1RI2A

Structure and mechanism of mrna cap (guanine n-7) methyltransferase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
252
structure length
252
Chain Sequence
SKTINIRNANNFIKACLIRLYTKRGDSVLDLGCGKGGDLLKYERAGIGEYYGVDIAEVSINDARVRARNMKRRFKVFFRAQDSYGRHMDLGKEFDVISSQFSFHYAFSTSESLDIAQRNIARHLRPGGYFIMTVPSRDVILERYKQGRMSNDFYKIELEKMEDVPMESVREYRFTLLDSVNNCIEYFVDFTRMVDGFKRLGLSLVERKGFIDFYEDEGRRNPELSKKMGLGCLTREESEVVGIYEVVVFRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords mRNA CAPPING ENZYME
publication title Structure and mechanism of mRNA cap (Guanine-n7) methyltransferase
pubmed doi rcsb
source organism Encephalitozoon cuniculi
total genus 70
structure length 252
sequence length 252
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2003-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03291 Pox_MCEL mRNA capping enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1ri2A00
3SX0A 5DWQA 1TW3A 2FK8A 2ORED 3G5TA 3KQOA 1HNNA 3HA5A 3KQQA 5ICFA 3M70A 5EZQA 4AZVA 3TOSA 4BLVA 1PRYA 2P3QA 2EJUA 2GAFA 2IP2A 3KKZA 5HIKA 4QDKA 2YXLA 2WA2A 2IBTA 3FTEA 1XXLA 3UWPA 4FT4A 1INLA 4RX1A 5LQNA 5U4XA 3L8DA 5IH3A 4OX9Y 4AZSA 1KPGA 1NW8A 1JTFA 2C7RA 2NXCA 3UJAA 3EEYA 3LDFA 4GBED 5DT2A 1VIDA 3THRA 2HWKA 2BR5A 3E23A 3KPVA 2PV0A 3G8BA 5H02A 1FJXA 1VPTA 2P7HA 3FRHA 4QTUB 1G6Q1 5K0NA 4EKGA 3A26A 4YV0A 4EKIA 2HV9A 3ELUA 4MWZA 4YUZA 1XTPA 1G55A 2AS0A 2VP3A 2OZVA 2PX2A 2NP7A 2YTZA 1ORHA 3LBYA 3M33A 1EG2A 2PBFA 4DZRA 2XBMA 1X1CA 3UJCA 5BW4A 5LSAA 3GJYA 5JR3A 4YUXA 3CJRA 4XUCA 3SR4A 3BWYA 4RTLA 3KPUA 1EJ6A 4FSXA 5LQRA 5ICGA 2PX4A 2ESRA 4C07A 3DLCA 1KXZA 3Q87B 2AOXA 3TKAA 4H0NA 5FTWA 2HTEA 2JHAA 2JH8A 3A25A 1RI5A 4E70A 1VQ1A 3BUSA 4MTLA 1AQJA 1TW2A 1XDZA 2QRVA 2N47A 5KS2A 1YFLA 3I5UA 5EMMA 2AOUB 1P39A 3EVFA 2NNWB 3EVCA 4LWPA 4U7TB 2ONZA 4GOOD 2PJDA 4XCXA 3UZUA 5CVUA 4GOND 3QV2A 5DTMA 4BP3A 4E2ZA 1F38A 2ZIGA 5FULA 2IIPA 3R3HA 4GOMD 2FHPA 3DXXA 4CTKA 2AOVA 5GIOE 1RI2A 4PYOA 5EQJB 4PYMA 5EZSA 2IDKA 4KIGA 1KIAA 4X63A 1SKMA 3G89A 2Y1XA 4RVDA 2H1RA 2I62A 2QY6A 4QQKA 3ELWA 1I9GA 5DTRA 4RV9A 2QYOA 2NXEA 1D2HA 4ER0A 5HEKA 4FGZA 3GXOA 4HGYA 5CVEA 5C0OE 2OO3A 3BWBA 3P9KA 3IHTA 3HCBA 4ER5A 3FTFA 3DMHA 2ZSUA 1FPQA 2ZBPA 3LCCA 3MTEA 3HA7A 2G1PA 3SMQA 1NV8A 1NV9A 1WXWA 1IY9A 3LHDA 4PNEA 2XYVA 4F85A 1G38A 3C6MA 2E5WA 1YZ3A 1NT2A 2IPXA 3NJRA 1KP9A 3B7PA 1YZHA 3GRUA 3MAGA 3S68A 1BHJA 3FYDA 3TM4A 3OU6A 3FTDA 1KR5A 1M6EX 4PIMA 3OCJA 1G8SA 3KPYA 4HG2A 4M38A 2AVDA 3OZTA 1N2XA 3KHKA 3R6TA 1RJFA 4HRAA 2WK1A 3KPWA 5K0CA 2ZBRA 5EIFA 3M6VA 1SQFA 2PSSA 2NP6A 5EKUA 3CJTA 3CKKA 1NE2A 4ZTBA 2BM8A 3PX2A 3FPGA 2AN3A 1PJZA 2P3LA 2V74B 3EGIA 4OBXA 4BLUA 4QPNA 4X60A 3FUWA 2QRVB 4E2WA 3UJ9A 4WXHA 3UJ8A 3MCZA 3G2PA 2YR0A 3OFKA 5C1IA 1ZHFA 2PXAA 2B3TA 4HTFA 5K0BA 1HMYA 4OBWA 5JUWA 4C4AA 5DX1A 2AR0A 3EMDA 3WSTA 3A27A 3QOWA 5E1OA 1SUIA 2ZW9A 4FP9A 3TKYA 5FHRA 4G56A 3EVAA 5DSXA 5DTQA 9MHTA 5DM2A 3TFWA 1M6YA 4LG1A 5F2KA 1AQIA 3FYCA 3EVZA 1FBNA 2ZWAA 4M36A 3JWGA 3OZSA 3ER9A 5DXAA 1P1CA 5E9QA 3HCDA 4WVLA 3V8VA 5LQKA 4GQBA 4KDRA 3CVOA 5DX8A 3UJDA 3PVCA 2UYCA 5FQNA 2R6ZA 3ME5A 2AN4A 3GWZA 1DL5A 3DULA 3B3JA 3B5IA 2H11A 1RJGA 3SSOA 3M6XA 2I7CA 5FA8A 4C05A 4PYQA 3FZGA 2IFTA 4PGHA 3BWCA 3E8SA 3HM2A 1KYZA 3THSA 5ERGB 4YMGA 1QZZA 2BM9A 3A4TA 1I4WA 5T64A 5LQUA 3B3GA 5K0GA 2HMYB 5T67A 3BKWA 1JG3A 5FHQA 4DMGA 3LX6A 5M5BA 1Y8CA 2GB4A 3I9FA 4P58A 3P2KA 2PWYA 1D2CA 3P71T 4RTNA 3NTVA 3NDJA 3KQPA 5FADA 5CCXA 3TM5A 4F84A 2JH9A 3PX3A 1VL5A 3LECA 2PWPA 2YX1A 3TLJA 3KU1A 3VYWA 3T7RA 4LECA 3UJ6A 1VE3A 5F2NA 3X0DA 2O06A 4RTMA 3PT9A 3P9IA 3P8ZA 3P9CA 3HCCA 5K0JA 3B3FA 4Y30A 1ZGAA 2OPBA 2PLWA 3M4XA 3SSMA 3UA4A 4PYJA 1JG4A 3KPJA 3DXZA 4HTFB 3OPNA 4MQ4A 5E1BA 3A7EA 2IDJA 2VZ9A 2FRXA 3KR1A 2PX5A 4RVGA 3REOA 2IH2A 5KQSA 3HA3A 1N7JA 2G8NA 3EGVA 3MGGA 5BP7A 1YUBA 5KQRA 5G02A 4RTSA 1QYRA 4R6XA 4YV2A 4RSRA 4ATNA 4M37A 5EHGA 1Q0TA 4ER6A 5DRYA 3HVKA 2JHCA 2BR4A 3K0BA 2DULA 4PINA 3O31A 4U7PB 5HILA 1UIRA 4GF5A 4RTQA 1X19A 2UYQA 5CVJA 1NW3A 2A14A 1NW5A 3PB3A 3G8AA 2ZIEA 2VS1A 3C6KA 3MERA 4YMHA 4IWNA 4YV1A 2DPMA 4KDCA 2YVLA 1I1NA 3FPFA 2NXJA 3M6UA 5HIIA 3U81A 2IH5A 3MCTA 1DCTA 3LGAA 2B78A 4HGZA 2R3SA 1QANA 4MIKA 5BW5A 1WXXA 5HOQA 2C7QA 3PLAE 3OFJA 3G2OA 5EC8A 1QAQA 2EFJA 3HCFA 3DMFA 2I9KA 3MB5A 2C7OA 5K03A 2UZ4A 3CBGA 4DF3A 1VP9A 1AF7A 4X41A 2JG3A 3SGLA 5GWXA 5CVDA 4FSDA 4RTRA 5GINE 1R8YA 2P8JA 2B25A 2ZWVA 3OZRA 2IH4A 2B2CA 1JQEA 5CCBA 2Z6UA 2FYTA 1U2ZA 1OR8A 3CC8A 3EVBA 3I64A 4GEKA 4PYKA 5EMKA 3T0IA 4PONA 1VLMA 1JR4A 1RI3A 2PXXA 3FPJA 5IKMA 3P2IA 3GCZA 4YUVA 4PYNA 2O07A 2BR3A 1NBIA 2OXTA 2ZZNA 4FZVA 1KPHA 4RTPA 3CJQA 1EJ0A 3G88A 4QPPA 1L3CA 3T7TA 1QAMA 4CKBA 3EGEA 3EVDA 3MHTA 3UA3A 2BZGA 1SQGA 5GM1A 4EVIA 2ERCA 4QVKA 1N7IA 4OA5A 3G5LA 1M0EA 1XDUA 1ZKDA 2I6GA 3DTNA 1VBFA 4FR0A 1BOOA 3OU2A 3SVZA 5CIYA 4YUWA 3RODA 3NVKI 3FTCA 5BXYA 2UYHA 1JSZA 5CM2Z 3O7WA 4OQEA 5DSTA 3FUTA 4OQDA 1XCJA 2ZIFA 4E30A 3LCUA 4GOLD 4E31A 1P1BA 1UWVA 4AX8A 5CVVA 1JTEA 1AV6A 2OKCA 3AJDA 3E05A 4Y2HA 1KYWA 3CCFA 4PYIA 4FS8A 5DXJA 3I58A 4UOEA 5EMJA 5EEHA 2VDUE 3KQSA 1WY7A 1UFKA 4QVGA 1R00A 2WA1A 3RW9A 3GRZA 