3BRWD

Structure of the rap-rapgap complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
167
structure length
167
Chain Sequence
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rap1 GTPase-activating protein 1
publication title The Rap-RapGAP complex: GTP hydrolysis without catalytic glutamine and arginine residues
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp binding protein
total genus 51
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3brwD00
3QF7A 4JL6A 2WSSD 4LPSA 4DZZA 1PJRA 3THWA 4HSEA 4NZYA 4WAUA 3W3ZB 5L3QB 2RGNC 1Z47A 1XBTA 1QF9A 2V55B 4Q1BA 5EP4A 2JLRA 5K8TA 1R10A 4AI6A 1DG3A 4DCUA 5EQTA 1LFDB 5GADl 2MSEB 4HLUA 3S1AA 2VP2A 2F1IA 1ZM9A 4DRZA 3PJRA 2AKAB 4DT1A 2PJZA 2QPOA 2ZJYA 4HAUA 3WY9A 1VYTA 4M8NE 3Q85A 1N5KA 2H57A 2H17A 4JSYA 1S1MA 2ZI5A 4MRNA 5FPKA 3K70C 1HH4A 4PC1A 1W5SA 3KUDA 4PC6A 5FTJA 1J99A 4BASA 4BFTA 1G19A 2BEKA 2FWRA 3LWNA 1JBKA 2RMKA 4QNMA 3W6NA 4XWAA 3LBNA 2ZRPA 4LJ6A 4HATA 1GNPA 2TMKA 3K8YA 4H1UA 3U6KA 4AD8A 1CJTC 1E2JA 4FMDB 2OCPA 3CM0A 3CZQA 1TF2A 3W90A 3V9PA 1EFRA 4NYMQ 2DWPA 1KNXA 1H8EA 5AJXA 5DYIA 1NVWQ 1JEDA 1HQYE 4R9UC 4WBSA 1D6JA 1N0UA 1NSFA 2O5VA 2VEDA 5JHGB 5AUNB 1JPNA 1MR3F 4U02A 4OK6A 5J4HA 4QBHA 1EWRA 4D82A 2OCBA 3SE0A 3VMFA 1E4YA 2B8WA 3KQNA 3GCGA 1Q57A 4PZLA 1AGPA 2R9VA 1YU9A 4MYUA 1TMKA 2REOA 3TE6A 3U7HB 1T8UA 1KI6B 1HV8A 4NCNA 4TYPA 2R62A 2XTNA 3WXMA 821PA 1FX0A 1IQPA 1E2EA 1I2MA 1KK0A 4M22A 4TLAA 1VCNA 2BCJQ 2NGRA 2G1KA 2WIBA 4QBFA 3OAAA 4JT2A 3IIKA 1E1RD 1WMSA 2GXQA 3EWAA 4B47A 1I4TD 2XX3A 3A4MA 5CM8B 2JJ8A 1FNNA 4A82A 1UFQA 4I1VA 2FF7A 1US8A 3RS0A 3FHCB 2VP6A 4J0QA 2BM0A 1X1RA 2QUZA 5FI0B 2ORIA 3K09A 1QVAA 4KAXA 2P3SA 3CZPA 3HR7A 1W4CA 3FKSD 3WNDA 1SHKA 4DJTA 3ZVLA 2V54A 3CWQA 1AZSC 5AJYA 4RKEA 3SFZA 3K9GA 2EWWA 4YXWA 3C15C 1U0LA 2R6AA 2ZSFA 4B48A 1DAEA 2GESA 3Q5EA 3F3YA 5EXPA 2PLRA 4OYHA 2YV5A 1MKYA 2FFBA 3PXGA 1QG4A 5AJWA 3U61B 1VYUA 3KUCA 5G41A 2ZANA 4LGMA 4ZPXA 1VCOA 3WBKA 1FQJA 1Q22A 5J5CA 2BIFA 2UKDA 3K9NA 4DXAA 4JBXA 2FJUA 4PSVA 3EPHA 4M4SA 4RJLA 1Z5ZA 1SZPA 1X1SA 3IQWA 4LYHA 4C30A 1Q20A 4RD2A 2QAGA 4QGFA 4C9BA 2HJGA 3C5HA 1F2TB 1KHTA 1IXSB 1T3HA 2HEIA 4GPTA 4LBWA 2Q3HA 4IHQA 1J2JA 2CL0X 2VRWA 5DGXA 5EP1A 1R0ZA 4MYHA 1YR7A 1IAQA 4RCZA 3R9XA 3FMIA 2AL7A 3L8ZA 4IVRA 3QBVA 3O8BA 4ARZA 3W5IA 2RKOA 4KFUA 4OKSA 4D2IA 4L9SA 4D80A 4CEIA 1N6OA 1JEEA 1KO8A 1SGWA 4OHXA 4CZ2A 4JIMA 1JJVA 1M8PA 1FTNA 3SBEA 2ZI7A 3QXSA 4PPNA 5TARA 2AKYA 1NMYA 3T15A 4Z8YA 2J41A 2HCBA 4JLKA 1DELA 1WDTA 4FD2A 4UNQA 1CJMA 3AM1A 4A36A 5HPYB 2Q9BA 3D31A 4CIDA 5HR5A 2QG6A 4MH0R 1LF5A 1BYIA 4M9SA 3BC1A 3B8HA 2FDCA 3NBXX 2QL6A 3K53A 2CCJA 5JRJA 2BVNA 3M6AA 3BFVA 4ON9A 3TW8B 3U44B 3WBJA 3VNUA 2DY1A 2Z6VA 3WYFA 4B6FA 1Z3IX 3U60B 4FMCF 1OXXK 2P6UA 1RRCA 3BK7A 4HI0E 3HDTA 121PA 3SHFA 2X8AA 4ZI3A 1YZNA 1Z6XA 3LW7A 3JVVA 1P62B 5KNDA 1C4OA 1MOZA 2G9NA 2W6JA 1FQKA 4KLZA 4ZO4A 3B9QA 4GMXA 2VP4A 4KHZA 1CS4C 2VP5A 1G3RA 4BGDA 1VCMA 3AF4A 2QBYB 1RJ9B 2IHYA 1XEFA 2ORWA 2ZS9A 1G6HA 1P72A 3AP3A 3GJ4A 2ZS8A 1R0XA 3BFKA 1D2MA 2O0KA 5CB6A 1T0HB 4A0HA 5AWFC 1UDWA 5FBQB 5HE8A 1E94E 6Q21A 3KZ1E 1UKYA 4UJ5A 3A1TA 4UNNA 3VKWA 4URWR 2WMNB 3B60A 2E1RA 4RZ3A 1X8KA 3AP2A 4W7SA 4AG5A 3OEED 2ZSEA 4F91B 2A7QA 1G4UR 2JGNA 1V5WA 3KJEA 1SVSA 3ZD6A 4DIEA 5J4YA 1JQJC 4IOLA 1KSFX 3ICQB 1TAGA 2PL3A 4CEJB 2ZE5A 5SZJA 2WBLC 5IK2D 4G5QA 3T1TA 1UM8A 2GBLA 1XB2A 3AH8A 1Z06A 4JKYA 2W2TA 2V9PA 1ZINA 2PEZA 4PC2A 1XD9A 4R2HA 3X1XA 4U00A 3VR1A 1GL6A 1DTSA 4OHWA 4DSOA 1R2QA 1M74A 1T4GA 3LA6A 4BEBA 1OFHA 1N3BA 3KKNA 5EE5B 3A4NA 1RKBA 2NOAA 1OIWA 1W36C 1LW7A 3VTKA 5KPJA 2VHTA 3U6BA 3AKCA 2ZRMA 4F93B 1ZU4A 1BYUA 3B7GA 2I1QA 1BS1A 1NY5A 1ZNXA 3CRW1 3I32A 1I2DA 2C03A 2QP4A 3TR5A 1Q1QA 4DSUA 2JJ2A 4A8JA 4BFZA 4BRUA 1FFHA 4ZDWA 4EQ6B 2ZU6A 3B82A 5JZVA 4Q1FA 4TQ9A 4TTRA 2OFOA 1SKYE 1TPZA 2AFHE 5DN6A 3KTAB 3TH5A 1NJFA 5EP2A 3ZVRA 4B3CA 2Z5FA 4YDHB 1VG0B 4JLAA 4O3MA 5HE9A 3T1VA 5F9HA 3SQXA 1BO6A 1G17A 1LVGA 4OI4A 3REFA 2FZ4A 1QDEA 2XNSA 2ZYUX 5F3WB 4NDZA 3QXCA 4L8GA 4PR0A 4QNRA 2CMKA 1CLUA 2ZR9A 2ZVQX 4KJZA 3DL0A 4N3NA 4X8LA 3T5GA 4DDUA 5L3SB 1T8TA 4JLDA 3UATA 2G83A 3DZ8A 5KDDA 3QKSA 2J7KA 1KDTA 5ANRB 1WE2A 4YMSA 2GILA 3OFND 5DNYB 4X8MA 3WP1B 1XCMA 4TTQA 1CTQA 4AY2A 2IXFA 4OL0A 1P9WA 5GJCA 1Z22A 4OI2A 4PZZA 4Q9IA 2GZAA 1DAIA 2C98A 3TQCA 4NBSA 2O8FB 1NF3A 4RFSB 5IHPA 3HJNA 1KI3A 4ERNA 2GNOA 3K0CA 2JIZA 3JZMA 4XOIA 2KB0A 3T12A 4DSTA 5EE0A 3KQLA 2BKUA 2XITA 5FR1A 4P31A 5KHOC 1EFCA 4IDQA 2F6RA 4FMCB 1O87A 4QOSA 5FOWA 1ESNA 5K8IA 1VG1A 2VSFA 3TMKA 1VG8A 1ZU5A 3G82C 2WPDD 1Z28A 1TF7A 2JJ1D 3C41J 3K0FB 3OE7D 2ZRKA 3ADCA 3AF3A 4B74A 3ZVMA 2PMDA 2ZYWX 3KKOA 2ZYVX 4Y0AA 4W5HA 1PUIA 3QVUA 3WYGA 4MQBA 3A6PC 1FL9A 4IFEA 1J7KA 4FINA 4JZKA 5EP3A 1ZM2A 4MDEA 2AN9A 2MSCB 2GXAA 4XD7A 2C9CA 5FL7A 3DMDA 1XMSA 3CNOA 3FMFA 4QXAA 3LLMA 1E2IA 3HPRA 3PEYA 4LBVA 4DSNA 4P33A 3NEJA 4V0KA 4ACAA 1IN8A 5FTLA 3CH5A 2DHRA 4WXPA 5BYJA 3EPKA 4WZAE 3OF5A 2O8DA 2BWJA 2JAQA 1FP7A 3VU9A 1KDPA 4GNKA 4IVQA 2Q3FA 3DPUA 4L5BA 2HJVA 3TAHA 3LW8A 5CM9C 2FFAA 1OH5A 4MRRA 2DCUA 2QTHA 2GRJA 