1RI2A

Structure and mechanism of mrna cap (guanine n-7) methyltransferase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
252
structure length
252
Chain Sequence
b'SKTINIRNANNFIKACLIRLYTKRGDSVLDLGCGKGGDLLKYERAGIGEYYGVDIAEVSINDARVRARNMKRRFKVFFRAQDSYGRHMDLGKEFDVISSQFSFHYAFSTSESLDIAQRNIARHLRPGGYFIMTVPSRDVILERYKQGRMSNDFYKIELEKMEDVPMESVREYRFTLLDSVNNCIEYFVDFTRMVDGFKRLGLSLVERKGFIDFYEDEGRRNPELSKKMGLGCLTREESEVVGIYEVVVFRKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA CAPPING ENZYME
molecule tags Transferase
source organism Encephalitozoon cuniculi
publication title Structure and mechanism of mRNA cap (Guanine-n7) methyltransferase
pubmed doi rcsb
total genus 70
structure length 252
sequence length 252
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2003-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03291 Pox_MCEL mRNA capping enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1ri2A00
5K01A 3HTXA 1NBHA 3KR2A 3PVCA 2I7CA 3CJQA 2VDUE 2ZIGA 1AF7A 2E5WA 5P8WA 1M0EA 2O05A 4EMSA 3HVHA 3DTNA 1P91A 4JXJA 4QQNA 5D1HA 3UJ9A 2NP6A 2GH1A 4OQDA 1YZHA 2XVMA 3FRHA 3G89A 5K0BA 4QVGA 5HEKA 1F3LA 3QV2A 1DUSA 2BR5A 3OE5A 4HGYA 1KYWA 3THSA 5GIOE 3FTFA 4MTLA 2XYQA 3A27A 3B89A 5DM2A 3RW9A 2HV9A 4WVLA 4CTJA 4FSXA 5DT2A 5BP7A 3BGVA 3KPVA 3JWHA 5KQRA 1L3CA 4ER6A 1B42A 1PJZA 3OCJA 1VQ1A 3G88A 2G72A 1O54A 5FHQA 3Q87B 1XDZA 3EGVA 2OXTA 3C6MA 2FYTA 5C1IA 3SVZA 4FT2A 4IV0A 3VYWA 3O4FA 4CKBA 1VL5A 1P39A 1VP3A 3DMHA 4HTFA 2IFTA 3AXSA 4RSRA 3MERA 3NTVA 5CVDA 5E9QA 3IHTA 5EOVA 5FWDA 4PONA 1XCLA 3G2PA 1JG4A 4FR0A 4HTFB 4RWZA 1U2ZA 5FA8A 3UA3A 4HH4A 5K0LA 4RVHA 2PBFA 3BKXA 3QOXA 1ZQ9A 3BGIA 3SMQA 5K8VA 3G7UA 5FHRA 2XBMA 5HFJA 2ONYA 3WSTA 5EQJB 4EQZA 1JSXA 1XXLA 3MAGA 3P9IA 1DL5A 3BZBA 4E2ZA 5HIMA 2AS0A 4KRGA 2ZWAA 1V39A 3B7PA 3OPNA 4OA8A 4CKEA 5CVUA 2H00A 3S68A 1R00A 3ELWA 3NDIA 4FS8A 3HVKA 1XTPA 3BWBA 3LGAA 1L3IA 1UWVA 3ER8A 4RVDA 3EVDA 4AZSA 3OZSA 1Z3CA 3LDUA 2Z6AA 1H1DA 1L9KA 2Y1WA 5F2KA 2FHPA 5BXYA 2AR0A 1JSZA 2PX4A 3GIWA 5EPEA 4AZTA 1WS6A 2ADMA 4ER3A 3T7TA 4ER5A 4QPPA 3JWGA 3DOUA 3KKZA 2GB4A 2ZWVA 3B5IA 5T6BA 3SX0A 4L7VA 5ICCA 5FTWA 1SG9A 5DTMA 2FRXA 2PT9A 1WY7A 2QYOA 3ORHA 4PINA 4PYLA 5GP1A 2WA2A 2UYHA 4GOOD 1XDUA 2P41A 3HA5A 4P7FA 3GRZA 1ZGJA 2I62A 3OFKA 2ZBRA 3FPEA 3L8DA 3DLCA 4C07A 3AJDA 1SUIA 2YX1A 1QZZA 4E31A 4O29A 5HZMA 3PS9A 3VC1A 3MCTA 4YV2A 1SQGA 3HCBA 1KPIA 2F8LA 3BWCA 3G8BA 3OU2A 1G8AA 3TKAA 3CKKA 1NBIA 3AWIA 2ZCJA 2XVAA 1JTFA 5CCXA 4Y30A 5ERGB 3FPHA 5KYGA 3LX6A 3R3HA 4HRAA 2G71A 2QE6A 3DR5A 1YZ3A 1D2CA 1MJFA 2ZIFA 3P2EA 5CM2Z 3TOSA 3O31A 2IH5A 4A6DA 3I53A 1NT2A 2AZTA 1KXZA 4ER0A 4MQ4A 3OZRA 2AOUA 1NW3A 2NP7A 3LCUA 4GQBA 2IDKA 5FA5A 1NW6A 2N47A 2P35A 5HIIA 1XVAA 5DRTA 3PTAA 2BH2A 1NW8A 3PB3A 3GCZA 2QRVB 1BOOA 4KDCA 3A4TA 2JJQA 1P1CA 2OBFA 4KW7A 3I5UA 3KQQA 1BKYA 2AN4A 4KDRA 5GINE 5IH3A 5JUWA 4RTNA 3KQPA 5EIFA 1F38A 3E23A 4AZVA 4AUKA 4BLUA 2ZZMA 5K0JA 3DLIA 5K0NA 2CMHA 3SSNA 1L1EA 5DXAA 2JHCA 4BLWA 3CJRA 3FYCA 4CWAA 1M6YA 1VP9A 2NNWB 2OY0A 5HOQA 1YUBA 3A25A 2P3QA 4RTRA 1HNNA 3A7EA 3MQ2A 1TPYA 5U4XA 3F4KA 5E1DA 4ER7A 1YFLA 5T64A 2NYUA 3VC2A 2H11A 1JG3A 1JR4A 4GF5A 5DSTA 4EVIA 3EMBA 4XCXA 5E2AA 2OYRA 2I9KA 1DCTA 3ER9A 5B1SA 1G55A 1JTEA 2K4MA 1FP1D 1KYZA 3HCCA 3JWIA 2YXDA 5K05A 3BWYA 2JH8A 1ORIA 3PT9A 1EJ0A 2VS1A 3KQYA 2ONZA 2YVLA 1FP2A 4FGZA 1TW2A 2IGTA 3P71T 5DM1A 3GRRA 3LDFA 4GC5A 4B17A 3E8SA 1AQJA 4R8RA 3G8AA 4U7PB 4C4AA 4QVKA 5F2OA 5LQCA 2IPXA 4AZWA 1YB2A 5DTQA 3HVJA 2PV0A 3OFJA 2C7PA 2CMGA 2DPMA 2Z6QA 2BM8A 4M36A 4MHTA 2YQZA 2PGXA 3EVCA 3LL7A 1Q0TA 2R6ZA 3ELDA 1MHTA 5EHGA 3KPUA 3P9KA 4PGGA 4QTUB 3IV6A 4RX1A 4XUCA 2GS9A 3FTCA 3HA7A 2V74B 3NMUF 3ELYA 4MWZA 3NWEA 2ESRA 4GOND 3EPPA 5E1BA 2UZ4A 3FPFA 1EG2A 3TM4A 2HNKA 4A6EA 2CWWA 5FQOA 3KQMA 4MIKA 4PGHA 1KHHA 2ZZKA 3KHKA 4DF3A 5CVEA 4QTTB 5C9ZA 4RTMA 3C6KA 4NECA 5LQAA 3QOWA 3TRKA 4E30A 5LQJA 4QQKA 3KU1A 4QDJA 5CUQA 3FZGA 3SSOA 2KW5A 5LSAA 2C7OA 4F85A 2IDJA 2GAFA 4CKCA 1VBFA 3GWZA 4KVZA 1WZNA 4RTPA 3DXXA 3MTIA 5EEGA 1RI4A 2EJUA 3GRUA 1ZKDA 3LCVB 3HNRA 3OZTA 1RJDA 3ID6C 5G02A 1QANA 2GLUA 3HCAA 4ISCA 1JQDA 9MHTA 1YFJA 3KR1A 3ERCA 5E9WA 1RI2A 4GOMD 3P8ZA 3FTDA 4V0QA 2PT6A 5IKMA 3NVKI 1PRYA 2OB2A 4E32A 1I9GA 4OA5A 1QYRA 3EVGA 3KQVA 3R24A 3PX3A 5FULA 1EIZA 3EMDA 5EMJA 2OKCA 4RVFA 4QDKA 1X1AA 1VIDA 2YUIA 4AX8A 1AQIA 1WXXA 2AOXA 4HSGA 3EGEA 3IYLW 1G8SA 2R3SA 4PYKA 4ZTBA 4X1OA 4EKGA 3FUXA 2C7RA 2NXEA 1QAMA 1I1NA 4R05A 4WXHA 3B3FA 2NXJA 4YMGA 4C05A 8MHTA 2H1RA 3EVBA 4BP3A 2AOVA 3B3GA 4PYOA 5EG5A 2HR1A 5DPMA 3I58A 1VPTA 3FPJA 3LDGA 3TPZA 1X19A 3E05A 4R6XA 2BR4A 2P40A 5EKXA 5CIYA 2EX4A 3P2IA 3UJAA 4DZRA 1T43A 1JQ3A 4K6MA 5BW5A 3NWBA 2Z6UA 1YF3A 2FPOA 1KP9A 3HCFA 5M5BA 5EZQA 5HIJA 4FT4A 1EJ6A 4PYQA 4DKJA 4PYJA 3D2LA 5D1NA 4LWOA 3T7RA 3HM2A 5EMKA 4YUXA 3MCZA 3KQSA 4RTOA 2VZ9A 4U7TB 4V0RA 2IBTA 1JG1A 5CD1A 3FRIA 5E8JA 1QAOA 3EEOA 2B25A 3O7WA 2ZIEA 2GPYA 4PIMA 4IV8A 2PY6A 3KQTA 3M4XA 4CXMA 4YUVA 3LBFA 4X61A 4ATNA 1KPHA 3TM5A 4E2XA 2G70A 4YMHA 3K0BA 2OO3A 3NVMB 4F84A 4M7RA 1D2HA 4OBXA 3T0IA 3R9XB 3GDHA 2ZTHA 4P7KA 4DQ0A 3UBTA 3TFWA 2AVNA 4GUAA 