3TQSA 4C06A 1YF3A 4ER3A 3P97A 3E7PA 1RJEA 2PT6A 3HEMA 5GOZA 3I53A 2B9EA 3LKZA 2XVAA 5FA5A 4CKCA 2QE6A 1WS6A 2KW5A 4PCLA 4OA8A 8MHTA 1XVAA 1T43A 1ZQ9A 2AVNA 2CL5A 1JG2A 1O54A 2ZZKA 3LDUA 3ANXA 4HH4A 3TPZA 2O0LA 2C7PA 3HTXA 3T7SA 3GRVA 1IM8A 2UYOA 3BGDA 2Z6QA 4R6WA 2ZTHA 3FUVA 1SUSA 2HNKA 3TR6A 2Y1WA 5E2BA 5GIPE 2H00A 3OE5A 5MHTA 5E1DA 3DH0A 3ELDA 3IV6A 4X1OA 3HNRA 1ZGJA 2GLUA 3F4KA 3FUXA 3BZBA 2P35A 1TPYA 3KQWA 3Q7EA 2OBFA 3NWBA 5D1NA 4HSGA 1BKYA 1R6AA 1DUSA 4R8RA 3P2EA 4GUAA 4C04A 5E1MA 3FUUA 2ZFUA 3H2BA 2VDWA 3HP7A 4QTTB 2YXDA 3OE4A 5DLYA 4NECA 5EGSA 3HVHA 3PFHA 4RTKA 2QM3A 2ZVJA 3P9NA 5E9JA 3A7DA 1MHTA 5ICCA 3DMGA 1QAOA 5DRTA 4POOA 2GA9A 1B42A 3BXOA 4A6DA 5E9WA 4CKEA 3KR2A 4CXMA 1NBHA 1WG8A 3DUWA 1G8AA 4C08A 1H1DA 2Q41A 5DM1A 1VP3A 2BH2A 1O9GA 3KQMA 2ADMA 3IEIA 1F3LA 2P40A 2EX4A 3R9XB 1RJDA 1L1EA 2AOWA 2GPYA 2O57A 4LWOA 1KPIA 2F8LA 4AZWA 4DM3A 2PY6A 4M7RA 4IV0A 3HVIA 1WZNA 5LQJA 5EPEA 3G2QA 3GIWA 2CMGA 2ZZMA 3IYLW 4RVFA 1EQAA 5KVAA 4RTJA 2OB1A 1BC5A 5EEGA 4CWAA 1XCLA 3NWEA 5K8VA 3DP7A 4RTOA 1O9HA 2PXCA 5B1SA 3PTAA 4R8SA 2EJTA 2CKDA 1NW7A 3NDIA 4P7KA 5FWDA 2FK7A 1X1BA 3GDHA 3PFGA 3KR9A 3HCAA 4IV8A 3HVJA 5D1HA 4Z2YA 5E8JA 3FRIA 3R0QA 1R8XA 5K05A 4E32A 4RYLA 4X61A 5KYGA 3BKXA 4E33A 5K0EA 1JG1A 3K6RA 3M6WA 3O4FA 4DKJA 3AXTA 2CMHA 3KR0A 2NXNA 3DR5A 4P7GA 4QQNA 5HIMA 1EAMA 4DCMA 3ER8A 4PYLA 3AXSA 2PKWA 3DOUA 3MQ2A 5DM0A 3VC1A 4E2XA 2IBSA 4HC4A 2YXEA 3LCVB 4PGGA 3BGIA 3G2MA 1FP1D 3TMAA 5HZMA 5EKXA 1YB2A 2XVMA 3CGGA 3BWMA 4RVHA 4R05A 10MHA 1JQDA 5C9ZA 3UJBA 1R74A 5DPMA 3UJ7A 3GU3A 3C0KA 3ID6C 1JSXA 1R18A 1D2GA 2NYUA 2P3OA 4V0RA 2FCAA 2AZTA 5EOVA 3GRYA 4O29A 4QDJA 5T6BA 2IGTA 2YUIA 3C3PA 4A6EA 5CUQA 1IXKA 5LQCA 3EPPA 3SSNA 3SM3A 3BT7A 3ELYA 1X1AA 2P7IA 4BY9E 4AUKA 2EG5A 2FPOA 3NMUF 1ZG3A 3ORHA 4PIPA 7MHTA 3KQYA 4KVZA 5F2OA 3G7UA 3GGDA 2GH1A 2AOTA 4EQZA 1ORIA 1RI1A 2OY0A 3LPMA 1Q0SA 3KQVA 5K0FA 2CWWA 1G60A 4EMSA 3OU7A 3EVEA 1L3BA 5EMLA 2Z6AA 2ZULA 3JWIA 4KWCA 1X1DA 3KQTA 2G72A 2LD4A 3UFBA 5ICEA 3BGVA 3VSEA 5LQAA 5LR6A 5K01A 3LDGA 4KW7A 5EG5A 3NVMB 2OB2A 5EVJA 3GO4A 1Z3CA 5FUBA 3LKDA 4DCGA 5K09A 2G71A 1XDSA 3B89A 4XUDA 2PGXA 3SXJA 1EIZA 3AWIA 3FPHA 4BLWA 4L7VA 2G70A 5HFJA 1L3IA 1P91A 2JJQA 2P41A 4KRGA 2YQZA 2P1DA 5CD1A 3R24A 4DA4A 1FP2A 3GNLA 5DX0A 5FWAA 4MHTA 3GRRA 2ZLBA 3HCEA 4P7JA 3VC2A 3MTIA 3DLIA 5FCDA 4AZTA 4ISCA 4C03A 3AY0A 2ZCJA 4RWZA 1NW6A 2AN5A 4KIFA 4PCAA 4DQ0A 4YUYA 5E8RA 3EVGA 4F86A 2XYRA 3PS9A 3FPEA 5EIWA 1V39A 2GS9A 2PVCA 4GC5A 3LL7A 5E2AA 3NW9A 3RIEA 4XUEA 3V97A 1YFJA 2PT9A 4EK9A 1XJ5A 4E2YA 3C3YA 5HIJA 3JWJA 3UBTA 3D2LA 3LBFA 4P7FA 5GP1A 4B17A 3EEOA 2ONYA 2O05A 4ER7A 3DXYA 1SVUA 2JHPA 2HR1A 3ERCA 3JWHA 1KHHA 2XYQA 3TRKA 5GM2A 1RI4A 2ZBQA 4K6MA 2K4MA 1JQ3A 2V7EA 5FQOA 2AOTB 4FT2A 5DM4A 5P8WA 3LSTA 5K0LA 2PX8A 5EHIA 2OYRA 4GC9A 1MJFA 2AOUA 1NKVA 4IKPA 4JXJA 4PWYA 1SG9A 4CTJA 1L9KA 4V0QA 2VDVE 3QOXA 3EMBA 4BP1A
chains in the Genus database with same CATH superfamily
3DDCA 4C5CA 4WH0A 3SOPA 2AG1A 3CINA 1KJJA 1OA1A 4RPKA 5G4KA 1I7NA 1L8OA 3EG5A 4IIDA 4R69A 2PJUA 3ROZA 3RTCA 1KKLA 5LOVB 4UVHA 2TECE 4LBWA 1ZN9A 3VR5H 3QU5A 4XDGA 2EJUA 5I7EA 3KOYA 3IDFA 4H7DA 4NFLA 1R6TA 1Z4LA 1LPBB 5HCNA 3R74A 3S28A 3D59A 3U48A 5CLQA 3PXCX 1R88A 5I7UA 4F4HA 1YOVA 4INPA 1Z8DA 3E4CA 4IUCS 1ZW1A 2BE7A 4R1TA 3ONWA 6CHYA 3BF7A 2XNCA 1Y6FA 1USVA 4J07A 3OEED 1G6Q1 3CKLA 4DJEC 4IKOA 2QOEA 2FMFA 1Y89A 1P5ZB 2HV9A 2OM6A 3ELUA 1G4AE 4KVGA 4YJ3B 1E6EA 1MEOA 1W0KA 4YRSA 4RULA 1G2OA 1SZCA 1Z29A 3A2KA 3QMPA 4LBYA 2O2ZA 3U19A 5CYFA 4FE3A 1D2NA 3UJCA 4WZBA 5EWLB 4Q3AA 4ZIRA 1T8YA 5KKCA 2XUZA 2HC9A 2J3JA 5AJTA 3NORA 3UAOA 1X1QA 1CQZA 2JDID 2FMXA 4ACAA 1VHLA 3GLUA 1GQRA 3AR4A 2HTEA 4B45A 1DPGA 1OASA 1RCTE 3FCOA 4CLOA 3CCBA 3CR3C 1XNJA 2C8KA 4IMJB 4XDZA 3UBMA 3BSSA 3Q8LA 4YXWA 3Q9SA 3N0WA 3RVMA 4CUJA 5K8JB 4LX0A 1NXOA 1XPOA 3UWDA 2IL1A 1L9XA 4QUAA 4G8JA 4BP3A 4PBRA 4COOA 2QENA 4E2ZA 5D7BA 4M4SA 4DDWA 3ROTA 4CTKA 2O0MA 5GIOE 5A0TA 1A7UA 4I1PA 3UJ3X 2WIKA 2C95A 2XXAA 4IS2A 3IL2A 1FFEA 2JVKA 3MPUA 4IHJB 2I62A 2Z56A 1W0JD 1NP6A 3OEHD 4WN9B 3ELWA 4B6EA 1OV4A 5CA1A 5DTRA 1VCOA 4DMLA 2PD6A 2FPIB 4B4VA 2WYIA 1XAJA 2QP9X 4F4JA 4JQZA 2AC4A 4YP6A 4P3OA 2ZOSA 2Z8XA 3ZXYA 5DJ5A 1GQOA 5BQOA 1CUJA 1T36B 4OUDA 3SYLA 4BZPA 1PV4A 2GZ2A 5AD1A 1VYUA 1RPTA 2NZXA 1R64A 1U3FA 1OGJA 2Y6VA 3EBPA 4JEUA 3OQIB 4NCIA 2HO5A 4P08A 5FEMA 4EPXA 2C2BA 1Z6AA 3K9QO 4KXMA 5BMVB 2YXNA 2IPXA 4JZKA 2ZM6B 1REQA 3MAGA 5AR1A 2AG5A 7REQA 2Q5FA 4R7GA 4PIMA 2V58A 1XDBA 2UZAA 4IIEA 2JAWA 4V1CI 3OKFA 2JEYA 3B6EA 3OMWA 4B7XA 4O2BA 3IXQA 2WK1A 3H9JA 5FTJA 4ZDJA 2C9ZA 1MN6A 3BMQB 4I1IA 4O4HA 3VR6A 1Z6XA 3ZE0B 4CL8A 5F1PA 2ZTMA 3A4VA 1WRBA 3K5HA 4H7IA 3CZAA 4QWMA 5JH7B 1RYNA 3BFXA 3BIFA 1XWWA 5FBKA 1ZU5A 2F7SA 2QR2A 4C0WA 3N7TA 5IJWA 4HB4A 1YDHA 2FQ1A 3M1AA 2WJWA 1F8XA 1SY7A 2CMKA 2VUHB 4IJWA 3SVLA 1OCEA 3WP1B 4JI8B 3LLSA 3U3JA 5FTMA 3IQIX 3K70B 3C7TA 4JR0A 2AR0A 1KJ8A 2HPZA 2XR1A 3OTHA 4LHZA 4REMA 4RO0A 3IEPA 3KD2A 2C5FA 3WSTA 3CVWA 2B20A 3ND8A 1CJCA 2JLZA 4X7BA 5FWXB 4FTWA 3STXA 5C80A 4AO6A 3ZCVA 2QZJA 1Z33A 3UF0A 4ZJPA 4D0SA 2AEFA 5EP3A 2GK7A 1G16A 2GAJA 