3QVUA

Crystal structure of ancestral variant b9 of sult 1a1 in complex with pap and p-nitrophenol
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
288
structure length
288
Chain Sequence
b'SRQPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFNRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPDPGTWDSFLEKFMVGEVCYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTIPQEIMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfotransferase 1A1
publication title Directed evolution of sulfotransferases and paraoxonases by ancestral libraries.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2011-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qvuA00
4KSBA 3RAPR 1MO4A 3QKSA 1OFIA 2YNMA 2QAGA 1KY2A 4D0NA 4FIDA 5FPSA 2W6ID 5JEDA 4HLUC 2QQ0A 1OKKA 1Z0JA 3TRFA 2QI9C 3OAAA 2CDNA 3V9PA 2DY1A 4ZKDA 1G4AE 3LO5A 3PFIA 2IWHA 4KV9A 1V5WA 1NVXQ 1KK3A 2J46A 4OJQA 5DIFA 4RZ3A 4A36A 2BM0A 1AKEA 4RFSA 5KNCA 2D74A 4JLVA 1NLFA 3ZZ0A 4IJMA 5F98A 1VG1A 2QRZA 3ETLA 1KNXA 3AVOA 4KAXA 2ZJAA 3P4XA 4I99A 4KJZA 3GFPA 2KJQA 2A3RA 2D2FA 3DM5A 2IHBA 3KXKA 1XPRA 1EESA 4B73A 2G1JA 1II8B 1AS0A 1NN1A 4AIIA 3BWDD 5J4KA 4CW7A 2GHIA 2H18A 4I1VA 1L2TA 2RB4A 3L0OA 2GXQA 2VSOA 4QJ5A 2RGDA 4LV5B 2Y8EA 2FDCA 1VIYA 2V1UA 1U81A 5IRCD 1S2MA 4DT1B 2WVJA 4JIMA 2OLKA 4BRWA 4JSYA 4BFZA 2NMVA 1H65A 1L4YA 1NMZA 2EFCB 3EXAA 1IN4A 3GJ3A 1E2PA 4LHZA 4LYFA 5FTNA 2ZAOA 2HJVA 1F6BA 4YQFA 3B1XA 2EFHB 3L8YA 3NTUA 4GNKA 3FVQA 1VG9B 1H8EA 2QEQA 2ZJ8A 3QF4A 3B13B 1P2SA 4DB4A 5DI9A 4DT1A 2OLJA 5SZHB 1FPMA 3ZVRA 4DLTA 2O8EB 1TEVA 2EW1A 1M7BA 3TNFA 2IC5A 2OBMA 3FHCB 1EFTA 3E2IA 3THXB 4NPHA 3GLIA 5FL3A 1OFTA 3QPUA 1CJTC 1QHNA 1I2MA 2W58A 3FWYA 4LJ4A 3B78A 5FPTA 3RS7A 2PJRA 1VECA 1MO6A 1XDBA 2REOA 4V0ME 2ZI6A 4LJ8A 1UFQA 1O87A 3THWA 3K70B 3VR4A 4TMKA 3UK6A 5EUQB 1IN5A 1JPNA 3QVUA 4L16A 1U0HC 3EC2A 1VKJA 5CB8A 4YMVA 3PUYA 3AM1A 2ZRFA 3I92A 3DVLA 4NHOA 5HR5A 1XU4A 2CK3D 4NONA 2GESA 4V0NA 3IIKA 3C5HA 3DKPA 1KZ7B 3GLGB 3U4QB 4QFMA 2ONKA 1YQTA 1CR4A 1X1SA 4NU0A 1FW6A 4V0LA 2WICA 5EP3A 5K8UA 2RKOA 1X8KA 2DFNA 1WBDA 2ZROA 1WMSA 3EWAA 4ZKEA 4IXNA 3IILA 2XTZA 4HUTA 1ANKA 2CNWD 4NH0A 2GJKA 4EIWA 5JMTA 2DPXA 1YR8A 3DPUA 3U4QA 3BS4A 2JA1A 1KI9A 1X8JA 3LLUA 1EFRA 1OIVA 3IIJA 5BYKA 1UADA 3LH5A 2WWGA 2HCJB 4A6PA 2HT1A 3CBQA 1J99A 1W36D 4BEJA 5FR2A 2JAQA 2DWPA 1T5LA 3LQQA 2JLUA 3RDPA 1P72A 2W2TA 1RFLA 4MRVA 4B76A 2XXAB 5G3ZA 1VYUA 3TLXA 1KK2A 1SQ5A 1XTJA 1M8PA 2QZ4A 5C4MA 2D2EA 3PEUA 4NZYA 1ZBDA 3QUSA 3U5ZB 3OFND 2ZRPA 4MRNA 1W7AA 2XTNA 4HB0A 1N0VC 2A30A 4LHWA 5SZIA 4ZDWA 3W5JA 4JVNA 3Q3JB 3ZQJA 1UDWA 2OM2A 4QL3A 1EWQA 3LY5A 3T1QA 1E9SA 1N6HA 1QZXA 2UZIR 4Q1EA 4XTRA 3LWNA 3SQXA 2IXFA 2IYRA 1OFHA 2QTFA 1YZUA 4OK3A 1RRPA 4ZV4A 4B48A 3MJRA 2ZYWX 5FUWA 2GVZC 3A4NA 4IFBA 3NDBB 2GXSA 2Q9BA 4DC9A 1WCV1 2IXGA 4MYUA 4IDPA 3AVYA 3NBYC 4WIAA 1BYIA 3AVWA 5FOXA 1T5IA 4L5BA 2JLSA 3I32A 3CKLA 4NCJA 3VAAA 3QJYA 5JWHA 5AK0A 4XWKA 1FX0A 1OYYA 1DAIA 2DHRA 2RCNA 4R9UC 4S35A 4B2IA 1W36C 2ZI7A 5CIQA 3WNDA 4JVLA 4FW9A 3FKQA 1UPTA 3K53A 4MGIR 4G01B 1S1CA 1TQ6A 4N0DA 1GIAA 1DVRA 1QDEA 4K8OA 2GCNA 4M1TA 1AIPA 4Q48A 5E7JA 1RJ9A 1IN8A 3V00A 1Q20A 1E6CA 2HXYA 1P75A 3P32A 5DI3A 3OIWA 4HEJA 4QGFA 5FPHA 3PEWA 4QXAA 1E4YA 2OXRA 2QA5A 4KVAA 3AF4A 4YLGA 3WHKA 5J4VA 5DSZA 2WJIA 1GNQA 3N5CA 4JJKA 5CDFA 1YHNA 5CYOA 4B75A 2PEYA 3B1WA 1RIFA 3KDSE 3SDZA 5IK2D 2H16A 3VKHA 1JEEA 1E3MA 1YR9A 1CRQA 4ZO4A 3DDCA 1EK0A 2OBLA 4M1WA 4TT3D 3TQCA 3A36A 2ZU0C 3FE2A 1KMHB 4PZYA 1E69A 3Q7PA 2OCBA 3QF7A 2GJAA 2OE2A 3RANA 3LBIA 4RCYA 2J7KA 2GCOB 1JR3E 2JIZD 1YZNA 1V43A 2VEDA 4LC0A 1YZQA 1XCGB 4O3MA 1XPUA 3ZD7A 1KO1A 4Z8YA 2ZQ5A 5EQTA 3CX6A 2QE7D 3GJ0A 2RGNA 3HR7A 4CEIB 1DAMA 1MKYA 5KYKA 4B3FX 4GT1A 3EIHA 4YDHB 1KMHA 2BC9A 1NG9A 3EWSA 5HKKA 4QOSA 4A1FA 2PLRA 2YJTD 4JS0A 3GEIA 4UNNA 2GCOA 1NF3A 1TU4A 3A1TA 1TEXA 1HQCA 1R7RA 2WSSD 3BK7A 4L8GA 1DAHA 1UBFA 3SE0A 4OK5A 2REXB 4GDFA 1W0KD 4IOMA 3DL0A 5DO9A 4LJAA 1P5ZB 5FUYA 4CEIA 2C04A 2W2XA 5A4JA 2D7DA 1W46A 2F1HA 2FU5C 3A37A 3S1AB 3W8RA 4YMTA 4DUGA 3O8BA 2QQEA 1S3SA 1ZCAA 4BFYA 1QHXA 3X2SA 1G1MA 1E0JA 3WYFA 1SVOA 3Q7QA 4UKDA 1A2KC 1JQLB 3JZMA 4PO8A 4DLZA 1CU1A 2E1RA 1QBKC 2G1KA 3CB4A 2CL7X 4PAQA 3KFXA 2C5LA 2I1VB 1NKTA 1PLJA 2B8TA 3N2IA 4OK6A 4I4LA 1Z6AA 3S1AA 1E2EA 2C99A 2WKPA 4QM7A 1HT1E 3IPYA 1JB1A 1G6HA 2QPAA 5EP2A 2QY9A 4GMXA 3C7KA 1A2BA 3OEHA 2QN6A 3GP8A 3T1OA 2IUUA 4EJSC 1P61B 3I1FA 4LSGA 5E3HA 2A5FA 1ZMXA 4WBSA 3CF0A 3NKVA 2BMDA 5F9HA 1OFUX 4D82A 4B6FA 1S9DA 4L15A 3ZJYA 5L3SB 2NOAA 2VTKA 3SC3A 2QP9X 2PLFA 5L3RA 2HCBA 3KX2A 1NVWQ 1PUJA 3K09C 3KKNA 3U6BA 3FKSA 2AKYA 1GRQA 1OT3A 1GFIA 2ZRAA 1KHTA 2EFDB 4K81B 2N1BA 2ZSFA 5L3QB 1GL7A 3UIEA 2YOGA 4IVRA 1R8SA 2PT7A 5FBQB 3UMFA 1Z63A 2RH5A 4LJ7A 4LX0A 3BB4A 2KBEA 5L3SA 4D2IA 2IYQA 2IS2A 4C0SA 4PHHA 5AUOB 1IN7A 4CIDA 4M1YA 1COWD 2IUTA 1ZUHA 1TF5A 2V8OA 1OLOA 2GXAA 2X1VA 5L3QA 5DNYB 4FMDB 3IBYA 4DXAA 1XB2A 4QBFA 1U99A 1RYHA 2QGNA 3CRMA 4HATA 3IBGA 2ORVA 4TSFD 3JVVA 4Z54A 1U90A 721PA 1BIFA 4HB4A 1N2CE 2RHDA 1DPFA 2CLSA 4AYWA 1G7CA 3THYB 3U7FB 2V7QA 1M7GA 4BFXA 1KJWA 1F48A 