1TK2A

Crystal structure of the complex formed between alkaline proteinase savinase and gramicidin s at 1.5a resolution
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/antibiotic
molecule keywords SUBTILISIN SAVINASE
publication title Crystal Structure of the Complex Formed between Alkaline Proteinase Savinase and Gramicidin S at 1.5A Resolution.
rcsb
total genus 99
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1tk2A00
2X8JA 1ST3A 1KE1A 1TO1E 5K7SA 1EGQA 5ARCA 1TM3E 1CSEE 1TM4E 4M1ZA 2XTJA 5JMOA 1T1GA 1WSDA 3VSBA 4NMXB 3DDZX 2PRKA 3GCXA 2Z2YA 4B5LA 4RYDA 4LVNA 1S02A 5JXGA 4NE7A 1C3LA 3ZXXA 1CNMA 3VHQA 3F7MA 2WUWE 1WVMA 4DWWA 1GCIA 1Y48E 5I9SA 4OV6B 3VV2A 4CFZA 1SIBE 1BH6A 1PEKE 1SUPA 3DVSX 3GT3A 1S01A 1SCNE 2X8JB 3WIVA 3F7OA 1TK2A 1IC6A 2G4VA 2SBTA 4DZTA 5B1DA 1JEAA 3DE6X 1SIUA 4GI3A 3D43A 3DE5X 1SUBA 1DBIA 3HJRA 3QTLA 1GA6A 1YJBA 4OMCA 3PTLA 1AU9A 1OT5A 2TECE 1GTG1 1SBIA 5B1EA 4K8RB 5ARBA 2QTWB 1AF4A 3L1KA 4I0WB 1R0RE 1C9NA 3BGOS 1A2QA 2ST1A 3OSZA 3CO0S 2W2OA 3DE3X 1C9MA 1KDZA 1Y4DE 2IY9A 2Z57A 2P4EA 4KPGA 2IXTA 1R6VA 1BFKA 3VYVA 4H6WA 1OYVA 5CW1A 2ZRQA 1SBTA 3Q5GA 5AQEA 1TO2E 1Y9ZA 2WUVA 3AFGA 2ZWOA 3EIFA 3DVRX 3EDYA 1BE6A 2SECE 2Z30A 4LVOA 4MZDA 1Y1KE 1KDVA 3A3OA 1YJCA 3A3NA 1P8JA 3I2YX 4AKTA 1TM1E 1MEEA 1Y33E 5JXIA 1TECE 1GT91 1Y34E 1GNSA 1UBNA 1WMDA 2E1PA 2WWTA 1SBNE 4NE9A 1ZVKA 1KDYA 1IAVA 3LXUX 2PWAA 3DE4X 1GA4A 3VTAA 3D9QX 3QFHA 1AK9A 1S2NA 3DW3X 5FFNA 5AVKA 1YJAA 3T41A 1GNVA 5FBZA 3GT4A 1PFGA 3I30X 1SCBA 5AMXA 1SH7A 3DE7X 1SCDA 1Q5PA 2SNIE 4WOBA 1GA1A 3TI9A 1TM7E 4HVLA 4FONA 4DJ5X 1T1IA 2Z2XA 3TECE 4H6VA 1KE2A 1SUEA 1SCAA 3WIUA 4HX2A 5AVJA 4ZARA 2Z56A 1Y4AE 3SQOA 1SBCA 2HD4A 4JP8A 3H42B 1PTKA 1DUIA 1EA7A 1WMEA 1V6CA 1GTJ1 3Q40A 1SBHA 4H6XA 1R64A 1BE8A 3AJ8A 1NDUA 1MPTA 2WV7A 3EE6A 3GCWA 2XRMA 1Y3CE 2ZWPA 3SICE 1SUDA 2ID8A 1NLUA 1GTL1 1BFUA 1SELA 3LPAA 3WQBA 1P7WA 2PYZA 1LW6E 4CFYA 3AJ9A 3QMPA 1THMA 4AKSA 1VSBA 1HT3A 3DW1X 4Z2AA 5JXJA 1TM5E 1P7VA 1SUAA 2PQ2A 3P5BA 3PRKE 1WMFA 3BPSA 3BX1A 1SPBS 3ZXYA 4YN3A 3A3PA 4OMDA 4BWGA 2ID4A 1YU6A 3DE0X 5JXHA 2DUJA 1SCJA 1AV7A 2PKCA 2Z2ZA 3LPCA 2B6NA 2PMWB 1SN7A 3DWEX 3I34X 1SUCA 1Y3FE 3TI7A 2GKOA 1C9JA 1BJRE 4CG0A 1NDQA 4KB5A 1V5IA 1XF1A 1SIOA 1T1EA 2SICE 2Z58A 2W2NA 3VV3A 3DVQX 1Y3DE 4ZOQI 3DYBA 1ZVJA 4WOCA 3I37X 1Y3BE 2W2MA 3LPDA 1ST2A 5SICE 4C3VA 1AH2A 1PJ8A 2V8BA 4J94A 2PWBA 3WHIA 4C3UA 2W2QA 3DE2X 3DE1X 2HPZA 5FAXA 2W2PA 3F49S 2DQKA 3UNXA 5ARDA 1AQNA 1OYOA 1AVTA 1SVNA 2DP4E 4KG7A 1TMGE 3CNQS
chains in the Genus database with same CATH superfamily
5MFZA 1P45A 1JE0A 3OEHD 4DF3A 1S8OA 3ZLBA 3DHYA 2G7ZA 1BJTA 3F0TA 2WQZA 3B7GA 4AX8A 3JQDA 1U0GA 4GO1A 4L4SA 2XLCA 4JVMA 5EEGA 3C74A 2QP4A 3NGMA 3E70C 2I7CA 1USWA 3TIGA 5IVPA 2A6PA 3DA8A 3KJXA 3UK6A 2WINI 3R74A 2XOXA 2AYYA 3JZAA 1GUDA 4MUHA 3OPMA 1U5CA 1V3TA 2EZ4A 3OQHA 1TTPB 4RA9B 1E2NA 4MHTA 1CE8A 5KQRA 3U7IA 1Q74A 2O8BB 4GLLA 4C0AC 4FR5A 1VDZA 3DVLA 1JAIA 2HM7A 1RCUA 1DGQA 3FIUA 3LUAA 5DCUA 2WB2A 2HTEA 1L7QA 3GRPA 4I4NA 3UWMA 5EC8A 3C24A 4UAJA 1NR1A 1ULHA 2B2CA 3AH8A 4LJKA 4ENSA 2GN2A 1FJXA 4XLTA 5EKDA 4B3HA 3GVHA 4POAA 3ZS8A 1U1GA 3JW8A 1YHYA 4IG9A 1F4VA 2JJYA 4RM2A 3IRVA 1IL0A 3KJQA 2W2KA 4I14A 2BL4A 4YRLA 1JHVA 3H4VA 1QIIA 4LZNA 4OHBA 2RK3A 5BWCA 3ZJUA 2X7JA 1C3EA 3G49A 1V25A 1VI5A 1CY8A 2XQKA 1ZL2A 2O7RA 2QLMA 3O47A 4H59A 4DRXB 2IQIA 1NGSA 1GGMA 3REGA 3T34A 4P80A 2R7KA 4KGXA 1BGWA 1RRGA 1V8ZA 4IXNA 3WMWA 3NDBB 3HDTA 3Q9LA 3LUPA 4BGDA 2NUAA 4TSFD 1DADA 5AICA 3CKKA 2F62A 3KLPX 2XVAA 4XDHA 4YUXA 1NBAA 4FOPA 1Y89A 5ECWA 4C0BA 5B3KA 2ZYHA 4NCJA 3V7FA 3NUZA 5CT8A 9LDBA 2C00A 4L4YA 3GPDG 4BX8A 4OREX 4KRGA 3A6LA 1D5WA 1CRWG 4REQA 4O1MA 4E5KA 5FLXA 1UFOA 2GHIA 2MT9A 2W2VA 3R3ZA 1SCIA 4RSGA 4YONB 3QKSA 4BJHB 5JARA 3D0KA 4C01A 3FCEA 5I7RA 1L7XA 5E4JA 2RHJA 1YVEI 5KVVA 5LQJA 5J5CA 2JGMA 5C34B 1BWPA 4NBVA 2PH5A 2XDWA 1W7AA 4QO8A 1HE8B 1BD4A 4AC9A 4C29A 2J5BA 4M0LA 4G1CA 1U9IA 3BULA 3ND9A 2ZSKA 1GRQA 4F4HA 3FMPB 3H5VA 4PWZA 3CSUA 3K6KA 3WIVA 4KNVA 3PUHA 5BN4A 3VOAA 3DUFB 4RPJA 1NBEA 5J4HA 4EZIA 1W2WB 1RI1A 1VJCA 2ZDHA 1DAOA 3ID6C 3R5HA 3RREA 4TMFA 3TBKA 5CXUA 2O8FA 5AJUA 2SBTA 1CUUA 2B3DA 1TTTA 1QRDA 2OL4A 3OIFA 1SK8A 2P9CA 4XD2A 3T5BA 4AYWA 4OH7A 5EJ6A 3K3PA 1O6FA 1PDVA 4ZEMA 2PKRA 5JD5A 4ZODA 2EJUA 1PR6A 1P5HA 3QEMA 2GCGA 3KSDO 4JU8A 4TMZA 1R00A 4DVGA 1F7VA 4R1OA 1R0XA 2EWWA 3OUUA 3SHQA 1NXSA 2PIAA 3VSDA 5F7XA 1DOHA 1FRQA 5DGHA 3E4DA 4R8SA 3G17A 1JIQA 4S3MA 1P0IA 2RH8A 2BFDB 1HPLA 3DH0A 4D2IA 1W6RA 3WISA 3PC7A 4KCGA 1ESMA 4GG1A 3GCDA 2O8EA 1F0NA 4RE5A 1MC8A 2ZRIA 3VVLA 3ZWWA 4UVEA 2C4KA 1Q3KA 1VE7A 3OICA 3S8MA 2JAQA 2VDWA 2WQ6A 4II7A 3IQGX 5DYIA 4K26A 4ASUA 1TRHA 5DI3A 3H99A 4GL4A 3TJZA 4EECA 5J4KA 3T06B 3BGOS 2GPTA 3VXKA 4FYIA 3VU8A 1GZHB 4HYEA 1EZ4A 3PVSA 3X1MA 3L18A 5KJ1A 4MEJA 4LDZA 1OZFA 1Q17A 4TMVA 3ZI4A 4D9CA 4WCFC 5G40A 3QE4A 1E4YA 1YR3A 5K3FA 1AZWA 4HVTA 2IXTA 5LKAA 5M34A 3HB4X 2JGRA 2GZ1A 4HN9A 2Y4OA 2UKDA 3LDUA 4UD2A 4AZ0B 3OWHA 5AESA 3VGJA 3NM6B 1RD4A 2ZJ3A 4CKEA 3CTMA 3D1JA 1OA1A 4G0PA 4R4JA 1QCDA 1UQUA 