1TK2A

Crystal structure of the complex formed between alkaline proteinase savinase and gramicidin s at 1.5a resolution
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN SAVINASE
publication title Crystal Structure of the Complex Formed between Alkaline Proteinase Savinase and Gramicidin S at 1.5A Resolution.
rcsb
molecule tags Hydrolase/antibiotic
total genus 99
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1tk2A00
1SBHA 4M1ZA 1SUPA 3EDYA 1Q5PA 5SICE 1ST3A 1AF4A 3VHQA 3DE2X 3PTLA 1ZVKA 3DVSX 4HVLA 4KB5A 1CNMA 4AKSA 3DWEX 5FFNA 1S2NA 1XF1A 1TM4E 5JMOA 2SNIE 3A3NA 5CW1A 1AK9A 2PQ2A 2IY9A 2ZWOA 3EIFA 3H42B 1OYVA 1S01A 5FBZA 2PKCA 1CSEE 1KDVA 1EGQA 1GA6A 1BH6A 4WOBA 1SIOA 3SQOA 2PYZA 4H6WA 1R6VA 5AVJA 3VV3A 1BE8A 1YJBA 1MEEA 4OMCA 4K8RB 1EA7A 3DVRX 3L1KA 2Z2ZA 3VTAA 1T1EA 2WUWE 4NE9A 3Q5GA 1Y34E 3DE7X 4LVOA 1C3LA 3F7MA 5JXIA 3LPDA 3F49S 3UNXA 2P4EA 1PFGA 3PRKE 3ZXXA 1Y3FE 1KDYA 3VV2A 3EE6A 1HT3A 4Z2AA 2V8BA 3LXUX 1SCNE 3WHIA 1UBNA 4CG0A 1SBTA 2DQKA 1IAVA 5ARDA 2SICE 1BFKA 2QTWB 2PWAA 1SUAA 5AVKA 2DP4E 1YJAA 1GTG1 1GTL1 1P8JA 4ZARA 1GA4A 5FAXA 2WUVA 1AVTA 1GNSA 1GCIA 3GCWA 1SIBE 3CO0S 2Z2YA 1C9NA 2HD4A 1AQNA 1SPBS 3F7OA 3DE1X 2PWBA 3WIVA 3DW1X 3DE6X 3I34X 2ZWPA 3GCXA 3AJ9A 1AV7A 3A3OA 4OV6B 1WMDA 4JP8A 2E1PA 1SUCA 4ZOQI 1Y48E 2W2NA 4J94A 3LPAA 1V5IA 1NDUA 2SECE 5ARBA 3I30X 3BX1A 2TECE 2WV7A 2WWTA 2W2MA 1Y3CE 1TO2E 4DZTA 2Z30A 4GI3A 3AFGA 1BFUA 1DBIA 1SN7A 4WOCA 2ST1A 3QTLA 2W2OA 1GA1A 1GNVA 3DW3X 3DE4X 3HJRA 1SVNA 1KE1A 3DE0X 5JXHA 1SIUA 1LW6E 1TECE 1TO1E 5AMXA 4CFYA 4RYDA 3DDZX 4NE7A 1C9JA 3DYBA 4C3VA 3SICE 1SELA 1SUBA 1THMA 1WSDA 2Z56A 4H6XA 5JXGA 1KDZA 3QFHA 1PTKA 2Z58A 1BE6A 1ZVJA 1SCAA 3D9QX 2XTJA 5ARCA 1Y4DE 4KPGA 1NDQA 2SBTA 1Y3DE 1P7VA 3QMPA 1SCJA 1DUIA 4DJ5X 1BJRE 1SUEA 3GT3A 3TI7A 1SBIA 3VYVA 5I9SA 1YJCA 3WQBA 2W2PA 2ID8A 1WVMA 1Y9ZA 1TM5E 4HX2A 2X8JB 4NMXB 4BWGA 3GT4A 3WIUA 3I2YX 1GTJ1 1AH2A 4FONA 2X8JA 4MZDA 3VSBA 3A3PA 5K7SA 1SCDA 1P7WA 3BGOS 2IXTA 1AU9A 2XRMA 1TM1E 3BPSA 1PJ8A 3P5BA 3Q40A 1IC6A 5JXJA 3OSZA 4CFZA 2Z2XA 1TM7E 1Y1KE 4B5LA 1SH7A 5AQEA 1T1GA 4YN3A 3D43A 1MPTA 3DVQX 2DUJA 4KG7A 4AKTA 1WMEA 1SBNE 2W2QA 2PRKA 2HPZA 2ZRQA 1Y33E 1Y3BE 3T41A 3I37X 1NLUA 4I0WB 1KE2A 1OYOA 2ID4A 3DE3X 1JEAA 1PEKE 2PMWB 4LVNA 4C3UA 1T1IA 1YU6A 3AJ8A 1SCBA 5B1EA 3TECE 1TMGE 5B1DA 1S02A 3ZXYA 1ST2A 4OMDA 1V6CA 3LPCA 1C9MA 1R64A 1GT91 4H6VA 1SBCA 3CNQS 1TK2A 1Y4AE 2G4VA 2B6NA 1VSBA 1SUDA 1WMFA 1TM3E 2Z57A 4DWWA 1OT5A 3TI9A 1A2QA 1R0RE 3DE5X 2GKOA
chains in the Genus database with same CATH superfamily
4BZWA 2NO4A 4NY1A 1COZA 2XLBA 4ZVMA 4TTSA 1U1CA 2JF0A 3P0RA 5DV9A 3LO8A 2X0EA 1RRKA 2P5UA 1LZLA 1XGKA 1UJMA 3EDYA 1TAQA 3QMMA 2RFLA 3AHDA 2QMYA 2R84A 2V6IA 3IX7A 1QVRA 4L02A 4NYIQ 5DM1A 3JSAA 4XQGA 4C21A 5CCEA 4V0MA 5C35A 1OI7A 1CUYA 3MGKA 3CLKA 1H9BA 1MG5A 2GLTA 1XK6A 1OB5A 2OHFA 3M6XA 4H27A 1C7QA 4WX2B 2L82A 2R79A 1L5KA 1A9QA 3KSRA 4CWAA 2PH3A 4AJEA 3D4OA 4FSDA 821PA 5HBGA 3CY6A 2XF2A 4G5YA 4GLBA 1RM5A 3B1XA 3SK0A 3VO9A 2RHBA 4C0SA 3A7EA 3QVWA 2YY6A 1BXRA 3PC3A 3MIIA 1U90A 5IAOA 4G1BA 4MYDA 3KQKA 4QU0A 1OX4A 2Q6TA 2GDZA 4AY3A 5GP1A 4OM8A 4DLVA 4H7JA 2FPPB 2XOXA 4G5HA 3GJQA 4L5AA 4BMXA 2OPHA 5CYPA 2UYGA 1L5LA 4RHFA 3C41J 1E6MA 3MQFA 4TLCA 2GZ2A 3M9XA 5C7LO 5CAEA 3NH9A 3GVCA 1WY5A 1Y1RA 1F12A 5DSTA 3U0VA 3U9TA 2X4IA 1FRFS 3RRXA 4XUDA 5JS7A 3G2NA 2IHYA 4A3SA 4PGFA 4C7BA 1TQ2A 4QUGA 1ODFA 2PKCA 3OF2A 1EVLA 1Y7TA 3RG8A 3W5HA 2C2HA 3HGMA 3IDFA 3R3WA 3R3YA 3WGGA 2HJWA 4GBJA 1KIMA 4RDHA 4KITB 2FSFA 1M10A 4IV5A 4WE3A 3ADCA 2XI4A 3V4RA 2XPCA 2XB8A 5E6SB 1MT3A 1GA6A 2HBYA 5GONB 4C4RA 1EHYA 1NZDA 1TUGA 3L04A 1N2OA 2QUBA 2RB5A 4FFPA 1YKGA 1PJZA 4HTAA 4RHCA 4YNBA 4GP7A 1NR7A 2O54A 3AI7A 5GM1A 4HLQB 4PHGA 3RAPR 3F8TA 1J2EA 2OXCA 1WSWA 4H3HB 1FUKA 5EEHA 5AI6A 2LNDA 2ZTHA 5DTMA 3PF8A 2VR1A 2W0SA 3PGLA 4ANFA 1Y0BA 5IVKA 2JFPA 1W5EA 4C88A 2RARA 3VO2A 1GZ7A 5A0VA 3DB2A 1H4SA 1SC3A 1C8BA 4KLAA 2GETA 1N3YA 4N7RA 1NKSA 2B20A 1EP9A 3LWDA 4L4RA 3ZXIA 3IAEA 3KSMA 2X5NA 3WIOA 2N1BA 4PZ0A 3ZDBA 2X86A 3TZCA 1NRIA 1F8GA 2BFOA 1EVIA 2D3WA 5CHYA 1G59A 4F46A 3KPWA 1UK8A 5ENVA 3ZLUA 2OGTA 3PDIB 5LPNA 1U4NA 2XDQA 4GPZA 4AG3A 2BMJA 1OU4A 4YJGA 3GAMA 4PQGA 3GJ4A 1G5FA 3PDUA 4JLSA 2HMWA 5DN6D 4FGLA 1ITZA 3NRJA 1W5BA 4LHZA 1M5RA 4OL0A 4E6PA 1V7PC 1WXWA 2PSJA 3I53A 2VH1A 3SIXA 2HBZA 5KYUA 2PR2A 1NMQA 2M1XA 2IE0A 4GQIA 1ISMA 1JN0A 2H85A 1IVYA 2CLKB 4ZK6A 4KR6A 1PWXA 3EODA 1WB9A 3HJBA 4X71A 4F3NA 1UC8A 2D0OB 3LPDA 1T3LA 2YHIA 3V55A 3B52X 1P7YA 3PXGA 1I0LA 5GOTA 1ZHFA 1NJSA 4BNUA 4YPOA 2HU8A 1W5TA 5BN3B 1LDNA 1Y8ZA 1TPZA 1W7AA 4HLDA 5KZMB 3V00A 2FW9A 2P9GA 4BVKA 4YXWD 2WMOB 3TMYA 5UKDA 2R6HA 2EKPA 2YWBA 3K1YA 4LJAA 4MS3A 2IOHA 3ZK8A 5FUWA 1HT3A 2HSJA 1E0DA 2HSGA 2O8VA 2XNDD 1QV7A 4UM7A 4PRKA 2H11A 3FOWA 1R6DA 4PXAA 4S1PA 4D80A 5FJIA 7MHTA 2WWWA 3BJRA 3Q3JB 4FDVA 4EG5A 2IHJA 2RHCA 3IQZA 5FAKA 1MFZA 2QIOA 5EWJA 2BF4A 3HKCB 2CD9A 2JGDB 2QR2A 1I14A 4PPQA 1MVLA 2ODPA 1FX0A 4Z1OA 1IATA 1OW3B 4KODA 3GUVA 3WA6A 5CURA 2V5UA 1G7CA 5DWQA 3G5TA 4GZ6A 3DWFA 4QVIA 3VKVA 