4KWCA 5ICGA 4LG1A 5GIPE 2O0LA 5JR3A 2HTEA 1O9GA 3E7PA 2YTZA 3BXOA 2UYOA 5EMMA 5CCBA 4PNEA 1G60A 5LQRA 2IH4A 2Y1XA 2PWYA 2PWPA 3EVZA 4OBWA 1WG8A 5F2NA 1AV6A 5GOZA 5DM4A 1ZGAA 2B9EA 5DWQA 4YUYA 1WXWA 1ZG3A 2AN3A 5GWXA 4CTKA 2YXEA 5HIKA 4PWYA 1R8YA 1L3BA 1OR8A 1RJFA 1XDSA 2LD4A 2ZW9A 3HA3A 3UWPA 10MHA 4E2WA 5K03A 3FPGA 5EMLA 4IKPA 4P7JA 2PX8A 4M38A 2PJDA 3UJ6A 1N2XA 5CVVA 5FADA 1M6EX 1XCJA 3HVIA 3UJBA 1RI3A 1SVUA 2B2CA 3C0KA 4EK9A 2YR0A 3LHDA 2DULA 2PKWA 3KR9A 3UA4A 2JH9A 7MHTA 3FUVA 4C04A 4R6WA 3GO4A 3HEMA 3GGDA 3G5LA 4UOEA 2AN5A 4IWNA 5K0EA 4HGZA 2QRVA 5E8RA 5EGSA 5KQSA 5H02A 3G2MA 1BHJA 4C08A 3M6VA 3NJRA 3BT7A 4Y2HA 3Q7EA 3T7SA 3BGDA 3FUUA 3SXJA 3HP7A 3SGLA 3M6UA 3G5TA 2AVDA 2QM3A 2QY6A 3I9FA 2ORED 3CGGA 2G8NA 3DH0A 1P1BA 2P3OA 3FUTA 1NKVA 5DX1A 5DLYA 3UJ8A 4XUEA 3M70A 3ME5A 2AOTB 3VSEA 5K09A 2IBSA 2AOWA 1KR5A 4M37A 1VE3A 3C3PA 3EVEA 1SKMA 3GU3A 3UJCA 5LR6A 2B3TA 5EEHA 1Q0SA 4QPNA 2FK8A 4YUWA 4RTLA 3P9NA 3DUWA 4RTQA 3KR0A 1X1DA 4OQEA 3IEIA 3CCFA 1RJEA 2PLWA 1X1CA 1INLA 5DSXA 4FP9A 2EJTA 2WA1A 1JQEA 2WK1A 3C3YA 3MB5A 2HMYB 2C7QA 1NE2A 2VDVE 5T67A 4P58A 1R8XA 3TKYA 3LCCA 1IM8A 2PXXA 3OU6A 1KPGA 4GEKA 3CVOA 5E1MA 3CBGA 4BLVA 2ZSUA 3I64A 5LQUA 4DM3A 5CVJA 5C0OE 1NV8A 2P3LA 2V7EA 3DULA 3GJYA 5DX8A 5GM2A 3M33A 1I4WA 2PX2A 4GBED 5K0GA 5ICEA 5DXJA 4FZVA 4GC9A 2P7IA 2PVCA 5DX0A 2JHPA 2ZULA 1NW5A 3KPWA 4PYNA 3K6RA 3X0DA 4YV0A 2PSSA 1KIAA 4R8SA 2ZFUA 1NW7A 3FTEA 3TLJA 3LECA 4DCGA 3V97A 3TMAA 1QAQA 2BZGA 3UZUA 3FYDA 4X41A 2UYQA 3U81A 1VLMA 1FJXA 4DMGA 1N7JA 3BUSA 5FWAA 3G2OA 2IH2A 2PXAA 3TR6A 1NV9A 3DXYA 4PIPA 2G1PA 3HCEA 3FUWA 2O07A 3NDJA 3P9CA 4KIFA 5EC8A 4BY9E 4DA4A 3GRYA 3PLAE 1ORHA 5DM0A 3UFBA 3DMFA 4DCMA 3ELUA 1R74A 2HWKA 1EAMA 1UIRA 3GXOA 3R6TA 5DRYA 5FCDA 3OE4A 3RIEA 1JG2A 2O57A 3EEYA 4PYMA 4YV1A 4P7GA 5BW4A 3JWJA 1TW3A 2ERCA 3LPMA 2XYVA 2P1DA 3LKZA 3M6XA 3MTEA 4KIGA 4POOA 1UFKA 2OZVA 4E33A 2VDWA 3EVAA 2YXLA 2ZBPA 1R18A 3MHTA 4F86A 1R6AA 3PFGA 4C06A 5K0CA 5LQKA 3NW9A 2P8JA 3UJ7A 5HILA 4LWPA 3AY0A 2ZVJA 3UJDA 1HMYA 4X63A 3A26A 3BKWA 2I6GA 5EKUA 1RI1A 3KPJA 3ANXA 4XUDA 2FCAA 2NXNA 4RTJA 1X1BA 5ICFA 2CL5A 3SR4A 5FQNA 1ZHFA 4G56A 4YUZA 3DP7A 2IIPA 3KQWA 3BWMA 2NXCA 1IY9A 5LQNA 3GNLA 5MHTA 3DXZA 2UYCA 1FBNA 2AOTA 3LKDA 3R0QA 1RI5A 1FPQA 2AOUB 3LSTA 3OU7A 4GOLD 3DMGA 2OB1A 5DTRA 5E2BA 1D2GA 4RYLA 4RTKA 2A14A 2O06A 2FK7A 4H0NA 3KPYA 3SSMA 5KVAA 3P2KA 4X60A 3M6WA 5EIWA 5KS2A 3B3JA 3MGGA 2JHAA 2BR3A 3HCDA 4EKIA 2OPBA 5K0FA 2EFJA 3H2BA 2CKDA 1O9HA 2BM9A 2ZBQA 1G6Q1 1EQAA 4HC4A 2PXCA 5GM1A 1SQFA 2ZZNA 4RTSA 3SM3A 2P7HA 4RV9A 4E2YA 5EVJA 4C03A 4Z2YA 3G2QA 5FUBA 4OX9Y 3CJTA 1SUSA 4BP1A 4PYIA 3PFHA 3THRA 1Y8CA 2JG3A 2EG5A 3KQOA 4LECA 5E1OA 3AXTA 5EZSA 3PX2A 2XYRA 1IXKA 2IP2A 3P97A 2Q41A 3RODA 3CC8A 4FSDA 3LBYA 4E70A 1XJ5A 2ZLBA 4PCAA 1BC5A 4RVGA 5E9JA 3TQSA 1RJGA 2VP3A 4HG2A 3A7DA 1N7IA 3EVFA 5EHIA 3REOA 4PCLA 1G38A 2B78A 3GRVA 2PX5A 3V8VA 2GA9A 3EGIA
chains in the Genus database with same CATH superfamily
1MGOA 3Q2KA 2VDUE 5P8WA 3HEAA 2H1SA 2BMFA 3NBUA 4EMSA 1IWPB 5JBQA 5I7VA 3HXMA 2NP6A 4UREA 2Q8QA 3TI9A 4F4IA 3U4AA 2AKEA 1UC5B 1NQAO 3U26A 4TTIA 4CFSA 1X2BA 1EK2A 1RW4A 2B5WA 2J41A 1D2NA 2VEOA 3GUYA 1TLLA 3CLUD 4QGGA 3TO5A 3U48A 1VCOA 3LBAA 5JQWA 2QTZA 2XZPA 4GEGA 4WCFC 2PUFA 3AM3A 3TTYA 2IS2A 1H1LB 4F11A 3TVDA 2G28A 1SQ5A 1GA4A 1B6RA 1PVVA 3EBLA 1ESNA 3A27A 4A1FA 1FUUA 3RYHA 2A1IA 4C6SA 1DRKA 5CJ2A 3RLIA 3DB2A 3OTHA 1RWPA 2BFOA 3VOBA 1XOIA 2WKSA 3EQ7A 2G72A 1TKRA 2Y76A 4RPGA 3S1SA 1DIRA 4AO6A 1KRXA 1XLUA 1UDXA 1Y4SA 3BRWD 3S2SA 1NDHA 1KJ9A 1KMHA 3UHPA 4AICA 5EUCA 2P2GA 3MCVA 4RVNA 3MERA 3GN2A 1JA9A 4QUGA 1GNLA 1KWKA 2HIGA 4Q6BA 3UAVA 2VA9A 5K0LA 2HMVA 4IIVA 3SKXA 4CUKA 3SHVA 5HJEA 3BKXA 2BFEB 4MV8A 2BISA 3H19A 2AWOA 4X90A 2B1QA 3DCYA 4OBEA 5K8VA 4K1XA 4QDOA 4GI5A 2HA4A 8OHMA 2GN4A 3OJ0A 3WSTA 1QGYA 4WLUA 3FUCA 4HMOA 1F2TB 4MLZA 1BOFA 1ZU4A 3KM0A 3RYHB 4M3NA 4LXTA 1IHDA 4P7BA 5AM2A 1RAIA 2GOYA 4Z8XA 3VHLB 1ADYA 3EIFA 3GFBA 2C5FA 5LB4A 3O91A 1NJFA 1Y9JA 5CPBA 3RUCA 3OUZA 2J1LA 3WB0A 1ACLA 4ZDJA 4ZVQA 4JBLA 1S2MA 4IDDA 4X8HA 4PR3A 2AWNA 2AR0A 4O4JF 4LZZA 5EPEA 3PQ7A 2ZUWA 3N8HA 4P3PA 5GJVC 2CMKA 4XVCA 3K3PA 1U1EA 3MS4A 3PC2A 3PXUA 2JVJA 2R2GA 4MICA 2Y1FA 4RH0A 5D5HA 3W8EA 4V38A 1T8YA 3BHMA 1JKJA 2UVDA 4MV4A 2JFOA 3VDXA 3DWEX 2RJNA 2G36A 4BUJA 5KMGB 3HJFA 1SQSA 4PYLA 3VPDA 4G0PA 1PGNA 3LUBA 4KKXB 1Z88A 1C0PA 2QVLA 4G07A 2OKGA 5GP1A 1CEYA 4YBZA 2XGSA 1MJHA 3IRVA 3GA5A 2BLNA 3QQPA 2C03A 1TCAA 1BA3A 3CNLA 4BWGA 1Z0AA 1ENYA 2NPOA 2DTEA 3GVHA 4MS4B 3SKYA 4AMYA 4JGBA 1PJBA 3VPAA 5EIXA 1RQXA 2P9JA 3GLSA 4XSGA 1C50A 4TKVA 4ZCIA 2YOHA 4JBIA 4LOLA 3OT1A 4O0LA 1L4FA 3OZBA 3OTGA 5IDQA 4GQIA 4TN1A 2NN3C 5FOSA 2H9YA 2MYPA 3CBQA 1AKQA 5K2OA 2ZVDA 1DRVA 3C5EA 2WDZA 1GM5A 2H7CA 3BDIA 1OBOA 4R2IA 2XUJA 2ZIFA 3P2EA 1ADGA 4PE5B 3A6FA 4EW6A 5DIZA 2A0XA 3ORQA 4JJ7A 3I53A 1N25A 3OLZA 3VR1A 1Y8QB 4I5IA 4I99A 1MDFA 2IDKA 1Z13A 2Z9CA 1XTKA 1XVAA 2V6BA 2W2XA 4FQ8A 4MQLA 5K5EA 4G4IA 4ZO8A 2NU6A 4XRGA 1MRZA 3NHMA 3X1KA 3EGDB 3ES9A 2IEYA 3IUNA 3MUFA 4FWBA 3UXMA 2CHQA 2PYDA 4RA9B 3GUUA 4MS1A 4OXXA 5JUWA 2PX0A 2W90A 5E9AA 4Z4EA 