XNHA 4JCCA 2WD7A 3WWEA 4Z4IA 1XMVA 4HZIA 1R0LA 1RYBA 3CIOA 2PSJA 2WSBA 3WYFA 1RHMA 1NW5A 3NQ41 1RWVA 1Z2AA 4IWYA 4RA6A 3TM4A 3NJ8A 3D2BA 2E89A 1YRAA 4YCJA 4Z86A 2OCIA 5F3DA 2HDNB 4O5OA 2B6NA 1E2MA 3EMBA 2C95A 1CJMA 1U8FO 3KL2A 4HNVA 4ETMA 3O1LA 4LNHA 4BFYA 4DCGA 1XWWA 5AI4A 3LBHA 2X2EA 5TDHA 2OP0A 3BC1A 1DRKA 4ND4A 3R44A 2O9JA 4TV8A 4BNUA 1WDLA 1ZL0A 2Q5EA 4JUAA 1P81A 3E82A 8LDHA 1FE8A 2FOXA 1HK7A 1PVOA 1HO3A 2FQQA 2RFLA 3G5LA 1QRSA 3BCSA 1M1XB 2NQ2C 1ETUA 1SCJA 4FP9A 3U4DA 5AVTA 4K2AA 2V9CA 1ZW6A 1EP3B 5FQOA 1G6HA 1LLUA 2G5TA 5ANRB 1IEVA 3CZRA 4H7EA 2XUJA 3B7GA 1KZ7B 2ZROA 2IP2A 1HRDA 1NVKA 3EZ9A 5LZ5A 4O4LB 2V1XA 5INTA 4WA8A 4YRFA 4E30A 2YFKA 2H1WA 3AL0C 3NHFA 3TEJA 3I52A 1TCUA 3MCVA 3DL7A 1BU5A 3O4RA 1VKOA 2IYPA 1RYMA 2YQ4A 2WP0A 1RAAA 3LX8A 4M8LA 4FN5A 3KXPA 1CB0A 3KB8A 4YALA 4HP8A 3AJ8A 4WLVA 2DHQA 3U3MA 4AWBA 1ZQ1A 4ETWA 3OY2A 4J4HA 3MCAA 1QU2A 4FFMA 1AVTA 3KWFA 1QPGA 3SP1A 2RGNC 1PR9A 1C7RA 1ZD5A 3BSYA 4DSOA 2IFTA 2FP4B 1XFAA 3W1VA 3PTLA 2JI7A 4BC0A 3D1VA 1SC1A 3ZH9B 4CTMA 3CUKA 2N42A 3CF6R 5CX1B 3GGCA 4NJEA 2EXXA 3EWNA 1GV0A 4HGYA 1BE6A 1LBQA 1ZMXA 4OYYA 1E3LA 1FYVA 4F6LA 2I1LA 2O2GA 2PKQP 3KPWA 5I7WA 3CINA 3MVEA 5P21A 3IE2A 1YE8A 3T9AA 3WDSA 3ANTA 1VE1A 1L7MA 1T2AA 1Q1GA 2NSYA 1CDZA 3O4JA 3VVCA 3VUFA 2O8BB 2I2CA 1L7RA 3K35A 3WB2A 1H66A 2IXGA 4L0DA 3CG4A 5ED0A 5HS6A 4OHZA 3ZY4A 4F96A 5LKRA 1M1ZA 4BYGA 1Z3IX 5FEUA 1UUFA 3D4LA 3R40A 1VE6A 3E22B 3S8EA 3PYXA 4OPMA 4KWTA 2AX4A 3KLPX 1NN3A 1S2MA 1SC4A 1KO8A 5COQA 1XZMA 3LK7A 2V58A 1CD5A 1HORA 3EXG1 3NXSA 4Y8VA 4DEXA 4IKPA 2Q8NA 4FBLA 5F1PA 3ZD8A 4FMCB 3AERA 4MYTA 5EJ4A 3K5PA 4DQVA 1PLLA 3F1LA 4LQDA 3UC9A 3GJ6A 1U8XX 3K09C 3EHEA 4IO0A 5DX1A 3WNZA 4ENQA 2HTFA 1OT3A 2Q0XA 4WL0A 3WMFA 1L7BA 2YQ5A 1F8UA 5EJ2A 1YIOA 4BNZA 1NUQA 1V37A 1Y1TA 1YV9A 2I4NA 2WLTA 