1OV4A

Crystal structure of human dhea-st complexed with androsterone
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
284
structure length
267
Chain Sequence
SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKEYVVDKTQLSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Alcohol sulfotransferase
publication title Identifying androsterone (ADT) as a cognate substrate for human dehydroepiandrosterone sulfotransferase (DHEA-ST) important for steroid homeostasis: structure of the enzyme-ADT complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 267
sequence length 284
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2003-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ov4A00
5JRJA 2ODNA 1QVRA 3GLHB 4GOKA 5C4MA 3QE0A 4KFUA 1VCIA 3RS4A 4P3YA 4RKEA 3CX6A 5L3SA 4Q9LA 4TQAA 4Q4AA 3LY5A 1W1WA 3DKVA 4CZ2A 1KK3A 3B78A 1NJGA 2BC9A 3X1WA 5FUVA 1Z83A 3L43A 1NY6A 4DRZA 1XJCA 5B57C 3U44B 2HEIA 2QA5A 2F55A 4TWZA 4HEJA 4UNNA 5DLQC 5FPSA 3W9YA 4IDOA 4XWOA 3LW8A 1IXRC 2Q6TA 3NC1C 3EX7C 4PFSA 4MGKR 1CRQA 1OKKA 5EUQB 1QG4A 5J5CA 4YMWA 2F9LA 2IYWA 3ZJYA 2P6NA 1G64A 2ZRAA 2IC5A 3CF6R 1A1VA 4KFTA 4IDHA 2QMOA 2OV2A 4YONB 3OEEA 2P2LA 4FCVA 4B73A 3FHOA 3L0IB 1Q57A 2BOVA 2RCNA 4TMTA 1UKEA 3RRYA 5JFGA 4QXAA 2Z4RA 4LYFA 2SHKA 4PPQA 1TQ4A 2A2ZA 5FOUA 4ZDWA 1OH6A 1XTSA 1YR6A 3EIQA 5JBQA 1D2NA 4DLVA 4HLCA 4WXPA 3O8CA 2ZSAA 4LJ8A 1R5BA 4F91B 3WYFA 3GJ0A 2C9OA 5JSZA 2F3RA 2AFHE 5GJCA 2DBYA 2ZS8A 4BECA 3B1ZA 2P65A 3CZPA 2IXFA 3OF5A 1OT3A 1WP9A 5IHPA 3SE0A 1TEVA 1Z3IX 2JJ1A 3AF1A 5JS8A 2BIFA 3TQCA 4C0LA 2WJIA 1ZIPA 2IEZA 4ACBA 1XZPA 2ZYVX 4Q01A 4H1VA 1PVOA 3IHLA 4U00A 4RZXA 1DARA 1M1YE 2QPAA 2VHTA 4KXFB 5FPHA 2JLXA 1KO8A 1JXOA 5DI3A 2F9MA 3VR5A 4PPGA 1R5OA 3EAQA 3I73A 1E0JA 1E1QA 3O8BA 1M7GA 1RJ9B 2HYDA 3BOSA 1N3BA 3VR4A 3MRSA 3BB1A 3AP3A 4JYCA 4B74A 2QP9X 4URZR 3U3KA 4C0SA 1OIVA 1XPOA 1Q1EA 2E9SA 1XD2A 2FGKA 2B7CA 4PC1A 4P33A 4QFMA 2CHQA 4NDZA 3VAAA 2YWGA 3HU1A 4NCIA 4GNKA 3D7MA 3GLIA 2V4ZA 3CX7A 1T3HA 4Q00A 4IFEA 2JJ2D 3KB2A 4D26A 1KMHA 2WICA 1TQDA 4NYIR 4XTCS 1GRRA 2FNAA 3IO3A 3EPLA 3H86A 3KJGA 4LPSA 1ONBA 2IXGA 3T61A 4G3XA 3NDBB 1U2RA 3B1XA 4R98A 1G8YA 1OFHA 2WZQA 3BJIC 4C0HA 4DCSA 5SZHB 1IN8A 4HB2A 2PMKA 1AS3A 2ZSBA 3NBZC 1NN0A 1W5SA 1RYHA 1TADA 1EFRA 1F60A 1N6RA 2D2FA 4EPVA 2YV5A 1G8PA 3OEHA 2VHJA 3EA0A 3FMPB 2YZ2A 2V1XA 1F2UB 2FA9A 2QRNA 4Q1AA 1ZM3A 4MYHA 1LTQA 3BC1A 4PAMA 3W90A 3THWA 5IK2A 1XEWY 3UPUA 4YDHB 3IIKA 1W0KD 2OESA 2ZVPX 4DSUA 1MR3F 2F1RA 4L8GA 3O8DA 1GILA 2AWNA 4TLCA 2GXQA 4OHWA 1XD2B 4ZDIA 2IS6A 4CGZA 4PQFA 2BMFA 1Z2AA 1ZBDA 4YMSA 3WYGA 2WWHA 4L15A 5DN6D 3WNCA 3WRYC 1W36B 4GBMA 4D4JA 1E2PA 4AG5A 4B35A 5CITA 4LHWA 1HEIA 3CM0A 4LYHA 1CBUA 1R7RA 2ZAOA 1N5LA 2ZRFA 2ZRJA 3GLGE 5FI1B 1NNEA 2IYSA 2G83A 1E9RA 1UKVY 1F3OA 1I4DD 3A1VA 3SFVA 5JZVA 4IVPA 5KNDA 1UKYA 3D8BA 3BFXA 2WAYA 4OHYA 2QE7D 2QAGB 3R7WA 3T12A 3AUYA 1TF7A 1SXJE 3AVXA 4BEJA 2HXYA 3OIYA 5DGXA 1EGAA 3EPHA 2CK3D 1ZM2A 2J41A 1I4TD 4Q4HA 3GEHA 1Q22A 1C1YA 1RKBA 1JEDA 3MAAC 1NBMD 3AF0A 3UKDA 3DM5A 1U90A 3AB3A 1CIPA 3QF4A 1KI4A 2W6ID 3K0AB 5JHGB 5CIWA 5AJVB 2KJQA 4WA7A 2C2HA 2QORA 1IHUA 3BE4A 3F5FA 3GLGB 3D3QA 2QEQA 1R6BX 2VYFA 1G6HA 3K0CA 1GL9B 4MGYR 4TYPA 3LVQE 1RPZA 3FMIA 3N2IA 3HYTA 2G3YA 3QKRA 5SZJA 2Q3HA 1MOZA 3ZS9A 4TSFD 5IT5A 4JSTA 3O47A 2OCPA 2JDIA 2ZSDA 5EE3A 4IOJA 1GZSA 1X8JA 4RFVA 1J2JA 1Z0JA 1JPNA 4L5BA 1LFDB 1VG8A 2ODWA 1E9FA 3I92A 1ZJ6A 2WJGA 5H1YA 4BFYA 1Z0KA 4FMBB 2D4HA 2ZJYA 2GK6A 3KQNA 5DNYB 4A82A 4QL3A 2XITA 4HAVA 4B6FA 3DZ8A 4RCYA 3RRZA 1ZIOA 3BFVA 4M9ZA 2G1KA 3TW4A 3UANA 3K70B 4FCWA 4ZCLA 5K8IA 1D2EA 2ZRDA 3TH5A 1NJFA 2XEXA 5F9FA 3SBDA 4KSBA 1E2DA 4RKFA 2CL7X 1G5RA 2GXSA 3QKSA 5FPTA 1KY2A 2X2FA 3B9QA 3C7KA 4Q47A 1Z6XA 2V54A 4RZUA 1GVNB 3AVUA 1UKZA 2JCSA 4G5QA 4DZZA 5DH9A 3VX3A 3A8TA 3CRQA 4JLNA 1P2TA 3TVDA 3GJ8A 3D6TB 2BBOA 4GZMA 5FPKA 4CRWB 1E2EA 2A5YB 4RFSA 3EPJA 5TV2A 5HZKA 1SULA 821PA 1FQKA 2J0QA 1AS2A 5AJXA 2JJ2A 1FMLA 2NO1A 2GBLA 4HZUB 1N6KA 2ZJZA 4DDTA 2MSCB 1KZ7B 2GXUA 1CKEA 3QI2A 1KTVA 3T1TA 3R9WA 3KX2A 2IK8A 1LS1A 2RGBA 4LJ7A 3K0EA 3QXJA 2YWEA 4RSGA 2MMGA 4M9XA 2QPTA 1KSHA 5FL3A 4ZCIA 2BDTA 5J4HA 3U7GA 3K0CC 4TYQA 2RGEA 4V02A 3SN6A 3CX8A 4D4KA 1KK0A 4UKDA 2KE5A 4PO8A 4M1SA 4CYMA 4OHZA 4KODA 1W7AA 5GVSA 1XD8A 2P5TB 1N25A 1XXHE 1W4BA 2UZIR 1E96A 2JIZD 2QT1A 1AGPA 2W00A 1KO4A 5HE8A 3H2YA 4BEBA 2C99A 2XOKD 5C1BA 2WJHA 4OQNA 3ZLJA 2OBMA 4BLTA 3G0HA 3TUZC 5DN6A 2WWFA 4RD3A 5A4JA 1GKIA 1G20E 2ZI5A 2B6HA 2FSHA 1F48A 2P6UA 1HTWA 1P9WA 1WE2A 1UADA 2PX3A 1FMJA 2ZR7A 4MH0R 4D6PA 721PA 2A78A 4HAZA 4TLEA 2WSMA 1XBTA 1Z63A 1AIPA 4OKSA 5FI0B 1HYQA 1QVAA 1X86B 4LJ5A 1A2KC 1BO6A 2J0SA 2QNRA 3PR1A 2YOGA 1SGWA 3BH0A 3U60B 2RGDA 4HAYA 2W2VA 1IY2A 2QE7A 4LJ4A 3RABA 3VR1A 5FTKA 1YZLA 4TTRA 3RSOA 4MRSA 2XX3A 4MDFA 1G9XA 4MRPA 2PMDA 2XTMA 3B1VA 2KI5A 4ARZB 1JXMA 3IBGA 2KBFA 4ZCMA 2ZANA 5GADl 2QBYB 1XNJA 1NBMA 5KOYA 2GBLC 1HE1C 2WOOA 1A5TA 1TU4A 1P6XA 1PLKA 2W6IA 2GWHA 3BH6A 4NTZA 1A2BA 2NZ8A 4HUQB 3MD0A 4D0LB 1Z28A 1ZNWA 4X8LA 3TUJC 2DR3A 3QNUA 2WM9B 2HYIC 4Q1DA 3A4MA 4RVCA 2DHRA 1C9KA 