4MP8A 2X9NA 1ZXXA 2YWDA 4AUKA 4HN2A 2H59A 1AKNA 1QS0B 1A2OA 3C5WP 2PANA 3PL5A 4JP5A 4UQPA 3VOSA 3C7CB 5AIBA 1XYYA 4KLRA 3DVSX 4BVEA 1BXRB 3BIFA 1CHNA 1N0HA 3CJRA 1JEOA 2VK8A 1UWLA 3HWSA 3TAXA 3ZHBA 2ACWA 5IC6A 4BMSA 3Q8XB 4RHCA 3A7EA 3B60A 5HS6A 5EN4A 3E9DA 3SOZA 2VLIA 4TS4A 3NYIA 1D4OA 2VNJA 2XSZA 1L4YA 1T3ZA 2P9GA 4J0CA 4JP2A 1SC9A 3QE2A 4X9XA 4P98A 2PMCA 3FOCA 4X93A 4YROA 4FWTA 1LBQA 4K5QA 3CSSA 3FCXA 1EX9A 5EFZA 3IAAA 4Q39A 4F3TA 3Q6IA 4QFCA 2H4WA 4J3FA 3QTBA 4TSKA 4MEJA 1A5TA 4KSCA 1A8PA 3V6LA 4WOCA 4O2AF 1EVLA 4CJXA 4CF4A 2H65A 3OZUA 4H7JA 3GYBA 4DWVA 3MMNA 1D04A 1N34B 2P91A 1QE5A 3HRHA 1NX6A 1TADA 3KEOA 3G8AA 2C3PA 4BO2A 2I54A 4QVKA 5F2OA 5KOIA 2E82A 1D1PA 1YRWA 4MI9A 1G5PA 2XQGA 3RC1A 4QOEA 1VI2A 2WWVD 3SX4A 3ZLUA 4DRYA 1P2TA 3WQRA 5DGTA 2QTGA 1MOZA 4IUBS 1D0VA 3DTVA 4O4LB 4LJ5A 3RVDA 4ERNA 4Z54A 1PYOA 4B85A 5HXAA 1P80A 1LK7A 4GOJA 4IGKA 4Q9AA 4KN8A 4QTUB 5E4TA 4BBJA 3OFND 3THXA 2IJGX 3CUWA 3GZ4A 3PWSA 3R9KA 1HFEL 2J45A 3Q7IA 2VCHA 5CDTA 5K6TA 4G5OA 3ZV5A 3I5YA 1DXYA 5HA5A 2NAFA 1GZ3A 4YUAA 3AERB 1I4LD 2W5UA 4IJWA 5KDDA 1P31A 4LVCA 1A9TA 4PF1A 2R7LA 2OZPA 4CTNA 4ZQHA 4FD2A 1VZ2A 4YONB 4MGYR 3KELA 4QTTB 4NECA 1U8TA 1UJMA 1TA0A 2H52A 2Z4SA 2ZJ1A 3EGOA 3L6OO 2G9NA 1GDDA 5LQAA 1JFFA 2ZEJA 1L7EA 5AM5A 5IUJC 4GBGA 1E2EA 1A50B 5FOWA 1FMCA 1AK1A 1JPVA 3RI3A 4G67A 4FCCA 5AW8A 3MJFA 4IL5A 4M0MA 3E7FA 4TRJA 2Q7OE 1QYWA 5JHHB 3FB1A 4BNFA 2HGZA 4XIYA 1PLLA 2VXBA 3REFA 1WZNA 1QFXA 4JLUA 1SUWA 5JC1A 4QPJC 2C2KA 1HNXB 2ETVA 4JI0B 3OZTA 5KNDH 3BB1A 5GPBA 1VRCA 2VPPA 3GD7A 1VJCA 4YC7A 1ZD2P 1RXIA 2OESA 1GTL1 5IBQA 2HJRA 1NVEA 1OLSA 1XVUA 1OT3A 2YZGA 3OJFA 4QECA 2R6AA 4B43A 2OCPA 2WHQA 3INRA 3VSBA 1ATZA 4YIHA 4PG6A 1JH8A 4BUZA 5DMHA 3KTOA 4C21A 2JAUA 3K2QA 2I91A 3T3PB 1U02A 5CIWA 1M8KA 4G2TA 3VXKA 4XTCS 1FFWA 2GM9A 2O2GA 4H9GA 1SIBE 3OPYB 4OHWA 3RYCA 1THGA 1WX1A 2ZUTA 2C5GA 1T9CA 4XARA 1JI0A 2O1EA 3WL7A 5J2TB 4QPDA 2BRUA 1G291 2PS0A 4ZTBA 2ZI9A 1R6TA 1JLMA 5KSWB 2R6GA 3AG5A 4PZEA 3SC2A 1NFFA 2H1RA 2I76A 2RH9B 3KOOA 3B3GA 1RVV1 5D3MA 3FWNA 1II9A 1Y1QA 2L82A 2W70A 3TPZA 3W5DA 4FFNA 4L28A 1JKJB 2JASA 1ZGHA 4AJ9A 2QE7D 1F48A 3UFXA 1IYZA 2CLOB 1DC4A 3AFOA 4KLCA 4ZI3A 5BXQC 5IS2A 1SZCA 1D2RA 5DP1A 1NVVR 1QTRA 3ZTYA 2FZCA 4K9SA 4V0RA 3K09A 2NTEA 3FRIA 1L5FA 3R9XA 3RSHA 1GPBA 3INYA 5B3LA 4IEEA 1AKWA 3NKLA 4NJMA 4DNXA 1R5OA 4LJKA 3OWHA 3X1DA 4TKLA 4H7HA 1Z6PA 1ZRMA 3I6ZA 1V1RB 4P93A 1P3DA 3WL4A 4N0DA 4NE2A 5CX1B 3MWEB 3NVMB 1XZIA 2XWSA 5B58T 4R3NA 2WV9A 5EPOA 2HA0A 3W8DA 4BO6A 2GPBA 2JFGA 3D0QA 3TFWA 2QJOA 3HUTA 5AVKA 4RVUA 3Q8MA 1ZVJA 4ZQBA 3VR4A 4XCVA 2B36A 3S99A 1E2JA 3OZEA 1QQ7A 1QKKA 4IJVA 3BIXA 3MLAA 4B40A 2XB4A 3HU5A 1NI4B 2BC9A 2AI3A 4P6VF 3IQDB 2UZ1A 1YJQA 3LLUA 3OCZA 1JKXA 5EJ4A 1SA0A 1FFYA 1IJFA 3EA5A 2IPMA 4ZT7A 3K8ZA 2CC2A 1NVAA 2XGGA 5LLSA 2GF2A 2LD4A 4HNSA 1VRVA 2HHHB 2XCRB 5A5FA 3N2KB 5JYBA 1ZZEA 1Y3AA 2XTJA 3HABA 1ZOIA 4ZEWA 3VMFA 2WHPB 5AI8A 2HW8A 1UBCA 5G41A 3RV3A 4YJHA 1JU3A 1F0NA 3L7JA 1P6XA 2K2WA 3CEHA 3E5MA 3CUKA 3O73A 1CUZA 2O5CA 2JLVA 1JHRA 3QM1A 4RAQA 3PC6A 1KQ3A 2O23A 2HRBA 2ZJ5A 1ZJ4A 1UPXA 4DW8A 4EPWA 1Z38A 1EUCA 3L1HA 4N41A 1U5BA 1YVDA 3A1EA 4D1YA 1XZ8A 1XXHA 2ZE7A 4FFOA 2G9ZA 2RH8A 4YCBA 5A4AA 1JILA 5DLPA 5H8WA 1Y4AE 3G2MA 4NCBA 2XDYA 1UKAA 3F6CA 2VPZA 4PAGA 1IN8A 1AQNA 2I6FA 2YFYA 5JJBA 5EIBD 4FLEA 2O7VA 4JFAA 2PKYX 2QXUA 3N70A 1ZJZA 3DLPX 3PC3A 2Q0SA 3NGMA 3W2TA 3WK8A 5IULC 1WBJB 2CNLA 4Z9AA 1QU2A 1GG8A 2X22A 1Y7LA 3NWPA 4DLZA 1GLGA 4LA4A 5BORA 1KR5A 1PWEA 4D9IA 2GYWA 2DR3A 1K92A 3S2EA 5SY4A 4A82A 1HDGO 1NXOA 3T1VA 1QWSA 3P9NA 5DYTA 2XTAA 4DZTA 4IKOA 4X6UA 5KQGA 5FIUA 2P77A 1RJEA 3F2IA 2GPJA 4M1QA 1YBHA 4NMWA 5G1PA 3OX4A 4AZ0B 1EM8B 1X15A 4PRKA 3FYUA 3GLHE 4IDNA 4EBFA 2WMDA 3HHPA 1MA0A 4ETWA 1WA5A 3H75A 1BZYA 1IM8A 5I7RA 2QB5A 1ZAKA 3LLSA 5AP9A 1ZFNA 3GAAA 5CVJA 3IUQA 1YD7A 1PQUA 4MRVA 1VG8A 2IUFA 5IDVA 1Y4UA 5K0GA 3KTAA 5LKAA 1NHWA 2XKKA 1NBWB 1RYDA 3CGWA 4PYNA 5EA2A 3TKLA 1ZGCA 3HN7A 3NIBA 3OICA 4Q4JB 4CODB 2FNAA 3HFJA 1HOXA 3K5PA 1YOBA 3TZLA 1ODLA 2Q1WA 3NR2A 2JCSA 3TLJA 5IZCA 1Y34E 5LXTA 2DKNA 2TECE 1QAQA 4ESHA 2QDKA 5AKJA 3S4YA 1E8MA 3L7DA 1CD5A 521PA 4YRNA 1WZCA 3IE0A 3IS3A 1SBQA 1R4NA 4LVOA 2IH2A 4NQZA 1KH1A 4LYJA 2FEKA 4LHSA 3BMQB 1CJKC 3MJ4A 4RBNA 3IIJA 4IXDA 3PQ2A 1HE1C 1NVTA 1Y8AA 3SIWA 3U09A 4COOA 1UMDA 4IEFB 1TX4B 4DA4A 3NOVA 2GAIA 4K9RA 3OLWA 5AVJA 3F98A 4IUYA 4EGFA 4CMIA 3AILA 3QW4B 3IAM6 1L5OA 3IQHX 4ZRMA 3U7JA 3EVAA 5HM6A 4INAA 3QU5A 4BO4A 1DSSG 2WIJA 5A9SA 4G0MA 3P26A 3SC3A 3NT5A 3W9SA 5IFKA 2ZK7A 2W0MA 3NGLA 1DOHA 4GLFA 4ZXFA 3TLCA 1P4RA 1JDUA 1UK7A 3GZJA 3AY0A 4EG8A 3JAMA 5JAHA 3COYA 4Y7DA 4GPD1 2Y2VA 2EGUA 3ZIUA 4HY3A 1WDKA 3GJ8A 3K9QO 2FJUA 2H4JA 3DQZA 5FOXA 5BN5B 3KDPA 2CD7A 1O5IA 3FSGA 3R5XA 2J6BA 4O63O 3ZXXA 2ZGVA 3CURA 2VAXA 1FP4A 3KQWA 1X0XA 5G40A 4R0NA 4FFVA 3AL0C 1ACMA 3O4JA 3E4CA 1OWOA 2AOTA 4L5AA 2X0NA 1JV2B 3OU7A 4I5GA 1M34A 4JT4A 3GLFE 1YDFA 4X6LA 1BVHA 4B3IA 1KJZA 3N75A 4DQVA 2JEZA 1GDHA 1AK2A 3RFUA 1KO1A 3JTMA 3KT6A 3SJUA 4HGPA 3GFFA 4OHRA 5LWHA 1MJNA 4CEHA 1OXSC 1U7HA 5GM1A 4UEKA 1NVGA 2Q5QA 1QBKC 1Y8QA 4JOSA 4E3ZA 3G8YA 