3L3BA 4B5KA 1SU8A 3OURA 5C5IA 2PWZA 3PQ5A 4LF7B 1BFKA 1C3JA 1T8TA 2YS7A 3EXEB 3OUTA 4POAA 1ZINA 4ZRNA 1A5TA 2BMWA 2RCNA 3ETGA 1T4CB 4LYDA 4Q3DA 1S3IA 2WOJA 2ZPTX 2YOFA 4WJLA 5A5DA 2XQGA 3P1JA 4Q9JA 1AMOA 1MAWA 4HC4A 4XGIA 5AR1A 1O7JA 4NC9A 3ZGNA 3WRWA 5LZ8A 1OWNA 1U0SY 3UYLA 4AMUA 1GSHA 2E4XA 1XTPA 3UHOA 4EYOA 4G9GA 5LA6B 5DRYA 1WW8A 1T9DA 2TRSB 1VE7A 3EF0A 4GM1A 3IVMA 3I76A 1Y5RA 2GYYA 3P52A 3G49A 2GJ8A 3ZHCA 3BWVA 3GH1A 1CU1A 5KWVA 5LDHA 1PFGA 3N3BC 4OHMA 2VJKA 4L8WB 4YBRA 5DSXA 5LL6P 2IHUA 2NVUA 1RRPA 3E61A 5B6JA 2ZB3A 3L0PA 2UDPA 2RI1A 3PLRA 3AI3A 3V8EA 1S9DA 2ILTA 2HR1A 3UJPA 1ATIA 3FOFC 3EQZA 3AILA 4ER7A 1IIRA 1PVDA 3NIDB 3R2JA 4QU8A 1GOTA 4UREA 1QDUA 3OQBA 4A92A 4ARIA 4KI7A 3JTEA 4JSYA 3SYLA 2CDBA 1RQ2A 4L51A 1J2JA 3S2IA 4ALKA 2I34A 1E2EA 3U5TA 3GDWA 1KJ8A 3O7WA 4ESHA 2A4KA 3D4PA 1VYVA 3M6MD 4AMGA 5GVSA 1CF2O 4N3CA 4AZTA 1SO8A 3UKJA 5KX5B 4Y6SA 4C1BA 4QVIA 4D4JA 3LTEA 2C00A 4D3XA 1GQOA 2R2GA 3N39C 2IYTA 4PV7A 3DHVA 2P9HA 3HB4X 4RHTA 2YRXA 4X7PA 2NYAA 3SKVA 5K3DA 3EQ2A 3T5PA 4EF5A 1H4VB 4BFWA 3LYLA 2I3BA 4K28A 1FNNA 1TCBA 3JRWA 1ORVA 4MPTA 4N6NA 4RD2A 4A6DA 4F4JA 1TVEA 3KK0A 2ZQZA 4FZVA 2C2GA 5K3FA 3D2AA 4RV9A 4YHBA 3TD2A 4MUBA 4OUDA 1LQ2A 4JJGA 3RUEA 3GG2A 1YA8A 4G0PA 5AXBA 5BN3A 3WL7A 1PYDA 4QJBA 3D6HA 4KLNA 1BJTA 3EF1A 2H5JA 4M8KA 4DSZA 1IG3A 4KN5A 3OZBA 1SOMA 4N9WA 4W5WA 1GU7A 4M60A 3PDHA 3G9ZA 4WMLA 3VFDA 4Q9DA 2JKYA 3NZEA 5LBIA 3SC4A 1S8OA 4RJ2A 5DM4A 4D9HA 3U61B 1U63A 4Y6QA 3R3VA 2WUGA 3K0AB 1QP4A 2VAXA 1TCVA 1G4UR 1XC7A 1NY5A 1M34E 2BGRA 4DV3B 2ETXA 2P6MA 2WAYA 1XZHA 1ZIOA 2E5LB 2DBRA 2QYHA 4ODIA 1TQ6A 2XA2A 4IHAA 4A8PA 1N3YA 4IEEA 4PZ9A 4M1MA 3MJFA 5ILQA 2QUHA 3D1LA 2CUTA 3A6ZA 3C1AA 3I2KA 4JUBA 4MQEA 3TJZA 1DG1G 4NFYA 5K8JB 4DNFA 5DM60 2QS9A 2Q4EA 3L9WA 1YS9A 1W76A 3GIWA 2W00A 3ZWQA 