2QLJA

Crystal structure of caspase-7 with inhibitor ac-wehd-cho
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
140
structure length
140
Chain Sequence
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-7
publication title Plasticity of S2-S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qljA00
4HQ0A 3KJQA 3NS7A 4JJEA 1NMQA 2QLBA 5LUAA 1RWKA 2J30A 2CNOA 2C2KA 4ZVSA 5IBPA 5IAGA 2DKOA 3PD0A 3D6MA 4QUEA 1IBCA 3NKFA 4EHAA 4EHLA 5I9BA 4QUHA 1GQFA 4AWAA 3E4CA 4QU9A 4PS0A 4FEAA 5IAEA 3PCXA 2Y1LA 3KJFA 4FDLA 5IBRA 3V4OA 3BIJA 3UO8B 1BMQA 1SHLA 2H54A 1QX3A 3D6HA 3NR2A 4N6GA 4AWBA 4D3ZA 3R6GA 4ZVTA 2H4YA 2NN3C 2QLJA 5IAJA 1CP3A 5IAKA 1F1JA 3GJSA 1RHQA 3DEJA 4ZVPA 2FUNB 1SC3A 2P2CA 4QUDA 4AW9A 4D3XA 1NMEA 4M9RA 4NOLA 1F9EA 1M72A 2XYGA 4JJ8A 4N7MA 2Y0BA 2QL5A 3GJTA 3DEIA 3V6LA 2J32A 2H4WA 2HBYA 1I4EB 3R5KA 2H5JA 2HBRA 3DEHA 3V4LA 4QU5A 1NW9B 4NOMA 2J31A 5K20A 2XZTA 2QLFA 4QU0A 3H11B 4JR2A 3S8EA 3R7SA 1QTNA 1I51A 1RHJA 3KJNA 4N6NA 4QUBA 4ZVOA 5LU8A 5IANA 4HVAA 5IC6A 3PD1A 4EHKA 3QNWA 3IBCA 1SHJA 3EDQA 1RWPA 2AR9A 1SC1A 2C2ZA 2XYPA 4ZVRA 5IC4A 2CNLA 2XZDA 3H0EA 2QL9A 4FGUA 1RE1A 1RHKA 4QULA 4PS1A 4I1RA 4ZVUA 4EHNA 3R5JA 5LUBA 1I4OA 5IABA 1ICEA 1RWNA 3D6FA 3GJQA 4QTXA 4IYRA 5IBCA 4HQRA 4PRYA 1RHRA 2WDPA 3RJMA 3V3KA 3S70A 4NBNA 3V55A 1RWOA 4I1PA 4EJFA 4EHDA 1RHUA 2CNKA 4JJ7A 3SIRA 4DCPA 2J33A 1K86A 4QUIA 1RWVA 1K88A 1RWMA 2C1EA 4D3YA 2CNNA 3ITNA 2XYHA 3H1PA 4IEFB 4JR0A 3R7BA 1PYOA 4FXOA 4QUAA 4QUJA 1RWXA 4JR1A 4N5DA 4NBKA 4N7JA 3EDRA 1RHMA 3K7EA 1SC4A 3GJRA 3UOAB 2CJXA 4DCJA 1QDUA 2H51A 2HBZA 2HBQA 3IBFA 2C2OA 3SIPA 4QTYA 3P4UA 4QUGA 4ZVQA 5H0IA 4NBLA 4EHHA 4QU8A 1NMSA 2C2MA 3V6MA 1KMCA 2CJYA 3R6LA 2H65A 1I3OA 3DEKA 3P45A 5JFTA 4N6OA 4LSZA 3H11A 5I9TA 5IARA 1CVRA 2FQQA 4NOJA 1GFWA 3H13A 4JB8A 4DCOA 2CDRA 2H5IA 4JQYA 3R7NA 1RWWA 4JQZA 2QL7A 2K7ZA 2H48A 3OD5A 4PRZA 1JXQA 1PAUA 4NOKA 5IASA 2FP3A 5LU9A 4EHFA
chains in the Genus database with same CATH superfamily
4LVOA 4ZAGA 1X14A 2HJSA 1IWPB 4BC1A 3FDIA 1BE6A 3Q8WA 1NVAA 1C4OA 1NVDA 1TMGE 3LG2A 4I1YA 2QE7A 4AJJA 4ENUA 2CKDA 5B2EA 1WD7A 5EGSA 5TC4A 2W6CX 4JLSA 4RETA 5EKSA 3EZLA 3CA8A 3OZ7A 1DSSG 1H22A 2VPQA 5TE9A 1F2TB 3DXFA 3QEKA 3EF1A 2GAIA 3PTZA 3A4IA 3ICCA 1X19A 1L7BA 2PH7A 2X15A 4PLYA 1WB9A 5C4GB 1LQUA 2WFLB 1Q2UA 4KAJA 1H8HD 2XJ4A 4P53A 3GJSA 4ON9A 2WU4A 3EUWA 1RD4A 3PRYA 1UC4B 2O3RA 3MILA 4KAFA 4PHGA 1FP6A 2FZVA 4E1VA 4EYSA 3FWHA 1YGPA 4F97A 1Q0UA 2G9RA 2BGKA 3SX4A 3V6LA 2JD0A 4BKMA 2WPDA 2HIMA 1CU1A 4INAA 1PT6A 3ZLBA 3UY4A 1R0SA 3E22A 4L73A 5JXJA 1DU4A 4DMLA 1JZSA 2HMSA 4P7FA 3EF3A 2HXYA 2NNWB 2WA2A 3ZU5A 3C8DA 1RXUA 3HBJA 4IHJB 4GI5A 2RH4A 1RM0A 4LE1A 4NYMQ 2FF5A 1OBFO 3EZ9A 3QH4A 1GAWA 2X77A 2DHQA 5FDFA 2WF5A 3HB0A 1E0SA 1BDJA 2XYPA 4YH1A 1VBMA 4D5GA 2IYTA 4UQLA 1ARZA 3ONNA 4O3FA 3AWIA 2GN2A 5G53C 4C0KA 5KTYA 4GKAA 4UXJA 5JMWA 1P74A 2IPOA 3EWIA 4BXOA 1VGQA 1PZHA 3R3HA 4AP9A 5L4NA 3BXHA 1K6JA 1VIVA 3VAAA 3DL4A 3NH6A 2OA0A 1JDUA 2SECE 3DLBA 1E6CA 3WWOA 3FCSB 4JBHA 2YHIA 3KZXA 4IHQA 2PX0A 4NKRA 4WLVA 4B3DA 2DH5A 4B40A 3BDAA 2WYHA 3FCUB 1UAAA 4CBVA 4KE9A 5F35A 1S2MA 4K87A 2JVJA 3RYCA 5BMOA 1P4HA 4V03A 5EYPA 1UOOA 3P96A 2YMPA 4YCLA 1ADJA 4YDRA 4EB8A 4JHXA 3JARB 3WSTA 4LGVA 3OQBA 3U80A 3PHJA 5EXEA 1YCFA 1I7LA 1XUOA 2WF6A 4WESB 5D84A 5BR8B 1RC1A 1WZNA 2XIQA 3G0BA 3NAZA 2C4TA 4M89A 5LKAA 4X65B 3DE5X 4G8BA 1EJ6A 3FR7A 2CMHA 3RS4A 3NRCA 4OSOA 3GFSA 4L02A 5CVEA 4IF6A 2R4UA 5DM60 1W88B 3E7FA 2Q0SA 2EGHA 4BQNA 1KEEA 2H4ZA 1LV7A 4GM0A 1P1JA 4JU9A 5LB2A 3UJAA 3PC6A 4INPA 3ADDA 3EAGA 2WP0A 1L7NA 4B81A 1G18A 2WE8A 1WF6A 3DZCA 4NESA 1M10A 4RFLA 4QDTA 3AESA 3TCNA 4B0PA 3KOZA 3RRYA 3BORA 1J0DA 2QTAA 1IU9A 3KUKA 3SYLA 2M1XA 3W06A 2GBFA 1UDRA 2CVQA 2UZ1A 3TVYA 1XNRB 2DT8A 2HJVA 3TLKA 3T38A 1OBHA 2R1UA 2JLYA 3SR0A 1LJUA 4X66B 3FNFA 2J45A 2C2KA 2Q21A 2PX4A 1A1VA 1ZSNA 1LBIA 1XTZA 1WVMA 2I1LA 4QOHA 1M7GA 1US8B 4WVLA 5DP1A 4NZPA 5A4JA 3N8NA 3RNOA 2X6QA 3U0BA 2WUWE 3W9SA 3QW4B 1ZU5A 2VATA 2Z2IA 3U81A 1H69A 4EDFA 4KP7A 5J4HA 2POCA 2WD9A 4G9EA 3CKYA 4AJ2A 1T3HA 5KU1A 4LJYA 4Y6PA 1UJCA 1V48A 4RPIA 4KQWA 4B8ZA 4L3OA 5IAJA 1RXWA 4CF7A 2B8EA 3O1LA 1NRXA 1OWMA 5P8WA 2C5GA 4O4HF 4CKBA 3IOYA 3A70A 4IDGA 4HWGA 4JJ8A 1X39A 4HS4A 3OAAA 4J0DA 1Y8QB 3KHTA 3JD1A 5J23A 1AZLA 4B8YA 3KYDB 2P6PA 1JMVA 1W5AA 1IN5A 4JA2A 1XIVA 4P36A 1RKQA 3L77A 3OM1A 4RE6A 1O2DA 2RGWA 1QIJA 1Z38A 1QK4A 4MS4B 1V4BA 4WCDA 1PIWA 1EWRA 3AJDA 3GZJA 4MS1B 4N6NA 4HTAA 5A3QA 1HTWA 2JHPA 3DHEA 3K9FC 2I4IA 3IVGA 3D8NA 1XF9A 4FOOA 4UXIA 5DI3A 1UEJA 5IMBA 3RVJA 3WJ1A 1QZXA 2DFTA 2ZYIA 1JGTA 5K0NA 3G8CA 1S9HA 4IDNA 1KDYA 4DR1B 3BDIA 1B6GA 5LYJB 3WO1A 4L27A 4UPVA 3WGJA 4JL5A 1QG4A 4R1NA 3IB6A 3OM8A 1RZUA 4ZALA 1N2CA 1JU9A 1E2HA 3BWBA 3FFBA 3I3SR 4ZVUA 3TAHA 6AT1A 1RWNA 4BE4A 2ZRKA 5IYZF 3U3JA 4K9SA 1KDTA 2QR2A 2QV0A 1PHRA 3C8HA 3U7EB 4OI0A 3IBYA 2XVYA 1PV1A 3SQLA 5ALVA 1FL9A 2VT6A 2LCQA 3RYHB 2WB2A 5CYFA 1QYIA 3WGMA 1KFCB 5KOIA 4UHBA 3OVMA 1RLUA 1P2VA 3D3WB 1N1GA 3MWFA 1GA1A 4WRRA 4ZZIA 1W29A 3A04A 4OHZA 3AR7A 3PRKE 1DV1A 