3BRWD

Structure of the rap-rapgap complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
167
structure length
167
Chain Sequence
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rap1 GTPase-activating protein 1
publication title The Rap-RapGAP complex: GTP hydrolysis without catalytic glutamine and arginine residues
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp binding protein
total genus 51
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3brwD00
1P6XA 3W8RA 2REXB 2VHQA 4A0FA 5AUOB 4ZCMA 2DBYA 3K9HA 2HEIA 2F9MA 3B78A 1G3MA 1K8RA 2GXSA 4QBFA 4U5XA 5JZVA 4CEJB 3U60B 1Q0UA 1KDOA 5AJXA 2BMEA 5HZHA 4AKEA 4JLPA 2YYZA 1H8HD 1SZPA 2A5JA 3CW2A 2JA1A 2XAUA 1LVGA 3X1YA 4B71A 4RFSA 4AYXA 5FTNA 1HE8B 5JI2E 1IXRC 1XB2A 4W9MC 4WOPA 1V5WA 1KAGA 2BOVA 3CM0A 4E5UA 5FBVB 3UG7A 1NG1A 2RGAA 3K09A 4MDFA 2JIZD 1GILA 1AIPA 2JDIA 5F2EA 5DGXA 3TW4A 1F6BA 2IYXA 1IN7A 1ZNZA 2XB4A 1ZD8A 3K8YA 1QVAA 4LX0A 4EPWA 1U9IC 4ZDIA 2Q9AA 1GM5A 2ZS8A 2DYKA 5CJPA 2DWPA 2IS4A 2YJTD 4B3DA 4FWTA 2XNDD 1A2KC 4KAXA 1QF9A 2ZUDA 2WKPA 2V1UA 2JCSA 5CDFA 1JJ7A 2GF9A 3EZ6A 4NCNA 4QKQA 4HZUA 3T1TA 4D80A 3BFXA 4Q19A 2FGJA 1VYUA 4KFTA 2P5SA 1A82A 4I99A 4M9ZA 1P2SA 2H5EA 1SQ5A 4A2PA 1J70A 3KKQA 2N42A 2WWYA 4LV8B 1OHHD 3EPJA 2G1KA 4KJZA 1LNZA 2ZJYA 4P4UA 5HPYB 4DSTA 1AGPA 5CM9C 1S1CA 3KUDA 3MAAC 4LHVA 2JJ1D 5KUTA 1ODFA 3AM1A 2RGBA 2AD5A 4MGIR 3IEUA 1HYQA 4BLOA 2G9NA 3FYHA 1LW7A 2XX3A 4YMVA 3B5JA 3GEEA 1E1QA 4NCIA 4Q4LA 2GXQA 2CE7A 1XXHA 3M6AA 1PZNA 3U3JA 4D4JA 1XPOA 1P9WA 3B85A 1P3JA 2V1XA 1W5SA 3B2EA 1G3RA 1DBSA 1JQJC 2F6RA 4U02A 2YC2C 1KO1A 2Z0MA 3SJZA 1BYUA 1G8FA 5AUPB 2A7QA 4HDCA 3GP8A 3IILA 1CF4A 1S1MA 2PX0A 3D7MA 2GK6A 4TTRA 4PC3A 2BHRA 4MKHA 1U0HC 4J0QA 2IK8A 3CIOA 1E69A 1ZRHA 4KBGA 4BZXA 2RGNC 4A8JB 1GNPA 4ON9A 2Z4SA 1G5TA 3MUFA 1GKUB 4GI7A 3NTUA 1VG8A 1DO2A 1FOEB 4QJ5A 2QM7A 5FFMA 5CM8B 1VTKA 3OEEA 3IIJA 1JPNA 1KSGA 1YU9A 2CCJA 3L8ZA 3TGPA 2QEQA 821PA 3FE2A 2ANBA 1OIWA 2PLFA 2J0UA 5E4FA 3QF7A 3TBKA 4B6EA 4MYHA 3ADKA 4IEIA 5CYOA 1X8JA 4F92B 3VR4A 2GBLA 2L0XA 1GRRA 4LJ4A 2O8FA 1N25A 1E6CA 2QGZA 3ICQB 1J8MF 1E9EA 3IPYA 2CCKA 2GJKA 1EWQA 3EIQA 4R2HA 1Z08A 1MOZA 3ZH9B 1NSTA 1OXUA 2DFLA 3FPAA 1JEDA 4LK2A 3AVUA 1R0ZA 2ONJA 4TYNA 4UXIA 5J4VA 2HT1A 2OXRA 3QXHA 1IONA 1KIMA 1EFRA 1PUJA 3BBPA 2VYFA 1JB1A 3ZVRA 4DKXA 3IBYA 2CMKA 4URUR 4B33A 2OBMA 1S3SA 3SHFA 2OILA 1KSFX 4QGGA 3P1JA 2IYSA 4M9XA 2ZU0C 1R5OA 4B47A 2GAOA 3GCGA 4H1VA 3TAHA 4JVMA 3BXZA 3AP1A 3FB4A 4BFTA 1KI9A 4GOKA 4O25A 2RMKA 2QQ0A 3LY5A 2GZHA 5JJLA 1OH6A 4AYTA 4CGZA 3PG5A 2PCLA 4F4JA 1C1YA 3NXSA 4PQFA 4F4CA 2ZR0A 5KDDA 2QZ4A 1X8LA 3CZQA 3A1VA 3RC3A 3CNNA 4Z1MA 1XP8A 2EU8A 2F7SA 5FUXA 2ZRKA 2DFNA 2J3EA 1YZGA 3WYAA 1XWIA 1LV7A 1KMQA 1F60A 4D4MA 1ELOA 4RD2A 4A92A 4O3MA 2O0KA 3U2QA 2GJAA 2IX3A 1WXQA 2WICA 3OIUA 4Q1FA 2ZSFA 2C03A 3QE0A 4N0EA 5CJ2A 3OIVA 4NYMQ 5FBWB 1NNEA 4URWR 2XTZA 1I2DA 2QORA 2A3RA 3JZMA 3H86A 2FEMA 1E2HA 1IN8A 1Q1QA 2F1JA 1FW6A 1UBCA 4LI0A 3T5DA 4B3BA 2IEYA 3O8BA 4AD8A 3FOZA 1S9DA 4DLRA 3I61A 3RRZA 3PUVA 4MRNA 2AD1A 1MRSA 2XJ4A 2QSZA 1XPUA 3N70A 1W47A 4TMWA 3R8CA 1KHTA 1JXMA 3TAUA 4B48A 3F5FA 3S1AA 3F8TA 4PC6A 1IHUA 3U4QA 2LCFA 4XTRA 5CLQA 3QIAA 4IVPA 3QXJA 2WJHA 5JFGA 1T3SA 5EP1A 3ZIAA 4NCKA 1VG1A 2C96A 1EFCA 3PJRA 4PSAA 4TYQA 5H70A 3KB1A 3V4RA 1SXJA 2QT0A 3R8FA 2J0VA 1LTQA 2O5VA 4JLDA 3HP1A 5FPKA 3TUZC 1NI3A 1ZM9A 1I4TD 1DPFA 2OHFA 3HYRA 1Z63A 1BO6A 2Z4RA 3QKTA 3U3RA 4AI6A 3NVAA 2ATXA 1AZTA 2ORVA 2RGDA 1YVDA 3P4YA 4RJLA 4LBVA 5LB2A 2R2AA 4V02A 2HDNB 3W5IA 2VPPA 4QM7A 2I4IA 2XSZA 1D2MA 2HYIC 3BS4A 3K0AA 2C2HA 1R0XA 2A5YB 1B23P 5FTKA 1G9XA 5G3ZA 1RC8A 5CK4A 2I1QA 2IEZA 1MH1A 3I73A 3UKDA 4HLUC 2IUTA 3NIBA 2OV2A 1ZC3A 2D4HA 4XWKA 5J4KA 3THWA 4X8OA 3QPWA 5E7IA 2O8EA 1EFUA 3UWOA 3TSZA 3QF4A 1E99A 4Q9KA 3N5CA 2P6UA 3GQBA 5CB6A 2D7CA 3QOFA 4TT3D 3LNCA 1QG4A 2YVUA 1UBGA 1Z6XA 1U8AA 4HUQA 1OYYA 3GLIA 1FZQA 4FW9A 1KY3A 1R0YA 2C98A 5JI3E 2MSEB 4CRWB 3T35A 3LLUA 4M1KA 3PEWA 3NHBA 4GMXA 4NYMR 2ZSDA 1W48A 3R7WB 5LDDC 1LY1A 2JLRA 1L8QA 1E9BA 1OPXA 3LDAA 3C4JA 2OCAA 4NE2A 4W5HA 4B2IA 2J7KA 1E1RD 4IKEA 2OT3B 3ZLJA 4PANA 2WIAA 4BLPA 2ZRDA 5GVRA 5L3SB 2ZI7A 4EPTA 2ZS7A 1KKLA 3EZ7A 1E9RA 3NHAA 3RVBA 1XTRA 4EJSC 3REGA 2BMFA 5JBQA 2F1RA 2EFDB 3KQKA 4ASUA 4G5RA 2AK3A 1CXZA 4DUGA 4JMPA 1N2CE 4PSVA 2OFOA 2ZJ8A 1IJEA 1J90A 1W4CA 1EWRA 2F43B 3FFAA 4LJ6A 4GZMA 3VU9B 2ZJ2A 4A15A 1F3OA 2H92A 4H9GA 4TSFD 1TQDA 3BAFA 3U3MA 4JS0A 4Q4AA 2DPXA 1HH4A 3BC1A 4M53A 1H8ED 4V0MA 4A9AA 1U0LA 4OK6A 5JEEA 4A36A 1NJGA 1OFHA 2IHBA 1VG0B 3N2IA 1G21E 1XTQA 1U2RA 2NTYC 1E2EA 4Q9IA 5KSYA 2VP5A 3RHFA 5CK5A 1IJFA 2NMVA 3MRSA 3IQXA 4PTLA 2UVQA 3DM9B 1HQYE 4R2IA 3KFXA 3NDPA 1L7VC 1OLOA 1KK3A 1BMFD 1S0UA 1W0JA 3U3OA 1OXSC 1Q21A 3VTKA 3NBYC 5C46F 4JLVA 3UIEA 4PFSA 1A5TA 2AWOA 1NKTA 2ZI9A 2IYTA 3MWKA 4RZUA 4B34A 3QI2A 1CS4C 2QMHA 3GJ5A 1TADA 3K70C 1XEXB 4I1SA 3U6KA 3B1XA 3EIEA 2GEVA 1JAIA 2JEOA 2GILA 2RHDA 5M04A 2P3SA 3U61B 3VX4A 1G8PA 4ILEA 4OI1A 1KY2A 1IN4A 3KJGA 4K8OA 5TXGA 4C4PA 2X2EA 3EC2A 3EW9A 1TQ6A 3TSWA 4JYBA 4WXPA 3GPLA 1ZUIA 