3SEFA 2FSIA 4EY7A 1X87A 1K5PA 3IH5A 4YRFA 5D2CA 4AY6A 3QXSA 1FSSA 2Q29A 3T94A 5E3HA 1ZI8A 2EL9A 2J1LA 2VT3A 2Z2JA 3GWZA 8GPBA 3BAFA 3X1JA 2M6RA 1M0TA 3QY0A 4C05A 2O8NA 4NR0A 5JDIA 2D1SA 3KT6A 1Z4QA 3IR6A 1GPJA 1U2EA 4I8IA 1WQ3A 4HAYA 2HY7A 2WJZB 3HPQA 3VR1A 1XR3A 2OWEA 4C2UA 1EWKA 3PDHA 3SNKA 3U13A 2BY4A 3M89A 1XD2A 3R9KA 2BI4A 2KE5A 2BGUA 2XMGA 2AFVA 1B8OA 1E5TA 1Y80A 1G3RA 2FY8A 3K9WA 4IIUA 1OVGA 3SHTA 1RRFA 1S02A 1ID1A 1Z68A 3NTVA 1ADCA 1IK6A 4JOCA 4L9SA 1TU3A 1VL5A 3HYLA 4OEHA 4RY0A 2DQZA 5TQ2A 4CI0B 1NM5C 2DUJA 2JJ2A 5C31A 3ZY5A 5HG0A 2ATCA 3TLKA 2VTVA 1UFOA 3NH6A 1ECJA 1SXJA 3PT9A 1P6QA 1DRWA 1D6JA 4ZV9A 1AQ6A 3SQOA 3ZXUB 4OKIA 1M1YB 3HCCA 5I4IA 3MC1A 3LX8A 3ZWDA 1PT5A 2HRDA 2GD6A 1KBQA 3TTXA 2D59A 4LC0A 1IAQA 3GJ4A 1PN3A 3DDHA 1XZ8A 2CBZA 3L05A 5KJEA 4H4CA 2SNIE 3I04A 3KR1A 3JSAA 4CCAA 4HLNA 3DEFA 3QPCA 3L6DA 4KFTA 4B3GA 2E48A 4X65B 3NCTA 3DLBA 4FHEA 2R86A 3JVEA 4PZEA 1FVFA 3IIIA 1FNCA 4F1JA 2ZG6A 1QP4A 1JGTA 4M37A 2G63A 3PR2B 1V47A 2R1VB 4BO0A 4B75A 2ZRHA 4RDIA 3K70D 4O5AA 3KKMA 1SB9A 2OXCA 1RYBA 1C7RA 4LCEA 2ZSJA 5C8YA 5IASA 4YRGA 2YNMA 4YVFA 1H1LA 1EGMB 4M9XA 4LZZA 3GJ5A 4PZDA 3NATA 3URKA 3WZLA 3EF1A 3HSYA 1L5VA 2W71A 2YVLA 5AKJA 2M9MA 4UBNA 3CISA 4FBMA 4ZVLA 4WLUA 1UPFA 1XK7A 1MCZA 3U4IA 4ILKA 4YECA 1DCTA 3GFFA 2ASEA 5ITSA 2PN1A 4IKEA 1D4ZA 2I9KA 4NOMA 3GZTB 1Y8QA 3FHJA 2DUNA 1VP9A 2Y99A 4YJFA 1PBTA 4ZVOA 3KXPA 2Y77A 2GM5A 3RSQA 1GUBA 2JAQA 3I62A 2B25A 1IL0A 1BNCA 2B2CA 4LXTA 4BIMA 1N6KA 4OL9A 1AZTA 1CUIA 2W8BB 2ZSBA 4I5GA 4IJKA 4U5XA 1KEZA 4X0EA 5DH9A 4D3XA 4IEIA 1QFZA 4RVNA 1WBJB 3K70C 4IPTA 1DNPA 1Q92A 4DV2B 2HQ1A 4J3FA 1HNZB 3DEAA 1SOAA 2AZMA 2P6MA 5FPHA 5H83A 3G88A 1O89A 3HY3A 1XTKA 3MHTA 3EVDA 1YZYA 3DSRA 3QU4A 4AM8A 1GPYA 3JALA 1LTHR 2CXTA 4GMDA 4NMWA 2ERCA 1SCNE 4L7QA 4NAUA 4M76B 2EX0A 4BNYA 4JB2A 5J5CA 4H0FA 4DC0A 1AUVA 1OXSC 2FWIA 4PANA 5A7HA 3X1KA 4QDUA 4GZ6A 4FONA 1JLHA 2B83A 2J3MA 3ROFA 4RZ3A 3TAUA 1UBUS 1E2DA 4EH1A 1C30A 2WR8A 4GGOA 1VRVA 4XTCS 4OGLA 4HQRA 4YHBA 2BGIA 4C7KA 1CUGA 5CLJA 4PYIA 3WXMA 4PRYA 1FFGA 3IVRA 3KYDB 1N77A 1Z4OA 5AIBA 5J1SB 4NH0A 4WBNA 4V1CA 2TYSB 2XITA 1AMUA 1PR4A 1M54A 2GAIA 4M9CA 3DONA 1EYZA 3CN9A 3WGQA 5JBQA 5FO0A 2CL7X 3DKPA 2F64A 4D9MA 5AI8A 2ZAOA 1XEAA 4ZHQF 3BBLA 1S8AA 1FQKA 2HK7A 1JEYB 3H9EO 5HMLA 3EXIA 3L07A 2QTBA 1PLLA 2HF2A 1QE0A 1MXHA 2G7ZA 3U3ZA 4TS4A 4EMBA 2B9VA 2BCJQ 3BGDA 1JXOA 3RR2A 2ZTHA 4UTNA 2Y2UA 3GOQA 4HY3A 5LP6A 1JHVA 4FGWA 3UAYA 3W0LB 2UKDA 4MRNA 3WL7A 2NPOA 3H65A 4B3JA 1PQUA 3LAWA 3SYMA 3U4DA 1AK1A 2H1HA 3PQCA 4IF4A 1SG0A 1QK4A 4JHXA 3IV6A 4HNTA 1PJCA 3GH3A 4UNQA 5HCIA 3ZQUA 3IBFA 5KTMA 4AROA 2QGFA 4FWIB 4I4TB 4KX5A 3VHXA 1E3MA 3IKTA 4OHWA 1BHSA 3N3BC 2ZIUB 4YFYA 2QM0A 3DEJA 3JRNA 3DT8A 4HYTA 1QR2A 4H2DA 1LF5A 4Z8YA 3HVHA 1MX9A 2QTZA 1LW6E 2V7BA 3E27A 3N75A 1QRAA 1LI4A 1TNDA 2WMOB 1DZIA 4B3CA 4JROA 1FXWA 1GTJ1 2JL1A 1V25A 3D8BA 5K8CA 5KI6A 2KYRA 4X6XA 3VR2D 4H7FA 2WHEA 5LN1A 5GONA 1RAFA 4IINA 1KZ7B 4B3FX 4MV7A 1ORRA 4BKUA 4UFOA 2VAMA 1G20B 3HO6A 1VG8A 3V6LA 4X92A 3F6CA 2PY6A 3IUSA 3MW8A 2DGDA 1V96A 1IEXA 3M5WA 3QA3E 4M0UA 4E15A 4A36A 3H1TA 4MGHA 2BVNA 1MC4A 3RABA 1K0FA 2E55A 3G2QA 2APJA 1Y7LA 4XPZA 3VKUA 3WAGA 4JJAA 4Z1MD 1SIOA 1HX7A 4YRNA 5IK2A 2ZRLA 4IDOA 3NWEA 5JPDA 1MO5A 3UAVA 3DP7A 2OBYA 3HDTA 2WSSA 4FI3C 2C3YA 2RBEA 4OAOA 1N9GA 2XB4A 1GA1A 4EDHA 3KTOA 4P7KA 1AGYA 3PHIA 4YRIA 5EQDA 2UXBB 2IYRA 4FS3A 4QFMA 1FVXA 5TMBA 1GZUA 4IV8A 1O95D 3VBCA 4B44A 4YCAA 2V3CC 2VSOA 1DHTA 1V1JA 4BFTA 3I72A 1KDOA 5AK3A 5B3JC 3O8CA 3N6VA 3NAZA 4EEKA 4ZV4A 1LVGA 3GJQA 3B53X 4NMHA 1PJRA 2I2AA 3JD0A 1CR0A 5JNLA 1CNEA 4U7WA 3NHZA 4D8VA 1N25A 1KZ1A 3I92A 1QHSA 1PS9A 3BFPA 1SWWA 4J1NA 4XB2A 5D3MA 4RA6B 4BE4A 5JEDA 3ER8A 1M2VA 3VC1A 1KH1A 1LK5A 3QM1A 3V7WA 1Y1LA 4HH3C 4Q15A 2NO1A 3WJ2A 2C2XA 5DNDA 2RKOA 2J9XB 1JHAA 3BWMA 4PAQA 5IAOA 4WKCA 1N0VC 1VL0A 1WZEA 1FJGB 1NVXQ 4GI3A 2CSXA 4CKEB 2MCFA 4J1QA 1KEEB 2NYUA 4N5HX 4FD3A 1BE6A 1MH1A 2VDRB 3C3PA 3GBSA 4JBLA 4BO6A 5KWEA 1D07A 3AP1A 3R7AA 3SQMA 1O95C 2KMLA 4P35A 3DUFB 4YX9A 3PEYA 1J24A 2FPOA 1AD2A 1OD6A 4Q05A 4JQSA 3ZX5A 4F5YA 4IJVA 5CIQA 4F56A 1LBQA 2WDPA 1GNLA 4EQZA 3GDOA 1FLNA 3LCRA 3WB1A 2PR7A 2O8BA 3TYXA 2HV8A 3ORSA 1A9OA 1MA0A 3A10A 1C0EA 2IJGX 2VWGA 5F73A 2XD4A 1II8B 5INTA 5CA1F 4AU1A 3VZQA 3WLPA 1AXGA 2W6CX 2P65A 3DA8A 3K3PA 4WOJA 2YJ4A 2XT9A 3RHTA 4E3WA 4YO7A 4PSCA 4LDJA 1N5KA 5AM4A 2FEPA 5C5EA 2C3MA 3B89A 1ZH0A 1SBCA 2A1IA 1U28A 2BKXA 3BMCA 1EUCB 3E3NA 4HNSA 4J2TA 4RV4A 4RU1A 1JHZA 1RJ9A 1UZAA 2QORA 3H97A 4K6GA 1CVLA 1KI6A 3WRWA 3WG9A 4DW8A 5KYKA 4H6WA 1HURA 4TYNA 1ZLXA 1J97A 1NXPA 5KSOA 4FZJA 2C42A 2ZLBA 4P7JA 5CG2A 1QKIA 2H1SA 3FHOA 1XZJA 4BX9A 2ECOA 4RWZA 3ZUPA 4DILA 1MNAA 1VMAA 1X86B 1YQEA 3QNWA 1P0CA 1EA5A 3MGAA 4YUYA 3T5PA 4YCMA 2C97A 3OOHA 2PVCA 3KKOA 4O2BF 3EQ8A 5DGCA 4MW2A 4O4HF 1D7AA 1FFXB 2JASA 3K09A 1R0XA 4PSKA 3DYVA 5FL3A 3C7KA 3MUFA 5HIJA 4HYYA 4E2YA 3UBTA 2EW1A 3K0HA 3KKQA 1UKBA 2C2OA 1VFNA 3R41A 4IH4A 3OESA 5HOEA 4UBLA 3VNQA 5A2GA 2R7LA 4IJ6A 2PL1A 3TLGA 1H3NA 1RHMA 1WL8A 3KTFA 3QKRB 1UWLA 1Y6RA 4J0EA 3GA0A 1Z6TA 4LTDA 4WZ6A 4DJTA 3OP4A 3ZCQA 4BECA 2WM2A 