3BRWD

Structure of the rap-rapgap complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
167
structure length
167
Chain Sequence
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Rap-RapGAP complex: GTP hydrolysis without catalytic glutamine and arginine residues
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp binding protein
molecule keywords Rap1 GTPase-activating protein 1
total genus 51
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3brwD00
2GCPA 3L82B 3PXGA 4G5GA 1GKUB 2PZGA 2Q21A 4NYJQ 5DE3A 4C30A 2A7QA 3WBKA 1U2RA 4TL8A 2ZS9A 1OJLA 3U44A 2XNSA 3S1AA 2HLDA 5JI3E 4PO8A 4I4LA 3RC3A 1OH5A 2ZRDA 1XD2A 4GI7A 3P32A 3UMFA 5DLQC 2WOJA 2D7CA 2GETA 2YC4C 4DSOA 1M1YE 2PLFA 4Q7JB 4UNPA 1AJEA 2RGDA 2ZR0A 3FMPB 721PA 1G8PA 1L8QA 1OYWA 5EXXA 2O8FA 2JJ1D 1GNRA 4EJSC 3IPYA 1YR9A 5CM8B 1NP6A 1Z63A 3W6PA 3ZVRA 2WWXA 1IJFA 1JQLB 3PUXA 3QBTA 2BDTA 1XDBA 2WKPA 1YZLA 2KE5A 2JJ8A 3KUDA 3K9NA 5G53C 2QMEA 1RFLA 5AJVB 1E2NA 4C7OA 3T1OA 3NBZC 3ND8A 5BWMA 2N1BA 1XEFA 1QHSA 2OESA 1FP7A 5H8WA 2EFGA 2G1JA 1UF9A 1CJMA 1CJTC 4RD6A 1IQPA 1QRAA 2NPIA 3THXB 1Z6YA 2VP5A 2ZM5A 1II9A 5EE0A 3SJCA 4D2IA 2QGNA 2I1QA 4CIDA 1W36D 1KOFA 3QKRB 3NEYA 3GLIA 3KTAB 1E2KA 5EE3A 5FPHA 3ZYCA 1R0WA 3W8RA 2O8BA 3P20A 2ZAOA 4L8GA 1YJ5A 1E2HA 1FMLA 2ODNA 3C4JA 3GCGA 3EX7C 2EYQA 2MMCA 2O5VA 3A36A 1IY0A 3RSOA 1ZM7A 4B2PA 2YZ2A 2FNAA 2J7PD 1MO4A 1DOAA 3EPJA 3FHTA 2CK3D 1TAGA 4NH0A 3CWZA 1K5GA 3A4LA 4HLUC 2AXPA 2YJTD 3ECCA 3QG5A 1NLYA 4WXRA 3M6AA 3BBPA 1COWA 2PLRA 1K6MA 3AVOA 3SU8A 3SJBA 5GVSA 5TVKA 1ZVQA 3WBJA 4AYWA 2GWHA 3TRFA 3GD7A 3CX6A 2ORIA 2CE2X 4Q21A 1I4DD 2V8OA 1RRCA 4R9UC 3W8NA 4BLTA 3QEJA 2J0VA 4WOPA 1X1RA 3U60B 1CF4A 3U3MA 1Q20A 5LB2A 3DOFA 4FMCB 4Q7MB 1XTJA 4RFVA 3GLHB 1FNNA 4KFUA 5B58C 2HDNB 5KOYA 4AD8A 3QPVA 2IS4A 2JLXA 1N5JA 4JLMA 1XXHB 4LJ9A 4ZCMA 5C4MA 2J0UB 4JKIA 3X2SA 2PMDA 1N5LA 2AKAB 2R65A 3BB4A 5KDLA 5A0FA 3TW8B 1XCMA 4FMCF 3QENA 2P67A 4D82A 1R8SA 2H17A 4ASUA 2ZJ8A 1N6LA 2EFCB 5F9FA 4PZZA 3RS5A 2HYDA 4BECA 3U6KA 4HAYA 1BYUA 2EFEB 4GZLA 1TNDA 4IOMA 5H70A 1P2TA 3QI2A 1TX4B 3ASZA 1SVOA 3PITA 2ORWA 3JVVA 3K9LA 1P2SA 2ZETA 2MMGA 2ZEJA 3ZZUA 2DHRA 2FZ4A 1DPFA 4ZI2A 3F8TA 4IVQA 4HLCA 4FN5A 1CR0A 4FMBB 3I5YA 2GJAA 2P5SA 4LV6A 1G16A 2KB0A 1SULA 2B7BA 2AXNA 3WNDA 1Z3IX 1WBDA 4RD2A 3A58B 1Z07A 1NMXA 3U4QB 3D8BA 4Q19A 5JWHA 3CUEF 3FFBA 2AKYA 2FSHA 3P27A 4EPXA 5TMPA 2DR3A 2YOHA 3DM9B 3HR8A 2ZANA 3HU3A 1G6HA 4R98A 5FR2A 4HZUB 5JI2E 2QA5A 3CRW1 2WV9A 3SR0A 1U8ZA 5B2ZA 1M8PA 2BMJA 5KO2A 1P2UA 1ZUHA 3UIEA 2DWOA 2W2TA 1R5OA 1Z29A 4LHYA 4TT3D 3A1TA 2IT1A 1XTQA 2NO6A 1JEDA 3NHBA 5CYOA 5AJZA 2WJGA 2ZRAA 5ANRB 5TB5A 3B7GA 4JBWA 5P21A 1RVDA 4RFSA 2V9PA 3NWJA 3PCRB 2OLJA 4B3XA 4AKEA 1P72A 3TW4A 4DWJA 4WIAA 2HJVA 4GZMA 2VHQA 2QSZA 3ZQJA 3DPUA 2HF8A 4RKFA 4O3MA 2ZRHA 2NIPA 3C8UA 3FKQA 3OAAD 2D06A 1IXZA 2R6CA 1Q3TA 4YXWA 1WE2A 3EZ7A 4CEHA 3LQRA 1I2DA 2VIIA 1XJCA 2CMKA 3UKDA 1R5NA 3HR7A 1XB2A 3L0IB 2F6RA 3EW9A 1QHHB 4PSVA 4KODA 3TR0A 4UXIA 1GL6A 2O8DA 3MWLA 3RAPR 4DCNA 1NVUQ 3LV8A 3QF4A 1CIPA 1F2TB 4LGMA 1DAKA 2IS2A 4NCKA 4DT1A 3TVDA 3B85A 3OEHA 3WXMA 2HT6A 3WY9A 2ZJYA 2ZJAA 1JXMA 4ACBA 3GJ6A 4KO8A 2GTPA 2UKDA 4MKFA 2JLUA 3ONWA 621PA 2Q6TA 2IYTA 1VHTA 3B13B 5KUTA 2UZ3A 4KFRA 4KYUA 3GLIB 1N6RA 1S2MA 2QQEA 2YNMA 4URVR 2CJWB 4A8JC 1IY2A 2W6ID 3U3OA 5CK5A 2PBRA 3K0FA 3C5CA 2G88A 5EJEA 1S3SA 4Q9LA 2QP3A 2RGNA 1V5WA 3G0HA 4HEJA 3DHWC 3BIFA 3PEUA 1JAHA 1IONA 3PIRA 4LV5B 1HH4A 2F3TA 2J7KA 2Q3HA 2CDNA 2VHJA 3DO6A 3LBNA 1K5DA 4B34A 3X1DA 3MCAA 1XEWY 1COWD 1A4RA 1JPJA 3I73A 3TSWA 1HURA 2ONKA 2FSGA 1TPZA 4KHZA 3IBYA 3EC1A 4MKHA 4DCSA 1EFTA 5FR1A 1XXHE 2A78A 1E2QA 1OXXK 4TQUS 1TQ2A 3RRMA 4AKHA 3K0EA 4JVNA 4OJKA 3QVUA 2ZITA 4IOLA 3RABA 2PL3A 2JLYA 4JMPA 3RLFA 1DO2A 4HB3A 3GLHE 4KXFB 5FUYA 4XWOA 1XJ0A 3TE6A 1FP6A 1S9DA 1D2NA 4M2LA 2HXYA 1TU4A 2G1KA 5FL7D 5KPJA 1A2KC 3Q72A 3A4MA 4YMSA 4B3DA 1KO8A 5FUVA 2J0UA 1UFQA 4DUGD 2W0SA 3IIKA 2OFOA 1CRQA 3LX8A 4QNRA 1P4SA 1ESMA 2VHTA 2IWRA 3C16C 1EG7A 4Q66C 2BMFA 1VKJA 5CM9C 1W1WA 4TLDA 2XNDD 1P9WA 1VECA 2ZI9A 3QOFA 4BWYA 2ZSBA 2A9KA 3CNLA 3CPJB 4E22A 1P61B 1FQJA 3AVTA 3NEJA 4G3XA 5F3WB 2BC9A 1VTKA 4QXAA 2ZJBA 3TR5A 3ZH9B 3THYB 1BYIA 2VYFA 2F1IA 1BO6A 1FUUA 1OIWA 4FW9A 4DSTA 2GK6A 2JDID 1XEXA 2HXSA 3KXLA 2DFTA 2ZJZA 4DB2A 1NBMD 1FNMA 1UPTA 2WPDA 4UNQA 3VR4A 3LVRE 2J45A 1HUQA 4IDHA 4RZUA 5FPKA 2WHXA 2CCGA 1P9NA 1QVAA 1KI6B 3LLMA 3SBDA 5BN5A 2NZJA 2FX3A 4KLZA 1G41A 2RAPA 1KDTA 2VH5R 4QBGB 3VU9A 1I4TD 4YXWD 1ZM2A 3K53A 3Q3JB 3I5XA 1E9DA 2OCPA 2QL6A 1PLLA 1G4AE 2FPMA 4FIDA 1Z0IA 2GVDC 4QFMA 4ACAA 3GEEA 3TK1A 1VYVA 3B2EA 3VR2A 1FW6A 2FU5C 2REXB 4DDVA 3DEFA 4A92A 3IILA 1QF9A 1UDWA 4ARZA 1ZCBA 1PUJA 2EWWA 4MQBA 2XB4A 1FOEB 4A2WA 4YONB 1RRPA 4N0EA 1G7CA 2ERYA 2OO7A 4RFSB 3I32A 4KITB 2CLCX 3LXXA 4JLVA 5EUQB 5EP4A 4DLXA 4JVLA 3IIJA 5FBLB 6Q21A 4TSFA 1ZNXA 3ZD6A 3AP3A 4QM6A 3OIWA 5HKKA 3I3SR 1OF1A 2BMDA 4M53A 3FTQA 1G3RA 4LHXA 1KTVA 1DS6A 4ZDIA 1U90A 4TLBA 1BMFD 4CRWB 1SXJC 4AIIA 4IEIA 2RGEA 4W5WA 5CB8A 4R7ZA 3BJIC 4HUTA 2FSFA 4LWZA 4N0DA 3AF0A 3EA0A 