2OV2A 4E5UA 1DS6A 3VX4A 2OFXA 4A15A 2R6DA 4ZIRB 2FSIA 1KDOA 3PEUA 4MKIA 2J9RA 3AQ4A 5EE9A 1R4AA 1Z63A 5D3QA 4JKIA 4OK5A 3QVVA 2HCJB 4GL2A 4QHYA 2VL7A 5FPHA 1TEVA 4YDSA 3R7WB 2FNAA 3D6TB 2O8CA 4DDTA 5FBWB 2F55A 4D4KA 3DO6A 2GWHA 3IBYA 4RD4A 3DHWC 3TSZA 4TMTA 1EX6A 2D7DA 5JMTA 1M34E 3B85A 3OIVA 2GXSA 3W34A 3RWMB 3SOPA 2XEXA 5E3HA 4GZLA 1EFRD 1ELOA 5JBQA 2G6BA 1H8ED 4F38A 2FSGA 3Q9LA 3A1SA 2IYUA 2H16A 2B7BA 1F2UB 1PLKA 2QT1A 5EZ6B 1T3SA 1DO2A 1E9AA 2FPMA 1OFIA 2GAAA 1KSHA 1G291 1VG9B 2AR7A 3ZIAA 2ZIAA 2YZ2A 3BRWD 4NYMR 3JVUA 2H18A 1A5TA 5L8VA 2V8OA 3DEFA 2GK6A 3KB1A 4CF7A 1GRQA 3P32A 1FMLA 1U8AA 4Q03A 2ZXUA 1Q1ZA 1R8SA 1XD8A 3GLIE 4B3DA 1NLYA 3OAAD 4RY2A 2F1HA 3UMRA 1E9EA 4B3BA 2XZLA 3GLIA 3ZQ6A 4MGIR 4JL8A 4V0ME 1D9XA 1GIAA 1XXHE 1RIFA 1UF9A 3MWYW 4W9MC 3U7GA 2YOFA 4V0MA 1AK2A 1E79A 1YR8A 1AZTA 1XXHA 2EYQA 2O0JA 4A1FA 5JCPA 2W00A 3PENA 1JNYA 3IIMA 4O0MA 5LB2A 3GJ6A 1TQ6A 4YXWD 3GJ7A 3K9HA 1ESMA 2GJAA 1TUIA 2WJVA 4HB0A 4KCGA 3PG5A 1KK3A 4QM7A 3AUYA 4LPKA 4RCYA 1FX0B 1S0UA 1QHHA 2BBWA 1PUJA 1GP2A 3ONWA 4G5OA 1NJGA 1SHZA 3H84A 4MKGA 5AUOB 2PEYA 2VP0A 1W44A 4B6EA 2FSFA 3IKJA 621PA 1XTRA 2FGKA 2J7PA 2R6CA 3NEYA 2IYLD 4RVCA 1SVWA 4Q66C 4FWTA 3EASA 1IHUA 2W58A 1KK2A 4B3GA 5FTKA 2BV3A 5KUTA 4LBZA 1X3SA 3UWOA 3ASYA 4TSFA 1NKTA 4TLBA 5DE3A 3HPQA 2CXXA 3NG1A 3GLGB 1FZQA 4L16A 2IBMA 1CIPA 4Q4AB 2GXUA 2XNDA 1CR0A 1XMIA 1YR9A 1GOTA 2DWQA 2WWWA 4CRWB 4QRHA 1HQCA 5BYKA 4LV6A 2BKEA 1E9CA 1G64A 2I3BA 3QKRA 1IN5A 3AGPA 2IHBA 2AK2A 2O0HA 2RGGA 1B0UA 3NBZC 5KSYA 2OBLA 2IA5A 4OJQA 2ECKA 2OAP1 1XD2A 1FMJA 2XOKA 4LJYA 4OHVA 4D0NA 2IXEA 2YYZA 2XSZA 4HAYA 5JWOA 2FE4A 1MO5A 4GFDA 3ADDA 2YNMA 1KDRA 1KGDA 1AS3A 1N5JA 4TN1A 4AKIA 2J0UB 1FUUA 3U3JA 2GJKA 2ZROA 4LX0A 2OXRA 3BBPA 5A0FA 1W48A 2KBFA 2QQ0A 2REBA 1C1YA 2JLXA 4KXFB 3TVDA 1KTVA 3QKUA 4NCKA 2EFEB 1A4RA 2J5XA 4MRPA 3ZD7A 5KU1A 2VQSA 1YRAA 5C18A 5DI3B 2CNWA 2YC2C 3AF2A 2EQBA 3R9IA 3GPLA 1JXOA 3SN6A 1A1VA 2FOLA 1DEKA 4NH0A 4P4SB 3LLUA 5JI2E 1XU4A 3ZYCA 5JHHB 2W6JD 2EFCB 4LSGA 1G3IA 1KOFA 1Q44A 3T1OA 3EIHA 3UK6A 4LJ8A 1CU1A 4D4MA 5IF9A 4G5SA 3OIYA 4IOMA 4HEJA 4Q1AA 1RVDA 3RRYA 5JECA 3QOFA 3B1WA 2N42A 3H1TA 4I1OA 3QEJA 3T61A 4DLXA 4B2IA 3C16C 1MRSA 5CYPA 1YZKA 4TMKA 3BH6A 1MABA 4G5GA 4URYR 4BLPA 4LK2A 4Z54A 4C2UA 1QG2A 2ZRGA 4D81A 3BS4A 3IPXA 1E3MA 3LD9A 4B44A 4FWIB 1KI2A 4HB4A 3ZGXA 4PZYA 5KSZA 1LF0A 2QEQA 2RGXA 1P75A 2YWFA 3GMTA 3ND8A 3W3AA 3TW4A 3HU1A 2W83A 4C0SA 1U0HC 3U5ZB 3PUZA 4YLGA 4HUQB 1E2KA 1NVUQ 1VKJA 1L8QA 3B1YA 2JLYA 3HWSA 1NL3A 1UKZA 3LVQE 4PTLA 1OXTA 1UAAA 1SXJC 1S9DA 1KKLA 3ZZUA 3MSXA 2HXYA 2OT3B 5HCNA 4MRVA 1Z0DA 2WICA 1E2MA 3GLFE 4EPVA 3PITA 4P4TA 2WJGA 1KJWA 2DFLA 5E7IA 4N1AA 3VKHA 3ZVNA 1UBFA 1N0WA 5BQ5A 2ODEA 3SZRA 5EZ5A 4KBGA 3GLFA 4KYIB 1V43A 2ERYA 2HXSA 3CLVA 1OIVA 2J59A 4LHZA 3TR0A 3RS7A 3D8BA 4A0GA 4EFLA 3QE0A 2JJ2D 5KDLA 1P2UA 3NDPA 5GJVC 2F43B 4Q48A 1KI7A 5K8LA 4MYTA 1UEIA 3H4MA 1GRRA 2A30A 3VX3A 1MH1A 4PFSA 5FL3A 1DOAA 5TXGA 4S35A 3GEHA 5DN6D 4I4LA 4JYCA 2YWGA 1XP8A 5CB8A 1OH8A 3KQHA 2VLIA 4DWJA 4QGAA 1IM2A 4BQSA 2UZ3A 1MO3A 2ZUBA 4FCVA 1FPMA 2CHVA 2RB4A 5A5GA 3PVSA 2V7QA 4DLZA 5BWMA 2GF9A 3J81k 3IGFA 2WWHA 1G8HA 3NC1C 4P3YA 4B2LA 5FOTA 3EW9A 1GG2A 4MGYR 2ZRNA 4KU4A 2Q9CA 3P26A 4LHWA 1OXVA 3IILA 2J0QA 4JS0A 1XF9A 1PV4A 3CRMA 2ZQ5A 4HYYA 1Z6TA 2C99A 2D3WA 3IQXA 4N0DA 5E7JA 5BN5A 1GL9B 2B21A 4US1R 3X1YA 2IS6A 3DM5A 2BHRA 5LBIA 2H1LA 5CLQA 2JIZD 1FNMA 4URVR 5FOXA 4EJSC 3EZ6A 2XXAB 2AXPA 1E2GA 3AF1A 3EARA 4ILEA 1E2PA 4Q1CA 1NN3A 1EXMA 1RC8A 4PXAA 2Q21A 3GP8A 5IT5A 5J40A 2OLKA 2CK3A 1GVNB 3SEAA 3U4QA 2GETA 1G7RA 1XTJA 4DCTA 4NTZA 1M7BA 4HDCA 5J4VA 1EESA 4XD7D 4KO8A 1E9SA 5FL7D 5FPTA 2UVQA 1G1MA 3WYAA 4BFVA 2OG2A 4B75A 4RZ2A 4QC2A 3B2EA 1NVVR 1RZ3A 3ND9A 3QXJA 3PIRA 1ZD1A 4CDGA 1TNDA 5DISB 1OXSC 1II9A 1RW4A 1E2FA 2MMCA 2WV9A 2X2EA 4OHYA 4QHTA 1NVXQ 5KDOA 4ZDJA 1U2RA 2DFNA 3L2OB 3RNLA 3IHWA 3KJIA 1L7VC 5L3RA 2JLUA 5JS8A 1U99A 4OBEA 4QHSA 1JI0A 1P61B 1U9IC 2FEMA 4OI1A 4B73A 1J8MF 4HZIA 3X1DA 4A2PA 1GSIA 5D3MA 1RRFA 3TLXA 3UMSA 3UWKA 1SXJE 3NBYC 2B92A 2QU8A 2GJ9A 4MRSA 1RRPA 2ZETA 4B3FX 3I5XA 5B30A 4A9AA 4YMTA 2C9OA 2JLQA 4GBMA 3SYLA 4FW9A 1IY0A 2GEVA 2ZE6A 5CDFE 2IXGA 1W7AA 3WMEA 1UDXA 1S1CA 1YZQA 1BH2A 2IYVA 2JCSA 1D5CA 4L9WA 3KXIA 3OEHA 4IXNA 5CJ2A 5B64A 3LDAA 2R44A 1II8B 1NN5A 1OB5A 2Q0HA 3SU8A 3GLHB 3FKQA 3X2SA 1OJLA 4HZUA 4DLYA 4IDHA 5EXTA 1CKEA 4M9ZA 3GEEA 4BE7B 3EXAA 3LRPA 4JLMA 2VSXA 2RGNA 5SZIA 3LBIA 5H70A 1KMHB 1NN1A 2X1VA 5AJZA 2ZI4A 1WP9A 1ZD8A 2R65A 4M1YA 1G16A 2KWIA 1XEXA 1EK0A 2R6GA 2WAYA 3HYTA 1JR3E 2D62A 3SJAA 1W0KA 1W1WA 4JT4A 3QG1A 1DPFA 4L15A 4LWZA 3RS2A 1G5TA 2Z4SA 4CEHA 3DOFA 4F4IA 3CF6R 2ZRBA 3FWYA 5FH9A 3SI7A 4ZKDA 1EFHA 1JR3A 3DDCA 2Z83A 5G3ZA 2FGJA 1I4DD 2EFHB 3IBGA 2W0SA 3NDBB 1Y3AA 3QF4A 2NZ8A 3LBHA 4LYAA 4NYJQ 5HTKA 3FMOB 5JRZA 5ELXA 3ZIAD 3B1ZA 4P0TA 2QSZA 3NVAA 5FFMA 1UBCA 3EG5A 2VTKA 4I1UA 3EC2A 4GP7A 2ZJBA 4G5RA 3MD0A 4LHVA 2GEDA 5FI1B 4LHXA 4TTPA 4HAWA 5H68A 2VF7A 5IRCD 4C0QC 1W2HA 2VHQA 4JLBA 1GWNA 4Q21A 1N6PA 4HUTA 5BN4A 2ZE8A 2VO1A 3KJGA 4A2QA 