4BO5A 4XWOA 3HL0A 2JKVA 1KMCA 4FGUA 2XXJA 4L4XA 3RS8A 2QMOA 3JVDA 3TCNA 4QZVA 2R8BA 3B9QA 4TLMB 2HXYA 3U17A 3O75A 1UBOS 3SQNA 1R6XA 3DGFC 1T4CA 1R0WA 2WSYB 1H23A 5MF6A 4V0QA 1JEQB 5I7SA 4ALNA 3AUAA 4GO1A 1UMBB 3DL7A 1GPBA 2GZDA 2V9CA 4D6PA 3U5TA 4F2GA 3SVTA 1OIWA 3G5TA 4AY5A 4YP9A 4IGKA 4I50B 1NFRA 3DDNA 3AR2A 4N7JA 4TTQA 4YT5A 2EKLA 1Y9AA 4LV8B 4G37A 2VQFB 4HAUA 4JWKA 4OM8A 3G82C 2PZKA 2VNKA 4KODA 1GGKA 2QSJA 3UUWA 3WGTA 4G0NA 3UC5A 4AZSA 4EG4A 5CXUA 4QM7A 2J6BA 1PD0A 1GZ4A 2AH5A 2QAGC 1P73A 3L46A 1DX9A 1T0JB 2JIOA 3LDFA 5TVKA 4CEHA 3RFTA 4XFJA 1ATZA 2BR5A 3ET5A 3LXXA 4UM9D 1BFKA 1FJXA 1GQFA 1YVRA 3VV2A 1NOJA 5K0NA 1TJYA 3GLGB 3PF9A 3IP3A 4DKXA 1GY8A 4LGVA 4KLZA 1YQGA 4ZQEA 3QSYA 2YN0A 4L4UA 4F9GA 5JYDA 2QD3A 4NYJQ 1EM8A 3BGSA 4EF4A 3UB2A 4EY5A 4Z49A 3KJHA 3RI3A 4YUXA 3QTTA 5K99A 1DTWA 1WMFA 2A0KA 2PMKA 3WRVA 3FTPA 3PUXA 5LQRA 1FYWA 2FMKA 1DKMA 1TOAA 3TPCA 1XUOA 1Z9BA 4LV5B 2QW1A 4QE3A 1NNSA 2RJNA 1HYBA 4QJ5A 3KHUA 3C5CA 3GI1A 3EIQA 4RETA 1WUKS 1RXYA 4MAMA 3HH8A 1JHPA 2AK2A 1O4WA 3L6EA 1UDAA 3O1JC 1G63A 4M49A 5A7GA 5TF0A 3SFTA 3VTAA 4AI6A 2PEYA 2TRSB 3ELBA 4AJOA 2PJDA 1GRRA 4XCXA 5KHOC 2X9LA 1IRXA 5AQ1A 3X2EA 4U2KA 3UW3A 4JQOA 5JTTA 3KJXA 2W2KB 1EQ2A 2FXVA 1QV9A 2IRWA 3TZBA 3U39A 1CF9A 2O1WA 1BWQA 1XNGA 3EIHA 4JUCA 3DLAA 3UAGA 1YAHA 1OPRA 5DULA 4BMYA 2IC5A 4P4SB 5FI0B 1JS1X 5HFAA 4B5KA 4EUFA 5CAEB 1RFLA 3RTGA 1MA3A 4ZAXA 1VFPA 1AKTA 2GWRA 4HZUA 2GF9A 4EJSA 4CL0A 4KV9A 1CG6A 5JV5A 1ZM3A 3VBEA 4IX9A 2CHEA 2WWTA 4BVGA 4ZI7A 1ISHA 1NV8A 2WUWE 2JIPA 3BD6A 3Q98A 1JLSA 1QJ4A 2QK4A 2P6OA 4FOOA 2DFNA 4NICA 2Q27A 5CRIA 2QE7A 1N1GA 3QIAA 4RLQA 1LX7A 1LXCA 1WETA 3KVYA 3FYDA 4OVKA 3YASA 1Y7PA 2PLFA 4Y2QA 1M6EX 3B6IA 2RH8A 3KTDA 3V7FA 3R5SA 4LBVA 1W88B 4DR7B 2PZFA 2CHFA 5KX5B 4BCCA 1NXWA 3ZEAA 2X7HA 2EFEB 1RKUA 5I4CA 4UFNA 2BC9A 2JGLA 3IAFA 1YQXA 3I01M 2I3ZA 3PDIA 2QTAA 1NE2A 4URUR 1T0BA 2A5FA 2J9RA 3CURA 4G0XA 4OBXA 1C41A 1U2GA 4JYBA 4UQOA 1LEHA 3SBXA 4FKBA 2C4WA 5A5DA 2P67A 3I8OA 1SKYB 2QVXX 1K3FA 1OBOA 1ZD4A 4L4YA 4EVQA 3GK3A 1E0JA 4TWAA 1C14A 4NYJR 1AKMA 1ZN8A 4OBWA 4KXVA 1ODTC 1UPTA 5ISMA 4LY9A 2VDLB 1R12A 1T9KA 1RR6A 4FN5A 1TTQB 3U7EB 1VGQA 2RB5A 3GUUA 3O3NB 1RKXA 1SUIA 2G9ZA 2W6PA 4QODA 1RXIA 4BFLA 1SUAA 3OIUA 4XWKA 1G8PA 2ZB3A 4JS0A 4W9NA 1JH8A 1QIDA 1UDXA 1FBNA 3IMEA 4WBNF 4QATA 3HJGA 4HYEA 4Z2AA 2ZIWB 4N41A 4DANA 1RXUA 5TEWA 1P1CA 1XDWA 5E9QA 5AK5A 2DQSA 4IDPA 3SOZA 3ZEIA 5LPNA 2UUBB 3NEAA 1MB0A 2P6RA 3VI4B 1F48A 2H11A 3K9HA 1WBBA 1PEAA 4GZLA 1CFZA 2RGWA 3V1YA 2YIVX 4PYQA 2WINI 2XODA 3Q6IA 2D7JA 4IOMA 4QU0A 1FMFA 2EBWA 4K0RA 3THSA 2ZJ4A 1T3ZA 2JLAA 1EJBA 4UTZA 3RSZA 1VA5A 4RH3A 2WWYA 4BKOA 4DCTA 1N32B 4HEHA 3PUKA 3QNUA 4DMGA 3HRIA 1T5TA 1VE5A 1Y1TA 3AVQA 3H8VA 1XK6A 2GBLA 3F6EX 3LX6A 3ND7A 3GDGA 4ND2A 3CPHA 1CDZA 3RTEA 5EIXA 1OI2A 1PR2A 2IXFA 2WUEA 3AONB 2AXNA 3KQPA 2WWWA 1WMDA 3VU1A 1ZO8A 1ZICA 4L85A 3CPEA 2EZTA 1GV1A 2JVJA 1EFRA 5JPCA 2XB6A 3P0EA 3QVUA 1NSTA 2ZSIA 4Z8XA 3L84A 4MRSA 1IBRA 1F14A 1NJ5A 1NR7A 4BGUA 1M2FA 3L6BA 3L8EA 1W8IA 3G2NA 3P8ZA 4JA0A 4NNJA 1ZZEA 1FXWF 2VEDA 3T7EA 4AP9A 2PLWA 1UXHA 1W1UA 5C34B 3R3XA 5K5EA 2ZU0C 4HTFB 3PCXA 4GYJA 1ZJWA 2FLWA 1WLSA 4HX9A 3K4QA 2B6NA 3Q2OA 2J6IA 4Q01A 5KQSA 3TZCA 3AQIA 1YK1A 1C2TA 3LPDA 1EXVA 3DV0B 5GV7A 2K7ZA 1HE3A 4N1AA 4HPXB 4IWXA 1ZUNB 3C43A 5TMEA 2W4IA 2WHRA 4RESA 3RVRA 3H18A 4OHCA 2BR4A 4PINA 1LPPA 1KDZA 3ZCXA 1WXQA 2VJYA 1PT6A 2UUOA 3VGJA 1SU6A 3AUJB 2Q5LA 3P7MA 1OBHA 2X0DA 3TGWA 3SM9A 1NW5A 2XRYA 1YZUA 2A9RA 3MGKA 2PWAA 4R98A 2FDXA 4TZKA 2ZIEA 3U7FB 4CQMB 3I6MA 3BTOA 1UF9A 2RGGA 4L9WA 4OU4A 1CQJA 1Z5WA 3M7IA 2P2DA 3U81A 1DRJA 1UXGA 4CV1A 2Z3WA 1EINA 3IURA 3IVAA 1QB7A 4LPSA 3NH9A 2YC4C 3CF4G 5THXA 2C7OA 4UCQA 1Q50A 4YDRA 2GXAA 1A5BB 1BS1A 3F0TA 2IF0A 5C5DA 2UZ1A 3PX7A 1AF7A 4EWLA 3FAKA 1BO6A 1H5NA 3CSSA 2DF8A 3SGLA 4PN3A 5HQ3A 1HYHA 4YAGA 1ISGA 1SK8A 2J3HA 1Z6QA 2OC4A 3CUUA 3GJ7A 3OZRA 3ZW7A 2H4ZA 4AF8A 5KYXB 2ZRGA 4HNAB 1DAMA 3UH1A 1NOIA 4XSVA 4LWZA 1KERA 1TM1E 2XMSA 3JR7A 4X1YA 2FZLA 2PXXA 2VKQA 2JLVA 2QEQA 1OZGA 2QUJA 5H16A 1OH7A 3H5VA 4JBNA 1FUEA 3MYRA 4B47A 2VWHA 4ERXA 3ICWA 3F71A 2FSSA 3PJGA 3CUEF 4CIAA 5FPTA 4UHJA 1OU4A 1QAMA 4B9AA 3HO1A 2Y1CA 4QOIA 5L6LB 2FW0A 3K05A 2ZBFA 1RHUA 2YJ3A 4PO8A 2QM7A 3DKRA 3VHRA 3MEQA 3P19A 5EE1A 3CNLA 4Q6BA 4R41A 1PU2A 2FA9A 4OM7A 4FR0A 1CRLA 4TWRA 4XX0B 5HE9A 1RBQA 2AQIA 1QH1B 3MIZA 4L78A 5CCDA 2GK6A 1YNSA 2OD7A 2OT3B 1R9JA 3HWWA 4UATA 3PNVA 3GVCA 1OLSA 4ZA2A 5DTEA 4EJMA 3OZGA 4FYPA 1ISFA 1JTEA 2WYOA 5F1OA 4CODB 1QQ6A 2HDNB 4UC0A 3P0RA 2RI1A 3HMKA 4EGCB 5KUTA 1SCAA 1E2JA 3L04A 1E8MA 3AB3A 3BVPA 1V3VA 4JJKA 3MNFA 4GX1A 1TMYA 4MO9A 4A8JA 4AS2A 3KCQA 5KSWB 2O7RA 3X1MA 3F98A 1BSVA 4QYMA 2Q5JA 3U4QB 1ZBDA 1NF3A 1R6DA 2CNWD 2P8SA 3JD3A 1YD7A 1ISRA 2CFSA 3KETA 2AVNA 3GEBA 2QX9A 4RF2A 4HNRA 1FL9A 5EUBA 2DB3A 4M98A 4GKKB 4V0MA 3KVNA 4LZLA 4G0OA 5KVVA 2F59A 1CC1S 2DC1A 2FTKE 4FCCA 1VPEA 3KCNA 4WA7A 4E30A 3IAUA 4GWLA 1UBEA 3RUAA 1VLZA 3NTUA 1I4TD 1BYUA 1QYDA 3T3HA 1E4YA 1O97D 3REGA 1PVOA 3IQXA 3EZXA 5DHTA 3WLKX 2M32A 4H77A 4MA4A 3TQHA 4YMUA 4QNNA 1W5SA 2W7TA 1H6CA 4MGKR 4KO2S 4U7FA 5AICA 