1J90A 2DWQA 3WNDA 2GNOA 2ZJ5A 3MG9A 3QXHA 2AK2A 4LX0A 1E94E 4KSCA 2HLDA 4ZV4A 1CXZA 4PHFA 2NPFA 2QUZA 2ZSFA 5CB6A 5FOWA 5E4FA 3U3MA 4ASUD 1UAAA 4I81A 3SR0A 3DO6A 2W2XA 5AWFC 1CJKC 2BWJA 3SYLA 4Q7KA 3TSWA 4Q19A 2WMNB 3W6OA 2EFEB 4Y0AA 1PLLA 4HUTA 4R9UC 5G40A 2O8EA 4NCKA 1XEXA 2OT3B 3NTUA 2O8CB 4AKIA 1BIFA 3EZ2A 2ZRIA 2D3WA 2AK3A 2J1LA 3EZ9A 5BQ5A 2CXXA 3NHAA 2IUTA 4KI0A 2DB3A 1U8YA 4TL7A 3V00A 1DAKA 1OB5A 2QSYA 1D2MA 1X6VA 1RZ3A 3QPUA 1KI3A 5BYJA 4KBFA 4R2HA 1G8HA 5BN5A 5F3WB 2P3SA 5AJZA 4AYWA 1KI8A 5CDFA 2N46A 1DADA 2C95A 3RWMB 1OSNA 1FX0A 1YRBA 1OFUX 5KTYA 3A1TA 2G88A 1P9RA 2VP9A 4GL2A 3UMSA 2FG5A 5FR1A 2WIBA 2ZE8A 3M0EA 4FMCB 2FJUA 4H1UA 5JCPA 4WBSA 3IIJA 3A4NA 5EP2A 3CPEA 4CW7A 2DY1A 6Q21A 1G5TA 3DMNA 4Q1CA 3RRNA 1XZQA 5KUTA 2BBWA 5B2ZA 4JBWA 3IKJA 4NU0A 3CRVA 4TMVA 3DZDA 2ZI3A 4D0GA 4DT1B 1H8ED 1T5LA 3FFAA 1P7CA 3GJ5A 2MSEB 5LBIA 3SOPA 2PZEA 2XXAA 1OXXK 1LY1A 1T4GA 1XX6A 4E07A 5G41A 2J59A 2VH5R 4BASA 2XB2A 1RW4A 1VKJA 2OILA 3BERA 2FOLA 5AUNB 4EPRA 2OM2A 1E0KA 3GJ6A 1KJWA 3EWSA 4C0JA 3IIMA 3TGPA 2EU8A 3WMEA 2HF8A 3LAWA 1J99A 2V3CC 1ESNA 3AV0B 4B3DA 2FWRA 2JIZA 3GFOA 4B6EA 1DO0A 4RD4A 3SEAA 3PQCA 1IOZA 2PT5A 3DM9B 1JR3E 2QTHA 3K9HA 1E79A 2JJ8A 2YOFA 4WZ6A 1FOEB 3TSZA 1KYIA 4QJ5A 2HT6A 4CIDA 2WJJA 4DC9A 2FZLA 1Z8FA 3SYKA 4B71A 1K6MA 4QJ3A 2R44A 4AKHA 2X19A 1RRFA 2VA8A 1VG0B 1I2MA 3B8HA 4KHZA 3DEFA 4HATA 1AQYA 1T0HB 5KDDA 4M1KA 1IQPA 4JL5A 2YWFA 1GKYA 3IBYA 4YMTA 1DEKA 2DFNA 2ZR9A 2L0XA 4ZI3A 4OJQA 2V55B 4Y0VA 1WA5A 2V8OA 3N2EA 3WYAA 5JI2E 1KK2A 5E7IA 1GM5A 4QKQA 3VKWA 4B44A 4DDWA 4YQFA 2VHCA 1GTVA 3OIUA 4BFZA 2FSGA 4NONA 1JECA 2ZRMA 2IYYA 3V4FA 2QPOA 4V0LA 4FD2A 2P5SA 4B3FX 4AG6A 4LJ6A 1DAIA 3K1JA 4JVMA 5TB5A 1OKKD 1YRAA 4TTPA 3R8FA 4A8JB 3CB4A 3I1FA 1WQ1R 2FEMA 2GZHA 3OEED 121PA 1XB2A 1Z22A 4BPBA 2BKUA 1XMIA 5DHFA 2GAAA 2C98A 2ZS9A 3KQKA 2CHGA 2PZFA 2BEJA 2WWIA 3ZH9B 1CTQA 4W5JA 2IYUA 3T5GA 2QP4A 5C46F 1R8SA 3UG7A 1ZINA 5SZKB 3A6PC 2HCBA 3TBKA 5FH9A 1CF4A 3FYHA 5J4KA 1P3JA 2XAUA 4PXAA 4DB4A 2GETA 1E2IA 3CZQA 4XVUA 4CEJA 1OFIA 1ZNZA 2WJVA 2DFLA 3GJ3A 4Q03A 1YZKA 5JI3E 1QHHA 4L16A 3TUIC 2GJKA 3LDAA 4B47A 3LFUA 4CEHA 3ZVLA 3KQHA 1CP2A 3BB4A 4TQ9A 3X1DA 5C18A 1XMSA 4BZPA 2WKRA 4NYJR 4XIGS 1PZNA 3OIWA 4JKIA 1FTNA 4XWAA 1XTJA 3LXRA 2KB0A 2FPKA 1WCV1 1G19A 1NN1A 2NMVA 5EXTA 4X8OA 3RNLA 1G7SA 3UWOA 4JIMA 2PH1A 2KBEA 3FWYA 1NI3A 3KZ1E 1OXSC 4Z1MD 3AUXA 3T1OA 4BLRA 4GZLA 3T1VA 4A36A 4HB3A 1AQUA 4O2LA 1TPZA 4WXRA 4DLTA 5KSYA 3I61A 1ESMA 1KIMA 4M1MA 3AF3A 4KCGA 3KKQA 3ASYA 4NYMR 1E1RA 3ND9A 5AJWA 3SC3A 4YMUA 3PIRA 2ZI9A 1Z6GA 3DHWC 3VHXA 2ATXA 4EJSB 1RC8A 1RRCA 4MYCA 5TY0A 4EIWA 1IN4A 1E2JA 1H8EA 3GLHA 4CEJB 1Z0FA 8OHMA 3EIHA 1MKYA 1WMSA 3QEJA 4DUGA 2VF8A 2IYRA 2JA1A 4OQXA 1W36D 1FUKA 1NVXQ 2IF0A 1QHYA 2ZRCA 2F43B 2O0JA 1NMYA 3MMPA 4NP6A 1IONA 3R8CA 4O2RA 1KI6B 3LX5A 3T5DA 1O3YA 1DOAA 2AKAB 2CE7A 2E1RA 1YZQA 1JJVA 4HDOB 3M1IA 3U44A 3PEYA 3VR3A 1E2HA 1KY3A 1Z07A 3CRRA 4MGIR 4KYUA 2O8BB 3VU9B 1DG1G 3TE6A 2XSZD 5DISB 1SHKA 3C15C 4TN1A 4Q9KA 1EFRD 3SS8A 4LPKA 2R62A 5JWRA 1KI1A 4URVR 2CLDX 1RIFA 1M2OB 1XDBA 2OHFA 1E2NA 1ZP6A 1AN0A 4LI0A 5FFMA 3VQTA 1U8ZA 2FFAA 2IHBA 3W3AA 1BOFA 1U8AA 4WOPA 1NSFA 1K5DA 2DPXA 2BM1A 2NOAA 4M2LA 1N0UA 2A5DA 2D7CA 2UVQA 4L9WA 2V6IA 1Z6AA 3N5CA 3D31A 4TMXA 4C3ZA 2OXCA 1J8MF 4JJKA 4P0TA 2A7QA 3GEIA 3NH9A 5EXSA 5FBRB 4TMWA 3OE7D 4NL4H 2NQ2C 3CO5A 4PZLA 1EFUA 3AVPA 1FZQA 1GL6A 4KYIB 3KXIA 4QGAA 5FL7A 1YZNA 3C41J 4UQOA 5FOVA 3QXXA 5KHOC 4V03A 2QY9A 1CU1A 1XEFA 5CJ2A 4E03A 4URXR 1A4RA 1XF9A 1G5PA 2ZRNA 3ZVMA 3M6AA 4M53A 3L8ZA 1IN5A 3K70D 1W4RA 3AQ4A 2EFDB 1COWA 2A5GA 2N42A 3E5HA 4KLNA 4PPNA 2ZRGA 2AX4A 2EW1A 4C0BA 4O25A 3F3YA 4F38A 1DE0A 3FE2A 1NLZA 1RJ9A 2IF2A 2X77A 1ODFA 1KSFX 1NVVR 1F2TA 3EASA 2OFOA 1XTQA 3B6EA 3GLFE 3G5UA 4ACAA 2O8DB 2ZRKA 3ZDQA 1P62B 2HJVA 1VPLA 2BCGY 2QM7A 4V0NA 2FN4A 3WBKA 1U99A 3ASZA 2QL6A 1MRNA 4QHSA 2ANCA 4RCZA 4Q18A 2F1HA 4ESVA 4LV8B 5F2EA 4FCTA 2XGJA 4A0RA 2VSFA 1TEXA 2R6GA 3SNHA 2FU5C 2VP6A 1QBKC 2JDID 3CF2A 1RE0A 5LD2B 3NC0C 2I1VB 3C5HA 2R6DA 4V0ME 3SBEA 3QF7A 1E9BA 1VYVA 3I4LA 4URUR 4M1YA 4A0FA 1UEJA 4NYIQ 3H0KA 2J9RA 4KO8A 2YOHA 5E3HA 1N5KA 2WVJA 2PCLA 3A1UA 4C0QC 3H1TA 5FPYA 2QGNA 2ZREA 4Q1FA 4PQYA 4QOSA 4XSHA 4Z1MA 3REFA 4CT5A 1F2UA 3GLFB 2GJ8A 4K8OA 3AVOA 4HSEA 5EE5B 1Z0DA 4DCTA 5JS7A 3IQWA 1F2TB 1MV5A 1DAGA 1PUIA 3DL0A 2B92A 2JLZA 3LQQA 4XJXA 1JEEA 1G4AE 2ZRHA 4QGGA 1NY5A 3CPHA 5DE3A 4JL8A 3K0SA 1M7HA 4DEYA 3NHBA 4JJZA 4B48A 1OPXA 4B2PA 4EQ6B 4PSAA 2ATVA 1SKQA 2ANBA 4IRUB 1PV4A 4IHQA 2R6CA 3VR6A 1KO1A 3A37A 1ZD8A 3MSXA 1ZVQA 4RD0A 1AKYA 3RWOA 1A7JA 1OV4A 2VBCA 2RMKA 3QBVA 2DFKB 2IA5A 1P4SA 1EWRA 2LCFA 4GP7A 2J7KA 2C8VA 5LPNA 2I3BA 1FFHA 2XSZA 3PUXA 4B76A 2QTFA 1DG3A 4FW9A 2QAGA 2FMXA 3FOZA 4IKEA 3SFZA 2H57A 1EWQA 2ZR0A 1W0JA 1R8QA 3CNNA 5DYGA 4DEXA 3A36A 2EQBA 3ZQ6A 4DIDA 2BMEA 2HDNB 2AHOA 2QN6A 2ZUBA 5P21A 1R10A 3OESA 2LKCA 4QBFA 1P2SA 4AWXA 4LDJA 4EFNA 2FGJA 2FZ4A 4KFRA 1TQ2A 1E3MA 4U02A 2GK7A 1B23P 3ZVRA 3ECCA 2RGNA 3K0AA 5KYKA 5BW8A 3GLGA 1GOTA 1G7CA 4DXAA 3VKGA 4JVLA 5H68A 1M74A 5HR5A 1PUJA 5FOSA 