2JLYA 3NC0C 5KNCA 1CEEA 2CVFA 4ZO4A 4U00A 4WW0A 5SZKB 1Z8FA 1X3SA 2JLVA 1W44A 2R8RA 5J5CA 5J47A 1H8HA 2B6HA 2ONKA 3K9LA 4C30A 4L9WA 1DAEA 1XFAA 1KZ7B 1K5DA 2GCOB 2YOFA 3FVQA 3FWYA 3PUYA 2DFTA 1M74A 4Q01A 4OL0A 3GLGE 1KDRA 1YRBA 3GJ7A 3MWYW 2JIZA 3PVSA 1ZM3A 1G3UA 4O2LA 1XEFA 3UG6A 3N2EA 4F38A 3ZVLA 1C4OA 1E2QA 1OFIA 4PC2A 1TMKA 3ZVNA 4GOJA 1QHNA 2WKQA 2FZLA 3SYLA 2O8CB 2OZEA 4OBEA 4WAUA 3OZXA 3CWQA 1XJCA 1FTSA 1KI2A 3ASYA 1NVVQ 1PLJA 2REOA 3D8BA 3Q85A 3TRFA 4DLXA 5KU1A 5DYGA 4EFMA 1NIJA 4AWXA 2XNDA 4RCZA 3GLFE 1FX0B 3FFBA 4IW3B 5EE0A 1DTSA 2W58A 3VR3A 4BPBA 4IVRA 2H57A 1IY2A 3BH0A 3F0TA 1FP7A 3CKLA 4JL5A 2O8DA 4R7ZA 3QKSB 3U7GA 3KKNA 3U44A 4FINA 2W83A 4PPQA 1NVXQ 1SVOA 4HI0E 4PPFA 4B6FA 2YINC 4DB4A 1MO3A 4MGZR 3AVWA 2G0NA 5JHGB 4F93B 2CNWD 4HLDA 2BM0A 2CE2X 4RKEA 1Q3TA 5DISB 1GVNB 1TEVA 4Q9LA 4MGKR 1OHHA 3ZYCA 4TLAA 1XTIA 4D0GA 1XD8A 2QM8A 2UZIR 3QBTA 2EFEB 1E9DA 1T8UA 2VSXA 1MV5A 2ZETA 4HB3A 4US2R 1P9RA 2JJ1A 4QGAA 1JAHA 2B7CA 2ANCA 1E94E 3CNLA 4A8JA 5JEDA 2ZJZA 2B92A 5AK0A 2FNAA 3RS2A 3SS8A 4B2LA 2GZDA 4LPSA 2HJVA 4C2UA 1DOAA 2PMKA 5A4JA 4H1UA 4TMKA 2XEXA 2Z83A 2QROA 3PIRA 1KO4A 2AKAB 1UDWA 4JVNA 1ZUHA 4V0OA 4M0LA 3LO5A 1G6HA 2IL1A 2GRJA 2JLQA 4ESVA 3ZZ0A 2Z5FA 1SVSA 4PPGA 5TB5A 1WB9A 2WWIA 3J81k 2WWGA 3SHWA 1GWNA 2FPMA 3QUSA 4C0SA 1KNXA 1TAGA 1TQ4A 1VHLA 2O8BA 3KJEA 4POAA 4X8MA 1VIYA 5KSOA 4DIEA 3EA0A 4KCGA 4ACBA 1FQKA 2WSSD 4HATA 3ADDA 3BIFA 4I4LA 1OIVA 1Q20A 2R6CA 1P60A 2QAGC 5EP3A 1RRGA 5FL3A 2HF8A 1P75A 3FTQA 4EDHA 4BUJA 3AGQA 4Q7LA 3ZS9A 4EJSB 1J99A 2UZ3A 1NVVR 3IPXA 4PR0A 4TMTA 1QHGA 3SR0A 4JLKA 4QBHA 1NMYA 5KDOA 3BWDD 4LYFA 4D6PA 5FH9A 1E0SA 1H65A 1NSFA 1SKYE 2NO6A 2F55A 4KITB 1S9HA 2ZRNA 2TMKA 1NKSA 2NGRA 4NCHA 3WMGA 4ZIRB 5KYKA 4MRSA 2Q0HA 3D3QA 4MA4A 4PZYA 4B75A 4CT4B 1YR9A 3V9PA 1MO6A 1E96A 1TF7A 3K70D 3WRYC 3QENA 4QOSA 3UPUA 5BQ5A 5EUQB 4HDQB 2BBOA 1P5ZB 1QDEA 2FFQA 4ZKEA 5ELXA 2P5TB 2ZRHA 3E2IA 3L2OB 4AIIA 1IQPA 1HT2E 3TQFA 1N6RA 4HAXA 4G01B 5GADl 4GRAA 4B3CA 2QSYA 2VA8A 4P4TA 4OYHA 5HE8A 2BC9A 2KB0A 1MABB 4URXR 1AQUA 1DG3A 2ZUBA 3RABA 1J7KA 4I1VA 3K70B 4M1TA 5FPTA 1Z6GA 2BCJQ 1JBKA 1HA3A 4ZDJA 3RC8A 3BFVA 3GD7A 1GOTA 1K6MA 1F2TB 4QGHA 4FMBB 2QUZA 1TEXA 4LJ5A 3DVLA 3ADCA 4Q5IA 3W3AA 3ZVMA 4BRWA 1X1RA 2ZSBA 1E2MA 5EE1A 4MRVA 3LLMA 1A4RA 3WXMA 1N6LA 5FL7D 2CHVA 2PLRA 3AB3A 1L4YA 2MSDB 3A1WA 1Q1ZA 1Z2CA 4V0LA 3RSLA 3EPLA 1P7CA 1WA5A 1XCPA 3BE4A 1T5LA 5BN3A 5DI3A 4LYAA 2ZRIA 2YOHA 3KTAB 1COWA 4YMSA 2QRZA 3W6PA 4BFUA 1US8B 2IYWA 2X77A 3L0OA 3WBKA 1WF3A 3K0CA 3GLGB 1KJZA 3CO5A 2EWVA 4YMTA 4Q02A 1D6JA 3AVTA 1U94A 3QBVA 4QJ3A 3HR7A 3VKWA 4C3ZA 3BORA 4G5SA 1CJKC 2EYUA 1QRAA 2WTUA 3THXB 1F5NA 2IYRA 3QVVA 2FA9A 5IRCD 2VEDA 4JLAA 2C77A 3IO3A 3IUYA 4M9QA 3C41J 4US0R 5CIQA 2ZU6A 1OXTA 3AKCA 3DPUA 4UXHA 5B57C 3ONWA 4JLBA 3BK7A 5L8VA 3W3ZB 4M1OA 4Z54A 1J8YF 2CK3A 4IOKA 4AURA 4FXPA 1NBME 3EZFA 1G16A 2KSQA 4LDJA 4DWJA 4X8HA 1XF9A 2PH1A 2WAXA 4A0RA 4PAMA 1Z6AA 2ZJAA 1DARA 4MRPA 4LHYA 2H1LA 2R6DA 1EFTA 5J4LA 5JECA 1IAQA 2HJGA 4TT3A 5FR1A 4EQ6A 5L3SA 4TYYA 4YXWD 4FMCF 1YR6A 1FL9A 3SJAA 2AK2A 1U8YA 2AX4A 2J9RA 4RD4A 3V4FA 4B76A 1YRAA 2EWWA 4IOLA 4QGFA 5JCPA 3GLHE 1BKDR 4LPKA 2EFCB 2FOLA 3SBDA 4V0KA 2F43A 3I92A 2J5XA 1ETUA 4BLTA 3T1QA 4DCUA 2RAPA 3VU9A 3DL0A 4KFRA 3TQCA 1VCNA 1D8TA 3VQTA 1IOZA 2RCNA 3LAWA 2FDCA 1DAMA 3AH8A 5FTLA 2FSFA 4Q4HB 1OKKD 5C1BA 1W7AA 3C15C 1E3MA 1G41A 4WVFA 1WCV1 4RSGA 4NTZA 4YDSA 5FTMA 4QHYA 3L82B 5BXQC 3SEAA 2ZRCA 2GJ8A 4M22A 3U5ZB 1KYIA 5BW8A 5FBRB 2QT1A 3KUCA 3B1ZA 5FPSA 3OAAD 2CJWB 3NDBB 2LKCA 1JR3D 2WSMA 1ZW6A 2QAGB 4BFVA 1QVRA 4DJTA 1E98A 1XEWY 2CEAA 3QXSA 4P3YA 2WMOB 1AS0A 2GEUA 2KE5A 2YWHA 1G8HA 2QPAA 4PAOA 2RGGA 4XIGS 4TSFA 1T5IA 1Z0IA 2FSIA 1YHNA 1EESA 2QE7D 5KO2A 1E0AA 2FPLA 4YMUA 1H8EA 2LWIA 5TDHA 4WXRA 1M8PA 3B9PA 4AY2A 3AV0B 3KDSE 3CF2A 1KI4A 3RDPA 1OFUX 1S8FA 2ZTSA 4C9BA 4AG5A 1XEXA 1UKYA 3BOSA 3MD0A 3MFYA 5IDVA 3BH7A 4D81A 3ZQ6A 1SKYB 4LHXA 2QG6A 4RKFA 3PXGA 4EPVA 1BMFA 3H0KA 3TJZA 4UJ5A 3RS7A 4NKRA 4DCNA 2ZAMA 5GJVC 2HXSA 2IXGA 4LSGA 5J4HA 2J0SA 1QHXA 4R71A 1EK0A 2QMOA 2IWRA 1KAOA 4CT5A 5A0FA 2HLDA 1W2HA 2XOKD 1CIPA 3K09C 1DG1G 1Q3HA 3QKUA 4OK3A 3LH5A 4DEYA 1NMZA 3AVQA 1WRBA 4PC1A 2YV5A 4HAYA 5TVKA 3LW8A 5K8UA 1JQLB 2UKDA 4DLSA 4MGYR 2XXAB 4HAWA 2Q9CA 4FI3C 4PO9A 1M1YE 2WJGA 4ARZA 3O47A 2OBNA 2D3WA 2VHUA 2JLUA 2Q3HA 2XNSA 3QEOA 2J87A 3SJBA 2CXXA 5GJCA 4HUTA 1C9KA 1Z0FA 4TL8A 2V3CC 3I4LA 3AF1A 4TYWA 2CCGA 4LZZA 5CDFE 1DAHA 3E5HA 3OESA 4Q1AA 1CLUA 1D2NA 3ZQJA 4IJMA 4BGDA 4PXAA 2GXUA 4Q1CA 4JJKA 2OLJA 1GG2A 5DN6D 1AS3A 1O3YA 1ZJ6A 2REBA 2VP6A 3GJ6A 2YNMA 3QKRA 4OI0A 5DI9A 1GRQA 1N0UA 2B21A 3I3SR 4BLSA 3CB4A 1OB5A 4QC2A 3DM5A 1OH5A 1S3GA 2GEDA 4CF7A 4LC1A 4B3GA 1CR2A 1FX0A 4LJYA 2QBYA 4NL4H 2PT5A 2ZEJA 2BWJA 3DO6A 4HZIA 4AC9A 4LBYA 3QKSA 3CZPA 4JKIA 2RHMA 2IYUA 2FG5A 2FJUA 5FOUA 2HUPA 3FKQA 4Q9JA 1M7GA 4JLNA 1Q44A 1XXHE 3MWLA 2ZSEA 2HYDA 2RKOA 2QTFA 4TQAA 3A6PC 4L8GA 1P73A 1Q22A 5F9HA 1M2OB 4FIDA 5GJWC 2P0EA 2PX3A 3E1SA 3KQUA 4Q1BA 1II8B 1QZXA 1ZBDA 2PEZA 1QG2A 3IQWA 5AJVB 4LGMA 4M8NE 3IEVA 