3QVUA

Crystal structure of ancestral variant b9 of sult 1a1 in complex with pap and p-nitrophenol
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
288
structure length
288
Chain Sequence
SRQPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFNRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPDPGTWDSFLEKFMVGEVCYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTIPQEIMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed evolution of sulfotransferases and paraoxonases by ancestral libraries.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Sulfotransferase 1A1
total genus 96
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2011-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qvuA00
3SFZA 4F7WA 5J5CA 1P2SA 1U9IA 1OHHA 5FL7A 3ND8A 1TNDA 1G64A 3DKPA 3GCGA 3UANA 3B13B 5GJCA 2Z5FA 4GOJA 3DEFA 1M7GA 4MKGA 2JLZA 5FPYA 2PJRA 1UF9A 2A3RA 1VG0B 4GZMA 1Z2AA 3T06B 4ZDWA 2JLUA 121PA 2MSCB 5CDFE 4LHXA 4Q9JA 3W90A 1OFUX 4KFUA 4BEBA 4KSBA 2ODEA 2O8EA 3AVVA 1FNMA 2D3WA 1ZUNB 3HWSA 4H1VA 4ZCLA 1IM2A 1NVVQ 4KODA 4XIGS 4DEXA 4C2TA 3EA5A 5JSZA 1W47A 1UJ2A 4B48A 1BMFD 1TF7A 2EU8A 5JI3E 4TYYA 3NG1A 4I99A 1XEXB 4ON9A 4TWZA 4G5RA 3VR4A 2QMEA 2JLRA 5FTJA 1NY5A 2V7QA 2YOFA 4UNPA 1E2FA 3Q5DA 5DN6D 1E2MA 1NL3A 3BB3A 4HLUC 5J4KA 1MO4A 4RFSB 3BS4A 3Q85A 4A36A 2BBSA 3L0OA 2IT1A 2B6HA 1P60A 3W8NA 4DLRA 2GVDC 2IYVA 1NVVR 1KZGB 2QEQA 2QNRA 2IS4A 1VYTA 1N5JA 3VQTA 2G88A 2YYZA 3NHAA 4LOAA 1IN4A 3MJHA 1CR0A 2CDNA 4MGZR 2JJ2D 3BAFA 2O8FA 4Q4AA 3AB3A 3TLXA 2PEYA 4R98A 3CWQA 3TAHA 4A0GA 1KI6B 2V9PA 4DLUA 5J4HA 1FX0B 3M6AA 1KDOA 2C5LA 4JVMA 2XZPA 5AUQA 4BQSA 4HLDA 2OXRA 3PXGA 1E9CA 3A1TA 5DN6A 2PT5A 2J5XA 3NH9A 3IHWA 1LTQA 4WXRA 4I1UA 3CR8A 3WMGA 3PCRB 5GJBA 1A82A 1MO3A 1XJ0A 1OB2A 1OT3A 4M53A 4JYBA 3PEYA 5DGXA 1GDDA 1XEWX 4PPGA 4B47A 3CPHA 2IYQA 3ND9A 3NDBB 2WJGA 1TQ2A 4RKEA 4OQMA 4MKFA 3ZDQA 4BFVA 3UPUA 5BYJA 1RJ9A 2G1KA 1JXMA 1OXTA 3N70A 3QBTA 621PA 2GESA 1XPUA 2BVNA 1G7SA 3Q8XB 4H9GA 4IFEA 4NDZA 1IBRA 4V0KA 2WKRA 3ADKA 3DPUA 2J0QA 3TIFA 1XXHB 3NH6A 1E9FA 1NVWQ 4P4TA 4V0ME 3AVUA 1DELA 1OSNA 1W0JD 4YMWA 3IPYA 2R6GA 3RANA 4OI0A 2O8FB 3VKHA 3SE0A 1IJEA 1IXSB 4BFZA 1IQPA 2RGDA 2QAJA 2VO1A 2ZSBA 3QXSA 4QL3A 3VTKA 5FBVB 3LW7A 1LS1A 1XTJA 4B3XA 2H8KA 4NMMA 4ZKEA 4BZPA 1S3GA 1QBKC 4GNKA 1G1MA 1ZYUA 5GVSA 1R0XA 4D82A 2F55A 3AKDA 1XTQA 4PANA 1G5PA 5F98A 1JXOA 1XF9A 3BB1A 3F5FA 1E2GA 3BIFA 4C4PA 4NZYA 1ZM9A 1ZRHA 3VFDA 4TQUS 4OL0A 3MSXA 2PLRA 4QFMA 3V9PA 1VIYA 2C99A 5IK2A 5FUWA 1MR3F 2JGNA 3U2QA 3VR1A 2CE7A 3EASA 3OIUA 2BM1A 2WIBA 4DDTA 1BYIA 3HU2A 2NO6A 3E5HA 2WOOA 2O0JA 2XZLA 1KK0A 1VECA 3HR8A 1D6JA 2RGGA 3A36A 3B78A 2BKEA 1Y3AA 1T6NA 2AFHE 4TMWA 5SZJA 1QG4A 2AD5A 5E7IA 1LVGA 1XMSA 2GCNA 2ZSDA 4JLBA 4MKIA 5FOSA 1II8A 1KSGA 3U60B 4A2QA 3MJRA 2Z4RA 2X19A 3B7GA 4B2PA 4PZYA 3I73A 3NDPA 4B43A 1F2UA 1NP6A 1N0UA 2O8DB 4QNMA 1IY0A 4EJSA 1A1VA 4MGIR 3D3QA 1ESNA 1JR3D 1Q22A 1W0JA 4R9UC 2FSIA 1NMXA 2G83A 4MH0R 3QKTA 5DYGA 2NGRA 1IXZA 1RPZA 1ZC4A 4MKHA 1S9HA 4B6EA 4ZCIA 4QM6A 2OFWA 4LZZA 4WVFA 3T1TA 4KLZA 4P3YA 3HR7A 2FPKA 4QJ3A 3PG5A 4A4DA 1Q3HA 2FFHA 3KQHA 4OQLA 4WZ6A 3EARA 4D4MA 4LY6A 2I1VB 3THXA 4JL6A 1JPJA 2A5JA 1D9ZA 4KCGA 2OBMA 4A2PA 3AF3A 1Z0IA 1KSFX 4JLAA 5B30A 1AM4D 3RYTC 4ARZB 2BM0A 2FZLA 2WAYA 3H1TA 5CK5A 5FTMA 4AKIA 1L4UA 3A4MA 5CM9C 2Q6TA 3RRZA 3L2OB 4QC2A 3WP1B 4US0R 2C78A 2VYFA 3ZD6A 1NVXQ 1NIPA 3A8TA 2IW3A 2GAOA 3FHTA 1KJWA 1UDWA 3G82C 1MRNA 4HLUA 4Q00A 2VBCA 3KKMA 1SZPA 2GKSA 1G291 521PA 1Z0JA 3ICQB 4URXR 1N2CE 2P6NA 3L8ZA 3B5JA 4FWTA 2QGZA 2IYUA 3K0SA 3PEVA 3DMNA 1NKSA 1T0JB 4LBVA 4RZ2A 4W5WA 3C14C 3KQNA 2CCGA 1PLLA 1FTNA 4QGHA 4FCWA 2C03A 2ZVPX 4PO8A 4HSEA 1G19A 1E96A 4R2HA 3B1XA 1HV8A 1T3HA 5KSYA 4UNQA 1FQJA 1RYHA 5H68A 4P4SB 4KXFB 3IO3A 5JMTA 1G3QA 4M1YA 1KAOA 5CYOA 2YHSA 4HZUB 5JZVA 1OFHA 3QXXA 3FTQA 5F9FA 2FPMA 1OFIA 1VHTA 3F8TA 3Q5EA 4G3XA 2ORWA 4P32A 2J9RA 3DM9B 1LF0A 3R8FA 1U9IC 2WJHA 4ESHA 3CO5A 4BLSA 3RRNA 4BFUA 3PEWA 5G41A 3T5DA 4EPVA 2IYTA 2J7PD 4IW3B 1SQ5A 3H86A 4KO8A 2RHDA 4D4KA 4DLVA 3EPJA 1ZD9A 1XMJA 3QG5A 4OI2A 2OEPA 1KO8A 4OK5A 2A5YB 2DWOA 3K0AA 2QORA 3QNUA 5FR2A 2BCJQ 1IJFA 2YWFA 5FL7D 5B2ZA 4C0SA 3AKCA 3BGWA 4Q1FA 2FGKA 1E4VA 2CNWA 2GK6A 2UKDA 3OEHA 2XNDA 4Q9IA 1KTVA 3T1VA 4TSFA 2WTUA 1NLFA 2EFEB 4UQOA 4CYMA 3NHBA 3VHXA 4P4SA 2VQSA 4M4SA 4PHHA 2AD1A 5GJWC 4W9MC 5HTKA 1IXRC 3KTAB 2KBFA 5TARA 3L82B 2Z83A 1CR4A 4F92B 5JLJA 4FW9A 4LUCA 1F48A 3FDIA 4GRAA 3SHWA 5JJLA 4IEEA 2ZI3A 1SVLA 3TVTA 4CEJA 4FWIB 2A5FA 1OYWA 2CE2X 2FSGA 1KNQA 1Z07A 2ORIA 4BGDA 3GJ4A 3BRWD 3QOFA 3VU9A 3B1YA 3GJ7A 4TQ9A 4Q9LA 1OHHD 1N6NA 1P7CA 2G0NA 2PCJA 1P61B 2NZ8A 3PUYA 3R20A 4YLGA 2R6DA 5EZ6B 2XZOA 1ZINA 1Q1EA 5KYKA 1W46A 2WWYA 5C18A 1A2KC 2HJGA 4B3FX 4FIDA 1US8B 4R2IA 2BMEA 1G5RA 2R62A 1O87A 1CKEA 1HE1C 2WIAA 2VPPA 3FKQA 3H2YA 4RVCA 3TUIC 3X1WA 4W7SA 2IYYA 2XTNA 1Q12A 1KAGA 4LJ6A 4RD4A 2QGNA 2CK3D 1EX6A 2XJ4A 5FBQB 3OIVA 1R4AA 4IDQA 4JLDA 2JDIA 2QU8A 3U44A 3SEAA 2WWXA 3QXCA 2OSBA 1WF3A 3LLUA 4PQRA 3I8XA 5EE9A 4LJ8A 3UMSA 3UWOA 4A0FA 3JVVA 1EFCA 5KDLA 4S35A 2R6AA 1HQCA 