4HB4A 2VHUA 3AKCA 3KB1A 3EARA 2RH5A 1G3QA 1P72A 1T5IA 3B1WA 3PG5A 1W2GA 4LHVA 2RGGA 5G3YA 1T6NA 3HP1A 2PCJA 3LWNA 3OE7A 4NE2A 3KJHA 3ZVNA 1Q21A 4P32A 4PHHA 1MT0A 4AC9A 1TMKA 1UDXA 4RZ3A 2ZETA 1E4YA 1SXJA 2BCJQ 3MLEA 3X2SA 4JT4A 4EPTA 4TYYA 3IILA 1E2QA 2FX3A 2WKPA 3L82B 4A6XA 2ZJOA 3QVUA 3SHFA 2GVZC 5TVKA 4HLUA 2QP3A 1ZM7A 4LV6A 4P4TA 4FXPA 2GTPA 4JLOA 4FWTA 1R0ZA 2O0KA 2NO6A 2QQ0A 4B3CA 4NZYA 2ZJBA 2J7PD 2RGCA 5AUOB 1W36C 5JMTA 2JLWA 2VLIA 3BD9A 3FGNA 1OJLA 1H8HA 1AS0A 1FP6A 1YR9A 3B60A 4KVAA 3SQXA 3HDTA 1YZUA 3KTAB 4QBGB 4URWR 3SHWA 1MO3A 4BLPA 5BXQC 3NVAA 2DFTA 3QPWA 2H17A 4W9MC 1NIJA 2OFWA 3TJZA 5EE9A 3AVVA 2IYTA 2OFXA 3CWZA 4PC7A 4QBHA 3NKVA 4JLVA 3SJBA 2QAGC 4BLQA 1CULC 1LB1B 3RS3A 3U61B 3T34A 3LQRA 4M1OA 2HLDD 2W6JD 1SVSA 4G5GA 4HZUA 5CLLA 2F1IA 4LYJA 1SXJB 2Z4SA 1Z5ZA 3AVQA 4D25A 4M8NE 5AUPB 2ZI4A 5FUWA 5HE9A 2GKSA 3BFKA 1SVOA 2PT7A 2CDNA 1KI9A 4NBSA 5JEDA 3H84A 5KSOA 4HLDA 1Q3HA 2VRWA 4N3NA 2RGNC 1LF0A 2D06A 3A1SA 3EZ7A 1GRQA 3QOFA 3P27A 1Z08A 5EJEA 5H70A 1IN6A 2ZSEA 1NLYA 4CDGA 2H8KA 5L3VA 4AYTA 1LS6A 1BYUA 4BQSA 4JZKA 5TARA 3WRXC 3EPKA 4A1FA 2GF9A 1M7BA 1Y63A 2ZTSA 2VQSA 1IJFA 1SXJC 2PEZA 4Z8XA 4X8MA 4B2LA 4PO1A 2B21A 2C03A 1FP7A 4HLUC 3REGA 4J0QA 3W5JA 3PUZA 4B43A 2Q3FA 1CJMA 1OIXA 1QHXA 1Z6YA 4P4UA 4Q7MB 4PC2A 3WMGA 3K70C 1KHTA 2J46A 4XD7A 4PSKA 4AKGA 4NCJA 3ZZ0A 1DAMA 3TAUA 2ZE6A 3DDCA 3AVWA 3RVBA 2GZDA 4Q1EA 3AGQA 1E6CA 2EFGA 3PXGA 1Q20A 4CT4B 1NVUQ 2H92A 4HB0A 2IUSA 3U3OA 4L4UA 3CR8A 4JVNA 1YVDA 5HKKA 2C5LA 4QNRA 1XXHA 5AUQA 3CUEF 4ARZA 1HT1E 1NIPA 4LHYA 4I1SA 1AZSC 4XTRA 1EK0A 4V0KA 5J4VA 2GJSA 3NBYC 4TZ0A 3GFTA 3P26A 3LA6A 2VP0A 1JR3D 1UBGA 3OHMA 4WAUA 1TAGA 3B13B 4DLWA 2QBYA 4UNRA 4F4CA 3C8UA 1VCNA 3GD7A 1XRJA 4DJTA 2XNDD 2ZRBA 2CNWD 2V7QA 4HUQA 3K0FB 1E79D 4LOAA 4AY2A 2WIAA 2HUPA 2IBMA 4QM7A 1UFQA 1NN3A 2FPMA 1IY1A 3SZRA 1O87A 3Q5DA 4C9BA 2XJ9A 4B3GA 2BJVA 4L9SA 2VP4A 1CR0A 3LX8A 4MKFA 3O8RA 2XTNA 2VP5A 3GQBA 3LW7A 4OHXA 2HCJB 3CRW1 1J70A 1WBDA 1VTKA 2Q9BA 2QI9C 1JQJC 3KQUA 3PENA 5TXGA 5FR2A 2PLRA 1XCGB 1IAQA 3LH5A 3IPXA 2PX0A 1XXHB 2O8CA 2ZE7A 1ZC3A 2VSOA 1GFIA 1TU3A 4BRUA 3QUSA 1FQJA 2J7PA 3AKYA 3BH7A 3IUYA 1QHSA 3KJEA 2CLSA 4US0R 5EXPA 4QGHA 1MABB 2IHYA 5F9HA 4M1WA 2GESA 2YKGA 2D74A 4OI4A 2BKEA 4EPXA 2JLRA 1B0UA 2GILA 2OLJA 2CHVA 2F7SA 1T3SA 3EC2A 3U3RA 3FFBA 3CNLA 3HYRA 2NIPA 3S1AB 2ODBA 2WPDD 1DELA 1II8B 2G6BA 4NH0A 1GITA 5FUXA 1HV8A 1U0LA 2W6JA 4KITB 2RGXA 3EW9A 1XPRA 3IDQA 3CWQA 1DS6A 3KJIA 5KNCA 2FSIA 4EUNA 5H8WA 1SVIA 5L8VA 4ZPXA 1FNNA 3W34A 2N1BA 1G3UA 5KSPA 2O52A 3QXCA 1YHNA 4DT1A 2ASEA 3RDPA 2A30A 1HH4A 3B9PA 2GCOB 2OLKA 1S8FA 4BRWA 2Q3MA 2AFIE 1XCPA 2ZU6A 3VNVA 3UATA 5FUYA 1EX6A 3CH5A 2ONJA 2I1QA 1WF3A 3ND8A 2ZM5A 2R65A 3LRPA 4BFVA 3GMTA 1G3MA 2REBA 3R9IA 1E2GA 4ZI2A 4JLDA 1CR4A 2C9CA 3I5XA 1FW6A 2ORVA 1F5NA 2JGNA 4IOMA 4LCBA 2ZRLA 4BUJA 1GRNA 1OYYA 2YC2C 4DLSA 2Z83A 3I62A 2WV9A 1OHHD 3HU3A 1Q1ZA 2WWYA 5DO9A 5FTJA 3UK6A 4B32A 2X8AA 2OZEA 4NKRA 4ZDKA 5F98A 2BJWA 4M22A 4QHTA 1E1RD 1E0SA 4A2PA 4ZO4A 1S1CA 2HT1A 3PEWA 1KNXA 2FV8A 4IEEA 1G291 3LD9A 4XSGA 4D82A 1S1MA 1Q1QA 2ZRPA 1DAHA 1X1SA 4DUGD 2IT1A 4ON9A 2GZAA 1DO2A 3C16C 4PHGA 5JECA 2E87A 2OUKA 4H9GA 3TR5A 3P1JA 1N5JA 4JSYA 3ONWA 4F7WA 1OXUA 4IOLA 1WXQA 1UBCA 5IRCD 1WDTA 4LBYA 1JR3A 1R0WA 3H4MA 4MKHA 1U98A 3U5ZB 3RAPR 1S2MA 2IYZA 4P4SB 4IOKA 2XNDA 3GJ4A 1GWNA 2IS4A 2CNWA 4LZZA 4O0MA 4A8JA 4M9SA 1CS4C 4GP6A 3KKMA 3P20A 1KAOA 1SVMA 2CCJA 2ZJ2A 3MCAA 1L4UA 3NBXX 4TZ6A 2ORIA 3LO5A 3GFPA 3MFYA 3RS7A 3FVQA 4JBYA 2G77B 2QM8A 1H65A 1W49A 3WHKA 2IWRA 4MRVA 3NEJA 3PUWA 4BLOA 2F1JA 3UMRA 2ZS7A 1E69A 2IUUA 1L4YA 4TL9A 2P6RA 4KV9A 5DIFA 4DCUA 1T91A 4OK6A 2NO9A 1ZD9A 1II0A 4Q9IA 1KSGA 1IJEA 4XVRA 5B64A 421PA 1NRJB 5K8TA 2GEVA 1LV7A 1EFHA 4QHYA 2G9NA 2ZXUA 4PAQA 5FL7D 1D6JA 4K81B 5J4LA 4R2IA 4C7OB 1G8GA 1SVWA 4JYBA 3JVUA 1YU9A 4JBXA 2CJWB 2D7DA 4OYHA 4R71A 4NYJQ 1IN7A 2R9VA 4MKGA 2VF7A 4O3MA 1JALA 3T1QA 1COWD 2A5FA 2J45A 4PC6A 4JLPA 2WPDA 5DSZA 4TQUS 3T06B 2ZPTX 2YNMA 1L7VC 2H18A 2EYQA 3KUDA 4NCHA 4JLJA 5KPJA 5JWHA 2J5XA 3I8XA 3QQ5A 2X1VA 1KJZA 4EJSA 3R9XA 1C4OA 4OI0A 4UNQA 1E9AA 4I1VA 4NYMQ 3CRMA 1ZM4A 3TW8B 1RFLA 1P75A 1Z0AA 2CLCX 4OQFA 1E9EA 4ZDJA 1G3IA 4FMCF 4G5SA 3PJRA 2ZITA 1ZNXA 2F43A 4A8JC 4DKXA 1KI6A 3CNOA 2RHDA 3KFXA 4MUBA 4DWJA 1N0WA 1NL3A 4ABYA 2V9PA 1P73A 2CEAA 2ZAMA 1JJ7A 3U6KA 2IWHA 4DVGA 4UNSA 3MGCA 2O8BA 4I1UA 3VU9A 2FEOA 4KBGA 4KJZA 4C30A 1MH1A 4N0EA 3B5JA 3IQXA 4S35A 5CJPA 3THYB 3TAHA 2CCKA 4YXWA 3W5IA 2H5EA 2IX3A 5E7MA 5KO2A 5JEEA 1II9A 3B82A 2R2AA 4WZBE 4LC1A 1OHHA 3DPUA 2FPLA 1K5GA 3KDSE 5KU1A 1MO6A 1A82A 2G1JA 2JAQA 4QG7A 4C4PA 2NO7A 4NMMA 4B34A 4EAQA 3ETLA 2ZROA 3OFND 4QC2A 1TQ6A 3DOFA 5JJIA 2JEOA 2ZE5A 4IW3B 1Q12A 1G21E 3LBIA 1L8QA 4YLGA 3NBFA 1U0HC 2CE2X 2ODEA 2YWHA 1US8A 4G1UC 2IEYA 4NHOA 2OAP1 4DB2A 4MITA 1E2LA 5KDLA 2BBSA 2ZEJA 3NEYA 1ZM9A 4JKYA 3B85A 4E09A 3E1SA 5A5GA 1V5WA 1L2TA 2KWIA 2DYKA 5LB4A 5CK4A 5JRZA 4GOXA 4Q9HA 2K5UA 4TMZA 2Q9AA 2XTZA 3SI7A 4A92A 4QM6A 5IDVA 4I4LA 4PR0A 3EZ6A 2BBTA 3IEVA 3KKNA 3QY0A 2ZI6A 5EQTA 1AGRA 1Z29A 4Q4LA 4EJSC 1W0JD 3ZS8A 