3D8HA

Crystal structure of phosphoglycerate mutase from cryptosporidium parvum, cgd7_4270
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
229
structure length
229
Chain Sequence
TYKLTLIRHGESEWNKENRFTGWTDVSLSEQGVSEAIEAGRMLLEKGFKFDVVYTSVLKRAIMTTWTVLKELGNINCPIINHWRLNERHYGALQGLNKSETASKFGEDQVKIWRRSFDVPPPVLEKSDPRWPGNELIYKGICPSCLPTTECLKDTVERVKPYFEDVIAPSIMSGKSVLVSAHGNSLRALLYLLEGMTPEQILEVNIPTACPLVLELDDYLKVTKKYYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of a new phosphatase from Plasmodium.
pubmed doi rcsb
molecule keywords Glycolytic phosphoglycerate mutase
source organism Cryptosporidium parvum
molecule tags Isomerase
total genus 77
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3d8hA00
2P2YA 1UJBA 3F3KA 3K4QA 2DWPA 3DCYA 3GP3A 3R7AA 2YN0A 5AK0A 2BIFA 4D4LA 2HIAA 1SKAA 2P77A 3D6AA 1YJXA 3BIFA 4AROA 1FZTA 1H2FA 3LL4A 3IT1A 4ARUA 3E9DA 1V7QA 2A6PA 4ARVA 2I1VB 3C7TA 3IT3A 1TIPA 3EZNA 1E59A 3QPWA 5AJZA 1T8PA 1ND6A 1SKBA 4PZ9A 1YFKA 1BQ3A 5CDHA 4FDTA 1C7ZA 3FDZA 3GP5A 2ENUA 1DKOA 4FDUA 4GPZA 2P75A 5AJWA 1C80A 5AJVB 3LNTA 4D4JA 1EBBA 3D4IA 2RFLA 4PGMA 3IT0A 4HBZA 2H52A 1DKLA 3E9EA 4ARSA 1H2EA 2P9FA 2IKQA 3MXOA 3NTLA 1QHFA 1C81A 2A9JA 1RPTA 4JODA 1DKMA 2EOAA 1V37A 2WU0A 4JOCA 1RPAA 2H0QA 3NFYA 3ZHCA 2DWOA 2H4ZA 3EOZA 2P30A 3K4PA 4ODIA 3D8HA 4EO9A 2WNHA 5CX4A 2EKBA 1FBTA 5AJXA 1ND5A 2P6OA 3PGMA 5HTKA 5PGMA 1BIFA 1CVIA 1SK8A 4D4MA 2YN2A 2P6MA 2HHJA 3QPVA 2F90A 1RIIA 2P9ZA 3GW8A 1DKPA 1QFXA 2WNIA 3DB1A 1DKQA 1NT4A 2OWDA 4QIHA 1K6MA 1IHPA 3FJYA 2P2ZA 2H4XA 1DKNA 1SK9A 3OI7A 1XQ9A 4JOBA 4IJ5A 2P78A 2P9YA 4TSRA 3QPUA 5CU7A 2GFIA 2EKZA 3F2IA 4PZAA 3KKKA 2ENWA 1UJCA 3IT2A 4IJ6A 2AXNA 1BQ4A 5HR5A 4MA4A 3E9CA 3FDZB 4GPIB 3O0TA 3LG2A 4E3WA 3HJGA 2PA0A 1QWOA 1E58A 3MBKA 4EMBA 2QNIA 5AJYA 4D4KA 2OWEA 2HPAA 2P79A
chains in the Genus database with same CATH superfamily
3H2HA 3ETGA 1OTHA 2NV0A 4P54A 3SBEA 1C9NA 1E4VA 2I2BA 2AB0A 2PWYA 2QD5A 2ZRNA 1CIJA 2R6GA 1Z9BA 4ENVA 4C7XA 3KQQA 4ARIA 2SKEA 2QOEA 4S3MA 1T9HA 1I4OA 3CLVA 3NX4A 4HCJA 1VQ1A 4NNJA 4JT2A 4X97A 2CF6A 2QKYA 3E0QA 2PS9A 2QSJA 4FDLA 3W1WA 4Z7JA 3QVWA 4QTZA 1PSDA 1MC8A 1ISIA 1WXDA 3N75A 4AF6A 2FQWA 4AY4A 2I87A 1U6IA 2JA1A 2VP5A 5TJ9A 4LRUA 5KX5A 3MBOA 4A2QA 4YN3A 3EPRA 2F4VB 4Y6GB 5BSHA 3V7UA 5JANA 5JAOA 1E9CA 4IY1A 4HATA 3VR0A 4ASUD 1EA5A 4AP6A 1D0IA 2QL5A 4E11A 1DKOA 4BGEA 5JCJD 1P9WA 4LYEA 3U5TA 2B3TA 2PD4A 1QIMA 3OZGA 1DVRA 3HB5X 1EE9A 1UADA 4NU6A 3UAOA 5KQMA 5IK2A 2G1UA 4ZFNA 3RQSA 5ES3A 2H29A 4C21A 2ZI4A 4RCZA 1HDXA 3K31A 1YR7A 1PVVA 2BKEA 2ZTVA 4UDYX 3PPIA 4GSYA 1B7GO 4NZ9A 4WSOA 5IFKA 3KLNA 1VOTA 5K3SA 2X5JO 3P4YA 1DZ3A 1YC5A 4N82A 3D7MA 3U4DA 3UBTA 3AKDA 1N0UA 1U0TA 1UCFA 5CB6A 5CEJA 4UE3S 5BY2A 3IKMB 4NCHA 5HNKA 1YRLA 4G41A 1ZD1A 1W581 4LV5B 1RLTA 3UGTA 1CB0A 5F21A 4W82A 1XRSB 5C34B 5CFOA 3FOAA 2HUPA 2PDAA 4AG3A 2ZRDA 2IBSA 3FSEA 1Z5UA 2AJ8A 2I76A 1SRQA 2V3VA 3K0CC 1R6TA 1JLHA 1ZL2A 3QY9A 1ESZA 4EVIA 1TVCA 4X9XA 4I4LA 4JJFA 2CLMB 1O1YA 1FFXB 3GFQA 4QDXA 1T2FA 3GIDA 2E5WA 2GAAA 5FL7A 3NDIA 1VI6A 1EVYA 1DXOA 2PO5A 4GYJA 3O3MB 4BNFA 4MEBA 1SBYA 1W36D 4JLKA 4LXHA 5G1NA 5EXPA 3NM4A 4U2KA 5IBRA 5CW2A 3NVMB 1OVGA 2O5CA 4FOLA 1NHGA 3LSYA 3R5JA 4UM5A 5A3QA 2O57A 1XKTA 3ER6A 3IS3A 1W96A 3AGPA 5DW3A 4PVDA 4BKOA 3FVWA 1DELA 3X1JA 1XCLA 2MSDB 3ZVMA 4V0OA 2MIIA 2PXCA 4CBVA 5HHTA 4MPRA 2YVUA 3I2IA 1IBCA 4Q3BA 3ZHYA 2G1AA 2Y1LA 1MO5A 3TLGB 3FMVA 2VRBA 4IMIB 4IXMA 3L7IA 1OHHD 1SCUB 2QG6A 2AN4A 1KERA 4GP6A 2Y1WA 4LQLA 4ZC8A 3TZ6A 4UXJA 2I7CA 5BT8A 2BKVA 1BQ4A 2AW5A 1BW9A 1YE5A 2BKXA 2ZLBA 3A9SA 3FKJA 3LUBA 4YCDA 5DASA 2FPPA 3TSCA 4DKXA 4ESEA 2BTEA 1IY8A 4RWZA 1N6HA 4OO3A 3BPSA 4N39A 4QRHA 4OYYA 2BEJA 4GXNA 4RJLA 2PUAA 1I80A 1L2TA 3IHTA 5JASA 1LU9A 1GITA 1TRKA 1BH2A 4LF6B 1S6YA 1U7XA 2ONYA 3BGWA 2UUPA 3BRCA 3QFSA 2DC1A 3B1KA 4J07A 4CVNA 3ID6C 1XZIA 2GLXA 1CTQA 2QTCA 3FG9A 3KQUA 2CMFA 1G7CA 2QT1A 5KPDA 2VVTA 1VLLA 4RLHA 2I66A 3EY9A 4ZC1A 3HZHA 4G01B 2FSHA 4HHEA 4QVGA 4WBNA 4UPEA 3AVYA 4P0TA 4X6UA 3TFOA 4C3ZA 3UJNA 4DLWA 2DXIA 1J7JA 2B7BA 3SLRA 1I24A 4GL2A 2QJRA 1EBUA 2VL7A 1Z13A 1ECBA 2OV4A 1D5WA 4EG6A 4RA9A 1JLLB 1VJDA 2AXQA 4UCWA 1KR5A 2XRYA 2CNOA 2YQZA 3D64A 2I4LA 3DF7A 1LV7A 4JIMA 2UVQA 3FDZA 2IPOA 4FOPA 3QQ5A 3VHXA 3G7SA 3C7CB 4EM6A 3IXLA 1QPZA 1BCRA 1K3FA 5BR1A 4FN5A 1MRNA 5DHQA 5DOZA 3TUIC 2Q6OA 2XHZA 3FR8A 2WJVA 3R3VA 3SHTA 1B0UA 4C5CA 2Y2UA 2OZLA 2YVAA 4I4TA 1DKLA 2I8LA 1W93A 3IAXA 3IDSA 3M7IA 3NBMA 4KI7A 4WERA 3K53A 5E9QA 4MA0A 4MQBA 4YP7A 1Z4MA 2ETXA 2A9JA 3OZCA 2ZKIA 5UKDA 1TUGA 1A8PA 2NU9B 4WXYB 1UPUA 2NO1A 3ZK7A 4PNZA 1N2HA 2VP4A 1XA3A 2I2XB 1HO3A 4DBLE 2FP4B 1HZJA 2Z1DA 2ZTHA 1NMSA 4OQQA 4NV3A 1Z88A 1A4UA 2AFRA 4GX2A 4ZVMA 1CWUA 1X87A 4V1CB 2X0JA 4XIFA 5EFZA 4JXKA 2WY2D 3R9IA 2VF8A 1U2EA 4U02A 2WNHA 2RHOA 3V8RA 4BMZA 4EHLA 3THXB 3NOXA 3TIIA 2WF7A 3AHDA 2IOYA 2JLXA 1WE2A 2MCFA 3MAGA 1IZ0A 1KAQA 4RPJA 1VXRA 4XSVA 1UJ5A 1AKWA 1V11B 1RZ3A 4O8ZA 4FI3C 3W9YA 2QVLA 1RPJA 3VR5H 3DEZA 4AUMA 3EFBA 2OD7A 3VPGA 4QOEA 2V96A 3NW9A 4AQ7A 3KOYA 3S81A 3E3OA 3R77A 1VECA 2VP9A 4F06A 4D6XA 3NDJA 2BHTA 4XQCA 5BPHA 