1EHIA 3BMNA 2O2EA 1QIDA 2WAXA 5JJCA 3MHTA 3MIIA 4Q7EA 1RYEA 5C3MA 1JE0A 3H83A 4O2BA 4CN9A 4E5UA 5JS6A 1USKA 2HLPA 4HBZA 2EFDB 1SA0B 1UKVY 4Z1MA 5HKKA 1KQGA 4W5JA 1F4PA 1YE5A 3H04A 3ZR4B 1NUAA 1ZJWA 1EJ6A 4BVGA 2EBWA 3JQBA 3NBUA 2MINB 3AJDA 4KG7A 1KZHA 1MQ9A 3D1JA 5TQ2B 4DCJA 3W2TA 1UM9B 3BMNB 1I5OA 3ZE7A 2F4VB 1CC1S 3ETLA 4AYWA 1A8HA 2XTMA 4BQNA 3I53A 3OOYA 1OLOA 2PVSA 4FC7A 3I92A 4E4YA 1DO2A 4Q9KA 2R8EA 5HUJA 5TMPA 5FWNA 5LUBA 1YS4A 2VWPA 2WMDA 1Y9DA 3ZWMA 1XPJA 2YKGA 2EGGA 3KUCA 1GTSA 3SD7A 4EZIA 1PUJA 2WLSA 5H16A 2CXQA 1JIKA 2HH9A 1QGDA 2IHZA 2LR0A 4QULA 5SICE 2WQ6A 2CXOA 4TTRA 5C7LO 1O0CA 1ENYA 4LOIA 3IS3A 2LBPA 4IIJF 3EPRA 4IMIB 2XE8A 4D41A 4CV2A 5IX8A 4A0RA 1W9HA 3B60A 3VR6D 2Y1CA 5REQA 1GHTA 1R50A 4R81A 3HBNA 1H9CA 1I3OA 1K27A 4JP1A 3N2GA 1KJQA 3WIEA 4KQEA 2A5GA 2O06A 3AM4A 4K5QA 5E2BA 3WC4A 4RH0A 4XASA 5KTTA 1BVHA 1OH6A 3KYJB 2DPXA 3L7AA 3ZKWA 3CGGA 1I1OA 5AI8A 3H87A 3HCCA 2C2OA 1OV6A 4EF4A 3FPAA 1G7RA 2QI9F 4V24A 1IWOA 5DYNA 2XZOA 1S0UA 1DI0A 1U2DA 3UPTA 1XDWA 5EINA 3W6PA 3DMYA 3UK1A 3OCCA 3CS3A 3GJZA 5A4DA 1FTQA 1IXYA 1TEHA 3T9EA 3WWYA 4TLBA 1IONA 3JVIA 2XCOA 4LN1A 2JLYA 5EIAA 4YJGB 4RZIA 4IZ6A 1HTBA 2JDID 4RIGA 4ENSA 2JDIA 4MV6A 3F90A 1MOZA 3GDFA 4R9UC 1E3SA 1RCUA 1UXOA 3BFPA 3O7MA 3T0GA 5JEEA 3LQKA 4JVOA 5AVVA 2XV1A 3FYDA 3L8YA 3P0HA 3KXIA 1QKKA 3TG2A 2WHEA 4IMRA 4DDVA 4M89A 1A9OA 2GYVA 2DBQA 3ABZA 2FPGB 4NZMA 1YUNA 1QHNA 1J9ZA 2OHJA 4QDUA 4Y6LA 5DISB 4OB6A 4YT8A 4ZCTA 1C3XA 1JMVA 2OQVA 4ALNA 2IF2A 5JRZA 1ZUD1 3FPHA 5I7RA 2P2CA 2ZI3A 2ZP1A 3F2IA 1QIIA 3HJHA 1KSGA 3HJUA 4YUYA 5ADWA 4CXMA 1NW4A 3KZKA 2X0EA 3VOSA 1EUZA 3LPAA 3I1IA 4GOND 2BFWA 5IM5A 1M5UA 2VZLA 1DC5A 4MW7A 4DG9A 4Y7CA 1C1HA 2C96A 2XKJE 4RLQA 1IK6A 4BLPA 4P7BA 4N48A 2Q4DA 1X7ZB 4LY0A 5I7HA 2F2TA 3PNPA 5EHZA 5H7XA 3K0FA 2I33A 3PDIB 