2MMCA 4M22A 1RW4A 4RD6A 4BLPA 3WBJA 1XD9A 1VCMA 4NYMR 1P6XA 1Q1QA 4QGFA 4ESVA 1RRPA 2R8RA 3TQFA 1ZCAA 2C2HA 2N46A 2GCPA 4Q21A 4L9WA 1OV4A 1XNJA 1XU4A 4OHXA 2GJ8A 2EFCB 3O8RA 2OBNA 1QHIA 4PPQA 1JR3E 2QUZA 2Q0HA 3AP1A 2V55B 1GSIA 1BIFA 5FPHA 3KJEA 2JJ1A 5GJVC 1CULC 4OI4A 2WVJA 2ZRCA 4HATA 3WNBA 4N1AA 821PA 3J81k 4DCNA 3CIOA 1KIMA 1CXZA 5JBQA 1KZ7B 1E9EA 5FBWB 3U3MA 5K8IA 2D7CA 1NRJB 1GG2A 3NBXX 4ZDJA 1H8ED 5JJKA 4AWXA 1DAEA 1COWA 1QHYA 1YZNA 2B7BA 1LY1A 5F3WB 3P1JA 5FUYA 2IBMA 4B74A 4OHZA 1G16A 4RJLA 5FI1B 3CKLA 1NN3A 3CPEA 3QXJA 1LS6A 1Q21A 2F43A 5L3QB 4Q1BA 3T12A 4DDUA 4TLCA 1XCPA 4V03A 1R7RA 5TDHA 5DYIA 2DFTA 1VIAA 3EZ2A 2D2EA 3LWNA 2AKYA 5L3RA 3TUJC 1FQKA 1SXJE 1U94A 2ZR0A 3LDAA 3NBYC 2QG6A 4M9XA 2JIZA 4HZIA 5SZIA 4EFMA 3OF5A 2EWVA 2AN9A 2WWFA 4A8JA 2FEOA 3EW9A 1N6IA 2ORVA 4YONB 4GPTA 1QVAA 1NI3A 2E9SA 4GMXA 1UDXA 1W2GA 3DMDA 2XGJA 3HPQA 4QXAA 1M7HA 4PR0A 1L4YA 2IXGA 4NHOA 1V5WA 1R8QA 5KUTA 1W4AA 2OHFA 2O8DA 2FFBA 1HH4A 4D0NA 1KI8A 3SFVA 3CZQA 1G8YA 2DCUA 5FR1A 1DO0A 3GFTA 2BJVA 4JS0A 3PUVA 4B76A 3FYHA 2WWWA 1J90A 4H1UA 5CIWA 5UKDA 1E2DA 2P6UA 1NJGA 3SJCA 1DADA 2O8BB 1Z0AA 3B1WA 3VX4A 2XEXA 3GJ5A 2GXUA 5IRCD 1GKYA 4BRWA 4JKYA 3W3ZB 3IBYA 1TADA 4OHVA 2IHBA 3LO5A 1XD2A 1HQYE 1XRJA 4PAOA 1TUEA 1G8FA 4KSCA 1W0KA 5E7MA 2VSXA 2IX3A 3W34A 1EX7A 4J0QA 4QHYA 4U5XA 3D8BA 4FMCF 3NEJA 3UMRA 4DLZA 3B9PA 3LW8A 2QRZA 2KWIA 4YMVA 2BBWA 3EC2A 4Q1DA 1HA3A 1ZW6A 1E2HA 2WJVA 3CH4B 3JZMA 2J59A 4YC7A 1K5DA 1DARA 2FZ4A 4DT1A 2CVFA 2OCPA 1NSFA 1GAJA 4WZAE 1UKZA 2QP4A 1OH7A 1NN0A 3G0HA 4LGMA 1D8TA 1KDRA 3IIKA 5KO2A 1G8GA 3GFOA 5EXTA 2O0HA 2R65A 4HB4A 2BEJA 1U98A 2OBLA 4G5QA 4QOSA 2NZJA 2H17A 3LX5A 4IOLA 3U4QA 5BN4A 3RS4A 3SJZA 1TX4B 1ZBDA 2ZJZA 1GOTA 1EG7A 3P4XA 1Z3IX 4CDGA 4BZQA 2EFGA 2RHMA 3LQRA 1OE0A 1Q3TA 1G5TA 2GWHA 3H4MA 5CLQA 1UKVY 1VYVA 3CF6R 4A1FA 2DFNA 3SZRA 3AEZA 2ZRGA 1OIVA 1TMKA 1W1WA 3GLGA 4BWYA 2RKOA 3CX8A 1YZGA 3TSZA 3AGPA 4B3DA 2VRWA 1WB9A 1T8TA 4Q4LA 4TMXA 1SVOA 1VPLA 1ONBA 1YE8A 3REFA 4DDVA 3FB4A 2A9KA 2FX3A 2ODBA 4UXHA 3X2SA 1XXHE 2HEIA 1EFRA 3TH5A 5JECA 3B6EA 2J0UA 4IKEA 1CJMA 3C41J 1G3IA 3R7WB 2BMDA 3H0KA 2QTFA 4DZZA 4IOJA 4DRZA 1GTVA 2WPDD 3W6PA 1XMIA 4D26A 4JL8A 5AJVB 2BWJA 3QKUA 4DCVA 3W5JA 2H5EA 5GADl 5CJPA 2QM7A 3FKSD 2VHUA 4ILEA 5FOVA 8OHMA 2CL7X 4EDHA 4BFXA 4AG5A 1AS0A 1G3RA 4C0BA 2YJTD 1KOFA 5IT5A 4ZV4A 3RHFA 2I3BA 1MO5A 3SC3A 2F1JA 3AM1A 1R5NA 1DE0A 1Z6XA 2RGEA 4XVQA 4RD0A 4LJ7A 4ERNA 1ZNYA 1G7CA 2D4HA 3IIJA 3T15A 3SU8A 2B8WA 2CJWA 2LKCA 3DKVA 5FTLA 5KTYA 2IF2A 1SXJC 2AX4A 1L7VC 5LB4A 2PZGA 5AR1A 4HUQA 1XEFA 1E1QA 2O5VA 4ASUD 5J4LA 4IXNA 1VCOA 5K8TA 1R5BA 5KU1A 2Y8EA 3RNLA 5DHAA 3C7KA 2IYWA 2OAQ1 5BYKA 1E32A 3JVUA 2YOHA 4TLAA 1RVDA 3CH5A 4LHVA 2WZQA 1OH8A 2K5UA 2BBOA 4CW7A 1KK3A 1ZCBA 2OFOA 4HB2A 1R8SA 4AKEA 3TR0A 1HT1E 1FZQA 1JQJC 1A4RA 2HF9A 5EUMA 2OLJA 2ODWA 3WMEA 3K70C 3GLFE 3CF0A 4NU0A 1YZTA 1QRAA 3QF4A 4NL4H 4RD3A 4FI3C 1N5KA 1G17A 2KB0A 4NONA 3PV0A 1X6VA 2IXFA 1A5TA 2VEDA 3QQ5A 5FPKA 1JECA 1QVRA 4PO1A 1X8JA 2TMKA 2WICA 3SYKA 4AC9A 4DC9A 3PQCA 3UIEA 3BE4A 3RS5A 3HU1A 4UNSA 1ELOA 3CRRA 3OAAD 3VR6A 1E99A 1F5NA 4MA4A 5FOXA 5CITA 1E2LA 4NH0A 3K0CC 1F2UB 2N42A 1M34E 3I72A 1YR7A 2DHRA 3ZZTA 4LV6A 3U6BA 2JIZD 1LV7A 3DDCA 2XNSA 2IS1A 1GIAA 1P5ZB 3B60A 2OFXA 4W5HA 5L3QA 1SXJD 3VKGA 1G3MA 1P9NA 4NCKA 4DSNA 4KI0A 3R9XA 3R8CA 3KFVA 1OXXK 2NO9A 4Q9KA 3QF4B 2V1XA 3RLFA 2QZ4A 4XH9B 5P21A 3UATA 1BOFA 1IY2A 3RAPR 3I5XA 1KY3A 5SZHB 2YKGA 1KMHB 1D2EA 4FMBB 4BLTA 4L8GA 2NPFA 2GZAA 5KSZA 4LC1A 3TVDA 1E1RA 4B73A 2D2FA 4URWR 4LYAA 4RSGA 3GLIA 1EWQA 1FX0A 2BKUA 1YKSA 4E07A 1R10A 1OFTA 3QKSA 4DLYA 4ASUA 1J8YF 1L8QA 2QAGA 2ZI5A 1P3JA 4KBGA 1ETUA 1KDPA 2W6IA 4GOXA 1E2NA 4TQAA 2FDCA 2IYZA 4JL5A 1E6CA 4US1R 1W4RA 4A9AA 4AG6A 5HCIA 3E1SA 1TU4A 3E2IA 3LNCA 1DO2A 2DY1A 3WHLA 3NVAA 1S2MA 4XVRA 2QP3A 4Q4HA 3NBFA 4IDHA 3GLGE 3AF1A 1G8PA 2NOAA 4D2IA 2GJAA 2OZEA 1W4CA 4XSHA 1BYUA 5TVKA 4JBXA 2ZU6A 4UXIA 2ZANA 1E2IA 3BBPA 5IDVA 4C0JA 1KSHA 5JCZA 4Q7LA 2EVWX 2WPDA 2YC2C 1MH1A 4KFSA 4V02A 2WWIA 1FUKA 3B82A 4TLBA 4Q1CA 5KNCA 1S3SA 4K81B 1AIPA 1TEVA 3FE2A 3ZS8A 4AYWA 4DDWA 5BWMA 3L0IB 4UJ3A 1T8UA 4JYCA 2FE4A 1E2PA 2VL7A 3DOFA 2AK3A 4FD2A 2DR3A 4HDOB 3NBZC 3MAAC 1KGDA 3PFIA 2QMOA 3EX7C 2IYXA 2FEMA 2NMVA 2Q9BA 1ZIPA 2QE7D 1XFAA 3O8BA 4PQFA 4R71A 3NTUA 5FOTA 4HLCA 2W2XA 2E1RA 3THOA 4MUAA 4JLVA 1GILA 1EESA 2ERYA 1ZNZA 3S1AB 3TNFA 4WOPA 1DAKA 3A37A 4R7ZA 2XB2A 1DAMA 2BDTA 4I1OA 1S0UA 3AVXA 2ZR7A 1EGAA 1BKDR 4RY2A 4E03A 2A78A 4F91B 2NPIA 4UNNA 3TGPA 1IAQA 4M1MA 4HAWA 1G41A 4C0HA 1PV4A 2QAGC 5JCPA 5FFMA 2QQ0A 2OESA 2PX3A 3UK6A 5LBIA 3T5GA 4EUNA 2P5SA 2QE7A 2IWRA 2J45A 4E5UA 5LD2C 1QF9A 5CYPA 2Z0MA 2QBYB 5TY0A 4C9BA 2HT1A 2SHKA 3QIAA 3TBKA 1XZQA 1S8FA 2P0EA 4D4JA 5DE3A 4DWJA 4DSOA 1W36B 5KNBA 3LLMA 4Q5IA 4I1VA 2IXEA 1AQYA 1VG9B 5EXXA 1OF1A 4QBGB 3KKOA 4LRWA 2IA5A 2GZHA 4V0MA 3A1WA 3CONA 1M74A 1G4UR 1OKKD 2PT7A 1R2QA 3N5CA 2GNOA 4TSFD 4EPWA 4XVUA 3PITA 1VKJA 4C0AC 3FMFA 2ZRKA 2EFDB 2IF0A 3K0CA 5JRJA 3ZD7A 4DIDA 1C9KA 2O8CB 1TU3A 2FV8A 2HLDA 3NC0C 4O3MA 1KI1A 1P9WA 3WYGA 4M8NE 3KFXA 5FOWA 