3QVUA

Crystal structure of ancestral variant b9 of sult 1a1 in complex with pap and p-nitrophenol
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
288
structure length
288
Chain Sequence
SRQPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFNRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPDPGTWDSFLEKFMVGEVCYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTIPQEIMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfotransferase 1A1
publication title Directed evolution of sulfotransferases and paraoxonases by ancestral libraries.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2011-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qvuA00
5IK2A 1G9XA 1RFLA 1KJWA 3QG5A 3GLGB 3R9IA 2G0TA 5AJZA 3RS7A 2XNDA 1IXRC 4TZ0A 2ZRPA 3WY9A 4DB4A 4M1WA 1A2KC 4LDJA 4LV5B 3HPQA 1GZSA 5AR1A 5FUYA 1Z5ZA 3CH4B 5A5GA 1MO6A 1H65A 3VR3A 1N0UA 4D25A 3RHFA 3BH7A 3ZQJA 4O2RA 4RD4A 2XITA 4YMTA 1VG8A 3UMRA 4KVAA 3A1SA 3HJNA 2R6CA 4EKDA 2ZRNA 4DLXA 4MGIR 5AUNB 2C5LA 4KODA 3K0FA 3NG1A 2GILA 4L16A 1S1CA 2XTZA 4GP7A 1N2CE 4BZQA 1PLKA 5FTMA 2G83A 1PV4A 2H16A 4HLUC 3ZS9A 2WJYA 4AIIA 4MYTA 4HAYA 3U6KA 3S1AB 4NKRA 1P2VA 4FCTA 4Z8YA 3WNBA 5FBQB 3NBFA 3FOZA 1E9BA 1FW6A 1UDWA 2QMUA 5C18A 2VP5A 1CF4A 1Q1EA 1YZGA 3WRXC 3HP1A 2ZVQX 3BERA 4US2R 1TNDA 3R9XA 1KO7A 4TLDA 2AKYA 2QQEA 2XEXA 3BOSA 5JECA 3ZVMA 1FQKA 2HT1A 1CRPA 2JIZD 2HDNB 1QHHA 1VMAA 2CHQA 5KNBA 1IQPA 1DADA 1SXJA 2CVFA 2QY9A 1OKKD 2FPMA 5DH9A 4II7A 4C0JA 4MDEA 1W2GA 1YQTA 5L3RA 2YINC 3OIWA 3CNNA 2NGRA 4HSEA 1ZUHA 3SQXA 2ZAOA 1TEVA 3QOFA 1ODFA 1FMJA 4PSAA 4Q9IA 1ANKA 1FMLA 1K5DA 4S2EA 4XD7D 1GRNA 4QGHA 1NN0A 2HEIA 3A1TA 3HYTA 1EX6A 2YV5A 4JLPA 2R6DA 3I61A 1E2KA 1WQ1R 5EUQB 3AF4A 5FOXA 2R44A 2X8AA 3GJ6A 3I8XA 2FPLA 1OE0A 1SVWA 4P4TA 1S3GA 4G5SA 2Q9CA 1KSJA 4BEBA 5H8WA 1M34E 2EYQA 2ODNA 2P5TB 4MGZR 3W8NA 4IFBA 3VU9A 4URWR 5L3SA 2BMEA 521PA 3VX3A 1TTTA 3LX8A 3TAHA 2P0EA 1GNPA 2YWGA 5KSOA 3K70B 1JR3E 2WMNB 2OT3B 3TK1A 1SKYB 5TV2A 3SYNA 2IBMA 2N1BA 2PJZA 4LHYA 3PXGA 1L2TA 1ZVQA 2B6HA 1ZP6A 2ZI3A 4U7DA 1G3RA 5EP2A 3GLGE 2P2LA 1KTVA 3WNCA 3K0EA 1XZQA 4TMWA 2IXFA 2WBLC 3WHLA 4DRZA 3RRMA 3CPHA 3U3KA 1TADA 1FZQA 1XXHA 3KQKA 4MYCA 4FMCF 1XTKA 4B75A 2REOA 3AV0B 4HDOB 5GADl 4FMCB 4C0SA 5J4LA 2F1RA 1WRBA 3IIKA 4JL8A 4BFSA 1W7AA 2GK6A 2F1IA 4IOLA 2H92A 5GJBA 2QM7A 3K1JA 1OB2A 3KB2A 2AL7A 1AGRA 3KUDA 4CW7A 2V3CC 4LJ6A 1YJ5A 3BRWD 1R2QA 4QKQA 2IS2A 3KKQA 2VSFA 1E69A 2GEDA 4D6PA 1M7GA 1FTSA 4JKIA 2HYDA 3ADDA 2JLQA 3REGA 1CBUA 1NMXA 2EW1A 1G3IA 2QL6A 3D7MA 3Q8XB 4PPGA 1A2BA 4B43A 4MKHA 4BECA 1E4VA 2QSZA 5E7IA 4KFSA 4TWZA 4OHVA 4YMUA 3PEYA 3TSOA 3KJHA 3LBIA 4NDZA 4M0LA 4FMBB 1D5CA 4EFMA 2ZSFA 2YC4C 3BGWA 3OFND 4G5QA 3QXXA 3FPAA 3EPHA 3BB3A 4RD3A 5IHPA 4OQFA 1NVWQ 5KUTA 5CYPA 4L5BA 1MOZA 2EFHB 1E98A 2G0NA 2FG5A 4AG5A 1OFHA 5DIFA 3T1QA 3WHKA 5CLLA 5FUXA 2QM8A 4GOKA 1QHXA 2I4IA 1LS1A 3DZDA 3QSYA 3NWJA 3U5ZB 3TRFA 4MUBA 5E4FA 3LLUA 5EJEA 1EGAA 3TVDA 3GFTA 2REXB 3WBJA 5KDDA 3RS3A 2BCGY 2XXAB 5BWMA 4A36A 3WMGA 4B48A 2EFCB 1OFTA 3CKLA 3LQQA 1DO0A 3U2QA 1VIAA 1TQ6A 2ODWA 2BJVA 2G88A 3DZ8A 4IVQA 3PUZA 1L4YA 1NF3A 2DBYA 3FHTA 4BGDA 1HYQA 2GTPA 2Q3FA 1E1QA 2O52A 2WPDD 4C0HA 4EQ6A 1S96A 1R5BA 2OESA 2IHYA 3Q7PA 221PA 2P6NA 3FHCB 1YRAA 4FW9A 4LPSA 5LB4A 1XCMA 1XTIA 2IYQA 3VTKA 3EG5A 3OESA 5EZ6B 2C04A 4D2IA 1VTKA 4IEIA 3KZ1E 4C30A 4AC9A 2JJ2D 3QPUA 3PV0A 1ESMA 1YZTA 2KE5A 1GP2A 1SVOA 3D31A 4LJ5A 1E1RA 4DDTA 5K8UA 3EA0A 4JLAA 1SQ5A 3MGCA 1S0UA 1L4UA 2W6ID 4LJYA 2WWGA 4NYMR 5HPYB 2ZREA 3BJIC 3K0AB 3A1WA 2J0UB 3S1AA 2ZU6A 2ODBA 4ZIRA 3T1VA 3T61A 2BEKA 2Q0HA 2XNSA 3G5UA 3MD0A 3UATA 1U0HC 1XCGB 1ZD9A 3RDPA 4GSYA 2VF7A 1XF9A 4P0TA 2V7QD 4A6PA 4FIDA 2XNDD 1UBEA 4HAUA 2FEOA 3CX8A 2A30A 5FTNA 2BM1A 5G40A 2FPKA 2N46A 5LB2A 4G0NA 1GNRA 2JDIA 2IEYA 2O0JA 2ONKA 4UNNA 4XVUA 1AS3A 2AK2A 2H57A 3VQTA 3FKSA 3OZXA 5FBVB 3L0IB 3EIQA 3GFOA 2Z83A 2EYUA 5JI2E 1W0KA 2QAGA 4M1MA 1R0XA 5FPYA 4PO8A 5IDVA 1ZM7A 2OILA 1CJTC 3OAAD 5SZIA 2GVDC 2HF8A 4L9WA 4UXHA 3LV8A 4PZZA 1US8B 4TTQA 1LVGA 4PAQA 1WMSA 1FL9A 1M74A 4HZIA 1E99A 1XEFA 3A4MA 4NMMA 4JYBA 3FMIA 4Q1FA 4AKEA 1AS2A 3THXB 4WA7A 4LOAA 3QBVA 2WJHA 4A6XA 2ZYVX 1KDTA 3LLMA 1E94E 4DSNA 1MABB 1X6VA 5FI0B 3ZYCA 4AY2A 4FXPA 4PHHA 1CR1A 1NBME 2DHRA 5TDHA 1T5IA 5DE3A 4IVRA 2EU8A 2EVWX 3U7EB 1TMKA 1ZYUA 3TIFA 4Z51A 1BS1A 1S3SA 1W36B 3OE7A 4D26A 1ZCBA 3VR2A 1BMFA 1W44A 4BFVA 4PANA 2DFLA 2RHDA 2KBEA 3MWLA 2IYXA 4HATA 1P2SA 1OIVA 3RNLA 5FUWA 3K9NA 2IW3A 1UBGA 1Y63A 2LKDA 3DKVA 4ZCIA 5DN6D 1ZJ6A 3ICEA 3AVQA 4I99A 4B3DA 3CRRA 4A0HA 1R0ZA 4IOKA 1E79D 2AR7A 4TTRA 4BPBA 5FPKA 2ZRAA 1AJEA 4R2HA 4JLOA 4RFSB 4GL2A 2W0MA 2Z4SA 2VIIA 1Q3HA 3FGNA 1UKVY 4RD2A 1DAEA 3FMFA 3THWA 2CEAA 1Z0KA 1CULC 5CK4A 1JPNA 1Q21A 2A2ZA 2JCSA 5C4GB 4U02A 1W2HA 5EXXA 3UMSA 2PZGA 3PUXA 1FUUA 2ZRHA 5JJIA 3L0SA 4Q47A 2JEOA 3NBYC 4PTLA 4RZ3A 4EFNA 5FL3A 2DWOA 5H70A 4X8LA 2QRZA 3DOEA 4B3GA 1FPMA 1JJVA 2NTYC 3SFZA 3GJXC 1AGPA 3PEUA 1PUIA 2R9VA 4B33A 3K70C 1SVSA 2QT0A 5DYIA 3UKDA 4JVSB 1J8MF 1G7RA 1RE0A 3KTAA 4B2IA 3GLFE 4A0GA 5FOTA 5FH9A 5DHAA 1KI6A 4TQ9A 