3HC7A 5K6TA 4L5CA 5KQRA 1A1VA 4ZHQF 3AF5A 1S8AA 1B0PA 1MO6A 1OXUA 3CZPA 2WD7B 4MLZA 3AJAA 1FXSA 5A06A 3IOYA 3HP4A 3JV7A 5SY4A 1J9GA 2IZ1A 2FEXA 2GPJA 1V9CA 2UZ0A 3FZEA 3U3DA 1FQWA 3IR7A 2RGWA 1ACJA 1D9XA 1NFFA 2VJMA 3A05A 3H3XA 1L9KA 3TBFA 5TS2A 2QM3A 3DWGA 1LLUA 1YCHA 5CU7A 1IBRA 2D5BA 2XNDD 3N86A 5ALLA 2Z4TA 4FX5A 5HDQA 1VI2A 2OSBA 4AJNA 5DYWA 1G1AA 4YR7A 1SM4A 1OE0A 3HI6A 4GECA 1Z29A 4BVJA 4G2NA 3GAAA 4HAUA 1YDFA 3MSCA 4GIBA 1JG3A 2Y0PA 4NIMA 1H6BA 2GXSA 4MJLA 4EYQA 1UK9A 4EMTA 4XWGA 3K6JA 2FOLA 1Z7YA 1UWLA 1A04A 4DA6A 1YCFA 2GK7A 4YAEA 3LGAA 5BYKA 3MB8A 4PGFA 1ZM9A 1V1MA 1Y63A 3B9QA 3HJGA 3IKVA 1QYIA 2PNFA 4XWOA 4S1PA 1OWNA 1OJLA 3BM5A 3GD5A 3PPYA 4HYTA 5FAKA 1HL7A 2O8DA 4C7JA 1R5JA 3JQFC 4CM4B 2ZI7A 2O8FB 2YVLA 3BE5A 2ZJ8A 3VZBA 1KJJA 4MCIA 2MMGA 4MIOA 4GM4A 1WUIS 1NIPA 2PH1A 1SKYB 5AK6A 3K1TA 2CFRA 1C3OB 3DZJA 2FWMX 3L8GA 3OOSA 5IU6A 1L8XA 1E3MA 3DCIA 4US0R 1R10A 5LB4A 2YINC 3A1DA 4JEHA 3QKRB 2OQ2A 5BOSB 5ELXA 3FUWA 3GRCA 3ML1A 5DXAA 3T3GA 4I4CA 3DP7A 4LTMA 4PZ0A 1MB2A 1MFZA 1E1CA 3AJEA 1JBKA 2BGJA 4I9UA 4PS1A 5I8WA 3R5SA 5JAIA 5KJCA 2PUGA 3OAAA 3HYSA 4M1TA 3BK7A 1NZDA 4ALMA 2PGJA 2GD6A 2R6AA 3VXKA 2VHTA 2P4HX 4LVOA 4KPYA 2I3GA 1SH7A 4MULA 5GOTA 5FEMA 1PL6A 4URYR 3Q8KA 3ACBA 2PX0A 1CUYA 3TKYA 2FQQA 1BDIA 3N3BC 1WO8A 4LHVA 1PJQA 4UUNA 2GSWA 4GGPA 2HCTA 4ZV7A 2GKOA 3B5JA 3T1NA 1N5KA 4C4ZA 1YDWA 2H7CA 2DBVO 5FOVA 5IDWA 3TEJA 4MYSA 1R4NB 3RS5A 5KKCA 1I0IA 5BWMA 2IOFA 5BV8A 3MTIA 4QNMA 4YACA 3MJEA 1N6KA 1U2PA 1X1DA 3ESRA 3LHKA 4MCAA 2OFXA 4TTTS 4AJKA 5I4BA 3C87A 3OZRA 4XR4A 3OCZA 4ZVRA 3H99A 4H0NA 3HXQA 1OXKB 1TA9A 4XJSA 3ZZNA 4CT4B 6ADHA 1MLDA 5H02A 2HA6A 5BSMA 2Z95A 1S9HA 2ZB2A 5DBHX 4ZO7A 3EG5A 8GPBA 1H2RS 1P1RA 5K8VA 4KR0A 1C2YA 3SNHA 2XXAB 4P08A 2CD7A 3CX8A 5B7PA 2P2GA 5EE0A 4J0EA 1QHXA 2WTNA 1VPWA 1ZMXA 5JXWA 2P2NA 4WA8A 3CC8A 1QGUB 4PFKA 2O2ZA 3A9VA 1WHTA 3IP9A 4XXHA 2B92A 1BA2A 5DXFA 2QIOA 1P3Y1 3NHRA 5JHGB 2RK6A 3OWHA 1W1UA 2GJ4A 3MTGA 4BNMA 1E6MA 2ZREA 4M1SA 1I7NA 3OQ1A 3CX6A 3EGWA 4ND2A 3U7QB 2W6CX 4OIFA 1V9SA 3UMCA 3I01A 1BS2A 3BCSA 5TQVA 2M6SA 2MINB 3D2AA 1UMBB 1VGQA 2P0EA 4CG0A 4EENA 1XK7A 1Q1AA 2F6RA 2JC3A 4JP8A 1X94A 3MJTA 3L0PA 3BBPA 2Q0HA 2QPOA 4O3MA 2QXTA 3LC1O 4ZVSA 1HYHA 4L2IA 3V42A 1DCTA 4WY8A 2NUAB 3PLAE 4IG9A 3L2OB 2B20A 4CUKA 1JMYA 4LSGA 5MN5A 3PDCA 2B99A 4D80A 5AW1A 1XWWA 3GEDA 1MUUA 4RTMA 5F52A 2EWWA 3PFBA 2BJHA 1V8FA 2A30A 4ND6A 4OM8A 4UUMA 4UMVA 1M7GA 1FNBA 2D5IA 4X7RA 5FHQA 3DCJA 4U5XA 3OZSA 3C8UA 4BNTA 2G8LA 1BYUA 1CY8A 4B4WA 4Z3OA 2BP7A 2IZZA 3HWRA 3H1TA 1NBIA 5KMGA 1KZ4A 1RE0A 2YJ3A 4XLTA 2DBYA 1DQSA 1CHNA 3EF3A 4BNDA 1YB7A 4O8CA 2WT8A 4WLOA 4ALKA 2OECA 1SMKA 3HL4A 3IEKA 4YJKA 5AVVA 4FFLA 4BNJA 4F11A 1FA9A 1Z08A 4FR2A 4CU5A 3GJ4A 4ALIA 4V38A 4BFSA 1BO6A 1T5IA 2I99A 3JD4A 4QLOA 1HT1E 3KV1A 2QMQA 3ITEA 5A1JA 1XZHA 3A2MA 5B12A 2I55A 4WLVA 4TN5A 5CDYA 2ZTUA 5J2TF 2VPIA 2JFQA 4RDCA 4MR8A 1VBNA 4EPTA 1VLVA 5H5JA 3P20A 4EGAA 4XRGA 5BORA 2ZT7A 2GS9A 3ZPXA 4ZARA 3O8RA 4PTZA 1QO0D 3TFQA 3HYCA 3EXAA 2C58A 4OQ4A 3A6EA 4JR0A 4AB1A 1BGVA 4MEJA 4BS9A 3EC2A 3SSNA 3FYHA 3NWEA 3O2SB 1E6CA 1W0KD 5IN4A 5A02A 3HUEA 4W7IA 1VBKA 2YY7A 1TU0A 1X86B 4B45A 4BYGA 1YB5A 3MOIA 4C0XA 3KU1A 3EUWA 3V1UA 5J5AA 3ZGYA 2GETA 4Q9AA 4O1MA 1L6RA 1Y7LA 2AEMA 3E9EA 2D7DA 4A0HA 3U4MA 3SLKA 5JNRA 1HQKA 5JSQA 4HNGA 3W1EA 4I9GA 1BS1A 2HI0A 1CD5A 5MN6A 1MBZA 2IYLD 3D0KA 4DR4B 4JP2A 1T2NA 3GMIA 4W5HA 1IIRA 2J3JA 4JNCA 1YDHA 1VSVA 1C7EA 2A9PA 1JR3A 2WJJA 3PA8A 3PQDA 1YC2A 4J3NA 1GZVA 2BZSA 2D2FA 3G8BA 2BDUA 3CUVA 3R5HA 1J8QA 1KEEA 5FNVA 4E30A 4Q4DA 1Q7TA 4MJ3A 3L1UA 1OH8A 1YMVA 1ZR4A 1DAKA 1J8FA 5ICGA 3GL9A 1ZN8A 1NNSA 3L0SA 4R1OA 5LD2C 2HQRA 4LJKA 4NSNA 1SC1A 3SE7A 1R6AA 4F6CA 4WNCA 4D41A 2DETA 4L0MA 3ZCTA 3E81A 1RE1A 3PFKA 3TB4A 4F0JA 5CLIA 3EVNA 4UULA 2C1ZA 3FF1A 4OUDA 4B6SA 2ZJAA 1DAIA 2YWDA 1P9RA 1P1HA 3QUTA 4HXGA 3K1AB 1ABFA 1U2RA 1UMCA 3HEMA 3KIPA 3GOHA 5K0ZA 3STWA 4E22A 1N0VC 1WLYA 3LTNC 3ZUGA 3UCEA 3NPAA 3S68A 5AVOA 4OHBA 3DH0A 1ZK1A 3UGQA 2JD0A 3H5AA 1P80A 4JT8A 3CM0A 3ESQA 4KBFA 4FZVA 3DYVA 1V39A 1G5RA 2RAPA 1UQTA 4REMA 3G9UA 5EJEA 1E2MA 2RG7A 3QF7A 1XZCA 3UFBA 1EFLA 1ODJA 2YV4A 5D7BA 4FFPA 3L7YA 1Z47A 3TPFA 1C4XA 3WLRA 1I33A 3LCMA 3I4CA 2HA2A 3TQFA 2DEUA 3NH6A 2QEQA 3OU6A 3KUUA 4ZOCA 1RWNA 3HUUA 2IYZA 3DLAA 5CIQA 2DM6A 2W5UA 1QHHA 1XA0A 1MHPA 3CB2A 1MJHA 3NAMA 1MORA 2ZKLA 4RD1A 5CNJA 4M3NA 1KH3A 3CLSC 3O8QA 3OZXA 4HC4A 1R8YA 1VFNA 4MV1A 3ZGZA 3LXRA 3LOUA 1WB4A 5CXSA 2QP9X 4C78A 5BVGB 4CEIA 2JGMA 5I7HA 1CEEA 3DD1A 3L3BA 1CEXA 3EVGA 3G79A 2WABA 3AF2A 2OBLA 3CLUC 3HQ4O 1K8QA 3MGBA 1Z83A 2NSDA 4DLSA 5BSUA 1JH8A 1M0TA 2JF0A 1GTVA 2Q3DA 4G36A 4YLEA 1H69A 1U7DA 2JPDA 2ZPTX 4ZYXA 5JH7A 3R9XA 1TX4B 3M6UA 1L8OA 1ZUIA 4ZV9A 4HYQA 1CV2A 3DNFA 4YRFA 3UAVA 4HNAB 3OY2A 4MGHA 4DQ0A 3HP1A 2JATA 2X3UA 4PSAA 3KJQA 3AETA 4O2AA 4NV1A 2I67A 1XTRA 2A92A 1KTVA 1D8TA 3B6EA 4H1VA 1FFDA 4K6GA 4TQGA 2PUHA 1G98A 4RXTA 3TZCA 4KR3A 3RI3A 3TCNA 1BU8A 3A0RB 3MWLA 2NQ2C 4LSMA 1GTRA 2OZKA 3VU8A 1E3DA 4JQSA 4PXSA 3K3PA 5F64A 5TIIA 1RYEA 4MW1A 2VJOA 4D9EA 3QWBA 5AW4A 1JAHA 3VZQA 3QM1A 