3HACA 4O4IB 3UCEA 4QARA 3DCIA 3AEXA 3MD9A 4RHYA 1XAIA 3T9DA 1T1RA 5BR7A 4MUXA 4RUKA 2GXAA 3WK4A 4MYSA 6PFKA 1W49A 4HNTA 4ZKEA 1T1EA 1GLNA 2QK4A 5E1OA 2GKSA 3AXTA 4FFDA 5IF3A 3K6KA 4D5GA 3F6PA 1PNRA 2VQSA 3QXGA 2ZBDA 3GZNA 4REQA 5BYJA 5E9JA 3QPAA 4CCYA 1XZMA 3ZBQA 4KQIA 1ZD3A 3WLMA 2QSZA 1PR6A 1N7IA 4LYFA 5EHIA 1GFWA 1SIOA 3CZCA 2A30A 4NV1A 4QPZA 3ADCA 1Y33E 2OHOA 3COWA 1MC4A 1THZA 2F9FA 3FKJA 3NLLA 1HDCA 1U04A 4NOMA 3GJTA 3VNBA 4YAJA 3WRYA 1MZVA 1YQTA 2ZU6A 3EEQA 2O05A 3DWGA 1P91A 3UJ9A 3H5TA 5HSGA 1DC6A 2GH1A 3IMGA 4O4IA 5C8YF 1PIWA 1PWXA 4TSFD 1ADCA 5K0BA 3IJPA 2P68A 3SM9A 3JASB 3URKA 4PLYA 3IMKA 1BGXT 1I4EB 1ZIPA 3BJEA 3M83A 4N5MA 1V95A 3F6BX 2FJ0A 4EJMA 4DKXA 4D8TA 2GDJA 1DUIA 3THSA 4CG0A 5FAXA 3FMFA 4IHJA 5HCNA 3M5DA 3SJAA 1NNEA 1QH8B 2HV9A 4AUEA 4FMBB 5JAPA 3ZDBA 1N2BA 4C88A 3U0VA 5BUSA 2XMQA 1E89A 4KBYA 3U4HA 1ZX1A 1H2RS 2AB0A 4BWFB 2CLMB 5DYWA 4CKWA 1OX4B 2GZMA 3NTQA 4KWHA 3E8XA 1HRDA 2GAOA 4XM2A 2GN1A 4EGCB 3ADOA 3KBOA 3VYWA 2QMQA 3N9IA 3L7YA 4RSRA 1Z33A 3SNKA 4JB2A 1G20A 5C31A 4DYHA 3S27A 4FB5A 4PONA 1XCLA 1ZJ6A 4RWZA 3FCEA 3LF2A 2D7CA 4UUOA 2PA3A 3VQTA 2ILTA 2PO5A 5AW3A 3FBTA 3VVCA 4V02A 3ZU4A 4B3DA 1ZQ9A 1E77A 1P29A 4IFEA 4ZI7A 4XVUA 4CVNA 1X7ZA 1K8QA 4MCIA 4RW0A 4HO1X 3ND6A 2W4IA 1XZNA 3VO2A 2VJNA 1GPAA 4JHXA 1RKVA 5F1OA 2A3RA 4RL6A 1KA9H 1MP0A 4HLNA 5KNLA 3MJDA 2W8ZA 1Q57A 3N87A 1ODFA 2BMDA 1BDBA 1DKRA 2JDIA 2Y1GA 1A69A 2BGJA 1W88A 3IV9A 1AA9A 3IBCA 4QG7A 1Z3CA 3UB3A 3GUCA 2CMDA 4J2HA 4YA6A 1LBSA 2XMGA 3BCHA 6REQA 1P73A 2GEFA 3AI3A 4PLFA 2VPTA 1DQSA 2Y4NA 2YS6A 3JWGA 2WWFA 5HTKA 2VK2A 4CW7A 4OVKA 4ETMA 1MX1A 4NBLA 4CUZA 1GLVA 1P2BA 3GCGA 3R6DA 4F0JA 1H8HD 4EMTA 2GJ4A 2QVYX 5T41A 1WY7A 3JYPA 4MPTA 3I45A 4EY3A 3NC1C 2BUBA 1XDUA 1AKEA 1YS7A 3I1FA 3LX8A 3PA6A 3OG9A 3GEDA 1NQ5A 3K9NA 2DUJA 3TLEA 4HFMA 5HWSA 3VVBA 5JH7A 4L2IA 4EMBA 2ODBA 2JFZA 5FBRB 4GYWA 1Z83A 4YQEA 3ST7A 4AM8A 4ZN6A 2DM6A 3O95A 4Z4QA 1PQ4A 3O4IA 4X7PA 1EP9A 1QM5A 2ZT6A 2TRSB 2RD2A 2AK2A 2DKFA 2QL6A 3ASVA 4HGNA 1FNSA 2EWMA 2ZSDA 4KE8A 4DMKA 5JCJD 2V58A 4P5PA 4KIWA 1IMOA 3B1VA 5DASA 4KZKA 4Y30A 3RRJA 2R11A 4LJ7A 4PZCA 4Y9DA 2XXAA 4LRUA 4XB6B 5AKZA 2D00A 3P4UA 2ZXEA 2G71A 3UG6A 3BILA 4M0DA 5FBZA 1MJFA 2NUBA 2V7XA 3AVPA 1S2NA 3OQHA 1U8YA 2ZE8A 1KXZA 4ER0A 5A4JA 4J4BA 4PAQA 1YULA 3H5RA 3DUFB 1EP3B 1X77A 3X1JA 5SZHB 3S29A 3UY4A 2C2OA 1CK4A 1HDIA 3CT4A 1OGJA 4HDSB 3VX4A 2BH2A 4H18A 1EQ2A 4UXJA 3I01M 1UFQA 1WNTA 3KSUA 1Q19A 3NTXA 1XP8A 1NP6A 4HN9A 4QNRA 4DA8A 2NU9B 3OM0A 4NYMQ 1NVXQ 4G0UA 1XNHA 3QBTA 3VU9A 5EIOA 1WR8A 3RG8A 4Z53A 2FQXA 2G04A 1M5UA 4QA9A 1FVOA 3NG1A 3DZIA 2CMHA 3SJCA 3SU8A 3MBIA 2YUTA 3QF7A 1CDOA 2Z56A 3CEPB 3PHLA 3N07A 3FYCA 1GL7A 1VP9A 5CCEA 4HGRA 3M81A 2V6IA 4UVHA 1YUBA 5DM70 1MOPA 4RE6A 4XD7D 3QQ5A 3BG5A 2ZYVX 4G86A 5CBPA 4NAHA 5DCYA 3H4IA 2XCIA 4ER7A 1SKBA 4DQDA 2JJ1D 2Q0QA 3MRVA 3I32A 3P2JA 3P94A 4EPRA 1DKLA 1F4LA 3D1JA 5FJJA 4UUMA 3J81k 1UP6A 1F1BA 1T9ZA 1YU9A 3ADDA 4E4TA 4HQRA 1Q12A 2DCMA 2JAOA 1DP4A 1U4NA 2FFRA 3AJ9A 3TUIC 3GFOA 3GUZA 4YR9A 5DM0A 2JHGA 1GUBA 2W48A 3KJQA 3H11B 3ZWMA 2FSHA 4EUEA 3K9HA 2VTBA 1XU4A 3BHJA 3BS4A 3FFXA 1DAKA 4FE3A 5ECDA 1O95D 2PRSA 3AYXB 2P2LA 4GECA 1CUCA 1XJCA 4HDKA 4CM1A 4PZUA 1I1QB 3UJPA 3ROGA 1V1MB 3IXLA 1A8SA 1A0OA 1NKSA 5I5EA 5EQFA 2BHNA 4C76A 3CMMA 1OB2A 4MHTA 1CRZA 3N2LA 2YQZA 1OJLA 1GPLA 2AD5A 3QHQA 1QOQB 4GKBA 3B1FA 1O94A 2GM5A 3H4TA 3OC6A 4LVNA 4NARA 4P54A 5EHGA 3KPUA 5EXXA 3CXRA 2OZLB 5NLLA 3BXPA 1PS8A 2QG9A 4DRXB 2D5LA 3JQPA 4JBHA 1WUHS 4B2LA 3FTCA 4KPUA 1FFAA 3MA0A 2YS7A 4AQ7A 4L1KA 2IYPA 2X0FA 1YRAA 1BTOA 1GTZA 4D4JA 2G25A 3QYPA 4LQLA 3A3NA 3B53X 4KRYA 1YMUA 4B33A 5K99A 3BPSA 4UBMA 2OCGA 4BYMA 2XB2A 1HSOA 1KJWA 4S1OA 4JYPA 2IV7A 4QATA 3SDBA 5IEJA 1B26A 2B0JA 1KP3A 1SCQA 2G4LA 1CDEA 3AVQA 3KUUA 4CKYA 2P11A 1HZZC 2A57A 4D43A 4ZVOA 3X3HA 1TVEA 3HO8A 1KZ1A 4MKXA 3BVPA 1U6JA 2P79A 1GPKA 2X9VA 1QV7A 1HETA 4MH0R 4RORA 4F85A 1C1DB 4F9TA 4GX2A 3QE9Y 4ZAGA 3N0TA 3U7RA 4FK8A 1J39A 3RVJA 1DLJA 1A8UA 2FUEA 3R5JA 3I1YA 4ENRA 1C7ZA 2F43B 5AK3A 2JFNA 1JVSA 4TT3D 2PZJA 2QLMA 3Q2OA 3L1KA 4KGVA 3T0FA 1QANA 3CSUA 4JKOA 1R6UA 3K5WA 1USUA 2JIPA 4HGQA 5JMOA 5J23A 4Y2SA 3ITNA 2FDXA 2Y71A 3FKSD 1NNSA 2FFBA 4KXWA 5C32A 2BKUA 4M1YA 4IMRA 7MDHA 5LNK1 1ZN7A 5TIIA 2PT6A 3RVSA 2Q6OA 1TD9A 3A06A 4PRLA 1QYVA 2WJAA 2XPCA 3HKCA 5EHNA 3ZHSA 2QUAA 3ZQKA 2O7QA 2BCJQ 2C2HA 2EFYA 1DWQA 2A5LA 2R6JA 4RLHA 4G8BA 4J75A 4KGZA 1AS0A 2RAVA 1B6TA 2HLPA 5EAIA 1RHMA 4G5XA 1Y3BE 4TMTA 5HUHA 3OX3A 2AKAB 4IS2A 4K9LA 3FTPA 4L5CA 1MQSA 1EHCA 1AC5A 1I1NA 3ZCQA 2C7RA 3GLVA 2Y0BA 4GPIB 3TUJC 1Z28A 2JLRA 3UQYS 5EG5A 4YAOA 4Q34A 1MO4A 1VPTA 5JYDA 3QX9A 1YL6A 4JH0A 4HLUA 4ODIA 2HMSA 3NRJA 2PR2A 2X86A 2ZUBA 3KJXA 4RDCA 3TL3A 2I34A 4E0BA 4M0UA 3JQ9A 4ZYUA 3ZWDA 2E9SA 3HDVA 3GCXA 4MZDA 4FHEA 4TT3A 3IKTA 3ZGZA 4HLCA 1YE3A 1D09A 5C8YB 2VUUA 4NMLA 4EHFA 2WZCA 3HM2A 2XF8A 2LE0A 1S3GA 3OURA 3S2ZA 5KKCA 4R2JA 4PPNA 3DNMA 4XUGB 2OSBA 4H1WA 4PIMA 3ZDYB 4UOZA 5KTMA 2OBBA 2B1IA 5TQ2A 2WFLA 4ESEA 5I48A 3KYBA 3LXMA 3FLEA 4DLUA 4RFSB 4B6JA 3H9BA 4BWYA 4XCQA 1L9XA 4A6PA 4UHFA 1L6IA 1E3WA 1NN3A 3Q6MA 5BO5A 1C7EA 2E21A 