2CHGA 1W4AA 5DH9A 3MWKA 1DAHA 4GOXA 1KI4A 3DVLA 2CHQA 4DLVA 721PA 2QMOA 2ZAOA 1N6IA 4JMPA 4M9XA 3N70A 4KLNA 1NI3A 2QE7A 4A2WA 2RGDA 2ZPTX 3NWJA 2QY9A 3GEIA 3OHMA 2CL7X 2NO6A 1KJZA 4A6PA 1E79D 3K0AA 2BBTA 2G1JA 3KDSE 1E9BA 2YC4C 1XMJA 4G0NA 4DEXA 2QRNA 2DPXA 1XTSA 4EFMA 2P6NA 1XPRA 4Q02A 4LHYA 4I99A 4UXJA 1JPJA 4PX9A 2CCKA 2HYIC 1G18A 3F0TA 1NRJB 4LV8B 1GKIA 1TL7C 4A0RA 4R2IA 4AK9A 1HA3A 1G41A 3DMNA 4E22A 4WZBE 1QVRA 4P4UA 2VP9A 4TMVA 1H65A 2J7PD 3BXZA 3Q72A 2ATXA 4LBYA 1I4LD 4FIDA 3TSOA 1UPTA 2Q6TA 1N6KA 4Q1DA 2GAOA 2NIPA 4U5XA 1PVOA 2QTFA 2NO7A 4NMMA 3RRNA 4AWXA 4TSFD 1DARA 4KFTA 1FTSA 3ETLA 3C14C 4NCJA 4PAQA 1MT0A 4AC9A 2RGAA 5L3QA 221PA 4B71A 1G5PA 2H5EA 2XNDD 3VR3A 3CX6A 1P4SA 5FUXA 2WJJA 4QGHA 4FMBB 4HAZA 1G3MA 1S4QA 3VKGA 1CJUC 2HDNB 1Q1EA 3U7FB 4GOJA 3A1VA 4KVAA 4B43A 1OFTA 4M9QA 2Z0MA 3CX8A 3GJ0A 3KKPA 1SQ5A 2XOKD 3CR7A 1IN7A 1COWA 4BLSA 2REXB 4QL3A 2ODNA 2XSZD 4BFSA 1XTKA 4NCHA 3NBFA 1UBEA 4I1SA 1VHTA 5FUWA 5C2JB 1JQLB 3FFAA 3W6PA 3NC0C 4OQLA 1ZIOA 1P9RA 3FMPB 2ONJA 2RH5A 2QM7A 4XIGS 1YZLA 4ZV4A 4IJMA 1GAJA 4QJ4A 4NP6A 4Z51A 3SQWA 4AKHA 1XJ0A 4AIIA 3I92A 2IUUA 5KOYA 5BN3A 3D3QA 2CLSA 1VYVA 2WVJA 3B9PA 1Q12A 4R7ZA 1P2TA 3CRVA 3AVVA 3VHXA 4EPXA 2CNWD 3CRQA 5LPNA 2OILA 1WRBA 1NBME 4AURA 1XD2B 2IF2A 4DDWA 1W2GA 2GA8A 1OW3B 2BEJA 3B6EA 1HY3A 4H9GA 5FBVB 1NBMA 1KI6A 1E2DA 1GKUB 2V6JA 3I73A 1MV5A 1S8FA 4BLQA 3EIEA 1IOZA 4DVGA 1P6XA 1W0JA 5FUYA 3DKVA 2ZEJA 2A5GA 3P4XA 3L0SA 3LQRA 3BB3A 2WKPA 2R8RA 2CCGA 3VR4A 1KZGB 3KFVA 1UADA 2PH1A 4Q01A 2GEUA 4RFVA 5KPDA 3THXB 1VMAA 1P60A 3EZFA 3R20A 1BIFA 4RD1A 2QZ4A 3N2EA 2VA8A 1OF1A 4G1UC 4LZZA 4XWOA 5JEEA 4GMDA 2VH5R 1KAOA 1TQDA 1YZGA 2ASEA 2C95A 2KSQA 4DLRA 1DBSA 4DLTA 4IFBA 2IT1A 3AF0A 3AVXA 1B23P 1KKMA 3H0KA 4JVMA 2GCOA 2ZITA 3RRZA 2WJHA 4QFMA 2L0XA 5L3VA 2F1RA 1O3YA 4JVLA 1CR2A 4A0FA 1QHXA 3ZZTA 1R5OA 2XJ9A 5FR2A 3A8TA 3UPUA 3IPYA 3UG7A 4TYQA 1JR6A 4EPYA 4C7OB 521PA 3QI2A 1J70A 1QZXA 2WTUA 2OESA 4E09A 3T5DA 1F2TA 1E0SA 3THYB 5CJPA 2ZVPX 4M1WA 1P73A 3M0EA 4KI0A 4D0GA 5DSZA 5FUVA 4KV9A 3MJHA 4NU0A 3EX7C 4O2LA 4RD0A 3I72A 1Q3TA 4KVGA 2WM9B 3I4LA 2GCPA 4AG6A 1XFAA 2IS2A 5KO2A 4Q4JB 4BLRA 2CVHA 2GTPA 4HLQB 5UKDA 1ZC4A 3IHLA 3B1XA 3AP1A 3FOZA 2OO7A 3AB3A 5JSZA 4PSKA 2PZGA 2E87A 3KJHA 3CIOA 3FB4A 1AKEA 3GJ8A 2BBSA 1Z07A 2ZR0A 4YMWA 2LKCA 5HKKA 2V4ZA 4P32A 3T1QA 4XJXA 4R71A 2O8BB 5JFGA 2V7QD 3GJ3A 5J47A 1W47A 1W46A 3CF2A 3EZ9A 4DB4A 4LV5B 4BRWA 3THWB 3CB4A 5FPYA 2QN6A 1OYYA 3FVQA 3U44A 1G5RA 4TYNA 4E07A 4QBIA 1HT1E 2X19A 4EFNA 1G4AE 2QORA 2NQ2C 1KO7A 3S1AB 4PQFA 4PANA 4MUBA 4IDOA 2BJWA 5JS7A 2ZSBA 3C5CA 5AUQA 4DT1B 1C9KA 3MWLA 2WIAA 2ZJ2A 3HU2A 4E03A 2BDTA 4Q4LA 1NIJA 4JBYA 3TQFA 3TUZC 3AV0B 1D8TA 4O25A 3QIAA 2CE2X 1YRBA 3SFVA 2FA9A 2W0MA 2QBYA 1RJ9A 1ZUNB 4IW3B 5FBLB 4EKDA 4QM6A 1CXZA 3DKPA 2AD5A 4TL9A 2FEOA 4XWKA 2MMGA 1GM5A 2XZPA 2CK3D 2IWHA 4B34A 1ZCBA 1OB2A 2GCNA 5HZHA 1UKEA 1E99A 5FOVA 2RHDA 1SVLA 1E1QA 3BIFA 1A2BA 2ZJZA 4I81A 5A4JA 4ZDKA 3NKVA 1SVIA 1Z0JA 2FSHA 2GK7A 4V0NA 3CBQA 3QXXA 3RAPR 1AQUA 5CK5A 1TU3A 1E0JA 2CDNA 4TWZA 1XX6A 4CEJA 4WZ6A 3C8UA 3PR1A 4TZ0A 3WNBA 2W6IA 2PCJA 3KB2A 3B1VA 2B6HA 4CYMA 4IOKA 1OHHA 1JXMA 2AK3A 2QP3A 2FFHA 2J1LA 3P20A 1US8B 1E32A 2E9SA 2MSDB 4W5WA 1KO5A 3RYTC 4QKQA 4M1TA 2X77A 1XDBA 4FI3C 3RWOA 2GJ8A 4IOJA 3R8CA 2ZSAA 1ZBDA 2ZM5A 4LC0A 4BEJA 1LY1A 3OEHD 4LRWA 2IYYA 2FH5B 4UXHA 4EAQA 4EPTA 4A4DA 3OIWA 4ASUA 2ZRFA 4PPQA 3L0IB 1Z0FA 3VAAA 4B76A 1U8YA 4HB2A 2J87A 2JLZA 1KMQA 2P5TB 1W4BA 2VHUA 5C1BA 4F92B 3Q3JB 8OHMA 2VHCA 4TMXA 5SZKB 4U7DA 3PFIA 3KKMA 4IRUB 5E7MA 2XAUA 4DLSA 1YHNA 4H1VA 5C4GB 3ADKA 2YHSA 3LX8A 3KTAA 3AEZA 5JJKA 5F9FA 3RDPA 4Y0VA 3SNHA 5D3MB 3THOA 2CJWA 3E70C 4UQOA 3L8YA 1W4RA 1EFTA 1GL7A 2RGCA 2C5LA 4D4JA 3V4RA 1W0KD 4D6PA 1AJEA 4HLUC 2QAGB 4X8HA 1P5ZB 4ITRC 1X8JA 4G01B 1W5TA 2BMFA 2D74A 4PO8A 4LJ9A 2DFKB 2ZUDA 3SJBA 4C0LA 5BXQC 1JR3D 5J4LA 2IW3A 3K70D 3ZS8A 1PLLA 4EPWA 5L3SA 1G7SA 3AVUA 2JASA 4V03A 1DVRA 4JLOA 5J4KA 1EWQA 2I1VB 1SVMA 1IXRC 2YWHA 3CPHA 2PZEA 3LXRA 4ARZB 1DAMA 1CBUA 2D2EA 4NKRA 4NYJR 3PUVA 4N0EA 4CEIB 3TNFA 2O8FA 4RFSA 1IN4A 5DHAA 1BMFA 3BB4A 1N25A 2A5DA 4NYIQ 2Q9AA 1N5LA 2A2ZA 2DR3A 2IYZA 3I8XA 2OBNA 1ZD9A 3BH0A 1YE8A 4KFSA 2XZOA 4DUGA 2PT7A 2OAQ1 1G3UA 4AYWA 2PJRA 1ZMXA 3UIEA 1S96A 2J3EA 2VYFA 3LNCA 2QE7D 1F6BA 3K0FA 5KNCA 1KJYA 3BD9A 1F48A 3BORA 4OQFA 1Z83A 2CE7A 2JDIA 5G40A 2OE2A 3BB1A 3FGNA 4OHZA 1JECA 1YVDA 3AVOA 3IDQA 1E0KA 3MLEA 4WXRA 3O47A 3RABA 4IDNA 3NH9A 5EJEA 1OSNA 4MITA 2LKDA 4XTCS 1T91A 4GSYA 2XB2A 1DADA 4G3XA 4A92A 1MO4A 2G88A 1QBKC 4DBLC 5JWRA 5CYOA 1AKYA 1P2VA 2FV8A 2QPAA 3TRFA 1HTWA 2ODWA 1LS6A 4V0OA 4HLCA 1UEJA 3A36A 2V6IA 2KI5A 5BW8A 3K09C 4WA7A 3IEVA 1GDDA 1XNJA 4TL7A 2XTMA 3W8NA 1JB1A 2F9LA 2JATA 2C77A 2QMHA 3U2QA 4MKHA 2IX3A 1ZM7A 3FPAA 5TVKA 5G53C 4TYYA 1R5BA 3P1JA 2H7VA 4M2LA 1AIPA 3K0AB 4IEEA 1XJQA 4ZCMA 1L4YA 2A5YB 2ZRAA 4GRAA 3QJYA 4PAOA 4ZIRA 1EX7A 3U3OA 1ZNYA 2GF0A 3B5JA 4MYCA 1M7GA 1T6NA 2BOVA 3L43A 4K8OA 3WP0A 1WA5A 1GNRA 2XJ4A 3B13B 2AX4A 3N5CA 3W9YA 4JLPA 4C0KA 3QEOA 3R7WA 1DE0A 1N6LA 