2V1UA 1HE8B 2J0SA 2NZ8A 4CZ2A 4A0HA 2PEZA 1GP2A 3WYGA 3U6BA 2O8CA 3MWJA 5DHFA 5CK4A 1LW7A 4OQFA 1TEXA 4TWZA 3ZIAD 1AS2A 1Q44A 3IGFA 1E2IA 1H8HD 1KK0A 1OHHD 3CONA 4DDTA 5AUOB 3U4QA 3NC1C 4WBSA 1JXOA 2H16A 2GAAA 3G82C 3BXZA 1G5RA 4W5JA 1NIPA 3ICQB 3B1YA 3SC3A 3AF1A 1E79A 3KJGA 2HCJB 3B60A 3E2IA 2KJQA 3HPRA 5IF9A 1RPZA 2QTVB 1GM5A 1KDOA 4YMWA 5J4KA 3RWOA 1WQ1R 2ZSFA 2V4ZA 4V0OA 3K0FB 2VHCA 1A2BA 3ZGXA 3W90A 4B47A 3T06B 5BYKA 2O8FB 4C0KA 2ZRMA 4NYMQ 4TLEA 5AJYA 1HT2E 5FOVA 2AK3A 1OFUX 2QU8A 4JVMA 4M1MA 4OHZA 2QG6A 4AG5A 2E9SA 2OBNA 1Q12A 1TQ6A 4JVSB 2P6NA 3DM5A 2BJWA 3QKUA 4XWAA 4PHFA 1CLUA 2OCBA 4KFSA 2DYKA 1P9RA 4BRWA 1CEEA 2JLRA 5JJIA 3TLXA 3T1QA 2XXAA 1AGPA 2X1VA 1ODFA 2C8VA 3M4YA 5JJLA 4DLRA 2A5DA 3THXA 5EE9A 4PZLA 2JLQA 3GFTA 1NN5A 2JA1A 4DIDA 2GJ8A 3LFUA 4D6PA 4Q4HA 3OE7A 4FD2A 1R7RA 3L8ZA 3VFDA 2DY1A 2YYZA 2FGJA 1JNYA 2XXAB 3NBYC 4Q00A 1Z0DA 2GZHA 1LF5A 3KB2A 1RZ3A 1YRBA 4D26A 3FDIA 2IS1A 3PJRA 4TL7A 3B78A 4BLQA 4E07A 3A8TA 3DZDA 2NG1A 2BJVA 3TMKA 4NYJR 4TZ0A 4D0LB 1MRNA 2DFKB 2FF7A 4JLNA 4MRVA 2RB4A 1NY6A 4U00A 2J0QA 2CJWA 4B3CA 2H8KA 2ZREA 4QC2A 1XF9A 3O8BA 1G5PA 1FUKA 4PC2A 4EFLA 1P3JA 1NI3A 4WXPA 4ZKDA 2R6FA 3EIEA 5L3QB 1W36B 1LVGA 4JL6A 1GSIA 4RVCA 1VIAA 5JFGA 3LQQA 1TF2A 1D9ZA 1JR3A 1J99A 1OXVA 3EAQA 4C0QC 3NDPA 3TGPA 1XPOA 2GXQA 1GVNB 3RWMB 4FCWA 4JLJA 4BLRA 2KI5A 4ZPXA 4C0LA 4YDHB 2AK2A 3NH6A 1U99A 1Q3HA 1G4UR 1TADA 1VCIA 2O52A 3B1VA 3BH6A 2IYLD 5AK0A 3CRVA 1YKSA 4G5QA 4PPQA 2BEKA 1V43A 4RD1A 3L0SA 2ZYTX 2X77A 2IYUA 4AI6A 2PJZA 4Q4JA 1AZTA 2QTHA 2J5XA 4F91B 2FMXA 5KSOA 3K70D 1E9RA 2WIBA 3B8HA 4DRZA 3A6PC 4ABYA 1HQYE 1L2TA 3GJ8A 3QG1A 3CBQA 1HTWA 2B8WA 1FTSA 2GZDA 2HJGA 4JJKA 4LJ5A 4XSHA 1NSTA 3RDPA 2QRZA 2R6AA 5D3QA 1KAGA 2W6JA 2RGGA 3WYFA 4ZDKA 3MWKA 3CM0A 3EIHA 4A0FA 1UEJA 3P1JA 2GJ9A 5L3RA 1TQDA 1M74A 1Q1EA 3C14C 4F92B 5G40A 1CR2A 2K5UA 1TUIA 4TTQA 1DG3A 3WHLA 1EFCA 2OAP1 2QQ0A 1Q57A 2OILA 1E2DA 4M1KA 3OAAA 4BZQA 3U2QA 3QXHA 2CVHA 3EZFA 3DKPA 3CX7A 3O8RA 3K0CA 4MKIA 1FFHA 1OXUA 2JCSA 1E4VA 1BMFA 4Q9HA 5AJXA 4OQLA 3KUCA 1KYIA 5BN4A 2IK8A 3TSZA 5CB6A 1KI6A 3EASA 4JLOA 3RS7A 3OFND 4DXAA 3VR3A 5E4FA 3K0AA 1IY1A 4QJ5A 4TT3A 2RHDA 4TTPA 3RANA 3O8DA 3Q9LA 3IEVA 4OHVA 2ZTSA 4DDUA 1R0ZA 1TU3A 3MUFA 4OYHA 3K0SA 2ZRPA 3L2OB 3MAAC 1CXZA 1FTNA 4IFEA 1MOZA 4G0NA 1G7TA 4MUAA 5CYPA 4GT1A 3WHKA 5DNYB 4W9MC 5EXTA 3R7WA 4EPYA 1NBME 1CJKC 3A37A 3H84A 1GAJA 1YZUA 3NH9A 4PQFA 2KWIA 2W58A 4LK2A 4CEHB 4KCGA 4M9XA 1H8ED 1G5TA 5GVRA 2VRWA 5E7MA 1VG1A 2PX0A 5H1YA 1HQCA 1NKSA 1G9XA 4JJZA 3KQUA 5HE9A 3NTUA 2LKDA 1ANKA 1AKYA 3AVQA 5DI3A 4U5XA 4A6XA 1XD8A 2BBWA 2R62A 4RSGA 5K8LA 3KFXA 1S1CA 4URYR 1DTSA 1Z0AA 3EWSA 1KSFX 2YKGA 1OT3A 1Z28A 4BEBA 5KSYA 2JIZA 4WAUA 1VPLA 2WPDD 1W2GA 1ZW6A 4P32A 1KI2A 3QF7A 4DEYA 1UADA 4AC9A 1T5IA 3P4XA 5F9HA 4I1OA 3DOEA 1AA9A 121PA 4LJ4A 4URZR 1KI8A 1U9IC 5EXSA 5EE5B 1OB2A 3VKWA 4H1UA 2QAGA 1T0JB 4B6EA 3U7GA 2QGZA 2V55B 2OEPA 4RZXA 5F98A 3HP1A 4CYMA 4XTRA 1KKMA 3CF0A 3L8YA 5IDVA 3CX8A 1Z0JA 4P33A 1ZC4A 1R8QA 5FUXA 1TTTA 2OFXA 4KLNA 4K8OA 5J4YA 1N2CE 5IK2D 2LWIA 1B23P 2JLWA 3DZ8A 3K1JA 3QVVA 4PAQA 1WP9A 2DFLA 1SXJE 4Z54A 4RJLA 2C03A 1CJUC 2WWWA 1KMHB 3I8XA 2XX3A 1JI0A 2O8EB 3CPHA 2V7QD 3JVUA 2O8BB 1UBCA 3QEOA 3THWA 2GEUA 3CW2A 1YZTA 4PPNA 2V54A 4PZYA 3QXSA 1R10A 2FFAA 2IW3A 2AWOA 1WBBA 4OK3A 4QGGA 1ZUIA 3VNVA 5AUQA 1VDZA 2IX3A 4DLWA 1X3SA 2OFWA 2W6IA 2DCUA 2Q9BA 4EIWA 1WMSA 3PUZA 1E9AA 2QP4A 2NOAA 5HCNA 3W34A 5KDOA 2Z0MA 4OHYA 3JZAA 2W0MA 1KK1A 2RGXA 4IDQA 3RS4A 3IPXA 3FFAA 3LW8A 3QKSB 4DLUA 3SJAA 1AK2A 5CJPA 2BV3A 1KGDA 4KBGA 3NIBA 1W0KD 1H8EA 2JGNA 3W5IA 4A82A 1YRAA 5LD2B 1SVWA 1KDPA 2AN9A 2IYRA 4LC1A 4POAA 4B35A 1NNEA 2A5JA 4Q1CA 1KO1A 3O47A 1T6NA 3LW7A 3THOA 4A1FA 5L8VA 3SI7A 2JEOA 1XPUA 3FKSA 4M1WA 4BFSA 2CLDX 4LBZA 1YZKA 5JRZA 1J7KA 3AM1A 1XCGB 4BFZA 4BQSA 2ZR7A 5IT5A 1NSFA 2OBLA 5FL3A 3VR6A 3WP0A 2IYXA 4A0RA 2ANBA 2GHIA 1A1VA 3V4FA 1EWQA 2XB2A 1QZXA 4TYQA 2GA8A 4OKSA 2EQBA 3OHMA 4GOJA 2AFIE 5E3HA 4C4PA 1IHUA 1OW3B 2GESA 4B43A 1W7AA 2Q9AA 4DLZA 2Z4RA 1G20E 1IBRA 1OE0A 4NU0A 4KBFA 2AHOA 3QJYA 4B48A 4C0HA 4AK9A 2VSOA 2ZRKA 1YZNA 3FPAA 2WWGA 5FOUA 4XIGS 3UWKA 2WIAA 4HUQB 1GFIA 3M0EA 2NO0A 4LZZA 3BD9A 1E3MA 3ND9A 4W7SA 1E2PA 2GILA 2YWFA 2WWHA 2CHGA 4TMTA 2UZIR 221PA 1A5TA 1NBMA 1QHIA 4NZYA 4Q48A 5AUNB 4LYFA 2D2EA 2Z43A 1DBSA 2XAUA 5BYJA 1OPXA 4N1AA 4DLVA 1PLKA 4M0LA 4Q01A 1AGRA 1F5NA 1T5LA 2QBYA 3AV0B 3HWSA 3LNCA 4HAUA 5FPSA 4D25A 3P4YA 4I99A 1SKYB 3IQXA 5FH9A 1RC8A 3OF5A 4Q02A 4F4CA 4PXAA 4M8NE 5BW8A 5J4HA 3B9PA 1JR6A 1TF5A 2XJ9A 4NKRA 5LB4A 1EFHA 1FX0B 4X8HA 5D3MB 3CNNA 4HLUA 1XZPA 3K9HA 3H1TA 1JJVA 1ZU4A 4LHZA 1KK3A 3H0KA 4HAXA 3TVTA 3DKVA 2QUZA 3HDTA 4YDSA 5HE8A 3WMFA 1P75A 4JT2A 1W47A 2R6GA 2ZE7A 5J40A 1E6CA 2AFHE 4E03A 2AR7A 1P2VA 1HT1E 2F1HA 2J9RA 4PPGA 4B76A 5FBRB 2F1RA 4NTZA 3UG6A 2AD1A 4KU4A 3B1WA 2OT3B 4ASUD 2V3CC 4L9WA 1OB5A 2F43B 3EZ2A 1DARA 1Q0UA 3CR7A 1HA3A 3ZVLA 1PVOA 1ZNWA 2A2ZA 1ZUNB 4ZDJA 2WWFA 1W5SA 1FZQA 5EE1A 3IQWA 2GXAA 3LO5A 4XTCS 5HZKA 5JWOA 1P6XA 1TL7C 3AP1A 2A3RA 3AQ4A 4FXPA 1E69A 