1OV4A

Crystal structure of human dhea-st complexed with androsterone
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
284
structure length
267
Chain Sequence
SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKEYVVDKTQLSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identifying androsterone (ADT) as a cognate substrate for human dehydroepiandrosterone sulfotransferase (DHEA-ST) important for steroid homeostasis: structure of the enzyme-ADT complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Alcohol sulfotransferase
total genus 87
structure length 267
sequence length 284
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2003-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ov4A00
1MR3F 4IFEA 5G53C 2W0MA 3SQWA 4A4DA 5EUMA 5BQ5A 1OIVA 4U02A 1N6NA 2GILA 2CK3D 5J4YA 1R5BA 2V4ZA 3LA6A 4I1OA 2O8DA 1XEXB 1DEKA 3SQXA 2JA1A 4EAQA 3WNBA 3WY9A 1GOTA 1OF1A 4P32A 3RSOA 3RYTC 2XZPA 1GL9B 4A0HA 2ZYVX 2FGKA 2F43B 1Z2CA 1OXXK 1YKSA 3H86A 4MGYR 1G4AE 4FMCF 4CVNA 4HZUA 4M1YA 2BVNA 1A4RA 3PEYA 3V4FA 1GUAA 3LBNA 1G19A 1WA5A 4NU0A 1KKLA 4GBMA 4GOKA 2PMDA 3ZQ6A 4F4IA 1Z6GA 1CR1A 1I4DD 4GNKA 1LNZA 2FSHA 3LAWA 1Z6XA 4LWZA 1G8PA 4JJZA 4WVFA 2DFTA 3W90A 3ZIAA 4C0KA 5A0FA 1IN6A 1F2TA 3MMPA 3RS7A 4B6EA 3CZQA 5CDFA 3ZH9B 3BE4A 3CO5A 1ZRHA 2QE7A 2WJYA 5IDVA 3WHLA 2BMDA 1YZNA 5HKKD 1N0VC 2H5EA 4BFTA 4BLSA 2HJVA 1E98A 4YC7A 1VCIA 2GJ8A 4NCIA 1II8B 2ZUDA 5FUYA 3ZD6A 1LVGA 2F9MA 4JZKA 1WF3A 2CCJA 4G0NA 2W2VA 4NKRA 1DAKA 4KODA 3UANA 4V0ME 3IO5A 1JQJC 4M0LA 4BUJA 1E9FA 1UKZA 1XRJA 4OHWA 3W3AA 1DADA 4DDWA 5D3QA 3A4LA 5L3RA 3DVLA 5KOYA 1KDRA 4OK3A 3NDBB 3AF4A 1KTVA 3EWAA 3I3SR 4POAA 1B0UA 1XB2A 4FMDB 2J0VA 1GSIA 2FZLA 1PZNA 1X3SA 1G6OA 2BC9A 4W5HA 5FOUA 1JPJA 1NJGA 2ODBA 5AWFC 1VCMA 3LY5A 2Q3MA 2A5JA 4GMXA 4WZBE 1E79D 3A1TA 4OKSA 4TQUS 1PLLA 4AYXA 1U0JA 1Q1ZA 2DYKA 3MD0A 3OIUA 4RSGA 4BFVA 2AHOA 2HXYA 3EZ7A 1OXVA 5JI3E 4L16A 3I5XA 4B2LA 1DG1G 3T1VA 5FL7D 3QBTA 5FPYA 3CKLA 5L8VA 3U5ZB 4XOIA 2CMKA 3IUYA 5KDOA 3ASZA 4LSGA 4OJQA 1V43A 4M1MA 4WXRA 1ZD8A 4KYIB 1FP6A 4DJTA 1S3SA 3IIJA 2FA9A 2ERXA 2HXSA 3UIEA 2X8AA 3OESA 4AG5A 2QSYA 1E3MA 5JHHB 3WBJA 2QTFA 4BQSA 3KZ1E 1OH5A 4B75A 2HDNB 2NPIA 3PQCA 4C9BA 2WWXA 4DDVA 4Q47A 4M2LA 2EFEB 2NO1A 1W4RA 4B3FX 3RNLA 5C4MA 3CIOA 1E2PA 1BYIA 1OW3B 2ZAOA 5E7JA 3NC0C 1F60A 3EIEA 4PPQA 4RD2A 1XTKA 2VP9A 4MRRA 4ZV4A 3L0SA 3X1XA 1DAHA 1KI7A 2P6NA 2BJWA 1H8EA 4E07A 4RCZA 3I62A 2REBA 3GJ3A 3LVQE 3VNUA 2YNMA 3UG7A 4HEJA 5B2ZA 2QPOA 3PENA 2AKAB 3TKLA 2WJGA 2A2ZA 5JHGB 5KNCA 4DLTA 1BS1A 3KXLA 5B57C 3GPLA 4A36A 2V7QA 2VHJA 1XNJA 3LLMA 3LV8A 5DI9A 1E2MA 3E2IA 3CB4A 1EK0A 1XD9A 2NZJA 3CW2A 5F2EA 1M1YE 1X1SA 5KTYA 1HQYE 2EVWX 2PL3A 2WV9A 4G5RA 4B3BA 4YONB 2OFOA 5KSYA 2P0EA 3BJIC 3UMSA 1I4LD 1Q3HA 4Q48A 1NIJA 2BMEA 1FUUA 1CU1A 3ND9A 2G0NA 1E1QD 3LO5A 1F48A 3K8YA 1OYYA 2JGNA 5TVKA 3ADDA 4LYFA 5FUVA 2F9LA 2HCJB 4C7OA 3H4MA 1E2QA 1N6HA 2AK2A 4QJ5A 1MKYA 4LX0A 4A2QA 4PO9A 4GL2A 4W5JA 4HB2A 1O87A 2ZR9A 4N1AA 1Y63A 3I5YA 5FTJA 2C04A 4JVMA 3DHWC 3N70A 221PA 5J4HA 4OQFA 3DMDA 4ILEA 2QBYB 2ZRGA 3WNCA 4D26A 1E2HA 2ZS7A 1W1WA 5AJYA 3A1WA 3S1AA 3W6NA 4BFUA 3J81k 1ZM2A 1TF5A 4KYUA 1Z0KA 3ETLA 2J5XA 3X1WA 1QHHB 2WPDA 2WICA 2JLSA 1S96A 4B73A 2GZHA 4ZIRA 1WRBA 4PZYA 3CPHA 5L3VA 3KJGA 4KFRA 2PEYA 1GITA 4DB2A 2RGAA 3ADKA 4GFDA 2IYLD 5F9HA 1FNNA 1IXZA 1T5LA 1S0UA 1Z0AA 1UKEA 2C9YA 4PQYA 5DHAA 5JSZA 3A6PC 2ORWA 3A36A 4OHZA 4DEYA 3K0FA 3B1YA 4MH0R 1KI1A 1JJ7A 2GDJA 3C7KA 3EPLA 3GLFB 1G16A 2ANBA 2RHDA 3MWJA 5TARA 3B8HA 4P31A 1G5PA 1P2UA 2GBLA 4RD6A 4Z51A 5KYKA 2V8OA 3KL4A 5TY0A 2VH5R 4RY2A 4FWIB 1F5NA 1X1RA 2O8BA 2CK3A 4TT3D 3GJ8A 2XGJA 3TUIC 3AVYA 1X86B 4W9MC 2CLDX 4K8OA 4P4UA 2W6ID 1CF4A 5J4VA 1TUIA 4Y0AA 3R9XA 1JR3A 4U00A 4YMTA 3GLHB 3C5CA 1IQPA 1KK2A 1FPMA 1A2BA 3CBQA 1UADA 1MRSA 1QHYA 1RZ3A 3UMRA 5FUWA 4AKHA 1EG7A 4O3MA 1GKUB 3L2OB 4WA7A 2VPPA 1RRFA 4IXMA 3VR3A 5J40A 4UXHA 2D2EA 3GEEA 4I99A 3TSWA 2NO6A 4P4SA 4U7DA 4XD7D 3KQNA 2JLZA 2FFHA 2W2XA 2XB2A 1XXHB 2H8KA 2RMKA 1DO0A 2GHIA 2QUZA 3AF1A 1C1YA 4RJLA 2PLFA 2N1BA 4NYMR 4YMVA 5LPNA 3N2IA 2WJVA 4QJ3A 4LJ6A 4EFLA 3E5HA 3BAFA 4MRSA 3AVVA 4EKDA 1FMLA 4WOPA 1VG8A 2XSZD 2ZQ5A 4XTRA 2XZLA 1BMFA 1HT2E 2BBOA 2ZSAA 1KZ7B 2JDIA 3B1VA 4JLNA 4Q19A 2JIZD 4PPFA 3B82A 3REFA 3UPUA 4B48A 4AKGA 3M0EA 3VU9A 3AM1A 1M7BA 3GD7A 4KXFB 4URUR 1XPRA 4JVLA 2IYUA 2ODEA 4OI1A 1UBEA 3MUFA 3OEHD 1N6PA 1G4UR 2AWOA 2YC4C 3MWLA 1KMHB 3T06B 4I1VA 1NKSA 1XXHE 3DEFA 2O0JA 1KJWA 3W34A 5F3WB 2CEAA 5HZHA 3SJCA 3VHLB 1KAOA 2MSDB 4KVAA 1NKTA 1NVVQ 2GJAA 2QQ0A 1XWIA 3PUWA 2DWOA 2PBRA 2A5GA 2ZTSA 1ZNWA 3TAUA 3KJHA 1W36D 4NYMQ 4TMTA 4XVQA 4A82A 2CHGA 5J4LA 5FI1B 1KZGB 4M1KA 2GJKA 3HU2A 1KI3A 4JL5A 5L3QA 2IYRA 2VIIA 3GP8A 3SYLA 4RD3A 4B71A 2HJGA 2B7CA 2R6AA 5LB2A 1UBGA 3BB3A 2IXGA 1XBTA 2WJHA 1U99A 1ZIPA 4QBFA 3FWYA 2WPDD 1P72A 2AWNA 3D6TB 2QY9A 4UJ3A 4X8HA 4I1UA 5JI2E 1KO8A 3PIRA 2Q9AA 2ZI5A 4URXR 4MRNA 2YJTD 2I1QA 1CBUA 3MWYW 4I1SA 5KSPA 2ZI4A 4ARZA 5HE9A 421PA 1NBMD 5L3QB 2A7QA 2B8TA 3QY0A 4LRWA 4URZR 1XEFA 3KB2A 3WHKA 3LBHA 1FW6A 3QPUA 3GFPA 4RZUA 3PEWA 