3BRWD

Structure of the rap-rapgap complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
167
structure length
167
Chain Sequence
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gtp binding protein
molecule keywords Rap1 GTPase-activating protein 1
publication title The Rap-RapGAP complex: GTP hydrolysis without catalytic glutamine and arginine residues
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3brwD00
2XNDD 3MCAA 3SDZA 3RVBA 4OKSA 3RLFA 3LBHA 1A82A 5DN6A 4ACAA 1G41A 1G8YA 2F1HA 1F2UA 1QZXA 2FMXA 3H84A 4AYWA 3K9HA 5CB8A 1JEDA 1RJ9B 1U9IA 5DGXA 3VHXA 3PXGA 4DB2A 2YZ2A 1RRFA 5H1YA 3QKSA 1DADA 6Q21A 2QSYA 1WP9A 2OCYC 3MJRA 3HU3A 2ZJ2A 2YOFA 3FMIA 2GAOA 3ADDA 2ZVQX 3OE7D 1XPOA 1VCIA 4X8OA 4J0QA 5TMPA 2OESA 4M2LA 1G3UA 1TUIA 3CRQA 1YRBA 2RHDA 4JVNA 4DUGD 2MMGA 1J2JA 1JJVA 2QPOA 4HLDA 4TQUS 4NCNA 4BLTA 2GKSA 3Q72A 2NZ8A 2V4ZA 1XCPA 4MYUA 5L3VA 2XEXA 5TDHA 4AG6A 1RW4A 1EK0A 4OBEA 4DCTA 1DEKA 2BV3A 1ZNZA 2V55B 1COWA 1B0UA 5FOUA 2OAP1 1A2BA 2PLFA 1F2UB 4LJ9A 4G5OA 3MG9A 4I4LA 3U6BA 3L0IB 1M7BA 3VR1A 1N0VC 1ZNXA 2FFAA 1SZPA 5CYPA 2OEPA 4ZCIA 3AH8A 3QKSB 4TL8A 2XGJA 5LB4A 4QL3A 2YVUA 3P32A 3AP2A 5JSZA 1BYIA 2REBA 3LNCA 3W3AA 2EFEB 1XJQA 1OHHA 1NKTA 3W8RA 3QXSA 3CX6A 1H8HA 4V0ME 2A5YB 4B71A 2YWFA 4OHZA 4LJ8A 1G3RA 2D2FA 1ZW6A 2A5GA 3R9WA 3SJAA 4D4LA 2VL7A 4OJKA 4Q4AA 2JJ2D 3EZ7A 4AWXA 1P2VA 2R62A 3CM0A 2WSMA 4OHVA 2BMDA 5CM8B 3SU8A 2J0UA 5G3YA 3SJCA 1E0JA 4LHVA 5FL3A 1D5CA 4XTCS 2VQSA 4WVFA 2WJVA 3NG1A 2FA9A 4MKIA 4MYTA 1FMJA 2BVNA 3QF4A 5DYIA 4CZ2A 2AXNA 2GJ8A 2LKDA 3QBVA 1VYVA 2EFDB 1BO6A 3IIMA 5CLLA 4JBWA 5FBWB 3THOA 4TLDA 3I61A 1T8TA 2BJWA 3UWKA 2HF8A 2IF0A 1NIJA 2ZPTX 4A92A 5H8WA 4LHYA 4KJZA 4PQFA 2G83A 3ZZ0A 2WIAA 1SVSA 4HEJA 1KK0A 4Q66C 1KI4A 3OHMA 5J4YA 4C0JA 3N2IA 5CB6A 1MO3A 2DWOA 2FPMA 1X8JA 3PVSA 2WWGA 1W47A 3P27A 4Z51A 5L3QB 3DM9B 3OIVA 4Q4AB 4Z8YA 1NVWQ 2J0UB 5HCNA 1ZIOA 4BFSA 1PLJA 3T06B 1T4GA 1Q1QA 4OJQA 4TQAA 4A1FA 4ABYA 2G6BA 4M9QA 3B1ZA 2HUPA 3B82A 4PO8A 4Q48A 4KAXA 2JJ8A 3BIFA 3I1FA 1G5TA 4L8GA 1N6LA 4XOIA 3B7GA 3ZVLA 2ZI3A 1FL9A 1KTVA 5TXGA 3A1SA 4F4JA 2CL6X 1N5IA 3ECCA 1VPLA 2O8CA 3C14C 1N5JA 3UXMA 4BRWA 1DAMA 3IIKA 5KO2A 1NN1A 2NQ2C 4HYYA 4E07A 2XSZA 3S1AA 1SVIA 5FPSA 4AYXA 2UZIR 4YQFA 3DZDA 4DLXA 2FFBA 4I1SA 2CLCX 1G291 3FMFA 5EXXA 4U00A 5CM9C 4DCNA 2YWEA 1A4RA 4DT1A 3AGQA 3KQKA 3I62A 1LTQA 4A0RA 1GKYA 1R7RA 3C8UA 1DS6A 1D8TA 4C9BA 1BS1A 5GADl 1P61B 2VHJA 4GMDA 1EXMA 3LX5A 4RZ3A 2GEVA 2QTVB 3X1WA 3OFNA 2OUKA 3HU1A 2EYUA 4DLSA 5FOXA 3LXRA 4XJXA 2ODBA 2ZE6A 3KXLA 4C7OA 1Z07A 2E87A 4QJ3A 5SZIA 4D80A 2C77A 3SJBA 3CB4A 4PZYA 2QPTA 3LH5A 3RC8A 4AI6A 4LBYA 2QRNA 1JR3A 4NYJR 4AKGA 2C2HA 4N0EA 1SQ5A 1TQ2A 3UMFA 5UKDA 3S1AB 1XJ0A 5DN6D 2QAJA 5AJVB 1G18A 2ERYA 1IY0A 2PJZA 4U02A 1LS1A 4KYUA 4WIAA 3P4YA 4Q03A 4DT1B 1ZC3A 4U5XA 1UKEA 1ZD9A 2TMKA 5F2EA 5KUTA 2G0NA 4ZCLA 3CW2A 1IXZA 2IS4A 3E70C 3MWYW 4LJ4A 1OH5A 1U8YA 4MYCA 1KZ7B 4C7OB 4DKXA 1UF9A 4UQOA 4P4SA 1KKMA 1KO8A 3PUYA 5GJVC 3BB1A 3CH4B 4LZZA 5B2ZA 2RGBA 3ZIAA 3LO5A 5JI3E 1E3MA 3Q5EA 4QM7A 2FEMA 3AF3A 621PA 1OF1A 2GXAA 4HAXA 2ZYWX 3VX4A 2H7VA 3TUIC 1CTQA 4IVQA 1U98A 3CR7A 2CLSA 2ZI9A 4M1MA 1COWD 2IYXA 3PEYA 1J90A 5EE3A 2OG2A 3TK1A 4QXAA 2P65A 2QGZA 3KXIA 4A6PA 4D2IA 3Q7PA 3GD7A 3GLHE 2DY1A 2QU8A 2WOOA 3M0EA 4QJ5A 4CEHB 4UKDA 1YJ5A 2ECKA 4YMVA 1EFRA 4DZZA 5JWOA 1A2KC 1G4AE 2Z0MA 1YHNA 4G5GA 4OQNA 3WP0A 3K0SA 1KO1A 1ONBA 1Z5ZA 2AFIE 3BH7A 3GJ0A 3K9NA 5DE3A 1E0SA 4TL7A 5IHPA 1OHHD 2JDIA 1J7KA 3LV8A 1H8HD 4P4SB 2PZFA 5FTMA 1AK2A 5JS8A 5F3WB 1C9KA 1Y63A 3SI7A 4D0GA 3C15C 3H86A 5J4VA 1IN5A 1TUEA 3CNOA 2R6AA 3U2QA 2DFKB 5FOTA 4EPVA 3WYFA 2Z6VA 1M34E 2FEOA 1KYIA 4NYIQ 3EIHA 5AUOB 1TAGA 1V43A 2AL7A 2EWWA 5CIWA 1J8YF 5L3RA 5CDFA 4YDHB 1W4RA 3IPYA 1IN8A 2YOHA 2J87A 3AKYA 4OQLA 5H70A 4FXPA 2ZS8A 3W34A 3SQXA 1MRSA 1NVVQ 1Z3IX 3WYAA 5EE0A 2KSQA 5EUMA 1UBGA 3MRSA 3TR0A 4DIEA 3IQWA 1GNRA 4XVRA 2V7QD 5EZ5A 1OFIA 1QHHA 1G16A 4BEJA 2XB4A 2IEYA 3CF6R 3GLGB 1G3QA 2BKEA 2EU8A 2NPFA 4NYIR 1SULA 4LV5B 1MO5A 4L9SA 3AVPA 5EP2A 2OFWA 3X1DA 4L5BA 4HATA 3KKQA 3PQCA 2N46A 4IDHA 1OPXA 2GK6A 1N6IA 5FBLB 1YZQA 2OLJA 4MQBA 3BBPA 4M1KA 5EP3A 2QM8A 3H0KA 4DSOA 5ELXA 2BMEA 1OLOA 3B13B 4PQYA 3WMEA 2P3SA 3V4RA 2GNOA 4BZXA 4YLGA 4BFUA 1ZCBA 1Z0DA 2X77A 3GLFE 4TYWA 3QG1A 1CR2A 1P75A 3VR2A 2ZS9A 4JL8A 1G64A 2ZYTX 2V8OA 1XPUA 2QT0A 2IUTA 4H9GA 5KYKA 5GJCA 1XZQA 5JS7A 3C4JA 1S8FA 3G0HA 2FGJA 1TF2A 1Z22A 3AVOA 2JIZA 2NO9A 3OIUA 2Q21A 1N6OA 2XSZD 4URUR 2W6ID 1UM8A 1KDOA 4B2LA 1IXRC 2ORIA 4MKFA 2QENA 4QM6A 5FR2A 1KAGA 3REGA 3K8YA 2QMUA 3FDIA 3R20A 1KSJA 2VRWA 3KJEA 1UKVY 3K1JA 2P6UA 4LDJA 4YONB 3RRNA 1Z0KA 3N2EA 1KJWA 2QUZA 4DLVA 3K0AB 4NP6A 1G8GA 1FTSA 4PC2A 3ADKA 3OFND 2WPDA 2AK3A 4IFBA 3UIEA 3T1OA 1EX6A 3EA0A 1P2TA 3W90A 4EFMA 3W9YA 3UATA 5DO9A 4GDFA 2GDJA 2Q9AA 1R10A 4G5RA 4Q7JB 1AIPA 1FMLA 2NO6A 2WJIA 2CCGA 1E0KA 3OIWA 2YJTD 3K0FB 1P62B 1VHTA 1RRPA 2ATVA 1ZINA 5FI1B 2ANCA 4FMCB 4URXR 2QEQA 3UMRA 1YZTA 1JPJA 3BRWD 4Z8XA 5EXPA 1Q1EA 2Q3MA 3U3RA 4Q7MB 2PCJA 2IYQA 4GT1A 3QXHA 4KFSA 3QPUA 