3KOWA 2R8EA 3H83A 1OGIA 4ZCSA 3I30X 1ZU5A 1TJYA 3N5CA 3TQCA 3RRYA 1OMOA 1T13A 1P7VA 1U7TA 2R751 5DYYA 4A4DA 4C6HA 2VAVA 2HTEA 5JR3A 1Z62A 8LDHA 4WX2B 2I99A 3HB9A 4NABA 2VR1A 5DGHA 3WNVA 1G60A 1A1SA 1W76A 2P2CA 3AOGA 4OF4A 2WMYA 1JR3E 2HLNA 4OMFG 3V4VB 5F2NA 5FUXA 4NU0A 1DJQA 5DM4A 1ZGAA 3B6ZA 1HDXA 1E9SA 1IC6A 2FG5A 2QR5A 3DWIA 3EG9B 3AEQA 4FZ5A 4W1SA 1RE0A 2W6CX 2O4UX 1M2OA 5EUQB 3AL3A 4ND5A 1Q1ZA 1ZH6A 3LW8A 3SY8A 1WY5A 4BX8A 1EUDB 1BMQA 4LZAA 2RC6A 2Q3BA 3GGPA 4FZ3A 3R7BA 4CEJB 5L7YA 2ODAA 2Q9CA 4DUGD 3MK31 1L4BA 3EJ6A 1XCJA 4OSEA 2B2CA 3VR0A 1YS1X 1X7HA 4J16C 3UHFA 2DULA 5KVQA 2OYCA 3D8NA 3RR2A 3X1MA 3VYRB 3UGTA 2XQFA 4PC7A 1RHKA 5EWJB 2VJAA 3EDYA 3M4JA 5CHEA 4OFBA 4IH4A 1J25A 3ZWKA 2EFDB 1RWQA 1AQ6A 2QRVA 4U2CA 3MS2A 4L3WA 2NNLD 1UJBA 2CV1A 3ZU3A 1BHJA 3K96A 4MDEA 2F1IA 3RE1A 3B1XA 2QR3A 4HH3C 5KWSA 2UVPA 3ZBUA 1U9IC 4G25A 1T4BA 4IS3A 3M6UA 5IWCA 1W1WA 2G9VA 3G5TA 2WJYA 3VTAA 4FGSA 3I9FA 4DDWA 1UL1X 1ZMTA 3ETJA 3D6UA 5DNWA 3T35A 3PFBA 1GQSA 1ISGA 3BM5A 5FBVB 1J1ZA 1HTTA 4NOLA 1ONSA 4ZJYA 3EVEA 4RQBA 2JGRA 1GRCA 1EYZA 3A8TA 3CRZA 1NC1A 2EFCB 3C8UA 5IBRA 5GGYA 1XKTA 2ILVA 3LQ4A 4V0KA 4CLXA 3TAUA 1CT9A 1G42A 4EFKA 4U2KA 4EHBA 1U9CA 2V54A 2EVWX 1OIXA 1L7AA 2PLWA 1CX9B 2PZMA 1INLA 4RJTA 5EP3A 2RGGA 1J2UA 4KQCA 3TQTA 4HK4A 1GGJA 1NE2A 5JLAA 1RXEA 3I9NA 1T2EA 2P2ZA 4KDEA 2JJ2D 3QWHA 2AMYA 3WGGA 4JLBA 4IWXA 3EGWA 4AKTA 3IP5A 4RJLA 3HYNA 2ES4A 3QFFA 3W4KA 3F5DA 2CXRA 5K8LA 2HOQA 4BFVA 5HJ5A 2ZZNA 1YR6A 4EFLA 2FFHA 1A9XA 1ULTA 2HXYA 2VJYA 2DBYA 2YWCA 3PRJA 4US1R 1YQ9A 3OMWA 5M04A 2IEDA 1BFDA 3HY3A 5BNIA 4XLTA 4FMCF 3IEXA 1NR1A 3PJFA 3QLTA 4NU5A 1Y1LA 2DHRA 1M73E 1NLZA 2XT6A 4MVJI 3FZQA 3OPMA 1I6MA 2GRJA 3NUZA 4M9QA 2GJ9A 5AI6A 1R50A 1YK1A 1JIXA 4RU1A 5BSRA 1QTIA 4Q9JA 1ZIXA 1SUPA 3I01A 2UXDB 3L79A 3GRYA 4PLHA 5K6RA 4OLBA 4A03A 1KTVA 3G9XA 1SEPA 4DCMA 4BGEA 4FHGA 4RXTA 4CU2A 4BMZA 5EESA 5DN6D 4IM7A 3LPMA 4XGQA 2C78A 4QYSA 5BWOA 2ZYAA 3WQHA 3AVOA 1DG9A 1J99A 1G63A 4PX5A 5DGXA 3W1EA 4L0MA 4WLNA 5C35A 1KDYA 5D86A 3NW9A 3IO5A 5ALLA 1SY7A 2A9KA 1Z75A 5IJWA 4K9KA 1W5SA 2I6GA 1QG4A 2QROA 4C3OB 1O96B 3U80A 4YQFA 3C87A 4OTZA 2FY8A 1T4DA 3VI4B 4Z2AA 2BM1A 4JCOA 4W1QA 4DPKA 3CKMA 3KZMA 5B6PA 4W82A 4TYNA 2CJFA 3NYWA 5BWBA 5I8WA 1C81A 1QCZA 3BMCA 3IFSA 3QVJA 2KJQA 1G66A 2AEFA 2FZEA 3CUTA 4U4AA 4D7AA 4EHJA 3IAM1 5A7GA 4WXPA 3OIGA 1E99A 4KFUA 5JI2E 4L8VA 2EYUA 1YH3A 5KS2A 1HLFA 4ZT6A 5LQSA 3TN7A 1HKUA 1Y7HA 4M9RA 3VUFA 2PFSA 3EAQA 3K2BA 1OC4A 3L7KA 2PXCA 3QXCA 4RMNA 4BEWA 4BDSA 4HFRA 5EHQA 5CFPA 4RTSA 4IRUB 2V6MA 3GAZA 3P0FA 1J9ZA 4JLOA 3RAFC 3OIDA 1DDOA 4BNWA 1FU8A 4Z2YA 4LTMA 4EB6B 2VF7A 3SLRA 3ZKWB 3RH0A 3ZCSA 4RACA 1W4RA 2CLFB 3OOHA 4OQFA 3PICA 3PL1A 1MKYA 3QBJA 2WOOA 3GOQA 2GJ8A 5JVDB 1XEWY 2JG3A 4DPMA 4E3WA 1N36B 3B7GA 2J5XA 2D3WA 4AF6A 4JEMA 5CA1B 4F4FA 1P2SA 5D85A 1M5TA 1NXTA 2VDLB 3CC8A 3BZUA 3LBYA 3RVRA 2ZLBA 1PEKE 3VYSB 2J3IA 4K46A 4M21A 2NU7A 1J0CA 3A3OA 3LPCA 2H6EA 3I62A 2HUPA 3OIFA 3RK1A 1EMDA 4PCLA 2ZBUA 2UZ1B 3C7KA 3CVJA 4BP8A 3PHIA 1Y6RA 1E0AA 2B5VA 2I6UA 2P1ZA 3R8XA 1NBHA 4IIEA 5ALSA 3FDZB 3ZI0A 1WSBA 2WFZA 1GCAA 1OYOA 5JZBA 4KHZA 2WRZA 1DBSA 3FLBA 3ZGYA 3KEFA 5KO2A 2JI9A 1WOYA 4LI3X 1DS6A 1UUFA 1YE5A 5FI3A 5JZSA 2XYHA 3FHCB 3M49A 4XX0B 1B8VA 3F6SA 1DADA 1DAPA 3E7WA 2AKYA 3K0CA 3OE5A 4LE1A 3DVAA 5E6SB 4UTVA 5JAMA 3FTFA 3L77A 4JI2B 3UMCA 4B4OA 5DZSA 1W47A 4GAEA 4BQNA 2PYZA 1HKHA 5TPZA 3BF7A 4CEJA 3OQOA 1OT5A 4IXWA 4EL5A 2R97A 3BMCB 3EY9A 4D99A 1P7WA 1QMPA 4MYRA 3UOAB 1B42A 1ZP6A 3GJQA 3IX7A 3K20A 4M8KA 3EOBI 4QNNA 3UWMA 5FHQA 3KYDB 5F52A 1TM1E 1R88A 2F1OA 3C3EA 3FJ1A 3IBYA 2QORA 4TUYB 5C1IA 2OXTA 3SVZA 3TW0A 2C82A 1NUPA 4ZVMA 4AU1A 5IM4A 1N8TA 4HVTA 1RXWA 2NMVA 2JAHA 2FE1A 4IGFA 4AUMA 3C2QA 3WP0A 3ERCA 5K2MA 5FA8A 5FD8A 1UDAA 2FF5A 5F2EA 3EDCA 3BXEA 1K6MA 3HKBB 3STWA 3NFYA 3QUTA 3G82C 4INOA 4D97A 1EWRA 2LVBA 2PG3A 1QLHA 3G7UA 3U1TA 1T0UA 3WLPA 4BB5A 3IKLA 5EQJB 3SE7A 2H5IA 4A92A 2NWQA 4KJZA 1P9RA 1Q7TA 2NGRA 2P0YA 1ZXLA 3OCXA 4O4HB 2EJWA 1IZ9A 3ESRA 4IZOA 3CUUA 1H1LA 1UDBA 4IG4A 3SBEA 4O3FA 1NY5A 3BWBA 3CUVA 3WV4A 3L7MA 4N6OA 5J5AA 1WZEA 3K71B 3N86A 4V24A 2OZEA 3HCNA 4II3A 4E1VA 3KWLA 2FCRA 4PZPA 3GDFA 1HE4A 3CF4G 3FB4A 4AZTA 4EATA 1LBTA 1G3IA 1WS6A 1UBGA 1JAHA 1HEIA 1R9JA 1FMLA 1EUQA 4BFTA 2QKYA 3ABQB 1N8KA 4NAUA 5T4BA 5C1BA 1TEHA 3B36A 3LLMA 4MRNA 2BFBB 2HNBA 4G5GA 2JGEA 1PGOA 1RHRA 3PUKA 2HXGA 3LRXA 5E4YA 2H3HA 5EKSA 3ESCA 4PX3A 4H7KA 4U7DA 1H93A 1ENOA 2FZKA 3L8DA 3NYQA 3WYDA 3UAYA 4NFYA 1GG2A 4P5EA 2FPLA 2FETA 1LV7A 3LX5A 3WSVA 1KPIA 2QSYA 4PR0A 3C7TA 4PO9A 2OVBA 2JLSA 4LSWA 1JALA 4WBNB 4KQ2A 1QVWA 2JDID 3A1DA 3AWIA 3H9GA 5KCZA 4D4GA 1F6WA 1FZTA 9LDBA 3LC2O 1K4KA 3ZY3A 3AHFA 4D9FA 3GL9A 4R1SA 3KUXA 4B3JA 1NONA 1II0A 3NB0A 1IN5A 3IDQA 1ZOOA 4B44A 4ZIRB 2O2ZA 5GAJA 5BYBA 4BRZA 1JRLA 4CMKA 4BVHA 3NORA 2O8EA 4R16A 1XTTA 3KKPA 3USZA 1QIGA 2V59A 1TUIA 1I0ZA 4UAUA 4CIAA 4J76A 1EJBA 2IYZA 4PFQA 1UFOA 5LM3A 4MUFA 3L49A 2EQAA 2XITA 3OZRA 2IX3A 2NP7A 1HURA 1ZNXA 1YC5A 2Z95A 1ZDMA 2IIBA 5IC4A 1GR1A 2F90A 1I7NA 2Q99A 3PNSA 2QRVB 1UZLA 1I5OA 3PZBA 5DN6A 4PHTA 7ABPA 4O3MA 1KY3A 1ZCBA 2OBFA 