3TQHA 1KY4A 3D31A 8GPBA 1ZGCA 3TZLA 1TJ5A 5A02A 2GUWA 4GM0A 1W5SA 5GMOA 2WF5A 1SC4A 4ZARA 1G4HA 1KI3A 2ZBDA 3FJ1A 1JDBB 3AUJB 2QY9A 4J8PA 5B53A 1N2EA 2GEBA 1XL0A 4L76A 3ASVA 2WZCA 4GEGA 4GMFA 5DTIA 4PV7A 4EHIA 3C6YA 2QN1A 4JASB 4DBZA 1QKJA 1I0IA 2I0FA 2H8KA 1NMZA 2BFFA 5L3SB 1I3KA 1E4YA 4D5EA 2YYYA 4K87A 5DX8A 3CPSA 1N1DA 4D9KA 3NVDA 2UU9B 2ACKA 3CNHA 3IEMA 1VOTA 5AVUA 5JOQA 2IA5A 5BQ3A 5FQOA 3EZ6A 1K1EA 2VHJA 3RUAA 3GI1A 5HUHA 3GV0A 1EQUA 2GAJA 2CMDA 2JCXA 4MARA 2IUUA 2AFIA 2P6MA 4YQYA 3BGSA 2D5AA 1DG3A 2R5NA 3SR3A 3VOTA 1JIUA 4MW9A 1TQ4A 2KI5A 1M2JA 4Q3CA 3WWYA 2HB6A 2W71A 3BWXA 2C99A 5EL0A 3VSEA 5C1BA 1GOTA 2H5JA 1YTUA 1YNSA 4GPBA 2I3AA 1CJUC 2OFWA 2R00A 3OX1A 1DTEA 2IYNA 2QTBA 1Z6PA 4X1IA 5JIBA 4PPFA 2A5LA 4DHEA 2OMEA 2PGXA 4K9OA 1XRJA 1XP5A 3WBBA 3CVYA 5JXWA 2VPXA 3W0LB 4B80A 1UODA 1PW5A 1R0XA 2ENUA 3ORYA 3SKVA 4G8DA 3DEJA 1JDZA 3KYCA 3KFLA 3S3TA 1GXSA 1Z4OA 4BFZA 4BP9A 4F3KA 4E09A 4WJLA 3ZJTA 2PU7A 1WETA 3JQ6A 3D0QA 4MVJD 4MKZA 1ORHA 2QTVB 1IBSA 1U3CA 3A4YA 16PKA 3QKTA 1MZVA 4JR0A 4IJ6A 5B1SA 2JDID 4F96A 1QBKC 1XRPA 4IIBA 4R9SA 2FSVC 1QZXA 4HXEB 2WYOA 4YV1A 3A25A 1N33B 1QQ6A 3TM4A 1SD5A 4B79A 5C5EA 3AI3A 2ZWVA 4M46A 2HWXA 1OXMA 1ZNQO 4NU6A 1ZN8A 3UWSA 3KZMA 5HF5A 3A6KA 4ALKA 4IDOA 2NXEA 2OORC 3PQ4A 2GO1A 4GICA 1HR0B 3UM9A 1RXEA 2FVYA 3K32A 3DKKA 4ACAA 3NMUF 3P4XA 1SQGA 3VDRA 4KBGA 1XRLA 2VDQB 3KC2A 4ER5A 4TKVB 2ZT5A 1TEHA 1G0NA 1X42A 2UDPA 3OE7D 5DBOA 1ORWA 3TUIC 4DVJA 4XUCA 1A8SA 3BXFA 5LIRA 4X93A 1QHNA 1TTHA 2XKAA 4HDAA 3BKXA 5DHQA 5LZ2A 4M83A 1OR8A 5BQPA 2MMGA 4GQBA 5FPPA 5CLFA 5K99A 3NANA 2AG1A 4IHKA 2A84A 5TSDA 3L6BA 4LTMA 3F1KA 3MJDA 2I4MA 3A36A 5ILQA 5F5LA 5L6LB 4L5IA 4R6WA 4KVZA 3VZCA 4CW7A 4WBNA 4QREA 2PR7A 2C2WA 4RZ2A 1UKYA 4TV9F 3GFSA 2PKYX 1ZGBA 4HEQA 1NW7A 1FNNA 2BLLA 2QGFA 3LOUA 1FUIA 2OBXA 4K9SA 5KJCA 1MOQA 1F0YA 1PT5A 2C7VA 3EPRA 1X7WB 1F3OA 1ZOOA 2FQQA 2G83A 4MJXA 5DHAA 4C5BA 4YUXA 4Z3KA 2PO5A 1P6XA 3HR7A 3H5NA 1U2QA 4TT3D 1NP7A 1KOGA 1HWYA 1E2MA 3KVNA 4I55F 1NNLA 3O8DA 5AIAA 3UK1A 3W2TA 1QSGA 2LW7A 1CEQA 1WDKA 4U2CA 3OZSA 4R84A 1CP3A 2PIDA 4F84A 1JJFA 4JT2A 4LOJA 2GR9A 3MTEA 4YX9A 1UBEA 4HDNA 1IU9A 3W77A 1QYWA 1R6AA 1GPJA 1XD2A 3ASZA 3B2EA 3GFQA 4WDRA 4KFSA 1OLXA 3TOZA 1NPDA 1VLLA 1QHYA 3O4RA 4FXOA 4B3SB 3Q9LA 1QO0D 2QTTA 4OJTA 4E21A 2BEUA 3AIOA 4MKXA 4BO8A 1BXZA 2O48X 1JUDA 2Y1EA 1K8ZB 5FLXA 4D6XA 2FP4B 4JSRA 5BVGA 4BGUA 5U4XA 3B9QA 4HNUA 4PTLA 1L5MA 3EGDB 4OTZA 4B81A 2XXAA 4H7PA 3Q9NA 1UBOS 3BF7A 3W5VA 3WK5A 4PLZA 3ZHVA 5EEGA 4X20A 5HK8A 3TRJA 1Q95A 4RF3A 5IHXA 3D0RA 3R7WA 2I4LA 1SMKA 2F48A 4P4UA 4QEKA 3S2EA 2WIFA 5FULA 4ZGBA 1N5RA 3ZE0B 3FWHA 1PV4A 3AHCA 3VTKA 3EXAA 3B9PA 1M34A 3W7AA 4ESHA 1REQB 1JKIA 1T43A 2X8AA 2NYVA 4MUYA 3I2GA 2VA9A 4K86A 2XDYA 3FYDA 3RVKA 1E4EB 3PVCA 5HCNA 1XVAA 1CB7A 3OMXA 5JD5A 1FMLA 2QHXA 3REGA 2ORYA 3SMVA 4YUWA 4HTFB 4OBXA 1GTRA 1I3LA 2VP3A 3KOWA 4I8IA 4K8OA 3U7EB 2O57A 4J0CA 4ZPXA 4IAOA 3S1AB 3V3TA 1N32B 1SC1A 4PVDA 2DWPA 1AH2A 1Z6QA 2YBEA 2LRHA 3I76A 3KYDB 5BSMA 3BERA 1XTKA 3DAPA 5JR3A 3VNUA 3EC1A 4IZ6A 3URMA 1RZRA 5D2CA 3LHKA 5KNCH 3PUYA 2LWIA 1PEYA 1DC3A 1AU9A 4NHOA 3AR7A 2HK6A 3IBSA 3KV1A 1BCSB 1RI5A 2FA9A 3CSSA 4CCSA 3AL0C 3ABOB 1HKHA 1BWRA 2VI5A 1ZQ9A 3JD2A 4EVSA 1O6ZA 1EAYA 5HKKD 4GXRA 1QOZA 3L41A 1SCUB 3K1AB 1E3WB 4GOLD 1YA8A 3HXLA 2ZBRA 2G1PA 3Q40A 4AROA 1QR2A 4TROA 3T7SA 1WF6A 1FOEB 4IJWA 3OEHD 1RLUA 1KVTA 2XA1A 4FS3A 2XQVA 2HTEA 2QV7A 3W06A 1EZ4A 3PD1A 4ZVLA 2X3FA 3SEQA 4WZ6A 4V0SA 2IDJA 1JQKA 4BO9A 3JPWA 1U1IA 1F0NA 4F6RB 2QJFA 3TW4A 3RWMB 3NDRA 1XKTA 1CRQA 1CYDA 1GKYA 3KLBA 3KZOA 2ZGVA 3MTAA 3NHAA 4JC5A 4Q18A 4Y0AA 3TPZA 2WVGA 3U4QA 3C39A 3AVXA 3P0IA 2YV1A 3PJFA 3V4LA 1TRKA 3PNOA 2QX9A 4N54A 4Q1DA 3VFDA 2A6PA 5FV7A 5BNIA 1PZXA 2YS6A 1EK0A 5EJMA 4U7WA 2XGMA 1GQYA 4JJ7A 2X19A 2X5KO 2E4UA 2V55B 1OZAA 2HA2A 2F9LA 2CHFA 4ZT5A 4D0GA 3H2HA 3K4PA 4HGYA 2E1RA 3BMQA 4R81A 4HLUC 5JYBA 1IXKA 4GT1A 4ZYWA 3HCBA 5MN4A 2FG6C 1C0PA 1U2RA 3DXFA 1W46A 3G8YA 5F51A 3PHIA 5FKJA 2JIQA 3DLPX 3KETA 1Y3BE 3QJ5A 2ZFUA 1XDWA 4IDHA 3UFXA 1ESMA 2VXCA 3QLEA 1KYZA 2QENA 4L0QA 3WHLA 5E4TA 1GZ5A 2GB4A 2OHVA 1Y5IA 4LDNA 5IAJA 1E5XA 2DQSA 3RS0A 1ZH0A 3I2JA 5JWOA 2P2LA 3R6LA 3HB5X 5DX0A 3A0RB 2X9NA 4LCBA 1V7CA 1JWAB 1L4UA 3EFOB 4A92A 1YKSA 1G8FA 1LV8A 1U0EA 2Q1TA 3SC6A 2KBFA 1XLTC 5GADl 4XM0A 2WP0A 3LXMA 5JBQA 3JAMA 1CERA 1FFXB 4QPNA 4HDRA 4EB6A 4E7PA 1FXWF 3QSYA 5JHHB 4GYJA 1PHRA 3HKDA 4ASUA 3H97A 4D5GA 3OTOB 4G5FA 1QV9A 3FFXA 2BEJA 2CNWA 1X1SA 3HHEA 3S2FA 4GNKA 2I2AA 1ZBQA 3DTVA 4MLCA 5BSVA 4XWWA 1AQIA 4W5JA 1TMGE 1WDMA 4ZAGA 3CZMA 4Q48A 4YRDA 2G8LA 2JANA 1OD6A 3O4HA 5DSZA 4LVCA 5C81A 3UZUA 2Z43A 2C04A 2JGLA 1ZMTA 4EI7A 4UM9B 3EB9A 3LZDA 3ZQ6A 1AHHA 3BD8A 3BIWA 4LE1A 3CB4A 1YI0A 4I81A 4I1RA 1DIAA 3FCXA 1C5KA 1QX3A 2FZ4A 5FI3A 5CVEA 3GY0A 3O1JC 1II8B 3BULA 4M86A 5ILGA 3TKLA 4UCFA 5FYDA 5IANA 4AQYB 1UP6A 3PPXA 3L0IB 3OM0A 4EYQA 2ZJYA 3F67A 3DLAA 4GSYA 3O4VA 3DLTA 1DO8A 5CFOA 2AXPA 3NCTA 4P7BA 5IFKA 3HL4A 3TEFA 5BV1A 1R0RE 1XLUA 4BTVA 5HQ3B 2HV8A 1KOJA 5ADVA 4K6OA 2A0FA 4OFXA 1KEZA 2UZAA 