3BRWD

Structure of the rap-rapgap complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
167
structure length
167
Chain Sequence
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Rap-RapGAP complex: GTP hydrolysis without catalytic glutamine and arginine residues
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp binding protein
molecule keywords Rap1 GTPase-activating protein 1
total genus 51
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3brwD00
2CL7X 3MD0A 3AQ4A 4BLPA 4IEIA 5JECA 2JLRA 4EPTA 1FNNA 2ANCA 4IVRA 4Q4AA 5LB4A 5FOSA 3ECCA 1FP7A 3OE7D 4ERNA 4NCIA 3RSOA 4N3NA 3LQRA 2G9NA 2FSFA 1A1VA 5CYPA 2QI9C 4LJ4A 2CHQA 4GP6A 4A36A 3KJEA 2YYZA 1WDTA 3CM0A 2RH5A 4H1UA 4OBEA 4P3YA 3CLVA 4M1MA 1NSFA 1U0HC 3V9PA 2WWWA 4IDHA 1KTVA 1X86B 4XJXA 3A8TA 3CBQA 3TSZA 4LJ5A 4PC1A 3S1AA 4A0HA 4XTCS 2F43A 3EPKA 2MMGA 1SGWA 5IHPA 3G5UA 1RJ9B 4MKFA 1GRRA 2Q0HA 2GBLA 3AV0B 3QF4A 3BGWA 5IK2A 2Q3HA 1VCIA 5GJVC 2WSSD 3L8YA 4D25A 1G3UA 1XWIA 2XB4A 1OB2A 2QROA 2C9OA 2IA5A 2IUTA 2PL3A 4GZMA 4C9BA 3B1WA 2FPMA 3CWZA 4ZIRA 2DCUA 2PLRA 1G4UR 2YINC 2V6JA 3ZZTA 3CR8A 4CEIB 4M21A 4DZZA 4F91B 1VHTA 2P5TB 2ZSDA 2QP3A 3VR3A 2ZROA 1ZUNB 2AR7A 2FNAA 3THXB 2VHQA 3OHMA 3GJ8A 4QGFA 5TV2A 4PQYA 5TXGA 2IYUA 1W46A 3MWYW 4M22A 3WP0A 1F5NA 4Q4JA 2ODEA 1PLKA 2IYZA 2OCPA 3ZVLA 2WMOB 2NO1A 2B7CA 2P6NA 1UFQA 1KI1A 4P4SB 3EASA 4Q03A 2QBYB 3VR2A 1HT2E 3AKCA 2D7CA 1KI6B 4ZKEA 3SE0A 2BEKA 3T35A 3EIQA 2ZQ5A 3NEJA 2AKYA 2MSEB 3T06B 4B44A 1XMVA 5JCZA 1XTIA 2OO7A 4XOIA 5GJBA 2GEDA 3OEHD 1PV4A 5CM9C 1Z0DA 4EQ6A 3ZD7A 1U8ZA 2XOKD 5G40A 3PR1A 3ZQ6A 1ZM4A 3TKLA 1Z2AA 5JS7A 2AK3A 5EZ6B 1QVRA 1MO5A 2B21A 2H57A 2V7QD 4HAYA 4LGMA 4UNSA 4PPQA 4W7SA 5CM8B 3SHWA 4US1R 1GVNB 2VIIA 2BM0A 4G01B 3TIFA 2JJ1A 2Q3FA 4PTLA 4RD1A 4C3ZA 4MYHA 2JATA 2OM2A 1MRNA 2ZS8A 3N2IA 4I1OA 5L3SB 1KI3A 1EFCA 3Q3JB 1NN0A 3CNNA 1MABA 5FR1A 4ZI2A 2ERYA 5KSPA 3AEZA 3BOSA 1TAGA 5EUMA 2QENA 3DDCA 1Q3HA 4Y0VA 1YKSA 3KKPA 3BRWD 5A0FA 2NO0A 1GKIA 1SVLA 2Z43A 3H2YA 3SJCA 3U4QB 3NKVA 2F7SA 4QBIA 5D3MA 5F3WB 3CZPA 1Z07A 2AX4A 4JJKA 1OB5A 4CZ2A 4BLTA 2PJRA 1SXJE 2I3BA 2VLIA 2YJTD 2FOLA 2W2XA 3U3KA 5AJXA 2OE2A 4Q02A 1XD8A 3MJHA 2WAYA 3AP1A 3AF2A 3KX2A 4MITA 1N3BA 4OJKA 3HJNA 3RRYA 4L9WA 4AC9A 1XEXA 3SFVA 5JRZA 4BFYA 4JSTA 1U2RA 2XTNA 5G3ZA 2OFXA 4AKIA 2ZVQX 2GCOA 2OILA 3C4JA 3EZ6A 5GVSA 2R65A 4PPNA 5JEEA 3FHOA 3OEHA 2MSDB 4R7ZA 3FFAA 1XRJA 1XXHE 1IBRA 1H8HD 1O87A 1S2MA 4HZIA 2WWYA 4PANA 1KMHB 2J0VA 3W6PA 4QC2A 5FBRB 1UKYA 1NMXA 2HYDA 1UDXA 4QGGA 2GK6A 2VSOA 3U2QA 2CHVA 3LDAA 1IY0A 2ZXUA 2C03A 2WZQA 1KOFA 3TQCA 3SZRA 1FX0B 1NF3A 4FW9A 1DAIA 1NI3A 4IHQA 4NDZA 1A7JA 1BYIA 1M74A 3CR7A 3B9QA 4XIGS 1TX4B 1E0AA 2B8WA 1QHHA 1S9HA 2AKAB 2VEDA 1FW6A 1BIFA 1UJ2A 3P27A 4IXMA 1SKYE 3BB1A 4OL0A 3I62A 1XEWX 1KJZA 1JR6A 4BLRA 5F9HA 4KHZA 1E4YA 3GJXC 2RGAA 1CLUA 5BW8A 3W3AA 6Q21A 4BFZA 5D3MB 2HT1A 2HUPA 3KKOA 2ZI5A 3U3RA 3LA6A 1SULA 1KZ7B 1VCOA 1DADA 1G41A 2YOHA 4JLPA 1Q57A 4AWXA 3KQUA 1VECA 1DAEA 1KI6A 1SVMA 2Q3MA 3RSLA 1H8ED 1IJEA 4B6FA 1W36C 1CRPA 2GCPA 2QAGC 4ZI3A 1UPTA 3KQHA 1ZM2A 1M34E 5FFMA 2O8DA 2FH5B 4RY2A 1SZPA 4TSFA 5CB8A 1Q1QA 1AK2A 3X1XA 4MYCA 2BOVA 1SVOA 5C1BA 2CNWA 4W5WA 1IN8A 3QOFA 2JIZA 2R6FA 4PSVA 2RKOA 2NMVA 4KYIB 2QG6A 4WZAE 1HQCA 1OKKD 5CYOA 4K46A 3IIKA 4RKFA 1XFAA 2YC2C 3GLIE 4TTQA 1AS0A 1TADA 4W5JA 1KI9A 2A30A 1XTQA 4HUQB 4PPGA 5FOWA 4AYTA 5JFGA 4JVLA 4DB2A 2FF7A 4OK3A 1CF4A 2OBNA 1CJKC 1COWA 2LCFA 3NBXX 3E1SA 1ZBDA 1T9HA 1YZLA 2QL6A 2I4IA 1JR3D 1Q44A 5EP3A 2IYTA 5CJ2A 3AF4A 1ZD1A 2EVWX 1DVRA 1RRFA 1VTKA 4RD6A 4NHOA 4Z8YA 3KQKA 4G5RA 3FE2A 3SR0A 3RWMB 2W0SA 2GF9A 2QT0A 4B34A 4YC7A 2JAQA 3DL0A 2E87A 3NH6A 1VPLA 4PC3A 1E0KA 2ZRMA 3THOA 5C18A 1R4AA 1OFHA 2G0NA 1F48A 3KFVA 5E95A 5EZ5A 5FTLA 1Z6GA 2ZR7A 2ZRAA 4LV5B 2XZPA 3KKNA 4PHTA 1Z6TA 5H70A 1EK0A 4HB2A 1FMJA 3NC1C 4FD2A 1ZM9A 4PO9A 3FFBA 2AD1A 1E9AA 3P26A 1G8GA 4JLMA 1KJYA 3GJ7A 1IXSB 2ZUDA 1WMSA 1E2LA 5DSZA 2X2EA 2QMHA 3T1VA 4AURA 5JBQA 3D8BA 3K0AA 2DBYA 3M1IA 4JKIA 1XTKA 5EXTA 2J0UA 2RGEA 1OHHD 1P9NA 5SZHB 4B3GA 2ONKA 2AXPA 1QHNA 4BFXA 1ODFA 3OF5A 2ORVA 2FDCA 2NO6A 2D62A 1AN0A 5EE9A 1H8HA 2IF2A 4URWR 1UBCA 4BWYA 2PZGA 2Y8EA 4QJ4A 2WWGA 3L2OB 1M2OB 1ZU4A 3OAAD 1NVVQ 1ZJ6A 1CIPA 4TLDA 4BGDA 2IX3A 1RYHA 1SQ5A 1W36B 1QF9A 4ZCLA 1X1SA 2YWHA 4A2PA 4ARZB 1XPUA 1VG9B 4IRUB 1X6VA 1CR2A 3IIJA 3LO5A 4Y0AA 3QQ5A 4TMZA 4LRWA 1RKBA 1OYWA 1ZU5A 1Z28A 3OEED 2J5XA 5FUWA 1MO6A 1N5LA 1G6OA 5FTKA 2LKDA 3CH5A 2DWPA 4N0DA 2FSHA 4JL6A 5TMPA 3DOFA 3KUDA 4GMDA 3IIMA 3AVYA 4GOXA 2HJGA 1XDBA 2JLZA 2EW1A 2NTYC 1QHHB 3UMFA 4EUNA 1R5OA 2JCSA 4S2EA 3CRW1 2VL7A 1OT3A 4TYNA 4Q7JB 3SHFA 4PZZA 3PEYA 3GLHE 1T5IA 2VF8A 4HLDA 1VG8A 3G82C 4Q7LA 4KBFA 1R10A 4A2WA 1UKVY 1W2GA 2C8VA 1RW4A 3NXSA 3PUXA 1ZD8A 4KCGA 3AF0A 4ZDKA 3ZGXA 4JJZA 1E1QA 1AJEA 3HYRA 1XEWY 1OXVA 4KFTA 4QHYA 3QNUA 1K6MA 3JVVA 1EX6A 5FPKA 3UPUA 5KO2A 4HDOB 5AJYA 2DPXA 1E79D 4BECA 1XJQA 1DARA 1LY1A 1CR1A 1EX7A 3K0SA 3GJ5A 4TL8A 1OXUA 4OHWA 1II8B 4MGKR 4CEJB 3NTUA 3MUFA 1KK3A 2J46A 1YU9A 2NZJA 4X8LA 2KJQA 2JA1A 3LXXA 1KI2A 1N6PA 