4TLMB 5C3UA 2M6LA 1Y4SA 1XJQA 3MJHA 3LBYA 4GBMA 4Z9XA 2FRVA 2CSUA 3KJIA 4KE7A 5DOZA 4BVKA 1DIAA 3GFBA 3HB4X 2IUUA 1CR1A 1CZNA 2BM1A 5CLFA 5JSFA 3D4PA 1FZTA 1QIGA 4X6LA 3LBFA 4WLEA 1E77A 3L7NA 1X8XA 1CQWA 2VFAA 2WYOA 3VUFA 5IWCA 2D1FA 3IEMA 5EMMA 4WNAB 4AY4A 3Q3VA 1OIXA 5KINB 3MOSA 5DHTA 4KYUA 4HDQB 5GMOA 4E22A 1V37A 1ZN2A 2EDAA 3GFFA 1ZXBA 1OI2A 3VM6A 1RRFA 4G25A 2ZR7A 4F2DA 1JI3A 3KWLA 3OJ0A 2C42A 2YHUA 4MPDA 4WN9A 5CT6A 3RFTA 3TZBA 1NQWA 4R1PA 5C32A 1ML3A 1Y5IA 3GMDA 5M34A 1IN7A 1OTXA 1WU7A 3SFZA 2GERA 2EEPA 5C18A 4W5NA 3EJWA 1W87A 4YAFA 4JUFA 4ZDJA 3CF0A 2ZDQA 4IJUA 3IYLW 4HQOA 2BY4A 4B17A 1A9XA 1U9ZA 1Q3HA 3TLZA 1U7ZA 2HT6A 1F8UA 1KJNA 3DE0X 4I1UA 3CONA 4CMGA 4AG5A 4DIUA 5EXSA 4ZZ0A 3MNFA 3PDIB 3JVUA 1GAQA 1Q22A 4N9QA 4AF7A 4AJIA 1EFRA 4CIYA 2FA9A 1OX4A 1NXQA 2GF0A 2OHOA 2GVNA 2YY7A 3EXEA 1SXPA 3D7NA 1TGVA 1ODJA 1LLQA 3NR2A 4JITA 2QW8A 1NKTA 1QNLA 3OZGA 3QNUA 4D0LB 3LIPA 4O4JB 1EXDA 1XA0A 4Q05A 1F17A 4D7AA 1P5RA 2WWFA 4DV6B 1TO2E 2CB0A 2ZJZA 4GF5A 4WGGA 3WB1A 2J3JA 2TMKA 1NJGA 2UVPA 1W0JD 1WPQA 5JZVA 2YVKA 3ZXXA 2WRZA 4OHOA 4DM7A 1G6HA 3FZEA 2W0MA 4AMBA 3EA5A 1BWRA 2FN8A 3EC1A 3EXIA 3GGSA 1F60A 3IT0A 3KPJA 2RD2A 1YMVA 4JI1B 3KZOA 1QVAA 2FJPA 1UJMA 2OM2A 1M0WA 2MCFA 2H5EA 2PD3A 3DKRA 3PYMA 4H27A 3J80A 2DP4E 2Q0HA 5KIAA 1U04A 2J4DA 3H5TA 3NWPA 3VGPA 4R4JA 1POXA 2BYTA 4EPWA 1QQ7A 2WOJA 5FFFA 4A0FA 3JV7A 2WWYA 1YNOA 3O84A 4D4KA 4M88A 3N2ZB 3O95A 2VAPA 4FZ5A 4LBVA 4OX9Y 1P1HA 5CX4A 4PAMA 1L7XA 5C35A 4BVJA 3WB0A 1KIMA 3RRXA 3MYRA 2N1MA 4DG8A 5IBCA 3C3AA 1W5FA 3LX8A 2RE8A 2BFAA 1GUFA 2UZ3A 3GGOA 1MB3A 4NDNE 4WDQA 3UPTA 1PDVA 4MYUA 2J3LA 1U7PA 3NTQA 5J5VA 3EUEA 3AFMA 2AN9A 2XTZA 5SY4A 1W30A 2YJ5A 1O57A 5A1TA 3U7RA 5HQ3B 4LFAB 4NLLA 1AS0A 4HRAA 5ESXA 4F7WA 3FD8A 3HA7A 3VDQA 4AKEA 2LBPA 4ZT7A 3H7IA 4CG3A 2R751 2WWRA 4NBVA 3O8BA 5CGQB 5IZ4A 5AI9A 2K87A 3DR3A 4GMHA 4Q9IA 5DIFA 1WPRA 2XGMA 3SNHA 3AF0A 3V4PB 1T9AA 5KDOA 4W5QA 2R2AA 4TL7A 2C7QA 1VMEA 1PJ8A 4ZHQA 3RS2A 5LWQA 3M82A 1E2PA 3VYSB 5BUZA 4BQFA 4QTYA 1WCXA 1V8OA 3GOHA 4XOIA 4DLBA 1U1DA 4RH1A 3DVQX 1Y9AA 3CG0A 4G0XA 5SZIA 4L07A 1I3CA 4URWR 1I24A 1P1FA 2HRQA 3T3IA 2FZ5A 4F11A 2KBEA 2JIPA 3H2IA 1E9EA 5DLEA 4CF4A 1IUNA 3DUFA 1WULS 4JB3A 3R3JA 1MRSA 3IAS1 1P80A 1BDHA 3HSYA 3A0UA 2OFWA 1VMKA 3DW3X 4F3YA 1OBOA 1JQLB 1DJQA 4GLBA 2CN1A 5IPFA 2IXDA 2VP0A 2BN4A 1CPYA 2PIDA 3QUBA 4RTJA 3CPSA 3NO4A 4LJ6A 1NAIA 3A58B 5LVAA 4UEKA 5TXGA 5FWYA 3CCFA 3VUEA 4WKPA 4G4SO 1NMQA 3C6XA 4Y6QA 2QTRA 4R2IA 4IIBA 3I1JA 5IAGA 1E2GA 4KPFC 4JB0A 1ODSA 4FGWA 2Q6KA 1IBCA 1D5WA 3OIGA 1HE5A 2YZGA 2A1UB 6PFKA 3G89A 4HGOA 1OKKA 1P9RA 2JRCA 4XKJA 4YUZA 1Q1EA 1E9CA 3FF1A 4BO0A 5FTLA 4YYEA 1NIJA 2DUWA 5HJ5A 1TAUA 3HXQA 1NF3A 1JVBA 3RO7A 4DYHA 4JYZA 3VSEA 1DRKA 2BFEA 4RORA 1JDSA 3U4QA 4YC7A 2PWPA 1ISHA 3FPCA 4WY8A 1QE0A 3H1BA 4CFYA 3QF4B 5CIYA 4CIBA 1E6MA 4OHCA 1CKEA 2PEZA 1A7AA 4NOLA 4Q4AB 1DO0A 5FI0B 1WXGA 5DF1A 5JDCA 2VRCA 3ZLTA 1VHTA 1ZRNA 4Y3UA 3WLAA 1LTKA 2O3QA 1ACLA 4X1KB 3ZE7A 4JI5B 1ZGBA 4DYVA 2YN0A 2IDJA 4RHEA 4YI3A 1OTYA 2JB9A 4PAOA 4BNNA 2I1WA 3G59A 5CW2A 2PO7A 4HGNA 3ADCA 1JSZA 2JG3A 1HDOA 4ZKEA 4RU1A 1L3IA 2FQ1A 2JF0A 4J2HA 1F38A 4QRIA 3TEFA 5L6LB 2I8CA 4EPRA 3CVXA 1E9VA 1RPNA 1Q7GA 3MTDA 1KHTA 4E4YA 1EGHA 1MQSA 1QGOA 2WKRA 2IHVA 1ZMOA 5KOHB 3RBXA 2I55A 3Q88A 1TE2A 5K0GA 2VJOA 3ZWMA 4BMDA 3FXAA 4AJOA 3VKGA 1RC8A 1KJJA 1CF2O 3WRXC 4IUYA 2YYSA 2AWNA 1TK9A 1QC5B 2ZJ2A 4JQCA 3THRA 4IVQA 2QN9A 1XCOA 2VUTA 3OA0A 3Q2KA 2YKGA 1U6KA 3RJ9A 3OIWA 2VEDA 2IXTA 2ZCVA 4MPRA 2FMTA 3KQPA 3CHYA 5A4DA 3CUEF 1S3SA 1AA6A 3JZMA 3T7DA 3A05A 3PITA 4OHBA 3RGGA 2QTFA 3S2GA 3T7AA 4YAJA 5JMTA 1K9VF 1Y9DA 2WWGA 3N58A 3MF4A 5BVGB 1Z5OA 5GONA 2JGMA 1ID8A 4KWHA 1ZW6A 1VZ2A 2G71A 4B33A 2ZZKA 1M6YA 2NYAA 2ZB8A 4OQPA 5M29A 2R7NA 3AZPA 4JJFA 4KBFA 1C9YA 4Y2QA 4WQMA 4E14A 3M83A 3NTRA 1TTPB 3BJRA 4AICA 2ZTMA 1E89A 2QG9A 1Y5NA 3ZDRA 4A0RA 1FYWA 4GR9A 5AM3A 2I1QA 1TQ6A 2R7LA 3QX7A 4R71A 1HR0B 3VNVA 1BW9A 1MW9X 1R6XA 4V0KA 1DOHA 4HNTA 2ZK7A 5CLJA 4IP0A 3VU9B 4J29A 1T36A 4AKTA 4DDKA 5KPDA 5AVKA 2BDUA 4RZ2A 4R54A 1H93A 3RIEA 3U60B 5IZCC 1A1SA 1IXSB 4UUAA 2YS6A 5J2UF 3UMMA 4EEXA 3WAJA 2GNOA 2NU7A 4ROTA 2YIVX 1EAMA 1XRSB 3U0VA 1Z16A 4GC5A 4RUKA 3AW8A 2OZLA 3HKEA 1SUEA 2C31A 2I66A 2NPIA 2B94A 2PBRA 3W8EA 4G0NA 4B3HA 5IXJA 1PQ4A 2XD9A 3OZDA 4YJ3F 1GARA 3THYA 1QH9A 2PUAA 4AN4A 2ZGVA 3NVMB 4Y1RA 2JCYA 3SJZA 5A3SA 1UKYA 2IITA 5BOSB 2H00A 1JEJA 2HSEA 2W2QA 3LC2O 4BL5A 2QI9F 1GG5A 2P2GA 1SB9A 1NNUA 1P7WA 1R0KA 1LFAA 1WLSA 4C2BA 2RARA 2JIRA 4A7PA 5KOJA 3EFEA 3BKWA 4LXIA 4GNKA 4DR4B 3FVQA 5JAMA 2W6JD 4ZANA 4AWBA 4CPDA 2QAJA 1ILEA 1XDWA 3D6TB 4NIMA 3QV2A 1XZFA 1DEOA 4JLMA 2OQVA 1WF3A 1IXKA 1EFUA 1R18A 4QGSA 4PY2A 3KSAC 1H0RA 1OYOA 3FSGA 3M33A 4C3OB 1WD5A 3OEYA 4DC1A 3IJRA 1II9A 1GZSA 3LIIA 3BIXA 1CE8B 2QVYX 2QJOA 3K20A 1F8XA 3E7WA 3O4IA 2NZWA 1VKHA 1DQPA 3Q9NA 4QHTA 1NJ1A 1MT3A 4DJEC 2M1ZA 3I9JA 5AKJA 3NBAA 4NAUA 4PBRA 1XE3A 3I45A 3TE6A 1KBOA 3IPRA 5KCMA 3WYEA 3RAPR 2OORA 3ZDEA 2BKLA 3LPMA 1NVUQ 4NZZA 4QRDA 2BEJA 2DYKA 1EGMB 1C7IA 1QTNA 