4Y2JA 2Y8EA 3QVGA 1EHIA 3WFIA 1FUUA 3BC1A 4IV8A 2WC1A 3R9KA 2C0QA 3SY8A 1U0FA 1SQ0A 2A58A 1XP8A 3KYBA 3H8SA 4D98A 5BN3B 3IBGA 2GBLC 5JD3A 1DAHA 1S1CA 4XAQA 3MCVA 5D3MA 4TLCA 4JY7A 2W6JA 4O5OA 3KV3O 3QHQA 4Y2GA 2R6FA 3H84A 2FMHA 2VK2A 4DTIA 1SUSA 4ZQEA 1IM5A 1VIAA 2ZSHA 2CNNA 2P90A 3DHNA 3DOCA 2G88A 3N0TA 4K2AA 3FTEA 1E2PA 2JNWA 4P22A 3ZD6A 1N1GA 1G2PA 2AG8A 3FKSA 2EKBA 4L4UA 3RVPA 3D6HA 3Q3IA 3D2BA 1HGXA 3D7LA 4D44A 4D57A 3UAYA 5KNBA 3W9UA 1JFFB 3IC5A 5AI9A 2VT2A 2CW5A 2V7TA 4K81B 1E3JA 1CG6A 1ONOA 2F43B 3MWFA 2IODA 2FX5A 4IIJA 2CLOB 1DKQA 3AXSA 3GRZA 1JAXA 1T6BY 1NT4A 3FD8A 4REQB 5GY7A 4EUHA 1JE0A 3I34X 4ZDJA 1KP3A 4ZAFA 5J63A 3HVJA 1Z5OA 4EG3A 1JQ3A 2DWQA 1F0YA 2H5IA 3AJ8A 1MRSA 3DONA 3ECCA 5E7MA 3UUFA 5TT0A 5BWOA 3K0HA 1M7BA 2BZ1A 4H77A 5BQ3A 1ZD8A 4DMGA 5JS1A 1GL9B 3DZBA 4TSRA 4CMEA 4TV8F 2VS1A 1SVLA 4QJ3A 1PYOA 3MWYW 2Q5FA 4R16A 4R6XA 1GNPA 3O2NA 2VTBB 1DADA 1M66A 3CF2A 4Z4IA 4UD2A 3IAHA 1J20A 4CTKA 4D82A 2EGHA 4GVLA 4DARA 1DCFA 3J7TA 3OUTA 3OY7A 3C3PA 3QE3A 4QICA 3OE7A 4GKKB 4WY2A 1WDLA 5C1IA 5AXDA 3AEYA 1JL3A 4MB6A 2SCUA 1JA1A 1W5SA 4F2PA 1E5VA 2DGDA 2VHYA 3SYNA 5ADVA 1R4AA 1H22A 1T5BA 2DFKB 3PXXA 4QTUB 3IMFA 3UJBA 1NVKA 3G7UA 2BGGA 1C4KA 4J0GA 4ZMBA 5DF1A 4JLOA 1GNLA 1M8GA 3WLLA 2CZGA 5E9WA 4DMRA 4UOEA 5TQJA 5JXJA 3U61B 2BW0A 2W00A 1DLJA 4RV4A 1E58A 4GLBA 5T4EA 3AB8A 3ZOKA 4EMBA 2X5NA 3QBTA 4ITRC 3ZDZB 1A4XA 1SRRA 4PAOA 1W87A 1NXQA 1JQLB 1EJ2A 3EXIB 5EYPA 5LJIA 3J81A 3ORSA 3A70A 2E1PA 5AICA 3HCWA 1DBWA 1NVVQ 2DWCA 5C7YA 4BECA 4IZIA 3ROXA 4LZPA 1O58A 4BUZA 1UDRA 3TMYA 4PBRA 2HU5A 2PU7A 4ARUA 1DRWA 1JWLA 4MVJD 2JGJA 1LQ2A 4YPVA 1DEAA 3TDMA 2C88A 4ER0A 1P60A 4TXHA 1T8PA 2R96A 1JKJA 4QFMA 3JQ7A 4TV9A 2OP1A 3CH4B 3DM9B 3IBSA 3L7JA 4I0WB 3T3IA 2XY4A 2JGEA 3KCQA 2F67A 4DDKA 1AXRA 4EX6A 3SYMA 3R09A 3JQEA 3D6VA 3RS0A 1YFLA 4LZZA 4YHBA 3W3AD 3DOFA 2EDCA 3IV9A 4I9NA 4LY3A 4JU8A 1CK4A 1W46A 3IQHX 4EJSC 3PC8C 2DQYA 2QZJA 4JXJA 4UU0A 3V3KA 3WLJA 4UUQA 5KKNB 4MQUA 4KE6A 3R23A 4QPPA 3F73A 1XAHA 1EZ4A 5G1PA 3CZ9A 4G63A 1OIXA 1E9BA 4GPAA 4UEQA 2CLCX 5FUYA 1IQ0A 1GGEA 1QDLB 3D6NB 4EB6B 3HG7A 4NHOA 3ABOB 2JBAB 3KWFA 2NYAA 4O02B 2UZ3A 4IS3A 1JWAB 3IEIA 1GCIA 4U63A 1CF9A 1L5ZA 2OO5C 1PGJA 3CMCO 4I81A 4G0XA 4YMUA 5IW8A 5ITVA 3EWIA 5FBZA 1NBMA 1KKUA 1ECFA 1O95C 4MX8A 1L4NA 2QLTA 2JRCA 4GLFA 3AB3A 4D1YA 4UHEA 2WIDA 3QYFA 2ACWA 4OMUA 3C24A 1VYUA 1U5BB 3A3YA 3BH6A 1SQSA 3CN7A 3NO4A 1UXGA 2YWRA 3IDOA 3CNLA 1EKXA 5LIRA 3H1EA 3MTDA 3ZD9A 4CLOA 1JVNA 5SY9A 1XPOA 1E1QA 4AQYB 2CV1A 3JD3A 1S7CA 2JLQA 2RKBA 2P1DA 4S0XA 2FSFA 3PNSA 1X7HA 1X80A 4QDZA 3VC1A 4DJ5X 1HM5A 2IHKA 4ND5A 4QPZA 2ZT5A 1WAMA 1IN7A 1QB7A 4B32A 2J3MA 1NW5A 1FNDA 1HFWA 1PDVA 1VRVA 1G4AE 5NLLA 4OHZA 4NMMA 2YJZA 4YK7A 5HK9A 4AICA 3A6HA 1R0SA 3EXHA 4ETWA 4UAUA 2DJ5A 1Q84A 1WPGA 3N0VA 3ZV7A 3UG7A 3FLMA 3K15A 3TTUA 3UK1A 1CUSA 1Q3HA 1B0AA 1YK0A 3EG9A 4LG1A 1L4MA 2CVFA 4X1YB 3WB9A 4CDRA 3EWAA 1QC5B 4RULA 1WCIA 3LPCA 4B3DA 2XUIA 2AI2A 3QITA 3UO8B 3B3JA 2GPTA 4OXNA 1XL0A 3I2JA 3R0VA 1VIYA 5A2GA 2BM0A 3B1FA 1VIDA 3HJCA 3F47A 2G9QA 1HQYE 3I83A 3OX4A 4HDKB 3R8XA 1QJ4A 4QVIA 2XECA 2HHAA 4CKZA 2PUCA 3HR7A 1YASA 3X2SA 4LISA 3HB4X 1AQYA 4YCBA 3SZOA 4UEJA 5JSZA 1W35A 3UJ8A 1T9KA 3FCYA 3AEUB 5TXGA 3DCYA 3KYJB 3DUFB 4MW0A 1DMSA 4B4OA 3BSWA 1MNQA 1VB5A 7REQA 3NHAA 3G68A 1A88A 1DEXA 1I7QB 2GM5A 4TM8A 2C8VA 1ZJJA 4TLLB 1S02A 2N1BA 4CM6A 4S1OA 1UXOA 1UZAA 4UBKA 1PR2A 13PKA 1KNXA 3RHZA 3JARB 5HKOA 2FPGB 2R60A 4KQMA 3FTFA 3CO0S 1QCDA 1Z0JA 1FYFA 1LQUA 2P9EA 4UUPA 5J47A 4RIHA 1WVIA 1QVAA 2XE8A 2VDWB 3C7DB 1BE1A 1NQTA 1RKBA 2XZDA 1ZVQA 3EIOA 2QRNA 3IV6A 4MS3B 4PYIA 4DA4A 4JELA 3MCAA 1XJCA 4NJOA 5F5NA 2C4TA 2XCIA 3WISA 3FIJA 2XEXA 1ZVMA 3AC0A 3BIOA 5TSDA 1VXOA 1WXXA 4A4DA 4ZALA 3KT0A 4HBZA 3QE0A 3GFFA 1PX0A 4JQZA 4BBAA 1V41E 3UMYA 2PWZA 3AHIA 1CQIB 3L6OO 1PP4A 1VSQA 4QXPA 4MLDA 2NPFA 1Z6TA 2AK2A 4HQFA 1ODLA 2ZDGA 4MQ6A 1WOYA 1XRJA 3GLHA 4IUBS 3UUWA 4EY3A 3REGA 2WDPA 3SNKA 1SXQA 5CH5A 4U9IS 3VYRB 2VYCA 1Q95A 1Y80A 3OPMA 3ZDQA 2P4QA 3DB2A 2VK8A 3UMVA 5JVDB 2NZVG 1EGAA 1QQ5A 1R88A 2WVJA 3MMZA 4Q1VA 4KYUA 4ND8A 4QQKA 2BKUA 3TQCA 2FB9A 2Z1NA 4CIWA 5EXDA 5EP3A 4LSWA 2K4MA 5FV4A 3ELYA 4QOHA 2GHTA 3HU3A 2AYXA 3BX1A 4ACAA 1VCNA 2R87A 1NVXQ 3DPSA 3CU5A 3EFOA 2ZYVX 3AL2A 4Q9JA 1CRWG 1ZGCA 3L6EA 3V8QA 2DE0X 4GZ6A 5DWDA 3VYUB 2PRKA 1G21A 3RVOA 5FH9A 3DM5A 1RMQA 5FWYA 3T3HA 1Q7CA 1W47A 5E4JA 4P2BA 3QEKA 2BUBA 3U3XA 3KG2A 1TW2A 5REQB 5JV5A 4OMFG 2Q6LA 2XGOA 4KXLA 3V8PA 5FI0B 1PK9A 3DT9A 4ZZ3A 7GPBA 4N3CA 2Z3WA 3IUPA 2R7MA 1E5TA 1K68A 1P4HA 4KQJA 3ANYB 3OECA 4RKEA 1FX1A 2BBOA 1U8ZA 4HWRA 3KUXA 3MS2A 2ZS7A 3OBIA 2YCLA 1GTG1 4JVNA 3ZS9A 1DWUA 4OJNA 4N6OA 4PXYA 1N9GB 3CTMA 1WSWA 2DR3A 5HM8A 2IU3A 1EWKA 1LEHA 1O6BA 2GCOB 3A0UA 3ILXA 1N9KA 1W88B 2RC6A 1BMFA 1IOWA 4B3MB 2Q1XA 1VG9B 1IN8A 3DQPA 5SZKB 3KJGA 4Z4EA 4MWDA 1CZOA 1HTWA 1NBEA 3VR2A 4M83A 3IQEA 4E5YA 1Y42X 2QUAA 4GR5A 4HSGA 1ULUA 2PD6A 2QVXX 2HIGA 4B83A 3GFRA 1PV2A 1VA4A 1LRJA 1XU4A 2QDXA 3FY4A 4E1VA 1WBDA 2A4MA 4Y6QA 3WGNA 3I3SR 4F4JA 3KL2A 4EGFA 3FCXA 2JIPA 2VT6A 1TA4A 1GO2A 3HXLA 4BNVA 4BO1A 3ADDA 