2R2AA 2JLZA 3KL4A 3PUVA 4A36A 1SVIA 3BORA 1QG4A 1HY3A 521PA 5E7JA 2KSQA 1R6BX 3NBFA 4Q9JA 3VQTA 1DELA 1E2EA 2GNOA 2WICA 4PTLA 1IN5A 1E0SA 2F9MA 1CKEA 1G8GA 2VHUA 2G0TA 1ZD1A 2WZQA 3U7EB 4MYCA 3KB1A 4BGDA 1UBFA 1QVRA 4ZV4A 3GLGB 4L4UA 1JR3E 2VF8A 1VIYA 3CRQA 3X1XA 2G83A 1GKIA 3VX4A 4QM7A 5FPTA 1SKQA 2D74A 2J41A 3B6EA 5JZVA 1UKYA 2GF9A 3TIFA 4GMDA 3QXXA 4LBVA 3DVLA 1VCOA 2B6HA 4RD4A 2ODBA 2ATVA 2WM9B 5HZHA 1M7GA 4ZIRB 1KKLA 4O25A 2QI9C 1G8FA 1OV4A 1RYFA 1FQKA 2F9LA 1B0UA 2VO1A 3QXCA 4NCIA 3ZS8A 3PEYA 1WA5A 4BZPA 2EFDB 1M34E 2OM2A 2WSSA 2IHYA 4NP6A 1S4QA 4PR0A 2IYVA 2ZYWX 4B74A 5H68A 3AUXA 2ZRIA 1W5TA 3ZD7A 3KTAA 1ZIPA 3PEWA 1N0WA 1T3LA 2GF0A 4TZ6A 4URWR 1XJQA 1CULC 4MH0R 1HE1C 4MRSA 1D8TA 4PPFA 4UKDA 1XCPA 4HYYA 4QBIA 3W6OA 3UPUA 2WJVA 1D2EA 2BWJA 3UXMA 2FV8A 4CGZA 1UJ2A 3KQLA 3K70C 4OQXA 1G17A 1UEIA 2BKEA 1XMJA 5A5GA 3CO5A 4XOIA 1KMQA 3K8YA 2R9VA 1IN8A 5BQ5A 3FGNA 4IDOA 2E87A 2REOA 4M1TA 3E5HA 4DCUA 4B3GA 4PX9A 1E2LA 4EAQA 3TH5A 1DO0A 2DPXA 2IWHA 1QHNA 3F5FA 1TUEA 5JSZB 3FE2A 2DWQA 3CB4A 3VKGA 4PC7A 2YWHA 3N5CA 5KNDA 4N3NA 1W4RA 2O0KA 3MLEA 4Q4JB 5J4VA 1ZJ6A 2ZIAA 4YC7A 5JRJA 2N46A 4IOJA 1XMSA 3OEHD 2OV2A 3NG1A 5JEDA 2EYUA 1AM4D 4CEJB 3LXRA 4JLKA 4D4KA 5FBWB 1J90A 2XSZD 1OH7A 2D3WA 1OH6A 3SYLA 1YE8A 2QBYB 2OBMA 2WAYA 4AKIA 2JDIA 4ARZB 2FE4A 1P62B 3IEUA 1T9HA 3CH4B 3A1UA 3QKTA 3TKLA 1OKKA 4Q1EA 3J81k 5JEEA 1DAMA 2XOKD 2ZU6A 2OXCA 4K46A 3B82A 1KSGA 4D0GA 1E1RA 3V9PA 4TLCA 3EC2A 1AKEA 4P4SB 1E4YA 2B21A 5SZKB 2VSXA 2XITA 3IHLA 4TYYA 4LYAA 4XWKA 2FEMA 3ADKA 3VAAA 4LX0A 3SFZA 4G5OA 1JJ7A 4Q4AA 4Y0VA 3GJXC 1VCMA 5L3SB 4FCTA 2HV8A 2VBCA 2GJSA 2P5TB 2EU8A 4WA7A 5LD2C 5EXPA 4KI0A 1XX6A 4JZKA 4OBEA 4DCVA 2QT1A 4P4SA 1NRJB 3E1SA 3MJRA 2BKUA 1X86B 1XD2B 1I4LD 3KFVA 1W4CA 2QAJA 5CJ2A 1N5IA 4IW3B 5A4JA 3REGA 4URUR 4XVRA 5FOWA 3I4LA 4EJSA 3SEAA 3VNUA 4DKXA 1XU4A 3FHOA 2QMUA 3QPWA 4JT4A 2Q3MA 4QJ4A 2G6BA 3SNHA 1WCV1 2B92A 4LOAA 1W4AA 3VR1A 5IRCD 1JPNA 1Z6XA 2Z5FA 3N70A 3SS8A 4IJMA 4EQ6B 4HDQB 2ODEA 1BOFA 3EARA 4XD7D 4HLQB 1PJRA 1Q1BA 4AYXA 3HYRA 1M7BA 2IXGA 1A82A 1KSHA 4C0JA 1EK0A 1SVMA 2R44A 3DMNA 5JCPA 4ZCIA 2OAQ1 1N5KA 1F3OA 4Z8XA 4EPVA 2QM8A 4F4IA 3IDQA 5J5CA 3FOZA 4QHTA 3PEVA 1CRPA 3OEED 4XVQA 5HPYB 3IIMA 5FTNA 3WRXC 3AGQA 1VHLA 3W9YA 2CVFA 5EP3A 1R0XA 1TEVA 2YV5A 2P6RA 4BLSA 4TL9A 2F7SA 5K8TA 2VLIA 3D6TB 2QMOA 1QDEA 4AYTA 3GLFE 1N6KA 3BOSA 4JSTA 2XTMA 2Q3FA 4LJYA 3SZRA 1N6IA 3QE0A 4DUGA 5KPDA 3BAFA 4DLYA 5FUWA 1Z06A 2C9CA 5EP2A 1F2UB 2O8EA 4HB4A 4Q1BA 3GMTA 4V02A 4OI2A 1S3GA 4LHWA 4EPRA 1ESNA 3A1VA 3IBGA 4PHTA 5FOTA 2OCYC 5FBVB 5KNBA 2GXSA 4HAWA 3EG5A 2WMNB 2QAGC 4IKEA 4MGZR 4GOXA 4E09A 3EXAA 1Z5ZA 4GFDA 4WZBE 3GLHA 3ZQ6A 1OFIA 2ZS7A 1MO5A 2H18A 3EZ9A 3RS3A 2ORVA 2VTKA 2MSEB 3NC0C 1LV7A 1XXHA 4DVGA 1QG2A 1ZM9A 1QHXA 2GEDA 4EPTA 1H8HA 1OHHA 2W00A 1US8B 3T34A 1BH2A 3HJNA 2W2XA 2X2FA 4HI0E 2IYWA 4X8MA 2FDCA 3GLGA 4RD0A 4XD7A 1KNQA 3QKSA 1HV8A 1GRNA 3FHCB 1Y3AA 3M1IA 3CLVA 3CNOA 1IJEA 4M9ZA 1OXTA 4EKDA 3BS4A 4HDOB 5EQTA 4RY2A 2F3RA 2G77B 3HU1A 5GJWC 5GJCA 3Q8XB 4LBYA 4QBFA 1RJ9A 2PH1A 2BIFA 5IHPA 2BOVA 1QHGA 3SQWA 1EX7A 5SZJA 3VTKA 3VHXA 3BGWA 5DI9A 1E2MA 2IL1A 1K8RA 1UM8A 3Q85A 4M1OA 2ZRNA 1XD9A 4PAOA 2GZAA 1LB1B 2ZPTX 3CRRA 3F0TA 3R8CA 1S0UA 2J87A 3TJZA 3DL0A 2OXRA 2JJ2A 4R2HA 1IN6A 3OESA 2C5LA 821PA 1GRRA 3VMFA 3L0PA 3WNCA 2P3SA 3BFVA 2GKSA 3C7KA 4GDFA 3MG9A 2XSZA 4GP6A 2XGJA 1XPRA 1EGAA 3GFPA 1E0KA 3BH0A 1XRJA 2ZUCA 3TAHA 1VMAA 4M4SA 4PFSA 2CL6X 2BMEA 1UDXA 2ATXA 2PT5A 3CF6R 1NMZA 1QHYA 2PEYA 2P0EA 5KSPA 1KZGB 1S9HA 1E9CA 4FWTA 2AD5A 4QBHA 3NDBB 5DYIA 5CITA 4V03A 4PQYA 2RKOA 1E98A 4F38A 5KSZA 1XTIA 2JASA 1NN3A 3LBIA 2IYQA 4UXJA 4V0MA 2IF2A 3BWDD 3DDCA 2D7DA 1EX6A 1KI9A 4GNKA 4BFUA 5CIWA 4NYIR 3FB4A 4R71A 1MRSA 1OH8A 1BKDR 5KYKA 3ADDA 3H4MA 1G7RA 1HYQA 3KKQA 4S2EA 3FMFA 3GJ3A 3UG7A 4IVRA 4HAZA 2ZYVX 2RH5A 4LYHA 1T8UA 2JLSA 2SHKA 2PJRA 2REBA 3MSXA 3U44B 1ZD8A 1GKYA 5GJVC 1LS1A 3WMEA 4CEJA 1E2FA 4ILEA 4Z1MA 3SJZA 2QMHA 4Q4LA 3MJHA 4FMDF 5JS7A 4H9GA 4LBWA 5TARA 3BK7A 4BEJA 2VP2A 1VYUA 4UNSA 3AF4A 1CTQA 4BPBA 3ICEA 1E1QA 2WWIA 1NF3A 3PQCA 1OKKD 4Q5IA 2EVWX 1DAIA 2VP6A 2BM0A 1EWRA 3SFVA 3A1WA 2CLSA 5FPYA 4Z51A 2J46A 3UWOA 1II8B 1E96A 1YHNA 2GK7A 2ZR9A 1ELOA 3R9IA 2ZI3A 1KO5A 2QM7A 3L43A 3MGCA 4PC1A 2F43A 2QENA 2W6JD 4M1SA 2Z4SA 1JEEA 4LCBA 1M6NA 4IDPA 5TY0A 1H65A 4TYPA 1XNJA 3RVBA 1LTQA 2C2HA 5JWRA 1YR7A 5LDDC 2WMOB 5C1BA 1E0JA 2AL7A 1F6BA 2J7PA 1BS1A 1RW4A 5FOXA 1G64A 2JAQA 3SHFA 2YHSA 2ZRBA 1SHKA 3W6NA 4MRNA 5FTKA 2QAGB 1F48A 3SE0A 1IN7A 4TQ9A 1F60A 2X2EA 1ZINA 4DBLC 4DT1B 1GOTA 4TQAA 3GLFA 3BFXA 3TQCA 4EJSB 2XZPA 4TTRA 3U7FB 3EPKA 2ZJ2A 5CIQA 1FPMA 1W2HA 5L3QA 3KJHA 3SYKA 1DEKA 1E94E 1KDRA 1G21E 4XSGA 1KMHA 1BIFA 1JQJC 3GLGE 3GEIA 4NYIQ 1XTKA 2WBLC 1SQ5A 1KZ7B 2QY9A 4GL2A 4WVFA 1KNXA 2ZE5A 4MGIR 4ZIRA 1KI1A 2QSYA 4FINA 3U3RA 1NG9A 1OFTA 2CE7A 3I62A 2P6UA 3K09C 3LA6A 4G1UC 4LJ6A 2V7QA 4ZKEA 3IKJA 4RCYA 1GNQA 2ODWA 4Q4HB 1RJ9B 1J2JA 4XJXA 4EUNA 3TUIC 3AVXA 2D62A 4QGHA 2ZRGA 4P4UA 5JLJA 3EIQA 1DADA 3AUYA 4NE2A 2OCAA 3GLIE 4CDGA 3T1VA 