1FZTA 3GJTA 7ABPA 2HHCA 3L8GA 4MICA 3VC3A 1QO0A 1E2EA 2FOXA 3LECA 1KERA 4CQNA 5L45A 2DFPA 2IL1A 2XECA 4KSYA 5FP0A 2H2WA 3SS8A 3ZWDA 3CVUA 1QVAA 2NZ8A 4CCYA 1TCCA 3DAGA 2CXRA 4PZPA 2XSZA 1FCJA 1CHNA 2XBLA 1HKHA 4OIMA 4RS3A 5A4FS 2F2TA 5E3JA 5FJJA 2BMDA 2G6BA 3VYRB 4C4AA 2YZMA 2RG7A 4J0QA 2OBXA 3UB3A 1FRFS 1YE8A 5K3SA 4JZYA 1TX4B 1YBMA 5EWLB 4DYHA 1B76A 3EXIA 1Q95A 4I55A 5G1OA 1RQPA 4UHJA 1KDVA 2QUJA 4LZAA 3WOVA 3NHMA 3OCVA 3JD4A 4QJIA 3MWLA 3KQHA 2BZ1A 3T95A 1GNPA 2DUNA 4LMBA 1TT7A 2V96A 3EC7A 2VZLA 2OD9A 1PEDA 3N59A 2PMKA 4KEAA 4RFLA 3WLLA 2FZGA 4AFNA 1WKCA 4K9SA 2TYSB 4FLMA 1GL7A 4RJIA 5K51A 3O4GA 4QYIB 1OXTA 1JXMA 1FDRA 3FBGA 3CPHA 1UJNA 1BN6A 2DFVA 2JIOA 2Z4TA 1QOQB 3Q8MA 4Q3BA 3HZZA 1C50A 4N4AA 3UC5A 2DR0A 3LQRA 3TIXB 1QH8B 4J0EA 4EY3A 2XNSA 1GTMA 3E9DA 4W1QA 4OHVA 1X7ZB 3P7MA 1IOZA 4NXMB 2XUJA 1WMDA 1U31A 2I29A 1CZOA 3CNHA 3V1UA 2WWTA 3HBLA 4OJKA 1E7WA 2O0JA 1IAVA 1XZ8A 3KRTA 5KTOA 4DR6B 2CF6A 3LCUA 4GP7A 2H59A 4HUQB 1T5TA 2PWAA 2ZXFA 3DVAA 3G1TA 4WPGA 3EFOA 4ZJZA 3REFA 3V33A 4TM7A 5GZ3A 5HQ3A 1KO4A 2EBWA 2ZRGA 3OQBA 4LDJA 4LRWA 4C7BA 3TL6A 1E59A 3WADA 1Q3TA 1QHYA 4JDPA 1EQAA 1ODSA 1WV1A 2WD8A 3KE9A 1NJSA 2N47A 1OLUB 2IYWA 3L8ZA 4UAGA 2ZB3A 4URFA 5AUNB 2CV0A 1F5NA 1YL7A 1SKQA 2ICAA 5KNDH 4XGKA 4AF6A 4XGQA 1YTLA 3P4XA 4XOIA 2XF8A 1UJ5A 2OCBA 2VYCA 1QDUA 4IV8A 4MZXA 2OFOA 2HTFA 4WY8A 1EGHA 4CTOA 1SH7A 3SNKA 5ADWA 1ZU5A 5TMPA 2WHPB 3K09C 1PWYE 2XZOA 2QGNA 4HPJB 2DHCA 4CL3A 1R8XA 1QFXA 1TYCA 4IIXA 4F9GA 1F2TB 3TRKA 1D2EA 4C9BA 4KLZA 3GMSA 4AK9A 4PVDA 3TLBA 2UZ4A 1VSVA 2ZYRA 3FZEA 4I1VA 4KQXA 1WOMA 3W6ZA 4B9EA 5HS4A 4IF4A 2K7ZA 4JHLA 2ZBGA 3B13B 4DMGA 1HDCA 1KBOA 2EYQA 3V6LA 1DBQA 2UZIR 2B35A 2CDBA 1PEYA 1H66A 3IVMA 1TM7E 2VTKA 3I9JA 3KPVA 3MQ4A 2PBFA 5GADl 5HKLA 2QD2A 1L4BA 1JLLA 5CLGA 2J3EA 4G36A 3EZ7A 1DCFA 2IDJA 3U6KA 4F6LA 5CCXA 5A6VA 4ENQA 4ZEOA 3H5IA 5ALYA 3GQVA 2KS6A 3HWRA 3KXPA 1H4SA 1LVHA 3S1AB 1DC3A 3NJ4A 3VNAA 2VNSA 2XITA 1P7PA 5SZJA 1DRKA 3BD9A 3H9JA 4IVPA 1EG2A 4B84A 2FEMA 3NJ8A 1UBGA 2AXPA 1CHDA 5M5BA 2YL2A 2UZ1A 2VJYA 5ELMA 3K5HA 3WE7A 4WBNF 5JNLA 2Q0QA 4Z53A 1CDEA 1K1EA 1LPPA 3TQFA 1SQGA 1BA2A 3GLSA 1IQ0A 4BNVA 4QL3A 5IWAB 4TXNA 2ZWIA 5F2NA 1UP4A 1ZNXA 1J2YA 3GJ4A 3D8BA 5GQSA 3FNGA 4QXMA 4A23A 4YACA 4O2AF 3OUZA 1MO2A 1PK7A 1G6Q1 3WB9A 3B52X 3RBXA 1T26A 3IE2A 1FUYB 2AOTA 1P2GA 1LDGA 2ZUVA 4DY4A 3WWOA 4C78A 5DT2A 1Q7BA 3M6FA 1U7TA 3V7UA 4QWWA 3V2UA 1VL8A 3V8PA 3CHYA 2JC3A 4PZUA 3SJ7A 2W90A 1WDKA 3B1FA 2VQ6A 2YZ2A 3JD1A 5EG5A 3U39A 2OCLA 1VSTA 3KFXA 5FWDA 3KP1A 1N7JA 4KWTA 2A30A 4G07A 2PGXA 3I5UA 4NF2A 4OXRA 5FNZA 1BN7A 4FILA 4ZTZB 1R64A 2V5VA 3DZDA 1ZC3A 3VPCA 4B48A 5EVJA 4K9DA 1NYRA 2QE7A 4FN5A 5C5CA 4KV9A 3ZS9A 3ZOZA 3O9ZA 4IYJA 3EZLA 4IEEA 4DG5A 1SHLA 1YNOA 1D2HA 3MTEA 4UMEA 4X1KA 3MYRA 2IYFA 3LCCA 5E9JA 3EC2A 3E23A 5ES3A 1TZ2A 4V0QA 3VR3A 2VOJA 1PHPA 2ECKA 4AY6A 3AERA 1Y3CE 1QHHB 4JEMA 2JGNA 2ZTVA 2BTEA 1Y98A 3DBLA 3H2KA 3MFYA 3ZE9A 4ZYTA 4BLWA 1YA6A 2FDCA 1RJWA 4PLGA 3HJFA 1P80A 1HDIA 5KC9A 4RANA 3L4SO 4M1MA 3ZWAA 4DMCA 1PDWA 1GGNA 2RKWA 3PFFA 2CLOB 1EA5A 1H5QA 4RA6B 5EYPB 4ZKEA 2OV1A 2ODNA 3TNYA 5LD2B 4Y6PA 5T4FA 5DM0A 1ATZA 4H3VA 2HIMA 3CRNA 3WYGA 4D0SA 3F96A 5KNBH 2H92A 4JJGA 2G7MC 5AI6A 5A02A 2BJVA 3EEBA 2XYVA 5EWMA 5IAKA 1GPWB 1WCYA 3DBVO 4ER7A 1UBLS 1YR6A 2CFOA 4WZBE 2ZB4A 2JLQA 2HJHA 2WOJA 4DQ0A 2BMAA 2E4UA 5I7SA 1RLJA 4ZVKA 3AEUB 5IBCA 3ROPA 4ZCLA 2ZCJA 1A97A 1CJCA 1Z28A 2BFFB 2PVPA 2YMLA 4HXYA 4J3JA 5DNWA 1P3JA 4DMKA 3AT1A 5DNUA 4Y98A 1LTHR 2LV8A 3KEGA 4CEHA 2YMMA 3BSSA 1IAQA 3AQ4A 2KSQA 2A9RA 3HBFA 2PANA 1Y1SA 1YR2A 4BIMA 3WK8A 1HOTA 1W94A 2OYCA 4Q1BA 1PLJA 4EGFA 3PJDA 1GTVA 3ZU6A 3CUKA 3KR9A 1F3OA 4ZT2A 1ZX1A 2LW7A 1KVSA 2VHEA 1IYZA 4OB8A 3V4FA 3AF6A 4Y2XA 3KSAC 1B74A 3QPAA 2XWQA 1M2VB 1HE4A 2CHVA 1OASA 3RU7A 1OBHA 2I9KA 3PIDA 3EC1A 4EHIA 3FNBA 4K46A 3C5CA 4HD8A 1XKTA 3T1NA 4OL0A 3TUIC 1QLHA 2C54A 2ZE8A 4EMTA 2WICA 1UQRA 1L7RA 4Y1EA 2D2VA 2CLIB 3X1KA 2YZ7A 3SYLA 1N6LA 2HFKA 2YZGA 3EXHA 4PIMA 3ZCPA 2P6UA 4YI5A 4RPGA 4F5WA 3ZTYA 4R71A 2BMWA 4L0DA 2YWXA 1JQKA 4UEWA 5D6OA 3EFEA 3ICVA 4U63A 4CV0A 3NHWA 1U8YA 4L6CA 3J81k 9ABPA 3KKOA 4D56A 1A4XA 2AX4A 4HGRA 2XUPA 4PZDA 1LWOA 2CHFA 1K5GA 2ZSBA 2BKUA 1GN8A 5DLYA 3T7KA 3JQGB 3O73A 4LXXA 1AGYA 1EYZA 2AMYA 3I1JA 4WKCA 3PI7A 4K6KA 2FUEA 4NQZA 4A0GA 2AR9A 1OLOA 1R7RA 1RM4A 1UDWA 1YBFA 3D4NA 3HNOA 3IR6A 3ORYA 4BKRA 4ZI2A 3D8HA 4J7UA 1V7ZA 2FE1A 4EATA 4XXHA 4J91A 4Y6SA 4WKBA 1URPA 1JDZA 1JFRA 1UJMA 4FC6A 5L3QA 4LCJA 3ZVNA 1ZIXA 1HGXA 2JFBA 3VR5H 3K0AB 5FORA 4Z9AA 4F8JA 1L5MA 1GL6A 2VSOA 2QN2A 2OQ2A 3CR7A 3DVQX 4P34A 3O4HA 4TKUA 1JTVA 5G4LA 2W42A 2WAYA 5KQSA 2GJSA 4CV1A 1N2CE 2PSHA 3P9SA 4GZMA 3VZRA 1GLNA 1YRYE 3AKCA 4KJZA 4LW8A 1P2SA 4YMSA 1FYDA 1XTPA 3MJRA 1JHZA 1NUTA 2W2MA 3OCXA 4FS8A 4Q16A 3U3MA 2PRYA 1J2JA 1L2TA 1ST2A 2EERA 1CYEA 1IOWA 3DP9A 2ZQYA 4S35A 4V0RA 1FDSA 2VBGA 4FEEA 2BRUC 5C7LO 4LXUA 2WVAA 2P2NA 2XA9A 3KIPA 4JP2A 4C7XA 3FNHA 5J2TA 2H1HA 5B2ZA 1ZMTA 4FEYA 5LKRA 4QAQA 4TXMA 1I9CA 2W2QA 2PT5A 3TAHA 3G0HA 2OGSA 1DFIA 3O26A 5JPIA 4F4FA 3OOHA 1E9FA 