3TF5A 3UWPA 3R7BA 4YXWD 1MPTA 2JLBA 2Y67A 4Z0PA 3AF6A 1QIEA 3HCRA 1UBUS 4NV1A 4EMUA 1GO2A 3P2MA 4N7RA 2BBOA 1FSFA 4AG3A 2F3UA 4MIYA 5DCYA 4NPAA 1PJBA 3S5JA 3KZCA 4B35A 8GPBA 1O4VA 2ZIEA 1FTGA 4IQGA 1U6JA 3PGVA 4AO7A 3U1BA 2C2KA 4V1CA 1UJ5A 3CXRA 4GI1A 3TVDA 3L6DA 3OZFA 2OFPA 3CRRA 3NOQA 1CUDA 2XWJI 1Z4OA 5JPDA 4F04A 2XTNA 3TQHA 2V7QD 4UOQA 4RAQA 2IA5A 3W6ZA 5ALRA 5J47A 4BGEA 2WT9A 4R0NA 3NT5A 4Q9HA 1G21B 3AKCA 5GQSA 4FGJA 1W87A 1T4DA 3ZVLA 1NM5A 1NQVA 2R25B 1CRPA 3VZQA 3C3JA 1NJSA 2AG6A 2BM9A 1ZH4A 3LBNA 2GPJA 2HF7A 2JHFA 1V1MB 2Q27A 4GOKA 1JPUA 5EUBA 4R3NA 5KYUA 3R6GA 1NLYA 1RWXA 2JJ1D 3O3OB 4OEHA 4K6FA 3CIFA 3CJRA 3VYWA 2PGDA 4ZCLA 3AFMA 5AJYA 3T95A 3D81A 3W6UA 2XHZA 3VPFA 16PKA 1W35A 3FGNA 2W2OA 3U60B 3C70A 1ISRA 1EFRD 1D1QA 4JUFA 4DIEA 1Z7GA 4AZSA 3SZMA 3I3OA 2GXAA 2JHPA 4QPZA 4OP2A 5AH0A 1Y37A 2P6NA 5BOVA 5IKOA 1JKFA 4AC9A 1KAGA 2OORC 1RD4A 4CM3A 3EFOA 3ZCQA 1Y1PA 3F8WA 4HQ6A 2I6QA 2WR8A 5B7GA 2CWDA 2HRCA 4P4NA 2VK8A 5G3YA 1XTZA 4RH1A 2DG2A 4KU4A 3A9CA 1E3WA 4HAXA 1YVEI 1P3Y1 3C4JA 2XH8A 4R8MA 1QNFA 3HQ4O 1USUA 1PG0A 1KDRA 4G1MB 4XWTA 5DOVA 3ZWPA 2FX5A 4Q66C 4D4IA 4R3WA 5FLYA 3EOZA 4OLBA 4BJ6A 1YDWA 1NN0A 3FWNA 4FLEA 4PE5B 3CEHA 2XYHA 5EIHA 3IAEA 3IMKA 4MKZA 3C5CA 4RXMA 1L4YA 2J0QA 4DMRA 3IBGA 4G1BA 2AZ4A 4Q4HB 3DAPA 2F3PA 4E03A 3MCTA 1R8SA 3FJ1A 3WGGA 2ASVA 1VG1A 2QW8A 1UMDB 1JZSA 2FMXA 4PFSA 1L5SA 1QHXA 4CJXA 4AI6A 1JVNA 3OLQA 1RRFA 3KQTA 4GPBA 5FR1A 4OQXA 1N25A 3I2JA 3VPDA 2GJKA 1CYDA 1KP9A 1YB4A 2C9YA 2XEXA 3HFRA 1Y4SA 3OFJA 2ZIWB 2Q4BA 2DCMA 5DNEA 2BI4A 4DYHA 3GFQA 3G0HA 1AY0A 4B2PA 4Y2XA 3TDMA 1Y4UA 4G8CA 4NTZA 1GPLA 4N6OA 3KQNA 3HYTA 1BGWA 3RVNA 2G1JA 3Q6MA 5A2GA 3OJFA 4EFKA 2VA9A 1RLUA 5TVKA 3OPQA 4NNPA 4B7UA 4B3GA 4GUAA 2AUMA 4BNIA 5IDVA 1PZMA 5L3QA 1ZJJA 2HSEA 3O3MB 4B09A 2WAAA 2WVGA 5TV2A 