1JXMA 3D3QA 3X1XA 1MKYA 3DHWC 4XSGA 3FFAA 4MYHA 1P72A 3SBDA 4PAQA 5DSZA 5HTKA 4PXAA 1GOTA 1T6NA 4TYQA 1MABA 3OESA 1E9RA 1CKEA 3AF4A 2JA1A 1IBRA 2RCNA 4C2UA 4IDNA 2W2VA 1E9CA 4LC1A 3L0OA 4YXWA 4DDVA 5HR5A 2ZJBA 1E2HA 4NMMA 1Z83A 2GCOB 1W5SA 1M7HA 3ZIAD 3QEOA 4A4DA 1VG9B 4AK9A 1KAOA 3SQWA 2VP6A 4WW0A 1UFQA 3NVAA 1F5NA 1IY2A 4Q9HA 3AB3A 5LBIA 1RYFA 1QHYA 421PA 4JLKA 1RFLA 4NONA 1GP2A 1VIYA 1LY1A 5TB5A 4C0KA 1VKJA 1TEVA 3M6AA 3JZAA 4U7DA 4JIMA 2P2LA 2YWHA 1X6VA 4RD0A 4C0LA 3KZ1E 1D2EA 1XBTA 2J45A 1EFRD 3EWAA 4CIDA 3PEVA 2FSFA 2GXSA 2P0EA 2G9NA 1Q22A 3VMFA 4GOJA 2QMEA 3LWNA 4H1VA 4QC2A 1OSNA 4RFSA 4GNKA 1KI3A 3THYA 3I72A 1VG8A 2JDID 3PV0A 5BQ5A 1ETUA 5J47A 1KO7A 3MD0A 4K8OA 5KTYA 1E32A 1XU4A 1ODFA 4GZMA 1S4QA 3IHWA 1W2GA 5G41A 1XPRA 1IONA 3ND9A 2ZETA 4R71A 4D4MA 4W9MC 3EZ6A 3GJ6A 4POAA 4TT3D 3RRZA 2O8FA 1EWRA 1KI1A 4IVPA 3FWYA 4AKEA 4G01B 2D7DA 2E9SA 3ZVRA 1AQUA 2B8TA 2F9LA 1XMIA 5E4FA 2R44A 4B6FA 3QSYA 3U4QA 1CEEA 4R7ZA 2YC2C 3SS8A 2EYQA 4BECA 2WJYA 2BEKA 1OV4A 4O2RA 3GLIA 4A0FA 3SC3A 4LJ5A 1TPZA 4JJZA 2XXAB 1GNPA 1NY5A 3CF2A 1ZMXA 3IO5A 5M04A 2DFNA 1Z63A 3VQTA 2WICA 1OXXK 3CRRA 5FTKA 4TN1A 1AZSC 4ON9A 4PSKA 4F4CA 4XIGS 4UNSA 1SXJE 4PHHA 3WNDA 3EZ2A 2PX0A 3PIRA 1U99A 4PSAA 4ZPXA 2NG1A 5D3MA 4JS0A 2VO1A 4TLEA 4B34A 3KKMA 2NZJA 4TMVA 1RRGA 4NYMQ 721PA 1SVMA 2ZSAA 1YKSA 3NIBA 4BPBA 4QKQA 2GF0A 4JJKA 2GETA 3IHLA 1ZM9A 2ZTSA 1E2MA 3RRMA 4ZKDA 1NF3A 4Q4HA 1R4AA 4RD4A 1HTWA 1HYQA 1NSTA 1HQCA 1CR4A 3AUXA 4KFRA 1M2OB 3IQXA 1NLYA 2J7KA 2W58A 2WKQA 5G40A 821PA 3E2IA 2IYZA 1EFCA 2VTKA 2F43A 3TQFA 1KI8A 5KPJA 1XMSA 4L16A 2PT7A 3U44A 2VSXA 1XRJA 1XB2A 4ESHA 2CVHA 3H2YA 1CS4C 4NYMR 3WRYC 3B1VA 2DCUA 4ZIRA 1CU1A 2J1LA 2QGNA 5AJWA 4C0HA 4JT4A 1F2TA 1YR7A 1N25A 2QP3A 4B74A 4R98A 2PMDA 1E2IA 3BERA 2Z4RA 5E7IA 4IXMA 4O25A 4TWZA 2C9OA 3M4YA 5J4LA 1KZGB 2I4IA 2AKAB 3B60A 1XMVA 5JECA 2ZJYA 2G3YA 2ZQ5A 4LJYA 1Z6AA 1Z0FA 1KI7A 4DSTA 4LHXA 2F43B 2ZRFA 3AF2A 3ASZA 4MRVA 1UADA 4ESVA 4DLZA 3U44B 2GTPA 1IOZA 4IW3B 4RCYA 4EJSA 2IL1A 3QKUA 1TX4B 3CPHA 5HE9A 2B8WA 3HPRA 2WJHA 4OI4A 1FW6A 3VR6A 5JFGA 1ZVQA 3LBNA 4GL2A 3TE6A 1F2TB 5JJLA 3K09C 3E1SA 3HYTA 3ZVNA 4HB2A 1P5ZB 1P9RA 3KTAB 4Z1MD 3IILA 4N3NA 4WZ6A 1OYYA 1HE1C 2PX3A 2WJGA 2C9YA 3TMKA 2H18A 3QENA 5FTLA 2ZIAA 4M9ZA 3I32A 1WBBA 4LBVA 1XTRA 4JVSB 3GCGA 2C03A 1CJUC 2IYYA 2FFQA 1ZUNB 2QQEA 4WBSA 4HUTA 5KSYA 2RGDA 4A0GA 4KBGA 3B8HA 4B35A 3UANA 3FOZA 1R0XA 3LFUA 4E03A 1JI0A 2HV8A 1KMHB 2NO0A 4DLUA 4HLQB 4UNPA 5HPYB 1NMXA 1S3SA 4ZI3A 2O8BB 4B43A 2JCSA 4PO9A 1FX0A 3WXMA 3VX3A 3AKCA 3HJNA 1O3YA 1Q3HA 3A58B 2AK2A 4LSGA 1XXHE 4A2QA 3TVDA 3VKGA 2R6GA 3BOSA 5A4JA 2DB3A 5FI0B 5AK0A 1R5OA 2VSOA 3AQ4A 3AVVA 2QAGB 1GUAA 4IOMA 2O5VA 1NJGA 4QG7A 4OI2A 5AUQA 1NN0A 1WRBA 2ERXA 4ZO4A 5JJKA 2J5XA 2DWPA 1QBKC 4LGMA 5F9HA 5A5GA 2FZ4A 1KKLA 1QF9A 2CHVA 2BDTA 2JLSA 2EQBA 2IEZA 4LV8B 4P32A 3ZS8A 2FJUA 2QE7A 1DELA 5GVSA 4W5HA 1X8LA 4HAYA 5CK4A 3WNCA 2GK7A 1KIMA 3LW8A 5JCPA 2ZJZA 1LS6A 2CHQA 3CZQA 1NJFA 1FX0B 1G7TA 4PZZA 2QORA 5CJPA 2FNAA 2I1VB 5JRZA 3BORA 4G5SA 1ZAKA 1Z2AA 1ZD8A 3K09A 3NDBB 2IYVA 1Q44A 3BK7A 4TMKA 1JB1A 2A3RA 4NE2A 2O52A 3PEWA 3U5ZB 4OQFA 3TUJC 5L8VA 1S1CA 4OYHA 3KJIA 5TY0A 3C7KA 1QVRA 2RGEA 2BIFA 4W5JA 5K8LA 4CEIB 1VHLA 1N6PA 5C18A 1Q1BA 3PEUA 1A1VA 1NN5A 4PANA 3REFA 4ITRC 4H1UA 1II0A 2ZYVX 5FL7A 3TAUA 5KSZA 4AYTA 3I5XA 2JLVA 1ZM2A 3ADCA 2F55A 1KO4A 4DIDA 3IIJA 1CR0A 1YR6A 2AN9A 4I81A 3EC1A 4WOPA 3C41J 1RIFA 1TU4A 2QZ4A 2HCBA 4PX9A 4FCTA 4RCZA 4DCVA 1R0WA 1G19A 2KB0A 1WQ1R 4M9SA 1ZC4A 3EARA 3O8RA 4HLUC 1H8ED 2NIPA 3JZMA 2DWQA 1DBSA 1W36B 4QGHA 3ZVMA 2ANBA 3P1JA 2ZU0C 3A37A 3LVQE 4TTPA 1FQKA 5JI2E 2PBRA 1GL6A 1RKBA 3A4MA 4Q21A 2W00A 4R2HA 1E2DA 5L3QA 2ZUBA 3CF0A 1J99A 5HKKA 2NPIA 1P4SA 1HV8A 5C46F 3CIOA 4D6PA 3ND8A 2WTUA 3A4NA 2IS2A 3FHCB 2A5DA 3B85A 1D2MA 4LI0A 4QGAA 3FKSA 1OXVA 3TW8B 2VF8A 1OYWA 1P3JA 4M1OA 5DLQC 4HUQA 3FMOB 3UG7A 2VP5A 2P6RA 3ICEA 3RS0A 2F6RA 4GRAA 4KSCA 1XCMA 4JLVA 1PJRA 2W0MA 2I3BA 3RAPR 3NTUA 2RGGA 2IYSA 2V7QA 3ZH9B 1HY3A 1UKYA 1NIPA 1GRQA 2ZR7A 4LHWA 3U7GA 3KUDA 1UDWA 5HZKA 1R8QA 1Q21A 3A6PC 2HYIC 5BN4A 5C4MA 3KQUA 5FOWA 4M0LA 2SHKA 4TMTA 2IXGA 1DAFA 4JZKA 3VR4A 3ONWA 2G1JA 1U2RA 4AIIA 5E7MA 1Z47A 5FTJA 4PPGA 2KJQA 3T5GA 3THWA 2NOAA 1EFTA 1N6HA 3L2OB 4OQXA 2ZSEA 4DDUA 1QHNA 1YQTA 5TVKA 1EGAA 1HQYE 5K8TA 1J70A 4FCWA 4HLUA 4HUQB 4JVMA 5C2JB 2AD5A 2Q3HA 1T0HB 2JLZA 1D6JA 3O8DA 2BC9A 2VBCA 4KFTA 3GLHB 1KK3A 1NVUQ 4NKRA 1UKZA 2JLYA 4YMUA 4YDSA 1NN3A 4F91B 3AVTA 2A7QA 3VU9B 2VA8A 1FFHA 1T3HA 3KJGA 1CIPA 3NXSA 2W6IA 4RVCA 1YE8A 5J4HA 4A9AA 3W6PA 3AP1A 4LPKA 1E2KA 3A1VA 5KDLA 1NI3A 1JJ7A 3WBJA 4QGGA 2ODEA 2ZRLA 1UAAA 2QQ0A 3PFIA 4OK6A 4L4UA 5FPHA 2XITA 1Q3TA 3WMGA 1DPFA 4Y0AA 1PUJA 2ZS7A 4MRNA 2Q6TA 1II9A 3OEEA 4A36A 3GJ5A 3QXJA 3X1ZA 2OSBA 3QXCA 3THWB 1MV5A 3KL4A 5E95A 3GFTA 1OFHA 4WZAE 3HWSA 5AUPB 2ZR0A 2EW1A 2RHMA 3GFPA 1LF5A 4V03A 1S9HA 3B1YA 3EG5A 2O8EA 2IS6A 2V6JA 4EPYA 3BGWA 4E22A 4Q1CA 4A82A 1Z08A 2QE7D 1IJEA 2ORWA 2B21A 2CE2X 2QN6A 2IYTA 4MGKR 3TW4A 2XB2A 4LK2A 1WMSA 1Z28A 2ZEJA 5J5CA 