5FA5A 4UVIA 3KLMX 1WPRA 2FSPA 3HUEA 5D3MB 5J9FA 5DN6A 4B5KA 1EKXA 1WQ4A 4QASA 5JI3E 1JHOA 1FQOA 3VZSA 5A2GA 1I1HA 1CY6A 4XUCA 2ECFA 2HBZA 3I9KA 4QJ4A 5JY6A 4WUTA 3MQ2A 2ZI3A 3EXFB 3TG2A 3JARB 4JWKA 4K1XA 1PJ4A 2QQFA 3JYHA 2AL7A 4QECA 4HAWA 1WCIB 3FDXA 1UKYA 5HFJA 1G21B 3PQ7A 4LX0A 4EG7A 5LFAA 4HRVA 5CIYA 1NJGA 3EGDB 4H7KA 5HIIA 5DBHX 4Y2YA 1RAFA 2JH3A 1D07A 2YOFA 2YCBA 1CEXA 1KSFX 1PR3A 4G5YA 5E4TA 2K4MA 3CW8X 5WRFA 5A3RA 3AVVA 1GAXA 1BHO1 3QVTA 2AN1A 1RMQA 2FEOA 5IU6A 5FUMA 1FVXA 3SE0A 2QTTA 2QKYA 1AUXA 4FX5A 4LY6A 3IDQA 4XQ0A 3IXLA 1IPEA 1UPCA 2C58A 2QVYX 1CQJA 3UWKA 5FUQA 1XR3A 1WXWA 3PUWA 2IE0A 3NG1A 3TSAA 3K70B 3DBRB 1MA0A 1G20E 2VKTA 5K20A 1WDWB 1RZVA 3MM4A 4MV1A 5A4DA 3THXB 3K2EA 4B79A 3HJNA 1PV1A 3GQBA 4TYPA 4YH1A 4A91A 2AVDA 1DAFA 2ERYA 1QOPB 4KH1A 5ALXA 3DDZX 3Q41A 4CM7A 2XVYA 4ES6A 5ITVA 5BW5A 5AKHA 4FWBA 3MWGA 2BW0A 3E2IA 1XMVA 3BXXA 4JLMA 4KN9S 3UFBA 2I91A 1NFQA 3OU2A 3SNHA 3WQRA 1F48A 5JAMA 4FYKA 2AC4A 3QEBZ 3B38A 1VYVA 5LQSA 4IXTA 1QBGA 4EB6B 2P68A 4TTRA 2HEGA 1P72A 3E9NA 4ZOEA 3V1YA 2FR8C 3DT6A 2HHAA 3TXYA 5HKOA 2E5WA 2WP0A 3SLGA 1Y3IA 3DF7A 3IJ5A 4WNAB 3PQDA 4LDNA 5MN4A 3MRTA 4PCVA 2IIPA 2JEOA 4FE7A 4LC1A 4TVKA 1DFGA 3S2FA 3W8EA 2O2XA 4GWGA 4PC6A 1D3AA 3H9CA 4GYYA 3OPYB 4D3DA 3RT1A 4IX1A 4BVGA 2PJZA 1KEEB 2V9ZA 2DFKB 3GJYA 3O9MA 4F9FA 3FDIA 1RDFA 4YJ2F 1JJBA 1HORA 1AKRA 2PWZA 3EG9A 1C8KA 2Z2IA 3NVAA 4FFSA 4AU1A 4CFZA 4F45A 2OSBA 5MFPA 1IULA 1GPNA 1NBHA 2CJFA 2Q99A 3GGGA 4IHQA 4FMDF 4RJLA 4JOCA 3BD7A 4IFTA 4BFXA 2OORC 3GT3A 5GJBA 2HRBA 4IJMA 4ZAGA 5ER6A 5SV2A 1L5RA 4NH0A 1LJUA 5C8XA 2D2EA 3D6JA 3AJAA 3E3OA 2C77A 4FFVA 4AG6A 2B61A 2X9VA 3QU2A 3NTRA 3SGLA 2JBWA 2QQEA 3LPLA 3AVTA 1KAGA 2BM0A 1TK2A 1DBWA 4RDXA 3U7GA 1VHJA 1ZICA 4RETA 1QG2A 5H70A 1W8DA 5B1DA 3KKLA 2A1UB 1YCGA 1IJEA 2EVWX 3DBOB 2V7PA 3KHTA 4MCJA 5C31A 3WKDA 3EOZA 1ODKA 2HUNA 4J16C 1JFVA 5I45A 1GUBA 2UYCA 1CJBA 3CWZA 3BVPA 3QTLA 5IJ0A 1FFGA 1C7IA 1U9JA 3HYTA 3P9QA 3P27A 1HY3A 5TNXA 3CLUD 1DXYA 3K9CA 3IMFA 1DXOA 1XD2A 3NTVA 4CM4B 4RHCA 4S1WA 3MAGA 1U3UA 3TR6A 4H60A 4KOAA 4OKSA 1UZUA 4RL6A 1A5SB 4Q34A 2CFIA 3E27A 5AK3A 4CL2A 3ECSA 5TQ2A 1F7UA 4DOMA 3NWPA 3U49A 4CKWB 5GGYA 1Y5IA 2OFXA 2C8JA 3KR0A 4BOYA 3TLMA 3TD6A 2OG1A 4CM1A 2ODBA 1SBIA 4CN9A 5JRDS 4X6YA 4LFCB 2ZKLA 4W5WA 2ZIVB 5B1EA 1DARA 3ELUA 4ZGGA 4GPTA 5PGMA 1GNTA 5TMEA 2QSZA 4EW2A 3WTBA 2YTZA 1C7EA 2EKPA 4QUIA 1QCZA 4AROA 3RRZA 4FFLA 2OHFA 2HLHA 4E2WA 5A3QA 4MJ7A 4P32A 4PNEA 4YCNA 1TD9A 1KJQA 3A6DA 3MCTA 3FGNA 3H2GA 3KAJA 3GYBA 4P7JA 4Y2UA 1FTGA 2JRCA 3A6GA 3X2EA 5CFPA 1H6AA 1S2OA 1VGVA 4ABTA 3UMBA 5JSYA 2C8VA 3WLEA 3UJCA 3TIVA 4B0OA 2A9KA 3I6ZA 5AOVA 3HJBA 1NNUA 3A4YA 5DYTA 5AQEA 4OI2A 4KMSA 1VIAA 4L8GA 4U7HA 4GZ5A 5AXDA 2QXTA 4L5IA 1E9RA 1CKEA 2ZSJA 3EIFA 4IL5A 1II8B 5DSZA 5YASA 3UFXA 2CYAA 1K5PA 1BE6A 4J6EA 1LDBA 3BXPA 3LHIA 4GLFA 4C2BA 2HF7A 3R5TA 4ZVMA 2H51A 5CW2A 4YTEA 3S5JA 3ZQUA 2X23A 3CCBA 3IJEB 3L05A 1YSCA 3MWEB 5DTMA 1RC1A 3E2MA 5DULA 5FTKA 3N74A 1B8OA 4NDZA 3NAMA 4AZ3B 2YICA 2PUDA 2O4CA 4N1AA 1PIWA 1U5AA 2WG1A 3MBOA 5JISA 1N2XA 3WL4A 1E5QA 5EL0A 1MX1A 4E03A 4E2XA 5ADHA 2QZ4A 1E8DA 2J4CA 2QX9A 5BVHB 4MA4A 1SD1A 1D2NA 2VZ0A 3CXRA 1WPQA 1NSYA 4KQ2A 3OLVA 2V3VA 3LA6A 1ADGA 1NMYA 4W7SA 4ZZ2A 5IVHA 3H13A 2HT1A 1JEEA 3KDAA 4EB8A 3ZWXA 2VOEA 3BWBA 2H5LA 1EDZA 2X6QA 5FEUA 4QJBA 5LU9A 1EFTA 3HKDB 4AICA 3GFSA 4O02B 3Q2KA 3LVFO 1NVKA 5BNWA 3FNQA 2FY8A 1NXWA 4Q12A 3SSMA 3N8GA 3RFVA 2JLWA 1TFUA 2ZG6A 5CDTA 2Q3JA 3L0PA 3OZVA 3PNYA 1Q0TA 1MTOA 1NQUA 1VRWA 3MIZA 4Q7MB 1XAJA 2IEZA 2ZE5A 3E5NA 4IMJB 4QDXA 5DGCA 3L6UA 5HS6A 4NE9A 1M2OA 3L77A 3HM2A 2FUCA 2C3YA 2PLWA 3TLKA 2A92A 1XWIA 2PAFA 5HCIA 1GGHA 1V35A 1KMQA 4BQPA 3WRWA 1XNQB 3IAM1 4KLNA 5EWJB 3O8QB 2H8GA 2D8MA 3AGPA 3D9QX 3R44A 3SEQA 4C05A 4WX2B 3ZX4A 5L40A 2GN4A 3T9FA 5LQUA 1DQRA 5AHXA 1NUPA 1U7XA 4EKGA 4R1UA 3I9V6 2BFPA 5I4IA 4FFWA 2PJRA 1VMDA 1NXPA 2NU6B 4P5DA 1MIOA 3RUDA 3WTCA 3I6BA 4JBIA 1QVWA 2V0GA 5FBZA 2JHGA 3IDZA 4FZ3A 4V3BA 2ANCA 4ZGWA 3VVBA 4RTRA 5F21A 4R2XA 3NO4A 4MKZA 3H5WA 5AMXA 1W0KA 3IBTA 3ESZA 1MGPA 1EFCA 3DE7X 2VUTA 3NHJA 4HGPA 4B3TB 1ZYUA 3KTAA 4IDAA 1EUDB 1X74A 1PX2A 2DKFA 4RACA 5TJHA 2X58A 1AK1A 4QTTB 3EIQA 4MHSA 5AQ1A 4TL8A 3SIWA 1CUDA 4DQUA 1HQCA 4H08A 2P6OA 3VGPA 3NOXA 3DPUA 4PIPA 4RKQA 4NAUA 4HGNA 2NVOA 2QUZA 4OTZA 5ALZA 3VOBA 3DQPA 2BEKA 1J9ZA 1ZD5A 3EMKA 4BMXA 2AFHB 1CNFA 6GPBA 4TLAA 4BVLA 4PTLA 3I2FA 2FJ0A 4KWEA 3QPUA 3SU8A 5KNDD 5I7HA 1Y37A 4Y2JA 2CXHA 1UIMA 4JVOA 4PX9A 4I50F 1A8PA 2B34A 2QRUA 4IGAA 1PKEA 4F85A 1T4BA 3CRW1 1V11B 2FR0A 2HV8A 3BL8A 4FFPA 4QDUA 3GEDA 1P3DA 4NICA 2VJOA 3RNOA 3SYKA 2VT3A 3WYBA 1L6RA 1YK1A 2QW0X 4Q93A 3AHJA 4RZ2A 1PJTA 1S8AA 1MZVA 3NAQA 2PN1A 4Z51A 1UT5A 2HRZA 1PZHA 1J97A 1WL8A 4QBHA 1M34A 4G0OA 1CW2B 2I7DA 3BE4A 1SCAA 3IUJA 3DC2A 1Y8QA 2F43A 1R6BX 4G5RA 4JNCA 4EP1A 3TZQA 3FZNA 1S1CA 4DA0A 1TK3A 3S1SA 4G1MB 1R4NB 5HA5A 4S04A 3RTCA 4AN4A 2HOQA 2OQVA 6AT1A 1MJGA 1U3VA 4NZ9A 5CH3A 2B94A 4Q9DA 2R6DA 1UK8A 2NV6A 3BDIA 2JZNA 4AQ7A 1Z0DA 1B93A 2BFOA 1RWBA 2YXBA 4A03A 4X62B 2HD4A 1RVDA 3HCCA 