4KR6A 3A4LA 1BZYA 2FN4A 3G7NA 3LV8A 5A05A 2YFQA 3UXMA 1P75A 1QG2A 4UVHA 1A1SA 4PYJA 1M5RA 1IBKB 1TL7C 2PL3A 1LV8A 3AX6A 4YRDA 4Z54A 1QG6A 5TR9A 1GPH1 4EKGA 3UOAB 1CR0A 1QRDA 2OPBA 4XFJA 1W581 1BQEA 5ALDA 4QVGA 3DPIA 1U94A 1NJ8A 1I32A 4NKRA 4NIMA 1CVRA 2REQB 2V74B 3DDZX 4N0EA 4PCVA 4TZ6A 1QIKA 5KPDA 4AVYA 5HGJA 3R5JA 3L04A 2B1JA 3L01A 1YZFA 1W8IA 2O4UX 1MRZA 3OF2A 4JJFA 3LWBA 1Y3FE 3INTA 2D1QA 3T8YA 3EN0A 5HM8A 4AK9A 1EUYA 3N6RA 2YJNA 3M6FA 5AW6A 1MA3A 5TQJA 4E08A 1XD9A 2CJWA 2P2SA 1H2WA 3GCGA 3L0SA 5KPJA 3PUYA 4KK3A 3DNPA 4RKQA 1Z8HA 4HUQB 3T1NA 3CX4A 1RRGA 5H9VA 3D8TA 3F7MA 1Q6YA 1QV7A 3EX7C 5LA6F 5FBLB 4FKMA 3IVAA 4Q4JA 4C20A 3TGLA 3TXXA 4ZGBA 4KX5A 3H2GA 2Y2UA 2Z3VA 1V11B 1NI5A 3OESA 4R1LA 4C7XA 4EA8A 5J4YA 4R8SA 3RV3A 1KOGA 4KE9A 2EW2A 2C2XA 2EJWA 1PFKA 4M54A 4GOLD 4ZQCB 3RARA 1DJQA 1L8OA 4BGUA 4E13A 3A1EA 3MYYA 5JWHA 4YIHA 3MHPA 1NQWA 2WTBA 1DKOA 3UG6A 5D87A 1Y4DE 4JOSA 3EEOA 3GMDA 3JQ7B 4A0GA 1NT2A 2BTEA 1PJ3A 3QF4A 2C31A 1T91A 2WK1A 2IODA 3CWZA 1SFRA 3Q1LA 2F7SA 4NENB 3WB0A 3ZGVA 4DA7A 5DHPA 1OASA 1V5WA 2VDVE 2CNWA 3HB1A 3N7AA 4H1HA 2FYTA 4R1PA 5JAPA 1FUYB 1JLSA 1JHAA 1RQNA 1NULA 3GEEA 3G2NA 5FRDA 4N40A 2BKAA 3Q0IA 4RESA 4JJ6A 1E5XA 1ZLXA 5FTWA 4BBZA 4F2GA 1ACLA 2D2IA 4POOA 2DQYA 5TS2A 2ZVJA 1J4AA 2ANBA 1LNQA 4HYQA 5BO5A 3VSEA 1LD3A 4I55B 5FJJA 4KMMA 4LZAA 3OEED 4GBGA 1G8FA 3R41A 4KN6A 1RYFA 2G1PA 5BW6B 5JROA 5KS2A 4PHGA 3HUFA 4OVKA 2YXPX 2ACEA 3WJ1A 2VYFA 4DGQA 2V3CC 3I2GA 1WMAA 1EIZA 3IA2A 3JALB 2QY9A 1RXYA 5DNAA 1ZONA 5F76A 4B45A 4BEWA 1U2TA 3RHTA 2Q3BA 3ZDXB 2E4YA 3VJMA 1E4OA 3USZA 1QHFA 2RSLA 3L5OA 5DHSA 1KYXA 3N8KA 4OSOA 4X3OA 4YAWA 4ARZA 1V8PA 1J23A 1PX0A 4U2CA 4UXHA 3V9AA 3LKVA 1VA4A 3GB9A 1E0SA 1XJ0A 5KYTA 4QSHA 2JIZA 2Y1FA 3AWIA 3VPHA 3FSRA 4MWTA 3PICA 4HDKB 4DUGD 3CW8X 4D9CA 3QFHA 