5EGSA 3SF8A 4QUJA 2QM3A 1S9DA 3S2ZA 1CBUA 1T2FA 2D62A 4YCLA 1K9SA 1TB4A 1XTUA 3WBBA 3R4VA 4EG7A 1KP3A 3NOQA 3K6SA 1D1TA 3NAMA 2H0AA 4HI0E 4W8OA 1KQ3A 1T3GA 2QTGA 4CM4B 4EHHA 5KSZA 1B00A 4MWBA 1DP4A 3TBHA 1TVKA 2UZ0A 4OB6A 3SC2A 1HKUA 4NPCA 1L5KA 3D6NB 3FGOA 3UCFA 3M4YA 2J45A 4HGQA 3ABSB 2JCBA 2NNLD 1I7LA 3V8RA 4PAWA 4E5VA 1PX0A 5MGBA 2WJ4A 2V98A 1O5OA 1JMKC 1PJSA 3ACBA 3KLOA 2A2ZA 3JQGB 1E8NA 4FNGA 2BW0A 2JGNA 2NTVA 4HLQB 3IPLA 3KAKA 4KRYA 4OHKA 5CK5A 2F55A 3QF4A 4GX0A 4JLAA 5DWDA 3TI7A 5AVYA 4TWJA 3VDMA 1K97A 5KINB 1VPLA 2DHEA 1QHNA 2WYHA 1NSFA 2PXCA 1O97C 3UFXA 3BWXA 4ZO6A 1ORVA 1KYXA 2LR0A 4BTLA 2BJHA 5IN5A 4M21A 3L8HA 4LSMA 2IX3A 2O3UA 3K0FA 2QRGA 3A0UA 1FRZA 1IJFA 1JVNA 2AHOA 1P0QA 2OQRA 2BELA 2Q6VA 3KX2A 5D1HA 4ENSA 1VPVA 1Z83A 3OP1A 5AKXA 5HKOA 1E5DA 4N6OA 1YQ9A 4WFQA 1E5LA 3L9XA 5H3HA 2XWPA 2JHFA 3OFNA 4MKIA 4AFNA 3AM4A 1UK7A 3OIDA 1C3XA 1TKCA 3NV9A 4A2PA 3L40A 2HN9A 5CDFA 3EXHA 2V5AA 3ZJTA 2Z43A 2X0EA 3LW7A 5LZ5A 1BH2A 4E2XA 3MMPA 1PUJA 3GLSA 1E94E 2WG2A 2B4AA 3BGIA 3BQMB 3IJRA 2VTKA 1GNQA 2NZVG 5CGZA 2P5UA 4HFJA 3TMAA 4KPYA 1JQ5A 2PZEA 3D6TB 4HMQA 3PVSA 3W2TA 1L5HB 5AJHA 3CGGA 1YQTA 2H1CA 4NFSA 2W2MA 1X1RA 2WUVA 1IVNA 4KI0A 4U6SA 5B2EA 1XJWA 2H2WA 2P3OA 1SVWA 2XWBF 1W47A 5EZYA 3E1KA 4JC5A 2BEJA 3NWOA 4ZMBA 4U8GA 1M34B 2QAIA 3DC2A 1V0JA 2VSXA 3UOAB 1BRTA 2UZ3A 4W5NA 4RS4A 4YMTA 3NDRA 4WOBA 1D6SA 3V8MA 1VBKA 1Q0SA 2HDHA 3GB9A 4G5XA 1TU4A 1UP4A 1EVIA 3UNXA 3OU7A 3SYKA 1EAYA 5L3SA 1M7BA 2A1UA 3H3XA 4Q39A 1BMDA 4Q4AA 2QTLA 2OD9A 2HSDA 4HDSB 3TTUA 2GJ4A 3G0BA 5EINA 3K1YA 3VU3A 5CLGA 4NBRA 5KTNA 3RRZA 2WQ7A 3VPFA 3DCJA 4P0PB 3WRXA 1RXWA 4H18A 2OV6A 1H8HD 2JIZD 4Y98A 3GEMA 4QA9A 2VEOA 4ETNA 3EQ9A 4QJIA 4RCVA 4KRGA 2DY1A 1JZQA 4Q12A 3OCZA 2XIJA 1ZRHA 2BFAA 3HS3A 3T3NA 2ZI3A 3RO7A 3RREA 5BQFA 2UDPA 2X86A 1BWPA 5I7HA 1Y33E 1TLTA 1IUPA 4JFRA 4DQ0A 1IMOA 3H2SA 1G8FA 1DBSA 1QC5A 2F6RA 3PUJA 4C0BA 3C3JA 4F9EA 1FYFA 5AW5A 4NH4A 3IEXA 5BW6B 1MB2A 2J9FA 4UFPA 1P7ZA 3K9NA 2PUAA 2CWDA 2NWQA 1NULA 4O4LF 4CMHA 2R6FA 3BOSA 3VH3A 3G8YA 4HDKB 2QROA 2BGNA 4LI3X 4RXUA 1NBME 2NTEA 4HAXA 4HBZA 4M0LA 2JI6A 5DGHA 2HRQA 2DMRA 3IS3A 4GMKA 5KWJA 1Q14A 4WK4B 3PV0A 1ZH4A 2JFPA 4OI0A 2YRFA 3Q11A 3DOEA 5G4LA 3JTMA 1QF7A 4AIIA 3QBDA 1GTG1 3AO0B 4OXYA 3ZI0A 3CMMA 3LFHA 2ZBQA 2EZUA 5EFOA 1JQ3A 3TMKA 4DDKA 2X9QA 3X43A 3WYEA 2CVZA 1AO0A 1JIJA 2PX8A 1COWD 3GLVA 4N3CA 5CNKA 4L8VA 2REXB 3BG5A 3MJTA 3VSCA 1NWCA 5IBQA 4YDSA 4F4DA 2CJYA 1CFJA 3B1JA 1I7DA 4ZCMA 1FRNA 4XRRA 4DQLA 4ECAA 3ISTA 5DWQA 3BHNA 1NTOA 5LNK1 1UP7A 4Z54A 3RT7A 1SHKA 1P1FA 3F9RA 1QRTA 4WZAA 1JIXA 1TZ2A 4X3CA 5EZQA 3RSOA 2QBYB 3QFTA 1TYEB 1T35A 1U1EA 3ZE2B 2HO4A 2Q9UA 1IHUA 1RLOA 4OHBA 1KL7A 1M6NA 1C9JA 1U3UA 1VPDA 5LQNA 3GN2A 5IH3A 1O9BA 2B35A 3WDKA 3ZLUA 4N6NA 3H0CA 4KR0A 4E5UA 2C7RA 4Q9KA 2NXCA 4EGAA 4ENVA 4IOLA 4HEA1 4DJDC 5JE8A 1P1HA 1TEHA 1A9YA 1ZVVA 1PLKA 1I3OA 1MB3A 1R4MB 4YJ2B 4BB5A 1OH5A 3KZCA 3ESDA 5SZKB 1E1RD 1SMKA 1XVVA 4QTUB 3NBFA 2LIPA 3NHRA 4TKUB 3GDWA 4TLLB 1SRQA 2O54A 3D8TA 4TSFD 2VP3A 3NT4A 4XFDA 1A8QA 3NOVA 5DNVA 3RAFC 4TV9B 3HB4X 1ZGHA 1GQ2A 3SX4A 3O2SB 2HSGA 1HNXB 1XEXA 3BL8A 2P4QA 4FFPA 4D4IA 5LSAA 4NJMB 1ULSA 3IUJA 3USZA 2YMPA 1AZSC 4ZYYA 3AOEA 4PS0A 5LB2A 3OE7A 1DC4A 4B0OA 1UL1X 4G5HA 2O1EA 4EG5A 3GEGA 4I55B 4JI4B 3I9MA 4KBFA 2JHAA 4YAWA 1C3OB 4W6QA 4D74A 1QRUA 1QWOA 2CXPA 1YL7A 5F1KA 2VKTA 3ITDA 5DXFA 1Y82A 2A5JA 1VMDA 1XMPA 2VH5R 1UT8A 4LOHA 5TT1A 4ROTA 1NQOA 3SI7A 4AN0A 4IQ0A 4R81A 3D3QA 3MRXA 3EQ2A 5BQXA 3GMSA 5B55A 5AI5A 4FGSA 4KYVA 3HWSA 3JQ8B 1E2LA 2IYFA 2VYFA 4G5SA 1X8JA 4ETWA 4EY8A 3MAJA 4WXPA 2IW1A 1RI2A 5CFZA 1E2HA 5A0FA 2G5TA 1P8AA 5ERYA 1KJQA 4HDRA 1C9KA 2JGJA 1U7HA 2QRJA 2W6JA 3FI9A 4RDHA 5F5NA 4EY3A 3KV1A 3IKMB 3GMIA 5IP5A 4M8LA 4DR3B 4UXJA 5FPYA 5HCUA 4E3ZA 1TUGA 1Z26A 4PR0A 5BV2P 1U9YA 4D9GA 1MJHA 5LQDA 1UMCB 2DR0A 3O92A 5FUMA 3LCCA 3P2JA 4DDHA 3M4NA 4FFOA 2IYEA 4RCYA 4CLDA 2WSMA 3H86A 4JHLA 2VSFA 4RMNA 2VRBA 2DBRA 4XB1A 4YBZA 3DFKA 1YS1X 1E8DA 1X7HA 2ZSHA 5DEIA 3UJPA 1ZIPA 2BE9A 3UT0A 4G1BA 1GKUB 1KP9A 4JMLA 1SBQA 1G9SA 2XUOA 4KE7A 4NL4H 4J94A 2RGAA 1KR5A 1EB8A 1MD9A 3H9BA 2AVDA 2GBPA 1Y37A 4WK6A 1LS1A 3V46A 2XEDA 1QK5A 2ISQA 3NDPA 4NKRA 2WTEA 3OT5A 1OFHA 4NEHB 3J7AC 4TYWA 3E9DA 3QE9Y 3I30X 1KY5A 3FPKA 1WBDA 2WSIA 1T3SA 4KRFA 4IH1A 1N6IA 5JEEA 4R1PA 2IUYA 4DV3B 2QG9A 5C3UA 2EU8A 5CB4A 5C1IA 3KB8A 3FMOB 4IQ4A 1YR6A 4UE2A 1GDTA 1Y9ZA 2Z2IA 1DV1A 4EM6A 2HPAA 4B3XA 2X0RA 1R3DA 2OCBA 4CTOA 3NOXA 1HLFA 3LQRA 1Q7BA 4MOWA 4DS3A 5CH3A 5BN3A 1QPZA 2XUAA 2GFQA 4L76A 3O91A 4CIYA 2YUTA 2V7UA 1LH0A 5A5VA 3JZDA 1D0SA 3GFVA 4TKVB 4DHEA 2FE1A 2Q9BA 2LRHA 2V96A 2P2ZA 4JUFA 1DAKA 1U80A 1I0ZA 2E4ZA 1DKRA 2FN7A 5ARCA 2HDOA 1KQFA 3A4IA 1DL5A 1FU4A 3P9XA 2PMEA 2O5CA 3F74A 1YU6A 3UYLA 2VJLA 1YR2A 2FOXA 2Q2QA 1GV0A 2Q6LA 3O2NA 1MQSA 4LZPA 2YJ5A 4NCXA 1IN5A 3QPUA 3GIDA 1NUHA 2X23A 3B3GA 4HLCA 4A91A 3C4QA 4L73A 3BKWA 4ANFA 3NBZC 4P58A 4X85A 1KYYA 1TM5E 1D2CA 2BEVA 1E6MA 3TAHA 3RBZA 3I83A 2CJWB 4JLSA 2XB2A 1N7HA 3QXCA 1PVVA 4Z4FA 1XP8A 2C00A 3VYWA 1U7WA 1GZ7A 4LHEA 2ATEA 1ZK2A 1F2DA 1RSZA 2Q1TA 5GGXA 3RRFA 2VCHA 3H1PA 4LFBB 1A0OA 