1ZU4A 1ZD8A 2H16A 2VSOA 3THWB 3TMKA 3OFND 1KJZA 2YNMA 4A6XA 1SVSA 3RWMB 3IUYA 5DLQC 4FCTA 3SDZA 5L3VA 1NVUQ 3I8SA 3THYB 4JVLA 4TMKA 3THXB 3MD0A 2ZITA 2QTVB 2J7PA 3QBVA 1U99A 1YR8A 3UXMA 2P6RA 2GJKA 3VHLB 5EE0A 2QPOA 2HDNB 4DCTA 1US8A 2JLQA 5FUXA 2J46A 2QQEA 4HAYA 3QPUA 3KQKA 1MO6A 1KO1A 4BECA 5JFGA 1VTKA 1NN5A 3U3JA 1AZTA 2ZSFA 3A1VA 2RGNC 2GEDA 2ZREA 3LVRE 3WYAA 4F4IA 1CF4A 3EIQA 1TPZA 1F6BA 3ZZ0A 2GRJA 1SXJA 2EFHB 2G1JA 5HZHA 3RDPA 2ZETA 5BQ5A 1Q57A 3SS8A 5LPNA 2VP2A 4NYIR 1E3MA 2VHTA 1N6HA 4MRRA 3UG6A 1CP2A 2W58A 4NCHA 3TW4A 3IPXA 4D0GA 4A15A 2ASEA 2ZUBA 4YXWA 3SOPA 4JJZA 2ZJOA 1TAGA 3C5CA 2JJ1D 2EYUA 421PA 2PZFA 2GAAA 4JLMA 2CCJA 4LPKA 4DHEA 4LV5B 4PHFA 1ZP6A 2REBA 2VP6A 4TZ6A 4IJMA 2Q9AA 5DI9A 2IS6A 2IEZA 2FGJA 2CLDX 3U44B 2ZYVX 4C3ZA 1XEXA 3P26A 2ANCA 4NBSA 1WCV1 1SXJB 4QGAA 2GEVA 3KL4A 3OEEA 1TQ4A 3UKDA 1Q1ZA 1VCNA 4Z1MA 3ZZUA 5EXSA 2VP4A 2XXAA 3T35A 2RCNA 4XTRA 3MWJA 1XXHA 4URUR 4Q4JA 5HCNA 3QKSB 2BOVA 4ZDKA 1UAAA 4CGZA 1N0VC 2ZROA 3GP8A 4MUBA 3QXHA 2QROA 2FOLA 4BRUA 1KYIA 2XSZD 4MRSA 3MWKA 2R6CA 3P4YA 1G7RA 5EP2A 3P27A 1ZM4A 3W6OA 1HT2E 2ZR9A 2JDID 3B8HA 4WBSA 1SKYE 4G0NA 1Z08A 1XTKA 4XSGA 1W36D 2W0MA 3U3KA 2ZI6A 5AWFC 3CR7A 3GQBA 3QVUA 1NIJA 1W7AA 5KPJA 1AQUA 4Q9HA 5L3SA 4ZIRA 4KU4A 4PXAA 2W2VA 5CDFA 2O8CA 1RRCA 4TN1A 2Z6VA 2A30A 4OBEA 4XJXA 4WIAA 4HDCA 3R9IA 2OUKA 3I3SR 1M6NA 1F2TA 5FTNA 4UKDA 4YDSA 3QPVA 3VU9B 4KFRA 4OHWA 4TTRA 1VCIA 1QG2A 4HYYA 1NY6A 4CT4B 1CRQA 1N5IA 5IK2D 4ZO4A 4HUTA 1XZPA 3SQXA 1OYYA 1KDTA 1XD2B 5JEDA 1DOAA 1OXVA 2P3SA 1WMSA 4LV8B 2QL6A 3LBHA 2JCSA 3SBDA 5FI0B 4KYUA 5L3SB 2G3YA 3U3RA 3KUCA 1J2JA 2GXAA 3FFAA 4AYXA 3C16C 5DI3B 3ICEA 5EQTA 1IY1A 1JAHA 3SN6A 2CNWD 3OEHD 2CLCX 4TMZA 1OH6A 3FFBA 4P33A 3HU3A 2VHQA 1H65A 1T91A 5H70A 1Z06A 3AVWA 3CPJB 2ZI9A 4WW0A 2VP0A 3I61A 1JR6A 1DG3A 4QBFA 1NG1A 2ZRNA 3HYRA 3WNDA 3OESA 1PZNA 2XOKD 2YC4C 3QEOA 1SKQA 2C96A 4YMUA 2IK8A 3DHWC 4BFTA 1ANKA 2I4IA 4PZLA 2GILA 1WP9A 4DLWA 2CCKA 4LCBA 3THYA 2ZUCA 2QMHA 4PC2A 1Q20A 1E0KA 2RGCA 5EE3A 3I5YA 4TL8A 1Z6TA 2D7DA 3SJAA 5BXQC 5GVRA 2ZTSA 3BOSA 2ZIAA 3K09C 2NO0A 1QHHA 3FMOB 4NYMQ 3NKVA 2PLFA 2XNDD 3WBKA 1G18A 2AL7A 2NO1A 3AP2A 2JAQA 4B3CA 4IDPA 2VHJA 1II0A 3VAAA 3RS7A 3IGFA 2QT0A 1A2BA 2H92A 2IL1A 2ZRBA 2ZJ5A 3ZH9B 5CJ2A 3CW2A 1CTQA 1FFHA 2C9OA 2F1IA 1ZIOA 2WMOB 3MWLA 2CL0X 1F60A 2GBLC 3W3AA 1H8HD 3TAUA 4JSTA 1KK2A 1V43A 4D80A 3A4NA 3VR5A 1JQLB 1FP6A 2ANBA 1IOZA 4O2LA 1AK2A 1YRBA 5JS8A 1CU1A 2WKQA 3GEIA 1GRQA 4OJKA 4ZDIA 2IYLD 4Z51A 1ZNWA 4QNRA 2IUSA 1GNRA 3QSYA 2BMFA 1B0UA 4N3NA 2XB4A 1DAFA 3WHKA 3GPLA 1G3UA 3EPLA 2NIPA 3IKJA 4TLEA 1AZSC 1RC8A 3K53A 1ESMA 3SYNA 3GLIB 4B34A 2GCOB 4IVRA 5DO9A 5G3ZA 1VDZA 1E4YA 1U90A 4GOKA 3KX2A 3VKWA 4L4UA 3OIYA 3GLFB 4ARZA 3TQCA 1N6PA 2VH5R 4NE2A 2XJ9A 1TTTA 2F9MA 3OHMA 2GZDA 3EPHA 3B9QA 1LB1B 3K0FB 1AS3A 3AVPA 2B8TA 1JPNA 4ZCMA 4NKRA 1NNEA 4YQFA 2OG2A 3LA6A 1XJQA 4HAXA 4M0LA 1JJVA 1L2TA 2A2ZA 4TL9A 2GF0A 2HCJB 1R0WA 4U02A 4Q7JB 1E94E 3CRMA 4OYHA 2I1QA 3P20A 1T5IA 1BO6A 1XCGB 1HE8B 2AXPA 2JLSA 3CNLA 4I81A 2ZU0C 4ACBA 5JJIA 4ZKDA 2ZSEA 3D31A 5BW8A 2AFIE 1WQ1R 2RGXA 5AUOB 2IHYA 5J4YA 2QSYA 4P0TA 1NN1A 4QGGA 3FMIA 4BFWA 4QG7A 4DIEA 4B75A 4OJQA 4TMVA 2GA8A 4DT1B 3FVQA 2C04A 2XTMA 4M1SA 2ZRHA 4WAUA 4OK3A 2FA9A 5FUVA 4IVPA 3G5UA 1DTSA 2QPAA 1E98A 4URYR 1K6MA 1KI7A 2MSEB 1ZJ6A 2ONKA 4HDQB 3DL0A 1IHUA 1OIXA 3WP0A 4LJYA 3KXKA 4RZXA 3BH7A 3U6KA 3B1VA 1GKIA 4QJ4A 3VR2A 4GT1A 3L8YA 2AWNA 1YZUA 1JR3A 5C46F 2ZRDA 1ZVQA 3MCAA 1TUIA 5JEEA 2RB4A 4GDFA 4MDFA 5JS7A 4CVNA 4CZ2A 1P75A 3OZXA 3O8DA 4DCSA 2KJQA 2AHOA 2ZJAA 1Q44A 2CLSA 1QHSA 2F1RA 4ZIRB 1RIFA 4MYUA 3BORA 3HPRA 2W0SA 3IEUA 1KMQA 3LRPA 3GLHA 4Z54A 1RE0A 3KKPA 1QHNA 1GNQA 1PUIA 1PVOA 3AF2A 3W6NA 1GITA 2BJWA 5IF9A 1F2TB 1FMLA 3JZAA 2JLWA 4DKXA 5CIQA 3R7WA 4AKGA 1EXMA 1M2OB 1R0ZA 2H1LA 5JWHA 2PEZA 1NKTA 4GBMA 3BK7A 1I4TD 4JSYA 4Q4AB 5KPDA 4RKFA 1GVNB 4F4CA 4G01B 3CUEF 5J4VA 4NYIQ 1G7TA 1R0YA 4O2RA 1KJYA 4QRHA 1Z6YA 3MRSA 4AD8A 3F0TA 1II8B 4O0MA 5FBRB 3OEED 4LSGA 5TV2A 1CJKC 3LAWA 1WXQA 3TSOA 4LJ9A 2FF7A 2ZYUX 3CBQA 4YMSA 1BS1A 2FMXA 3L0SA 4JLPA 4V0OA 1MRSA 4A2WA 3GJ8A 2WJIA 3MGCA 1NSTA 1E0SA 1E0AA 3CRVA 1SHKA 1RFLA 4CF7A 2KE5A 1N6LA 1J8MF 3GJ0A 3HP1A 4P31A 4Q02A 2J0SA 2JLVA 4GL2A 3EZ9A 4B44A 3TK1A 3EIEA 2XAUA 1Z8FA 2RGNA 1P72A 2IUUA 5KDDA 2HT6A 4Q4HB 2JA1A 1WBDA 4NYJQ 3K8YA 4BUJA 1Z83A 4NTZA 2W6JD 1I4LD 1E0JA 1U2RA 2HV8A 2QY9A 2C95A 3ZYCA 3SYLA 3C15C 4LHYA 4PC7A 3LFUA 2DB3A 2UVQA 1G8HA 5JWRA 1X3SA 1UEIA 1YZQA 2ONJA 4QBHA 1YJ5A 1MOZA 3EC1A 5SZKB 4PSAA 2JATA 4PC3A 3K70B 4BEJA 3M0EA 2QBYA 2REXB 3IQWA 3T61A 5CB8A 1P4SA 5FBLB 1ZNXA 4LC0A 3MFYA 4X8MA 4PC6A 3EPKA 5AJXA 2EW1A 3SJBA 3SHFA 1XDBA 2Q21A 2BMJA 4NYJR 1HUQA 3PVSA 4X8OA 2QSZA 2YINC 1CR1A 4HI0E 1PLJA 4JVNA 5A0FA 3IO5A 1UKEA 2J0UB 1J99A 1GP2A 4F4JA 3LXRA 4U00A 1HEIA 2HUPA 1GUAA 3AQ4A 1NLZA 2VTKA 2O8BA 4GP7A 4G5OA 3TSWA 1J7KA 3OFNA 4KFTA 2QM8A 4MYHA 4LYJA 2HYIC 1YZKA 4RD2A 3K1JA 2NTYC 2WJJA 4A8JC 3RVBA 5ELXA 3B1ZA 4M1WA 2OCYC 1E9RA 2D62A 3FHOA 2V7QD 2B7CA 1W48A 1SGWA 5AUNB 1LNZA 1H8HA 5JHHB 4JZKA 2DFLA 2H57A 1BMFA 2RGAA 