1ZD8A 8OHMA 3DOFA 4JLNA 2GA8A 5DYIA 4DDUA 3R8CA 1ZNWA 2JLRA 4KYUA 2O8FA 2R44A 1LVGA 3EG5A 1HV8A 2ANBA 1R8QA 4DIDA 2JJ1D 2IXEA 4XVQA 1G3RA 2WPDA 1ESNA 2MMCA 4XWAA 1GNPA 4AKHA 4Z1MD 2W6JD 2IS4A 3R9XA 5KOYA 3KKMA 3QVVA 1XXHA 2CE2X 1XJ0A 2C03A 2GILA 4LUCA 2FX3A 3K70C 3I8SA 2QMUA 4XSGA 3HYTA 1NVVQ 4QBGB 4ESHA 1G41A 3C14C 2FFHA 3CPJB 2GF0A 2YOFA 2UZ3A 4QGGA 5FFMA 2GAOA 2CMKA 4WZAE 1LW7A 3RABA 2RGEA 2WOJA 4A2PA 1TQ4A 1PZNA 3G5UA 1VTKA 1OH8A 2BBSA 1C1YA 3C4JA 2GBLA 3PQCA 5EE3A 2GZDA 2ZUDA 5KDLA 3WMEA 1R0ZA 3MFYA 4XTCS 2JLZA 1Q57A 3LNCA 3IHLA 4C2TA 5LB4A 2R6AA 4Y0AA 3PIRA 3CLVA 1P3JA 3EZ6A 5M04A 4MKHA 1Q1QA 3SI7A 2AD5A 2XEXA 3WBKA 5UKDA 1SVKA 2PCLA 4I1SA 1NVUQ 1KY3A 4A8JC 4DDTA 3I61A 3AP1A 2KWIA 3PUZA 4IW3B 3U3KA 1G7TA 4URVR 1F2TB 3UWKA 1XTIA 4V02A 2J1LA 3QOFA 5FOWA 3SFZA 4RJLA 4NKRA 4FCWA 4LWZA 4US1R 2XOKA 1IM2A 2KE5A 1LTQA 2O8DB 2GWHA 3Q9LA 3OZXA 2AKAB 3PUWA 3BH7A 3RRMA 3WRYC 4KFTA 4CF7A 5KPDA 3W34A 1UM8A 2VF7A 3NBZC 3KUCA 4PFSA 1NBMD 3UG6A 1F2TA 1W44A 1KSJA 2O52A 2OO7A 4BLSA 5KSYA 2I3BA 4A92A 2PX0A 2ZJBA 1R0YA 2DFLA 4JKIA 4GL2A 2RGCA 4V03A 2XZPA 2NPFA 4Y0VA 1XMSA 2F43A 4B34A 2FOLA 2ZRIA 3WYAA 1QHHB 2D06A 2G3YA 2CLDX 1ZM4A 4P4SB 4HB3A 4LCBA 3GJ5A 1VHTA 1E9EA 3P26A 2GF9A 4JLJA 4AD8A 1HH4A 1HT2E 2QORA 1UKYA 2DFKB 2VHTA 3PEVA 3THOA 4DDVA 2FH5B 1D2NA 4MRRA 1I4LD 2YYZA 3K0SA 4DWJA 1W4RA 1Q44A 5DE3A 3CX7A 3BB1A 2V1XA 3LXRA 1SGWA 2H57A 3LW7A 2A78A 2VF8A 3PUVA 3SS8A 3I5YA 4LOAA 3ADBA 4Q1FA 1QHHA 5FBVB 3RRYA 2VHJA 3B82A 4P4SA 1PJRA 1XEFA 4G1UC 3C5CA 2NPIA 4GOXA 3HU2A 4ZCMA 2KI5A 1XEWY 4P3YA 2J5XA 5B2ZA 1KSFX 4OQMA 2WAXA 5HTKA 2VBCA 1FP6A 4URWR 3P20A 4B47A 3OE7D 3KXIA 3ZZTA 4EQ6A 1QF9A 4FCVA 2B8WA 3NG1A 1NP6A 3I72A 2F1JA 5J47A 1G4UR 1KAOA 3VNVA 1AS2A 1N0UA 3TVTA 4H1VA 4LRWA 1G5PA 4KO8A 5AJWA 2D3WA 1JEDA 2ZS8A 1KYIA 1W0JD 5CDFE 1R5NA 2F3RA 2GK6A 2GKSA 3B8HA 2GXUA 4PPNA 1R4AA 4TLDA 3SR0A 1FUKA 3BRWD 5JSZA 1E0AA 2AWOA 3A4MA 1PLKA 2VP6A 4DIEA 4TYWA 4JT2A 3ND8A 2EU8A 2F9LA 3B6EA 1GAJA 2WWYA 3TW4A 3ZS8A 3H1TA 1H8HD 1SULA 1VHLA 1J8YF 2NIPA 4QBHA 1T9HA 3C15C 4EKDA 3BFVA 4WW0A 4QNRA 4MUBA 1XD9A 3CRVA 2QT1A 3AKCA 4PPFA 1DELA 3A1VA 4C0LA 3LFUA 4Q7LA 2P5SA 3U6KA 3VQTA 1T8UA 4I81A 2ZAMA 4FCTA 3OIYA 1XD8A 2YOHA 3VR5A 4IEIA 5G3YA 4AK9A 3VKGA 5FR1A 1U8AA 1GITA 1ELOA 1ZNXA 4IRUB 4PC2A 4Q4HB 1TTTA 1E9FA 5KNDA 3SZRA 1N5KA 4GZLA 3VTKA 2A7QA 2QGZA 4M21A 3VR6A 4DJTA 2EYUA 1FFHA 2XNDD 4AURA 2ZXUA 2BHRA 5KPJA 2VQSA 4KYIB 4BPBA 2F1RA 2FSGA 3C8UA 1K8RA 5KO2A 2QAGB 1HY3A 2C8VA 2Z43A 3EPKA 3ZVMA 2YWGA 1DO2A 2MSDB 1XX6A 3AUYA 1G19A 5FL7A 4Q4HA 3TSWA 4URUR 4Q19A 2CCGA 1P73A 4Z51A 5J4HA 4IDQA 3TW8B 2WJGA 2V6IA 4UJ5A 2VHUA 4PAOA 5EXSA 3ZYCA 2NO6A 1A1VA 1AA9A 3B1YA 1GSIA 2XB4A 3KXLA 3EASA 1AKYA 2J7PA 2G9NA 2LKCA 1NG1A 4TN1A 1IN6A 4JBYA 4KFUA 2EWVA 3KZ1E 2C77A 4HAXA 1MRNA 1WBBA 2ODWA 5DYGA 3BD9A 4AY2A 4J0QA 3EARA 4DSUA 3QPVA 3TR5A 2I4IA 1CJKC 3HJNA 1XMJA 4BUJA 1QHSA 2ZRCA 3SOPA 2YWEA 2A9KA 2JEOA 4A6XA 5HCIA 1GVNB 4D25A 4TLBA 2Z0MA 3KB2A 1OH7A 4W7SA 1NN3A 3CF2A 2VIIA 2BWJA 3L0SA 3QEOA 4DCTA 1JR6A 5F3WB 1G8HA 1IBRA 1YU9A 4YMSA 2H8KA 1EGAA 2WJVA 3OIUA 2W00A 3MUFA 3RS4A 2QP4A 4YDSA 2B21A 3EIEA 2QMHA 4FD2A 2QTHA 2XX3A 2ZI3A 221PA 5CJ2A 3X1XA 1RRGA 4MGYR 1L8QA 3QF4B 1Z08A 4KU4A 1W47A 2D62A 4IDHA 3SBEA 4JZKA 2F7SA 1NNEA 3UMSA 4US2R 1HTWA 1KI8A 5K8LA 2G0NA 3BE4A 1E1QD 2G77B 3IUYA 1OHHA 4TMZA 3ZVNA 3WY9A 1S0UA 2PMDA 3CF6R 3VX4A 2Q6TA 3WNBA 3GLIB 2PZGA 1ZU5A 2CLCX 3AF3A 1OV4A 2JLVA 1NJFA 3ICEA 1DOAA 2REBA 4E22A 2J59A 4H9GA 2OFWA 3FMOB 4FXPA 4HAYA 3THWB 2WSSA 1MABB 4EDHA 2CVFA 2WJHA 3TR0A 3WXMA 4KHZA 3GLFB 1T4GA 4TTPA 1B23P 4AYXA 4ILEA 5H8WA 2WM9B 2BEKA 3EZ7A 4WA7A 2H5EA 3L8ZA 2ZJYA 3IPXA 2BOVA 3OF5A 3T1TA 2ZM5A 4I1UA 4JMPA 3KQUA 2LKDA 4CGZA 1J8MF 5IT5A 3X1DA 3FYHA 5AUQA 4BLRA 4AYTA 2X2EA 3AV0B 4Q4AB 2DB3A 1MABA 2NO7A 3LLMA 1N6LA 2A5JA 2ZIAA 1N25A 2A5DA 2PZEA 4MRSA 3GLFA 2OXCA 1G3QA 1JECA 1SKYB 1VCMA 1OXUA 1UAAA 2VHQA 2IYXA 4HAUA 1XXHE 2BVNA 1DG3A 2CVHA 4NP6A 1ZP6A 5KDOA 2Z4RA 1W2GA 2BCJQ 1KDTA 4R71A 4IVQA 2IF0A 4DCUA 2DWOA 5AJVB 1XTSA 3Q5EA 3MWLA 3AF1A 3LV8A 2IYWA 4Q4AA 4C0HA 2QROA 1YZTA 3TE6A 5JJKA 5ANRB 5JHHB 3EA0A 4YONB 3AVXA 1QG2A 1M2OB 2O8CB 1DG1G 3AVTA 4HZUB 3FDIA 3KB1A 5FPKA 3RRZA 1GM5A 1E94E 3KJEA 4XVUA 1IY2A 1MV5A 1RE0A 1T6NA 4BZXA 4MITA 4KBGA 5DISB 1XRJA 4JL8A 1YR6A 4ON9A 2XSZD 2AXNA 1G7SA 3TVDA 2BCGY 2BDTA 2LCFA 4URZR 2ZREA 3PXGA 4NTZA 5AR1A 2X77A 2O8CA 4ASUD 4HZUA 4DLXA 4IVPA 5EJEA 4Q7KA 5KSPA 4HI0E 2CCKA 4UNPA 4TZ6A 121PA 1G64A 4CRWB 1OXTA 3VFDA 1Z0DA 1EWRA 3LD9A 3BORA 2JLWA 3OEEA 1PV4A 1KI1A 1CXZA 1D2EA 4HB2A 3H0KA 5GJCA 1CKEA 2AK3A 5AUNB 2VRWA 2WOOA 4FMCF 3SU8A 3FHTA 1HURA 1R6BX 2AHOA 4M9ZA 1JXOA 1AQYA 4AWXA 3RWMB 1TF7A 1ONBA 3IHWA 3VHXA 1E1RA 1ZJ6A 4BQSA 1DAKA 5SZJA 4B32A 3PV0A 2FSHA 4TQUS 1KDRA 5CIWA 2OUKA 1IXRC 2YKGA 1II9A 1GUAA 3GMTA 1US8B 3I8XA 5B30A 4LBVA 4HLDA 3SHWA 3GCGA 1P62B 4ZI3A 4EPRA 1M7HA 3K9NA 1E2KA 4M2LA 2QP3A 4XSHA 3OIVA 1FX0B 2ZSBA 3C16C 4MGKR 5FOVA 2WBLC 1FMJA 1U98A 1M34E 4GPTA 1YZKA 4L9WA 1E9CA 1J2JA 1JR3D 1XBTA 2VYFA 1Q12A 3AGPA 3Q5DA 4TL9A 1P4SA 2H7VA 2YWHA 2ZRHA 