5H8WA 1KSGA 1ZNZA 4TLDA 4MA4A 5DI9A 3V4FA 5FTMA 4Q5IA 1RFLA 1R0YA 1E96A 2A5FA 2QAGC 4NHOA 3LXXA 5AJVB 4B33A 2QMUA 2WWXA 4MDFA 1H8HA 2GHIA 2NZJA 1G9XA 4Q00A 2IWRA 3ZS9A 3E2IA 2BMJA 2RCNA 2BMEA 4RZUA 2KBEA 2D2FA 3FYHA 3NXSA 3LAWA 3TAUA 4Q7JB 1XPUA 2VSOA 3L0OA 4JJKA 2IK8A 1DAKA 3EIQA 4UJ3A 2P65A 3SHWA 1CJKC 1L2TA 3BOSA 1NN0A 1GILA 2FN4A 3KXLA 4PSAA 1JALA 4LDJA 3SYKA 3AVTA 1NY6A 1E2LA 4BLTA 2GZDA 4XSGA 2QPTA 1AS2A 3OESA 1F5NA 2D4HA 4IDPA 3CX7A 4KSCA 5DLQC 4O2RA 1F2UA 4PC7A 2JLSA 2EWVA 4Q7MB 3TIFA 4A8JB 3X1ZA 4Q4HA 2WAXA 1XEWY 3SDZA 4KBFA 4EDHA 1S2MA 1N6HA 1E2QA 3M1IA 2GVDC 1NBMD 3QSYA 4US2R 2G0TA 1T9HA 1KO4A 1YZTA 2QQEA 2O8EA 4XVUA 4LYJA 1W0JD 3WHKA 3VQTA 4PPFA 3Q8XB 1ONBA 4URXR 4OQXA 5KSOA 3ZQJA 4XVQA 1GFIA 1KO1A 4JLVA 1Z29A 1SKYB 2PX3A 4ZCLA 2C96A 4QJ5A 5P21A 4RD6A 3TUJC 1TTTA 4GI7A 1JJ7A 1NP6A 1G21E 3KKQA 1ZUHA 5FOUA 3PUXA 1SVKA 3QPVA 5G3YA 3TGPA 1W49A 1E0AA 1NLFA 3FE2A 3FHOA 1XZPA 2AWNA 3QNUA 2QT0A 2JA1A 3X1WA 3EPJA 3A1UA 4RZXA 3QKSB 2RAPA 1K5GA 3I1FA 3GFOA 5FOSA 1KI9A 1P3JA 2ATVA 5EE1A 3AUXA 3BH7A 4BECA 2OM2A 1HT2E 4LJ4A 2PLFA 1D9ZA 2QNRA 2OHFA 3OZXA 2C2HA 3QG5A 2J0VA 2PBRA 4EPRA 3RHFA 3CRRA 3CWZA 1U0JA 4TT3A 1YQTA 2A5JA 4UNSA 3GLGE 3I62A 2VF8A 3UANA 3G0HA 2O52A 3IUYA 3TJZA 1OT3A 1X8LA 4JLJA 2NO0A 3GLGA 4IKEA 4NCIA 2AHOA 2OLJA 3RANA 4Q4AA 4NPHA 4XH9B 1JAHA 2CEAA 2F7SA 2ZRCA 3IO5A 4D26A 2GCOB 1II0A 2GBLC 1SXJA 1FP6A 4UKDA 1CF4A 2BJVA 1K6MA 3NIBA 5CK4A 2EVWX 5TB5A 1TQ2A 1NG1A 1E9FA 1W36D 4BUJA 3PCRB 5CDFA 3ZDQA 3GJXC 2ZRDA 2ZS7A 4GT1A 4PHGA 2Q3MA 4UNRA 2JEOA 1XTQA 4MKFA 1SULA 1VHLA 1NNEA 5E95A 1IJFA 1KSJA 5C46F 1XZQA 3TBKA 2O8DB 5GVRA 1EG7A 3ZZ0A 4YONB 3VU9B 4DC9A 4TYWA 2WWIA 2J0UA 2YVUA 3KX2A 2ZJAA 2H92A 1XMVA 4KSBA 4A8JC 5HKKD 1ZM4A 2FPKA 4PHHA 2HF8A 1CR1A 2WOOA 1Z0IA 3HR8A 2CBZA 2DYKA 1HE1C 2XTZA 1X6VA 3TKLA 2P6RA 4OI0A 1MO6A 5DI3A 3LY5A 1P9NA 2N46A 4WIAA 1W36B 1E6CA 3FDIA 1JAIA 4URUR 4DCVA 2J0SA 4MGKR 3WMGA 5FPSA 3TUIC 2JLWA 1GTVA 2A9KA 4P4SA 5CIWA 2O8CB 3MAAC 4Z8XA 2FMXA 3CW2A 3WHLA 4ZKEA 1KI8A 3HYRA 1GUAA 2BMDA 5JSZB 4JLNA 3I5YA 5FTNA 1UBGA 2AD1A 2IC5A 3QUSA 2HLDA 4URZR 2IYQA 2ANBA 4TL8A 3EA0A 4V0LA 3ZH9B 4LOAA 3T34A 4BFUA 5CIQA 5AK0A 2WWYA 1NMZA 2FU5C 4POAA 2FPLA 4EJSA 2ZI9A 1Q0UA 3CPJB 1AQYA 2KJQA 1KZ7B 2YKGA 1KYIA 1E1QD 4II7A 5AUPB 4Q19A 1XTIA 3AVQA 2ZI6A 3K0CC 1N0VC 1LNZA 2QGNA 4CT5A 2OCYC 1WQ1R 2ANCA 4TQAA 1Z6YA 5TY0A 1OE0A 2WKQA 1G8YA 3A4LA 4IXMA 3GFTA 5EE3A 3PEWA 2RGEA 3AVPA 4LUCA 5IDVA 2ZJ8A 3BGWA 2P2LA 3B78A 3LV8A 2IF0A 3MUFA 1YR6A 3GD7A 4HUQA 2W6ID 2QM8A 3C7KA 2EU8A 3U3RA 3FHTA 1WF3A 2C8VA 2ODBA 3BAFA 4OQMA 3GLIB 4RKFA 1OHHD 2DBYA 4M53A 3QKTA 3JZAA 4A6XA 2IL1A 1D2NA 4BFXA 5CLLA 4BLOA 1IBRA 3CNLA 4GOKA 1U9IA 1XXHB 4M21A 4TMWA 4Q9LA 2GVZC 2W2VA 4ESHA 4RD3A 4M1OA 3WRYC 2IYSA 3Q5DA 4ASUD 1CULC 4HAXA 5EXXA 1OKKA 3EZ7A 2F43A 5B57C 1CRQA 1QHHB 2G77B 4PQYA 4Q18A 1ZRHA 4Q9JA 1KI1A 1Q21A 5H1YA 1TU4A 5LD2B 3MWJA 4OQNA 4DIDA 2P67A 4Z1MA 5GJBA 1ODFA 4JVSB 5B58C 3GJ5A 3VR6A 1Q1BA 3CO5A 2EFGA 2DFTA 1YJ5A 3ASZA 2OEPA 1E2NA 4Q1EA 3RRMA 3IIJA 1NSTA 1CJVC 2AXNA 4ESVA 4YMVA 1F3OA 2WSSA 3MRSA 1LS1A 2NTYC 4K81B 3SBDA 1Q3HA 2Z43A 3F5FA 3T06B 4GZMA 3K0SA 1T5LA 3QKRB 4PQRA 2QP9X 3IEUA 4WVFA 4IVPA 3RC3A 4DCNA 1S9HA 4EUNA 3RVBA 1T3LA 1BMFD 1KY2A 1LTQA 1GRNA 2ZUCA 2ZREA 2CJWB 1E9RA 2FFQA 3HP1A 3NHAA 1A2KC 2CL6X 5GVSA 4F4JA 2XXAA 5DO9A 2D06A 3CKLA 4TQUS 4DUGD 2OSBA 3VFDA 1G20E 1S3SA 4LC1A 4DEYA 4TLCA 4NYIR 2WHXA 4YMUA 2PMKA 4PC3A 3IO3A 4C2TA 4B35A 2NO9A 2FX3A 3UG6A 3UKDA 1RYFA 4C0JA 3O8CA 2IYXA 2JDID 2XB4A 4LI0A 2IEZA 2WMOB 1Z2AA 1FUKA 3SR0A 1XPOA 1Z8FA 5JWHA 5FBRB 2AWOA 2ONKA 3SC3A 1PZNA 1ZNWA 1AM4D 2X2FA 2C78A 3M4YA 3I61A 4AKGA 5KTYA 4BFYA 2ZJOA 1QHSA 3LQQA 5F98A 1XCGB 2K5UA 3LVRE 4KYUA 5TMPA 3FTQA 3I3SR 1LV7A 3HU3A 3A37A 1U94A 2DB3A 2G0NA 3UXMA 1J8YF 2ZRIA 2FG5A 5E4FA 1GKYA 3EA5A 2HUPA 5AR1A 1KIMA 5JI3E 1G8GA 2PX0A 3PUWA 2ORVA 1GZSA 1E1RA 3BWDD 2W2XA 1OXUA 2QA5A 4F4CA 5EXSA 1ZYUA 3CF0A 1UKVY 3NTUA 4ZCIA 1OV4A 2QRZA 1ETUA 1XJCA 3AKEA 1KAGA 1NVVQ 2ZSDA 4DDVA 1NLZA 3G5UA 5JCZA 1MRNA 2NPIA 3EZ2A 3GLHE 3QY0A 3FKSA 4IEIA 4LJ7A 3AVWA 1GNQA 1M6NA 1TUEA 4PPGA 5LD2C 2QMEA 3E1SA 1WBDA 1Z0KA 4OJKA 1R0WA 2IUSA 1II8A 1XWIA 2G3YA 2GJSA 4D0LB 1MABB 1IXZA 3GLHA 3RLFA 1M2OB 1FW6A 1ZAKA 4BWYA 4BFWA 2PT5A 4M1SA 3BJIC 2WKRA 3E5HA 1HE8B 4LY6A 2ZR7A 2ZRLA 3TK1A 4ZI2A 3CUEF 2P5SA 1TEXA 1H8HD 2OCAA 1OYWA 4FCWA 1QHNA 4BZXA 3MMPA 4K46A 1KMHA 4XSHA 1AN0A 2HT1A 1QRAA 3GFPA 4BZPA 1IY2A 1G8PA 3LO5A 1BOFA 4TLEA 1N2CE 4Q9HA 1M7HA 2ERXA 4HB3A 2A3RA 5TDHA 3O8DA 3R9WA 4DB2A 5C4MA 5JJLA 2OXCA 5M04A 3RS5A 4TZ6A 4LCBA 1HYQA 1P2SA 2NO1A 4JVNA 3DZDA 1G7TA 3GLFB 2WWGA 3L82B 2ZE7A 1OIXA 2Z4RA 4CGZA 4JBWA 2EW1A 3D7MA 4PHTA 4US0R 4HDQB 1HURA 3PEVA 1E9DA 2HF9A 1ZIPA 4CT4B 1T0JB 1WXQA 2WWFA 3LX5A 4Q9KA 1KY3A 2YINC 2IS4A 4PO1A 1ZJ6A 1DO0A 2V3CC 3PQCA 4MUAA 1VIYA 1EGAA 4RSGA 3KQUA 3TSWA 1AGRA 2VHJA 5KSPA 2EFDB 3R8FA 2XGJA 1RRGA 1L4UA 4BPBA 4C4PA 3O8RA 2QAJA 1Z6AA 4WW0A 3F8TA 4DHEA 4KODA 1FOEB 1IJEA 1CRPA 2AFIE 1VECA 4R98A 3U7EB 3P4YA 3PV0A 4TL6A 4M1KA 4Q4HB 1ZUIA 1OLOA 2HV8A 2QI9C 