2WHXA 2A5JA 1DAEA 3LV8A 2RKOA 3THXB 1JPJA 3NIBA 3NG1A 4C2TA 1WRBA 1N6OA 4Q48A 3BORA 2NO0A 2Q21A 3CIOA 3K8YA 4MRRA 1XTRA 5G53C 5KPDA 3U4QB 1E2MA 4D81A 4C0KA 1R0XA 2GEDA 1XPUA 1S4QA 3KFVA 4ZIRB 2PJRA 4P31A 3MWJA 5GJBA 1VCOA 3LBNA 4FMDB 2OE2A 621PA 3MWKA 1G3RA 3GP8A 2O8DA 1NVVQ 1W46A 2XB4A 4KAXA 2QT0A 4R7ZA 2J3EA 1HA3A 2H1LA 3I5YA 1US8B 2PZGA 4WIAA 5B58C 4LWZA 3VMFA 5DYIA 1X8KA 2IYVA 3HJNA 3Q8XB 3KQLA 1VYUA 1AKEA 1PJRA 4HAXA 2VPPA 2J0UB 4IDPA 1ZU5A 5K8UA 3QBTA 4FI3C 4LHXA 2Z43A 4TL6A 1SVKA 3RLFA 1SXJD 2RB4A 3UIEA 1NMZA 2PBRA 4N0DA 2OO7A 4A0HA 1G18A 3PCRB 4ESHA 1ELOA 2Z0MA 2JLSA 3A58B 1E98A 4DBLC 3ICEA 2WKQA 4BLSA 3VNUA 4DSNA 4DLUA 5HCIA 3DOEA 3SDZA 5TMPA 3IO5A 1VHTA 2HF9A 1GUAA 1U94A 1ZUNB 1GNQA 3GLFA 1H8HD 3UMFA 1QF9A 2CL0X 4XVQA 4DLYA 1CEEA 2ZYTX 5IF9A 4N1AA 3K09A 4JLBA 4QGFA 2OXRA 3U7HB 5D3MA 2W0SA 2VTKA 4PTLA 4DLXA 2GCNA 2O8FB 3X1XA 4GI7A 2XZOA 2WOJA 1NMXA 1RRPA 1T9HA 2OEPA 4FWIB 3F0TA 1XCMA 4EQ6A 3TRFA 3J81k 4V0MA 1Z0IA 3OZXA 1J7KA 1EFTA 1J8YF 1E4VA 1HQYE 2VSXA 3FKQA 5EZ5A 4TL8A 1DBSA 1Z06A 5L3QB 2ZJ8A 1KKMA 1FUUA 2GRJA 4URYR 3AVTA 5FOXA 1P5ZB 1GAJA 2QRZA 2AD5A 1N6HA 3CW2A 1SQ5A 2WWGA 4IVQA 3AKDA 3NWJA 5L3SB 3SQWA 4DDVA 2REXB 1HUQA 4Q4AB 4TLBA 1D9XA 2WSSA 4MRNA 1T8UA 4JVSB 4WVFA 1G7RA 1HQCA 4TMKA 4BZXA 3VR2A 3DVLA 3BAFA 3FKSA 3P4XA 5CM9C 2QG6A 1SKYE 3MJHA 3HR7A 4AK9A 5D3MB 3EG5A 3V4RA 1VDZA 1Y3AA 3ZQJA 3B7GA 1KI7A 5JJLA 5LD2C 4B2IA 4HDQB 4MUAA 4WW0A 3OFNA 4Q9JA 5EE1A 4A0GA 1D9ZA 4C2UA 5KNBA 3TNFA 3Q7PA 1VIYA 4LK2A 4OK3A 3ZYCA 1D5CA 3ADBA 4KFSA 2AWOA 5G3ZA 1ZRHA 3VFDA 4PO9A 4EPYA 1CJUC 1TUEA 2Q9CA 1KAGA 3WNBA 4XD7D 1HURA 1JBKA 2YHSA 4RD1A 4V0OA 2C78A 3LLUA 3WP0A 1X1RA 1G6OA 3BGWA 4YDSA 5CYPA 4FMDF 4JLKA 2HJGA 3K09C 2C77A 2FSFA 3AP1A 3QG5A 1U9IA 1SKYB 2OBNA 5HKKD 5JSZB 1OB2A 3RS0A 1T8TA 3U7EB 1XTKA 2NTYC 4M1TA 2YYZA 5C2JB 5FTNA 1CLUA 2JLUA 3AF2A 4M4SA 3WP1B 4QRHA 2NG1A 1ZMXA 1KK1A 3U3JA 3BBPA 5LDDC 4PX9A 1BKDR 5FBWB 3AF4A 2RGAA 3GLIE 1AA9A 2IS1A 2OSBA 1M6NA 4UJ3A 3TKLA 3KTAA 3HR8A 4A4DA 1T0JB 3K9GA 4LBVA 2V7QD 2P67A 3UG6A 1S96A 3W6PA 1TF2A 4I99A 2AN9A 3K9LA 1BMFD 4LJ9A 5FTLA 1CR1A 1E32A 1W4CA 3E70C 5DI3B 2IYXA 4IXNA 3FDIA 1W5TA 1NVWQ 5EZ6B 1JAIA 1S3GA 3F8TA 2O0HA 1R4AA 2IXEA 1OF1A 1KDTA 1GNRA 2OCAA 4JLAA 4RD6A 4BZQA 1OE0A 1VIAA 4G5RA 1ETUA 4GDFA 2FFBA 3QPVA 1CJVC 1W2HA 2RHMA 2FDCA 2QZ4A 1KO7A 1XWIA 1JQLB 1YE8A 1ANKA 3B1YA 3FB4A 4Z8YA 3TLXA 1VHLA 3GLIB 3OAAD 4MGZR 1EESA 2DCUA 1KMHB 1XP8A 1OH8A 3FMFA 3X1YA 2CCGA 2CMKA 3W3ZB 4QNMA 2AXNA 5EP3A 2EWWA 3Q3JB 2F3TA 2QGZA 4D4LA 3BK7A 4UNPA 1JAHA 3C4JA 2GJ9A 4NCNA 2DWPA 4DLRA 3IHWA 2CVFA 1KMQA 5J40A 3QSYA 2V1UA 1NG1A 4Q1BA 1G7TA 1U9IC 4JS0A 4M0LA 1FTSA 5FBVB 2IS2A 4JT2A 2XZPA 4LSGA 4Q21A 4B33A 1NN5A 2IL1A 1W4AA 5LB2A 3THWB 3QVVA 4DSTA 1MO5A 2YVUA 1G17A 1ZC4A 3JZMA 4IFBA 3RS5A 4Q02A 4LBZA 3BS4A 5KSZA 3CONA 1QG2A 5ANRB 3I32A 2FFHA 4B3XA 4CVNA 2EFCB 4PZYA 1RYFA 4Q7JB 4BFSA 1GSIA 5GVRA 1KSJA 2Q0HA 1AK2A 2YINC 3CF0A 2MSDB 1S0UA 1XEWX 3IEUA 3TK1A 3W6NA 3QKUA 2X2EA 1GP2A 1UJ2A 4LJYA 4HI0E 3L0SA 4W5WA 1IXSB 1RVDA 1RRGA 2JATA 2G0TA 2FF7A 5FTMA 1U0JA 4D80A 4LUCA 3GJ7A 2GXAA 2R6AA 5E95A 1KGDA 4W5HA 3R7WB 2BVNA 2TMKA 3BB3A 3G82C 4AIIA 1OH7A 3LLMA 4BFWA 1CRPA 1OLOA 2VL7A 1DTSA 3BXZA 4Q5IA 5EP4A 3K0FA 1R5NA 4ZKEA 5KDOA 5HPYB 1UBFA 4KLZA 5E7JA 4Q4HB 5DI9A 2O5VA 2RAPA 2W0MA 2OCBA 3L0OA 5CIQA 2PEYA 4DDUA 2PLFA 1Z2CA 3PUYA 4ITRC 1N6LA 2LKDA 3T15A 2I4IA 3PEVA 1TX4B 3QF4B 2QMEA 4G0NA 5JLJA 3M4YA 4II7A 2XNSA 2OG2A 5JCZA 4AI6A 3RANA 2BMDA 3SU8A 1VG1A 1YZGA 1UPTA 2REOA 3MWYW 4PC3A 3QKRB 4TT3D 2GDJA 2GAOA 4PZZA 4IDQA 5EP1A 1E9CA 1M34E 1PLJA 4MYTA 3HPRA 3ADDA 4E22A 3R20A 1EXMA 4BFTA 2VEDA 4OJKA 1MO4A 4M9QA 4GMDA 3FMOB 3Q85A 5B30A 2IW3A 1MABA 3NXSA 3MWLA 1TNDA 2QENA 1LNZA 2VP2A 1EG7A 3CR7A 3EWAA 1LF5A 1GDDA 2JASA 5J47A 1DPFA 4PAOA 1ZCBA 3ZD7A 4AYXA 3Q72A 1BMFA 2MMCA 1ZNYA 3SJZA 1K8RA 3S1AA 2GA8A 4ZKDA 3VHLB 3RSLA 1ZAKA 1II8A 2GJAA 2NPIA 4TLAA 4G5OA 4DIEA 1G4UR 1NKSA 3WHLA 3QKSB 4BFUA 2YC4C 4MKIA 5M04A 2KSQA 1W0KA 4RJLA 4RZ2A 1AJEA 1JR6A 1HE8B 3VKHA 1E9SA 4LHZA 4B75A 3I8SA 4RY2A 1XD9A 2JLQA 2CL6X 3FPAA 1FPMA 4RD2A 4F4JA 2GEUA 3CH4B 2HV8A 1QZXA 4RFSB 3FHCB 2GCOA 4FN5A 1AM4D 2C9YA 4PPFA 3OAAA 5JJKA 4OI2A 1XJQA 4OL0A 1N6IA 4AURA 1XMVA 5BN3A 4DSOA 5UKDA 1P61B 2ZI7A 5AJYA 2ZIAA 3IGFA 3ZZUA 2H16A 3HWSA 3WY9A 4GFDA 4BWYA 4HAUA 5HCNA 3AVYA 4IEIA 1KOFA 1HY3A 4EDHA 2B8TA 4US2R 3GPLA 3DMDA 3TR0A 3ZIAD 4EFMA 4DCVA 1Z6TA 4UXIA 5TDHA 3UXMA 2UKDA 2AD1A 3FHTA 1QRAA 3ZGXA 1D8TA 2CK3A 2OCYC 3RC3A 4UXHA 4XWKA 4GSYA 5ELXA 4G01B 3C5CA 3VTKA 1JI0A 4A2WA 3L0PA 2VIIA 4E5UA 1VECA 1QHGA 2ECKA 1TL7C 2EYUA 4I1OA 3ADCA 3GEEA 3NH6A 2IYQA 3PFIA 5EUMA 3THOA 4GMXA 5FOTA 1QDEA 2EFHB 1Q0UA 1Q3TA 2WWWA 1P9NA 1N6PA 3QJYA 1E2FA 2QQEA 2Y8EA 1NBME 4BE7B 1F6BA 1NSTA 4LY6A 4NPHA 1UEIA 3AEZA 4LYAA 2XZLA 2C04A 4TSFA 1IM2A 1LVGA 3QIAA 4XOIA 4D4MA 1GKUB 1XJ0A 3ZD6A 1YR8A 4IVRA 2ONKA 5EXXA 4LV5B 4YC7A 1YJ5A 2J0VA 4PANA 2PL3A 1N0VC 2QMHA 1UF9A 221PA 2QU8A 3Q5EA 4AD8A 1N2CE 1N6NA 5A0FA 1SHZA 4P4SA 4IXMA 1YQTA 4YXWD 2ZYUX 2Z5FA 1UBEA 4CEIA 4JMPA 2WMOB 2QTVB 2HXSA 2LWIA 2YJTD 5BYKA 