1U9YA 3T3GA 4ETWA 3S8EA 1RPZA 1WAMA 4GWGA 3TR6A 1Z0JA 3FCOA 1CBUA 3QA9A 3IT3A 3NOXA 2A5YB 4X8HA 3BE6A 3TX6A 4B44A 3SFTA 3LUCA 2JLXA 4EUSA 2CJWA 2VJMA 2V7QD 2VSFA 2CNLA 4OOFA 1PN3A 3I2KA 4K88A 3DNFA 3I37X 4J4TA 4DMRA 2GYVA 3PYLA 4TKUA 1G41A 3C87A 2QAGB 3UGTA 4K05A 2IU3A 4HXYA 4YB8A 1W1UA 3ZS9A 2ZB7A 1XQ9A 2QUHA 2EHJA 3PV0A 2LW7A 3ZKAA 4JJ7A 3U13A 2HA2A 4Q4JA 3ND5A 1BCSB 4PBTA 1CIPA 3ZNQA 4ZJUA 2Q7OE 2QQFA 2WTEA 1GGJA 5HE8A 4BNTA 3BMNA 4QSHA 1ISGA 2WYIA 4BP1A 4DE5A 4FBLA 1LDNA 2E1PA 4C3VA 4IOJA 4LDPA 3ESYA 3Q3IA 1OXTA 1ZW1A 2C9BA 1AXEA 2AQHA 2XF8A 1SCDA 3G17A 3L8GA 4TOIA 4Y6OA 4YUAA 5T64A 4AMYA 1ZESA 4PVCA 1R0BA 2JFYA 3NUZA 2HHLA 1PP4A 3UG7A 3IA7A 4OK5A 1P2UA 4C29A 5HK9A 2O6LA 2RH9B 4KLAA 1GUZA 1TT5B 1JTFA 1OPRA 3MGKA 1GYQA 3TIIA 2Y92A 5TGTA 3FROA 5CLHA 2WT9A 2GKGA 5IJWA 3JYPA 3OE7D 1P7PA 3ORFA 3TJMA 3TSWA 3W6ZA 4I50B 5D6OA 5KEIA 3K6SB 4N6OA 1YQUA 3LX4A 3HKDB 3RHSA 3DYIA 4FE7A 2I4TA 4KWEA 1CVRA 1LD3A 1CIVA 1WDKA 4L4SA 1YQWA 1D1QA 4PW0A 5EHQA 5A03A 2I6TA 1M0EA 1QLJA 2YOGA 3H1FA 5H8WA 1EX1A 1X9GA 2CF5A 2NU8B 2PBLA 3LT2A 3RSCA 1NPYA 3RIYA 4CE6A 2XTMA 4L6IA 5FWDA 1R6UA 4ZOLA 2V7TA 3A2MA 1ZK0A 1QMPA 2AMFA 3WNQA 3RFVA 3M3PA 5I8PA 4M0EA 4RMIA 4ZEVA 1ECFA 3VVBA 1C7RA 1LK5A 3GT0A 4HX2A 1G1AA 4BFTA 1E6WA 3I04A 4F4HA 1QGDA 1I5RA 3IO5A 3E8XA 4NENB 3V7FA 4ZCSA 2DTDA 1GKKA 4C89A 2ZVPX 2C5HA 5HKOA 5BXQC 1B41A 4GGMX 5F2EA 3GXBA 3I53A 4G8JA 5J63A 4X41A 9LDBA 2ENUA 2J41A 3ANSA 3INNA 3LC1O 3A14A 4JFRA 3U7GA 1IHYA 1MR3F 1YB2A 2PVPA 1GNQA 2V45A 4R2MA 3U1TA 5CT9A 3UW1A 2YIDA 1CUWA 3CLHA 1XB2A 4TQUS 2CXPA 2WV7A 4P35A 1BN7A 2NXNA 3T1QA 4BO9A 5K99A 1RJFA 3O94A 1QONA 2WHPB 2P68A 1ODFA 4IHKA 2NUBA 3OZEA 3PJFA 3EFOA 1ZK1A 1FDTA 3NV9A 3PUJA 2O9JA 2I2FA 2XUZA 2A1TS 4UBJA 3QUSA 5JAZA 5CA1F 1GNSA 2WJGA 1NNI1 1SVWA 1EG2A 1A0OA 3LA8A 5H4GA 4HQ6A 2XT6A 2P8SA 3EEBA 2R66A 2GQ0A 1X1SA 3GZTB 2NT4A 3EC2A 1C3OB 2JEZA 4IXNA 4TYYA 5EUBA 1RTTA 3OY7A 2HJGA 2QQEA 3L8HA 1RAEA 4NMLA 4AU1A 5CB6A 3MWEA 4AXBA 1XLTC 1SG9A 2Q5EA 3LH5A 2FSSA 4TMZA 3GP8A 1M34A 4OLJA 4DADA 1KAQA 1AGPA 4GKJB 2HQRA 4IYRA 5FCDA 3KSBC 1UQTA 4RK6A 1KJIA 1J97A 1YDMA 1GRQA 1O0SA 4CKEB 3DW1X 1IUKA 2UUCB 3PICA 4FMDF 3HB5X 1QVWA 3ICQB 2FQYA 3M89A 2BH9A 1V4VA 2Q5HA 3LOQA 5BRNA 5KQMA 1N32B 3QUQA 5D01A 2B4TO 2GEDA 3WIEA 2CV1A 4IIDA 1X7YB 2O4CA 2PUBA 4YDHB 1BX0A 5IDQA 4OFXA 1YQQA 3UUGA 4C3UA 4QQFA 1T8YA 2EW8A 1P3DA 1E3WA 3KTDA 4B71A 5JVDA 1NYQA 2IEDA 1Q0ZA 2J4CA 3MOGA 4LY9A 4ARUA 1YJQA 3F5FA 2RGRA 3LT1A 3ZVMA 4ZICA 2G72A 4MUBA 5EJ6A 4M1QA 4H4CA 1TGYA 1N78A 5GGYA 1ZGCA 4CM6A 1X6VA 3BMOA 1KFBB 1SIUA 2YICA 1HY3A 1VP3A 3K8OE 4YRBA 2GF9A 5MN6A 1OXVA 3Q6IA 1Q1QA 4CLOA 3JQAB 4HEHA 1V5WA 1KGDA 5A2GA 1NJ6A 4OJYA 2NTJA 2V4ZA 4MKFA 3P32A 2CXNA 2HM7A 1ZI8A 1Y34E 1SKAA 2OAQ1 1JG4A 2H5IA 2VG8A 1U5AA 3DDNA 3MERA 4J6FA 1LZLA 2ZUFA 3SSNA 3JVDA 3VH3A 4ZT3A 1D2NA 5G3YA 1O95C 2C97A 2BFDA 1C0KA 2NAPA 3DHVA 2PT6A 3H05A 5CPFA 3KKZA 3RARA 3MUOA 3WISA 4ZIRB 1DAMA 3K09A 1PHPA 3DA8A 3WZLA 1LPAB 5B7PA 4BLRA 3DQPA 3VKFA 5KTOA 1ZMBA 2YHAA 1H1TA 1ZO8A 2G6TA 4CEHB 1FQWA 2UZAA 1O6ZA 3HVJA 1K97A 4MW7A 4QUEA 4GPEA 4UHHA 1JIIA 3L04A 1AUPA 2YCBA 1T9ZA 1ORDA 4LC9A 1RKVA 2NV2B 2Y1EA 4QEDA 4UD6A 3WKAA 1T0IA 2ST1A 5CB4F 5CHYA 3H2HA 3L0YA 3TRJA 4BP8A 1KMHA 3LDFA 4WVFA 1FS6A 2JNWA 2QI9C 2Z2KA 3RC3A 4LEIA 5C5IA 1L5YA 1X42A 2HOQA 3A9RA 4C6TB 4F4IA 2IIQA 4AI6A 2YY6A 1AKNA 2E9SA 2WA1A 4LE0A 4CR8A 4KR7A 4CLDA 3T4XA 3JQBA 2ECOA 1W6UA 2I80A 1QDLB 4PLGA 5HBRA 2IYVA 2GJSA 3PNLA 2A92A 3UT6A 1Y1SA 3G2PA 2J32A 2OMEA 4FR5A 1EEXB 2MSEB 2QZ4A 4DV1B 2CWWA 1KPHA 2DWCA 3RYFB 1CUEA 4KQ1A 3FDXA 1TCUA 2RONA 1JILA 4NEHB 4OXXA 3AGQA 4UARA 2D2EA 1M5TA 1VE7A 1M1NA 2OD7A 2Z1NA 3ITEA 3RC2A 2DPLA 1QF7A 1I51A 2I4RA 3VYTB 2X22A 4HT3B 4C01A 1SXJC 1NVEA 4RPJA 4X93A 1FMFA 5KYUA 1VC2A 2VBCA 4GP6A 4AX8A 3RWBA 3FZYA 4IXTA 1T2CA 6REQA 4CIAA 3QKRB 2AR9A 3IJPA 2X9QA 3GBPA 3H8VA 2Q28A 1QCYA 2SCUB 4JGGA 5B2ZA 3JATA 1TEHA 2G5PA 2H1LA 2NACA 1UIRA 4FUTA 1MRZA 4PFKA 3HDHA 4FFSA 3UJ9A 1R8QA 3WR5A 4UTPA 3T06B 1P44A 2AEJA 2H0QA 3TQFA 1CJBA 4ENWA 2QGZA 5DBGA 4OOEA 4E31A 4X97A 4DWJA 2YN4A 4BCBA 4BUCA 2PKQP 4CCSA 121PA 1CY7A 1QYDA 1KGSA 1E7RA 5B1EA 5CA0B 5EC8A 4F72A 3HWRA 1RKBA 3PWSA 2OZEA 1RABA 5T8KC 2PKWA 1BEZA 2VAMA 2OGUA 3TD6A 4N0PA 4A8JB 1G3IA 3DAPA 4IDQA 4D42A 1GAEO 1POWA 3VZRA 3CNOA 4QDZA 1G2PA 1HC7A 4GLLA 5HWSA 3M5CA 4YRPA 2OCGA 3WK9A 2LIVA 1JDBB 1YKSA 4A0HA 2P9YA 3S6JA 3KVOA 2WV9A 3BB1A 1M7HA 1VXOA 3VU0A 1MGOA 4YJHB 1YRBA 3HJCA 4KQ9A 4OJTA 4C43A 1UXIA 3LQYA 4IGAA 1HE2A 2PLFA 3BD7A 5EVJA 7MHTA 3LVQE 1JALA 2Z4SA 5DMHA 3SICE 2C2WA 2QW0X 3K9QO 2JAOA 1DXOA 1UR5A 2EP7A 2PS9A 4UVDA 2IOFA 4ZAFA 1WABA 2B36A 2Z09A 3U37A 2ZJBA 3H84A 3H2GA 3ECCA 5ALWA 2WP8J 3BFVA 3SIXA 4NCHA 2ASVA 4YP1A 1GZ4A 5TS2A 3DZDA 3P4YA 1TM3E 1RR6A 1U90A 3ETLA 5DNCA 5F1PA 5B6IA 4YCBA 2IYZA 1V8DA 2H48A 1HSOA 1A82A 3FLAA 3GW8A 3GAMA 4G01B 1PT5A 3DTYA 3TQQA 4EHFA 2X9NA 3DZFA 1DRVA 5EMNA 3WNCA 5KWVA 4N5LA 2A30A 3EQ9A 5SYAA 3K5IA 1JJ7A 3EDYA 5CP8A 1KYXA 4LA4A 5B3LA 4LI0A 4HGZA 3K1JA 1Z68A 1FJ2A 2FMIA 1NP3A 2GM3A 4BS9A 