5EP2A 5KDLA 1NBMD 3VX3A 5C4GB 5KSZA 1CR1A 1OB2A 2XITA 1G7RA 1NMXA 3E70C 3RRYA 2IYYA 2AWNA 1CRPA 4IDNA 2RH5A 3KJHA 3EZ9A 3PUWA 3V00A 3U3KA 1LFDB 5L3QB 3FMOB 1ANKA 3WNDA 1IN6A 2FFAA 2VSFA 1ESMA 1YR7A 1VCIA 2ZYUX 1PLLA 3EAQA 4PHHA 2ZVPX 4TLDA 1Q1BA 3DZ8A 3WHLA 1ZAKA 2QL6A 1W1WA 2YWGA 3SNHA 2HCJB 1VHTA 2IT1A 1KOFA 1NN5A 1QHYA 1S96A 1X6VA 2FF7A 5EUMA 4UNNA 4BLRA 2GBLC 3OE7A 4NPHA 621PA 3KQLA 1RFLA 3IO5A 2ZI3A 4LJ7A 3HU3A 2OAQ1 2NZ8A 4MH0R 4MKGA 4ZI2A 2G77B 4DSNA 2AXNA 4RD1A 5JMTA 2F1IA 2QPOA 3OHMA 3VR6A 3PEYA 1E9SA 1GRNA 2AKYA 4B3FX 5IF9A 3W8NA 3ZJYA 4DRZA 1Q1EA 1FQJA 1R8QA 3PENA 4TLBA 1T6NA 1W4RA 2R62A 3EASA 1UEIA 2ZM5A 3H2YA 2ZI5A 1MRNA 2KBEA 1E79A 1GL6A 1Z83A 3W90A 1WBDA 1DO0A 2OG2A 3QEJA 2GWHA 1XMSA 4JIMA 5DLQC 1RJ9A 3VFDA 1GUAA 1UFQA 1DAFA 2XTNA 2JAQA 4D26A 2DWQA 4Q1EA 3K53A 4O0MA 4Q00A 4C0JA 5J4YA 1T0JB 1PJRA 3B60A 3T34A 3UK6A 3CWZA 3A37A 2ZSAA 1OH8A 4GPTA 1FUKA 1QHSA 3FMFA 4QBIA 3KJIA 4XSGA 4ZKDA 2ZYTX 4RZXA 3CX6A 4JLMA 1IY1A 1QHIA 1TU4A 4OHZA 4Z51A 1AJEA 2Q3FA 3Q3JB 3FKSD 2YZ2A 2VP2A 3Q5DA 1KI3A 4RCYA 1G8GA 3QJYA 1RRCA 2YKGA 2ZROA 1V43A 4IXMA 4Q18A 2BBSA 4CEHA 4Z8XA 1U8ZA 4A0HA 3SJCA 4KBFA 2WKRA 1UEJA 2GA8A 4HB2A 1XNJA 4HLQB 1CU1A 4KHZA 4NP6A 2QP3A 4EAQA 4TZ6A 1FTNA 1N0WA 3MCAA 4JT4A 2P65A 4ESHA 1FPMA 2A30A 1T9HA 2OM2A 3OEHA 5DE3A 3I8SA 1YE8A 3U7HB 4GDFA 3D6TB 4JL6A 3L0SA 3BB3A 5B58C 1NN1A 1N6OA 1ZMXA 1N5KA 4ACAA 2ZRBA 2G3YA 2IYZA 3BB1A 3RS0A 3X2SA 4A4DA 4F7WA 5LBIA 3OFND 3SDZA 4RFSB 3WP0A 4A6XA 4CEIB 1R0WA 1KK2A 3A8TA 4Q4JB 4D4LA 3H4MA 1AGRA 5JSZB 5L3VA 1XRJA 2V7QD 3AKDA 4NYIQ 3QPUA 5TY0A 3AVPA 1SXJE 2GJSA 1SXJC 3A1SA 1UM8A 2IA5A 1ESNA 4K46A 3RRMA 3CR7A 4URYR 4YONB 4DT1A 2E9SA 3CF6R 1M7HA 2BDTA 1G6OA 3A4LA 4KFSA 3WHKA 5BYJA 3VR1A 4PAQA 3NEJA 3AUYA 1LF5A 4V0NA 1YJ5A 4FCTA 2B8TA 3VR5A 3W6OA 1E32A 3BJIC 1UBEA 1SVWA 4TYPA 4IHQA 3UATA 3L8YA 4HZUB 3IHWA 4NHOA 1ZYUA 1SVMA 4LCBA 5FL7A 1E1QD 3R20A 4HB0A 4TLCA 3THXA 4PC7A 4F91B 2DB3A 3GFOA 3EARA 4Q21A 1YZTA 1R6BX 2VP4A 3Q8XB 4AKHA 3A36A 3A1TA 4Q47A 5JS7A 2VSOA 3ZDQA 3TW8B 2A78A 1SVLA 2RB4A 1G5PA 3ASZA 4YMWA 3GLIE 4E09A 3PUXA 4CEJA 3MMPA 2OO7A 3KL4A 3VR2A 1RW4A 5EXPA 2GJ9A 4DCSA 3HU2A 3U7FB 4KFUA 5EZ6B 2YOGA 1KI1A 2ZI6A 4DHEA 2X1VA 4TN1A 4FWIB 1EXMA 1AS2A 1AZSC 3EWSA 1W0KD 1E2PA 1CR4A 1BOFA 3OEED 2RGCA 4C7OB 2J41A 5H1YA 3KFVA 4JSYA 2O52A 5AR1A 3A1UA 2ZYVX 1KSJA 5SZIA 4WBSA 2J0QA 2WOJA 1ZD9A 2BEJA 1TUIA 2FV8A 3BRWD 3MG9A 1XD2B 1N6HA 5D3MB 3RYTC 4L4UA 1A2BA 2KWIA 3ZGXA 4P0TA 5JWHA 1UDXA 1JPJA 3LA6A 4UNSA 4KXFB 3PEVA 2QI9C 2CHQA 4JBXA 4GBMA 3PFIA 5DSZA 4GP7A 2BCGY 1EFHA 1W49A 1N6PA 3G82C 4KU4A 4QJ4A 3TIFA 5BWMA 4XWOA 2CLDX 4Q4HA 4YXWA 2BEKA 2FU5C 3MJRA 2ERXA 2J0UB 2NQ2C 5B30A 4GFDA 4DDTA 5EZ5A 2ZITA 2CHGA 2XZLA 2JJ2D 3I32A 4V0ME 2AR7A 2BMJA 2HF9A 2O8FB 3HDTA 3SOPA 3UANA 5KNBA 4D2IA 2XZOA 5FTJA 3LX8A 3RS5A 2CLSA 1VYVA 121PA 1R4AA 4QG7A 2QAGA 2QMUA 2QP4A 4IXNA 4M1YA 1ZIPA 1Z0DA 4PO8A 1WP9A 2OLKA 1G4AE 2ODEA 4L9SA 2GXAA 3HU1A 1U81A 1L4UA 1E0KA 1E4YA 1BIFA 1OKKA 5JCZA 4UNQA 1XD9A 1NRJB 4QNRA 3SBEA 1VDZA 3NBXX 1EGAA 1E9CA 2VF8A 4MUAA 1KGDA 1XU4A 2VIIA 2VLIA 2JLZA 5SZJA 3LV8A 5HCNA 3EC1A 4ZDKA 4U7DA 4FCWA 4YQFA 1BYIA 3A58B 4WZBE 3U6BA 3OAAA 4PO1A 1E2JA 2JLWA 2Z6VA 5F9FA 3O8CA 1JR3A 4DLVA 3CPEA 1HV8A 5JRJA 2WV9A 4KLNA 4UKDA 3G5UA 1CJTC 1T0HB 5EXSA 4WA7A 4C0AC 1GTVA 2X2FA 4DBLC 1WMSA 2QN6A 2IYVA 2J59A 3RNLA 2QE7A 3K0FB 1OSNA 1NJFA 4XVUA 3THYB 1ZNYA 2H17A 4LOAA 4G3XA 3CH5A 5JRZA 2WZQA 2B7BA 3WNBA 1A7JA 1OJLA 3SFZA 3AVXA 2GESA 2ZE5A 3NBZC 4PQYA 1SGWA 2NO0A 1FMLA 5E7MA 1ZINA 4IOMA 5CITA 4RD0A 4QXAA 2AN9A 3WRXC 2W2VA 1T91A 2KBFA 1TF2A 1ZUNB 5C18A 1VG9B 3T12A 4G1UC 3LD9A 3JVVA 3ZZUA 2K5UA 3HWSA 4BFZA 2ZYWX 1DE0A 4YDHB 5EE3A 2BKEA 2W00A 3DMNA 3VMFA 1Z07A 3WBJA 1N6IA 1XJ0A 4CVNA 5FOSA 2C9OA 5LPNA 1N6KA 3SQXA 2B8WA 1FFHA 2N46A 5DHAA 2ODWA 4URVR 2OFXA 3CRRA 3A4MA 3K1JA 4EFNA 4DC9A 3CR8A 2V54A 4FMCB 4OQMA 4PHGA 4O2RA 1AKEA 1Z2AA 3RWOA 2FWRA 3S1AB 1NL3A 2BIFA 4LHWA 3HJNA 4ZDWA 3U4QB 1W4AA 4XD7D 2RGEA 4RZ2A 2CBZA 2WPDD 5JWOA 3W34A 3VNVA 5G3YA 3BERA 2QRNA 3R9WA 2IS2A 4RD3A 1AKYA 2FSGA 1YZUA 5DN6A 5FUVA 1TF5A 3I5YA 1VKJA 4B44A 1KI6B 1GP2A 2WVJA 3EIHA 2DHRA 4DSOA 1XPRA 1UPTA 4XH9B 1II8A 3B1WA 4M9SA 3EPHA 2QA5A 4Q7KA 3K0AB 3VKGA 4LC0A 2C95A 1XX6A 3IBGA 4TTPA 5AWFC 3LWNA 3TUJC 2Z43A 1F2UB 1XTJA 2BKUA 3KKPA 2IHYA 5HTKA 4A8JC 1O87A 4AYWA 3SFVA 4A2WA 4BECA 2IWHA 3ECCA 2ZREA 5DNYB 4MYUA 2XTMA 3THWB 3LVRE 1JR6A 3F3YA 3QF4B 4EPXA 4XJXA 2ZRFA 1M7BA 1OYWA 1GITA 3AKEA 3DMDA 4I1OA 2D2FA 3IDQA 4LWZA 4B35A 2BV3A 4HUQB 2FMXA 3LXRA 3UWKA 4HSEA 2VF7A 4TMXA 2JLXA 5CB8A 1G8YA 3CRQA 5FOVA 4A82A 3X1DA 3W9YA 4G5GA 4DSUA 4B32A 4FMDF 2VH5R 1W4BA 2ERYA 1ZVQA 3WYGA 2EFGA 4IDPA 4UNPA 4II7A 2V9PA 1IXZA 2ZE8A 1G1MA 2AXPA 3TR5A 1Z5ZA 3AKYA 3B7GA 1JI0A 3MLEA 3PCRB 1KMHB 1R8SA 3L43A 2A2ZA 4M1SA 1P9NA 2C99A 1U9IA 5JHHB 1UF9A 1TPZA 2VRWA 4NONA 4DVGA 5IT5A 1DAIA 2XGJA 1Z47A 1CJMA 3CH4B 4LY6A 2V8OA 4PQRA 2E1RA 1FNNA 2JATA 1OE0A 2FGKA 4IDHA 2ZR7A 3QXXA 3B82A 5AJYA 4BEBA 3UMSA 1U90A 4HAZA 2AHOA 4NCJA 4LJ8A 5HR5A 1VIAA 1XJQA 3KX2A 2R6GA 2GCNA 