2D7CA 1V43A 4U00A 5KPJA 3RYTC 1OXTA 1G7CA 3FTQA 2HJVA 4ESHA 1CR2A 1G7SA 4Q02A 2XZLA 3L0PA 5D3MB 4BFWA 4KSCA 3QENA 4NONA 2Z0MA 3U3JA 5FR2A 1MT0A 3VMFA 1OKKA 4XTCS 2GVZC 3U6BA 1F2TB 2ZJOA 3I5YA 2Z4RA 1NVUQ 1NVXQ 4NCIA 4KJZA 1KSHA 2FNAA 5CDFA 3IUYA 1E32A 1GWNA 3D3QA 1XZPA 4KFRA 1OH7A 1WCV1 3A1VA 2QMEA 2PH1A 3ZDQA 2QA5A 2QPAA 2ZUBA 3B1XA 1HQYE 2OFXA 4XD7A 1NL3A 4PHGA 4MQBA 1LS6A 4NCKA 2XX3A 3DM5A 1G4AE 4Q9LA 1YU9A 3IKJA 1N6RA 1TQDA 4C0AC 3KJGA 1G8PA 2F7SA 4DBLC 5LDDC 3QKSB 3AH8A 4ZDWA 1Z08A 4QJ4A 1X3SA 1UKZA 3VR5A 4AK9A 4M9QA 4CZ2A 1OHHD 4ZPXA 2YKGA 3SHWA 3AVUA 2V1XA 4GBMA 4LX0A 1ZM9A 4JL6A 4MRNA 1G8FA 1UAAA 1G5TA 4Q4LA 4B3BA 1GSIA 5GVSA 3Q85A 1DAIA 4IRUB 2WKPA 1U0LA 1CJKC 2NO0A 1P2UA 3M6AA 5AJVB 3IGFA 3GJ4A 4URZR 1WA5A 2QMHA 4HUQB 4KCGA 4JL5A 1C4OA 2GRJA 2GZHA 1VDZA 1EWQA 1PLJA 2BWJA 1XD9A 2YWEA 4JT4A 4PC1A 3NC1C 3PITA 2WOOA 3LDAA 2O5VA 4M9ZA 1HA3A 2RGDA 5FPTA 3K9GA 5G3YA 4ARZA 1Z2AA 5K8LA 2QROA 1RZ3A 4M53A 2PT7A 4JLJA 2K5UA 2QPTA 1PVOA 1KHTA 1YZKA 5A0FA 1HH4A 3EW9A 3AVVA 1FX0B 3HR7A 3TAUA 1SVMA 1VHLA 3HR8A 2FFHA 2ZRIA 2VP4A 3K53A 3O8BA 1KY3A 4YDSA 4MRSA 3K0AA 4R2IA 5DHFA 2NOAA 4WW0A 1JECA 1JQLB 1G5RA 1JR3D 3SS8A 4FINA 4P4SA 4MYUA 3QQ5A 4Q9KA 4L4UA 4Q1DA 2GJSA 4EPRA 2LKCA 3ZZTA 4TMVA 2G1JA 1FNNA 4P4UA 5J4VA 3X1DA 2ZRKA 2C2HA 4D0GA 2CBZA 4EPYA 2QT1A 2BDTA 4I1UA 4OQXA 4PC6A 2BVNA 1NIPA 1RYHA 2OM2A 3KJIA 3NH6A 3C5HA 3RS5A 1SULA 4KITB 2P6UA 4PZYA 1WBDA 5TXGA 3TW4A 1BO6A 1NKSA 3OFNA 1XMJA 1M8PA 4DDVA 3WXMA 4TT3D 2ZE5A 2OXCA 1TF7A 2QUZA 2XZOA 3SEAA 4GP6A 3GP8A 2ZE8A 2A5DA 4URYR 2J7KA 2IL1A 3ZIAD 1OYWA 1YZNA 1ZNXA 5DI9A 3THYB 1NY6A 1P3JA 2PLFA 3RC8A 1VIYA 4UXIA 1B23P 1ZINA 3CNOA 1XPUA 1EX7A 1DE0A 1XP8A 5IRCD 3NXSA 1JJ7A 5JSZB 1ZRHA 4EPTA 3EPJA 4RKFA 2O8CA 3VFDA 2PJRA 1R8QA 2EWWA 3EZ9A 3JVVA 1PJRA 4Q1EA 1T8TA 4S35A 5H1YA 1R5NA 2MSDB 5DO9A 4B6EA 2JATA 3R20A 3TNFA 1EFRA 1JR6A 2IEZA 2QZ4A 4C7OB 1W5TA 4Q21A 4DEYA 5JJKA 5HZKA 4PHFA 3PIRA 1KZGB 2WPDA 1Q57A 2E9SA 2CLDX 3E5HA 4LV6A 3F3YA 3CX7A 1XD8A 1G8GA 4LYAA 2GESA 2FF7A 1II9A 4DWJA 4IDHA 1N5IA 1W0KD 4DB2A 1RC8A 1IN4A 1ZU4A 4CYMA 3GJ3A 1OSNA 1NP6A 1CJMA 4C2UA 1AN0A 1GILA 2C98A 3RWMB 5KO2A 4JLBA 2VYFA 4L15A 3TLXA 5EP1A 5EZ5A 1X8KA 2P5SA 4QBFA 4US1R 1E9EA 4RFSA 1N5KA 3CM0A 2R65A 1IN6A 4URXR 1RIFA 2VHCA 2QEQA 1WE2A 2J41A 3QF4A 4CEIB 2LCFA 4WXRA 1SXJE 5HE8A 4TL8A 2FV8A 1UEJA 5FTJA 2QQ0A 3TGPA 3SHFA 1MH1A 2WWFA 3KQNA 2IXGA 1N6OA 5L3VA 2ZANA 4A0FA 2GNOA 5EE5B 1ZNYA 2F9LA 2VSXA 2ZTSA 3K09A 5CM8B 3SE0A 4EPWA 2WJIA 4IXMA 3EIEA 1W36C 4NYJR 3GJ8A 3K70D 2CK3D 1ZAKA 3O8RA 4GZLA 2C9OA 3B60A 5BYKA 2JLSA 4JJKA 2JLYA 1E4YA 2V7QA 2AFIE 1ZNZA 4C3ZA 1UBCA 2ZJBA 3BIFA 2ZRFA 3T15A 3ZZ0A 2YZ2A 1LV7A 3CF0A 4KV9A 2RGGA 2R6FA 4L9SA 1GTVA 5TVKA 4LK2A 3B8HA 2EFGA 2OLKA 3FDIA 4AKGA 1LW7A 1ZU5A 2DYKA 1U99A 3C14C 1G18A 1KK1A 5EE1A 4DCTA 2JLZA 1ZIOA 5JWRA 2ATVA 4MYHA 4XSHA 1F2TA 4DHEA 1ZC4A 3QKRA 2D62A 4V0NA 1IXSB 3IHLA 3A4NA 3JVUA 4JBWA 4KHZA 4Q7LA 2O8BB 5TARA 3VR1A 2NO9A 4Q4HB 2E87A 3OAAA 4B34A 3EZ2A 2BBOA 4X8HA 3TR0A 5FBWB 1EFHA 1QHYA 3K09C 2BV3A 2ERXA 3T5GA 4GFDA 2R6GA 3SFVA 3ZVNA 3SOPA 1DBSA 4LZZA 1CIPA 3CZQA 3B2EA 2IWHA 4TMZA 4O2LA 2OLJA 5UKDA 1NSTA 1U2RA 2J3EA 2DY1A 3QKSA 3B5JA 2ZITA 3DO6A 4KI0A 1KO5A 1T3HA 2IUSA 5JEEA 3PUVA 3BC1A 5J4YA 2ZI6A 1JI0A 4N0EA 2GEVA 4KLZA 5P21A 4CT4B 5BN5A 1MV5A 3T1OA 1E2FA 1P9RA 4JLMA 1ZNWA 3SU8A 4K46A 5GVRA 4LJ8A 1HTWA 4C0LA 1S1MA 3WMFA 1BYUA 4LWZA 3DEFA 1FFHA 3U7GA 4QM7A 3OIYA 1G8YA 1OYYA 3BORA 4YDHB 4HUQA 2IYLD 5C4MA 3H4MA 1M1YE 5L8VA 4PX9A 5DN6A 4IDQA 5KDOA 3X1XA 4MGKR 1E79A 2BOVA 4ON9A 1CP2A 3KXIA 1J8YF 1ZUIA 1G5PA 2GCNA 1SVLA 4C0BA 1Z07A 1QDEA 1KI9A 1Z0DA 1IOZA 5JRJA 5KYKA 3N70A 2V6JA 3I72A 1Q12A 3HU1A 1HE1C 3TE6A 5FPSA 2ZI5A 3OEHD 4JZKA 2BBWA 4QRHA 3MUFA 4KAXA 4LHVA 3V00A 2DPXA 1OT3A 2WJVA 2ZR7A 4G5RA 4ZI3A 2ZS8A 1GDDA 3V4FA 3KB1A 2AXPA 5EXSA 5C2JB 4BZPA 1FTNA 1ZMXA 3B7GA 3TR5A 1Z0JA 3GLIA 1P61B 1QG2A 1ZM3A 5F2EA 4IDPA 4BLSA 2HUPA 2W6JD 4BWYA 1D2NA 4GDFA 3B13B 3AVPA 2ZUCA 3NIBA 4NYMQ 1TUIA 3PUYA 3WYFA 4M2LA 3KQHA 2LWIA 2VSOA 4PQYA 4JT2A 3DVLA 2VA8A 3CPJB 1W47A 2D3WA 2J7PA 3BE4A 3IO5A 4WBSA 3REFA 1RJ9B 3ADKA 2H18A 3MG9A 1QF9A 1F48A 2JAQA 2FWRA 1I2DA 3AUXA 4K81B 3WMEA 1VYTA 1G20E 1YKSA 3B6EA 1LY1A 1NVVR 3L0OA 4C4PA 4HAXA 3Q72A 5E7JA 3GCGA 3PQCA 3WP0A 4E22A 2NO6A 2OFWA 3THYA 3R8FA 5KDLA 3GMTA 2FOLA 3GLHE 2ZRDA 4QJ5A 4YLGA 1G8HA 3SQWA 1RRCA 2WAXA 3LY5A 4WZAE 3MWYW 1U8AA 2QE7D 4C0QC 3TSWA 1GOTA 1CS4C 2C9YA 2VO1A 3A58B 4KYUA 4BRWA 4R71A 5JBQA 4V03A 4B74A 2ZYUX 4O25A 2FX3A 1VYUA 4IEEA 2W2TA 4RY2A 5JI3E 4WXPA 3A8TA 2FSGA 1GAJA 4UKDA 2G9NA 3W6PA 5M04A 1YZUA 3MMPA 1E2GA 3TSZA 3AKEA 4JVNA 4QGFA 3ZJYA 5L3QA 3G0HA 4DUGA 1YVDA 2IC5A 1IN7A 1XB2A 1GRRA 2C8VA 3LVQE 2AHOA 5LD2B 4C0KA 5JCPA 1KJYA 1OHHA 1HQCA 5EE3A 1TPZA 1M7HA 4CIDA 3RRZA 1Z0IA 4EDHA 4LHZA 4E09A 4ESVA 1HV8A 1VHTA 2AFHE 3TBKA 1GL6A 1YR6A 1G7TA 3NDBB 1P7CA 2ANBA 2ZJ8A 2F3RA 5IF9A 2IXEA 4HAVA 1DG3A 4HZUA 4Q19A 1MO3A 3WP1B 1JAHA 1IHUA 4PFSA 1KI1A 4IKEA 4LV8B 3MRSA 2C96A 3PEVA 5JWHA 4M1KA 1KYIA 1NG1A 3IIMA 3W6NA 2HCBA 3FE2A 4P31A 2IF0A 1RRGA 2ERYA 4BRUA 