3N70A 4IDNA 1CJTC 2FE4A 2ZJAA 4S2EA 1NF3A 3TQFA 3JZAA 1NG9A 4MYUA 3RYTC 1IBRA 1ZUIA 1S9DA 4Q66C 3Q9LA 2ERXA 3OIVA 4XH9B 5CM8B 5GJVC 1KNQA 1YZTA 2OBLA 1S3SA 1ZCAA 2ZU0C 4LC0A 3V9PA 3QEOA 1E2KA 2BHRA 3EIEA 4TT3A 5FBQB 4UXJA 2GVDC 5FBLB 2UZ3A 5CDFE 2JLYA 4X8HA 3MUFA 1P2UA 5HTKA 4A2QA 1VCMA 3QG1A 1FNMA 2NZJA 4C7OA 2GHIA 4ERNA 4JL6A 1SZPA 3AH8A 4PHTA 2CJWA 4PQRA 2O8EB 1XEXB 2W83A 2BM0A 1X8LA 3WMFA 1YKSA 4CEIB 1OXVA 1TF5A 5CYOA 1AZTA 2QSZA 3LNCA 4OBEA 5AK0A 2V6JA 4EPWA 1XU4A 3U6BA 1W44A 3AGPA 4KU4A 4U5XA 5CK5A 4EFLA 2G0NA 1OIWA 1BYIA 3CPJB 4Z51A 3KL4A 3WBJA 3KXLA 3A1WA 1G41A 2H7VA 1HT2E 1FX0B 3I72A 3NDPA 4HZIA 3ZZTA 2R6FA 2ERYA 4MDEA 2XOKA 3C14C 3WXMA 4YMVA 1Q44A 2OAQ1 4US1R 1VMAA 5D3QA 1GL7A 2QROA 4BGDA 4PSVA 1WB9A 2AR7A 3CBQA 1SVLA 4GOJA 1NKTA 1I2DA 3KKOA 3Q7QA 4ILEA 1IY0A 4B3BA 4LJAA 1Q1BA 3P4YA 1G1MA 1XTIA 3P32A 3LBHA 4TYWA 1DAFA 2W58A 4QJ4A 2A9KA 1CR2A 2R8RA 3L2OB 1Z47A 2FH5B 3QXSA 2XXAB 3X1ZA 3ADKA 3ZIAA 2IYLD 2AL7A 3THYA 3LVRE 3GJXC 2Z6VA 1OH5A 4AKEA 3TIFA 4TYNA 2JLVA 2GCPA 1G16A 2NGRA 5C4GB 4U7DA 2ZUCA 2ZYWX 3A4LA 1ZD1A 3PVSA 4LGMA 2WJYA 4Q4JA 4D2IA 5AR1A 3HPQA 4D0NA 2CVHA 521PA 1W47A 1KKLA 1ZYUA 4M21A 2AXPA 1I4LD 3EZFA 1MRSA 3HU2A 4GT1A 4HAWA 2ZQ5A 4WZAE 4DCNA 1U81A 2D2EA 2QAJA 4A6PA 4TTQA 4QBIA 5L3RA 1TTTA 2FFQA 4GRAA 4OQLA 3DKPA 2D62A 3L8YA 2ORWA 2W2TA 1OFTA 4HDCA 4A9AA 1QHIA 3SYNA 4HYYA 1TUIA 2VO1A 2WWXA 2J87A 4ASUA 1VG9B 1BH2A 2ZVQX 4F93B 5K8LA 1OW3B 5GJWC 3W8NA 4FIDA 1JB1A 5JHHB 1EX7A 4Z54A 4OI1A 1QHNA 2P0EA 4F92B 2WSSD 3CKLA 3GCGA 3I3SR 5JWOA 4KVGA 3EA5A 1NLFA 1E99A 1P60A 3THXA 3FKSD 2A3RA 4BFXA 4W7SA 4Q4JB 1DVRA 3ICQB 3K53A 3U4QA 1W48A 2JJ1D 1KI2A 1XMJA 5DHAA 1E9DA 4OHVA 4ZIRA 2B8WA 3SJAA 3EXAA 1YR7A 2DWOA 1ZW6A 1KZGB 2WAXA 3K9NA 2VHQA 1BS1A 3QENA 5HZHA 3W8RA 1WBBA 4JLMA 1KDOA 1R0YA 1KDPA 2XJ4A 1V43A 3BWDD 3KXKA 1ZUHA 1OXTA 4EKDA 5SZIA 3BRWD 4C0AC 1UDWA 1N5IA 2B7BA 3SJCA 3PEUA 3E2IA 3KUCA 3KKPA 1E1QD 1FL9A 2AKYA 3IPYA 3TSOA 1S9HA 1X3SA 2J0UA 4IJMA 3U7FB 1E0AA 3TVTA 4LBWA 1KJYA 1GIAA 3VX4A 2BMJA 1JNYA 1KDRA 2WTUA 1VYTA 3RRMA 1NP6A 4DHEA 1GNPA 4DLZA 1QHHB 3T35A 4F4IA 2CBZA 1T3LA 4CEHB 1G8FA 3PITA 3CLVA 2BV3A 4FINA 3RC8A 1IXZA 3GLHE 2QMUA 3LXXA 1LW7A 1OYWA 1R2QA 3MJRA 3AM1A 3PV0A 1M8PA 3QKTA 4GPTA 4A15A 1UM8A 4UJ5A 3JVVA 1ZU4A 1XFAA 5BN4A 1KO5A 3FTQA 4Q7LA 1EFCA 4HLQB 4TLDA 5CLQA 2O8FA 2BEKA 2EVWX 4LRWA 4MQBA 4OK5A 3TMKA 4POAA 1P2VA 5EE0A 5BWMA 5J4YA 4OQMA 3RHFA 3BIFA 3UWKA 3OEHD 3AP2A 2F6RA 2PJZA 3B2EA 5IK2D 3EC1A 4MA4A 1GG2A 2WBLC 3RS2A 2GF0A 2EWVA 3U2QA 5L3QA 3AKEA 2C96A 5CB8A 4CF7A 3PUVA 2ZUDA 4K46A
chains in the Genus database with same CATH superfamily
4JROA 4G0MA 4JX8A 2ATCA 4GOKA 5C4MA 5H9WA 2C7QA 1VCIA 1HQDA 3RS4A 2GN4A 1KZ9A 1MB2A 4D43A 1WUIS 1GVHA 4Q9LA 5JXHA 5L3SA 3S5UA 1W1WA 1B8PA 5EJ8A 4WEOA 4EY3A 2LNDA 2WDZA 1DIHA 2JEZA 4X94A 4N47A 3X1WA 3TIVA 1XCOA 1ZESA 1ZK0A 2WT8A 4YUXA 1NY6A 5JQGA 3E5RA 2F55A 5KOHB 3W9YA 5MN5A 5FPSA 1W35A 1TUBB 3OX4A 3UKJA 4MWDA 4KIFA 3LW8A 1GG9A 1X9HA 5ETJA 1OASA 3ROFA 4PFSA 3UB3A 2UYHA 1XSEA 2F9LA 3WC4A 3BRQA 3W4IA 3ZJYA 4MIKA 4BIMA 1G64A 1I3LA 1LLQA 3FDZA 3THRA 2CD9A 5COQA 2H2GA 3CF6R 4YRPA 4KFTA 1A1VA 3DO8A 3OEEA 2P2LA 4FC6A 4FCVA 1IEXA 2W2LA 3A4VA 3FHOA 3M2PA 2FY8A 5C32A 1T2NA 2RCNA 3G5AA 4BV3A 3RKUA 5H5JA 2EXXA 5ALRA 3WWCA 4QLBA 1TC2A 3ZE0B 2MSNA 1NAHA 3N0XA 3PWSA 4Q0MA 3JQDA 4RXTA 3TQQA 2QRHA 2SHKA 1SD2A 2A2ZA 2YIMA 4QU9A 5FOUA 4L8WB 3S2SA 5AH0A 1DZIA 4DLVA 3PQDA 4INJA 2FSSA 4MQMA 4ER3A 1KU6A 1R5BA 2AG5A 1TM4E 3CX4A 1OC2A 4F91B 1QKKA 1E4EA 4P4GA 3GJ0A 2C9OA 1TJNA 4UEJA 4BC0A 2AMVA 2COUA 3EB9A 2AFHE 3HMKA 2NU7A 1UXHA 5EJGA 3D7KA 1JEJA 2ZS8A 1CZOA 3KQWA 3VGJA 1KQNA 2IXFA 2YRFA 1PWXA 3NQ41 2I7DA 1OT3A 3BDVA 5TC4A 1GDTA 3TOZA 4BKPA 3DZBA 2JFZA 2JJ1A 4OQDA 1P7VA 4FBMA 4JUAA 3RHZA 1J8DA 3UWPA 4BNWA 4MICA 1VKNA 2QX9A 1I14A 1HT3A 1RACA 1ZXBA 2VKQA 3N2LA 4MVJG 4ACBA 4ZODA 3MLAA 5HFNA 1HTTA 1UODA 4QULA 3UJ3X 2PMEA 1YAJA 4U00A 3NAQA 3WWDA 4RZXA 4BGVA 2QPAA 3HBNA 2VHTA 1U6KA 4UHFA 1QX4A 4GLLA 3K31A 5KX5A 1KO8A 5DI3A 4F5YA 2F59A 3FSGD 2BP7A 2ZTUA 1N7IA 4PPGA 1ONOA 3BE6A 1R5OA 3EAQA 4RA6B 2XUIA 5H7XA 3FPKA 1V71A 3OT4A 4HQOA 2JLBA 1T2CA 2VHXA 1J0DA 4O2BA 2FPUA 3AP3A 3MGGA 5TF4A 3K92A 4URZR 5I48A 1OIVA 3TPZA 1QR6A 1XWFA 2E9SA 2C54A 2FGKA 4GPBA 3JPYA 2OZKA 3LHIA 1ACJA 1SK8A 2O0MA 4OUKX 1CJBA 4W1PA 2VOJA 4FFOA 1M83A 3R7DA 3W04A 5ITSA 4GNKA 4IJQA 2V4ZA 2B9VA 3ND7A 3KB2A 1XU9A 4QPCA 3BIXA 1TQDA 5ABPA 3VR6H 3F74A 2QJWA 1VKRA 2GHTA 4NV0A 2QUKA 5JRDS 3T61A 3ULKA 1HYEA 2GA9A 5DX0A 2Q99A 4Z9XA 3UB2A 3NDBB 1U2RA 3B1XA 3IBTA 3HGMA 4R98A 4JASB 2O06A 1G8YA 3RRJA 4BNHA 4ZZ0A 3R5JA 1UPBA 1FFXB 3BJIC 2XYGA 3U1TA 4DCSA 5SZHB 1OZFA 4XXHA 2PMKA 5KTOA 3UGTA 3R6TA 3NBZC 1NN0A 5JO0A 2D2FA 1F60A 1N6RA 3A4YA 1XLWA 3EVBA 3H1BA 3BZBA 1FSFA 1G8PA 3OEHA 1DHRA 4KPGA 1YV9A 4CN8A 2V1XA 2FA9A 1VHJA 4RAQA 1SKUA 1ZICA 3W90A 4ZOAA 2E6UX 1OY1A 1XEWY 3GARA 1FTQA 1JVSA 2EDCA 3WGZA 1W25A 3JYHA 1GU0A 1SZJG 4YS6A 1MR3F 2AWNA 4EHNA 4AZ3B 1N3IA 1H4SA 4OHWA 5DNCA 1SUEA 4DL9A 3IAEA 4N8EA 4QFBA 4MWOA 3D2LA 3LDFA 3WRYC 1YE3A 3G2OA 1NFRA 3LTEA 1W36B 2VH1A 4GBMA 