3JQGA 4AL4A 1DX6A 4HQLA 2IS4A 2XWBF 4I5DA 4LGVA 1NP3A 2OV6A 2YY5A 4LX8A 5AK0A 5HUHA 1OH7A 4DQDA 4JP3A 4WGFA 4S1TA 1RMTA 1QKJA 2AKYA 5AFSA 4MUJA 1LB1B 1Z37A 2OFPA 1QKIA 1A96A 2WHRA 2ZUDA 2JIDA 1XEAA 3A1FA 5ICEA 3ZGLA 3GI1A 1JEAA 1UPFA 1DFGA 1KZ7B 2PT9A 3FNFA 4R01A 2E18A 4FOOA 3QU9A 1GLNA 2D54A 5AXAA 4TKVB 4DLTA 4P4NA 3LUCA 3UFXB 4D3DA 2ZXUA 4NYJR 5FOXA 4PHTA 1XTBA 2AZMA 4BO0A 4CM7A 2VKQA 4OFZA 1DHTA 3MMNA 2HU8A 3NHJA 5AJTA 3LLVA 4LOLA 1RXEA 3IMCA 5AW3A 5HJ7A 1II8A 1IHXA 1IOVA 3FPJA 3DDSA 4KPUB 3PTZA 5I45A 2QRZA 1Z8DA 2ZIGA 1MENA 1X1QA 2HLHA 3P9ZA 4KWEA 4MITA 2X14A 5CDSA 1Q16A 1B74A 2Q7XA 1MOQA 4JD5A 4J7AA 1LCIA 1CP3A 1PZGA 4R0NA 4X94A 2QE7D 2VBGA 2PWBA 1R66A 3IXMA 1WXGA 4BCCA 2YWGA 5BXQC 3I61A 4W9NA 3N8IA 5EUCA 4O33A 1DOHA 1FPQA 1SVWA 5JQGB 5CJJA 3QPDA 3BQ9A 3ECSA 3KEQA 1LWOA 3OZAA 2XKKA 2VF7A 1ZD3A 3IIJA 3I9LA 1E6KA 3EYWA 2WHPB 2EC5A 4Y2HA 3KJHA 4JEMA 4P1ZA 2OC4A 5LYYA 2BI7A 3RH0A 4B6EA 1XD2A 4NK5A 3TSZA 2H1CA 1BX0A 5EXXA 1CSEE 1S5PA 4ECEA 1UKYA 5TQ2B 3HPRA 3N6VA 3Q9LA 3QXSA 4Q1FA 4YFVA 1DFIA 4I66A 3BILA 5EJMA 3FFWA 1ULAA 3DBOB 3IIIA 2D4AA 2KHZA 4LY9A 3WYBA 1GU7A 3FHOA 4AZTA 3JD2A 2WNIA 3HBNA 3FFTA 4TTVA 1M6HA 1DTWA 2XSZA 2BEVA 3H9QA 3OEEA 5C5EA 1PFKA 1OLSA 1NRWA 2GVZC 2XD4A 3A3OA 3LKVA 1N3BA 4DR1B 3GLQA 3PJEA 4FLEA 3BRWD 3QBJA 4FKBA 5FXMA 1YMUA 4LBVA 3WRXA 5C1BA 1Z6ZA 4IJ5A 4JUFA 4LRTB 3BD8A 2OZVA 2IYQA 3BQNB 1HH4A 4HLCA 1KO4A 2WM2A 3CONA 4HY3A 1GN9A 2C3MA 3W04A 3SBXA 1H2XA 1U5CA 4Y9UA 1CQWA 2RSLA 5FNZA 1OMOA 1M2JA 1YUNA 4HAOA 5C1PA 3PFNA 3FLAA 3Q3EA 3AFNA 4OLFA 2FGKA 4H08A 5KYUB 3PNOA 3SX0A 4OHKA 4M53A 3QELA 4I8DA 4CIXA 1V25A 4XGKA 2O2GA 1ZXLA 2DHQA 4Y0VA 4DC0A 4CEJB 4GF5A 4XCXA 3B3QA 1ITZA 4JR2A 2ODWA 4D2IA 3HR4A 3PUZA 1ZVVA 1E2DA 1C3LA 5HMLA 2J07A 2QRVB 2VJPA 4K5QA 2JLCA 3AXTA 3HKDB 3RLIA 3KLOA 2V9ZA 1JB1A 3AEZA 3JRXA 3KTAB 4WK4B 5EFOA 1FUEA 2FSSA 5TGTA 3R7AA 1UJ6A 3DXFA 2PY6A 1W4AA 3CLSD 4IG4A 5KWJA 5CLGA 1VA5A 3WK6A 5B7NA 2R8ZA 5IH3A 1ZN9A 1OI2A 4CF5A 4G5XA 1GT91 1L5VA 1KQOA 4BX8A 1R8XA 4K9LA 4BPRA 1RYYA 1YHZA 3CLUD 4X7BA 1M8PA 4QYWA 4UNNA 4MVJM 1R3UA 5FOWA 5FFMA 2W2KB 1FW6A 1LC3A 4BFLA 3CN9A 4OGWA 1TJNA 5L3QA 1THGA 1N5RA 1O08A 4OI1A 4AKHA 1M6VB 1IAQA 1FSZA 4NKRA 1G8MA 1NN1A 2PUVA 2EL9A 3TR6A 3WK4A 4Q02A 4MWBA 4X8OA 4OLAA 1WUTA 4WAUA 4YFYA 5HP4A 3CUSA 5FI3A 4PHCA 4QJIA 5JD5A 1F12A 1W0CA 2R3SA 3DULA 3ENWA 2GEDA 1Y6ZA 3TL3A 1XDDA 4IO0A 2CV0A 1UBUS 2OHFA 1XZBA 3QMMA 2CYBA 2J7PD 3FPLA 6CHYA 4G4IA 3W2TA 4BIIA 1AU9A 1DKMA 3FNGA 4IGFA 1VG8A 2BMJA 1GPWB 1S8FA 1E5DA 4DLUA 4KQKA 2Q46A 4X00A 3F8WA 3O2JA 1UDWA 1K7YA 2B4YA 2DFTA 4HFRA 4L3WA 1QYCA 4LXIA 3GR6A 4X0EA 3ZJ4A 1TXGA 1KRWA 2IIVA 1K97A 5EN4A 3R0ZA 3PFFA 4RABA 4KGZA 1N0IA 1TVKB 1FRVA 1VLQA 3P8ZA 1SUBA 1R15A 3KOUA 3Q6NA 1YA8A 4MDYA 3RTBA 1JHYA 4Q9KA 5C32A 3GCDA 3LAWA 1WD5A 4RHXA 2Q0QA 3ST7A 5H4HA 4I1PA 1HDIA 5AKJA 3C0KA 4H7JA 4RZSA 5J4KA 4R84A 4A8PA 1N0WA 3HJTA 2Q6IA 4TX1A 5IAOA 821PA 3KAPA 2X0FA 2M6KA 2A9OA 5BSKA 2PMDA 2W2VA 1VLZA 4IDDA 3R5TA 1XDUA 4ZDIA 4DFDA 1D2CA 5FPKA 4RPKA 4KGDA 3V4RA 5EJ2A 2NZYA 1O97C 3U9LA 4ENPA 2HR1A 4M0PA 3AIMA 2REQA 5E6RA 3S2YA 1YR9A 1EUCA 3QX9A 1QIDA 3T5DA 3WIEA 4V0QA 3WGIA 1A7AA 5B3AA 1W48A 1T4CA 1IPHA 1ZSYA 2CE7A 5CX1B 2QQEA 2FJUA 5FDFA 1Z5NA 4OP2A 8MHTA 3QYPA 3T94A 1S2MA 4B48A 2AWNA 4KMMA 5CITA 3H42B 2C9CA 2WU8A 4F3RA 2IGBA 3A9RA 1FUKA 4JSTA 3RVDA 4X64B 2NTEA 2OXTA 4BWVA 3DFIA 3MINA 1KAHA 5LP6A 1RLJA 1Y3HA 4TSKA 5EQFA 3GLIE 1I4TD 1ZX1A 2VAMA 3VR5D 2YHAA 5SYMA 5ADUS 2FPXA 2Q5JA 2ODEA 4IF4A 1UWVA 4Z8YA 5DRTA 3MLBA 1FDIA 4WKGA 1DQZA 3AV3A 2I91A 3EOAI 2OXFA 4ZI7F 3H1FA 4HLQB 3TZLA 4RFVA 5I8PA 4GRDA 4KQCA 1AC5A 3QJYA 4LWZA 4X6XA 4LRSB 4LYHA 4ARZA 3EF1A 3T8YA 4EGSA 2W71A 4GRIA 2IU4A 2XBLA 4MVCA 2JCYA 2LWIA 4H1UA 4OBXA 5FBLB 3CLRC 2DHDA 3CMMA 2CJWA 1IUNA 5KYWA 1HURA 2XMZA 2XKBA 1QVZA 2H16A 3DMRA 5CPFA 2IYUA 2FCAA 4EX7A 3EPHA 1JHZA 4OI0A 4JLMA 4QRDA 3WFJA 4F3NA 2ANCA 1EK5A 1STOA 2OBNA 3HP7A 3V8NA 3VPBA 1UANA 2AR9A 2XQGA 3UENA 2J9RA 3V2UA 5BV2P 3X44A 3PHIA 4UVEA 3SX4A 1PJRA 4ZCTA 1ZK2A 4Z0PA 2E55A 3AVUA 1SN7A 2FMFA 3TSYA 1AY0A 2ZRQA 3UAZA 4LTDA 5E7QA 5KYNA 3LZCA 2XWJI 2GZSA 2HNAA 4C6RA 5KQSA 3H4MA 4A2CA 1JS1X 3I9JA 4Q47A 3PQFA 5D1NA 3GDHA 2HT1A 4P3XA 1D1PA 1H66A 3C3DA 3HLTA 4IHJF 5AKEA 4I6EA 3PGLA 1YE3A 1CR4A 1PF7E 4BQPA 4F4DA 1ZOIA 2J4FA 4EG0A 4HMPA 4I5EA 5DM60 1AKMA 3EEFA 4F5ZA 1YU6A 2Y1DA 3JQCA 1CRQA 1US8A 4WCFA 1OLUB 3JU3A 2DWOA 1Z36A 1EFRD 1ZUNB 2OHOA 2QVZX 1RRVA 2ZCVA 5FPPA 3REOA 3RVSA 2YVKA 3ZTYA 3IQXA 3OEHA 4QATA 3VGJA 1NAHA 1QIJA 3FR7A 2OAP1 3PDHA 4RKRA 5FI5A 5LOVA 3TRIA 2BFWA 4HGPA 3CNHA 3UC9A 3CXRA 4JROA 1F06A 3MTBA 1EP3B 5BWBA 2JGDA 1WXWA 4ZCPA 1JYSA 1N2JA 1Q5PA 4MXDA 4XE5A 4YQFA 5JDIA 1C3VA 1H0KA 4GSLA 4LYDA 1WZ2A 2ZM6B 4V0MA 2W8BA 4AXBA 4NCBA 1Z6XA 3WYGA 2NPOA 1KAGA 3R4CA 1OASA 1YI8A 2FWBA 4W8OA 2Z2ZA 2UYOA 4CF3A 3DYIA 1T3GA 1E92A 1MZPA 1XU9A 1Y8QA 3GELA 4J16A 5B58C 1VFPA 4C4SA 1NR1A 5JAMA 1YZFA 1MH9A 1KAEA 2XYPA 3PRKE 4S1NA 4ER6A 2R4UA 1DXHA 2DAPA 1NUPA 1JBEA 2CUTA 5K8TA 3ZJTA 5HZMA 4OA8A 1PZXA 5ALVA 4OQXA 4M0UA 4CMHA 4MVJE 1EEXB 3AM3A 4QBIA 3D6FA 3F97A 2ZVDA 