2ZTSA 1US8A 2R6DA 4HUQA 4PC1A 3DHWC 5EXXA 3WRXC 5FOTA 4YXWD 1FMLA 2HLDA 4JT4A 1SVWA 4TL7A 3QXCA 1EFCA 1KZGB 1UKEA 4M1OA 4PQFA 1RJ9B 3K0CC 3O8DA 1P9NA 2OFOA 3GFTA 5HCNA 1ZUIA 4BGDA 3EA5A 5DI3B 4C7OB 5JS8A 1OXVA 1Q0UA 4PQYA 3TAUA 2R6GA 3NH9A 1I4DD 5G53C 4UNSA 1E0KA 2QAJA 4KLNA 2BEJA 5SZKB 1BYUA 3ND9A 2J0VA 1RC8A 5GJVC 2WWIA 1LB1B 5JI2E 1SXJB 2WTUA 1GKUB 4PAMA 1EG7A 1F5NA 4PHFA 1U8ZA 1S1MA 2AD1A 2OAQ1 2EFGA 5EE5B 2IS6A 2FJUA 3CH5A 4D80A 5TMPA 1G8GA 1P2UA 4LK2A 4JYCA 2ZJOA 4W5HA 2X2FA 5IF9A 3LX5A 3B1ZA 4DHEA 4BFWA 1ESMA 4BFUA 2IK8A 1N5IA 2J0UB 2WWXA 5TARA 2CL6X 1W48A 1OKKD 1SXJA 3MMPA 2WMOB 3OAAD 3U3OA 3WMGA 3PVSA 1VYTA 4E5UA 2IX3A 3B9PA 4C0BA 5AWFC 4P31A 4XD7A 5JWOA 1ZC3A 4CT5A 5FBLB 3ICQB 2KSQA 4UXIA 1E2FA 1U0LA 1AK2A 3SYKA 2IYZA 1BS1A 1QHGA 1UBGA 2IA5A 1QVAA 3C41J 4N1AA 4D4JA 2XB2A 1CTQA 1Q22A 1W5TA 2J0UA 1G3IA 5CM8B 1G21E 1OXXK 1E2NA 1ZNYA 1NY5A 2BJVA 4R7ZA 5D3QA 4F7WA 4WXPA 5B64A 4C0QC 3KQNA 1GTVA 1M1YE 2ZE8A 3SJZA 3EPLA 4A0RA 2R6CA 2FEMA 1W4AA 1NIPA 2QL6A 3SHFA 4FI3C 5ELXA 4DSOA 4D4MA 1PLLA 3TSOA 1GL9B 4BLOA 2HJGA 3VR1A 5FTLA 1Y63A 4UNRA 1XJCA 1RPZA 5DN6A 3BJIC 4GSYA 4A0HA 5BN5A 2BBWA 4KVGA 1E2DA 4C9BA 4EPYA 4C2UA 4Q47A 4Q03A 1BH2A 3EIQA 3GQBA 1H8ED 4IXMA 4OI0A 3J81k 2B7BA 1KI7A 4IOLA 2XZLA 1KI3A 4IEEA 4OJKA 4RKFA 4UXHA 3ZH9B 4ZDKA 3G0HA 2QAGC 4KITB 2FGJA 4LYJA 3QXHA 1OF1A 1E79A 3ADCA 5HZKA 3AKYA 1X86B 3JZAA 2P6NA 3I5XA 2C98A 3AVVA 3NC0C 4BZPA 1FP7A 2IHYA 1NJGA 1K5DA 2G6BA 1NSFA 1Z5ZA 2GZAA 3B7GA 4RZUA 4DLVA 4BWYA 3U3RA 3MCAA 2ZUCA 4LBWA 1UBEA 3ZIAA 1U9IA 4IDNA 3GJ6A 1I2DA 4EFLA 4B33A 1QHYA 2V3CC 4OKSA 3R20A 1PVOA 1Z47A 4RD6A 1BMFA 1CR1A 2JJ2A 1YZGA 4PXAA 4OI1A 1RRCA 3SFVA 3KL4A 2ZJ2A 2FPMA 2DCUA 4GP6A 2WWFA 2ONJA 1VCNA 4QNMA 3UATA 4B3XA 1EFHA 2JLXA 2RGAA 3W9YA 5HE8A 1EX6A 2EFEB 2RMKA 4HLUA 3T61A 4BFVA 5C2JB 1WQ1R 3CX8A 1VCOA 2QPOA 3TIFA 5CK4A 4E07A 1E9DA 4G5QA 4K46A 2VP4A 2FN4A 1N6PA 2FZ4A 4LDJA 4W5WA 4WAUA 3O8CA 3K70D 4PTLA 4RKEA 2HF9A 5KSOA 3K9LA 2H1LA 1HYQA 3B60A 4A9AA 3ZD6A 1B0UA 2HDNB 5FTKA 4V0OA 4QGAA 1G8PA 3TUZC 1FZQA 3NEJA 4B44A 4R2IA 1JPJA 1TL7C 1ZM9A 1Z6XA 2ZSAA 4M1SA 3TK1A 5CLQA 5LD2B 3TAHA 3H86A 5AJXA 3Q85A 4U5XA 3KQLA 4B6EA 2NO1A 1LY1A 4MKFA 1M6NA 1TMKA 4C7OA 1EFRD 2WV9A 2O8FB 5JRZA 3A6PC 4TTRA 4NYMQ 4PX9A 2PT5A 5EE0A 2PBRA 3EX7C 2YC4C 4N0EA 2JGNA 2QM8A 3MSXA 2F55A 3BC1A 2IYSA 3QKTA 4A4DA 1N6KA 3BERA 2W0SA 1F3OA 3GLIE 6Q21A 2QTVB 2ZUBA 3CIOA 4D0LB 4DLWA 3UMRA 1CULC 3FFAA 4N3NA 1UDXA 1KOFA 1P60A 1XXHB 4P32A 2JDIA 4PZLA 3WBJA 2Z5FA 2WJJA 2ZRLA 3WP0A 3MJHA 4KI0A 3V4RA 3RS0A 1ZVQA 4Q66C 4KBFA 3AB3A 1XMIA 3LVQE 4XWOA 3HU3A 3GLFE 3T15A 2N42A 4OHZA 3WP1B 2VH5R 2ZE6A 2CXXA 4PC6A 1FNMA 1JALA 3AF0A 4RVCA 4QKQA 2W6IA 4GBMA 3ZZUA 1TQDA 3K0FA 4M8NE 1WDTA 1C9KA 1BO6A 1E96A 1TF2A 3L0PA 5AJYA 1IOZA 1KSHA 4MGZR 3MLEA 1IY1A 4CVNA 3TGPA 3VHLB 1SVSA 2IW3A 1W2HA 5TB5A 5FUXA 4DSNA 4XVRA 4QJ3A 2NZJA 2F6RA 5FOSA 3ZGXA 2MMGA 4JLPA 1SKYE 2ZS7A 5F2EA 1HQYE 1GRNA 4MUAA 2H92A 1ZRHA 1DAGA 2A2ZA 3CRQA 2WJYA 1E2JA 3UANA 3FTQA 1LV7A 4OI4A 2HYIC 4DLYA 4TYPA 2Q3FA 2OCYC 2IL1A 5BW8A 1NKSA 2FG5A 3BAFA 2HEIA 4TLEA 1KK1A 4DZZA 4AI6A 3G82C 1E2HA 2G0TA 2HT6A 1DS6A 2ZYTX 3GJ8A 4KXFB 2PJZA 1T91A 1OIXA 3ZVLA 1O3YA 1ZNZA 1DE0A 4URYR 1SKQA 3PUXA 1WXQA 4JLOA 5HPYB 3KJHA 5G41A 4Q7JB 5GJBA 4PC3A 5GJWC 3T06B 4L4UA 1Z28A 3M1IA 1Z22A 2P6UA 5DH9A 3UG7A 2J0SA 5FI1B 4OQXA 1E9AA 3MRSA 2XGJA 3HR8A 3K0EA 3IDQA 2FE4A 5KNBA 1QG4A 1G3MA 2F43B 1OPXA 2YWFA 1OYWA 3MWKA 2RHMA 3AGQA 2OAP1 5KU1A 2ZRJA 2DWQA 4E09A 4P4UA 1YE8A 4DDWA 1XTRA 1EXMA 1A82A 3MAAC 1VCIA 4M9QA 3LA6A 3MWJA 5EUMA 4A15A 3PJRA 3JVUA 3U61B 4O25A 2ZI9A 3CPEA 3MG9A 4JVMA 3X1ZA 1CR2A 5HZHA 3QKUA 3U2QA 5CM9C 3UPUA 1NN0A 3EC1A 4G5RA 3AKDA 1AS3A 2D4HA 4TMTA 4ABYA 1W1WA 4WXRA 3RS5A 5LB2A 1Z0AA 3PENA 4TYNA 1M74A 1R5OA 2ASEA 1XPOA 3AKEA 4Q4JB 1OE0A 2EQBA 2W2VA 3SJCA 2ODEA 2CE7A 2ZI4A 1ODFA 2VP2A 1RKBA 2B6HA 1G20E 3BOSA 5TXGA 4C30A 3O47A 2GCPA 4NBSA 2CK3A 4D4LA 5E7MA 1OH5A 1UEIA 2XZOA 2FF7A 4EQ6B 2J41A 1G16A 3I4LA 3LX8A 3QPWA 4PQRA 3I73A 1KGDA 3MD0A 3NBFA 4D6PA 4EFNA 2A5YB 3QY0A 421PA 1D9ZA 1FOEB 5DHAA 5HKKD 3NHBA 4JL5A 4MKGA 2IEZA 3GD7A 1A7JA 3CRRA 4ITRC 4Q4JA 3T12A 2QBYA 5BQ5A 3CWQA 4PHGA 1QRAA 1KNQA 1ZM7A 2CBZA 2FA9A 5JSZB 3B85A 1ZIOA 4RZ2A 1W36B 2ZRBA 2ZRGA 3ZDQA 2CNWA 2KB0A 2O0HA 2WHXA 4IOJA 3MGCA 1YJ5A 1NRJB 1GNRA 3KFVA 1G5TA 1LNZA 1G8FA 2OHFA 3UXMA 4ARZB 4D4KA 1AGPA 2P5TB 3LBNA 1Q3HA 3QIAA 3TMKA 4ZI2A 1OXSC 3U3JA 1MT0A 4DUGD 1AQUA 4R98A 3CNNA 2FMXA 4EPXA 4DCNA 1AZTA 1TPZA 1S4QA 2XJ4A 4MKIA 2J0QA 1SHKA 2O8BB 4XH9B 5AJZA 2VLIA 3CW2A 1ZCBA 2Q0HA 1W4BA 1SXJE 4ZDJA 2C9OA 3R7WB 5TY0A 2IYVA 3H2YA 4OBEA 1VYVA 3QG5A 4PHTA 4ARZA 4RZXA 1K5GA 3RSLA 4ACBA 1GP2A 2P67A 1P7CA 2N46A 3ECCA 3VR3A 3IEVA 4OI2A 4G5OA 1MRSA 1R0XA 1CF4A 3RSOA 3R8FA 4UXJA 2ATVA 3OFNA 2ATXA 3OEHD 4OHWA 3SJBA 2O8BA 2ZVPX 3LDAA 1N6RA 4FMDF 5LBIA 2C78A 5DHFA 4C0JA 4ZCLA 4D0GA 5G40A 1GKIA 2ECKA 2RGNC 4JBWA 3R7WA 3CH4B 3IKJA 4LBYA 4NL4H 1D5CA 4Q7MB 1IQPA 4KSCA 4CEHA 1CR0A 5FOUA 4PPQA 5GVRA 4JSTA 1IXZA 2VP0A 2IEYA 1KSGA 3FKSD 3AP3A 3IQXA 1XFAA 4F4IA 3SYNA 2L0XA 1BKDR 4YMUA 