3VH2A 3I5UA 2X8WA 1BKYA 4YJ3F 4HZUB 3IVXA 1L5ZA 2M6LA 1PR2A 5CLQA 1ZJJA 4KPFC 2PGOA 4AECA 2X9GA 1U2GA 3E1SA 1OXKB 3Q9LA 2ATVA 3V1MA 2OOKA 2HDHA 1C8LA 3PD1A 4JDUA 4JYBA 1SG6A 2QMEA 3OX1A 3OZCA 2HCBA 2Z3VA 5T4EA 3WL3A 4A1OA 3EMKA 4L15A 3VR2D 4GVXA 3N8DA 4R83A 1WZIA 4IJQA 1DZIA 1HNNA 2DQ4A 3VNUA 3HL0A 5D5QA 5FTMA 4ETNA 4J90A 4QOHA 5FH9A 2A0KA 2VBFA 4W1PA 1DGQA 2B7CA 3CO5A 3W6ZA 3L8MA 1PT7A 2BEVB 3F5SA 3LHKA 4JL6A 1CETA 2W6IA 3EZYA 2CCJA 4JA0A 4XCXA 5KWEA 1L1RA 1ND5A 2KLHA 1JIIA 1D07A 3D3NA 3JXEA 1TT5A 4R71A 1SMKA 5BSFA 1O0SA 4LX0A 3V8QA 2HEGA 2LRHA 2HBZA 4IIUA 4YP1A 3GVPA 5F7OA 1PK9A 5EWMB 4YPVA 2IYEA 2Y68A 3IUMA 4RA9A 4RZQA 1YQXA 4NZOA 4R8RA 1PW5A 4YPFA 2GFIA 2BVNA 4WXRA 1M1UA 5K3FB 4D3SA 1C30A 4IHKA 4LYEA 5E6SA 5ALVA 1E7QA 1H65A 3WB2A 3BBLA 4HXGA 4UVEA 4A8TA 2VNHA 2JBHA 5LL6P 2QR2A 1I2AA 1TNDA 1RLUA 3AHJA 4WRRA 3HB0A 2WD9A 4KNVA 4MWZA 4V2UA 1KK2A 3PLRA 1F1JA 3AM4A 2XCQA 2Y1OA 2HNKA 2ZYWX 1I4DD 2CE2X 1U2DC 4F7WA 2WE7A 2G1AA 4PGHA 5HPYB 2DY1A 1IJEA 4MNTA 1YDHA 1N2CB 2O7NA 4TXMA 5ENZA 3BICA 5BSWA 1LFDB 2C9ZA 4DDKA 1YNSA 3S5UA 1NDUA 3EUEA 4BWVA 3T1QA 2QTWB 3RJMA 1NBMD 4EHDA 4FYMA 3CLTC 2Z2KA 3DNFA 5IJ9A 2ZAGA 3BZWA 1Z0SA 2XZLA 2ZITA 1LX7A 1MO2A 1XJ0A 2GAFA 3B82A 2BCEA 1D2EA 3Q3CA 2C0CA 4HBZA 4LMAA 3QMWA 1JDNA 1GZUA 3JW8A 1C1XB 1V2GA 3ICOA 4ZVVA 1ZJ5A 1ZKDA 2AG0A 5DIFA 5ILQA 4JP3A 1CUGA 1Z0UA 2B82A 5CFQA 5C8VA 2UYYA 1NPDA 1JQDA 1E3DA 1TUGA 2GBLA 1Z2DA 2JGAA 3K4HA 2DOKA 2QM7A 2VHQA 1KJJA 3JQ7A 3N2ZB 1AKVA 3QBVA 1DI0A 4Y6RA 4C4RA 2C2WA 4F6LA 2BGTA 1E9FA 2JI7A 4I2VA 4HNHA 2FPGB 3SX2A 1Z63A 3LSYA 2OEPA 1UDRA 4HI0E 1L5HB 4RIHA 2I71A 1WL8A 3O2JA 1QVVA 2O8DB 3KQVA 2NSHA 2YFKA 4C0KA 2DWUA 7REQA 3OOYA 3NHZA 5EMJA 3PNVA 5AXCA 4MR7B 5JE8A 2FLWA 3UCFA 4BMXA 4DS3A 4A16A 3H5AA 5C52B 1T8UA 4H2DA 4QXMA 2W8BA 1UK6A 3F3KA 3HZZA 4JYCA 2PPLA 3RYTC 3C3AA 1XEXB 4ND2A 2B4AA 3HJRA 3KEGA 4QELA 2MCFA 4C05A 2X15A 8MHTA 3CTMA 1R27A 1Z2PX 4PYOA 4G1BA 1KQFA 5EVCA 1W5EA 4G85A 4R7ZA 3WGKA 1PR3A 5CU7A 1GEEA 1FFBA 1XA4A 1U7WA 2K2QB 4J3NA 1VLJA 1H2ZA 1XZHA 1AA6A 4N3AA 1PV4A 1JN0A 2WE8A 2Q3MA 1BGWA 4L8FA 3FPSA 4BKMA 3T5CA 3CW9A 4FT4A 1B0UA 3I09A 4RABA 2UAGA 4F2PA 2R8YA 2I7XA 5IKOA 4DB4A 4B3SB 3PJGA 4WBNF 5LC1A 5KTRA 1KVSA 3LY7A 3O8RA 3QY9A 5E8JA 1K4YA 2VF8A 1TEZA 2H1OA 1A4IA 1MVLA 1M9NA 1RWOA 3K9LA 4IZIA 4Q15A 4EEZA 3D5TA 2QTCA 1FTWA 1V35A 1YGYA 3W4JA 2UUBB 3OIVA 4P22A 2EEZA 2ZRNA 2RHHA 3CH6A 3GLHA 3AG6A 3MINA 2ZTHA 4X8LA 3IUJA 3ORRA 2OECA 3TCKA 1VL2A 3JASA 3CW8X 3IQIX 3JU3A 4M9XA 4XFDA 4WASA 3RPEA 3KYJB 3QIVA 4M9SA 5DHQA 3KT8A 3A70A 4DIKA 2IH4A 4WL0A 3C3BA 3VO1A 1DJPA 2OCLA 4LWQA 2IS6A 1AV6A 4DB2A 3IAS1 1EM6A 1HT3A 1MF7A 1RBMA 4EJSC 2GCPA 4CTKA 4Q9DA 2IEIA 2YXEA 4C2TA 3QSGA 1OR8A 1HBJA 2PR7A 1OWMA 3DYVA 2K7ZA 3UJ6A 1LI4A 4DDVA 1FSZA 3B9QA 3DFIA 5F5XA 3TLXA 4E5SA 2FP3A 1QIHA 3W8RA 2XRYA 1LBHA 1L7RA 4XKJA 4GFDA 2HT1A 1Q3HA 4LC9A 5J59A 1OYVA 1QHXA 3S70A 1W0KA 2OV8A 1C9YA 2VYNA 4HHEA 4MUNA 1KZGB 4Z51A 2KMLA 2XD4A 1MC1A 2SKDA 4OHUA 3UH0A 2W2NA 3V7FA 4CL3A 3UTDA 1XVLA 4KK4A 3WC4A 1KERA 1XQXA 4YCAA 4NVRA 3ROMA 2ZYTX 4HB0A 4EPXA 3FOEC 4FQ5A 1L4LA 4RAOA 2C84A 1KTIA 1Z17A 1XZCA 5F5LA 3VPCA 3G2JA 5LU8A 1REQB 4WI1A 1BE0A 2AQIA 2HK7A 3K35A 4I55A 4AS3A 1ZSNA 1JHOA 1G5HA 2IUEA 4F6CA 4B76A 3CS3A 1N3YA 2E49A 1Y3HA 4BKUA 1LPAB 1DO2A 4CFYA 1XU9A 2OGTA 3PGVA 4ESOA 4UBOA 1YB7A 3C3PA 4PBSA 3TNDA 4BLSA 3AUYA 4N65A 2DG2A 1VGQA 1FF9A 4QFBA 2C4UA 2FK8A 2ZRJA 4JBNA 5FPTA 4B47A 3LT1A 2L69A 2WHPA 3AI2A 1PLJA 1IEVA 3MT0A 4HZGA 3PGXA 2AFRA 2G63A 3VJMA 3Q15C 2WA1A 2WK1A 2ZRCA 3T95A 4R1QA 2HA2A 1LLCA 1FRVA 4FPXA 1R8XA 1HUQA 1BS2A 3PNYA 5JY1A 1Q92A 2OQIA 4UATA 1WCV1 4DR4B 3O9MA 2JF0A 2VSYA 1FFSA 3DULA 2RC5A 4O4LA 3W5SA 3U3RA 5JEEA 3ZW7A 4TKUB 5EXPA 2P4HX 5B3JC 1EQUA 2CZCA 1S7GA 3LA8A 3S3TA 1XC7A 2FEPA 4IVNA 3ENVA 3PQ8A 5DF1A 4AO7A 1X14A 4I1SA 4U2FA 1JWBB 2HU7A 3FCSB 4CIWA 1QQAA 2BE7A 5WRFA 1MG5A 3PITA 4KUGA 1NU6A 4L95C 4LK2A 3P2MA 4OK6A 1HYQA 2YJ6A 3GGGA 3NKFA 4GMKA 2V1UA 4XYEA 1FDOA 3CRMA 3RK0A 4RFSA 4ZOLF 2HU8A 1M1ZA 2O07A 3NDJA 5EQTA 1T3GA 3IB3A 4MXDA 3BORA 5FFNA 3V1LA 3I2YX 3DGFC 2H0QA 1PV2A 1DC5A 1R74A 2QZ4A 1UIRA 5DRYA 4ZI7B 3HXTA 1ULSA 4MS3A 1T8TA 3CR7A 1WDWB 1TW3A 3KOMA 3MTEA 3W5HA 1IVYA 3ZVRA 1LPNA 4E33A 5I4CA 1BVRA 6ABPA 3LQYA 1NR7A 4WEOA 4L9AA 3SZMA 1YVUA 3NKVA 4LJ8A 1W6RA 5DVZA 1WKBA 1WWKA 4MR8B 1CQPA 3GY0A 4TV9B 3P27A 4PSUA 3HO1A 3EF0A 5EKUA 2IV3A 1T9DA 3DFFA 1JFVA 5A6SB 1CQJA 2JIQA 2FGKA 2WTXA 3D5QA 5ES3A 4TKMA 1FXWF 1T2NA 1C2YA 2FW8A 2FN7A 4WCFB 1Q0QA 2NZWA 3G6KA 1QQTA 2NXCA 1KKMA 2V7BA 3NHWA 3QRWA 5K3EA 1XSEA 4MIEA 1ZXBA 1FQWA 1KK0A 1FPQA 1MN6A 2EX0A 1WMSA 3LSTA 3MELA 4X00A 4D9BA 2AI1A 3IAS6 1SC1A 1GARA 3UPTA 2EOAA 2DPHA 2DQZA 2ZYIA 4JKIA 5JJKA 1G20E 1W9MA 4NNOA 3RNOA 1O8BA 4UEQA 4RK6A 2B83A 2OAEA 4P2GA 2ZR0A 1O9HA 1ZL2A 1XRSB 2H4YA 1KJNA 4X91A 1JPUA 1UANA 3VR2A 1PL6A 4FDTA 4R40A 4WY5A 1DIAA 2GM3A 4EFMA 3BMNB 4NV0A 1KDPA 2R87A 1PS9A 4BGIA 2I66A 4TKVB 4AJJA 1NL3A 3H2ZA 2ADOA 3G2QA 3MAJA 3OHMA 4HDMB 4IH9A 1H1TA 2BJVA 2O50A 2BD0A 2M6KA 1S3SA 1B7GO 1QHNA 3C1OA 3QU9A 4G4SP 3UMYA 1IUNA 4LY6A 3N7AA 3VZSA 3PX2A 2OXIA 1E8NA 3A28A 1KC3A 5ALPA 