2GRJA 2YMQA 4ZOEA 2O9JA 3ZCUA 1UBKS 4EUFA 4HGRA 2ZOSA 3QV2A 1Q2UA 1UPBA 2QZPA 4IO1A 3VUEA 3C3BA 4G0NA 1MJNA 3GB9A 3EBOA 5EZSA 2RGGA 1BD4A 4QPNA 2I71A 1CCWA 2BEWA 2ZT8A 5TPZD 2Q5QA 1GKIA 3TNLA 4Z7NB 1A9XA 1N6IA 1VJ0A 2RC5A 5EEGA 2PSEA 3OQIB 4WZAB 1QE5A 4KWIA 5LMNB 5HFNA 3MBKA 1RCUA 1ORHA 3TE7A 3L93A 3I76A 1PFWA 3DXZA 3H4TA 4EHDA 2GXAA 4MHTA 3I72A 1EWQA 2RB5A 5A9SB 3UHAA 4ZMRA 3DQZA 3L7KA 5FO0A 2JEYA 2C61A 3E9MA 2ZT6A 4U5QA 4BX9A 2P77A 3IP8A 1Z5VA 2IU0A 3PJGA 2PZEA 3P2YA 3R5KA 4CKWB 4CTMA 5A5GA 4E09A 4LXTA 3EGXB 5EMJA 3C5EA 4RA9B 3ZE9A 1L7BA 4MGIR 4ZAYA 5IDXA 2W6NA 3N3AC 1K5PA 2BE7A 2V0NA 3QHAA 3S2SA 1AK1A 1VL5A 5H7XA 3WL6A 1NN3A 1Y3CE 1Y81A 3OKPA 3M6MD 4N0QA 1MKYA 3DTTA 5IBCA 2CLSA 1KR2A 3G5AA 4JJIA 4QM7A 3BMCB 3GUYA 1ABBA 1HXHA 4U3JA 2CWDA 5JWOA 3RK1A 3LF2A 1AUQA 3A4VA 5CJ2A 2P75A 3LCVB 2YN4A 2FI1A 4FXOA 1UKBA 4PGAA 3KKZA 1E3IA 1IAVA 2RGEA 3VDQA 2P9TA 2JKYA 1GYPA 3COPA 1O4VA 4DGSA 4MS4B 2CLEB 5CBPA 4HUQB 4JIGA 3H2YA 4S24A 3RRBA 2CMKA 4JUCA 3H05A 4QPDA 2HUNA 2EZTA 4ZEVA 1I7PA 4HNSA 1JEYA 1WB6A 2Q6TA 1C8VB 1TCCA 2HADA 3KHTA 5B3KA 3NT4A 4MUXA 1MQSA 1C3JA 4DM7A 3VR6H 1CYDA 1FSSA 3SQDA 3PTAA 2HEGA 1ODCA 1QH8A 2HFJA 4LQ4A 5JROA 2P35A 5J9FA 4V24A 3K4PA 1NLYA 1KDOA 1OXBB 1KMQA 4FZJA 5GVSA 2C4KA 1CLUA 1W4CA 3ASZA 5GJCA 3TOXA 5IZ4A 2GD1O 4EG4A 3VVCA 2FN9A 2V4MA 3B6MA 5LZ4A 1UIMA 1ETUA 1B1CA 4ZT3A 3I30X 3LJKA 3A31A 1Z0DA 2AX3A 1JJBA 1Y3BE 2PMWB 4MV4A 1IB0A 2P0YA 1IE3A 3AT1A 3VU9B 1ZZGA 4EHKA 2RH8A 3TDKA 1JLMA 1FFEA 2OK7A 2VPZA 4D3YA 5T64A 1JGTA 4AULA 4A6EA 4D74A 2FDRA 3OE1A 3CRMA 4IOJA 4NCKA 4U7PB 3RK0A 3LPMA 3GLVA 3ZZUA 1JRLA 2VJMB 2Q9BA 2BM8A 2EW8A 3HDHA 3PI7A 2QNRA 3FGNA 1P0QA 3DBVO 4GDMA 4OEHA 4TS3A 5EESA 2X0DA 4UDNA 3IKTA 2R751 3LC0A 4WD3A 1LQTA 3JATB 5K8CA 4UHDA 2A8YA 4LXGA 4P36A 2WVAA 1R6DA 1JG2A 1UR5A 3IJPA 4HUJA 1THZA 2VSXA 3IAUA 1KNQA 4YDHB 4BE9A 1PWHA 2FX3A 4TRMA 1LS1A 3S2IA 4BNDB 3QKSB 3HN6A 2VDJA 3INRA 3WIVA 2XWSA 3V8VA 2Z2YA 1Y1LA 2C2OA 2ORVA 2V6JA 4PTYA 2QRLA 4AJ1A 2QMUA 4WK6A 1JIXA 1T8UA 3V4PB 2XCSB 1HL3A 4ZVKA 3SN6A 3D6MA 5BWCA 3BGVA 2FHSA 3IODA 4CEHA 4WJKB 1JPVA 2EFYA 2C4UA 1EFHA 1O94A 2AW3A 3I32A 5BR4A 3FTQA 4GS5A 3FCCA 3NOQA 4YQYA 1GRRA 1IUKA 1CS0A 1AB6A 2P2YA 3BOSA 3I9V6 4OH1A 3TVDA 1NJ5A 2ZUTA 3GFOA 2ZYAA 3I9V1 3HH8A 2VSQA 3TQHA 1WQ3A 4V1CI 2MR6A 4LRXA 3GFBA 4P3PA 2XRZA 4RJIA 4UTVA 2H1SA 1JI0A 1P9OA 1QM5A 1UFQA 1L7MA 1ZP6A 1A5AB 3D8RA 3HDJA 3NYIA 4XFDA 6REQA 2HGSA 4I1YA 4D79A 4M0FA 8AT1A 1CDZA 4I99A 1G4UR 4HLNA 1LPOA 2A3NA 2PFSA 4MPJA 1UMDB 5FFNA 3ZXSA 1UDAA 4K0KB 1Q50A 1E1CB 1UIRA 1ND6A 3L1IA 5FA6A 4ATNA 2Y99A 3HKEB 5CNIA 2ZAYA 5G3ZA 3M6WA 3W7VA 1ODIA 3S5UA 2BEUA 3M9XA 1XR3A 4FMCB 2GCNA 2GNAA 2XGGA 3FVVA 4FR0A 4LHXA 5CVVA 3CRNA 4G65A 2I9KA 1ZO8A 3CW8X 3FVTA 4Z8XA 5AVSA 4NEQA 1V35A 4P5EA 4PR0A 3KKQA 4KNWA 4LF5B 1LTHR 1M83A 1E66A 2NT4A 2ZS8A 3HXPA 2RFLA 1G5FA 3IA7A 4GOXA 2QR2A 4BQEA 3PEVA 2KX7A 3AYZB 4D02A 1E79D 1J1UA 1BU5A 3W1VA 1G3MA 2JH3A 1L4HA 3WLMA 2FUCA 2PD3A 1FTSA 2EF0A 2PPLA 2I6SA 3PXCX 4L3VA 4UEKA 5HIIA 2AUMA 3UYLA 2HRDA 4R81A 1MJGM 3HCCA 4M1WA 5EKXA 3ET4A 5DSTA 2QX7A 2WWHA 1PCXA 2UUAB 4B47A 1R9JA 5IPFA 3JYQA 2WW8A 4CKEB 1DJLA 2W0SA 3R41A 5JD4A 3PC7A 4NPAA 5IANA 1I0LA 2XZTA 1BN7A 3MEQA 3WIDA 4AYTA 3RSQA 4BNIA 2DHRA 3WMFA 3GH3A 3MG9A 4NCXA 1YFZA 2XJ9A 4TT8A 3F5FA 4QGSA 3KVOA 2P9CA 1W0JA 2Z8XA 4YRAA 2F9LA 1SK8A 2M9MA 4X1KB 4YT5A 4A1FA 1X0XA 3SQWA 5K2MA 2HHJA 2GASA 5JZBA 3BHJA 3KB8A 1NATA 1Q1EA 1QIEA 1YRBA 1Y9DA 2F90A 4PRLA 1KE1A 4EPVA 5DVZA 1TKRA 1JR2A 5BMVF 4DV5B 4ZGGA 1SUEA 2QG4A 4NYIQ 5LA6A 4YRJA 4JBNA 2JL1A 1K2WA 1P2GA 4RMHA 2DSTA 3WQBA 5CTJA 3SHVA 2OBYA 4CF4A 1C30A 1YMQA 3TTWA 2QTRA 1K08A 3PHBE 1OX6A 1UXKA 4EW6A 4BJ1A 1XN1A 2H48A 3RU9A 1BMDA 1KMIY 1TJ5A 4XWAA 5LQMA 2TSYB 4ZQGA 1MO3A 2COEA 1KFEB 4KI0A 4F92B 4E4YA 2V1XA 4L2IB 3LRTA 1USUA 1BXRB 2MSWA 5JU6A 2Q9UA 3F6EX 1XZGA 3SICE 3O1IC 1MTOA 3PGJA 1CZHA 2GESA 1RLUA 2OPBA 4YCNA 3L6BA 4CGZA 4QOSA 1U1IA 3AVVA 4MA4A 3S4YA 1QGYA 1GNVA 2XUGA 4Y6OA 3BICA 3OJEA 4C0WA 1YBAA 1B8NA 2DCMA 1QHSA 4Y98A 1QFMA 4BX0A 5AKKA 4G8DA 5TEVA 3DLHA 4ETNA 5C4GB 2A78A 2CNWD 2YFKA 4K26A 1PGPA 4I55A 2R65A 4GG1A 2YXBA 4D8TA 1QAMA 1RTKA 3R0QA 3U9SA 4Q7KA 3E7FA 4FHGA 3H5IA 4PC3A 5KQLA 3FYSA 1RT9A 1SBCA 4AXXA 4G37A 4DYDA 1KYYA 2PRJA 2IYWA 3CE9A 1RJFA 3D3JA 4I50F 3ZHXA 5BPFA 5BRNA 1B8UA 3ZLUA 3GY0A 4HAXA 4ZV4A 4Q7JB 3GG9A 3TW4A 3T3EA 1OAOA 3EIQA 2VCHA 3RYFB 3ACCA 1NSYA 1NX9A 2JCSA 2VYVA 4NBVA 5E4TA 3IAFA 1XLVA 4P33A 1WXHA 2BSXA 1LRLA 2JI8A 5J5CA 3WO1A 2ZZNA 2BH9A 3PNBA 2WG2A 4KPGA 5HS6A 4NESA 3UB2A 3WLFA 3PNLA 4HH3C 3NBKA 2Q1YA 1IZ7A 4B2LA 1RXWA 2QM0A 5CNMA 4L50A 2FW8A 4IKEA 2ZI6A 4GX5A 1HDRA 2ZRMA 5LU9A 4FI3F 3OUUA 1YAHA 1UZMA 3TNFA 3A2KA 2JAWA 3AEKA 4RHYA 5BURA 1ZAKA 4BHTA 1PHRA 4C76A 4L72A 4G5OA 1U9JA 2CL0X 3MWEB 2VC2B 5EWMA 2Q4OA 3L4JA 1A71A 3BWCA 1QRUA 4L0DA 5AKLA 2VP0A 3RRYA 1SG9A 3HSKA 4DYHA 1XZEA 4ZU3A 4OHOA 1BG6A 5CB8A 1RTTA 4KKVA 2CK3A 4CMEC 2HXYA 1X1AA 2BPOA 3NS7A 4BMYA 3T1QA 4MYUA 3EZ7A 4NZZA 4ZVNA 1MD9A 2WUWE 4BL5A 1JQBA 1M6WA 3O93A 1WDMA 5AP9A 5AJXA 4YXFA 3B3GA 1T8SA 3Q3HA 1M2OB 4CG3A 2GPBA 2ZETA 