1J70A 3OIWA 4S2EA 5FPSA 4TTPA 5EP1A 4V0LA 4DCUA 4U7DA 1CS4C 2ZE7A 1YU9A 2OLKA 4GMDA 2GBLA 1W49A 1T9HA 3CM0A 4L15A 1U0JA 4LBWA 4M21A 5TMPA 5D3MB 2XOKA 4TT3D 4D6PA 2N1BA 1DAGA 1T4GA 2ZRJA 3IIMA 221PA 3CX6A 3KJGA 3RS2A 3BB4A 3DVLA 5DISB 1YR6A 2ZSAA 2FU5C 3KB2A 3QEJA 3SQWA 4PHGA 4LK2A 2ZE5A 4XOIA 2Q3MA 4C7OB 1B23P 3QY0A 5E95A 1XEWY 3AKYA 1Z5ZA 1E69A 2RGBA 2JJ8A 2J1LA 3KDSE 2O0KA 3K9NA 1W36C 2LWIA 4I4LA 2ZYWX 4JBYA 2X2EA 5IHPA 4CEIA 5EJEA 1G21E 1CJTC 4EFNA 4PSVA 2IUTA 4O25A 4IFBA 4KHZA 4DLTA 4HAZA 1AN0A 4PPFA 1E2JA 4TYWA 5E3HA 2A5GA 2UZIR 3AH8A 1QDEA 2ODNA 4E09A 2C77A 1E9BA 3GLIE 2WJYA 3AVQA 3ONWA 2CVHA 5G40A 1NMYA 3Q72A 1PUJA 3UG7A 2PL3A 3CRQA 3MUFA 1MT0A 1SKYB 3M1IA 3AP3A 1KSJA 5E7JA 1HYQA 4LI0A 2F43B 1OXUA 3RABA 4FMDF 5KSPA 3HYTA 3K9GA 2KSQA 2QP9X 4K46A 2H7VA 4MRVA 1NG9A 4B2LA 1P62B 1FPMA 5EP3A 1G4AE 5A5GA 2ZQ5A 4Z1MD 1FOEB 1YRAA 2Q3FA 1SVMA 3EZ6A 3GLHE 3T1OA 3CZPA 4LYFA 4V0NA 1TF2A 5TXGA 2OO7A 2FG5A 4LYHA 2WWHA 3EZFA 1P2VA 2ZJ2A 3GFPA 5KOYA 1ZUHA 2GXSA 3LY5A 2X1VA 4XD7A 2CL6X 2BC9A 4DJTA 1DAIA 1D5CA 2IYRA 2VA8A 1GKUB 3GLGB 2ZM5A 2X77A 4BFSA 1SVWA 1R6BX 2W6ID 4Q48A 4B3GA 1U81A 1XCMA 1IN6A 2BCGY 2WHXA 1JBKA 2YVUA 4LJ4A 5D3QA 1NLYA 2YZ2A 1ODFA 5EZ5A 3VNUA 2KBEA 2DFKB 3W9YA 4FXPA 4DB4A 1KI4A 5AJYA 3FHCB 3KXIA 2F9LA 4BZXA 4AI6A 3OE7A 1NJFA 2WWGA 4TYNA 5EE1A 3CB4A 5K8UA 3AF4A 4OQNA 5HR5A 2A7QA 1FNNA 2IC5A 3U7EB 4XTCS 2BBTA 2HYDA 3ADCA 1D2NA 4LX0A 4GI7A 1CR2A 1MABB 4L16A 3LBIA 1EK0A 4MGYR 4I1SA 4US2R 5KSOA 3BFVA 2EYQA 4LDJA 1KI3A 2WAXA 2Z43A 1IN8A 4L9SA 1CBUA 2FSHA 2GCOA 3BERA 4PPNA 3O8CA 2V3CC 1G6HA 2OILA 2ZRIA 5G53C 1NBMA 4FINA 3QKRA 4JT4A 5C4MA 4YXWD 1P73A 2JJ2A 2ZVQX 4HZUA 1OB5A 1GWNA 2X2FA 3NWJA 4CEJB 2X8AA 1Q0UA 1X1RA 4HAVA 3S1AA 1S96A 4ITRC 3PIRA 3AUXA 4OKSA 3WY9A 2OCAA 4HUQB 3ZVLA 5C2JB 1HY3A 3I32A 3AVTA 3ADBA 1I4DD 5FH9A 1XMVA 3U4QB 5E4FA 3GJ3A 5HE8A 2DYKA 4B2IA 4UJ5A 1S1MA 1FMJA 2FJUA 2FN4A 4LJ5A 2DWPA 4DSTA 2Q3HA 1FP7A 4IOKA 2KI5A 1Z0DA 4A82A 2FH5B 3HDTA 4RCZA 1MV5A 3A4LA 5AUPB 2DBYA 3LVQE 2ZUDA 3KJHA 2ZJYA 4EPTA 3W5IA 2LKDA 1AJEA 2AWOA 3U5ZB 4QHSA 1VG1A 4B3BA 2WKPA 2ZRLA 1GRNA 5BN5A 3WYFA 4DLXA 4EAQA 1W4BA 3REGA 3VNVA 4Z8YA 5KDOA 2QI9C 1QHHB 1HURA 3QG1A 4M9SA 5HZKA 3QI2A 4LBZA 1TQDA 1UBGA 1E79D 2NQ2C 2YWEA 3NXSA 2C8VA 3QJYA 3WRXC 2EQBA 4Q03A 1KI9A 3TRFA 3X1YA 3DOEA 2C9YA 4L5BA 3GEHA 2BEKA 4HB3A 2GETA 1S9DA 1NF3A 3UMFA 1CJUC 3KTAA 1OW3B 4NCIA 4BE7B 1YHNA 1W5SA 2HF8A 2PX0A 1P2UA 3V4RA 3KB1A 4HB0A 3K0AB 2IWHA 1U8AA 4WA7A 1X8LA 2J0VA 1RRGA 2R44A 1UBEA 1UKYA 1O3YA 3ZVRA 3AVOA 3EWSA 1FTSA 1DAHA 3F3YA 4NPHA 3LQQA 4B32A 4F93B 3M4YA 1X1SA 1JEDA 2HCBA 3SBEA 1UFQA 1ZMXA 1OKKA 4JKIA 2PJZA 3GD7A 1G9XA 4M9QA 3CNNA 3AF0A 4DUGA 2WSSD 1T5LA 1GZSA 4PAQA 3EWAA 3KZ1E 3ZQJA 5TB5A 3CX7A 3PUXA 4ABYA 5JSZB 2FSFA 1D2MA 2FFQA 2ZEJA 4JLKA 3RWOA 2WM9B 2ZS7A 3MG9A 1YVDA 2D74A 4NCJA 3ZIAA 5D3MA 3ZIAD 4AKHA 1KK1A 3KKQA 2Q9CA 2F3TA 5CM8B 5AK0A 4E22A 1EFHA 3RC8A 3DZ8A 1DBSA 5F9HA 1Y63A 3X1XA 2JLYA 1CRPA 4JLNA 2LCFA 1C4OA 4URZR 1GFIA 2OE2A 1N6KA 2ZRMA 4PO9A 4D25A 5B64A 2F3RA 1R5OA 3P32A 4DSUA 4TL6A 1M8PA 1MABA 2D06A 4JMPA 1WE2A 1XP8A 2VP9A 4A0HA 3AVYA 3QVVA 2G77B 1Q1BA 4TZ0A 3DO6A 4UNRA 2EWWA 1KI6A 4PSKA 5EUQB 2WOJA 1E9AA 3T1QA 3V4FA 1WDTA 3I4LA 2YWHA 1Z22A 2YWGA 4AY2A 2ZYTX 2G6BA 3C4JA 2XSZA 3Q3JB 4MYTA 1JI0A 1RKBA 1LFDB 5CLLA 1UBFA 5F2EA 1PJRA 1WA5A 4XWAA 1X8KA 3DZDA 1KO7A 2HJVA 1E1RD 2J7KA 2BV3A 2RMKA 4K8OA 1XPOA 3K9LA 3R9WA 2QENA 5DIFA 5HKKA 5LB2A 4M2LA 5C4GB 4KITB 2R2AA 3L43A 4BLOA 3NIBA 3U7GA 1GRRA 1GL7A 3I1FA 4Q19A 4DEYA 2WMNB 2PMKA 2GEUA 2NG1A 4BPBA 4W5JA 4CIDA 1YQTA 1N6RA 5JWOA 1Z29A 4A92A 1XJCA 2F7SA 3D7MA 3GEEA 5AJWA 3WMFA 3Q7PA 4XWOA 1G6OA 1KO5A 1N0WA 3LV8A 4IXMA 5JI2E 3LXXA 2QA5A 1KI2A 4M1KA 3KXLA 2VHCA 2WSMA 3AV0B 3E70C 4HAUA 4MQBA 5FL3A 1N3BA 4HEJA 4RCYA 3VMFA 2L0XA 3ADDA 4EPYA 2ZS8A 3X1DA 4G5GA 4RD1A 1FL9A 3AGQA 1BH2A 1ZAKA 2V4ZA 5KHOC 4X8LA 2CJWB 2E87A 3L0PA 1Z0FA 1UADA 1KNXA 3EXAA 3QKRB 2FNAA 2CEAA 4XWKA 1Z6AA 4PX9A 1SULA 4QJ5A 1DEKA 4CT5A 3BC1A 4Q18A 2DPXA 4TL7A 2GVZC 1JJ7A 4GP6A 4X8HA 1GM5A 1JB1A 2V54A 2CBZA 1OJLA 2J87A 2IEYA 4KJZA 4QKQA 4OHYA 2DWQA 5G3YA 5A4JA 4IDNA 3K09A 1S4QA 4OQXA 4Q7MB 3RSOA 1OXSC 4DBLC 2O52A 2QMUA 1WBBA 4PHTA 4KBFA 3OE7D 3Q9LA 3CRW1 4PC1A 4JLJA 4JVSB 5CB6A 1AA9A 3THWA 1E9DA 5J40A 3LX8A 2ZI4A 3OAAA 1OH5A 1IN7A 2GF9A 1M1YE 3PUWA 4DXAA 4C0QC 1QZXA 1E1QD 3FOZA 3I92A 2W00A 1WRBA 4KYIB 5DSZA 4N0EA 3EIHA 2REOA 4XD7D 3FWYA 3RC3A 4TMTA 4BLRA 1ZM2A 2QRNA 1U8YA 4KVAA 2H18A 4OI1A 2VP5A 5B58C 2HXSA 4IVQA 1T0HB 4EQ6A 4CEHA 3UWKA 1ZM7A 2PCLA 3K0FA 2ZS9A 4WXPA 5JHGB 1E2EA 3H84A 4B6FA 4FMDB 3ECCA 2F1HA 1DVRA 3WRYC 2HLDD 1AGRA 1HTWA 4AYTA 2CMKA 1A7JA 4A6PA 5LD2B 2MSDB 1TF5A 4C30A 1T3LA 3A1SA 2Z4SA 4TYPA 1JAIA 4B33A 1S1CA 2V6JA 4LHZA 3FGNA 2G9NA 5LDDC 2GJSA 2OT3B 3CLVA 3BH6A 1RRFA 1XX6A 1N25A 4DVGA 3KKNA 2FWRA 4MDEA 1EFRD 3K9HA 3RS3A 4B71A 2IS2A 1ZD1A 3BFKA 2CHGA 4KVGA 4D4LA 2CK3A 1N5LA 1W2HA 1ZUIA 2OM2A 4PTLA 3ZGXA 3U7HB 2W83A 1KKLA 4PFSA 1E9SA 721PA 5DH9A 3QE0A 2ZAMA 1ZM3A 5ANRB 4G1UC 4IRUB 1QHXA 3TKLA 3ASYA 4M1OA 3SNHA 4EQ6B 3FKSA 3ASZA 4LPSA 4JLOA 2ZRPA 