2HLDD 3NVAA 3UANA 3ZVMA 4IDNA 3SN6A 1DE0A 2NPFA 4KJZA 4B3FX 4EFMA 3ZLJA 1NLFA 2CBZA 1E2JA 2CEAA 4P3YA 1J8YF 2CHVA 2ZU0C 2IUUA 2GCOA 1ZAKA 1U98A 4FCVA 4Q7LA 1SXJD 2CNWA 4UNRA 2QPOA 3RSLA 2NQ2C 3GFOA 1GUAA 3KXIA 1XTSA 1G8HA 2ZSAA 1KIMA 1SVSA 4QHSA 3T15A 4AURA 4MDFA 1Q1QA 3QXJA 4FWIB 3GQBA 1N25A 3A1SA 8OHMA 1IXSB 1PUIA 1E2GA 3SHWA 2RMKA 4JLBA 4EPWA 3RRNA 4Q03A 4ZO4A 3THYA 4HAVA 3BERA 2ZE8A 2HEIA 5JHHB 4P0TA 4A8JB 4NONA 1EFUA 1CJVC 1XEXB 1EESA 2GVZC 1E9BA 5LPNA 2QTFA 4FMDB 3CZPA 3RRZA 3QQ5A 5KNCA 4RKEA 1G7SA 4TN1A 3AF2A 2ONJA 4RZ2A 3ASYA 4Q9KA 4B73A 4IXNA 4KV9A 2GBLA 5HKKD 1SVLA 3VX3A 4DLTA 4UXHA 4NCJA 2ZS8A 4LC0A 4NPHA 3KQNA 2QE7A 1Z08A 1S1MA 2LKCA 3G5UA 1D6JA 2CHQA 2O0JA 1KO7A 3EA5A 2DFNA 2X19A 4QOSA 2BHRA 4H1VA 4IVPA 3HU2A 4JL5A 1FMJA 3OFNA 3OZXA 1DAFA 1ZM4A 5DI3B 3T5DA 1AQUA 3LH5A 1E1QD 3B5JA 4QJ3A 2WJHA 2ZI4A 1IAQA 2JATA 1L4UA 2B8TA 4BLOA 5E7IA 1Z2AA 2RGNC 3AVUA 4LDJA 2VP9A 5FOSA 1PLJA 4MRRA 1E1RD 4V0ME 2O8DB 4LHVA 1II8A 4JBXA 3FWYA 1IN4A 2ANCA 1Z6GA 2BCJQ 5UKDA 4B33A 3PV0A 1ZM3A 3ADCA 1JALA 2CCJA 3PR1A 3QF4B 4L16A 1KI3A 4JSYA 3ZS9A 2ZVQX 3R20A 4B75A 1KSJA 3IHWA 2RGBA 3OIYA 5AWFC 3GPLA 1G19A 1X8LA 1C9KA 2NO1A 1GWNA 4O2RA 3QPUA 5TV2A 5LBIA 1GITA 3EPLA 4M1YA 1G3QA 2RGCA 2UVQA 4ZDWA 3UMRA 2IUTA 4MGKR 5DH9A 2BEJA 3S1AB 2QP9X 5AR1A 5BXQC 2FEOA 1XMIA 2C9YA 2VA8A 3SDZA 3T5GA 4A9AA 5DSZA 2O0HA 2C98A 1UKVY 3THWB 4NBSA 1JR3D 4I1VA 1GRQA 4DCTA 5FTLA 3FMOB 1NVVR 4OI4A 4NHOA 1WRBA 1EXMA 1GDDA 3K70B 4Q1FA 1QBKC 1IM2A 3FMIA 2VF7A 3LLUA 2PMKA 1Z6AA 3V00A 1VCNA 2YINC 5L3VA 4AWXA 4BFXA 2J59A 1Z83A 4QG7A 5KDDA 2EFHB 3AVWA 1WXQA 3CF2A 4HDCA 4BE7B 1RRFA 1J70A 4CEIA 4B2IA 2XEXA 2ZRLA 1W4BA 2TMKA 4TMVA 2ASEA 4NMMA 3R9WA 2ZRFA 3OIVA 4II7A 4KSCA 2C9OA 3LDAA 1NVXQ 1ZNYA 4IEEA 4GBMA 1NN1A 3C41J 5JECA 3KQKA 1N6PA 2OUKA 1Z0FA 3RYTC 1O3YA 3HPQA 3TUJC 3KJIA 2PZEA 1LNZA 2Z83A 2OHFA 1CU1A 2B7CA 2IF0A 2YVUA 4I1UA 3Q5EA 3QBVA 1NY5A 2W83A 1JB1A 1KO4A 4YMVA 4KAXA 3TBKA 1L4YA 3TQFA 3Q7PA 2L0XA 4MYUA 4LJ7A 4X8LA 4J0QA 3Q5DA 3PG5A 3TNFA 1CR1A 4B3BA 1ZP6A 4C0SA 4C0BA 4JLAA 2PCJA 4CT4B 2VPPA 4FI3C 2C04A 3CR8A 1FL9A 2HUPA 1AN0A 4ITRC 4C0AC 4BLPA 2JJ1A 3TUZC 1DG1G 4PHGA 2BBOA 4LI0A 2QORA 4KSBA 4PSKA 4NDZA 2PZFA 4QRHA 4UJ5A 3SQXA 1VG0B 1YVDA 4S35A 4DZZA 1KK2A 1N3BA 2DBYA 1VG9B 1NLZA 1X8JA 2Q9CA 3CH5A 3MFYA 2R8RA 4V0NA 3T12A 1MO3A 1LF0A 5DO9A 2DWPA 4IHQA 5SZHB 4D0NA 1XP8A 3PFIA 3I61A 1NVVQ 1OFHA 4LUCA 4F93B 2FN4A 3AKDA 2IEZA 3I1FA 1XMVA 4Z1MD 2ZSDA 4CF7A 3KX2A 1O87A 2FZLA 2H7VA 1W36C 2IUSA 3V4RA 2YWEA 4Q1DA 1KJZA 3T1TA 4G5RA 2I4IA 2BVNA 4QNMA 4M9QA 5C18A 2VQSA 4EFNA 4AKGA 1ZC3A 2Q0HA 3WP1B 3KQHA 4HATA 5DN6D 2V6JA 5CLQA 4KVAA 1SZPA 4YMTA 3EWAA 4F7WA 3AEZA 3AVVA 2ZVPX 1A7JA 1GL7A 1XEWX 2WTUA 4P4TA 1S8FA 1W46A 4HSEA 4PHHA 421PA 2D4HA 4BFTA 4W5HA 2IBMA 4P31A 4D81A 1PZNA 2WOOA 3K0AB 4TLAA 4D4LA 5JS8A 4I81A 2YOGA 4ESVA 1KJYA 3HYTA 1W0JA 2IS6A 1SVKA 2IHBA 2NTYC 3B9QA 4JKYA 1MKYA 4ZCLA 4DHEA 4A4DA 2XOKA 3NBXX 4PAMA 2CL7X 1NJFA 3KJEA 1X1SA 3JZMA 4US1R 3TAUA 3VU9B 1W48A 5CLLA 3EPHA 1Q22A 4NCNA 2KBEA 4HB2A 5EZ6B 3LAWA 1GG2A 4CW7A 3QIAA 2EWVA 1HEIA 2QT0A 3AVPA 3LRPA 5C46F 2XZLA 1JBKA 1SGWA 2IC5A 2ZJ5A 3AKCA 3AGPA 2IA5A 4TL6A 1DAEA 5G41A 4RZ3A 3WMGA 2X8AA 2ZAMA 1KI4A 4TMKA 1Z47A 4LY6A 3RC8A 5CDFE 4ESHA 4BUJA 2ZXUA 5B57C 4G01B 3K0CC 3N2EA 4KVGA 5B30A 1FX0A 5D3MA 4ERNA 4GMXA 2WSSD 3RS2A 5KTYA 1OSNA 1LY1A 4L9SA 4RD3A 3I92A 2PCLA 4KFTA 1ZMXA 1F2TA 2ZQ5A 3KKNA 2BBTA 5TDHA 2KBFA 1NIJA 3GJ5A 2NO7A 4GP7A 4IFBA 2GAOA 3B1ZA 4OJQA 1XBTA 4V0LA 2I1VB 2FPKA 1P73A 3QSYA 2J3EA 1T3SA 2JJ2D 4LJAA 2F55A 2ZI5A 5KU1A 2GEVA 3D31A 2FFBA 5J4LA 3BH7A 1C4OA 1SXJA 5G3ZA 4PANA 1DAHA 3CWQA 3KZ1E 4QL3A 1G6OA 4EDHA 2O8CB 3LBHA 3I72A 2ECKA 1W0KA 3BB1A 4JS0A 1ETUA 2XNDA 2A30A 1ZU5A 4JL8A 1KAOA 2V1XA 4U02A 4C3ZA 4XH9B 2NO9A 4B32A 4BFVA 5FTJA 3AKEA 3CZQA 3ZZTA 1Z6TA 2YOFA 4GOKA 5C4GB 4M22A 5EZ5A 1N6OA 3PUYA 3RNLA 3H86A 2PX3A 3KKPA 3KXKA 3BE4A 4JBYA 2P65A 5FFMA 4URXR 1DVRA 1JAIA 2H1LA 2GBLC 3PUWA 5EUMA 3U3JA 1G3MA 2VL7A 4K81B 4DDWA 5DISB 3OEEA 1GTVA 3NHAA 4PO9A 4PSAA 1UKEA 2JIZD 4F4JA 5GADl 2FFHA 1U94A 3ZVNA 2QPTA 3BFKA 4DJTA 4Q47A 4BFWA 2QNRA 1XFAA 2ZSEA 1US8A 2WVJA 2H92A 5JJKA 4Z8YA 2ZUBA 4DLSA 1N0UA 3H2YA 1UBEA 1S96A 5JCZA 3QNUA 1Z2CA 4KYIB 5HCIA 2C95A 2E1RA 4OK5A 4E5UA 4L5BA 4UNNA 2GCOB 3FYHA 1CS4C 3R9XA 2ZYUX 2F1JA 1G3IA 4GPTA 2VEDA 3MWYW 5DGXA 2BBSA 4JYBA 4PO1A 4TSFD 1WF3A 3RHFA 3T61A 1YU9A 3U3KA 3AB3A 4LPSA 4B2LA 4JLDA 2ZJOA 3ZIAA 4V0KA 4B6FA 1MR3F 1ONBA 1KI7A 1IOZA 5KHOC 1NJGA 2C99A 4A15A 4HUQA 3U61B 1M2OB 1DAGA 2NGRA 5IK2A 3ZDQA 5L3SA 4LPKA 2CXXA 1YQTA 2ZE6A 4D80A 4QKQA 1T3HA 2WKRA 2IEYA 2WWYA 1NL3A 4JYCA 1Y63A 3K09A 3W5JA 2V6IA 3REFA 4NYMR 2ZI6A 4GRAA 1CBUA 3RRYA 1RYHA 1MT0A 1X6VA 2XJ4A 2ZRCA 1G3UA 5DHAA 1GL9B 1AZSC 2YC2C 3C5HA 4DSUA 4QHYA 2R6DA 1I2MA 4DSNA 4MRPA 1E0AA 4MYHA 1U0HC 2CL0X 2VP0A 4WW0A 5DN6A 3AF3A 3C15C 2IXEA 2EW1A 1MH1A 3K9GA 1Q1ZA 3SYNA 4EQ6A 2A5GA 4MITA 1G18A 2Y8EA 4QGAA 5BN3A 3R7WB 3SBEA 4I1SA 4MA4A 1E9SA 3WRYC 4O0MA 3EZ6A 4YMUA 4DB4A 4DEXA 2OLKA 1OYYA 1W0JD 3RS0A 3ZJYA 1OIVA 1MO6A 4OQMA 