3MBKA 1CP3A 3KYCB 1P9NA 4A8HA 4HO1X 1EE1A 4UU1A 1PTKA 1QTIA 5DNCA 4PLCA 4ZXFA 5AKXA 4OSEA 1ZK0A 2XIQA 5EESA 4O1IA 5F4BA 1TPZA 2GQ0A 3T7TA 5EJ7A 1MW8X 2BGMA 5HF9A 4FBMA 3NHSA 3BREA 1T36A 4HNRA 2UDPA 3W78A 2X5KO 3WMXA 4MAAA 1WHTA 1W1IA 1ECPA 4UTOA 1YR8A 4B8ZA 3LZCA 4ARZB 3H05A 3Q4GA 2QRZA 1S96A 3BMNB 4DG8A 5KNLA 1J5XA 4RW0A 4QUKA 1JBKA 1NX9A 5CHEA 3RAPR 4WN9B 3RJ5A 4RPKA 4UVDA 3SHTA 4CRWB 3ER8A 1COWD 1SHUX 3MG9A 4KTVE 4FGUA 3E0XA 4H6PA 3NM5A 4LWQA 4FKMA 3RBVA 4D4GA 1IWBB 1F5SA 2CL6X 1E6WA 2RHMA 2JW5A 3V3KA 1YVRA 4JHXA 1Q7CA 1X1SA 4QEZA 1KXZA 2VK8A 2PHZA 1QKJA 3O3OB 3OZRA 5E9AA 1I36A 4DJJA 1TJPB 2QT9A 2XOKD 5DASA 1EESA 5IHXA 2Y1WA 4LF6B 2AG5A 1GVHA 4FLFA 1XQYA 1H9CA 2CJYA 2OV8A 2OFFA 1W4LA 1K89A 1JEDA 4JSYA 4CFYA 1VFNA 5EZYA 3QMPA 3T9BA 3KDPA 2YH2A 3EB9A 4MSUA 3L84A 3A28A 3UH0A 3HFJA 5LZ4A 5CB8A 4MUBA 3AW8A 4EJ0A 2FZ4A 4Z7OB 5EKSA 2WFLB 1EE2A 5KHAA 1XZHA 4GUAA 3WZLA 3ENNA 5AP9A 4YIHA 1N2GA 5AOAA 1D09A 1QWSA 4IS2A 1GPMA 4Q4LA 1E3IA 4YBRA 1B6RA 3SIPA 1YRQA 3PDHA 5T67A 1PSZA 3GJ5A 4F38A 4X7MA 3P9KA 4HYYA 2A9JA 3R9XB 2FPSA 3ORHA 4YJ3F 3L0BA 1XE3A 4FFDA 3TQTA 4LYJA 5CPFA 1P29A 3MCUA 4P5PA 2C99A 4OHFA 1H8HD 4EG0A 3FTFA 2YHIA 3CEJA 3NNDA 4NG4A 2HWWA 1Y6JA 2QP3A 2ZREA 3EGEA 4D9KA 3IERA 2AKAB 4HH3C 1M1ZA 1EVJA 2HSWA 2I76A 4EB3A 4S05A 2PUCA 1JEOA 4MWBA 3LMKA 2RI6A 2CLMB 2BEVB 4ITUA 4B8WA 1XHEA 2ABWA 3AXSA 4N3CA 1EFPA 5FFMA 4PPNA 2IPXA 1V4BA 2AG1A 2VNKA 1HURA 2YY6A 3L1VA 3VUEA 4BWGA 5JYDA 1Z6XA 4C0HA 1MU0A 1FSGA 2CLCX 3GLHE 4YRRA 3THWA 1BHJA 1TVCA 3LUDA 3FTPA 1FBNA 4ER6A 4YRMA 1B73A 3RVMA 3VPBA 2PGIA 3L92A 4KN5A 3AU8A 1IJBA 1JYSA 4FMPA 4WNYA 3B6KA 5K0CA 4DR7B 3X2FA 2UUCB 3AHCA 4K6FA 1PD0A 1SCJA 2NQ8A 3IAXA 1JMYA 1P1JA 2C8LA 5ESDA 1Z5PA 4L78A 3JXEA 4DLLA 4D45A 1W4CA 3T0IA 2EBUA 2FMTA 4OHKA 4K9OA 3RC3A 2NTJA 2P79A 1WIWA 2YW2A 2COEA 4BN0A 2GARA 2J3QA 2VXYA 1JKXA 2ZBUA 4R9UC 4EBFA 1AB5A 4ZOLA 4OSOA 2BKXA 2QZZA 3BM5A 3QUSA 2PAAA 4UFOA 1L5GB 1BQ3A 1Z26A 2XZDA 1Z82A 3CXUA 4C6TA 5K0GA 1BJRE 1ISRA 1GPDG 4CG0A 2YVKA 1UP7A 3FWYA 5D86A 5KKAA 1XMPA 1UOPA 3KKZA 1N6KA 1XRNA 4EGQA 2P3SA 3HZRA 4YFYA 4CBVA 3C7DB 3GFGA 4GNRA 3GEMA 2QWXA 2GRJA 3F8SA 3KYIB 4J2TA 3FDZA 4OO3A 4IZHA 4BO9A 5A3JA 2V7UA 1L7OA 2ZSUA 2Z8ZA 4P08A 1A8QA 4BE4A 1H5UA 2NO9A 3JATB 3PICA 3GLVA 4RH1A 1V4NA 1REQA 1QS0A 2HU2A 4Z4QA 2EBHX 3T61A 3CLSD 4MAFA 2G77B 3X1JA 1GNRA 1TZMA 1ONBA 1X94A 4TS3A 3R7BA 1PR4A 4PG8A 5IUNC 2YIJA 1JXQA 3E53A 2P5YA 3RC1A 1JR3E 2VJMB 3BMOA 3C0KA 4KDFA 5L53A 2I6XA 2H1LA 3QUBA 1X1EA 1HTTA 4MUYA 3B6ZA 3KQUA 4HOYA 1YDEA 2FRXA 1Z4IA 3A58B 5A7GA 4ZHQF 1XTBA 3DE1X 2D74A 5CFZA 4NK5A 2AXNA 2F9LA 5DFAA 2H6EA 1CR0A 1NPTO 2HJRA 3WK4A 1K98A 1XDSA 1W47A 1TMKA 3L7DA 5D1HA 4YRBA 1J25A 2EGUA 5HHTA 1XJCA 4HNHA 5DTJA 4FVTA 4KZPA 1QM5A 3ZDBA 4GPD1 1YI8A 3BMQB 1PGNA 5DIZA 1OYOA 4KPFC 4B43A 1AVTA 1ND5A 3GD5A 4MCIA 5DPMA 3AVXA 4OHOA 5IRCD 4K28A 4RL4A 4TXHA 1J0DA 2IV2X 4A1FA 5AM5A 4NJMB 5TIIA 1Z4KA 5H81A 4W7IA 5CA1B 1V3QE 3MNFA 3ADCA 1N4AA 4RGVA 4LHYA 4UCFA 4XSHA 1UANA 2QRHA 3KOOA 1W5SA 2ZI7A 1SXGA 2FR8A 2A7XA 2PRJA 2V7VA 3ICCA 4AMGA 3TLEA 5EZ5A 3IEIA 3V55A 1T9BA 2IC5A 3O31A 3MT9A 3CLUC 2NSDA 1YOVA 3T54A 5IKMA 3PX7A 3F8WA 5EERA 1DUVG 4XM0A 3DAOA 1LX6A 4HI0E 1MTZA 2YYSA 3CLKA 1OJ7A 3HG7A 4F56A 1WCV1 2YDXA 3DYVA 5JYCA 2O8EB 1TFRA 1EFKA 3I12A 4NATA 3ITDA 5FWXA 5CPBA 4AY5A 4JI4B 1TA4A 2D3TA 3MLAA 3QMVA 1UM9B 2PGOA 3ZDQA 2OZKA 2Q1YA 3HJCA 4Q4HB 1Z7WA 3B8EA 4N76A 4G09A 4OFXA 4YMLA 5KOIA 2GD6A 2DC1A 2QYTA 2V5UA 4GP6A 5AH0A 4OJTA 4O4JB 4LHXA 2RGWA 3F3MA 2FSGA 1G7RA 2VHUA 4IOLA 1VYHA 2JJ1A 2IJGX 4ZCQA 4HZGA 4YUVA 4A27A 4HUJA 1T6XA 3DG9A 2E0IA 3SEAA 1B8UA 4ZALA 1WU8A 3PA8A 3FSGD 2EIHA 1A7AA 2CBGA 3CY6A 1NW7A 2P69A 4X85A 1WU7A 2HMTA 4GOXA 4HSGA 3GWZA 1YQXA 4F92B 4ZD6A 5BSWA 4LJLA 1AKTA 1ONSA 4EH1A 4ALIA 5FWYA 1SQ6A 1PBNA 3ISTA 3AWIA 2QSJA 1NI4A 3UZUA 1LK5A 4QX6A 2GK3A 1ORDA 4OX9B 1OUMA 1QC5B 1YC5A 1AQIA 2GAJA 4R2IA 1WXGA 5EE9A 5A4MS 4UBKA 2J7PA 1SIBE 2AK3A 1QQTA 4D42A 2GJAA 5L95A 4W5OA 5KMGB 3NUQA 3L8CA 3L41A 3N05A 4YXFA 1OROA 3DMTC 3ND5A 4P38A 4ZAXA 1HDGO 5T6BA 3RS2A 1ZMOA 2QJWA 2RKOA 3DKPA 3C6BA 4WQMA 4NENB 5D01A 1WULS 5SYNA 1LLQA 3FZQA 1NVTA 1UWVA 4TV8F 5EQDA 5HQTA 4WNCA 2NO7A 2AXQA 3KPWA 1V3UA 4TWRA 2ERCA 2Y92A 4LAFA 5K4AA 2GDZA 1L4LA 3DDOA 4RK1A 3QGMA 3SKYA 5BRJA 1P1FA 1T5SA 4US0R 4WLUA 1OX4B 1BQ4A 4EG5A 1GFWA 1OZHA 3A4MA 4XGRA 2W00A 3AB8A 4ZOQI 1NONA 3M4NA 3OEYA 4G5SA 2W48A 3H84A 3D7MA 4UUOA 3ODPA 4ZZ0A 2R751 3NHUA 1U6IA 1XRQA 4D25A 2F59A 1NN5A 3WMRA 3BOSA 4UM8B 3KJNA 4CCAA 3E9CA 4CU2A 4OMCA 1KVQA 3KM0A 2YS6A 3CLHA 4KV7A 3ZDDA 4F86A 2XODA 5HWSA 2B6HA 2PL9A 3STVA 3UHAA 2D7JA 2IV3A 3T6KA 1RXCA 2IPAB 4P9NA 1QF7A 2CEAA 3QEKA 4CKCA 1J07A 3HKCA 2R5NA 3FRHA 3F6CA 5JAIA 3MW8A 2XZLA 1W6UA 3OQIA 2AE2A 3H3JA 4BS9A 1PBTA 1M6VB 1NPYA 2C2GA 3L1KA 4I0WB 2LIVA 1ZUNA 3AR7A 3I0NA 3IIEA 1SKBA 1KIFA 2H7CA 4HV4A 3CO0S 4YMGA 1DQZA 1P4RA 3I53A 2ZUEA 3V4ZA 5L3RA 3GLIA 2B8WA 3H87A 3ROQA 4N40A 1ZR2A 2B4QA 4AS3A 1KR2A 4JJZA 5B3AA 2YJGA 4UBLA 2IDZA 5CBPA 5HOQA 1Q0SA 4HXFB 5AW5A 5TT0A 5EJEA 3O8NA 1L1RA 3UWSA 2HWKA 