4KV9A 4JT2A 3A58B 4C0KA 3I62A 2RH5A 1CLUA 5AJZA 3LH5A 4FN5A 1XWIA 1N6OA 4CRWB 5EE5B 2ZJ8A 1GNPA 1ZU5A 3DM5A 1DG1G 3B2EA 3BFXA 3C8UA 3T34A 3TW8B 5H8WA 2GDJA 2VSFA 3PUZA 4IHQA 2XXAB 1MKYA 1OLOA 5FPTA 3RS0A 2QTHA 4TT3A 1NMZA 2YV5A 3B85A 3K0EA 3TJZA 3N2EA 4LHWA 1K8RA 2J3EA 3U61B 3QF7A 4TYQA 2A5DA 1IONA 4POAA 3QUSA 2P65A 5JRZA 2YOGA 4GZLA 4M1TA 1RZ3A 2C98A 4ZPXA 2WSSA 1X86B 4MITA 4DUGD 2NO7A 1IN5A 2ATXA 1KKMA 1Z47A 3IQXA 4LJAA 3CWZA 4KLNA 4EJSC 3QPWA 3CNOA 4FMCB 2P2LA 3CF2A 4LWZA 1FW6A 2W2TA 4ACAA 3MMPA 1U0LA 3BJIC 3EA0A 1SVKA 3ETLA 1KMHA 2ZE8A 5H1YA 1II9A 1XB2A 3TUZC 2ZXUA 2RAPA 4WZBE 4EPXA 1UBCA 4BLQA 3EG5A 1XPRA 2O8EB 5DNYB 1VYUA 4C2UA 1KHTA 1OIWA 5L8VA 3KQUA 2ZRFA 3FMPB 2B92A 1E79A 4YMTA 4CEIB 2OXCA 4AK9A 3WNCA 6Q21A 1DS6A 4EKDA 2MMGA 2V1UA 2ERXA 2BHRA 3RSLA 4A8JB 1F3OA 1TL7C 2GTPA 4ZI2A 1NBMD 1W0KD 5DHFA 2R9VA 1QHGA 3GMTA 4MYCA 1Z6GA 3PENA 1I2DA 3W8RA 4Y0VA 4IEIA 1JALA 2XITA 4TTQA 4BFYA 4Z8XA 2UZ3A 4MRPA 2AXNA 1M7BA 5DI3A 4EPRA 2OAP1 3KUDA 4OK6A 3A6PC 1P9RA 2FFAA 1VG8A 1GL9B 3ZVNA 2J41A 4Q1EA 2QPTA 3QENA 5BN3A 2GHIA 1OPXA 3LD9A 2ZRAA 2QN6A 4YDHB 3WXMA 3SI7A 3FPAA 3U7FB 4G5SA 3ZS9A 2ZI7A 4QHTA 2W6JA 4RZUA 4RFVA 2G0TA 4II7A 4KAXA 2B21A 2XTZA 4F38A 1XTIA 4Q4JB 3PEUA 4B35A 4D81A 2AKAB 2JASA 3Q7QA 5B57C 1KY2A 1C1YA 1U0HC 4Q47A 1TEXA 3NC1C 4IOMA 1UEJA 2V6IA 2BIFA 2IYSA 1T3SA 2F6RA 3C5HA 1PLKA 2VLIA 2PBRA 1LW7A 1FUUA 2VIIA 5C1BA 2HXYA 2OCBA 4PAMA 1Z63A 1CJVC 2XX3A 4IDOA 4NCNA 4BASA 5M04A 3VR3A 1COWD 1RJ9B 4Q01A 4RFSA 5HKKD 3KQLA 1W5TA 1H8EA 4UXJA 3PR1A 4TLDA 5CK4A 1AKYA 3KJIA 4QM7A 4QBIA 2ZJBA 2FPLA 2GK7A 2ZPTX 1XD8A 3BWDD 3ZQ6A 5FOUA 2GXQA 1K5GA 2WBLC 3BH0A 3BD9A 3IBGA 3LBNA 2ZE6A 1E2KA 3BXZA 3IEVA 2AK2A 1LF5A 2ECKA 2PMDA 1XTRA 1JEEA 4EFLA 4MRNA 3IDQA 3SR0A 4GSYA 5FTKA 1CIPA 4NP6A 1U8ZA 2VF8A 1VMAA 4LBYA 2ZAOA 3ZJYA 1TQ6A 2P5TB 4CEHB 1GL6A 4Q1AA 1G20E 3NEYA 3PJRA 1I2MA 2P67A 4C0LA 2C9CA 3TR5A 4HLQB 2AR7A 1EFUA 2CHQA 3IILA 5KNDA 1RYFA 3MWYW 3GLHB 4PZZA 1YZLA 2ATVA 5HPYB 1P2TA 2CHVA 3GLFA 4PQYA 3EAQA 4EIWA 2JLXA 1NBME 3GJXC 2PH1A 3U3OA 4EJSB 4Q66C 2JEOA 4P4UA 4DLSA 5K8LA 2OV2A 1KO4A 1XBTA 3GJ6A 4A0RA 3AKEA 3ZLJA 4JJKA 4URVR 4C7OA 2GJ9A 1UM8A 4RZ3A 3RRMA 3V00A 1AKEA 4N0DA 1DPFA 4D0LB 4FCVA 1SHZA 4GFDA 1Z0KA 4OQFA 1SVIA 3AUYA 5EXPA 2CXXA 3RRYA 2VF7A 3MLEA 1ZC3A 3X1ZA 3HJNA 3O47A 1YR9A 1CEEA 2QT1A 3A1UA 5HE9A 1EFTA 2WV9A 4MGKR 1W44A 1Z28A 4Y0AA 4JIMA 1AGPA 4ZI3A 1Z2CA 2R6FA 3TE6A 3VX3A 1VHLA 1XTSA 4DB2A 1EWRA 1E2QA 3D6TB 1D9XA 4AIIA 2QAGB 3ZVMA 1JNYA 4Q7KA 3EZ7A 2PZEA 2V8OA 3N2IA 5EP4A 1UPTA 4AURA 3K70D 5J47A 3IHLA 4JBWA 1AS2A 4M9ZA
chains in the Genus database with same CATH superfamily
4MV5A 3G2JA 2G4LA 3OQVA 4ALMA 2H54A 3AG6A 3KQVA 1P2SA 2Z08A 3M6IA 1PV1A 2WF6A 4BX3A 4GI1A 2D2IA 5THXA 4I3GA 3I58A 3UANA 2Q4EA 3UMVA 3ZLBA 3SS9X 1YB6A 3H2ZA 4GOJA 2YFHA 3DEFA 1G9TA 2G8LA 5ETJA 1RWQA 3T7IA 4CUKA 1IPFA 4L07A 3GGOA 3BXEA 3OZEA 4H16A 5GONF 4UNIA 1VG0B 4GZMA 5DP1A 1ZN2A 2Z56A 3QMVA 4FFLA 2JLUA 2R84A 4WH0A 4DG9A 4W1RA 2WE8A 3E15A 1K7EB 4QUBA 3W90A 4LFBB 3MGAA 1OFUX 4L4XA 4Y67A 4HJXA 2A1UA 1M6WA 3HWSA 4ZC8A 3WZLA 2O8EA 4RTPA 2QPLA 1IM2A 1LQUA 1NVVQ 1JILA 3FDFA 2YH2A 3AI2A 4RDIA 1L5KA 2Z2YA 3BPSA 1MTOA 2Z8ZA 2P30A 5JSZA 3P8ZA 4B48A 4QEZA 4X66B 1DBIA 2EU8A 4DL9A 3A2MA 4RIGA 4E33A 1N4AA 3NG1A 4INJA 1XEXB 2HX1A 1CUXA 2EDAA 4Z9XA 1QLWA 1BGWA 2IQIA 4MJLA 4PLHA 1NY5A 3ITNA 3TTTA 4ER7A 4YUAA 5KOJA 4IHJA 1NVBA 3N2GA 2QDKA 1PW7A 2XIJA 3DQZA 5BOSA 2YRFA 2I6GA 5DP2A 4RFSB 3N8GA 3QNWA 4BXOB 1DWOA 1ZIYA 2XDWA 2A8YA 2ZBQA 3DE1X 4MVJD 2B6HA 3MTDA 1NXVA 1QXSA 3NIGB 2GVDC 3R0VA 1TA0A 4RGBA 3IT0A 1OZFA 4LSZA 4OM7A 2ON6A 5A4MS 2HW8A 3OT1B 4NRDA 4EO4A 5CPBA 3ZD8A 2FN7A 3WLLA 1YKGA 3OQIB 3R5HA 4EUKA 1EU1A 5F21A 2Q7DA 2E5FA 1S3FA 3F1KA 5JPDA 4LOAA 2JAWA 4K87A 1ZOIA 1IN4A 1QJCA 4UEOA 3MJHA 5E1MA 4QQNA 1RZRA 2AQKA 1I1QB 1F7VA 3BAFA 2DQ4A 3FF4A 4Q4AA 4CBVA 5T67A 3TAHA 2BGNA 4UTNA 3M2PA 1JVNA 3M6AA 4JVMA 4Z9YA 3LDUA 5ED0A 3G8CA 2WTMA 4REOA 3PXGA 3R7AA 4E5VA 1TDJA 2J5XA 4XVHA 5ICGA 1I7DA 2RC5A 4U2KA 1LTQA 3WMGA 1EUDB 4B3TB 2A58A 3T3IA 4B3MB 4JQZA 1OT3A 5F7XA 4JYBA 4WKOA 1USIA 3NEPX 4IF6A 4TM7A 2YN0A 2YIVX 3VZSA 4S04A 3ORRA 3CPHA 3A05A 5HIJA 2RD2A 5FAXA 1AU9A 2WJGA 3T41A 3JD3A 2D8MA 2NSLA 4KEAA 3HO6A 4RKEA 1U28C 3INGA 1RTKA 3PHCA 3PU6A 4MKFA 3ZDQA 4OQ4A 4HTFA 5D00A 4BFVA 5BORA 1RJ9A 4PG6A 5KNBH 1JXMA 2RHHA 2O48X 5LMZA 2BVNA 1G7SA 3VC3A 1XVAA 3CLSC 3Q8XB 4KPEC 1CY6A 1IBRA 2AIRA 4NDZA 1EGVB 3L49A 4RQAA 3UKJA 5JT1A 3DPUA 3AHHA 3C7CB 1KDZA 2J0QA 3BA1A 4L0QA 1BROA 1E60A 2B4RO 3B36A 1AKTA 4R2WA 1NVWQ 2I87A 5MF6A 3AVUA 1E63A 1W0JD 3IPYA 3PHBE 1UKAA 1PBTA 3CLUD 3IQHX 4BFZA 1VZ2A 1THGA 4OY3A 5CT8A 2GEBA 2ZSBA 4I4NA 2KS6A 1CETA 4AJOA 3DWFA 4EHNA 1YDEA 4BZPA 3DQQA 3O9ZA 2GEFA 4C05A 1M5UA 1B93A 4QECA 1U7ZA 4FGKA 5J2UF 3V4SA 3E9EA 1K75A 2R6R1 2ZJ6A 1QYVA 2J3DA 3P9ZA 2Q07A 5F98A 1JXOA 1XF9A 1ZA2A 2AI2A 1PL8A 4ZOEA 1E4EB 1NXTA 5JAIA 3F46A 3OZDA 2WAAA 1ZRHA 5U4QA 3SEZA 3QITA 4TQUS 3VFDA 1QONA 1T4MA 2VNHA 1CVRA 2PLRA 4P1ZA 4NOKA 2YFKA 2P7HA 3QTLA 3A4VA 5LNK6 2JRCA 3VR1A 2JGNA 2CE7A 1U65A 3EASA 1KERA 3OIUA 1PP4A 