4TMZA 1AIPA 1U8AA 1J8MF 2OSBA 4IRUB 2FOLA 3LX5A 4LYJA 2QN6A 2FFQA 2ZUDA 3FKSD 4Q1AA 1LFDB 5B64A 1RIFA 4HB0A 1D2MA 3X1ZA 4PC6A 3UMSA 2A5YB 4B44A 3U7HB 4C7OB 1IXRC 2BM1A 2IYYA 5SZIA 1UKZA 2WJIA 3W3AA 5G3YA 4YLGA 1XTRA 1NVWQ 4U7DA 3GP8A 4Q4AB 3F3YA 3LD9A 1QHHA 1U81A 5JHGB 1TMKA 2CNWD 2XTNA 1MABB 1NG1A 1TF7A 3UATA 5HR5A 3QKRA 3BB3A 1SXJB 1ZBDA 1R2QA 2RGAA 1F2UA 1KJWA 1ZCAA 4OL0A 2C78A 1R5BA 4Q9IA 4D4MA 3D3QA 2HCBA 4D4JA 3VHLB 1E99A 2QROA 1W49A 5GJBA 1T91A 4A0GA 1TQ4A 2C77A 3D7MA 1AQYA 3NXSA 1OXSC 5FTMA 4BFYA 3WYAA 1W44A 5M04A 1E9FA 1R4AA 4MDEA 2Z6VA 2P2LA 1EFRA 3ETLA 3X1YA 2GXUA 3NKVA 1T0HB 4PQRA 2ZRJA 1D5CA 2C96A 4JIMA 3CRMA 3TSOA 2D2FA 4BASA 2WSMA 2HT1A 1XZQA 1AS0A 4IXMA 2ZI7A 3GEHA 4HLDA 5ELXA 4UQOA 2I3BA 1CP2A 3DMDA 4DC9A 2GDJA 3IO3A 4OI0A 5FI0B 2XZOA 4HZIA 1U0JA 1N0VC 1D9XA 2IYZA 4MYTA 1CR4A 2OE2A 4CEIB 1VG8A 5K8UA 3O8CA 5TXGA 4TYWA 3CIOA 4MGYR 2AX4A 2WJJA 3GJ7A 2IXFA 4M21A 5DIFA 5DYGA 2FA9A 3GJ0A 3T35A 5JMTA 2HF9A 3E70C 4Y0AA 2FH5B 2A5FA 2W2VA 3PVSA 5JBQA 4C2TA 5FI1B 1ZRHA 1P60A 3IUYA 3AVYA 1C1YA 2CK3A 4Q7KA 3KDSE 4AG6A 2BCGY 1P7CA 2RCNA 4O2LA 1EFRD 1KHTA 1WDTA 3VKHA 4TYNA 2HYIC 2MSCB 3MRSA 4NCHA 5AUPB 4LJ8A 2JLVA 5FL7A 3AP2A 3AKYA 4US2R 5EP1A 2GRJA 1XWIA 3B1XA 4DIEA 1YR6A 1X8KA 3QUSA 4ZI3A 2G0NA 4B71A 1ZYUA 3P26A 2ERXA 1JECA 1U8YA 4AY2A 4XVUA 4LV8B 2CCKA 4BRUA 1GNPA 2G3YA 1YZGA 4GSYA 1YZQA 3X1WA 1RKBA 2MSDB 3GJ4A 2FGKA 1U0LA 3AH8A 4CT5A 4X8OA 4C2UA 1ZNZA 5JSZA 1UAAA 1G8YA 2XTZA 1WB9A 2OG2A 3SOPA 4OHXA 4MKGA 5F2EA 2FWRA 4JLPA 2VP4A 1PV4A 2N42A 1Q21A 1T4GA 4WZ6A 1M7HA 1VYTA 2GCNA 2FSIA 3Q7QA 3LVQE 3VR5A 4BZXA 3CPEA 3L0OA 3W3ZB 3ZZ0A 2WAXA 3OIUA 3MD0A 4MUBA 2DB3A 4RCZA 1N6HA 1GZSA 3KKMA 3OE7D 5J47A 3R8FA 4TMXA 3MMPA 4TMWA 2LCFA 1SHZA 1MV5A 1NMYA 3PENA 1U9IA 1ZD9A 1GILA 1RE0A 4OQNA 1E79D 1N6NA 4A8JA 1NKTA 2YWGA 5CDFA 1RRGA 1T8TA 2QPAA 1KY3A 5E95A 5C2JB 2QRNA 5HTKA 3WNBA 1OIXA 4QGFA 4A2PA 5AJWA 3N2IA 2WKQA 1R0YA 5K8IA 4US0R 2IYSA 1P5ZB 1E32A 2GJKA 3BRWD 3FVQA 1II0A 1GIAA 3KKOA 4LSGA 2G9NA 4A6PA 4OI1A 2PT7A 1KY2A 2H57A 2J1LA 4YQFA 4NL4H 1AS3A 2FJUA 4IOKA 1ZIOA 4M9SA 3QY0A 1LS6A 1G291 3IO5A 4Q18A 4WZAE 3CKLA 4LRWA 2NMVA 2FPLA 3LY5A 2FG5A 2H5EA 1Z0KA 3UK6A 1Z22A 2RHMA 1E9EA 4A2QA 1G1MA 2WJYA 4OHWA 2QZ4A 2VSFA 4PC3A 1NN0A 4OK6A 4CVNA 4L15A 1OLOA 3BC1A 1YR8A 1SKYE 4UJ3A 1Z8FA 1MABA 1L7VC 4R2IA 3LWNA 1UBGA 2OZEA 2ZROA 4ON9A 3U5ZB 3I8SA 4HZUA 2AWNA 2QEQA 4G5SA 2QE7D 5FBQB 3A4NA 3GLFB 4C9BA 3ADBA
chains in the Genus database with same CATH superfamily
4X1IA 1MMFB 4G5GA 4Y2UA 2C5GA 4TT8A 4Y2XA 3HO6A 1QC5A 5I6DA 2FSSA 2JFUA 3KR2A 2FWAA 3TECE 4B45A 2XNSA 5K05A 5JYDA 1MJGM 1PT7A 1NSYA 2HLDA 4B83A 5JI3E 4PO8A 2AVNA 2VYVA 2ZRDA 1R6AA 1XRNA 3DW1X 3F6YA 3GL9A 3PI6A 1K9SA 1R9JA 1MQ9A 2WOJA 1A2QA 4H0CA 4KO4S 2R8PA 2YC4C 3GLVA 4Q34A 2NXCA 4QREA 4DSOA 2C5EA 4Q7JB 2OG1A 1FJHA 4UU1A 5AI4A 2OQ2A 3R76A 3M6FA 3N0VA 2RGDA 4LRTB 4AZ3B 1JLLA 2Q4RA 3IOBA 4K6OA 1OYWA 2ZOSA 2IYAA 5AVKA 2O8FA 5CFOA 1HOXA 1NP6A 2G08A 4OFXA 4CIYA 3C7TA 1WXFA 3PUXA 4KIUA 4M6WB 2C4NA 1XDBA 5KVQA 5J43A 2VJPA 3ZXIA 1OFGA 3IUPA 4YO8A 5D3ZA 3G8CA 2XDQA 3SZGA 4CKXA 4OFZA 5F7OA 5FOQA 3CZMA 2FP3A 2GD2A 2QMEA 3RYCB 3QELA 1RXWA 4ZJZA 1F1BA 3UB2A 3FYSA 5AJVB 4CG0A 1ZSVA 4CNQA 4H7EA 3EGCA 3IH5A 3NBZC 3HI6A 5B6JA 1LK7A 3VR0A 4N3CA 1Y8AA 4TV9B 2LRHA 3G79A 3ZE1B 5C37A 1ATZA 1QHSA 3WL5A 1Y6GA 2EFGA 1R8JA 2PKRA 4XIFA 1F12A 4M7OA 4GQIA 2A0UA 1CJMA 3GO4A 1E1KA 1R15A 2CXPA 1QRAA 2NPIA 4RD6A 1WW8A 4WDRA 5EWLA 3THXB 5HF9A 1Z6YA 2VP5A 1II9A 2CXSA 4D2IA 2QGNA 3FNQA 1XRMA 2JCGA 1W36D 3IVAA 3JD0A 4AVYA 4QUGA 1E2KA 2QUJA 2AMJA 4LGCA 5B7NA 1UJBA 3N8GA 3DVSX 2X86A 3P20A 2WWRA 2RONA 1E2HA 3GCGA 1VGQA 3EX7C 2ZIWB 2EYQA 3AB8A 3KTOA 4JQOA 1IY0A 4X1YA 2YZ2A 5BSMA 1YE3A 1DOAA 4PS0A 3EPJA 2CK3D 2DQZA 3IOMA 4DA0A 3U4AA 1YH3A 2X9NA 4GBJA 3AJDA 2HJHA 13PKA 1VLQA 4WXRA 4DWWA 5IEJA 5EQJB 1E64A 2QJTA 1T3TA 2H4JA 4RGVA 3SU8A 2AGVA 2VNHA 3SJBA 1N78A 5C8ZA 4JHLA 2GWHA 3TRFA 3L1HA 2YMLA 2VJMA 2QNBA 3PR2B 1RRCA 1TM7E 3CEMA 3MD9A 2V8OA 1EVQA 3X1KA 4QZVA 3FCCA 4R9UC 3GFQA 1QH1A 4WXEA 3W8NA 4JA0A 3UA4A 3QEJA 4CKZA 2RH8A 3IS3A 3OQIB 3DT6A 1CF4A 4N65A 4BAGA 2NSYA 1YC2A 2X15A 3FPHA 1XTJA 3KJZA 4FMCB 2ZTMA 4AJKA 4MQ6A 1T8RA 3HCDA 4RK7A 4P38A 4HDMB 4Q1VA 1BXZA 4D46A 1N5JA 1CUYA 1XYYA 2J0UB 3WGHA 4BP8A 3X2SA 3BF7A 1F0YA 3E58A 1ZD5A 5AMXA 2V98A 1N5LA 1U28C 2LDXA 3C1AA 3G88A 3IBFA 4Q3OA 2G17A 4F5EA 4JGBA 1CY2A 3CJRA 2P67A 1RXSA 4IF6A 1R8SA 4G0PA 3R5HA 3ILYA 2QRHA 3KHSA 3MTEA 3A1FA 4KQXA 4ASUA 4CLOA 3RS5A 1C0KA 1O5IA 2W2KA 3U6KA 1BA3A 1IVNA 1BYUA 4HAYA 2L2QA 4YX9A 2J0EA 3OT1B 1CS0A 1CD5A 3IA2A 1NE7A 1B6SA 4IMIB 4QASA 4XFJA 4L50A 1QH0A 5LLTA 2HPAA 2ORWA 3K9LA 4Z4CA 3PF9A 4QA9A 1QE5A 3MAGA 5C8DA 3ZVKA 4NQZA 3H2KA 5AIAA 4DC0A 2DHRA 3O7MA 4FGZA 2FZ4A 4F6CA 5EHZA 3EVBA 1XNQB 2OUIA 3IXMA 5IBQA 1YU6A 3DUFA 3I5YA 1G16A 2KB0A 2BR5A 2AXNA 1DFHA 4RELA 3WNDA 4ZZ3A 5CD9A 5MN4A 1WBDA 5MGNA 3TFOA 3U4QB 4ZPJA 3V4LA 2W6PA 4KXNA 3WHPA 4BWYA 1D4FA 1KVRA 3TTSA 2Y1KA 3A2LA 3HRIA 5LBTA 3P27A 5TMPA 3DM9B 1P5FA 1C2TA 3WRYA 3ECAA 2F3SA 2ZANA 3KPVA 3HU3A 3VKFA 