1KTVA 4V0KA 3K0AB 5E4FA 2DR3A 2ZRDA 1GL6A 5C46F 2FFAA 4GI7A 3K1JA 4DCVA 4DB2A 2F1IA 4P4TA 5EP1A 5JWRA 2R9VA 4DRZA 2MSEB 1JAHA 2Q21A 4Q21A 1L4UA 3KQHA 4FINA 4ESVA 1KI6B 2FGKA 3LRPA 1LFDB 3HP1A 3N2EA 1JJ7A 4PSAA 3K8YA 3W6PA 5CLLA 4JVSB 3VMFA 4BASA 1CEEA 2BM1A 2CHQA 3K0AA 3D8BA 3QSYA 3BGWA 2GEDA 3DMNA 1S96A 3SN6A 3WMFA 1Z07A 3EZFA 4AG5A 3CR8A 4DSTA 1E2IA 4U7DA 2WKRA 5JECA 4PO1A 1KI6A 2GJSA 2V7QD 2ZE7A 1CRPA 1Q1ZA 1UKVY 3FMFA 3U7HB 2AN9A 1IJFA 3B1VA 1KMQA 5JBQA 1GOTA 2FWRA 2YV5A 4IHQA 3Q72A 3RS3A 5IK2A 1CP2A 4Q1CA 1Q3TA 2WPDD 1IAQA 2OV2A 1F2UB 4HAWA 3TBKA 1RRFA 4EJSB 1NVVR 3O8RA 2JATA 1HEIA 2Z4SA 5P21A 1CBUA 2OBNA 4JLMA 4O2LA 4TT3A 1Q1EA 2C2HA 4NMMA 1J7KA 3SJAA 3WYGA 4CT4B 4NCIA 3L43A 2NO0A 4UNQA 3T5DA 2JIZA 1FUUA 5D3MB 2GZHA 1CLUA 2GAAA 1E9BA 4X8HA 3PITA 2O0KA 5JS7A 2EVWX 4LHYA 2I1QA 1F2UA 3L2OB 3ONWA 4B3CA 2QRNA 4EJSA 2OZEA 4B43A 4PZZA 2QE7A 4QHTA 4TLCA 4DCSA 5L8VA 2O5VA 1KJZA 1Z6YA 4TQAA 1UBCA 3CNOA 3SNHA 5J5CA 2AFHE 1NY6A 4NCHA 4Q02A 4C3ZA 4PSKA 4LBZA 3BH6A 4Q4LA 1ZM2A 2R6FA 3K09A 5D3MA 1IONA 2FZLA 3W3ZB 3HDTA 3FOZA 3TJZA 1KO4A 1KDOA 2E87A 1W0KA 2ZPTX 4PC7A 4DEXA 3AQ4A 2ZVQX 3CPHA 3IGFA 3NWJA 3M0EA 2IWRA 5LD2C 2HXSA 1II8A 4HDQB 5BN3A 5JJIA 4KFSA 4G0NA 4LHVA 3QE0A 3TUJC 4OQNA 4FWIB 1X6VA 1WP9A 4LPSA 4Q9HA 3WHLA 1XCPA 4B3DA 2BKUA 2XOKD 3GJ4A 3LAWA 5JHGB 3RC3A 2ORWA 4RY2A 1TQ2A 1NLYA 1YRBA 1K6MA 2QM7A 3RC8A 4RFVA 2ERYA 2FPLA 1P9WA 3D6TB 4GMDA 1C4OA 1GZSA 2C9YA 4NYJQ 4MDEA 2ZR9A 1CS4C 2RGXA 3NC1C 4QC2A 3AEZA 4DLRA 2ZETA 4MH0R 1TUEA 1G3UA 3GEEA 3IQWA 2UVQA 3NHAA 3W8NA 3RRNA 3KJIA 3VU9B 3FHOA 4LI0A 4IKEA 2OT3B 4POAA 4M9XA 4OHVA 2ZE5A 1GILA 2R62A 2AXPA 1FNNA 3FMPB 4MYHA 2O8EA 3DZ8A 2XJ9A 3H4MA 3VR2A 1S3GA 2G88A 4HDCA 1JQJC 4GZMA 3RS2A 4DVGA 3IO3A 1D6JA 1G17A 2GBLC 2R8RA 3L82B 1RZ3A 3NBXX 4WZBE 3THXA 4ZIRB 2UKDA 4LJYA 4CYMA 3EPHA 3VU9A 2VP9A 3ZLJA 4B71A 1HE1C 1KAGA 1OH6A 2CJWB 1P2TA 1Z2CA 1XTKA 4LYAA 2GTPA 4ZPXA 4OHYA 4BLPA 3DM9B 5BN4A 1OB2A 2OFXA 2ZSDA 3AVUA 1GG2A 2BMJA 1GDDA 2ZS9A 3A1SA 3AP2A 2NTYC 4NCNA 4ZIRA 1Z06A 1KDPA 1D2MA 4F93B 1Q21A 4A8JB 3LXXA 4NYIQ 4EUNA 3SBDA 1IHUA 4A0FA 3GLGA 1KJYA 2CJWA 3W5IA 1UJ2A 4R2HA 4JYBA 2HYDA 2B7CA 1COWA 2CHVA 2FSFA 2GRJA 2ZRKA 4BLTA 2Q3MA 5H68A 4A2WA 5A5GA 1YR7A 3F0TA 1X3SA 1S8FA 4GOJA 2LWIA 2R65A 4KCGA 4TSFA 2CHGA 1XMVA 1N3BA 4FN5A 4A8JA 3EZ9A 1IY0A 4LV6A 4HUQB 2QSZA 1ETUA 1F60A 3EZ2A 1VG0B 5B57C 4Q9JA 2YC2C 1WRBA 4A2QA 1JNYA 2JJ1A 1AZSC 2Q3HA 1Q1BA 4ZDIA 1Z83A 4XOIA 3QNUA 2ZANA 4PSVA 5J40A 2AFIE 3NH6A 4HDOB 1R10A 3KKOA 1KIMA 4Z1MA 1G8YA 2W6JA 1UKZA 2ZJZA 3D31A 3X1WA 2IYYA 1HA3A 2C96A 2VL7A 2FEOA 3R9WA 3ZQ6A 5JRJA 5FI0B 2XXAA 3QEJA 1G291 2VHCA 4RSGA 1DEKA 2PH1A 4HSEA 1YKSA 4DLSA 3RWOA 1TX4B 2QMOA 1E2GA 2PL3A 2P65A 1E99A 4W9MC 5E7IA 1W4CA 2VSFA 2P2LA 5KDDA 3GJ7A 5TDHA 1FL9A 4IOKA 3CNLA 2J87A 5FL7D 5FPYA 4D81A 2BV3A 4I1OA 3BXZA 4P33A 4II7A 3Q8XB 4F91B 4AC9A 4OQLA 3VKWA 4UQOA 2OCAA 4ACAA 4TTQA 5JCPA 1FTNA 1LF0A 2PZFA 1A4RA 4RD0A 1SVLA 2J7PD 2RGGA 3A1WA 3AF2A 4GFDA 4C0KA 3P4YA 2GETA 4Q9LA 1GKYA 3CR7A 4PANA 4B3BA 4CZ2A 1AM4D 3HPRA 2AK2A 2ZYVX 5FH9A 5CITA 1D8TA 3CRW1 2V54A 1CJVC 4TMXA 2JLQA 2EYQA 1P6XA 1SHZA 1YZLA 3NIBA 3I3SR 5C18A 1X8LA 2FV8A 2JCSA 3TUIC 1NBMA 1OSNA 3K9GA 4G5GA 3HU1A 4HAZA 4LJ6A 2F3TA 1T0JB 5IHPA 2NZ8A 1XZQA 4QHYA 4RD2A 2IS1A 1T3LA 4HLQB 3KTAB 2WIBA 5TV2A 2WZQA 3QKRB 3FMIA 3A4LA 3ZS9A 2CEAA 2XAUA 3A1UA 2R2AA 4TWZA 2TMKA 3M6AA 1N0WA 4LZZA 2VA8A 5K8IA 1ZD1A 4NE2A 4RCZA 5AUPB 5K8TA 4LV8B 1AGRA 2ERXA 3AH8A 2VSXA 2AR7A 1KO5A 1TAGA 4Q9IA 4DEYA 4JLKA 4U00A 1OHHD 1GRRA 2FNAA 3RHFA 4Q01A 3KTAA 1NL3A 4WZ6A 3QKRA 4O0MA 2BMFA 3GLHB 3QI2A 1G5RA 3TQFA 1KKLA 3PR1A 3QXXA 5EE1A 2D7CA 2GNOA 1NMXA 1NN5A 1VG8A 3FB4A 3QENA 3KJGA 3QXJA 4OHXA 3CZQA 4JLAA 4OL0A 1G9XA 4G3XA 1XTQA 3AVQA 2YZ2A 3WNCA 5EXPA 2FSIA 1Z6GA 3OE7A 1X1RA 3PEYA 1LS6A 2IBMA 1ZU4A 3DEFA 3ADDA 1WB9A 2ZITA 3RVBA 1GWNA 4NYJR 3E5HA 3GLHA 2CCJA 3KKQA 3F3YA 3P1JA 3W3AA 5EE9A 5EZ5A 4IDOA 3A58B 3U60B 3NXSA 1W0JA 4MYCA 2IUSA 2OCPA 1QVRA 3D3QA 3T5GA 1WA5A 4EFMA 4F4JA 5L3VA 2NGRA 3DO6A 5J4YA 1NMYA 1UEJA 2ZEJA 1RW4A 3E70C 4BZQA 5GVSA 1LS1A 1Z29A 2GJ9A 2ZR7A 3CONA 4JL6A 1DARA 1XCMA 5H1YA 2VP5A 2P6RA 2PEZA 3EAQA 4RD4A 3D7MA 2IYTA 1PUIA 4EPTA 1XZPA 2AWNA 1TU3A 2B92A 2BBOA 4W5JA 1H8HA 3M4YA 1KO8A 1ZYUA 5LPNA 2RAPA 4BLQA 3V4FA 2OESA 4F38A 2BMEA 3AVPA 1CIPA 1IXSB 4YC7A 4PR0A 2XTMA 1I4TD 2WWWA 3T34A 621PA 4GOKA 2FFQA 3DKVA 2QG6A 2ZYUX 2WSMA 4IFEA 1R5BA 3BFXA 1JXMA 3HYRA 1R2QA 4EPWA 1VPLA 5TVKA 3T1VA 5J4LA 3PG5A 2QU8A 1E2LA 3REFA 3KKPA 1JAIA 4M22A 4Z8XA 2YHSA 2J9RA 5F9FA 3IEUA 1YVDA 1XEXB 3HWSA 5JFGA 1EFUA 2GVDC 2JJ8A 4ERNA 4MA4A 4M1KA 2XNDA 4EAQA 1QHIA 2FPKA 2WIAA 1UF9A 1T3SA 4NYIR 4PPGA 3TSZA 3F8TA 4Q5IA 4EPVA 4D26A 2O0JA 3E1SA 2WAYA 4BE7B 4Q1DA 4P0TA 4F92B 3K0FB 1G6OA 5C1BA 4DBLC 4LYHA 4TL6A 2AL7A 4AKGA 1DAEA 2OG2A 4M0LA 3OEED 2DYKA 4G5SA 1XEXA 1WE2A 4MYTA 3HPQA 3SYLA 4CEJB 4JLBA 2YVUA 4A82A 1Z0FA 1DBSA 3QQ5A 2QMEA 3LBHA 4S2EA 3SQWA 5B58C 4B2PA 1E1RD 5C4GB 4NCKA 1FTSA 2J45A 3VNUA 1Z2AA 4LHXA 1TADA 5GADl 1DTSA 4M4SA 1G18A 4L9SA 3F5FA 2NQ2C 2WWHA 3W6OA 5FBWB 1W49A 1JBKA 1E4VA 