2P41A 1ZGBA 3I5AA 2PUDA 3PRHA 4J0JA 5DGDA 1SIBE 5A9RA 3QHQA 2IJGX 1DEAA 1SQSA 3GVIA 1XR3A 3IAXA 4LVUA 3V1YA 4F12A 1P3DA 1ONPA 2GN9A 1T9KA 1X1TA 2WF9A 2G83A 1YCGA 1CWUA 1Y4DE 1OGYA 2YJ4A 2JAHA 2PVSA 3EY4A 2R8XA 2VH2A 4WL0A 1I4DD 3GIDA 3V8NA 5IFKA 3TW6A 1TZCA 5ALQA 4S12A 5JZVA 4IVPA 4QYSA 1XU7A 4YCCA 5A9SB 5KNDA 2YVAA 3D8BA 2XMBA 3T12A 3A06A 4OMUA 3WLTA 3GCZA 3KHSA 5AM4A 3WLRA 1TF7A 2BFFB 3O6VA 1C3VA 2NUTA 3OIYA 2AW5A 3IUEA 4WNAA 4YAWA 4ARBA 2JI6A 2JCXA 4MRMA 4F4FA 2CK3D 1XVVA 2R751 3T8YA 2B1QA 4JMLA 1JB9A 3KKZA 4HEHA 3GEHA 4QSMA 2X1MA 4G4SP 4ID3A 5JNTA 5CEJA 5CX1B 2Y2VA 3QPAA 1GAXA 1G0OA 2RH8A 4FMPA 1T0IA 2E0IA 3UKDA 3N75A 2XDYA 4QTUB 1KFCB 1U90A 2ZFUA 2PANA 3AB3A 1JQDA 3EZXA 1KI4A 3PC7A 4I8XA 1M1NA 4IIJF 4RZQA 3EQ8A 4R7TA 3PS9A 5CIWA 5EQFA 3CQ9A 5LMUB 4IR7A 3GLGB 3F5FA 4E33A 4UMEA 1HZZC 1G6HA 3K0CA 3MIZA 4WOJA 3LVQE 1X3LA 4YRGA 3FMIA 1RPZA 2RHTA 4D0RA 3QKRA 5SZJA 1MOZA 2GX6A 1CUIA 1UDBA 2CFRA 4UUQA 1U7WA 4TSFD 2ZUTA 5IT5A 4JSTA 3RYHA 6ABPA 4CF4A 3MJDA 4PBTA 2HIGA 5A04A 1QZ3A 2UAGA 4OXQA 2Z1NA 3SK0A 1P0PA 1J2JA 1SHUX 1H2XA 2XV1A 2G4LA 3Q40A 4FR0A 4L5BA 3MT7A 4PIMA 4TUYB 3BILA 3FFXA 1Z0KA 3RF7A 3R3VA 2G80A 3V4LA 2X5OA 3MA0A 2ACWA 5KYWB 4HAVA 5DEIA 3OCVA 1SCUA 3DZ8A 1XQYA 1ZIOA 2BSAA 4MW0A 1Y7PA 3QI7A 2IHTA 4RHXA 3UANA 3UMJA 5FLXA 2CEKA 4ZCLA 4DIOA 1YCFA 2DLCX 3GRUA 1D2EA 1QPGA 2ZRDA 1EX1A 1L9XA 3FBWA 1NJFA 1HL3A 1K6JA 2I62A 1P74A 4QUHA 5L40A 2WWRA 3V1MA 3V1KA 4CMIA 2A35A 1F7UA 4RKFA 1RLOA 2B1IA 1G5RA 2BKAA 2JIMA 4WKCA 2IE8A 4H6XA 4RV4A 3T52A 2X2FA 2XI4A 1EXNA 3B9QA 1BE8A 1M1NB 3ND5A 4UHEA 1Z6XA 3NJRA 4R83A 5TNXA 1J1UA 4HRAA 1UKZA 2BONA 2JCSA 3CJTA 4XWGA 3AVUA 4G5QA 4PAGA 1M34A 4A1OA 2V6GA 1P2TA 3GJ8A 3D6TB 2BBOA 1PZMA 3Q9NA 3WQQA 3N9IA 1JHVA 2A5YB 4FYPA 5DLEA 5TV2A 3EPJA 2ZTHA 3S28A 4QG3A 5HMLA 1KVUA 1P0MA 3AI7A 4X1YA 1GPBA 1ONNA 2VNSA 3IDFA 2B99A 4OJTA 5AVWA 2B2XA 2NO1A 4HS9A 1N6KA 2P9CA 2OHHA 3ESBA 5JAPA 2MSCB 5BT9A 4B4DA 4G8CA 1IIRA 2QRJA 2GXUA 2VJNA 1KTVA 3T1TA 5JD5A 3KX2A 2IK8A 3G2QA 2JBAB 4TXHA 1LS1A 2FPWA 4ZARA 4LJ7A 1W85A 4NMXB 3K0EA 4K6MA 2YWEA 4GL4A 4WUTA 3DAFA 4Y1RA 3T5TA 2QPTA 1KSHA 1HEUA 5FL3A 1N77A 1IZZA 3PEFA 4V02A 4B8WA 3L8CA 1SC9A 1V11A 3KVRA 3RK1A 2VWQA 4H6VA 4PO8A 2Q5HA 2DLNA 2VA9A 3B89A 4M1SA 5A1TA 4KODA 2LCIA 4DCJA 3B20A 1KYXA 4RDCA 1XXHE 4DQ0A 1WCYA 2F48A 1W4BA 2UZIR 4DJ5X 5CFMA 4L7QA 1MPTA 4YROA 2QT1A 9LDBA 1QMPA 5HE8A 3H2YA 1Z2NX 2VZLA 3R24A 1WUJS 1CNEA 1MOQA 1G63A 2C99A 2PA0A 2AUMA 1PFKA 2QU7A 2YW2A 2OBMA 2ZBGA 1EEXB 1YJ8A 2CYAA 3IQFA 4I08A 4MINA 5T4HA 3RIYA 2ID9A 5ALKA 5DT9A 3Q12A 1ULHA 1ES9A 4DJFC 2Q28A 2OFFA 3P5BA 2P6UA 3MGBA 1HTWA 1Q92A 5JARA 2FZGA 2OZVA 3DULA 2QN3A 1NOKA 4XQGA 2Q41A 2HOQA 2WSMA 1XBTA 4HDNB 1AIPA 5C1IA 1QR2A 4B6JA 4UTNA 4I3GA 1Y8ZA 1TIBA 1SOWA 3RC1A 2BMWA 3U60B 3D2AA 4D8VA 1BJRE 3GBSA 1YS2X 2B4YA 3USCS 1XCBA 4D4GA 3RABA 1OBHA 3GVPA 5FTKA 3K9FC 2QDKA 1O5OA 1OX4B 1QIDA 2LTAA 4LNUB 1JLMA 2PL1A 5CFRA 4YIHA 4UARA 2DBQA 3B1VA 2JCBA 1OLSB 1JXMA 1SCAA 3MMXA 1YC2A 3GGSA 2KBFA 2A9OA 2C3PA 4ZT4A 4FZ3A 4NBWA 4ZCMA 1GKKA 1QE0A 4F9FA 1XNJA 3QEBZ 3TXXA 1MFPA 2GBLC 2P1ZA 5EMJA 2ZJFA 1LGYA 4BL5A 1PLKA 2ROQA 4MPTA 1QQ7A 2GWHA 2O3RA 2W6IA 5JSKA 2CXQA 4NTZA 4TN5A 1H2HA 4CU2A 2QN8A 1IN1A 1XZCA 3WSTA 5IAEA 2PZAA 5EHXA 3BMNB 3BVPA 1WCIB 2DUWA 1ONSA 2FZEA 2WM9B 1TTQB 4OHKA 3A4MA 4Q1DA 4RVCA 4W6QA 1QK4A 4PX2A 5EWMA 3WNDA 1FNDA 2P78A 1OWOA 2V7UA 4P4NA 3MG9A 1SUFA 2VJAA 3QQPA 4H7KA 1J9EA 3JQBA 4LX0A 4M9UA 3TZHA 1CUBA 2ZT7A 1N2CA 1CB7A 1CXZA 3GOHA 5IKEA 1L1QA 2BLLA 5CB6A 1FBNA 1UP7A 3M6FA 1UEXC 3SS7X 2XUFA 2IPLA 4MEJA 1VJ1A 3ZOKA 2W2XA 4PQEA 1QUEA 4Y2VA 5ITZA 2NLOA 4PYJA 2VYNA 3Q1KA 3EXFB 1PV2A 3BXFA 4C6SA 2VXCA 4NNJA 2I6XA 4R9UC 4CE6A 4HUTA 1TVKB 3DB2A 5HKOA 2O8EA 4FX5A 2O8CB 4KYVA 3SHTA 3WL8A 1MAWA 2H0RA 2D3WA 4U1RA 4Y2UA 2CXXA 3GDOA 2IUTA 2ZK7A 5B1IA 1U8YA 3F46A 4B9EA 1P9LA 4TL7A 4RDHA 5IT0A 3OCXA 1X6VA 2OWDA 4ARAA 1RYYA 5BYJA 1ZR2A 1LJUA 2HX1A 4CTNA 2GD6A 3G7SA 3I2JA 2EHDA 1PNTA 5I7RA 5HSGA 5IDQA 2Q6IA 4FEYA 3V8EA 2XVAA 2DBRA 1PS8A 3MTJA 1GTMA 4YGYA 5C51B 1OFUX 3DEHA 3H05A 3AJ9A 5F9MA 3A1TA 2OOKA 4C5CA 1PYOA 3O26A 4Y6LA 1W59A 5LZ8A 4E2XA 2L82A 1JLHA 3OWOA 1P2FA 3UFXA 5FR1A 3ZCXA 2ZE8A 4ZQHA 1URPA 1QRTA 3IE2A 4H1UA 1LLDA 1N2CB 3HJGA 4WBSA 4KK4A 5EP2A 3QE3A 5DF1A 1OU0A 1XQWA 4PWYA 1Z7GA 3RRNA 1XZQA 3BIOA 3S0JA 4PM4A 1K6XA 3HR4A 4IMJB 4DPLA 3L0BA 3CRVA 4TMVA 1X2BA 2BSXA 1GNTA 2FI1A 4U2BA 1TM2A 2D0PB 1NI4A 3SOPA 2XXAA 5LBIA 5A4IS 3UK1A 3D8RA 3KEOA 1XX6A 3GGCA 4JJ6A 4ZZ2A 5GPBA 4E07A 3E05A 5TGTA 2J59A 2DBZA 3I04M 1ZQ9A 2XDAA 3RFUA 2IRWA 5AXDA 1RW4A 1VKJA 4BASA 2XB2A 3BERA 2FOLA 4UPDA 3HWX1 3STTA 3R0ZA 2C0PA 5ALXA 1PT5A 3K9CA 4S1TA 1J39A 3GU3A 3IIMA 4CM4A 4DJAA 1VIVA 4NPCA 4R9RA 2V03A 1IB0A 5G2OA 1ESNA 3AV0B 2FWRA 3GFOA 4B7AA 4DWVA 2WC1A 4I9HA 5LUBA 5KWJA 1DO0A 1K97A 2J9FB 5G0WA 2XCTB 1YGPA 3PQCA 2UYOA 5EYPA 2PT5A 3OJFA 3C8MA 3DM9B 2JB9A 1IUKA 1V3QE 2YOFA 4WZ6A 2IH5A 2R1ZA 3TSZA 3AFGA 4CN9A 4OMFG 4YRFA 1OXKB 4MV1A 4R3WA 4AAYA 1Z8FA 3DE4X 2QS9A 5ULLA 3SYKA 1GRCA 1I36A 1PBNA 2DCMA 2WJ4A 4XFDA 1WW3A 1VG0B 1YQGA 3LPCA 4L3VA 5DMHA 2GBFA 