4LJAA 2DWOA 2ZPTX 3CNOA 3H84A 2NPFA 3EPKA 4MRRA 2NO7A 3HYTA 2A5DA 1KSHA 2EFHB 2EW1A 3GLFB 3SN6A 2FSHA 2QMEA 1R5BA 3B1YA 6Q21A 4QHTA 1G20E 1EX6A 1JJVA 2J7PD 1B0UA 3R7WA 1Z6YA 2JJ8A 1HE1C 3X1ZA 2IYLD 3T5GA 1XEWX 3C5HA 3DDCA 1P62B 2VL7A 3GEIA 1KJYA 1YR8A 4TMVA 5KOYA 2CL7X 3FKSA 2V4ZA 3PUZA 1A1VA 1UAAA 1E4VA 4DIDA 2NO9A 4OQXA 1ZC4A 3PQCA 2Q9BA 3CBQA 2CL0X 3CRVA 3RANA 1G3IA 2RGNA 1S2MA 4XWAA 4UXJA 3R9IA 4DLUA 3T1OA 1KJWA 3WY9A 1G18A 3P4XA 4CEIA 5E7JA 3GFPA 4Q4JA 2ZRLA 5H8WA 3AF2A 3KXLA 3KQHA 3I5XA 1R2QA 4M4SA 1NVUQ 4TWZA 4DCVA 5BYKA 5JSZA 4MDEA 2VTKA 4P32A 1HEIA 3QXCA 4BFSA 3VHLB 1E1RA 4P33A 1KKMA 4URZR 1ZM2A 2VO1A 5B2ZA 3QSYA 1IM2A 3LQRA 2HXYA 4JBYA 3T15A 4QBGB 4ABYA 3SC3A 3LW7A 2QPTA 4US1R 4EIWA 2ZVQX 5GJBA 1ZM7A 2PCJA 4EFLA 3OIWA 2F3RA 1TQ2A 3KXKA 4M2LA 3OFNA 1UJ2A 2DR3A 4OHVA 1LF0A 1ZNXA 3SU8A 4MITA 2CDNA 2ATVA 3B6EA 4TQUS 521PA 2W6JD 2JGNA 3U7EB 4IDQA 4KYUA 5EXTA 3K0CC 2V7QA 2W0MA 2OBLA 1GIAA 2IXFA 2VBCA 1E2LA 5ANRB 3IGFA 4WZAE 3H1TA 1W46A 4GZLA 3C8UA 1U0JA 4L5BA 4DDWA 2BVNA 3B8HA 3RRNA 1RKBA 5KSPA 1ZNWA 2ZJ5A 1VPLA 5B64A 2IXEA 3ZD6A 1PLKA 4JBWA 2OFWA 3MGCA 4Z8YA 1GNRA 2O8DB 2IUUA 3U44B 5K8LA 4NDZA 5LD2C 1KI8A 3T06B 1Z0KA 3LBNA 3WYFA 5H68A 3AF4A 3DZDA 1JALA 1CR0A 4GNKA 2ZAOA 4OHWA 2NZJA 4C7OA 2JASA 1NLFA 2GZAA 2OCBA 3GJ3A 3ZD7A 2GVZC 4MQBA 2FFHA 3IIKA 4G0NA 2OUKA 2DFKB 4B43A 5DO9A 1RVDA 4JLJA 4S35A 1XD2A 3NH6A 1WDTA 5D3MA 1Z3IX 1KO8A 1MO4A 2AFHE 3AUXA 1GFIA 1E2KA 5GVSA 1TTTA 2GCOA 1U98A 2W6ID 3TK1A 4IOJA 4LBZA 5BN4A 5A5GA 4G5QA 4Q66C 1NN3A 2H18A 1KTVA 1W0KA 2ECKA 2V55B 1NVWQ 721PA 4DDUA 4IEEA 1PUIA 1W36C 1E2IA 4BFYA 3L0IB 2ZJBA 5FUYA 4P4SB 4LHZA 1G64A 1Z28A 3AVVA 2OCYC 1RYHA 3MWJA 1E2FA 4A0GA 2PZFA 2ZRJA 2O8CA 1G7CA 2WIBA 1DVRA 1Z29A 1BS1A 1MT0A 2Q3MA 3D31A 4DCTA 2BM1A 2ZS9A 3PEUA 3TE6A 2O8BB 1KO7A 1TL7C 4YLGA 1Z22A 1LB1B 2C9YA 4B2PA 1P72A 1NG9A 3LVQE 4GP6A 2QP9X 3THOA 2PJZA 4OK5A 2IW3A 4NU0A 2WJVA 4BLQA 4ZPXA 4OKSA 2E87A 4XVQA 5AJWA 2ZI4A 4RFVA 4CDGA 1XMJA 4CZ2A 2EYQA 1MR3F 4TL7A 4Y0AA 5SZHB 1KNQA 2PEYA 2WHXA 2ZRPA 2JJ2A 3SYKA 1UKZA 5TV2A 2WJIA 1SHZA 3IIMA 1XMIA 2IF2A 2VP0A 1HURA 2A9KA 4KVAA 3AF0A 1D5CA 4BQSA 3AVOA 5IK2D 2O0HA 4HLUA 4GSYA 2A5FA 5EE5B 4JVLA 2X8AA 3K0EA 3K0FA 4HAVA 3CPJB 4PHFA 3CX7A 2CNWA 1W5TA 3THYA 1N0VC 4MKIA 3RS3A 1JECA 3FHTA 8OHMA 1GL7A 1GNQA 1FUUA 2OAP1 4AK9A 2GDJA 3KB2A 4QFMA 4N0DA 5FPYA 2D06A 2C78A 3IKJA 2D7DA 3WP1B 1RPZA 4KI0A 4D25A 1SKQA 1KZGB 1CKEA 1G7TA 1U99A 1YZLA 2XZPA 3QG1A 3T61A 1VYTA 2PMDA 4KLZA 4LV6A 5E95A 3TR0A 3I8XA 4JLOA 1ONBA 3LX5A 1XTKA 4V03A 1EX7A 5CYPA 5HCIA 2MSCB 3FHCB 1NY6A 3EXAA 4QRHA 1R7RA 1JNYA 4EJSA 2QQEA 5HKKD 1KDPA 2PZEA 5EJEA 1COWD 3ND9A 3GLHB 3KKMA 3RS4A 4DXAA 1TU3A 4QNMA 5BN5A 4AKGA 1G19A 1HUQA 3GFTA 2ORIA 1NLYA 1DEKA 3QPVA 1XMVA 1ZCBA 3AGPA 2QTHA 3M1IA 5FOTA 2WSSA 1Z6TA 3Q72A 4LBWA 1G4UR 2OESA 1CP2A 5DIFA 4Q9HA 4XVRA 3EX7C 1X1SA 1OV4A 4KODA 4KYIB 1QHHB 1NF3A 5G53C 4S2EA 4KV9A 3TLXA 1Y3AA 2PJRA 2IUSA 5EE9A 4ZIRA 3TNFA 2WOOA 1CJUC 1CULC 2BBWA 4A6PA 4JYCA 2V6JA 1KI6A 1LS1A 2C9CA 5DI3B 1PV4A 2YWEA 2HV8A 1NN0A 4AG6A 5C2JB 1G7SA 1Q12A 3K9GA 1IN5A 2IF0A 3QG5A 4MKFA 4QL3A 4D4KA 4TL9A 3LXXA 4MUBA 4XD7A 2P6NA 4G5OA 2PBRA 4LYJA 1XCMA 1ZM4A 2CK3D 2WPDA 3KZ1E 4XOIA 3LBIA 3FMPB 4R9UC 1S4QA 5E3HA 1ZD1A 4KVGA 4B73A 1F2UA 4A2QA 1VCOA 1GKIA 2ZUCA 1RRFA 4Q7MB 1D9ZA 1X86B 2QU8A 4EPRA 1P2TA 2P2LA 2YC4C 3AEZA 1YZQA 3NKVA 4BFWA 4CIDA 3O8RA 1MABA 2JDID 4D82A 3L0PA 3P20A 4L16A 1X8KA 4W7SA 4B74A 4UJ3A 4DLWA 3B13B 4PSKA 2FH5B 4GT1A 4DZZA 1YQTA 2FEOA 2GF0A 3BD9A 2F9LA 3AP3A 4PPNA 3RSOA 4ZCLA 5LD2B 3QVUA 3JZAA 1OH7A 1T3LA 1F2TA 2D62A 4TQ9A 421PA 2Q6TA 4PHTA 1L2TA 4Q1DA 1LS6A 3UMRA 2BBTA 4LYHA 4BASA 1W36D 4ZV4A 2WAYA 2YWFA 4JT2A 1JEEA 1HY3A 1E9FA 2H16A 4GMDA 4TMZA 3PR1A 1KMHA 4EQ6B 2WWWA 2ZE7A 3C7KA 3CPHA 1DADA 1I4LD 4WIAA 4W5JA 3KTAA 3RLFA 3LRPA 2WMNB 4DLZA 1UADA 3HR8A 1GSIA 1Z0JA 2DCUA 2JLSA 3P27A 3TSOA 1US8A 2SHKA 4E07A 2OSBA 4ERNA 1GAJA 3AVYA 4ZCIA 1P4SA 1YZNA 2I3BA 3GLGA 1Z06A 1CTQA 3DOFA 4NYJQ 3K0SA 1W36B 1JXOA 3K9NA 3W6NA 3SI7A 4DLYA 2BJWA 1G291 2GKSA 1CJVC 2QY9A 4HYYA 4M1WA 4NH0A 5G41A 3R9XA 1YZKA 2N1BA 1R5NA 4WZ6A 3GLFA 5UKDA 1KO5A 4TL6A 2WBLC 1E2DA 4Q48A 2C8VA 3AQ4A 2YHSA 4NBSA 3GJ8A 4DLTA 4BRUA 4HEJA 2R9VA 5F98A 4OQNA 1MKYA 1HTWA 5JJKA 2GETA 1XXHB 1RE0A 3KXIA 4FN5A 4IVQA 4RY2A 5K8TA 4C0KA 2G6BA 2HLDD 3DKPA 3CONA 2I1VB 4RZ3A 3ZS8A 4IFBA 4MYTA 4QM6A 2Q21A 1M6NA 2QAJA 1ZCAA 1E2NA 5HKKA 1G5RA 3WMEA 5JWRA 4PZZA 2XJ9A 1P2VA 4Q03A 2FZ4A 4OI4A 2J7PA 2HCBA 4M1MA 2MMGA 5C4MA 1Q57A 4RD6A 4KSCA 1DELA 2CL6X 1BH2A 2WJJA 3DKVA 4HDOB 3SQWA 2KJQA 3FGNA 3MJHA 4R98A 3NC1C 1ZU4A 2HT6A 5JS8A 4NYIR 2D2EA 3DOEA 2R6FA 1E9AA 2LKDA 3DEFA 3LQQA 2PL3A 1EFRD 3I1FA 3PV0A 4OJKA 4DDVA 2FE4A 5EQTA 2W2XA 4F4IA 4E22A 1GDDA 1KK0A 5AUNB 1DS6A 2BMDA 2KI5A 4OQLA 3GMTA 3ICEA 1CBUA 1DAGA 1ZU5A 3HPRA 4C0LA 1D9XA 1IBRA 1XDBA 3BB4A 4ARZB 2ZRGA 4PX9A 1I2MA 4Y0VA 1AQYA 2ZXUA 3REFA 2D74A 2WM9B 2WWFA 4YC7A 4NYJR 2R65A 2IS1A 2CJWA 2OXCA 3NBFA 2BJVA 5FI0B 1FMJA 3FDIA 2Y8EA 1AN0A 2GAAA 5FPHA 4HB4A 1RZ3A 3LFUA 4FMDB 1M34E 5L3RA 3ZZTA 1II0A 