2BDTA 1IXKA 1V3TA 2ZUVA 3DEAA 4RVGA 2JW5A 1Z06A 4R1TA 4LDAA 721PA 1XMPA 5KMGA 3AJRA 4C29A 4BEVA 1BN7A 1EFHA 5MN4A 4LISA 3E3MA 2J3DA 5B2FA 4IY1A 2GA9A 5KZMB 3G2NA 3BE5A 1QRDA 4BO5A 2F62A 3UANA 1JYEA 3HNOA 1ZPDA 2F7SA 2ZRFA 3GJZA 3OUTA 3RFFA 3JRWA 1YDEA 1AIPA 5F7ZA 5AH0A 2GPAA 3L6UA 3NV9A 4H77A 1PFUA 4LQCA 4CQMA 5HEKA 4L73A 3W3ZB 3NASA 5IJAA 2BEJA 2Z5LA 3G0OA 4NIMA 3HXLA 1GQFA 4P8RA 5LZ5A 4BFXA 3P0EA 5EJFA 2VDQB 1VKRA 2BZSA 4BE9A 3OT4A 2CXOA 2AMFA 2QWXA 3AR2A 2JVIA 2FQQA 5DN9A 5FP0A 1FLVA 3OY7A 1PI3A 1PJZA 3ROQA 4EHAA 5KNBD 2R65A 2D8MA 1C3VA 2ZJZA 3JVEA 4LPKA 4BB6A 1T5SA 5FB3A 4YRDA 2J7PD 4YWJA 1QIEA 5LBUA 4EO9A 1HYEA 2HDWA 5AM1A 3LRPA 4CEIB 3RRZA 4ZT2A 1LPOA 1O57A 4CKBA 1IBRA 4XGNA 5DBFA 1WHTA 1WP9A 1F9EA 2IFTA 2ORWA 1MB9A 3IP3A 5CT6A 1CEEA 4L74A 4TSFA 2CEKA 2X19A 4BAGA 1GL9B 1NLMA 3B1YA 2I55A 1YI1A 1P1KA 1AKUA 4MGEA 1M1YA 2C54A 3L0SA 2KYRA 3EUFA 1XLTC 3K05A 1RQPA 4DA6A 4DCUA 1GGFA 1O6FA 1SBNE 3IULA 1XXLA 2R6DA 2YQ5A 2OCBA 4HR7A 4COKA 2PKEA 4EB8A 1PT6A 4AULA 4ZK2A 1BXRA 3QGMA 4L5IA 4R1OA 2XZOA 4CF7A 3QJGA 3WYAA 1VSQA 2QRUA 4D9JA 1I7SB 2GAJA 4KHPB 3ZXUB 1CPYA 1UJ2A 1X8XA 1SOMA 2LWIA 3KLBA 4ZXPA 1RZRA 4LHVA 5CXSA 3H1PA 1H1DA 3A1UA 2BSXA 1E2GA 3D6FA 2CBGA 4L7QA 4PPQA 2WVHA 1FVHA 3HFSA 4PZYA 4UFOA 4XR4A 1SVNA 1YFKA 3KQUA 1Y89A 4QAJA 5DI9A 3SR0A 1MAVA 4NYIQ 4TMXA 5A9TA 4DA9A 3KKZA 4OHPA 2ZWVA 2JI8A 4ALLA 2C94A 4BMVA 2NYRA 3QWAA 4Z5XA 4ND3A 2Q1SA 2IOQA 4FEYA 3CLSD 4N3BA 4I9NA 2I4OA 1RZVA 4YLEA 1BMTA 5ITWA 3B6EA 1KDRA 2JLUA 2CLSA 3DLCA 4BAUA 3RU9A 1SUIA 3A4MA 2VF2A 4I50F 4TTSA 1L5KA 4OGLA 1ZH0A 4ARVA 1R1DA 1GNRA 3D6VA 2B34A 2WMNB 2F1HA 4YRGA 3LT2A 1G8AA 1DJOA 4CQNA 4UDXX 2W2VA 1GPYA 2UDPA 2PZAA 2KBFA 4J3JA 3KTFA 4MS4A 4N5DA 4JLDA 4BKRA 5ERGB 3I37X 4XRRA 3KVYA 4L2IB 4BMNA 1Y4ZA 4L6IA 3JWEA 4N0QA 3TJRA 2AV6A 4JLJA 3GPDG 4KIJA 1JPJA 1VI6A 5ICMA 3VNVA 2FSUA 2IDMA 5CM8B 5E3HA 3VU1A 1BE8A 1OKKA 1DINA 1WXHA 3PRHA 3VU3A 4W99A 2RGCA 3FOAA 3LUDA 1I0LA 2NIPA 4N01A 1DDGA 5AVVA 2WZDA 3DTVB 2O0HA 3FROA 3RWOA 1RMYA 3INNA 4BZWA 4RIFA 2J3LA 2JJQA 2JLQA 2C58A 1YIAA 2OGZA 4FKZA 1SOUA 1UCFA 1IEXA 2GZHA 1R6BX 3HZHA 3L4BC 3GLRA 4KK3A 5L45A 2G0TA 1R8SA 3ZJ4A 5EFOA 1YRBA 5AVRA 3MPOA 3E23A 4CDRA 3LL4A 1H23A 1AB6A 4I3GA 5EWLB 1T6XA 3T06B 4CYMA 2CXQA 2NO6A 4UPDA 3GDGA 4Y98A 1P3JA 3CNQS 4BLWA 1GT91 2BKLA 3DOHA 1C8BA 4TWRA 4I4CA 3ACBA 2HK9A 4UD6A 3ZVLA 3KVRA 3EIOA 3C3JA 5DYGA 3RU3A 2OM2A 4N49A 4XR9A 1U9JA 1H4VB 3ZWBA 1U1FA 4MPDA 2FOLA 3PXDA 2PUCA 2VYND 2W6PA 3ENZA 4P1ZA 3EMBA 4F2HA 4KNWA 5K7SA 1T2DA 5GMOA 2WNSA 4ZJPA 3H8VA 1JTEA 1QIKA 4ZV4A 4CEIA 2G9RA 3ESAA 4K0RA 2WD7B 2VWPA 4W8GA 121PA 4M88A 1K63A 1MABA 3ZZ1A 2XBUA 1CJSA 4I1IA 3TOCA 4URXR 4MMXB 1YK0A 1CRQA 4YRTA 3IMFA 1GKIA 2POQX 2O3JA 4DCPA 2RHRA 4OJYA 3H8JA 1JFRA 1GGHA 2JFXA 2UUPA 4V0MA 4HNQA 4L8WB 3ESZA 4M1OA 1TYAE 3K8YA 3OEHA 2BM8A 2VYVD 4OQMA 3UUWA 4FXOA 4DSTA 1F2VA 1S0UA 1EFPA 3G9ZA 1K9VF 1UJNA 2XEDA 3L4JA 1U11A 3IJ5A 2WTBA 2UZAA 4IKEA 3ZBTA 3HA7A 3NMUF 3DAYA 1O8CA 4DLYA 2G8LA 2XNCA 1UXJA 4GMGA 1YMQA 2DWOA 2VJPA 1T24A 2PV7A 4NLLA 5AHXA 4X85A 1Z8DA 2NZ8A 2X1HA 1KHHA 1U8EA 1KAEA 2DH6A 3LP5A 2WJ4A 2BHSA 4OYLA 1S8AA 4M7WA 4JBGA 221PA 1CUEA 2WDPA 4ZQCB 5LQJA 4BGVA 4QQKA 4C3ZA 1QIJA 1J49A 3QBDA 1BJRE 1IATA 3IBGA 3DDUA 3LBNA 3N7UA 3PC4A 3HV0A 5K1ZA 4DDTA 5CA0B 2C7OA 1P3Y1 2CE7A 2VO1A 1D1SA 3QI7A 3DE6X 1SKAA 1TIKA 1KY5A 1P19A 2XTZA 1LW7A 3AONB 1BFKA 2XE8A 1NG1A 1X38A 3GV0A 2EKLA 5JOQA 4HX5A 2HAEA 1ADFA 2C3OA 3HXOA 1BRMA 4JUFA 5ALEA 1GYPA 1ZR4A 3F4LA 1RDFA 3FDIA 2W43A 3GLGE 3AUUA 4XQEA 4FR5A 5H16A 5KBYA 2BHTA 1TF5A 3ABZA 3M9WA 1IE3A 3PX3A 3R24A 2I3GA 1YCHA 2NTJA 1JHXA 5FULA 4H35A 4RVFA 2GARA 1OILA 1EWQA 4MB2A 1I3LA 4OUKX 1ECBA 1Q91A 2A35A 4DV1B 3M2TA 2V4UA 3HL4A 2BGRA 2C3MA 2BAGA 1FTYA 1S1MA 3MUEA 1MEOA 1CTQA 4MROA 4R5MA 4U39A 1XTBA 1BJKA 2GDZA 3PFKA 4O4JA 4XGIA 4QUJA 4U2BA 1TYBE 4DR6B 3EUWA 2XQIA 2H16A 4NZNA 2Q4RA 2YNMD 3F46A 1C7FA 1XCPA 2QQ0A 3IXQA 1G18A 1XNGA 1JA0A 2PBLA 1JQ3A 3WK6A 1NN5A 3WDLA 4Q3AA 2X0KA 4UQLA 3I9KA 3QMVA 2F2TA 4WFKA 5FTKA 3ZWYA 1UMKA 1VHTA 4WY8A 4F91B 1IZ7A 4N8EA 3BFXA 2QN9A 4TV8B 4QXRA 3W2EA 1M67A 5CW2A 1QCCA 3TRHA 2C2XA 1G59A 3TDMA 1OGYA 4Z9YA 3GRPA 2Q1XA 3RIHA 4BQRA 3H4VA 4H1TA 4CR6A 3EX7C 1R0SA 1AZTA 3VR6D 1XG5A 3IKJA 3AU9A 4KB5A 4NG5A 4YCMA 3NANA 4ENPA 2XZTA 3WGTA 4HNAA 3SZUA 4M7RA 3H84A 1J0XO 4NJMB 3H42B 2OAQ1 3GFQA 3TF5A 3ZCXA 2PRJA 1B2RA 5IDXA 1V47A 3EXAA 3F6RA 4RSMA 4CM3A 3GG2A 1UKZA 2JFFA 4IAOA 4RVOA 2ZXFA 5FF9A 4JI1B 2KHZA 4PQFA 3TB6A 2ZR8A 3E58A 3M8KA 2EIXA 3QE0A 1LDNA 3NAGA 3RVQA 5EMMA 2OQ2A 2PUWA 3DO5A 3HGTA 1UKBA 1VYUA 1W36B 2J9YB 3WLFA 1HQYE 3U3DA 2GGSA 3EC7A 1WXWA 3TFQA 5IF9A 5A06A 3H1FA 4DIDA 1PWYE 5JD6A 2YY5A 4G8DA 5EMLA 2P90A 4JASB 3UW1A 4XWOA 2H7VA 5BNZA 4O4HF 4L02A 2AXQA 3BQNB 3A4NA 1YOVA 2EAUA 3HNPA 3KKEA 3R0IA 2CD9A 3GBSA 3P32A 1PFYA 4G26A 4KWIA 1BD3A 3H6KA 3KR9A 2GEUA 1ULBA 5ITZB 1YS6A 2CZQA 2V4MA 3CV3A 2AJBA 3INGA 3LS2A 4U0KA 4UEJA 7ADHA 1TXGA 2H08A 3GJ4A 3BL6A 3PE6A 3HJHA 1E3JA 3NPMA 2JCVA 2YQ4A 4JOCA 4OI2A 4G5FA 1EIWA 5EGSA 3MS7A 1N4AA 1SHJA 4UMEA 3RC3A 4EMUA 4ABYA 3RUFA 1OBCA 4JL5A 1C1XA 4MCHA 4PHCA 1YR7A 4LGCA 