1TUIA 3RLFA 2QPTA 4CEJA 5A0FA 4MRPA 4M53A 4A0GA 4QM6A 3KUDA 2V55B 4V0MA 4TYYA 4X8OA 2GEUA 4X8LA 3U3MA 2Z6VA 2BIFA 4US0R 4NDZA 1FQJA 3W6NA 1KI2A 1VMAA 3OESA 4X8MA 1SZPA 1U2RA 2FFBA 3THYA 2Q9AA 5BYJA 1Y3AA 1XJQA 2KBFA 1NSTA 3ASYA 2IT1A 3X1YA 3BIFA 2XNSA 1AN0A 4B3GA 4PO9A 4UJ3A 4FMBB 5KHOC 1OIWA 3EW9A 2HLDD 1DADA 2WKQA 2HV8A 4OQFA 1FQKA 2ZI5A 3L0IB 2HF8A 3RNLA 1Z6TA 3UWOA 1E1QA 3A8TA 4TQ9A 1DO0A 1EX7A 4TMWA 4Q9KA 2QNRA 4HAVA 4RD3A 1NLZA 2QT0A 3BBPA 3NVAA 4QRHA 4C0AC 2IF2A 3GLGE 4C4PA 2P0EA 4H1UA 1L7VC 2ODBA 4AKIA 1E32A 1N6IA 5JLJA 5CYPA 1XD2B 2VO1A 3FPAA 3SEAA 2E9SA 5E95A 4YMWA 2H17A 3NEYA 1ZM3A 2SHKA 3I62A 1ZINA 2ORIA 1J90A 3CUEF 1R0WA 5CK5A 5EXTA 3GEHA 3U7EB 1J70A 5HE9A 1T3HA 1CJUC 4MDFA 1SXJD 3VX3A 4O2RA 1XD2A 4AG6A 5FTMA 4Q18A 4BEBA 2NO9A 2C9CA 1DAFA 3H84A 1MH1A 1HUQA 4XD7D 4Q1BA 4B35A 1CJMA 2QBYB 1HE8B 4MQBA 1BOFA 1ZAKA 5KSZA 3CO5A 1T8TA 821PA 2Z83A 2ZR0A 2Q9CA 3ASZA 3BFKA 3KQKA 2AX4A 5DGXA 2IYLD 4B74A 2O8DA 4WVFA 3PCRB 2GJ8A 4BRUA 5EZ6B 2RGBA 3QXSA 1W5SA 2OEPA 3U7GA 1JI0A 3IIMA 5CB6A 2ODNA 2PCJA 4LJ9A 3QG1A 1U94A 5BWMA 1N5LA 1KO7A 3W90A 1IJEA 2QSYA 2HUPA 2A5GA 4QBIA 2GK7A 2V9PA 2C95A 3UKDA 1N5JA 3LVRE 4URXR 2XSZA 1N6OA 3B2EA 3FFBA 4TLAA 3QBVA 3IO5A 5DN6D 3DZDA 4OYHA 3AUXA 3DMDA 2PMKA 4LY6A 3RYTC 4DLUA 3TH5A 5DLQC 3K0CA 1D9XA 1ZW6A 2V6JA 4ASUA 1SVMA 4TZ0A 1G7RA 5H70A 2NG1A 2ZU6A 3B5JA 2BKEA 2P3SA 3U44B 4DKXA 2XITA 4LPKA 1E79D 3P27A 4U02A 1SXJC 4WOPA 2PX3A 4E03A 5IDVA 4JJZA 1AJEA 3DOEA 5JCZA 2F9MA 1P2VA 3B9QA 4FWTA 1KI4A 4CEHB 1JJVA 3GJXC 4JKYA 1LF5A 1KK0A 2JLYA 3ZIAD 4TYQA 1TNDA 2EWWA 3FGNA 3BH0A 4KFRA 4LGMA 5BXQC 1NBME 2WMNB 5CJPA 2G83A 1II0A 4GRAA 4GP7A 4BFTA 3U44A 1BMFD 2JJ2D 4TL8A 1ZIPA 2OILA 2QENA 1YRAA 3CM0A 4CDGA 4XIGS 5JEEA 1WF3A 4QGHA 1P9RA 521PA 1NI3A 3REGA 4JBXA 1OW3B 1A5TA 1E9RA 2GDJA 4AKEA 2CL0X 1OB5A 1U0JA 3TKLA 5JZVA 1XWIA 1ZUNB 2V4ZA 4QJ4A 1MO3A 1XEWX 4LC1A 1MR3F 1KKMA 2OSBA 4M9SA 2JASA 4F4CA 3R9IA 1MOZA 3T35A 3CWZA 1JR3A 4HZIA 2IYUA 2ZSEA 1MO5A 5FUVA 4KODA 2X19A 4HYYA 5JJLA 2ZRNA 4YXWA 1E2QA 5JI3E 2K5UA 1U8YA 1Z0IA 4B2LA 5FBRB 5FTJA 1RVDA 1XP8A 4NYMR 4QG7A 4FMCB 3CZPA 1VIAA 1OJLA 2DFTA 5KUTA 1E2MA 5EP4A 5LDDC 2X8AA 4BFSA 3BB3A 2BJWA 3K9HA 4RD1A 4BECA 1Z3IX 4XJXA 2W83A 1S9HA 1SVIA 2YINC 3GFOA 1Z8FA 5KTYA 2MSCB 1T0HB 4TMVA 3QBTA 1ZD9A 4JLDA 3EPJA 1E0SA 3QKSB 3ADKA 4KLZA 4LJ5A 4Q1AA 3OHMA 4HLCA 4QHSA 2ZJ5A 1XF9A 3N70A 1XNJA 1VDZA 3LQRA 1ZC4A 2J3EA 3GLHE 4ZCIA 3LW8A 3GPLA 3NDPA 4Q00A 3MWYW 1N6NA 2ZRMA 1U9IC 1NIJA 2JDID 2VPPA 1Z0KA 2ANCA 2W0MA 1E98A 1RYFA 2GEVA 4RFSB 2QUZA 2BBTA 2DBYA 4M1MA
chains in the Genus database with same CATH superfamily
2V7TA 1QTNA 1L3CA 5CFZA 3QKSA 1FMFA 1QE3A 3I37X 4IKOA 4HRVA 4MW1A 5DWVA 2XD4A 3GJQA 1FYXA 3GT3A 1L5RA 2W6ID 2VG8A 2GHTA 4GOND 2ZUSA 1NXWA 3L7NA 3PKJA 3RH0A 4PONA 3TRFA 2CDNA 4ZKDA 4X94A 3R0IA 3ZKAA 3PFIA 2DBVO 3D8TA 2VPYA 4ID3A 1Y34E 3CNEA 5DIFA 4RZ3A 4FFOA 4P22A 5FB3A 2I8AA 4A36A 3JZFA 1IRXA 4JLVA 2LIPA 2NZXA 3ZZ0A 5ARDA 2ZBRA 1TD1A 2FPXA 2H4JA 4JNKA 3FUCA 5TVGA 4CU2A 4KAXA 3WV4A 2XRZA 1MO2A 1B6TA 4S1VA 5A02A 1GU7A 2PNJA 1I3OA 1I3NA 1QFZA 4K40A 3DM5A 3ZQ4A 2IHBA 1XPRA 1P0QA 1R9JA 2VYVA 2XY4A 4F4DA 2WU1A 4GOOD 2G1JA 1AS0A 1NN1A 2QD2A 5BN3B 2PV7A 5J4KA 1CUYA 1LUAA 1NQOA 2QXYA 4TTIA 1F9AA 4I1VA 4U7GA 4IG4A 2FAXA 1FNCA 4XIFA 3OM0A 5LXTF 3EGCA 5IZCC 4N39A 3O1IC 2VZ8A 4LV5B 4D46A 2FDCA 5LQDA 4DR4B 4J3NA 1VIYA 1M3SA 4ZHQF 4ZMRA 1S7GA 1T6ZA 4ECAA 1S2MA 1MJGA 1TM4E 1WUKS 2IQ5A 3AC0A 1UM9B 3KQOA 5J5VA 1U02A 3KU4A 3K9CA 4BRWA 1ONNA 4BFZA 4GUAA 3VXKA 1NMZA 1FLNA 4E5DA 5BR1A 4UAGA 1ISRA 1KZ9A 2H5JA 1E2PA 4HXEB 5HP4A 2E6UX 4IRXA 1JLLA 2ZBGA 4NXMB 1F6BA 1N2CB 2I76A 5G0TA 4DIFA 2B2CA 1Y9JA 4MB0A 4DDMA 2QEQA 2I3ZA 3GGPA 2O3TA 1AVTA 1MG0A 3DTTA 3KBOA 3P2YA 3P9KA 3VR4H 1SC9A 4HLNA 1L5HA 2ZBQA 3F67A 1QB7A 3MT0A 4DT1A 2ECFA 1FPMA 4DLTA 4J16C 2EW1A 1M7BA 4INAA 3RSGA 1NBWB 4C01A 2GLTA 2P8SA 5IU6A 1IIBA 4Z4EA 3D3WA 4HBGA 3C6XA 4NJMB 4G89A 4YCJA 1XZEA 4YAUA 1T5BA 1DIGA 3OPVA 3PLNA 4EFMA 2X7HA 4PLYA 4KUGA 4DQVA 4JJIA 3KZNA 4KYVA 3QYFA 2I91A 1JN0A 3B78A 1FP4B 5H02A 4PLWA 1VECA 2YN0A 1EWYA 2VCHA 2ZI6A 3KUKA 4LJ8A 3N7TA 4D9KA 1VMKA 4INJA 3GUVA 3STUA 2WSYB 4ROTA 3VR4A 3HS3A 1YVEI 2CT8A 3L92A 3UK6A 1HXHA 1ADCA 2Y1EA 1JPNA 4L16A 4YCBA 1U0HC 5EUQB 3EC2A 1EGHA 5IVDA 4DBZA 5CB8A 3SY8A 3O91A 4KTVE 4M8KA 3E82A 4NHOA 5HR5A 1SCUA 3Q40A 2PUJA 3WQSB 1XZJA 2FOXA 2OPBA 3A1EA 1PR2A 2P9EA 2CK3D 2CZQA 1PP4A 1QIIA 2P9GA 3EDYA 3MIZA 4YP0A 3ANTA 1RXUA 3KT3A 4QGBA 4V0NA 4DLPA 3C5HA 3DKPA 3F97A 5DCUA 3GLGB 5DBIA 1NNUA 2W6PA 2G5PA 4DOMA 2PGDA 2P9TA 2A84A 1GAXA 5AKJA 1UMBB 2OD7A 1OC4A 3OIFA 4L9RA 4MVJI 3GLTA 4V0LA 2WICA 1FW6A 3NBMA 4M55A 2GZ1A 3L5KA 4OQQA 5EP3A 1L1FA 2RKOA 4UBKA 1DAPA 4JEMA 4HDMB 4C05A 1WBDA 2CNNA 4WZAA 4EG8A 4YHBA 1TUBB 4UM9B 3CZCA 4IXNA 4LF7B 3IILA 1GZ4A 2M9MA 2O6HA 1ANKA 5JFTA 3QWIA 2BN4A 3JQFC 1NI4B 1O8BA 4XZ3A 3KR9A 1JEAA 3ZE1B 1OC2A 2ABWA 2DPXA 1YR8A 4J76A 1V2HE 3QV1A 2N1MA 2D0DA 3KWMA 4HJXA 3PL1A 1JHQA 4HEA1 4OHRA 3RVSA 1W9HA 5HQ3A 3O8QB 3AEXA 1JAXA 2WDZA 3K9FC 1UWVA 1XVLA 3NTOA 5FUBA 3STYA 5LZ2A 3GT0A 1J99A 1DJQA 