4OI2A 4NONA 4NP6A 2IC5A 4FMCF 1XCPA 3I72A 3IQXA 4JVSB 2GJKA 1W0JA 4LBYA 5K8IA 4TZ0A 4LWZA 2XJ4A 2ZRPA 2C99A 1WF3A 3CO5A 4CT4B 3U3OA 5C2JB 1CR4A 3LBNA 4XD7A 4WIAA 3C14C 5BN3A 1SKQA 4X8OA 2BIFA 2W2VA 2RAPA 3MMPA 3ETLA 4TL6A 3SN6A 3ASZA 3KFXA 3L0OA 3FWYA 4Q4LA 1ZC3A 5AUQA 3TAUA 3WMFA 2BJWA 2DFNA 3AVPA 1I4TD 4Q47A 2JJ1D 3V00A 1VDZA 5JS8A 3K70B 4TMKA 1IJFA 4LSGA 3TE6A 2WWHA 121PA 1K5DA 4DDUA 5A4JA 1T3HA 4IOKA 1GL6A 4ESHA 3ADDA 4QNRA 4M1YA 2QGNA 1DAGA 1BKDR 2QMOA 5KDDA 1I2MA 4IDQA 2IHYA 3UXMA 4QBFA 1V5WA 2WKPA 3T5GA 1Z6XA 4MUBA 1GRQA 5EXPA 2CL0X 4CDGA 3K8YA 2N1BA 4OI1A 3DPUA 4EPRA 1EGAA 2Z4RA 4FMDF 1KO7A 1KO5A 1IAQA 4QXAA 3K09A 1YZKA 3NIBA 2GVZC 4AYXA 4V0KA 4H1VA 5FBWB 1VYVA 3FMIA 2YZ2A 2P67A 3UIEA 1YZUA 3IHWA 2FPLA 1FPMA 3EIEA 3CX7A 3QXSA 3DEFA 4NYMR 4A8JA 2FJUA 2OCBA 4NKRA 4E5UA 3L0IB 5JHGB 4FWIB 3RHFA 1NVXQ 1VHLA 4C0HA 4A1FA 2RB4A 1G8PA 3F0TA 3P1JA 5K8UA 2WOJA 2WKRA 1P9WA 3NHAA 1CBUA 2QGZA 3K70D 4WXRA 2GAAA 1N0UA 3EPHA 1KO8A 2ZS7A 4C7OB 2R44A 1IXZA 4AG5A 1XPOA 2GF0A 5H68A 3H86A 5L3SA 2HDNB 4KLNA 3QIAA 4FXPA 5E3HA 1GDDA 4LJ7A 1ZVQA 4LC1A 4OK5A 3LW7A 1FQKA 2UZ3A 3UWKA 5FBVB 3I1FA 3K1JA 4DEXA 2QTFA 3B1XA 4B32A 2QP9X 3SYLA 1AS3A 2W00A 5CK4A 2VHCA 5DE3A 5JJLA 2GVDC 3THXA 2HT6A 1KGDA 2FX3A 1JI0A 1G19A 1N2CE 4TMXA 4TQUS 1TF7A 1U81A 2JLYA 1E1RA 2YV5A 3U44B 2D2FA 4K81B 3AH8A 4EJSA 1W1WA 3WMEA 4IKEA 1GNQA 4WVFA 1FUKA 3REGA 4PO8A 2F1JA 2FFQA 1E2EA 1XBTA 4G0NA 3W8NA 3EC1A 3EZ7A 3T1OA 4Q5IA 2OZEA 4DSOA 3ZVNA 1KYIA 2YVUA 3PJRA 4G5GA 2AK2A 3LX5A 1GKYA 1GOTA 1LS6A 1G5PA 3VMFA 1CULC 5BXQC 2F1RA 4QHSA 1JEDA 1FZQA 2J59A 3R8FA 4B3FX 1YJ5A 4ON9A 4WA7A 3EA5A 1GZSA 1JECA 2QTHA 3I73A 3L0PA 4OHZA 2EFGA 4HDCA 1CJMA 1T3LA 4TLEA 3SQXA 3C8UA 1KMQA 4DCUA 1P3JA 1GNPA 2MSCB 3LAWA 2IT1A 2BC9A 4BE7B 1JALA 1YQTA 2FA9A 1KI7A 1XF9A 2QRNA 3K9NA 1S9DA 4P31A 2R8RA 2C9CA 4KFRA 1Z5ZA 3AKYA 3HPQA 2A5JA 1R7RA 3SEAA 4CF7A 4M2LA 4LYJA 3CB4A 4QKQA 2J45A 4PAOA 4FN5A 1L4YA 5GJCA 3FDIA 2OCYC 4Q7KA 3IEVA 2CCKA 1P73A 3A1SA 4YMSA 3WNDA 2O8FB 4ZKDA 5EE5B 2XXAB 3PQCA 1QDEA 2ZU6A 1PUIA 4OKSA 3NDPA 4QNMA 2QAJA 1OFTA 4IOJA 3V4RA 3QPUA 3GJ6A 1BMFD 1S0UA 5UKDA 5D3QA 2W0MA 1T91A 2ZRLA 3IKJA 5HKKD 3EW9A 1EWRA 1L7VC 4KSBA 2BBSA 4KXFB 3KB1A 1G21E 4CW7A 3AVWA 1KSHA 2OHFA 4LHZA 1QHXA 5LBIA 2GAOA 4BFVA 4FCWA 1E2DA 4QJ3A 2ZIAA 5CDFA 3TR0A 3B9PA 3BIFA 4EJSC 3L82B 1NG9A 4Z1MD 4MGZR 5EP1A 2J0SA 1E3MA 4I4LA 2IK8A 1N6RA 4JLKA 2FMXA 3GLHB 1QHIA 2C77A 4Q1EA 2NO7A 4OQLA 3I5YA 1FNMA 4S35A 3RS5A 1F2UB 1W47A 3B1YA 1D9XA 2VSXA 3PEVA 3LH5A 3K70C 4XVQA 2A2ZA 1EWQA 5J4YA 2IUUA 1KI4A 2ECKA 4LZZA 1Z8FA 2QT1A 4YXWA 1JR3A 3Q5EA 3FKQA 3EC2A 3U7HB 3MWJA 3KKQA 2WJGA 4DCTA 2WKQA 4D2IA 3GLFB 4B3CA 2BMEA 2O52A 1G18A 3K9HA 4BRUA 5TB5A 1P5ZB 3MCAA 4JYCA 4EFNA 2JASA 2ERXA 3VHXA 3VKWA 3O8BA 2GHIA 221PA 4Z1MA 1JPJA 1GNRA 4I1SA 4CEHB 4BPBA 3OZXA 4KLZA 4RZXA 3C5CA 1QBKC 3BC1A 2UVQA 5KOYA 2G6BA 2G3YA 2QMEA 4P4SA 2QBYA 1EESA 4PC6A 1NBMA 1XB2A 4URVR 4KI0A 1F6BA 3QXCA 1MKYA 4Q19A 5FH9A 1WA5A 3U3MA 4EPYA 4F4JA 2R6CA 3UATA 3T12A 3DZDA 3CW2A 2WHXA 3TQFA 3W9YA 2OSBA 3AB3A 1JR3E 3BB3A 2PEZA 4D80A 2JIZD 4R2IA 4C2TA 1EFTA 4BFTA 2H16A 3W34A 1T5LA 3FKSD 1IN7A 4BLQA 2Q21A 3LQQA 4IVQA 2FZ4A 1DPFA 3QF7A 4CRWB 1X8JA 4RCZA 4LV8B 1OH5A 3L0SA 4E09A 1Q1BA 4GBMA 1F2UA 5JLJA 1E9DA 4XWKA 4HUQA 2XB2A 3EZFA 2ORWA 2XITA 3NBFA 2QQEA 2A5GA 3HR7A 3UANA 4O0MA 4NE2A 5EJEA 2XZOA 1ZRHA 1TEVA 1YZNA 4GP7A 3HU1A 4FCTA 1Z08A 4D4MA 1K8RA 4F38A 4YQFA 3LFUA 3F3YA 1KHTA 2PX3A 5GJWC 3RS2A 4CEIA 1G5RA 3QPVA 3RAPR 2GEUA 1BH2A 3E70C 1G3QA 5EE0A 1TEXA 5FPYA 3SJZA 5B58C 4W5HA 4JLDA 4DSTA 1VIYA 2CLDX 1J7KA 2NGRA 2X8AA 4QFMA 3WNCA 4M1TA 3Q5DA 2EWVA 1IY1A 5KPDA 1DELA 2PCLA 3O8CA 3RDPA 2X1VA 4A2QA 3J81k 5KDOA 3EIHA 3ZQJA 4YMVA 5CLLA 1E94E 2PT5A 1KSFX 2CNWD 4RCYA 2VP5A 2VP9A 2C95A 4C0KA 4K8OA 4HZUB 5F98A 2VHJA 3GEEA 4D0NA 4O2LA 3U60B 2WV9A 3D7MA 1E6CA 1NY5A 3IQWA 4GMXA 4URYR 4B35A 4EFLA 1Z0FA 2JDIA 2G77B 1N6LA 2K5UA 2OLKA 3KKMA 3MSXA 4AY2A 4FMDB 2V4ZA 4M1KA 5JHHB 4ZCMA 1XCMA 3A58B 4OJQA 3E2IA 1T8UA 1QVAA 2WICA 3QKSB 5DYIA 2QUZA 1TMKA 4A0RA 1E2HA 4LYHA 4HUTA 3OE7A 3K0CA 1YR7A 5HKKA 1HYQA 2RHMA 1WRBA 2E1RA 3RC3A 3WYGA 2IL1A 4RD3A 2WSMA 1XMSA 1KK2A 4TT3A 3IO5A 2CCJA 3B60A 4JLVA 1Q21A 4V0NA 2IYVA 4DWJA 2RHDA 4B3BA 4UXJA 1OFIA 5H1YA 1NN3A 2RGXA 1DAHA 2NIPA 4IOLA 4V0ME 1HA3A 2IYLD 2FSGA 1ANKA 2IS4A 4NCJA 3ASYA 2BCGY 3QKRA 2YNMA 1AGRA 3P32A 3TSOA 1DG1G 1Q1ZA 2WJVA 4TLCA 2AHOA 1HQYE 2FPKA 1N6KA 4DLWA 1NVVR 2F9LA 2OT3B 2WSSA 1FUUA 3VKHA 2YWFA 4R2HA 1YE8A 4L9SA 2GZAA 2YWEA 3ZIAA 4O3MA 2H17A 4AK9A 2PLFA 3KXIA 3RS3A 4URXR 1OH6A 4F4CA 3RS7A 5HZKA 4AYWA 4AKEA 4NU0A 4R71A 5JCPA 1E4VA 1E96A 1N5IA 4BQSA 3SBEA 2JLVA 1U8AA 1XXHB 4UNNA 3TBKA 5CK5A 3TMKA 2QA5A 2RGCA 4JSYA 4Q9LA 3EAQA 3M4YA 2BMDA 1R2QA 1P2TA 1U98A 4MRSA 2P3SA 2NG1A 1SVKA 5KDLA 3WNBA 1D9ZA 1CXZA 2ZR9A 2IYYA 1IN4A 3LLUA 1KO4A 2J9RA 4Q1AA 4US0R 2CK3D 4KV9A 1RRPA 2HCBA 3AF1A 4NYMQ 1LF0A 1TU3A 1YHNA 1NIPA 2BMFA 1KDRA 1KI8A 1GL7A 4DLUA 3TUIC 5C4MA 2HYIC 1XX6A 3CKLA 1VG0B 2A78A 3HWSA 2Q9CA 5G41A 3CNLA 2PJZA 3DO6A 1QHYA 5JWHA 4CVNA 1SXJB 