3MJRA 1T91A 5TY0A 4KVGA 3TKLA 1P75A 4CEIA 4DKXA 2CE2X 2H8KA 3T34A 5KSZA 1X8LA 4B71A 4BUJA 4V0ME 2YWHA 5HCIA 4NCHA 3GJ0A 5B2ZA 3BBPA 4FMDB 1EFRD 4QHYA 4KYIB 2GF0A 2QTVB 3CIOA 1HEIA 2NQ2C 3SDZA 4F91B 4CF7A 3FHOA 4B3FX 4A2WA 4HAWA 4Q9HA 5JEDA 3KKOA 3T1TA 1AQYA 1DAKA 1W36D 4DXAA 5B30A 1JR3A 1W0JA 2PCLA 2X2FA 4PAOA 1SHKA 1T3LA 4DLWA 1EK0A 3KJEA 4ZKDA 3GLGA 4H9GA 3C16C 3IPXA 2JLVA 1TL7C 1JNYA 2O8DB 5JS7A 3NTUA 3EX7C 5FOSA 2ZR9A 2RKOA 1NKTA 5JZVA 1P73A 2OO7A 1T8UA 3CPEA 1EFCA 1GUAA 5CJ2A 3OHMA 2VPPA 4O3MA 2QP9X 4YMWA 4OL0A 5F9HA 1CJVC 3IBGA 4JBYA 2BIFA 3QG1A 5JWOA 4TT3A 2ZS7A 4GZMA 2VQSA 2JLUA 1R4AA 1S9HA 2YVUA 2B8TA 3RC3A 3PUWA 4KXFB 1MRSA 4Q18A 1IN8A 3CNLA 2O8BA 2W83A 2L0XA 3ZIAA 4I81A 1P9WA 1IY2A 1LF5A 3GQBA 4HLCA 4Q4HA 4TMXA 3ZS8A 3CWZA 4W9MC 2J87A 3FMPB 5KTYA 4Q7KA 2ZRGA 4MRVA 2EWVA 1PZNA 3NKVA 3QXSA 4RD0A 2OG2A 4TL6A 4G3XA 1N6PA 3JZAA 3KL4A 4KBGA 1BKDR 1CXZA 2X2EA 4MITA 2MMGA 1UPTA 1KO1A 4P33A 4XIGS 3GLFB 5AUOB 1QHSA 1I4LD 1VCNA 2IYWA 2OHFA 3AF2A 1YZLA 3AKYA 2MSEB 3V4RA 2HV8A 1CR0A 1WXQA 2IWRA 2VRWA 4A2PA 4BE7B 2IX3A 4ZI2A 2Y8EA 4KLNA 1IONA 1DAMA 1OPXA 3QJYA 3R8CA 3KXKA 3C7KA 4LBYA 1E9FA 1EFTA 3M0EA 3DKPA 4OHWA 1QVAA 3KKMA 3IEVA 2IUUA 4TYYA 4IW3B 3LRPA 3X1WA 3Q7QA 1C9KA 1ZCAA 3H86A 3EWSA 3MSXA 2KWIA 1WF3A 4FCVA 4UQOA 4F4JA 4F93B 4E03A 2CL7X 1NY5A 2ZQ5A 4O0MA 1PLLA 5HCNA 3W6OA 5CIQA 2GBLA 1RRFA 3KKPA 3F8TA 1DG1G 1P60A 2BC9A 4EJSB 1VCIA 4HI0E 5FOUA 4F4CA 1G64A 3RSOA 4BLPA 2IF2A 4JBXA 3AM1A 1D9ZA 2RGAA 2QPOA 4IVPA 2GKSA 4QHTA 1KI7A 1JXOA 1K8RA 2XB4A 3AVTA 3Q3JB 2GCOB 3LWNA 3R7WB 1R5OA 1U9IA 2ZJAA 3D8BA 2WMOB 3ND9A 2A7QA 4XH9B 4RKEA 4JVLA 4URUR 4Q7MB 2CLSA 4QC2A 5LPNA 1XBTA 3AVYA 1KOFA 1R10A 3DDCA 4BLRA 3CZPA 3EC1A 3AF3A 2CK3A 2MSCB 2IYZA 4NL4H 1OXXK 2C9CA 4Q4AB 1X8JA 3RLFA 4Q03A 4F4IA 3AP1A 1IJEA 2F43B 1FNMA 1XMVA 2GXUA 2YWFA 2NIPA 1UJ2A 4ZDKA 3IQXA 2BBSA 2FGJA 2BMDA 1DTSA 2YNMA 2MMCA 2GBLC 2OBMA 2FJUA 3LBHA 1RJ9A 1DARA 2O8FB 2GF9A 2P65A 1T4GA 2I1VB 4WAUA 1AA9A 1JPJA 4NCNA 4PR0A 2WKQA 5CB6A 3EC2A 4DCNA 4Q4JB 1OV4A 2P3SA 1U9IC 4H1VA 1Z28A 4OKSA 3TQFA 1GITA 3ZZUA 2DFTA 4BFUA 4CVNA 1EESA 3QVVA 4F7WA 5BXQC 3UG7A 2KBFA 1AK2A 1GL9B 5EE0A 1P72A 1Z6XA 3BFVA 1KMHB 4TLEA 1UM8A 4PC7A 3RAPR 3GD7A 5EP3A 1VKJA 1OFUX 5E7MA 1XDBA 2JJ8A 1JEDA 3U3RA 5JS8A 2OCPA 1ONBA 8OHMA 3U60B 1Z6AA 3QVUA 3PVSA 1EG7A 3BH0A 1HURA 1W4BA 4XJXA 1N6NA 1FOEB 2CCGA 2C95A 5FTKA 1NJGA 4YQFA 5KSPA 2FFAA 2V9PA 4E5UA 2IYUA 1WBBA 3QKTA 2J7PD 4OHXA 4IFEA 3W34A 3UPUA 1JB1A 3EZ6A 2DR3A 2QGZA 4LBWA 4E07A 3FYHA 2Q6TA 4PQRA 3HU2A 1GKUB 1II8B 4PQFA 1W4CA 1KJZA 3UG6A 3DPUA 4PPQA 2PMDA 4QNRA 5CK5A 4A15A 1A5TA 3AKDA 3PFIA 4HB0A 2P67A 4PZLA 4QBIA 3GFPA 1XU4A 4WIAA 2ZR0A 5AUQA 1MKYA 2UZIR 3C4JA 5AJYA 1Z8FA 1NJFA 2CL0X 5FI1B 3TUZC 2F6RA 2FE4A 4HDQB 2XXAA 3M1IA 1YR9A 5EUMA 4M1YA 4OK5A 2WWYA 2AD5A 4F92B 3CF2A 3CO5A 2ZIAA 4Q1CA 3VKGA 1QHNA 1HE8B 1VG1A 1XEXB 2IS4A 2BKEA 1NBMA 1OIXA 3GEIA 1VCMA 1E9DA 2WWWA 4DUGD 1YRBA 4DDUA 1W46A 821PA 4IDOA 3OEHA 1Q1ZA 4UNQA 2E1RA 1SVKA 1I2MA 1BIFA 1KAOA 1LF0A 3K0FB 3QXCA 5LD2C 4YMSA 2RGNA 4ZV4A 1ZC3A 2PL3A 4IXNA 2D2FA 3IIJA 3PCRB 2AWOA 4A82A 1S9DA 4A4DA 2BMFA 1CJUC 3L82B 1H8HA 5CB8A 2Z43A 2DWPA 4PO9A 1D9XA 2GZDA 5FPHA 3PR1A 4Y0AA 2W6JA 4B32A 2VHTA 2BCJQ 4JLVA 5G3ZA 1SHZA 1Z6TA 1Z3IX 1XPRA 3ETLA 2G77B 4TTPA 1XTRA 4XVRA 3MFYA 2ZJ5A 2GJAA 2WSMA 5FR1A 2F55A 3DL0A 4NYJQ 4M1OA 1P5ZB 1LB1B 1Z47A 4RZXA 3VHLB 2NZ8A 1XPOA 3BWDD 3BB4A 4B2PA 4OQNA 1QHHB 4D0NA 3EASA 5J40A 4Q01A 1SXJB 1W4AA 3W5JA 2V1UA 3B1VA 4TYNA 1Q1BA 4OHYA 5HR5A 1CKEA 2HT6A 2PX0A 1OLOA 2UZ3A 1M2OB 4LJ4A 5BYJA 3BH6A 2J0UA 3CBQA 1G4UR 2W00A 1J7KA 1JALA 4BASA 2RGNC 1QHGA 1O87A 4G5OA 3I1FA 3ADCA 1GNQA 1W0JD 2QE7A 1K5GA 3G82C 1EFUA 1E9SA 1TEXA 1W49A 4NE2A 2ZJZA 1P6XA 4DLSA 3GLFA 1Z2CA 1E96A 3TW8B 2KB0A 1NMYA 4DCVA 4OQMA 2ZI7A 1DEKA 2B92A 1ZM4A 2ZVPX 1R6BX 2PZFA 1AKYA 4Q00A 1J90A 2RHMA 3X1ZA 4BFXA 2OV2A 2YOFA 3UWKA 2ZU0C 2GJ9A 1DAHA 1G41A 2BMJA 4CDGA 1XEWX 1Y3AA 3C15C 2Z5FA 3QNUA 3VNUA 1DAFA 2HXYA 1JAIA 3CUEF 3DMDA 4NYIR 5DSZA 1L8QA 1EWRA 3OIVA 3P26A 3WYAA 4ABYA 3VU9B 5BN3A 4LYHA 5L3SB 4PAMA 3B78A 2H7VA 1K6MA 4R7ZA 3RS0A 3R9WA 2ZJ2A 1P9NA 3UXMA 2OAQ1 2RGEA 4QHSA 3FMOB 2XJ9A 1D2MA 4W7SA 4W5HA 3B82A 2X19A 1AS0A 1D6JA 3B1WA 1US8A 4UJ3A 1Q44A 3ASYA 2ZJYA 1UKYA 2J59A 3ZQ6A 1XTJA 2IT1A 4TQAA 4EJSA 3AGPA 4OYHA 1XXHB 1SZPA 3B1ZA 3OIUA 4DSOA 3THXA 1GG2A 5K8IA 2OEPA 3N2IA 1AQUA 1J99A 1G21E 1YR7A 2W58A 3T5DA 4A8JB 1MABA 4IOJA 4QBHA 3R7WA 2GCOA 2VP2A 3RVBA 1VCOA 1NN3A 4GI7A 4I1SA 5TB5A 2CVHA 1DAGA 1H8ED 2CCKA 3CH5A 2QGNA 1IN5A 2PT5A 4X8MA 3I62A 4B76A 5B57C 1VECA 2QTFA 4HDCA 5SZKB 2CL6X 1KY2A 3HDTA 3MLEA 3NHAA 3U7HB 5ELXA 3IDQA 1E2JA 3Q5EA 3U61B 4Q1AA 5DI3B 4X8OA 1P2TA 3LX5A 1R0WA 2OAP1 2F43A 4M1SA 4V0OA 1NSFA 4I1OA 3THOA 5FOVA 3ZGXA 4TYWA 2CJWB 3EIHA 2IHBA 3H1TA 2GXQA 1XX6A 1OFIA 2WJJA 4HLQB 4D4LA 4EJSC 5JCZA 1F2UB 2O8FA 1U90A 2CE7A 3P27A 4P32A 1G19A 5B58C 3FFAA 3VR4A 2A5YB 3QXJA 4I1VA 1YR8A 3O8DA 3T12A 2FFBA 5F3WB 5F9FA 4PSVA 3EPLA 1FP7A 4IOMA 4JSTA 4A1FA 2QAJA 2XAUA 2A5GA 1KI8A 3RRNA 4A0RA 2VLIA 4TMKA 1N5JA 5DGXA 4A2QA 2ORIA 1G6OA 3NC0C 