3A4LA 2GESA 1L7VC 1TNDA 2JEOA 4QFMA 1XTJA 1OIVA 4CEHA 4ZCMA 4OHYA 2EWVA 5KHOC 1Z0JA 4JLBA 2GJSA 2XTNA 2ZRGA 4G5QA 3KKNA 1N5KA 2QI9C 4Q1BA 4PC3A 1G6OA 1XCGB 1G5PA 2QTFA 1L2TA 1T3LA 3T1QA 3SFVA 1Z06A 2YV5A 3L82B 4MRRA 4DHEA 1W4BA 1YRAA 1W36D 4KLNA 4PC6A 1CRQA 1ZU5A 5CLQA 1OXUA 3GLFB 2O8EB 1QG2A 5JEEA 1VG0B 2R6FA 1E2NA 1OW3B 2RGCA 3R8CA 1GFIA 4D4JA 3L8ZA 3I73A 1RZ3A 5FL7D 5BYJA 5LD2C 3VKWA 1XTIA 1DARA 2ONKA 2QPAA 1WA5A 4TYPA 2VPPA 1GRNA 1XF9A 2A30A 3LRPA 1WCV1 2VLIA 3T34A 4PQRA 4RD1A 1D9XA 2EVWX 2C78A 4ZDKA 2CK3A 4B3XA 4IDQA 2V1UA 2OXRA 4GBMA 1YZUA 2CDNA 2CVFA 2VP0A 1X3SA 2XAUA 3G82C 4TYNA 4LBWA 1LVGA 4GSYA 3T5DA 3VNUA 1W44A 1YU9A 2KBEA 1E9EA 4IHQA 1C1YA 3IO3A 1M6NA 3W8NA 1CJVC 1P2SA 2BM0A 4NCJA 3T1TA 3SHFA 3OEHD 3QKTA 2ZREA 5FPTA 4A2WA 1QHGA 3GLGA 2BWJA 4II7A 1W1WA 5F9FA 1FP6A 4Q18A 5E3HA 1ZYUA 1XMJA 1OB2A 1N6KA 4NHOA 3J81k 5IRCD 5HZHA 1W46A 2D7CA 3DM5A 3L8YA 3QY0A 4PTLA 2ZI7A 1PVOA 4MRPA 4TT3A 4HB4A 5HKKD 2XX3A 4TL9A 1G6HA 1W0KA 2ZE7A 4PPNA 3RC3A 1X86B 2ODWA 5K8UA 5LDDC 3AKEA 2ZI4A 2FGKA 2ZYUX 1IQPA 3HR7A 2WWIA 4V0NA 1NVXQ 1Y3AA 2BEJA 2C98A 3FKSD 3ZZTA 2FOLA 5DHFA 3DOFA 4EQ6A 1S2MA 3AF1A 1KHTA 1NLFA 4DLWA 4OI1A 4GI7A 4B73A 2H8KA 2HT1A 2N42A 4ZDWA 5J4KA 1MO4A 2HJGA 2OAQ1 4JLOA 3AKDA 4NDZA 4NCHA 1MR3F 2QBYA 2MSCB 4JKYA 4W7SA 5C1BA 3KJHA 4HAWA 3DKPA 1R0ZA 2ZROA 5KNDA 5CYOA 3N5CA 5KPDA 2AXPA 3HYRA 4UJ3A 1IJFA 1S9DA 1U0HC 3TGPA 1NVVR 2D06A 4MITA 2ZRIA 1U90A 2C5LA 3TSWA 2EFCB 4A6XA 1XJCA 3K0AA 4XWOA 4XSHA 2D3WA 1JNYA 4US1R 1P60A 2PLRA 5F98A 3LVRE 1G7CA 1LW7A 4Q9KA 2PH1A 3SYNA 4EQ6B 2REOA 2VHCA 3RHFA 1DAHA 2C04A 4GOXA 3EPLA 2A5JA 2F3TA 1AGRA 1GKIA 2BOVA 3K0FA 4MGYR 4PHFA 5EP4A 1P6XA 3LQRA 2OV2A 1A5TA 3PJRA 3CUEF 3K0EA 1XP8A 2OBMA 1E9FA 2QBYB 1NP6A 3K0CC 5LD2B 3GEIA 3NH9A 3U3OA 1K5GA 5JHGB 4LHZA 2ZRMA 2QM7A 1JR3E 3ETLA 3FVQA 4JSTA 2C8VA 1U94A 1YR8A 4F7WA 1KNXA 3BXZA 4EKDA 3TVTA 1NMZA 4KO8A 2JLRA 3OEED 1T5IA 3TKLA 4UJ5A 1K5DA 4FW9A 4IRUB 3SHWA 3QEJA 1TF5A 3MMPA 4EFNA 2OBLA 4AC9A 3KX2A 3GJ7A 4JYCA 2GCOA 2W2XA 2Q3FA 3D7MA 3F3YA 4F92B 2BHRA 3X1YA 3VTKA 4OI0A 1A7JA 2WWXA 2D2EA 2YNMA 3VKHA 4HAUA 4UNRA 1UEIA 3P20A 3ICQB 3EZ9A 1XD2A 2F9MA 2JGNA 4Z54A 1E2PA 4ARZA 1W0JA 4FMDF 1SXJB 3P4XA 4IVRA 3SYKA 4Z1MA 1G5RA 2FSIA 4RD3A 4ZDJA 3K9LA 1KI6B 4MGIR 1AM4D 3QJYA 5JLJA 3FE2A 1JPNA 3AEZA 3SN6A 1CF4A 1EFUA 3EC2A 1QHXA 4OK5A 1MO6A 2R2AA 3ZJYA 2VSFA 4KHZA 4GZLA 5D3QA 2ZITA 1US8A 1CJTC 3NC1C 1GDDA 4CF7A 4DLRA 3B78A 3U7HB 1KDRA 3RS4A 4EFLA 4PAOA 4C0BA 3A8TA 2X19A 1DTSA 5DIFA 4IOLA 2XJ9A 3PUWA 2OT3B 2MMCA 4PPQA 4V0OA 1ZIPA 3AVXA 4BFVA 2WZQA 2GVZC 1XTSA 3K0CA 2GZHA 4PC7A 1E69A 5EXSA 4EPWA 4FD2A 4ILEA 4DDTA 1XD2B 3CNNA 1AZTA 4ARZB 1RRCA 1XEWY 4KFUA 4V0KA 3Q5DA 1SKYE 2ZM5A 1GTVA 3NHBA 5DISB 3C5HA 4BLOA 1NLZA 2CK3D 2PT5A 3H4MA 1ZRHA 3BB4A 3QXXA 3C5CA 1VMAA 4LY6A 4KU4A 4M1TA 3LW7A 5AJXA 4WZBE 2XXAA 3DL0A 1VCMA 1NNEA 3RWOA 1B23P 1DVRA 2ZJ5A 1US8B 3NKVA 1I4TD 2J59A 3TJZA 4Y0VA 5CDFE 2IHBA 3NH6A 1XTQA 2V1XA 3UMSA 3Q9LA 1S1MA 3JVUA 5DI3A 1KOFA 4JT2A 2J3EA 3CO5A 3N70A 1AQYA 5DNYB 3MSXA 4AURA 4QGFA 2JLWA 1NY6A 3IDQA 5B64A 4FI3C 3CRW1 4IXNA 1W0KD 2GCNA 5EZ6B 3THXA 3FPAA 1TU3A 2GF9A 4M21A 3AV0B 3NDPA 3DOEA 2KE5A 1KMQA 1TQ4A 3D8BA 1SVLA 1TTTA 4JSYA 1Z0IA 1NBMA 1TL7C 4Q1DA 4FMBB 4P3YA 2JAQA 3L0PA 2ZRDA 1AS0A 3NHAA 3KUCA 4I99A 2OHFA 4CRWB 1SVKA 3V4FA 2FWRA 1HURA 1II8B 2AX4A 5J40A 1ANKA 1CULC 5DI3B 4P0TA 3ADBA 4TLBA 1MOZA 1IAQA 2DYKA 3B5JA 4FN5A 4G0NA 4MKHA 4OHWA 3W5JA 2FSGA 4LRWA 1WE2A 2O8DA 4UXHA 1HT2E 3ZZUA 2QAGC 3THXB 1N3BA 1XZPA 1H8EA 1E2FA 3KFXA 4TLAA 5C4GB 1KY3A 1PZNA 1XXHB 1E2JA 4GFDA 2BBWA 4S35A 4BZQA 4TTRA 4MGZR 4TMWA 2CE7A 2V54A 4Q02A 5G3ZA 2NO7A 4Q1FA 2FZLA 3OAAA 4QBHA 1XTKA 5EE1A 3Q3JB 3BC1A 4ASUD 2CNWA 4HB0A 3TIFA 2OILA 1JXOA 2VP4A 1Q20A 2YKGA 3GJXC 5L3SA 4KVAA 1FNMA 4B3CA 1XEWX 4CVNA 3FB4A 4BLSA 1J8MF 1G4UR 1Z6YA 1ZM4A 3QI2A 3QVUA 2FDCA 1AKYA 2W6JA 4B75A 5KNCA 1EWQA 5EUQB 3I8XA 1P9NA 3A36A 3KB2A 3LY5A 1OH7A 2AKYA 2O8DB 3FGNA 1SXJD 1XEXA 3KTAA 4LJAA 4LJ7A 2IWHA 2ATXA 2R6CA 3H1TA 4IKEA 4Q9JA 1K8RA 2QMOA 1E9SA 3BFVA 2VEDA 4RZUA 4N0DA 4LOAA 4BFTA 2XZLA 1N2CE 2AD1A 3FYHA 3W3ZB 4IDOA 3WNBA 4IOJA 4NZYA 1KNQA 4BQSA 1F6BA 4ZV4A 1FP7A 4LYJA 1RVDA 4V0MA 1KMHA 1KK2A 4L15A 1EFHA 2O8BA 3KKPA 5FBVB 5L3SB 2DPXA 2PCLA 5LPNA 1E9DA 2GJKA 4DEYA 4I1VA 3NBZC 1FUUA 2B7BA 1SHZA 521PA 2UVQA 2QAGA 1OB5A 1W4AA 2PMKA 4KVGA 2IS1A 2OE2A 1KI2A 5CIQA 3OIYA 1Z29A 1W0JD 4C0AC 5KNBA 1XEXB 1FZQA 3IEVA 3TSOA 5BN3A 1JEEA 4EAQA 3AVWA 2GVDC 5EE9A 1W36C 1KSFX 4DBLC 1GAJA 3I4LA 3NBFA 2OCBA 3PITA 1G8PA 1LF0A 2HLDD 3UG6A 1Q0UA 4URZR 1S96A 1CP2A 1L8QA 4NH0A 2IT1A 1SGWA 4LYHA 1W5TA 3B1XA 4O2LA 4Q4JA 4MA4A 2A9KA 4K81B 1GWNA 3AM1A 2RGXA 2CL0X 3EIEA 2WVJA 1HEIA 4RKFA 4C0SA 3CONA 2WAXA 1TEXA 3U60B 1AJEA 4D26A 2PEZA 1ZP6A 1G8FA 2XZPA 4DCSA 3K70C 2GBLC 4B76A 4NU0A 4CEIA 3F0TA 3GP8A 2PJRA 4RKEA 4LWZA 1M74A 1X8KA 1MRNA 2IC5A 3LXXA 2LCFA 4PHTA 4A2PA 2H92A 1RE0A 1TMKA 1G8HA 1ZM7A 2HDNB 1P2UA 3FMPB 3GFOA 2OM2A 4BLQA 2HXSA 1XD8A 4Q4JB 3FKQA 4M1WA 1I4LD 2C9CA 4BASA 3GPLA 3GLIE 1YZGA 2P5TB 4PZLA 2GZDA 4B48A 