3FMOB 4M53A 4D4KA 4A82A 3JZAA 3HP1A 3K53A 1W4AA 3SDZA 3A1TA 2PH1A 2TMKA 5KTYA 2WM9B 2GRJA 2REBA 3SYNA 3AVXA 3GJ4A 5L8VA 4DSUA 2G83A 4UXHA 5AR1A 5E7MA 5FI0B 1FOEB 2PZFA 4NBSA 4ZDWA 2BHRA 4Q9JA 4B3DA 3THYA 2RGBA 4G5QA 4M8NE 2D3WA 4QRHA 4MKHA 1RYFA 2V9PA 2O8FA 2AXNA 3AGPA 2QAGA 4LUCA 2P5SA 1M8PA 3FVQA 2P65A 1S8FA 3IUYA 1KZGB 3IPXA 3REFA 3ZVRA 2R62A 1EXMA 4D6PA 5FUXA 1D8TA 1NKTA 2XSZD 1CEEA 1G7CA 3U6KA 1U99A 4P4TA 1G7TA 2IYXA 3KJHA 1KDPA 3BE4A 4NL4H 5IDVA 3A4LA 1G17A 3UG6A 2O0JA 4ZPXA 1UM8A 3MJRA 2AWOA 1DG3A 5FBLB 3MRSA 2OAQ1 1J2JA 1VCNA 4M4SA 2KE5A 2IS6A 2VPPA 3FHTA 4PHFA 2BBOA 3DMDA 4YDSA 4JBYA 3W3ZB 3WMGA 2J0UB 3SS8A 1EFUA 1FX0A 1N6HA 3CNOA 1LVGA 2FFAA 2EFDB 1NLFA 4HAZA 4LPKA 1E2QA 4D26A 4MA4A 4Q4AB 3WRYC 3AVVA 2JLWA 3I92A 3RABA 4E03A 5E4FA 1E98A 1Z83A 2V54A 2GJ9A 3GLHA 2JJ8A 1XNJA 4LJYA 2D2EA 2O8EB 2CK3A 3A4NA 1MO3A 4D4LA 2FE4A 1KJWA 2F1HA 2VRWA 1UBGA 3C7KA 2GCNA 2J7PD 2WIAA 3D6TB 5FUYA 3U4QA 4NCNA 3SNHA 3B2EA 4TYYA 2XAUA 4AKHA 4DSNA 4HB0A 5AUPB 4ILEA 1D2NA 4A92A 2QN6A 2XTZA 1E79A 2CXXA 3GJ3A 4F7WA 3LBIA 4DLXA 1NKSA 4PHGA 1QG4A 4LHVA 1ZM7A 2WBLC 4JT2A 3C15C 1YZTA 3T34A 2NZ8A 1NP6A 5H8WA 3A1UA 1Y63A 1AKYA 2CLCX 4NYJR 5CIQA 3R7WA 1HURA 2ONJA 4G3XA 3EXAA 1R0WA 3MG9A 2AD5A 1Z22A 3BS4A 3BK7A 3LX8A 3VHLB 2IS2A 3PITA 1W5TA 3KXKA 4QM6A 1KKLA 4ACBA 2JJ2D 1SVSA 1OIVA 2DB3A 1Z2CA 1FL9A 1G20E 2C9YA 1D2EA 3EZ2A 3SQWA 1JXMA 3PIRA 2QU8A 4A0FA 3R8CA 4HDQB 4JKYA 1M6NA 2WOOA 1XCGB 4C30A 1W4RA 2Z6VA 3SI7A 2IHBA 4LBZA 4LBVA 1N6OA 4QHTA 1BYUA 3IDQA 4IDPA 2VQSA 5K8TA 4M1OA 1IHUA 2B6HA 2AFIE 3QBVA 3VR4A 3RS4A 1NL3A 1WXQA 2QQ0A 2R6AA 5FPSA 2V3CC 3NDBB 3KZ1E 1RZ3A 4JLBA 2QZ4A 2ORIA 1OXTA 2AL7A 3N2EA 2IEZA 3C5HA 3IILA 1HUQA 2MMCA 2HXSA 1A2BA 3K0FB 1DEKA 4QJ5A 3VNVA 2ZU0C 2ZYTX 4TLBA 4MRRA 4YDHB 4DRZA 2JLQA 1IN6A 1KY3A 1U0LA 2XX3A 5J5CA 2J7KA 1GAJA 4GNKA 5AJVB 1J8YF 1WP9A 3QXXA 3RRZA 4LOAA 4G5SA 3EARA 4DIDA 5AJZA 2X19A 1KSGA 3ONWA 4TWZA 821PA 3I3SR 3QVUA 3QXHA 3CZQA 3THWB 2BKEA 1SXJC 3I5XA 2BEJA 3AUYA 1OE0A 4JVMA 1Z0JA 3BWDD 1ZCAA 3IBYA 4RFVA 2NPFA 3GPLA 5TARA 4DCSA 4CEHA 4DVGA 1EFHA 3TGPA 4ZO4A 1FTNA 2FWRA 4PHHA 5BQ5A 1QZXA 3CX8A 1YR8A 5ANRB 1UBFA 3QENA 2A5DA 3LXRA 4C0JA 1CTQA 5HZHA 1CJTC 2IXFA 4L8GA 4CYMA 2HV8A 3OEEA 5KSZA 4Q1FA 1NMZA 2NQ2C 5HR5A 2Q9AA 4TN1A 1RJ9A 2ZEJA 2CE7A 1LF5A 3TRFA 1E9RA 4TMTA 2R6GA 2D4HA 4FI3C 1RE0A 4TTRA 1KSJA 2H18A 3LV8A 1FMLA 4B48A 1KNQA 3ADBA 4B71A 1W7AA 4M9QA 3U7GA 1L2TA 1ONBA 1W2HA 3KTAB 3F5FA 2A3RA 1DAMA 2JLSA 4UNPA 3ZS8A 4JLAA 3QF4B 4R98A 3ZVMA 2RGDA 1F2TA 4PR0A 3B5JA 2ZJZA 4U00A 4E07A 2F43B 2OBMA 3KUCA 1CRQA 4GSYA 1UEJA 2IYRA 1OF1A 1ZNWA 1Z3IX 2ODNA 2PMDA 3D3QA 5FPHA 2NOAA 1RIFA 2Z83A 2KB0A 3T1QA 2H92A 2WPDA 4EIWA 4LCBA 2O8BA 4A8JB 1KNXA 5DI3A 1PJRA 2ZRJA 3QY0A 4KSCA 2A7QA 1UF9A 3X1ZA 3KJIA 521PA 2GILA 2O8EA 1U90A 1W0JD 3BD9A 2ZI7A 4HAXA 4UKDA 2F6RA 4WAUA 3MGCA 3LRPA 4I1UA 4LJAA 1W5SA 3IHLA 4FIDA 4FMBB 2BJVA 4XVUA 2G1KA 1JJVA 1PLLA 2QORA 2ZRNA 2IYSA 3PVSA 3VX3A 2ZM5A 2ZI6A 4BLOA 1UKEA 2YHSA 1E2IA 2WMNB 4DT1B 2BDTA 4QM7A 2QP4A 4DCVA 1R5BA 2R2AA 5SZJA 2G88A 4Q4HB 2UKDA 4Q4JB 4EPWA 4GT1A 1UADA 2GJ8A 2PCJA 8OHMA 3W5JA 3GCGA 2FN4A 1E99A 1KDOA 4JLNA 1W4CA 3VKGA 1KAOA 4HLUC 3GQBA 1Q12A 2ANBA 1TF5A 1EG7A 2Z5FA 4PZYA 2ZANA 3N5CA 4URUR 1XXHA 4I1VA 2YOFA 2QPTA 5DHAA 1GTVA 1TL7C 1E0SA 1O3YA 2IYWA 4XH9B 1DO0A 1KAGA 5AUNB 1GRNA 1R0XA 2CJWA 2ZRHA 3OIUA 1JBKA 3CRQA 1ESNA 2IXEA 5DLQC 1T0HB 1S3GA 5DHFA 3PUYA 4LV6A 2OUKA 3G0HA 3CWQA 2IBMA 3RRNA 4X8HA 4MRVA 1II8A 4DDTA 1GG2A 4YMTA 4TT3D 1SHZA 1S4QA 2EWWA 2FG5A 4RKEA 3AVTA 1JAHA 2CMKA 3LNCA 2O8CB 4DT1A 4KU4A 4ARZA 1Z0AA 4LHXA 3KQLA 1ZNYA 4GZLA 2C96A 1DAFA 2V55B 3QUSA 4JS0A 3VQTA 1TQ4A 1NRJB 2OEPA 4PC7A 3WHKA 4F93B 5JJKA 1E2PA 5G53C 1NG1A 1XZPA 5BYJA 2Z4SA 5B64A 4GOKA 5KSYA 1VIAA 5JJIA 1OXXK 4YLGA 4ZDIA 3I32A 4EDHA 5FOXA 2X2FA 1E9FA 4HATA 4I81A 4WZ6A 2ZRKA 4WBSA 3CPJB 4OHVA 4LI0A 4V0MA 3BXZA 5KSOA 4B73A 3TSWA 4F92B 4BLSA 3O47A 1BO6A 2ZRBA 4HSEA 1G5TA 4QOSA 3EG5A 2ZJBA 1HY3A 3TW8B 5JSZA 2EQBA 2FGJA 3KL4A 1NLYA 2VTKA 2RGGA 4B43A 1ZNZA 3SC3A 4V0OA 4D82A 4G1UC 3B82A 1MH1A 2Z0MA 4WXPA 3BFKA 1COWD 4XWOA 4QL3A 2N42A 4A4DA 3VR6A 5DNYB 3A4MA 1VCMA 2FGKA 1X8KA 2CCGA 4BASA 1K5GA 2WPDD 1IY2A 1M7HA 2VF7A 3UMRA 3OFND 5DIFA 4RD2A 1AZSC 1AQYA 1NVWQ 1XD9A 2IF0A 1OFUX 3PEUA 5EXSA 5JWRA 5LD2B 4Q18A 4US2R 5KNDA 2IEYA 5M04A 1E2JA 4KODA 2HXYA 1OPXA 1HEIA 5P21A 3U3JA 1G8FA 1JXOA 4P0TA 3X1DA 2IXGA 3UMSA 1WBBA 1QRAA 4JBXA 1DO2A 3FKSA 4ESVA 4QGAA 3WYFA 4KFUA 5AK0A 4WW0A 2DFTA 3UWOA 1DS6A 3T61A 5EP4A 5JI2E 1OW3B 3CRMA 2O8DB 2VHUA 2W83A 3T5DA 2XGJA 4OK6A 4V0LA 1XU4A 1Q3TA 2P2LA 3EA0A 4PXAA 1OH7A 1VG1A 5J47A 1ZIPA 3RRMA 4DLTA 2OAP1 2GNOA 3RS0A 1E2GA 2EFHB 4Q66C 3WY9A 1XJ0A 3PENA 3DOEA 2GBLC 3NH9A 3ZYCA 4AG6A 4BFSA 3I8SA 3FTQA 1OH8A 1X8LA 2C04A 4MRNA 5HTKA 2OESA 2PBRA 2P6UA 3GD7A 1XEXB 3L8ZA 1FFHA 4A9AA 1A2KC 2VH5R 2QMUA 1N0WA 4DUGA 3VU9B 4KO8A 2BBWA 5KHOC 2PT7A 2GESA 3GFTA 4GI7A 2IS1A 1EFRD 1TQ6A 3AGQA 4B2PA 3RVBA 5AJWA 1MOZA 3TUZC 4PQRA 1JB1A 2D7DA 1S1MA 4DBLC 2RCNA 1W49A 1W48A 4J0QA 1G8YA 3QPWA 2CLSA 1XJCA 