2QLFA 3FA2A 2OHIA 2EQ5A 5AVZA 1RKUA 2VDNB 3F1LA 5BN5B 4NYMQ 3BWVA 2Q2OA 1MQSA 2XWBF 2AW5A 3Q5GA 4ZQGA 3UBMA 2Q8QA 5H8WA 4UEKA 3S2YA 4ND8B 3H3FA 7REQA 2FJPA 4GOMD 5KNDA 3TPCA 1GDDA 2UZAA 3ER6A 1GVNB 2X8LA 5A7HA 4HDAA 4QRDA 1R5OA 5JATA 3ZUPA 4TKLA 2DTXA 2WUFA 4MMZB 4HCJA 4XUEA 3FYDA 1GLGA 1KJYA 1UPAA 4R1MA 3LAWA 4UDYX 3MGBA 5TQJA 3RTGA 2YV4A 3LCRA 3RS0A 3CZCA 3FXAA 2JBAA 3VBEA 2GBLC 2JANA 4Y1FA 4KE8A 2F3TA 1YZLA 3ZCTA 2XMRA 3E05A 4G81A 1ZINA 1XJ5A 5F12A 3W05A 3C3DA 3MOIA 4PLHA 4D3FA 3UIEA 5JXIA 4QGGA 3PGKA 3OESA 1SZJG 4FJ1A 1OLSB 2ZS8A 2WNIA 3SS9X 2E89A 3WRYA 1N9GB 4B6FA 4AS1A 1GT91 5CU7A 4F4UA 3KUKA 3K8QA 2QJFA 1OH5A 1G38A 1B8VA 2WU1A 4GXQA 2GO7A 1N33B 3L1IA 4O2RA 3UXEA 3OX1A 2PZEA 1CRZA 3DDWA 3BGWA 2O2IA 2FSFA 4ZANA 3SE7A 4ZJUA 3WBJA 3MJFA 5AW8A 1OZ0A 2QBYA 5DW0A 5CAEB 3D8UA 5ILQA 3ZNOA 1NM5C 4GZ6A 2IQ5A 1M1YA 3DE4X 4L8FA 5E6RB 1IBRA 1XQ9A 1E9EA 3LCJA 3PNPA 3AXTA 4DTCA 5B7GA 1TYDE 2R1ZA 4BO1A 4LWOA 1DHRA 4BLOA 4E22A 1KI7A 5TPWB 4QGAA 1SK9A 1F0YA 4ZMRA 2NZVG 3U61B 4BY9E 4WT7A 3CU5A 3RDPA 1GNVA 1XN1A 1XWWA 4NTZA 1AO0A 3Q9NA 1Z5VA 3QPWA 2HBYA 2YWFA 3OBIA 4JJ4A 4ZT5A 3NEPX 4I1YA 3TZ6A 4CLOA 5LJLA 1QGYA 2YJNA 2POQX 3F6RA 1LDNA 2YN2A 1VRCA 5I7VA 4V39A 1G1AA 4QREA 4G4SO 1AKWA 2YXPX 5JQGA 4BFWA 3U5ZB 1EHCA 3LWBA 4G4IA 4DREA 3ENZA 2VKQA 2IEBA 3VSCA 3L5KA 1T9GS 1V2GA 5G4KB 5JFOA 3QLUA 3FVWA 4O3FA 1WZCA 1XHLA 5LA6F 2GVDC 4KR7A 3FOBA 4UVGA 1HG1A 3CX3A 5FR1A 5SY9A 2JZOA 5J23A 4TZ6A 1VE9A 1ZM9A 3C3EA 3MMZA 5BMOA 3INNA 2I80A 3OX4A 1MG5A 2PSJA 3I09A 4RY9A 5DK6A 5LLTA 1UMBB 4GPIB 4XYMA 4AJ1A 2GK7A 2JGDB 4U00A 4BECA 3RT7A 1U0OC 3ONVA 5B37A 2WG0A 1L1QA 1ODLA 3KX2A 4MV3A 5KQLA 1JN0A 1U80A 3D4IA 1Z07A 3SC2B 4L28A 3VR2D 1GDTA 4MKXA 4P3PA 4ECAA 2VJKA 2TMGA 3Q8KA 4DIDA 4S24A 1Y9AA 1ZHFA 3DLHA 1XXHA 3PG5A 1GR0A 3RRNA 1X7HA 2AEEA 2BP7B 4PYLA 1AA9A 3HBMA 3M89A 3PRYA 3PNMA 2RAUA 4R2WA 4QUDA 3LBIA 3UAVA 4CTKA 3EGXA 8LDHA 1LB1B 1XMIA 1YO6A 4YCDA 4PQEA 5KNBA 1JU3A 1Q7RA 5EZQA 1P1BA 1SXJA 4XPIB 3LY7A 2YJ4A 4MNTA 5JJCA 5DM2A 5HCUA 3RRBA 3G2PA 3T9EA 4HDMA 2HMWA 4HWKA 2UVPB 1M0EA 2CXNA 4V1CI 3NT2A 4RTPA 2J9RA 3TB6A 4INPA 1TF5A 5K09A 1WM1A 3SQOA 3TMYA 2OR3A 5KB3A 1RWMA 2XDQA 2PPLA 2FP4B 1SC9A 4UD6A 4QBKA 2VJLA 4GXTA 4C6HA 4QJ3A 2P4UA 4A0RA 4MJLA 2XUZA 3KELA 1ISHA 2WIGA 3M7IA 3N2GA 1N6HA 2QP9X 3DFMA 4LRTB 1FS6A 4CM9A 1UKBA 3KZNA 1BKYA 3IOYA 3W5IA 3R4VA 1DG1G 4JXXA 3NIBA 4XWAA 1FW6A 2XX3A 1I1OA 5CGZA 5LM3A 1XEAA 3KCQA 3K2IA 1VMKA 3Q40A 4Q1AA 4WZ6A 1B6TA 2PS0A 4KPUB 2V9CA 2XY4A 5E0KB 2BGKA 1RZ3A 1QGUA 1X77A 2BGJA 4ZAZA 1BE8A 3I5AA 4Q3OA 4CIDA 1VIYA 2H16A 2VTDA 2WMNB 1ULAA 5J1SB 1YUBA 2A35A 1GITA 1O8CA 3A6JA 3TLGB 5JRJA 1HLPA 3DAPA 4TN5A 4HB2A 3UAXA 3GJZA 3VHXA 1B41A 1MPTA 2HAEA 2WV7A 1V9SA 3LPNA 5LPNA 4AY4A 1OJLA 2IYRA 1WX1A 3MUEA 4WBXC 3WGYA 3SXUB 5CH5A 5JNRA 1V8PA 4Z5XA 2Q5IA 1FJ2A 3A4IA 3NC4A 2IHJA 3EIUA 1D04A 4QUEA 2EF1A 2J7KA 1J0AA 4PYQA 3TCKA 1R0KA 2BZGA 5FH9A 1WD7A 1UBKS 1KEZA 1DEAA 1F20A 1I80A 1J8QA 1Y0BA 3K6JA 2WMYA 1SGWA 4QBGB 4DYDA 4REMA 1YGYA 3QXSA 4H7JA 2B1JA 1EM6A 2PS1A 4LZWA 3RAJA 2HLDD 3L0DA 4H0CA 4MX8A 4FDVA 2EW2A 1W25A 2WDZA 3PKZA 4RFSA 3IILA 3UF0A 1DAMA 1RYBA 2IOYA 3IBGA 3HVRA 1LLCA 2Y1OA 2NX2A 3PA6A 1OWMA 4OB7A 2O2YA 4L9WA 4EA6A 3EBPA 3CLSC 3SOPA 4H4EA 2OHOA 2XZPA 3U9LA 4ZYWA 3OKAA 2E49A 4QM7A 1BG6A 4ND1A 2HCTA 1ZCAA 1J00A 1NLZA 3I73A 4B9AA 3GT0A 5EJ5A 4AY2A 1W85B 2GZRA 5AVVA 2Q9AA 3BWDD 1ISPA 1SUAA 3UN1A 1WSBA 2QM3A 2ZLBA 4A2PA 2P7HA 3LDHA 3DOUA 3ZDYB 3CPJB 2VK2A 3DMFA 4GBMA 4IOKA 5FNVA 4C4XA 1V1MA 3KKKA 1EXNA 5K05A 1MHTA 5FDFA 5H4GA 1MT3A 3OPYI 4RAQA 2XI4A 2AG0A 5KTYA 1ZSNA 1UBJS 4IDEA 2P35A 3T52A 2OO5C 3JX9A 3F90A 2VDVE 4WCDA 2RGRA 5B5SA 4QGHA 5JC1A 2VJNA 4TUYF 1SBZA 5ITZA 2W6JA 4BKMA 2G0AA 2GVNA 2XHEA 1XV5A 4X0EA 3F9RA 1QIKA 3RSGA 6ABPA 2BHNA 1SCUB 1KZ1A 4GDMA 4QU8A 2FPPA 5JSZA 1Y6QA 3SM3A 2FFRA 4AM8A 1TW2A 5C7OO 2CK3D 4JC5A 4LJSA 4X3PA 1ISMA 1NVFA 2BY4A 4XD7A 5DNDA 5D84A 4TT3D 1HNZB 2X0IA 1P5JA 5AJTA 4DILA 3ASZA 4X92A 2JGAA 1DU4A 4P1ZA 3N8HA 3W5HA 4OX9Y 2VPPA 3E1KA 1FSFA 3I2GA 5U4XA 5JDIA 2M2IA 5FULA 1OD6A 3CURA 1AQ6A 3DO5A 3VR4A 3REOA 1K2VN 2JCVA 3T0FA 3W2TA 1H6DA 1JWLA 5FPTA 5G41A 1C0PA 3GNSA 1SVIA 3GIWA 2DRIA 1E2FA 1A5BB 2HGZA 1E8NA 3ITEA 4JLKA 4MQFB 5K4HA 4J9UE 2P6MA 3UGJA 3TCXB 2Q29A 2WTBA 4WASA 3SS7X 3JWEA 1UXJA 3PDCA 4I6JA 1V48A 2EDAA 2FRVA 2VF2A 4R2JA 4TLEA 4COOA 4NARA 3UOAB 1T1EA 2SICE 2JNWA 2HKIA 2PYIA 3KWMA 3Q7TA 3QF4B 2KLHA 3I04A 2OBYA 2PUGA 3T7IA 1YDMA 1PNTA 2A94A 1K27A 5BW6B 2ACVA 1HYQA 3AVQA 2VYNA 4YAFA 4JA0A 2OXCA 3OCYA 3RTAA 3NC1C 1Z73A 3DNPA 4Q00A 1TJ5A 5DM60 2CVZA 5G02A 2EXXA 3FCXA 2D00A 4YMIA 3CNBA 1E18A 2LBPA 3TM4A 2FN4A 1E58A 1RHJA 5NULA 3IPAA 4FOOA 5NLLA 2B83A 2V8BA 4IFEA 5FJIA 2JI8A 2GHTA 4F46A 2GRAA 1Z35A 4ZK6A 1NUSA 4FP9A 1JMKC 2FXIA 3BCHA 2W6PA 3LDAA 4DUGA 5J3JA 3EEYA 1ADYA 1BX0A 1H8EA 1YV9A 1OI3A 1NUQA 3MOGA 3T7CA 3AEKA 1W8IA 2L17A 1E5LA 3VX3A 2RGGA 3KZVA 2J0UB 3QF7A 1UMCB 1TJYA 2H07A 1NLYA 2X8BA 4BE9A 4EHBA 1IQPA 2YQZA 3AY0A 3F49S 4NHEA 3WWDA 3ZCUA 5AIAA 5EQFA 5EGSA 4YR7A 5ARDA 3MILA 5AJWA 4XGNA 1AUQA 3B1WA 