3OZXA 2C95A 4HLCA 1N5LA 2WKRA 1JAIA 2ZAOA 3IBGA 3D31A 3IEUA 3B9QA 4R2IA 1E94E 2W0SA 3TQCA 3CPEA 4HAVA 1BMFA 1KJYA 3I3SR 3EXAA 4Q5IA 1DAKA 1VECA 1XWIA 1AS3A 1E2GA 5SZKB 3UWOA 1NBMD 4F93B 1E1QA 2Z5FA 1ZBDA 4MDFA 4P31A 3W6OA 1W2HA 1W7AA 3CH5A 3X2SA 5IK2D 2D62A 1UBCA 2PZGA 3QPVA 1TADA 121PA 2CBZA 2OCPA 4HI0E 4XWKA 2FN4A 3ZLJA 4MDEA 5GJBA 2ZUCA 3CLVA 3WMFA 3EIQA 2K5UA 4US0R 1L4UA 2EFGA 1HE8B 4LYFA 4QBGB 2ORVA 1GKUB 3MUFA 4IOKA 1WB9A 2JLXA 2B6HA 2GBLA 2XOKD 1XNJA 5EE5B 4JLNA 2B7CA 5KU1A 3GMTA 2QROA 3OEHA 3Q85A 2Q0HA 4HAZA 4WXRA 1F60A 4LX0A 1CBUA 1O87A 2C96A 4XTRA 4AY2A 2YINC 4QHSA 5JRJA 1E2EA 1I4DD 1T91A 3OAAD 4GOKA 5AJZA 1RC8A 5H68A 2CNWD 2RKOA 1N0WA 2P67A 4P33A 5IT5A 2OFOA 4NL4H 3T15A 2NO1A 3U3MA 2AWNA 3CRVA 4DEXA 2ZSBA 3C16C 1YZKA 3BFXA 3GEEA 1Z6TA 4R9UC 4BZPA 4B33A 1E99A 2FE4A 4Q7KA 4BFWA 5JCZA 2BCGY 2X2EA 3M1IA 5HCIA 1NG9A 2OZEA 2W6JD 4BFXA 1NG1A 4RJLA 2MSEB 3VHLB 3TLXA 4RD6A 3BS4A 4BE7B 1VYTA 4KYIB 5FBQB 3MJHA 3QPWA 3GLHA 3K70B 2Z83A 3MWLA 5CJ2A 1OT3A 1XDBA 1AS2A 2IXFA 4W5WA 1OH8A 3MLEA 4QRHA 4D0LB 3VU9A 1ZNYA 2Z4SA 3NBXX 1N0UA 5KDDA 2RGNC 1E1RD 1KDPA 2WIBA 2Q9BA 3SOPA 2FU5C 2J9RA 3QQ5A 4JMPA 2CHGA 5TARA 5FTNA 3QUSA 3U3JA 2BBOA 3QIAA 2KBFA 4URYR 2A2ZA 4A8JC 4Q1EA 2AWOA 2GEUA 2QRZA 3PENA 5FOSA 2JATA 2WMOB 1GILA 1XX6A 3QE0A 3LQQA 1T3SA 5B30A 4JLJA 1AN0A 5A0FA 1M8PA 2E1RA 2VHUA 1GNQA 2XTZA 4PAMA 5JSZB 1ZNWA 2ZJ8A 2HCJB 3CRMA 4US2R 1GRRA 4UXIA 1NSFA 4ZI2A 3VAAA 3IGFA 2FV8A 2ZRHA 3PUVA 2YYZA 2Q9CA 4B47A 1E9BA 2F7SA 2ZRBA 3VR5A 1X1SA 4HDOB 5BXQC 1GITA 2XNSA 4TSFD 3CWZA 3NBYC 2CJWA 5FUVA 2QTHA 2LWIA 1GG2A 2WBLC 1CJMA 1NRJB 5FFMA 3QF4B 4DJTA 3EA5A 4EJSC 2VHTA 4QOSA 2QP9X 2GXQA 2VYFA 3DZ8A 1SHKA 3R9IA 4LV6A 5ANRB 1E2QA 3G5UA 1P9WA 4YMWA 3FHOA 3DDCA 3MFYA 1KJZA 4B3BA 5JWRA 4Q4LA 2JLQA 4X8HA 2JASA 2WWWA 4DVGA 1N6NA 4JLAA 5FUYA 4D0NA 1ELOA 4JYBA 2YHSA 1JECA 4Q7LA 5FUWA 3EPHA 3RSOA 5FPKA 4JVLA 1WF3A 4DWJA 3LAWA 5GJWC 1U8AA 2C99A 3QBTA 2FH5B 2QMHA 4BRUA 2RGNA 4NYJQ 3GLFA 1KI9A 2CJWB 3KQNA 4RZ2A 5FOVA 1BH2A 4AKHA 4QJ4A 3R8FA 4TQ9A 2A5FA 3BE4A 3EW9A 1PLKA 3QVVA 4A8JA 4C0QC 3RS2A 8OHMA 2QY9A 5BWMA 1G9XA 3CR8A 3I92A 4DCUA 1Z8FA 5BW8A 4B3GA 3T12A 3JVVA 5BN5A 3ASYA 1K6MA 2FPLA 2F1RA 1T5LA 3TBKA 4EPXA 1GM5A 3R9XA 5KSOA 1E6CA 3DVLA 1NL3A 1OH6A 3EZFA 2ZRKA 4ACBA 1FQJA 1OFTA 4B32A 2WKPA 1DO0A 2O8CB 3IPXA 5DI9A 2F1IA 4QHTA 1IN7A 1SKQA 4JBYA 3NC0C 5IF9A 2J0SA 3A1WA 2FSHA 1ZM3A 2VP2A 1UBFA 3CNLA 4URWR 4M8NE 3MAAC 1AA9A 1BMFD 3VR3A 4N1AA 5EQTA 2WV9A 1IM2A 1E1QD 3U7FB 2H16A 3CX7A 1KK1A 1R6BX 1BKDR 4A8JB 5FPYA 1I2DA 2QT1A 2ZJOA 2RGAA 2Z43A 3RSLA 3ZS9A 1U0LA 3QF7A 4NPHA 1UEJA 4KBFA 2KI5A 4PR0A 4BFYA 4TTQA 2ODNA 3VNVA 3L43A 3CX8A 2WWFA 1ZUHA 3AVUA 3L0SA 2ZJAA 1IN4A 2CLDX 2VHQA 4LCBA 3K70D 4BEBA 3KB1A 1IY1A 5DHAA 4HDQB 2J0QA 2WSSA 3GJ3A 1PLLA 2ZE5A 4HSEA 2IYWA 3BJIC 1OJLA 2WM9B 3LLUA 1R5BA 3EAQA 4GP7A 4O3MA 2G1KA 1NMYA 3AF0A 3GEHA 2R9VA 1L4YA 2VIIA 2H17A 1H65A 1YVDA 4B3FX 2XZOA 3KKOA 3O8CA 4FMCF 4TYYA 2HT6A 2G0TA 4OHXA 4PC1A 2QA5A 4FIDA 1Q1ZA 3RNLA 3T35A 4QBIA 3V00A 5EJEA 3Q7QA 1IHUA 1SXJC 2FG5A 1OIWA 2YC4C 1Z6GA 4GMXA 2ZSDA 4BLRA 2PZEA 1JAHA 4UNQA 2ZXUA 1KY2A 2ASEA 2D4HA 2VF7A 3WBKA 2V3CC 2ZRPA 1G7SA 3D6TB 1E2LA 4ZKEA 1IN6A 2YWGA 1CRPA 2R65A 5FBRB 5EP1A 4C4PA 4LPSA 1CXZA 4DSNA 3ZD6A 5IDVA 1ZUIA 4XD7A 1RPZA 1G1MA 3WHLA 2OO7A 1WDTA 2IA5A 4IEIA 4LYAA 4P4UA 3QNUA 2V6IA 3AVQA 2WAYA 1VYUA 1DG1G 1SVWA 3AP3A 2WHXA 2IYUA 1Q12A 4X8LA 4JLDA 4A0HA 1DE0A 1P73A 4IFEA 1HH4A 1R8SA 3T61A 2IBMA 4DXAA 2CXXA 1VTKA 3EX7C 1G20E 3LA6A 5SZJA 1YZNA 4FWTA 3FHTA 4TZ6A 4ASUA 2WWYA 4WXPA 4KV9A 4B44A 4DDWA 5BYKA 1QRAA 1SKYB 2GJ9A 2RAPA 1T8UA 3RANA 3LD9A 3WP1B 2GEDA 1KO5A 3WY9A 4DC9A 4B2IA 1U81A 4PFSA 4S2EA 2W2TA 1FNNA 5GVRA 4EIWA 2QL6A 3WRXC 4QHYA 2L0XA 3HDTA 4CDGA 3VFDA 1EX7A 2R6DA 2ZRNA 2NMVA 2GILA 2IYLD 2IUUA 1SXJA 2GRJA 2IK8A 4X8MA 3FFBA 4I1OA 2D74A 5JJIA 1KSHA 5KOYA 1KI6A 4Q47A 1Z2CA 2ZUDA 1JBKA 1TF7A 2GZAA 1GZSA 3ZDQA 4P4TA 1QG4A 2DBYA 3E5HA 1QHHB 3EPJA 3A1UA 2GXUA 4URVR 1V5WA 2BCJQ 2IF2A 3I8SA 1ZCAA 4BFZA 5KDOA 1LV7A 4FWIB 4Q00A 3W5IA 4JBXA 4YMTA 3TUZC 1GL9B 2BMJA 4Q19A 1JALA 2OXCA 1DAEA 3IUYA 1NKSA 3KXKA 2G77B 1X1RA 3O8BA 3BH6A 3EWSA 4L9WA 1LB1B 3PUZA 1PV4A 2OCAA 3OF5A 3RWMB 4XVQA 2GAAA 1GSIA 4O0MA 1HUQA 4QNMA 5JEDA 2V9PA 2OFXA 3QG5A 4K46A 4RY2A 3V9PA 4MRSA 5G53C 1C4OA 1N6RA 4DRZA 2N1BA 3SZRA 2R8RA 2PL3A 3MGCA 3ZD7A 1BYUA 5EXTA 3ZQ6A 4C3ZA 2F1JA 2QNRA 1ZD1A 2H57A 4BUJA 1JR3D 2HLDA 2P5SA 3GJ4A 2CCKA 2O0KA 1S0UA 2HJVA 2J0VA 4M22A 4TL6A 2XTMA 1TQDA 2OLKA 2UZ3A 1UDXA 4MH0R 3B6EA 4MUBA 4CT5A 4C2TA 3SBEA 1WBDA 3RDPA 2AFHE 2WOJA 5HE8A 2XJ4A 4D25A 5JWHA 1T0JB 2BBTA 4V0LA 1OXTA 4IEEA 2A78A 2LKCA 1OKKA 4MKGA 4G1UC 4PO1A 4UNNA 2BMFA 4HZIA 3GLGE 1BIFA 1IXSB 1E4VA 4OL0A 1QHSA 1ZU4A 4KODA 4YMSA 3I5YA 1DOAA 4RSGA 4QBFA 3AVYA 3CZPA 2ZRCA 3SEAA 2DR3A 4ZDIA 1G17A 5FR1A 3TNFA 3DMDA 4GP6A 4PSVA 2O0JA 3DMNA 1XFAA 2WJJA 2AHOA 1W4CA 1II8A 1E79A 1QDEA 2REXB 2WSSD 1KGDA 1QVAA 4DLTA 4OQMA 1QHIA 2GWHA 4BWYA 1M1YE 1OE0A 2J7PA 3QKRA 3Q8XB 4D82A 3UPUA 4RD2A 2X1VA 2B92A 3BB3A 3TH5A 5DH9A 5TV2A 3LLMA 