2BIFA 2ZI7A 1WDTA 4H1VA 2DR3A 2DFNA 4JYCA 4Q01A 4G3XA 2GA8A 3NH6A 2ZJZA 4M1TA 2W2TA 3HPRA 3KUCA 4LV6A 3HR7A 3TE6A 2DB3A 4M22A 2ZITA 2BEKA 4V0KA 1K5GA 3HU1A 4YMWA 1L8QA 4DEXA 1ETUA 2F1RA 4ZCLA 4LY6A 3FMPB 4KV9A 2ZJAA 4NZYA 4A0GA 1XTIA 4QKQA 4IOJA 3EPJA 3FOZA 5CB8A 1IN4A 1EX6A 1JNYA 1DS6A 2VRWA 2NMVA 4KLNA 1OH7A 3MGCA 4IDQA 1P2SA 1WBDA 1G3QA 1OLOA 2QI9C 5AUPB 4KFSA 4TL8A 4OJKA 3NH9A 4Q9KA 2AR7A 4TZ0A 3H84A 3KKPA 1FZQA 3CX6A 1KY2A 1NVWQ 1P9WA 1G7TA 2QMOA 3OEEA 4U5XA 1FL9A 3AVUA 2D06A 4TYYA 2G88A 2C96A 4RD4A 3C14C 4J0QA 4YQFA 1GNPA 3DOEA 1LS6A 1NG9A 1XD2B 3P32A 2WSSD 1H65A 4US2R 2QMEA 1OB5A 4AC9A 3P4XA 2MMGA 1D5CA 2DCUA 2JLUA 2IF2A 3IO3A 1E2IA 1AQUA 4LZZA 4D4LA 1US8B 5K8TA 1DAFA 3TLXA 1AN0A 2JDID 3CZPA 2GEUA 1S4QA 2PH1A 2A5DA 2DY1A 2V6IA 3VR6A 2J0SA 2AN9A 4QBIA 4D81A 2ZRKA 1CRQA 3GLIE 1E1QA 5EZ5A 1G3RA 2XEXA 2R6DA 3L43A 1OFUX 3ND8A 1S8FA 4OI2A 1G8HA 1TEXA 2H1LA 1Z83A 4C0LA 3IHWA 3T1OA 4IEEA 3QF7A 2XOKA 1U2RA 1QHHA 2BMJA 1N6LA 5FL7A 3VR1A 1E2EA 1VYTA 1WBBA 3OE7A 1GILA 4JSTA 1YR6A 4JKIA 4LCBA 4LBWA 1QVRA 1IAQA 4FMBB 3GJ5A 4PSKA 1OFTA 4Q1AA 4BFSA 1JAIA 5DN6A 1AS2A 4XSGA 1AM4D 2GEVA 1HUQA 2OM2A 1YRAA 2GK7A 2HT6A 1NN5A 1KKMA 1DG3A 4LI0A 4LK2A 2WOOA 2ZPTX 4GMDA 1X8KA 4Q7KA 3TK1A 2ZEJA 2YC2C 3FPAA 3K0FB 3T15A 1N5IA 1NJFA 1H8HD 2CJWB 2CL6X 3TW8B 1W36B 3U44A 1LV7A 1G7SA 3BERA 3L8ZA 4B3DA 2X77A 1RC8A 4DC9A 3THXA 3PVSA 2HLDD 4Q00A 4RZ3A 4V03A 2ZJ8A 1VHTA 1SXJC 4F38A 3ZLJA 2HUPA 2OFXA 3SFZA 2B7BA 5AR1A 3OFNA 1KDTA 4MGKR 3EX7C 3NEYA 3CNLA 2OCBA 4MA4A 5D3MA 3ZZ0A 3THWB 4KITB 1E94E 4Q1DA 4TTRA 2QRNA 5CJ2A 3B85A 1T8UA 2QTHA 4OI0A 4PZZA 1Z63A 3BFKA 2G77B 4PFSA 1T3SA 2RGNA 4AK9A 2ZU0C 4HAUA 1AZSC 1MABB 1E32A 1EFCA 1PV4A 5JRJA 4M21A 1FTSA 3KXKA 2IC5A 4ZIRB 4P0TA 5CK5A 3O8BA 3VMFA 5IK2D 4W5WA 4B2PA 2OBLA 3KXIA 3NXSA 3QNUA 2AKYA 1KSJA 2CBZA 5EZ6B 2QPTA 1KSGA 1VCNA 1CRPA 1U8YA 1Z29A 4QRHA 2RGCA 1EFTA 4A8JA 2QROA 2GAOA 3BB1A 2P5SA 4DIDA 3BH0A 1PUIA 1NLZA 1UEIA 2WTUA 2N46A 3U3KA 621PA 1E9EA 1UFQA 4MGZR 2HT1A 4H9GA 2KSQA 4IVPA 1NIPA 1SGWA 3GLFA 2GNOA 3AKEA 4IHQA 1J2JA 3QXXA 1LY1A 2VP0A 1A2KC 3U3RA 2ZSEA 3G0HA 1BKDR 2ORIA 1OJLA 2JJ8A 3FKSD 1RVDA 1W49A 1TQ6A 2FPLA 4MRPA 1COWA 1OKKA 3Q7PA 3IQXA 4UXIA 3NHAA 4NYIR 2R8RA 2UKDA 5DI3A 2LCFA 3EC2A 2VL7A 1GKYA 1JALA 1F6BA 1ZD9A 2VF8A 3QPVA 4PSAA 1E2FA 1IY0A 2ZRPA 3ADCA 1KGDA 5J4KA 4RD1A 4XVRA 3FFAA 3SEAA 2Z6VA 3MAAC 4M4SA 3AH8A 4PC1A 1LF5A 2C77A 2VP5A 2WWWA 3VX3A 3U6BA 3BGWA 5JSZB 1R5OA 3THYA 4S2EA 4X8LA 1XMSA 4A8JC 2ZI9A 3B9QA 1RFLA 3LW7A 4NTZA 1YZLA 1R8QA 1HY3A 1G1MA 2GJSA 3LDAA 4LPSA 3NG1A 6Q21A 1NNEA 2KI5A 3T12A 3PITA 1VIAA 3X1YA 4TTQA 2DWQA 1N3BA 1RIFA 1SVOA 4MYUA 2SHKA 4OHVA 2JCSA 2C8VA 4M9XA 3U7FB 2A78A 4TYPA 2FPMA 2K5UA 3U7HB 2JLVA 4LJ5A 4F4JA 1Q12A 4BLTA 4CIDA 4BE7B 4QGFA 3LD9A 5FPTA 1DBSA 1Z0DA 2BBSA 4ZDKA 3IEUA 5HTKA 1G41A 5BW8A 2IYWA 3H1TA 4EPRA 2IUTA 1G5TA 4IOLA 1AKEA 3UK6A 4PAQA 2YKGA 2VO1A 4DSNA 2E1RA 5FFMA 4US0R 3CWQA 3RVBA 4QHSA 1XD8A 2WWGA 2O8EA 3C4JA 2RGGA 3BBPA 3O47A 1TU3A 3SR0A 1TQ4A 4AKIA 4LGMA 5EJEA 5KDDA 4F4CA 2XITA 4H1UA 3TMKA 1KJZA 2OG2A 5DH9A 3HYRA 4EDHA 1N6OA 3ZZTA 4IDOA 1XEWY 2GKSA 2OO7A 2H17A 3RRZA 1YZUA 3CH5A 1M7HA 5FUXA 1ZUIA 1WB9A 2WMNB 2ATXA 3TAHA 3S1AB 2VBCA 2CL7X 4JLMA 1SVSA 521PA 5DO9A 1FP7A 3CRW1 2QG6A 4PPNA 1G8YA 1JXMA 2XNDD 3THYB 2H7VA 3MFYA 3CRVA 1X6VA 4NH0A 5AK0A 5FL3A 2PMKA 2YOHA 3RHFA 3HP1A 3U7GA 1T0HB 3FMFA 1IY2A 2FNAA 2ZSFA 4NONA 2FDCA 2WKRA 1P9NA 3I4LA 3IIMA 4ZCIA 2ASEA 1IJEA 3IPXA 3TR0A 5CM9C 2ZVQX 3I92A 3ZVMA 1T5IA 1S9HA 2FFAA 2IW3A 3VX4A 1FTNA 2QP9X 4TZ6A 1ZU5A 3B13B 2VSOA 1M2OB 3LQRA 1ZM4A 4ZI2A 1CJUC 1OKKD 2Q6TA 2VSXA 4V0OA 1YHNA 1XZPA 3PUYA 4BZXA 5CDFE 3FHCB 5CM8B 3IQWA 5C4GB 3C16C 5GJWC 4DLYA 2IF0A 3RWMB 2JASA 1JQLB 1XF9A 3L82B 1W48A 4Q1BA 5K8IA 2VEDA 2CHQA 2GRJA 3A58B 3I73A 1HURA 4FCTA 4D80A 5ANRB 2Z5FA 3UWOA 1P3JA 1KO4A 2IS6A 4HLUC 4PX9A 4QBGB 4HDQB 5TB5A 3DKPA 1SXJB 2P6UA 2P67A 1G8FA 2X2EA 5FI0B 4CEIA 4ESHA 4G5QA 4ZCMA 1D2NA 3BD9A 4PSVA 1R2QA 1OHHA 1UBCA 5FBWB 5FBLB 2GESA 3RSLA 1WQ1R 1C9KA 3I72A 2G0TA 1GWNA 3ICQB 3I8SA 3M1IA 3K09A 3RS3A 4Y0VA 5AJVB 4NYJQ 1XTSA 1PLKA 2QE7D 1ZUNB 5JJIA 1HA3A 3FFBA 4GZLA 1U9IA 1TF7A 5EXTA 2JJ2A 4FCVA 1MV5A 3CWZA 4LYAA 4Q1EA 1Q1BA 1ZU4A 1VMAA 2ODNA 3QKTA 1TQ2A 1ZM3A 1NG1A 4DLSA 4TL7A 4IDHA 1Q3TA 3CLVA 3TJZA 2OAQ1 2CE2X 4RZXA 2J7PA 5C18A 2IEYA 3TQCA 3DM5A 4LOAA 4PC7A 2ZXUA 4DCTA 2QORA 3K0AB 4DCNA 2V9PA 5LD2C 3SHWA 2J7KA 2O5VA 1SVIA 2QQEA 4O0MA 4RD0A 4TSFA 1FOEB 1N25A 3CONA 1MO5A 4CT5A 5G40A 2XAUA 2OT3B 2UZ3A 2OCPA 4ZKEA 2PEZA 1OV4A 2IYQA 3GMTA 1WE2A 4PAOA 4Q03A 1RRGA 3KJIA 4AG6A 4HAVA 3NBZC 1AA9A 4F91B 3NC1C 1RKBA 3RRMA 1R0ZA 2D7CA 4HDOB 2WMOB 4ZO4A 2IA5A 5BWMA 1T9HA 3X1ZA 1YZKA 1XX6A 3GFOA 4JT2A 3QQ5A 1T3HA 3RDPA 1YZQA 4RFVA 3OIWA 1Z2AA 3WYGA 3SC3A 1KI6A 2QM8A 1CLUA 1IM2A 5IK2A 3X1DA 3WP1B 1MO3A 1ZIOA 4C4PA 4MQBA 1AS0A 2R9VA 2ZRNA 4RCYA 2IWHA 3FE2A 2GVZC 1EWRA 4GSYA 3L0IB 1K5DA 1II8A 3CF0A 5E4FA 1NLYA 4WXPA 4BFZA 4A15A 1YRBA 1XU4A 4PR0A 4QC2A 1JJVA 1O3YA 3THXB 2O8DB 2EWWA 1SHKA 4QL3A 2FOLA 3K9GA 4EJSB 4CEJA 1G17A 4NMMA 5KNDA 1CP2A 2JLQA 2OLJA 3LW8A 4FCWA 