2I03A 4CM9A 2Z1MA 1PNRA 3JAKB 5JI2E 2QA5A 3CRW1 4RV4A 2WV9A 3QLJA 3SR0A 1CZUA 5B2ZA 4RLHA 1SD5A 1SEVA 1Y3DE 1ND5A 2BN4A 2BMJA 3Q41A 3FLEA 3MMNA 3HNRA 4DDHA 3IIEA 2DWOA 2W2TA 3O92A 1DC8A 1Z29A 3G0DA 2IT1A 1XTQA 3E1KA 1OQAA 5AJZA 2OV3A 2FXVA 4J9VA 3V46A 2ZRAA 2FPIA 3R5FA 5T3YA 4F84A 2RE8A 2PUCA 1R12A 1Z16A 4JBWA 1A4IA 2JFWA 3MMZA 2RH9B 2VZLA 4WIAA 2HJVA 2JGDA 2VHQA 2QSZA 2Y4NA 2HF8A 3A3NA 1ZLXA 4KQMA 1B8VA 1K8XB 1NJSA 4O4HF 2GJ4A 4ZQFA 3V48A 3FJ1A 2IE0A 1WE2A 1JZSA 4G0UA 3CBGA 4LJKA 4NX2A 1IULA 3OQPA 2ZYRA 4PICA 1IBLB 4JI3B 4AXBA 1XJCA 3UKDA 2LNDA 3EW9A 3NV9A 4HPWA 4UPEA 2EBUA 1OTXA 4Q4CA 2Y1XA 1SCAA 2Q07A 2X7XA 4HQ6A 5JD6A 1NVUQ 4HMQA 4O63O 3OTQA 3CR3C 5HM6A 1F2TB 1DO8A 2RGRA 3S8MA 1RBZA 3FPKA 3U4CA 2QR2A 5TC4A 2QD3A 3N7AA 4DMRA 2R85A 4DYVA 3EAGA 5J2TB 1Z7WA 1M34A 2ZJYA 5KQRA 3HC7A 2ZJAA 1L8AA 5IM5A 1BTOA 3LCRA 4ACBA 2FRXA 2XCUA 4KO8A 1T36B 3C98A 4MKFA 4MI6A 4CLDA 1BKYA 1S8AA 3TLMA 2ZDHA 3B13B 2WR8A 2ECOA 2NVUA 3W04A 621PA 1V7PC 4FNOA 4C05A 3IBTA 2VPQA 5K6RA 2VQDA 4UHCA 3S0JA 3EIWA 5MF6A 3EA4A 1NQXA 1QSGA 3MTAA 4QPDA 1D1TA 5ED0A 4A8JC 3U3OA 5DNUA 3OE1A 5CK5A 3U4HA 3KR9A 3CLSD 4RHEA 3C5CA 4BDTA 1H2RS 4QEDA 2FB9A 3V33A 3B12A 3IVCA 4Q9LA 4P7BA 1V5WA 4G1MB 3EEOA 3DHWC 3BIFA 1UXKA 1U0EA 4DRYA 2OP0A 2F3TA 2Q3HA 2J7KA 2VHJA 4I5EA 4IV8A 3UFXA 4ECEA 3P5BA 1WW2A 3PWKA 3MCAA 4PG6A 1SCBA 1XEWY 2JIPA 4FYJA 4WCFA 1KEEB 5IABA 1JPJA 1VIVA 3WV4A 1ESDA 2VH2A 3LGAA 4CF4A 4K9KA 4MKHA 3IBYA 1WSDA 1OC2A 2O48X 3T52A 5C1OA 3IPAA 1ARZA 2KPOA 1VCHA 3L9WA 4B3TB 4AKHA 1OVMA 2MOKA 2ZSKA 4IWYA 2ZITA 1QH1B 4IOLA 4OJKA 4EENA 2JLYA 1IEVA 2F9FA 4JMPA 3RLFA 5FUYA 4XWOA 2IPXA 3VAYA 1XJ0A 2XMGA 3E9RA 4RQAA 3S2ZA 3O8LA 1PX0A 2C2XA 2H07A 2O3RA 4M2LA 4H77A 4QX6A 2V5VA 3QLVA 3T7TA 1MP0A 1A2KC 2EF1A 2P2DA 4IX1A 1H5UA 5J5VA 3ZK7A 3A4MA 1B4DA 4BO1A 3ZW9A 1UFQA 4IIVA 5E6SB 3FOAA 1L1QA 4UMEA 2EEPA 3IAAA 2R5FA 2M9MA 4GE3A 1H6AA 3DAFA 4L9RA 1ESMA 1DX9A 4PLHA 1SIWA 1OI3A 2AYXA 5H3HA 1RLJA 3DLAA 2ZSBA 4QFBA 1AV6A 4KTTE 3VZSA 2ONZA 1P61B 3AVTA 1W5EA 4UEOA 3DEAA 1P1RA 2QTZA 2ZGVA 4OP2A 3WGTA 3ZH9B 4IHJA 2Z5VA 3FVRA 4YI3A 4ZVSA 2AOTA 2VYFA 1Y6RA 2F1IA 2WFMA 3FDZB 3KM0A 4FW9A 3I34X 2WUWE 4RACA 4DSTA 3TIVA 2HPVA 1MJ5A 2HXSA 4UVGA 5D86A 2DFTA 2ZJZA 1TC2A 5LUBA 5JYCA 4DB2A 4N3BA 2YZGA 1FNMA 3HL4A 3GMSA 2GYVA 1V1MB 2P6MA 4UNQA 3FOEC 1MDFA 1G5FA 5FPKA 4S1NA 1KY5A 3DZIA 1KI6B 1P5RA 2CYBA 1YMQA 3FPBA 3LLMA 5TQ2A 5BSEA 5C8YB 1NNI1 4OHCA 4RVFA 1D6SA 1MNQA 1VDMA 1W5AA 3RW9A 4XEUA 1D4AA 1E9DA 4UHDA 4FPXA 4FK8A 1XKXA 5AYVA 2OCPA 2QL6A 1Y7HA 3CKKA 5ARDA 4ZYWA 4TWRA 1G4AE 4IJVA 1WX1A 4M9CA 3ZIDA 1EWVA 1NRXA 3BYZA 4P5DA 2OPHA 1E6MA 3QLTA 2Y2VA 5KJFA 4L28A 4ACAA 3B2EA 2JARA 1FW6A 3HMQA 2JIMA 1C3LA 3ZN2A 4A92A 1U0BB 1QF9A 1PVDA 1PUJA 2EWWA 4JT9A 3JARA 4MQBA 1Z5GA 2VOJA 1Q0QA 2FR0A 2W90A 4TS3A 3AKZA 2Y1FA 4B40A 3UBTA 2ERYA 3BIXA 1JIKA 4RFSB 4TS4A 4ZA2A 4KITB 2FZWA 5EWMB 5IT0A 2AJBA 2V45A 3DE1X 4F3NA 3UUWA 1BZYA 1BHJA 1FYXA 1G63A 5EP4A 3VHXB 3ZD6A 4TSFA 4G0ZA 3T4PA 4RGYA 4ZWNA 3OIGA 5HKKA 2E5LB 1AV7A 3FWKA 2J3KA 4Y7CA 1QB8A 2AEMA 1U8CB 5K0EA 1W2WB 1WUJS 4AIIA 1H1TA 2G9QA 1BC5A 1QMPA 2AFRA 2QV7A 2X5JO 4KQCA 3FFTA 4HUTA 2AOWA 4MA5A 4DR1B 4N0DA 2VQ3A 4DV3B 1FRZA 2XNCA 3EGXB 2R1VB 1L5QA 3MUNA 4HEHA 2NZ8A 2J0SA 4QPZA 3K9CA 1VKRA 4ND8A 4CZ2A 4KX5A 4O4IF 4PYIA 1IVYA 3RAJA 2CUTA 1PWYE 5FWNA 2QDKA 3IE2A 1IU9A 5ADWA 2AOUA 5DJ5A 3UMCA 1XCOA 2OXTA 1AS2A 3EF3A 4AG3A 4ZMSA 1NC3A 2JI8A 4HG2A 1E2IA 1OHHD 2HLHA 3BCUA 2J9FB 2PX8A 4LE2A 5AUOB 4ER3A 3U4QA 1JXOA 1XLWA 2GAAA 3UJAA 3GHYA 1G5RA 2XA2A 2EZ9A 4AO8A 4Q9DA 3QX7A 3B1YA 3ICQB 2ZWMA 4E1BA 5JISA 5J3JA 4CETA 3PQ5A 4BC1A 3CNQS 1JS1X 2DMRA 2BZ0A 4NFLA 2VCYA 2QTVB 1EGVB 3WK7A 5BR4A 1DTWB 1PDOA 2H1OA 3HB4X 1Y9AA 3MLBA 2OZVA 4H4DA 1WQ1R 3OT5A 4NV0A 4UARA 4XGKA 4C4TA 1PF7E 2CXUA 4ZEWA 3WAJA 3ZGXA 1M3SA 3T06B 2WJWA 5BYKA 1XDWA 4NYMQ 2AC4A 5FOVA 3IIIA 4MV6A 1TM3E 1QCCA 4M1MA 4L57A 5C3UA 3JQFA 4YP9A 4JA2A 3ZDXB 2E9SA 4GC9A 1NUAA 2PGOA 4G0XA 3AUJB 3N8HA 1KS9A 1TQ6A 3DM5A 4IS2A 1EB8A 2BJWA 2XUZA 4XDGA 4IR7A 1FDIA 4EABA 2A1UA 1UC4B 2B4RO 2CD7A 2PS1A 3H17A 4REOA 3ZI7A 1CEYA 2DYKA 3SMVA 5AVZA 2IPNA 2BMAA 4LE1A 4BRWA 1U28A 2JLRA 1XA0A 3DV0A 4OY3A 5E4JA 3TLXA 2G5PA 1F14A 2NUAA 4F5WA 5JJIA 1KQFA 2X1VA 4QLBA 1KXJA 3M4YA 1XNHA 1ODCA 5JJLA 5I5EA 4D3DA 1U7ZA 2XQVA 2IZZA 4Y2JA 3D5QA 1BJTA 3WKAA 4KKXB 3LFUA 4D6PA 4FD2A 1TZJA 1R7RA 1ORWA 5GGXA 3Q8KA 3JALA 1I13A 2IOYA 1ZMTA 2DY1A 2XKJE 4MVJE 3RE1A 3NETA 4RK0A 3TS1A 1Z6QA 3AEUA 4JASB 1QGYA 1JNYA 2XXAB 3NBYC 4L5IA 4CLXA 4OYRA 1Y6ZA 1DRKA 4Q00A 3T3HA 3U7QB 4CL3A 1YFLA 4II3A 4RF5A 4D26A 3VYSB 1GU0A 4OKNA 4NEGA 2E2WA 5JC8A 3K8ZA 5IC5A 1IMOA 3Q7SA 2YUIA 1DCMA 3B78A 2JZOA 3DZDA 4F9GA 3QA3E 2JD0A 4D0LB 1PFQA 1MRNA 2FF7A 4JLNA 1PI3A 1NY6A 4KQ6A 4U00A 3B6JA 1H2EA 2ZDQA 4M0EA 3VDXA 2ZREA 2VK8A 3DQQA 4FZ3A 2EKPA 4KNVA 4B3CA 3TR0A 5J58A 3V8EA 3O8BA 3TTVA 4IMPA 3QTTA 4WECA 4WXPA 3TBFA 3TRIA 2J48A 3BMQA 3UBMA 2R6FA 1TK3A 3C8ZA 4XGRA 5JATA 1LVGA 5HSGA 4OHBA 4HH3C 2ZUFA 3F6CA 4JL6A 3DZHA 3G0GA 3GGPA 3O94A 4E3WA 2XBMA 4I50F 4E4TA 4BHTA 1UMBB 1EUYA 4FFRA 