3NWJA 4WA7A 2RH5A 2BM1A 1G3MA 3B1WA 3HPQA 4XWAA 5AWFC 4EDHA 4M4SA 1XD9A 2JJ1A 4HDCA 1AKEA 2XNDA 3AGPA 4CW7A 3TR5A 3CBQA 3T1VA 2GHIA 1XXHA 1MABB 1FPMA 1UBEA 1VIAA 2CMKA 4F38A 4FCVA 3SE0A 2Y8EA 1UPTA 2MSDB 1FTNA 1HA3A 2RB4A 4KSBA 3BWDD 5JBQA 1I2MA 3PR1A 2YOGA 4KITB 3CKLA 2O0HA 3PUXA 1KSGA 1D2NA 1R0YA 4CYMA 3KQHA 2BJVA 5IK2A 1BOFA 3TSZA 4CEJA 1MH1A 3DKVA 3SNHA 3OE7A 2HEIA 1F3OA 4CT4B 2J46A 3IKJA 4XD7D 1M7GA 3U7EB 4IJMA 3QKRB 1P7CA 5JHHB 2X2FA 3TRFA 4NCKA 4D4KA 4DUGA 1VDZA 4DB4A 3F8TA 2WMNB 2UKDA 1Q57A 2XOKA 4JL6A 3KFVA 4LUCA 1AGPA 1E96A 3B2EA 5DYGA 3K53A 2CCJA 4M1SA 4DLYA 4I1UA 4RFSB 4UXJA 4B2PA 4FINA 3BD9A 4LBZA 3THYB 1DG3A 5KSPA 3WHKA 3DPUA 3LBIA 2EFHB 4Q9LA 4JL5A 1ZJ6A 4TLCA 4A15A 3HP1A 3KQLA 4NCIA 1GVNB 2WWHA 3B9PA 4PHGA 4CEJB 3U6KA 4FMDB 4HZUA 2O8FB 3P26A 1CR1A 1VCNA 3R7WA 4BLPA 3FTQA 4B6EA 1YR9A 4V02A 4LJ6A 5FH9A 5K8IA 2ZSFA 2GA8A 2FX3A 4NTZA 2ZRAA 1E98A 3MWKA 2IX3A 5CK5A 3U4QB 4HB3A 2DFLA 1FUKA 2AR7A 1GIAA 2HYDA 4JLPA 4KLZA 3ZQJA 3SYLA 3DEFA 1G7RA 1E4YA 2JJ2A 2GJAA 3GLIB 4G3XA 2VP9A 1GL7A 5B57C 3DO6A 2IHYA 2IYRA 2QG6A 2DHRA 1D9ZA 5JZVA 1E1RA 2ZE8A 1TQ6A 4XVUA 3EASA 2JIZD 3PCRB 1ESNA 1KDTA 2CEAA 4TMXA 5P21A 2QP4A 2ONJA 3ZGXA 3WYGA 3HR8A 5D3MB 2X8AA 2ZU6A 1VCOA 3NEJA 2J41A 2IWRA 1G3IA 3K9GA 1RYHA 4AKIA 3UK6A 3F5FA 3MWJA 2P6NA 1UJ2A 2I1QA 4HZUB 3R7WB 3UKDA 3GJ8A 2G88A 4Q4HB 2F3RA 4ERNA 2BBSA 2ZRJA 4BGDA 1SVOA 2W83A 2ZAMA 4WAUA 3QOFA 1FOEB 3SFZA 1E9AA 1W48A 4QNRA 5AUNB 2PEYA 2WPDD 3RS3A 5LB2A 1Z0AA 2IXEA 4TSFA 3IBYA 3LDAA 4YC7A 4Q9IA 3BH0A 3RS5A 4KCGA 4EPTA 2IW3A 2OBNA 2DFTA 1JR6A 2BKUA 2RMKA 3A1TA 1E0AA 4M9XA 1F48A 1OXSC 3CPJB 4KI0A 4JKIA 4M53A 4ZIRB 1OFUX 1U9IC 4CGZA 3RRYA 3TAHA 4M1YA 3SR0A 2ZANA 3PG5A 2QSZA 1DAGA 4PPFA 4LC0A 1R5NA 1CLUA 1LNZA 3HU2A 3W6NA 3ZYCA 4Q1AA 2ZR9A 4DSUA 3O47A 1JQLB 3NEYA 1HT1E 1OIXA 2FPKA 2VH5R 3LX8A 4EPRA 3EPKA 1WXQA 3CWQA 1DAIA 2H1LA 3KDSE 1U0JA 1EESA 1ESMA 1Z6XA 4JLMA 4B3DA 1OKKD 3BFKA 5CITA 4D81A 1G21E 1W49A 1R2QA 2HXYA 5FUXA 4AG5A 2GCPA 4Q01A 4E09A 5AJYA 3RYTC 4MUAA 1MT0A 1U8ZA 4RZXA 4YXWD 1RJ9A 2ZVPX 5JMTA 2CL7X 4KXFB 5B58C 1PUIA 1VG1A 2FFHA 2NTYC 2IUSA 1S3GA 5AR1A 4OK3A 4EUNA 3RS7A 3RABA 4EJSB 1YZLA 2ZI6A 4F4IA 4TZ0A 1EG7A 3U3KA 1E79D 4E5UA 1CJKC 221PA 5E7JA 3GQBA 2HF9A 4TMZA 2J7PD 4AD8A 2ZI5A 1NBME 3BAFA 1DO2A 2FF7A 4NBSA 2JLUA 4GPTA 4RFVA 3SJZA 1LFDB 1JQJC 1T9HA 4XH9B 2KWIA 4IDPA 3U61B 4C30A 1XEFA 3AUYA 5SZHB 2NGRA 2JJ1D 2H5EA
chains in the Genus database with same CATH superfamily
1ZA1A 2XNDD 3BUSA 3MCAA 1C7IA 7ADHA 5IKPA 3IKTA 3RLFA 4JITA 2VJQA 2AE2A 4ITUA 3ZDEA 1P1KA 3OUUA 1M6WA 2R1VA 1A82A 4LWQA 1TM4E 1DINA 1IUKA 3PNPA 1G8YA 5GMOA 3EF0A 4II2A 1JHXA 3JATA 5ADVA 5C7YA 4DNQA 1ATZA 3C87A 4CMCA 1VI2A 2YDXA 5DGTA 2JVKA 3EG9A 5DGXA 3VHXA 1PK8A 4CMEA 1RRFA 4J0EA 3O84A 3RYHB 3UJBA 1DADA 3H9GA 5K4HA 1NUHA 3ZXYA 3MJRA 2R1TA 2ZJ2A 4MK4A 1PR4A 4BB6A 2B78A 3RSQA 2GAOA 3RWBA 2ZVQX 3G9UA 3CYFA 3OE7D 5KNBH 2W6PA 2I1WA 2P5YA 2R6ZA 3NQ41 5KWEA 3HZHA 1KOGA 3IPRA 1MVOA 1JLHA 1VCIA 4K1XA 4PBSA 4CFSA 4YFYA 3NNNA 4GH5A 5G1PA 1BDMA 3I64A 4JVNA 5CB4B 2WIKA 2IZZA 2X1MA 1L5LA 1BDBA 1SCQA 4Q3NA 4TQUS 1KRHA 5DNVA 2C61A 4GHWA 5CURA 1OAOA 1XCPA 5JQWA 4LMPA 4MUHA 5L3VA 3CFYA 4AG6A 4DV6B 1WZEA 1N2XA 2I0FA 1EK0A 2Y0PA 4YJGA 1DEKA 3DB1A 2NUAA 4OA5A 4QICA 2OAP1 4UFNA 4C14A 3NHKA 2CLIB 5ALIA 1SWVA 3ID6C 1DWQA 1H23A 3MG9A 4FNMA 4NEQA 3LDUA 4FHCA 1Z82A 1M7BA 3PPIA 1N0VC 1ZNXA 4RVFA 3UKJA 3CLRC 4OOFA 3VR1A 5E38A 2O5CA 4CG0A 1HRKA 4INJA 3GRZA 1QAOA 3FR8A 4MWCA 1U6KA 4TL8A 2QTLA 1JAXA 3HRIA 3AJRA 4LX8A 4NOKA 2DZDA 5JSZA 3I28A 2G0AA 3W5VA 2RGRA 2P2CA 3QVXA 1JHPA 1GZDA 3JX9A 3Q3HA 4N5DA 2WEKA 2MCFA 3LNCA 3W3AA 4FE3A 4K9QA 1YZYA 3EXHA 4RAQA 4BGVA 3EF1A 3QXSA 4LWOA 2GFQA 1H8HA 1NKVA 4NCAA 2YWFA 3DE4X 2FFRA 3I05A 1DSSG 2FTKE 3D4IA 1ZW6A 2WD8A 2ZBFA 4OLAA 1JYEA 4E33A 1JHYA 3HCWA 2OFPA 3SJAA 2VL7A 2RKBA 1P5HA 1DXHA 3PQFA 4Q4AA 2JJ2D 2Y6UA 3EZ7A 3ILVA 1P2VA 2R62A 4OYRA 2YVQA 4Q0MA 5EKDA 5JSKA 3W9BA 3ZGOA 4AM8A 3LPMA 1GZ3A 5AMXA 1E0JA 2QQFA 1OLXB 1D5CA 4XTCS 3KCNA 1S8OA 4I08A 4MUMA 2N75A 3H8VA 4P08A 5DYIA 1FMJA 1RE1A 2WI8A 3IT1A 1F1BA 1SBIA 1I4EB 1CQIB 1X15A 2AXNA 2EKQA 2GJ8A 2LKDA 3BYZA 2X9LA 4KWHA 3ENQA 4YBZA 2HPVA 3N9IA 1BO6A 5FBWB 4JBWA 3FWNA 1O8CA 2W43A 4C0XA 2IXBA 4YRDA 1PNOA 1UAAA 1LPNA 3AEQA 4DYDA 1NYTA 2ZPTX 4QUAA 3IQZA 4WLNA 4KJZA 3WLMA 1FTYA 2G83A 2DXIA 3HJGA 3GGOA 4JOQA 3CLKA 4NXMB 3U80A 3L04A 3F6EX 1AURA 4K2HA 4RKYA 1VYHA 3DOHA 3E9MA 5EIBC 2FPMA 2G25A 4C6TA 1DC7A 1RKQA 2OVBA 3QTTA 5LN1A 3LUGA 4A1OA 3DM9B 3OIVA 3D4NA 4C78A 4M6WB 3UUGA 1HKHA 3MJEA 4WECA 3SC4A 5DX8A 1ZIOA 1SCKA 2DBQA 3EQ9A 1T4GA 4BNIA 3IL2A 1ZRMA 4H3HB 3ZY6A 1GTSA 1GGVA 2ZYAA 2FI1A 4LOHA 4A1FA 3R5KA 1PG5A 1MGPA 4M49A 2IV2X 3O2QB 3B82A 3NYIA 4B79A 1K7FB 1KOJA 4ZO9A 4ENRA 3K1YA 3GRKA 2MSKA 1EVEA 2GLXA 3S2SA 2Z9BA 4ZVRA 3ZVLA 2ZI3A 1K4YA 1JEYB 4P7GA 4QXOA 1KTVA 1VIVA 1IUPA 2BSAA 4KPUA 3C48A 4HUJA 3LLCA 2VWGA 4NMHA 3ZKAA 4DXHA 1VPLA 3C14C 4BP1A 2IEBA 3D8TA 4B31A 1DZ3A 2P91A 2NQ2C 4NCBA 4JB0A 2YRFA 5FPSA 3TXXA 3DZDA 4BNYA 3WA7A 5TMBA 1U5BA 5FWXA 2CLCX 