1UKEA 5GJWC 1CEEA 3C8UA 2CNWA 3VNVA 4UNSA 3WNDA 1KK3A 2XJ4A 1NVVQ 3ICQB 3QPWA 2HYIC 2FSIA 2QN6A 1KGDA 3SJZA 1KKMA 2OCBA 1NLZA 4URVR 5JMTA 1N25A 2WSSD 1KI2A 2ZM5A 3GPLA 1NNEA 4IDNA 2I3BA 5CLQA 3SZRA 4AWXA 3LA6A 3LVRE 5D3MA 2ZRJA 1KO4A 1DPFA 1S4QA 2V54A 1U94A 1ZM2A 4MRRA 4EQ6B 4DDWA 1II8A 4L8GA 4KSBA 1GVNB 2OE2A 2QG6A 5JJLA 1XMIA 2G1KA 4UXJA 2ZI4A 4UNRA 3W5IA 2GHIA 1G16A 2QSYA 4K8OA 3GLHB 4LY6A 4Q5IA 3CB4A 1E3MA 5BW8A 1G3UA 3AVWA 4JS0A 2AN9A 1NMZA 3CLVA 2IK8A 4G1UC 5FUVA 1S2MA 2B8WA 3DMNA 2DWQA 1XXHE 1IM2A 4FCWA 1XWIA 4QL3A 5DISB 1XEXA 3SBEA 4PHTA 1AM4D 1QBKC 2GJ8A 3LW7A 1ZD8A 2ZUDA 2XOKD 1E9CA 3B9PA 1KNXA 2C03A 5SZHB 1N6HA 3MAAC 2GWHA 2CHVA 4BLOA 2O0KA 2F3TA 4BFZA 4DJTA 2CHGA 4QOSA 1E0SA 1TQ2A 2DB3A 3X1YA 4ZIRB 5AUPB 2H1LA 2XTMA 2ZYTX 4GRAA 4PPFA 2A5FA 1E2IA 2PZEA 2WIAA 3SNHA 4OJKA 1RKBA 1VYVA 1ZBDA 2PEZA 3FKQA 3H0KA 4DT1B 4XSGA 4DIEA 3AUYA 3GJ5A 4V0LA 1E6CA 5JRZA 4FWIB 1O3YA 1N3BA 4GT1A 5HZHA 4MKGA 2IYRA 4U5XA 1CTQA 5EQTA 4PSKA 2BKUA 5DLQC 3CR7A 2YOHA 4TQUS 1Z6YA 1X1RA 2WJGA 3DHWC 2J5XA 4RJLA 4AD8A 3NH9A 3T06B 3VX4A 1FX0A 1MO5A 1NBMD 2HCJB 2Q9BA 3CF6R 2YOGA 4NBSA 2VHUA 4LJAA 1Z6GA 3BB1A 2HLDD 3IBYA 1Z29A 4FD2A 3KKNA 2QAGB 4DLVA 1WDTA 2RB4A 3BXZA 3MWJA 5DNYB 2QBYB 3AVOA 3SYKA 3Q9LA 4ZKEA 4W5JA 4H1UA 5FBRB 1GM5A 3QBTA 1A82A 3D6TB 3K9HA 4M1TA 2AKAB 1H8HD 1E2PA 1MR3F 4DCUA 2WOJA 2ZS9A 2XGJA 1XJQA 4ITRC 3NBXX 4BQSA 3AQ4A 2JJ1D 5GJCA 2HXSA 1B0UA 4JLNA 2Q9AA 3UMFA 4D80A 1KDOA 2F1HA 2FFQA 1GL7A 3RS2A 5HKKD 1N6LA 2ZETA 3H84A 4YONB 4B2LA 2VP6A 4DZZA 1T5LA 1N0VC 2VTKA 4DVGA 1SXJC 2GDJA 4RCYA 1QZXA 4Q9JA 3U44B 4D82A 2QI9C 5F98A 2WIBA 2FU5C 5E95A 3A6PC 2TMKA 2B21A 2C99A 1DVRA 1NN1A 4N3NA 5IT5A 2NG1A 2WWXA 4AKIA 2VBCA 2FN4A 1XNJA 3TQCA 4WZ6A 3KFXA 4V02A 5JSZA 1JQJC 2AD1A 4TN1A 4OJQA 1WP9A 2J0QA 2J45A 3MWKA 1ELOA 4A8JA 1YHNA 1Z22A 2QNRA 2GCPA 5D3QA 4XOIA 1TF5A 3N5CA 3THWB 4DEXA 4D81A 2F9MA 3I32A 4ILEA 2ORVA 1OXVA 4LYFA 4C7OA 3ECCA 3TH5A 3EARA 4KU4A 4EAQA 1EXMA 4P3YA 2RGXA 1E2NA 1OB5A 1E0AA 2ZRMA 2F1JA 3A36A 4LBZA 1UEIA 4MKFA 2GAAA 1OF1A 3IILA 4QBGB 4DC9A 2ZRLA 4ASUD 5DI3A 4MA4A 4YXWD 3UANA 3K0SA 1G291 2VP0A 2ZYWX 2YC2C 3QXHA 2V55B 4I4LA 5KOYA 3KTAB 4Z1MD 1ZIPA 3BD9A 1KK0A 1U0JA 1JEEA 1T0HB 2CJWA 2B7BA 2ZSDA 4HB3A 5K8TA 1DELA 1KI6B 2FZ4A 1GIAA 4XTRA 1DO2A 1MO4A 2CXXA 4ZCMA 2XSZD 1F2UA 4G5GA 5FFMA 3SR0A 4JMPA 4CRWB 4XWKA 1LNZA 2DFNA 1E2MA 4WZBE 3TVTA 4BLQA 2VEDA 3QUSA 3PJRA 1P4SA 2DFKB 4A8JC 1UDXA 3KQLA 5KNCA 2IA5A 3W3ZB 4ACAA 4RZ2A 3AGQA 4FMDF 3LXRA 2ONJA 1BYIA 4D0LB 4DLRA 1OH8A 3RRYA 3SN6A 3WBKA 3I8SA 1V5WA 4KO8A 3A1UA 5JLJA 1XEWY 2D06A 3ZVLA 2OUKA 1HY3A 4MRPA 4NZYA 421PA 5KNDA 2QU8A 4YC7A 1TF2A 2XB2A 2GZAA 4D4MA 2GXSA 1BH2A 4PPNA 4MDFA 1QG4A 1E2EA 3ZD7A 1E2HA 1XTSA 5HTKA 2FSFA 2ZSBA 4UJ5A 3RSLA 3BFKA 4NPHA 2VHQA 4GNKA 4LGMA 4RVCA 4PC2A 2ZXUA 4LJ9A 1T6NA 3ZVRA 121PA 1JBKA 2GXAA 2ZSEA 2GAOA 3IHWA 1R0YA 1R7RA 4R98A 3OEED 2O8EB 3CONA 1U8ZA 5FL7D 3KX2A 3P32A 4R9UC 1J70A 3VKWA 1SKQA 2PMKA 1NLYA 3MCAA 3P4YA 4HB4A 4MKIA 2ASEA 3O47A 4OI2A 5J5CA 5C46F 4RSGA 1N5LA 3GLHA 1SKYE 4F38A 4BFTA 4CEJB 2PLRA 1ZUNB 5EXPA 2NPFA 3U4QB 1A1VA 4CEHB 1F6BA 2VF8A 3UK6A 2CNWD 4ZDIA 4TLBA 1E9RA 1FUKA 4B47A 2JLWA 1QRAA 4ZO4A 4WOPA 4ARZB 1COWD 3IQWA 3NEYA 4QNMA 3X2SA 3HYRA 3SI7A 3QF7A 1W5SA 2WWIA 4HB2A 1JXMA 1LTQA 2CCJA 2JA1A 2PCJA 3HU3A 3KUCA 3LO5A 3QEJA 4TLAA 4LPKA 4TSFD 4OHZA 3GJ7A 1X86B 3K0CA 4FN5A 4NU0A 2AXNA 2XTNA 1N6KA 2FA9A 4GMXA 1P62B 1TX4B 3WYGA 1H8EA 4US0R 1XRJA 4TZ6A 2FH5B 4OI1A 2FGKA 2I1QA 2ODEA 4A92A 1XCPA 5CIWA 1FQJA 4PXAA 3I5XA 1M7BA 1N0WA 1NIJA 4LBVA 4M22A 2YJTD 4P4SB 1XD2B 1NI3A 2GA8A 2OCYC 4V0KA 4DLYA 5IK2D 3FWYA 4QG7A 3EA5A 3NVAA 5B64A 4DT1A 2EFDB 4ZDJA 4NCJA 2C77A 1NN5A 1IY0A 2KSQA 1YE8A 1W48A 2WKRA 4YMVA 3L8ZA 3NDPA 2RAPA 2R2AA 2FMXA 2IYSA 3M4YA 4B73A 1Q22A 2XZPA 4OK3A 3LFUA 1RYFA 1T0JB 4Q48A 1XJCA 2UKDA 3RABA 4D4JA 4AKHA 3W9YA 3T35A 4V0MA 4BLTA 2V8OA 3B1YA 3BK7A 1KAGA 3Q5DA 2FEMA 3EXAA 4ZCLA 1YZQA 2CLCX 5BQ5A 2D2EA 1KI3A 2IYYA 2VL7A 3DM9B 3CRW1 2ATXA 2Q3HA 3K0CC 4DSUA 2ZRCA 5A4JA 4C2TA 1ETUA 2QBYA 5AK0A 3O8CA 3GEEA 4CGZA 1I4TD 3HWSA 2Q3MA 3AB3A 5KPDA 1AZSC 2N42A 3ZH9B 1ESNA 2J9RA 5CDFE 5EXTA 1TU4A 2J46A 2QP3A 1TUEA 2OBNA 2O8CB 4BEJA 2ZEJA 4EIWA 1UBFA 2D7DA 4RZUA 3SJAA 3AF1A 4GOJA 4Z54A 2JASA 4M21A 1NLFA 2KJQA 5G53C 1IY1A 2IS1A 3ASZA 1E9AA 2WSSA 3SC3A 4LSGA 1OH6A 1XJ0A 1NRJB 4LJ7A 1U8YA 3EPKA 3F5FA 3L2OB 2CDNA 3VR6A 2D4HA 1SXJD 3U44A 3KDSE 3P20A 3B85A 2JLRA 2OCAA 2NPIA 1LFDB 2J0VA 4AI6A 2RGBA 5EE9A 3U3MA 4LC1A 4JYCA 4XWAA 4B44A 5E3HA 1DS6A 2QAGC 1E0KA 2A9KA 1S8FA 1TAGA 3KXLA 4QGGA 4NYIQ 2RMKA 2PX3A 1E2DA 4AYWA 2NO7A 2JLXA 2BEJA 5SZJA 4AURA 2J1LA 1Z63A 1TQ4A 1UADA 3QPVA 2GJKA 3TJZA 4CT5A 2WM9B 4ERNA 1U81A 4IHQA 4JLDA 2ZE7A 3QF4B 5FTLA 1G3MA 1G1MA 3KQUA 3DOFA 1D2EA 1HT2E 1T9HA 3H2YA 3GEHA 2O0HA 4RD1A 4XWOA 2OFOA 2XOKA 2D74A 1IXZA 4EFLA 3CWQA 3AVXA 1KDPA 3L43A 1WB9A 1OW3B 3PG5A 3LH5A 3QIAA 4N0DA 2VP9A 2W0SA 2RGCA 4GMDA 1GRQA 5JHGB 5KSYA 4JIMA 1OXSC 3LD9A 3FVQA 5J4HA 3CRVA 2WV9A 1Q0UA 1G6HA 4B3XA 4DLZA 1CRQA 4OI0A 3BFXA 1W1WA 2WZQA 3CW2A 4EPXA 1Q3TA 1C1YA 4NTZA 4MGYR 