3U4IA 4XDHA 1AURA 4YAFA 5U4QA 4BEJA 3PVCA 5BUCA 1N78A 1CW2B 1KERA 2JAQA 3MM4A 3I9LA 3ZW7A 4M9CA 4EJMA 4ZYTA 4KNYA 1T5LA 3GA0A 3K0KA 4I5DA 3RUHA 2G28A 2E4VA 1NURA 3QEMA 3SX2A 1P72A 4S0ZA 4DMGA 1TTHA 4GZ5A 5KAMA 1TGYA 4MSUA 3QBDA 4QYMA 3VSCA 1QGUB 2VPTA 1SQ5A 2Q7XA 3LC7O 4QAQA 1T1IA 3BD7A 4GMKA 7REQA 4OP3A 4YAIA 5DW3A 5C4MA 5ITZB 1RXCA 4S2UA 3ENKA 1VPWA 4KIGA 1E7RA 3D64A 1JPUA 1CUBA 3UGTA 4PAGA 4IIUA 4C22A 3VVBA 2JFUA 3DFUA 5CVCA 4JX8A 2GWRA 2DSTA 3GN1A 1GUDA 3P2JA 3PYMA 3Q3JB 4QL3A 4RK7A 3ZQJA 4R8RA 1EWQA 2E5WA 4MUFA 4JP8A 1QE0A 4XTRA 3IE0A 4UQLA 1N7GA 3I1JA 1XDDA 2OGSA 3SQXA 4KREA 2EIHA 5KJFA 4JU8A 5ALRA 5LLSA 1OFHA 2HR1A 4M49A 4TWRA 4G6ZA 3MBKA 1XTZA 5CCDA 3MJRA 3H8WA 4JXKA 4R1TA 3RASA 4B48A 5JNUA 4ER0A 1ODSA 3U3DA 1IY8A 3PL5A 4CUJA 3HJRA 3AUUA 1P4RA 1QIMA 4YLYA 3A4IA 2PPLA 5F7JA 2GPNA 3LLSA 1A5ZA 1RZRD 1ICEA 3C74A 3SYMA 3H2GA 2BH2A 3AVYA 1THMA 3ACBA 3HI4A 3OE5A 3V8MA 1NI5A 2NWQA 2B82A 3AFMA 1F0PA 4O5OA 3W5CA 3TEFA 5IF3A 2JLSA 4KWIA 1KJJA 3DGFC 4NCJA 5JWHA 4AQDA 4Y6RA 3JXEA 4F9GA 4RIIA 3L6OO 1FX0A 1KH3A 4AJEA 1RAEA 4WGFA 4KW7A 4S35A 1MA0A 1HG0A 2NT4A 4B2IA 5CFRA 1G5HA 1T0BA 1ZGGA 2ZI7A 1AHIA 5REQA 4UOZA 1Y7HA 3FKQA 4XUDA 3SZMA 3TJMA 2QDKA 2XQJA 2VPIA 5CDHA 5AVTA 4MGIR 1SCAA 4N0DA 2JANA 5B5SA 1DVRA 4M1TA 2QN3A 1Y8QA 3L7LA 3UT5B 4B3MB 4I55F 3NHZA 2O06A 3QQPA 5E7JA 1V25A 1IN8A 1YGPA 4CT0A 3FDJA 3HA5A 2QNIA 4OMFG 5E38A 1HFWA 1KJ9A 5DI3A 3GX1A 4Y2JA 1ODTC 1EK5A 4UCFA 4GMHA 2QY6A 2GA9A 5AO9A 2YN2A 3WL8A 4YLGA 1CUVA 2WJIA 2R7LA 5CDFA 4JJKA 1NU6A 5CYOA 4TRRA 2GFHA 2PEYA 2VDWB 1NLUA 1X7YA 3KDSE 1T6BY 2VA9A 3FYDA 3COWA 3S1LA 2ZM6B 1JEEA 3N87A 3PQ3A 4GL4A 4LCEA 4CI0B 3WRVA 1VB5A 4QPCA 1SC3A 3L93A 2Z8XA 5SV2A 1ZR2A 2FEKA 1M66A 5FO0A 3TI7A 2B8EA 3V7YA 3TQCA 4AO8A 1QC5B 1G2QA 5F52A 1RP1A 4BRSA 1K2VN 2RKWA 1E69A 4P53A 2ACEA 1GFZA 1UQTA 2OE2A 3QF7A 2BEWA 4RCYA 3DS8A 1XJWA 2J7KA 1S2GA 1BOOA 2GCOB 1JR3E 2XYHA 1YZNA 4HMQA 4O29A 3LT2A 4Z0PA 1N5DA 1V43A 4CIWA 3BMQB 1XCGB 3NB0A 4A2CA 4O3MA 3K96A 4RJTA 2VOJA 4O63O 3KHKA 3JQBC 4L3OA 4Z8YA 5B7PA 2FEWB 2ZB3A 3ROEA 4C2AA 5HUHA 4OHCA 1DAMA 1MKYA 2I4RA 2DUMA 4IYJA 5KYKA 4LXTA 1NQUA 1FDWA 1Z5VA 2OO3A 2H9IA 3EIHA 1KMHA 2BC9A 2JS7A 2WNHA 4FEYA 4MLDA 4W1QA 4BKQA 5HKKA 1A0OA 3DYIA 2XE7A 1P17A 2GBGA 5DCWA 4A1FA 3RYFA 3JTEA 1TEXA 1HQCA 1ZHHA 2QHXA 2MCFA 3TQOA 3BK7A 4O2BA 4B3HA 1KOGA 4FDVA 5DEIA 1D2CA 3KSDO 3O8LA 4M6WB 5CLJA 1W0KD 1S8AA 1GGVA 3DL0A 1B8VA 4CE6A 4X7BA 5EKUA 1WTCA 2C04A 2AQHA 2DKFA 4D5GA 2PUFA 5BW6B 1I1OA 1W46A 3C2QA 3W8RA 1SUEA 1DBPA 4MW6A 4YMTA 4UE3S 4ZOBA 2VH1A 2QQEA 4D3YA 1VXOA 1ZCAA 3M4NA 2ATIA 5MGNA 3A04A 4FFMA 3WBFA 3ZV6A 1T1RA 4REOA 4GKBA 4OGWA 1T0UA 2HK7A 4M0UA 2G1KA 1QIJA 4BIIA 2CL7X 4FYHA 4FVTA 3WXBA 1GNLA 3KFXA 4I2VA 1WCYA 2B8TA 1QFJA 4IDAA 3H2BA 4MRAA 1M67A 3QUBA 5G2OA 5LOVB 3IQIX 1O1YA 3IODA 5A7HA 3WB2A 1UP4A 2RI1A 3EXEB 4S12A 3U09A 2H85A 1JB1A 2K7ZA 2QPAA 4RF3A 4MEAA 1PTKA 1E6EA 1BHSA 1YI0A 2XB9A 5EJ9A 3N0RA 3RYCB 4XGKA 2E7ZA 5IBRA 3GP8A 3HO6A 3VR2D 1NHWA 1NJ1A 3O74A 1EBFA 4UAVA 3T1OA 4EJSC 1QNLA 1R0BA 4LSGA 1KDYA 3S0JA 2GR9A 1ZMXA 2O2JA 3AJRA 3DWGA 2IV2X 3TIIA 4WBSA 5MGBA 3CF0A 2BMDA 4ME6A 4BGUA 5F9HA 3H2SA 3IQEA 3SHQA 4C87A 3NDRA 1S9DA 3ZJYA 5L4LA 2RHGB 2REQA 1WSDA 1Z2OX 5KWIA 2QP9X 1O9BA 4RJJA 2HJRA 1V6AA 1NVWQ 4OHFA 1SBYA 5CT6A 4Q7QA 1K7XB 4I6EA 1KHTA 1EP9A 2EFDB 4LNUB 5KHAA 2FK8A 3VAZA 2ZSFA 4YMGA 3BRSA 2V7XA 3U26A 2KQUA 4G5HA 2IY9A 1QUEA 1USIA 2PT7A 3MLBA 3N0VA 3F47A 3ORFA 5SYAA 1SCIA 3K1YA 1M2EA 3GAMA 4IGIA 4LX0A 2D3TA 1Q83A 1A7KA 1FYWA 1RMTA 2KBEA 3R3XA 1OFGA 2BFPA 2IU6A 3IP5A 3H1PA 1TZCA 2PKEA 3IP9A 4GEKA 2VJNA 5B3AA 3T3EA 4C0SA 4E5NA 4M3NA 4DA0A 2QYTA 2OLEA 3RSZA 2PTGA 4CIDA 3TRJA 4BVGA 1COWD 4PGGA 1ZUHA 4KQCA 2V8OA 4FYIA 1CQXA 5JTUA 1GKKA 4EO7A 1RCTE 5L3QA 4FMDB 1XB2A 4XFJA 3AUFA 3CUVA 3OC6A 2QGNA 4MKRA 4DKJA 3IBGA 1DKNA 2ORVA 2IOFA 4PV7A 4TSFD 4UM9D 3V1LA 1H5UA 4CMEA 4ZZ1A 1XI2A 1AO0A 1BIFA 3NM6B 2QLLA 3F71A 4R2WA 1ADJA 1AKVA 1EK1A 1Y1SA 2CLSA 1LDEA 2IE0A 2WZDA 3DXFA 3JRNA 3LC1O 3FWHA 1YD7A 3M81A 1TO6A 3N75A 3PC4A 4IQGA 4N0QA 4P6VF 1Y9AA 2HJHA 3HUEA 4XXHA 4YV0A 3ORRA 3M6VA 2Q45A 5D6NA 1XMQB 1U3CA 3S7ZA 1JZTA 2ZYRA 5HZMA 2VJYA 3OH8A 2ANBA 3EXFA 4XVQA 3Q7IA 1G3RA 4RA6B 4ZFNA 3C4VA 2FQ1A 4XWAA 1UPFA 2JFGA 5I7RA 2IS4A 5AHWA 1KBZA 2W37A 3EFHA 2CE2X 3QVVA 4UZSA 1WHTB 4M60A 4AP6A 1IQUA 4PSCA 4J0JA 2GILA 5HUJA 5KMGA 3FYUA 2X9QA 1YJAA 3HEAA 4D96A 1PL6A 4E94A 3WL4A 2H7XA 3UYLA 3WKEA 1LWOA 3ODPA 3DJYA 4H15A 3SFTA 2UZ3A 4QGGA 2W6OA 3E9QA 3HWWA 2CMKA 1ZN9A 3C4QA 1NJ8A 1WPQA 1V3QE 3L8CA 3OF3A 2WOJA 3RABA 2OA0A 1TQ4A 1SD2A 5KKAA 4A7PA 4A8TA 2O2CA 2ZT6A 3GK3A 4YUXA 3WYEA 4ZCQA 2DTXA 4ZGBA 4L95C 2NXCA 3PQCA 5EE3A 3KOYA 5KDLA 3PD7A 4CL3A 5IN4A 4B3TB 3B9RA 3MFYA 4NZMA 2QZJA 5CFNA 2P0YA 1T36A 1ZD4A 1GN9A 1IBCA 3AIMA 4J4HA 4BO6A 1KJQA 1U1DA 3CLRD 1WPGA 2VYND 2D5CA 2W8BA 5BUZA 2Y1XA 4Y0AA 5CAEA 3PIRA 1P3JA 2MJLA 1X7HA 3RR2A 1JIKA 4DGQA 3LP8A 1SJ9A 2Z8YM 2AD5A 1ZD5A 1KR2A 4G0VA 4BVHA 4FQ7A 2EZ9A 4I1SA 3UAGA 4DDTA 4KGXA 3PZRA 5AKHA 5AMXA 3WGOA 1F2TB 1HE4A 1XTIA 2COKA 2OBYA 3EWIA 3MMSA 4LYDA 4Q3EA 4V02A 4YAWA 