3CE6A 1G291 3FMFA 5EXXA 1X77A 4HHEA 4U00A 3ICPA 2PXAA 4JJGA 3TKAA 1W94A 1LTQA 1M0WA 3AUTA 3G85A 3K1AB 4RSRA 4ISCA 4UHFA 3H0EA 3JAWA 1PFYA 1R7RA 1YFZA 4N7JA 4UOQA 1D8TA 4C9BA 3UBTA 5KOIA 2VHJA 3LX5A 4G26A 2IKSA 4DBLE 3OFNA 2OUKA 2B30A 2EYUA 5JATA 1J25A 1PHPA 4DLSA 3HNPA 3DA8A 2Q46A 3BMNB 3OF3A 3RTDA 3KXLA 4RA6B 1YDFA 3RROA 3ZG6A 5ICCA 4BXOA 4DF3A 3SJBA 1GU7A 2C4TA 2G5TA 3LH5A 3RC8A 4LBYA 1OYOA 4MTCA 1WZNA 4S1TA 5JNVA 1U1CA 3JALA 2GK4A 1QGOA 1TE2A 2VZLA 1V11A 4DMFA 4HN4B 1PJBA 1SQ5A 3G0DA 3UMFA 1SUDA 1B3BA 2ZP1A 4V0SA 5FLYA 3S1AB 3WYEA 3CA8A 1XJ0A 3BRWA 2I8LA 3JAKA 1LSJA 4GMHA 3C6QA 3HBAA 2IY7A 3QYJA 2R8BA 4RTLA 4IO1A 3FOBA 2VPIA 3WMWA 1ORDA 1QS0B 4Q03A 2GN1A 1Q7BA 4REQA 5JQGB 3JY6A 5C32A 1UKEA 1ZD9A 2TMKA 5DM4A 5KUTA 1FVFA 2QK4A 1WSWA 3FLEA 2C8LA 2FRVA 1U7PA 3N53A 5ALPA 2VH2A 5TS2A 3R6WA 1GCUA 1VSBA 3MQ2A 3TRIA 4DTCA 1OH5A 3V1UA 1K66A 4AO8A 1FRFS 2VJKA 4MYCA 4FGSA 5E0KB 1I6KA 4CN9A 1KZ7B 4OGGA 5F9MA 1WXFA 2GM5A 3ROPA 8ABPA 3CVYA 2QX9A 2OXIA 5BWCA 4C7OB 5JW6A 4P4SA 2ACVA 1KO8A 3OZDA 1AMOA 2IH5A 1CY6A 4LZZA 2RGBA 2NTJA 1DX4A 2BFEB 1EQ2A 2HGSA 2WDPA 5B2ZA 3ZIAA 1E3MA 1TLFA 5CVCA 621PA 3WBFA 3VYWA 1XRSB 2NUBA 4YQEA 1F4LA 1WDKA 5BYAA 2EBHX 2P41A 3TUIC 1CTQA 3HLKA 2C8KA 2XNHA 3PU6A 4WRRA 3UJPA 2CLSA 2ZI9A 3TI9A 1EJ6A 4M1MA 1HLPA 3C4QA 4R1TA 1J90A 1ZGJA 2FP4B 1O9BA 1QZTA 2OG2A 2P9YA 4D2IA 5J43A 4LGCA 3Q7PA 1NC3A 1HGXA 2DY1A 4LYGA 1SURA 3M0EA 5DWDA 1DAPA 4C7JA 4D9KA 2C7QA 4CEHB 4UKDA 4UBIA 4EUFA 4UUOA 3M4ZA 4YMVA 1L7BA 5F12A 2Z0MA 4R01A 2R2GA 3RSSA 3G13A 4YJ3A 5JWOA 2FMFA 3F6BX 3O8OB 3WP0A 3BA6A 2HDWA 1Z5ZA 1N5OX 3UUEA 1OU4A 2X22A 3HUEA 1CERA 1J7KA 1JDSA 1L4HA 5M29A 1PQWA 1OFVA 2PZFA 3WS7A 4HNVA 5F3WB 4H0NA 4JJAA 2IIBA 1Y63A 1PL0A 3ADPA 3SI7A 4D0GA 4AT1A 4MKZA 3STXA 1T0IA 3JYHA 3WQSB 1IN5A 3CNOA 4LSWA 4MVJG 3S2YA 1V8BA 3U2QA 1ECFA 5LQKA 5CBPA 4BLVA 3TZHA 2FK7A 3TL2A 2PMCA 1KYIA 1H1TA 5DULA 1TAUA 4MICA 5JR3A 5L40A 1DKQA 1NYQA 5C31A 3RVDA 5CDFA 3IPYA 4WT7A 1IN8A 3CKMA 2HF2A 4E94A 5LP6B 1FU7A 4LDRA 2W2MA 4FXPA 2ZS8A 3TLCA 3W34A 1NVVQ 1P5JA 1UJ4A 4EYKA 3WJ1A 5EE0A 5AW4A 6ADHA 4BNXA 4XYGA 5EMJA 4N7MA 3VPXA 1P1IA 3CKKA 3N05A 3EGDA 3FUCA 3H4IA 1HG1A 3O4FA 4DLAA 3CF6R 3GLGB 1G3QA 5K3DA 4Q39A 4Z0NA 2HU7A 1TJ4A 3RU9A 4LV5B 5EP2A 3AVPA 1KMMA 3U4GA 4MRMB 2HI0A 3PQCA 1XZEA 1G98A 2FXVA 3VSAA 2XCSB 4NG4A 3VOAA 3FPEA 5G4LA 1FTWA 1N6IA 2ALJA 5ALZA 1YZQA 2C2OA 2OLJA 4L9AA 5CR9A 3BBPA 3AR3A 4KOAA 4M1KA 5ALSA 1EK2A 3ZHOA 1OLOA 2G7MC 2XGGA 3B13B 3HXTA 3WMEA 1XL0A 2P3SA 4QGSA 3MT9A 2VK8A 4LZPA 4BZXA 1M1YB 4NPCA 1M76A 1XN1A 1D4AA 4BFUA 4E2ZA 2HA7A 4TYWA 3GLFE 4EEXA 1P4AA 1Z62A 1CR2A 1FJ2A 3LRXA 3MSCA 4M8SA 3VR2A 3W1VA 3KAQA 1FMTA 4EB8A 4M60A 4UEOA 3M6UA 2P1DA 3F3MA 2QT0A 4H9GA 1XZQA 4ZALA 3G0HA 5JDIA 4NLLA 3T9FA 2EJCA 1I9GA 3OIUA 4WA8A 5KJ6A 1VJ5A 1D07A 4JBNA 4R2KA 1K8XB 4L2IA 1C3LA 5IBQA 1PW7A 3O0DA 3CNQS 4B2LA 9GPBA 3BT7A 3G17A 1C4KA 2OYCA 3V97A 3DFUA 4MMXB 2QRUA 4J7XA 4C87A 1JQEA 1CQWA 5FR2A 1JHQA 3NDRA 1E3LA 1D1TA 4QU5A 1V3QE 3B3JA 3FDIA 4M55A 4JCOA 3C4VA 1FFYA 4IV0A 4R8SA 1A9PA 1TO6A 4BVJA 4V39A 4AO6A 3RRNA 2QUZA 4C22A 5FWAA 3LY8A 4DLVA 2V0GA 1U3GA 1RSZA 3IFSA 4L1KA 4DMGA 5JD6A 2FPPB 4PC2A 4AQ7A 3X1JA 2WPDA 2AK3A 4U8GA 2WY2D 3T1OA 5BR4A 3EA0A 3U3XA 1A8HA 1QK5A 3QBEA 3M81A 2ZYGA 2N0SA 4PS1A 1ZUD1 3FVWA 1ODLA 4FB5A 1SPXA 4G5RA 5TQVA 2BP7A 1QGZA 2CCGA 2LR0A 2V4UA 2YJTD 4I9GA 2EL7A 1Z6ZA 1KYTA 4URXR 4N82A 2QEQA 1UWCA 3UMRA 5CVTA 1JPJA 1NPDA 1VRWA 2Q3MA 4GKVA 1GCIA 2C9DA 2PCJA 4GT1A 3QXHA 2I7VA 3F8SA 2XDAA 1JXMA 2GARA 4G9EA 1YSCA 5HIJA 4R7GA 4RS3A 4MYHA 2VNHA 5AVTA 1MPTA 2YMPA 3SYTA 4PAQA 1QGUA 5AKEA 4TYQA 4A6EA 1P2BA 2Z3WA 5E0OA 3LCVB 4PFKA 1E3TA 1ZZGA 1JLSA 2JA1A 3FCSB 4HQRA 5HZMA 4LC1A 1DFHA 3L0OA 3IXMA 4IKOA 3TVYA 2ZSJA 2ZJBA 4NMMA 4W1PA 1Z83A 2GCOB 2A84A 2HN9A 4P3PA 2FSUA 2W4IA 2Z2JA 5BVGB 2I66A 1DXOA 1KAOA 2YASA 4HQ6A 2D2IA 3NVAA 1D04A 4FYPA 1QK4A 4PPYA 2C3MA 1AMNA 3AB3A 3MOGA 3S2EA 1SUEA 1XFDA 4M99A 3T9BA 3WGMA 1I10A 2A9OA 4JLKA 1RFLA 4QQKA 1Q0QA 2LZ0A 4KR3A 1R9NA 3HZZA 2EDCA 4CLRA 3HDGA 5I9IA 2C82A 4NH4A 1WDLA 4C0KA 3EZNA 3M6AA 1UDRA 2I91A 1TU0A 4CKYA 3ZHQA 2OUIA 2XMRA 5I7SA 2P2LA 2PKWA 3Q6MA 4OL9A 4CMGA 5SV2A 4OGKA 1D2EA 4HEQA 1EFRD 1MAAA 3B2NA 4XSVA 4CIDA 3DFKA 4CNQA 3I2IA 1PE0A 5J2TB 4S04A 3M5DA 1JU3A 4GNKA 1YT5A 1KI3A 4DE5A 3I72A 2YJ4A 4LXYA 2VJPA 5HG0A 2X23A 5H82A 2ICAA 3PV0A 1KO7A 2XPCA 4CMJA 5KTYA 5EWMA 1XU4A 1ODFA 1S4QA 2VEOA 3C8HA 3ND9A 2HJ9A 4Y9TA 1JBEA 4AZ0A 3GJ6A 3RRZA 5IHXA 2O8FA 4QOJA 4DR5B 1EWRA 4HH0A 5DOVA 4AKEA 3D1VA 4G01B 4NULA 2D7DA 5HJ2A 5JCJD 2PWPA 3NDJA 3E22A 4DA4A 3ZIUA 1U7WA 1E1MA 2OP1A 3VTZA 1U65A 1XMIA 1P0FA 3S68A 1BHQ1 3F3KA 1HZZA 1M6VB 4K9DA 4DG8A 5LLTA 3WL4A 4F84A 2ZIEA 2EYQA 1O6FA 1BX0A 3BKXA 3TF5A 2ATCA 3AK4A 2H1VA 1G5QA 1TPZA 4JJZA 1NW9B 4LRQA 3IO5A 2IDZA 1RPAA 5M04A 2OV8A 2PNJA 3CRRA 2OL4A 3NTRA 1VIMA 4G1CA 4E3WA 4PSKA 4FBMA 4NSNA 4XIGS 2XECA 4QARA 1SXJE 3EXG1 4PHHA 3EZ2A 4AS3A 5BUQA 1NVAA 5KOHB 3JQAA 2W2LD 3E05A 4TLEA 3VPAA 4CJXA 4B34A 3KKMA 1V5IA 1RRGA 4MX8A 1TZKA 2ZK7A 3IUBA 1D0VA 3JD3A 4Y2HA 1ZN7A 3KTOA 