5CFRA 2X9GA 4DTCA 1MB4A 2FSVA 4ZEOA 5C34B 1MABB 3OPVA 2IV7A 3K70C 1EI9A 1TU3A 2FYTA 4HEA1 3F7TA 5EZ5A 4KPEC 1RHJA 3PICA 2OORA 1G291 1D6NA 2AFHB 5BUZA 1W8IA 2P7HA 3K8YA 4AL4A 1DDOA 2QMZA 2WT9A 1ZUNA 4G9EA 2K2WA 2QP3A 1KBOA 1D07A 3FOAA 3K20A 1DKRA 3IELA 4QJIA 2H63A 1ZVQA 2PWYA 3PTLA 4ZI7B 4URXR 1Z63A 2RGCA 2UAGA 4H18A 4IOJA 1NURA 1IWPB 2O52A 1O6BA 1TJPB 4GE3A 1PJ4A 1W9MA 2IW1A 4IF4A 4D41A 2P2GA 4HAUA 4IEIA 1KRWA 2L2QA 4YRQA 4D3XA 3L0SA 2YR0A 4QYMA 4LS3A 4ABYA 5J40A 5JZMA 3N6XA 1W8DA 2AG8A 3ZHXA 4XSHA 4G85A 4PY2A 3SJZA 1J70A 1U3FA 4FGSA 4D6YA 2ZKIA 4PSCA 1VYUA 1U0BB 4O4LA 3IQHX 5ELXA 1PYOA 1Q2XA 1XI2A 4UHJA 1OYVA 2BY4A 3EOBI 3MT9A 4QBKA 4XOUA 3R1IA 3IDOA 1T8WA 4MEBA 3UGQA 1MQAA 3BRCA 3OLCX 4NFLA 1DTWA 1H93A 1U3UA 2ZE7A 3BE8A 3ESAA 1XZQA 3GPIA 3V7YA 3NT2A 1UPUA 1MHPA 2R8PA 4N5NA 4OGWA 2VP5A 4R40A 4AN1A 4Q3EA 2DKNA 1NJ5A 5BRNA 4D45A 1T9DA 1KI9A 3W2EA 1EJBA 1QP7A 2NOAA 2VBCA 2GD0A 2BKUA 3AERA 2VDJA 3U7GA 2G40A 3EULA 3GQVA 1U7OA 4QOJA 3GZTB 3T7EA 5BMVB 2LBPA 4MWCA 4G0MA 5FEMA 1V26A 1YDFA 2QM0A 4KAAA 1H8HD 4WD3A 2IPNA 4PTYA 2AN3A 4XXHA 3RAFC 3O8LA 5IC5A 2V54A 1JHRA 1X2EA 2GAOA 3BD7A 5KTMA 2W7TA 3JTMA 4IV8A 1IOZA 1GZHB 3CHYA 4OYHA 5DTJA 4BDTA 5KOHB 2C03A 1J0EA 8AT1A 1T2AA 3G2IA 5DYYA 1D2MA 1TAHA 2EKLA 2ATXA 1E9VA 3D7RA 4YGXB 3SHVA 2PGOA 2QDKA 4A0GA 3C3AA 1QYXA 5HM8A 4JSTA 5FQNA 2XVZA 2JHGA 1GCOA 2QDXA 4L22A 1TU4A 1R18A 3L7AA 1E0JA 2JLSA 4E5SA 3HB7A 4RK4A 2LCIA 5ALMA 4BWFB 5KYXB 4MVJF 3QKRA 4WY8A 5CM8B 3O8NA 4NAHA 2IH5A 4Y0NA 3EXEB 1ZC3A 3MIZA 2QMEA 3F7MA 2WTAA 1K8XB 3GNTA 2AFHE 1YZTA 3H8VA 5T5QA 2HIGA 4FPXA 3AU8A 3N87A 4NATA 1KJYA 4YXFA 4RY2A 4NK4A 3L1HA 3KTAB 4J4BA 3UHJA 1IB0A 1K97A 2B4AA 2X5JO 3G2HA 3R5SA 4AW9A 1R6UA 1U6JA 2H1CA 2UVPB 3IVGA 3JS5A 4JCOA 5EAIA 2R1TB 2DQZA 3IP1A 4YROA 1PZNA 3GD7A 3QVSA 4KQIA 4R5HA 5K3FA 4OXRA 1XXHA 4C0HA 2FEMA 4BVAA 3AILA 2Y1LA 3VR2D 4Z2AA 2V8BA 3E1SA 1SCNE 3HJAA 5B3KA 1UBNA 2VTKA 1FFEA 4ETNA 5J2UA 2F3UA 2UUOA 2OCKA 1QOQB 2GVNA 3QFFA 4RNDB 2WG0A 2C9MA 2E21A 4KXMA 4F5WA 4L3OA 3W8NA 2OM6A 2Q6LA 4GOXA 3Q8WA 1DX4A 1WCIA 4IX9A 3ONVA 4HVAA 4D4KA 2SKCA 2YY5A 2VT3A 3HACA 4AN4A 2W6NA 1THGA 3TZ6A 2I3ZA 2VT6A 3I04M 1MUUA 1LVUA 4WA7A 1OREA 3IPXA 3TW8B 3VR6A 5JHGB 5DNYB 5IWCA 2OGZA 4IFBA 5DGXA 1JLMA 4U7GA 3DBLB 4ZJUA 2GTHA 1BDJA 3AEYA 4CN8A 2VDWA 1VJGA 4TRJA 4UOZA 1YE5A 1ZISA 2I7DA 4Q02A 4PANA 2IXEA 1S5PA 3CLTD 5AJXA 4TL7A 4LSWA 2X8LA 2EJVA 1QIFA 3JALA 3L02A 3FHJA 4UVGA 3VU9B 3EUFA 4REOA 4ZVSA 2VWGA 5LVAA 4HLUA 1QF7A 4L8GA 2QNRA 3IEIA 4Q1EA 3TBHA 4HQNA 4EG3A 3DZHA 4DR7B 2ZI6A 4EHFA 1E3SA 1Q84A 3RFCA 3L4KA 1G5IA 3AXSA 3H5WA 2RHWA 1G2PA 2GERA 2PUCA 1NI5A 2I76A 4FOTA 1YAHA 2VJYA 5K8CA 1ODIA 1FMTA 1H2RS 3FOFC 5IJWA 2P0AA 4G0UA 4MLDA 4OQEA 5PNTA 3WLOA 1DU4A 1MRSA 1ABFA 2KBEA 2XY4A 2GNPA 5HKBA 2B25A 2X2EA 3D59A 4DLZA 1XLTA 4E3WA 3BA1A 1PR9A 4L3VA 2AJ8A 5EIBC 5KYWB 4AY4A 5IABA 1SUCA 3MJRA 4WZBB 1JFVA 1ZL2A 2SECE 1L4FA 1L1EA 1SU6A 3G2PA 3LHSA 3IXQA 4IYRA 3TX2A 2GAFA 5GIOE 1JEYA 2IUTA 5EUMA 3L7DA 5H02A 4OI0A 4L5CA 1YS1X 2PBFA 2EGUA 1NF9A 5CLIA 2PGDA 3C6BA 1H2XA 1MRNA 4O08A 4BN4A 2NO5A 3KR2A 1MPXA 1GAEO 2CVPA 1NDHA 2GZDA 3TCNA 1UPXA 2C4VA 5G3ZA 2HDWA 4OB8A 3HRIA 2O2ZA 1WU8A 3EZNA 3GEEA 5EOVA 1KRXA 3IQEA 4DXAA 4MCJA 5KQRA 1GQQA 4S24A 3E22A 2POCA 4HN2A 1ZFNA 2IK8A 2OOKA 3ONEA 1U7DA 3CRVA 1YR1A 2QX7A 3SYRA 5HRUA 2V74B 1X80B 4FKBA 4BV3A 2ZYRA 1F2UB 4Q4AB 2JAWA 4KV9A 5KINB 1E3MA 3SOPA 2BR3A 5DIZA 3RYIB 3S7TA 5BVHA 3E58A 4ABTA 2ADOA 1XMOB 2JASA 1C3JA 1MAVA 4BNIA 3DW3X 2VHEA 3SXUB 5A04A 5HJ7A 5CFQA 4PVCA 3WK6A 1BMDA 4JC8A 2GBPA 1CZOA 1N2HA 4C2UA 1G20A 1VLQA 4PYNA 3SM9A 3DR3A 3V6LA 3VPBA 1YQEA 1U0FA 3OMLA 3TOSA 1M3SA 2XVAA 3WLAA 2J08A 4HUTA 3WRXC 3PGKA 1AZLA 5DNEA 1CY1A 2VTBB 4JSYA 4R1MA 4DLXA 5DNVA 3KQHA 4DR3B 2XXBA 5KDOA 4LF4B 4MIEA 1XTQA 3AHFA 1N2GA 1P8AA 2IUFA 4AIIA 3ZHBA 1E4VA 1VI2A 3JVDA 2G1JA 5K0FA 3RUIA 4F0JA 2B6HA 3BGDA 3HUUA 3VYUB 1E3IA 3NWPA 3MTQA 1RPTA 3WRVA 4P84A 3A6FA 4QX6A 4RPGA 1YL6A 1R0BA 2B1QA 3N5KA 1BX1A 1T0BA 1B00A 1FU8A 3HPRA 4EJ2A 3FWKA 2WJ3A 3LGAA 3SZ3A 4G36A 5JS6A 4C05A 1OXBB 1WSDA 2Z56A 3HA2A 3QRWA 1B43A 2OD2A 1ZNWA 4FMCF 1XZNA 4IV0A 2VS1A 3TNYA 2ZULA 5FOQA 4KSYA 4REQA 4WBSA 4KQKA 1S3SA 1ZD4A 1E9RA 5GJWC 5DCWA 5LLDA 4J4TA 3KSUA 4US1R 5LLTA 3QKWA 2AUTA 5DZSA 4JXXA 4CQMB 1BXGA 2VT2A 1EFPA 1Q6ZA 2ZBGA 3RSZA 1FFDA 3AGQA 3AB3A 4EA9A 2PX8A 4QBGB 4EM6A 1YA6A 1AQYA 1MXFA 1GRVA 2PMBA 4KREA 3UATA 1Z22A 2XTJA 3QBTA 3BCSA 4PNHA 3MLBA 2GF9A 3RVLA 2O8BA 1YMUA 4QTTB 5B36A 2AVNA 4MKFA 1YCFA 4RSRA 4NCXA 3HA7A 4HWSA 4F2GA 2YASA 4IH1A 3ZLJA 1NVVQ 2BEWB 2FZ5A 3D6JA 4Q4HA 5CXXA 5BSTA 2CL5A 3FRIA 4MRSA 4RORA 3MT0A 1EHIA 1YFKA 4LA4A 3GROA 5AXBA 2X0RA 1DAOA 1U2DC 4HSGA 1TW2A 2LV8A 4XM2A 4Y6QA 3WR5A 4UTXA 2EW1A 1Z7GA 3EC2A 1SM4A 3GDFA 5HGJA 3V8RA 1O0BA 3EA5A 2PD3A 3H1AA 2Z1NA 3H6KA 3K0FB 3RIMA 1BVHA 2ZI5A 2PZKA 3SQLA 2R8YA 2X0NA 3UMJA 1GL7A 4RM2A 4AJOA 2ZXEA 1DCFA 3LP6A 3QTTA 4BFWA 1M66A 4B7UA 2C2GA 4RTRA 4ARCA 3IJPA 3ZIDA 4CLRB 4XA8A 4YRSA 3B1KA 3U40A 3EVEA 1XQXA 3LQRA 4R0MA 1GPLA 4OYYA 1PDOA 4GRIA 2BFPA 2RK4A 1E1CA 2RHRA 4P4TA 