4Q47A 4D4LA 1X86B 1K5DA 1WBBA 4FCTA 2CVFA 2P0EA 3ICEA 1U98A 4AYXA 2GDJA 4NONA 1VTKA 3ECCA 1TF5A 5K8UA 2O8EB 3RC8A 421PA 1QHIA 5DYGA 1YKSA 1LB1B 3KFXA 2C9YA 1KK1A 3QPUA 4CW7A 4GDFA 3MJRA 1TADA 4GP6A 4TT3D 3P27A 2WZQA 3T35A 2HT6A 4V02A 1ZVQA 3C4JA 3EC1A 1HEIA 3CNNA 1OFUX 2BC9A 2VIIA 2J45A 3MCAA 1BKDR 2F3TA 1F60A 4M0LA 4Q7LA 3EPLA 2F1JA 3KL4A 1G6OA 4L4UA 3U4QB 1NG9A 2PCLA 4D25A 2LCFA 2WJIA 2CLCX 2IYRA 1SXJD 1Z2CA 3QQ5A 3OEEA 4AKEA 4UNPA 3REGA 3W5JA 2F3RA 1U8ZA 3RSLA 1D2EA 5EUMA 1RPZA 1Z0AA 2B8TA 1ZC3A 2OFWA 4KITB 1XCPA 2WJYA 3NH6A 1WB9A 1AS0A 3EWSA 1R7RA 4OK3A 1Z6GA 2WOJA 2GZHA 4JJZA 2D7CA 3QENA 4WOPA 4EQ6A 1VIAA 5JJIA 2UZIR 3ADBA 5IK2A 2F9MA 4CVNA 3VR5A 3K9LA 1CEEA 3NHBA 4QJ3A 1M1YE 3TVTA 3QBTA 2ZU0C 2B7CA 2QROA 5DHFA 4C3ZA 3PUYA 5LB4A 1ANKA 1VDZA 2N1BA 2YOHA 1EFUA 4QG7A 3ZLJA 4C0BA 1PLJA 2PZFA 2ZRJA 4F7WA 1SXJB 2OUKA 2ZRHA 2ZTSA 1R8QA 4ABYA 1U90A 1OPXA 4DLWA 4DCSA 1NKSA 1VPLA 1ZW6A 3WRXC 5EUQB 4FN5A 3WNCA 1NIPA 1N6RA 1IONA 4JSTA 1ZCAA 2BBOA 2R2AA 3I8SA 4YQFA 4HZUB 2HYDA 3MG9A 4C0HA 4W5JA 1YZUA 4LYFA 1RE0A 2RHMA 4FMDF 2BCGY 3SYNA 3UMFA 5KNBA 4HLDA 3AKYA 3Q7QA 3QXHA 4B32A 2EYUA 3SJCA 3L0PA 4BZQA 1AA9A 5HZKA 1T5IA 2YOGA 3KXKA 1ZP6A 3Q7PA 1SKQA 5JEDA 3EAQA 4AYTA 2HLDD 2C04A 2VBCA 4LJAA 1QHGA 1XEXB 5DIFA 2NPFA 1TX4B 4YC7A 4FXPA 3THXA 1UJ2A 1G8FA 1J90A 2QGZA 4CEHB 4ACBA 2QSYA 3MFYA 1DAGA 1K8RA 3W8RA 3CR8A 1ZM3A 4QGGA 1Z08A 3RS4A 2A78A 3K70B 3ZJYA 4XVRA 3RSOA 2YJTD 5KYKA 2IUTA 2R6FA 1IN6A 3V00A 3QF4B 3CPEA 1GITA 3OFNA 1KNQA 1R6BX 2JLVA 3A1WA 1NMXA 4QBGB 3WMFA 5GJWC 2KE5A 3GQBA 1XEWX 3OIUA 1G7CA 1OH7A 1XRJA 1HUQA 4HAVA 4PO9A 1E2HA 5HCIA 1SVOA 3BE4A 4B2PA 4TMZA 1R5NA 1IY1A 2Y8EA 4PHFA 2IEYA 3KQKA 2IS1A 4X8OA 1N5IA 4ZDIA 1Y63A 3AKDA 3H86A 5TV2A 3RS3A 4C7OA 4C0AC 3SS8A 1DG1G 4EIWA 1E69A 4MGZR 4EJSB 2IYWA 2WPDA 3THYA 2JJ1A 4HDOB 2ZI3A 2H8KA 2J46A 3N2IA 2V1XA 3OE7A 2YWEA 4B3XA 4UXIA 4PAMA 3W6OA 2NMVA 1CP2A 3A58B 2FZLA 3VHLB 2NG1A 4Q7KA 4KFRA 2ZYTX 5LDDC 3QPWA 3U3MA 1WCV1 1RYHA 1S3GA 5CITA 2V1UA 1E4VA 4JL5A 4XTRA 4S2EA 1A7JA 2CLDX 3BFXA 4LJ5A 2OZEA 2WSMA 4NL4H 1OKKD 4M1MA 3FFBA 5B2ZA 5SZHB 3DOEA 2I4IA 4DLUA 2IYTA 2LWIA 3VNVA 3CH4B 2SHKA 4Q4JA 1N6NA 2ZAMA 3DM9B 3LFUA 5JLJA 1TQ4A 1CR4A 2BM1A 3H2YA 2GKSA 3LH5A 3U3KA 4DKXA 1OH6A 1G3QA 3MGCA 1QHYA 2DWOA 4NE2A 1COWD 3CONA 4Z1MD 3AVYA 1E98A 2OBMA 3AGQA 4JYBA 2QENA 3K0EA 3K1JA 3SJZA 2RGBA 5F2EA 3BERA 1VCIA 1U81A 2ZJ5A 1A82A 2VPPA 1DAFA 2QTVB 3VR2A 2O8BA 1P7CA
chains in the Genus database with same CATH superfamily
1GPLA 1UC5B 1GQYA 1YKFA 1BS9A 1PJRA 4WAUA 1GNSA 3D4LA 4NZYA 3W3ZB 4AWBA 5CLJA 5L3QB 2PUEA 1E3WA 1Q83A 5U4QA 5K8TA 1Z74A 4BNYA 1HZZC 4MTCA 5AKJA 1E3IA 3C8HA 3PDJA 3RAFC 1QC5B 5EQTA 2IU3A 2C9DA 3HEAA 2QTNA 3NANA 1NOJA 2VJPA 4G2NA 3L7CA 2PYIA 2AF3C 4O8ZA 3H0CA 4KACA 5E2BA 3FR7A 2GEJA 1O0BA 4QFBA 3QVWA 3CZMA 3I2JA 4MPDA 5BMVB 3MTIA 4K3VA 2AKAB 4WLVA 2Q49A 2QPOA 4X63A 3ZWAA 4PAWA 5FCDA 4DT1A 5BOSA 2HWWA 1VYTA 2C3OA 3LT0A 4K9NA 1BJRE 3GCXA 3HGMA 2XZTA 5AVYA 1N5KA 1U3FA 2H57A 3CF4G 4DV7B 3D54D 3GDWA 2OQIA 1SD2A 4MRNA 4WCDA 5DBHX 3JALA 4S05A 1QOPB 1RAEA 4OQZA 5FTJA 4DSAA 2FWRA 2BEKA 2OHVA 1WV0A 1CS0B 4QNMA 5KWVA 4I4TF 1ZUNA 3W6NA 5HZGA 3LBNA 1K4KA 4QVIA 4LJ6A 4XM2A 4X90A 1PEYA 1E2JA 2ZBQA 4FMDB 4OFZA 1L5LA 3CM0A 3CZQA 1TF2A 1TCVA 2TS1A 3OJCA 3OOYA 5E6SA 4DDMA 4IGFA 4Y2RA 5K0CA 3HLTA 3NRBA 2QLFA 1H8EA 2WSBA 4QECA 3NOOA 3PU6A 4DNQA 5JQWA 2Z3WA 1DPGA 2ZK7A 4WBSA 2OD7A 3VO1A 4KMRA 3OO0A 5AUNB 5J4HA 1M1ZA 2OCBA 1M73E 4BV8A 3VMFA 1E4YA 1K66A 3WLKX 3GCGA 4L9RA 3VNAA 3V3KA 7GPBA 3GXOA 1PD0A 2IZOA 2VBFA 1TJ3A 2HZBA 4MYUA 3X2SA 4KV7A 1BVYF 3CCBA 4KK4A 4RVNA 4Z3DA 3TE6A 4CKEA 2PQ6A 4I1PA 3NHKA 4WKCA 2NUTA 3WKAA 4M22A 4LJKA 2H31A 4DSZA 4KR9A 2B1GA 1V8PA 1RCUA 2BZ0A 2G1KA 3CMMA 4K6KA 2J3LA 4KLRA 4FUQA 5CYFA 4BO4A 3ZDFA 5IAOA 1J56A 1RQ2A 2IYEA 3F78A 5CM8B 2JJ8A 2P4QA 1UFQA 4I1VA 2X7XA 3GEDA 4IGAA 5EJFA 5BQ3A 5JD6A 4BKPA 1YDWA 2H51A 3K0BA 1SUWA 4EJ0A 5A62A 3N53A 4J0QA 3MJSA 2BM0A 1IFXA 2COKA 4UBMA 5HJEA 4YQEA 1UJNA 1D1PA 2OYCA 4DLNA 3VYUB 5THXA 1ZMRA 1EDBA 3IC5A 4BEVA 4MTLA 5K0BA 3ZVLA 2HPVA 3MCWA 1U8EA 4RK0A 1SIWA 3UHOA 3EBOA 3U40A 4ZJUA 4RKEA 1BXZA 1PHPA 2O2CA 1T6BY 1GQ2A 3M6VA 1U0LA 2ZSFA 4J49A 3GUZA 2X8LA 2ZBDA 4B48A 4NPAA 4XUCA 4YRIA 1DAEA 1C1XB 2VS1A 4HG2A 4MCJA 3F3YA 1SU6A 5DNVA 3P9XA 4ZAVA 1E1CB 3CY6A 1NXTA 1V47A 1ADYA 2FFBA 1QG4A 3EE6A 2C9BA 1C3XA 1VYUA 4MYRA 3KUCA 4URHA 5G41A 1WETA 1VCOA 2FJPA 1JHZA 1FQJA 5CEEA 2BIFA 3JWJA 3KVVA 2ZYAA 4ARVA 4F2HA 2PUTA 4J7XA 2XIJA 4LYHA 5HIIA 2C7BA 2IQ5A 2HMWA 2Y3IA 4K6MA 4C9BA 5D6NA 2NV2B 1NTOA 4Q3BA 4IHQA 2W37A 1J2JA 3TIVA 1WL8A 4KWTA 2BHLA 5AVUA 1MQ9A 3P2EA 5JVDF 4HDNA 3LZ6A 1OYOA 4LISA 2IIBA 1CJSA 1MG0A 4DCMA 2ZDQA 4WOJA 1P1IA 3K35A 1Z75A 4FEYA 2BGMA 1QKJA 2AL7A 3AUKA 2VRCA 4B5KA 5CB4A 2G4VA 4IWYA 5A4IS 3P96A 4KFUA 4BP1A 3RYCB 4S24A 3IOEA 5IMBA 1N6OA 4CEIA 1JEEA 4RKWA 4ZRNA 3HN6A 1MNAA 1NFFA 1M8PA 4CHGA 3OY7A 2RK4A 1M6HA 2FMFA 2OV6A 3OT1B 3RYIB 3SBEA 3UOGA 3LO8A 3PC3A 4PPNA 4WGGA 3ZDEA 3BRSA 5EQJB 1NMYA 2PUCA 3PBKA 4F3KA 3WDMA 2MHCA 4CV3A 4LNAA 1U2QA 4BO9A 