3GEDA 1YB4A 3F3SA 4QHYA 1OCEA 1KVSA 4JP5A 2E85A 3DC7A 5DBHX 4QX6A 3OOSA 1DXHA 3DVAB 3OSZA 4ITUA 4EKGA 1JI0A 1SBZA 2OFPA 4I08A 1I2ZA 4D3ZA 3GUZA 3PQDA 3DZBA 1CC1S 4OXRA 5AOVA 5MGNA 2GCOB 2YFHA 4I55A 5AIAA 2X1LA 1ORRA 4F8EA 2UUAB 4D4HA 4DSUA 1SC3A 1JSRA 1EVZA 3FWKA 3HGQA 5C7OO 1KU0A 4EWLA 5FTJA 4G41A 3K9CA 2JLWA 3DZJA 5KHOC 2NVWA 2RI6A 1DRWA 3E82A 3OX2A 5FI1B 3ITKA 2IP4A 4CR6A 2HEGA 1T4DA 1O5TA 2ZYAA 4BO7A 1A76A 2ICAA 1IQRA 2C9CA 2FEXA 2Y1XA 1E4OA 3NDBB 4R1MA 3MIZA 1EWKA 3VR5D 1J8VA 1Z35A 3LY5A 3JR3A 3AHJA 4MYDA 1P4SA 2AN5A 2ENWA 3NB0A 3SZ3A 1N2XA 4DLLA 2G5CA 3D3EA 4PF1A 3WBKA 2JBWA 5M3BA 3S99A 4W1PA 3LHDA 5F3DA 5K6AA 4Z3KA 3O4HA 4WH0A 2DRIA 4WKNA 3UMCA 1ZCJA 4XQCA 1VHQA 4J2OA 4UOQA 2PE5A 4EPVA 2FEWB 4LOJA 5DHUA 1Z3IX 5BVHA 3OO0A 3A6DA 1YC2A 2E4UA 2Y1FA 3HB9A 2AW5A 3MQ4A 4QIHA 4MRRA 4CV1A 5IABA 1N9ZA 2H17A 5DXFA 4BNYA 3V3KA 4J3FA 1KY4A 1A97A 1IE3A 5HEKA 1LLDA 4RPGA 5LZ4A 4O8CA 5B7QA 3EXG1 1TKAA 3L0PA 2NV6A 3G02A 1SKQA 3E2PA 4XGQA 3UF0A 1YHZA 2ZRPA 3BKXA 3ONDA 4PONA 3SBXA 2VUSA 1HT0A 3HCEA 4FKBA 3B60A 2CLIB 1S8OA 5F9FA 4LSMA 4MKRA 1GV0A 3H4TA 4LI3X 1ZC3A 4U39A 3BE5A 4LNUA 1DE0A 1GGVA 1GQ2A 3TRIA 1ND6A 1QIEA 3AVQA 2AFRA 3RS7A 3VDNB 3E48A 2D8AA 3FVTA 1KYVA 3OQJA 4MZDA 4TWIA 4BJ6A 3CH5A 5BWCA 3O0DA 1PEYA 2DLCX 5FAKA 3D1VA 2FKNA 1NVMB 4FINA 3AU8A 2P5SA 4YASA 1WXIA 1I7QB 3PUXA 2ADFA 4Z4EA 2QR5A 1IONA 4RSRA 1XX6A 2AA3A 1NQAO 2OBXA 5JW6A 1ZUNA 3ND9A 4EO7A 2HQSA 4IXWA 3OP1A 4N5NA 5EYPB 4IHJF 3L7AA 2Q3LA 4ZPJA 2GZ3A 5DT9A 4YQEA 1PNTA 4IX9A 4RD6A 2WZQA 3HPQA 2PT7A 1QBGA 2NQ8A 2FEMA 1XF1A 1G6OA 3DG9A 2YNMD 4DXDA 4GSLA 1LZKA 5SYNA 2IL1A 2L18A 4ZEXA 4F5WA 1RPAA 3BK7A 1EAYA 3MZ0A 4HDKB 4N12A 2ODEA 3KJXA 3W2TA 1BMDA 4ZQIA 5FULA 2FI1A 3B6EA 2FR1A 1KEEB 3G13A 3JQQA 5D87A 1G2QA 3Q3CA 3LCMA 1QIDA 2R1VB 3DXXA 4BKUA 1I7DA 4J0CA 1I94B 2BSXA 3UC5A 1H6DA 4HH4A 3VHLB 1A8HA 3MMNA 5IFLA 1LDYA 2PGNA 1SHUX 2BR4A 2OAP1 2XMGA 3PR2B 3V4OA 4MLPA 4EF5A 1Y3BE 1UWKA 2C3YA 3EY9A 3H87A 1NASA 4KXWA 3RK0A 1L5ZA 4IUBS 2EBFX 5DT2A 2HK6A 3CRZA 4HYQA 4L0DA 2WSMA 3V00A 2V7XA 4G5FA 1W48A 2J3MA 2QPLA 4GGPA 2IYQA 4KNWA 4OGLA 3ISVA 3DEIA 4QL3A 2AMLA 3HJAA 3FHTA 3E9DA 3KAQA 1ZI6A 5FX2A 1LV8A 1IZ9A 3UJ7A 4PTYA 4RQTA 5KU7A 4F9FA 1N9KA 3O92A 3C14C 3HCOA 4JJKA 3R0VA 3PZRA 4RTLA 1SCKA 5KDDA 4E09A 3VKUA 2YWGA 4EOGA 1ULHA 2OR3A 4TMKA 3DBIA 4ZVOA 2O54A 4EA6A 3R6WA 1OT3A 4D9GA 3L0OA 4HO1X 1C4WA 5EP2A 4CF6A 4CKWA 4JUAA 1KC1A 4ENRA 1RI4A 4YIKA 5FV4A 4ZI7F 1I2BA 1OLUA 4J0QA 1VYHA 5FQNA 2ZJ4A 5JCJA 1H9AA 1NFFA 2PD6A 3K0FB 4M7RA 1WIWA 4UDNA 1AKTA 1J09A 2BGMA 3AB7A 3EEIA 4KRYA 3LT0A 3UUEA 4C0BA 1L3BA 1UPFA 3DE7X 4M99A 1P7CA 1BXGA 3RKRA 1K6XA 1T9BA 5EMJA 2JEOA 1NBME 2Y1OA 1UXGA 1VSBA 3WRYA 3IEXA 5F7XA 2C9MA 3UJBA 4B7UA 3DEFA 3DTVA 1RHUA 3WQHA 3TUZC 2FN7A 2ES4A 2HRZA 3D31A 4OUDA 4B09A 4YRZA 1I13A 2F4NA 2X2OA 2YQ5A 3NVKI 2GILA 1X8JA 3GVPA 1CVIA 3KE8A 4PX5A 1USGA 1GEEA 2OV3A 1UKZA 1R0WA 3B1ZA 4KR3A 3PS9A 2P6OA 3LQ2A 1IHOA 5A4AA 4A15A 3UMFA 4C2AA 2ONZA 2V7EA 2ERXA 1IJFA 2F3RA 3SD7A 4IFBA 4LJRA 2B1RA 2Z04A 3NMUF 2MSLA 1U81A 4MV3A 1HWYA 3U3RA 1YI8A 2CJXA 3IBGA 1GL6A 3QVTA 2PH5A 5EERA 3VR2A 3KETA 1D7AA 2I03A 4FFNA 1JR4A 2OXIA 2YJ3A 4V2IA 3RE1A 5HF6A 3VYVA 4POOA 2RHTA 2I4LA 2WU0A 5KTTA 3HN7A 2B8NA 3KBBA 2ZB2A 5KREA 3TB4A 4CI9A 3ND7A 4RGQA 4Y2YA 3E23A 5G02A 4EKYA 5I47A 1SGWA 1V45E 5AESA 4Y0AA 3GF4A 3N0WA 1KJ9A 2PLAA 3NHFA 1DEAA 2GD2A 3MXOA 1KFJB 1TKRA 3Q7RA 3AOGA 5IT5A 4KR9A 5F7ZA 2ZDHA 2RGBA 4ASUD 3CPEA 2JAPA 3AVOA 2H2WA 4N0DA 3RKSA 1CV2A 3MWJA 4NFSA 1U8XX 3G5AA 1QFXA 1ULAA 1BVUA 3NHAA 1N5DA 3O4VA 4PPYA 1QPBA 3DQQA 4DC0A 3DZ8A 1HX7A 4ALMA 4W9NA 4PFSA 4B2LA 4YRNA 2ZRNA 3ETDA 5ISMA 2HU7A 4IOKA 3TXYA 1KI6A 1PSWA 3LLMA 4DAEA 2W11A 3LWDA 4WN9B 1XK7A 1XTUA 4BGEA 1Z63A 2RCNA 2ILTA 3GBVA 2YV2A 4EY4A 1AQ6A 1KOJA 3LUFA 3CJQA 2QTWB 2ZYTX 5EAIA 3AG6A 2GPTA 3PRHA 2IHBA 5DLQC 5HIIA 4TM7A 3N7TA 3RSLA 1B76A 2MTBA 1IC6A 2O2HA 3GPDG 1F0YA 4KH1A 4LZPA 1IBRA 4MI3A 5IVDA 1KWKA 2QZPA 3ZV4A 3RUHA 3RU3A 1VRWA 1FDIA 4B6GA 5IBQA 1XI2A 2H2DA 5D3MB 1WQ3A 2H4WA 1L4GA 5DTEA 4LPKA 1D8AA 4O1IA 1QP8A 1WCV1 4FILA 4Z3OA 1V6AA 1MJNA 2R8OA 3PGXA 3VTZA 4C76A 4FB5A 3AHDA 5EI5A 2PAAA 2WMOB 2XUGA 4C0QC 3Q4GA 3LPLA 2GETA 3WHLA 4PSUA 4NQZA 3W5VA 2EP8A 2Q6OA 2JLQA 1XMSA 2X9LA 3ET5A 3MC1A 5CT5A 3RV3A 1FLVA 5LDGA 1XKQA 2PA0A 4KV7A 5C52B 1KZYC 2XODA 3KPWA 2BM0A 1DUVG 2Q3FA 4MQ5A 1U28C 3DMPA 4KX3A 4XIFA 4L57A 5FBHA 1U5CA 3ANMA 1AQUA 1A95A 4XSVA 2Q50A 3CKLA 1EMDA 2CHVA 4DJTA 4IH4A 2CFCA 1H8EA 4KN9S 3EOZA 1U1IA 1Z62A 3IPXA 2XEXA 4UQPA 1Q1NA 4AJEA 1CUAA 3CRVA 5A6VA 1NSTA 1O94C 3GAAA 1LRJA 3C3CA 4IDBA 1Q77A 1QE3A 3GLTA 2IYNA 2ZE8A 4A2QA 2W83A 5ADUS 2R5NA 2ATCA 2PX5A 4DV7B 3WLPA 3PDUA 1Q0RA 3QHAA 4HUTA 5KQSA 3F7NA 1TQHA 4JYBA 3P7MA 4FXOA 4KQCA 3G2KA 3DBLA 5LNK6 3WIUA 2WSIA 5FOUA 2O06A 4D8WA 2MSCB 2BFBA 4O2BA 1YS4A 5CHEA 1SBNE 4FZRA 2YIMA 3WB9A 9ATCA 4K86A 3DNMA 3TQRA 1N1MA 4B5KA 1AO3A 3IBTA 3FSEA 1B0ZA 1E2KA 4JC4A 3T5DA 5LIRA 4H31A 3RODA 3GLGA 1GGEA 2ZJ8A 1BVRA 2PUVA 3SNKA 4BMVA 4WBNA 2A3NA 4EELA 4KPYA 3T8YA 2PA3A 4RZXA 2SICE 