4GVXA 1N6LA 3M0EA 4EFMA 1K6MA 3UW3A 4P92A 5EC8A 1X87A 2EDCA 3ZGLA 5MFZA 2IYSA 2Y1OA 1SO8A 3BPSA 3QPVA 2V03A 3CF2A 4PBSA 1IXSB 5BQXA 2ZAOA 1MB0A 3CLUC 1VPTA 5DNCA 1AKQA 1JJAA 3QPCA 2H59A 1ELOA 2P27A 4N3AA 5AK3A 4C7OB 2FR0A 3FNGA 1IC6A 4XX0B 1IB6A 2BFMA 2HF9A 4CT0A 5I4CA 2BSQA 1SOWA 1LXCA 2CVZA 3M1YA 4QGAA 3WLHA 3SN6A 4A26A 4C20A 4K05A 4CFZA 4M1EA 1Y1KE 2Q29A 4FKMA 3IEVA 1RXUA 3OOWA 3WGKA 2FGJA 3FVTA 3FPBA 1WPRA 1ZD8A 4Q39A 3RVQA 3BG5A 1BW9A 4GX2A 2D5IA 3S5UA 5FPQA 5ITSA 7ADHA 3V9AA 2I2CA 2WUDA 3WA7A 1EFVB 1Z16A 1Y8QA 2FRXA 2RC6A 1NKTA 4A8TA 1RWOA 2IKSA 3T5TA 4HQFA 3SC4A 4TV9B 2BFBA 1HM5A 2P4HX 1XTUA 2PAAA 2W6IA 3DMRA 4I9NA 3CRW1 4JBIA 1ZL0A 4FFMA 5JVDA 1NQAO 2Q3JA 2WFAA 1JLLA 1YR9A 3B36A 3C6ZA 4JA0A 2C7QA 3DOJA 2AGVA 4GWLA 4MVWA 4BUJA 1ULZA 3WO1A 3ZHYA 1AN9A 1XZKA 3IIKA 2DQ4A 4UUAA 3HFJA 3QU2A 1R0ZA 2O2DA 1CRLA 4O8ZA 3FPKA 1IZ8A 3B7PA 1U7UA 1WY7A 3ZWCA 1VE3A 2EBFX 3M34A 3QVGA 1G1MA 1S96A 3SLRA 3KEQA 5BNWA 1LSUA 1E2BA 2CXQA 1E4OA 1NG9A 1LBTA 1T5OA 2YJZA 5AKIA 4CCYA 5HHTA 2IF2A 3ELWA 1R0CA 4RA9A 3K6SB 4RJKA 3PU6A 4JI1B 4QOIA 2AN9A 4RVNA 3EZXA 1PQYA 1PJLA 1W94A 2IXFA 5TPWB 2PYDA 4PR0A 4RETA 4GDFA 1WHSA 1DQYA 2Z6VA 3B60A 4QRHA 2CCJA 2Q2OA 3U5TA 2JKZA 4ZOAA 2BN4A 4MRAA 2XMRA 3TH5A 2DSTA 4NICA 1WLSA 1K7SN 3RT7A 5C9ZA 1PVDA 4DSTA 2R97A 3FW1A 1FSSA 4J16C 2F7SA 4MSUA 1VKRA 2A3RA 5CB4A 2W6CX 2M1ZA 4QLOA 1P1FA 3DP9A 2HCJB 1E6WA 3LPNA 4KH0A 2VF7A 2B1IA 4N49A 4UARA 3ROQA 3U3OA 5HS6A 1HURA 1S2DA 4QG7A 5LC1A 4EKYA 2NQTA 5BWBA 4BMCA 4KN6A 1TI7A 2O2SA 4BPBA 3KU1A 2G9VA 3EQ9A 5DM60 1Z56C 3WSVA 4OK5A 1NN5A 2WV9A 1OV6A 2B5VA 3KQOA 4A2CA 4TLEA 3T3PB 5A4KA 4H6VA 5JY1A 2ZROA 1GVNB 3EEBA 2O2CA 4IQ8A 3W8FA 4P54A 3ZY6A 4C3ZA 4CI0B 2EFCB 3AFHA 4X6XA 1DGQA 2YHUA 3SQXA 3G8DA 1PTJC 4F3TA 1QIJA 4NJEA 2YV3A 3OJOA 3L6UA 4AM8A 4EG6A 1D2NA 1QFMA 2EG9A 2AF3C 1IHUA 2WYHA 5BN4B 5K2MA 3X43A 3BSWA 1EB9A 5AM5A 1UQUA 4A8PA 5JQGA 3I73A 1XJQA 4CM1A 5DW3A 5J3JA 3WLJA 3C87A 3QLJA 3DE5X 1Y6RA 2JLCA 4ZQFA 4YA6A 1KYWA 1B3BA 4UVHA 1BCRA 3M83A 4YRCA 3CVWA 2ZIGA 3LL4A 3ONNA 3LCJA 4G07A 1KVRA 1R00A 3TR5A 4WY2A 4YPVA 4IFIA 1HFWA 2FWRA 4AJ4A 1CZLA 1F4PA 3ZDFA 2VNIA 4O2AA 5CFLA 1ZD9A 4HWKA 5F1KA 3U60B 3HEAA 2AMLA 3K15A 3FTQA 1WZNA 1E2FA 2KE5A 1UM8A 2QXUA 4RGQA 2QQ5A 5JFGA 1AUXA 1E1LA 2CXHA 3LDHA 4E2ZA 1M1YB 3NETA 3QHAA 3THWA 1KJWA 3I8XA 1ENPA 1DAKA 3HG7A 4DJTA 2XWBF 1IUKA 3S29A 4AY2A 1G98A 2DF8A 4IMRA 2N3ZA 2VZEA 5A1TA 4P2GA 1QP4A 1RXCA 2HFKA 2J0UB 4PCLA 2R48A 4NPCA 4WKNA 3GLHA 4MIOA 4URVR 1EWQA 3W9BA 3MCWA 3CVUA 4TKUA 3HVKA 1S2NA 1Q14A 3BMXA 3WRXA 1MIOA 3K1TA 3K5WA 3LUAA 4AUMA 5HQTA 1FP1D 5HE8A 3RJTA 3SHTA 1TM4E 1QK3A 3S27A 4OBBA 2ZUEA 3F4LA 2P0EA 1NY6A 4MYRA 2BGJA 1NF2A 2SNIE 5T4EA 3SPXA 4EVRA 2NPFA 4POOA 3QLUC 5K4GA 3ECAA 3VKFA 3M4NA 3MMNA 1N8KA 2PQ2A 1N4DA 4AT1A 1MGOA 2J9FB 3ME5A 3AXTA 2P2ZA 5ALJA 4YAIA 2ZYDA 4P3KA 4B85A 5EUCA 4QXQA 4UZFA 4WXPA 3CZCA 2FN7A 3KOOA 4GWKA 5ALEA 3FVRA 3G59A 3MTGA 3F2VA 4JB0A 4FKZA 3T5PA 3BCHA 2PUDA 1OVGA 2HMAA 2VATA 4HD8A 5IBCA 3A9VA 5A9SA 4UZEA 1KBZA 1KJZA 2F1HA 2VUUA 4RLFA 5J43A 3SVTA 1XVLA 3MGAA 2O8DA 2X6QA 5BYAA 5AVXA 1PO7A 2I3GA 3HPQA 4LV8B 3TIXB 3R9XB 5JEDA 2P6OA 5H81A 3E2IA 1HL3A 2OFPA 1Z7BA 4LHXA 4V1CB 5AVZA 1QRSA 1DAHA 1EZ1A 2F64A 4NQZA 3FWYA 3KKPA 2YIMA 4TMYA 4HAYA 3PWZA 4AZSA 1I2CA 4X24A 1YS7A 4IJKA 1Q12A 5THXA 2P65A 3EXHC 3PEYA 4W5HA 3MS7A 3V2IA 3NM5A 3IBFA 3HO1A 2BIFA 5BR4A 1JTVA 2VYFA 3L8HA 2FJUA 3SP1A 1CY4A 1G8JA 1PQ4A 2FE4A 3HDJA 3QYAA 4KI0A 3VV3A 4D4IA 3VSAA 3BM5A 1MEEA 1ZKDA 4KRXA 2QN9A 4BKPA 5L3QB 4RHUA 1ND5A 2XLCA 3CW9A 3LP8A 5L6MB 3OPYA 2PZMA 2QA5A 3BXXA 4NMMA 3MWGA 3V4VB 3PNPA 1BKDR 1K4KA 4NH4A 4BGEA 4UQLA 1PJ2A 1A5BB 1DHTA 3B1VA 1XB2A 1B0ZA 4HQ6A 3DL7A 3OM9A 4EFLA 3E53A 3V1MA 2H00A 4R71A 4BE7B 1C7EA 4BN5A 4X9XA 4BY9E 1JXMA 1NVAA 4NE9A 4I66A 3IAM6 1L7XA 2A5JA 4RIFA 3WMEA 3O4FA 4JOCA 4AJJA 3WDKA 3ZYCA 1UDRA 1GT6A 3QKSB 1K88A 1UXIA 3N70A 2OB2A 4N3GA 2OO3A 1VHTA 1OYWA 3D6UA 2NTJA 1ESDA 3ANNA 1N6IA 1U65A 3FOBA 1DMSA 3UO8B 1L2TA 3CVJA 1XTVA 4Y6SA 5EMKA 5DBHX 3UXMA 3CGWA 1QFZA 2VBGA 3O95A 4QEDA 4U63A 2ZRBA 3CNOA 4DLLA 2LKDA 1NV8A 3GAAA 4B0OA 1VIVA 5FH9A 3NHZA 4KJXA 1D7OA 1KJNA 4QSHA 3ZZUA 4ZALA 1ZEMA 4LBYA 4CLXA 5BN5A 5JZ9A 4DJDC 2X9LA 5CNMA 1KZHA 5AK5A 3VI3B 4G26A 2V6GA 2ZI7A 2YRXA 4ZCQA 1VG8A 2IXGA 1NVXQ 4AS3A 4KN8A 1UKBA 4H0FA 2RH5A 3W5IA 4M21A 1KAQA 4HHEA 4BCCA 1ECBA 3HU3A 1BYIA 2E49A 3AF3A 1YVUA 4PO3X 2QI9F 4QWWA 1DJLA 5IKXA 1ENOA 2GN8A 4PGHA 1BO6A 1PAUA 1XRSB 3HBMA 4FMBB 3R76A 3T9FA 3TMAA 2YOGA 2LGJA 3BIFA 4BO4A 1Q0UA 4CJXA 5KNDH 1PFVA 3R8XA 3PFKA 1YNOA 3M5WA 4QHYA 1H9CA 4N41A 1S6YA 5L45A 2ZYTX 4DNXA 5DX1A 2RJ3A 2AOUA 4ZP1A 4AF6A 3Q7QA 2VTVA 2XCSB 1SG0A 3OZEA 4RQUA 3SZGA 1EU1A 1HEIA 4ALMA 2CF5A 5GAJA 2Z4SA 1UT8A 5ELLA 1CR2A 4B4DA 3EAFA 2HMYB 4QYTA 5BN1A 2I99A 2WUVA 5JSZA 2G1UA 1D9XA 1P2GA 4L8VA 4QQRA 3ZTWA 1Y5LA 1LLUA 2RI0A 1YIOA 2WTNA 1EBUA 4GLLA 4JJKA 4BO7A 4ZI2A 4IO1A 3A4NA 2DBYA 2J3DA 3BAFA 3USZA 1W4ZA 2Z2YA 4E5UA 4Z4HA 2XUDA 2ZR0A 3IAHA 1KY5A 3PUKA 3QPUA 2IP2A 3QX9A 3Q9UA 4KXLA 3H1EA 2W8BA 4AURA 2WIGA 4WACA 1RZRD 