7MHTA 1WDTA 1SXHA 2QTRA 4KAJA 4ZARA 3UUWA 2ZAGA 5I51A 1G6KA 3AM1A 2L19A 3GUVA 3NBMA 1B76A 5IH7A 4Q3OA 4YR7A 1SHJA 3LE8A 4D02A 4CIDA 4J1QA 5HR5A 1AUVA 4MP6A 4I5IA 4FP9A 2HIGA 2QL6A 4KQ2A 4DJFC 2C5FA 2XNHA 5JRJA 3OWHA 4ROSA 1GGFA 1AX9A 4UVDA 4BQOA 5IARA 1I51A 1H3NA 2FEPA 2FPPA 2QVZX 3GPIA 3HACA 4FN4A 4Q0MA 3T5MA 1XZFA 5FUQA 3CVXA 1Q17A 5TQVA 4P7JA 1OXXK 3N2NA 4Z2AA 3RJMA 4HI0E 4RZIA 3HDTA 3HRKA 4BO7A 5DHTA 2VJMB 4CETA 5AVXA 1TYEB 3SHFA 2V7TA 2AGVA 3DYIA 3DBOB 3IUBA 1A0OA 1Z6XA 5KNDA 5BW4A 4B40A 2O05A 2W6JA 2NU9B 1FQKA 1QUFA 1PFWA 5HK9A 3PNYA 4AT1A 3ZCQA 3QLUA 4EOGA 3B1JA 1CS4C 2ZOSA 4M60A 5HQJA 5BURA 2VP5A 1O5IA 4A6DA 1G3RA 2LIVA 4BGDA 1H4QA 1E6WA 5LC1A 3ER8A 4HPJB 1WCXA 4Q24A 1RQGA 4E6PA 2A0XA 1XEFA 2ORWA 4BL5A 4EW1A 2WYWA 2ZS9A 4LF4B 1P72A 3AP3A 1PQUA 4IH9A 5CVEA 4YV1A 4JNCA 2EOAA 3VH4A 2ZS8A 1EIZA 3BFKA 2WABA 5CB6A 1T0HB 3Q2KA 4JFAA 5FBQB 3ID6C 1HE5A 2GARA 2VHYA 3ITNA 1JR4A 1KU6A 1EGMB 3D3NA 3OPVA 4QAJA 4URWR 2E1RA 3K9BA 3AP2A 1FJXA 4EB0A 5LNK6 2A7QA 5EIFA 2D1FA 4NXMB 4OP1A 5LVAA 2X6TA 3HXQA 2AR0A 5J4YA 1TM2A 1YONA 5J2UB 3H4VA 4PX3A 3CUKA 1QGYA 2NXCA 5A3SA 3MGGA 1TAGA 4GX5A 5AQ1A 1FU4A 2PL3A 2ZE5A 5FADA 3ZNNA 2GFQA 2JFYA 4G5QA 4UE3S 3T1TA 2GBLA 3SNKA 1T4BA 4YV2A 3OTIA 3TCNA 4PC2A 3T6KA 4LQLA 3VH2A 4CM6A 1E63A 1V41E 3U16A 5JSKA 1IWOA 3EISA 3VH1A 5CG2A 1H1LB 4IIJB 3UENA 1C4XA 4TYMA 5GIPE 2BGKA 2PANA 1M74A 3OJOA 1FE8A 5AM3A 5EE5B 4H1WA 3DLHA 1OIWA 1OPRA 1W36C 3DZKA 2PUDA 1UOOA 1QH8A 1U7WA 2EF0A 4MUXA 4LRTB 3I0MA 4HX9A 4DYVA 3T7KA 4V0SA 1BYUA 2H5LA 1X7YA 2VJAA 3MGAA 1NY5A 3CJTA 1ZNXA 2KW5A 2VTVA 3NBAA 4UOEA 1VE9A 2QP4A 421PA 1TVEA 1Z34A 4DSUA 3G5TA 3L1HA 1QK3A 3F2VA 2CUNA 3DEAA 5BP7A 2OV4A 1PGJA 3Q3GE 2GLXA 4NE9A 4Y6PA 1QGUB 1KVUA 2RJ3A 4DZRA 3HDGA 2Z58A 3PGXA 4TQ9A 4B4UA 1ENOA 5KU7A 1V2GA 1MD9A 2OZVA 2XQVA 2QUBA 6PFKA 4PINA 5LYJB 3OEWA 3TH5A 5DN6A 5A3QA 3F6EX 1GGVA 2ZJ3A 2RH9B 3ENVA 1P0QA 4EMSA 5DCLA 4PZDA 3CRNA 4TT8A 5HOQA 4JLAA 4R8VA 3HYNA 1RM0A 4G1MB 4MJXA 5IXJA 2RHGB 2RHWA 5HE9A 2QTWB 3QX3A 1QF6A 5FD8A 5C31A 3REFA 5MN4A 4R31A 1QDEA 1YS4A 2XNSA 4M1ZA 1XRSB 3D3WA 3AOEA 4PR0A 2BFEA 4QNRA 5BRJA 2FEXA 2NNLD 2VJNA 3QEMA 4H16A 1CLUA 3T5GA 3LUHA 3JQGA 1JTVA 3MTJA 1E7MA 4X8LA 2ZG6A 3OQBA 4JLDA 4E30A 4L6AA 1Z4LA 3QKSA 1EZZA 1X7WA 4GPIB 3PQEA 1PG2A 3MT0A 4X8MA 5HKOA 1L7MA 1E5TA 4ED9A 2ADOA 3AONB 4RGYA 3N0RA 2YJNA 4ZQBA 5CA0A 3GT4A 1MQ8B 1DG9A 4OL0A 5BWCA 4U6QA 1QJ4A 2RGYA 3TTXA 3WE7A 1GA6A 4PZZA 3UQYS 2Q3CA 4F8YA 3I58A 1JPUA 3TQCA 2CLKB 3H65A 5ES4B 1KI3A 4M0MA 5KKCA 5COAA 2GNOA 1GZ4A 1TFUA 5CR9A 4EA6A 4FONA 3R6GA 1CRWG 3M81A 3P94A 4PZCA 1UAGA 5AKKA 5CVJA 4AJHA 2QR5A 4F6RB 4EG4A 1F2DA 2Q6KA 3IL2A 2BKUA 4I9NA 4D43A 5KHOC 2PY6A 4FMCB 1O87A 1U9ZA 1FF9A 2EDCA 5K8IA 5L40A 3OD1A 4M9RA 2O5RA 4QYIB 4CBVA 5J43A 3UFXB 1VG8A 3G82C 4TTAA 3URKA 2X5XA 5AH0A 2VYNA 1JEQA 4RUKA 4B74A 3H11A 4RAOA 1GKKA 2O07A 5IYZB 4DF3A 4LI3X 1F20A 2F2TA 1LWOA 2XQJA 1TKRA 4HVLA 5AKGA 3BA6A 1HDZA 2C9CA 4KRXA 1HLGA 3CSSA 3KS9A 4Z0TA 5L45A 5ALEA 1WLSA 3CNOA 2R4QA 5FA5A 1MHPA 3PD0A 4OG2A 4QQ8A 2AVNA 3R9KA 4JYPA 2G7ZA 1XN4A 4M0UA 1GV1A 2VQDA 5ER9A 4BUZA 5HVNA 4ZPJA 4AMVA 1VI5A 3G1TA 3W8DA 2QX6A 4LBVA 4DSNA 3C3EA 2WTEA 2HK9A 3NEJA 2L2QA 1IN8A 4HDSA 4JXJA 4KH0A 5FTLA 4GX2A 3UJ7A 1U4SA 3MS2A 5HQ3A 1XGKA 3NWPA 4H7JA 1P45A 4EHFA 5IJ9A 3OU2A 4Y9UA 4DQ0A 1EVYA 3A9WA 2O8DA 3QMMA 2J9GA 3SC2B 2Q3FA 4XLTA 1LKZA 4C6TA 2IRWA 4G4GA 4EP1A 1PD1A 3O1HB 3VR2D 2FFAA 3P71T 2QTHA 3Q7IA 5JDCA 1J5EB 1LLQA 4JUFA 1DS6A 4RK5A 3D6AA 3JWEA 2G9QA 4AJOA 2NUPA 3I2HA 2R6DA 5TQJA 4ZIRB 4BKQA 3H9BA 1KDOA 3E8XA 1NYRA 3AQ4A 4ZZ1A 3KQTA 3DDNA 5D3QA 4JKIA 2NVUA 1I4OA 4EZEA 4PCLA 2HCJB 1EFKA 4E2XA 3BILA 1N9GA 4QZVA 4QHYA 4N9QA 2HEGA 4PZ0A 2EX1A 5CNMA 2YV3A 5LMNB 2FZWA 2YXLA 4H2DA 2FNAA 4GKVA 2Q99A 3G68A 2BLLA 3TM4A 1R4NB 1KFKB 2O2DA 3EFHA 4UVHA 1GLVA 1PR9A 1R00A 5A9RA 4RZHA 3DHWC 1TXGA 4KQ6A 1DEOA 4MUJA 3UEOA 4MR9A 2IUFA 4MLDA 2D0PB 1AK1A 3MIZA 4TMTA 3SS9X 2PHZA 1NXQA 4GQIA 4AZ0B 1RPNA 2QW1A 2JW5A 2BGWA 1UIRA 2FQWA 2PTHA 1OLXA 3BDIA 4S2UA 1XRLA 5FB3A 2G70A 4BNXA 1LBQA 3SOPA 1DRWA 5AM4A 1X7GA 5C80A 5G0UA 2PG3A 2VN8A 3ABOB 4GZLA 1T9ZA 3T0GA 3W9SA 5JBQA 3FSRA 4L08A 5E9JA 4F56A 1U1DA 2V7PA 3JYNA 3Q9LA 5L4SA 2H16A 2Q1UA 4HBGA 4U7FA 3LDGA 2RC5A 2OKGA 1V16A 1E9AA 4CMIB 2F8SA 1KSHA 1JAXA 2PRZA 1JG3A 3S6JA 1EUCB 3K96A 4H6PA 4NYMR 3JVUA 1A5TA 2QLNA 2PLNA 1NQVA 2V8OA 3DEFA 3DDSA 4JP5A 3C3YA 4G0PA 2QG9A 1FMLA 3PYLA 3YASA 1JX6A 4FC7A 5C81A 1ABBA 4QJIA 1XD8A 1YMQA 3GLIE 5DM1A 3A6LA 2ZBRA 5A71A 3CUUA 3NIFB 4EYQA 2IYFA 3PC6A 1DJPA 5AICA 1NLYA 3S29A 5EJ9A 4DQXA 3DZFA 4K0KB 1E9EA 1TJ5A 4UTPA 3ZK9A 4FW8A 4RY9A 3JARB 1D9XA 2P9CA 2EQAA 5K2OA 1CVLA 1UF9A 4MV0A 4W9MC 3O8NA 5A03A 1RWBA 2YWBA 4KXWA 2F64A 4M54A 3DXYA 1XXHA 4A1FA 2O0JA 5TMDA 1R64A 1NULA 4WD3A 3OQMA 3DUFA 4LDRA 2LVBA 4DNOA 4PZEA 3IIMA 4R6WA 4O0MA 3TZEA 3GJ6A 2XCSB 3GJ7A 2WA2A 5AK6A 3K9HA 5KOJB 4TTSA 3QH4A 1ZK4A 1OCEA 3G7NA 1PR5A 3AUYA 1UMBB 3ETHA 1V71A 1D4AA 1HMPA 5LXTB 1Y3CE 1FX0B 4KPUA 1X7XB 2G08A 2BBWA 1PUJA 3FYDA 1N3LA 2BF4A 4O4HA 5FI3A 1R18A 3JQ7A 3RSFA 4FQ5A 3SHQA 