2OXRA 1GKIA 4AG6A 2GK7A 5DYGA 2W2VA 4D4KA 1CR4A 4JSYA 4NH0A 4DLTA 2JIZA 1VPLA 2FDCA 2HF9A 3I4LA 5CYOA 1U98A 4RD6A 3PENA 4LUCA 3SJCA 1A7JA 3EZFA 3AP3A 3QKRB 4Z8XA 5TMPA 2HLDA 5FOWA 2V6IA 1IJFA 2C78A 2ECKA 1CU1A 2PBRA 2AWNA 3LQRA 4QXAA 3JZMA 4BFYA 2IYTA 1KMQA 2R6AA 4TYPA 3N2EA 3U3OA 4TYQA 4B35A 3LXXA 5BN4A 1I4DD 1SGWA 4FWTA 2O8DA 4M9SA 1FP6A 5FBLB 1N6IA 4LC0A 2JJ1A 1Z0AA 2QORA 1M6NA 4Q1BA 4OBEA 2WTUA 4J0QA 3LAWA 2B7CA 4QM6A 2R8RA 2ANCA 2O8EA 3QI2A 3K9LA 4KFTA 3RS4A 5CITA 2OBLA 5HKKA 2WAYA 5AJWA 2CMKA 2ORWA 3C41J 1Z83A 3SJBA 5GJVC 2AK3A 4HLDA 2HJGA 3SYLA 5EP4A 4TLCA 2QENA 4OK6A 1CLUA 4W5WA 3CR8A 4OI4A 3UWOA 4KBFA 4QFMA 1R8SA 4CEJA 1XMSA 3U4QA 3NEJA 1RRPA 4CEHA 2P6RA 4LYJA 6Q21A 1VG9B 5LBIA 1T3SA 2VH5R 3A4LA 4XVQA 5ANRB 2WHXA 5JFGA 5JHHB 2EQBA 1KIMA 1G3QA 1X1SA 5AJXA 2OSBA 4AYXA 3CX6A 4Y0VA 1HUQA 2Z6VA 721PA 3OF5A 4PC3A 4PO1A 2REBA 2WICA 3ZLJA 2RH5A 1TU3A 2PEYA 1Q20A 3FB4A 4NP6A 1G17A 4QJ3A 2FZLA 2ZSAA 5CM9C 2V4ZA 3AF0A 2KI5A 2G3YA 3I3SR 621PA 4TMTA 1E1QD 1KI4A 2IS6A 3ND8A 1Z0FA 3TMKA 1XD2A 2IUTA 3ADBA 3GLIB 4G01B 3B9QA 3EAQA 2GETA 2BJWA 2NMVA 1A4RA 1L7VC 4ASUA 2G6BA 2BHRA 3RWOA 4YXWA 1D8TA 2ZE6A 2ZRBA 2ZAMA 3IO3A 5CJPA 3QEOA 3EWAA 2UVQA 4RFVA 4Z1MA 3AEZA 3VKHA 1OXUA 4JKYA 3W8RA 3QE0A 3CRQA 3LNCA 2W2XA 4DSTA 2R62A 2XSZA 3IEUA 3KFVA 2FSHA 2H5EA 4WVFA 1AZTA 1E1RD 1ZW6A 2X77A 4FI3C 2A78A 2ZI9A 5J4KA 4AYTA 4HEJA 4POAA 2ZROA 5G41A 1OJLA 3WRYC 1KK2A 3E2IA 4N1AA 4B6FA 3TUIC 2AX4A 2EFEB 1SVIA 3UIEA 3BAFA 1UFQA 4GPTA 1KSFX 3CRMA 1HT1E 3EZ7A 4QGAA 3IPYA 4LCBA 1F3OA 3RANA 1XTQA 1QVRA 4Q4AA 2QMOA 4HAZA 1VG0B 3L8YA 2YYZA 1RVDA 1RPZA 3PEWA 2YHSA 1Q1QA 3I92A 1IAQA 2BBTA 1MRNA 1E2LA 1Z06A 4TL9A 2GEUA 4JVMA 5AWFC 2ZPTX 1AKEA 1KKLA 4LHWA 3W90A 1ZD1A 5L3QB 2WWHA 2QP4A 4A9AA 1KNQA 3F0TA 1KZ7B 2JDID 1PUJA 4Q7JB 4LHXA 1F5NA 1KDRA 3OEEA 4EPVA 3NBZC 2SHKA 2JGNA 4GOXA 3J81k 2NO1A 2RCNA 3TUJC 3FKSD 4OQLA 4KFUA 3E1SA 3QKUA 5FL7A 4C9BA 1E0JA 3FFBA 1W4RA 4M8NE 2OZEA 2QRNA 3C5CA 1KO8A 4Q4JA 3SBDA 1AIPA 4ACBA 1F60A 1OIWA 4TL7A 4M4SA 4HZUB 3U7FB 1GKYA 4HUTA 5KU1A 1KMHA 4JLKA 4LI0A 2JJ2A 3LW8A 4DCSA 5J47A 2VHJA 5C1BA 1IBRA 2IYVA 3ONWA 2J0SA 3P4XA 4JJZA 3VAAA 1COWA 2A3RA 4DLUA 3LBNA 1II0A 4B3CA 5KHOC 2QTHA 5HE9A 3E70C 3P1JA 2Q21A 2NZJA 4IJMA 3ZD6A 3VHXA 2X1VA 1RW4A 3W3AA 3I73A 4MUAA 4Q66C 4TSFA 4LRWA 1E2QA 2W6IA 2WVJA 4UNPA 3MJHA 1DOAA 1KSGA 1XFAA 3BS4A 4HLUA 4NHOA 2H17A 4RCZA 3V9PA 4BZXA 4HYYA 3NHBA 5H68A 1GFIA 1BOFA 2DCUA 1NG9A 3QY0A 3AKCA 1OH5A 3AP2A 2BM0A 4MH0R 4DIDA 3OE7D 3HPRA 1BMFD 1UF9A 4M9XA 3K8YA 3A37A 1J2JA 2A5JA 1QHIA 4EUNA 3GLIE
chains in the Genus database with same CATH superfamily
1DBWA 1L5VA 1J06A 1WMDA 2PRKA 3BXPA 3R9IA 5J5AA 5AJZA 1AO3A 4WBXC 1S5PA 1IXRC 1P2BA 5EGSA 2ZRPA 3UAZA 4TZ0A 5CD9A 3HY6A 2C97A 3OIDA 3R23A 1A2KC 3B2NA 3RGGA 1GZSA 2XIQA 1P7WA 1JVBA 3PC2A 3N2GB 4GNRA 4QGSA 3WGTA 4UREA 4NBRA 3ANMA 4Z86A 3IXQA 3UPDA 4BEVA 1H65A 3AJEA 1N0UA 4R8RA 1G21A 3GEGA 1XAHA 1I51A 3KCNA 3A9WA 3JWPA 1E7YA 3VO2A 2HDOA 1VL5A 2CLEB 4UBMA 2PGAA 2XMPA 5DRYA 2B0CA 4JBHA 1U7PA 2C1EA 4DM7A 3A1SA 2R6CA 4Z0TA 5AUNB 3GP3A 3FNHA 1L7QA 2Y0CA 1HKHA 1BFUA 4ZVTA 1X8XA 5I9SA 4H3SA 2E18A 4L16A 3NG1A 2GILA 5CB0A 3AIOA 1YTLA 3C6XA 4CKBA 4GP7A 5FWXB 1N2CE 4BZQA 3LTEA 2I9KA 4E51A 1WQ3A 4IF4A 1JQ5A 2H16A 3UXYA 5AI4A 2BZ0A 2OK8A 1Y5MA 4HAYA 3S1AB 4AN0A 4NKRA 5AI6A 2J9FB 5AK5A 1LPSA 1NW9B 3TPZA 4YB8A 2RG7A 2H08A 2IUYA 3NBFA 3AYZB 2AF3C 3Q87B 2YRWA 3HBMA 3KG2A 3ZD8A 2JB9A 4DEVA 1CF4A 4GRDA 3PDCA 1UMKA 1OASA 1YZGA 1Y3HA 3FPSA 4QICA 3H8WA 2EW2A 1TNDA 2BR3A 3R9XA 1S02A 3L49A 4OU5A 3EW7A 3LQ2A 4TLDA 3VC3A 3JQ7B 2QQEA 5B1IA 3WLLA 5KOJB 2J3IA 2XEXA 1NAIA 1ORVA 3FNEA 3T9DA 2CEKA 3X1MA 5BRJA 3ZVMA 4X1KB 4RDXA 2W37A 4DJFC 3OC6A 2MDTA 2WZBA 1QHHA 1W85A 2VNAA 1FNSA 1XNHA 4LWQA 1U7HA 4H1HA 1U28A 2CVFA 4X7RA 5JAZA 3G7UA 3QYFA 3I9JA 4IIJA 4QFDA 2O20A 5DH9A 2I7TA 1XKXA 4IHAA 3ZH2A 4BX0A 3USCS 4OYLA 4BC0A 3CLRC 4XZ3A 1SC4A 7MDHA 4KLRA 2B69A 5DGDA 1QLWA 2C84A 3OIWA 3CNNA 3X1JA 4X5OA 4U9IS 2HTFA 4U7GA 1ZJ4A 4N0MA 1RLMA 1E7QA 2K7ZA 3K7EA 4BO1A 1E4OA 1XA0A 1YGYA 4PSAA 3K0KA 1J4AA 1FMLA 1K5DA 1KVTA 4S2EA 4FLFA 4NOLA 4PYIA 3JQGA 2BGRA 5HK8A 2JANA 3JQCA 3JTEA 3PT9A 4PBTA 2EP8A 4XW2A 2IUEA 3UUEA 5C7YA 4JLPA 2R6DA 3KOOA 1V26A 4FFSA 2WHQA 4F7DA 1E2KA 3IC5A 3GOQA 5LR6A 2YHAA 4GLJA 5CMLA 4MULA 3YASA 1F2DA 4DSZA 1Z37A 2C3PA 3UHFA 1YNSA 2X14A 4P4TA 5K99A 4G5SA 4LHSA 2ID4A 1Z4JA 3R3YA 5K8VA 2C3YA 2ODNA 3D0RA 3C3PA 4E12A 3EGEA 2XEDA 4PN3A 4Z53A 3NTVA 1JTFA 4AZ0A 5ALSA 1HNXB 4HNAA 2E5LB 2WMNB 3EJ6A 3P2KA 5HP4A 2VQDA 1B76A 1SKYB 5TV2A 4D9KA 2PJZA 2BFDB 1P74A 2X0RA 1L2TA 1CERA 3EAFA 4LXYA 1H9CA 2PGDA 4Y0NA 2EJVA 4OD0A 4U8HA 3UO8B 1YJCA 2G6TA 3AEKB 2WBLC 3OFJA 1YI8A 3WDMA 3RRMA 2QMZA 1Z2EA 3IP7A 2K7FA 3LUBA 2DJIA 2R48A 2I9PA 1EEHA 5EKTA 2GHRA 2REOA 3AV0B 1CDDA 3LDUA 4HDOB 4LDNA 4N7RA 1XU9A 1CYDA 1HQKA 2L2QA 4CLDA 4BFSA 1W7AA 2PQMA 2XUFA 1N75A 2H92A 4E13A 3ZDAA 3BMQB 3DE0X 5GJBA 3DBLA 1PR9A 1K63A 4JASB 2PYZA 4QODA 4WCDA 4XRGA 4LJ6A 3AYXB 5BYBA 4WNAA 1Z35A 2H5JA 4QKQA 1CSEE 2P4HX 1E8MA 3IKMB 3KTOA 2VSFA 4M88A 4EI9A 4ZAGA 2HYDA 4WJKB 