4ZD6A 5I7OA 3RRFA 2IQIA 1ZNQO 2IIVA 3V2HA 1NW7A 4MV1A 3HDJA 1AVTA 1MT0A 3WJ7A 4TVSA 4JHLA 4ZCIA 1K2WA 5A7HA 5HXAA 4X0EA 3WGGA 5THKA 5AT1A 3R7DA 4BFCA 5TMPA 4XVHA 2W2VA 3I2JA 2WIGA 3G6WA 4F2HA 4YXWA 2FGKA 2Z08A 2DKNA 2V6BA 2NO0A 2V55B 3KB6A 3A10A 4FUQA 4N8DA 1W7AA 3LF2A 3PQ3A 2AKEA 4ZI3A 3BT7A 1HEUA 2E0IA 2HA6A 2QJRA 3GGGA 2WFMA 1G64A 4MKIA 4CNBA 1KERA 5B5SA 2IS6A 5FTMA 2DKOA 4RFVA 5CFZA 2NG1A 4RV4A 3OX1A 1RPTA 4BRWA 3BPSA 1R3UA 5F21A 4A4DA 2IS2A 1X15A 3ESQA 4V0ME 3ZCXA 2ZWMA 4IDDA 5FLEX 2P9HA 1VL6A 2XUQA 3P2IA 4PS0A 5L53A 4WADA 3RADC 4HFMA 4WKBA 3U39A 5CPBA 3H9BA 4X7BA 3SY8A 3W3AD 5EG5A 2MSDB 4EX6A 1QGZA 1R5OA 2K6GA 3MTIA 4G8CA 3A6GA 4TROA 2JDIA 1KDZA 1CP3A 5LSAA 1KRWA 5H5JA 4MAFA 3PF9A 2C4NA 3CLSC 4C0LA 4JP2A 2QMZA 3KV3O 3OC6A 3SBEA 1GXSB 2PUJA 3KJZA 1UMCA 1LI4A 4XOUA 4DB2A 2JLZA 1GLGA 2FPMA 4AS2A 1ZMRA 4FYIA 2PVSA 2IXBA 3ZU3A 4Z3DA 3WLLA 1PSDA 4GMGA 2AN3A 2H1VA 1UC8A 2G9UA 5JYDA 1ZVVA 1E0JA 1JIJA 1I3MA 4F06A 1KQNA 5LQKA 5J47A 2IXAA 4RC9A 4PZPA 5TPZA 1HV8A 4BGIA 1S2LA 4F3NA 2BFEB 2XEDA 3IUQA 3F71A 2QD3A 4GX0A 4QNMA 5DBFA 4Z8XA 3IDFA 2NOAA 1U3TA 1KP3A 1XZEA 4ZAWA 1DMSA 4QOIA 1E5TA 1VECA 1JHQA 4NHOA 4LXXA 3LC7O 5FI3A 1XU7A 3BGOS 2OL4A 4QDJA 5KYNA 2O8CA 1L4MA 3LQKA 3L6UA 4DLSA 5H4HA 1N8SA 5CM9C 4BMSA 1YKGA 5JNVA 3EPKA 1UKVY 3JW8A 4I8IA 4O5AA 1K7CA 3KHUA 3C98A 3GJXC 4D43A 2QNRA 4AJNA 2W2MA 3B1WA 4C78A 1P19A 1PVOA 4XWKA 2BZ0A 1MAAA 1PJSA 1SCBA 2ACVA 3E4DA 1CULC 1COWD 2Z56A 4L8WB 3T0GA 3ZY2A 2VP2A 3ZH2A 2SKCA 3JVIA 4PGGA 3UXYA 2HB6A 1ENOA 2P3SA 3M9LA 3H3FA 4H0CA 5IUJC 3L1HA 1HG1A 3C2QA 1G9TA 1SPXA 1TECE 4B3MB 2RHMA 1JDVA 2FW9A 1PU2A 1EUDB 4PLVA 4E21A 4Z51A 5LZ2A 1QQAA 3A3PA 3GL9A 3GLKA 1XMXA 3GJYA 2XLBA 3R5HA 4HAOA 3FYCA 4AVYA 4PZCA 3QLTA 4CXMA 1EFPA 4DQKA 3M6IA 4R2WA 3WYBA 3MINA 1Y6FA 4HQLA 1OILA 4MRMA 4O0MA 3O26A 3ORSA 4KO4S 4DZRA 4PGFA 4RULA 4J7XA 1PG5A 5EKXA 1GJRA 1CSEE 4D4LA 4NQRA 5AI8A 1NAHA 1Z7YA 3RT9A 1ND5A 5GONB 2XR1A 5ARDA 5GOTA 1W36D 4FMPA 1KRHA 4JAVC 2YWCA 4P9NA 3G79A 4I4IA 4C7XA 5JI2E 2PCLA 1L7OA 1XJ0A 3WMGA 4Q4LA 3RI3A 3CQ9A 3HN2A 3VH1A 1AB5A 2VDQB 4MV7A 1V3TA 3USZA 5C4IA 1KK3A 2EL7A 3AEXA 3RF6A 4EFKA 4AQYB 3A1FA 3OIUA 4HEQA 4XH9B 5FEUA 1YD7A 3D2CA 2ZAGA 1NXSA 3L8YA 3N6RA 4JC0A 4LXYA 4BNDA 1HNNA 1ZFNA 2WI8A 4FFMA 5H59A 5T4EA 5C1IA 3ZBTA 2P78A 3G8BA 3QTLA 2A0YA 1TLTA 4XRRA 3WBJA 4XYGA 3W0LB 2AG5A 3JY6A 3PEYA 4CLEA 1Q6YA 4U00A 3H4IA 2NU7B 3WGOA 2I6XA 4OREX 5ESRA 4AROA 4YDQA 4NCBA 5LQUA 2PSDA 1QHYA 2OZLB 3OKAA 3HKEB 1VKJA 3WXMA 4K6OA 3UV6A 1P7ZA 1JUDA 3KK0A 3M4ZA 4A16A 2LCFA 4C07A 5INTA 3R09A 5GIOE 3THYB 1G8SA 1UMDA 1SUBA 2D3WA 2RHBA 1REQA 4Y1RB 4Y2SA 3QELB 1IWBB 4A23A 3A1CA 1ISMA 4G5OA 1N3LA 4M86A 2LGJA 4O4IA 2CHUA 2V6IA 5JEEA 2ZUDA 1JW9B 1WXQA 3O4JA 1USVA 1UT6A 4FYYA 4C4TA 4GVLA 2W2OA 2J3KA 5HUQA 1MW8X 3TBFA 1HT2E 2Z5LA 5FUQA 3TVTA 2LVBA 3RQIA 2VJPA 4D8UA 3MBKA 4ZCQA 3PDJA 4CM9A 5I7UA 3O8DA 3PC8C 2WHQA 5CH3A 3LT4A 3ZDFA 2PXHA 4O1HA 2PH3A 4EECA 1IEQA 1JPNA 3FI9A 3KYCB 5HZGA 4FOLA 3RS8A 3W7AA 3H97A 1WPXA 1ZICA 3CLVA 2ZU0C 3GMIA 3GFOA 2FR8A 3V4VB 4AG3A 4D96A 1YOVA 3GLIE 4R41A 5CU7A 3K35A 3QFHA 4P7BA 2ZSDA 2N0SA 4MB6A 4WZZA 1UINA 2FMFA 2QBYB 4MO2A 2QRJA 3KKPA 5EA2A 2QR3A 3U7QA 1QRSA 1RQGA 4QTTB 3VJKA 2PUWA 1K8RA 1TYZA 2BIFA 4NP6A 4UVHA 3SHTA 1QOZA 3IQGX 3PDHA 3C41J 3MM4A 1P5JA 3BMCA 1YR2A 3I9NA 4IICA 5JD4A 5LDHA 1ZA2A 2QD4A 4PXAA 3V7NA 1TPZA 1YB1A 4MQLA 2D7JA 4ZT4A 4D1YA 1QZZA 1SC9A 1UKBA 1XTTA 2CVHA 5DISB 5LBIA 2FSFA 1M2OA 4K6KA 5FBVB 4TS9A 4XM1A 5IDXA 3ZDAA 5A0VA 1D1SA 4PG4A 4HUQA 2C5EA 2X0FA 3TYXA 2F55A 16PKA 2IHYA 4TKUB 1EE9A 4F1JA 2WY2D 1HZZC 4JXJA 1E79A 4U0JA 1E0KA 3L1KA 3WGKA 1INLA 5F5NA 4DCVA 4YXFA 3CURA 1K7XB 1ZNYA 5FWXA 5AHRA 2P9CA 1Y3FE 2B98A 3NU1A 4Q4JB 3A6PC 1MB0A 4H0NA 2JJ2A 4HB3A 1QH0A 2D5AA 3EGXB 3KUDA 4K6GA 5H0IA 4JDUA 4DVGA 1A8UA 4H35A 4EA7A 5LIPA 1KZ9A 4RTPA 2QUZA 1T35A 2YTZA 1N0VC 2I2DA 4P38A 5BP7A 5CEJA 1W8DA 1H3FA 4IMIB 5EJ2A 3RRZA 1YZKA 1FP2A 2KPOA 4DRZA 4G37A 4MR8B 1IDOA 3AVYA 1VB3A 2RHJA 4LRSB 4M7PA 1R64A 3CH7A 1KETA 1OZ0A 3NWEA 4LRQA 2HYIC 1DKLA 2QSYA 4GC9A 2QTTA 3T5MA 2FPLA 3PXAA 3PFWO 1JAHA 1JWBB 4DXHA 1PGOA 4UOZA 1XMVA 4JLPA 2HTFA 2A9JA 3FE2A 1MV8A 1RP1A 3F67A 4LW8A 3SHVA 2BJVA 5A06A 2REBA 2ZLBA 4UCQA 3AVTA 1HDEA 1SOAA 2ZR8A 3HV2A 2AI3A 1G4UR 3C5CA 3FMVA 2WLSA 4FJ2A 4DLTA 2V03A 3GROA 4MVJI 4PC6A 3C8ZA 5FNZA 1TZCA 4RYDA 1HDRA 1KH3A 1WMDA 2DSNA 4NU8X 3ZGZA 3LFHA 4LJKA 5C2JB 2NXJA 1YS7A 2R6CA 2UVQA 3CCCA 5SZKB 3ABQB 2BGIA 1FUYB 1MORA 2BHTA 2Q3HA 3P19A 4KJZA 2VR1A 2E87A 1A77A 4N0EA 4EO4A 5DH9A 2ESRA 5HFJA 4ZOLB 3WQSB 1K0UA 3LUKA 1PLJA 1TQ2A 5AVXA 3GLRA 2ZFUA 4FYJA 4QXPA 1HURA 1JH8A 4RV9A 1R4MA 5KHAA 1MQ9A 1KI9A 1J8QA 1L7DA 2F3UA 2HNKA 1NUQA 1IEWA 3MWYW 1RQLA 2LKCA 3EZXA 4D9BA 3AL2A 5EIEA 5IRCD 4MW4A 2A0UA 3U4IA 4FBGA 4CKXA 4TTAA 4QAJA 2EFJA 3ECAA 3THOA 1TK3A 1G21E 2AK3A 1HDYA 3NJRA 4TZ6A 1Z4NA 3U4MA 3EEQA 1UBOS 2DSTA 4I50F 3SR3A 2QUIA 4RPCA 1C2TA 3OESA 1S6YA 4UDOA 3Q7QA 1M2JA 1IOZA 1FYEA 4D0NA 4E33A 1NRIA 3I39X 3WHPA 4B31A 1XQXA 3D0QA 4XWOA 1P75A 4MA5A 3JPWA 2RH8A 3PKIA 5D00A 