3LPNA 2G5CA 2Q5OA 4KXXA 2C3MA 1NJ6A 4C87A 4B6EA 4B3JA 5IBCA 1ORRA 1YNOA 3JZAA 3UXYA 2BHTA 1L4UA 1M6WA 1H4QA 3OQJA 3PT9A 2R8OA 3KSBC 5ESDA 4EKNB 1GSIA 2O57A 3K32A 1KVSA 2LGJA 3GFRA 1Y5IA 4JBLA 3D8BA 3PBKA 2G76A 1EDZA 3OFKA 1BS1A 2FPGA 4IGKA 1E6MA 1L8LA 2OCYC 4IOLA 2IU3A 3PC7A 4GNKA 4MP3A 4QT4A 2Q6KA 5EERA 4JLKA 2XF8A 2O14A 4F1WA 1LK0A 3RU7A 4G63A 3DZIA 1GTL1 3ZGYA 2ZWVA 4MVXA 3A1UA 2IF0A 3PNMA 2GZ3A 3COVA 4TMKA 1N77A 3TQOA 2Q7XA 1DKNA 3RC9A 3C2QA 4WNYA 2VHWA 5IJAA 1CZHA 1JEYA 1KY5A 1IJEA 4KK4A 1EUCA 3RYHA 2O2YA 1QC5B 1V1RA 1N9ZA 3I6IA 3WRVA 3DKRA 2VH1A 1JJVA 3WWZA 1NTRA 1KIAA 3L4EA 3SBXA 4H6XA 3VMFA 3G2LA 4C7JA 2WWIA 4MRSA 5EQFA 4B31A 4FXOA 4CG1A 6NULA 3CC8A 4UVDA 3HFJA 3JYOA 2I6XA 3M6IA 4X90A 5BSKA 3EXFB 4M55A 1ZC4A 2W11A 4QJ4A 5EWJB 4E51A 2MDTA 2ZBPA 3I5AA 3BXFA 3PR2B 4QQRA 1QRRA 5CH8A 2PLAA 5CW2A 2CF6A 3N74A 1XALA 1OWPA 1MW8X 4H1WA 4S05A 3KDSE 3CLKA 1VE9A 3OE5A 2JGRA 2XB9A 3I12A 3IAAA 3AB3A 2QQFA 3PTAA 2ZI5A 4ZWNA 3NRBA 2WWYA 4C0HA 1G5FA 1ZI6A 2XYPA 2B0CA 1KK3A 2FX3A 3EDQA 1VHQA 3C43A 3GAZA 3OJWA 3RQIA 3TAHA 3W9SA 1NJ1A 2X86A 1XXLA 6LDHA 1V71A 3A25A 4WASA 2Q4OA 3LHFA 2GJ9A 1TJNA 4MWSA 5DYIA 3X2SA 3C39A 4C0XA 4ZFNA 1G0NA 3HR8A 2YWFA 1Y6ZA 4HOYA 5AUOB 3BXXA 1D2AA 3CVYA 1CUGA 4RZ3A 1NJGA 2FZEA 3OM9A 4NY1A 3F47A 3TVTA 5HKBA 1H8HA 2CD9A 4RL6A 2QE6A 1M9NA 2JFXA 3JD2A 3RS2A 3G2PA 3GWZA 3KB6A 3T06B 1QRAA 2Y0BA 3PHGA 3S27A 5FNVF 3ZBTA 2N3ZA 5JSFA 4KL8S 3AO0B 3I1JA 3BGOS 3DE4X 4D8TA 2DR0A 1L5ZA 1KS2A 3G2HA 5BURA 3PA8A 3Q72A 3TIVA 4KX3A 4TMYA 3N8GA 3R5HA 5TC4A 5TMEA 1J1UA 1E4EA 3W9YA 4X54A 1L9KA 2AZTA 1MF7A 4AKTA 1OE0A 2NUTA 1XKLA 4CMJA 3VC7A 2PPVA 1RPAA 4E6PA 1A4UA 3AFGA 4B3XA 3STXA 4NBTA 4WN3A 4CFSA 3CBGA 1UOEA 2R65A 2EQ5A 2XDYA 4C6SA 4FDTA 3LQFA 2C61A 5IWAB 4BMVA 5ALIA 2CHFA 1OVMA 1JH8A 1XNHA 2P9CA 3KOYA 4W4T<