3GMDA 3EBLA 2GN9A 1QPGA 4KO1S 2P5TB 1YHYA 4M87A 4J9VA 3P5SA 3WNBA 1KMHA 3PXCX 4KOEC 5BV2P 3RYFA 1A82A 1NXPA 1BWQA 4QARA 4A6XA 3LX8A 4LGMA 4UEKA 1GDHA 1TKRA 2OZVA 3SX0A 5A1JA 4LDQA 2WICA 3PT9A 2Z9BA 2QE7A 4MVYA 2ISQA 2RH4A 4BNLA 4M1YA 5HK9A 1Z2NX 3R0VA 4BNDA 5DYTA 2PJRA 1YZKA 2C4KA 2FB9A 2QRJA 4ML3A 5TE9A 2Q1SA 5L3VA 1RTKA 2W00A 1YBFA 1TL7C 4XJVA 4W7IA 2OA0A 3GUZA 1OAKA 4MA5A 4N9QA 5TVKA 1RJWA 3O38A 4NCNA 2BJHA 1VIMA 1DB3A 2EZ9A 2ZJ8A 4NE2A 5IC6A 4LF7B 1ZUHA 1KFBB 2G0NA 1SQFA 4ME6A 2ZI9A 1O9BA 4J16A 4DDUA 4EQ6B 2H2WA 4X1YB 2EQAA 3GFBA 2P1DA 3CVVA 4YCBA 3FI0A 1P77A 4II7A 2P67A 3HU5A 4Y3UA 1E94E 2Z08A 3KOUA 3AOGA 1QPZA 3WYAA 3K0CC 1GNRA 3HYCA 4CTJA 1EWVA 4H1UA 4Y8VA 5FUXA 1MVNA 4EHAA 2V7GA 2XD9A 3G5LA 3VPSA 1H4VB 1VXOA 1USKA 1QGOA 2ODQA 2RB4A 4P58A 2WE8A 4UQPA 3JQQA 1V9CA 4JJFA 5FTJA 4XWOA 2Y6VA 3AI2A 4YMGA 3OPMA 2BH2A 2Q49A 1HZJA 1TB4A 3SS7X 5F5XA 4ARZA 4Q3NA 5CEJA 1GFIA 3AM5A 3QLVC 2UZ0A 3TFQA 3VISA 4P98A 1PTJA 3DWGA 5ALXA 1K6JA 1TADA 3BTUA 5CDUA 5K3OA 1UKEA 3OKFA 1FDVA 3FMFA 1EX7A 5BW6B 5DGCA 2QNBA 1T8PA 4YMWA 2W90A 3TZHA 4DT1A 2FLWA 3GIDA 3PQFA 5JWHA 3L0BA 5HUQA 1KGDA 1R4NB 2IYQA 2CFCA 1E9AA 1UXOA 2P78A 4OKSA 4BMYA 4NJMB 2R85A 3Q7TA 2EIXA 1IHOA 2DMRA 3EZ2A 9LDTA 3GPBA 2H2GA 4RE5A 4DLKA 1XTIA 1IULA 3ZX5A 5NLLA 2JAHA 1NXOA 2J45A 2XECA 1R88A 2BHLA 3ABSB 2P75A 3EC7A 5J5VA 4YQEA 4GWGA 3QVKA 3PQ7A 5D8DA 1WULS 4DG9A 2VSYA 3N6RA 4FI3C 4RYDA 3SNHA 1QRTA 1KEKA 4LF8B 5BWLA 2A9RA 2O06A 3I0ZA 1TNDA 2ZSHA 2VL7A 3H2ZA 4C6RA 3IIEA 2OQ2A 4ASUD 2DHRA 3L77A 4PIPA 4YAWA 2F17A 2EF0A 4ZIRB 1UXJA 5A5VA 2OESA 1H05A 3BUSA 2CNWD 1DIOB 4WVFA 5C37A 2DBVO 5CCBA 3VVMA 2FLKA 3DTVD 1DEKA 2RCYA 3BTSA 1E1QA 1PL0A 1SVOA 3WGOA 1NVUQ 3ED1A 1VBKA 3UGJA 5KTRA 1H23A 1RMTA 3DYBA 5DK6A 2BJWA 1RYBA 3SICE 2YZ7A 4IMIB 2ONKA 5HIJA 3KL4A 1X8JA 1AGPA 1E0KA 4NNJA 4J49A 4HS4A 2ZBVA 1CUUA 3NBFA 4I5IA 3QLUA 1QG4A 1PLKA 1W4CA 2XDAA 1IJBA 3KQMA 3ORFA 4GKBA 4AZ0A 1UBKS 1G8AA 3QFHA 3RG2A 1RXSA 5KVQA 4EWLA 1Y4UA 3AM4A 3OQIB 2V1XA 1W0CA 2Z2JA 3M4JA 4FYJA 4LYDA 4TM7A 4WV3A 3UT5B 3WKAA 2C59A 3AF1A 521PA 3VDMA 5KYYA 5K8JB 5F9MA 4V38A 3BD9A 3R20A 2X1VA 3N2LA 3C6KA 3TTUA 1EXDA 1XU4A 2BM1A 1D5CA 3K96A 4MKHA 1T29A 1MDFA 2AMJA 3FFAA 4GUDA 1AA6A 2WU3A 2B4KA 4MDYA 5FIUA 1M2HA 3KQSA 3EIWA 1A5ZA 3IP5A 3N2IA 1X7YA 1XTPA 3ZI4A 3FOEC 1M2VA 1Y3DE 2OCAA 3NIBA 4MPTA 2Z2IA 4RSGA 1P7VA 1L5OA 5D5QA 4BFTA 1J9ZA 3S8MA 1SCJA 4QQ8A 3SSNA 4DJ5X 3PNYA 1ULSA 1LLFA 2O0LA 5B7GA 3F3KA 1XYVA 4LN1A 1TUBB 2EFYA 1H2ZA 2EFGA 3EXHA 3T7CA 3U26A 1DV1A 1XCJA 3WV4A 5K3EA 4TYPA 2XGGA 1YJCA 2Y99A 3T3GA 1LI5A 4RMJA 1HE3A 3LYAA 2EJWA 4OEHA 3LCCA 2DE0X 2OCBA 3M6AA 5FPYA 4HAOA 2QSUA 3ADKA 4JCCA 3PE3A 1NTOA 2WA2A 3HUFA 3D6VA 4MVJE 1U8FO 1S2MA 3RIHA 1LLQA 3MINB 2UUAB 3C0KA 3R7FA 1WBDA 3B8EA 3GVXA 2BM0A 2EZ8A 2Y6UA 5DM0A 4FONA 4Z4FA 4L9AA 1E63A 3FZQA 4ZT6A 5EHZA 3GLFB 4LW8A 4OQYA 1U7HA 1UCFA 2PPVA 3BIJA 5DLYA 2CV2A 4K9MA 1YQXA 4RF4A 2Q07A 1VECA 3D1LA 4MHOA 2DUWA 3DEYX 1JA1A 1D2EA 4D3YA 1ML4A 2ZR9A 2BBOA 3Q7EA 1BS2A 3GN2A 4QLBA 3NM6B 4G4GA 4RXTA 1EFDN 4KZKA 5DT2A 3LJKA 1XJCA 2FEKA 3QUTA 2XUHA 2VSNA 3TTTA 1ZLXA 2ZJFA 1JDNA 3D3WB 3MSXA 4YCJA 5EMMA 2E89A 3CTPA 4M4SA 5JTUA 3RYCA 4LBWA 1KYTA 2E85A 4LC0A 2J3HA 2OD9A 3HY4A 2R86A 3C3JA 3FBTA 2CDAA 1PVOA 2JLAA 3WBKA 1DNPA 5FYQA 2FMTA 2P68A 3TNFA 2C58A 3L5OA 1CUVA 1FP4A 1UXKA 4HLNA 5IDXA 2H31A 2XZOA 4DNQA 1F17A 1MAHA 3L6OO 4EY7A 4LFCB 4Q7QA 5BSEA 1L1FA 4EI9A 2AWOA 2O5RA 2MCFA 1E99A 2XWSA 1V48A 4YDHB 1XDBA 2PDAA 2FEOA 5D3MA 1T1JA 1IIRA 2FZEA 1LBQA 1QKIA 3IAS1 1ZA2A 4P36A 2CLLB 3PDJA 4JA2A 3S7ZA 3ZC3A 1U8ZA 1MTZA 3FDZA 4JBXA 1DT3A 3NP9A 1ICEA 3K1JA 4MW6A 1M8KA 1BTOA 1QE3A 3D2LA 4LWPA 3EHDA 1R8SA 4A6EA 2WAXA 2AOXA 2W2QA 4EGJA 4CMIA 3SJCA 1GEEA 2JK0A 1JDBC 2ZRQA 3PK0A 4LDRA 2ZM5A 3WB0A 1P4HA 5EZYA 1QQBA 2W11A 2AKEA 3V8VA 4B8ZA 4Z54A 1U5BB 4PFSA 4FMCB 2Y0PA 5E0OA 3T9BA 5H9VA 3OTWA 4Q7JB 4AYWA 3KQLA 1JG2A 1FW6A 3W04A 3HCRA 4ZVKA 4CPDA 1SXPA 3UXHA 5CX1A 1DC7A 1A5AB 2QNIA 5IBQA 4RVCA 2Y1KA 2VIIA 4NBNA 4XFKA 1IONA 1CXZA 3DT6A 1YRWA 2J0EA 2XWQA 3HI4A 3JPYA 1KK0A 3I1FA 4D0SA 4OHXA 3IL2A 2RMKA 4NEQA 1V2GA 1VYVA 2AS0A 2XMPA 4DUYB 5G1PA 3GX1A 4PZUA 4YJHA 3OU6A 1MW8X 2P8SA 2R8ZA 3DAOA 3FOCA 4GYYA 4AKHA 2BF7A 1OFVA 3IRUA 2BUBA 3I9NA 3A2LA 3I45A 2PK3A 3L7OA 4MVCA 4ZCPA 3N07A 2HHHB 4IPTA 4J91A 4UVIA 5IJ9A 1JV2B 1VRWA 1IPFA 1RZVA 5CT5A 4ZT2A 2Q3CA 2EWWA 4JU9A 3ZWWA 4D3DA 5IXYA 2POQX 5JZVA 4FGWA 1PF7E 3N53A 4P2BA 1EWTA 3CSDA 5I3CA 5KS2A 5I6DA 3D6FA 3R3SA 2I03A 3QE9Y 1UDCA 3H5AA 4WKPA 2DCMA 3K2EA 3ZXYA 5ECDA 3GLFE 2ISCA 2PBZA 4YO8A 3NUQA 1DJNA 3K0BA 1M2KA 4XM1A 5EHNA 1O95D 3CNQS 1YI8A 4ZU3A 4C7VA 3TQQA 4AY6A 3B6MA 5FLKA 3FLBA 1AJEA 2IYZA 5KTOA 4FEGA 4R9NA 4F97A 4WBNF 5EIHA 3K0CA 5KNBH 1M7GA 1SAYA 3NR2A 5TT1A 4C03A 1D1SA 1NBOA 3OBBA 2A1TR 5C3UA 2RKBA 1GCGA 1MC8A 1GKLA 4UHBA 1L5WA 4TXHA 5DXFA 2CHEA 1IVNA 2OYCA 1Z5GA 1IOVA 4LQLA 1OF1A 2QWXA 4U2EA 1BMQA 2QTGA 1DEAA 2F55A 1SUPA 3QLVA 2YWRA 1PIWA 4M37A 2DXIA 1GUFA 2PUFA 1WCXA 2CDCA 4HADA 2V6MA 3G9UA 4BU0A 3G9QA 2ZJ7A 3GF4A 4D8WA 4F38A 1CKEA 2CYBA 1YGPA 3W4JA 2ZYHA 