2DWCA 4BKPA 5IH7A 4MMZB 4UBKA 1XZIA 1H2HA 3L5KA 3EODA 5ARDA 5T3UA 5BY2A 5LMUB 1MGPA 1NXTA 2FVXA 1JKIA 2QL6A 3D7MA 3E9ZA 3K4PA 2X0FA 3V2HA 1A2BA 4P2BA 4MKHA 1JDSA 4ARUA 2GN9A 4ERXA 3VDRA 4QOFA 3PEYA 2FQXA 3LBIA 4NDZA 4FMBB 5D5HA 1U2EA 2ZSFA 2QYSA 4PRZA 1YJAA 4FKBA 3QXXA 3FPAA 3DNPA 5GZ1A 3EPHA 4B1FA 3AL0C 2UYYA 3AZOA 1Y8RB 3DEJA 3QELB 3TIXB 5KUTA 5LC1A 5CU7A 1KHHA 3CG4A 4WKBA 5JDIA 2YICA 2O0LA 5EN4A 4DG8A 1DKLA 4DCOA 3SAJA 1RDFA 2FG5A 3A6FA 1ZCZA 4WHMA 3OWOA 3IHTA 4FZ3A 2DF8A 4KN6A 4PGMA 3UJ8A 5CLLA 3WBBA 1UPAA 1BCRA 1QHXA 2EKDA 3DWIA 3D1LA 4GOKA 4R8VA 3RC2A 3QSYA 1W94A 5DHQA 1QONA 1UOEA 1KH3A 1TO2E 3TVDA 3IP3A 3RVJA 1RAIA 3QBJA 4RKRA 2DWUA 3OKCA 4DMCA 4DPKA 2WIFA 4U3JB 3ZY4A 3CZMA 2I4RA 5B2FA 2GM5A 1I4EB 3U7RA 4DYHA 1QGZA 3CKLA 2R8BA 4MR9A 1ODJA 5KSWB 3N28A 5E7QA 4DXHA 1VIAA 1BE0A 4A7PA 1YDFA 2HJ9A 5P8WA 2JFFA 4KQWA 1EJ2A 2ZVDA 3FRIA 3FGPA 1CUYA 2QTLA 3NKLA 4NPCA 4P80A 4DLRA 4BGDA 2Q3FA 5HM8A 2NXNA 1E1QA 1YVEI 2WPDD 3W5BA 9MHTA 3OH8A 4WESA 1DFHA 1G2PA 3Q7PA 4GRIA 221PA 2QVBA 4NJMB 1KZ9A 4MWBA 3TB4A 2D8AA 2EBWA 2X0NA 3TQOA 4OXIA 2NU8B 5U4QA 3O8QA 1K3TA 1IZZA 1NAHA 3DEZA 1EJBA 3E03A 3EHEA 1YA4A 2HPVA 3OESA 4WFKA 2W70A 4LOLA 2IEAA 3K6SB 3ZV7A 3EMBA 3KZ1E 3H7IA 4UAUA 3C6KA 3HXKA 3OD1A 4EO4A 1IVNA 2XB6A 1XTZA 3PV0A 1JSCA 5CH8A 4TKLA 2AFVA 4FYPA 3DYIA 4R2XA 3AJAA 4LSMA 2D1RA 1DTWB 4RM2A 3E0XA 3EA0A 4LK3A 5AK4A 2BF4A 3CUWA 1XFDA 1N8SA 1CY2A 2O2XA 1Y4SA 4Y1FA 1XCLA 2QXTA 1GTL1 1MGOA 3AEQB 3K96A 4TWAA 2ZREA 1GQOA 1VL6A 2Q0SA 2Z2YA 1MBZA 2D59A 4JELA 4QYSA 5MN6A 1D2AA 2J0UB 1GGFA 3IP9A 3R0VA 1RYBA 4LQLA 2J9FA 4HEA1 2HHLA 2WYUA 1DEXA 2HGZA 2ID7A 3O3OB 3R5TA 4K6FA 3ZE1B 4JUDX 4BVBA 4ZIRA 1K4MA 2O23A 2OECA 3HJTA 3HS3A 2EWMA 4IM7A 4GI1A 5I48A 3V8RA 1JHVA 1ZD9A 3FLBA 4J0JA 3PFKA 4TGLA 1FSZA 2G76A 4JB2A 3IESA 1OYVA 4MB0A 4S1VA 1Q7BA 5DHSA 1JG6A 3WFJA 4BNVA 1AF7A 4W1RA 1UBEA 1QG0A 1ZOSA 2R66A 4HAUA 2O3JA 3SZGA 2RIPA 1VJ0A 5FTNA 1I9CA 3JQ7A 1XOIA 3GCXA 1IVYA 2G4LA 2Z5GA 3T3PB 4TS4A 4BB6A 5AVUA 4G0NA 4KQFA 5IS2A 5DCWA 5CD1A 3TEJA 2JDIA 1A5ZA 1NVKA 3CZAA 1M2KA 2O0JA 2YMLA 2ONKA 4KQEA 4OUKX 1DEHA 3E2MA 4RELA 5I5EA 5BW4A 3VQTA 1MXFA 4GX1A 4KPFC 4F5YA 1WHSA 1U63A 5BN3B 1CP3A 2K2WA 3C6YA 5B4TA 4U6QA 2BR5A 3JW8A 3M4JA 4FHGA 1JDNA 1J9GA 3D43A 4K9PA 1PRYA 1W0KA 1TK2A 5FHRA 5HUQA 1DO8A 5JYCA 4ITUA 5LA6F 4N9WA 6REQB 2WSBA 3COZA 1AKRA 2HF8A 1T35A 3ABZA 4L9WA 1QIMA 4YVFA 4UUNA 4DLZA 5J23A 5CB4A 3PYXA 4PPYA 2OORA 4L4SA 3V7NA 2QLFA 3HJBA 1TUBA 1GV0A 1PNRA 3L1IA 1XEFA 2O50A 3T9CA 3WVNA 1MX9A 1SN7A 4NMMA 3TLAA 4X85A 2PSFA 1AS2A 4K6GA 4QXPA 4WA7A 1FZTA 1ZK3A 1XJWA 2WJHA 1I80A 4FYXA 1W88B 2R86A 3MF4A 1XDGA 4A6XA 2MINA 4BO2A 1KDTA 3IOMA 1E94E 3S2SA 4DSNA 1E92A 3OT1B 1ZITA 3HRIA 3OLWA 4FXPA 3O38A 1KR2A 1NBME 3EY4A 1VIMA 1TVCA 2V7PA 5DE3A 2LVBA 1FLAA 1Y9ZA 4IO1A 2QIPA 2EU8A 3OE4A 1DQYA 1YZ3A 2YN2A 3IP1A 5KYVA 3OHPA 4IJKA 4EUHA 1S3SA 3A6JA 4ECEA 3OE7A 4BMDA 4WOBA 4D26A 3LF2A 2X5JO 1W30A 4X94A 5C5EA 1JE1A 8GPBA 2Z6AA 2CF6A 3U3ZA 4PANA 1T36B 1VRVA 3L41A 2BFDA 3MWLA 3Q0TA 3OLYA 1B0PA 1OIVA 3K30A 5FUWA 3HB9A 2IW3A 1UBGA 4ZCIA 1G60A 1QQTA 5DF1A 3ICEA 3N2NA 4I99A 4R01A 1NOJA 1R0ZA 3A05A 3DOJA 1D2GA 3FVWA 3GRUA 3HCOA 2HRBA 3OOWA 2QVGA 3DZCA 3PS9A 2VJMB 4EX7A 3SQNA 1KEEB 1M6EX 3BTSA 2FQ1A 3L8FA 4TTRA 4YASA 4B3SB 4R2HA 3FYUA 4B6GA 2AYZA 1Q3HA 2J5BA 2JFWA 1DIBA 2XUPA 3E8XA 3R3HA 4H7JA 4LYDA 3FGNA 4OGWA 5K0FA 3FMFA 4QVIA 3BIOA 2DPMA 5E9AA 4Q37A 5C4GB 16PKA 5EXXA 3UMSA 4MEJA 3L93A 3PUXA 4C21A 2ZRHA 2UUAB 5JJIA 1KETA 4CQLA 2B25A 1Z2PX 1FDTA 2Z9CA 2JEOA 4RZ3A 2PX5A 2VF2A 1BD4A 1ZIXA 5FL3A 1PZHA 2DG2A 3JYHA 3MQ2A 4LDQA 1UEXC 1NBWB 4ZK2A 5IULC 5KNCH 4LZNA 1N36B 1GGJA 1XO1A 3Q8KA 4LNAA 5KMGB 5ITVA 4E94A 3HL4A 4JVSB 4TV8F 1RE0A 1CUWA 4XUDA 1SAYA 2BKLA 2I6XA 3S1AA 4B2IA 1WW2A 4E46A 2AFRA 2B37A 2ZDQA 2AX3A 4AJPA 3O2SB 3V3KA 2VYNA 1V43A 5BNWA 1EH5A 3RYTC 5IJXA 4EFDA 1P1KA 4MVJF 2HJVA 2H2AA 4MV4A 1K08A 4FBGA 4XGQA 3VAYA 1L5HA 4E1AA 3QELA 1Y8RA 1KY5A 3CG0A 3PFBA 4LQCA 3T5CA 1ZCFA 1O95D 1OBFO 1Q1AA 3AI1A 2I78A 3FYTA 4CL3A 4F4HA 3ADOA 5FV4A 4JC8A 4YPFA 5JSYA 3JRXA 4XQ9A 3VMFA 3K1ZA 5CVEA 1JHMA 1OKKA 4N5NA 1BDMA 1RI3A 2GVZC 4II2A 2AN3A 5I45A 2CFCA 1VB5A 1F2TB 2IU6A 3NWBA 1QX4A 5BRAA 5AW1A 5FOQA 4WI1A 5K2OA 3ZNNA 2ARKA 5JXHA 3DEYX 1P1RA 4K1LA 1T1SA 1EUDB 2BZGA 2FP3A 1EUCB 3FH0A 4EHIA 3Q0EA 4UD6A 5CDFA 2QG9A 3MC1A 2ZWAA 3N76A 3D3QA 2EGUA 1OH7A 3TGLA 4U3JA 2PH1A 1HZZA 5KWJA 2N1MA 4QUIA 4YHBA 4AY5A 5DGCA 5T8KC 4N49A 3M6FA 4QJBA 3UWSA 4MYDA 4S1TA 3JD2A 3PTLA 3P94A 2YIVX 4J4HA 1KERA 1O03A 2R7AA 3MD9A 5E2AA 3JAWB 2Q6OA 5LDDC 5JNSA 1SOVA 1Y3BE 4YTEA 4O3FA 2DKOA 2AI3A 2H8GA 3AH8A 3QKSB 1WNTA 4ZDWA 1GTRA 3I3OA 4J49A 1UKZA 5DPMA 1LJLA 3GRFA 4U2GA 1D1PA 1J49A 2BN4A 4P3OA 4HQOA 3AVUA 3GDWA 2J32A 3MTBA 3GDGA 1Y42X 4E5KA 1WR8A 1G8FA 1VJGA 3AO0B 5MGBA 3HXLA 1ZW1A 3ES9A 2G9QA 4KKVA 5BWBA 4L75A 2GN2A 5EKUA 4YFVA 2NU8A 1HDZA 3RKUA 2YXNA 3GCWA 2PGJA 2REQB 3NQ41 4URZR 1IMJA 3K6SA 4POOA 3QE9Y 1WA5A 2QMHA 4KCGA 3FR7A 1NXXA 2GRJA 4TRRA 3T3NA 3T3OA 1ULUA 2DUJA 1QXSA 1IYZA 2BWJA 2YWEA 3AWDA 3OPYB 3R24A 4JT4A 4PC1A 3HEBA 3NC1C 3ID6C 