5DBIA 3GLRA 1F2UB 5IANA 3FJYA 2QX7A 4LZOA 2X0DA 4JBLA 2DP4E 3CLVA 3NP7A 4GMXA 2OHHA 4HXEB 3TOXA 1FK8A 3WL6A 4ARAA 2Q3FA 5A3VA 2R11A 1J9EA 1QK3A 3FN4A 2OPBA 4UARA 2A0WA 4ZVNA 4CLXA 4D9NA 2BE9A 1YHNA 3IALA 4OAQA 3W3AD 3HGMA 5LSAA 1OKKD 3K32A 2AMJA 4GGOA 4G4SP 1FDWA 4YP6A 2WUGA 5IC5A 4RGQA 3ZHSA 1EGQA 3C87A 4R8KA 4G24A 5FLKA 1GKLA 1YZFA 2CFCA 3DMGA 4OQLA 3RYTC 5T3YA 3SIXA 4A82A 1E1QD 4BWVA 4FEGA 1QHGA 1OBFO 2PQ6A 3CCFA 5KOHA 3QOWA 2W2LD 4Y2GA 4KWHA 3CB4A 2P2ZA 1HRKA 4Z7NB 1TT5A 1AV6A 2NZJA 4OA8A 5JZ9A 3NTLA 4MOWA 3OZDA 5J5AA 3L4KA 2C2BA 4BMCA 4URZR 1F4PA 2YJZA 2G17A 4EFLA 1HYBA 4OBEA 4E07A 3S2ZA 2JI7A 5DWDA 3G9UA 2Z2YA 3T3IA 5IP5A 1CK4A 4DSOA 1KQOA 1ICEA 4IHKA 2Q6IA 4B4OA 4B32A 5A5DA 1RNLA 3H18A 1LS6A 3WHLA 1T2EA 4I3HA 4YJGB 3B3FA 4JDUA 5G0WA 5IMBA 4KRFA 3N6RA 1IIBA 2IPNA 2I8CA 4QFMA 3W4JA 1NQXA 4XUDA 2JFZA 1HUQA 2R2AA 5DP1A 2E7ZA 2IIQA 2EF0A 3FKJA 2WYVA 4QOGA 4JD5A 1WNFA 1QDLB 1FZQA 3BKWA 3RARA 4A9AA 4G41A 2WSLA 3CZ5A 3SBEA 4OFWA 1UJ6A 4TKMA 1KU6A 1DP4A 1E7QA 4RWEA 5DBEX 4RD4A 3ZHUA 1DWPA 1NOIA 2H65A 3TW8B 1P62B 1H1LB 1AKYA 4BWFB 1Q0LA 2ZFUA 4IVQA 4L5BA 2R5WA 3F2VA 2HQ1A 4PF1A 1KVRA 5DYNA 3RIHA 1AJEA 4DWVA 2YW9A 3KPJA 4GWKA 4ZTUB 4UUQA 3ORSA 4FFBB 1KDPA 3CKLA 1PUJA 3PBKA 1EFRA 3LFUA 4JITA 3VSEA 2Q49A 4M0MA 3G23A 5EIEA 2ZI4A 2QMEA 1VJGA 4P54A 4UDOA 3U26A 5AK0A 2DTEA 3ILXA 1JT2A 3C8MA 3R3VA 2GKSA 4JI5B 3S99A 1FX1A 9LDTA 3TAUA 3D1LA 5H4HA 1MT0A 2ZVDA 4QBFA 4R2LA 4XCVA 5BWLA 2V1UA 5AK6A 3F3YA 1GGFA 2Q1WA 4EOGA 4DZTA 3VA7A 1IN4A 1TU3A 3TTWA 4E2ZA 1OSNA 1JB9A 2OGUA 1NL3A 4BASA 4V38A 4BGIA 2B4TO 4P7FA 3LZDA 4QTXA 3OWOA 4FJ0A 4HNAA 3WJ1A 3HRIA 2XNDA 3EUEA 2CDAA 1G41A 1KJ8A 1YE5A 1ZU4A 3GG2A 3ZQKA 4HNSA 5B3JC 5G53C 2JHPA 3ZLUA 4PLTA 4M2LA 1YJBA 2KBEA 4KO3S 4LNHA 1X42A 1DQYA 1ID8A 4OA5A 3DFKA 4O1HA 1PJBA 4JFAA 5TPZA 7GPBA 1P1RA 1IOVA 2BEUA 3EYAA 1WHSB 1ISIA 1OXBB 2YY5A 4MYDA 2OESA 4A6DA 1R0LA 1T2UA 2DHEA 3GARA 3TX2A 1RRKA 3CISA 3L79A 4MWGA 3DMNA 4Q9JA 4X94A 3HV2A 1SOUA 4YRFA 3E6AA 5JBNA 1R4MB 5J59A 1JPNA 1Y9DA 1GUFA 2Q0HA 2HRQA 4ND3A 1TAUA 2Q62A 2PFKA 2OOSA 3G5TA 1VPDA 1G4AE 1QYXA 3I2HA 1W0JD 4GOOD 5EKTA 4AKEA 3BDAA 4CMIB 1QG4A 2NXWA 1Z2EA 3DOEA 1L6IA 4R0VA 4YI3A 1XMSA 4EZBA 5LZ9A 3H1FA 1MDFA 3CX8A 3CUTA 2CVHA 3KAKA 2VH1A 4K9NA 4JMLA 3WP0A 4BZPA 5KWSA 3A6PC 5IKPA 2FDRA 1PWXA 4FUQA 5HE8A 1OYVA 3U31A 3F46A 3CTPA 3LUFA 3PC4A 3AV3A 4BQSA 4P3OA 4W9NC 3BB4A 1SUIA 1PWEA 5CA0F 3O95A 4M49A 3AL0C 2C3MA 3SYTA 1WSWA 1PR9A 1EJ2A 2QJTA 3AF2A 1NKSA 3BYZA 4RNDB 4V2IA 2C57A 3LVRE 1DMRA 4JP1A 3WS7A 2G1JA 1G55A 2IHUA 1KOGA 1UMDB 2GJ9A 3F7NA 2YHSA 3HCBA 2QVBA 1FU4A 2JKZA 3PNLA 3QU5A 1P5ZB 3A1WA 2IY7A 3IDAA 2MDTA 2PZGA 1J0BA 2ZK7A 4EL0A 3U7FB 4O2BA 1TLFA 4QGBA 3X3HA 1UUFA 1P8JA 1KI3A 2HRDA 3I2YX 3LRPA 2Q3BA 1KVTA 3FMOB 1W36B 3TSYA 2X0FA 4MMYB 4FYMA 4JLNA 1TECE 2AHOA 4W5QA 1HDYA 4AKHA 1ZDMA 2ZIUB 1LBSA 5MGBA 3RHTA 4M1QA 4UE6A 2EV9A 3KQNA 1RXUA 1EVKA 3ND8A 1DEOA 3OE7A 1XKXA 2B37A 1XTZA 2AVNA 2BISA 4IIBA 4U9HS 3GB9A 2OUIA 2QLTA 4RTQA 1UBNA 5JQWA 3EA0A 2MSWA 2JI4A 1KZ9A 1U2TA 2VUHB 3BZUA 3EH1A 3MFQA 4J4HA 3WXMA 1C1XB 3OO0A 2VAMA 4FW9A 2WJIA 4KBFA 5CFMA 1ISJA 1SD5A 2WF9A 3ANSA 1KDYA 3K6RA 5LNK1 3IO3A 2Q7XA 4NPCA 4I66A 3IDFA 2BFBA 1OGJA 1R3DA 5EJ8A 4IDQA 1IEVA 4QBIA 4W6ZA 3L0SA 4EO7A 4URWR 4Y9RA 3SBXA 1NAIA 5KREA 3KVVA 1VKOA 2ZYUX 1Z6QA 2B21A 5E1DA 5I51A 1KWKA 3P9YA 4B6GA 1G3UA 2FR1A 3UO8B 4F3KA 4IRMA 2HY7A 2DWOA 4RXMA 4R7TA 5J63A 4URYR 1YB1A 2ETVA 1WBDA 5CB4A 1I94B 3WL8A 2ATCA 3JZDA 3D3WA 4M1YA 4TWIA 1ZNZA 4WK6A 1TZCA 3S29A 1RRFA 3BRWA 2ATVA 4A5OA 3FTEA 2OZLA 2PIDA 2GRUA 3B2NA 2ZU0C 1PZNA 1UK9A 3A0RB 3FYUC 3PQFA 3LIPA 1QXSA 5I9MA 1EUCB 5K0NA 2OBBA 1JMVA 3OY7A 3ZWMA 1JHPA 4IQ8A 3ZLVA 4CG1A 1I4DD 3BCSA 3GMIA 3VX4A 1NG1A 2AJBA 1DJNA 5JG7A 4A1OA 3KQKA 1DKRA 3PJFA 2IY8A 1LSOA 1RM3A 2AJDA 3N5CA 4R1TA 3FBTA 1A1VA 4U7PB 1JHYA 5JCPA 2IXDA 2PEYA 4QQFA 3PFBA 5F3DA 2PBLA 2RK6A 3A8TA 4KJXA 4JP3A 4PZAA 5CXQA 2Z04A 3RIEA 2IOFA 1BWSA 2SKCA 2X1LA 2IXFA 3DTVD 3QV1A 1VYTA 5BMVF 2QDXA 3RU2A 3TGLA 1FMTA 5BQ5A 1AS3A 1UDRA 1WDMA 1IWPB 1P4JA 1U7UA 3PFNA 1EGMB 2PUTA 3R3WA 4Y2TA 2H0AA 4CKYA 4D6XA 3VR0A 4PNZA 2VP4A 2VAWA 5HOEA 5HZKA 3G9ZA 4MO2A 1TIPA 4PQYA 3R23A 3D02A 3Q3GE 2AG6A 3IUSA 3G0CA 2FX3A 3QLJA 4OIFA 4RMJA 4IGKA 4RMNA 4BE7B 2XBMA 4ZYZA 2HL6A 5FFFA 3MINB 4MEBA 2IU4A 1O0BA 2UVQA 1OFHA 4CQMB 6NULA 3STHA 5D3KA 3JQBC 1XNRB 1GKUB 4EEZA 2QXUA 4ARBA 2PS3A 1DJLA 3T8YA 4MKFA 3L2OB 1GTZA 5J2UF 5DN9A 2QMYA 5THQA 3T7DA 2XCUA 1Y8RB 1VECA 1DBPA 3BTVA 3K0KA 3PUJA 3QIVA 3H19A 2I3BA 5CR9A 2QOEA 2V6IA 4HZIA 3M2TA 3AWDA 2I4IA 4JP8A 4B3BA 3VISA 4MR7B 1E1RD 5AHOA 4DRZA 3L5OA 4C2AA 1ZUWA 4RUKA 1KMHB 2JA2A 1C41A 5AKGA 5LQKA 1FFHA 4HAIA 1PR0A 1IY2A 1NBMD 3V8RA 2BHTA 5EA2A 1O97D 1ZKDA 3TQCA 4RKFA 3JAKA 4DV0B 4QSHA 3LC7O 1E9DA 4HAYA 4JR2A 3NM4A 2G80A 2XJ9A 2OMKA 1DTWA 1HT1E 3JR3A 3TX6A 4E5YA 1P0CA 5D7NA 5T4HA 3UOWA 1RYMA 2WDPA 3AUUA 1SKAA 3GVIA 4YPOA 2WSMA 3AJ8A 4NONA 3ROZA 2ZBRA 1HZJA 3V8NA 5EHNA 4BUJA 1G5HA 1YZKA 2GFIA 2DZDA 2OWEA 2ASVA 2A78A 2CLFB 2EJCA 1ARZA 3CPEA 3SQMA 4E32A 4IHJA 4AJKA 3KQPA 