1FE8A 3ZWAA 4BB0A 2JGMA 1AQYA 1FLDA 1YQWA 2QTMA 3NBKA 4C4OA 1FSZA 2P5UA 2O2JA 1Y34E 4Y6RA 1IQPA 4MWSA 4NCXA 4JL5A 2BM9A 3QIVA 3QYJA 4EA8A 2CT8A 2GPTA 3WTCA 3OKPA 2M1ZA 4EHKA 2B7LA 4MWTA 1P39A 2ZRQA 3ZE8A 1FC0A 5IM5A 3I64A 1CUCA 1E61A 1SPBS 1WA5A 2CFCA 2FQQA 4JSRA 1VRCA 2BFBB 4TPKA 2Z4TA 3FPCA 2IX9A 4WKBA 4DDWA 2FUCA 4QKQA 3OIUA 4BFZA 2CDCA 1F8YA 4YFVA 3OU2A 4FHZA 3RAEC 3IB6A 3M82A 4F9TA 2QPOA 4CT0A 1ZK1A 4A16A 1KETA 2A57A 4F8JA 4FD2A 4B3FX 2QVZX 5CDUA 3D8SA 1EUDA 3BBLA 4WZAA 5GM2A 3ZKAA 5ADVA 4PU0A 5BV7A 4RYLA 1X7ZB 2F8LA 3ACBA 1YRAA 3HCOA 4B8ZA 4HRXA 1EGQA 2Y1DA 3O5AA 2C2XA 4X20A 4A8JB 1IMOA 3FLEA 3JQ6A 1ENOA 1E1CA 1WQ1R 3R0XA 4GLBA 3EJ6A 2VHZA 5CRIA 2B5WA 4IMPA 3X1MA 5LQNA 1Z22A 4UAVA 4BPBA 2VT3A 3AU9A 1WQ4A 1XMIA 2WZBA 4CMEC 3CEAA 2C92A 1O9BA 2W93A 1F0NA 2ZS9A 2CHGA 3MHPA 5HFJA 3V55A 5CFLA 1MU0A 2JIQA 3TQOA 5KAMA 2IYUA 5FYQA 3T5GA 2QP4A 3DQZA 2BE7A 2M2IA 1ZINA 3LNTA 5SZKB 2WYWA 4PYOA 4Y6OA 3EUWA 5FH9A 1CF4A 2AKEA 5FUMA 2VJQA 4QPDA 3LYHA 4BHTA 4PXAA 3TBFA 2GETA 4BPRA 4CEJA 1K9SA 2DFLA 2C2KA 3WGJA 1XQ9A 1BDIA 2V0NA 1PV1A 2P3QA 3F8SA 3L6DA 3MILA 4PYNA 4QYIA 2GJKA 5IC6A 1QYRA 3LDAA 4B47A 4BNTA 4C4RA 2BI7A 1RS0A 1U1IA 2CB9A 3OSUA 3V7NA 4QDTA 3ZVLA 3KQHA 1CP2A 3PD7A 3PFNA 4L76A 2GEFA 1T3GA 4TQ9A 2J3LA 5BURA 5DTEA 4BO3A 2B1JA 4DS3A 5JPDA 1QYCA 3UBTA 2Y1EA 4XIGS 1Z7WA 1DB3A 3BZUA 1PZNA 4JKIA 3U81A 3M1AA 1FTNA 2O2SA 4XWAA 1YR2A 4ZJZA 5GZ3A 2PUBA 1E6LA 1AU9A 2FPKA 4XUEA 2HFKA 2BGWA 1WCV1 2YUIA 1MVLA 5T6MA 3RNLA 4F4HA 2LIVA 1Z4NA 1RP7A 3LU1A 4QYTA 5DM2A 5GQSA 4JIMA 3FYTA 5BV2P 2ZJ4A 3QUTA 3OOHA 1KXZA 1UJCA 1OXSC 2EV9A 3KZ1E 4H7IA 3AUXA 1AC5A 3ZE6A 5JJ5A 3W77A 4LFCB 4IPTA 2AOUB 3DLIA 3ZDCA 1MJFA 4A36A 1AQUA 2JZNA 4KXUA 4DC0A 3G9QA 1RM4A 4WXRA 4YRQA 4DLTA 3I61A 1Y5MA 1ESMA 3VR4D 5EPEA 3AF3A 4KCGA 4LQLA 3T99A 5CH8A 3SC3A 4XGQA 3F5SA 5IJXA 1P77A 2FUG6 1JXAA 1U4OA 1Z6GA 1Z16A 2XGGA 4X7BA 5HEKA 4ARUA 2AJBA 4C7JA 2V5AA 3MPOA 3MTGA 1C8KA 2FUKA 3GAAA 3QOXA 4DOMA 1Z0FA 2JW5A 1GZ7A 2ZBPA 1DX6A 1WOYA 1MKYA 3QEJA 4HFNA 5LC1A 4YAJA 4DUGA 2WZCA 4EKIA 3JRXA 4DW8A 1FUKA 1NVXQ 3STYA 1WMBA 3UJ6A 1YQ9A 1NMYA 4R2KA 1KI6B 1M9NA 3PE6A 4MARA 3T5DA 3OM1A 4OA8A 1AXEA 4MCHA 4IGEA 3WLFA 2E1RA 4XEHA 2W6OA 1YZQA 1AY0A 5TT0A 3DE2X 3F96A 3VR3A 2A4MA 1CIJA 4MGIR 1AQIA 2EC5A 2X0FA 2I8AA 3I0ZA 1F7VA 2WZDA 3VU9B 2BUAA 1QQBA 2XDQB 1B76A 2XSZD 3UMMA 1QFZA 3S8YA 4QRDA 5KU7A 2I7TA 3OPNA 1U1DA 3DF9A 4LPKA 2R62A 1KI1A 3NHPA 3D6FA 3BK2A 2BKLA 1M2OB 3U3DA 1D2RA 4EG7A 3EZLA 3CUKA 4IIVA 1LUAA 2FEKA 3CX3A 1AN0A 3FJ1A 3CUTA 1SWWA 3FJYA 2JGFA 2OP0A 2IHBA 4K1LA 3EFHA 1BOFA 3MWDA 3GYGA 2IIBA 2P7IA 1PQYA 1Y4UA 5EJIA 1EHCA 2FPIB 4OFZA 1H93A 2DPXA 3B7WA 5JH7B 2A5DA 3NPAA 2XWQA 2UDPA 3ZWDA 1RKUA 1VSBA 2DKNA 2B78A 5GONF 2XA2A 4FFBA 4LMPA 1Z6AA 3N5CA 4J3NA 1GLNA 1MJ5A 1JSZA 1QH9A 4JJKA 4MSUA 3D9QX 3TI9A 3HKEA 4ZYLA 3VNRA 1RXYA 2A7QA 3NH9A 2QX6A 2ZIGA 1PK7A 5DLPA 3SZGA 4TMWA 3QV2A 2CFSA 1OLUB 1NATA 3C8DA 1TYZA 4YACA 2BPOA 4YCDA 4DGQA 2VUTA 4NBUA 2VWPA 4OHBA 5IX8A 3HN2A 1JJIA 5CBPB 4XIFA 1DUVG 3KXIA 1DC8A 5D7NA 2JFOA 4P82A 3T0IA 2LP4Y 2Z58A 4CLOA 2VYCA 4V03A 2VDMB 5KHOC 5D5HA 2GARA 3BFPA 5HHTA 1Z75A 2D5AA 5F2KA 5CJ2A 1X92A 1ZSNA 4IIJA 3SF8A 3MPUA 3M6AA 4M53A 1OFGA 2XYPA 3JW8A 3R3UA 3EIXA 3IEMA 3K70D 2HK7A 2BLNA 1JHYA 2EF0A 4YLEA 5KYXB 3CUWA 5MF6A 3OPQA 4GZ6A 4PPNA 3WO1A 2QGFA 1KEKA 2FWPA 2OA0A 4A5SA 1BS2A 4C0BA 1LC0A 3F3YA 1YIAA 2ZM6B 1QP7A 3FE2A 2VYQA 1RJ9A 2IF2A 2CLKB 4EUHA 3PNLA 4HNVA 1KH1A 1NVVR 2Y4OA 5K3DA 4JLSA 4BO1A 1ZO8A 2IGBA 4YCBA 3VSBA 1XDZA 3B8EA 2O8DB 1YRLA 2GLUA 3GMSA 5HOEA 3GP3A 1NI5A 2WHQA 2WQ7A 2QM7A 3BKXA 4V0NA 1DKPA 1U99A 2AE2A 1MRNA 1E7QA 4QHSA 4MQFB 4D46A 1E3JA 4Q18A 4PCVA 5AK6A 1UOEA 4YT4A 1CUZA 3B6IA 3D6JA 4LV8B 3MB8A 1YIDA 2VHVA 3IRVA 3PXCX 1SNYA 4MWZA 4CQLA 2VP6A 1QBKC 2JDID 3CF2A 4MS3B 4IV8A 4PLTA 2R6DA 1QFXA 3P5SA 3SBEA 5AW2A 3ZY3A 4XVCA 4K9OA 1VYVA 5JAMA 4URUR 4I1YA 2I22A 1SXGA 3UMGA 3QM1A 4CKWB 1REQA 4HV4A 1Y3BE 3NI2A 4HWOA 5DHQA 3SF8B 4EHHA 3U80A 5DWQA 4BEWA 1NQXA 1T0BA 3T3IA 3A1UA 3WNQA 3WWYA 3WKDA 1U3UA 2QGNA 4PQYA 3REFA 3DWGA 3V2UA 5C37A 4E15A 4MQ4A 2A9QA 3U4HA 3AVOA 2W4QA 3AESA 4D7AA 1A8IA 3VU3A 3O8QA 4YAKA 3Q7SA 5E38A 3I9LA 5CB4B 3IQWA 1MV5A 1PUIA 1DAGA 2QDXA 4QQFA 4RYDA 2YIJA 4YAGA 3LQQA 2XXJA 4XARA 4YJ2F 1RT9A 5K8JB 2XMQA 1Y0BA 4JL8A 2VF5X 1WD7A 5DE3A 1E3IA 3TGWA 3OQIA 4H7FA 3ORYA 1AN9A 4WKGA 1T8RA 3JQGA 3OLVA 1BEUB 4NC9A 2R8OA 4LTDA 3DVAA 3VR6A 3WGMA 4EGQA 1U04A 1ZD8A 3NIWA 4QU5A 4YI5A 3R5FA 4DA8A 1AKYA 5ED0A 1A7JA 3QBVA 2VBCA 5EHZA 2O19A 1OYOA 1R6DA 2DQSA 1H6BA 5BSRA 2C9DA 3A6EA 3EXG1 3P2KA 3VO1A 3VR4H 1IY9A 1XQVA 2J7KA 3ZU3A 4C7VA 5KI6A 5HXAA 4CQNA 4E31A 4X1IB 2BI8A 4HQ6A 3M4NA 1OX5A 2OO5C 4PLPA 1LI5A 2FMXA 4BE4A 4LCEA 1S6YA 4J0IA 2J3JA 2TYSB 4DR4B 2H57A 1W0JA 5K3BA 4DEXA 3T7SA 1NBEA 3M5WA 2NV2B 5EMMA 2BMEA 3ZHSA 4CNBA 4YR7A 2B37A 2AHOA 2AMJA 3EEQA 3HBMA 1SIOA 5B3JA 3TZQA 2ZCJA 1R10A 1KGSA 4XGNA 2LKCA 4RL4A 3WLHA 1DQPA 3C7CB 4XYBA 5D6NA 3VTFA 4AWXA 3VXKA 2PZJA 4BWVA 2Q3BA 2FZ4A 2LZ0A 2W11A 4KFRA 4AZ0B 1TQ2A 2B8NA 4D9HA 3MN1A 2GK7A 3AR8A 1RKXA 2PS9A 2FPGA 1PZEA 4LJRA 1CYEA 4N39A 