3DM9B 1S3GA 3T1TA 2WIAA 4NCKA 1GRRA 1K6MA 4TYNA 2JATA 2W83A 1KAGA 4FW9A 4D4MA 1P75A 1OH6A 2ANCA 2AD1A 3AVOA 4UJ5A 1E79A 5FTMA 2RGDA 1SVLA 5HE8A 2FFBA 4EFNA 1I2DA 4Z8XA 4BZPA 1DAMA 2WVJA 4MDFA 3LBIA 1G7CA 4QGHA 3ZZUA 5JWRA 1W4AA 1E0SA 1KK3A 3K70B 1DOAA 2CVHA 3THWA 3A8TA 3FDIA 2YOFA 3CRMA 4Q18A 1PLJA 2RH5A 3Q72A 2DFKB 4E03A 1P2VA 4AYTA 3B60A 3R20A 1G20E 2FGJA 3SJBA 3QVUA 4C3ZA 2VHCA 2CCGA 1ZW6A 3LH5A 4CZ2A 2HF9A 4JS0A 5CYPA 2JAQA 3G5UA 2J9RA 1E9CA 2V54A 4D6PA 1N6IA 1R8SA 1T6NA 5CK4A 5FTKA 2IYXA 1EFUA 1AGRA 2VHUA 4DHEA 4CW7A 2GCNA 1AKYA 2IYSA 3NBXX 2IXEA 1B23P 2FWRA 3PEUA 3IIKA 3MWKA 2F43A 3REGA 3ZGXA 2V1UA 3LXXA 2YVUA 4V0LA 3QKSB 2AD5A 1QF9A 2O0KA 2HEIA 2ONJA 1L2TA 3EA5A 3Q85A 1MH1A 3QENA 1Q22A 1P9RA 1T3LA 2W0SA 2ZVPX 2J3EA 1DVRA 1V5WA 4MYHA 3VR2A 3SYNA 4C0SA 5JMTA 3FHTA 3BC1A 2P3SA 2CHVA 3B5JA 5JZVA 2W6JD 3AKCA 4FMDF 4Q66C 3TIFA 1Q21A 2RB4A 5JWOA 2HYIC 3B9PA 3IGFA 4C30A 2WSSA 3TNFA 1Q57A 4MKIA 3CR7A 4FD2A 2C03A 3D8BA 1NBMA 3BWDD 2FX3A 2PJZA 3FYHA 5JJKA 4JMPA 3LQQA 4RVCA 3EC1A 4JLVA 2V1XA 1VTKA 4YXWA 4BFWA 1JBKA 1AIPA 1J8MF 4GT1A 3P27A 121PA 3K0CC 4C7OB 3B78A 1G3IA 3LLUA 1AS3A 5EE9A 5TV2A 2IUUA 3EARA 2QAJA 5FH9A 3PCRB 4K46A 5BYKA 4YXWD 1XP8A 3K70D 4BEBA 4E09A 4A2WA 2PX0A 2ZJ5A 4URWR 4Q9LA 4AYWA 3OFND 4PXAA 3RS4A 4DDUA 3CNOA 4ASUD 1RRPA 3C5HA 4HLDA 5JCPA 5GADl 1NBME 4BRWA 2ZAMA 1UBFA 4O25A 2JLXA 1W7AA 2GBLC 1JECA 3RWOA 3A1SA 4EQ6B 3GEIA 5BYJA 1J8YF 4OQMA 3W3ZB 1NF3A 2ZIAA 2IWRA 3AP3A 3W5JA 1N5JA 4P4TA 5BN4A 5HCIA 2G9NA 4B32A 2Q3HA 2O8CA 3VKGA 4NHOA 2MMCA 1G64A 3B1ZA 4Q21A 5KDLA 5FBRB 3WYFA 3L8YA 4YDSA 4IRUB 1U94A 4NDZA 4A92A 1HTWA 1QHGA 3AF3A 3K9LA 5D3MB 3TVTA 3BH6A 4TQAA 1RW4A 3DZ8A 4ARZB 4IW3B 2AXNA 4BECA 2A30A 2KWIA 5G3YA 2ECKA 2EYQA 5KPJA 4R71A 3I8XA 1G21E 2ZYUX 5FPSA 2OXRA 2BEJA 4Q4HA 2IK8A 4OYHA 3WRYC 2PJRA 3MSXA 1NN3A 3OE7D 1XJ0A 1Q1EA 3RS2A 2WJIA 2C9OA 1BOFA 5JWHA 1ZC3A 3ZS8A 2YZ2A 1GL7A 2JEOA 3MCAA 5ELXA 5KO2A 2F3RA 3N5CA 4HSEA 1SQ5A 8OHMA 3QI2A 4BASA 5JBQA 4RZ2A 3Q8XB 3KQUA 3QOFA 2CXXA 4DSOA 1IONA 1XCPA 4BLQA 3MJRA 1FQKA 1H8ED 2ZJ2A 4QGAA 2PZGA 2WAYA 1T8TA 1Z6YA 3KKQA 3U3JA 1OYWA 1CR2A 3OIVA 2RGEA 2G3YA 2Y8EA 4Z54A 4KSCA 2P2LA 4V0MA 2HF8A 2ZE7A 3T5DA 1NY6A 2C98A 3A4NA 3EA0A 1SULA 3QBVA 5LB4A 3KKMA 2IL1A 4KLZA 2R6CA 3SE0A 1A82A 2G1KA 3P20A 3QKSA 5FPKA 2OXCA 3K70C 1E99A 3WP0A 2CDNA 2QGNA 3HWSA 2AX4A 5H70A 2XNDA 1UKVY 4EJSA 4CEJB 2CVFA 4TTPA 5EXPA 1KHTA 4FI3C 4EPYA 4LBZA 1XMVA 3UMFA 1E9RA 4TMVA 4N3NA 3RC3A 2QTVB 3ZIAD 4RKEA 4MYCA 2OUKA 2O8BB 1DARA 1CTQA 4G5OA 3PUZA 3QXCA 3U7EB 3GJXC 5H68A 1CR4A 4HZIA 2ZRMA 4PHGA 3FGNA 2EFDB 1LS1A 2EFHB 1F2UA 1RE0A 2MSEB 2V7QD 5JS8A 3QSYA 5CJPA 2XTMA 4FINA 3N2EA 4RFSA 3FKSA 5FBVB 4UNRA 3F0TA 1ZUHA 2A3RA 4JSYA 2ZE6A 5KHOC 4M9ZA 1J70A 2ZJYA 1XPUA 4K81B 2FG5A 1R6BX 4IXNA 2VLIA 4NCNA 3O8RA 3CUEF 3TRFA 2IX3A 1G291 4Q4AA 1GP2A 1MO6A 1SXJD 3KTAA 3MRSA 3L0PA 2OBMA 4HLCA 4D2IA 1WMSA 3AF2A 3DZDA 4B35A 2C9CA 5C1BA 3OAAA 2EU8A 3MJHA 1IN5A 3W6PA 3EIHA 4LC1A 3CH4B 2N42A 4NYIQ 4CRWB 1GFIA 3UXMA 3KKOA 4AKEA 3K1JA 1U90A 2OSBA 4CEIB 1S1MA 4B43A 3QPWA 1XEWX 4JL6A 5CIWA 4JLDA 5IRCD 4RFSB 4PHFA 4ZDIA 4TMXA 1KK1A 1GG2A 3SDZA 3AEZA 3AUYA 1ANKA 1LW7A 1I4TD 2FEMA 4S35A 4LYHA 1W2HA 2FSIA 4HLUA 2X1VA 4GPTA 2RCNA 1FNMA 3I61A 1N6RA 1Z06A 4CEHB 5KUTA 3ZYCA 5C2JB 2IHBA 3K9HA 3LXRA 1E69A 5H8WA 2OCYC 4TMZA 2QNRA 4M1SA 5HR5A 2EQBA 2R2AA 2BCJQ 4GP6A 3WMFA 2WWYA 2OILA 1GKIA 1CKEA 2DBYA 3B2EA 3PR1A 1GVNB 4LV8B 1D6JA 3V9PA 1ONBA 1CJMA 4LBVA 4PAMA 4EPXA 4B33A 2R62A 4DCVA 4Z1MD 2QA5A 4DCUA 1LF0A 1KI6B 4B3XA 4DWJA 4ACAA 2FSFA 2WKPA 1W2GA 1R4AA 1PJRA 4LJAA 4MGIR 1Q0UA 4KCGA 3GLHE 5CB6A 5AUNB 1P61B 4I81A 1SVKA 3HJNA 3OZXA 1E9BA 3HU3A 3VHXA 4DVGA 4Q1CA 3RANA 4OK5A 5TDHA 3TSZA 1KIMA 4Q4AB 2JIZA 4YDHB 1TEVA 2YOGA 2ZU6A 4JYBA 3RS5A 2GF0A 4KBFA 4GRAA 3MLEA 3QVVA 2ZS8A 1GAJA 1XEXA 2VHQA 2FFQA 5EE3A 3AF0A 4C2TA 1P2TA 1FX0B 1TMKA 4HLQB 1TADA 3GLFE 5G41A 1Z6AA 1QG2A 2B92A 3JVUA 3GJ7A 3QEOA 3CX7A 4ON9A 4BLPA 3SOPA 1I2MA 2IS4A 2XJ4A 2ZS9A 4ITRC 1Z6TA 2BM0A 2P6RA 3VU9B 1CJVC 2FZ4A 1LFDB 4HDCA 2ZRCA 4BFYA 4HATA 4PQFA 2X19A 5LBIA 2QT0A 5GJCA 3RAPR 1R7RA 4DLXA 2YHSA 3PG5A 2GK6A 3EZ2A 5FR1A 3W5IA 1QHIA 2J7PD 4GI7A 1XTJA 5EE0A 1JR3D 3ECCA 1IOZA 1GIAA 2VYFA 1OFIA 3QG1A 3QKRB 4MRVA 3PXGA 1UKYA 3KFVA 4LC0A 1SZPA 2ZETA 2ZRLA 3Q3JB 1ZCAA 3O8CA 5B30A 3E70C 3P26A 5DI3B 2WBLC 1E0JA 3R7WB 3I1FA 4LV5B 4O2RA 3GLGB 721PA 1JXOA 2RAPA 1DAIA 2Z83A 4EPVA 4PQRA 4JBWA 1W0JD 4B47A 4EIWA 4TT3A 1GDDA 3KB1A 3KQHA 2KJQA 3C41J 3QEJA 2C2HA 4QXAA 2VF7A 3CF6R 5JRZA 3RRYA 2BKUA 1T4GA 2F3TA 4A6XA 4EPTA 3DO6A 4JT4A 3VFDA 3U61B 2Q0HA 1IY1A 1RYHA 3Q7QA 3E1SA 4XH9B 4LJ9A 2JLRA 4QM6A 1EESA 4LJ4A 2FN4A 2GCPA 2XX3A 2ZYTX 3AVXA 1ZYUA 2I4IA 3CPEA 3F5FA 1VG0B 1UJ2A 3SJZA 3DKVA 4KVGA 2GZDA 4GOJA 4FXPA 1YR9A 5J5CA 3GCGA 1S9DA 3RS0A 1J99A 4LHVA 3BXZA 2NIPA 4DBLC 3ZVNA 1FFHA 2UZIR 4GOXA 1NSFA 2ZE5A 4C0BA 3FMOB 3QG5A 1HH4A 4LDJA 1EXMA 1Z47A 5HCNA 4R9UC 2QAGB 4BEJA 4AI6A 5E7IA 2GVDC 4JVSB 1TUEA 2FEOA 1YR7A 3AQ4A 3W8RA 4XVUA 3WBKA 2CLCX 1N5LA 2L0XA 1NVUQ 4PHTA 2IYTA 2F1HA 5FOTA 1OXSC 5JEEA 2JLYA 1EWQA 4KBGA 4Q7MB 