3I9OA 3CEAA 1FFYA 3Q3GE 1CF4A 4MX8A 4L4ZA 4L3OA 1SKUA 4U39A 4WXMA 4LX8A 3EWSA 1I2AA 1L4NA 3MTAA 4JB3A 2POQX 2ZANA 5IRCD 1T25A 1X92A 2LTAA 1TT5B 3C3EA 3RBVA 1SD2A 2AX4A 4BNLA 5IFLA 3CKMA 1Z5ZA 1D2RA 2BSQA 2XHZA 3BZUA 4Y6SA 5H1YA 3RYHA 1RQLA 1UODA 4DUYB 4MVCA 1F1BA 3HA3A 4WLEA 3JQ9A 4RTSA 5T6MA 2BFDA 2PQMA 3RSHA 2JJ8A 4D6YA 1FJ2A 2QJOA 2WG1A 4R6XA 5KQLA 5LMNB 2BMFA 1VOTA 3H8JA 3WP0A 4J16C 4CCWA 1X77A 2D3WA 2NSJA 1KVTA 1TRHA 1UXKA 2E4UA 2IUEA 4GBJA 2LCQA 4ZOQI 1Q0TA 3MMNA 2A4MA 3A4LA 1UDWA 1A7JA 3LSYA 4M1TA 4U7PB 2OAEA 1M2GA 4DMUB 1YE5A 1XQ9A 3D8NA 2BV3A 3ICCA 1X19A 2OP1A 2P9QA 5TMDA 1GZVA 5CVJA 3IAHA 1CV2A 4M60A 2YZGA 1C8VB 1XQVA 4Q3BA 3GD5A 1O94D 4MQ5A 3GUVA 3EIXA 1QFMA 3LRTA 2IW3A 2VS1A 3C6KA 3MJRA 4FD2A 4GE0A 4RBNA 4BATA 3EK2A 4OQLA 4ZCIA 5GVSA 3AU9A 3DNMA 4CHGA 2MINB 4HGPA 4RC9A 2J46A 4YRPA 1O0BA 5BSUA 4GS5A 1TQ6A 2GDJA 3OZBA 4LJRA 3BYZA 2I4IA 3FDZB 1BQ3A 3RUPA 2HLDD 1F2TA 3OE1A 1DDOA 2MSWA 3IEUA 2RHWA 1CQWA 1PS0A 1T3HA 4M6WA 2PMBA 4ZEXA 3T8YA 2FMHA 2Y4OA 3AFMA 3T1VA 2ZTLA 4BV2A 1XCOA 5JS7A 1OX5A 3L7NA 1IXZA 2BGLA 2GRAA 1E9CA 3FWKA 1EFLA 4QHSA 4JXKA 5DVZA 4LJ4A 4V2UA 5CXQA 1FRFS 1TYDE 2A4KA 3PI6A 4OIFA 2JGRA 4PONA 5FI5A 3THYA 5E6SA 4UW9A 2J6HA 4NE9A 5LJLA 1CNMA 1PJ3A 2FSUA 2O07A 3LRXA 4X45A 2RC6A 2FF7A 2YCLA 3NHBA 2OXTA 3ROXA 5HHTA 4RTPA 1O94C 4NOJA 3UB3A 2J7PA 4QPPA 3U4GA 4JVNA 3GF4A 1CJBA 2R7MA 1E2EA 1GGFA 3NG1A 3L0PA 3QRWA 4MKHA 4RJLA 1U98A 2G82A 4UNSA 3GJ3A 2B4TO 4PGFA 2WMDA 5GQSA 3VPBA 4TMFA 5BWNA 1A69A 2BDEA 3H75A 4LXIA 2I4MA 3ITNA 2OGZA 2ZIXA 3AEQA 2AFHA 2EXXA 2EGGA 3IOBA 2WDZA 1K7CA 4GOLD 3S3TA 1DT5A 2PD3A 4M55A 4B7UA 3AJDA 5DXJA 4LYYA 4PZ9A 4BKPA 5JIBA 2WILA 1WY7A 3KQSA 3GXBA 4QUBA 1D2MA 3TIFA 1B14A 4E22A 4V2IA 4FYXA 2F90A 2PT6A 4NU5A 2VZEA 5EXTA 2DUWA 1OXMA 1OYWA 2OCPA 4MIEA 1V8DA 3LKZA 3K0EA 3LT1A 3DMTC 1Y6QA 4XYLA 2CXSA 4LXXA 5G53C 4LTMA 3A2MA 4C7OA 4IRXA 1PSZA 4G9GA 1ZQ9A 4UMFA 3RC2A 1AKUA 3N3AC 3C6XA 3BORA 1T4GA 1Q0HA 1TMKA 2VUUA 2BWJA 2FSVC 3I2IA 3QVXA 4HDMB 5DBEX 2ZGVA 3OLWA 4FFMA 3U56A 2G06A 2NU6B 3T3EA 4I1OA 2GN6A 1GTRA 5B58C 1H2XA 3EXEB 4B8YA 4UPEA 3LYUA 4YI3A 2YWBA 3HKEB 4EQ6A 1OYYA 5BR4A 3A06A 4FCTA 4XLZA 3CX6A 4MRVA 4X95A 1Z0DA 2EW2A 2ZAYA 3AHGA 3GOHA 1DUSA 1NG1A 3NR2A 4G25A 3WOVA 5A6SA 2FWAA 4S0XA 2R1ZA 4X97A 4B3TB 4DV4B 1JFVA 3BB1A 4O8CA 1A76A 3GRKA 3CZMA 3OFVA 4PBSA 4ZGWA 1M73E 5ECYA 1J5XA 2AJBA 3DE6X 1U7UA 4QFBA 4YY3B 2R6AA 3ZCRA 2ISCA 3BXOA 3D81A 5CLIA 2B3DA 2MSCB 1GZDA 4N65A 5BN4B 4WESA 4UEJA 4HT3B 1ESCA 4FOSA 1LBHA 2ZCUA 4PHHA 5FBVB 2EX4A 3OLZA 5FOSA 1DJMA 2AOWA 1LDBA 1M2WA 1ZH2A 4LJAA 5F7OA 3ZVLA 3OA2A 3TZLA 4KPEC 3M5PA 4LC1A 1L7PA 1A9SA 1GWNA 1MABB 4G4SO 4RGQA 1P2UA 3RYIA 3CVUA 3E2MA 2ZUDA 3AGQA 4COKA 4BJHB 4PTLA 3CT6A 3PJRA 1Y81A 1NYLA 4I3GA 5DBOA 3CTPA 4X24A 5K8VA 3DTVB 2C58A 3LS2A 4ZALA 4BBZA 3WLJA 5AVSA 1F5SA 3T5TA 1NN5A 1DFGA 2F1RA 3AVUA 1XD9A 5LKRA 1U2DA 2DCUA 1A88A 1F2VA 3SYNA 2JRCA 1JFSA 1PJ4A 2EF1A 1IOVA 1W49A 2FZWA 4R1MA 4TTSA 4KPFC 3WA6A 4C0KA 1B41A 3AY7A 4UU7A 1N6RA 1L4HA 3EOAI 1WB5A 1GTL1 4OH1A 3V1LA 3O1IC 3LMKA 3IB6A 2PANA 4MVWA 2A0YA 4XSGA 4ZVVA 2GTIA 1R8QA 4QQNA 1EP2B 4DLTA 1NKSA 3DZHA 4LJ7A 1HT3A 2IXGA 2ODAA 1ZVQA 2BTOA 3IV7A 4MEJA 4QFDA 2YXEA 3LCVB 1ZMBA 1E63A 2VP2A 4BX0A 1FW6A 1WY5A 4QOEA 1HE8B 1A2OA 3M6IA 1ZY2A 2BHTA 1JHMA 2B1GA 2V7PA 3BQNB 3ZTTA 1N0IA 2JFFA 3GG2A 2K2QB 2JKYA 3F5DA 4P54A 2ZU6A 1P77A 3EARA 2RAUA 3FNQA 3I3SR 4GRIA 2O7SA 4L5CA 4B35A 3ORRA 5JYEA 1HDYA 2GZHA 1J2YA 2FCAA 4TXMA 4AIRA 4I6GA 4KQ6A 4A6EA 5T6BA 4CMIB 3G0OA 4EFLA 4M46A 4YJHB 3RS7A 4KZPA 2H8GA 3I28A 3W6OA 4EUKA 2B5OA 3WBJA 2EBHX 2WJAA 3NFRA 2XUKA 1N0WA 3ORHA 4GXTA 1P0PA 2X4LA 4RVSA 2NYRA 4GM1A 3ZHSA 1OPXA 3R6DA 4IM7A 1L7NA 4Q3NA 4AF7A 1AUPA 1D5WA 4WOCA 4BVFA 2JARA 3OAAD 4EMSA 3TFOA 3D3NA 1WOYA 2ZULA 2RHBA 5AP9A 5TS3A 2XD9A 4QO7A 4BVBA 2QU7A 3E0QA 4PE5B 1AHHA 1E62A 4P33A 1P33A 4JBYA 2QG4A 1JP7A 4QULA 4N4AA 2DH5A 4HDOB 1IB6A 2A84A 2D13A 1M3SA 2PRYA 2HSZA 3ZDQA 4ZI3A 2NUAB 3TRDA 4MYRA 2WUDA 1DOAA 4MW9A 4P34A 5EHXA 1RZVA 4Q1VA 7YASA 2D00A 4IEEA 2FW6A 1HDIA 1ZOOA 2XDQB 4ZT7A 1U0SY 3QX7A 4QGFA 3ODPA 2C2GA 2F3SA 5KKAA 1J8MF 2YWFA 3AR5A 1NW6A 3UMJA 3KSAC 3D7MA 3JQDA 5TDHA 4PWZA 3RK4A 2JCYA 3QF7A 1YGYA 2PD4A 3H2KA 4K6OA 2XYRA 2VF4X 1R8JA 1OHHA 2FWRA 5DHQA 4DFDA 3R9WA 4WFJA 4BFYA 5B6PA 2PT9A 4IJ5A 3UPDA 2OXEA 3LLCA 3TXXA 2RKWA 4KGZA 3U4CA 3KVOA 2GA8A 4YCBA 3RTAA 2YYAA 2GNPA 3C6ZA 1UOQA 4YMSA 3WADA 3AFHA 5IJ9B 1TA9A 3K9GA 4CF6A 1N6NA 2VHWA 4YJKA 3RVBA 2OVFA 1P5HA 2JFNA 4AXBA 5IANA 3ZGLA 4UM9B 2C0CA 4PZYA 2AW3A 1V4BA 3E35A 1DAPA 1X80B 2JI9A 2AFIA 3B12A 4KFRA 1XFDA 3QG5A 2Q8PA 3GNQA 1W85A 2VJPA 2PU5A 4II3A 1Z2DA 3SFZA 3LSTA 4NONA 4YIKA 1VLJA 2ZS8A 3ZHZA 2B8EA 4L3VA 5EHIA 4D8YA 1UMDA 2G4VA 4MR8B 2EP5A 1WUJS 1W4BA 2FWBA 1PK8A 5T8KC 2NU9B 1CUUA 1QGUB 4YACA 2CV0A 2YDYA 2V9ZA 5FWYB 3MHPA 3SPXA 4BMVA 2NVBA 1E0SA 4IXTA 3SX0A 4BQFA 4L6CA 2IPLA 4OATA 1O58A 4F3RA 4WADA 1EHCA 3AINA 3BEOA 5B36A 2GCOB 1G8HA 1P0FA 3JAKB 4RS3A 4FBLA 2GAFA 3R6GA 2OAQ1 3I23A 3NETA 1LJUA 3I52A 2H9IA 4GW3A 3UWPA 1T2CA 1INLA 4B34A 2RGYA 2GN2A 1LSSA 2VAPA 1IATA 1WOMA 4MNTA 1KPGA 3JCZA 1IEWA 4XGQA 