1TNDA 4LX0A 4NYIQ 3A6PC 4LDJA 2ZVPX 3R9WA 5CLQA 4NCHA 3CF2A 1F3OA 5DH9A 4D4JA 4ABYA 2WWFA 2OFWA 1Q20A 2ATXA 1TUEA 4PAQA 4B76A 4UJ3A 1P2UA 2OFOA 1E2KA 4TYWA 1W36D 1GFIA 2WJJA 5CJPA 1WCV1 1P61B 1E9SA 1GILA 3LVRE 1N5KA 2V7QA 3X2SA 3NVAA 1GP2A 2AN9A 3BAFA 2GK7A 5LPNA 1JAIA 4B33A 3EZ9A 5DGXA 3RANA 2ODBA 1OIWA 3W6NA 5CB6A 3GLIA 2ZRIA 3THYB 2OBLA 2PEYA 3IO3A 4KYUA 5IF9A 4P33A 1OHHA 1ZNXA 4NYJQ 1P9RA 4UXIA 3GLFA 1GIAA 3JZMA 4DLZA 1DE0A 1YZGA 2JGNA 1ZUHA 3MFYA 3ICEA 3QVVA 4GDFA 2P6RA 3QE0A 1BMFA 3NWJA 3K0AB 2VP2A 3GFOA 1J70A 2EFEB 4HAWA 4Q1CA 1XTSA 4MDEA 1GSIA 2QM8A 4H9GA 4XSHA 4MUAA 3K0EA 4A6XA 4OI0A 5TVKA 4LBWA 4LHWA 1OKKA 1T3SA 2GA8A 2VYFA 4XD7D 1MT0A 4YXWD 4B2IA 3ZZUA 2QPAA 2F3RA 5CDFE 1Q0UA 4P4UA 2BBTA 5DO9A 4HB4A 5SZIA 2O5VA 4IDNA 4A15A 2GZHA 4RZUA 4WOPA 1NJFA 4MKIA 3KDSE 2DR3A 5E7IA 1RFLA 2ZTSA 4JYBA 1II9A 4LPSA 1KK0A 3EWSA 3SYKA 4D81A 3A1VA 3LY5A 5FOTA 5FTJA 5C46F 3T1TA 1S1CA 2ZUBA 3TK1A 5BN4A 4BEBA 3ADCA 5BWMA 1MABB 1E2NA 4YONB 3VFDA 1Z6YA 3NHBA 1YRAA 4BRWA 1Z06A 3ZS9A 5J4LA 1JPNA 3QKSA 4R9UC 1HE8B 1NVUQ 1T4GA 5KUTA 4ITRC 5JEDA 4GOJA 1YR9A 4AD8A 2QPOA 3DKVA 4IDOA 2DFKB 1I2DA 3H0KA 4NTZA 4Q7MB 5JWOA 4M0LA 2ZSAA 1P72A 3QKRB 2ZYUX 2REOA 2O8BB 1D5CA 2CHGA 3LBHA 1YVDA 2C98A 1OV4A 1DOAA 3PG5A 5FI1B 3C41J 1PVOA 5FL7D 3OIYA 1ZM3A 2ZUCA 1Q1EA 2V1XA 4KITB 1AIPA 4D0LB 4NZYA 4U5XA 2I1VB 3P4YA 2XJ9A 4DUGD 2DYKA 2O0HA 2A9KA 2XSZA 5AWFC 3U6BA 1HTWA 1LNZA 1US8B 2ZSEA 4L4UA 4UJ5A 3PUVA 2ZJ2A 3PXGA 3SFZA 3RC8A 1GITA 1AQUA 3UG7A 4MYTA 5IK2D 3LW8A 4TQ9A 4LC0A 3CONA 1CJUC 1NJGA 3KJGA 4EJSB 3P4XA 2PZEA 2ZRGA 4ZV4A 1E69A 2ZYWX 5L3RA 1R0ZA 4DLRA 4F4IA 2JEOA 1LV7A 2FEOA 2FFBA 3O8RA 3CPEA 4JL8A 2YWGA 1P4SA 2IW3A 1W4BA 1G7RA 4B47A 1X3SA 1XTJA 3Q72A 1OYYA 3K0CC 2NO9A 4B2LA 1TPZA 2E9SA 2J7PA 3MWKA 2KSQA 4TTPA 5FPTA 4TLAA 1R8SA 2RMKA 5DI3B 1KMHA 2SHKA 3B6EA 1E2FA 2EYUA 3TNFA 4D0GA 5HCNA 3CRVA 2CVFA 2HF9A 5J40A 3GLFE 4DC9A 1C1YA 4X8MA 4MRPA 3H84A 1MRSA 1ZMXA 4C7OA 2ZREA 5A5GA 4C4PA 2BWJA 4TSFD 1VKJA 2W6IA 2VP4A 3AF3A 1CJVC 4HLCA 3FYHA 4LJ8A 4PQFA 3NBYC 2RGNA 1KIMA 1T8TA 2H5EA 2V1UA 1G16A 1G64A 2ZAOA 4PC2A 2F9MA 1G291 2H8KA 3B78A 3TR5A 3BB4A 1E1RD 1YRBA 2FEMA 3WHLA 2DY1A 2EYQA 4LY6A 4Q48A 3TVTA 2AFHE 4DB4A 3MLEA 1MR3F 4HAUA 4BEJA 5CITA 2WTUA 2WJHA 1CR0A 2N46A 3DM5A 3H4MA 2QSZA 2VP0A 3X1YA 3QG1A 1AZTA 4POAA 4LHYA 1M7BA 3MWLA 3SBDA 3BBPA 3VX4A 3ZJYA 1CS4C 3HDTA 2G1JA 1NBMD 3I61A 4IW3B 2IYQA 4IXNA 1G4AE 4RFSB 1P2SA 4ASUA 2KWIA 4L5BA 4UNRA 3EPLA 3HU3A 3R20A 2W6ID 1Z0IA 3U7EB 3AM1A 1II0A 1SXJD 1J99A 2ZR0A 3K9GA 5C4GB 2CEAA 3DM9B 4CGZA 5IT5A 2BVNA 4NH0A 4XVRA 4Q9HA 2GKSA 2LKCA 3FOZA 4KVAA 3AKDA 1OIXA 1SVWA 5L3VA 4MKGA 4HI0E 2BCJQ 2ZS9A 4ZDJA 1N5JA 3QBTA 4Q9KA 3U7FB 2VBCA 3DKPA 2G0TA 1UAAA 3GLIB 3ZZ0A 1CKEA 1VYUA 3R9XA 1IN5A 3AP2A 1NIJA 1XMIA 1KK1A 2QM7A 3QJYA 3LLMA 1JJ7A 1AS2A 3TVDA 2C78A 4IVPA 4DJTA 2F55A 4NPHA 5L3QA 2GXQA 3UK6A 3QXJA 3TUJC 5TDHA 5J4KA 1D6JA 2FZLA 3ZD6A 1F60A 2R9VA 1R0YA 4DIEA 2ZPTX 1NSTA 4B74A 1E0JA 2JLXA 4JVNA 1OLOA 1J90A 4M1WA 3MAAC 4TZ6A 4JZKA 2ZJYA 3R7WB 2QY9A 3HYTA 4FMCB 1SVIA 1ZUIA 5KNCA 1KDTA 4B75A 4CIDA 5GVRA 4XTRA 4RJLA 2C2HA 2GJSA 5KNBA 4OQMA 3JVUA 2Q6TA 3VR5A 2CBZA 3QEOA 4C0LA 1HV8A 4EPXA 1GKUB 1PZNA 2D74A 1P75A 2QE7D 4TYPA 5HE8A 2X77A 4WZBE 3B1ZA 3NBZC 1ZIOA 2VHTA 3PCRB 3WYAA 3GLGE 2FV8A 1DAKA 2J87A 3E5HA 4URZR 3U61B 1G3RA 4RFSA 1XEFA 2HEIA 5FL3A 1DTSA 4BFUA 4KAXA 1DBSA 1AM4D 621PA 1MO4A 1L8QA 2QNRA 2LWIA 4O2RA 4L16A 2BKUA 1Z47A 3TLXA 1G8HA 1VMAA 2VA8A 3BORA 1RC8A 2NPIA 1P2VA 3TAHA 3DMNA 2DFLA 4C0SA 4U7DA 1BS1A 2B92A 2XOKA 1H8EA 1FQJA 3K0FA 1P6XA 4DDWA 1G6HA 3IGFA 2ATVA 1NLZA 3V4FA 3WP1B 1E1QD 4UQOA 3D31A 3Q7QA 3ZLJA 3IPYA 2QRZA 3VTKA 1N0VC 3K9LA 3SU8A 4TMWA 1S96A 2IUSA 2XXAA 1Z0KA 1XZQA 4Z51A 2BM1A 4JBWA 3UKDA 1J8MF 1U8YA 3VR1A 3IBGA 3ZH9B 5B2ZA 5JZVA 5EUQB 1T0JB 1YZQA 2ZYVX 3PV0A 4MGIR 3GJ0A 5FOUA 2REXB 1NY6A 2QAGB 1TF2A 1NBME 4HLQB 3HPRA 4RD0A 5DISB 1US8A 4N0EA 3BH6A 5G3YA 1WBDA 1OXSC 2P0EA 2VSFA 4W9MC 2OXRA 4L15A 4EQ6B 4LK2A 4Z54A 4HLUA 1B0UA 1KKMA 3AVUA 2GXAA 1UBEA 1PUJA 2QEQA 5HE9A 2ZI3A 2WJYA 2V8OA 3S1AB 4BZXA 4AKGA 5KYKA 1Z63A 4U02A 3W8RA 3ND9A 3B13B 3W90A 5J4VA 4JL5A 5FOVA 2OLJA 5GADl 3CF0A 2J0QA 1G3IA 2O8CA 1E32A 3FGNA 1ZINA 4EKDA 3U44A 1N6NA 3EWAA 3ND8A 5E7JA 3BFXA 2L0XA 1W0KA 5DN6D 2XNSA 3PUZA 5SZKB 2KBEA 1XTRA 4AIIA 2GJAA 5KPJA 1P60A 3I4LA 1HH4A 1TTTA 3GMTA 1B23P 1C9KA 2WIBA 4OQXA 1IONA 3QG5A 1E2MA 4DCNA 1KY2A 3PEWA 2KBFA 3U5ZB 2ZETA 4LJ9A 4OQFA 4FWTA 2XZLA 3CX6A 3BERA 3N70A 3LVQE 1RRCA 2F1IA 4PSAA 1TQ2A 2BMJA 2GXSA 4V03A 1A5TA 1BOFA 1SXJA 1ESMA 4OHXA 4Q1BA 1P62B 4A0GA 4IFEA 4DLYA 3VNUA 4RZ2A 3Q85A 4TL7A 2JJ2A 1CU1A 1I4LD 2V6IA 5EP2A 1JNYA 4QGHA 3VAAA 4ZCIA 2J41A 3OESA 1P7CA 2ZJ8A 4JT4A 1NMYA 2DWQA 1C4OA 2FFHA 1ZYUA 4V02A 4A8JC 4DEYA 4TL9A 2IWRA 1LB1B 1NN1A 1U9IA 1M7GA 4B6EA 4Q4HA 4N1AA 1X1RA 4LYFA 4YMWA 3LWNA 5FTNA 3GLGA 3HU2A 3ICQB 2VP6A 2PMKA 5EE3A 4GL2A 3AVQA 2H1LA 2ZE5A 3A36A 2GWHA 4XSGA 4PSKA 2ZRDA 4HEJA 2XEXA 5K8LA 2VO1A 1IXRC 4JLOA 3X1WA 4DKXA 4DHEA 5JRJA 1U94A 3GEHA 3TH5A 2O0KA 3VU9A 3NC0C 4Q21A 1LW7A 3WBJA 