4IMIB 5BSWA 2PQ2A 5DW0A 3BWYA 3O5AA 5HBGA 4DJ5X 2R6CA 2PZKA 2FE1A 3NEYA 3S2IA 4NDAA 2Y1KA 3EH1A 3DGFC 2VG8A 4EG0A 5LP1A 1L1RA 4FWTA 3EASA 2W58A 5B37A 4EGQA 3KOZA 1Y6RA 5KUTA 16PKA 1J24A 1LDMA 2IE8A 1ZKDA 1H6CA 3CSDA 1V7ZA 3FVRA 5JXWA 2BELA 1YDFA 1KQGA 1JLLB 3WGMA 3T1HB 4TLBA 3E9MA 4Y9SA 1LBIA 1MJ5A 4FNAA 4R8KA 2OAEA 4OHFA 3GLGB 4EKYA 1LI4A 2IBMA 1AKMA 1CIPA 3ODPA 4Q4AB 5CVVA 3LK7A 2XNDA 1CR0A 2E37A 4N7JA 1ORDA 2B2NA 2R86A 3KAPA 5BWLA 3GELA 3TJMA 1HQCA 3J7AC 1SELA 1NW5A 2RI0A 2HW8A 1GZ3A 2I29A 3AGPA 4U0JA 2IHBA 2RGGA 1UKAA 4RMNA 3FPJA 3DEKA 2NYVA 1RADA 1XD2A 5ALIA 1W85A 2XOKA 1TD9A 3A2LA 1EDZA 1R50A 2YYZA 5AIBA 4EUKA 4YYEA 3H1EA 4GFDA 1YL6A 1KDRA 2YNMA 2ACWA 4ND5A 4BAGA 1SCDA 1LDBA 3EWNA 3BD6A 2CNOA 1H4VB 2J0UB 4XARA 1MX5A 4PG5A 5A0VA 4AKIA 1NNI1 2GJKA 5IBRA 2M98A 4X3PA 1TI7A 3CG0A 4UUPA 8LDHA 2OXRA 3BBPA 4NJMA 1PGPA 3U7IA 5B1YA 5CCXA 4X93A 2QQ0A 2BP7B 3GP3A 3TKAA 5ELMA 1RRVA 1LRKA 2IUEA 1TVKA 5FO1A 2CDAA 4C22A 2VQSA 4XRRA 5KNBH 5DI3B 1E7YA 1SEPA 3FWNA 2EQBA 3UMMA 3N7TA 1V8DA 4ZAZA 1A1VA 2FOLA 3WV4A 2IIPA 2I9PA 1GU7A 2H1CA 3DEIA 1CP3A 1IZYA 4QTZA 4CV2A 5JI2E 4P86A 1OC2A 1Z5WA 3ZR4B 1SKUA 3T5AA 3NNDA 4J16C 1GD1O 1ZG3A 2WKWA 5KINB 2O06A 1Q44A 1JIKA 1BX0A 3EIHA 3HYCA 4XX0A 5F7ZA 4R69A 4KQHA 4CQMD 1CU1A 2QQFA 2EL7A 1KJQA 1XZIA 4RA6B 1SM4A 3T3GA 1O96B 5JARA 4G8BA 4N8EA 1P0FA 4G5SA 2OXTA 3OIYA 4GF5A 1QLJA 3QVJA 2QRQA 4NNPA 3ET4A 1ULUA 3UJ8A 3CLTD 4MQEA 4NEQA 1D4FA 5JQGA 3QEJA 4YRLA 5BSMA 3WSWA 1C80A 2CDBA 3OF2A 4DLXA 5BSGA 4MK4A 1QZTA 2VK2A 3ILHA 1ZOIA 3D5EA 3DD5A 4NZNA 4RF2A 5DM60 4MWSA 5HRAA 1MRSA 3L84A 3BH6A 4ARIA 2ISQA 2AOXA 3TBFA 2HDHA 2P35A 3CINA 3LD9A 4B44A 1OWPA 5FNVF 1KI2A 4H35A 3TEJA 5AMXA 1A9XB 3BJRA 4KEAA 3ZTWA 3H9CA 3ND8A 4HMOA 4OUKX 3TW4A 2Y93A 3F9RA 3HU1A 4IINA 1OLUB 2G5PA 2W83A 4TV8B 4C0SA 4CI0B 3PUZA 1VKJA 2XXBA 3AY7A 2JLYA 2I7CA 1U3CA 1UKZA 1KA9H 4AICA 1OXTA 5JJCA 4NXNB 1ZL2A 5GGYA 1SXJC 3GK3A 3HJGA 3ABZA 3CV3A 4JB8A 1JJFA 1RZVA 4V1CI 3VZDA 3OMLA 2HXYA 1C0LA 5TNXA 1M8KA 3I5UA 3CUVA 4FMPA 1A7AA 2C1XA 3U62A 3PITA 1B42A 2DFLA 3DAPA 3GG9A 4N1AA 4AF7A 5DSXA 2VYVD 3MTAA 3WA7A 1JVSA 1NQAO 1YUNA 2YVQA 4MUEA 2ADFA 5BQ5A 4KYIB 4U7PB 2HXSA 2X7JA 1OIVA 4LHZA 1B3BA 2BKVA 4TRMA 1A8HA 1U7XA 1ZK0A 5TQ0A 1KDVA 4GRIA 3WK5A 4MPTA 1W9HA 5HF8A 3FDXA 1BROA 5JV5A 4OSPA 3VSBA 2F43B 1CZRA 2PT6A 4P7GA 2GKOA 3D6VA 1IRXA 3NWOA 3LG2A 1NNUA 1UEIA 3FFXA 4MYTA 5DBFA 1PS8A 4M7WA 4G56A 2G71A 4HNGA 3VX3A 2QJTA 4BE9A 1E2BA 1AD2A 1E64A 2AUTA 2ZWAA 1DOAA 3CKMA 4S35A 2XNKA 3AJ8A 3GEHA 2NZVG 2H1VA 4YUVA 4AJNA 3R5XA 1LGYA 1FDTA 5CB8A 4L9AA 4HWGA 3KQHA 3QU2A 1XTUA 1C8VB 2P7HA 3B9BA 4FDAA 4K9KA 4QGAA 3CHYA 2NSHA 4PCVA 1C30B 3WQRA 3W78A 5A2GA 2C2MA 2XNJA 1FPMA 4GOND 5IUKC 1JU3A 2H4HA 3CX4A 3PVSA 4G1FA 3W4JA 1VLMA 5FLXA 2OD9A 5BWMA 2GF9A 4EF5A 3J81k 1AB6A 3EEYA 2C5AA 4P3YA 3UT5A 3EW9A 4JB3A 1GG2A 1ATZA 4MGYR 4KU4A 4OXYA 2NXJA 1XT6A 2Q9CA 2HK8A 4H7EA 2VRNA 5KVAA 1FDIA 1XQVA 2D7JA 3K16A 3P9CA 2V7VA 4DS3A 4LRYA 4JS0A 4QTUB 4Z7OB 3DHYA 3LA8A 2GTIA 2UUBB 1ZCJA 1Z8DA 4YJ2F 4Q16A 1Z6TA 2C99A 3VXKA 4BVEA 2IS6A 1RYDA 5EZYA 2B21A 4TXMA 3DM5A 4XEHA 2BR3A 2VDKB 5LBIA 2C2ZA 1Q15A 2JIZD 2VPYA 4JY7A 5FOXA 2XHZA 5TS2A 4D3YA 4EJSC 1MT3A 4F60A 1W5AA 3CE9A 3AF1A 3EARA 3P45A 4NAUA 1E2PA 1IL0A 4Q1CA 5TEVA 1MOPA 1NC1A 3WAKA 1O94C 1WB6A 3LC7O 4MVJD 1B0ZA 3H99A 2CSXA 4HLNA 3GP8A 4U9UA 1NF9A 5H02A 5KQSA 4DM4A 1BCSB 1G20B 3ZCTA 2JGKA 1XRMA 1GVNB 1L5NA 4GPZA 2OWDA 2VJBA 3U4QA 2IXDA 4GGPA 1G7RA 1HRKA 3WLQA 3HCPA 3B36A 4LY0A 2Y0DA 4NTZA 4FB5A 2CUKA 5J4VA 1RKQA 3N8IA 1PS0A 4HC4A 2H1WA 4FILA 2YRWA 3H5TA 4KO8A 5FL7D 3GA0A 5AW8A 2AE1A 2Q6OA 3GEBA 1PEKE 2ZTUA 4OLJA 4A16A 5JALA 4B75A 2PS9A 4RZ2A 2DY0A 2NU8B 2XUOA 3ZXIA 1RPAA 1RAGA 1LNQA 3EOBI 1E2FA 1WOYA 4Y8VA 4EUEA 1RZUA 5I7SA 4NK5A 4IDQA 4DE5A 4WXEA 4ZVNA 3IHWA 5L3RA 1L7VC 2E2WA 1WY5A 1SUBA 4OBEA 5HRCA 4LZPA 1GGJA 3KV1A 4YVFA 1J8MF 3QLTA 1SCKA 3X1DA 4D6YA 2WB4A 3F6BX 1RWKA 1Z36A 1GSIA 5D3MA 1RRFA 3UWKA 1SXJE 3QOYA 5DW3A 1RRPA 4IFTA 1O9GA 4E3WA 5F2KA 3DG9A 4YMTA 4X1KA 3DWEX 4AX8A 3SYLA 2WJWA 1KAHA 1PV1A 3QEKA 1YZQA 1S1CA 3FCYA 1KYYA 2HA5A 3M8KA 2Q5QA 1RAFA 4FR5A 4X1IA 4GM4A 5C1DA 1UK7A 2ZVDA 3SU8A 5A4KA 1JHVA 1JQ5A 4NOLA 3IODA 4ZQEA 1WCYA 3V7YA 2FR0A 3LQ2A 1WNTA 2Z2KA 4NFLA 4M9ZA 1XRRA 1WHSA 3CA8A 1EFPA 3B48A 4NU5A 1MU0A 4AN4A 4RGBA 2R8OA 3M1LA 4R1QA 4IQFA 4L8LA 4N40A 2X0KA 2AFRA 3D7NA 4F85A 2E3JA 2JGMA 2M9MA 5H3CA 2WFLB 4QWMA 4BX8A 4EO7A 1ZD8A 2VF2A 2QMQA 1GZUA 1XEXA 3OLZA 4EJFA 4GKJB 2W90A 2ZYIA 3L6UA 2AQHA 2QOEA 3QG1A 4L15A 4B6GA 3VOTA 3DCYA 4HDMA 2PQ0A 2JS7A 4M9CA 1Y0BA 3QYFA 3OCWA 3OPYA 3KOXA 2ZRBA 4DIUA 2C7QA 5ES3A 3SI7A 3X1KA 1QZ3A 5G3ZA 2FGJA 2R11A 1Q74A 2PWAA 3H6GA 2CT8A 2PUAA 4DR6B 4LYAA 3LBHA 5IM4A 4PBSA 3CCFA 4B7UA 3IPCA 3ZIAD 1T24A 2PL1A 1KY5A 1NPTO 3B1ZA 3O7WA 5A3JA 3NVAA 5FFMA 1Z68A 2EG9A 4AJ9A 1YL5A 4G0XA 3WSVA 3EG5A 4QAQA 1GAXA 3AFHA 4H08A 4HDAA 1HBJA 3IT1A 1SN7A 3ZDDA 4PZPA 1AQJA 1GA4A 2DFVA 2HSWA 3CMCO 2Q2WA 3PF8A 4MPRA 5CVCA 3N74A 3ZOKA 4CNQA 3TLEA 4F9FA 2UYYA 4O4JB 2QF7A 1Q1GA 4MVYA 4YAKA 1O0CA 1QH1B 2VHQA 1TCAA 3ZWNA 