4WCFC 4BV8A 5K4AA 3EFHA 1BG6A 1TXGA 2DZDA 2NZVG 4Q03A 5K2MA 5LPNA 1MO3A 1U0FA 3OT1A 4LN1A 4WBSA 5EQJB 3CCBA 1Z7GA 4UMVA 1CX9B 1P39A 2CL6X 3BS4A 4NBSA 2I4OA 2XDYA 1IEXA 3TECE 3SIRA 1R1DA 4BQPA 3A1TA 2D59A 1ULTA 2J0EA 2Y9MB 1JZQA 3IFSA 3NBMA 4K0RA 1A7UA 4UATA 2CW5A 5KVVA 3UAOA 5CG1A 4IEFB 1ZM3A 4J03A 3BBPA 3MWEB 4PZZA 1PKXA 5AM0A 4F96A 2QRNA 1XTVA 4G85A 1NJ5A 1GKUB 4HH3C 5IDWA 3EQ8A 3QE4A 4D56A 3FPSA 1IL0A 2HPAA 4NAHA 3KL2A 5A62A 4G1EB 3A7EA 4ZOAA 2YN2A 2ZYWX 3SYRA 4DZZA 2DPYA 3EIQA 1GRRA 1VCIA 4D0RA 2XITA 3IB3A 3BH6A 3HY3A 1HBJA 4OQZA 1FP1D 4BGVA 2AFHA 3KKEA 1GZUA 4LVCA 1F4PA 1NP6A 1S3IA 3VVMA 3ZYZA 5KNCD 4R05A 2VDMB 4BZZA 4M9QA 5DO9A 1NR7A 4MV8A 3AM3A 2L42A 3WY9A 2PGXA 1G7TA 1M6VB 2A57A 4H3KB 3CX4A 2CDBA 2P90A 3ABRB 4P58A 1WETA 1TMKA 2Z5GA 4UTXA 4TYPA 3VYUB 4V0RA 3GWZA 3UQZA 4EKIA 3TLMA 2E5LB 5AJZA 5K8UA 2NAFA 1T2EA 5AJWA 1XMJA 4M9XA 3GLIA 3BXXA 1B6RA 4L28A 2BMWA 2OCDA 4AIIA 4Y98A 4CLOB 2WAOA 3F5QA 1ORVA 1WJGA 3AETB 3N5KA 1AHHA 3KSUA 3HSSA 3UK7A 2WICA 2FSHA 4FHFA 3WLHA 4BNZA 3BCUA 4FS3A 4RACA 3KC2A 3WKCA 3EZYA 1XP8A 2XCOA 3IBSA 5CR9A 4FDLA 3CWZA 3R5FA 3VAYA 1EYZA 1HRDA 3P2JA 4MUYA 3CUKA 2BFDB 1NNSA 2NM0A 2E6KA 3AYZB 4JASB 1JHPA 1YS1X 2JARA 4LJSA 2BI7A 3CT6A 4IZIA 2XNCA 3FNGA 4HGRA 5IG2A 4QARA 3QEMB 5LMUB 1VLJA 4ONEA 1VMDA 1XTRA 2GYYA 3F2IA 1VA5A 2PWYA 2BOVA 3TRDA 5EE9A 3DQZA 3RBAA 1W5TA 3LKVA 1NLZA 4ES6A 1F9AA 1XLWA 4O4HA 1JIXA 2C4KA 3B2NA 3OCCA 1MO4A 4LJ5A 1F6DA 4UULA 4G4GA 3TTSA 1QFSA 1RQRA 2XRYA 1B93A 1MO6A 3H8SA 3FBTA 4HTFB 5ALDA 3EARA 3RG2A 1P0CA 3V4LA 3T5AA 1DS6A 1UOEA 3G5LA 3ORHA 4E94A 5FB3A 2QTGA 1KMHB 1TL7C 4KLZA 1OLOA 1WB4A 3TSOA 1NN0A 2G07A 4LS3A 1SHTX 3A6HA 1PWEA 2CXUA 1MOQA 3CZQA 4GR5A 2OHIA 2WT4A 13PKA 4JSTA 1BDBA 4NPAA 2W93A 3WRXA 2X1MA 4U0KA 3K72B 1AGXA 2B25A 1JG2A 5AVTA 1I1NA 3HP1A 2ORVA 3WLQA 4Z49A 2W98A 1DAHA 4IRMA 4AQDA 4OQDA 3RAJA 3EG5A 3V34A 4F38A 4I1RA 1XQ1A 1BMFD 1R00A 2DR0A 3DMTA 3DULA 1DBWA 1YCDA 3WAGA 1ZGAA 2JKVA 2XNSA 3AUSA 3G0DA 4ID9A 4Q5IA 2Z1DA 3IO3A 3NT5A 4JZYA 3VZSA 3ZE6A 5AW6A 1KVRA 2QG4A 3OURA 1TYBE 4EZEA 3QU4A 3LY7A 3WWDA 4TWBA 3I0MA 1GQQA 1OJ7A 2MINA 2ZIEA 1RJWA 5G41A 1C9NA 1N4DA 5IYZA 3RC8A 1RBMA 2H06A 1XELA 1P2SA 5AM1A 3S28A 5K0JA 5BUSA 3K1AB 5JJCA 4J90A 3JATB 1LBTA 4XPIB 4AFNA 4D80A 5IJXA 1NI5A 1ZVKA 2QTVA 3GEEA 2OXCA 4P8RA 3UA4A 4ERNA 2WIFA 3OZVA 2I6SA 2MMGA 5A4FS 3GJRA 1VKOA 2CMGA 3NAGA 2GO1A 4NVRA 3IEUA 3AMVA 3O1JC 4ROSA 4E3ZA 2MT9A 3QUTA 4LE2A 4RM2A 1ZCFA 1C4XA 3D4IA 1U0JA 2P9FA 1YI1A 2H2GA 1J2UA 2IZ7A 3DV0B 1M67A 4DV0B 1SG6A 1T8PA 3ISTA 4Q9HA 3I4FA 3IKMB 3W1VA 1VXRA 3QWIA 5BN3A 3C1AA 4GOOD 4IG4A 3TTVA 3W5CA 1JFSA 1CR2A 1ZAYA 3B1XA 1YK1A 4B4UA 4NG4A 1WBBA 3BHMA 3F96A 4IV8A 1U2GC 1VJ5A 2P9GA 2UZ0A 1LWNA 1CUZA 4C06A 1ZRSA 3G23A 4HWOA 3BK1A 3H8WA 3EQ7A 5IW8A 3UWDA 1J22A 1DJPA 1EDBA 5KYXA 2AK2A 4MQBA 2VXOA 3D3KA 3TLXA 3G9ZA 2VK2A 1N5OX 1UQUA 3NRBA 4RLQA 2OOKA 1ZQ1A 1PFWA 1W96A 1A9QA 2ODTX 1Y4DE 4HLDA 4DHEA 3DMNA 1NNEA 4GI3A 4EH1A 3NS7A 1FFBA 4GPBA 4MP6A 4P92A 1EQUA 2Y76A 4G0ZA 3SEQA 1I0ZA 2FUCA 4KTTE 5EHGA 4XA8A 2Z4TA 5DRYA 2ZIZA 2JCSA 1S0UA 5B55A 5CA0F 5JTTA 1KAOA 1Q92A 3FSJX 4MWZA 2XT9A 2ZIXB 4BWFB 2VF2A 5CLLA 3I30X 2VYNA 5BW8A 1HDGO 2IE0A 3E4CA 5KVQA 3EISA 5DULA 5LXTF 3NBQA 4XDZA 1BHO1 1YFZA 1Z15A 3EBLA 3L7JA 4V3CA 3AKCA 1O77A 5JCOA 1UODA 3H0CA 1TJNA 5ESDA 2NU9A 2CVFA 3H42B 3ETGA 3CV3A 3NT4A 4KRGA 5IVKA 4CMIA 1BHSA 2AHOA 3LFTA 4KQIA 4D3XA 3DHWC 3M6VA 1C81A 4FGZA 3PNBA 3IKLA 5JBIA 2XYRA 1YR6A 1IEVA 4R1TA 4FYHA 3J7AC 1TB4A 2IXEA 1FTNA 3FLBA 2GSDA 3ZYCA 3O03A 4H2DA 3TDNA 3Q3JB 4UUQA 2ZPTX 3PE6A 1YSCA 4WL0A 2NP7A 3UQYS 2JBAB 5EPUA 3DT9A 2GM5A 3MJRA 4PHHA 1MRNA 4C21A 5AXCA 1XYYA 1E1NA 2JGIA 4JC5A 3QMVA 5DSTA 4MR7A 4BZQA 1XT6A 3EDQA 4BNFA 1THGA 4NC9A 5AJUA 4GX5A 3EXHA 3VV2A 4EFDA 4XB2A 4X6UA 4KE6A 1NQUA 4ISCA 4PWYA 2YWFA 5BWMA 4XTCS 3IAUA 1T29A 4EGQA 1P17A 5CMLA 2EARA 1UBLS 3LDAA 3DEAA 3F6SA 1IN6A 3NXSA 1KVQA 1V6SA 1XLUA 1BXZA 2HU5A 3FJ1A 5KYYA 5ERXA 2UYYA 1OXBB 3E9NA 4LCBA 4S12A 4WXYB 4QEKA 4ZGBA 3E7PA 3TW8A 1IRIA 1LBQA 1Z26A 5CNMA 2VNSA 4DQVA 4GGOA 2D0OB 4E08A 3EIXA 3LPNA 4F6RB 1Z2EA 1TRHA 3ESCA 3HSKA 3SEAA 5JI3E 3PIIA 3GT3A 3DBVO 4J75A 4NBKA 1G8YA 5KTSA 3TRKA 1AMNA 2QKYA 3IERA 3K9NA 2G7ZA 3LNTA 1MNQA 2RGXA 3MMZA 2O7VA 3S1LA 1Q17A 1L4LA 4JVLA 1I6MA 4XWYA 1SXJE 2EW2A 1QIKA 5J5CA 4B4OA 4OGFA 4Z86A 4DSAA 1S2OA 3BZBA 3KQYA 1CYDA 4FGKA 4NABA 5L3VA 3A4TA 5EXPA 4DQUA 3CVJA 2L19A 1GTMA 4LC1A 1P3JA 3TX2A 1W4RA 2ARKA 1C1HA 1JFFB 3KZNA 2ZWIA 3R6LA 4HAUA 2QLMA 1PQUA 3I4LA 3H4MA 3ND6A 2YR0A 4RKFA 3GNQA 2PRSA 3AJ9A 4ML3A 3UB2A 2QW1A 1BXRB 3ZCRA 4JI8B 5AJYA 2ZVQX 2FX5A 3SYNA 2GD1O 2ZBVA 3DDOA 2WG2A 3P9PA 2OBMA 4L3VA 3HO8A 2F4VB 2VDWA 4HB2A 4R69A 4YQZA 1GV1A 4CMBA 3I9LA 3A4YA 4IIJB 1M6WA 2R96A 4UCXA 3DXYA 3P2KA 4OHXA 2LNDA 4N7BA 3TKLA 1G291 4F5DA 5C8YB 3MQ2A 3FWNA 3VBEA 5C81A 1GCOA 1F8YA 1RAIA 3ZNPA 1IY0A 3LX5A 4KN8A 1C0PA 2ZAOA 3FTNA 4YV2A 2GASA 4JVMA 1R9MA 2XCIA 4Y9TA 3UHOA 2OG1A 4JH0A 3ZHTA 4B75A 3P26A 2BFFA 5IHXA 5KNCH 1PR4A 1XRMA 4OBBA 2XYVA 5TVGA 5IKMA 2OO3A 1QP4A 1TT7A 