4UEOA 1KH2A 2QG9A 1QIFA 3VKGA 4ETNA 4JVLA 1TM7E 3DMYA 4IRMA 5H68A 4DPKA 3JQGB 1M74A 5D01A 4ARVA 5HR5A 1PUJA 2AS0A 3IVAA 4UUPA 1YF3A 4PTYA 1KPHA 1PJ8A 3AKCA 4RENA 2Q4BA 1GN9A 5CUQA 3PG5A 4NK5A 2V3VA 4J0CA 4Y6PA 4C06A 2C31A 1SPXA 3HP1A 3RIHA 2C4VA 3LWNA 3OE7A 5A7FA 4NE2A 3DKRA 1ID1A 3F2VA 1GSAA 4GW3A 3KUXA 3SQDA 3M6WA 3ZVNA 5I8PA 4ZPJA 1C9JA 4LGCA 4EATA 1IJBA 3PWKA 2ZETA 1E4YA 1VBMA 2BCJQ 1AKVA 2C3MA 3HV2A 2N0SA 2QQFA 3HI6A 4JT4A 4EPTA 4MGHA 2FX3A 2AXQA 5A3VA 3SHFA 2FK7A 2O7QA 3MTDA 1ZM7A 4LV6A 1FXSA 4UBLA 4CDRA 3LT0A 4BQOA 4RORA 1MLDA 3NP7A 4JYMA 1ECGA 4AULA 3MOGA 1T4BA 5H81A 4PICA 1XJWA 4JEMA 5LWHA 4YJGB 4NZYA 4HXGA 4K6GA 2VLIA 4G09A 1SO8A 1FFEA 1PF7E 3FNBA 4BO0A 2FZVA 2W43A 1YR9A 2WNIA 3L77A 4FE7A 3H97A 3WNVA 2Z6AA 4RV9A 4GWKA 1YZUA 1KY4A 1WHTA 4QBGB 4URWR 3ZOZA 4RVNA 3CZAA 3MMSA 3NUQA 2CNBA 3DE3X 1KAQA 2PWZA 1I51A 3KBOA 4AZWA 4W9MC 1CDOA 2HHAA 2GAIA 2PVPA 3HCPA 1NIJA 3LUHA 3VGPA 4BP8A 4DIFA 3CWZA 4PC7A 2BELA 4ZT7A 1NQWA 1BVYF 1JHAA 4HVAA 4HNUA 3SJBA 5DRYA 4BFLA 5KREA 2WUEA 2VLBA 4JQYA 1WP4A 3T34A 4BYMA 2TMDA 1ISRA 2HLDD 4J1TC 1FFWA 1KZ6A 3GEMA 1E92A 1P91A 4LYJA 3FNQA 2IZ7A 1DX4A 3AVQA 1SUCA 4FSXA 3NYWA 3TSCA 3BHIA 3F8WA 1J8VA 3V00A 3B3AA 2GKSA 4KTTE 1SVOA 4F2GA 4F3YA 3ISJA 1U2GC 1KI9A 4UQPA 3FZQA 3HFSA 1YRYE 2X0RA 1UWLA 4H7PA 4HLDA 3ZE1B 1J49A 3WOHA 4N3NA 2VUUA 2Z56A 4F4UA 3TXAA 3VA7A 1UT6A 2PS0A 1IRIA 1WV1A 3GG9A 5H70A 3SXJA 4AS2A 2X9LA 1NLYA 1I13A 2PV7A 5HS4A 2H8KA 2XZDA 3KU4A 5HIIA 5L3VA 1KWGA 1QJCA 2BGLA 2NQTA 2OD9A 2VS1A 3WL3A 1WETA 4BQSA 1RCUA 2OBBA 2ZSIA 4WFQA 2WEKA 1U7PA 4O4LA 4Q3BA 4RHTA 4YI3A 3WRXC 5A3JA 4HFMA 2PUCA 1M7BA 1Y63A 2ZTSA 1C7QA 2R7KA 3CV3A 4RPHA 4IHJB 4BFCA 5HFAA 1DJQA 1WDMA 2OV3A 4Z8XA 3RRXA 3JTEA 4E2WA 5KQSA 3AY6A 4PO1A 1WMEA 3N2GA 4RJJA 4G9EA 4RF4A 2FPXA 4M38A 3TLKA 2JIBA 1IDN1 1XDGA 2O4CA 4UD2A 5FULA 3N3BC 1B8OA 4EEXA 4NHEA 2CJYA 3W5JA 3PUZA 1QHXA 1OIXA 3AFNA 1YOVB 2PGNA 4OIMA 4Q7MB 5BMVF 3K70C 3PJDA 4OU4A 5PGMA 3T4UA 3I01A 5AKKA 3I3OA 3ZZ0A 1R16A 1ULAA 2R68A 3PX2A 4EB0A 3RG2A 2Q6LA 2AA3A 3AGQA 1WIWA 4OKNA 5MN6A 3ID6C 4UBOA 4ZYTA 1GFWA 4HB0A 1THMA 3AINA 2WTEA 4UVIA 4Z7JA 1YBAA 4X6XA 1GPWB 3B9BA 1LEHA 3NIDB 4R1OA 1YVDA 3VAZA 2H4HA 3QU7A 1YULA 2ZYGA 3CLSD 1X7HA 1X74A 4HOYA 5K3EA 2H7YA 3NUZA 5AUQA 5I7VA 4ARZA 1Z35A 1U3TA 1NIPA 2NU9B 4QXOA 1HDYA 1T2AA 4O4LB 5T3UA 3UWDA 4D6YA 2QTAA 2X0IA 1O5TA 1NR5A 2GHRA 3H6KA 3P26A 1SQGA 3R4VA 2OBXA 1DEHA 4WAUA 1TAGA 2X1HA 1CUAA 3GFRA 5EIAA 1G20A 2WE7A 1HXHA 3C8UA 4L28A 3UQYS 1NBOA 1XRJA 2WVGA 2Z2XA 4WINA 5BVHB 2XNDD 3P97A 4JU8A 1C7FA 4UD6A 3TFWA 2C88A 2V7QA 4CL8A 5B6IA 3C4VA 1B8UA 2VTEA 4HUQA 3LUDA 4AY2A 2WIAA 4NY1A 5GOTA 5C31A 1NW7A 2W6NA 4LXYA 4QM7A 1IFXA 4FBGA 4EHDA 3OBBA 2YV1A 4IZOA 1ZJWA 2NP6A 1L7OA 1I1NA 1L7PA 5TPZA 3LLSA 3AL3A 5IF3A 1KAHA 3NANA 3LX8A 3DS8A 3VVMA 1OZHA 3TBHA 2VP5A 3GQBA 3ZXIA 4DR7B 4OHRA 1WZNA 1J70A 1WVIA 1G2PA 1MQ8B 3F3SA 5BV1A 8MHTA 1H22A 2Q9BA 2YWJA 2QI9C 2FUG1 4UHHA 1TAUA 3KQUA 2FKAA 4M83A 1ZRMA 3WIBA 3R4CA 8GPBA 1R0RE 3AR9A 4AJ4A 4QYWA 4G56A 4EMUA 3VZSA 5FJIA 3LH5A 1IWPB 1BWRA 4HQNA 2PGAA 4YEDA 5FPPA 4YYEA 1UBSB 2C58A 3LBFA 4GX0A 1MG5A 1RXUA 3DDUA 4P3OA 3TF5A 1SUDA 3I9FA 1PFUA 1EYZA 5DDIP 1F38A 4JYZA 3QUSA 2J7PA 3AKYA 2I67A 3VISA 2G82A 1Y9EA 2CLSA 4O3FA 1GU1A 3R44A 5AVKA 1I1OA 3ZZ1A 4YTEA 4M1WA 2V6MA 4UU7A 4YCJA 4GRIA 2NQ8A 4JJ4A 4YMIA 4UZFA 1YL7A 1C1XB 2BKEA 3PX3A 4N0MA 1WV0A 1K7EB 3GNQA 4PR3A 3W2EA 3D4OA 3CB2A 2VF2A 1ACMA 2ODBA 3TNLA 5C8ZA 3N7UA 1Y4ZA 1II8B 2G6BA 4OJYA 2D5LA 4NH0A 3JCZA 4DM7A 5JZ9A 2BSQA 4K28A 4FEEA 2W6ZA 1HV8A 1EKXA 4GVLA 4IGKA 1TE2A 2QXYA 1LSSA 4I9NA 2J07A 4CKBB 3WLMA 1DS6A 1KYYA 2WUVA 4EUNA 3ZHVA 5IKMA 4Y1FA 4B6RA 4KAAA 4YLYA 3K1YA 5L8VA 3U7IA 3ECSA 1FNNA 4X0EA 1A50B 4B3IA 3W34A 1ORRA 5LDGA 2N1BA 1G3UA 5KSPA 3DXFA 3D3JA 3LOUA 4KQFA 2A30A 4LK3A 4R05A 1EM8A 3ZBUA 2PIAA 5CFNA 3T3PB 1S8FA 3R9KA 1QCYA 2Q3MA 4WXYB 3W8FA 2ZYIA 2ONYA 3DHNA 5L6MB 2HUNA 4PBRA 4XKJA 5KYTA 2YWRA 5ALPA 5IXYA 1XQ6A 3SD7A 5JANA 3BXXA 1CCWA 4WESB 3QYFA 3AKZA 1RE1A 4X9XA 2WG1A 1XAHA 2HHLA 5JVDB 5BSEA 4N65A 4FNAA 1XG5A 1WF3A 2ZM5A 5C8DA 5K6TA 4W8GA 2A9FA 3GMTA 4MYDA 3QHPA 3BMQA 4KXNA 3T3GA 4JLDA 4DZTA 4WECA 3I5XA 5B3LA 2ORVA 3KSDO 1MENA 1UCFA 4IOMA 1MJGA 1H4TA 2I65A 3GPCA 1A88A 1HBJA 2ZRLA 3HUTA 4LNHA 1GRNA 1OYYA 2YC2C 4BUJA 2Z83A 1TK3A 1RQGA 2OZLB 2I2FA 4IJVA 4OM8A 2VTBA 1OHHD 2J0EA 4ATNA 4R8SA 5K0ZA 4B32A 4QUAA 1OROA 3VR2D 3QELB 1SCIA 2OZEA 4MRPA 1X7YA 1HLPA 4TOIA 3ZV6A 4QHTA 2VUHB 1E1RD 1E0SA 4YH1A 4CTOA 3R0IA 1S1CA 4ZO4A 5KYGA 3PEWA 2AFIB 1ADJA 3N1UA 2BFCB 4KAJA 1O6CA 1M0SA 3UK0A 2A9JA 4XSGA 3WK5A 4LTNA 2GCEA 3ESCA 3H1GA 1DAHA 1X1SA 3OPYI 1R12A 2WUFA 3F78A 2IT1A 4ON9A 2CD7A 1DO2A 4ZI7B 3OT1A 2OUKA 1IK4A 3E4CA 1YT5A 3G2JA 2CBXA 4XB1A 1QF6A 1ZOPA 3I6MA 2Z8YA 1U3CA 2X4GA 5DTMA 3TR5A 3RYCB 1ZX1A 2RGYA 4OH1A 4EB8A 3M5PA 1RDFA 1WXQA 4KR6A 1WDTA 4ALIA 3VO9A 1HKHA 3H4MA 3MCZA 4HN4B 4IY1A 1KEWA 1OAOA 2EGHA 1H85A 3U5ZB 4DKJA 1S2MA 4HAIA 2FN7A 2HSZA 4QPNA 3VRHA 4IOKA 2VRBA 3KDAA 2CNWA 3COWA 3N2NA 1DQRA 3OTHA 3H0CA 3HUUA 3LHDA 4XX1A 3P20A 5CAEA 2PKRA 3ES9A 3KTDA 1N3LA 1XVAA 3A4TA