4D4KA 1ZD1A 2A5YB 4GDFA 1LB1B 1R5NA 2BOVA 2P5TB 2O0HA 3KQKA 1HE8B 1D2MA 2I1VB 5CLQA 1DO2A 2ZJBA 4CGZA 2OFWA 4QNMA 1TQDA 3IEVA 1W46A 4TYWA 4LJYA 2QL6A 4QFMA 2KBEA 1XTQA 4Q9HA 4B3GA 4DT1B 1PUJA 1ELOA 4LUCA 3X2SA 2VP6A 4LHWA 5A5GA 1GM5A 1KNQA 4UXJA 4Q4JB 1W0KA 1SXJE 3SN6A 2CJWA 4MKFA 3U4QB 1YQTA 5K8UA 1BYUA 1Z07A 4D4JA 2HV8A 3AKDA 3NBFA 2C99A 1CR0A 2BDTA 1NP6A 1N6KA 1AZTA 1D8TA 3AKYA 5F9FA 5G3ZA 5EP4A 2DFLA 5BN3A 1II0A 2Q21A 2XNSA 1XJCA 5AJWA 3AGPA 2ZYWX 1NMYA 3M6AA 4B3CA 4TL9A 4DIEA 2VP2A 2OCAA 4C0JA 1G18A 1DPFA 3V4RA 3TVDA 1M6NA 2J59A 4NP6A 3MG9A 1F3OA 4LBYA 3B1XA 5EUQB 4D0NA 5E3HA 4JL8A 1UDWA 2QRZA 4BZQA 2RGXA 5FOSA 3GJ6A 4PC2A 2IYZA 2AXPA 1BIFA 1MO4A 1P5ZB 5C46F 2XOKD 5JS7A 3IPYA 2AFIE 3I32A 4B44A 2JLWA 1OPXA 2CCKA 2O8CB 3LX5A 2W58A 2LKCA 3U3OA 5HKKA 1Z0IA 2FMXA 2ZRHA 4UNNA 1ZM7A 1NN0A 1OB2A 4TLBA 1JEDA 1OIWA 1OSNA 1E0KA 2REOA 2ZI3A 3PUXA 4N0DA 3LNCA 1G6HA 4V02A 2ATVA 3PUVA 5AJZA 4QBHA 3QKRA 4PC3A 1U98A 4DDTA 5H1YA 4OQXA 4TL6A 2J0UB 1W0JA 1PVOA 4A9AA 3FB4A 2F1JA 4A8JB 4HI0E 1A1VA 3AVQA 1MT0A 2IHYA 4HUQB 2NPFA 2QBYA 4Q4HB 4BPBA 2BKEA 2X2FA 2XTZA 2OHFA 4JLPA 2GF9A 4A2PA 4C0HA 1ZNZA 2G1JA 3GLIA 4DZZA 3EG5A 4XJXA 3W9YA 3U6KA 3FVQA 4Q1FA 1RRCA 5P21A 3TSOA 2KE5A 4Q4JA 3U4QA 5FR2A 1IJFA 3R8FA 1ZJ6A 1Q1QA 1FX0A 2W6IA 4L4UA 4P4SB 1IHUA 3SYKA 5IHPA 1BH2A 1CIPA 4KO8A 4TLAA 5FOXA 3SI7A 4QHYA 1D9XA 2ZREA 2AK3A 2V55B 2GJ9A 3PJRA 1X8LA 3EPHA 4M9QA 4BFXA 1NMXA 4IDPA 4D0GA 3R9WA 1CULC 1ZNYA 3BORA 4A0RA 4AIIA 1W36C 1GNRA 4P3YA 4DLZA 4Q7JB 4WZAE 3SNHA 2PZEA 1W5TA 4URYR 3LFUA 5L3SA 1BMFD 1W47A 3BH7A 2GZAA 4JJKA 1VCOA 3EWSA 4ASUA 4PTLA 2CNWA 5JJLA 3FKQA 3NHBA 4GP7A 1W4BA 1XCMA 2XXAA 1D9ZA 4HAZA 4TLDA 4EFMA 3DDCA 3NWJA 4UQOA 2RHMA 3AVWA 4IVQA 1KY3A 4LPKA 1IN7A 1EFRA 1WXQA 2R65A 4QNRA 4NCHA 2QU8A 4Z8YA 3ZD7A 2QM7A 1L7VC 2B6HA 3L0OA 3WYAA 3ZS9A 4I4LA 4L9SA 2ZSDA 4OI4A 2EFGA 2GXAA 1OT3A 2ZRFA 1KOFA 4IDNA 1N0UA 2BWJA 5LD2B 4XIGS 2AFHE 3OHMA 4DLVA 3K0EA 4MITA 4JLJA 3AV0B 5BN5A 5J47A 2WWIA 4L8GA 2BCGY 2F7SA 2I3BA 3AP1A 3CPJB 2IEZA 1IXRC 3KX2A 3TR5A 4HAXA 1GRQA 1KDPA 2KBFA 2W6JA 3CX8A 3ASYA 4O2LA 3GEHA 2ZE8A 1Z5ZA 5E7MA 4W7SA 5FOVA 2YYZA 1Z28A 2ERYA 2D3WA 2WOJA 3EIQA 5AUOB 4LYJA 3WRXC 3NVAA 4Q9IA 3GJ0A 2P65A 3CF2A 1HEIA 2VTKA 3GLGA 1VPLA 1YVDA 4BGDA 4L15A 1OFHA 2ZI6A 2ORVA 1A7JA 4R2HA 3UWKA 2WJJA 4ZKDA 5HZKA 4L9WA 1ESNA 1SKYB 1G8GA 2J45A 2PLRA 1Z22A 1C4OA 2FJUA 4RKFA 4IKEA 3BOSA 2V6JA 1XFAA 5DGXA 2WAXA 4KI0A 4ESVA 4B2IA 1ZCBA 3ZVRA 4CT4B 3VKWA 1NN1A 1GZSA 4V0NA 3RC8A 3RLFA 2CL0X 3IDQA 2IUSA 1H8HA 1N2CE 5IT5A 1F2TB 3IBGA 3F3YA 2IYYA 4N0EA 3U2QA 4QG7A 4BRUA 2H57A 2QENA 4OQLA 3EZ9A 5BXQC 1NL3A 2D4HA 3IKJA 1XXHA 1YU9A 5DE3A 1E2KA 1CS4C 1ZVQA 1JB1A 1UPTA 1KMQA 2QN6A 4HUTA 3NTUA 3BS4A 3OEED 4ZDJA 1JR6A 1E0AA 2LWIA 2J0UA 4IFBA 4OHYA 4NPHA 3G82C 4M1OA 3R7WA 3ZVLA 3Q5EA 2Z0MA 4AURA 3CNNA 1VECA 4QHTA 3LWNA 3THOA 3AVTA 4G5SA 1U8AA 3OIYA 1KI8A 4P33A 5EE1A 4B6FA 5FTNA 3ADBA 4PHHA 4IEIA 2NO9A 3BB4A 1QDEA 2XB4A 1W44A 4Q9JA 3QIAA 3QJYA 1YE8A 3TGPA 1FMJA 3QF4B 1II9A 1E9SA 4DLWA 1RYFA 1VHLA 2YWGA 5DYGA 2IS2A 4QJ4A 3IBYA 1A5TA 1J90A 2VP4A 1G5RA 1NSTA 1OXTA 1R0YA 3BRWD 3NIBA 3TW4A 1RJ9A 3EZFA 4PO8A 4LJ7A 5CYOA 1AQYA 5DLQC 1ZMXA 4A6PA 4US1R 1KDOA 1YZGA 4M53A 4TMKA 1KK0A 3Q5DA 3SZRA 2ZROA 4PO1A 2ZRDA 1QRAA 3TH5A 5EP1A 5F98A 4OBEA 2YV5A 1KO5A 3ZJYA 1KI9A 2B21A 2ONKA 1E1RA 3BIFA 4M9SA 5DN6D 4EQ6A 4AY2A 4TLCA 3EZ6A 5SZKB 3SS8A 1E4YA 1IXSB 5JFGA 2DWPA 3BFXA 4BLOA 4G5GA 1M74A 5E95A 1LTQA 2OLKA 4NCJA 1SKQA 3A4MA 1W4CA 4M8NE 1ESMA 1SVWA 1GRNA 1Z8FA 1QBKC 3TUJC 1VYUA 5AUQA 2Q3FA 2YWEA 2QGZA 3AVPA 3T61A 1E2LA 2QZ4A 3ONWA 1N0WA 4EUNA 1VKJA 3SHFA 2VQSA 2WWHA 3ZQJA 1XCGB 4TN1A 5GJVC 3AUXA 4Q02A 2BHRA 1DAGA 2FE4A 4F7WA 1ZNXA 4FIDA 4MYTA 5JEDA 4FN5A 5GJBA 4E22A 1QHSA 4JBYA 4IOKA 4DUGA 2NO7A 1GNQA 1DTSA 2FH5B 3K53A 5GVSA 2F6RA 2FSGA 2IYVA 1VDZA 5B58C 4G01B 2D62A 2XJ9A 2ZRJA 3D31A 1Y3AA 5JLJA 2DPXA 4X8OA 1U9IC 1KJYA 4HAWA 1IN8A 1WP9A 4PZLA 4CDGA 4E5UA 3OAAD 5DSZA 2O8FA 2BMFA 1WCV1 1G3MA 2A5FA 5TMPA 4XSHA 5K8LA 1E9DA 5EE5B 1NRJB 4MUAA 4WIAA 4D25A 1ODFA 1OXUA 1HV8A 1Z3IX 3AGQA 1QZXA 3A37A 2Q9CA 5IF9A 1SHZA 2XSZA 2EYUA 1NVXQ 4MKGA 2PX3A 2GEDA 3UG6A 2ZSBA 3B6EA 1CJKC 4OK6A 3U44B 3R8CA 5L3SB 2GAAA 2ZUBA 1P60A 2Z4SA 2C5LA 1EFHA 4CYMA 4GZMA 1NY5A 2YWHA 2ZRBA 3C15C 5HPYB 1UF9A 3GLHA 4CF7A 821PA 1Z0FA 4C2UA 2RGBA 3CRRA 1E2JA 1NMZA 1E1RD 4D0LB 2F55A 1T91A 1OE0A 3ZDQA 1UEJA 2DHRA 5DNYB 2J46A 2GXQA 3T5GA 2ZM5A 3VNVA 4Z1MA 3O8DA 1U8ZA 5EXSA 2RGNC 3IILA 2QT1A 1VG9B 2OBNA 2OAP1 4OHXA 2EWVA 1EFRD 1QG4A 2QMUA 2WIBA 4Q7LA 4HYYA 4IJMA 1OHHD 4BLRA 1Z08A 2ZJOA 3H2YA 4XWAA 1TNDA 2ZRIA 2NG1A 4YMSA 1D2EA 3UATA 3RRNA 3EXAA 3BFVA 3K0CA 5AJXA 1E96A 1XPOA 3CR8A 3VKHA 3FHOA 1E2NA 4PPGA 4XTCS 2RKOA 3FMIA 1XTRA 4WAUA 2NZ8A 1RJ9B 4JVNA 5LDDC 2E87A 1HYQA 4KHZA 3TQFA 3KTAB 1S1CA 2CNWD 2QMHA 5SZIA 1KI2A 1R0XA 2D2FA 3T34A 1OH8A 4LHZA 2PZFA 3DOFA 2R44A 3T1QA 1CEEA 1XDBA 1VYVA 2QP3A 1HE1C 3EASA 3M4YA 4UNQA 1RPZA 5FPHA 4MDEA 4HB0A 4CEHA 4JLKA 4YMUA 4PC6A 3OEHA 2JJ1A 2H16A 3R9IA 2GXSA 1TAGA 1YJ5A 2KB0A 1ZC4A 1TU4A 2EW1A 1JAHA 5CLLA 2QSZA 1AK2A 5KPDA 5JCZA 