1NNEA 3FHCB 3B1VA 4O25A 3CIOA 4XWAA 3DVLA 3W6OA 5BN5A 4FINA 3RWOA 3ZIAD 3QSYA 3K09C 4RD4A 2A5FA 2ZSBA 1AGPA 1E9EA 4I99A 1XPRA 4YMUA 3EX7C 4DLSA 2XNDD 3AKEA 1UKZA 4B3XA 4UNQA 4Q1DA 4M9SA 1VYTA 3PUWA 5KU1A 4KFSA 3WXMA 2QE7A 1F2TB 4DLVA 5JI3E 2ZJAA 2YKGA 2EU8A 1U0JA 1LTQA 1G9XA 2FU5C 4Q00A 2ZE6A 2YOGA 5EE1A 2IWHA 3EPJA 1AA9A 2XTMA 4II7A 1SHKA 3AP3A 3I8XA 4BZPA 5CIWA 5FL7A 1G3MA 3R9IA 3NG1A 4GRAA 5EXXA 2PX0A 1XP8A 4P32A 1EFRA 1ZC4A 1ZP6A 2ZE7A 2GXUA 3B8HA 1ZAKA 4TMVA 2YC4C 4DXAA 3GP8A 4AI6A 2A5YB 3IEUA 3QKTA 2HLDA 3FMPB 5F9FA 2OG2A 3RYTC 3AVOA 5FBQB 2HF8A 2OXCA 5HPYB 4ACAA 2B8TA 3M6AA 1R6BX 3BJIC 1IOZA 4M1SA 2B7BA 3CUEF 2GDJA 4IJMA 1UDWA 2JDID 5IRCD 1NN5A 1XD2B 2W58A 4PZLA 3KB2A 5BYKA 3FPAA 5FUVA 4MGYR 4OYHA 2ZJOA 2WWXA 1GUAA 1D2MA 1PLJA 1Z6AA 3O8DA 1RRGA 1HE1C 2QTVB 3KTAA 4HB3A 5AUOB 2Q9BA 4KVGA 4C0QC 5L3QB 1G1MA 2GEVA 3AUXA 3CPHA 2CJWB 4NMMA 4RVCA 3B85A 3TJZA 4MDFA 3A1WA 3KQNA 4TYQA 2JLUA 4IFBA 2ZI9A 4HZUA 2OCAA 2CVHA 1CP2A 1UEIA 3TW4A 2CL6X 3BFVA 4KJZA 4RZ3A 5FR2A 3CRRA 4G5OA 1H65A 3NEYA 3T15A 2GZDA 3Q9LA 2ODWA 3Q7PA 1LS1A 3QEJA 2CE2X 5DI9A 4MH0R 4E22A 2ZITA 1S3SA 1TU4A 4OI4A 2ZJ5A 1IM2A 2AWNA 2J3EA 1QHGA 4PAMA 4OQNA 1R8QA 1GM5A 3QI2A 1E9BA 2WVJA 3GEIA 5LDDC 4C2UA 5DYGA 4GPTA 2DHRA 4C0AC 3ZDQA 1N25A 3L43A 5TY0A 3SJBA 4M9ZA 1WQ1R 1FP6A 1FTSA 4ASUD 4ZIRB 4OHYA 2W6JD 4JLJA 3A37A 3WRXC 2H7VA 4BZQA 1Y3AA 1ELOA 2XNDA 3F8TA 3FMFA 4Z8XA 3LD9A 4QG7A 3RLFA 5LD2C 1WB9A 2W6JA 2WAXA 421PA 2GETA 1QG2A 2I1QA 2GCOB 4M9XA 4C0BA 5JSZB 1IQPA 1JQJC 1LFDB 1XD2A 1SKYB 1YR6A 3B7GA 2GTPA 3Q8XB 4HAVA 2ZSFA 4PPFA 3CF6R 3GLGB 1I4DD 1RPZA 5EQTA 4IEEA 1TQDA 1OJLA 3OIWA 4QBHA 1N6IA 4BUJA 4EFMA 4EPVA 4TQAA 2WWIA 2J1LA 2DWOA 4QBGB 2ZE8A 2F3TA 3OAAA 1R5NA 2QSYA 2HLDD 1GWNA 1MV5A 1OSNA 1RVDA 4A6PA 2RGNC 4Q01A 2ZRCA 4CEJA 2R6DA 4PFSA 2OV2A 3QKUA 1Z29A 4Q9IA 1E9CA 3W5IA 2W2TA 3FB4A 4PX9A 4NYIR 3BH0A 5HCIA 1L4UA 2HCJB 1A4RA 4PO1A 1WE2A 3WBKA 3OIVA 3BH7A 3P20A 4GFDA 1JQLB 1ETUA 2BV3A 4EAQA 5J4HA 1V43A 3SJAA 3KXLA 1TUIA 2ZAMA 4RSGA 1JEEA 3PFIA 5F2EA 2C5LA 2ASEA 2WJIA 2KI5A 4CT5A 3CH4B 3M0EA 1W0KD 4JMPA 4NCKA 5DN6A 1XMJA 3DZ8A 1A82A 3GFPA 2EFCB 4DDVA 3SOPA 1QHSA 2FSIA 5B57C 3HR8A 721PA 3ADKA 4LYAA 2D06A 5B30A 4FCVA 2CDNA 4HYYA 3C16C 4MQBA 1W44A 4KBGA 5JMTA 2ZRFA 1G7SA 3THWA 4JIMA 4LJ6A 2HJVA 3RNLA 2UZIR 1KO1A 3DHWC 1Q22A 1HT1E 4IOMA 5LB2A 5FTMA 1AKEA 1M1YE 1ZCBA 3H1TA 1GL9B 4BFWA 1U9IC 2ZI4A 4MYUA 1ZW6A 3OFNA 1ZD9A 5ELXA 1T6NA
chains in the Genus database with same CATH superfamily
4PU0A 3TDKA 1F2VA 4OKNA 3GRVA 4BXOB 3JWGA 4IP0A 1DQZA 4IEIA 3REQB 1K6XA 1FNNA 2O2HA 3V8MA 2ANCA 4IVRA 2B1QA 5LB4A 1V5EA 5FOSA 4F6LA 1FP7A 3H1BA 4HQLA 5SICE 2M6RA 5G1OA 4N3NA 3ORSA 3ZHYA 1DAPA 5H02A 1RM5A 1EQAA 1ZVJA 1GTMA 3JVDA 2BT4A 5CYPA 3W6UA 1MOPA 4H27A 5HGJA 2VQEB 4RMIA 2M9MA 5B1SA 4A36A 2QYHA 3KJEA 4ZEMA 3N8IA 2YXDA 5K7SA 1U0HC 2VSQA 3V9PA 5EIEA 3LQYA 4N49A 1J56A 3RIXA 2G1AA 4GVLA 3S1AA 1O6GA 4AVYA 1K4YA 5KCZA 2XE7A 4KPGA 4S1NA 2F43A 3EPKA 2DUMA 1SGWA 3D2AA 1RJ9B 1P29A 4OXNA 3R7BA 5FWXA 5CT4A 4DQUA 2CMDA 2NP6A 4P36A 3U3XA 3K2EA 5HFJA 2R7NA 3PSAA 2EFYA 4RGBA 4IJKA 1TJYA 3DE1X 4HNRA 4IV0A 4NJEB 3TSYA 4C1BA 4IMPA 3K9WA 1G3UA 3H11B 1XWIA 2XB4A 3HEBA 1OB2A 2C9OA 4OAQA 1NYTA 2PL3A 1GSHA 2QY6A 2RK3A 4QWWA 1RBMA 2F8LA 3A2LA 1KDZA 5JY1A 4W8HA 2V6JA 1YFJA 4H0CA 3H5LA 5I9NA 4X44A 1DC5A 1DRWA 2OZLB 1IL0A 1WCIA 2I55A 2O7SA 3ZWQA 4IIJA 1L5YA 4N7BA 1LDYA 1WMBA 4X94A 3C8MA 1SY7A 3EH2A 3RAEC 4I4CA 4PQYA 1HDGO 2IYUA 4M22A 3WP0A 4HWOA 1V6AA 2ODEA 4Q4JA 4HGRA 4MVJP 2AF3C 2CLHB 3BSSA 3M5WA 5JD4A 4GW3A 2IZZA 1JS1X 1UFQA 1UKAA 1W94A 4X84A 1KI1A 5CNJA 4ZU6X 5F3RA 2GLUA 1Z7GA 5EIHA 1D6SA 3VR2A 1FFXB 4C6RA 2VPXA 1LPPA 3VPXA 4ENQA 3MJVA 1V3TA 4AXXA 4EL0A 3Q8KA 1KERA 5KOJA 3EIQA 3HKDB 2ZQ5A 3IQIX 2AG8A 3T7RA 1GAQA 3NEJA 3T06B 1XMVA 3DB1A 1XLVA 1XYGA 2VLBA 2OO7A 3O4IA 1DTWB 1HG0A 4GM0A 4U3JB 2HDOA 4X24A 4XOIA 4DZRA 1LRKA 3OEHD 3DHEA 4MKXA 4TVSA 2HXGA 3CKMA 5HF8A 4KYTA 4TV8F 4G23A 4ITUA 1IFXA 3LVBA 1FDOA 3OTQA 4F8EA 3AF6A 3HGMA 3KYBA 1H1DA 3K30A 2Y1DA 1UAGA 1F3LA 1WNTA 5EZ6B 1WUKS 3L3BA 1Q95A 4RK1A 4J3FA 2E55A 4PRLA 4UNSA 4ZQHA 5GAJA 3ZH2A 1W4ZA 2JJ1A 4BNKA 3HNOA 3NAQA 1UPAA 4XWTA 3VSAA 1EVIA 1V71A 2JATA 1O2DA 1EX1A 1NBOA 1UOEA 4NXMB 2CNOA 9ATCA 3I9LA 5T5QA 3BZWA 5EGNA 3CNNA 1MABA 5FR1A 5FX2A 1PR2A 1PTJC 5K03A 3HBMA 4LVOA 4JX8A 4YRGA 3D3KA 1Y4UA 2QENA 4RIFA 4MR7B 1WP4A 3TKAA 5DBGA 2C07A 3IULA 1Z45A 2X86A 4E15A 3R0IA 4Z9YA 4W9NA 2C94A 1GKIA 2FPGB 3AEYA 5D1NA 3TNJA 3SJCA 3TQHA 4HUTA 1FRVA 1U1EA 3RRJA 3U4QB 4HADA 1DDGA 1UMDA 3C8DA 5BWBA 2AX4A 2ECFA 3JYPA 3D5QA 1BXRA 4MUHA 2D5LA 1CPYA 2RFLA 1X7YB 4XQ0A 1SURA 2I3BA 4IG9A 5TQJA 1QH1B 1YACA 4DA0A 2PZAA 3HWX1 3L7MA 13PKA 3UJAA 3U3KA 2ZUWA 5H83A 3EODA 4Q02A 1PTKA 1WBJB 2A9FA 1A72A 3GLUA 3LUHA 3ENWA 4PYLA 3FPJA 1CX9B 2FZWA 2ARKA 3LFTA 1QGAA 3DMYA 3I1IA 4PWYA 3AP1A 4B5LA 1XF1A 3AF2A 4PSUA 4GQIA 3WGNA 4ESEA 4NR0A 2QVCA 3HVHA 3L01A 4F84A 4WOJA 4JNCA 4AC9A 3TGLA 2VT3A 5JPIA 4BFYA 3EEIA 1I2AA 2A67A 1Y1PA 3BTUA 2C57A 5EI5A 2XTNA 5G3ZA 5M7EA 2AE1A 2OFXA 4CV1A 1K08A 4JUIA 1EDDA 