3BT7A 4XD2A 4YHBA 4YRLA 3Q7EA 4JA2A 3T7SA 2VHZA 1SIWA 3BGDA 3ZHYA 4FGUA 4AB1A 1C4KA 4WERA 4L5JA 4WOBA 1LF0A 5BOSB 2DXIA 1DHTA 4BN5A 4MJ3A 4BO1A 5FWNA 2IBSA 2IHZA 3DD1A 1QIMA 5GONF 2P0EA 5EZYB 3ROZA 1ML3A 2ZT7A 3AT1A 3E18A 3GVIA 4GSKA 1VPEA 4I50B 1LWOA 4M60A 4X65B 1KI9A 4QL3A 1GGKA 1PL7A 1EXNA 1P0QA 3H86A 3SBOA 4EG4A 1UM9B 1T8SA 2C5BA 1ZA1A 1C4XA 2GXUA 3A9CA 3B5EA 5DSXA 5GVRA 3TNLA 4DYVA 5B30A 4IYRA 5AI9A 3LFUA 4TL8A 5FL3A 2HI0A 4YFYA 4XLLA 4WGFA 1V25A 2C4HA 1O9BA 3WGYA 4EG0A 4L27A 4WFJA 1OQAA 2ATXA 2IEGA 3AC0A 1C9EA 3ETHA 3I72A 2AJDA 3NOOA 2QLBA 4MWOA 4WDQA 4WXEA 1IG3A 4WNIA 4Y0VA 1X7WB 3DYIA 1R0KA 2B9VA 1I7DA 2AD1A 2JJ1A 2ZULA 5AXAA 1BQ3A 5LVAA 3K6RA 4YV0A 3R5TA 5IU6A 4BNUA 1PZMA 1ECCA 1G3MA 2AFIE 2AR7A 5KJCA 4ZHQA 3UZUA 3CZQA 3I1JA 1JDBC 4P3XA 2GKGA 1V11B 4KGXA 3RYFA 2R9VA 3E35A 4MVJM 1N7JA 5B2EA 1E1RD 4PSVA 4HPXB 1U3TA 2VDOB 5KJFA 4MKZA 4UE3S 1JJIA 3FZNA 2XUQA 3NEJA 5L40A 5EC8A 1R12A 2OK8A 4CN9A 1W30A 1FFCA 1K8RA 2VG8A 2V7QA 4JJFA 1WQ4A 3W7AA 1UC8A 2ZZMA 1FDIA 1TB4A 1GPWB 1ODSA 1X80A 2HHCA 3BIJA 3EXFB 3JQAA 5TJ9A 2XTMA 2LR0A 1S4QA 3A2NA 3CLRD 3SYMA 2CXUA 2H4ZA 5DGCA 2GBPA 3VPBA 2X0IA 4N8DA 4DC1A 2ZBPA 1GR0A 2GZRA 2XMSA 3DSRA 1BH2A 2ODNA 3U7FB 4RKEA 3IR5A 1FYEA 1T10A 1V8BA 2A6PA 5B7NA 1NJ8A 4RADA 2B2NA 1C9KA 2AUNA 2OORA 1KS9A 2X40A 2PVSA 4MW6A 4R31A 4Q9KA 5H82A 3RS8A 3WL6A 4DLAA 4K6HA 1J97A 3RS0A 3UJDA 4OG2A 1KAMA 4LNAA 2FCAA 4FCTA 4L4YA 4ALIA 1YS9A 5B6IA 4X71A 1H8ED 1NP7A 3AR4A 4AF7A 2WYVA 1NRXA 3HKCB 1CQIB 3NX4A 3O8LA 3UXYA 3RYIA 3WL5A 2CL6X 3UK1A 1QMGA 3W2GA 4UM7A 1DWOA 4QHTA 1DFIA 4MVCA 4AXXA 5MHTA 1WDLA 3ESQA 5G1OA 1P4SA 3VZBA 4M1TA 2QSUA 4G1CA 2QSJA 4RK1A 1N1EA 1Z73A 1Z6YA 3JX9A 3KHSA 3PIRA 3VPHA 2JGDB 3KPYA 3DBLB 1NVVQ 3IHLA 4HQLA 4DNPA 5KVSA 1H6CA 3HKEB 1JHMA 4NPCA 4L08A 3E53A 2QPOA 2I1WA 1E4EB 4NBSA 5FV4A 4I5EA 3TIVA 4WSOA 3LC1O 2WSMA 2X41A 3PDCA 4OH1A 4REOA 3S8MA 1SFRA 1KSHA 1KR2A 1PDVA 3I0NA 1CF9A 4RM3A 2E85A 3ENNA 3DTVD 4BNVA 2GK4A 1CR4A 2X5XA 4FCVA 4WK2B 4P4GA 1IN6A 5GJBA 2CVFA 2YJNA 1FK8A 1QCYA 3G9UA 3HE3A 3IP7A 1AS3A 1Q6YA 2PQ0A 3E9RA 3BF8A 4XPIB 3DHNA 4ROSA 3NH9A 3H9CA 1NQTA 1WW8A 3GEIA 4A5SA 2OO7A 1EHIA 5BWNA 2X2EA 2YWGA 4XI9A 2PH1A 3S2UA 3M6FA 2Z0MA 1GU7A 1R8QA 2HHJA 3D4BA 3GEMA 3EVFA 3KHUA 1LF5A 3C1UA 1D1QA 1MO5A 1ZH8A 2PKQO 2VBIA 3I9LA 3K53A 4RF5A 5DI3A 1GFZA 3GEBA 4ZC8A 3VGPA 2OENG 1RPJA 2JBWA 2XUKA 3EGIA 4KMOA 3SF8B 1BDHA 2XE6A 4XZ3A 2BEUB 3KTDA 1SVIA 4LX8A 1NXPA 3KU4A 5KJEA 3SCZA 4WWHA 2GASA 4M4SA 4DCSA 2PSFA 3DV0B 1IQUA 1OF1A 1ZI6A 3U4IA 1U2SA 3SLKA 4M99A 2ZBFA 3SIPA 2E48A 3IO3A 2R00C 3JQ9C 4I6GA 2J6HA 3NAMA 4XM1A 1YR9A 3GLHB 3T15A 4F06A 4YJGA 4B9AA 3M6AA 1MO6A 4RZIA 4Q3OA 5C7YA 5J2UA 5EXSA 2FMTA 3WK9A 2O3SA 4BVKA 3AM1A 1UBKS 4ZDWA 2Z9BA 1A5AB 3FCOA 5LA6F 5GJWC 4ER6A 4ACBA 4ML3A 4LF9B 1XDDA 3AI1A 5FXMA 1PT5A 3LA6A 1NJ5A 2D5IA 2BKAA 1IY8A 1WTCA 1XDZA 1XPJA 2YHAA 3C5VA 5JPCA 1M1NA 2OAGA 2RGAA 3PT5A 4NZYA 3TS1A 1U8ZA 3DMRA 4BX0A 2ZYGA 3WMEA 3MMSA 3ICQB 4WN3A 1R0BA 1NJ2A 4QUIA 3L8EA 3AY3A 1NURA 3FGOA 2NUPB 2PJZA 2W0SA 4HH4A 4QAQA 3WGOA 4PLPA 4IX1A 4DIOA 1Z47A 4B82A 3FLAA 2G5TA 5HR5A 1A9RA 1J9GA 4V2IA 3SMQA 4ARUA 1E1MA 5A9SB 1IONA 1UAYA 1FL9A 3IERA 3S0JA 2DPYA 3B8HA 4I5FA 5IAOA 1EHYA 4BFWA 1XEXA 1ARZA 3PNLA 5E0KB 3PGKA 1BFUA 1NMQA 2OHGA 1KH3A 3T3IA 1G5IA 4KU4A 1KEWA 3UQZA 5JDCC 3DLAA 2P3SA 3DPUA 3ZHRA 5EJ7A 2X4DA 5JAIA 5IT0A 3B78A 3OQ1A 2M1XA 3WHPA 4B6OA 1E2MA 3IVCA 5EE0A 5FR1A 1AZWA 4Y2YA 1T9BA 5F35A 2FN9A 4DLKA 1WABA 1CLUA 2X76A 3QUSA 3TRDA 1M72A 3RF6A 3WMFA 1Z7BA 4DJTA 1F60A 3O83A 5EP4A 2E4VA 4A0FA 1UZNA 4HRVA 1TRKA 1RAAA 3MBOA 2GB4A 3I2KA 4Q7EA 3GFPA 4D46A 3UBMA 2G7ZA 2Z4TA 1B41A 5IUNC 4LDPA 3DDOA 1YHYA 4YJDA 1O6ZA 2XQVA 2XODA 2J3QA 2R96A 4MV5A 4C0WA 4CNQA 1LLQA 4MQBA 5CT9A 3AETA 1HT0A 3WGQA 2HT6A 4ZEMA 3C3KA 4CI0B 1VKHA 3ZWCA 3V00A 4E31A 4DQUA 4CT4B 2GJSA 2ZREA 1NOIA 4D9GA 3MJVA 3G0IA 3FPCA 1QGUA 1SHLA 3TMYA 3FMIA 4HXYA 1JSRA 4F4JA 1UZAA 1K2VN 3L0BA 1UT6A 2QRPA 3QVTA 1SC6A 3BK2A 4I55B 5CW1A 4CF6A 3NHRA 4ZMBA 5JXIA 4QVIA 4V3BA 2XHZA 3IVMA 4MUKA 1BN6A 3R7WB 2ZP1A 1DAEA 4QYMA 4TLLB 3EOZA 1P60A 3C1TA 3ANMA 3SXPA 5HIAA 1WQ3A 3A6DA 2AOUA 1P18A 1DARA 3AB3A 3O3OB 3KAQA 4D0NA 1NW8A 1TO2E 1IWOA 1X92A 2NTVA 1G16A 4FC7A 4I4NA 4YCSA 2FX2A 1A9SA 2QX6A 4IOJA 3RKRA 4IFTA 2ZATA 4MR9A 4WLFA 1IEQA 1OZFA 1X42A 2V1XA 1KP2A 2REBA 3LVRE 4FOLA 4O08A 4R2XA 2H57A 4O33A 1GPUA 1KMMA 2W22A 2YHSA 1F2UA 3K09C 4KH1A 3JZAA 1E6LA 4DM7A 1X7ZB 1QPZA 1E6UA 1HA3A 3OE7D 1D2MA 3ONVA 2F1RA 2E87A 4YJ2A 4NCAA 3K6JA 4W7SA 5ICSA 2O14A 1WW3A 2OCAA 4INPA 4OXYA 1ISHA 3H6GA 1RXCA 1YGPA 3SXUA 1UFRA 2O52A 3CEMA 1PFGA 5E1DA 4BN0A 1XRMA 4WJLA 1U2PA 3DL0A 4DJJA 2I8AA 2YVUA 3UNXA 3T3EA 5CDFE 1DKNA 5CVTA 1TAQA 2VWGA 3MINB 2OCDA 1DCTA 4DHWA 4KVFA 1XD9A 2W2LA 2CXHA 3ER9A 1GU1A 1NZJA 2DWQA 3B1ZA 4U6NA 4MS3B 1XPUA 2YXDA 1OFVA 2XY4A 3D4IA 3QXXA 1KYXA 1Q17A 4B79A 1TO1E 1YVEI 1BXZA 2ONZA 1M83A 5B1IA 1VYHA 4EWLA 1C0LA 5AW1A 2XZDA 3GRRA 4BL5A 3Q85A 2GYYA 4DUPA 3E8SA 2J6IA 1L7MA 2ZTVA 2R5WA 1UT8A 2VOJA 3E2IA 3L8CA 2NUTA 3REQB 4P5DA 2IPXA 4Q21A 3WGLA 3X1WA 3OOSA 4AZWA 4EQ6A 2BT4A 3I3SR 4XLZA 2B8EA 4EOGA 1SXJE 1XZLA