1OW3B 4IDOA 2V6IA 2QNRA 1NIPA 3SE0A 3VHXA 4CYMA 1AK2A 3QKRB 4E03A 1PVOA 3IHLA 4Z1MD 1GZSA 3AF3A 1NP6A 4XTCS 5J40A 4HLCA 2F3TA 4JSTA 4OI2A 221PA 5FI1B 3TKLA 4C0HA 1XTSA 3TUIC 3TVDA 2W6JA 2A5GA 5CIWA 2QBYB 4FCVA 2QGNA 3VAAA 1D2EA 1SHKA 3KKOA 3WMFA 3CLVA 1KK1A 1VECA 2WWHA 4KSBA 4C0BA 3KQNA 4I1UA 4BZPA 1OT3A 2PZGA 3OIYA 3NG1A 3X1XA 2VHJA 5LB4A 2OCPA 5FUWA 1UBFA 1P61B 2J1LA 4JVSB 2ASEA 2FPKA 5F3WB 3GJ4A 2IC5A 4PZLA 3GEHA 5DH9A 4HAUA 5FOWA 3WNCA 2VHCA 5HZKA 1IY0A 1IXSB 2W2TA 2ZQ5A 2XXAA 3CX8A 1EG7A 3OE7D 3X1WA 4BEJA 3TMKA 1J2JA 4C2TA 4OHYA 1YKSA 2FFBA 2GVDC 2P67A 1RIFA 5FOXA 3EZ2A 2FN4A 3ZIAD 2NOAA 2R6AA 1GKYA 2EQBA 2WJYA 3JVUA 4LV5B 1N3BA 2XOKA 1T8TA 4P4SA 1SXJD 4TLEA 3BGWA 3EG5A 3QNUA 5FR2A 1AM4D 1I4DD 2H8KA 4P31A 5D3QA 4QHSA 1E0JA 1TX4B 2ZE6A 3VKHA 3I72A 1WQ1R 2DY1A 1E79D 1TNDA 5P21A 1VCMA 5KPJA 2ZR9A 4OJQA 2W6IA 3CRMA 3CUEF 2XSZD 3VNUA 4FD2A 4LRWA 1ZIOA 4NMMA 4EKDA 1DAKA 4BFXA 4IFEA 5DHFA 2QENA 2F1HA 3P26A 5AJZA 1OFTA 4EPYA 1OXXK 4UQOA 1SULA 2ODBA 4MYCA 3NWJA 4EUNA 3CRW1 2WWXA 4B3XA 1XCGB 1SXJB 2OEPA 3ETLA 2XB2A 2VHTA 1AA9A 3Q9LA 3NEYA 5TMPA 4XSHA 5IHPA 4TTQA 1K5GA 3I62A 2NG1A 1SVIA 4LJ9A 1RJ9B 3B1VA 1OXVA 2W0SA 2ZIAA 2IYQA 1JR3E 2VP9A 4LUCA 2H7VA 3QY0A 5FBQB 2G1JA 1OIXA 1QBKC 2C5LA 5K8IA 4IRUB 4JJZA 1N5LA 3NH9A 3O8DA 4BZQA 2FX3A 1OF1A 1P2UA 4D0NA 5L3QA 2O8EB 4GOXA 4W5WA 1UKEA 5EXXA 3OEHD 1XZPA 2OE2A 2NIPA 1NY5A 3M0EA 1NLZA 4L15A 1WBBA 4M21A 1T3HA 4CW7A 1HQCA 2J46A 1GL9B 2QTVB 2GHIA 3LBHA 3EA5A 4D0LB 3GLIB 4ITRC 2AL7A 1G17A 1Y63A 5TARA 2NPIA 1G3QA 1NBMA 5IK2A 4ASUD 4CEHB 3BH6A 2R44A 2ZRMA 4DUGD 5JJIA 2ORWA 4JZKA 1N5JA 1WE2A 3DHWC 4NZYA 3TVTA 5KHOC 1TUEA 3RWMB 4GL2A 3A4NA 3PITA 4I81A 1VMAA 4JL8A 4Q7JB 4C0QC 1KDTA 4N3NA 2ZANA 1FP6A 3ND8A 3SYNA 4DB2A 3FMIA 2ZRAA 4DEXA 1FNMA 1RYFA 3W5JA 5JLJA 1XZQA 4UNRA 2ZJOA 1RRPA 2X19A 4KO8A 3C5CA 4N1AA 2GTPA 1CRQA 2G0TA 3GLHA 3EWAA 3UXMA 3AP2A 1ZP6A 3Q7QA 1N6NA 4BWYA 2IS6A 2PT7A 3BFKA 5KNDA 5KPDA 3T1VA 5CLLA 3P32A 3FHOA 1F48A 3M4YA 3HPQA 4RVCA 2GK7A 1W0JD 1QHHA 3CF0A 3MSXA 2CLCX 2EVWX 2GCPA 2P6RA 4A1FA 2MMCA 4ZI3A 2AFIE 2O0JA 1N5IA 1R10A 4OQFA 1E2GA 2IBMA 1HT1E 2J45A 2VQSA 3GJ0A 4Q4AB 5AUQA 3C14C 5G40A 3SZRA 3G0HA 3QQ5A 1MO5A 1XBTA 4DT1B 3UMFA 4TZ0A 1Z0AA 3GJXC 1W2GA 3RAPR 5KTYA 4OHXA 5EP4A 5HE9A 1KI7A 1T4GA 2ODNA 3Q5EA 4JKYA 2CVHA 3TH5A 2G83A 1II9A 4BE7B 5FBLB 3OF5A 4AKIA 3B9QA 5DYIA 2G88A 2GNOA 4K81B 2NO1A 2C04A 3ADBA 3Q7PA 1SVKA 2RGXA 4X8LA 1UKVY 3C16C
chains in the Genus database with same CATH superfamily
4Z3DA 4LVCA 4L8WB 1T36B 3IQIX 1X2BA 1WUYA 3CV3A 3IHTA 2H9IA 4MUGA 2BF4A 3K9HA 2HEIA 3B78A 3BCSA 2O0LA 4W8HA 3T7JA 4OJNA 1YUNA 3FCCA 3ENNA 1R6XA 4CEJB 5AJXA 1A97A 2BMEA 2O2HA 4FFNA 3AFHA 5BRAA 4DGSA 5HZHA 2YYZA 2UZ4A 3A27A 1UMBA 1ZVJA 2W93A 4R1PA 3I53A 3STVA 1WB5A 4D56A 3A0UA 3ON5A 4RFSA 4P0QB 4LZAA 4MCJA 4AYXA 5FTNA 4H3SA 4JJAA 1IXRC 4R5MA 4EA7A 4RLFA 5JI2E 4W9MC 1V5WA 2ZAGA 1PJAA 2BOVA 2Q8QA 5E6RB 1GCIA 4LDRA 4IGKA 4JELA 1NG1A 4IV0A 1ISSA 2OTCA 4MO2A 5HS4A 3EZXA 1AIPA 3PT5A 3E81A 1XWFA 1GCAA 4HDRB 2XUFA 2X2PA 3KWLA 5HRCA 3M4ZA 3FNGA 4YFVA 4Z9AA 3TW4A 4K6MA 3NHYA 5D87A 1G0OA 2H4WA 1IN7A 1B8PA 1JKIA 4ZOEA 3K8YA 1H3NA 4MR8B 2KX7A 2XA2A 2JIQA 4KQJA 2QLNA 4QYIB 1C3EA 3BXOA 2LD4A 2O57A 4NMWA 1WD5A 3FB1A 4FWTA 2XNDD 3IAM1 4BVBA 5CD1A 3ZGZA 3DDSA 4TGLA 1GPWB 4DMCA 3NJ4A 2ZUDA 1CIVA 4LNAA 2WKPA 5H4HA 4W5RA 4YNBA 5KS2A 2V1UA 4FHEA 4TS9A 2JCSA 5CDFA 2JAPA 3EZ6A 1Z4OA 3H5LA 4J0CA 1Q2UA 4O08A 3V4PB 4AQYB 3T1TA 2PD3A 3E18A 4IWNA 1V2GA 2IIPA 4Q19A 2FGJA 4JUDX 2JIOA 4OUDB 4A10A 1CIJA 3TVYA 1YK1A 4KFTA 1A82A 5DWQA 2TMGA 1P2SA 1PZXA 2H5EA 1SQ5A 4A2PA 1A8UA 5J9FA 2YN2A 5FWNA 3ZKAA 2DSTA 2NO5A 1BG6A 3L7AA 3PHHA 4ZAGA 1JLRA 3BIOA 2G1KA 5G1PA 5FB3A 3F7OA 2MWMA 2PK3A 3HKBA 2ZJYA 3TW8A 3MA0A 3TIXB 2NP6A 5CT6A 3L79A 5HFAA 3RC7A 4N48A 1H2HA 3RCBA 3R44A 3DLAA 4DA9A 3I5MA 3MMNA 3AM1A 4MIEA 2AD5A 4LS3A 4BV2A 5CW2A 1SZCA 5DRYA 4LKOA 2G9NA 4BLOA 3RYCA 1LW7A 3IUBA 4BX0A 1ACJA 3GEEA 1E1QA 1Y7LA 4PZ9A 2GXQA 2VJNA 1PZNA 3ACBA 3U3JA 3W77A 1P9WA 3OG9A 3B85A 4FFBB 4OSOA 3PGJA 4IHKA 4IKPA 1ODCA 2J07A 1W5SA 2DULA 3B2EA 3C97A 1DJQA 1YHYA 2YJ5A 2ZSHA 5AFSA 4AZ0B 2R4QA 2YC2C 3ZHOA 1BYUA 3VYTB 4H59A 5DX8A 5AUPB 2A7QA 2PSSA 4IFIA 1BTOA 1P39A 4EG6A 2EP8A 2PX0A 2PKXA 4ZALA 2GK6A 4RM2A 1UJNA 2I4NA 1OAAA 1YUBA 4KBGA 2IK8A 3CIOA 3I12A 1DBVO 1GNPA 5EQFA 1BE6A 3GUUA 4AU1A 4YV1A 4U8GA 1DXOA 2NAFA 4DA0A 3NTUA 1P4HA 1SA0A 4QJ5A 3U4QA 3WWEA 1IRXA 3CZRA 3PNBA 1LRJA 2H9AA 1JPNA 5KVQA 5THQA 4RV4A 4CKWB 4FOOA 3PZBA 3EVDA 4O2AF 4ZI7B 3EGWA 821PA 4GX2A 1WMBA 2ANBA 4IUDS 4D9BA 4B6EA 5E4FA 2J0UA 2O3JA 4TRNA 3TBKA 3U0BA 5M3BA 3V2UA 2XNKA 1M2FA 3HMQA 4CGYA 2I6GA 1V7CA 1WDWB 3B8EA 2GBLA 2XKAA 3L8HA 1GRRA 1SCUB 1EG2A 3G7UA 4YX9A 1GRVA 2VDWB 4MV4A 1EWQA 5IJ9A 1YBFA 1MN6A 3N07A 4I2VA 1TVKA 1ONPA 3JQ7B 2REQB 1K3FA 1Z08A 2NXNA 3ORFA 1NSTA 1P0QA 2DFLA 3FPAA 4AF6A 5KJ6A 1R0ZA 2ONJA 3EF0A 2NYAA 4UXIA 1TJNA 1E59A 3A9SA 3QXHA 1A7KA 2LXNA 3VZSA 3D5QA 1NE2A 2RHCA 3BBPA 5AJUA 2VYFA 2OCDA 3H5RA 3IBYA 1B8VA 1LQ2A 2AEMA 2EAUA 3ENWA 4UHHA 4MI9A 2ZIUB 3GVCA 3R09A 