1U80A 2GCOA 2JHFA 3CG0A 4U2KA 2DBZA 4TSRA 1TA4A 4RH3A 5DLDA 3RVLA 3AUUA 1HEYA 1Z82A 1SBIA 2R65A 3F7NA 4GI5A 4OREX 4R8SA 4WCFB 1P8AA 3LX4A 2MSDB 1SBCA 3FFAA 1XRJA 1P18A 4UVGA 4HZIA 2WWYA 1NQ5A 4HFMA 3NDIA 1KMHB 3NGLA 4FW8A 2PD4A 1ML4A 3M6XA 4LVUA 4NNJA 4QC2A 4R8VA 4WKPA 4QGGA 3LY9A 2XNJA 1YC5A 2ZTHA 3SS9X 3BK2A 4H60A 4E11A 1KOFA 4HDMA 2ZT5A 1OBOA 2JGIA 3AHCA 4NNPA 3ZK9A 2UXCB 4CLEA 1K97A 3H2IA 4I66A 1YA8A 5CX4A 2J8ZA 5TS2A 3SZRA 4ILKA 4Z7QB 2XUJA 2ZPUA 4FE3A 1A7JA 5BWLA 1MP0A 2AC4A 4GAEA 1VMKA 1WKBA 1E0AA 3NHSA 5AVUA 4KXWA 4E30A 3SEFA 4XOUA 1LQUA 5IJ0B 2VAXA 1QHHA 2VEDA 2JK1A 3A10A 5DTJA 1IWOA 3JQ6A 4CG0A 5IYZB 3I62A 4ALJA 4HWSA 1FYVA 3I4FA 3O4HA 4KHZA 3RG2A 3HVRA 3GJXC 1QFYA 1CLUA 2RGAA 3OF3A 4YJKA 4B3IA 5BW8A 1NURA 3W3AA 5GMOA 1M2NA 1Z2PX 3HYNA 4PLZA 1G6Q1 4EHDA 4ENRA 2DVMA 3F5QA 3KKOA 4GX5A 2ZI5A 1GFZA 2GTHA 4LJLA 2O06A 1SHLA 3U3RA 1SULA 4AIRA 4CFYA 1I36A 1DADA 3ESDA 4AWXA 1VECA 2ZTUA 1CRPA 1SVMA 3DOCA 4UM7A 1H8ED 1IJEA 3U3ZA 4C87A 2X5XA 2E4UA 1QDUA 1PQPA 2SCUB 1AUQA 2D5CA 1D0VA 1CUUA 4YUYA 3WDMA 3DHVA 2O8DA 4UUQA 1SZPA 4TSFA 5CB8A 2X0RA 1VB3A 4G1FA 3I6QA 1NPDA 4QGBA 4ZVKA 1SVOA 3M3PA 4UBLA 5C1BA 1LPNA 1RJFA 4IUCS 9GPBA 4BGVA 1EUYA 3WNQA 5FYDA 4PSVA 2RKOA 4CIVA 1SB8A 4DYVA 3T1YB 4WACA 2NMVA 4K9LA 1I6KA 2C9MA 3HUEA 1OKKD 4RVGA 5CYOA 4R54A 3UT6A 3ZJ4A 2XB9A 1M6EX 3NRCA 2PFSA 3PPWA 4J0KA 5JSHA 2BHSA 2FQWA 2FY8A 2GK3A 2HKIA 3Q7TA 1OLSA 4EY7A 2PSEA 2G1PA 4G8CA 2B34A 2BF4A 3G89A 4HXFB 4R2KA 5DKFA 1DCTA 4AYTA 1A3CA 1TKBA 1YS6A 3UHOA 4E5NA 1QG6A 2Q1UA 2XVXA 3Q8WA 1NVDA 5LC1A 1J2YA 4Q15A 5A9RA 4D74A 2LCFA 1ZBDA 4OXRA 3S6JA 3LYLA 4A6EA 2BISA 3E4CA 1EZZA 3WFIA 4ZCSA 1U3DA 1DDOA 4Z3DA 2C88A 3AF4A 3AUJB 3E9ZA 5NULA 3TX6A 2ZUEA 1VTKA 5FEUA 3EQ9A 4FOSA 5CB4F 1M1NA 4UEQA 1EGMB 4XCXA 4NHOA 4F4FA 2E4WA 4OP2A 1UDAA 4CLOA 4G5RA 2ZUVA 3KQKA 1H3EA 2OXFA 1NU6A 3FJ1A 3FLBA 3S40A 4QQRA 3A1DA 3F74A 2GF9A 2CT8A 3RB8A 3E9NA 3AR5A 1HTBA 5GOTA 3FCAA 3RD5A 3K2QA 2IITA 2G0NA 3KFVA 5E95A 5EZ5A 2NQTA 5KHAA 4CFZA 1Z6GA 3GFQA 1SPBS 3FHJA 4LV5B 3KKNA 2X8WA 1Z6TA 1AF4A 1PJQA 3CZMA 2KLBA 4RHCA 1VYHA 4FD2A 2R5NA 2B6NA 2X0KA 1KE2A 5JJBA 3FFBA 1YI1A 4HV4A 1EFVB 3WISA 5FA6A 4ZU1X 1SPXA 2B4TO 4O2AA 3BL6A 1KEEB 4JLMA 3ZX5A 2ZUDA 5DSZA 4D4IA 1EM8A 4MEJA 3V4LA 3RBZA 2XWJI 5I9LA 5ITZA 5JBQA 3EAFA 3UF0A 2HTEA 4E5DA 1HLFA 4JKIA 4YRMA 2E4YA 2AQHA 2XODA 3L7YA 3EGVA 4Y2TA 4KLRA 1OHHD 3COWA 2H5LA 2Y6UA 3AI1A 4JLWA 1HOXA 3IXMA 3QXGA 4B3GA 5ERXA 2AXPA 4BFXA 1ODFA 3UAGA 5AW6A 3F7MA 1GU1A 3TD9A 1AN0A 3DCIA 3G59A 5AW7A 3ODGA 3ER8A 1H8HA 2IF2A 4B0PA 2PZGA 2Y8EA 3HJBA 1FDRA 2WWGA 1DIOB 1M2OB 2P1RA 2R68A 4HDRA 3JQ9C 4QJ4A 4QODA 8ADHA 2C97A 1NVVQ 1ZJ6A 2OD7A 4RQBA 1KYXA 4YAFA 2JD0A 4Z9AA 4KMOA 1RYHA 2ALJA 4KAJA 2R87A 7AT1A 1JQ5A 1G9TA 2QZZA 2YWHA 3CG4A 5JS2A 2X6RA 3PNMA 4I14A 5KVCA 4IRUB 4KKVA 4XQ9A 4Y0AA 1DU4A 3QQ5A 2XDQA 3VOTA 4TMZA 4LRWA 1RKBA 3SKXA 3EYAA 3GL9A 1OYWA 1S02A 1Z28A 2J5XA 5MGNA 3NKFA 2RHWA 2ZWVA 1E62A 5FUWA 2LXNA 1G6OA 2DRIA 3S5JA 2Z09A 1YT5A 2GN9A 3LECA 2DWPA 3RLIA 3UH0A 1O4VA 2VDVE 3HB7A 4MS3A 4RCVA 1IIRA 3T7EA 4GMDA 3IIMA 4OLBA 5TPZD 3ZJ5A 1Q1NA 2HJGA 4ABTA 4D44A 1U1DA 1XQ6A 2EW1A 1BWSA 4L0CA 1JEOA 3H05A 5B1YA 5EJGA 2ILVA 2NTYC 1JFLA 3CT4A 4FYMA 5DK6A 1JDJA 1ADCA 4UAJA 2JCSA 4S2EA 2WYOA 3CRW1 2VL7A 4TYNA 4Q7JB 4PZZA 1BW9A 3DLCA 3PEYA 2INGX 3IUEA 5IZCA 1VG8A 2ZBPA 4IM7A 5DYTA 2BFEB 1I30A 1P4JA 2CFOA 2C8VA 3NXSA 4MGEA 5A3SA 4K87A 2FMTA 2DLCX 4KCGA 4CT0A 5F7XA 4HFRA 1FNBA 4ZDKA 1VL2A 4JJZA 1AJEA 3HYRA 4QHYA 4YUWA 2GYWA 1E1CA 5BXYA 3HI4A 1LLUA 3QNUA 3R6DA 1K6MA 4NENA 3JVVA 1B1CA 1P1RA 2EG5A 4J6EA 5AKKA 5EQJB 2W42A 5FPKA 2MR6A 2Z9BA 2WTXA 2YMLA 4ME6A 5EIBC 4OJTA 2O2CA 1Z6PA 4PF1A 5I7OA 3UPUA 3NYWA 4BECA 1SO8A 1XJQA 1LY1A 1GNSA 4FFMA 1CR1A 5AW3A 3V8RA 3GF4A 1T4CA 3HJTA 3SQOA 3AHFA 1RWWA 2YY5A 3AERB 4JJFA 3M8KA 4TL8A 1K1EA 3CC8A 4X7BA 1UMCA 3WLJA 1R6VA 3BPSA 4LVNA 1R16A 5HSGA 2R7LA 1T25A 2XQFA 3EGEA 3ZU5A 3OQIA 3I2IA 2FRXA 2KJQA 2QVYX 2FPIB 2QZPA 3HCDA 1Y81A 3JAWA 3NBQA 3P7MA 1IHYA 3MTDA 4OXQA 2ET6A 5KWIA 3R09A 2VWPA 1KP3A 3G0OA 2QJOA 5CCBA 5HJEA 2WM3A 1ZJYA 2ZBRA 3IQXA 4FONA 2GJKA 4XIIA 3OCJA 1CYDA 4U4AA 2VCEA 5CYGA 1IZ0A 2XJ4A 5EJ4A 2C99A 1RHMA 3CO5A 4NBTA 3U3OA 3AV3A 3KQMA 1CR4A 4EENA 3GOQA 3U3DA 1L0BA 1C5KA 2G7MC 3DZJA 4WIAA 5H9WA 4X8OA 2RAPA 1SM4A 3ETLA 1TKCA 4FGWA 4GM1A 1M66A 1TIBA 1ICEA 2GZ1A 4LECA 3L0OA 5AXDA 3N6VA 4IILA 5AUQA 2YJZA 2DFNA 4CV3A 1KEUA 1QPZA 5KKAA 2ONYA 3ZPXA 1IZ7A 3WXBA 1R0KA 1TYZA 2E49A 2TYSB 1EM6A 3KL2A 3UB3A 1T3HA 4IOKA 4YN3A 1O95D 1GUBA 5JSQA 3L6RA 3R4CA 1BKDR 1W581 1TUGA 3UQYS 4HGYA 1F0YA 1H4VB 3C6KA 2IHYA 3NNSA 3TLJA 4QBFA 1PEYA 5F1PA 3QFCA 1EK5A 4MUBA 3M5CA 4TTVA 3K6RA 4EG8A 4R8RA 3DEZA 3CVYA 1EGAA 2Z4RA 3H9BA 1G55A 1KO7A 4AUKA 1KO5A 2PA3A 4AJ1A 3ZOKA 4UM5A 3K09A 1DLJA 5FRDA 2PD6A 2MIIA 4ZA2A 4EA8A 3MELA 3T7AA 3RYIA 4JT9A 4ZJPA 4H1VA 5IBPA 1DINA 3U80A 2P67A 2FPIA 5EIFA 4NU6A 2C2OA 1SHUX 3IHWA 3VR0A 2P78A 4NYMR 1FYXA 3SXJA 4IH1A 3V80A 4A0QA 2FJUA 4C07A 4NKRA 3ER6A 5FUBA 5JHGB 4FWIB 4DBLE 1DUVG 3Q6IA 4GC9A 4A1FA 1ZL0A 3G8AA 2RB4A 4P2BA 5A9SA 