5E4TA 2VJOA 1P2DA 2RHCA 3H18A 4XM1A 5BSRA 4ZVRA 4FNMA 2ZBQA 3EAQA 1N4DA 1PR0A 4P36A 2PKXA 2V3VA 1RP1A 3QFCA 1KC1A 2WK1A 1IH8A 1GVNB 1X1AA 3EF1A 4LCJA 3SEZA 3TGPA 3Q87B 2GEKA 4ZPXA 1BS2A 3CG0A 4X20B 1VJ5A 4BB9A 4IJ5A 5BYBA 1N1GA 5BY2A 3KBBA 4JBIA 1G4UR 1VCIA 2O52A 4A8PA 4BZZA 3I6YA 1QYDA 3KR0A 3G23A 3OHSX 4FMPA 2BEKA 1YFZA 4KEAA 3HVUA 2ZWAA 3FUWA 2X77A 5EY5B 3T7AA 5FDFA 2QTHA 2J5XA 3QFHA 4U7GA 2FMXA 2LCIA 4DIOA 3GNSA 3R9XB 5C34B 1D7OA 4YAGA 2GSDA 4E32A 3GJ8A 3QG1A 2QG4A 3CBQA 1HTWA 5DOVA 1SOVA 2Y1EA 4GLFA 2J3QA 4LJ5A 3DEHA 2D5CA 3TCKA 4KE9A 3TQRA 3M1AA 1J8QA 5ELMA 2A4MA 1P0PA 3E81A 4IV5A 1PWHA 3CM0A 4A0FA 3UOWA 4BO9A 2GJ9A 2J33A 1TQDA 2MSLA 3I01M 5L3RA 4DV4B 1P6QA 2YVLA 4HQLA 1WG8A 4W99A 4Q3KA 1IQRA 2YY7A 5KYNA 1CR2A 2K5UA 3MT9A 1A96A 3D0OA 3SM9A 1E5XA 4TTQA 4K86A 3WHLA 3KQMA 2B37A 1Q5PA 1W76A 4BZQA 1VRCA 4LNUA 4P7FA 3G5AA 4KUGA 2RHLA 2G5GX 3O8RA 2IZOA 2Z8XA 3RFTA 3K0CA 2IHVA 3IR6A 3RWBA 6CHYA 3ES9A 1E4VA 4Q9HA 3VUFA 1X8XA 3BT7A 1P4RA 1S89A 5CCDA 1KYIA 2ZIFA 5BN4A 3Q7IA 2P9QA 4IWNA 3TSZA 1LTKA 3L7LA 1IBCA 1O6CA 1KI6A 2ZT7A 5TQ2B 2Q0SA 4D9CA 4GOMD 2AE2A 1BU8A 4Q39A 4UHHA 3RS7A 3OWOA 4EY3A 2I2CA 3GBVA 4G8DA 1CUXA 3TQSA 4DXAA 3IL2A 5E4FA 3K0AA 3COPA 2C5AA 1MG5A 3FH0A 4ALKA 1NU8A 1I10A 3PC8A 4KO1S 4ICIA 4BTEA 4Y9UA 4X84A 3K5HA 2RHWA 2ZTSA 4Y18A 1R0ZA 1J5EB 1U3VA 1U7XA 1IATA 3MAAC 4IFIA 2PRSA 4IFEA 1Q83A 1MOZA 5K0FA 1G7TA 3CU5A 3QVXA 4XYLA 5ES4B 1UT5A 1P1KA 1V37A 1SHUX 4WNIA 1L7MA 3R7WA 1NBME 1CJKC 1JJBA 1R8YA 3ZBPA 1MTOA 5F5LA 8ABPA 2R11A 1V5GA 1YZUA 2OKCA 4MI9A 1PQ4A 3FMGA 2CMHA 4TUYB 4M9XA 1H8ED 2WI8A 1X70A 2P68A 4AAYA 1M1NB 1JFSA 1U6IA 4TKVB 4JJEA 5JXJA 2O2ZA 2PX0A 4KK4A 1WHSA 4NV1A 3CN7A 1CQJB 1PEAA 4OAOA 5L7YA 2LKDA 2NYAA 4G9EA 1ANKA 2COUA 2WIKA 3SPXA 3U0BA 4F60A 5ALDA 4PE5B 4RSGA 4D9HA 5HJ7A 4NXMB 1S1CA 1IG0A 1DTSA 3EWSA 3GH3A 3BQ9A 3E8SA 1OT3A 4KWCA 4TS9A 1I30A 2JIZA 3PEFA 1XJWA 2DE0X 4HQRA 2WPDD 1UMCA 1PGQA 1GNTA 4UCFA 3VPHA 4AC9A 1T5IA 2MJLA 5F9HA 4RFLA 1GZ7A 4BNXA 4FU0A 4URZR 3FUTA 1KI8A 1U9IC 3L0BA 3BWYA 3VKWA 2ZYSA 2A4KA 3QUBA 3C5VA 2VK1A 1QLHA 2KMLA 3PNYA 1RQ7A 2QGZA 4OIFA 3RTGA 4RZXA 4B6EA 1EFKA 4L0DA 4CHTA 1CNMA 4MVJD 3CF0A 5IDVA 4GKVA 2O2EA 3CX8A 4UUPA 1CY0A 5FUXA 4OF4A 5CA0B 1FDTA 1PJTA 3GVCA 3WRWA 3WJAA 5J4YA 1Y5LA 1RADA 3PBKA 1NQTA 4FDTA 4MINA 3K1JA 4YTEA 1XLUA 4LHEA 3I2HA 3STXA 5JRZA 2C03A 3GWGA 1X7DA 2Y9PB 3OCUA 5L9AA 2RK3A 2GWRA 1JW9B 1IHPA 1KMHB 1XDUA 2Z58A 2XT0A 2JBAB 2J9GA 3KOWA 3ZCSA 2VHYA 1JEYB 3NIGB 1ZMOA 2YXEA 1C30A 1BVUA 4QYWA 3TXXA 2I2BA 1NUPA 3QPBA 1AHPA 1A76A 3P0JA 3MTDA 4FHZA 2Z8ZA 2O8BB 1SNYA 1TVEA 3GLTA 5JR3A 1UBCA 2BR4A 3D8UA 5K3CA 4MLPA 5TGTA 3THWA 2GEUA 3CS3A 3OPNA 1YZTA 1DUVG 1XHLA 1FLAA 5H83A 4D5EA 4DYHA 1Z7EA 3NHFA 3O8NA 4DUZB 3FTFA 1GPJA 1EX9A 1EJ2A 3ONDA 1A5BB 4NK5A 2OORC 2X4DA 3ZY3A 2AN3A 1DEOA 1ZUIA 4UM7A 5AUQA 3H4VA 1BXRA 5HK8A 1QZTA 4W7IA 4PONA 2OFWA 4DE5A 3UMVA 2W6IA 4BY9E 1XTUA 3RJZA 5FQNA 1MVLA 5AJHA 3PUZA 1PZXA 2NOAA 3MUOA 4BNIA 2XD4A 3JZAA 4EVQA 1J7JA 1KK1A 3DULA 3RS4A 3PX2A 3IPXA 5E9WA 4E0BA 1AK2A 2CBXA 2VTBA 2BV3A 2V3WA 4KBGA 2RHJA 1W0KD 1ZISA 4JITA 1YRAA 3RG8A 1SVWA 1M0TA 2V58A 2CZCA 4KGDA 4N0MA 4EMSA 4B35A 3LCJA 2HU8A 4Q1CA 3SXUA 3THOA 4CFSA 5L8VA 3ZDDA 1M2GA 2CLDX 3G9XA 4EVRA 1X15A 1GQQA 2Q5EA 3S4YA 2IPLA 3CEHA 4LY9A 3PXCX 5K0CA 2HSDA 1XCGB 2BHTA 2QR5A 5AI0A 4JB2A 4BFZA 4RHUA 1NSFA 1NQVA 3CCFA 3PUJA 2CYCA 4Z0TA 3KSBC 2VA9A 3LJKA 3DXXA 4PSUA 4LSZA 2F8MA 2IYXA 1V1MA 2GHIA 4Q16A 4C22A 5KOHA 2W42A 3AXTA 4OQZA 3LQ2A 2HA2A 1EVEA 4OKSA 4XLLA 5B1DA 4ETWA 1VPWA 3OX1A 5BMVF 4GOJA 1GPWB 2IVZA 4C4PA 2W70A 5DM1A 4IBOA 4U5QA 3Q0TA 4W1QA 5CT5A 1HFJA 1HE2A 1QIKA 4CF6A 5A02A 4DLZA 3T95A 5DOZA 2CLIB 3WJ1A 1OE0A 4KBFA 3HFRA 4DREA 3VZQA 2A6PA 3W1EA 1BXKA 3QJYA 4D79A 4AK9A 1YBVA 4NZMA 4V24A 3EVEA 2W71A 3F7MA 3HSYA 3Q3EA 3R74A 1EIWA 2WIAA 3RVOA 1CEQA 1M2KA 3M0EA 4LZZA 1Z62A 2AT1A 3S68A 4W7SA 2HSEA 1ODJA 4B0PA 2GQ0A 3TI9A 1UK8A 2XH8A 2CHGA 1YQUA 1LRJA 3KCNA 5CR9A 3OLQA 1KA9H 4L4XA 4MVXA 4ZI7B 4LGVA 5JO0A 3RUPA 1NBMA 4GX5A 5M2QA 4TV9F 3HGTA 1GTZA 2WW8A 2F00A 5EIOA 4MZXA 3FETA 2Z43A 5CB4F 4MULA 3EOZA 3GBPA 2XYHA 4XQEA 5BYJA 4W8HA 3F5MA 4G0QA 4WOCA 4LXTA 2BUAA 1SZCA 2XQIA 1AGRA 1L4NA 2J85A 2XMPA 4HDSB 5B6PA 4IDFA 4NPCA 2QE6A 1ML3A 4J0DA 2QTNA 4YRQA 1U4OA 4I99A 3DAYA 5E6RB 3TGWA 3K20A 3WVNA 5FLYA 3ZCTA 4Q02A 4F4CA 1W8DA 4HPJB 4M8NE 4YAKA 3IAM6 3B9PA 1JR6A 2PUDA 4LY3A 5LB4A 1YOBA 3RYCA 4HLUA 3ZWOA 1TUBB 5JAPA 3K9HA 2IX9A 3IELA 4C0XA 4EGCB 3JQCA 1TW3A 4IHKA 1FB5A 1PJSA 1H2ZA 2PMFA 4M9UA 4Z4HA 4V1CI 4JUDX 1Z4KA 3PHLA 5KBYA 3TRJA 4KX3A 5HE8A 1CUDA 3H2SA 1LJLA 4YCDA 3LI2A 1H0KA 1B6GA 2WPNA 2R6GA 3HXPA 3PJGA 4ZAFA 3ABZA 4BO7A 1UBRS 1G20A 4G1VA 4PPGA 4QDTA 3LKDA 4QUIA 3IP6A 4JI1B 3EF0A 4E15A 2V3CC 4WZBB 4ZHQA 4L9WA 4FP9A 1EE2A 3RU3A 3NASA 4LTDA 1Q0UA 3CR7A 1FSZA 1EEXB 4IXDA 3V8VA 1SCUB 3PQ6A 3ZVLA 1PT9A 3ESRA 1PK7A 1ZNWA 2A2ZA 2W2NA 2WWFA 3L8CA 1AK1A 2E4UA 4RH1A 5DTQA 3ZCUA 1TJ5A 3IQWA 2GXAA 2DH5A 2Q6LA 3BGOS 3P9IA 1P6XA 3GLKA 2YQZA 1D2RA 1TRHA 1YDWA 4WUVA 4JLUA 4OD0A 3SEQA 5ICEA 2OA0A 3DDOA 1XROA 3S7TA 