4LHYA 3A1VA 5FTLA 2FPKA 1E2DA 1L4UA 2R6GA 4XWOA 3AP2A 2GCOB 4DUGD 1QHXA 2FF7A 3SFVA 1P7CA 2J1LA 4TWZA 3HDTA 4Q4LA 2FU5C 1FQJA 1ZM9A 4KAXA 3QE0A 2QP4A 1JEEA 4IVRA 3VQTA 3SJAA 2CLSA 3B7GA 4XWKA 2E9SA 1SXJA 1HT1E 4F93B 4JBXA 4OL0A 2BM1A 1IBRA 1E2GA 2VA8A 4WBSA 1FUKA 1TPZA 3JVVA 1ZP6A 4IOMA 1W5SA 1YZTA 2OE2A 2HCBA 2VHTA 3KDSE 4UNPA 2ODWA 2QPAA 1P62B 4ABYA 2C95A 2OV2A 4DB4A 2GCOA 1P6XA 4HZUB 1GTVA 4DXAA 3QUSA 3JZMA 2WM9B 3RABA 3GLGE 2ZUCA 2QEQA 2AL7A 1GL6A 4ZI3A 2Q9BA 4JIMA 4ERNA 2OESA 1W0KD 3C8UA 4KFTA 5FOWA 4LJ8A 1SVMA 2NO0A 4TLEA 5GVRA 4NYJR 1KO1A 4PANA 3QF4A 1U0HC 1CJTC 1ZINA 2IBMA 4EJSC 4G1UC 4R2IA 5UKDA 1R0WA 3GQBA 4DT1A 1VIYA 4UNSA 1S2MA 2O52A 4M1WA 5TXGA 3WMEA 1QHNA 2O8EB 3SBDA 1OIXA 2J87A 3K09C 2QAGA 5EP2A 1N5KA 1TTTA 4JLAA 3KFXA 3P1JA 2GTPA 3WNDA 4HB3A 4R7ZA 1MRNA 5KNBA 4DRZA 4F92B 1KNXA 2GETA 1TX4B 1E6CA 3LVRE 4EPWA 1UM8A 4OQNA 2GWHA 1M34E 3SU8A 4DCSA 2JJ2D 1M8PA 4WZ6A 5CIQA 1XD2A 2TMKA 3D7MA 3QXSA 4C0QC 2BJVA 1J7KA 3KUDA 4C0AC 3NDPA 5KU1A 1U0LA 3KJEA 4KJZA 5A4JA 1AGPA 3CM0A 1G3UA 3CRQA 3PV0A 2ZRAA 3GFTA 4BWYA 2HYDA 3QKUA 3FTQA 3Q9LA 4MKHA 1Q44A 3K0SA 2XZOA 3DMNA 4TYQA 3P4YA 4AWXA 2O8FB 1KI4A 2HLDA 2J41A 2Z43A 2MSCB 2NGRA 4UKDA 4NBSA 2H92A 4ACBA 4HB4A 4URVR 4WW0A 3OF5A 1F2UB 4TSFD 1JPNA 5SZJA 2QAGC 5KSOA 3B1WA 4A1FA 2YINC 5FBQB 2H18A 3TBKA 1P4SA 3VAAA 5EXXA 4Q5IA 2NQ2C 1KSFX 2BBTA 1XZQA 2OEPA 3H0KA 5B64A 1ZBDA 2WHXA 2NTYC 1QVAA 2VSFA 1UDXA 4NL4H 2XXAB 2JJ1D 1XJQA 1P73A 2YWFA 4TQ9A 3EW9A 5KSZA 2J0QA 1L4YA 1DAEA 4MUBA 3A1UA 1TF2A 4DSTA 3QXHA 4HUQA 1NLFA 1NVVR 2R6FA 2WZQA 1R10A 4DLUA 3HPQA 3ICEA 1DE0A 1TL7C 4YLGA 4JLOA 2LKDA 4R98A 2ZR0A 3F8TA 1US8A 4L5BA 3W8NA 5EP3A 1AJEA 2F1IA 1K8RA 1X8JA 1COWD 1EGAA 2G6BA 1M7GA 4KFUA 4TMWA 3NKVA 1KYIA 1G9XA 5DYIA 5JECA 1SKYE 2WSMA 3VR5A 1XMJA 3HR8A 4ZDWA 1UAAA 4AD8A 2Z4RA 5SZHB 1G7RA 2C78A 4X8MA 1EX7A 3VR4A 4DLRA 1Q20A 3LRPA 3WMGA 3PFIA 4QOSA 3IHLA 2CE7A 2EFCB 2PT5A 3NEJA 3PEVA 3W6OA 4B76A 4NE2A 2OZEA 2BV3A 3TUZC 2A9KA 3HYTA 1E4VA 3BK7A 3JZAA 2REXB 3AB3A 4KSBA 2FV8A 3NBYC 4JKYA 5EQTA 5DISB 2UVQA 3VTKA 4FWTA 3LX8A 5CITA 2IT1A 2B8WA 4HAYA 4QGGA 3K0AA 2WWFA 1MOZA 3K9NA 3U3MA 4DKXA 5M04A 4A0FA 4DSUA 2G83A 3T35A 4LHXA 2GXUA 2NOAA 1NI3A 4QM7A 1T0JB 2W00A 2XTNA 1Z0JA 1XMIA 1KSHA 2BBWA 3D3QA 3QXJA 3GLIB 1U81A 4ZPXA 2D7DA 1MABA 3U60B 4FMCB 3UKDA 4B34A 1E9AA 4XD7A 1CXZA 2ZR7A 3KKNA 1ZAKA 2PCJA 3EAQA 4KU4A 5DIFA 2IXFA 1VG1A 3EPKA 1DELA 1BO6A 4B74A 3DPUA 3WXMA 2D74A 2ZANA 3V00A 4JLBA 1HQCA 3GJ4A 2PCLA 1YR8A 2IS1A 2PT7A 1JI0A 1KMHA 3DL0A 4II7A 5DHFA 3SBEA 3KQLA 2V3CC 1JR3E 2WKQA 1KO7A 4D82A
chains in the Genus database with same CATH superfamily
2Z4TA 1MR3F 1W52X 3DZCA 3AEUA 5G53C 3L6DA 3OQHA 4E94A 4RTLA 2AYXA 3PKZA 3U3MA 1XK6A 4G25A 1WHSB 3LI2A 4QATA 1U5CA 1OIVA 5BQ5A 2JHCA 2E37A 1ZNQO 2R7KA 1UZUA 3GEGA 4OREX 3TTXA 4I1OA 1URPA 2CXPA 3PQEA 4ZOBA 4B7XA 4DCCA 1DEKA 4DTCA 2AOVA 4G5FA 3P9XA 3SQXA 1YWGO 4HCJA 1XALA 5KVQA 3EH1A 5KYXB 4P32A 1OF1A 2ZIFA 3QELB 1DC7A 2Z6QA 2FGKA 1D2AA 1Z2CA 4XGQA 2RI0A 4HBGA 3ZTYA 4HKTA 2IZ6A 4ARBA 3M6IA 1ZD4A 4H1HA 3T3NA 3MRTA 2G40A 4JX8A 1YA6A 4ALKA 4M1YA 2I76A 4HN9A 3GVPA 3T9AA 4G0XA 1GUAA 3AFIA 1G19A 3LBNA 3OG9A 4C6RA 4EBBA 2HQSA 4AJ1A 1INLA 1JHRA 2CLKB 3ILVA 3GGGA 5BT9A 3M3PA 2DPYA 4OH1A 4FEGA 3T7IA 2BGGA 1Z6XA 1WCWA 4YS6A 5I7EA 4WVFA 3RVKA 3TM5A 4AUEA 3QU4A 1YRHA 4AJNA 4DQKA 3HCEA 4OA8A 4DJFC 5A0FA 1ADGA 1LDGA 1ONOA 2QY6A 2Z5VA 3ESCA 2REQB 5JZMA 2CYAA 3FNRA 1QG6A 2C7GA 1RXIA 3BWCA 3EZNA 4NMLA 4F96A 2X8LA 4HWGA 4PIVA 1D2RA 1SBHA 3P9QA 5IM4A 2FPIB 1K3TA 5HKKD 4BFTA 1T36A 2BR5A 1VCIA 3ZY6A 4AO8A 2ZUDA 4QUKA 1CZKA 4I2VA 2CCJA 2FLKA 3TD9A 2AN3A 2D8AA 2Z8XA 4NKRA 1IM8A 3PLNA 5K0NA 5LJLA 4B34A 1LPNA 3ODGA 2H1RA 2IYOA 4M0LA 4BUJA 1E9FA 2XKJE 4G81A 4IWYA 3O1JC 4V1CI 2OKGA 4GBGA 1M1ZA 3H17A 3W3AA 1DADA 4DDWA 1EKXA 1N9KA 1NNUA 3A4LA 3LU1A 5D3QA 4ZEXA 3PIDA 1KDRA 4OK3A 1BNCA 1KTVA 3EWAA 3MIIA 1IVSA 1BKSB 1HT0A 1WZIA 1ZJJA 1K7XB 4XGRA 4ZHQA 4EZEA 1V3UA 4RX1A 3ZOKA 1G6OA 1OTYA 4WUTA 1JPJA 2ODBA 3DMYA 2I8AA 3B51X 3LGAA 4QYWA 4WZBE 5A5VA 3A1TA 1J9EA 1PLLA 4MJ3A 4XR4A 1M2KA 4FOSA 1TCAA 4URHA 4BFVA 2CBXA 2YNMC 4JJAA 4C05A 5B7NA 5KOJA 3S2UA 3CUSA 1E3QA 4BX8A 1EXNA 3I5XA 1Y1SA 2DOKA 5M29A 1WSAA 1F3LA 4EX7A 2BZ1A 1Q0LA 2CJXA 2VUSA 4QLBA 2NU6B 2W93A 5A9TA 3VZSA 1VKHA 1VZ3A 1X9HA 2WUDA 4B8ZA 4BQFA 5I3ZA 5KDOA 1Y1KE 1YNSA 3E84A 3BHMA 1QX4A 1JBEA 1YL6A 3KKLA 4HJXA 2JCBA 3GVIA 4LCEA 4DJTA 4REOA 2ERXA 4NAUA 3UIEA 4CFYA 1OJ7A 4MQLA 4D9BA 1O97C 2VZLA 3G7NA 2OZVA 4FKZA 3GN1A 4UTZA 1YGYA 3MZ0A 4EHJA 2NU7B 1WMDA 1KEUA 4BQSA 3KZ1E 1PTJC 3QEAZ 2AMFA 4B1FA 1OH5A 1XZ8A 2NPIA 3CX4A 5KJ1A 1EX9A 4PZAA 2YQZA 2QUAA 2I6QA 1W4RA 3FWKA 4B3FX 1E20A 2R48A 1WZUA 2K2WA 4WUVA 2Q0XA 3CIOA 4OL9A 4Z3DA 2ZAOA 3ZU2A 3L1IA 4RD2A 1HGXA 1XTKA 2RHHA 4WEQA 3G9TA 3GXOA 3X1XA 4C04A 1VE3A 3AONB 4JH0A 4E07A 1YTLA 2FW8A 1V16B 2LVBA 3RKRA 2HXGA 3S27A 2H52A 3H9CA 2YNMA 1BDJA 2FYTA 3GLTA 3GXBA 2HNBA 4KWHA 4RHFA 1MGOA 3PENA 5B2ZA 3ZWNA 3O4RA 2A2ZA 4UZEA 2AZTA 4EY3A 2QLMA 4DLTA 1BS1A 2KLBA 4PCUA 1H1LA 3CKKA 3GPLA 5AW1A 3ZNQA 4IHAA 2WPNA 1RWQA 3GJRA 1YJQA 4RH0A 