1ZM7A 1W19A 1E5QA 4NZ9A 3H8JA 4B7XA 4BKQA 4LQ4A 3CVYA 4MV6A 1S2IA 1ZISA 3D2BA 2D5IA 4EY3A 2WHYA 5HE9A 3D1LA 5JCPA 2IUSA 3OD1A 1CNEA 5I5GA 4GXRA 2OV8A 4GO1A 3KB8A 1I4EB 4FFBB 4Z4HA 5AM4A 4EYKA 1SN7A 1Q44A 2YUTA 4CN9A 4YRMA 1II0A 2QT9A 4HB0A 1E1RA 3NBXX 3AF1A 1TJ5A 2I99A 1GCUA 1JLMA 4RXUA 5H70A 3ZWNA 3VTFA 3BYZA 3ZXIA 4BCCA 4CW7A 2CC2A 3F8SA 3UXEA 1CFJA 1BWQA 1I2AA 2BP7A 1VE6A 1Y5LA 1T2FA 2IGBA 2JLCA 3A27A 3LW8A 3KOOA 4RTQA 1JEYB 1E1CA 4COOA 3J7TA 1SVLA 3LTEA 1KKMA 3CT4A 3I2FA 1I1HA 3LO8A 2B92A 1U63A 3CB4A 3ZCTA 5L7WA 2XXBA 1EUCB 3CUUA 1D2CA 1D9XA 2X0JA 3I05A 3JASA 2H07A 2AJBA 4IWXA 1W36B 5KOYA 3FHJA 4P7GA 4Z9YA 2O2IA 4MR9A 1X0XA 3DCIA 2GB4A 2C0PA 3CE6A 5KX5B 2NTEA 4HDMB 5AK4A 5CBPA 1MH9A 4YO8A 1DWPA 5ALPA 3HWX1 4MH0R 3VO1A 5J3JA 2PUCA 1AQJA 2I67A 1DTWA 5E9QA 1OXKB 1U0LA 1HNWB 1XHEA 1NTRA 2B3DA 1U8ZA 5KPJA 1OLUB 4JROA 4PTLA 3SJBA 8ADHA 5K03A 2G3YA 3EQZA 1NP7A 3G0HA 4JR1A 1M6HA 2HU2A 3G5UA 1WB6A 3H6GA 2ORED 1BXGB 4MYCA 4PGMA 2CXQA 4QPPA 3HHPA 3R3SA 4KVAA 2CD9A 1MHTA 3DBOB 1ETHA 4YRTA 1ZRMA 2DAPA 1YNSA 5HQJA 4GKVA 3FNQA 4UU0A 4FT4A 5L45A 1JG3A 1LY1A 3DTVB 1UP7A 2ZIWB 3ZVKA 3RK4A 3NTVA 1T5BA 2QMOA 4OUDB 1G8MA 5LBUA 2FSPA 1N8KA 4DJFC 1RZVA 3Q85A 5GIPE 3D4OA 3IT1A 1W4LA 1DFHA 3UT5A 2XE7A 3GUUA 2OHVA 4BVLA 3L46A 1OHHA 1IXZA 4TYNA 3HKBB 3T9AA 2BHSA 3OEHA 1LSUA 1XZJA 2QUBA 1GEGA 3FOWA 2C7GA 2FWJA 1O54A 1SNYA 2BVNA 1OIVA 4CU5A 1VLMA 3JD2A 3QHPA 1O95A 4PCLA 5K4GA 1AZTA 1C50A 3EIEA 5FPYA 4YWHA 3ZVLA 4Y0VA 3QG5A 2ACEA 1QLWA 2QX4A 4D9EA 2YS7A 3UJ3X 5J2UA 2DFLA 3V9AA 3G9QA 4OQ4A 4K9NA 1K63A 4HFRA 3O3MB 1GGMA 4PYKA 3DMRA 1MP0A 4NOKA 2YUIA 1FRFS 3DMYA 3HCNA 4G2TA 2Y4NA 3DE3X 1R10A 4AS1A 5CVJA 2ZREA 5KTKA 4YJ3A 1BQ3A 3I5UA 1S8AA 2NADA 5ANRB 1G8GA 2XB9A 3MCAA 1L5OA 4PLWA 1OASA 4NL4H 4TQAA 2IY9A 1CHNA 4NJOA 3QU2A 3IXQA 3KTAB 3N07A 3LP5A 3OPYB 5JSYA 5TSDA 3HP4A 2IV3A 2VPTA 1AK2A 3EIHA 3IAEA 1O6FA 4IIGA 3MJDA 5HMMA 1FFAA 4F92B 4UTVA 1VBKA 1E4EA 2JH8A 3MT0A 2CUKA 2V0NA 4MYTA 3SI7A 5KNBD 1NXTA 3DDSA 5FL7D 2OBNA 2VH1A 1VHWA 4HJRA 4UU1A 2FXIA 3ELYA 1JHYA 1GKIA 1H5QA 1QQ6A 1ZPDA 2BUAA 2X19A 4CMEA 2E82A 2XGJA 3RTDA 2YJTD 5FI5A 3E05A 4JXZA 5KKAA 1V1MA 4LC0A 2QQGA 4ZFNA 3JYLA 4M55A 4ETNA 2HGSA 1PYGA 3C4VA 3ND8A 5KBYA 3OOHA 1BO6A 3H5RA 4KGXA 5K3FA 1QG6A 4X85A 1W2WB 2VSXA 3VKHA 3CXRA 4DA0A 5IX8A 6ABPA 1U0EA 4ZCRA 2YV1A 2I22A 4N5HX 1DLJA 1H2YA 4MWBA 1E1DA 2CHFA 3QVLA 5JJKA 1XAIA 2RKWA 4V1CA 1Z5ZA 5JASA 1Z74A 4L9WA 5IC4A 2G0TA 1OI4A 1FMCA 3C7KA 4N0MA 4ALJA 5EZQA 4HYYA 3SDBA 4EL5A 5L9AA 4R6XA 2PL9A 1NZDA 5MFZA 4C5CA 4F3RA 5JTUA 2E4XA 5L3SA 5G0WA 1Z0SA 1U3CA 3LLCA 1WHTB 3RBVA 4I9FA 5JYEA 2IVZA 5LQDA 3PLNA 2G9QA 4CTKA 4AUEA 3K5PA 1MV5A 3SHWA 4QBTA 2V8BA 2PAFA 4P7JA 3RKUA 3GV0A 4BDTA 3GPIA 4P5PA 5DEIA 2G17A 4HEJA 1RQ2A 4LRWA 3A0RB 1Z12A 4TXHA 4YP9A 1MCZA 1TW3A 1A4UA 2OCXA 4K9KA 4L2IA 5JD6A 3OFJA 1RHMA 1R4ZA 2P8JA 5CEEA 2KBFA 1SZPA 3C3BA 3FGZA 1H0SA 2PMEA 3EZ7A 4Q66C 4DLZA 3KQHA 4FGSA 3GVIA 2D5BA 2VK8A 1DCFA 1GU0A 4DA9A 2QRLA 2ID4A 2RHLA 3HBMA 3LKBA 3ZHRA 2VAXA 3FFXA 2QLLA 3R3YA 3W5HA 1N34B 1E6EA 1N4AA 5CAEB 1SUSA 2I2BA 3LZCA 4N39A 1MFZA 1LDBA 1NM5C 1IY9A 1RYFA 3ZUGA 3CWQA 4MXDA 4CQJA 2MYPA 2WTMA 4L4UA 4MS3A 2VDVE 3HXOA 3NTXA 3NIBA 1CRPA 2BFBB 4G2NA 4O2BB 3QVXA 2EF1A 2IHJA 3SXUA 4NNPA 2V1XA 4KUHA 1CY4A 5FA8A 2AWOA 3CRNA 4LMBA 1XTKA 3KSMA 5IH3A 4WBNB 2C00A 5GQSA 2Q5QA 2PRJA 1J1IA 2OQRA 4JUIA 2C94A 4LF9B 5BNTA 4FFLA 4B46A 2GS9A 2CYBA 1OV6A 4TTJA 3T54A 1L7VC 3E7DA 3VC3A 3TZ6A 1NG9A 4RVFA 1NSYA 5DEOA 5EWLB 2Y3IA 1NW6A 2O52A 3RJTA 1QWOA 3EGCA 5H81A 3GC6A 1ZCZA 3BIWA 3HHEA 1O9HA 3QBTA 3LUGA 4FTWA 1FNCA 2J6BA 3BXFA 4GLFA 3DWEX 1OAOA 5DYYA 1LB1B 1LW6E 1TEZA 3I42A 2G9NA 1X38A 3F6EX 1RW4A 5GAJA 3UICA 4ZU1X 1JHRA 1UFKA 4C1BA 5EN4A 3VPSA 2O3UA 4ZVLA 2EWMA 2DWOA 2OGSA 2VC2B 3FSGD 2HO5A 3PA8A 3BHIA 1I32A 1IB6A 1V95A 1MC1A 3DFZA 1D3AA 2B9VA 2VVTA 2X0KA 2WJAA 3VR4A 5KYGA 1ACMA 1Z2NX 2X4DA 4AZ0B 4OLBA 1XEFA 1NDUA 2G06A 2YXDA 3ED1A 3G68A 4OJMX 5C37A 1I4WA 2CV2A 2NO5A 4QG7A 5C3MA 1SK9A 2BH2A 2G09A 4LNHA 1GPLA 4LWOA 1QORA 4B83A 1XA4A 5G1OA 3RFUA 2X6TA 1H2HA 3PE4A 2HF8A 4L5IA 5CA1A 2FLVA 1P0FA 1UMCB 3TAXA 1R0CA 3EUFA 5CFLA 3H5IA 2AUNA 1N9GA 4XIIA 4HAYA 1ES9A 5E2IA 3U4GA 3WYDA 3OH8A 1Z6AA 4EY8A 4Q34A 1JLRA 1JLKA 4KSBA 4R9VA 5J9FA 3D6FA 4PLHA 3S7ZA 1BE8A 3A1WA 3ZHBA 3KLOA 1KBQA 2WJWA 4FBMA 4QXRA 2G76A 2Q49A 4GR4A 2HLNA 4E88A 4UBKA 2AIRA 1FS4A 3K8QA 3KXIA 2DCMA 4WJZA 1JNXX 2JHGA 1PJ3A 2FUKA 3L2OB 4D82A 1RJEA 1BIFA 2DTXA 2JPDA 3AUJB 2A5GA 4D44A 2ZJ7A 2E3JA 4NBUA 2QQ5A 3V4ZA 2A9PA 1BE0A 2OQIA 3A1VA 4MRNA 4MSUA 5EJEA 4II3A 1I1OA 4NV0A 4M22A 3ZUPA 5C31A 1C7EA 1PR3A 3SS7X 1ZVJA 1TZBA 2DHCA 5TT0A 5AW4A 3JQGA 2O2XA 3CZAA 1DQNA 1J1ZA 2WD7A 1Z2PX 1Q16A 4JT4A 2WTBA 1W76A 3GDWA 5T6BA 1QHSA 4EKEA 1I3OA 1N77A 2Q4BA 3R3ZA 3R4VA 2GVDC 3ZQJA 3QXXA 5IARA 5CDUA 5ECYA 1MXHA 1EFPB 3KFLA 4NBWA 1NGSA 3BD9A 2PMCA 4UUOA 3UWOA 5K7SA 1KYTA 4FDMA 1AA9A 2H5LA 5KYWB 3GLVA 4IX1A 4RTKA 2VSQA 3Q9SA 3AONB 2Z30A 3CLRD 3L9WA 5DWQA 2RBKA 4GECA 4BMYA 3WSWA 5IJAA 1G3RA 5THQA 2VTBA 1T24A 3T61A 4ZAYA 1SVSA 