4MXDA 4K87A 4TS1A 4AMBA 1QHEA 1EK5A 4A27A 4EYQA 3A1CA 3GA5A 1ZCZA 2JLZA 3WLKX 2HIGA 3BORA 1R64A 2B8JA 2QRJA 3UO8B 2AQ8A 5E7JA 2KSQA 3EXG1 1D04A 1PJCA 4JUFA 1C30B 3SZUA 4Q9JA 1GO2A 1Y8QB 5L3ZA 3AFOA 4PTLA 3E9QA 3OZGA 1FFAA 3E3LA 3L1UA 2GHTA 4JFAA 2F9MA 1CKEA 1G8GA 1LPSA 1P45A 2B4YA 2ECFA 3B70A 1F06A 2XXBA 4MYCA 4RORA 4BGDA 1A8UA 4OLAA 3ZHSA 4TUYA 2AA3A 5BWCA 1DTEA 2DWCA 3CRQA 4ITVA 3PDCA 4HJXA 3M9XA 3B6EA 1ILWA 3UB3A 1U1GA 5JZVA 4LXHA 3JASA 1PG0A 1C9DB 5EJ9A 1Z2NX 2GCIA 3DVLA 4I36A 4WMLA 2H7XA 5DBOA 4DXHA 4BEWA 4RD4A 1CUWA 2B9VA 4Q82A 2ATVA 4ADSG 3H1BA 3HYSA 1Q0ZA 1T3GA 5HZHA 3FCXA 1M7GA 1FBTA 1KKLA 1W88A 1XZ8A 1MZVA 1MCZA 2QI9C 5JZOA 3JYOA 1G8FA 2VO1A 2YWCA 1O95C 3QXCA 2VSQA 4R3NA 1JDSA 2YVAA 3HJRA 4CIWA 1USGA 5EWLB 1N32B 2IHYA 1A8IA 5BNTA 5B1SA 4NP6A 4PRLA 1OI7A 3CLRD 5H68A 1HDIA 2DGDA 2CVPA 3E7FA 4WK2B 1TKCA 3PEWA 1N0WA 4LISA 3IP3A 4MVJA 5JQGF 1JIUA 2O1EA 2B34A 1QANA 1S2IA 4MRSA 4PPFA 2EKQA 3AZQA 4QBIA 1KWKA 1D2EA 1AKTA 4O59O 5HS6A 3IODA 1T9GS 4E08A 4K9QA 1UJ2A 1K08A 2JFQA 3D7NA 5B3JA 3ZOZA 3K70C 1G17A 2HJ9A 2IZ6A 2Q2OA 3FSEA 2HK6A 4EY6A 1SU4A 2FQXA 4Z3KA 1XMJA 5DT9A 5G1OA 3TIIA 1KMQA 2BGKA 3K8YA 5JPDA 4FGUA 3FGNA 2NSJA 4E14A 4C5CA 3TB4A 1AD2A 3IR7A 1E2LA 4EAQA 3E18A 5E7QA 3G8YA 2EX1A 5I9BA 1T5BA 1XRQA 3K0KA 4CG2A 3JYPA 3F5FA 1JHRA 1TZMA 3TJRA 3MOGA 5K03A 3IC5A 3DWIA 5JSZB 1UPCA 3G2PA 3FE2A 1GSAA 2UYYA 1FNCA 2Z2XA 4CU5A 5M34A 3VKGA 2IXTA 4G24A 2PWBA 5CH8A 1IPHA 5FO1A 3B48A 5KU7A 3RSCA 5J4VA 5CYFA 4YC7A 1YOVB 2N46A 4CF5A 3SC2A 2JCBA 4D8VA 2H9IA 4UBKA 4DLBA 5EESA 5DRTA 4QVKA 1IB6A 3NM5A 1KZ4A 2HYIC 4D4KA 4KYVA 1Q84A 5FBWB 5E1OA 2XSZD 3BSWA 2NXNA 4U7JA 4YAEA 1RQNA 3O74A 5JYBA 3LY7A 4PQGA 2VPYA 5KWIA 1YE8A 2DUWA 2OBMA 2WAYA 3ROZA 5BMVA 2CHFA 1EK2A 3OJCA 3QWHA 5T8KC 1PV2A 2W6MA 2FX5A 4ARZB 1M1XB 2ENUA 4RVNA 4UNIA 3A1UA 3CVYA 1LBEA 2XE6A 3DONA 3Q9UA 5JEEA 2GZ2A 4L75A 2IEIA 4NOMA 3AJRA 2HEGA 2I2WA 4P53A 2ZU6A 4YAJA 3RUIA 4YAWA 1KSGA 3WI7A 2I6UA 1JFLA 2C00A 2QM3A 3LLSA 4MCHA 3STVA 4CMEA 3RD5A 2WA1A 4P4SB 3FG9A 3T3MB 2VPXA 3I5AA 4UBMA 2OVFA 1E4YA 2H4XA 3ET5A 4N6NA 2VXCA 1FXWF 5CX1B 2VSXA 3IHLA 2X3YA 4DQ0A 4XWKA 5LA6F 4X1IB 5ALYA 1Y98A 4QEKA 4KYTA 3H9UA 3C3KA 4K5QA 2H08A 4RPGA 3VAAA 4G5OA 1JJ7A 4CMJA 3CURA 3KEFA 3KELA 4OYLA 5KTTA 2WJ4A 4D9IA 5L3SB 4JC5A 3H2BA 3HKEA 2ZCUA 4FDMA 4CV2A 4EHJA 5LIPA 4NJMB 5EXPA 2Y0BA 3IJ5A 4DCVA 1C0LA 4YMIA 1FFDA 3GPCA 4ZO8A 4MUYA 1NRJB 2ZVJA 3E1SA 3JAKA 1XD2B 1IUOA 5BURA 5DULA 1W4CA 2QLBA 4OH1A 3NGMA 3BRWA 3ESYA 1N5IA 4IW3B 4CLRB 4HAOA 3T54A 3I4LA 3IKMB 4GEGA 5C81A 4JOQA 1Z7BA 1PJAA 3OZBA 1THMA 4DR6B 4F4HA 2QMUA 4KQ1A 3J7AC 1N2ZA 2RHGB 1C3JA 1E8NA 2AN4A 3NC4A 1VXRA 3D6NB 4NS4A 4YA6A 3RF6A 3WIEA 4H16A 2BRUA 1WCV1 1X94A 4LOAA 2FPIB 1SB8A 3VR1A 1FSSA 2IBSA 3R3SA 3ETCA 3EUFA 2VVTA 3RVDA 1CFJA 2X41A 4YMLA 2XDQB 3ZK8A 2Z5FA 3MINB 1A9TA 1OU0A 3G0IA 3MWFA 3QEMA 4PGGA 1GG8A 3BJZA 1THTA 4KOAA 4HR7A 5JY1A 2ADFA 3WGZA 4C3VA 4XD7D 3VHQA 2EF0A 2QYOA 4B9EA 5KOJB 1PJRA 1WF6A 3Q7EA 1RBYA 1EM6A 2ZJ0A 5DWDA 1OGIA 1M7BA 4ZCQA 2CLEB 3KE8A 3R77A 2PQ2A 5ADVA 4C03A 1DV2A 1XI2A 2XUQA 3P9SA 1OWPA 4YDRA 5JCPA 2OAQ1 4RO0A 4DN6A 1N5KA 1F3OA 4NOJA 4Z8XA 2NNLD 4EPVA 4F5DA 2OORA 3RADC 1Y9ZA 4LFBB 2ZTVA 1KJ9A 3IDQA 3PKIA 1O97D 1C5KA 2BI4A 2AMYA 3C3CA 3WYNA 7AT1A 3PEVA 4DV2B 2L69A 3ACDA 5G0VA 1YGYA 2YS6A 3D54D 3WRXC 1NBWB 2JRCA 3OLVA 2E4VA 1JMKC 1XQ1A 1LH0A 4J4BA 5EJ8A 1OPRA 3IVMA 1R3UA 2YV5A 5FLKA 5JH7F 4TL9A 2DPLA 3GLFE 3DLPX 3BOSA 3R09A 4EEZA 2I54A 3FFWA 1Y1RA 2JGMA 2Q3FA 2XDAA 1JA9A 4XYEA 2LR0A 1I2CA 4AUKA 5DASA 1TT5B 3CUWA 2GPAA 3ZWNA 1JEYA 1ID1A 3CUVA 1RJWA 4QT0A 4EW2A 2O8EA 4HB4A 3NKFA 4DA8A 2E82A 1KRHA 2VJMB 3OZWA 1S3GA 2J6HA 3DZCA 3IPLA 4IZ6A 1F5SA 3JZDA 4EPRA 3IBGA 4PHTA 5LKAA 3ZY5A 5KQMA 3R6DA 2CDRA 5FOTA 4EY8A 5FBVB 4X93A 4ND2A 1WPXA 1X9IA 1W25A 3P0RA 3JQAD 4E09A 4S1OA 1KP2A 4U4AA 3DCIA 4IG4A 4AY6A 4TN5A 4GFDA 1TYCA 3IEMA 4IQ0A 1ADFA 2H18A 4W9NC 2VTEA 3U1TA 2MSEB 1T2FA 1LV7A 4P82A 1QG2A 1QHXA 1PUXA 3EMBA 3PX7A 3KPJA 1H8HA 3B6MA 3F3SA 4BV8A 2NZWA 4LF8B 3AR3A 1FVXA 3RYIB 1SCDA 2VPZA 3MOIA 1VB3A 1GRNA 2ETXA 5DW0A 4PYJA 1T29A 2WJ6A 3IDAA 3M1IA 3NUZA 2HQ1A 3RBAA 4AY3A 5LZ2A 4JJ6A 4M9ZA 1OXTA 3AHHA 2DHEA 2FG7C 1AKWA 4RY2A 3HU1A 2ZIEA 3T9BA 5GJCA 3Q8XB 1Y5MA 4QBFA 1RJ9A 2PH1A 3FYTA 4D8YA 3SQWA 1QHGA 5AOVA 2C31A 3KHUA 2FMFA 1NYTA 3CLUC 4ETNA 1SEPA 2YJ4A 3VHXA 5FPPA 1JSRA 3ZXYA 4J9UE 4BCDA 3PGKA 1K8RA 3Q85A 4M1OA 1RSZA 2ZB7A 4GOLD 1XTTA 1D4ZA 2DF8A 1YFJA 2B2NA 1PNVA 3TJZA 1S0UA 2J87A 1NM5A 3R7BA 1JF8A 3PJDA 3KU4A 2JJ2A 3U1VA 3VHRA 3OESA 2EW8A 2QY6A 2C5LA 2RKWA 821PA 1GRRA 1BXGB 1K0FA 3N5KA 1WCWA 4X62B 1TE2A 1R0SA 1W4LA 4DLLA 5ITZB 4IINA 3KSUA 1OWLA 3CZ9A 3R3VA 3HVHA 2XSZA 2YQ5A 3D3NA 1J0CA 3FBWA 3L40A 3ZD8A 1RMQA 1EGAA 2GN9A 3C74A 1NW4A 4MMXB 1E0KA 3IALA 1XRJA 5AOAA 3LZCA 1K0UA 2ZUCA 1KDVA 3SWWA 1DJLA 4IGFA 3BZUA 4FFVA 5AW2A 2ATXA 3Q9SA 2PT5A 3OQOA 4YGXB 3ZHXA 4QXQA 3Q6MA 4ZCRA 4QOHA 1KZGB 1RYDA 4Z2AA 4JX9A 4O8ZA 2AD5A 4QBHA 4IXTA 3HLYA 4QQNA 2ID8A 2PJUA 4PBRA 2VP3A 1WPGA 3AETB 5ALNA 3H6KA 4FUQA 3TL2A 4F38A 1J23A 3HMKA 5ALRA 5LQCA