1ZIDA 4QKQA 2GF0A 3IHLA 5F73A 5IVHA 5G0VA 3ZXSA 2P27A 3LFTA 1H2HA 1E2MA 3BJZA 3DT9A 3RRMA 3WK4A 1NF3A 1TGYA 3AJ8A 1R4AA 3DNFA 4GKBA 3LWBA 4NOLA 1GUBA 3H8WA 5ENVA 3M6MD 3G0OA 3L6UA 3PC8A 2QJRA 1REQA 2B8JA 2EP5A 5DRYA 3E9DA 2AG1A 1YQXA 1LDMA 1TUBB 5DKFA 5G40A 1IWBB 1V47A 4TXHA 3TQFA 1EFCA 2PUVA 2VTKA 3ISJA 4HS9A 5IZCA 1BXKA 4H7HA 5KPJA 3IUNA 2BEUB 3IR7A 2MDTA 3U44A 1LH0A 4HO1X 3DTNA 3H2YA 4KDRA 3NT5A 3Q40A 4W6ZA 3B1VA 2E48A 1AY0A 3BG5A 4N6OA 3VH1A 4M89A 5AJWA 3UW1A 4D74A 5DNUA 2OHOA 4RZHA 4QQ8A 1ZGHA 4IIJF 1OI7A 1YB1A 2HMUA 4WNIA 2WT4A 1LX7A 5CT8A 3LYUA 4F2GA 3T5AA 1Z38A 2IYPA 2C42A 1DBVO 2PMDA 1LSUA 2VPQA 3LT4A 1UJ6A 1Y5RA 3O73A 5FQOA 4QUDA 4N12A 1OLSB 2QRKA 4BNVA 1IK6A 5K99A 3HKDB 2FWBA 2J67A 4P82A 5E7IA 4DIKA 2C9OA 5J4LA 2XT0A 2QG4A 4RO0A 5FXMA 1SXPA 1I36A 4QPZA 2AKAB 1PYOA 2ZJYA 3GRAA 4QYIA 3VU8A 1JJIA 3CC8A 3G2IA 4FFWA 5EFZA 5IAGA 4LJYA 1ZGCA 3LUHA 5IJAA 4TVSA 1KI7A 4DSTA 5KS2A 3HGTA 3CUTA 5LIRA 3ASZA 3WK8A 1ULHA 2AVNA 5B30A 1JEOA 4ESVA 3LZ6A 3QW4B 3FYUC 4RCYA 2PMFA 4OO3A 4C04A 5KTPA 5TT1A 3R7LA 1T9BA 3QKUA 3HVKA 5K1ZA 3JV7A 2PH3A 4I55B 2HUNA 2D2XA 1Y8CA 3PZRA 1ZI6A 1X1CA 4GUDA 4HNHA 2JZCA 2VHZA 3L93A 5U1PA 5CXUA 2BGGA 1Y3FE 5B1SA 5HRUA 1O03A 5E2BA 4YR7A 3NUQA 2GYUA 4N3NA 2HO5A 4D0SA 1SRRA 4X6LA 1HE1C 3KKEA 3RYFA 5JZSA 4CR7A 4M9ZA 3I32A 1M2HA 4NECA 4GSKA 5C35A 1XTRA 4JVSB 1UEXC 1CJUC 4IQ4A 1TCAA 3R3UA 4ZT2A 2CLEB 4WBSA 3IBFA 3TIGA 2RGDA 4A0GA 5IC4A 1L8AA 4R4JA 5G4KA 5KSYA 2NXNA 4B35A 1R0XA 1JQ3A 2JAWA 2B6NA 4E03A 2QN1A 1JMVA 2D1YA 4UNPA 3MWGA 1C2YA 1JI3A 2PIDA 5CH3A 1XJ5A 4B43A 2O8BB 2EJTA 3EUAA 1Y7IA 2JCSA 1GCGA 1OA0A 3SHOA 4D5GA 1WMFA 3HJNA 1KRWA 3Q0EA 4LSGA 3VKGA 4A2QA 1XXHE 3DLPX 3OP4A 3GJZA 3TVDA 1ECJA 4L73A 4L9RA 2XA1A 5A4JA 1J0XO 3D5EA 5DPMA 3KV1A 4EMSA 5FV4A 5FI0B 3ZCVA 2HHAA 4OTZA 2QAGB 3RFFA 1ZMRA 2RI0A 1Q19A 5AUQA 4GBJA 1WD5A 4IRXA 5CB4A 2YBEA 3P9CA 5CDHA 3FNIA 5GV8A 4CDMA 2EL9A 1QBKC 4GMKA 4J07A 5SYMA 5IT0A 4G0QA 4R8LA 5A5GA 1BG6A 1VP3A 1QF9A 2JLSA 2AE1A 5A9SB 1RC8A 4NU6A 3KYBA 2I3DA 1FLDA 1TK9A 1JYSA 2AJ8A 1TRKA 2QE7A 3E84A 3LYLA 4J4TA 4HTAA 2IDMA 4JHXA 2NTVA 2Q6LA 5JC8A 2WHRA 3FNGA 5E9WA 2CXHA 1QRSA 1X8LA 5CFLA 4BO4A 3FRHA 3RD5A 5FIUA 1IDOA 4WKBA 3W1WA 4F5ZA 4XWYA 2JZNA 3CZQA 1AB5A 1FX0B 2Z58A 2QVLA 1MAHA 2I1VB 3LUBA 3P9QA 4NS4A 1R88A 3IVAA 1QO7A 1ZD8A 4MQFB 4NBKA 2IYVA 3AHHA 3WIUA 1CZUA 1V6CA 2IUYA 3U5ZB 1VB3A 3TUJC 5L8VA 4E4YA 1DTWB 3C7KA 4PG7A 1ZI8A 3D3WA 2I4MA 5G1NA 2BIFA 3SKYA 3HTXA 1OVMA 4LFCB 4MMZB 4W5JA 4JVOA 2IU3A 3AFHA 3M5PA 2FUG1 3OBBA 1CUWA 1A1VA 2ZJ4A 4PANA 2VCYA 4BO2A 4DLNA 1FSZA 3T7KA 4R0MA 3ZDAA 4MPTA 1TIKA 2M1XA 4GD3Q 4JI4B 2ZYVX 5LUAA 4LE2A 1I2BA 2HSZA 1N3LA 1OLXA 2XYRA 4HDRA 3TAUA 4HD8A 3UV6A 4R9NA 4E12A 3D6VA 3I5XA 1QCCA 3WLPA 1CQIA 3JQ9C 2F55A 1KO4A 1R6AA 1LCIA 1S2IA 3I30X 3EVTA 3IIJA 1NE7A 5ILQA 4M0EA 3SVZA 1E8MA 5I7EA 2AN9A 1MJGA 1QOPB 3FLBA 4MW0A 4WOPA 4TWIA 5BUSA 5FUMA 4KGXA 4CDNA 3HJRA 4KTTE 4B09A 2YIJA 1R9MA 4RCZA 3MGAA 4X20B 3VPSA 1MJHA 1QRUA 2VQ6A 3QU9A 4C01A 1IWOA 3ICOA 3E7WA 1ZC4A 3MBOA 3O8RA 3IX7A 5G1OA 1ZLXA 2NIPA 4UCXA 3MTGA 4P22A 4Y9DA 5EIOA 5EHXA 1DBSA 3AM4A 1YQGA 3SBDA 4QGHA 3IUPA 2ANBA 3A37A 3JWHA 3U48A 3U5TA 5JI2E 1Q50A 3BWEA 4WKOA 3SX0A 3HKCA 4D96A 3A4MA 1EXVA 2FUNB 1MIOA 3EEOA 3ORQA 1J5XA 1SBTA 1Z56C 4BGIA 1P4SA 4IG9A 2XY4A 2EQAA 3TZEA 2ZVDA 3CIOA 3V1KA 1TIBA 3ULKA 3DQPA 1HORA 3LUPA 2PQ2A 4OBBA 4AUNA 4DQVA 1EX1A 2ZB2A 5FA8A 1CPYA 4DUPA 1D2MA 1WEKA 1XVVA 4LI0A 2K2QB 3ZTTA 4NRDA 3TW8B 2HDHA 5DRTA 4ZREA 1OYWA 1E6LA 3FMOB 1Y6FA 2VP5A 1JEYA 3ICEA 2XWQA 2F6RA 3NONA 4GRAA 3IOCA 1TQ8A 2JC3A 3LG2A 2B3DA 1U8TA 1ZOPA 2C84A 4KG7A 3WMXA 4OXQA 1I6MA 3I23A 2I3BA 4HVCA 4R3WA 3FIUA 4RY0A 3ROTA 1HY3A 3PLNA 1IM5A 2J30A 2R87A 1NXOA 1W8IA 2ZR7A 4QE3A 3MW8A 2GAFA 2ZYHA 3KUDA 2EGHA 2HCFA 1UDWA 4BNGA 3QEMA 4U4AA 4DQ0A 5IFKA 1AVTA 1SD1A 3LI2A 4YI3A 5FOWA 3TCNA 2QLMA 4H4EA 3Q98A 5CUQA 5ERYA 3PWSA 4KQEA 5IAEA 3CLUD 2VWPA 5T57A 3QEBZ 2R00A 2CMDA 4L76A 2O2IA 3ONWA 1M33A 2G1JA 4AIIA 1JDPA 3KC2A 5E7MA 5FTJA 1OTHA 3MA0A 2VR1A 5CHEA 1SAYA 3P9NA 3H2KA 5GAJA 7MHTA 4RVDA 4CM3A 2NOAA 3AHCA 1N6HA 2ZBUA 4P93A 4BNDA 3GELA 4DDUA 1YQTA 3G8AA 2G6TA 1OPRA 2AD5A 2H29A 13PKA 2PPLA 3B48A 2AG6A 4RA6A 4DR3B 2PGXA 2VBCA 1IIBA 3LQ2A 3OOYA 4NKRA 4YAOA 5TE9A 1SA0B 1ZWKA 3U39A 2JLYA 3BICA 3I04M 1NN3A 1K7CA 1JKXA 2ZIUB 1WHTB 2C4HA 4FZ5A 2A7QA 2PIAA 2W6IA 2P2DA 5D1NA 5K3FB 3W6PA 2EARA 3K9BA 1SUWA 5KDLA 1EMDA 3NKFA 4YN3A 4RLFA 2ZRLA 3CCBA 3GDGA 3PFIA 4OK6A 2K7ZA 4L4UA 2XITA 3WMGA 3KOWA 4S1WA 3R5XA 4TV8B 5H9VA 1DGQA 3T3DA 1HE4A 2BHTA 2ZYIA 3FVVA 1II9A 1H0SA 1H2XA 1ECPA 3KL2A 4FW8A 1IN1A 1VJ0A 4PBRA 2K4MA 1QTIA 3O92A 1BDJA 2GCEA 2PZMA 5JMWA 3KLBA 3S4YA 5EPUA 5EZYA 4WZAE 1CLEA 1KWGA 1H94A 4YCSA 2C5FA 5LP1A 2P2YA 1Y4AE 4YJ3F 4RBNA 2EW1A 4U0JA 2RHMA 1NLUA 2BFEA 2AMVA 4RK4A 2FQ1A 1OX5A 4UATA 4V03A 5CLGA 2IP2A 5JYEA 4W5RA 1JAZA 4OX9B 2O8EA 1DWOA 1U2SA 4NFYA 3TZLA 2AYZA 3RIGA 3D2LA 2CHUA 5DBIA 2O7VA 4KQJA 4BO7A 3BCUA 3OEWA 4UVEA 1OBVA 2CE2X 4OAPA 2WP8J 5HK8A 4FN4A 3TW4A 5M5BA 3ON5A 1RBMA 2VRNA 4LK2A 1ULSA 2FP4A 1U02A 2O1WA 