1JDBB 2WC1A 3S7ZA 5F2EA 5KTYA 4MZDA 3D4LA 4FE7A 2PL3A 4R8KA 5CFPA 1SO8A 3MQFA 4TWBA 3VSBA 1L4EA 1CJSA 1I1NA 2AH5A 1SB8A 2UZ4A 1BQ4A 3R1IA 3UMSA 1PL7A 2DBVO 4LYEA 4BJHB 1OA0A 2BMEA 2ZCVA 3GD5A 4AY5A 3ND9A 2WW8A 3UT6A 3NV7A 1E1QD 4RZSA 3N0RA 2ADFA 2F67A 3K8YA 3QEMB 4LZJA 2JKVA 4P2BA 4ZTUB 3OZDA 1NNLA 3HN7A 1A4IA 2EKPA 1WPGA 1J21A 4C7OA 3H4MA 2AK2A 4KH0A 2GSDA 1GPNA 1DC3A 3I2KA 3RUAA 5DVZA 3JWHA 4MJ7A 4ND8A 3EGWA 1XL1A 2P8SA 2YZ7A 4A2QA 2QTZA 3K2QA 4RSMA 3PNSA 4BUCA 1NNSA 1Q50A 4C4ZA 1Y63A 2A3NA 5KTSA 5FTJA 3K16A 1T5SA 4JVMA 2RHTA 3N70A 1LBSA 3DE3X 4OQFA 3O8OB 2R00C 5J4HA 1RRMA 3DMDA 4CKCA 4BWVA 4FKMA 2RCYA 2TMGA 3ACDA 2ZRGA 1L5HB 3WNCA 3HXMA 4D26A 2BFPA 1W1WA 1BEUB 1UXHA 2PGDA 4MP6A 1KE1A 1YRLA 2CVQA 4NOLA 3ETLA 3X1WA 2BFEA 1QHHB 4LDZA 4WACA 3V1NA 2JHGA 5TGZA 3SOZA 1SOAA 2JAWA 4W1SA 4LQLA 3D2BA 1LZKA 1P0FA 3FVRA 4QOFA 1N8TA 3KJGA 1PKEA 2G08A 4K1XA 4C4XA 4CMEA 2RGAA 3MILA 2R79A 1UKEA 2VAPA 3IKLA 5DHAA 3A6PC 2XRMA 3SF0A 5AT1A 1W29A 4RUKA 4ND1A 2PHZA 3QJGA 5DBHX 2AMJA 4QXPA 2MYTA 3K0FA 3RK4A 4MH0R 1JJ7A 1QF7A 5T4EA 1RAFA 2ARKA 3GLFB 4IJKA 2RHDA 4WD3A 1MFZA 1DZ3A 3PS9A 1VKRA 3B8HA 1FVXA 4HAOA 4UULA 5KYKA 1I94B 3L1HA 1VPVA 4GPD1 4RENA 4RY2A 2UXDB 1EAMA 2OO5C 1U2EA 2JZOA 2CK3A 3BHJA 4IIUA 1FIUA 2NW6A 1A98A 2XGJA 1SC1A 3L8MA 2MT9A 3A2KA 1N9GB 1X86B 2C1ZA 3LZDA 2COEA 2PZMA 1QGZA 2PPLA 1L5QA 4IFIA 2CLDX 1XZNA 3S2GA 4XZ3A 3C3WA 4P4UA 5A5DA 1G2PA 1LI5A 4MYRA 3AR4A 3R5XA 3OJCA 2BFCA 3DZHA 1FDTA 1B2RA 3CEMA 1JR3A 3OE1A 4NG5A 1IBLB 3DBRB 4KO4S 1K88A 4NXMB 2W11A 4KMMA 4QUEA 3BRCA 1S89A 1RIIA 4FUQA 1IQPA 1YQDA 2OPBA 4XASA 4D8UA 1BVRA 2GYYA 2Z57A 3AF6A 4ODIA 4R3NA 4R0VA 3K2IA 5LQKA 5EC8A 4LXTA 4O3MA 2JI7A 4WA7A 4ICIA 4OYLA 4TSRA 3VR3A 1DEOA 2CFIA 2WLSA 3NFYA 5J40A 4CM9A 2D2EA 1YFKA 3GEEA 4WL0A 3TSWA 2PGXA 3DNMA 3K7EA 4S24A 3LK7A 5YASA 2JLZA 4RIEA 1Q5PA 2FFHA 3LXMA 1XXHB 2H8KA 3AG6A 2RMKA 3S68A 3JYOA 3F6YA 3NMUF 4OP3A 4PN7A 3RUIA 1CS0A 2N1BA 1G98A 5E4JA 4LJKA 5JXWA 4BMDA 4YMVA 4GXQA 5K4GA 3DFZA 4ME6A 1RLUA 1QHEA 4XIYA 1CRLA 4KR0A 3SKYA 3UB4A 2PUAA 1VKNA 2HK8A 4D9NA 4GQIA 3IQIX 3ZE1B 2GD2A 4BYMA 5A04A 1QXSA 3AVVA 4EKDA 2C94A 1QZTA 4FFMA 1VG8A 1UT5A 2GWRA 2XSZD 1E1DA 1MORA 3GZNB 1Z26A 2BBOA 2VKQA 2BGIA 1ZCZA 4JB0A 3EVDA 1YV9A 2IZ5A 1H42A 1IZ7A 2YUTA 3NHSA 2EF0A 3AW9A 3B82A 2E85A 3H11A 4EKYA 3VU9A 3AM1A 1TYEB 1XPRA 4KXFB 5ALPA 1BFUA 3DEKA 3NRBA 4MV1A 4OI1A 3MUFA 3OEHD 1N6PA 1K27A 3R3YA 1VM6A 2YC4C 3S2FA 4QE3A 3FETA 1ZN8A 1L4HA 1XYGA 3LDFA 2FZEA 5DWVA 1NKSA 1XXHE 5KOHA 1VLJA 3HRHA 4EHBA 5HZHA 3O2SB 3ZY3A 1KAOA 2MSDB 2I8CA 2EL7A 2V74B 3M6UA 4KVAA 5I7SA 4UDOA 4NBWA 4D9EA 3C97A 3N86A 2PIAA 1N5MA 3OPVA 3P4UA 3PUWA 3ZD9A 1ZNWA 3KJHA 4TMTA 4XVQA 4FDAA 2CHGA 1KZGB 3D9QX 4FHCA 5ER9A 2GJKA 5K0BA 4JL5A 4OATA 3JPWA 4GX2A 3SYLA 5IJ0B 2DPMA 2HJGA 3F6EX 2B7CA 4N4AA 3EWNA 2R6AA 2HBRA 3ORHA 3KALA 2P1DA 1ML4A 2QR3A 4TXLA 5LB2A 3BB3A 4UEJA 3S29A 3VTKA 3K70C 3PDCA 2XCTB 3B70A 3HSKA 2ZR8A 2WJHA 4UMVA 4WE3A 4OBBA 1U99A 3WL4A 1FJ2A 2WPDD 3DD1A 3FWYA 4UJ3A 2B9VA 1XZAA 2RK3A 2ICAA 3NU1A 2OYCA 4D6YA 4GXNA 5IYZB 3AINA 2BGMA 3PIRA 4J3FA 3P2YA 3LX6A 2YJTD 2I1QA 1YB2A 3MWYW 2BTEA 3G88A 2P0AA 5IAGA 1OLUB 5BSEA 1NBMD 4JLSA 1KY4A 4LRWA 3BMCB 1RTKA 2QRQA 4LDQA 2AFVA 5DW0A 1WXEA 3IR7A 3GFPA 3SS7X 2UXBB 2BIFA 2OKCA 1TMGE 4AY4A 3FNBA 2DR3A 3GUZA 4N41A 3ANLA 3F4KA 1AMNA 1GDTA 1EXWA 2ZJZA 4M1TA 2A58A 2W2TA 3HPRA 4FHGA 4J1TA 4WOCA 4Y6LA 1C4WA 1Q0QA 4XAQA 1I9CA 4BNJA 3HV0A 4P4LA 2ZK7A 2VDWB 3GA7A 2D0DA 4JJEA 4YMWA 3A1EA 4N8EA 3FMPB 3SK0A 2ZJAA 4NZYA 2BGTA 1XTIA 4AP5A 3L0YA 4CUJA 1WCXA 2VDUE 4TXJA 3EPJA 2FUNB 1IN4A 2FTKE 3ASVA 2ZXEA 4Z9YA 3UGJA 3TF5A 8MHTA 4L50A 4F6CA 4LF4B 3UJ3X 3L92A 3ZV3A 2LIVA 2QI9C 3VC1A 3N0VA 4NU6A 5FYDA 1E7QA 4OJKA 5AUPB 4JI8B 3EVGA 4OB6A 3H84A 3I4CA 2QJFA 3BTOA 1HFJA 3KKPA 3P2EA 5FLKA 3RUEA 3RYIB 3WKCA 1P9WA 2QMOA 3A05A 3BGDA 3G5MA 4U5XA 3WK9A 1FL9A 3F2VA 2YJ3A 1EFAA 3ETJA 3QWAA 5EKUA 2OHOA 4PZUA 3LT1A 2IVFA 3THRA 1OU4A 2HL6A 4TKMA 4YQFA 5KOIA 4C21A 4HYEA 4KE6A 1NG9A 4QSHA 3P32A 3ZJVA 1Q16A 2HSZA 1H65A 1GNVA 1XVTA 4US2R 2XZLA 2OM6A 1RLMA 4WXEA 1T9AA 3PPXA 4AC9A 4HX2A 5D51S 4FLEA 1CD5A 3K8ZA 3PC4A 3U1BA 2ADOA 2QTNA 3CG0A 1D6SA 2HDOA 1IG0A 2O6HA 3OEYA 5K8TA 3W5DA 5KNLA 4HEA1 5DMXA 5LN1A 4GE3A 1JKXA 3DCJA 1KBZA 3JQ7A 3G02A 1ODSA 4ZVOA 4MVJE 2NTJA 3UOGA 4IXWA 2HMVA 3FCXA 4C03A 3N6VA 2V6IA 4RPKA 2NUPB 2J0SA 2GEBA 4BFCA 3O21A 1JEQB 5BR8B 1WUIS 3O74A 1SA0A 4FGWA 1YIOA 2PZ8A 5K3FB 4HWSA 4A27A 3G89A 1X1DA 2O7NA 4P80A 3IEKA 4G09A 4TVOA 4DA6A 1G8HA 3UC5A 2P91A 5FBHA 2FW6A 4R9SA 5IVHA 2A59A 4KGDA 4D3SA 3I1JA 3VI3B 3DHNA 4DBVO 4Z3OA 2XOKA 4G89A 4ZOLA 2XWJI 3W4IA 1C9JA 1QHHA 3RJTA 4HF7A 4UE6A 3KCNA 4MHTA 1RKUA 2IDZA 4XGIA 4WFQA 4CR7A 3OE7A 1GILA 4JSTA 4DYDA 1Y7HA 3C6XA 4JKIA 2HQRA 4OU4A 4LCBA 3N7TA 4RA9B 1TAUA 1IAQA 1ZA1A 4FMBB 1L5LA 1GD1O 2P5UA 3WFIA 1OZAA 1OFTA 5HQTA 2CNLA 5E6RB 4CDRA 3OWXA 4NABA 2FPPB 4CQJA 3AIOA 3IMEA 4OOEA 1HPLA 2B69A 3FNGA 2HT6A 3SVZA 1NN5A 1KKMA 1DG3A 1ZHHA 4RWZA 2WOOA 4WFJA 3T3DA 1BU5A 1W36B 1KP9A 3RK1A 1JG6A 3FPHA 3VU0A 3STUA 5BOSB 4H7EA 1XRMA 3MYRA 3DMHA 4FGJA 5IWAB 1IXYA 2CJWB 