1L5QA 5A62A 2IU0A 1ECBA 1GZ5A 2O50A 2W71A 3TGWA 5HKKD 3R76A 3IIJA 1JS1X 4OI1A 1J2RA 4ZKDA 3N6VA 1O96B 5FWNA 3VNUA 1UODA 2YS7A 1TVKA 3NTUA 3BZWA 2B7LA 2W4QA 2ZWPA 4RKYA 1UM8A 1L5YA 1TCBA 1CJMA 1ZJ5A 2QE6A 2VSYA 3L4BC 3ML1A 1Z37A 1GTL1 3IPLA 1BS9A 1KIAA 2JATA 1TIBA 1KPHA 3I28A 3NYQA 5DV9A 4RMGA 3RRYA 4E5UA 1FDVA 1IE3A 2NWQA 4IMRA 1CXZA 2DH5A 1PW7A 4KSCA 1P6UA 3H97A 2J3LA 2O05A 1ZRSA 2C9OA 1W5BA 1RM5A 3NI2A 3KV3O 3QELA 1VLJA 2VYFA 3L8EA 4S1NA 2KM1A 1KO1A 3HUUA 1MB4A 3IP1A 4TYMA 5C51B 2ZE6A 4ROTA 3H16A 5AXAA 2ZJFA 5CIWA 5JZOA 4IKOA 4Z2AA 4DG9A 1LI4A 4M8IA 3UT6A 4AVYA 1Q3HA 2ZBFA 1Z33A 2AJTA 2WF8A 1PCXA 1XBTA 2GPBA 2FQWA 3R3SA 4MUIA 4WXEA 4OYYA 5TC4A 3TKYA 3O8CA 4H4DA 3C8HA 4OH1A 3FMGA 4J49A 4O08A 4TQAA 3IHWA 1XVLA 2DQYA 2H3EA 4RPIA 5DHRA 4CQLB 5MN5A 1LK7A 4NKRA 4HLQB 5F64A 5IG2A 3C4VA 4U7WA 1N3YA 5JBIA 1ZLYA 1QGDA 2CVFA 3QKUA 4RGYA 4RQAA 5EHGA 1QIHA 2BE7A 1L5NA 1JJIA 3HB0A 4AECA 2R8ZA 2PV7A 3NALA 3P4YA 3B9QA 5JH7A 1IMOA 5MN6A 2WFAA 3MMNA 1QOZA 2H48A 3DCNA 3E9YA 4PG6A 1PGJA 3QQ5A 1IXKA 1MBZA 3ZXYA 4U3JA 4NSNA 5EHZA 3BMXA 3DV2A 1K5DA 1IZ0A 2YJTD 1KEVA 3OEWA 5HIAA 3K4PA 4PG4A 4MYCA 1GEGA 4WZBB 4J03A 3TCNA 3ZCVA 3HB9A 2ID4A 4G5OA 1QIFA 2GD2A 3CWCA 4K0RA 5HE9A 3ZH9B 3ABOB 2VP0A 3TYXA 1YBAA 2G9QA 4CF7A 3D5TA 3OPVA 1V37A 4RADA 3QEAZ 4H7IA 1IZYA 2XCOA 2D5IA 2FAXA 1U7PA 1EFUA 1T8PA 2G07A 2VS1A 4WV3A 2XW6A 3STXA 2V6JA 4ZT6A 2ONYA 5EOVA 3QA9A 4FCVA 1XP5A 2DLDA 3KKQA 2FW0A 3LPCA 3PENA 4L4XA 4C20A 1HYEA 3UT5B 2ZDQA 3ABIA 2WFZA 2LCQA 5BWOA 4NCAA 1FNNA 2Y05A 2PMDA 2Y1EA 1QZTA 4P4TA 1QX4A 4PCUA 2CMDA 2WTEA 1MOPA 2ZUFA 3OT1B 3P9PA 4QZVA 1JG3A 3E15A 4XVCA 3FI0A 4U6NA 3THYB 1IJFA 3FCAA 3NPAA 1ZGAA 1OV6A 1WVIA 2OD2A 1PS9A 1FNDA 1QUFA 1A2BA 1VC2A 1WW2A 2PXCA 4UOEA 4I4TF 5FPQA 2P6RA 1O7JA 1Z4QA 2PBZA 3QLVA 4LGYA 4LF5B 1I14A 1QTQA 3U44A 1UT6A 1EX7A 3ZQ4A 2CVOA 1ZMRA 4FSDA 3QP9A 1OTHA 2VPWA 2LP4Y 3ZI7A 1EFHA 3B1JA 3EXEA 4F5ZA 2UUBB 3UAWA 4ZMBA 1N5DA 3TQHA 1AMNA 3V48A 2VDPB 4P3YA 4LBWA 5C8VA 1DEXA 2HPAA 3LPDA 4JKOA 3I64A 4F0JA 1G8AA 2XEXA 3QJ5A 3ZV7A 4NOLA 4O59O 5C4GB 4C3VA 4TWAA 2YWHA 3OKPA 1D0SA 1P9LA 1N1EA 1Q20A 1ZWKA 3UHJA 3RD5A 1K7CA 5TE9A 4AW9A 2IZ5A 2QL5A 4WKNA 1DIHA 3CONA 4UDXX 5LXTA 3HC7A 4K86A 2C5EA 4O8ZA 3B5JA 1KAMA 3ITKA 4MI6A 3SZMA 4DZZA 3TZEA 2AGVA 4LK3A 2CCJA 2E6UX 2RG1A 1HWYA 2JIMA 4GW3A 4ENPA 3UPTA 3OIDA 1NJ2A 2BFCB 3N8IA 1DO8A 2D06A 4UKDA 2QM7A 1ZH6A 3N39C 4KZKA 2IYNA 1KMNA 3D4LA 2HQOA 4CKBA 4DS3A 1BHQ1 1UP6A 1KXJA 1N2CB 1PQPA 1VBFA 3B5IA 4XOUA 4IXMA 1QO9A 1XRSB 2XCQA 4Q37A 1EXWA 2X41A 3KEMA 4CVNA 4RZSA 2B78A 1XAHA 3Q98A 4G5FA 3E9RA 4W82A 3PFWO 4ZQBA 4L4ZA 4ZREA 5EMHA 1J1ZA 5IFLA 3O4IA 1CUVA 1F12A 2QENA 2QIPA 2JD1A 3ZY2A 1ZOPA 2CFRA 2VT6A 3GGOA 4RKEA 1EDBA 1H42A 4H1VA 2Q4RA 4NVRA 3NS7A 3Q3VA 5IF3A 1G8PA 1K0FA 4ZU3A 3FGPA 2G8NA 1XFDA 3MELA 5LP6C 1Q0RA 3UUGA 1KU0A 1TM3E 3C1TA 1BDBA 3A4NA 1TTQB 4OQQA 2ONJA 1NQOA 2N1MA 3T12A 3WNZA 4KMOA 4KPYA 3RS7A 3GRRA 5HZMA 3T3EA 3CVYA 1M1UA 2X3UA 2L2QA 4GEGA 1FRZA 4J1SA 1ML3A 1P60A 3KVYA 2DFNA 5C8YA 1BRMA 1HDXA 4YQZA 3TKAA 3ZK7A 1KSJA 4EJSB 3T5AA 1PDOA 5EHXA 1EX9A 3D59A 3EOAI 1EUQA 4AG3A 4P86A 4OUDA 4RY2A 3LYAA 1RBMA 1UEJA 3EEIA 3CVWA 2P75A 4P83A 4PWYA 4IBOA 1LPNA 2GI4A 5KYGA 4JBNA 3GRYA 1CB7A 3P0HA 1K68A 4Y7CA 1W49A 2VA9A 3AJEA 3T3DA 3VKVA 4PZ0A 4TV9A 4KXNA 1EXVA 2WIFA 2ZW9A 2FRDA 1XD8A 4KLAA 3RTBA 4DXHA 1ZNQO 3LFTA 3DGEC 1Z62A 3GA5A 3K96A 4KQHA 4PXAA 5EINA 4C5BA 3LX8A 1T25A 1W75A 4D97A 2O0KA 3AG6A 1QCCA 4XWGA 1G20B 3KKEA 1F06A 3H0CA 3SDSA 1XELA 2GZHA 2FOLA 2P5TB 4AMVA 4BMPB 2Q3DA 2WTNA 5GOTA 4YRJA 3IEMA 3INGA 4WOKA 5DBOA 2VBCA 4LUCA 2H2IA 3A1FA 4MIOA 3SLKA 3PR1A 4MKRA 3AUJB 1XL0A 3QWHA 2YUTA 2VP5A 3C3JA 2WJAA 4EY8A 1PJLA 1BH6A 2MJLA 2BEWA 1YI0A 4RHUA 2CNBA 4RVUA 3I3OA 3KVRA 5KJEA 4DBZA 3Q72A 3QVGB 1CNEA 4UHKA 4RVDA 1S01A 2C42A 1XEWY 4CEJB 1KKMA 3K53A 3E3MA 3KZOA 5AT1A 1UZNA 5KNCD 3KS9A 2QVGA 3QHAA 1G66A 3PD7A 4PW0A 4Q0MA 4D8WA 3FYCA 3UHFA 1EFVA 3MB8A 2VRBA 2QPLA 2XUDA 3ZJ5A 2JLSA 4C7JA 1IPHA 1Q2UA 1PJZA 5TDHA 2J0EA 2XKBA 3IYLW 4RTNA 2PKWA 1KBQA 3BIFA 5D2CA 3BRSA 4A0HA 2J3KA 4MW2A 2QSUA 2ZWVA 4RA9A 1I10A 1JFFB 1YZUA 4OHPA 4X8LA 3VYSB 1JEAA 1KDRA 2ORVA 2XA1A 4GEKA 4A8JB 1CEEA 1XTJA 5B58C 2XGOA 3R7FA 4JQCA 2AA3A 2H9YA 4C7MA 1SWVA 2R9VA 3C1UA 3LD9A 1OC4A 4ME6A 4KDCA 4WBNB 4LF8B 3OKFA 1J06A 1RAAA 1RC8A 2ZAIA 3AF3A 1UDBA 3H4MA 3IMCA 4I8XA 4EHAA 1DFHA 3AR6A 4GR9A 5ENDA 4UBIA 5DTQA 5CVEA 1NBIA 3T38A 1JKFA 1YCHA 3UW3A 2G6TA 1O0CA 4JYAB 1QMGA 1MXHA 4IJ5A 4O2AB 4DDHA 1OB2A 4FI3C 5CYPA 1ESDA 2FQ1A 4DZRA 3W2EA 3P0EA 1E0KA 1KI6B 5BORA 1IHXA 4AT1A 3C3XA 2CNLA 2WAXA 3AM3A 3IPXA 3QX3A 4HLUA 1GGKA 1GZ3A 1KP2A 1ABFA 1ZSYA 2R6JA 3IEUA 2IHYA 2IH5A 1FTQA 3S2UA 4MXDA 3KDSE 3WWYA 5BR7A 2JGIA 4ZO7A 4ZJYA 2W22A 3G5UA 3PC6A 4POOA 1QE0A 1F8YA 2GEKA 3FFBA 3GW8A 4MQEA 1PI3A 1NJFA 5F1YA 1POWA 3RVNA 3MLEA 4UXIA 1Y5RA 1FP4B 3CKYA 4K40A 3P2IA 4OQPA 1TEZA 1JR6A 1XJ0A 5BOVA 2C4HA 4B3IA 5B7QA 1G9TA 4KXYA 3CUUA 5T5QA 5TEWA 3PC2A 1PZFA 4MVXA 4PO1A 4AJLA 5C5EA 1QH9A 2RONA 1Y8CA 5EZSA 5FX2A 2GR9A 2OB1A 2BGNA 4L0CA 3QKWA 4CHGA 2D8AA 