2PZJA 4XGKA 1Z28A 3PQ8A 2ZEJA 1EX9A 3OX1A 2GESA 2I2FA 3KZOA 4HMQA 3W7VA 1EE1A 5BR7A 4QQNA 2H5JA 4YAWA 1H1LB 3A2NA 1LDEA 1OIVA 1VA4A 1X0VA 3OKAA 4J4BA 4NMWA 4BO5A 4CEHA 2G4CA 2GJSA 2ODPA 2PYDA 3CLTD 5EQDA 4G5QA 3H5OA 1JWLA 1Z4LA 4U7WA 1T9DA 4GRDA 1KFJB 4YJDA 2EJBA 4PC3A 1UM9B 3ZDFA 1L2TA 3DF7A 5FBZA 3GNSA 3PGJA 2YV5A 1PWZA 4G5FA 2O3UA 1ZH4A 4KLNA 1W36D 2PM8A 1ZU5A 1KYQA 5CLQA 4NU5A 2GCGA 1OXUA 3I2GA 4B6JA 3GCWA 5JEEA 1FNBA 3C3CA 4BEVA 1Y1QA 1UXHA 2C3PA 1EFVB 3L8ZA 3RJ5A 4LRSB 4Q1VA 1ZJYA 3LNTA 1JL3A 1LQ2A 3SX2A 3UV3A 4DANA 2HEGA 4P54A 1XTIA 1DARA 2ONKA 1N7JA 1NBIA 2CYAA 3QIVA 1OWOA 4LE0A 4L6CA 5CM2Z 1WA5A 2H4HA 2VPPA 3KB8A 5E9QA 3L07A 3LRPA 2VLIA 1GVHA 3C45A 3T34A 3VZSA 3SS9X 3PXDA 2C78A 3O75A 3NGLA 2OOKA 4Z49A 4ZDKA 5LP6A 1MV8A 2WM3A 5KVQA 2O48X 2IQ5A 1X3SA 2NPOA 3G82C 3IRUA 1OX4A 3IP5A 4R81A 4GSYA 4XUDA 1PNTA 1DRUA 5GZ3A 2WTXA 2IHJA 1KIAA 4IHQA 3IO3A 1M6NA 3W8NA 1P2SA 2BM0A 4NCJA 1LPPA 3BIXA 4A2WA 1TVCA 4MQLA 3OP1A 1BN6A 2RK6A 3GLGA 2BWJA 2PR7A 3JWGA 4II7A 4JP2A 1FP6A 2J31A 4Q24A 5NLLA 3CEPB 3PNYA 1BCSB 3ILSA 1N6KA 4NHOA 5JARA 3GROA 3TJRA 1F8YA 5DVZA 4BZZA 4D98A 4PTLA 3L8YA 4ZANA 4B83A 2CN1A 4P2BA 2C8JA 4HB4A 2B83A 4QFBA 4UBMA 5C7LO 4JJ7A 3KR1A 1G6HA 1KYWA 3JRWA 1DCFA 3DKIA 3EY4A 3IUEA 1X86B 2ODWA 4ZQFA 5CCXA 3BXEA 3DZJA 3QYAA 5E8JA 1CF9A 1GQRA 1X7DA 3GUYA 5L51A 3JQFC 4J1TC 1IQPA 3USES 4AQDA 5A7HA 4WLFA 3W7AA 1B0AA 3D54D 4Q16A 1Y3AA 2ERCA 1YA8A 2HJHA 1M1YA 4DRXB 5J9FA 1QDLB 1ZQ1A 4F7DA 3ZZTA 1QTQA 3B12A 1RPTA 2CLLB 2FOLA 3K4PA 5AM1A 3PGKA 4DLKA 5DHFA 1DJQA 1H0RA 1NR1A 2AFHB 1JJFA 4MSUA 4U7FA 4ARBA 2GPTA 1S2MA 3HN6A 5BOSB 4OI1A 4DV3B 5DNAA 4WKGA 4CUZA 4B73A 4WY2A 1DKLA 2X40A 4NJMA 5CG2A 2HT1A 3P0RA 4C89A 1MO4A 1WX1A 3T54A 2PKCA 2X9QA 4ZPJA 1PHRA 4RMJA 1A5BB 1ZOOA 1MR3F 1RWKA 1XLWA 2HBYA 3L0ZA 1GPMA 2Z1DA 3KU1A 4FGWA 4HNQA 4JKYA 2FR0A 4YO7A 5JD3A 4PXYA 3OU2A 1R0ZA 1QNFA 4ISBA 2ZROA 3N5CA 2M32A 3WR5A 3C7AA 1IJFA 3K9QO 3VR4D 1TM5E 4JGBA 4WERA 3TGPA 4GOOD 1XCBA 2C5LA 2VUIB 3ZK9A 3WWEA 4BX3A 2WJPA 4N0MA 4IUYA 2DUWA 2AF3C 1PWEA 5EFOA 1T5SA 3PPVA 3GRFA 4I19A 2PLRA 4X3CA 3VVBA 3ZU2A 2Z6QA 2C4KA 2AXEA 2C2XA 1G7CA 4BB5A 3RHTA 5IXSA 2G9UA 1KE2A 2VHCA 3GARA 2PD6A 1P9LA 5AFSA 4FFDA 3JR3A 1H9AA 5AM5A 3AOGA 5FUBA 3WIVA 3UAZA 1U0FA 3HUTA 1EA5A 4KO3S 1XC7A 3TOZA 4FHFA 5L4NA 4HDAA 2XWSA 2QBYB 5E4YA 3W4JA 4A16A 3F5MA 4AO7A 1W9MA 5L9AA 1K5GA 5JHGB 3UHFA 1DDIA 2ZRMA 1NT4A 2JKZA 3ZHUA 3L4KA 2QM7A 1FXWA 1JR3E 3VNAA 1XAIA 3ND5A 1YR8A 4RTPA 2WT9A 2DJ5A 5JRDS 1SCAA 2FMIA 2ECOA 1NMZA 1NGSA 4KO8A 3TVTA 4EECA 2CFRA 1J97A 1T5IA 1L7EA 1TAHA 2HREA 1L5OA 2I1LA 1GFSA 2V74B 1K5DA 3OLYA 2Q7DA 3RF7A 4IRUB 5CEJA 4V2IA 4GPEA 1K3FA 3R8XA 1NZFA 3CLHA 1D5WA 3PVCA 3D4OA 1FJGB 5I4CA 1NE2A 1MFPA 2P0AA 4JYCA 2GCOA 1SQSA 3F3YA 4F92B 1K1EA 1QH8A 2BHRA 3ORHA 5BVGA 1CZLA 5F21A 4XAQA 1RMQA 1Q1AA 2XCUA 3UMYA 4ML3A 5BNIA 3VKHA 2WD7B 3P20A 4U3JA 1XD2A 1IOWA 5HF9A 5AW1A 3Q1LA 4OQZA 4MI3A 4YJFB 1CDEA 2NQ8A 1E2PA 3FW1A 4ARZA 4JI3B 3V2HA 3HHEA 4JX9A 4IVRA 1OREA 2ROQA 3HA7A 3SYKA 4DY6A 1G5RA 2FSIA 3LCJA 1GQYA 4RD3A 2HQRA 2YS6A 4YY3B 4LAFA 1GRCA 2QTBA 1S8NA 2E2WA 3OFJA 3QJYA 2EKPA 4TTTS 4YRRA 2ES4A 2WMYA 5JLJA 5HE8A 3UV7A 5K0SA 3ZJYA 2O4UX 2ZT7A 1RNLA 4ARIA 2P4UA 5D3QA 3THYB 4GZ3A 3KQPA 1X1QA 1GDDA 3RTAA 4EO7A 4FOSA 2J33A 4L8VA 5A02A 1BWRA 1E0DA 3ZZMA 1JDBC 2CKDA 2BY4A 3VC1A 4TQGA 2AMLA 4LDQA 1CHNA 3U4MA 1THGA 4W99A 1CJSA 1P1CA 4IOLA 2QQ5A 2OT3B 2DT5A 1MH9A 2VTEA 3DDOA 4PPQA 1HDIA 2WZQA 4ER5A 3PTLA 2J6HA 4LRUA 4J16A 1NI4B 2GZHA 3HXKA 1G5FA 4PC7A 4DUZB 1E69A 5KHLB 1QOQB 1L5HB 4GPIB 3HP7A 2AOUA 1IPEA 4ILEA 4A2CA 1U7UA 4DDTA 1ULUA 2NSJA 1Z6PA 2O20A 4J8PA 4U2GA 4LDPA 1N34B 1XEWY 3WZ2A 3O4GA 4CM4B 2JH8A 4RACA 2Y76A 3W9SA 4U2EA 1SKYE 4GXNA 2F64A 4AMBA 2ZM5A 1M6VA 5B53A 2P4SA 1NLZA 2IJGX 1O89A 3V9AA 1T1RA 4F85A 3QXXA 5HIAA 4PQEA 3ZWBA 5TR9A 4WZBE 2AQ8A 3RWOA 3VNQA 3TZKA 4BJ5A 3L7CA 1B23P 1P5RA 2GERA 3KR9A 1I4TD 1X70A 2BI8A 3I37X 1UT6A 3JTMA 1AHNA 1XTQA 4MEBA 4Q6WA 4LNHA 3Q9LA 2H1IA 4A26A 3E7XA 1SC4A 1KBOA 5DI3A 3PQ2A 1KOFA 4H3SA 1SKAA 3P2JA 3CO5A 4JT2A 3RB8A 1GAEO 2SKEA 4A7PA 5JNWA 1L4LA 2NNLD 4Q6BA 5JXGA 2D5IA 6AT1A 3QXGA 4QGFA 3RASA 2UXDB 1NY6A 4L74A 4MA0A 1P1BA 3IALA 4UBJA 3AHEA 3A3PA 3MCUA 4W82A 5EZ6B 4DA0A 2IYAA 1Z6QA 3I9KA 1TU3A 2AEEA 3K2BA 3ZKWA 1P39A 1RQXA 2NO5A 2KE5A 2R8PA 2X13A 5CLFA 1KMQA 5EERA 1SUFA 3V48A 1TQ4A 5ALKA 2X0DA 1TTTA 4JSYA 2J9XB 5E2AA 2DFPA 1LA2A 1S02A 3NORA 4Q1DA 4P3YA 1FRNA 2JAQA 4UVHA 1AS0A 2AGVA 4AROA 3L6OO 1SXGA 5FI3A 4N76A 2BEUA 5LWHA 2PRJA 3OPNA 4I99A 4YHHB 3O0TA 1ZFNA 4HWOA 1P9OA 1II8B 4ADSG 2UZ4A 3DQQA 2AX4A 3G79A 3OO1A 5EKUA 5IVKA 4BQEA 2Z1MA 1ANKA 3CLUC 2A1TR 1CULC 3GVHA 4FQ5A 3RVJA 1XQ9A 3SKVA 4P0TA 3ADBA 3GT3A 4G0NA 1D2CA 2DYKA 3B5JA 4MKHA 3N76A 4OHWA 2H4JA 3W5JA 3GDHA 4P8RA 4BX0A 2ZB8A 3BHNA 4UXHA 1HT2E 3R9KA 5CT4A 5FNVB 2XDWA 5HNKA 4IG4A 5JFOA 3T94A 1XZPA 1H8EA 2P7HA 1WCYA 4FLEA 4TLAA 5C4GB 1KY3A 2BUAA 4B7XA 1E2JA 3Q2IA 4GFDA 5C5IA 4OLBA 1LSSA 2TSYB 2CE7A 1XMOB 2V54A 3QKIA 1QORA 1YI8A 2QVXX 3ZNQA 2NO7A 1CCWA 3OAAA 3JD0A 3QJ5A 4QBHA 1XTKA 1WU7A