3A14A 1N4DA 2CL6X 3WDKA 3KVNA 3H2JA 2YZKA 4IDGA 3WB0A 3L1VA 1LV7A 2G5CA 2ZIWB 3HGTA 3KTOA 2ODAA 4P7BA 4U2BA 5D3MB 5DJ5A 1W9HA 1UAYA 3NTVA 3RRJA 4AW9A 4L9RA 2QN1A 1SU6A 3JQGA 3S2IA 3VR5H 5BPFA 1GU0A 4ZA2A 4X6YA 3RC1A 2J07A 1E5TA 1OBOA 1ZOOA 2FWNA 5IPFA 4FZ3A 5G0VA 3G8BA 2IU3A 4UUNA 5HRUA 4MA4A 1TO6A 4YA6A 2JGAA 1PSDA 3U7JA 4N5IX 2IELA 2MSNA 3OOHA 3CO0S 4TSKA 3THWB 2NAFA 4QDXA 4FW8A 3AYZB 4NRDA 1AXEA 1LNQA 4TTRA 1ZJYA 1GGFA 5CJ2A 2C7QA 4XCXA 1Z38A 4KO1S 3CNEA 3JQ9A 3URMA 3O92A 5JAIA 1Z63A 1RD4A 1QS0B 2G77B 4JWTA 1X9GA 4YO7A 5TPWB 3GB9A 4HAUA 2YFYA 1K1EA 1TZJA 1SMKA 1YS4A 4M21A 5JRJA 1F1BA 2XQJA 4B7CA 1MAHA 1D1QA 1BJKA 1NHWA 2RHWA 2I33A 2WYWA 4P0TA 2NN3C 5KWSA 1N3IA 3DOCA 5IK2D 3W5AA 4BNMA 2XEDA 2XQIA 3KXIA 5KTOA 3OQMA 3QNUA 1Z5UA 1Q2XA 1U2QA 5KS2A 2AKYA 3E3AA 5E6SA 1TD9A 1KMIY 5SV2A 3LYHA 5EZ6B 4JFAA 3OOSA 1KSGA 2POQX 3G49A 3K6KA 2Q9UA 5JD6A 1JG4A 2RGCA 1EFTA 1FUEA 3GBPA 5CA1B 1YJ8A 3LP6A 1L4NA 3RO7A 2QROA 4OMCA 2ZIEA 1VIDA 2JH3A 3BB1A 4DIDA 1FRVA 2M6SA 3BH0A 4UHCA 1OFGA 1NLZA 3HRKA 1LH0A 1YZVA 3O75A 5DNUA 621PA 5IKOA 2B61A 1AH2A 2BH2A 4FCCA 1QCCA 2FDRA 3LCRA 2PL9A 3IJPA 4CKBA 1RE1A 3HB1A 2ZZMA 2NXCA 4ND6A 3AKEA 2C00A 4JQOA 4TTIA 1LY1A 2B30A 2X0JA 3D3JA 4OVKA 3UWMA 5EYPA 4WBNB 3F6RA 3ZE2B 2ORIA 4Q7EA 1AXRA 1NXPA 2JJ8A 3ZLBA 3FKSD 1RVDA 4ZAGA 1W49A 3ICPA 3HH8A 5HUHA 2FPLA 2JA2A 3WWYA 1ECFA 3Q7PA 4BNDB 2FZCA 3H19A 1K5PA 1Q1NA 3NHAA 4NYIR 3R3JA 1ZK0A 2QYSA 2GAFA 4TKLA 2EV9A 2H2GA 5LYYA 4QU8A 2H0QA 2QJRA 5GONF 1EDOA 1ZD9A 1EHYA 1PP4A 1IY0A 2ZRPA 4W9NC 1NQXA 2QHXA 4E46A 4QTZA 4RD1A 2FW1A 3SKVA 3H6KA 1X2BA 4M4SA 1JDSA 4TOIA 4UZFA 4WZBA 1J0AA 2C77A 3MJEA 3SD7A 3HI6A 5I7FA 4QQKA 1ECPA 3A04A 1PFQA 1SUIA 3DCNA 4S2EA 3UC9A 3GEPA 3RRBA 2F8MA 4NTZA 1KDVA 4YJFB 1GG5A 1W59A 2UXCB 3TO5A 3PLAE 5FWXB 3R7LA 1R8QA 4DXHA 1G1MA 1DBIA 3RYFA 1ZW1A 2FJPA 4O33A 4ARVA 1VGQA 3LL7A 6Q21A 1Y6GA 4OPMA 2KI5A 1WG8A 3AEXA 3NB0A 3RSSA 5KOHB 4Q3AA 1R3DA 1SVOA 3RVNA 7MDHA 3V1TC 4A0SA 1AMOA 2PXAA 2C8VA 2C20A 1OXMA 4EL5A 4BO4A 2FPMA 1ZMOA 1AQJA 3U7HB 1YVRA 1Q12A 2BFOA 1XG5A 2YRXA 2W4IA 4L4XA 5IF3A 3VSAA 3SQOA 1L7RA 3D0QA 3ONDA 4J75A 5HTKA 5DCYA 3X0DA 3H1TA 2Q29A 2IUTA 8AT1A 3M70A 1G5TA 1KFJB 2WJAA 3QVJA 1AKEA 1W30A 1XNHA 4FFBB 2NQTA 4M0PA 5GV8A 2EKBA 3FLEA 3FUTA 4QFDA 5FFMA 5B3JA 2XRZA 1XTBA 3R75A 2IHNA 1QRRA 5BYBA 4ZT2A 1PNOA 2WWGA 4MCHA 5IN4A 3EDRA 1U3CA 4E1BA 3S5JA 1TYBE 3MQ4A 2P7HA 1QRSA 1HC7A 1TU3A 1LPAB 2VHXA 4BZWA 3CJRA 3OQOA 4NX2A 2A86A 3NGMA 1JFVA 3GZTB 4JSRA 4F4CA 2J9ZB 3EIXA 4WLEA 1QBGA 3K73O 4FNAA 3QVGA 4RIHA 5DH9A 5FRDA 1Q83A 3DC7A 1KP2A 3ZZTA 2AOUA 2VK2A 1HORA 3N05A 2H17A 4WPGA 1YZUA 3R3WA 1M7HA 2FLWA 2QAIA 3RRZA 3ZDZB 2WMNB 2ATXA 3DDHA 3RYIA 4AMUA 4EYEA 3HVKA 4LW8A 4UHEA 2OYSA 2D5IA 2PMBA 2PJUA 4D0SA 2VBCA 2CL7X 4JLMA 521PA 2F9FA 2EWMA 3IC5A 4P5PA 4UBMA 5GZ1A 5HJ2A 1G8YA 1V4VA 1DHTA 3NIDB 2ZXFA 4CMCA 4KOEC 1X6VA 3NBMA 1AE1A 1DU4A 3HG7A 5FL3A 3E7FA 2XDYA 3OQJA 3HP1A 1UBSB 1IY2A 4M6WA 5EWJA 4FDTA 5M5BA 3W9UA 3ZLVA 2XE6A 1VMDA 4KYVA 2WKRA 3ZQ4A 2Q5LA 3IIMA 1P4RA 3ER6A 2CV0A 2BE7A 1IJEA 2EF1A 1U4SA 1TO1E 2ZVQX 2Y71A 4J90A 1T5IA 1JWLA 1NRWA 5I9MA 1T13A 3VX4A 4OQEA 3ERCA 4P98A 2R751 3KU4A 4P6VF 2B37A 3Q3HA 4ZI2A 2VSXA 1YHYA 1OWPA 3QGMA 3JVDA 3PUYA 1N92A 1NI5A 4KXUA 1QYDA 4OXYA 5CM8B 2PX5A 5GJWC 1YS7A 2JASA 1IHYA 1JMKC 3BDAA 3F67A 3I73A 4FCTA 5THKA 4BKRA 1E1LA 4XWTA 1QLHA 2Z5FA 3NR2A 4LXYA 2UU9B 1BRMA 1KO4A 2EDAA 4QBGB 3MS4A 3DKPA 3PHBE 2QVGA 2X2EA 1LBQA 3GRUA 4XIIA 4ZCMA 1D2NA 1HTBA 1TDJA 3WLLA 2A33A 3GGJA 1ZO8A 1Y8AA 2IE0A 4PSVA 4RTQA 5DM4A 1AGXA 3CH6A 1OHHA 2NUPA 1TAHA 3TZKA 3W04A 2WYVA 2GBIA 3KB6A 3MA0A 3ZWBA 3I72A 1J2RA 2G80A 3K09A 1G20B 2X4DA 2JGFA 4RV9A 3RS3A 2AN4A 3LOUA 4H1WA 5LCXA 1WUYA 2H07A 4UREA 1XTSA 5DK6A 5DSTA 4BRSA 1L4LA 1RAAA 1ZUNB 1LK5A 1HA3A 4JEUA 5DXFA 1U9IA 2A67A 5MN6A 2NVBA 2ZTMA 4KNVA 5EXTA 2JJ2A 3ZHRA 4EA8A 3PGLA 4BX0A 2L18A 3CWZA 4PLFA 4Q1EA 1JAZA 1Q1BA 1VMAA 1XWWA 5J9FA 2AMLA 4LFAB 2NT4A 3DTNA 3E4CA 3FGPA 3H1EA 4IS2A 4FBLA 4B9EA 1OLXB 3CWCA 3I6BA 1GT6A 3GEDA 1ZONA 4AICA 3T9CA 4M88A 1Q3TA 3C39A 1T9DA 2HJWA 5JVDB 3ZV4A 3TJZA 2OAQ1 5HKBA 1PJ4A 4MB6A 5B53A 5ISMA 2BSQA 4QYMA 5C18A 5IM5A 1HR0B 4OM7A 2HCTA 2O3SA 3CUYA 4LOAA 5K2OA 1ICIA 4XDHA 1CRWG 3AY7A 2V9CA 1FP4A 2GN6A 4XRGA 4DCNA 2QORA 1YDHA 4OXIA 5M34A 1LWOA 4MV9A 3SHWA 4NOKA 1B3RA 2GPAA 2BISA 1SVIA 2PR7A 2ZJ3A 4TSFA 4NEHB 3DGEC 4HQLA 4J1SA 4WT7A 1NNI1 1P19A 3CONA 2FPXA 3RT9A 5IMSA 1MO5A 3VPBA 2O05A 4D3DA 2P78A 3ZTTA 1XRPA 2OCPA 1A8IA 2L17A 4RMIA 2Z5GA 4Q03A 5DM70 2V7PA 5B58C 1CUFA 4M60A 4ARAA 1DIAA 3NBZC 1AUQA 3GT0A 3NC1C 2NNWB 4MP8A 2QM0A 2QW8A 4WNCA 5F51A 5SYNA 1EZ1A 1A0OA 5ERXA 2D7CA 2JGMA 1WY5A 7GPBA 4HRAA 5BWMA 1AY0A 3DDSA 1T2EA 1Q1GA 1LA2A 5LLDA 4JT2A 1GNSA 1ZXXA 2J5BA 3CURA 4CTMA 5IAAA 1UJNA 3EISA 1YZQA 3PR3A 3GDOA 4NQRA 5AIAA 3WYGA 4O59O 2OBFA 1EVQA 1CLUA 1YDWA 1HX7A 4ARIA 3WP1B 1MO3A 2MSKA 1UMCB 2LCQA 4NZ9A 4C4PA 1A3CA 4F60A 1U2GA 2R9VA 2J85A 3CE6A 1MQ8B 3HL0A 2IWHA 2GVZC 1WNTA 1XLWA 2W43A 3HS3A 1K5DA 3L0IB 3LCVB 4UAUA 4ZZ2A 5KNCD 1PD1A 4NIMA 5FLYA 5AI9A 1LVHA 3GAZA 1EFLA 1YRBA 5A4MS 1O57A 5A71A 