4G5HA 4DMRA 1Q2UA 4M9ZA 5FPTA 1WKVA 2HA2A 5JQGF 1ZJZA 3T7IA 5IYZA 3D5QA 4M53A 1OX5A 1JBQA 1DTWA 4JLJA 1YIAA 2A3NA 5LFAA 4QELA 1GGNA 1HH4A 3JS5A 4Z7NB 1FX0B 4MUMA 5E1MA 4OXQA 1VHLA 5TT1A 2GT1A 3HR8A 4BO3A 4C29A 1JEYA 1D04A 2OHXA 3C43A 2HW8A 2VP4A 3AEQA 4HYEA 3KZNA 2O19A 4YDSA 4QRIA 3VV2A 3E0QA 3TE7A 4G0UA 2AJBA 2GSDA 1JYSA 2NT4A 2FI1A 4MDYA 2IHUA 3GJZA 4FOPA 1RCTE 3PX7A 4BIIA 2W2LA 5J5VA 3I2KA 4XI9A 4Q1DA 2GJSA 3QNWA 1PWXA 3WGNA 4BNGA 4BP8A 3AEUB 3BF7A 3T3IA 2L69A 3PLAE 2QT1A 2BDTA 4OQXA 2IOQA 3H1FA 4PC6A 2OM2A 2PKQP 4E14A 3NH6A 3PKZA 5LXTF 4BJHB 1FP1D 1P7VA 2P6UA 2WAMA 2X42A 3VZCA 4ZQGA 4PZYA 3T9EA 5I4CA 2ABWA 1FW8A 2RHBA 3I9LA 3IS3A 1BO6A 3BBLA 3WLQA 4JC0A 4NZMA 1YVRA 3UB2A 1A7AA 1ZGCA 4F3YA 4IG9A 5THQA 1BROA 1QIEA 1TF7A 5KQRA 4FWBA 5FPPA 5KYWB 5AKGA 1T43A 2A5DA 5GM2A 3M1AA 2B98A 2ZT5A 3Q10A 2IL1A 1IXYA 4AL4A 1OYWA 5AOVA 3USZA 3CX3A 4UTOA 1ZNXA 1ULZA 3VR6H 6REQA 1RMQA 1UFKA 1IOWA 5TLSA 3RC8A 1VIYA 2E49A 2IEGA 1OTHA 2HWWA 3M81A 4FJ0A 4UXIA 1EX7A 4ZT2A 3A7EA 5JSZB 3C3AA 4RKFA 5A4KA 2X41A 1JN0A 3EUWA 3EZ9A 4V24A 3MB5A 1QVZA 5B53A 4R16A 2VWQA 4FDUA 3TD9A 1MB4A 3MJSA 2HWKA 1INLA 3IBTA 4MP3A 5L6LB 1ENZA 5DO9A 2HCRA 3GVHA 4JT9A 4ZHQA 4JP8A 2A58A 2JATA 2YN4A 1Z4LA 2A1UB 3KR2A 3NAQA 1EHIA 2FRVA 1YU6A 1JR6A 2IEZA 4GBGA 4MV8A 3SQLA 4Q21A 1Q7RA 2YWBA 5HZKA 3QNMA 2OD2A 4N8DA 3PHJA 3WJ7A 4Y6RA 4JJ7A 1E7SA 3UJBA 2C7RA 3IPLA 1G8AA 4R1PA 3CX7A 1O9BA 2RFLA 2ZUSA 2BFPA 2VF5X 2ZB2A 2AJ8A 4CETA 3W2TA 1YC2A 1M1YB 2XRMA 3K8QA 1RC8A 2W8ZA 4O4HA 1OSNA 1NP6A 1P5RA 1J5XA 3DE6X 4FUTA 4GXNA 1CJMA 4H35A 4KQ1A 5CW2A 5IBRA 4JAVC 3UHOA 3VPDA 3AHDA 4C2UA 5K3CA 5KO2A 2VYFA 1DC5A 1U2DC 1N5MA 3HE3A 4L15A 5EZ5A 2GK4A 5F2NA 1KEEA 3GT3A 4PZEA 5IKMA 1ZMRA 2O8NA 1O89A 2QRHA 4IILA 4MVWA 4WUTA 4MROA 4URXR 4KQIA 5FUMA 3SJ7A 3RRFA 1USUA 3EF1A 4CEIB 2LCFA 3TQTA 5EJ9A 1LQTA 2X5NA 5HE8A 1IBLB 2JCXA 4RS3A 1KVSA 4GZ5A 3Q3EA 3WR5A 1WZEA 2YMMA 4GPAA 5J2UF 2IDKA 5L3VA 1SQFA 2ZANA 4A0FA 4C76A 1XQXA 2GNOA 3K92A 2F9LA 2HSJA 1EFAA 3S1LA 3A9RA 1EBFA 1C7JA 3K09A 3PWTA 5I7EA 4J0EA 2W6OA 3KNZA 4QXQA 3GHYA 1W36C 5E4TA 3VISA 2GAIA 4RA6A 1IE3A 1Y3DE 2CK3D 3K70D 1B2LA 1T4CA 4NK5A 5JQWA 1XA4A 3AHIA 1T2FA 3C3CA 4GZLA 5DGTA 2CFOA 1MC5A 2I67A 4OXRA 4N8EA 2JLYA 2FOXA 3UUWA 2PFGA 3EULA 4PYJA 2EF0A 5K3BA 4DPMA 4CIYA 4YXFA 5ICMA 4ZI7A 1GQQA 1EGMB 2IRWA 1LV7A 2D7JA 3IB3A 5BMVB 2RGGA 3DG9A 3NHUA 3VKUA 1DLJA 1ZA1A 3NJRA 3B8HA 3N6RA 3FIUA 1RBYA 2EFGA 2OCXA 3EDQA 6AT1A 1DNPA 1T0PA 1VE9A 1NU8A 4RTPA 4AKGA 1ZU5A 1KMCA 3GGPA 5MFPA 3D2BA 3PIIA 3KV3O 5JWRA 1MA0A 1USKA 1PZFA 3VVMA 4L9AA 1N78A 1F2TA 3H9QA 1LTKA 3QX9A 1VC2A 4O2BF 3ZW7A 2WE8A 3JQQA 3JVUA 3A4NA 3O3NB 1RQXA 2IYPA 3PXBA 4KHZA 1EUCA 3DA8A 3TCXB 1ZONA 2IP4A 2O8BB 1O1YA 4KEAA 5JZOA 1B0AA 3A4YA 3B6JA 3BSFA 4FKZA 3EZ2A 2BBOA 3VNSA 1WJGA 4JEMA 1OILA 2NSHA 3TR0A 5D7NA 1L5YA 1EFHA 1I2BA 3D7NA 4OYRA 2BV3A 4GMHA 1L7EA 3T5GA 1L7AA 1OZHA 2GM9A 4GFDA 1WCXA 2R6GA 5ICEA 2ZWOA 3D7SA 1PWEA 4P5PA 1M5UA 1UKAA 1WAMA 3EG9A 4LZZA 3CZQA 4UEJA 3B2EA 2CXSA 4FKMA 1ULAA 4IWYA 2GN6A 4WA8A 4Z2AA 4RXTA 1L0BA 2VBGA 2OLJA 3F7TA 3JQAB 1IUKA 1Y8AA 2DY1A 3O84A 3QKSA 2R4TA 1EB9A 1K9SA 4N39A 5DK6A 2Q6IA 3ST7A 3TLZA 4C6SA 2IUSA 3LIPA 4ESOA 1K9VF 5A5FA 4H2DA 4XUCA 4I9UA 3QU2A 4GDMA 5J63A 6NULA 5J4YA 2CSXA 5JJBA 4P53A 3LE8A 3REOA 3SQOA 3P19A 1DHRA 4TRNA 4DIKA 3T1OA 1E2FA 2RGRA 4GGPA 2F4VB 1V45E 4MWEA 2VDPB 4IH9A 4K46A 5GVRA 1WZIA 2FW8A 3KDPA 1NXSA 4N6NA 4C0LA 5A3QA 3I52A 3R5HA 4QVKA 3F6SA 4GKAA 4XOUA 4KXLA 1CUDA 1GLVA 2VT2A 2IPLA 2REQA 3SZOA 3KQSA 3W2FA 1OYYA 1V41E 3BORA 4Y7CA 1GSHA 3CEMA 4YDHB 2IYLD 2C0QA 5DN9A 1TT5B 5DN6A 3ZGVA 4AF7A 3WYEA 1R0SA 2PZJA 3H5WA 4O4JF 2HK9A 4Z3KA 5F1PA 3VA7A 1RBZA 3DGEC 2KLBA 3DVAB 2X4IA 1E79A 2BOVA 4KE9A 1XGKA 1ISMA 1WPGA 3FWKA 5LMNB 2HF7A 2O2DA 3LC7O 1SVLA 1EGVB 4Y6SA 5CGZA 3ZLTA 3TF5A 2WVAA 3KYIB 2WF7A 4G8JA 4WASA 1Q0QA 1QR2A 3VOBA 1K97A 5KYKA 4F2HA 3AY6A 4M1ZA 5FPSA 1Y37A 1JNXX 3ODPA 2ZJ4A 4FGWA 4JZKA 5DNCA 3CLSC 3IEPA 3V00A 3F46A 1HFEL 1V3UA 3QZUA 4G5RA 2H7CA 5TC4A 1L4EA 1E5VA 4FP9A 4X3CA 1VHDA 3R6TA 2ZS8A 2BE7A 3TL6A 1R27A 2MYTA 4JVOA 5C2JB 4DR5B 1ZVJA 2FMHA 3EVCA 2RBGA 3ED1A 3TR5A 1P61B 1QG2A 3OLCX 2ATEA 3AEUA 4IDPA 1QTRA 3I04A 3KTFA 4ZXFA 4BLSA 1JIJA 4RDCA 3EWIA 2R47A 4LYEA 4GDFA 1EWYA 1X13A 4I3FA 1JAZA 3AVPA 3VPXA 1QK5A 5A9SA 1LC3A 1TUIA 3PUYA 4AXBA 5FUQA 2XRZA 1A98A 3B3GA 3B3QA 3JXEA 4PE5B 2A92A 3QJ5A 2C5FA 4FGJA 1A9YA 2JLAA 2VA8A 3U1VA 3WWEA 4CM5A 2IEIA 3GNTA 1YMUA 1L5FA 4LZOA 1T2AA 3REFA 3G13A 2I7DA 2OC9A 1Z16A 3ADKA 5FQOA 5KYWA 1K2WA 1QF9A 3AUXA 1RWXA 1MEEA 4Z0NA 4X1YB 1LY1A 1N5RA 3Q72A 1J8QA 1TLTA 3O31A 3SBXA 3K8OE 4UCQA 2OZPA 2OFWA 3N39C 3CZ9A 2BUAA 3HM2A 1D7OA 5LDHA 2H4ZA 2L19A 4MVJM 3R8FA 3GMTA 3FX2A 4MPPA 2FOLA 3ABRB 3C1TA 3SJUA 3ZI7A 5LQKA 2HU7A 5JBNA 3BE5A 1RLIA 4FNOA 4GBJA 3A1EA 4GR5A 5LQSA 4DYVA 2QE7D 4C0QC 1YQXA 5AXBA 1YHYA 4EM6A 3NFYA 4L51A 3OX4A 1GOTA 3P0FA 2GLTA 3A58B 3I5UA 3TD2A 4R71A 5CEJA 5JBQA 3L4JA 3ZLBA 4B74A 1ODTC 2P41A 3IMCA 2P40A 4O25A 4LC9A 4LXIA 1E6LA 3SF8B 3VPGA 2FSGA 2OK7A 4FN4A 2G9NA 1GSAA 4RGVA 3ZHSA 5KZMB 2A1UA 3TSZA 3AKEA 3DE4X 2ZZKA 