4TS4A 2WSBA 3SFZA 1W0CA 2XOKA 1YK1A 3V8NA 5FT9A 4DAEA 1USVA 4URHA 1DWQA 4ZI7A 2XZTA 2OZPA 3K32A 3CX3A 3Q9LA 3E1GA 2HOQA 4W99A 5CRIA 3G17A 1VSVA 2AKAB 2OMEA 3RUCA 4UTZA 4DPKA 1KYQA 2FP4B 3SQOA 3KS9A 2GLUA 1NPTO 4OU5A 1DU4A 4M0MA 4J8PA 3QUTA 4OHBA 1DKRA 2VF7A 4KQMA 3WSTA 5CXSA 1Y5LA 1R6VA 1N4AA 2VT3A 4MQEB 4JC4A 3UG6A 1W44A 1GCAA 1ZKMA 3QLJA 2GTIA 3VUFA 2O52A 2OO7A 2AGVA 2IODA 5K3AA 2EARA 2RGCA 1G6KA 4V03A 1ZIDA 2XZPA 2YJZA 3OT4A 5LXTB 1TQHA 4YRCA 1AMOA 4ETNA 3KG2A 1KU0A 4JWTA 1KYVA 3PP8A 2F43A 3UXYA 3SQLA 4ZHQB 2FOLA 3I0MA 2G3YA 2D06A 1Z2NX 1P2FA 2QK4A 1ZH2A 3R3VA 4O33A 5K3SA 1Q77A 1SZJG 4H7DA 2H4WA 3PI6A 1E9EA 3U7JA 2GF9A 4YMLA 4OKIA 3GRKA 2I4NA 3DG9A 4HWSA 4AD8A 3QA3E 1H1LB 1UKYA 4IIXA 3SS9X 1RWVA 4MGEA 4MRRA 2XW6A 2YYZA 5GY7A 1NJSA 3SBOA 1W4RA 3STHA 1Q44A 5IDYA 3VOAA 5ADHA 1F17A 3LDHA 1LDBA 2R751 1ORRA 2AYXA 2JJYA 2LTAA 2QTCA 2V1XA 2O7SA 3CLRC 4H1HA 3WGLA 3SXUA 3LW7A 1SKAA 2IKQA 2VF8A 3DHNA 1ZA2A 3VJKA 4M0FA 3RRYA 3OLZA 2DKOA 3KPWA 4ZOLA 4E3ZA 5DTIA 4HN9A 2VK4A 3IV9A 1Z0UA 2H11A 1XEWY 1QGYA 1W52X 2QD5A 4QODA 4CKWA 3D8UA 4GPIB 4Y9SA 4DR1B 5IKXA 2PR7A 3SYTA 2XYGA 1XLWA 3EZXA 5HDBB 1S2DA 1V39A 2QZSA 1J24A 1TRHA 4NEGA 4X71A 2BI4A 1NGSA 4ZV9A 4NAUA 1IUPA 4B4WA 1AMUA 1GPH1 2FMFA 1N0UA 2QL9A 3KNZA 2YFHA 4NE7A 2C5BA 3TVTA 2AF4C 1G5PA 1M2GA 3DTVA 4LRWA 5AJWA 5FHRA 3HUUA 3LQ1A 1U7ZA 4QUEA 3U4DA 1CJBA 4CLHA 5T41A 5AQ1A 5CA1A 4K9KA 4CT5A 2Z4TA 1C50A 3GPDG 2TS1A 4RMIA 5EIWA 2WHRA 4RGVA 1E0AA 2Q2VA 2ZWMA 3A4MA 2HSZA 4GZ3A 4H7PA 4RLQA 3O0DA 4DIEA 3PQEA 5KTMA 2H7CA 2C2OA 4TYWA 3H75A 4DNFA 1PGJA 4AYWA 2EU8A 2F9LA 5IXJA 1SAYA 1V5IA 4JI3B 2WWYA 2DLCX 3CURA 5T8KA 1VHLA 4G8CA 5JAZA 4QBHA 2XUDA 3C15C 4GIBA 5E0OA 3WA6A 2FRDA 4Y9TA 4WW0A 3VR6H 1UH5A 5FLEX 4X00A 3RYIA 4KE7A 1I0LA 1OOEA 1Q0ZA 2C82A 3IYLW 5KWVA 4XDZA 1IWOA 4Z4FA 1L6RA 4C0LA 4C4YA 3LIIA 2EZTA 3U6KA 3IP3A 3L7YA 4I81A 3OZCA 4TVBA 2DHCA 4WX2B 3DLTA 1GNTA 5D51S 1ZSNA 4IEIA 4TWAA 4NQRA 2PUHA 5B1IA 2LIVA 4QDOA 3VKGA 3M3PA 3QU9A 1N9GB 3TMAA 1ELOA 4HFMA 4Q4HB 1I4OA 1E9FA 5LJIA 3NJRA 1SCKA 3UWSA 4RSHA 2I2CA 1RPNA 3G5AA 3GBSA 1M1YA 2FR8C 4GZLA 3HO1A 1U5BA 4NI5A 3PFHA 3JYLA 1PJZA 2QGZA 3ABSB 4D42A 1C0EA 3VR6A 5LZ4A 1DIBA 1W93A 4TXNA 2PKWA 4TKVB 1SG0A 3PHJA 5KPJA 3UA4A 1Y4AE 2IYOA 1QJCA 1K8RA 1N2OA 4ENVA 1YU6A 1HY3A 2GARA 1N2ZA 1NW9B 2Z43A 2ZYAA 1YTUA 2IOQA 2YWGA 2MSDB 5ALKA 1KJIA 4CMJA 1G19A 5DGDA 1C7QA 2XCSB 2GBFA 1ABEA 2DAPA 1P73A 4F84A 2X58A 2JIMA 1L7NA 1NW3A 2BP7B 4WFIA 5AM1A 1W5BA 3ZJVA 1VPTA 5K3OA 5LVAA 1QKIA 2IBSA 2D6FA 5FYDA 4RL4A 2POCA 2QMQA 3UM9A 1FP2A 2QM3A 2VHUA 3C6ZA 3FZEA 1L8AA 1A1VA 3GDFA 2XB4A 1OX5A 1AKYA 1WF6A 2J7PA 3IAS6 5B1DA 2LKCA 3CUTA 1PIWA 5FWXB 1C4XA 4TN1A 4JBYA 4KFUA 5F7OA 2EWVA 3KZ1E 2C77A 1QV7A 3Q6NA 2G08A 2WW8A 4JMLA 4TMFA 4J0QA 5BP7A 4ZVSA 1WM1A 3GP5A 2ZZMA 1OI7A 3TRDA 4BUJA 1XRQA 3PTAA 3FOCA 2FETA 5HJ2A 1QQ6A 2W22A 5EJ8A 1NOKA 1XZMA 2A9KA 2QR2A 2WF9A 4UPEA 3LUJA 7MDHA 2FMHA 4KMRA 5CU7A 3WZ2A 4I9NA 1XAIA 3UHJA 3WOVA 3OE1A 3KB2A 4RL6A 4W7SA 2VIIA 2BWJA 2UDPA 3QEOA 3WQQA 5KVSA 1G8HA 1YU9A 4MV0A 5BNFA 2NSYA 1EGAA 1JEQA 2XGMA 1MIOA 2WJVA 1JLLB 1I9GA 1KBOA 3IR7A 1ILWA 2QP4A 3DYBA 3RS4A 3MUEA 2XX3A 1T2EA 2HWYA 4XFKA 4EGJA 1JIIA 1SFRA 3JALA 3OQOA 1U28C 2FEPA 4K6GA 4KU4A 3GZ4A 1W47A 2TECE 4L50A 4RVUA 4WEOA 4RLHA 4AKSA 1V9LA 1HTWA 1KI8A 1UMDB 2VJOA 4W63A 1S4MA 2QGFA 4V3BA 3D3WB 3HA2A 3IUYA 2FJ0A 1SD5A 3BFJA 5E9QA 3O90A 3WY9A 3CF6R 2RBEA 1ZKDA 4EA9A 3CV3A 1ZU5A 3BK1A 3HRHA 1GAEO 3AF3A 3ZOZA 2CB0A 2VSQA 3H7AA 1VBNA 3HN2A 3F9CA 3DWFA 3IDOA 3MERA 3OKPA 1SU4A 4KQ2A 1DOAA 4P81A 1FDIA 5ECWA 5FTWA 4H9GA 1XP5A 1VA5A 4XRRA 5AOVA 3B70A 5EWJA 4N3AA 1IHDA 2DP4E 9LDBA 1E8MA 3I6MA 2WJHA 3DQZA 4W5RA 2Z6AA 1TO1E 2PYZA 4I5GA 1T4GA 1X92A 4KQFA 1GLGA 4YJ2F 4ZN6A 3TLYA 3ICWA 2CFIA 3ZWWA 4TTPA 1MDFA 4AYXA 1LPBB 5H8WA 2Z2YA 4CG3A 2IUFA 3E8XA 1L7DA 2PUDA 3CCBA 1XTUA 3T4UA 2W4QA 4CQLA 1Z8NA 4KGVA 1J8MF 2ODTX 4UQPA 3TWOA 3RVLA 5IT5A 1F0KA 5AW9A 3FYHA 3K3PA 3SC6A 2QPLA 5LP6F 4AYTA 4Q3OA 2GTHA 3VYVA 2EHJA 1MABA 2FPOA 3QLUA 3O2NA 3FUWA 3OQPA 3BD8A 3PUIA 3U4CA 4MW0A 3AY6A 3PE3A 2WD7B 2O48X 4MQ6A 4OYLA 1IATA 1N6LA 2O2HA 2ZIAA 3R0JA 3O8NA 4J3FA 3CEAA 2OXCA 5BOSA 3HVIA 1LVHA 1NZJA 5M29A 5F2OA 1UAAA 4FKZA 3C8DA 4ZREA 4LYYA 5TF4A 3FNQA 4HAUA 3HB7A 1XXHE 4NP6A 5I7OA 2P4SA 3GG9A 5IYZF 4KX5A 1W2GA 2RGYA 1KDTA 1YA8A 2DBZA 3KZOA 3OT5A 4YFYA 4DC1A 2IF0A 2R1UA 4Z0TA 3WZMA 1YNSA 4RORA 1XTSA 3Q5EA 5AJVB 3MWLA 2HBYA 3AF1A 3LV8A 3A4YA 1EKXA 2BZ1A 3C3YA 1T15A 4C0HA 3B1JA 2QROA 5BWBA 3TE6A 4L2IB 1BMTA 3PICA 2C88A 1T34A 5JJKA 2OAGA 3DO8A 4YONB 4RVHA 3DAPA 4ECEA 3AVTA 3NRCA 3PWTA 3RRZA 4LECA 4MEBA 4K2AA 4Q0MA 1E94E 4R9NA 3LUAA 1JG7A 4DWVA 1MV5A 4XX0B 5KOJB 4MITA 2E5LB 1NBEA 1ZIYA 3F73A 3GWGA 2WFAA 5DISB 1FZTA 1YR6A 2YJ6A 2XSZD 1E3DA 1K97A 1WB4A 1ZRSA 4EHNA 3Q0EA 1G7SA 3PE6A 1H0RA 1NYQA 3QEMB 1Q1NA 4KKXB 4U6NA 1QRTA 2YVQA 4URZR 1TTQB 2GN4A 2V0GA 5AI0A 4RXMA 1OAOA 2ZQYA 5K51A 2SKCA 2G9RA 3TPZA 7REQB 5KEIA 1EXVA 2J48A 5FV7A 5KSPA 4BNYA 2RH8A 3S3TA 4UNPA 2D5IA 4TZ6A 121PA 2GNPA 5KYUA 1R0RE 3DMRA 1YASA 3QOYA 8LDHA 3OEWA 1SUCA 4XW2A 5LYJF 2JLWA 