1TIBA 3IDFA 1AGNA 1I5RA 2R68A 1ZKMA 3AR4A 4OSOA 4LECA 4RD2A 4LQDA 3MD0A 2W58A 1DKPA 2JDID 4HRXA 2B8WA 3JVVA 2F8LA 3OFND 3SZGA 1E2BA 2EG9A 4IQ8A 4Y1RB 3UVEA 2P9GA 3HKCB 1EFCA 1JDBB 4DW8A 4R7ZA 2IUFA 4DR5B 5LBTA 3IP6A 4DQUA 4AW9A 4PZDA 4N3NA 3DVAB 3SX2A 4J94A 4NG5A 3BDIA 1QR2A 1MO4A 1G5PA 3D2LA 2HIHA 3GGDA 3L8CA 4Q6BA 2NOAA 4QAQA 3OQ6A 4YGYA 1JSZA 2W2NA 3H8JA 3EQZA 4DHEA 3IUMA 3B60A 3BQMB 5EMMA 3MZ0A 3WKCA 4ZJZA 1C7QA 1G9SA 1RADA 2IBTA 4N8SA 2YWEA 4Q03A 4EI8A 4Y9RA 1XZPA 1X38A 3UXHA 5LZ9A 1C7IA 3IDQA 3OF3A 5B37A 3UV6A 4MDFA 3USZA 1TYCA 1KI6A 3H11A 5BYJA 1ECGA 1E8MA 3NDRA 4RNCA 4MRAA 2XTNA 5F5LA 5FR1A 1CHDA 2IXDA 2AMVA 1J2EA 4NXNB 2P9HA 3LE8A 2JH8A 4ERNA 2XDQB 3OLWA 3WGQA 1Q77A 4B17A 1G5IA 1OX5A 4GD3Q 3GQBA 4PLGA 4YRMA 1LI4A 1FJXA 2CL7X 5ER9A 2AUNA 3A4TA 5JZMA 1V43A 4KQHA 4OHPA 5DNEA 4BGDA 4KNYA 2Q4DA 4BKMA 3AQ4A 4I5FA 3RHSA 1BE0A 4B3CA 4GMHA 4CGYA 4P9NA 1RCFA 1X7GA 2JB9A 4Z2YA 4ENQA 4O2AB 2IIQA 4C0HA 2YZ2A 5BSTA 2J8ZA 3IUJA 4KAJA 2RGRA 2EWVA 5JJKA 2N42A 3AVXA 4PLZA 4OBBA 1VSUA 4ZCSA 1SHLA 4MQLA 1UINA 4KOEC 2EZ4A 2QROA 3TX2A 5DGCA 5D00A 4W8HA 3WGLA 2UYCA 1J22A 2G80A 2IOFK 1ZAYA 2B35A 5GJVC 2PUBA 3QUQA 3QKUA 2R7LA 4JYMA 4RL4A 4ZVLA 4DRZA 3MUOA 1FFAA 3EAQA 4G0QA 2GMWA 4OL0A 1X39A 4WXPA 2XB8A 2HMWA 3RC1A 3IOMA 4NLLA 2QTZA 3VJMA 5K0TA 1RXSA 1XZFA 1ZMTA 2PZLA 4N5DA 4H15A 3ZY4A 4W5JA 2KBEA 5BYBA 1L5QA 2AHOA 3DL2A 3L0CA 4CYMA 3M4JA 3G2PA 5C3MA 1U2GA 3NHFA 2DBZA 1XKLA 2TMYA 3JVDA 1GG5A 2PLWA 3PLRA 3VPXA 1J1ZA 3MT0A 1RWQA 3CXUA 4IXTA 2GZMA 1TADA 1MVLA 4IMJB 1HORA 2ZRFA 2C7OA 1O0CA 2OBMA 2J0UA 4OQPA 4ESHA 4FSDA 1KTIA 1B42A 1U3WA 2XMQA 3EXHC 3Q1LA 4QPCA 1M1NB 4TMTA 3CKLA 5F76A 1GP2A 2Z04A 1JA9A 1GFWA 4AY6A 4WADA 4A2PA 1G7TA 1BXZA 1UM9A 4JKIA 4WHMA 4PPQA 1NUQA 3RF7A 1PWZA 2QUKA 2AG6A 4EA6A 4IGEA 1GCUA 3U62A 2HRQA 1NYQA 4Z51A 2CXQA 3QY0A 4CTJA 5IP5A 3LQ2A 4U39A 3PUHA 3TM5A 1UXJA 2ARKA 2VAVA 3N2LA 3Q0TA 3QQPA 2UZ1B 2XOEA 3JRWA 1N5JA 2HC9A 4L74A 4N48A 3HY3A 4Y7DA 4BNYA 3O83A 1AUOA 2Y1XA 3D9QX 1NJ2A 2I5PO 2FETA 1TO1E 1XQ9A 4ZQFA 4C14A 4BO7A 1CR0A 3QUCA 4YS6A 3RSOA 3D4OA 3A3KA 3HHPA 3MA0A 3E23A 3I0NA 1WZCA 1CP2A 1SD1A 3OLZA 3C85A 4R41A 3D3WA 3FBGA 1RXCA 5IT4A 1QGZA 2IHTA 4NR0A 2FPUA 2X76A 3IUBA 2C8LA 4UBJA 3ESCA 3COZA 1WQ1R 1I9GA 3RNOA 2VPYA 4J6FA 5IWAB 2DBQA 3MYRA 3O8DA 4XKJA 1VYTA 3EZLA 4G8CA 4GWLA 4EKYA 4OHCA 2X7XA 2GBCA 3B85A 4ZPXA 3PE4A 3A4YA 1QONA 1RI3A 5JJIA 3D3EA 4FYPA 4EQZA 4PWZA 3W3ZB 2LPMA 4O4JF 3W8NA 1V95A 3GPIA 4ZT6A 3HSYA 4L57A 2E49A 3IGFA 3NM6B 1KQNA 1DXQA 4MTLA 5CB4F 1YJQA 4ZICA 1ZI6A 2COKA 2VZ0A 1DJNA 3SBOA 1D2MA 1M34B 5EINA 4WZBB 1JEEA 1W6UA 1CJVC 1MP0A 3VTFA 4DZRA 3NHUA 5LQAA 1QOPB 2VDLB 4JBGA 2A0KA 5CVJA 4C03A 1ZMBA 5JBIA 4NBLA 1XXHE 2RHCA 5DOVA 3R8FA 2B1GA 3QPCA 4E4TA 4D5EA 4RFSB 1CT9A 1L7DA 3DS8A 5GJBA 2HF7A 1H9BA 1X8KA 3V4ZA 3OQNA 3BG5A 3FPAA 3G2KA 1TT5B 4ZOLF 4DIUA 621PA 2FK7A 4EHAA 1P5RA 1MQAA 3ZE0B 4GKAA 4ZOQI 4TXMA 3TUJC 5JDCA 5ALFA 1CRLA 1EGQA 1RCTE 3NRBA 2PG3A 5K0CA 3URKA 3KB6A 1AIPA 3QPAA 4CTOA 5IX8A 1UPAA 4Q3NA 2YHUA 4Y2VA 4MW2A 2OXRA 1U0LA 3WI7A 1GUFA 4Z3DA 5JY6A 2I3AA 2PU5A 1OH5A 1Y1KE 3GLKA 3E7DA 4PGMA 2W70A 4KPEC 2ZIWB 3LRPA 1KFKB 3NHYA 1MA0A 1XQXA 2ZRCA 3C3AA 4XCQA 2ONJA 3ZHQA 3SKXA 3U7HB 2CT8A 1WU8A 3AVOA 3QLEA 2ORYA 3M6LA 4H2DA 3L7BA 4PX2A 3DEKA 3CUUA 4RF5A 1D04A 3GPCA 2D1FA 3NFYA 2FZWA 4QAJA 2V6MA 3WK9A 2V58A 1Y3DE 4ZZIA 4IH4A 3H2JA 4J0CA 4RH1A 1KQ3A 1XYVA 2YKGA 2F55A 1SGWA 4NHEA 1CLEA 1U65A 2WHXA 5HXAA 2H9IA 1U80A 5C7OO 4HZUA 1U2SA 3UHPA 3GRFA 4BO6A 4TQAA 2EJTA 2ZIXA 1NF9A 3K6KA 4KO2S 2ZUWA 3FSGA 3TBKA 4JASB 2VSYA 2XB9A 4IPTA 3CR8A 3CZ4A 2CFOA 2V98A 4ZODA 3G49A 4HDNA 5HE8A 2J5XA 2R2AA 5AQ1A 1WF6A 2VWGA 1M6YA 1XYGA 2YQ4A 1VJRA 1R2QA 3M6VA 1I4EB 1L5YA 3CKYA 4QYTA 2XNKA 5DT2A 3WIBA 4YRSA 4M99A 3AM1A 4B6QA 2QTFA 4FCWA 1G8HA 1XCBA 1KZ6A 4FX2A 1DIHA 1VLMA 3EXHB 1CX9B 2C3UA 3FPSA 3O94A 4QFDA 4X20A 5AM4A 3TW8A 3PEUA 4TLBA 2OD9A 1ATIA 1J23A 2WIAA 3WDSA 3GLFE 3Q2KA 3L82B 1GT6A 3CH7A 2CXOA 1PN3A 1WCIB 1TUBA 1GADO 2A1IA 1OTXA 3FIUA 3L6CA 3T35A 4D9BA 5I47A 5F33A 3UT5A 3EARA 2NN3C 1V5EA 1EBFA 1QGOA 2J0EA 1E1RA 1N5LA 3L92A 1BHO1 1K8ZB 6REQB 2YYZA 1OPXA 3BH0A 3O4HA 4KXQA 1FFGA 4B3BA 1JHDA 1GZ6A 1THTA 5FRDA 2BRUA 4RVSA 2RH5A 1W85A 1FVXA 1QGED 1P0PA 1NBWB 1SU8A 3EEBA 3CZMA 3EUFA 3HHEA 5DBIA 3VUFA 8LDHA 3IEXA 5K8IA 3O90A 1JEJA 3OA2A 1UQRA 3AFGA 1YULA 3KXPA 3HYNA 1NW9B 2AVNA 5HK8A 3ILHA 2XAUA 3LU1A 3P1JA 4RF2A 4L78A 1XE3A 4A82A 2WM9B 1MDFA 3TRFA 3DP9A 5K0FA 1MFPA 3ICQB 3G5LA 4NG4A 2AYZA 1CUJA 3IPAA 4ZI2A 5IUJC 5JFOA 3K4QA 5BO5A 2NV2B 2NG1A 2P7HA 1X19A 5BXYA 1MPXA 3DZFA 4TKUB 1J8MF 1QK3A 1G8GA 5HIJA 5KO2A 4GI1A 1KF0A 2YWFA 3ZW9A 4RTQA 3U09A 1H4TA 1IG0A 4JJGA 1PEKE 3KD2A 1LNSA 4TQUS 4DADA 2O19A 1AQLA 2EFDB 2FEMA 4FFNA 4HTFB 1V3TA 4AZ0A 3CKMA 4W9NC 4ASUA 5JCJA 1HQDA 2Q1UA 4PLWA 2C9DA 5AJZA 4NBKA 4AUKA 2RHTA 3T7JA 3U0VA 4MMXB 3ZJUA 1N3LA 2G04A 1L5WA 2I34A 1FQKA 1QGAA 4CN9A 3I9KA 2B0CA 1D0SA 4WBSA 2VAWA 5E3IA 4QEZA 1OZAA 4UC0A 2BMEA 3CF4G 1NTOA 1IRIA 1IZ9A 1EG2A 4D4JA 1QIIA 3WA6A 4DR7B 4EAAA 1C8KA 2WWGA 1RWKA 1NWHA 1N2CE 2HCRA 2FZLA 1MIOB 3CRRA 1XJQA 3IT0A 