3P1JA 3R7DA 2ISCA 3ND5A 2RH8A 1CBUA 2FN7A 3HCWA 4KXYA 2QRLA 4PFJA 4HBGA 4TL6A 5A7GA 3K70D 4RTOA 2ZS7A 2Y71A 3D2BA 2AYZA 2A1IA 1VIDA 1CUSA 3VPBA 4AG5A 1JHQA 1PDOA 4Z0PA 1JTVA 4QARA 2OAGA 4WPGA 3TW0A 3UJ7A 4F97A 2HDNB 1EZ1A 3ONNA 4TQGA 1M6HA 1FUEA 3ROGA 1ULTA 1ZVQA 1C2TA 2G5GX 2NXWA 2PY6A 5AXCA 2X3FA 3COPA 4JUCA 3BD8A 4HRAA 1FQKA 4GD3Q 3UWKA 1RCUA 4YCLA 3ORQA 3ST7A 3K1JA 1V5FA 4IH4A 3N2GA 4J2OA 3G88A 4E51A 2VJQA 3RSSA 1AS3A 1R4MB 4ZVTA 4X54A 2VHCA 5KOJB 2AZMA 1HNXB 5L95A 2GVDC 3N74A 3MTBA 3VHRA 1C1XA 4YRNA 3THXA 1KGDA 2XA2A 3MMSA 4GZ5A 2IXBA 1VI5A 4IGAA 5DV9A 2YICA 3FMGA 3TIGA 1OAOA 1YZHA 2QXYA 2VHXA 1JQAA 1TF7A 3WRVA 1E1RA 1IB6A 2IEDA 1E5XA 4PV7A 2NSHA 1POWA 1RBZA 2B9VA 4G0YA 5HQ3B 2PU5A 3I2YX 3G5MA 1I3KA 3GC6A 2BGLA 2JJMA 3E7PA 1FYWA 2CVZA 2YFHA 5KQPA 1VJRA 2I7DA 3DVRX 4UTZA 5KAMA 2XDWA 4YLEA 4PO8A 2F1JA 3DOHA 3EFOA 1UZLA 3SOZA 2UZ1A 3WGIA 1Y5NA 2CXSA 3T1OA 3TNDA 4E6PA 4Q5IA 1ZG3A 1KYIA 4ND5A 4G5GA 1JNXX 5KYXA 4Y1RA 3O82A 3KOXA 3GPLA 1Q3KA 2BHLA 4QHSA 1IWBB 1FZQA 1YBAA 4ZT5A 1E1MA 4B3FX 4WRRA 2O5EA 4EI2A 3W7VA 2Z9CA 1XQ9A 5F7JA 1L5LA 2PZKA 4YS6A 4D3XA 4WZBB 1T0PA 4EECA 3BIWA 2QTHA 3I73A 3ADPA 4UHEA 3NO4A 4OHZA 2I8AA 3KQVA 1T3LA 3DTYA 5H16A 1KMQA 4DCUA 2X42A 5HKOA 2FPPB 2HPVA 2DE0X 1SVNA 2WM8A 1XF9A 5DX0A 1ZI8A 2R8RA 3V7FA 2VDWB 4KFRA 1VRCA 3PR3A 3O1HB 2YIJA 1LSUA 2HBRA 3S28A 5I4CA 2W11A 3A7DA 4ZAVA 4L27A 2PTHA 4W5RA 1K6IA 2QZSA 3BGDA 3HPQA 4M0PA 4N0PA 3IDFA 1WCXA 1R7RA 2KQUA 3AZQA 3IAEA 4ZAGA 3O26A 3MBOA 4LYJA 2OHGA 3SYRA 1U1FA 4PLTA 1C3EA 3KZKA 4EY6A 1EFVA 5GJCA 3FDIA 2AX3A 4XA8A 2QQFA 4Q7KA 4ZOLF 1MV8A 1Z5GA 1FW8A 3AOEC 3WNDA 4FKBA 3Q3IA 1KYZA 1L5HA 2P2NA 5ADVA 4QUIA 4E5VA 1UWCA 3LS2A 2L69A 3H9EO 4OKSA 4R51A 1ECFA 4QNMA 1WZEA 1HKUA 3QYPA 5JH7B 1LEHA 5LXTF 2PNJA 3V4RA 4QQ8A 4OU5A 1C0IA 1MC8A 1CDZA 3KG2A 3ANMA 5FAKA 3V9AA 3MCTA 4P3KA 3DLPX 3ZX4A 1EXDA 2BBSA 2FCAA 5ECWA 3KB1A 3MMZA 4CW7A 3AVWA 1S3IA 3O9MA 1RPTA 3TEMA 1NHGA 4LHZA 3GRFA 5LBIA 2GAOA 1J9GA 3O7WA 4FCWA 3TZQA 4GVPA 3BIFA 1EB9A 3BBLA 5BOVA 5KWEA 3DAFA 4FNGA 1NW6A 3MILA 1FNSA 4MGZR 1APBA 2J0SA 4JKOA 1E3MA 1V8PA 1N6RA 3PHGA 3ND7A 1CE8B 1Z35A 1SCDA 2FMXA 4R2JA 4W99A 1QHIA 3I5YA 4OQLA 3R5KA 4YJDA 4XRRA 3WO0A 4FHGA 1W47A 2WMYA 4HYTA 3JQAB 4CM1A 2H52A 1TFUA 4EMBA 3K70C 3P2OA 2FJ0A 2EJVA 1T9KA 4XVQA 2A2ZA 1D1QA 4B09A 5J4YA 1CF2O 2DT8A 3DE0X 3N0TA 3GK3A 4DSAA 5JARA 3ETEA 2VDWA 3OCVA 1Z8FA 2QT1A 3H42B 4ARVA 4YXWA 3FVRA 1F9EA 3FKQA 4RLSA 5JO0A 3WYBA 2J3KA 1GQOA 4WESB 4WFJA 3MWJA 3KKQA 4KB5A 2I33A 2ZLBA 2IEGA 1AB6A 1NAHA 3LC1O 4EWLA 3IPLA 2IYPA 2NV2B 5K3FA 2QL7A 1NX9A 3MCAA 1NM5A 2BEWB 2JASA 3VKWA 4KVFA 1VE6A 3OIDA 2XCOA 4UPVA 4A91A 3AIMA 4FFDA 3FNRA 4IX9A 2VR1A 1A9OA 1AZLA 1GPUA 3LZ6A 1GNRA 1U9CA 5CNIA 3ZWVA 4CEHB 4BYMA 1DXYA 1LI5A 1WSDA 3OZXA 2WNHA 4KLZA 2QLNA 4ZT2A 5LP6C 3JQ9A 4RNDB 3K1TA 3B70A 2QMEA 3QBDA 4BFCA 2XWQA 4TV8A 2FUKA 1YDHA 1H2BA 1NBMA 4PC6A 4RV5A 5KS2A 1K06A 3QXCA 4Q19A 1MKYA 3T7DA 1A4UA 2BD0A 1N5RA 1ST3A 3C43A 3T12A 1BFKA 2RK6A 1N0HA 1Z36A 3PJGA 3DZDA 1CIJA 2VSYA 3HDHA 5EPEA 3PI7A 1C9JA 3HYCA 4NMWA 4PYQA 4KR9A 4E2FA 2ZSKA 1SQGA 1JLKA 1YSCA 3DC7A 2OSBA 3WK8A 3BB3A 4C2TA 4H7HA 1EFTA 5DM2A 2H16A 3ONFA 3ROXA 1M6YA 3ZWOA 4R1TA 1B76A 3TGWA 1JJAA 3QELA 3LQQA 1C8KA 2FPWA 4OMUA 4ZCTA 2FZ4A 1TAUA 2XA9A 5F23A 4K6OA 3TZHA 2RJ3A 4HNSA 2C4WA 2AN4A 1MGPA 1NASA 2EX4A 4ONEA 4RENA 2XCTB 3DR5A 1LTKA 2XB2A 3WO1A 5E2BA 3IQEA 3UANA 3WYNA 2V65A 1XRSB 4QO8A 4GXTA 4ND1A 2H9YA 5EJEA 3LHFA 1AMOA 1ZRHA 2Z2KA 8ATCA 2XZOA 2IVZA 1T26A 3DNMA 4F38A 1K8RA 3LFUA 2QKYA 3DAGA 3P2KA 3DDWA 3RC1A 4CEIA 1G5RA 4C14A 4X92A 3USES 3SJZA 1IDOA 1TEXA 5LKAA 3EB9A 2CXOA 1NYLA 1NZFA 1CC1S 1VIYA 2A59A 2GEKA 1DC6A 1WIWA 2X8AA 5CR9A 4DV7B 2WE8A 1KR2A 3J7AC 1Z17A 4K05A 4OUDB 3DHNA 2FUEA 2AEFA 4ZK2A 3MAJA 3O8CA 4TTJA 1ISRA 4UQLA 4LI3X 1ECJA 4CLXA 1FB5A 3ESZA 3P9IA 1QH1A 3IP7A 3SXPA 1MBZA 1HLDA 2QTVA 3ZQJA 5CLLA 1E94E 1L4GA 2FWBA 4YMVA 1ACJA 3PR2B 4MS4A 4RCYA 2VP5A 4BEWA 4PBTA 4O63O 3TMYA 1XAIA 2Q1XA 1IG0A 4Q9NA 4K8OA 4HLNA 1CW2B 2W93A 1BN6A 4BTVA 1DXOA 1T24A 2VHJA 3GEEA 4D0NA 1TQHA 1E1LA 2VCYA 3GPDG 3IQWA 1RM4A 3D3NA 3PGLA 4P4GA 3OMWA 4URYR 2BFEA 4B35A 3ZHUA 4RHFA 2QUIA 1Z0FA 1O1YA 4OYRA 3ABOB 1UQRA 1O5IA 1JW9B 1NUSA 1WPQA 3DAOA 3UJ9A 3ZE9A 4EI8A 5EJ8A 2AFVA 2JANA 2XHEA 2F3QA 3AINA 3C3XA 4GSKA 2Q99A 4YBZA 5ELLA 4HJXA 5TR9A 2O3UA 4EO7A 1F4LA 2AMYA 1W0CA 4OJQA 2A14A 2FTKE 5J5VA 1T8UA 1ZMRA 2UU9B 2FSVA 3EULA 5DYIA 4A0RA 4L07A 3W06A 5CT5A 2GKOA 3JYLA 1WRBA 3WYGA 2F90A 4K0RA 1Y3IA 4RD3A 1X94A 1M1YB 1P5RA 2VKQA 5KYUB 3FJOA 3COZA 3DCNA 3IUPA 5F5LA 1OBHA 3JQFA 4HXEB 2CSXA 1E4OA 2WYWA 1M83A 1SBYA 1VPTA 1M0TA 2Z2YA 3FIJA 2ZAGA 5HHTA 3LPMA 3EGCA 4WOCA 1WVIA 1OD6A 2RGXA 3ICPA 2ST1A 4AS2A 4EW3A 3AX6A 2WF5A 4EHLA 3I30X 2AVNA 1EBUA 4IOLA 2Y1XA 2ZUTA 2IS4A 4Y3UA 4NCJA 5COAA 4EO4A 1AGRA 2WUGA 2ODPA 1LPSA 3P32A 3TSOA 1DG1G 1Q1ZA 2WJVA 2Q6OA 2V74B 1XN4A 3H9UA 2BEUB 1WDKA 4BNWA 2P41A 2OT3B 3VKHA 3V2HA 1QBGA 5BP7A 2YWFA 3JQGB 4R2HA 4BNDA 3KDAA 2IU0A 4F3TA 4MARA 4JYMA 1KRWA 3A1CA 2QYTA 5TQ2A 2ZOSA 2VT6A 1AX9A 4KR2A 2YV4A 4MPJA 3SSNA 