4ZHQB 2ZYSA 3DQQA 2GLXA 1JDNA 5DT2A 2WT4A 2FPKA 4UU1A 4YN3A 4MW6A 3WK9A 1ADGA 1CB7A 2P0EA 4UE6A 4C4PA 2AEEA 1ACJA 3R40A 1PIWA 3A26A 3NIBA 4TWBA 4ZODA 4EOGA 4F3CA 5HBRA 3UXYA 4WBSA 4YRKA 1G9XA 2X3UA 1JYEA 2WLTA 4LOLA 3I3OA 3V8NA 4AN4A 5HX7A 3EJ6A 5CCXA 1H93A 1F2UB 4F4FA 1CYEA 4PG7A 1DOZA 5F12A 1X1EA 1G64A 3AHFA 4KC0A 3HGQA 3RSSA 4B3BA 2YJTD 5T4FA 1KETA 1Q6YA 1XHFA 3VPHA 1CD5A 1P5RA 4EPVA 3JQAB 5ALIA 4Y67A 5L95A 1UPUA 1V16A 2AOXA 3EQ6A 3PDCA 1YHYA 4URWR 3WDMA 5B4VA 5C37A 4NQRA 3DL2A 1XQ1A 2GXSA 4MTLA 1B8UA 1PHRA 2I9PA 3GEIA 2G17A 1XDZA 4QX6A 2QRVA 1WUTA 2FF5A 1YHZA 4J76A 4LDPA 4PSAA 2AOUB 2Y9PB 2J85A 2Q1XA 2JBHA 4OQ4A 4LFCB 3L6CA 4ZHSA 3BGOS 1LA2A 1FY2A 3MWYW 1T3LA 5DTMA 2XGSA 4J7XA 4S24A 3UHAA 1AY0A 2BFFA 2O3RA 1V7ZA 2IIPA 4IIFA 2ZRDA 3AFGA 1BFUA 2HLNA 1ENZA 1DCMA 2QMZA 2WW8A 3ET4A 4PYOA 2BKEA 4JOSA 1SU7A 4O1HA 1NF9A 3ZUGA 1G21E 2WKQA 1WB9A 4XVQA 3ICEA 2L18A 1OF1A 1MF7A 1SC1A 1JSCA 2X1VA 3DMPA 5FLXA 4DAEA 3AV0B 1YOVB 5CVEA 2D2VA 4OYYA 2PGLA 5AJWA 2AMVA 3BA6A 5KDOA 1H85A 4YPVA 1E6WA 4NFYA 1GVNB 2NU8A 4IR7A 4EBFA 2YICA 1K7SN 1P2TA 3Q72A 4Y1EA 4ZEWA 2YZ7A 3IP9A 3KEGA 1ZI9A 3LHDA 1GL9B 3OLYA 3VPAA 1PS8A 1P6UA 3HB9A 4BLTA 3I6IA 2IZZA 4DIFA 3OPYI 3ROMA 2AXEA 2VNSA 1YZHA 4K9MA 4NLLA 4NNOA 3WLFA 1GG8A 1N5RA 4AMBA 2XGJA 1W36B 2OBBA 4HG2A 4OHZA 3SHQA 1HNWB 4G4GA 3MCAA 4JL6A 4RSMA 2TMGA 1CVRA 1SJ9A 4QASA 3WMRA 4AS3A 3KPWA 1SIWA 4G0WA 1G1AA 2IEIA 1RRPA 3FKSA 4M89A 3SDBA 1RRKA 3CJTA 4X6LA 1W4AA 1E69A 4RZXA 1PKXA 2V6FA 2EP7A 1IUNA 3OQ6A 1JH9A 3BHIA 1VIAA 1GPNA 4TGLA 3LUCA 3FUWA 1YC5A 4ZU1X 5L4LA 1QG0A 1V11A 3JQAD 3PFIA 3VA7A 1D4AA 3GYBA 1JBEA 2IYWA 2A33A 3ZHUA 5TPZD 2ZW9A 3N0RA 3EAGA 3VOAA 4X6YA 2ZCVA 1XPRA 1GZ6A 4QPZA 3AF4A 2Y67A 4UXHA 2BD0A 2UZIR 4BBPA 1M6YA 1XL1A 5E4TA 2OHHA 4EPWA 2CE7A 1N2CB 1ZGZA 2C5EA 3W7BA 1FF9A 2GEJA 4G23A 1X9IA 5FUXA 4BZXA 1SC3A 1PBNA 1H2RS 1MDBA 3ZYCA 1G3QA 5B7QA 5CA1B 1W73A 3HCDA 4KGVA 1TGYA 4ZJUA 4DIKA 2ASVA 3C1AA 4G1EB 5JNSA 4DPMA 3H17A 3NEPX 2JS7A 1L5QA 4GVLA 2CBGA 3RK0A 1RJGA 2CK3A 4LQLA 5FA8A 2V59A 3U9TA 2F3TA 4OUDB 1X70A 2HHJA 1UJ2A 4CFYA 4FMCF 4OJYA 4FC6A 3SZRA 2P2YA 3AM3A 3WLHA 5DNCA 4KN9S 2Y1LA 3U1VA 3FYUC 3PPVA 3ZXSA 1I2CA 1REQB 5HVNA 1ZUD1 5FUVA 4KN5A 4MUKA 4V38A 4RTNA 3IKJA 2ZKIA 2LDBA 3G1UA 4UEQA 3TOXA 4PX5A 3ZHRA 4O2BB 3H16A 3KU1A 4MYSA 4O4HB 1W0KD 1L6RA 1VE3A 3UJ6A 4OMCA 5H4GA 2H17A 2DPHA 2PMDA 3ND6A 3V3TA 3WB2A 2ZI5A 3PGVA 4M1WA 3V4PB 4GZ5A 5GY7A 2KI5A 1XTRA 2V7GA 3IBGA 1JXQA 2VJBA 2JF0A 4UUQA 4CM6A 1MG5A 1JIKA 2VF8A 3S6JA 5HJEA 1E9BA 4WA8A 1Z16A 3D3EA 2I4RA 4P2BA 4EW6A 2HQOA 1JDVA 1VKJA 3I9JA 1ZN7A 1HOXA 4IBOA 4W1SA 4YUAA 5F5XA 2G8NA 1RYMA 3PQFA 3MGGA 2HW8A 2I8LA 3OJEA 2R5WA 3OH8A 1EFHA 1QYRA 4E08A 3LGSA 5DASA 1U0HC 4KQHA 3S8MA 4AF6A 3M49A 1LNQA 3O95A 3L01A 1IJEA 4OQPA 3LQYA 4GICA 1GGHA 2XMQA 1Z47A 1KZ4A 4MKXA 4CV2A 3G9ZA 1H4SA 1D6MA 3CVJA 2HRBA 2JFGA 1KO1A 3HYSA 1YRAA 4GGMX 4D44A 1Z2EA 3LUPA 4XWGA 3LBNA 1K5DA 4QBGB 3UTDA 3EN0A 4LCJA 3AC0A 3S55A 3WK4A 2IUSA 3NC1C 4B7AA 2ZITA 4R8LA 3Q3CA 4WCDA 3SQDA 4A92A 4WECA 2G9RA 2YV1A 2FEAA 3QEBZ 2A59A 4GD3Q 2BCGY 3GQBA 2PKQO 4R1OA 4R8KA 3ZBQA 4BO3A 5JCZA 1W5EA 4Z99A 5BW5A 4AJ9A 5F9MA 1XD2B 4DLYA 4ND8A 2KBEA 4LK2A 4PAOA 3TQIA 2H0RA 1NVVQ 2BBSA 1G19A 1T9AA 2AW5A 3EAQA 4DF3A 2ZQYA 1KXJA 4CLEA 4UQLA 1GAWA 1PWZA 2W4MA 1GDDA 4EW2A 3NTOA 2FYTA 1SXJB 3RKSA 2LKDA 2UVPB 4DQXA 4RPHA 1E4EB 1Y4DE 1NJ1A 1ENOA 2VCYA 3ISJA 5ESDA 5FV7A 4TMXA 3V1MA 1ES9A 5K45A 1ESNA 1GCGA 5FBHA 2C4KA 3FRJA 3FJYA 4KTTE 2XMBA 1BMQA 1OVMA 4RWEA 1T1SA 1YZNA 5EXXA 3CJQA 3VR6D 4BMOB 1XCPA 3SIXA 3TIIA 1XE3A 3ZWPA 4EPRA 1PWHA 1ZUWA 4JJ4A 3DBHB 1SZDA 3T7KA 3N2KA 1C1XA 3CO5A 2GAAA 2OUIA 3F4BA 4ABYA 1JQJC 2Q5CA 4LRXA 4QUGA 3RHZA 5BVGB 5L8VA 1FNSA 2FQQA 2GN4A 1DIGA 2OV1A 1VBFA 5GJBA 1GU1A 2GPNA 4JJ7A 1SNYA 3WGYA 1ARZA 3OU2A 1PJAA 1N1DA 3L7JA 1NZDA 1OYOA 2FFHA 4XLLA 3WIEA 3NVKI 1KKMA 2Q6TA 1R9MA 2G9UA 4XWAA 1DJQA 3QKWA 2ZIFA 3L4EA 4RANA 4N48A 3LFTA 3HNPA 1PZNA 3IALA 3OPYA 4AX8A 1H1LB 2X14A 4Q37A 3I6QA 3WGNA 2PE5A 3L93A 4NBUA 4Q9AA 4XSHA 1HFJA 5EEHA 3RW9A 5J2TA 4KEAA 3VDRA 3GRZA 2R79A 3GLHE 3Q7PA 4UZSA 3GLIE 1POXA 1RJEA 2V6BA 4NP6A 4P86A 3VR4D 4E5YA 1N78A 2HL6A 2IEAA 5DF1A 2JAUA 2E9SA 2Z5VA 1VXRA 1MB4A 5KNDH 2WU8A 2J08A 5AI9A 1T43A 4MJXA 3EASA 1Y8QB 1SUPA 3QVLA 3VXKA 4YJFB 4IQGA 2DKNA 3IX7A 1XN1A 3PGXA 5JQGF 1PK9A 3K8QA 1NRJB 4ZMRA 4TTJA 3TLCA 3OZIA 2YJGA 3PHJA 2Y1WA 4IUBS 3UATA 3L6UA 3WI7A 5EWLA 4MZXA 3MMZA 2IIVA 1GHTA 3TIGA 2BFOA 1WVIA 3LXMA 1JR3E 1WA5A 2SICE 3ELDA 3F4KA 1U2TA 3I0NA 3Q7EA 4B32A 4CETA 2VP5A 1EVJA 3NTRA 4JB8A 2V97A 3W79A 1XF9A 3FFWA 1NVVR 1SEVA 3HYNA 2MSEB 3IDQA 5JSKA 3WIBA 4DWVA 3BMNA 2JJ2D 3IQDB 1Q16A 1D04A 4FFNA 4DN6A 1EQUA 1N4AA 3F8SA 2JB9A 4MA5A 4ZQIA 3F67A 3OZUA 3RNOA 3JALB 4O4JA 5DRTA 1ZSYA 2EZ4A 5FP0A 4BAZA 4OOEA 4X6UA 1QP0A 2BH2A 3WV4A 3SS8A 2VT2A 2ADMA 4NHEA 3HYTA 1Z62A 1MJ5A 2EP8A 2P40A 1NXQA 2P5YA 2JAHA 3ZHBA 1Z5NA 4UHHA 5HE8A 1Z0JA 1HM5A 2I8AA 5E4YA 5JDIC 4M7RA 4IV0A 1CZLA 2A0WA 2JJ1D 2PTGA 3DQZA 5E0OA 2MYNA 3HVIA 4RKYA 3VJKA 3WYDA 1K68A 1RWBA 4EHLA 1W34A 2DVMA 2QRLA 3DGEC 4IHJA 3G8DA 1IU9A 4MMYB 3E9YA 4NCNA 4RQAA 4WN9A 