1ZWKA 3BRQA 5KVQA 3AEXA 2D5LA 2E4WA 4IVNA 3GJ6A 5KNDH 1YFJA 5KYWB 2YZ7A 2PX4A 4BLPA 1NKTA 3V55A 4KOAA 2IS2A 2NYVA 5FWXA 1EZ1A 2ZXFA 4PC1A 4B6OA 4FOSA 4D3XA 1L7VC 1N6OA 2Q2NA 4NPCA 1KZ9A 2H59A 2O7SA 2IX3A 3ZV4A 3S3TA 5DNYB 2HLDD 3WRXC 5JBQA 2ZPUA 5F9MA 1F8XA 4RSMA 1JHPA 3RADC 3L1KA 4EY8A 2QRMA 2VFAA 1W4BA 5A6SB 3D8SA 1Z16A 1QH1A 2VUIB 3BGOS 1U11A 1U81A 2ZIAA 4J29A 1R64A 1YTUA 1KQPA 2FE4A 2ZVJA 4IJVA 1VP3A 4RH3A 3WLHA 5AW6A 5JAQA 5IMBA 3E6AA 1QZZA 5AIAA 2WB4A 1NVTA 1O54A 5JXHA 4MQEA 3THOA 1W52X 2BDEA 4Y67A 1U0RA 2QT0A 4XYGA 3TTSA 1KXJA 1XZQA 1Y6GA 1JTFA 3TMAA 2D0DA 4HPXB 2QTLA 2FN8A 5DCUA 3M3PA 2H4XA 3GJXC 4YP0A 4EF5A 3ZY2A 4F9TA 5F73A 2AL7A 4MW7A 4QQNA 4BU1A 4JOBA 4TMYA 1OHHA 5EJ6A 4RAQA 4RHUA 3VBCA 3VV2A 5H80A 2JKZA 2WJGA 3WY9A 5MN4A 1UBFA 5KS2A 1G2QA 1JT9A 1HNNA 2FTKE 2WF5A 2CHVA 1RABA 1KBZA 2Y1OA 4DCVA 5BRJA 2MU1A 4Y9DA 3RO7A 2AR7A 5IVHA 2AG5A 3JASA 3ORHA 2NXNA 3FTPA 3U7EB 1XZMA 5FX2A 4ZVQA 2HK7A 4RENA 3T95A 2P5UA 3SXUB 2AE1A 5CDGA 1NV8A 1T9CA 2Q3EA 1RBYA 3EGCA 3GX1A 3M1IA 3PGKA 1GNTA 2CNDA 2OHJA 2BGKA 3IOBA 3Q15C 3DT8A 4FJ2A 4ND7A 4DAOA 1ONPA 2WE8A 4M1KA 2ORWA 3AR7A 4L08A 4MJ7A 5TGDA 1HNWB 3VMFA 1HNXB 1Q6ZA 4DV2B 1NVVR 3FBWA 1NQ5A 5CR9A 3KR2A 2VXOA 3CHYA 2ZP1A 1EHCA 2NX2A 1PZMA 4KLRA 5K3OA 4IJWA 2HK6A 1FYEA 2VF5X 5AHOA 3WGKA 1Y98A 1NVWQ 2C9BA 3KSMA 4AMZA 4CDGA 3K9HA 1R16A 3TL2A 1Z8HA 4DSNA 4EEZA 1TL7C 1BFKA 3D6AA 3F7MA 1NHWA 4X8HA 4AD8A 1A4RA 3Q10A 4BQIA 1TM7E 1RU3A 5EOVA 5FB3A 1J0AA 4X41A 3EZXA 2C8JA 1T10A 1NOJA 2G4CA 2QK4A 4DRXB 1VPVA 1WCYA 5BUQA 1AMUA 3N74A 2ZE6A 4NK4A 4EA9A 5CNKA 1H0HA 1T91A 2VQ3A 3OO0A 1UJMA 1T1JA 1KEVA 1SXJB 1ZU4A 3HXMA 1HOTA 2Z43A 4G0OA 1R4MB 3ZNPA 4A26A 5KB3A 5KVCA 1J0CA 2GK6A 7YASA 3AF0A 2IDKA 4O4IB 1VHQA 5CDHA 2YDXA 1M2GA 5CYOA 1Y9ZA 1II8B 4TMKA 1Z5WA 3GP5A 3IMEA 1MXFA 1PD1A 4C6HA 4HNTA 3OFSA 5C81A 2Y71A 1WF3A 1MIHA 2XLBA 4M4SA 3PS9A 3ESYA 3BFJA 4ZK6A 2J5KA 1X3SA 1JP7A 4HDCA 2AK3A 1ATZA 3RUHA 3MTEA 4POOA 1CJCA 5JD6A 4YUVA 1X7ZA 4QGAA 1XAGA 5JI2E 2D2EA 3PJDA 2PWAA 4KQ2A 5ULLA 4FYMA 3QZUA 2DKFA 1KDTA 2JW5A 2HQ1A 2WJWA 2HCJB 2O14A 2QRUA 3PUIA 2DUJA 2CXXA 2EOAA 3U7IA 2D0IA 4B7UA 4EG1A 2QD4A 4IX1A 3ELDA 3DZHA 2EXXA 2M1XA 2B25A 2DLCX 1M75A 2WK1A 1Z5PA 3GARA 4TWBA 2WP0A 4WKCA 2C82A 3R40A 2J9FB 2OGTA 1Q0UA 1GKLA 3ESDA 1NF2A 4ID3A 5D6NA 5EIWA 5F4ZA 3UWPA 3WLTA 3LDFA 2BC9A 4I8XA 4EJMA 5KOHA 1T5HX 3GT4A 4K9MA 1E9EA 4UBLA 4LBYA 3B20A 3O7MA 3KB1A 3L77A 3T3DA 4OI2A 1PFUA 5ERGB 4LDAA 5HQJA 1CF2O 2Q4RA 5AJUA 1G8YA 3ZTWA 4H35A 3IBCA 3B6JA 4KYIB 4DMFA 1ZL0A 1PRYA 1P7PA 3N2NA 2C7VA 2BI8A 4LZOA 2BGRA 2B5VA 3VR4A 2BV3A 4ZVOA 2FF7A 2QBYB 4YP5A 1Z07A 2OCLA 4TPKA 3DWEX 1SVSA 2ZJ5A 3HV2A 3PPXA 4EL0A 5CG1A 3P52A 4A6PA 3ORRA 2C2BA 2C9MA 2WFMA 3HU2A 3O6VA 4QTTB 3EDMA 2XNDA 5LBIA 1B16A 5I9BA 1C1XB 1IH8A 3WB1A 2CUNA 4CMGA 3E4DA 3WAGA 3PX2A 2PT5A 4KLAA 3UWKA 1KH1A 5TMBA 4H7FA 5LQCA 5LZ2A 4E3ZA 3DOEA 5TF0A 3CZCA 2WTBA 4PSVA 5JJ5A 5KTSA 1J97A 1FLVA 5EP4A 4CT5A 4RTRA 2MJLA 1M6NA 1VPEA 1BE8A 2HMVA 2GCGA 3UMBA 4C0QC 3UZUA 4LFBB 1IFXA 2NSJA 4I19A 3T0IA 1Y3IA 2CHUA 4DNQA 1SZDA 3QLUA 3R6LA 3O2QB 2EYQA 2YXPX 2HM7A 3CCBA 1G1MA 4FFVA 5AIBA 4ENRA 2H1FA 6AT1A 5JQGF 3KDAA 4IRUB 5EXEA 3HK2A 4YRPA 4G97A 2WZQA 3KKPA 1W5AA 3FCSB 4PG8A 3ZWBA 2E4UA 3AUTA 4CV3A 2A9VA 5BNWA 2Q9AA 3ZQKA 4TUYB 2Z5GA 3L1JA 3M1YA 3ZWOA 2YN0A 4LK2A 2VIIA 5KNCH 1AD2A 1DEHA 1JA0A 1PUIA 3MT8A 3NIFB 4IMRA 4NBUA 1MX1A 1YJXA 4Q1EA 3OJ0A 1G8JA 3NG1A 3G2JA 4CL0A 4LDRA 4OX9B 4G56A 4QREA 4XARA 2HNBA 5SYNA 3WR5A 2X2FA 2Z8YM 4G07A 1UKAA 3GNTA 4FT4A 4WCFC 4W7SA 2HN9A 2PX8A 2O8NA 1QTIA 3P2MA 3MFQA 3IPXA 3B7GA 3WYCA 5KTYA 2ANBA 3ZDCA 4C43A 1N8NA 1Y6FA 1S2GA 1PU2A 4XD2A 3ZY3A 3T3NA 3NAQA 2P0AA 4L8YA 5ALEA 3RKUA 4KIFA 2HO5A 1E2KA 1WZIA 3DOIA 2CYCA 4AI6A 1TRHA 3AMVA 1NRJB 4EZIA 4NNOA 3DZDA 3KYDA 5JDIC 2L18A 2FDXA 2CVHA 3LT5A 2G7ZA 1LVUA 5SZJA 3TXXA 1K8RA 1VMIA 3L1VA 4RCVA 4TROA 4ARSA 1NBMD 1TYEB 3DF9A 3FZGA 4L5IA 2WIBA 4M49A 1P91A 4WLFA 3OP4A 3T7SA 1KARA 1DS6A 2FLVA 2O2EA 2OYSA 3E27A 4ZKDA 4FTWA 5AOBA 2YOGA 4J16C 1Z82A 3FRJA 2Q3MA 4AZ3B 4CFSA 5DNUA 1J0DA 1LSUA 3OEWA 3QUAA 1KMMA 4YYZA 1PYDA 5AKHA 2HGZA 4OFBA 2Q2QA 4ZQCB 3WYDA 1SU4A 3HY4A 1RXIA 3JQ8B 4WK2B 1WR8A 4FMPA 4BQRA 4HUTA 4YAIA 4LUCA 3RU2A 2DUUA 4FIDA 4P31A 3THSA 1RJEA 3I0ZA 1OFTA 1GQOA 2BJWA 3OE5A 2Y1GA 4QT0A 4PYNA 4DR6B 3OHSX 2ZUUA 3STTA 1M0WA 3HFRA 2D59A 5HF5A 4URVR 3MN1A 2QUZA 3BL8A 4OLBA 1IOZA 5EZYF 3T06B 4Q16A 3N8GA 2AT1A 2ID4A 3ASVA 3Q3VA 2IZ7A 1N4DA 2JFHA 4F5DA 1Y9EA 1BAPA 2VHQA 1NYRA 3AUXA 4RZXA 2O7VA 3GPDG 1M76A 4UCQA 4REOA 3DDNA 1T4CB 3DT6A 2OORA 2JZNA 1C9KA 4KXWA 4MRVA 2AXPA 3ABIA 3KJZA 4UNIA 2HREA 3V4LA 1TYZA 2FCRA 5E9AA 4HWGA 4R51A 3PA6A 1A8SA 3FAKA 2R7KA 3L02A 1ULHA 1G5TA 1AHIA 4E2YA 5JWRA 4J3JA 3BCRA 3URMA 1PNTA 2AVDA 3EK2A 1M7HA 2KSQA 2V74B 4O4HF 5HF6A 4II3A 2H65A 4DEXA 4E15A 3KZXA 5IKPA 3VZSA 1ZRNA 2PVPA 2RE8A 2VNSA 5F98A 2GJSA 4J49A 5HRAA 1QWSA 3PT9A 1GCOA 3LG2A 3QKIA 4IHQA 3VM6A 3HVRA 4DDWA 3MJRA 3V1MA 1A7KA 4Y6LA 1YV9A 3VYVA 2R8PA 3GJZA 3LV8A 3DDCA 2QTMA 5CFPA 4KN9S 2ADMA 2Y68A 3C8MA 4HQ0A 2PH3A 3F3KA 3I5UA 5GTDA 3IHKA 1IWOA 1P31A 