1YQDA 2O7NA 1DTEA 1O94A 1V1MB 3ANNA 4BUCA 5A2QA 3O83A 1E1CB 1VE7A 4HB2A 1LDYA 3HB9A 1PJCA 2AK3A 1Y6ZA 2VRWA 4JCOA 4R3WA 1LLUA 1EVQA 2X13A 3EH2A 3DYVA 4FMCF 3RRXA 3TNJA 2FSSA 2ZJ0A 5FUMA 1R6BX 3O4HA 1Y3HA 2XCRB 1X7WA 3LUHA 4OFBA 4ZEXA 1AQYA 3HNOA 4LF6B 4RPGA 1ZJ6A 4QVKA 4MZDA 1DAKA 3K0BA 3PRHA 4RVNA 4B32A 2XNJA 1RCFA 3QSGA 3UJAA 2A92A 4R9SA 4G63A 5JPCA 4GICA 1IXRC 5IVKA 2VQ6A 3ER9A 2ZUWA 4UM5A 3L7JA 2RJ3A 4BNVA 1E9VA 4U9IS 4LBVA 5IWCA 3SHWA 1VJ5A 1P62B 2X8JB 1M7HA 4OM8A 2V3VA 4EW2A 1E2KA 3W5BA 5E1BA 4M2LA 2MWMA 4QDZA 3SICE 1AKTA 4WECA 3E23A 4V1CA 5MN4A 2PUGA 3OIVA 3OP4A 1FX0B 4ZT4A 4LJSA 1WDKA 3KSMA 4MGKR 1TZMA 1YE5A 2E89A 3X1KA 2P9CA 4C4SA 3RTBA 1FMJA 1MTOA 1U98A 2FB9A 2XNHA 1E9CA 1J2JA 3DBVO 1D04A 2QX4A 3WIBA 2Z5LA 3Q5DA 4TL9A 5BYBA 1P4SA 2H7VA 2W6MA 2ZRHA 2ZTSA 3QNWA 3RSCA 2GPAA 4NJOA 4HUJA 4G0XA 1P33A 2P9HA 3JASA 4KXLA 4LMPA 4CKXA 3IURA 3EVGA 5DT9A 1HLFA 1DEOA 1EFCA 1UKEA 2I80A 1E7QA 2ZPUA 3K0CC 2JJQA 4X6UA 2NM0A 3LNTA 3T0IA 1P9NA 2OWDA 2XYVA 5HCNA 1ZUIA 5CTJA 3RM3A 3WX0A 5DI3B 4BGDA 3WLMA 2J85A 2R8XA 4N01A 4NABA 3CPSA 2FRXA 4PQYA 3JV7A 5J2TF 2PMCA 3NUGA 4HNHA 4JGIA 3LUBA 4KK3A 3K5WA 1E0KA 1C14A 5G53C 3P19A 1NA5A 2BEJA 3VMMA 4GBJA 4AMBA 3HVRA 2Q4EA 3ZGNA 2XODA 3O4FA 3PNBA 4B0OA 2IKSA 1BYUA 2GM3A 3JATA 4OGFA 2GMWA 5GJVC 5JAHA 5TJHA 2HGZA 1DPGA 1Z13A 4MRMA 1UJ4A 1NR1A 3V6MA 1T6YA 3EK2A 5EZYA 1SWVA 2YR0A 3F74A 1K86A 1F5NA 2ZVDA 1KWKA 1KQNA 1RPJA 1S1MA 2A59A 5G02A 3KE9A 5EE5B 5AXDA 4BGEA 2IS6A 1SBQA 5TMPA 3OCZA 1G8GA 3HHEA 4LK2A 1EM8B 4JYCA 2VTEA 4HMOA 1X80B 3EUFA 4WN9A 1I2AA 1W75A 2X0NA 3D8RA 4OFXA 4XAQA 4DHEA 2I29A 3U62A 2HMVA 4BGIA 4YN3A 4BFUA 4MPDA 5TARA 5DTEA 1W48A 4QOIA 1SXJA 4HWGA 3HDGA 5CHEA 1PK8A 3WMGA 3PVSA 3HJGA 1Z4NA 2C5HA 3OZWA 4E5UA 2C5EA 3ED1A 4ZPJA 1PKEA 3BSSA 6ABPA 3DT8A 4AVYA 5ICGA 5JWOA 3ZTYA 1V26A 1APBA 2AE1A 2AEMA 1PEDA 3BWBA 4NOJA 2C7QA 2KSQA 3NIFB 1U0LA 1AK2A 3NHLA 2B1GA 1NQAO 1QHGA 1UBGA 3C85A 1NLMA 4O2BB 1QVAA 2OP0A 2P4HX 4ZU6X 2PJDA 4BMXA 3AU8A 1T1JA 3M49A 1ULTA 3FTNA 3TCKA 3SHTA 2A9QA 5C5EA 5KS2A 1G3IA 2VYVD 1OXXK 1XO1A 1E2NA 2Q8PA 3LZDA 5CM8B 2OGWA 2BGGA 5TQ0A 1ZNYA 2W90A 4BMPB 1K4YA 4CCWA 4C0QC 3EH1A 2JGDB 3K20A 2WB4A 4W7HA 5KTPA 5JSYA 5AHXA 3EPLA 2R6CA 3H65A 2FEMA 1X1EA 2PZBA 1W4AA 2HFJA 4G56A 2E2WA 3SHFA 4BLUA 4HGOA 3RVKA 2QD4A 1NQ5A 2PYDA 2H06A 4IKPA 3IRUA 3S8MA 3BWYA 3TSOA 1NBAA 1Y63A 3VR1A 2J9FB 1JH8A 4XEHA 5BSTA 4AAYA 4GSYA 4AS1A 1PJ4A 5BN1A 1ECJA 1B15A 4CL8A 1ENZA 1T4CA 3TLEA 3A6JA 4G0UA 2R6JA 2HRBA 4IXMA 1Y5RA 1PL0A 3DT6A 2Q4OA 3TB4A 3W1WA 3ZXYA 3J81k 2VQEB 2AFVA 4AZ3A 3R7SA 3HBFA 4Q24A 2RFLA 3QXHA 4EGAA 2X0IA 4YROA 2RB5A 6YASA 3WDSA 5LC1A 5BR4A 1DCFA 1V2GA 4N9WA 2C98A 3AVVA 4UHEA 1EVIA 1VOTA 1FJ2A 2B20A 1NSFA 1VJCA 1Z5ZA 2YIVX 4DLVA 1UKCA 4QBTA 4BWYA 3U3RA 4YRNA 5F33A 4JYZA 2ZUCA 4EKEA 4HRYA 4LBWA 1UBEA 4YUWA 5HMMA 3GLSA 4N7JA 3DOIA 2JZCA 3F3SA 4EYGA 2OD2A 1W88B 3R20A 3PNYA 1OZGA 1RRCA 1CR1A 1YZGA 4ZVPA 4UEQA 3SFVA 2Q1TA 3UCEA 2FPMA 2DCUA 2DMRA 1K3UB 2ZUTA 4GP6A 2H5LA 2JKVA 1RLMA 2R6ZA 3TRHA 4F5WA 5DHQA 1NUUA 3A9CA 4KXMA 1D07A 5FI5A 1LI5A 2RMKA 1Z73A 2FW9A 3FCCA 1WQ1R 1TB4A 1VCOA 2QPOA 3L6EA 3TIFA 4E07A 1E9DA 3IR6A 2Q1XA 2FZ4A 1N6PA 3I45A 4LDJA 1HLGA 1P81A 3Q2OA 5DM60 3B20A 1UC9A 4WAUA 1GZVA 2ATCA 1Y4DE 3F7NA 4MUNA 3ZHSA 2YQ5A 1FDUA 3G8AA 1HFEL 2AFHB 1NE2A 1PG2A 3W2EA 3TZ6A 2I66A 3K9LA 2OC4A 3ZD6A 1B0UA 2HDNB 4EYQA 3L6CA 4ND4A 4QGAA 3X2EA 1FZQA 3NEJA 3TUZC 1EZ1A 1JIQA 4JR2A 3RUIA 4ND1A 1PL7A 4BX3A 1Z6XA 4MWDA 1U7WA 3EA4A 2XGGA 4B83A 5LD2B 3MPOA 1NQTA 3FUTA 5ALOA 2BFBA 4PN3A 3SSAA 1LWNA 3UOGA 3A70A 1EEHA 1TMKA 4C7OA 2CEKA 2ZYIA 3WC4A 4K9DA 5JYCA 3I2HA 3H11A 4V24A 5HKBA 2P9BA 2YC4C 4HDRB 4YRKA 3OZVA 4I3GA 2PZJA 1MG5A 1N2XA 1FFDA 3C7DB 3QKTA 3WGZA 3GLIE 4G36A 1F3OA 3CYFA 3RPEA 3ZK9A 4F2HA 2QTVB 3NYWA 1Y1KE 4D0LB 5LP1A 3FFAA 3GELA 4RV9A 1P60A 2H54A 2WAOA 3IMGA 5ICMA 4P32A 2JDIA 4Y2HA 1YDWA 2WJJA 2JFXA 3ELDA 1J5XA 4FEAA 3V4RA 2FWMX 4KI0A 2Q5FA 2Q6KA 4F06A 2CHFA 4WV3A 4EY7A 5B6JA 3AB3A 4MVJG 3LVQE 3ABIA 3GLFE 1BE6A 1OT5A 1IXKA 2P35A 3WP1B 3GRFA 1JG3A 3PHGA 4Z5XA 2ZE6A 4FT4A 4PC6A 4TUYF 1FNMA 3MWEB 1R4MA 1U0EA 3CLKA 3L9WA 1VMIA 3K0FA 1WDTA 3FZGA 3T3GA 1QB8A 1UC5B 2E18A 1KSHA 3BHMA 4RPHA 4IMJB 3MLEA 1IY1A 1YR3A 1SVSA 2QRQA 3LWDA 3P4UA 4Y2SA 4DSNA 1KY4A 1OBVA 3BMNA 3I5AA 3I04A 3OM8A 3ZGXA 3PLAE 2MMGA 4LRYA 3ECAA 5BYAA 4H31A 1PZFA 2VK2A 4U7JA 1RWOA 1ICIA 1T5TA 2ZATA 5B58T 5CAEB 4C7JA 5C8YA 4ENQA 1LVUA 2C4NA 4MUAA 4OREX 2A2ZA 1Y4SA 1SG6A 4HYTA 1E2JA 5AIAA 2XWJI 3FTQA 3HA7A 5EMHA 1LV7A 4OI4A 1K6JA 4MAFA 4D0SA 3ZDCA 2VJMA 4DLYA 2C2XA 4RHYA 1K3FA 5M7EA 3WDLA 1AKUA 3OFKA 3DKKA 3EEQA 3HWRA 4UHDA 4WZBA 5BW8A 4YAGA 4H27A 4TLEA 1BS2A 2VVTA 2X2PA 1QP8A 4FR2A 4B4OA 4DZZA 5KB3A 4CLEA 5KZMB 4AI6A 3HKEA 1E2HA 2HT6A 3WO0A 3KQWA 3HY4A 3IPLA 4ZAWA 3SGLA 2J6IA 2PJZA 4YJ3F 1WD5A 3WJ2A 3OCUA 4ZAXA 3ZVLA 2AUMA 5LLDA 3I61A 3IAXA 2LUOA 1JIUA 4QYIB 1DE0A 1JBEA 2H2IA 1LSUA 1XZHA 2ZR8A 1SKQA 5ENZA 4DHWA 1ISMA 2PG3A 2QQGA 4MUEA 4BKMA 4BEWA 1XLTA 3KJHA 1EK6A 5G41A 4LMBA 4Q7JB 5D84A 1EP2B 5PNTA 3UA3A 4AKTA 3ZHTA 4NATA 4HGRA 4PC3A 4QELA 2XCTB 5LMUB