2V3CC 1YACA 4IKPA 3UENA 4JBNA 3NPAA 2XZDA 3HHPA 1WO8A 1ZS9A 3W5BA 3UQZA 1WS6A 3JWJA 2YWCA 4DY4A 3T7AA 3K9HA 1XDUA 3KPJA 3LC2O 4QATA 5IM4A 1W0JA 1H5UA 4KR7A 4AYXA 4TV8A 4QGHA 4YECA 5C46F 3PNMA 4PWYA 3VHLB 3SZRA 4S2UA 1ZCZA 1ULBA 1DLIA 2VRWA 3H2JA 5DP1A 2R8RA 3CH7A 3UJ7A 3OKAA 5ALNA 3RVJA 4QOEA 2XKBA 2BFEB 3O2SB 2EWMA 4A7PA 3DBRB 5H1YA 2G9RA 2BFNA 3HJHA 5CDSA 3KLOA 2ZOSA 3DV0B 3L1VA 2YH2A 1TVEA 2ODBA 4MRMB 4LJSA 4PAWA 4Q7LA 2ZBPA 3HJNA 3LKDA 4IUCS 4MUAA 1KC1A 2G06A 2NO6A 4L0DA 2PL1A 2V4MA 2DY0A 2WJJA 3L79A 4MWZA 5CNIA 4YV0A 2OZEA 5BXYA 5E9AA 5K0NA 4RPLA 3U31A 4BX0A 1EM6A 3BMNA 3D81A 4EF5A 5B7QA 3UWDA 5B6JA 2QS9A 4OJMX 3O91A 2P1RA 2HU2A 2JLVA 1FQKA 2IHUA 3FTEA 4XUGB 2WJWA 2IW3A 3EEYA 3VZRA 4AMUA 4KN9S 5GONA 3HNRA 3SDZA 1DQPA 4PIVA 2D2EA 3P26A 2VP9A 4NZYA 1VJ5A 3Q88A 4OHZA 1UP4A 4BO0A 2GZ1A 4KRYA 3FTFA 2NG1A 2J07A 3E7WA 2K87A 3IDAA 3CJTA 1FX1A 1C0EA 1T0IA 4KJZA 1U99A 3ZIUA 5L8VA 4LE0A 5LQDA 1I6LA 3MMPA 3OQHA 5EYPA 1HNXB 1TD1A 3HCNA 1WOYA 2QRZA 1YJBA 4KMOA 4AF8A 2RHHA 3LLVA 3BFJA 2ID9A 2EHJA 1G60A 2IYFA 2YICA 3I28A 3L0CA 3SIPA 3C3EA 3LOPA 4V1CI 3QBJA 3EHEA 3GLTA 1LDGA 3K70D 3NTVA 3IMFA 4IDBA 1P5ZB 2EIHA 4J0JA 3WLFA 3OLYA 4I1YA 3I5MA 1G8HA 4Q7EA 4QOFA 5FPKA 1C2TA 1HRDA 5D84A 3JCZA 1MRZA 2I8CA 3PGA1 2PEZA 3EYWA 3D6MA 4DUGA 2R7MA 5G4KB 3K0EA 3WK4A 4CV3A 4GRDA 1T1EA 1LPAB 2LD4A 2IBTA 1KI7A 1XMVA 2WUWE 3QQ5A 1QWOA 5EP4A 2E5WA 4K0KB 4XYLA 4MUEA 4DMGA 1Z35A 4YGYA 5U1PA 4D3ZA 3CCFA 1Y63A 3H0CA 3USCS 5FX2A 1QG6A 1V5FA 4O5AA 1TC1A 2IYRA 4OHUA 4GMHA 4DJFC 1RXWA 3HDQA 5EIAA 4OYLA 1ORDA 3IDSA 3EWSA 3PJDA 4B3CA 2WYIA 4V0RA 2A0YA 2XE4A 3RSGA 5CK5A 3L1IA 4A36A 2AB0A 5TS2A 5CB8A 2FPRA 2F4NA 2XCUA 4I14A 5T4BA 4YRFA 3FPJA 4B6FA 3V2UA 5BWNA 4GKJB 1IWOA 2C54A 2G72A 2HRQA 2OKCA 3DS8A 2JCVA 2DZDA 3Q2KA 5E95A 2PU5A 1F6BA 2QAIA 4KXWA 1QHHA 3WLPA 4ZTZB 2Y4NA 1VSQA 2QX6A 4EY6A 4D25A 3WHIA 2A67A 1P1BA 1C8KA 3IA7A 3CUWA 4FFLA 3SXJA 3R7DA 3QV2A 4LSZA 4CF6A 3PSHA 1P9WA 3SE7A 3H19A 1NVEA 1KI4A 5DRTA 3UTDA 1Q57A 5LDGA 3C24A 2BAGA 4GSKA 3TSCA 4YMLA 1Q3HA 4GC5A 2GN4A 4L9RA 5K3SA 1L5VA 2Q5EA 1Q20A 1T8UA 4LZPA 3DOHA 3FTDA 5B37A 4LSGA 3IXMA 4XLZA 1A4IA 4A2QA 4MR9B 2YZKA 4AJKA 1YE8A 2JGDA 4F7WA 2A9FA 5JAOA 1ZVMA 4PGAA 3M6WA 1DI0A 1AHIA 3AUYA 4N1AA 4L51A 1W85A 2C2BA 4FWBA 3IOYA 4JVSB 3WL8A 3AVYA 1THTA 4IIJA 1B73A 1SQ6A 5J4VA 3NJ8A 2PKRA 1OBFO 3OCJA 4OJKA 4Q1BA 1GPBA 4F2PA 4KVAA 5IFLA 3NDPA 3QEJA 2RCNA 2ZPAA 3DOFA 1P74A 2Y0EA 3BMOB 1PUJA 3Q3EA 4COOA 8LDHA 2FSSA 3Q8KA 3D8RA 3SX2A 4NFSA 4UATA 1GFZA 1DQZA 1AQNA 3PGVA 2R5WA 2WB4A 4UTZA 3TPFA 3WV5A 2BEVB 1AC5A 3DE1X 3NTQA 3C6QA 4KVGA 5K0CA 4I6JA 3E5HA 3HE3A 5THKA 4M1QA 2CSXA 1N7HA 2PUTA 1FSPA 1IN7A 2ZWPA 5L3SA 3KQPA 4FQ7A 4M0CA 4MWOA 4XQ0A 1G19A 5ALOA 5J63A 1FLVA 1SXJB 3CKYA 5T64A 4OMUA 4MQUA 3HNPA 3ZE2B 3GNSA 5CNJA 3FFTA 3UWPA 3DDOA 4EG4A 3CWQA 4C2AA 1I13A 1U9IC 2HRBA 2ZSUA 1FVOA 4RK0A 5LBTA 4Q9JA 3B6JA 4J94A 3FFWA 3QU5A 5B1IA 3RHTA 4DN6A 4R2IA 2W70A 1Z36A 2BUAA 4AWAA 5K3CA 4MH0R 3N76A 4HMQA 2YBDA 4RTKA 3MCVA 2YMMA 1FRQA 3RS2A 3SMQA 1ZZGA 3T54A 4DNFA 4I3GA 5J23A 2ICAA 2J3LA 1XMPA 4MS4B 3NM4A 5EFZA 3K3PA 5HS4A 1FJ2A 1D2AA 1OFGA 4CNQA 4D8YA 1Z6ZA 3G6WA 4RD2A 2D7DA 2AJTA 2Z30A 3LO5A 2VVTA 1Y4SA 3RB8A 3AVOA 3AY3A 3GJ6A 2AUMA 2W6ID 5F4ZA 2CMGA 3DEHA 3CEHA 4CF7A 1N6KA 1TOAA 3ZHOA 4G8BA 1ONSA 3H16A 2H6EA 2ZZKA 5ERGB 1B8VA 2IEDA 2OC9A 3EVBA 4I36A 4QICA 3RASA 1SUIA 4JL8A 5D5PA 4Z4QA 4EDHA 1M76A 4IFTA 3AV0B 5F35A 2DLCX 1EG2A 3JQGB 1ILEA 5FR1A 1BYUA 4UXIA 4XGRA 4TTRA 4HDMB 2LVBA 4ZMSA 1T2UA 2Q4DA 5GVSA 1GL9B 2ZIAA 3UMFA 4Q1VA 1Z5PA 4O4LF 2H18A 3E9ZA 5T4HA 3Q98A 5M5BA 1KEVA 2VPPA 4ZVQA 3V4FA 1Y8RB 1DC5A 3JD3A 2V9ZA 1QDEA 4UJ3A 3W1WA 1VP3A 4NDAA 4ADSG 4N7BA 3QXSA 2HJRA 4D79A 2DT5A 1UWLA 2JIMA 3IVCA 5E6RB 2VBFA 2NU8B 421PA 4MVJI 5DYGA 4DWOA 1SKUA 3PA8A 3OZAA 5K0ZA 2O7QA 1GQOA 1SUSA 1N92A 4LRUA 1TECE 4ZANA 3NHWA 4LV6A 5AMXA 3RTCA 4ZPJA 3ZHRA 3HDVA 4FSHA 2GEDA 3E82A 2GHQA 1PJRA 2C61A 3GVPA 4L0CA 3VGPA 3SBDA 1TYBE 1F0PA 3GJ5A 4JYBA 1X3SA 4PG4A 2GN1A 3UQYS 4DMMA 2D13A 4O29A 1R3DA 2XHZA 1OU0A 4H7FA 3RSCA 3QXCA 2NU9A 1BD3A 3AWDA 1Y6ZA 4RK5A 3TLGA 4B6QA 4CT5A 2IU0A 2GEJA 2ATEA 2AW3A 2W93A 1XLVA 5G3YA 3DT8A 5KOJB 1RLTA 5EIBD 5GZ1A 2EKDA 1TLLA 2J4DA 3AETB 1XZDA 1YB7A 3B48A 4BNJA 4DCOA 3OHPA 3O9VA 4H6XA 4JKOA 4PRZA 4XB2A 2QLBA 5M34A 3FPHA 2FSPA 4Q37A 1J21A 3HB1A 3RYTC 3WQSB 2AYXA 2C5AA 2HYDA 5MGBA 4ZCSA 4Q01A 3EIHA 4IIDA 2ODAA 2PMCA 1CIVA 1QIKA 2YYSA 2ZQZA 2VWPA 3FKSA 3RD5A 1SCAA 3OFKA 2AA3A 4DLRA 1SXJE 2ODNA 1RCTE 4MCIA 4BYMA 3KXIA 1MLDA 2YOHA 4K28A 2BGWA 1LK5A 5CA0A 1EXMA 4L7VA 1MH9A 5EN4A 3LQFA 2M2IA 4ZJYA 2FXIA 3NHMA 1CZUA 1L5HB 1XWIA 2Q3BA 4CODB 3GD5A 2VJBA 3HNOA 1OYYA 3JARA 3O73A 3QMPA 2GXAA 1U2EA 4B1FA 2FP4A 1LPSA 1QP8A 1N2CE 3CIFA 5EMLA 1BJRE 3NDIA 3TRDA 1CY2A 3E9EA 3IILA 4RKFA 2CFSA 2RGDA 3P4UA 3IXLA 4CL8A 4TZ0A 4OG2A 4HR7A 1TIPA 2FK7A 4E03A 1O97C 2IOQA 4BCBA 721PA 2YWJA 3WQBA 4EGCB 4OQNA 5FBLB 4ZEMA 3ILSA 2VF8A 5AVTA 4J6EA 4GR9A 3RT9A 2FVXA 2P6RA 1OROA 1RIIA 4PXYA 3WY9A 1V3QE 2FZWA 3TTXA 1G8MA 1ZINA 3QY9A 1OIXA 5J2UF 3B8HA 2G8NA 