3OX2A 4NJMA 2JHGA 2BM1A 2WIBA 2P1DA 4HD8A 4HTFB 2BP7A 3SS7X 1A9RA 1T25A 2NO6A 5DLPA 2PD6A 3UEOA 3OU7A 1PTJA 3P5SA 1ADCA 3IT3A 4NI5A 1U2EA 1X7GA 4N3AA 3AIOA 1QK3A 3B78A 4Q82A 4MI6A 3IESA 1M1NA 2Q3EA 1BEEA 3WGKA 2D5CA 2AFHE 2HMYB 4YV1A 1Z2OX 4TZKA 3ETEA 2B99A 1W9MA 4DR1B 2ZSDA 4JLBA 4X6XA 5DNVA 4PYLA 1JQKA 5DSTA 5AM4A 2Z4RA 4QU5A 4E31A 3JWHA 3A7EA 3TMYA 1LPBB 3AL0C 3QVJA 4IIGA 2B83A 3KAPA 5K05A 3BMQB 4W5RA 1B0PA 1C1DB 3HKCB 2I62A 4R1UA 3ZWPA 1A1VA 3L7JA 3LPMA 4FE3A 1Z13A 1Q22A 2KX7A 1AHNA 2PYDA 4D45A 2HPHA 4R9UC 3PA6A 4BO5A 4K1XA 3Q2KA 5DYGA 1IXZA 2C2XA 3SSMA 5LP6B 2JJYA 4MKHA 4I3HA 3KQYA 3E9YA 3EW7A 4UMVA 4B6EA 3GLQA 1ZKDA 1ZJZA 5HF5A 4LZZA 1WABA 3JPWA 4WVFA 1X15A 4KLZA 5EHNA 4BNUA 1PFUA 2HEGA 4QJ3A 3PG5A 2RG1A 2W2OA 3TQHA 1Q3HA 3PVCA 4Z7OB 2H2HA 4QXMA 3R7BA 4AY4A 4D4MA 4Q39A 4M86A 2FWBA 3THXA 3THRA 1SJ9A 5K09A 1GGVA 5DCLA 2WD8A 3C3CA 3ESYA 3IP8A 3FBGA 3SK0A 1CS0A 1OLUA 4NBWA 4YUVA 3TBFA 5I7UA 1QLHA 1EYZA 1CQJB 1Z0IA 4POOA 3TRDA 3KLOA 1T2UA 2ZOSA 4KPYA 2BM0A 2FZLA 2XQVA 3ER6A 1GZ6A 2F4VB 4NPAA 2EG9A 4TVOA 4UUAA 2FETA 3FA2A 3SCZA 3A4MA 3KZMA 4LQDA 5LWQA 3AUKA 3FSGD 4UM8B 3L2OB 2O20A 3WP1B 2C78A 2A1TS 2VYFA 3ZD6A 3UW3A 3UJDA 5AXAA 3Q6NA 2QVYX 3UK7A 2GAOA 3A6DA 3FHTA 1KJWA 4E5DA 1MRNA 1NW4A 8LDHA 3HCWA 2GKSA 521PA 4URXR 2I54A 4Q15A 4BO4A 4XE5A 4K6OA 3B5JA 5AXDA 1JTFA 3TXXA 2Q1TA 4ITVA 1PT5A 1S7GA 1D5WA 3PEVA 1NKSA 4LBVA 4W5WA 3DTYA 4M8IA 4XI9A 5SYMA 5JTUA 3UY4A 4JJ8A 3C14C 1YK1A 3KQNA 2WQ6A 2CCGA 1PLLA 2GARA 4O5AA 4LQLA 5JOQA 1TAQA 3R5KA 4GKAA 4HSEA 1G19A 4AX8A 3E2PA 5JDCA 4YPVA 5BXYA 3LF1A 1HV8A 2I2DA 1VP9A 5I9LA 2OAGA 5HBGA 3K1TA 1MO2A 3QMWA 4MR9B 2Z2IA 4H7JA 4BJ3A 2CXQA 5JMTA 3CZ5A 1IFXA 3NJ8A 1G3QA 1CZOA 1NWCA 4OQYA 5YASA 2HHLA 2VT6A 4FTWA 5HILA 4DR3B 2V65A 4BNZA 3LDGA 5MHTA 4LYGA 3DCYA 3Q5EA 4FDTA 4Y2XA 3VYUB 2PR2A 3UFBA 1XOIA 2JC3A 4UHBA 2N9UA 2HH9A 3BQ9A 1HZJA 3F49S 3KJXA 1LF0A 3NOQA 4WOKA 3V7NA 1EAMA 3E3OA 3VC7A 1CQWA 5JJ5A 3CO5A 3T4XA 3Q88A 1DCMA 4BLSA 1ECGA 3HWWA 4LKRA 4NEHB 3R5SA 1U2TA 3JAWA 2BHTA 4NZNA 2CJYA 4ABTA 3OT5A 2Z1NA 4EPVA 2WHPA 3QW2A 4IQ8A 2BFBA 3VU3A 4IW3B 4ZANA 4HWPA 2WIGA 4KO8A 4WA8A 5THQA 3S28A 4EJFA 2RHDA 3KKEA 3U09A 1EVZA 4MXDA 3PNQA 1VLLA 2JFOA 4V39A 3UXEA 4KMRA 1G6Q1 1CP3A 1KO8A 2IDZA 3HGTA 3I42A 4OK5A 2CNKA 2FUG1 2DWOA 2ZZKA 3HN2A 1WXHA 1ZL0A 4IJKA 4ODIA 4BP9A 1IBLB 1CIVA 2FFRA 5EMMA 3HUDA 1PHPA 2BCJQ 3DL4A 4DEVA 5LA6A 2Y6VA 1QQTA 2YJZA 4LRYA 3BGWA 1A0OA 2XWJI 3KLMX 2DY0A 1PWYE 2A1UB 4Q1FA 2XNDA 1VIDA 2VWQA 2Z1MA 5IYZF 1NLFA 3WYNA 1EEHA 4UZEA 4XARA 3NHBA 4E3WA 1E6LA 4P4SA 3HRKA 5FULA 3NVMB 5IJXA 3FVWA 1TM2A 1FRZA 1Y1LA 3G5LA 3ZE1B 4BCBA 4W9MC 1ZH8A 4K9PA 1IXRC 3KTAB 5TARA 2R47A 2XGMA 1H2HA 4YPFA 4F92B 5JLJA 2G36A 1JQBA 3LY8A 3R24A 4XUDA 1IK4A 3TZEA 4CNBA 2VHVA 2H65A 3DLCA 5ERGB 3HNPA 3KWLA 2XQGA 4G0YA 3COPA 4IEEA 4QLBA 1SVLA 3TVTA 5KTTA 2CE2X 1OYWA 3CGWA 3KT0A 1KNQA 4YVFA 1ND5A 4UCXA 1UC9A 3QVOA 3OUTA 2Z4TA 4BGDA 1L4BA 1VE9A 1C81A 3GJ7A 5A2QA 2ID8A 1OHHD 2V7TA 4YLGA 2G0NA 2PCJA 3AUTA 4PLCA 2TSYB 2Q8PA 3G7UA 2HA5A 1SPXA 2EJVA 4OJNA 4GGOA 2VSQA 4RS4A 5GGXA 1W46A 3IUEA 1LI4A 2QHXA 1B1CA 3NHZA 4X91A 3RKRA 3VNBA 3TOZA 4ENUA 5BUSA 3FWKA 1E1LA 1A2KC 4GPAA 2AMJA 1Z16A 1U7UA 3D4IA 5L4SA 2ZKLA 3HQ4O 4AJJA 2MDTA 1O87A 2R62A 2VPPA 2OHVA 3TUIC 2L42A 3QIVA 1I3MA 4U5QA 3EHDA 3MOSA 1D6NA 1TB4A 1IWOA 2QAIA 3GZNA 4DLLA 2HN9A 3ER9A 4M1QA 1P9LA 1N0IA 2QU8A 4LVOA 1I32A 5BSTA 2DF8A 5TPWA 4GZ3A 5G1PA 4D8TA 2WWXA 1RM0A 3I8XA 4A0FA 5LDGA 1PX0A 1P0QA 2J3IA 1ECJA 2O3JA 5F1OA 1EFCA 1IDN1 1YNSA 4HNRA 4Y2HA 1A8IA 1F7UA 2XVAA 2RGRA 2WDPA 3S7TA 3DZJA 3KYDB 1VCMA 1P6XA 5FYDA 4YRFA 4E70A 1AUQA 4RESA 3HYSA 1OFGA 1RYBA 2XGSA 4ESVA 1I36A 4QTZA 3O3MB 1UPAA 2R8RA 1GDHA 3FCXA 5KYXB 3HBLA 4TXNA 2OG1A 1OB5A 1LTKA 3F2VA 4HY3A 1QPBA 2R8OA 5KB3A 1M0EA 2GCPA 3CVWA 2WHYA 5K2OA 3ONEA 3EVBA 4BWFB 1TZMA 1XNJA 3ONDA 4FFDA 3HADA 3ZN2A 4W6QA 3QVXA 4AB1A 2EFCB 1CEQA 3G9TA 5AYVA 3CCCA 4HRXA 2WE7A 2W6NA 3NM4A 4GUAA 3ZCXA 2PANA 4PSCA 1QHIA 4PPQA 4U7TB 1LA2A 2RC6A 2W2PA 5JY6A 1KH1A 4F6RA 1K6EA 2HQSA 1M2OA 4QTUB 1BIFA 1VMEA 2CNBA 4PYRA 3KJEA 5ICEA 1D3AA 1E9VA 1E61A 2A5LA 1KMIY 1XYVA 4HATA 4N1AA 4MSUA 2Z58A 3AU9A 4DCNA 1KIMA 4GBED 4MUHA 4FDVA 3PE3A 5JBQA 1DKRA 3JQQA 4M9UA 3U3MA 2D7CA 1NRJB 1SUFA 4FXOA 4PX2A 4AZ0B 4ZCTA 4ZDJA 1H8ED 5JJKA 1I5OA 3O7MA 4R3UC 1BFUA 3ENZA 3O82A 4ZU3A 2PUCA 5F1YA 4YWJA 1GQYA 3ISVA 5I7HA 1L7BA 2V6BA 2IBMA 4PG4A 2FN9A 2IXBA 3N0WA 2OGTA 1ZL2A 3CKLA 3QXJA 2G80A 2F43A 4ND5A 4UCQA 2CLIB 4FEEA 3T12A 4DUYB 5TJ9A 3H2SA 1R7RA 5I4CA 3V8EA 4MUGA 2DFTA 4FKZA 4KQKA 2D2EA 4BAGA 4YQEA 3NBYC 2CXPA 1U94A 2FXVA 3LDAA 4C4AA 2GZ2A 5HGJA 1AVTA 2QG6A 1P1BA 4DJFC 4HZIA 3D81A 1SXHA 2E4UA 4M89A 3WLJA 1R0CA 3OF5A 1E3IA 3EISA 5JFGA 2WWFA 4J75A 3VUEA 4P5EA 1XCBA 1KFBB 2ORVA 2QT9A 3GDOA 4GPTA 1U8UA 2IHKA 5G4KA 1RM5A 3NBUA 3OU6A 1UDXA 1MF7A 1W2GA 2ZYRA 3DMDA 4ND2A 2RBKA 1RLUA 4F1JA 3LHKA 1QIFA 3Q1LA 2XF2A 2G70A 4GO1A 1D0SA 1XTVA 4DRXA 3FLBA 3WO1A 4YJ2B 2CSXA 1WCWA 2FFBA 3TRJA 1MX5A 4AMUA 4C4SA 1DKUA 3FCAA 3H42B 4PGMA 2F8SA 2BJVA 2WJZB 3OX3A 1RKQA 3FYHA 1K5HA 3E9MA 3M1LA 2LP4Y 4N47A 