4B33A 1EX9A 1DCMA 1G55A 1N3LA 1EEXB 4M89A 3SHFA 3DLTA 4Z0TA 3R41A 1KJNA 4WX2B 3EEBA 2IYSA 4X41A 5B37A 1R5OA 4XFJA 2B99A 1DZ3A 2QVBA 4YI3A 2GAOA 2VRBA 3GCGA 1H1DA 1F1JA 4JI1B 3KO8A 4QUBA 4C6SA 1JFFA 3JRXA 5C1IA 1U3VA 2RMKA 3L6EA 1IDOA 4OSPA 5ALYA 2GZHA 4CUJA 1ZL2A 3HCPA 3PG5A 5IH3A 2NU9B 3ROEA 4J1QA 4F4JA 4MAAA 3DJYA 4QA9A 2ZR0A 1U6JA 3P0HA 1Y7IA 3I4CA 1BD3A 4QRIA 1WTCA 3A2LA 3AHFA 1DJNA 1KAMA 1OLXA 1X8LA 2IU6A 3A1VA 3OLZA 3CNNA 3QPAA 4BNJA 2N47A 1HLPA 2ZSIA 2ZRKA 5C7LO 5CDYA 4X24A 1FTWA 1M9NA 3AR7A 3WYAA 2WFAA 2VZLA 1D7AA 1KMQA 4G56A 4RD2A 4GM0A 3GLSA 2O0KA 4EHJA 2OHXA 4XW2A 3H6HA 4PF1A 3G2OA 3G2KA 2E1PA 3LUGA 3V1KA 4BAGA 3WIBA 1JDJA 1L7OA 5I9BA 2XNJA 1E4EA 1KGSA 3F6RA 4W5OA 1U0SY 3Q8KA 2XTZA 1NVGA 2JBAA 3C98A 2A3RA 1J25A 3H86A 4J1SA 4PZ0A 4XWGA 5KU7A 2F1JA 1PS0A 1UBCA 3ZK8A 3GYBA 4LI0A 3PRJA 3GEMA 2XADA 4TVOA 3T5DA 4DLRA 1U65A 1WEHA 4CM4B 2J6BA 2VQ6A 3DCYA 4G97A 3N70A 4JFRA 1GQFA 2ZZMA 3TWOA 1KHTA 1JXMA 1JKFA 1ZCZA 1PR1A 2YNMC 4L3OA 3F5FA 4RZQA 3S1AA 3N8DA 4ZYYA 3BGVA 3NATA 3R4CA 1X8XA 4W1SA 3LBFA 3TG2A 1IHUA 4A73A 2WJHA 4QELA 2VDKB 4ZOBA 4Z99A 2NUAB 5JFGA 2GN0A 3ZDDA 3FWPA 4RELA 3ZIAA 3SLRA 3ZCRA 2H65A 1NRXA 4R9VA 4QXMA 4TYQA 1O96A 3ZW9A 1XA0A 2CVQA 3V4RA 4UBJA 5FUQA 1CZOA 1WABA 4JLDA 1XCBA 1Q95A 3MXTA 1I5RA 2R1TA 1I4TD 2RB5A 2VF4X 2LDBA 2ZXEA 5BN3B 1QLWA 1WL8A 5AW9A 5L4LA 1O2DA 2RIRA 4UUOA 4ZQBA 2I78A 3TI9A 2D2XA 3VAZA 1N32B 2IOYA 2X40A 2HDNB 3SHVA 1V4VA 3W5IA 2Q4OA 2P9GA 2VPPA 2I4IA 1ISGA 4B3JA 4QM7A 1D2MA 1UFRA 1QE3A 1EDEA 3RF7A 2C2HA 4U6SA 2A5YB 2P2ZA 1G9XA 1KIFA 3EXFB 4QYXA 4LXIA 1VPVA 2Q2OA 1W9HA 1EE9A 3UKDA 1KYZA 1EQUA 2I6UA 3I73A 1ZPDA 4YACA 2W70A 3NIBA 1RWMA 4QAQA 5KX5F 4WZAB 2CHEA 4LQCA 2I7TA 2PAFA 2YV3A 2HV9A 5E7IA 2O8EA 1EFUA 4ARUA 3UWOA 3QF4A 3N5CA 1DTWA 2P6UA 4HKTA 3QWIA 3N39C 4NBRA 5JXJA 5CB6A 4TT3D 3LNCA 1QG4A 3O26A 4NOJA 2OWDA 3LM8A 4FR2A 3ZU5A 3BL6A 3W8DA 4ZZ0A 3U4CA 5EYPB 2H6EA 2PZJA 1D4ZA 3H3XA 4L8YA 4OLFA 1RI5A 2H7YA 5ISMA 2HWUA 1I51A 5CGZA 4RS4A 5EZYA 2MSEB 4CRWB 1IXKA 5T57A 2Y67A 3Q7IA 4RL6A 3NHBA 2VQEB 4R8KA 4WA8A 3LL4A 3N0VA 5DMHA 2KMLA 5DTQA 3KZOA 4I1RA 1W36C 1PEYA 4GR9A 3LX6A 4YRLA 3QUBA 3ZQKA 1E9BA 2GR9A 3LDAA 4PZDA 4B2IA 3GNLA 1E7YA 1SHUX 4JCOA 4JROA 4ZYXA 2ICAA 2OT3B 1SPXA 5DCLA 4OHUA 5JMWA 1UCFA 2B2NA 3W2TA 4BLPA 4YMHA 4GLBA 4ALJA 2ZI7A 4MR9A 5HUJA 2O50A 1FLVA 3E05A 3QSGA 3WL3A 2K7FA 1D1TA 4GGOA 4DR2B 4R1SA 2NUTA 3VDQA 4TKUA 4HGPA 3QPBA 1CEQA 2B7LA 3GGCA 5JBQA 4I4NA 4E4TA 2AK3A 1CXZA 4GR5A 4IHJA 2FQQA 2XWPA 3PE6A 2CSXA 2EC5A 3OIFA 4ZTUB 1J90A 1P4RA 1W4CA 2CDAA 4LJ6A 1QH9A 1Q6YA 4UZEA 1TQHA 4MPJA 4J0JA 4UCQA 3UV3A 2ZJ2A 2VTBA 2PGJA 3VOSA 2Q1WA 3EDCA 1RR6A 4JP2A 3ZCTA 2O4CA 3QWBA 4IXWA 4ZAZA 3U3MA 3GGGA 4Q4AA 2GZ3A 1UK9A 1VPDA 3BC1A 1HH4A 4H17A 1E89A 3WRVA 1CE8B 4A9AA 1ECPA 5DHUA 1EUQA 4OK6A 1FYDA 2B4AA 1OFHA 3EGDA 2ZUUA 4R69A 2X86A 4IDCA 1CUXA 1XTQA 1ZOIA 2NTYC 1LNQA 2D7JA 4IO0A 4PHCA 1SG6A 5CK5A 5IN5A 2VZ0A 1EDOA 1BHSA 2QL7A 3UTCA 1W1UA 3HKDB 1G5IA 3G2QA 3MGKA 3O3CA 3ZK9A 1IATA 4R2IA 1JG3A 1YQWA 3KFXA 4Y6LA 1O8CA 1FA9A 1OLOA 5AOBA 1J8VA 1UP6A 2RKBA 4ZOAA 1WUHS 2OHVA 4KN5A 3WGMA 3FI0A 2ODAA 5LOVA 5T6BA 1JHOA 3WI7A 3UIEA 3CSDA 3OZEA 4PFSA 5CP8A 4U7JA 1ZWLA 3T3GA 4ZD6A 5EJFA 3DZFA 3KE8A 4DDMA 1LK0A 5LP6F 3JYQA 1H2BA 2EP5A 3QLJA 3QI2A 1Q1GA 4WZBA 3VZPA 4TVSA 5AM3A 5LJLA 1UBOS 1XEXB 4QWWA 1JWAB 3BEOA 3JS5A 3U6KA 1I2ZA 2GYUA 1L8AA 3EIEA 2GEVA 4UDYX 1KWKA 2WE7A 1JAIA 4QUHA 5ALKA 1DKQA 2YJ6A 4YLEA 3TEFA 4JBGA 1XMQB 4NE7A 5TRTA 5EAIA 1KYVA 3EXHB 2P3SA 1FFXA 1KY2A 1IN4A 4X7BA 5TXGA 3N2KB 3K72B 3UB3A 2FWNA 2X2EA 2O2XA 4YUWA 4DB4A 3A9WA 1N36B 1D0SA 1OZAA 1ZUIA 3VZRA 4FOLA 5K0BA 1BMQA 1C3XA 1ORTA 5ILGA 1NFRA 1NQVA 3TFWA 3WSTA 2WU3A 4TWRA 4Y2TA 4ZO4A 4N8DA 4E5PA 1GPKA 3KALA 3KZVA 2JLVA 3G1TA 2YNMD 3JQ8A 5DW0A 2R8RA 4HXGA 2B6HA 2XMQA 1R9JA 2FSVA 2X5XA 3EDMA 4J2HA 1I0ZA 1FYWA 1OWPA 4L2IA 4C30A 4C4ZA 1XA3A 4EHFA 5B4TA 1UODA 3EFOA 1MJNA 2GLTA 4KXNA 3H9GA 1QR2A 3AR3A 3EEQA 3V1TC 2C88A 2JIDA 3VTFA 1WUIS 3LQKA 1ORWA 1ZM3A 1G3UA 1SCQA 4O2LA 3PQ3A 3UG6A 3DD1A 1R8JA 1C4OA 5T8KA 1E2QA 1PKXA 2Q3JA 5C8ZA 1SELA 3GJTA 3P0IA 2DEUA 3DHVA 4GOJA 3QU9A 4DQVA 3SYLA 2E4AA 1L5NA 3DXZA 3OZXA 4WEQA 3CLKA 3R0JA 5FQOA 2H48A 3REQB 1FTSA 1KI2A 2C4VA 2HL6A 1P0CA 2IHKA 3HP7A 1TCVA 1Z4IA 1Z75A 4IJUA 3W06A 1A8QA 1NIJA 4DLXA 2XNDA 1G5QA 4RCZA 1PJ4A 1Q50A 1FX0B 3FFBA 4IW3B 3IQEA 3GNTA 2M9MA 2XHZA 4IVRA 5IT4A 4O4JA 1IY2A 3TQQA 3VO8A 2WJ3A 4RJJA 1JIQA 3QLVA 1D1QA 3E7XA 3TRIA 3QKSB 3TFOA 2O8DA 1DC4A 1WU8A 3DAYA 3IUEA 4K1LA 4PPQA 1OI4A 4E13A 3TPZA 4HI0E 4XFKA 5LC1A 3AF6A 3AVWA 1M5UA 2G0NA 4W63A 5C1PA 3LO8A 3CVYA 2F3PA 1PR4A 4MKRA 5AH0A 3KV1A 2MYUA 5ALTA 5TF4A 2P8SA 1U8UA 1DJPA 3NYWA 4LXGA 4MGKR 4B40A 4CQMB 2QZZA 2UZIR 1MW9X 2Y0DA 1NQ5A 3NHFA 4GI1A 4I55B 4F72A 3RYIB 1P9RA 1IXYA 1ZJZA 1BE1A 4QGAA 4U9HS 3GF4A 4I5EA 4WKGA 5ENDA 2B7CA 1XDGA 4W8OA 2YZKA 4O5AA 1KEUA 1VIMA 2BEWA 1PQ4A 4MGEA 4ND6A 3EOAI 2H59A 2B92A 2ZJZA 5JEDA 5AK0A 2FNAA 4LRSB 2ZWMA 3KBOA 4J0GA 4TTTS 3RE1A 3SS8A 3LECA 2FQ1A 2GZDA 1P4GA 5LZ9A 2J30A 3V7FA 3QNMA 5CA0A 1SUSA 5A5FA 2O2EA 