4X6YA 1JG1A 5E2AA 4ECAA 1JRLA 2YCBA 4B2LA 5LKRA 1E4EA 1Z07A 3B7GA 4ESEA 5I9LA 5LUBA 4CETA 4Y0VA 1BXRB 3ZYZA 1L7BA 3HBJA 5IYZA 4EJ6A 1I32A 1YU9A 3OX3A 1SCDA 1P9NA 1AQ6A 2PQMA 1O96B 1USWA 3GAZA 3R41A 5LCXA 1JVSA 1EBBA 1ZNYA 2BGRA 2F62A 2PNFA 5ICMA 3TF5A 1M8JA 1U0RA 1TRHA 1SVIA 2P9JA 1TM1E 2JJ1A 1J0DA 3VNRA 2YOFA 1YOVA 1LCIA 1AE1A 1WU7A 1PU2A 3AUAA 4H1WA 5CAEB 1O03A 1XROA 4RDXA 4OHBA 4RTOA 3SE0A 1EUQA 3H8WA 3TBKA 5FHQA 4MCHA 4N6NA 1A8UA 1ZN7A 2L19A 4U8HA 4TLAA 5DLEA 4M0LA 1WMBA 1QJ4A 4M54A 1WLYA 1HPLA 5JQWA 4H0NA 4RIGA 3ZU5A 2NZUG 5DLQC 2BM8A 2Q5QA 1G41A 2B1GA 3I8SA 5ALPA 1TM7E 4L0MA 4IW3B 4FE7A 1PS0A 4B46A 2VQDA 1KMNA 5ECWA 2Y0DA 5EVCA 1DPFA 2Q4TA 2C2XA 1Q0TA 1BS9A 5T3YA 2V7TA 5C3MA 2AYYA 3MRXA 5DBGA 1L5NA 4G1VA 1WQ4A 4OHMA 4RD3A 1NY5A 1MPTA 3R7AA 3ZE6A 3IR5A 5MHTA 1W87A 4ISBA 1X38A 3ROZA 4FFWA 3AR4A 4E11A 4MV6A 4WLFA 3G2JA 3HCDA 1A7UA 4KG7A 2PZAA 4Y9SA 2I67A 4KO4S 4Q4DA 4E7OA 3W6NA 4FEEA 1CUJA 2FFHA 2AI2A 3LP5A 1QYRA 3WSWA 4DVGA 4DTIA 3IVXA 3TVYA 3REOA 4K46A 2W6JD 4QPZA 3GLGB 4KLRA 4R3WA 3UMGA 1JDVA 1D8AA 2FOLA 2O2YA 2FFJA 4FLEA 3KWLA 3B53X 2UYQA 3O8OA 1U8UA 3CZAA 1FC0A 2ECPA 5EZ6B 2J3JA 2JRLA 2F1JA 2WE7A 2XDQB 4FFVA 4XIYA 4XR4A 2PFKA 5KEIA 2BMDA 2QMOA 2CHGA 4C4XA 3HP1A 3ZLBA 4XVQA 4N48A 3HCPA 3DE3X 3K16A 3GRUA 5F3RA 3VYSB 2VAPA 1OMOA 1JEAA 1ZPDA 4H1HA 3HCCA 1E6EA 2CWWA 1JPNA 4FWIB 2BKEA 1RHMA 4OVKA 5G1NA 2OLKA 1MO5A 3OOYA 2IODA 1FTSA 4R54A 3RV3A 3WLTA 4B0PA 4TXJA 5HZMA 3IO5A 3ZKWA 5JD4A 2ZJ2A 1ACLA 3MWFA 3TSZA 1T1IA 3SDBA 2V3VA 2YHIB 2ZDGA 3R77A 5COQA 1Y3AA 2JLUA 3IKTA 1J4AA 1K98A 1KH2A 1YDWA 2QSZA 4EY8A 2GS9A 4BLRA 2WHRA 5E7IA 3LCUA 4ZQGA 2JA2A 1PYDA 1ZGJA 4ZCTA 5BXQC 1DBPA 2BI4A 2WF7A 3R75A 1UC9A 2HLPA 2EL9A 1U9IA 4JOBA 4LRTB 4WN9A 4FW8A 4YCCA 5I47A 2JVJA 1FUYB 4AKIA 3DJFA 1MO2A 5B7NA 3GRYA 1X94A 4QRDA 1QFJA 5IH3A 1E9EA 1AB6A 1KS9A 1RZ3A 2DX7A 3JQAA 4Z3DA 1X6VA 3ZDDA 1ZNZA 3MHPA 3RJ5A 5C7OO 4YP6A 4FC6A 1W25A 1UOEA 2PL3A 3IMGA 1Y4AE 5JBNA 1T9KA 3CN9A 4RVGA 5D7NA 4BFYA 3T7DA 4M0MA 4WK4B 4B3XA 1FX0B 3D8NA 3FOZA 4ZYVA 5I9IA 2DPHA 2W9XA 4Q6BA 2IPLA 1II8A 4CEHA 1JI0A 3AYZB 2Y77A 5JAUA 3P9PA 1KKUA 3WHKA 2NSLA 4XJTA 4DPLA 1UFRA 4WLEA 1A1SA 3A4IA 3QQPA 3RANA 4C4OA 1XFDA 5HQ3A 3EF1A 2BZ0A 3KIPA 2ZJOA 3GRKA 4JR2A 4MP6A 1ND6A 4INJA 4N7JA 4DQKA 1MABA 5LA6F 1Z2AA 1PQUA 4PLCA 4QNNA 4XPZA 3NBMA 3DMTC 1Q92A 4Z6KA 4M9SA 1ZXBA 5F2EA 3TBFA 2AFHA 4N6GA 4FOOA 3VHQA 2C31A 2BFFB 2ODWA 2PAFA 2XB9A 2I2DA 2X41A 4HUQA 4O59O 2NSDA 4PZDA 4RANA 4XDHA 5GGYA 2CY0A 1NMYA 5JATA 3VJRA 1KKLA 2QE7D 3F1LA 3B1FA 3FZGA 5G02A 4AKSA 3GLSA 2YW9A 5IG2A 3MILA 4CL0A 4H4EA 2DB3A 2G7ZA 4JLOA 1LC3A 4J7AA 4TWJA 1PLLA 4DW8A 3PXDA 3F6SA 3A2MA 3GLGE 3VR4H 1U31A 2O2HA 3MQ4A 4FLMA 5LQSA 2B61A 4N40A 1DJQA 4RTPA 3WISA 4TYWA 2DUMA 3DPSA 2A59A 3FTCA 3JR3A 3OQBA 1UT5A 2WQZA 4KK4A 1HORA 3PKJA 5AM3A 2I6TA 4G25A 2CZGA 2EDAA 2ES4A 2MWMA 1MJHA 3H04A 3T4PA 4HN4B 3V97A 4OLBA 5EIWA 4FYIA 4X1IB 2H1OA 4ZYTA 2JAPA 2JFYA 2V5VA 2MJLA 3NV9A 4X63A 2AUNA 2IU4A 3IVAA 4PPNA 2DHDA 2HMUA 2VHZA 4PRYA 4WCFB 5ICCA 4IX1A 4DA8A 2ZVDA 3CRZA 4DNPA 1CB0A 2R8OA 3KYCB 2CCGA 1GXSB 1AT1A 3DHWC 1XEAA 2JFGA 4FN4A 4XCQA 5EJIA 5YASA 4MGKR 5FTMA 3WGLA 4FMDF 4I2NA 1XMSA 2GF2A 4DLAA 1ZM7A 2EJUA 3LECA 5U4QA 1I1QB 1GWNA 3PLNA 4DPKA 1X9IA 2J32A 1GITA 3ESQA 3LVFO 1OIWA 5F3WB 2IFTA 1ECFA 4D8UA 1GSOA 1KAGA 2A14A 1M72A 1RWWA 3KZXA 1HE8B 4RD0A 5AJTA 4BS9A 2CLOB 1I0ZA 1NG1A 5AVRA 3IBGA 3ZV3A 2Z0MA 1VDMA 5BUCA 2HA4A 2JGAA 1J0BA 2OCLA 4ZZ1A 2AR9A 1WCWA 3C8MA 3DUFA 5IJZA 3BXEA 5L4SA 5D51S 4S1OA 5E9QA 3TR0A 2GFHA 4B4OA 1UBFA 5BMVA 2WYVA 3E7XA 3S4YA 1KP9A 1OH6A 3C98A 3ZG6A 3IB6A 5L95A 1G8KA 3N5CA 4TS9A 1T3ZA 3LKBA 4IDEA 1H6BA 1TYAE 4YJDA 3SQNA 3STTA 4E5DA 3VTAA 4UU0A 1S89A 3MAAC 3EY4A 3E9MA 5FI0B 3SHQA 2FQXA 1OH5A 2WJIA 5TQVA 4ALNA 4QJBA 4CCWA 1XPUA 4B82A 3TJRA 2WKWA 1GN9A 1R9JA 3EZYA 4JT8A 4WBNB 2GDJA 2Z8XA 2GD2A 4OAPA 1C3LA 2FRVA 5JE8A 5LBUA 4MIYA 1HRKA 4AJPA 4BUZA 4ZEVA 1UAAA 2I9KA 2FOXA 1Z47A 5JSKA 5JVDF 1C9EA 1HMPA 1K7EB 2NO1A 3OP4A 4E3ZA 4WN3A 3SCZA 4UUBA 5BW5A 4JVOA 1GUDA 4Y30A 3EXEA 5A9RA 2QRQA 3O1HB 1PGQA 2GRUA 4KIGA 2K6GA 3RM3A 3O7MA 5FWAA 2D1SA 4QDTA 4B6RA 4CU5A 3M33A 1KO4A 3PRKE 1GPH1 3HZOA 5LBIA 3G1TA 1X2BA 4KFUA 4YQZA 2GI4A 3R6DA 5DEIA 5HRAA 5AKGA 4HDNB 2AT1A 3FBGA 4PQEA 3UAYA 3A9WA 3N9IA 2PIAA 2EYQA 5KWVA 4FNAA 2UVPA 2RGWA 5IKOA 1ONPA 3NJRA 1SKAA 3BZUA 3K0HA 1SBTA 1Q7CA 1U9ZA 5ESDA 2DQKA 4O1HA 4DLYA 2CJXA 2XVXA 1JALA 1GRRA 1JT2A 2BEUB 3EDRA 3G2OA 2CDBA 4ND7A 4DILA 1LFAA 3V4OA 2NUAA 2D06A 1ZDMA 3CX6A 2QTWB 1GDTA 2E6UX 1RYMA 4GH5A 3VJMA 1KYVA 4QYXA 3VNBA 4B17A 3AZQA 5BVGB 4H7IA 1DQNA 2BYTA 4OMFG 1VLZA 2XXAB 1Z83A 4FOPA 1Z6AA 3ENVA 1RAHA 1T36B 3OT5A 3OE1A 4LRYA 4X20B 3CE6A 3VVLA 4CV2A 4EAQA 4KQ1A 4K9LA 3R7WB 5CB4F 3THRA 2C4NA 1JHYA 1J0XO 3WRWA 3ZDRA 4Q9HA 3TW8A 1YBVA 2V6JA 2ZR8A 4COKA 4DADA 3F3SA 1PKEA 4QT0A 3EBOA 1B6SA 1G38A 1CHDA 4E33A 2IXAA 5JAPA 4MMYB 1QKKA 1XTJA 3C3DA 3T7JA 2Z9DA 2EGHA 3EG9B 3G5AA 4IVPA 5DCUA 1JU9A 5BNTA 4HWRA 3CNEA 1XAHA 4UUPA 4MRRA 3DMHA 5IVPA 3UJPA 3UA3A 1QONA 1R8QA 1NUUA 3ZBQA 1E0SA 1IWBB 