3WNZA 3M89A 1NJGA 3L40A 4L4ZA 1Q84A 4X6UA 5C3UA 3SBOA 2YXDA 4C21A 4D74A 4LF9B 2GXUA 5JQGB 1N77A 5I8WA 4F5ZA 3W5CA 1GAWA 3IBYA 1TADA 2D59A 4OHVA 4YJFB 3I04M 4PAOA 3WZMA 2HSJA 3R6DA 4RPGA 1Y1QA 4FDAA 3QE4A 1E3WA 1F1BA 2Z57A 1UC5B 3ND5A 5BMOA 4U5XA 2F3SA 4WOBA 3L0ZA 1NMEA 4KV7A 4Z3DA 4MRMB 2AUTA 1NFQA 5JROA 2IHVA 4JXKA 2QRZA 3UAYA 3KVNA 2BBWA 4Q1DA 1NM5A 1Y5MA 3F5DA 4LMPA 1NBWB 2H1RA 2VJMA 3N5KA 2QN1A 5B7QA 3B6IA 4J7UA 2D0DA 1UM9B 2CVFA 1FUYB 2OCDA 3ZLTA 3RTDA 3SHOA 4WZAE 3V4VB 1UKZA 4Q3CA 2H31A 1R8JA 4XFDA 3G0HA 3GCXA 3ZKAA 5BW4A 1NUAA 1D8TA 1STOA 3DW1X 1BEUB 1YU6A 1SBIA 1G8GA 1IH8A 1TJNA 1QH8B 4HQRA 5EXTA 1D4AA 1SA0A 3PVZA 2FMHA 1U98A 5CVUA 1VCHA 1P2GA 4G5QA 4NJEB 4RE6A 1B8UA 2H17A 4BMZA 1KYTA 4BLWA 1NUTA 1QTIA 4IOLA 3U4QA 2WVAA 2D1FA 3UO8B 3AJ8A 3HTXA 1MVOA 1PK7A 1Z3IX 3GNSA 3P4XA 3FUVA 2EFGA 3KLPX 1EX9A 1L4LA 2RHMA 3DXZA 1MFZA 2C8KA 2IYAA 2BP7B 2PD3A 3NTLA 1G5TA 5ABPA 3G1TA 5KTOA 4E5MA 3KPWA 5D6NA 2DUUA 3V2HA 1WZIA 1VYVA 3CF6R 1WVIA 3D7RA 2CGEA 3S5JA 4PTZA 4XFKA 3OWHA 4P8RA 2ZRGA 3X3HA 3AI7A 4LGVA 1TMKA 2Z8YA 3EUFA 3U16A 4BWYA 3GLGA 5ALJA 2DSNA 2G40A 3JYPA 3T3HA 4DLPA 3BWCA 1RJWA 3OLWA 4FCCA 3DDNA 1QORA 1VPLA 1GYRA 3A1FA 3MSCA 4JUCA 4LNUB 4DDVA 1SH7A 4EITA 1RAAA 4DV6B 4LDRA 1ICEA 3UT5A 1FS5A 1MVLA 2FX3A 2KPOA 4RANA 1JA1A 2HEIA 2YXNA 1QE0A 4F3NA 1N2XA 2XJ9A 4O4IA 3C41J 1MAAA 2CFCA 2QYOA 1W8IA 2BMDA 3R7WB 2A92A 5BRAA 5CDHA 3F73A 2J6IA 1MAVA 2Z3WA 3P9CA 3OA2A 1GTVA 5LP6A 4PWZA 5LYYA 5AJVB 3QKUA 4DCVA 1MD9A 2H5EA 2GN6A 2WG0A 1MA3A 2Y1DA 3C74A 3QBDA 4I4TF 5GADl 1NE2A 4IS3A 4RMHA 3CLTC 2CL7X 4D99A 1L7DA 1AE1A 1EUYA 1SB9A 1QTQA 5KC8A 4BFXA 4W8GA 4BTVA 4LAFA 2EZ8A 2YJTD 4TSKA 4TYMA 5IT5A 4RL4A 3UHOA 1BGXT 1TVKA 3BN3A 5BUCA 3AM1A 4HX9A 1FYXA 3QZUA 3UFXB 1Z6XA 3WIEA 2GS9A 4RD0A 2VF5X 1OX5A 2HRRA 3PQFA 4RIFA 5E3IA 1U1EA 3OPVA 3IIJA 4QICA 1VQ1A 3W8DA 5TIIA 3SU8A 1Y6FA 2YHIA 3G89A 2LKCA 3DKVA 3IMGA 5FTLA 3S2IA 1SXJC 2QUAA 2AX4A 2RARA 3JYLA 3P19A 3DQPA 1DEXA 2PZGA 3I37X 2YQ5A 5AR1A 4DJJA 2Q0SA 1I7PA 5C81A 2X13A 4FYKA 4PY2A 4AJEA 5FHRA 1TYAE 2IY7A 2NSDA 5K8TA 5KU1A 3MCTA 1ARZA 3R41A 2HRZA 5BYKA 2OAQ1 3ELDA 4B4VA 2AC2A 4TLAA 1RVDA 4HDRB 4LHVA 1U8TA 2XMZA 5D86A 1ZISA 1OH8A 2BBOA 4CW7A 1O4VA 1WUYA 3E7DA 3VA7A 3HCDA 3RK4A 2PLNA 2ZDQA 1KOJA 5AHKA 4OB6A 3PTAA 1R8SA 1FZQA 2C92A 1JQJC 5CA0A 2OLJA 1LXCA 3WMEA 3D1LA 5DNCA 5TT1A 4CKXA 4RZSA 3CF0A 1J1IA 1YZTA 2OK8A 1VLHA 2FDRA 3FROA 4JLUA 4MKZA 1Y9AA 3CN9A 1C3EA 1OAKA 1G17A 1YZFA 4L85A 5FJIA 1MB2A 4B81A 3TSAA 1SBTA 1BW9A 1TKCA 1DIRA 2IXFA 1VL5A 3Q98A 3QQ5A 1QDLB 1YAJA 3RC7A 4CWAA 5FPKA 4PO1A 1L7OA 2TMKA 2Q6IA 3RBVA 4KZKA 3OEYA 3SYKA 1ZRMA 4QJBA 4RK0A 3KSAC 1LJLA 1DHTA 2I7TA 2QDXA 3I83A 4H1HA 3ZTYA 2W9XA 1IQRA 4DADA 5IVPA 1ILEA 3BE4A 3MRTA 3GN2A 4UNSA 1YWGO 1WHTA 2JGEA 5HP4A 3BVPA 2X58A 3CRRA 3PNVA 3VR6A 2ZJ3A 1F5NA 5CITA 2ZB4A 4ZEMA 4MS1A 4HDSA 3VTZA 1FYVA 3N2GB 4NH0A 1XT6A 1M34E 4D97A 1SO8A 2W98A 2PXHA 2R79A 2ZTUA 4MWSA 1EWVA 3VSAA 3FTCA 5CA1A 1R15A 4HGZA 5E38A 4UVIA 4NIMA 4ZVVA 1LV7A 1KU6A 5J59A 1V3VA 3B60A 1RYYA 4ND1A 2MSKA 4RULA 2AFIB 5FPQA 4U0JA 5L3QA 1SXJD 3VKGA 2GT1A 2XCUA 3H5LA 1FS4A 2EGGA 1QAMA 1PUXA 2YJGA 1A76A 3C85A 1QPZA 2WT4A 4MK4A 2QZ4A 3RAPR 4ZO9A 4KLCA 2XLCA 4KIGA 5IJ9B 1F2VA 1QR2A 2XVXA 1NVKA 4YJKA 2GM3A 3LYAA 5ECGC 2MJLA 1C8LA 3N2KB 1GAQA 3SXJA 1M10A 1Y5LA 1SBHA 1F0YA 1SWWA 4RSGA 1EWQA 5E6UB 1XQXA 2GYWA 4CQMB 5TQJA 4C1NA 3S68A 1J8YF 4ZCSA 1HYEA 2FPPB 1ETUA 1KDPA 4ZA2A 2W6IA 4C6HA 4GOXA 4D0RA 1EM8A 4D46A 2BFCA 3FCYA 1PVDA 3AFOA 3M7IA 3O9VA 3LCUA 4JL5A 2VHYA 3RBZA 1O94D 3C3AA 3RIYA 5DLYA 4A9AA 4ATNA 5B6JA 3OO0A 1W85A 4CETA 3FPSA 5DGCA 2VXCA 4FVTA 4DWVA 3NVAA 1T4CA 2TS1A 4DBVO 1R4MB 1YZYA 3LXUX 1XQ9A 2CJFA 2E85A 4YP1A 2XUJA 3QVSA 2FQ1A 1Y7LA 3LTEA 3U9TA 1CZLA 1G2QA 3WSTA 2DZDA 1J0DA 3JALA 1Z0UA 1G8PA 2IZ6A 2GJAA 3IAHA 1W4CA 3ZPXA 1IHXA 5IAKA 1SUBA 2FZWA 3HFRA 5LQKA 1Q19A 1ULBA 3OE4A 1IK6A 3BBPA 4C0JA 2AJBA 3EMKA 5FORA 4BBPA 1KAMA 4Q7LA 3BWBA 8ATCA 1Q7GA 1GT6A 4V02A 1YACA 2WWIA 1J2EA 4Q1CA 2IH2A 5B1YA 3AZOA 4I9NA 1WUJS 4DDWA 1Z17A 2AJDA 3UJ3X 3S40A 3G13A 5EJFA 1T8UA 4I50F 1E2PA 2IHJA 3HRIA 1OD6A 3VNAA 2AK3A 3OCXA 1DMRA 2AH5A 4GWGA 4U2GA 3MAAC 2I8CA 1KGDA 1YBMA 2BFOA 1VGRA 4MWCA 2QMOA 4GQAA 3EX7C 4NBLA 5LQDA 3WBFA 1FNSA 1ZIPA 3BZBA 4TV9B 2QE7D 3IUNA 4R71A 4PQFA 2AOXA 3TW0A 1KEKA 4ND3A 2E1RA 3ZHXA 4JLVA 1A4XA 1SN7A 3OH8A 1TCVA 1ZNZA 3GRKA 3BL5A 3A37A 3NUZA 4LHSA 5LLSA 1S0UA 3N07A 2ZR7A 2DBRA 1BKDR 4JQSA 4UEJA 2Q28A 5HFJA 2FZKA 4UNNA 5F4BA 3TGPA 1BJRE 1GU0A 3GGCA 4M1MA 3L7KA 4JASB 4GYJA 3QV1A 2DPHA 3ELBA 3S27A 3K0KA 3T5GA 3H13A 1E66A 5KJEA 1KTIA 4E5UA 1WPXA 4GMKA 3H9UA 3C8DA 4ZGWA 1IZ9A 2QBYB 5JTTA 1E3EA 2ZTLA 4C9BA 2HT1A 1H85A 3RIXA 2SHKA 2P0EA 3BHJA 1W5EA 4DWJA 2Q5CA 4M9CA 3F90A 2NACA 1HDYA 1R00A 3LLMA 3EXHA 2EW8A 3EVZA 3LS2A 4I1VA 3HG7A 4QBGB 4YCAA 1N36B 3A1WA 2YY5A 1M74A 3GEGA 2LPMA 2G06A 4CIVA 3LZCA 3GNLA 1KEUA 4QLAA 4TSFD 5SY9A 4D5GA 4EPWA 3NBKA 3OE1A 4XVUA 1VKJA 3M6LA 3NAZA 5LMNB 2CZGA 4N9WA 5FWXA 4WBNB 2IF0A 5JRJA 4DIDA 1SEVA 1LK5A 2CXTA 3HZOA 3I3OA 3LG2A 3LCCA 1C9KA 1POWA 2O8CB 1TU3A 3DR5A 1PFYA 3NC0C 3C39A 