2PMKA 4L4XA 2DHEA 3PIRA 4GWLA 1KO4A 2O48X 1U80A 3NHSA 4RQTA 3G88A 2G71A 1YQDA 5TJHA 1P9LA 1IBKB 1PV2A 2IL1A 2OYCA 3ZZ0A 3K6JA 2CD7A 2VHYA 4J76A 4PPGA 4ZJPA 1F17A 1WB9A 1R4MB 3MS2A 1OREA 2WWGA 3UHFA 3J81k 4RGQA 1DEHA 2FPMA 2PL1A 2P78A 3QUSA 3QYPA 2PBZA 1T2NA 1KNXA 2E49A 1TQ4A 3DT6A 5EJMA 1EUCA 1YIAA 1BQ4A 1L4FA 3ESAA 4X8MA 1PZGA 4DIEA 2PQ6A 1E6KA 1R0KA 2LVBA 5JQWA 2ZCUA 2AYYA 4ZEXA 4G9GA 3ADDA 3BIFA 1SB9A 3OQMA 3K92A 1SOMA 5FL3A 3ZWCA 3EXEB 4D3ZA 3ZCXA 1LWNA 3FTQA 4EDHA 2PX5A 5A03A 1D5WA 2RGWA 1GGJA 4Q7LA 1Y33E 1T6YA 4EJSB 1J99A 2HCRA 3PPIA 3J7TA 5E0KB 4F8YA 4ALMA 2VDQB 5AXBA 1CRLA 1NVVR 3IPXA 4ZV7A 2R00A 4IQ4A 1YA4A 4PRYA 1WQ4A 2PKQP 4DPLA 5BSFA 4RKWA 4YCAA 1H0KA 2Q62A 4G5FA 2FX2A 3E3OA 2CMGA 3UW1A 1WY7A 5DMXA 3QEAZ 3E9NA 1NMYA 3ZDZB 3BWDD 3Q5GA 1W29A 1A76A 1DIOB 1SKYE 1EB9A 3FRJA 2F55A 3OZGA 2XTJA 5EHZA 2BY4A 4WOKA 3V8QA 2PUTA 1NKSA 1Z12A 3OZIA 4U7PB 1ODJA 1PR3A 1WCIB 3EZNA 5CLIA 5F7JA 5ALMA 1XZAA 2VAMA 4PZYA 4IIUA 1FDRA 4YRSA 1YR9A 4PVDA 1EZZA 1TF7A 3ZKWB 3K0HA 3QENA 3DVAB 1LPNA 3I1IA 5BQ5A 4YUVA 3LKBA 5EUQB 3W5CA 1U7DA 2HPAA 3GBVA 3KETA 2AMVA 1WVGA 2DPGA 1QQ7A 4ZKEA 4HY3A 2HZ7A 2RH9B 3NS7A 2ZRHA 3FCOA 4ZCRA 5CA1A 1C1DB 2O19A 3L2OB 4PRKA 1IQPA 2YHIA 3S7TA 3ED5A 4HAXA 2ZUTA 3LDFA 5GADl 4B3CA 2QSYA 4BNGA 5AD1A 1NVEA 1FP1D 1A9SA 4OYHA 1LZLA 3FSJX 1AKMA 3L4BC 4BU1A 1XDSA 2WABA 1PV1A 4CNQA 1LLQA 1FNDA 2Q5QA 2XBUA 4F96A 1AVTA 1MABB 3FROA 3K0BA 4AULA 3RABA 1L1QA 2QR2A 2SICE 2XRYA 2R5FA 4F46A 1CY0A 3U5TA 1L3IA 3HCNA 1Z6GA 4DSZA 3PBKA 4PG8A 4D5EA 1F9EA 4DPMA 1TQ8A 3WGYA 1B8NA 1KA9H 4EUKA 1NXPA 2CUTA 1LXCA 1GOTA 1ZX1A 1X7XA 4M1ZA 1VIDA 1ES9A 5REQA 1DCKA 3VPAA 2H2DA 1LPBB 2HADA 4LJ5A 1UWCA 2IODA 5K3BA 5KVAA 1T2AA 2O5RA 5IAJA 3LRTA 3BQ9A 4EI9A 4MRVA 1SVUA 3FJ1A 1FC0A 3PFBA 4R1MA 1UMCB 3WXMA 1N6LA 5FL7D 2CHVA 1L4YA 4HVAA 4U6NA 1Q1ZA 4F86A 3JV7A 3JWPA 1K3TA 3IR5A 1DOZA 2D5CA 3LF2A 1XCPA 1F0PA 1KR2A 4O59O 3GLKA 4BZWA 5IXSA 3WLRA 1KVRA 1RPNA 3I0NA 4N9WA 4WRRA 3R5JA 2AI2A 5LZ7A 5FD8A 5REQB 3RU9A 1B74A 1Y8RA 3HEBA 3W6PA 1XQ6A 2QNIA 3HS3A 1YRQA 1FQWA 2FDRA 2W7TA 3NRBA 2W2LD 3P5BA 1C0PA 4GUDA 3L0OA 4LXQA 3WBKA 1N9GB 3EUWA 4GKAA 5A4IS 3ORYA 4EJFA 1JFRA 3BCRA 3GLGB 1LC0A 2XHEA 2RKWA 4HWPA 5AK3A 1PL0A 1PZFA 3HFSA 2MYNA 1F0NA 1HQKA 5HFNA 2C0QA 4C3ZA 5K03A 4MVWA 1RQ2A 3QFHA 3L0CA 1QZ3A 2DVMA 3H5NA 1RVV1 3P0EA 1QXSA 3ILYA 3NP9A 4LXXA 5F1KA 2C77A 2HJWA 5CU7A 4HX2A 3IUYA 5AVYA 3AIMA 4M9QA 5HHTA 4GGMX 4PBRA 2ZU6A 2GRUA 1QH0A 3AKCA 4O63O 1KXJA 4M86A 4EA9A 3KUUA 3FYSA 3RHTA 1UZMA 2SCUA 3E3LA 3O82A 1RSZA 3EMDA 4IOKA 1NBME 3B2QA 4FEYA 3EZFA 1G16A 1ODIA 1XF9A 2WAXA 4GL4A 4IDFA 4JY7A 2AN3A 1Z6AA 4PZEA 3IOYA 1W0CA 5TMDA 4HRYA 2FJ0A 4EO7A 5IH7A 1YO6A 4XQGA 3WIDA 2BP7B 1KPIA 2W2KA 4LHYA 4RPLA 1OLUA 2DRIA 4NG4A 5D1HA 5IC5A 2H1LA 5TPWA 3VO2A 2NU8B 4TV8A 1Y4ZA 3N58A 4OB7A 4Q4CA 2HPHA 4TT3A 3FBGA 5L3SA 1HEUA 1ECLA 2WI8A 4YXWD 3DZKA 1NXVA 3FCUB 1EA5A 1NM5A 4I1YA 4PLPA 3ROGA 1U8YA 1F38A 4RD4A 3T3HA 1YULA 1TRHA 4A5OA 3KIPA 1R66A 1HF3A 3KOZA 3UT0A 4B76A 3LWZA 2EWWA 2QL9A 4FX5A 4IOLA 1VJ5A 4OGGA 1AHIA 1BKDR 1GT6A 4LPKA 2HXGA 5KYYB 3NHRA 2WKWA 1PGNA 4V0KA 1BA2A 5DULA 1XN1A 1ETUA 1EWYA 1DJOA 4BIIA 3KWJA 4QGSA 4P54A 3VU9A 3WGNA 4C29A 4C03A 1VCNA 2R7AA 3VQTA 3K73O 1IOZA 2QZJA 3LL7A 5CFMA 2R97A 2RCNA 5LQRA 1DAMA 4P36A 5FTLA 1MGPA 2NSLA 5FO0A 1SXHA 3H5VA 3MUEA 1JIKA 4Q3AA 4YGXB 1PR0A 1G41A 1QWSA 3PD7A 4YDSA 1C0KA 2C20A 3JYPA 5BR4A 3WV5A 5JS2A 3T9DA 4CL3A 2GASA 2NXCA 1TAQA 5CXQA 2P91A 2OA0A 3SHOA 2XQFA 3MTGA 4FFDA 2R87A 3KUCA 1LNSA 4HL6A 5FBRB 5FPSA 5DBOA 4NULA 3D2LA 4Z7NB 3FPFA 3IE0A 4E08A 3IQFA 1IQRA 5CAEA 1RABA 2LKCA 5HBRA 2QAGB 1E98A 5DU2A 1XEWY 3DKIA 2UV8A 3QXSA 1AS0A 2GEUA 1V71A 5EEGA 1BD4A 1W52X 2DPLA 4TV9B 3T9EA 1PTKA 2ES4A 5ULLA 5KO2A 3ISTA 1E0AA 2FPLA 3UZUA 4F45A 3ZCVA 2NW6A 2WM3A 4GXQA 1M8PA 4GPAA 1KQGA 4WCFB 3KDSE 3H65A 3KZMA 2IDMA 1ISPA 3Q8MA 1PTJA 1Q7EA 1OFUX 3OCXA 2OP0A 4HGZA 3QVJA 1MEOA 4QUKA 2CB0A 3K2QA 5IDVA 1K5HA 2RHOA 4HYTA 2MOKA 4D81A 3A31A 1SQFA 3QWFA 4RKFA 4B7AA 3I9JA 4UBLA 4DCNA 1L3BA 2OHGA 1YAJA 5I8ZA 4YAIA 2BM9A 4N9QA 4LSGA 4ZCPA 3SCZA 5J4HA 1ZBQA 1QOQB 4A8TA 4V1CA 5EWLA 8MHTA 3CF4A 1BH6A 1KAOA 2IWRA 4EY3A 5A0FA 5EIFA 1GUFA 4XOUA 2PN1A 2W2QA 2XOKD 2HJHA 5KYTA 10MHA 2H2HA 3A05A 3LH5A 3DE5X 2GLUA 1NMZA 4YA6A 2BONA 2YV5A 2RGRA 1ZOOA 2VJMB 3LW8A 5JT1A 1J1UA 1GUBA 2FPPA 4DLSA 5JNLA 2F8SA 4MUEA 1EB8A 1M1YE 2BFDA 5KBYA 3O47A 4LYYA 5K6RA 4EW3A 2JLUA 3L7LA 2QZSA 5LQNA 2BELA 2BN4A 3IQHX 5AYVA 3SJBA 2CXXA 2X0IA 4HUTA 1N5DA 4KJXA 4MRAA 4P84A 3UWSA 4RABA 4BCDA 3LP6A 1Z0FA 4MWEA 4YUYA 1R15A 3WDLA 1I1QB 4EY4A 1X70A 4ZODA 4LZZA 4QXQA 2C7QA 4HRXA 3OI7A 7ABPA 4Q1AA 2PX4A 3FETA 4I7EA 1BJKA 3FPSA 3SNKA 3ZQJA 3NHWA 4WBNA 3IC5A 4IIVA 5DN6D 1AS3A 2REBA 1EVIA 2EQ5A 2LIVA 5GMOA 2YNMA 3F78A 5DI9A 3R7LA 2G5GX 2JPDA 5GONB 3I3SR 5DZSA 3ZHVA 4RHTA 3HN7A 4IJ5A 2O06A 2SNIE 5CVCA 3UK0A 3ZY4A 1DXHA 2RJOA 4B3GA 4RMGA 3QE4A 1CR2A 5BSVA 1I2BA 2XB8A 2H1CA 2H4YA 5C5IA 1XZLA 2I7VA 3AHDA 3G0IA 3L5OA 4ZU1X 1Q6ZA 2BWJA 2QY6A 1O54A 1ZUWA 2Y4OA 2ZEJA 4HZIA 3DCJA 4K9QA 4RJKA 1JPUA 4AY3A 2RHMA 