1KORA 1H2RS 1FDVA 2Q99A 3AHIA 2IEIA 3CNNA 1QH8B 5TQ0A 4QGFA 3QFFA 4KLCA 5AXDA 3W4JA 4DDUA 4GMKA 5JAOA 3BTUA 4O2RA 2R00A 4UQOA 1KQ3A 3O8OA 1ADYA 3A4NA 4X20A 2C88A 4DN6A 5MFPA 1GFZA 4BMOB 5FXMA 4JYCA 2G1JA 3L7OA 5CB4A 1IDN1 2DECA 1LFDB 1U4SA 1X8KA 1UK9A 2OV6A 1W9MA 4CDGA 3QBEA 1T9HA 1XEXA 2UUOA 4BLTA 3RUFA 2G7MC 3D6UA 1H2EA 4R7TA 2WJIA 1TLFA 2J9FB 1GA6A 4IKPA 4MCIA 1X1QA 2QUKA 2DULA 2V3VA 1F4LA 4Q6WA 2P9BA 2QZ9A 3NVDA 1JBKA 3Q2OA 5B53A 2OKCA 1K06A 5TJ9A 5KJEA 1FJGB 3TKAA 2C9ZA 3B1YA 4OG2A 2DR2A 1U8FO 3TQOA 2HY7A 2EX0A 3H65A 4KXMA 1JQDA 1P2GA 1V11B 2ZBRA 1UMDB 2D13A 4MQEB 4OYRA 1XP5A 1REQB 3VOBA 2CMDA 3BL6A 2HYDA 4X7PA 3N8KA 3PFKA 1E32A 2HK8A 3FUWA 5FUXA 1ZY2A 4O4IB 3TDKA 5B4TA 4K9QA 1F3LA 2HMTA 2Y0CA 5J59A 5K0LA 4A8HA 4ZVNA 1D04A 4ZYZA 5BN5B 1AB6A 2CFSA 2CY0A 3ACDA 2JGKA 4X6YA 1V8FA 2O0HA 4QYIA 2B83A 2O5EA 4UREA 1OU0A 2BUCA 3HJNA 2DLDA 3CR7A 3GZ4A 1SO8A 3OPNA 1G8AA 1P0PA 4TKZA 2FRDC 3H5OA 2FUG6 5ALEA 1M6EX 2FEKA 3LGAA 4I1PA 4LKRA 3C16C 5M5BA 4XYLA 2VT3A 4MGHA 2I2XB 5JHHB 1XV5A 3BE4A 3PQEA 1YOVB 3H16A 1A98A 2IBMA 1PBNA 4DQXA 3ZTWA 4NU6A 3K0KA 3ZU6A 5JISA 3ZLUA 1DAIA 3EY4A 4YP6A 1QP0A 4C4OA 4ZO4A 5JS8A 2NW6A 2V3CC 2HWXA 3TF5A 4URVR 1A2BA 4FD2A 1QUFA 1ADFA 2VJCA 2ZJ3A 4L8LA 5D85A 3T3HA 1G5HA 1MTZA 4TSRA 3V1LA 5AIBA 2RMKA 3VZBA 5AVRA 4E07A 3BWEA 1YRQA 4K40A 2R7AA 1QHIA 1V5FA 1XVTA 2VPPA 4XJSA 2ZUVA 3HY6A 1WCYA 3INRA 5JCZA 1YRYE 5J5AA 3RS9A 1HA3A 1A50B 1T9KA 2IDKA 1W0KA 1RYHA 2R86A 1M2VB 4AD8A 1GILA 2F3TA 4UBNA 3LXMA 3SYMA 2H29A 4E2XA 1M2OB 1W44A 2AG8A 2C29D 3W5JA 3BG5A 1XYVA 5JRDS 4AP6A 1YXMA 1GGHA 1WP4A 2NUPA 1OPXA 2NO4A 3N87A 4Q3EA 3CRMA 4QREA 2H31A 2KYRA 1FRNA 1J24A 1J2JA 1JR3E 1SA0A 2W2LA 2XQIA 4QNRA 5EWJA 4OUKX 4DMFA 2F1IA 4NH4A 1CQJA 4EJ0A 5BV2P 4L0CA 4K6CA 4KR6A 1JE0A 1T4GA 5DDIP 4I2NA 2VJLA 4JQYA 3RYIB 2AYZA 2XA9A 4P98A 3WI7A 4WACA 5FPSA 8GPBA 2YVQA 1QZ3A 1J2RA 1HE8B 3R44A 1Y4ZA 4FHCA 5T41A 4FB4A 4RY8A 2VH2A 5ILQA 5G1PA 1DBIA 2P9ZA 5J2TB 3SOZA 2V3WA 1ZLYA 1YAJA 3U7FB 3GLHA 4AP5A 3BJEA 2VJQA 2EATA 2R3SA 3GCGA 3QXHA 2BGWA 1QR6A 1YRLA 5DPMA 1NLYA 4DSZA 5C7LO 1PV4A 1KEWA 4Y1FA 1X8LA 1GPDG 2E4VA 3TUJC 3FOBA 1OV4A 1U7OA 2JIDA 4OA5A 2G80A 1RRPA 2G1UA 1WMBA 3KKMA 1Q12A 3IHWA 4IMPA 3I9FA 4KQXA 5HYVA 3BRQA 1CZUA 1YZNA 1RJ9A 1FQJA 3ANXA 3LPDA 4Q4DA 3VTAA 1R6DA 4PFJA 1B2LA 1IMJA 3GUCA 4X6XA 1NNLA 4NZMA 2A5JA 1JHDA 3SG0A 5JNSA 1Z4PX 1Z56C 2I29A 1H9BA 2GA8A 1TLLA 5DMXA 5IAAA 4V38A 3CF4G 2JI4A 2Q9CA 1OE0A 3COWA 3O8QA 2F3QA 3SVTA 1BJTA 3I2GA 4XLTA 3L0IB 1EJ2A 1QR2A 4QFCA 2Q4EA 4WIAA 1WKVA 1H4SA 2H0RA 4OHVA 4LJ9A 2X2PA 3VR3D 5EGNA 1DC6A 4J16C 2A1IA 4HZUA 4Q7LA 5IXSA 4UUMA 1TM2A 1IMOA 3R3VA 4TXMA 3LYLA 2V0CA 2QN8A 3HCAA 1R4MB 5D1HA 3VZQA 3QWFA 1C3EA 4MW0A 2ZTVA 1NJSA 2JCVA 4B6QA 5KSOA 2N9UA 1IBSA 4DBLC 2PR7A 5DXJA 4QM6A 1EI9A 1L5SA 2BCEA 4Z99A 4EHNA 4Q3KA 3B7GA 3L4EA 4IO0A 4LYJA 3QJYA 4OK6A 2V54A 1JVNA 2BELA 4GAEA 4QTXA 5C7IO 3CG4A 3DPSA 4Q0MA 5B2FA 2D54A 3OZBA 4DA7A 1NVGA 2F8MA 3BQMB 3L4BC 1PGPA 3OU6A 1SD1A 2ZTUA 4OSEA 4DYDA 2NT3A 1JA9A 1QO0A 1AURA 1EDZA 2O4UX 1M6NA 2QXTA 5CNIA 5LFAA 1UDCA 4HFNA 5CYGA 3S5JA 1NU6A 2BTEA 3DO8A 3PXCX 3TUIC 1F2TA 1ICIA 2A67A 3OLQA 4BJ1A 2WLTA 1R5NA 3WL6A 2C5AA 5DNVA 3Q8MA 2A9FA 1DIRA 5FA5A 2WFLA 1E61A 1EDEA 1DO2A 4D81A 4NNOA 4JELA 4ZQBA 3F3YA 3PSAA 3VKVA 4IZ6A 3JU3A 1W34A 3H6HA 3L0SA 3NQ41 4C20A 5K09A 4IV5A 1FYDA 5ADHA 3TOVA 3MIIA 1NMSA 2B8WA 3IPLA 4AJ4A 4MA0A 5KSZA 1JA0A 1IQUA 2JI8A 2R1ZA 4FCWA 3WRWA 1C8VB 3NDIA 3PXDA 4FOPA 2ZYUX 4G1CA 4L4RA 3DLPX 4C4PA 5B4VA 2Q3JA 1MB9A 4J1SA 1HQYE 4DSNA 4M1YA 3TEMA 3CLUD 4R5MA 2FQQA 2WM9B 3IR7A 2Q1WA 2ZUBA 3B2EA 1P6XA 2CDRA 3LRXA 4IHJA 3OY2A 2Q5CA 1CS0B 4EARA 5ALNA 1OT5A 3K2QA 3G7UA 3QP9A 4ZRNA 3ZHSA 1N75A 1JBEA 4FP9A 3ROTA 1KI4A 2AKYA 2SNIE 3AF3A 4Z2AA 2E4AA 4IIFA 4CQLB 5KJ6A 3A28A 3MJEA 1RWKA 3R8CA 3L4KA 1XL0A 3MGGA 1GSAA 5LZ5A 4Q7MB 1PUJA 2CNWD 1T4CA 2A78A 4GUAA 1KSFX 3GLFE 5FT9A 4CT4B 4RXMA 3V8RA 1CQPA 1ZCAA 3UHAA 2IE8A 4L6CA 4WA7A 3CNBA 3E5HA 3HLTA 4RNDB 1GO2A 2H54A 3AK4A 4FWBA 1EA7A 2GO7A 3EUAA 3OI7A 1HLDA 1NQTA 2PYDA 3H75A 4O63O 5ADVA 1DEHA 3MJFA 5AKIA 3S2FA 3W5IA 5JBQA 2FZLA 3GLIB 4H77A 4IH1A 2FSIA 2Q2OA 3GEPA 2H59A 4I4NA 1NT4A 2VJDA 4LDZA 3TCKA 5UKDA 3S2IA 3S2ZA 1ODLA 1Z17A 2CJFA 4ER6A 1THMA 3NBFA 4DPKA 5KVSA 2YY5A 2IYFA 1WL8A 2JIZA 3O21A 4UEWA 3GGJA 1NBWB 2YHBA 1Y1LA 2HDOA 1YZQA 4WESA 4G5HA 4GMXA 2PXXA 4MUJA 5BV7A 5JARA 5C0OE 4A1FA 2A0KA 2GZMA 4EI9A 1JECA 1H5NA 3GR6A 3FTQA 3BD6A 4RHCA 4B3FX 2H0AA 1W88A 3WGIA 2EKZA 3L40A 3QEOA 1DLIA 4KQHA 5LA6B 4EI8A 2E89A 1KMNA 1SULA 2IX9A 5KWEA 4HLNA 3GAZA 1E1MA 3H0EA 2J9GA 1JR3A 1SWVA 4MRPA 2IZ0A 2WR8A 3LNCA 4F8JA 1RHKA 2YC4C 5KO2A 1WDTA 4YPFA 2ZBFA 3Q3EA 4ZI7A 2OP1A 3MJCA 5DGDA 4RWZA 1LQTA 4EGSA 3R7WB 1X2BA 1VJRA 3WGLA 1UWCA 5FUWA 3PWTA 1V5IA 3L7DA 2BBWA 3QX3A 2ATEA 3H9QA 3QYFA 2ZAMA 4KC0A 4EM6A 2QHXA 2YDYA 1NY5A 2XMQA 1SU6A 5IH7A 4NFHA 1US8A 5ECWA 5AKHA 3IIKA 4RZUA 2PVCA 2I76A 1PGJA 1Y4AE 4PIVA 1KL7A 2GXSA 1R88A 4WGFA 4BO3A 5A3JA 4WLNA 3IKTA 1SXHA 2BSQA 1RWXA 4P54A 1GRNA 4LNAA 1GQOA 5CVDA 1VPEA 1F7VA 2DX