3OIDA 3PB3A 4JFAA 4TMVA 1Y9AA 3FNFA 1E98A 4NMLA 3H9GA 4RWZA 5I7VA 4CU2A 4IRMA 3CF0A 3UYKA 1MC4A 2WVAA 1RP1A 1QIMA 2EZUA 2REOA 3OJ0A 2C84A 3UUGA 5K2OA 1KFJB 2BMAA 1FQJA 1A9YA 2JLQA 2GF0A 2Q2VA 1WP4A 3JQFC 2GILA 1FP2A 1Z06A 4GD3Q 4LHWA 4TYMA 2UVQA 3FCAA 1WMDA 5DYNA 4B6EA 5HIMA 4BDSA 1AM4D 4DQVA 4LY0A 1KEUA 2P3LA 1PR4A 2ZRCA 1SKYB 3TJMA 4BMVA 2DWUA 4NBSA 4HFNA 4O2AF 2FV8A 4DPMA 2GQ0A 4QU8A 3NHLA 3LD9A 2WOJA 3PVSA 3RFUA 3ZEAA 3CNLA 4NV1A 4CKWB 1SWWA 2FY8A 3FTPA 1T5DX 2OV8A 3B89A 3QYPA 2HW8A 1T10A 1VHDA 4F91B 5DNUA 4GBED 5F3DA 1J7JA 1VRCA 1XU7A 3GGCA 3RS8A 4XLTA 2RAUA 1URPA 2JFVA 4E94A 3OE5A 5KREA 5D5HA 4HZUB 1T6BY 3UOGA 1XWWA 4R31A 3STYA 3SZUA 4A23A 5JYCA 4B5KA 1TZMA 3FUCA 3U4QB 4J3FA 2XMCA 1LBIA 1U80A 1Y82A 4MDHA 4EYSA 4EIWA 1G7SA 5FEUA 3NASA 1EK1A 4KO8A 2D2IA 3AP2A 2XUGA 2EJCA 3RRNA 5LQNA 3AONB 3PNQA 1MO3A 3LX4A 2D2XA 3E8SA 3PQDA 1EVQA 4XIGS 5FTLA 1VCOA 2WZDA 3ZCQA 2I22A 5HZHA 3BMQB 1E8DA 1B8NA 2XQGA 1ACMA 1IOLA 1L7QA 3NHUA 4W5TA 4LK3A 4DLNA 1X80A 2VJPA 4UMEA 2BFDA 3DMGA 3RIEA 3WB9A 1NW4A 3SWWA 3UFXB 1BX3A 3HJRA 1F2UA 2IEGA 4AQ7A 4IG9A 4Q4AA 1NHGA 1M6YA 2G5GX 4MV3A 2NP6A 5KOYA 1RCUA 2CB9A 4HYTA 1QGUA 4RKQA 2NO9A 4QYSA 1QC5B 4B45A 4TZ6A 3SXUA 5TC4A 2AE1A 4F5DA 5JBIA 1LW6E 1D03A 2QSYA 1SURA 1NOKA 1KAMA 2HF2A 2FWMX 2OWEA 4EL0A 3UC5A 4EVQA 1B41A 4R1UA 2DGDA 2VTBA 1ZSNA 3DMTA 3NC1C 5CXUA 1U0SY 4J0HA 2E87A 2Z3WA 2OV4A 3PQ5A 4P86A 3AFIA 2CFRA 3WQHA 3ANLA 2Q5OA 3L7CA 3DDZX 3HJUA 4EB6B 1XK7A 5COAA 2MHCA 5AM2A 2DYKA 2L18A 4NPAA 4XSGA 2J9XB 5LQUA 3LY9A 1HQDA 1XNHA 3HKDB 3DM5A 1U6IA 3PGMA 5EE1A 1L7EA 2VP0A 3DTVB 5H3CA 4IVRA 1ENYA 4DC1A 4RXUA 3I58A 1A9OA 4M88A 4Y6GB 3RK1A 1ZI6A 3E48A 3BILA 1PYGA 2ATIA 3LY7A 3E7PA 4G5RA 2NAFA 4LTNA 5C4IA 4D97A 3KSAC 1A9RA 5AUNB 4F1KA 2NAPA 1VE1A 4M53A 2CDRA 1UBMS 4F56A 3ZCTA 8OHMA 2H06A 2DJ5A 1RXYA 5AI0A 1BE6A 1XQVA 2LR0A 3MTBA 3EBPA 5EJ2A 1NGSA 3T1NA 5C8VA 4GX0A 3MD0A 2RGRA 1YUMA 3B3QA 2PMKA 1FSZA 4KQCA 1ZRSA 3N2EA 2SKEA 4BMZA 5I3ZA 3FDFA 3RSOA 2YJGA 3DDUA 2UUBB 2IS2A 2EW8A 4TTIA 1U3WA 1J0CA 2J6IA 4KO3S 4B33A 1X39A 3GELA 3B3FA 4IQFA 4RGBA 2BCJQ 121PA 1TK3A 4QJ5A 1VPVA 4U7PB 3QEKA 2R751 1HT2E 3K5HA 1OE0A 3OWOA 2J3EA 3QELB 3FSRA 2XXJA 3EOAI 4P5EA 5EQDA 1XMIA 2CLDX 2VHWA 4WKOA 1JAIA 2BEWA 1S9HA 3OCUA 3Q4GA 1YRYE 2QYSA 1KMCA 3CPJB 4PHCA 2WHQA 4F4HA 5IT5A 2J3QA 4MULA 5FTWA 5KQGA 2JJ8A 2QZ4A 5AJVB 4ZHSA 1CUBA 5LZ9A 3FHCB 4N8EA 2OAP1 1BXKA 4GGPA 4OI1A 4TMKA 1GKIA 1XAJA 3W8RA 1UR5A 1ZUNB 2PSSA 2RHJA 4CMEC 3JW8A 1FF9A 4GM4A 1V41E 2D0PB 2D5CA 4TZTA 2Y93A 3E3OA 2E9SA 4CFSA 3W2IA 4D74A 1SB9A 4FFSA 1W0JD 1CS4C 2GN2A 4RM3A 1M0WA 4C6TB 3AF6A 1NVBA 1YBHA 4CE6A 1Q0HA 4QKQA 3II6X 4DWVA 3QA9A 1X7ZA 4CLRA 4C4TA 1UK7A 3KQVA 2A0UA 2EATA 2HTFA 5J59A 4DR1B 1KXJA 2WA1A 2WJYA 4OQ4A 2CD7A 1TTTA 4OHYA 4EYEA 5BRAA 4AJIA 4V0QA 3G5UA 2ZSJA 1SBYA 3NIDB 1CF9A 2YYAA 3IMEA 1M6WA 3DHNA 4MICA 1ZR2A 4OXNA 5IM5A 2OV2A 1MR3F 3FKQA 4O4LB 3HYLA 3ADBA 3GNQA 3G89A 4KACA 3O9MA 2FX5A 3MT7A 2UZ1A 1C7ZA 5HJ2A 2FKAA 3IEPA 1EPUA 4P4LA 2XDWA 3KEGA 5BT9A 1QVVA 3ZW7A 2HCBA 5J2TA 1TYDE 2X1LA 2Z2XA 1CE8B 4QU5A 2O7VA 3OLXA 1DLJA 2JEZA 3JYNA 4J90A 2PKEA 3BZBA 1XZFA 3DO8A 3ESYA 1RWKA 1ORRA 1T1GA 4JQCA 5AQEA 1J2UA 2NN3C 2ZYSA 3GJTA 5DB4A 3NRBA 3EISA 4BJ1A 4TX1A 2G09A 3BREA 2HZ7A 2XUFA 3T5DA 4QNRA 2VSXA 3R5FA 4FJ0A 2WHPA 2AR0A 4K88A 4LDJA 5C8ZA 5THQA 4PFJA 4XB1A 3V7WA 4DDMA 2A30A 2K2QB 3F4BA 3BL5A 3I64A 4I4IA 1NJ8A 5F77A 2W6PA 4AKTA 1OH7A 3H5LA 4LXYA 1XZAA 1Q44A 3WTBA 4BFVA 3ZOZA 4WK0B 4DE5A 3CCBA 1WMEA 3DTNA 4EAAA 1V95A 1HQCA 3LBAA 4TV9A 3H8SA 3EPKA 1SBNE 5A3SA 3E03A 4JX9A 3HLTA 4KDEA 3U0BA 4BNZA 2PRKA 4O63O 4QFMA 1LS6A 4BRWA 1A1VA 1LDBA 4UBOA 5JWRA 2FPXA 1PEAA 3SBEA 4DDWA 1JXQA 1J33A 2HREA 3BXZA 4NOJA 1VBMA 4DKJA 3EWNA 4PNPA 3TLAA 4DUGD 4I55A 2WSIA 3PQ2A 2JFHA 1UUFA 4MUMA 2Y3IA 3Q5EA 2BTQA 3DQQA 3PR1A 1LNZA 4FFNA 2J3IA 4RXMA 4A0QA 1DKOA 4CKBB 3E9NA 4ZGGA 2BHRA 5C4GB 3DMYA 4Q05A 4E5PA 1H69A 3LRPA 4CR6A 2UV8A 1JMVA 3RWOA 4X1KA 3G0HA 1CQIB 5SYAA 5ES4B 3A6PC 1YS4A 3K6SA 3TXAA 5K4HA 3BDVA 3H0EA 2CL7X 2IYAA 3RFFA 5JCXA 4W1SA 3QKRB 4FSXA 3HV2A 3WYGA 4R1LA 3GFTA 3WAJA 2PQ0A 3C5HA 3LUBA 4Y1GA 5E2IA 4UE3S 4MV1A 1HDZA 2HK9A 4LNAA 4LOHA 2PJZA 2LPMA 1YU6A 1SD1A 2X1HA 1U8TA 3CRRA 2JIRA 2VTEA 4PYIA 3OWHA 1F06A 1QFSA 5H4HA 5JFTA 1UM9A 1W47A 2OILA 3D4LA 1TD9A 3JQFA 3HM9A 3O7WA 3R7SA 3S2GA 3U3JA 4LZLA 5B1DA 4M1WA 4B76A 2UXBB 1O77A 4PYJA 3OA2A 1QP0A 2A3NA 5K3FB 3TINA 4L07A 4BXOA 1ST2A 1GU0A 1VHQA 4D92A 3LIIA 2QXYA 1EVJA 2FKNA 4KPUA 2J87A 4JYAB 5DCYA 5J2UB 3UH0A 1JHDA 1GRNA 4M89A 3U17A 3VZBA 1E79A 1M83A 2GARA 2Q45A 1PNVA 3RE1A 3O4IA 5CH3A 3UIEA 4C2BA 1RI4A 2G0AA 1XZ8A 5KOHA 3AEKA 3EW9A 3QU7A 3T99A 2B6NA 1WX1A 3KHUA 4HKTA 1JEQB 1NXTA 4BC1A 4AKGA 5K20A 4D4HA 2WMNB 1SQ0A 4AP6A 1WMFA 4DGQA 1TM3E 3NXKA 3PRHA 5AI8A 1ZK0A 4KMMA 4DWWA 3HY3A 3IPCA 1P75A 3ZDXB 1H0HA 1ZOPA 3NT5A 3UJHA 4BE9A 1UJ4A 1FNMA 5JSYA 1A76A 1SBHA 4HGPA 4EHKA 4C9BA 1JZTA 1R4MA 1PSZA 2AQHA 2VDWB 4EGAA 1YB2A 4URUR 1GLNA 1LJUA 3CW2A 3H4MA 3MTIA 4HI0E 3RS7A 1C7RA 1T9ZA 2GD6A 2PANA 1BSVA 3MRSA 3T7RA 4B9AA 4K81B 1TXGA 3GT7A