1BXGA 4K05A 2OC4A 3LZ6A 1YDWA 4U0JA 3DUFA 4S1OA 5AM3A 4FKBA 3UANA 3V4RA 5BNFA 1Z2OX 3AG5A 3DDUA 5AD1A 3R5JA 3W7VA 4D9JA 3LWNA 4GGMX 3MJSA 1U2ZA 5C5IA 1UCFA 4NEGA 2AOWA 3PT9A 2HC9A 3W2GA 1W581 2FLKA 1E6MA 1ZOOA 2BUCA 1VPLA 2VHQA 4UM7A 1BROA 3IHTA 4DM4A 2MWMA 3DTYA 2C2ZA 5A5GA 3MERA 4Y30A 5DMXA 2BFDA 3P45A 4F60A 1FPMA 3DV0A 1SULA 1QRTA 4GP9A 2BGIA 1JR4A 3WYNA 2BAGA 4NRDA 5FOQA 4PYIA 4WXRA 1KORA 1M54A 2H1RA 3RIGA 3B1XA 1W30A 2H52A 4PYKA 2EU8A 3HO6A 2FPRA 1C3JA 1IFXA 2R7LA 1N25A 4GPEA 1YRWA 2PCLA 4EVSA 1QANA 4NCNA 1AIPA 1W2GA 2IU3A 2ZT5A 4NOMA 4M9QA 1YVUA 2E4ZA 1PJSA 3COSA 3D3QA 3WKCA 3ZE8A 5KYXB 4MVJA 1O97C 1AUPA 3ASVA 3HNRA 4AZ0A 1E2PA 4GPAA 3W5SA 5AVRA 2VYVD 3M1LA 1P4HA 5DKFA 4GLJA 3MJHA 1Y6FA 2ZR8A 2IEYA 2ZRJA 3ZU5A 3DW3X 4AXBA 5AVKA 3I4LA 3F5DA 3BA6A 4XB6B 3UK2A 4BV8A 4ESHA 3JYQA 2TSYB 4JOBA 1Q6ZA 4HEA1 3A1CA 3ZD7A 2Q3LA 2R6FA 4YHHB 3AR2A 4ZT3A 2CWWA 1M3SA 1UOEA 2XUQA 3TR5A 1UOOA 4NYJQ 4QODA 4C4TA 2GPYA 2O19A 1XEFA 3U4AA 4WK2B 3ZX5A 1ZN2A 1X15A 3VPHA 4Z1MD 3T1YB 1M6HA 2SNIE 3JQRA 4WOBA 4HTFB 4P33A 4EAQA 3GNLA 1IY0A 2ZYGA 3UYLA 2CB0A 2I33A 1X8JA 3MBIA 5GINE 4PPQA 3UV7A 5EWLA 3RLIA 4YEDA 5AFSA 1BMQA 2X2EA 3KLOA 2QZ9A 1ETHA 2QLNA 2PJDA 4A6XA 2BKEA 3D2BA 3NJRA 4GYKA 4IH4A 4K81B 1N0WA 1Z88A 2I34A 4NFHA 1FYWA 1V45E 2A8YA 5JC8A 3RVOA 1YJ5A 4JJ7A 3C70A 4MUXA 4QYIA 2FEWB 2V0CA 1FS4A 1R27A 2YQ4A 4G9BA 3GEIA 4ODIA 4R6WA 4H6VA 1MVOA 2PU7A 3ETNA 2VXBA 3GZNB 4J0KA 4R9NA 1BMFD 2DBZA 4XCQA 1C8LA 3M6WA 2C4NA 4FDTA 1X7ZA 3ESQA 4LXTA 5DSXA 1VGRA 1F17A 3UM9A 5K3EA 5JJKA 2JFYA 4RTSA 4Q05A 5CFOA 1SBYA 3WGHA 2BONA 4EUNA 4UASA 1VL6A 1KP3A 3KWFA 2WVHA 5E8JA 4DBLC 4E4RA 1SRQA 1Z06A 4G8CA 1XKQA 2R85A 2ZJ5A 1IB6A 2HNAA 2GASA 2HA4A 4HUQA 3QX9A 4LYYA 4ZARA 5I8ZA 1NY5A 3A7EA 1MNQA 2ZRAA 5JV5A 2ORIA 1DRWA 2EFYA 1A82A 1YZHA 4ZYXA 1GU1A 3SOZA 3D3EA 4B7AA 3BCUA 3V4VB 3COJA 3WYFA 3B85A 5F9MA 1NP7A 5ANRB 2QL7A 5EKXA 3LYUA 1E89A 3NTOA 3NV9A 4YRCA 1LBEA 1UWCA 5A4KA 1U3DA 4M9RA 1OLUA 5SZKB 3SWWA 3B6JA 5FHRA 2AN3A 2OK7A 4UEOA 3RT9A 4TX1A 4LGMA 2F3SA 1L4YA 2OBLA 1T2DA 4UHBA 3C4QA 3GV0A 4HDNB 3WNCA 3BMCB 1MRNA 3ZUGA 3K0HA 3UXMA 3RUPA 4OMUA 4JCOA 4EIWA 1F2TA 1T8TA 3ZD8A 3GEEA 4FQ5A 1P2BA 1PJ2A 2OFPA 4MI1A 4BKUA 4C08A 3IVAA 4RD2A 3M9LA 2EGGA 4O4HF 4X93A 3PD0A 3VR6A 4PHGA 1NMZA 2QPAA 4PHHA 3GUVA 4X41A 4ZRMA 5JCOC 2D7DA 4PCLA 3WXBA 1P2TA 4C5AA 1ZXXA 3EVBA 3KEOA 3BSYA 5SZIA 3GNTA 3V7NA 4KMRA 2J9ZB 1NQWA 4MGYR 5JPDA 2IODA 3OMLA 4B6PA 1SC3A 3ZIAD 3IBFA 3QFRA 3TZLA 5F78A 2XKJE 5F1OA 3WQQA 2O57A 3PXBA 2NU9B 1HO3A 2EP7A 3SJBA 3UK1A 3CCCA 4ISBA 4LF7B 2BH2A 3S1AA 1FP2A 2Q21A 3OZEA 5FA6A 3VYUB 3LJKA 2A4KA 4NBRA 2AWOA 4IMPA 4YUYA 2Q4TA 5LWHA 5JNWA 5ENZA 4XIGS 1XYYA 4F72A 3N7TA 4ZI7F 4JR0A 1ZGGA 4W5HA 3FPEA 3HXMA 3EZ6A 3DW1X 2FMXA 1VL2A 3K2QA 4G4JA 4JB3A 1B3BA 2ZB8A 4MR8A 5A9TA 4U7TB 3HDVA 5IVDA 1E2HA 1G0NA 4D41A 1VCOA 2JGFA 3UK7A 4BMSA 4JJIA 3O3MB 1K08A 5FCDA 4JL5A 2GGSA 3RVPA 1Z4PX 2GN6A 1AOXA 1M0SA 5COAA 4DBVO 5FPKA 5BOSB 3C6KA 3LM8A 2YHUA 5HJ2A 1C14A 2XDAA 3H17A 4H7DA 4DR3B 2O0HA 2ZIXB 4TVSA 2QR2A 2NVBA 3EG5A 1MB0A 4FNAA 1NE2A 1JTEA 1JIKA 2HXSA 2WFMA 3ZC3A 4CTMA 5BSVA 3U17A 4JASB 1BE1A 2XUIA 2QD5A 1BMDA 2WT9A 2R8OA 4XEUA 1H2BA 2XD9A 1XCGB 3GFVA 2KQUA 2R8YA 1G3RA 1J70A 1XTRA 3I62A 4YJ2B 5EPUA 3VO1A 4Q18A 1JR3D 3DEYX 3RODA 1GOTA 1N2SA 4FMDB 4MRPA 4FGLA 3PGLA 2WTAA 3A3PA 1E2DA 4LFAB 1NXQA 1ZFNA 3L82B 3MAJA 5CB6A 4LCBA 3ZY4A 5KWVA 2BDEA 3GP3A 3RHFA 1NW5A 1E3JA 3NWJA 1KYXA 2PA3A 3PE6A 4MP6A 4MHOA 4NZYA 5INTA 3KE8A 4LNUB 3E9MA 3A6HA 1PQWA 4C3ZA 3A1VA 1QHHA 4HRAA 5C81A 4CMGA 3AP1A 2YNMD 4RF5A 3BAFA 3T7JA 2HDNB 5AW9A 3WLHA 5KX5B 1PT7A 1JXOA 2Z2ZA 1GG5A 3WYCA 5K8CA 1I13A 3N2EA 4BFUA 1R88A 1SAYA 1I30A 1UADA 1D2MA 4RVSA 4HWSA 1QK4A 4H7HA 4M1KA 1ZIPA 4RA6A 4R5MA 3AP2A 5EYPA 3OPXA 4QTUB 4Q1DA 3I1IA 5MGNA 1E99A 1IN5A 2ZBDA 1SQ5A 3HJAA 1SOVA 3RROA 4B3CA 4EGAA 5LIPA 3LRXA 2M1XA 3JZFA 1FEZA 1L4GA 1FU8A 3M5DA 1ZSVA 1WLYA 5BNZA 1JL3A 5JHHB 1ATIA 3IH5A 2AUMA 3GLHB 2B2NA 5GJCA 5HCNA 1GG8A 3OLYA 4CXMA 3VM6A 4H15A 4S2UA 4FS3A 1PTJC 2R60A 1XF9A 2I1LA 2IUEA 1P77A 2YHAA 3AEUA 1O89A 1W5TA 1JQ5A 3WRVA 5EP1A 4ZZ3A 4OKIA 4C0SA 1X6VA 2RCNA 1BCRB 2BFFA 3AF5A 3C6QA 2YJ6A 3QMMA 3L01A 3TLJA 4D9HA 1NKTA 1CUFA 1ZVJA 2C59A 2HA5A 2JGJA 3G02A 4YUWA 3OZWA 2FPXA 4CMAA 5I6DA 1M67A 4RF2A 1KO8A 3DR5A 4EK9A 4JLDA 3OETA 4Z99A 2AE1A 4Y6GB 2BUAA 1ICIA 4EVQA 1LS1A 4I1SA 2L82A 4KTTE 1FF9A 3C7TA 3PSAA 4H18A 1ZUD1 5ALQA 3OZXA 3G8DA 4KUHA 1CC1S 3DBIA 4QXOA 1GU0A 4XCXA 5IAAA 3B7PA 3S70A 5KYNA 1SZDA 4TSKA 2WAAA 4JUFA 3HLYA 4B44A 4EGJA 5AI8A 5K0ZA 3GLKA 1UDCA 1E7RA 1DRVA 5JO9A 1U7HA 1GZ4A 1Q12A 1Q11A 3ZVKA 1EX6A 2QNRA 2AUNA 1ZQ9A 4DMFA 1DBRA 4UM5A 4D92A 1Y1RA 4I5EA 4EG8A 1BFDA 5FAXA 4EGCB 3QE3A 4XQEA 2Z8XA 4NJOA 1RAHA 3L6BA 2B1IA 3WOHA 1NN3A 1QJCA 2O3QA 2PLRA 1XDZA 2PTHA 3B9PA 3ZVLA 4MGHA 2X22A 4D3SA 5I4CA 4LDPA 3V8MA 1L5FA 2D0PB 4TLDA 2C7OA 1E9AA 3SD7A 1L8XA 1T9ZA 4DMUB 5C46F 2ESRA 2YVLA 4G0MA 1RQ2A 2X8JA 1BW9B 7MDHA 5CDFA 2P5SA 5DIFA 1E9BA 1IEWA 1ULTA 3L43A 4L75A 2MMCA 2VDJA 4FIDA 4PNHA 5AUOB 4R01A 2PJUA 3QOFA 1FXSA 5DK4A 3JQGA