4YAFA 3VMFA 4WBNB 1KIFA 1JKJB 3L8YA 3NXKA 4MITA 1DEHA 2FPIA 1OZ0A 3IIMA 4EPTA 2PLRA 4K9DA 4RD6A 4U7DA 3MILA 1H94A 4DY6A 4Z1OA 3U5ZB 4RHYA 4CR7A 2CNOA 2YNMD 1T36A 1X1BA 3T4UA 2MSLA 3HCAA 1M67A 1AKQA 1IEVA 1Q1EA 2HXGA 2ZWMA 3EXIB 3KAQA 6REQA 4EG8A 4CQNA 3GBPA 5HJ7A 1GQYA 3O3CA 4CIWA 5K05A 4E32A 4HYQA 1KY3A 4HWKA 5BMVA 2ZKLA 5MFPA 4E0BA 3I1JA 3IIKA 1AUQA 3P9QA 2CYAA 4KK4A 2XQKA 4YONB 3DR5A 1EXWA 4AWBA 1V5WA 4IWYA 1MIOA 2IE8A 2ZRPA 3OUTA 1GPH1 4PYLA 3ZE6A 3MQ2A 2JNWA 3L77A 5HA5A 3VHXB 2WEKA 1CUYA 5CDGA 2CV1A 2PVSA 4Q4HB 1MAHA 4F1KA 3RVSA 2PKEA 2Q2NA 2JFUA 3ZBPA 5JAZA 3GYGA 3N53A 4GRAA 4PAMA 4PLPA 2XVMA 4XAQA 4DDTA 5C7IO 4Q9NA 2CEAA 2C92A 3X2SA 2IS2A 2C8JA 4M0CA 3CVXA 2BF7A 5L53A 3GLFA 5H8WA 1YGPA 4KQXA 2UVQA 3QZUA 1ODIA 4M54A 3TVYA 1VHWA 2BOVA 5FYQA 3LDHA 1Q17A 5C1PA 2YNMC 3DNPA 4G1VA 4LZNA 4REOA 4XCVA 3WLNA 3AVYA 4NZMA 2WTXA 2PCLA 4QDOA 3SS9X 3UAZA 3RUDA 1X7YA 2P79A 3FFXA 1MT0A 3SMVA 2QI9F 3V7YA 1RW4A 5DMXA 4DLVA 4YCDA 1EFVA 3AETA 5DIZA 3G5AA 5EMLA 3DR3A 3K71B 3S8YA 5KTKA 3AZOA 4DXAA 3N5CA 4MYHA 4ND4A 4E1VA 2ZUWA 3LC0A 3EQ7A 4JOBA 1ILEA 2HPHA 1N9GB 4NV1A 1NY5A 5JQWA 2GSDA 2OB2A 5EVJA 5LWQA 5F9FA 4G0PA 3MUNA 4I1YA 3C87A 5JCOA 2XCUA 3VR4H 4CM5A 1XDSA 3HXOA 1JUDA 3O90A 4GXNA 1VPWA 4BIIA 3C6QA 1JWLA 3RVJA 4CUKA 1PDVA 2CSUA 2B4YA 3F90A 3NS7A 3OCVA 2NN3C 4L5AA 4UAUA 5F4ZA 3N39C 3VNBA 1BMFD 3HG7A 2RGNA 4BZZA 4WK2B 1C29B 4CG0A 3I6BA 3DFMA 3R24A 3TOCA 3WVNA 1RPZA 4MHTA 3PVZA 4NI5A 3ZJYA 5FFFA 1OXUA 1FP6A 1DLJA 5D3MB 1R4ZA 2AN5A 2P5SA 5CDHA 3AVVA 2WWFA 3VOTA 2LNDA 2QQFA 3EUFA 1PQPA 1Z45A 2PZ8A 3JQQA 4LRUA 4CPDA 4EI8A 2O2CA 1RS0A 3OJOA 3PQ2A 4X7MA 3GRPA 5B57C 1JG7A 1M1YA 3E2IA 3G3EA 3CZQA 3QWAA 2VA8A 4LVOA 1GFZA 4I1RA 4S2UA 5A4FS 5I7OA 1MJGM 1J2UA 2RBGA 4CV0A 3JWJA 2IWRA 4E88A 3TL3A 1QIEA 2DTEA 4DRXB 2XYGA 1YCGA 1H66A 3TTVA 2ONYA 1G6OA 2LWIA 3D1LA 2WB2A 5JNWA 5K3BA 3PD7A 1KI8A 1WCXA 3HWRA 3ERCA 5FI1B 4G89A 2PL9A 5L6MB 3GUCA 2WWRA 4UTOA 4PZZA 2C3UA 2H6EA 5D85A 4CR8A 4C4RA 4ZVQA 3G0CA 1C1DA 3P9SA 1ZITA 2B5WA 3IAS6 4FU0A 4B84A 4CDNA 1FZQA 2YASA 1GAQA 3NU1A 4ZDWA 2O8BB 2OYRA 3ICQB 2CY0A 5DCYA 3T4PA 1T9ZA 3P2MA 4P5DA 1TE2A 4M0PA 5AW3A 5AVQA 3BXXA 1QO7A 4HH1A 3AR9A 3ZZNA 1EM6A 1NF2A 2FV8A 4H59A 4Q4DA 2QX6A 2NQ2C 1KQOA 3DAPA 1VJCA 1JHQA 5LP6C 2C77A 4CR6A 1QYCA 2OZLB 3BMCB 1W94A 3OJXA 3RJTA 5IK2D 1N4DA 4ODIA 2QAJA 5LBIA 4ZYWA 1KI6B 3I73A 1XKXA 4HWPA 1U8CB 2WSSD 4KJXA 1RYEA 3BSYA 1JFFA 3WMFA 4LF9B 5H3CA 3BK2A 3JZFA 1I0IA 1L6IA 2JI7A 4U2EA 4N0EA 5IVKA 3TUIC 3NEYA 4ZU3A 1RRMA 4KLCA 4H6VA 4JELA 4KOAA 1GRCA 1MRNA 1U0NA 3L1VA 4HO1X 4L4SA 4TX1A 1XMXA 3GV0A 4YJGA 4HX2A 4A26A 4EKIA 1FMTA 2F1OA 3LP5A 3RVDA 3TTSA 3QJGA 5ESXA 4OU5A 1Y3HA 4PU0A 4Y9UA 1RZ3A 1H2BA 2WTAA 4JJGA 2QLJA 3FGPA 2HQBA 5KQPA 1Z0IA 2Q3EA 1L5MA 3C8UA 1YRYE 3TLGB 1I5EA 1KVRA 3ZXXA 5F23A 2IHZA 3H1GA 1RXVA 2GZ3A 3KKPA 4N54A 3DOFA 2B82A 2PX4A 4R2JA 1SU4A 2ERXA 1F9AA 3ESBA 2PMWB 1GDHA 2JKZA 4DBVO 1SCQA 5C2JB 4RF5A 1VDZA 1ODSA 2G1AA 2AKYA 3FX2A 2ZAIA 1AQJA 1QHHA 3VTFA 1KJYA 1NVTA 2JGMA 3ZYZA 2HA4A 4NCHA 5D5HA 3ACDA 3EGDA 5BSEA 2EJWA 3KYCA 3QFHA 3I5UA 4URZR 2X2FA 1QHFA 4LJKA 2O59A 1T4CB 4U7TB 4U2BA 3KSUA 4MVJI 2NIPA 3KYDA 3ZH9B 1Q0ZA 5JXHA 5FT9A 4R84A 1RU3A 1N3LA 2CL6X 2W2NA 4JYCA 2AMLA 2DPYA 4GAEA 4C2TA 1NUPA 4ZO8A 3WOHA 3AU8A 3W5DA 3FLBA 3PGLA 3I4LA 2JFZA 4PYMA 2ZT7A 1QV6A 3HCOA 4MDEA 2W6ZA 5KPDA 1SKMA 3R5HA 2XNHA 1WHTA 3SEAA 4BNDA 3GZJA 3IXMA 2FUCA 3FR7A 3L7DA 5I45A 1UBLS 1JEYA 3A1UA 2IXTA 3O21A 3W6UA 2BRUA 4C2AA 4ZYVA 4ND1A 1GOTA 1KI9A 1IZ7A 1ECLA 1KEVA 2OCAA 2AL7A 2AG8A 2V45A 2OO3A 3GGPA 4TL8A 3EW7A 4UMEA 5BY2A 1YMVA 1V43A 4LXHA 1M2HA 2E82A 4AYTA 4LDRA 3WY9A 3DZBA 4G9BA 1SBNE 1XO1A 2FGKA 2PR2A 3VPSA 3PITA 5AOCA 2PZGA 2X8BA 2GYVA 4PFKA 3F2IA 4F04A 5EWJB 5EJ5A 3QWBA 1D4FA 4FFDA 5HF8A 4FYIA 1EM8B 5F76A 5IN4A 1G8SA 1SCJA 5HGXA 5ALEA 1ZJ4A 2NUPA 5J4VA 1DI0A 2P6PA 1Y1KE 2JGDA 1B2LA 2IP4A 3AL0C 1BJTA 4KQJA 1G0NA 5FX2A 2QXUA 3NC4A 3BSWA 3M4ZA 1E2UA 2FPXA 2W2PA 1EDBA 1Z73A 1L8XA 1Z15A 4I4NA 3V7NA 2FQXA 5BWCA 2YKGA 1JE0A 4NXNB 3PPWA 3PRKE 4IO1A 4EFKA 4MLDA 3H83A 5CNIA 5K0BA 1KY4A 1LPAB 2B3TA 4DE5A 4C4AA 2ZXEA 1X8XA 3L6OO 1U28C 2JZNA 5DX1A 1IN7A 3B8EA 5EMHA 4GI2A 4C78A 5K6AA 1W59A 3TKYA 1Q1ZA 3IBCA 1D1SA 1ZGGA 5H59A 4IGIA 4G1UC 4R40A 4REQA 3FHCB 2HUNA 1WWKA 2Q50A 4XWYA 5J2TF 3IKLA 3EVZA 4FILA 4F2HA 1D1PA 5J4YA 5M04A 4NARA 2AUTA 3EBLA 4JAVC 1TX4B 2P6NA 4KQ1A 2NZJA 1N8TA 5DXAA 2I2FA 3HDJA 3RRJA 5EE9A 5F3RA 4HZUB 2AN4A 4JLBA 4M8SA 3KWMA 1LI7A 4EJSB 3VJRA 2BI7A 1KORA 5F77A 2AYXA 2PAFA 2JK1A 3R7BA 2HIAA 3GA5A 5LFAA 1ECPA 2AUNA 2H7YA 1H0KA 1DEAA 1YMQA 1P72A 4A5SA 1NMSA 2H29A 1DBRA 5T64A 1M6VB 3SKXA 3UUFA 4GM4A 5FOQA 3MLBA 2I33A 4P8RA 5MGNA 1FXSA 1OLXB 1XA4A 3I9FA 4QBTA 4X8OA 4JV5B 2PWYA 4CTMA 1OROA 3P71T 5KJFA 3CQ9A 4RDXA 3N59A 1VSBA 4M0MA 4F84A 3VR3A 3KFVA 4BQSA 1E3LA 5DLEA 1FNMA 3EZYA 1PR6A 2H92A 4LECA 1CZRA 3HI6A 3PDIB 4I81A 4O4LB 1O2DA 1ORTA 3LVQE 4ZPJA 1BXRA 3U7JA 1TMOA 2RK6A 4ZICA 4FWTA 4O4JF 1GT6A 3WFIA 3PNYA 1ISPA 1P44A 1VLVA 1C8KA 4Y30A 1QRDA 3IV9A 4AMZA 3QXGA 3A31A 2H2HA 3KDPA 4PLZA 5CX1A 2IS6A 3H4MA 2M1XA 5E1BA 5B7GA 2R60A 4MDYA 2WHYA 1I7SB 1X8KA