4W5QA 1N6PA 3HYSA 2WIDA 3E05A 1O9BA 4H59A 5AHOA 4Z7JA 4CHTA 1DAHA 4DARA 1KI4A 4MWEA 721PA 1FFAA 3F6SA 2QMOA 1LZKA 1N6IA 2AR9A 3DHNA 1PJ4A 3HN7A 4HCJA 3NHFA 1NI3A 2QE7A 4HEA1 5BRAA 4IQ8A 4C5CA 4MULA 2Q50A 1BRTA 2G06A 1IMOA 2HRQA 3KQVA 5JD3A 4M89A 1E3LA 1A50B 2BFCB 3AEQA 4HYEA 4XWYA 4FNGA 2QRNA 2CYCA 5E7QA 4DEXA 5K09A 3BWBA 1KWKA 1XPRA 1HL7A 1KEWA 1NATA 3MWEA 1SUDA 5KNDH 3PX7A 2FSVA 2QT9A 3C6KA 1BCRB 3WV5A 2V6BA 1NXWA 3QMWA 1HFEL 4P81A 3DOOA 1C2YA 3TLAA 4GYYA 3IP9A 1H66A 5AKHA 3TLGA 3OETA 3RADC 3BL5A 1QGZA 2BISA 4IH4A 3OM8A 1SKAA 1HA3A 4QUAA 1VLJA 2GDZA 3DMNA 3KNZA 4K26A 4Q15A 3R7SA 4B9AA 4V1CA 2I3GA 3G6KA 2VP9A 3ULKA 5IPFA 2QMZA 3I5MA 3IVXA 4LBYA 1I4LD 4FIDA 4QPPA 1XK6A 1PT7A 3CUWA 3KRTA 1DT3A 4WZBA 4ARUA 5JE8A 1YIDA 4NMMA 1IH8A 1YRQA 3HLYA 3OUUA 4OB7A 4M0CA 1DARA 5C5EA 2R2GA 3EVBA 4MW4A 1J1ZA 5DN9A 1CPYA 1FTSA 1USGA 3GJTA 1HR0B 1IHOA 1GCUA 4CU5A 5C8XA 4X9XA 3TZCA 5C7YA 4YUYA 5GOTA 4HMQA 5FUXA 3L77A 1OXKB 4C7BA 3KETA 1I2ZA 1LK7A 1S4QA 3EY4A 4ICIA 2HDNB 3DEHA 1HPLA 1Q1EA 3QVXA 2VQEB 4KVAA 5HJ5A 1OFTA 4Z6KA 4RLHA 2W22A 4FS8A 2PS0A 3A9CA 4EARA 1K4YA 1NP3A 4AULA 3C7TA 1IN7A 2H08A 1COWA 3RT9A 2N9UA 3AU8A 3WRVA 1N7JA 4GYJA 1KOGA 1Z2EA 4TXLA 4NCHA 2Y9MB 3G0DA 1UBEA 3C0KA 4I1SA 1TFRA 5DGDA 5B4UA 4ZTZB 3MOSA 2H4XA 2Z6AA 1XZLA 3SR4A 4ZOLB 5C8DA 5DGIA 3SE7A 4BMCA 4HFRA 1DZIA 1I80A 5K1ZA 1GAJA 3E15A 1DJOA 2GAIA 2EZUA 1NZFA 3E1GA 3PIDA 5GPBA 3SQWA 4TKVA 1U0GA 4JYZA 1FMCA 1XJ0A 4G0MA 4D41A 1YQQA 2IUUA 5KOYA 2I7XA 2OD2A 5BN3A 3D3QA 5ISMA 3OMXA 2RK3A 1B74A 3T7JA 4UULA 4R1LA 5LPNA 2XDWA 1C0IA 4G65A 4JIGA 1MAUA 2NYUA 2JBWA 4AURA 1WABA 3D59A 4GYKA 5KWIA 2IF2A 3N8NA 5HFJA 3B6EA 2X4DA 2Q4EA 1P4RA 2WD7A 1HY3A 2GLTA 4H9GA 3V46A 4HX2A 3P19A 1NBMA 1KI6A 1PJ2A 3INGA 1AU9A 1SRQA 1PRYA 4C1NA 4ARAA 5LN1A 3E4DA 3FRJA 3UYKA 4KFCA 1MV5A 1S8FA 1Z73A 1B0AA 4DVGA 5HUHA 1Z9BA 1W0JA 3NYRA 3PXUA 2WQ7A 3KYJB 1WSWA 1QQ6A 2E4XA 3QU4A 4HRVA 4LWQA 5IJXA 2WW8A 3A1CA 1H2HA 1C0PA 3H42B 3LQRA 2DOKA 2R8RA 3VR4A 3WLLA 4PBTA 4S1VA 1MZPA 1BDHA 1HQKA 3L7JA 5TPWB 3V42A 3WBFA 1PQYA 1P60A 1JTFA 4NATA 3EZFA 2OG1A 5BVHA 2KYRA 2A58A 2WI8A 5LUBA 1M6WA 4LHEA 2Y1WA 5KHAA 4O2AA 3IHKA 4COOA 3MRTA 2KLBA 1S3FA 3F71A 3EXG2 1TMOA 4G9EA 2CUZA 2VH5R 1KAOA 1TQDA 1YZGA 5JEEA 2P4HX 4NEHB 1XVTA 4DLTA 5IT9A 3ORSA 5CYGA 1BDBA 3MA0A 2IT1A 3SEFA 3VTZA 5JD4A 4UCQA 2YZKA 3HO6A 4D92A 2V58A 1RLMA 3MCZA 5T7BA 4QPZA 5E4JA 2XMPA 3AUAA 2XA9A 4I50F 2ZVJA 3SK0A 2F1RA 4OLAA 5KTNA 3RVMA 5C8ZA 2N1MA 3KT3A 3ABRB 3JD4A 4JVLA 4UVEA 3UV3A 5KVVA 3W3AD 1Y1LA 3Q8KA 3H9EO 1NNLA 1A76A 1EDDA 3C6QA 4ZANA 4BLUA 2XH8A 2UUOA 2BSAA 3MC1A 3GVHA 3N58A 4HTAA 3W2GA 2OL4A 3WL7A 4EY6A 4TRRA 2P77A 3IPYA 2JARA 4ETIA 4D6XA 4Z4CA 1QFZA 4J6EA 3BXFA 4EPYA 2XCUA 3QI2A 1QZXA 3V4PB 1BXRA 1T8SA 2I6FA 2ZIUB 4HWSA 3T5DA 1AQLA 3AXTA 4UMDA 4EELA 5CJPA 4EVRA 4M1WA 4YCJA 1P73A 3C3AA 2X0JA 3DMYA 4KI0A 4LK3A 4D0GA 3IEIA 1IG0A 2RDMA 3AI3A 3D7KA 5FUVA 3INNA 7REQA 3ZOZA 3F3KA 4FT2A 4KTVE 5EXDA 4BEWA 3WHIA 1BWPA 3P9YA 1Q7EA 1TJNA 3TG8A 4JD5A 4UW9A 4X91A 2I4MA 1P2BA 1X0XA 3WL4A 2GCPA 1IHDA 4AG6A 1XFAA 1TZBA 2OC4A 1ODSA 4YFVA 3HC7A 1T5SA 4BLRA 4EUHA 3QA3E 1M10A 1ZC4A 1UOPA 5KYWB 4WBXC 1Z62A 3AP1A 2Q7OE 4B0PA 4FKBA 4KGVA 4D3XA 3AB3A 3NFYA 5A5DA 3DBIA 3WIBA 5JSZA 3BT7A 1IC6A 4ER6A 3FB4A 3O4JA 3IRVA 3MMSA 3GBPA 3WOVA 2E48A 2BBSA 1JYSA 2ZR0A 4FR0A 2LKCA 4WY2A 1A69A 4HNUA 4HNTA 3T1QA 4XJXA 4R71A 2O8BB 1DTEA 5IXSA 2GN9A 1J2TA 3NT4A 3CF2A 2C9ZA 4G24A 3EZ9A 3HXTA 2Q3BA 4D8WA 3LF2A 1SZJG 1JLHA 2NTNA 1JDUA 4TMYA 1E3WB 5CW1A 5EHQA 3VAYA 4C4ZA 4TYNA 4QBIA 2OB2A 1CUHA 2X19A 1Y8AA 4BY9E 3HL0A 1ZI9A 1B8PA 4I4TA 2QRVA 4M0KA 2SCUA 1SQ0A 4PQFA 3Q3CA 3M6UA 1R74A 1ZH6A 4MUBA 4IDOA 4O4LF 2BJWA 5AKEA 1FS5A 3NBKA 1DRKA 4DT1B 3MWLA 4TVKA 4OJTA 4YRNA 2CXOA 1BGWA 2BEUA 4G23A 4E03A 3ISJA 4RJJA 5I7VA 1P4HA 2JIMA 4Z9BA 3S5JA 2JI6A 4DJDC 4ZTUB 1C4WA 1UDCA 3OX1A 1OTHA 3UK1A 3TUZC 1QP4A 1B00A 3OFVA 4JX8A 3QIAA 5L6MB 1GAQA 5B1SA 2QBYA 1ZUNB 4IW3B 4QM6A 3AZPA 5KQRA 3DKPA 3PGJA 4OHMA 2MYNA 5DLDA 4BBJA 5LFAA 1UFVA 4I1RA 3IH5A 1T35A 2XZPA 5E6SB 2X5KO 1ZCBA 1ZGJA 4J75A 4B34A 1LLCA 5GTDA 2VAWA 2WINI 4XIYA 4YN3A 5FLKA 3QFFA 1Y33E 4CE6A 2BGTA 1A2BA 2QTAA 4I81A 1HETA 3D8SA 5IJ0A 2P41A 1QHEA 2ONCA 1KVRA 3NKVA 4DM7A 1F9EA 1U6IA 2BT4A 1I0LA 1ORWA 4DWOA 3W9UA 1FIUA 4ZHSA 3MXOA 3LX4A 4V0NA 3ZUGA 1SUFA 1XUOA 2DF8A 1KMMA 5CK5A 1TU3A 1TM4E 3DLAA 3EOAI 4RXUA 1E0JA 5BN5B 4ENVA 5JNLA 5LIPA 1J4AA 2WT4A 3L7KA 3RWBA 4CKEB 3LM8A 1ULHA 2R00C 2OCXA 2YL2A 4OLFA 3EIWA 2EBFX 4GEKA 3C8UA 4G5YA 4HPWA 4EUFA 1CR6A 2COUA 2NUTB 4QTTB 4X24A 1IUPA 2AA3A 5EHXA 3NOXA 3D4PA 2HQ1A 2CXSA 4U5QA 4N6OA 4Q3DA 2DFPA 2B6HA 5FWNA 1XKLA 3P0RA 4N01A 5LMCA 4B3MB 4BJ6A 1OHHA 1JXMA 3DV2A 1DX6A 1E32A 1P1RA 2E9SA 2MSDB 1W9MA 1AQIA 1Z45A 2DMRA 4HQLA 4LHSA 2C5BA 3HDHA 1BQ4A 4QA9A 1H85A 3PR3A 4XYBA 3GD5A 3LF1A 1XDBA 3PNLA 2YMQA 4IOJA 1EUYA 2IEBA 1N5DA 3WIOA 2XYPA 3UMJA 2VYCA 2ZM5A 3R5SA 4BEJA 1NX6A 2TMGA 2R7MA 4M8SA 4O1HA 2AOWA 1XTPA 2B7LA 4P3NA 3LUAA 3OU6A 4EPTA 1P9LA 4EVIA 3IPLA 2PIDA 2QJOA 5JJBA 1WTCA 2HHAA 4YMIA 1U8YA 3JY6A 1M2VB 1RLOA 2BFBA