1MHPA 1L4EA 3WYGA 2R4UA 3Q0IA 4RVOA 5DK4A 1DKLA 1WDLA 4CR8A 5IBPA 1GPYA 1L1FA 1SPBS 1FFWA 3OFND 1KJZA 3VJRA 1QMGA 1SVSA 2V3VA 3IUYA 4O2BB 5DLQC 1PGQA 3E27A 1NVUQ 2DJIA 3I8SA 3GEPA 4JVLA 4TMKA 4EG8A 4ZI7A 2OK7A 4OFWA 2ZITA 2QTVB 4CLHA 2NXJA 3K20A 4YECA 1U99A 2GEKA 5EIBD 2ADFA 3B53X 3NOOA 3MT9A 2GJKA 5EE0A 2VDNB 3RTEA 3ONFA 1PR1A 1ONOA 4QVGA 1DBPA 4DCTA 2JLQA 3T9DA 2J46A 3CLTD 3ABIA 2JGFA 2ZYIA 1A9QA 4GL4A 1GGFA 2JBAA 1S01A 1MO6A 1K6XA 3E9CA 4HVTA 1RLIA 5H3CA 3U3JA 3LBFA 4QO8A 4P7JA 4X93A 2GPNA 3GI1A 3LUBA 5DBFA 4C3ZA 1L5WA 2WJWA 2ZSFA 3RU2A 1MMFB 3DO8A 4ZGBA 1B8VA 3F4BA 3IP3A 3LVRE 2PHZA 3CF4G 4JOSA 3WYAA 1T2EA 1E6UA 3EUEA 1U2QA 4ARVA 2HIGA 1NBHA 1F6BA 2JLAA 3PNPA 4QUJA 3RRJA 3AZQA 1IM8A 4NBUA 3ZQKA 1SHLA 3D3WB 3RDPA 1X7WB 3BZWA 3KZOA 3FUWA 3CEJA 1Q57A 1HFWA 1S89A 2CXHA 5ITZA 4N54A 5LPNA 3O8OB 1E3MA 2RB5A 1C3OB 5DGIA 3EGDA 1XZAA 4JZYA 4GRIA 1CP2A 4NCHA 5JSKA 4A1OA 2HHJA 3ICCA 4H7EA 1KZ4A 3JAKB 3FMGA 4YXWA 1FFSA 2I2AA 2H48A 4KR6A 1XC7A 2ZJOA 3KSRA 3RVSA 2B4QA 1DBRA 4QUKA 3D5EA 4G09A 4Y2VA 421PA 1CZKA 2PZFA 5EG5A 4JLMA 1CY0A 4LPKA 4UREA 1L6IA 4DHEA 3FCUB 4U4AA 3B6KA 1WPRA 1BXGB 3T54A 5I7WA 3TNDA 2DHQA 2H00A 1U3DA 3O8QA 2WA1A 1BJKA 1WG8A 2IEZA 4WJKB 5E2IA 1FJHA 1WNFA 2CLDX 2ISSD 1OWNA 2VJMB 4U2CA 5IM4A 3GU3A 3DE5X 1N5OX 1R9JA 3KL4A 1Y81A 1I4EB 3VJKA 1TQ4A 4JXJA 1UFKA 1MB3A 1U1CA 4Z1MA 4A8TA 2I9KA 4PYIA 3D59A 1C0PA 3LX6A 1U0OC 2B8JA 3U17A 3EUWA 2O9JA 4YXFA 1C7QA 4O08A 5KEIA 2XXAA 5TF0A 2QKYA 2A33A 4H1TA 3AJEA 4B87A 4IDBA 4K0KB 1NHGA 1XXHA 1NW9B 1I2BA 2I8LA 4Q4JA 5HKAA 3K31A 4ZDKA 1R12A 2C0CA 4MUBA 2JI8A 5GQSA 1PX2A 3H7AA 1UMCA 3MWKA 4LVNA 3P4YA 1VFPA 3ED1A 3GWGA 5T5QA 5EGNA 1G7RA 3WFZA 3H16A 1Z33A 3P27A 4B45A 1HT2E 2VUTA 3B8HA 3K92A 5IJZA 3ESDA 5DRYA 3PI7A 2IU0A 1Z08A 3DAPA 4NWIA 4OQQA 4RTQA 1XTKA 2C4VA 3KUXA 1PZGA 2FSVC 2W0MA 1R4MA 2R60A 4MR8A 5CVJA 1LRJA 3PJFA 1ORWA 4KK3A 1NIJA 5AWFC 3DDOA 3GAAA 4CLOA 2ZM6B 4KU4A 3PP8A 4L7VA 4PXAA 3UGJA 2W2VA 2O8CA 2AF3C 3DDUA 2Z6VA 2A30A 2R8ZA 1CNEA 4XJXA 4AO8A 2EBUA 2F64A 4XYBA 1CNFA 4ZAWA 5CA1B 2VUIB 3V97A 2Z30A 4BKRA 2RCYA 1DQNA 2WJAA 3DEIA 4J7CA 4P2GA 2YY7A 1SUEA 5FTNA 4KREA 1E7YA 4TTJA 2E55A 4WNYA 4FFSA 4V2UA 4YDSA 1VHWA 5A02A 5IMSA 4FFWA 1HYHA 2ZWMA 3BRWA 4IM7A 4OHWA 5IMBA 5L7WA 1P5HA 1CHDA 1W4LA 4RGYA 3W4IA 4K9OA 5IXSA 2AVDA 3EXHC 3F74A 3LVFO 3I9MA 2XMSA 2P8SA 3S55A 4AN0A 2DR0A 4U39A 4FSXA 2V4MA 1OYYA 5BQOA 1KDTA 3SNKA 1XD2B 3MJVA 4RF5A 4YALA 1C0KA 1OXVA 1RRMA 1PNVA 1OBOA 2FP3A 1V7ZA 1WMSA 1T9ZA 1MW9X 3UJNA 1YH3A 4HRAA 2JCSA 3FTFA 4FNAA 4EGSA 5LL6P 4GM1A 4P36A 4X7PA 4X1YB 3U3RA 4CM9A 5FI5A 2QN3A 1J2JA 3E8XA 5LMCA 3M6WA 4G4SP 3PFGA 1EM8B 3BGIA 4AYXA 1U11A 2B5WA 2QTCA 2JCYA 4UDOA 1MC8A 2ZUVA 1NJ5A 4COOA 2F3UA 2CLCX 2E4ZA 4B17A 3FFBA 1L7PA 1OREA 3MQFA 5H70A 1T2NA 4BCCA 4LY0A 5LP1A 1DX6A 1ZK2A 3RT9A 1R74A 3OTQA 1M76A 2ZI9A 2AEJA 3FX2A 3MK31 3W06A 1RHMA 3HBJA 3U56A 1N9GB 4IJVA 3PGMA 4MI1A 3AW9A 3DVRX 1YJBA 2ZSIA 3WNDA 4DJDC 1RCTE 3GDHA 5JLAA 3WVNA 5EEGA 5A0TA 5JNLA 4YJHB 2DKOA 2Q5IA 3IAEA 4A91A 4YMUA 3AFNA 4XM2A 1J56A 3SJZA 4BIMA 3DDHA 2D2XA 3AUFA 1WMDA 2ZUCA 3I5YA 1Z6TA 1DJPA 1JHXA 5LZ8A 4G41A 1ESZA 3BOSA 2P90A 2ZIAA 4Y2QA 2WYOA 4PONA 4ENTA 3A9UA 3IBSA 4NYMQ 4K8RB 4WJLA 1UZMA 3WBKA 3ZHSA 2AL7A 8MHTA 4RE5A 4PXSA 1A2BA 5CLIA 5TE9A 2ZJ5A 1I3CA 3ZH9B 3FSRA 5HOQA 4EMTA 1CTQA 1FFHA 1IRIA 1QO0A 2FMKA 1ZIOA 1FC0A 1DUSA 1T8WA 3KKLA 5CXUA 5FUMA 5KYWB 3USES 3IVGA 1AUOA 3K2EA 5EJ2A 1XAGA 3U3DA 4ML3A 1SA0B 1KK2A 1XYGA 4JYZA 3UA3A 1GSHA 3A4NA 1ZSVA 5F7OA 2A9OA 2O4CA 4UU0A 4OHMA 4KXQA 2WKQA 3GEIA 1YI8A 1GRQA 4OJKA 5EAIA 3MHTA 1WDKA 1U2PA 1UOQA 3S29A 5LZ4A 5DXFA 2BEUA 1T6ZA 3EGXA 3JRNA 5JAQA 5GPBA 3SC4A 1NQ5A 5BSWA 5ADVA 4IMPA 1DAFA 2H2FA 4D9NA 3HKBA 3O94A 2UYGA 1CK4A 5K1ZA 3CWCA 3IKJA 1XKXA 5EKXA 1ESMA 2E21A 1SOAA 2GCOB 4MVWA 4B34A 1VDZA 1PFKA 4HK4A 3KYCA 3RSGA 16PKA 3JYHA 2VK2A 3CZCA 3PNBA 1UIRA 3ZWNA 2WNSA 2X0KA 4NSNA 4RTNA 3I1IA 3OPQA 3QY9A 5CNKA 4EWLA 3QX3A 1EVEA 1I24A 3BM5A 3P2YA 1U3VA 4XRRA 3N8NA 1TK9A 3B9QA 2P4SA 4JU8A 1P1IA 1AS3A 3BXPA 3FR8A 4BNXA 1WSBA 2X6TA 4ZCMA 4NKRA 1JXQA 1OJ7A 2OG2A 3U4GA 1FMFA 4R1OA 5HRCA 3OG9A 1V71A 3KR9A 4O33A 1A1SA 1RQXA 2A2ZA 3O6VA 3TNYA 3ESZA 4KSYA 3X1KA 1M6HA 4EYSA 3KJNA 1E94E 2PM8A 4YRBA 5ER9A 5EKSA 3P20A 4L2IB 2BTOA 3L4SO 1XCGB 3O2QB 5P8WA 4NJMB 2JLSA 3CNLA 3JVIA 5GIOE 3LUAA 3NRJA 3NOVA 3AY7A 1EVLA 3PHGA 4HTAA 3D31A 4EKNB 3OQJA 4RHXA 4Y2YA 2C9ZA 4WLNA 2RGXA 3KZKA 1SU8A 5J4YA 4XX0B 4CL2A 4MR7B 3DDWA 2NSYA 4ZQIA 3FMIA 2BGUA 3DUWA 3MN1A 3CW9A 2MYNA 1AKUA 4DQUA 1SVUA 3W04A 4NABA 4QGSA 1V0JA 4EG5A 3FVQA 2C04A 5KKAA 2QRHA 2ZRHA 3U3XA 2LCQA 3PWZA 4QQRA 2YWDA 5BV2P 2BI8A 5AKIA 3SZMA 2LDBA 1QFJA 4J1TA 3C5EA 3IAFA 5K0GA 5K45A 2FUCA 1JMKC 2VYVD 1C30A 2MSEB 1ZJ6A 4HDQB 3S3TA 2A0WA 2PD4A 1IHUA 1OIXA 3DL0A 3M34A 3WP0A 4ZJPA 3FOFC 4DV3B 3BH7A 4MQ6A 1N1GA 3DE6X 1GKIA 3MC1A 2D1SA 4QJ4A 3VR2A 1LZKA 1JR3A 1TIKA 2AEFA 4EGAA 5JZOA 4PYMA 5B55A 5JS1A 1QS0B 2HMVA 3IQZA 5B2EA 2UAGA 4CIXA 1FP1D 1XHEA 2C07A 2CXOA 4CVNA 5JS7A 1A5ZA 4RABA 1H1TA 3LECA 1LNSA 2AHOA 1Q44A 4P83A 1YQWA 1RIFA 3VBEA 2UV8A 3HPRA 4RPIA 1KMQA<