4JVNA 4QGFA 2V7WA 4DUGA 4RV5A 3B2QA 1XB2A 1GRRA 4E1BA 5HKAA 2XVXA 2MT9A 2KW5A 3AG6A 3HLTA 5LD2B 1NXQA 1M73E 2PWYA 3FETA 5T67A 3IDOA 4AJKA 1M5RA 1NT2A 1N2IA 5D3KA 4ZYUA 1M7HA 4YJHA 3RRZA 1H1LB 1Z0IA 1JRLA 3CFYA 4LHZA 1VHQA 4CQNA 4E09A 3RADC 4W82A 2QD1A 1HV8A 2QJTA 3EOZA 3OSUA 4TROA 1VHTA 1UJNA 2AFHE 2OR3A 1NE2A 4DIFA 2SNIE 1GL6A 1YR6A 2W93A 2YJZA 4DMUB 3LXUX 1U9YA 4ER7A 4G67A 5MFZA 1LBTA 4U8GA 4Q19A 1MO3A 3WP1B 4L8LA 3PI7A 4XYBA 3CH7A 1DB3A 1FDVA 2X5XA 4QVGA 1QGDA 3RQSA 3G68A 3BDIA 3DOUA 4LV8B 2C2GA 4LXXA 4CWAA 5JSFA 3IIMA 5C7OO 3FE2A 4P3PA 4BMSA 2BJHA 2AZXA 4Y2XA 2VUTA 4MVYA 1JHQA 5TY0A 4KVGA 3I01M 4ZMRA 4P83A 5KYXA 1MQAA 4CEIA 1WY7A 2M2IA 2CE2X 3E23A 4R9SA 4B84A 2Z98A 5DXAA 2BMAA 3PJGA 1BGVA 3GJ0A 2PKQO 3HSKA 4B7UA 1J56A 1KVUA 4QHYA 2AEFA 3DV0B 2GF0A 5IT9A 3GUVA 3CIOA 2HO5A 4F91B 2QDXA 4X3OA 4WLUA 4B3FX 1K68A 1JHPA 4Q9HA 1H6CA 4D96A 5JEDA 1CZHA 3MUOA 1XKLA 3CE6A 3LHSA 1JG2A 3GFGA 3RC7A 3SFTA 3WB1A 1NR7A 3B70A 3DQPA 4PAOA 4AUNA 4RF2A 4IKPA 1DX9A 3OQBA 1EDEA 2AR9A 5F7ZA 2VQEB 2DH6A 3ENWA 4AO6A 3FZYA 1OQAA 3KJEA 4KDCA 4G5YA 4H9GA 4E2ZA 4ZKDA 3GLGA 2O8DB 5JJCA 2D5AA 2FP4B 4AMVA 3EX7C 4RW0A 2ZR9A 2EHDA 3LY7A 1P73A 4JYPA 3WJ2A 3CPEA 3OHMA 5K4HA 1RWPA 8LDHA 4YMWA 1T2CA 1SG6A 1CJVC 3IBGA 4EZIA 2G9UA 5JDCA 3BL6A 2BIFA 1XUOA 2X3FA 4JOQA 1RZUA 2VA9A 4RVDA 3AHFA 4TT3A 3JTMA 2PS3A 3L7LA 4KZKA 3ZWDA 2A4MA 4P5DA 4EARA 3E9CA 2BKXA 3AKZA 3C3MA 5C7LO 3LVBA 2O8BA 4YY3B 4BX3A 2H0AA 2L0XA 1QF6A 2DLDA 1O08A 3GQBA 1LF5A 1CUZA 4TMXA 2A6PA 4GC5A 3CWZA 4W9MC 2J87A 3FMPB 3FBTA 2ZRGA 4W8OA 1NBHA 3LXMA 1PZNA 1UZLA 3Q9NA 3NKVA 4L6CA 4B5LA 3O4HA 1C9MA 2XBLA 3OZSA 3G0DA 3A0RB 4BFLA 5I51A 3JZAA 3OQPA 1BKDR 2X58A 1QU3A 2X2EA 4Z3OA 4ZMBA 2MMGA 4D3ZA 1NVTA 3N2ZB 3GXOA 4IAOA 5F51A 3KDAA 5BV1A 1CFJA 1QHSA 1VCNA 1JI3A 2X7HA 3JQAA 3AKYA 3PHIA 1RXUA 5AKXA 2YR0A 1JLSA 1LZLA 1RKVA 3PDUA 3WL6A 2ETVA 5KVSA 2VRWA 3G1TA 4A2PA 1WL8A 5BW6B 4LXQA 3SZ3A 2DUUA 1TJ4A 1DAMA 1OPXA 4FFBB 2ROQA 3BT7A 1UINA 4DR2B 5CCXA 4ID3A 3M0EA 4MVJP 4Z4HA 3P8ZA 1SZCA 1EHCA 3IEVA 1MIOB 3QMPA 2IUUA 5TQ0A 3L6OO 4JR1A 2XHEA 3B36A 2C88A 3HGQA 1NR1A 2AJLI 3LRPA 5DBHX 3CU5A 4B40A 5JPDA 2HBQA 4ZAFA 4L78A 1KFEB 3EEQA 3HXOA 4F4JA 2JIQA 2CKMA 3MIIA 3LDGA 5AKLA 5EQJB 5IPFA 4Z4FA 1GN9A 2ZQ5A 2A0FA 3DVAA 3GGSA 1H4SA 2OHHA 3U4GA 5ISMA 1NA5A 3TXAA 3F8TA 4RTRA 2GM4A 3HZZA 1PW5A 2HB6A 4EJSB 1HDOA 3V1TC 4DF3A 1ISPA 1BD3A 3RSOA 1X80A 1XVUA 4X92A 2RGAA 2QPOA 3HEAA 1U0SY 5LNK6 1KI7A 1GFZA 1JXOA 1QH8B 2DUWA 1K8RA 4WERA 3D6NB 5EWLA 1UXHA 3RVLA 2YJGA 1F0PA 3U37A 1IB0A 1LJ8A 3BXEA 2WMOB 3ND9A 3NRCA 1Z73A 3TTVA 1QNFA 3PVCA 2PQ2A 4Q7MB 5DYYA 3UCEA 3WLIA 4QC2A 5A4IS 3MZ0A 4Q1VA 3WAKA 2WSIA 1KQNA 3AVYA 3UM9A 1UR5A 4O8ZA 4J0GA 3CJQA 3FLAA 5JBIA 4PSCA 3FHLA 3ABOB 2AMYA 2IYFA 2XKAA 2Z09A 3AF3A 3GJTA 2MSCB 4RF5A 3TCKA 3G0IA 3U1BA 1TU0A 1RLJA 4Q4AB 4Q03A 3RLFA 3M34A 1Z9BA 2VK1A 1SBTA 4GWLA 3QUQA 2O6LA 3OE1A 4LW8A 2I7CA 4ZVPA 3LBHA 5GPBA 3T0GA 4C89A 1THGA 1DARA 3FCYA 3L6DA 3OFSA 2I1VB 4WAUA 4E08A 5ESXA 1JPJA 1EXWA 4NCNA 3WSTA 1RXVA 2PR2A 5F21A 3HTXA 1WZ2A 3WKCA 2V65A 3L8EA 4ZU6X 4DCNA 4HT3B 4JV5B 2YTZA 3I4CA 4YMLA 5DM4A 1OV4A 1KPIA 2OD9A 2IHNA 1R4MB 2WB4A 1F51E 1Z28A 2X8WA 1GITA 3FWZA 5T4FA 3Q6MA 3UBTA 3QVVA 4BP3A 5BXQC 3UG7A 2OAGA 1P91A 4CM4B 1VQ1A 5K6RA 1AK2A 1ESCA 1GL9B 2ZR8A 1FUEA 4EWLA 1NF8A 4TLEA 1UM8A 4PC7A 3RV3A 1A04A 5HK9A 5E7MA 2JJ8A 4LRXA 5I4BA 3IALA 1HMPA 3GNLA 5ICGA 3KVRA 1Z6AA 3DZIA 3U60B 1Y33E 3VH4A 3EIFA 1W4BA 3A4IA 3DFIA 3B6MA 1FYDA 2H1VA 1FOEB 1NYRA 1XROA 2C95A 2PD4A 1NJGA 4ARBA 3EDCA 2HUNA 5CG1A 1NATA 1OXMA 3O4FA 4HDMB 5EAIA 4CL0A 1QQBA 4OHXA 5G4KB 1GZ6A 1RYZA 2IZ5A 3W34A 5I9TA 3KZCA 1BH6A 1XZLA 2X7JA 5SY4A 4CUZA 3QEBZ 4LBWA 4K6CA 4N5DA 2A0KA 4LWPA 4MPDA 5CVTA 1II8B 1TCVA 3QU9A 1NI4B 1N34B 5ALGA 5GMOA 1KPGA 1WXEA 1I0ZA 2LP4Y 2POCA 3KJXA 1DRKA 4Z7JA 3FWPA 5L4NA 4I46A 4A15A 3NBUA 4JX9A 2O4CA 3FYSA 4QBIA 4XB1A 3RPEA 4EY3A 5BSTA 3EQ6A 1I5EA 3ICWA 4CMGA 3C4JA 5AJYA 1Z8FA 3L1UA 4QYIB 4EDFA 1KE1A 1YBMA 1VIVA 1N4AA 4HNGA 2F6RA 1SRRA 1VSQA 1R18A 2HZ7A 2ONCA 3M1IA 4J1NA 1YR9A 4QDKA 5EUMA 3ZV4A 4OK5A 4ZK6A 1I7QB 4FX5A 2WWYA 1UPXA 2AD5A 2EW8A 2RHWA 3WLPA 1TCCA 1E6UA 4Q1CA 2W2PA 4HMOA 1X1AA 1BGXT 2VI5A 2NZVG 3QHAA 2IS4A 2Z2XA 2NACA 1OIXA 3EHDA 2BSQA 2MR5A 2WWWA 3VBCA 3QE2A 5AHKA 5JSUA 3KYCB 3GGJA 3EA4A 1VPTA 3K5HA 5LLDA 1Q1ZA 1EQUA 1OA0A 1SVKA 2V0CA 3K6RA 3K72B 3T7RA 3S7ZA 3EIWA 1YB6A 3WGKA 1VBNA 2I6SA 2ZBPA 3IHKA 3NORA 4XAQA 3ESZA 4IXNA 4ZV4A 4AZVA 2WU8A 3AR2A 2C7GA 2EJTA 1EDBA 3O1IC 3U09A 1LRJA 2XWJI 1CJUC 3PGXA 1QFZA 3L82B 2YV1A 2DWPA 5JH7F 2FP4A 2JFHA 1D9XA 1E3DA 2PWAA 2PX2A 3CPSA 1EE9A 1X1DA 2WLSA 4HRAA 1HR0B 5IVDA 2VHTA 1SK8A 1TOAA 1B3BA 2BCJQ 3HO8A 4CMHA 1Z6TA 3ER6A 5EERA 4EI8A 3K2QA 1K92A 2EARA 2XBMA 3PRKE 1BVUA 2XCIA 1XTRA 4XVRA 1RCFA 4NS4A 3B8EA 3ISVA 2ZJ5A 1UIRA 2QLTA 2WSMA 2F55A 4X90A 2ZG6A 3AR7A 3QGMA 4RPGA 4PY2A 1KE2A 3FOEC 3D3NA 3F78A 1SVNA 3EASA 3IX7A 1TYEB 5J43A 1M83A 1QUFA 2FKNA 3ICPA 4DOMA 5KNCD 3NIFB 2Q6VA 1L5WA 3NT2A 2XCUA 4KOEC 1Q0TA 4AW9A 2GN0A 3GVIA 2Q1XA 2LW7A 3QTTA 1OLOA 1MRZA 4F45A 5KWVA 5KU7A 4E5DA 3CZRA 3ONVA