4PR0A 1O3YA 2CLIB 1FLAA 5DP1A 2EWWA 3E5MA 3BQMB 3TD2A 1R5JA 2HADA 2J6CA 4UEQA 4EJSB 5CD1A 3MWEB 4MEAA 3R9KA 5AIBA 1QZZA 1PDVA 3VVBA 4EMSA 2Q46A 4HR7A 1EVEA 3H7AA 1MEEA 4Y2UA 4CCYB 2RE8A 1KVTA 5AK6A 3LW8A 2RJOA 3DM9B 1S3GA 3N6XA 1O95A 1RAIA 2COUA 4AULA 4HY3A 1C2TA 1N2HA 4FW9A 5DFAA 1GZHB 4JC4A 2AD1A 4MUGA 1ATZA 3AVOA 1RLOA 4UJ5A 1E79A 4EFNA 2P2ZA 3DE2X 5HE8A 1M6VA 1TTHA 1WUTA 4GMKA 4M37A 4Z8XA 1DAMA 2GVNA 1GGHA 1YFZA 4MVJD 1R8XA 1NLMA 4JBLA 4Y18A 3LHFA 1DFGA 2VEOA 3MWDA 3U7RA 3RTEA 3WS7A 3ZZUA 3R6WA 3AETA 1JHAA 1XTVA 1N5OX 1QB8A 3A8TA 2F4NA 2B98A 2Q4DA 1XRLA 3Q72A 4E03A 3FI9A 3MJFA 2QPLA 3CFYA 3CEHA 2V8BA 2WF7A 3ANSA 3FTPA 3IP5A 3NNNA 4AYTA 1NMEA 2VUHB 1Q77A 1M2GA 2WE7A 1ZITA 3QTLA 1T36B 2AW3A 1DPGA 2VNKA 2GMWA 3GWZA 3F3KA 3N7AA 1JIUA 2HF9A 3ZV6A 3DT6A 1E9CA 1U0EA 2V54A 5JVDF 5K3BA 1G42A 3E5RA 1VI6A 2VHUA 2ZKIA 3KFLA 4CW7A 2GCNA 4KQ6A 1AKYA 4EEXA 3LUDA 1ZIDA 2FWRA 5HWSA 3LP5A 1HOTA 1ZISA 1TEHA 4R5HA 3T7DA 4X54A 3MINB 5A0VA 3NQ41 3QKSB 4P7KA 1QF9A 4MIKA 2O0KA 3D0OA 2VDWA 4E32A 5KYWB 3JAMA 5AKHA 4YCNA 4CG2A 3OJOA 2ORYA 4MR7B 1MH1A 4NEQA 3ZJ4A 1NVFA 2NLOA 4J0KA 1P9RA 1DRJA 1OASA 2JRCA 3I2IA 4I1YA 4REMA 3ABQB 4MYHA 2Q5OA 3JQAB 2WHQA 3W4JA 4BNXA 4K2AA 1UXOA 3DW1X 2CHVA 4C3VA 3MB5A 3QLVA 4A3SA 1X1CA 1QU2A 3TNLA 3OOJA 1Q21A 2ACVA 4OAOA 1MVOA 4CLOA 3I4FA 3DZFA 1IK6A 3TGWA 1RM5A 4FFRA 1DRWA 3EXEA 2BGNA 4RHUA 3VMMA 4F3RA 3CR7A 4FD2A 1CPYA 4PZEA 3WLHA 5IDYA 2C03A 2VRCA 3NT5A 3D8BA 3U7QA 4F84A 3VPXA 3IUBA 5HKOA 4JMPA 3QMMA 3TM4A 2VJCA 2ID9A 4KVZA 4JLVA 3WQRA 1VTKA 4BFWA 3F46A 3L0CA 5IUKC 4EHAA 4OBXA 3UWPA 4GH5A 4O2BF 4P7FA 3JWIA 3ZWCA 5T67A 1MA3A 4NBVA 1JJIA 2C8JA 4IZ6A 2JL1A 121PA 3K0CC 1RWMA 3I64A 3HGMA 1G3IA 1OX6A 2HLHA 4DYHA 1DB3A 5G4LA 3G6WA 1U3DA 3PCRB 4X6UA 4EH1A 2JKYA 4YXWD 3K70D 4CMAA 4Z53A 3T3GA 1GR0A 3PWSA 3OFND 5ALUA 1JL3A 2PZAA 4PXAA 3RS4A 5JROA 3CNOA 4G5YA 1RRPA 3HMQA 4HLDA 4HNGA 2AJCA 3ZE7A 5GADl 1FW8A 2Y1GA 3BXGA 4NULA 4ZMRA 1NASA 1H0RA 3MJTA 2GBLC 1N0HA 1XDZA 3D6NB 4KDEA 1GGVA 2RONA 3A1SA 3VU8A 2AQKA 1EK5A 2OZLA 3EBPA 4FBGA 1FBNA 5DM60 4OQMA 2FQYA 3KDPA 3RT1A 2ZIAA 5BSUA 1H4SA 1YRQA 1VE5A 3TKAA 2EZUA 1GUZA 4P4TA 3W5JA 3AI7A 4B32A 4ZALA 1T2NA 2O8CA 3ZU3A 2WNHA 1CUBA 1SCQA 1SRRA 3ICWA 2JVKA 3A9RA 4ZV7A 5KDLA 3UZUA 2R8YA 4FVTA 3MTIA 4D9IA 3UCXA 1SXQA 2IDJA 5FQOA 3VH3A 1D09A 1QQBA 3ORSA 1JX6A 3E27A 3K94A 3KC2A 4PINA 4A92A 1QHGA 3AF3A 4XFKA 2CFRA 3DFKA 5D01A 4Y2RA 1OVGA 4Q3OA 2YS7A 1ULHA 1RW4A 2FSVA 2KYRA 2QSUA 1STOA 2VXOA 2XT6A 3CJQA 3DZ8A 3KOXA 4GPZA 4L1KA 5E9AA 1CUVA 4BECA 1I51A 4IKPA 5G3YA 2VNSA 4QXMA 1KVUA 4OKNA 2NVUA 2FR8A 4J03A 2OXRA 4OP2A 4V0RA 4B4WA 5KEIA 1BHO1 4KPUA 3V7WA 4G97A 4Q9AA 2PJRA 3WGYA 1NN3A 4PF1A 1XJ0A 1YUBA 4U7PB 3V80A 1CQWA 3I62A 2PUGA 1HYBA 4YRSA 2HSEA 3H2IA 4RS4A 4V39A 2JEOA 4L6CA 4F04A 3VR5D 4FX2A 4B3JA 5ELXA 1EUDB 1LNSA 5GGXA 2F3RA 4R4JA 4MVJP 1FUIA 1P7VA 3OZWA 4U8HA 1Z4LA 4O4IB 2FVXA 2D1QA 4I50F 4UCQA 4WXYB 3V97A 4RZ2A 4K9SA 3Q8XB 5JBQA 1IN1A 5C34B 5T4FA 3JW8A 1TLTA 1PT9A 1UFKA 1Y3HA 4K9PA 3OI7A 3MJRA 3QKIA 1GADO 4M8LA 5E1BA 1RQLA 1EBUA 3F8WA 3STHA 4W6ZA 1V8BA 5LZ4A 4C7KA 3KKQA 3E6AA 2PLAA 4K9LA 3ZXYA 3IV7A 2FP3A 2GYUA 3I5AA 3MHPA 4PBRA 2P2LA 4Z54A 2D6FA 2VT6A 2OHGA 1DT5A 3NIFB 3O90A 4HDSB 4BPRA 2GEFA 4HNUA 2C98A 4MV5A 4GBED 1CY8A 1F51E 2R1VB 3KKMA 5HBRA 2REQA 5HFJA 1VZ2A 3HNRA 2V7EA 3I9KA 5HX7A 1A82A 1Y3CE 2G1KA 3UA3A 3G5AA 3UXEA 5H3HA 1E1YA 2FX5A 1MAVA 1MB4A 1OA1A 2PWZA 1Q17A 4YR7A 5ICGA 2WT8A 4PFKA 4D3FA 2IFTA 3D4OA 2IOFA 5JVDA 5HIKA 3WP0A 1ENYA 4GKAA 4BEWA 4QTTB 3WIOA 4CEJB 1QQ7A 3HA7A 3KSRA 3N2LA 1UKAA 3DEHA 4K3VA 1B15A 5EXPA 5BSTA 5GONB 1ZJ4A 4NDAA 1TVMA 4N8SA 3VNBA 4N7BA 1GTZA 1DUVG 1IHXA 1XMVA 2O4CA 2QM3A 1R27A 2OXTA 1I7DA 3D8HA 4PQGA 1FSPA 1L6IA 2II6A 3EJ6A 1I1QB 3QHPA 2Y1EA 3TX6A 3PUZA 3QXCA 4O2AF 3GJXC 3BWBA 3DSRA 4PRLA 1YO6A 3QRWA 4ETWA 5KMGA 4HZIA 5ESXA 4PHGA 1AK9A 1S4MA 4F6LA 1CQPA 1CQIB 4BQOA 3QSYA 1ESCA 5CJPA 4KMRA 4QUAA 1WCYA 4GXTA 1QFYA 3TZ6A 5FXMA 3INYA 3AOEC 1W4ZA 3PYXA 1Z0ZA 3F0TA 3VU1A 4BIIA 1IY8A 3IA7A 4U0KA 1VE9A 3DBVO 2ZE6A 3GPIA 4D3YA 1U28A 4K6CA 3NNDA 4M9ZA 5TQVA 3UHAA 3LWDA 3V8BA 4BKMA 2ZJYA 4CM5A 1E3SA 1B0ZA 2SBTA 1C7RA 1GCOA 3UXYA 3O8RA 3DL4A 2IX3A 1BMDA 3BIOA 1E9VA 5IHXA 3EIUA 3MRSA 2ORED 3L0PA 3ZBUA 4HV4A 1GKLA 4F2GA 5C7IO 13PKA 3DZDA 4YV7A 5C1BA 4UCXA 4JVOA 3MJHA 4N5DA 1ZH8A 3B3JA 5KJCA 3EIHA 4OU5A 1YFJA 4IZOA 1GFIA 1BEZA 4RHCA 3KKOA 3UXMA 5IULC 1QRDA 2OSBA 4H3KB 4HFNA 4A91A 4B43A 1QQTA 3R3VA 3QBEA 4I08A 2WAOA 4JLDA 3F1LA 3H5IA 4PHFA 2A92A 3P0HA 3ZGOA 1NXSA 4ZDIA 3NUGA 1GG2A 3CU5A 1NZJA 3AEZA 3NAMA 2RH8A 3E7PA 1YR1A 1EBBA 2CUTA 4F8EA 1ANKA 4X95A 4K9MA 4P4GA 1L4GA 1ZN2A 3L7IA 2ZCJA 2Q5JA 4PNPA 1SM4A 1W2HA 5IJAA 1Y8RB 2JLCA 4GLJA 4KWEA 4RADA 4KGXA 4EF4A 4GPTA 4O4JF 3AQIA 2HMYB 1VYHA 3L0BA 4Y2HA 2RGUA 1KVQA 3AIIA 3FA2A 5CFMA 2BCEA 4O4LF 1C14A 4WZBB 1CZHA 3LXRA 2G76A 2XODA 4ZCTA 5KYXA 3DXZA 5CNIA 5JBIA 4TMZA 4RBNA 2V0GA 2PANA 5GIOE 1A71A 2QGFA 3IAM6 4GP6A 5H83A 4AO7A 2WWYA 3ZJTA 4P93A 1AN9A 1HE4A 2DBYA 2PNFA 2Q3JA 2YW9A 5I5EA 3MTBA 1KZYC 4HEHA 2W2KA 3RSCA 3V9PA 1CJMA 1WDWB 2FSPA 3ZDYB 2R62A 2HWXA