3K31A 1OTHA 5HX7A 1NBIA 1JG2A 2Q5OA 4R71A 4KRFA 1E96A 1J4AA 1Z25A 2YJ4A 3ILVA 2LIVA 3SBEA 1PS8A 4AECA 5KNDH 4HPXB 3WI7A 2JLVA 4DCCA 4YV0A 1UZMA 3LSYA 1U3CA 4KNWA 1ZY2A 5GONA 4Q9LA 1CUCA 4RPGA 4I9GA 1P2TA 3N2ZB 3BMCB 1UANA 1SVKA 5TEVA 1U04A 4NPCA 4OYHA 5LLTA 3WNBA 2JCYA 3H11A 2ZR9A 5BMVA 1JZTA 3LHSA 3KM0A 4LGYA 3CNBA 3DP7A 2PR2A 3F5DA 3O73A 4JHXA 4P80A 4YY3B 1NFQA 5JCXA 4CR8A 3OQMA 4EG6A 1QH9A 2BMFA 4R1OA 3IKTA 4LG1A 4HNTA 4BATA 1KI8A 5IC5A 3CZ4A 2WHEA 1XX6A 3CKLA 1DAOA 5YASA 1VG0B 5C4MA 4NCXA 5K3BA 3DE3X 3MGBA 4UVEA 1O57A 1HGXA 1U31A 1L7QA 3SIXA 2JIBA 2EP5A 2C4UA 3O95A 2QTTA 1Y1RA 2Y1LA 3RC2A 4M53A 4RA6B 3ZHVA 4F12A 2PS1A 2YXLA 3VU3A 4EUFA 3RTGA 4DMMA 2PH1A 2TMKA 5EMJA 1IIBA 3DDHA 5FPQA 2LIPA 5IKEA 3AVXA 5JCJA 2V96A 1NYQA 3OMLA 3R44A 5HVNA 4F72A 4KR0A 3LUPA 1W73A 4NBSA 1YJQA 2BHRA 4Q9JA 2HTFA 3V1YA 5JCJD 1MF7A 3B5IA 1T0IA 4JOQA 3HN7A 4JZYA 5BSRA 4BE4A 3AGPA 5IG2A 5JPCA 5E1MA 2VTBB 2P5SA 3FVQA 5L7TA 1OFVA 4BNTA 2FMFA 2BRUA 2R62A 3PGVA 2XUKA 3GR6A 3S99A 1D8TA 3EBPA 4BCDA 3CIFA 4UTVA 2JRLA 3L0CA 5CFQA 3U6KA 2ZIXA 4O0LA 4TMYA 3RUHA 5HILA 1SCUA 4P4TA 3VV3A 3Q8MA 3KAJA 2PVCA 2B2XA 4U63A 5IDVA 1G17A 4UFOA 4G0QA 4UOEA 1T9CA 3BMNA 2AWOA 3PDHA 3MRSA 1YJAA 2BEWA 1SAYA 1EE1A 2KE5A 2HB6A 2BBOA 2X0NA 3TXYA 4YDSA 2QX4A 1S2LA 4WBXC 3UK2A 5MHTA 1CUBA 5JU6A 2J0UB 3IAUA 1VL1A 3IMCA 3VGJA 1XE3A 2IV3A 1Z38A 1YCFA 3RBAA 3IV6A 1ISPA 3PVCA 4KJXA 4MA4A 5BW6B 5BR1A 1P5JA 5GZ6A 2P3LA 5IMSA 1MXFA 3B7PA 2Y1OA 2OKGA 2XMBA 2R1TA 1JDBC 3CLKA 3TX2A 3OLCX 1GUYA 1U5CA 2WB2A 2XYHA 3FWPA 4O4HA 4INAA 1UKCA 1HYGA 2F1HA 2NZWA 4Y6RA 4B17A 3PNBA 4QECA 3D6TB 1DQYA 3SNHA 3B2EA 3GWZA 3GZNB 2YYYA 2IV2X 1UXHA 4C03A 1KH3A 4C22A 4EA9A 2HL6A 2Q5FA 3HB5X 3I9MA 4HB0A 4AKHA 5A6SB 1YQEA 1USVA 3QELB 3EHEA 3G0CA 3RARA 1E79A 4A92A 4GXQA 2BTQA 3LBIA 2A9QA 4IF6A 4ZQEA 2CYCA 1L6RA 2P4EA 1ZM7A 1CY1A 2APJA 2FQYA 3C15C 4FDUA 4J0HA 4ENWA 4GG1A 2EBUA 2MSWA 2O2IA 4BJ5A 5H8WA 1A5BB 3A1UA 5CIQA 2NO4A 4I50A 3R7WA 1QV7A 4EUKA 2F4VB 4BKRA 3IEMA 4S2UA 4E5SA 2OB1A 5I6DA 1NBHA 3MG9A 4EB0A 2ZSIA 3RU9A 3BK7A 5AYVA 3NVMB 1ZK4A 3PITA 3TNLA 1KKLA 2E3JA 2C3UA 3RUCA 2GD2A 4MYRA 4BCBA 2WTEA 3GNTA 3W7BA 2QU7A 2J5QA 2B25A 1Z2CA 1FL9A 1NVBA 4JP8A 3LUDA 1CZHA 1JXMA 2R0QC 1A8UA 3UAVA 4R0MA 3R8CA 4IWYA 2EP8A 4HDQB 4JKYA 1T2EA 4L51A 1M0SA 3DZKA 1IZ8A 1WW3A 3IVXA 1QIHA 2AOWA 3LUGA 1IQ0A 2AOUB 4YJGA 2V6GA 4K9QA 4RTJA 4LBZA 1N6OA 4WJZA 5SYMA 4EB6A 1BYUA 1RRKA 5ARDA 4U9HS 3VKUA 3OOYA 1EDZA 2B6HA 2AFIE 1XGKA 2VRNA 2B83A 2NU7B 4KO3S 3VR4A 5B4TA 2R6AA 5IHXA 1D4AA 3UGJA 1FCJA 1TLLA 2V3CC 1IY9A 3NDBB 4JA2A 3H8VA 4JLBA 1ZA1A 1VLQA 6REQB 2I62A 2H11A 3ED1A 4C78A 2AL7A 3D0KA 4JBGA 2ONZA 4E33A 1FQOA 4ED9A 4GMHA 2IEZA 3PHJA 2WAAA 4TV9F 2QX8A 2HXSA 1A2BA 2LGJA 1ZW1A 1Q19A 3K0FB 1EJBA 3T1HB 1DEKA 3HVUA 4QJ5A 1J0AA 4H7JA 4I9NA 2C61A 2ZU0C 2ZYTX 4NXNB 1KRHA 1USGA 4MRRA 1GCGA 2O8VA 2XRFA 5L7YA 3U0BA 4P34A 2EHJA 1IN6A 1KY3A 3ZBUA 1V9LA 2QVGA 3TEFA 1I51A 1MC4A 1W35A 3G17A 4MR7A 3EGIA 3M6MD 3VC1A 4M0UA 4GNKA 4RMJA 4EA7A 3RRZA 2Q28A 2FZCA 2XCLA 4FGSA 1I7NA 3UT5B 4DIDA 3A9SA 2Q62A 4OQYA 3U7QA 3BXHA 4DR6B 3LCCA 3UMGA 2H1RA 3L02A 2WSBA 4L0MA 3QXHA 821PA 5DM0A 3THWB 3F4BA 4EJMA 1ZHOA 1OE0A 3MAGA 1KMIY 4RFVA 2NPFA 1HORA 4YPVA 4U2BA 3E61A 1J2TA 3OECA 1VRWA 4KQ6A 3KLNA 1R0BA 3PX3A 5BV0A 5C8VA 1ZS9A 3DFFA 1LBHA 1FTNA 4PHHA 3FXAA 5BQ5A 1B3BA 1BQ3A 2GTIA 2IJGX 1Z4NA 3KBBA 2UYQA 5E3IA 3ZV6A 2A5DA 1HNNA 1AGXA 1AQIA 2W2QA 3E1GA 4C88A 1CJTC 1GQ2A 3FFWA 2IXFA 1FSSA 2VTDA 4GL4A 1I1NA 1I3OA 3OEEA 4TUYA 4Q1FA 5AVJA 1QOZA 2D0PB 4Y8VA 4CU2A 4CTNA 5JYEA 1RJ9A 4JR1A 4UM9D 1Y8QA 3TRFA 2B5VA 3DLTA 1YF3A 3B5EA 4CKYA 1RE0A 4RS3A 4IPTA 1VHQA 3SYMA 4ENPA 3LV8A 2JAOA 2J3IA 1R0CA 3F8SA 3ESBA 5LOVB 4B71A 4AJHA 1LU9A 2HSDA 1DQRA 1W2HA 4P92A 4QASA 1NQAO 2DKOA 4UNPA 1CQIB 1RXSA 3FDXA 2ZIFA 4NG5A 3TG2A 2ZJ6A 1KWKA 5HUHA 5JQWA 5B4UA 2ZJZA 2H5JA 1IUNA 3CKYA 3PQ8A 3VH3A 4FYHA 3TEJA 3TVYA 3FUVA 1CRQA 3G9QA 2ZT8A 3HKCB 3LP5A 3M6FA 5JXGA 5B7QA 3NHWA 2PPVA 4MVJM 2ODNA 5EWLB 2N0SA 2NOAA 2X1MA 1RIFA 3PPVA 3T1QA 4XVCA 4ZEVA 1ADFA 3L7JA 3C6QA 3ZKWB 2ETXA 4EGQA 4DADA 1KNXA 3UW1A 4FR2A 1JYFA 1UF9A 4AF7A 1IBSA 5DSXA 3GFBA 1WB4A 2GILA 3D3WA 4QYTA 1U90A 5LA6A 4HAXA 4RE6A 4U7FA 1A8QA 4UKDA 1C4XA 1ECBA 3VOBA 5JBNA 1BJRE 1M75A 2WM2A 1EBFA 1OC4A 1W5SA 1KZ4A 3A3PA 1TIKA 4FMBB 4MWDA 3KB8A 3VX3A 1PLLA 2QORA 3MM4A 2HA5A 3CNQS 4Q37A 5HKLA 2M6KA 3FTCA 1K86A 4CN8A 3C0KA 1E2IA 2WMNB 3EQ8A 5DOZA 2WJ6A 2C92A 4DN6A 1WULS 2QP4A 2ON6A 2G88A 3PHBE 3L8CA 2UKDA 1N7HA 4NOLA 1S2GA 4GT1A 4P4NA 4EKEA 2GJ8A 3ZDAA 8OHMA 3W5JA 4MNTA 4B6OA 4D3SA 3GCGA 4K9KA 4GBJA 4GQAA 3GAFA 1KDOA 3CF4A 4JLNA 4FEEA 4HLUC 1ISFA 2UVDA 3QK7A 1Q12A 1UEXC 2V7PA 3BKWA 3I9V1 5JANA 2Z5FA 3N5CA 1GNVA 1Q17A 3ONVA 3B1KA 4WEOA 5C8DA 4M7PA 4KAFA 4O1MA 4XR9A 1U7PA 4EL5A 1LH0A 2QPTA 2YOFA 3FAZA 3ONEA 1O3YA 2IYWA 4XH9B 1XVTA 1DO0A 2FDRA 4OL9A 3ZEIA 5HBRA 1KOGA 1R0XA 4F96A 3I05A 1R3DA 5LOVA 4MV1A 1XHEA 2QW0X 4MHTA 3AEUA 3G0IA 2XF2A 3K0HA 4RVOA 1ZRMA 1AVTA 2R5WA 1Y7TA 4Y98A 1JKMA 1POXA 3EF3A 4RVNA 5EYPA 4LV6A 3MSCA 1MT3A 2OUKA 5TSDA 2EERA 3CWQA