3R3SA 4GPBA 4CM3A 2ZW9A 1V3VA 4YWHA 1Q44A 1EEHA 1L4EA 1UODA 4UXIA 1RWVA 3OKFA 3PKJA 1Y8AA 3RNLA 3HA3A 4AF7A 1QO0A 4C05A 1U0OC 2YY6A 4OSEA 4CKYA 4IQGA 1I1HA 4RGQA 1W0KA 3A4LA 1Z7BA 1Z56C 5JEEA 1VKHA 1T1RA 1SKBA 1YFKA 2F1IA 1HUQA 1SOUA 2QZ4A 1M6EX 7ADHA 1BYIA 3A11A 2QX6A 1DG1G 3ODGA 1BHSA 3ED1A 3M83A 5T7BA 1IWPB 4Q5IA 3X1XA 3LLUA 1RP1A 3N5KA 2AC2A 2XOKA 2A0WA 2WYWA 2D1QA 1QORA 2BDTA 4UHJA 4UM9B 1LFAA 3AYXB 2E4ZA 1JZTA 5IYZF 1GDHA 1GGMA 1HFJA 4H7IA 4MVXA 5BR7A 2D0PB 3T7AA 1PR1A 1US8B 2EFEB 4M8NE 2GAJA 1LDGA 1AN0A 1GTL1 1ZVJA 4INZA 2MSLA 2H0QA 1ZS9A 1JIIA 2PGAA 2P5SA 4QQ8A 3EEQA 4X3OA 5J4VA 4MGEA 1P8JA 4URWR 4F8JA 3D81A 1G9XA 2PQ0A 1NY6A 1IY1A 1EXNA 2PANA 1WU7A 2ZBGA 4I3FA 3TPZA 4RKWA 5F23A 1HLPA 1HEYA 4Q4LA 5IXSA 2W8BB 1LLCA 2B1JA 2NYRA 5EZ6B 5INTA 2VQ6A 3F7NA 4MW4A 1GPKA 2ODBA 3G3EA 2B36A 4X1IA 4QWMA 2NU8A 5KX5F 1IXKA 2JIOA 2X19A 4P7FA 5DHRA 5DYGA 4D92A 4JP5A 1JEOA 3WWZA 3UAWA 1FDRA 2ST1A 4HDSB 3EXFA 1E3SA 2D1RA 5LXTA 1O94C 4I1SA 4I4IA 3NWPA 3ZU5A 3A7DA 4M9UA 2YWCA 3W2EA 2YYAA 3M6XA 2HAEA 3IMKA 1S89A 1TM5E 2NO5A 3JXEA 3L49A 1PNVA 2UVPB 3HGQA 4O0MA 1WNTA 4OUKX 4C2AA 5LN1A 4D6PA 2G1PA 3VR2D 5ILQA 3E7WA 3UUGA 4LMPA 1J21A 4BNLA 4JYPA 1I1NA 2ILTA 3BULA 3NIWA 1GA4A 1QG2A 3X1MA 4U9HS 5ICSA 3PR3A 1AS2A 3OFJA 3LWDA 3GFGA 3I2HA 1QVWA 3I4LA 3UMFA 2IXTA 4U7JA 1R0RE 2XGSA 3P5SA 1N36B 3HKBB 2CDCA 1KI7A 1JWBB 2B6NA 2PMCA 3HNOA 3HJRA 4JLBA 3L18A 1X42A 1DUSA 1ECPA 1CUGA 1JSRA 4HDMA 3X1WA 2AXNA 4LRQA 2GDZA 5DSZA 4HGYA 4MUKA 1LF5A 3A1UA 4MSUA 1EIZA 1EVKA 4X45A 3ZGVA 2IE8A 3K70B 4ZHQB 2WT9A 3D54D 4AX4A 1ENPA 1Q83A 1H1DA 1Z6GA 1UPCA 4LHYA 4PLPA 5EI5A 3BIJA 1TCAA 1HQCA 4WRRA 3GEEA 1L8LA 1XI2A 4R8MA 4C9BA 5FOQA 1FRFS 1UJBA 2HK8A 3QVKA 4HS9A 4A0SA 1E20A 1G3RA 4DJDC 4YJ2A 1G291 1SHJA 2W4IA 4OAQA 1E1KA 4OPMA 3SSAA 4HDRB 3GLIA 1NDUA 2X0IA 1KSGA 1AGRA 1R8JA 1RR6A 2I03A 3KUKA 4B5LA 1EFKA 3UA3A 3P71T 5JNTA 5JPDA 4X5OA 3CFYA 3UNXA 1CJBA 1N78A 3QLVC 4W5QA 1YHYA 4MA5A 1FBNA 2ZDQA 4R8VA 3ZTTA 5KSYA 1KKLA 3MTJA 3UBMA 5CBPB 1JXMA 1WSBA 2OGZA 4ZDKA 4BJ5A 2OESA 4RPLA 5AJVB 3RYIA 4B79A 4DIMA 4YMHA 1PW5A 5K99A 6PFKA 4LC0A 1P5JA 1EDOA 1O6FA 1DRJA 1KEKA 2E7ZA 2HNKA 3EZYA 2CEAA 2VKTA 3C45A 4R40A 1F0KA 3TG8A 2EBWA 5LP1A 3RGGA 4CDMA 1PJ4A 3AUJB 2I2AA 2C5SA 4OOEA 1VHTA 2V0CA 4HB2A 1UBRS 1RKQA 1X8JA 4JC8A 3W8FA 4DB2A 1CY2A 1AMNA 1M1YB 1QK4A 2EFGA 2RGUA 2WWTA 1XMQB 4YAGA 4GT1A 4K86A 3RSZA 5A5EA 5J4YA 1QLHA 5KYTA 3G8CA 3NUGA 4EZEA 1TGYA 1KJQA 4JUIA 1U3VA 4JNKA 4DV0B 5JOQA 1LLFA 1C50A 2XSZD 3DAPA 3OEED 4HFNA 3HDTA 4NMXB 5CA1A 1P72A 1OA1A 4TVSA 2O7RA 4WBNF 2AR0A 4H7EA 3SI7A 4G4JA 2VSFA 2WOOA 3RTDA 3WXBA 2WWVD 2P6MA 4BUCA 4DQKA 3D7NA 5I9TA 4WESA 2RHDA 4QXOA 5A9RA 5EHIA 3RVKA 1O8CA 3W78A 1VE7A 1P2FA 1YB4A 2YHIA 3I53A 4DZZA 5KNBH 1KO1A 3K96A 3N2YA 4A03A 2ZSBA 1I6WA 2N47A 4GAEA 4WUTA 3UHJA 5CP8A 2ZB8A 1TAGA 4Q39A 2OYRA 4LJRA 2ZIFA 1WP4A 3TLJA 4D8WA 4EVQA 5IJWA 1P7CA 3HEBA 2PX3A 2BFAA 4JR1A 4BB5A 4AWXA 1G2IA 3R2JA 1JHMA 1V3QE 4P84A 3HVIA 3UTCA 2YRFA 2L82A 5MFPA 4I4TF 1JX6A 2N75A 4LOKA 1AZSC 1XNHA 5AM5A 3N2IA 1G19A 3MQFA 3L8ZA 1RQ7A 1PBTA 1U9IA 1ZPDA 4Z1MD 2NUTB 3HWSA 5BQ5A 1OAOC 1SCKA 1WM1A 5KUTA 3KRTA 1ZC3A 4WKPA 1OXSC 1SZJG 3DL0A 4LZLA 3RBZA 4ND3A 1KS2A 1R4ZA 4LN1A 2AZ4A 2ZRIA 4H1HA 3TZQA 3UXMA 5GQSA 1E9RA 5KYYA 1N5IA 2GD0A 1CS0B 3R5FA 3B7WA 5JRJA 2JAXA 4XB1A 3ZEIA 2C4NA 5LMCA 5FUXA 4O25A 4QSMA 3B52X 4PSDA 1C3XA 5K8JB 2E0IA 1A8IA 3L4KA 5EMKA 4AS1A 4MVJA 5C5CA 4WCDA 1SVKA 3K0SA 1QRTA 5KREA 2IZ0A 3WHLA 2UU9B 2E3JA 4HEQA 4HGNA 3TLCA 1K66A 3PR2B 4FNMA 4Z3KA 1AO0A 3LUGA 3SP1A 3LVRE 1H2FA 2GUWA 1RZVA 3O4JA 1ZVKA 2GYVA 2AD5A 2FEKA 2ZVQX 3EYAA 3KFLA 3OT5A 4IIVA 2BLNA 4J4BA 5AI0A 5EQTA 4F7WA 1B23P 4EO4A 3W3AA 3RC9A 2CNKA 4QDJA 2OM6A 4O2BA 2A5DA 3TZHA 3PC4A 2DKNA 3KZCA 4YBZA 5FIUA 1SKYE 1V5WA 1BA3A 1E4EB 3H17A 2NAPA 4I6JA 4NS4A 5HMMA 3SJCA 5FUQA 4ZVVA 4QECA 2ZJ6A 1A9RA 4FKMA 1IBKB 3GJ0A 4ND4A 4BP8A 2DFNA 1GIAA 4JGBA 3WQRA 1C8LA 1SCBA 2J3QA 1EB8A 4EG8A 5BSFA 3X0DA 5CVEA 2V7GA 3S1AA 3VTZA 1GR0A 2WF9A 4CF6A 2A3RA 4LNAA 2BR4A 1U6JA 2IYXA 2DTEA 4CM8A 4L5BA 5DU2A 3GVIA 1QLWA 2XUKA 5EUBA 2WFLA 4BNUA 4CT0A 1HE4A 4OQNA 5JTUA 1VHWA 2GI4A 4L9SA 1M2VB 4N03A 2HMSA 2N9UA 4R9SA 4AO7A 4OFWA 2Q4TA 5TQ0A 4TTPA 4B73A 5J2TB 4RE6A 2C5LA 2PRSA 1JIKA 4JJ4A 5JCOA 3T9BA 3BORA 3KYCA 5EUMA 2JHGA 5T6MA 4DUZB 5JIBA 3FHLA 4DTCA 4WJZA 1XRMA 1Y8RA 3WGHA 5HQ3A 5IXJA 2VTBA 4CR6A 4ZYVA 2XB4A 1C1YA 2XV1A 1UPTA 4FMBB 3C6BA 3UW3A 4BMOB 4YJFB 4C7MA 3QUSA 3AO0B 3QH4A 5K6AA 1FDWA 1DCKA 1UFRA 2AGVA 4K1LA 4BGVA 4R1MA 3ADCA 5IHPA 1JU3A 5J40A 2GT1A 3M6AA 1S4QA 3AW9A 2AOUA 3CUEF 3QPVA 4BLRA 3TG2A 2JJ8A 2NVUA 1XDGA 2Q1TA 3HYTA 1GQRA 1PSZA 3OLVA 1C30B 2J6IA 3I92A 3TIVA 3TQOA 3ZU4A 2IEBA 4QG3A 2NO4A 1QX3A 3T7DA 4MUMA 1EFPA 3R5XA 2VRNA 4KWHA 4NBRA 2JKVA 4Z9XA 2PYIA 5H3HA 2JHCA 2C29D 3H1GA 2VH1A 4UATA 1S2IA 3KZKA 5HKLA 3ZXYA 3THYB 4B3GA 1ADGA 3K5WA 2GRAA 5U4QA 1YQEA 3KPJA 1IY0A 4DSZA 2R66A 4MIYA 4R1QA 3PDIB 3DD5A 3T4EA 3UAXA 2MYTA 3EHEA 3E35A 3MMXA 4A73A 2YJ4A 4FW8A 1FTNA 1AF7A 5LDDC 1DAOA 1U8AA 2YL2A 3SXPA 4I5GA 3AFIA 3KEMA 1TCVA 3A27A 1M1XB 5CT8A 2EIXA 1NOIA 4B80A