1DAPA 5IZCA 5FOUA 2L2QA 1A9YA 3RREA 3FDZB 2GMWA 5KQPA 1JAYA 3S5JA 4YCDA 2W6NA 3CLSC 3MWLA 1QPGA 2ONYA 4KMSA 1N92A 4UW9A 2HYDA 3CHYA 5C4IA 2PDAA 2KYRA 5G0SA 4ZHQB 5IYZB 3AL0C 4L8GA 3T3DA 1BX0A 5F9HA 2FUEA 1GZ3A 4DXHA 3LSTA 2QRMA 1II8B 1K0UA 1QZXA 2FUCA 3N0WA 4ZICA 1TA0A 1ZBDA 3IQWA 1NJ2A 5DBFA 2ZW9A 4LGMA 4FGJA 2JFXA 1RACA 5HQ3A 2FWPA 2Z9BA 3LWDA 5C4GB 1CR1A 1ADYA 5KSZA 1L5MA 5EGNA 2B1JA 3TZCA 2IYYA 4LZJA 3HY3A 3URMA 1L5YA 1LLUA 4MWBA 4F60A 2C7RA 1ID8A 4CCYB 3MGAA 3AESB 2AR0A 4MVJD 4BNTA 1IN6A 2IYPA 1KHHA 1J2RA 1PJBA 3M89A 1YR7A 4L1KA 3EAQA 4NE9A 3GAAA 4NU8X 1IZ9A 5BSGA 1MO2A 1Q1BA 2K87A 4J9UE 3SNHA 1REQA 1HLFA 1KU6A 2YWGA 4AICA 5IU6A 4Q39A 4JJ7A 3KT6A 4MAMA 1S96A 1W5AA 4YR9A 4TRRA 4CLDA 4MMZB 4BLRA 2P2GA 3OE7A 4BN0A 1ST2A 2CLMB 4UMVA 2QTRA 4G8DA 5ALGA 5FJJA 4EI7A 4OP3A 9LDBA 3KQLA 4NG5A 1ODLA 2HF7A 3EEFA 4DMRA 5FWYB 5KQRA 4MKGA 4ZI2A 3NTQA 3P9NA 2AXNA 3IAFA 2F1IA 2QPOA 3A2NA 3ETGA 1M8GA 3IT2A 3KOUA 5AI5A 5ALPA 1E9SA 3ZWYA 5HK8A 1U2DA 2GCGA 3UJAA 3LA8A 4NOKA 4B3FX 1ST3A 4X6XA 3PR2B 4DRZA 5IF9A 4LRXA 1FQJA 1R8QA 5JASA 2O5EA 3L7JA 4GQBA 4KQHA 3K16A 3DE2X 1DINA 1JB9A 1V45E 4JJEA 5DV9A 5JVDB 3BMQA 2A1IA 3ETHA 4U6QA 2NVUB 4BY9E 4MVJM 1OVGA 2EBFX 1X1AA 2OG2A 4MP3A 5LA6B 2DE0X 4OXNA 4QPCA 3UT5B 3MOIA 2XTNA 3O91A 3T6KA 1Z4LA 5IG2A 3GT0A 3WJ1A 3K53A 5J4YA 3UK6A 4JGGA 2DG2A 4PYKA 3MAJA 1OH8A 4C7MA 3T94A 1NLMA 1FUKA 2MSNA 3FMFA 4ZKDA 3KJIA 5CB4B 1EFPB 3UMVA 4OHZA 1FJHA 3Q3JB 5IKEA 4UC0A 3G8DA 4FYYA 4R7TA 2CXSA 3K5WA 5A9TA 3VJKA 3H8WA 4YRBA 2QNBA 1KI3A 4MPRA 4RCYA 5CBKA 4RF2A 1G8GA 3BULA 3ND6A 4HJXA 2YKGA 5DHTA 2ZROA 3TNYA 4IXMA 2NU8A 2F8TA 4KK3A 1VMIA 3HA2A 2KQUA 1KIAA 1W85A 2TS1A 4Z8XA 4I50B 1UK7A 2P9CA 3UPTA 1PYOA 3LKVA 2WNIA 3A3PA 1UEJA 4HB2A 4X6LA 4YP7A 4NZMA 2BZ1A 3DFMA 3EIFA 2D00A 4KIFA 3LSYA 3OJEA 3G2PA 2PZKA 3H4IA 4KQ2A 4MV5A 1X1CA 2JFGA 2P65A 2P6OA 4RMJA 4X0EA 2ZZNA 1PN3A 2A30A 2I5PO 5I4KA 3C3PA 4HAOA 4LG1A 4CV2A 4EQZA 2HWKA 3KQVA 3WLPA 3ZW7A 2E48A 1YE8A 4MIOA 4NWIA 1I5EA 3ULKA 3D6TB 2JI9A 4M7PA 4W1PA 2J6HA 3FGPA 3L0SA 3STHA 1XE3A 4D9KA 1N6OA 2JCVA 3WTCA 5JTTA 5HF9A 2ZRBA 2IYZA 2ZB3A 3BB1A 3CSSA 1C2TA 3RS0A 4F7WA 2XB6A 3LQYA 1AK1A 2WIDA 3FTPA 5KVCA 3RVNA 2PLNA 3JWHA 1NJ6A 2J33A 5A4AA 3A8TA 4Q4JB 5FADA 1YMUA 3HA5A 1A0OA 5CBPA 3H4MA 2EW8A 4CLRA 2JFOA 4MA0A 4PG5A 2QN7A 1XRJA 5HQJA 2VKTA 4H7EA 4AN0A 4YLYA 3DTYA 2AOTB 3QPUA 3WLSA 3KXPA 1SXJC 3PC4A 2IITA 3A1SA 4CM5A 1ZGGA 1ESNA 4Z4FA 3RRMA 5LNK6 1JDUA 2VHVA 4URYR 1TVCA 3KD2A 5JNRA 4DTIA 1VL8A 1WS6A 3D4OA 5A3QA 4XPIA 2DCMA 4KQGA 3QW2A 3ZNNA 4EZIA 2PV0A 1KF0A 5KTYA 2ZT8A 2JZNA 4FK8A 4BNFA 2Y0CA 3NEJA 1Z13A 1RZVA 1Q0PA 3IEMA 1V26A 3VR5A 3LOUA 3AEUB 5JD3A 3UATA 3BJMA 1M34A 5ESRA 1RKXA 2RBKA 1ZYUA 2CMDA 4YB8A 2HCTA 3WYNA 5FL7A 4LXUA 4HB0A 3MTEA 3GZNB 4CLEA 4F91B 2YRWA 3HSYA 1W1IA 3NUQA 4M76B 4Q21A 1R6BX 2FYTA 4X1IA 1PFGA 2OO5A 2VZ8A 3WG9A 3A1TA 5JS7A 4C20A 1V47A 1T36A 1H2EA 4MS3B 2I2CA 4B5LA 3O8NA 1T4CB 4Y1RB 3ER8A 1W30A 3JYNA 3SC2B 2YICA 1BGXT 4AZ3B 1NLUA 4D3SA 2HFJA 3OMWA 3VH3A 4CEJA 4E09A 1AQJA 1KMMA 3W2IA 5BVHA 4EHBA 2GJ9A 3MT0A 4LI3X 6PFKA 2PRYA 1P33A 2E4VA 3HU2A 3R3XA 4KFUA 4U2DA 2BR3A 5EZ6B 3U7FB 2ZI6A 3ILSA 4DHEA 4CDNA 1AK9A 3D7NA 2WIJA 4R2WA 2VYND 2Q6OA 5EFZA 1R8XA 5E6RA 3EWSA 1DWOA 5JY1A 5B1EA 4IJQA 4KXYA 1BOFA 1XJ5A 3HE3A 1LSSA 5K8VA 4OAPA 4MWZA 2FRDC 4Q6WA 4AJ1A 4HDRA 3HUTA 5ED4A 1OX4B 2Q5LA 5BOSB 3V97A 1RM5A 1VGRA 3CCFA 4HWSA 4D5GA 1E66A 2WOJA 4OGWA 5ALOA 1M1NB 2BEJA 1WKVA 4YP5A 1AA6A 1JDPA 1U5BB 1ZMOA 2EFYA 1QIJA 2WRZA 4MR8A 4L4UA 2C5EA 4PQEA 4JP3A 4UTXA 4AWAA 4ATNA 1B16A 2DQSA 2KWIA 2Y77A 3GVHA 3LF1A 5JWHA 4C4SA 3LIPA 1GCOA 3FUXA 3GJRA 4QYSA 4UNSA 4X1YB 2WMYA 1WQ3A 4BP3A 2XDAA 3HJCA 3PEVA 1BGVA 2CHQA 4JBXA 1U7PA 2A33A 1QIMA 4GBMA 4CFYA 2K7ZA 3G82C 4QJ4A 1Z39A 3DUFA 2QLJA 4YV0A 1K63A 3M1YA 4MQ6A 2HA0A 1VHJA 5ES4B 1J1ZA 4UDOA 1W4ZA 4HWOA 4OUDA 3MJRA 4YXWA 5MHTA 3W9UA 3TLYA 2JKYA 3CKMA 4J2TA 5BMOA 2MJLA 3W4JA 4DDTA 3FJOA 3MWGA 2XKBA 3PYMA 3I32A 3QVLA 4JI3B 2QJOA 1TUBA 1QGDA 2HF9A 3HDTA 5DF1A 4ZAFA 3MM4A 3I6QA 3G9QA 2FUNB 1F8GA 4FUTA 3ERCA 1IM8A 4TKZA 3MELA 3DHEA 1TE2A 1VYVA 5BORA 4BMYA 3OQBA 4DXDA 4IXNA 2QMUA 3O1HB 4LTNA 4M1YA 2CXNA 3E9MA 1FTYA 1Q0QA 1XLTC 1Z0DA 2AF3C 5JSZB 2Q2NA 3ZE1B 1MG5A 3L07A 2CLHB 1ML3A 2DHQA 4PO8A 4AXXA 1DIGA 4Z7JA 2GXAA 3ETNA 3A4TA 2QU7A 4RTJA 4X3PA 3TEMA 7REQB 1FJXA 3DMRA 3GWGA 4UNQA 3K31A 1NRJB 3RQIA 5LMUB 4EOGA 3ZWOA 2AOUB 4OHOA 3PCXA 2VF8A 4ZGBA 5J3JA 2VLIA 2VIIA 2FMFA 2JLZA 3LV8A 3QM1A 1CY8A 4U7DA 5JV5A 4YQFA 4YRPA 3DFIA 3X1KA 1H5QA 5JDIA 4AO6A 3IR7A 4KUHA 2HI0A 2JLWA 1J9GA 4DLVA 1HV8A 3MB8A 5JRJA 4I2NA 2WV9A 1YIOA 4KLNA 4MB0A 1XTUA 1JJBA 1T0HB 3QE2A 4RK4A 1G8AA 3CB2A 3AIKA 4WFJA 2X2FA 4LRTB 1WMSA 2HA7A 2QN6A 3E0XA 4H4EA 2IYVA 2GZ1A 2J59A 1KYYA 4F8JA 3IOBA 4RKYA 1CWUA 5EIBC 4EUSA 1UMKA 3AFGA 1XGKA 5A5EA 1GVHA 1MT3A 1YASA 2EZ4A 2ZDGA 4CKWA 3DDUA 2ZT7A 1A7JA 1Z8DA 2C3YA 4ZI7A 3Q7RA 2FB9A 3MTIA 1MMFB 4IJKA 3OOWA 3NBZC 4OCZA 4PQYA 3TIVA 2IOHA 3HCBA 3MMSA 2AZDA 1FMLA 3PQDA 4CFZA 1ZINA 4B4OA 3C7DB 4RD0A 4QXAA 4XXHA 2CL5A 2VDWA 3A1FA 4RTOA 5AW5A 3TN7A