6LDHA

Refined crystal structure of dogfish m4 apo-lactate dehydrogenase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
329
structure length
329
Chain Sequence
ATLKDKLIGHLATSQEPRSYNKITVVGVGAVGMACAISILMKDLADEVALVDVMEDKLKGEMMDLQHGSLFLHTAKIVSGKDYSVSAGSKLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKHSPDCIILVVSNPVDVLTYVAWKLSGLPMHRIIGSGCNLDSARFRYLMGERLGVHSCSCHGWVIGEHGDSVPSVWSGMNVASIKLHPLDGTNKDKQDWKKLHKDVVDSAYEVIKLKGYTSWAIGLSVADLAETIMKNLCRVHPVSTMVKDFYGIKDNVFLSLPCVLNDHGISNIVKMKLKPNEEQQLQKSATTLWDIQKDLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M4 APO-LACTATE DEHYDROGENASE
publication title Refined crystal structure of dogfish M4 apo-lactate dehydrogenase.
pubmed doi rcsb
source organism Squalus acanthias
molecule tags Oxidoreductase(choh(d)-nad(a))
total genus 100
structure length 329
sequence length 329
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1987-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 6ldhA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 6ldhA02
1ARZA 1C1DA 3HFGA 1R66A 1A5ZA 3RU9A 3NYWA 4IXTA 2CZCA 3FR8A 4ZGWA 1KS9A 3UKOA 5IF3A 3W6ZA 4B3HA 3OJOA 2VRBA 5DCYA 5L45A 1OMOA 3JQ6A 1I2BA 4IBOA 1SMKA 3UXYA 4PRKA 4DPLA 3T4EA 4EBFA 2Q1WA 2VRCD 1GY8A 2HJSA 2ZYAA 2BFAA 1D4FA 3KV3O 1XU9A 1A72A 1ZUD1 2DM6A 4CLRA 4JJIA 1UJMA 4QTZA 1R12A 1QYCA 3GN2A 3TZKA 4MDHA 2WD7A 1H2HA 1R6DA 2X4GA 4WPGA 4CR7A 2Q4BA 5ES3A 1U3VA 2X7HA 3JTMA 1NR7A 1UAYA 4KTVE 1LSJA 3F9IA 2HDHA 3SC4A 5DOZA 4BKPA 5JYDA 4TVBA 3WLEA 2ZKLA 4MP6A 1R4NB 3WSVA 1U8XX 2F00A 5JS6A 4I1IA 1GR0A 1VKOA 1QV7A 3DOJA 1N1EA 3MEQA 1KY4A 2Y0DA 2G17A 2OMEA 4JNKA 4FBGA 1GPDG 2LDBA 3EHEA 4OXNA 4U6QA 1UXGA 2GRAA 4IY1A 2FOIA 3GAZA 2FRDA 2YFQA 2Q45A 3GNQA 4FS3A 2ZTMA 1Y1PA 1PQUA 2NUAA 3ZW9A 3UOGA 5KWEA 3RI3A 3N74A 4BNFA 5IXYA 3PEFA 2UUPA 2I3AA 1A7KA 4IDEA 3BTUA 3TSCA 4WCDA 2P4QA 2XXJA 3IJPA 3P5SA 3OF2A 4IQ8A 1SPXA 1A4UA 3G1UA 2I65A 2DKNA 2O3QA 1GPJA 4RLSA 1MFPA 1WZEA 4BGEA 5JY1A 1YVEI 2FMUA 2Q50A 4D3SA 3E03A 2E48A 3MJSA 1HYEA 2B5VA 4QSMA 3JQFA 1ENZA 1ZFNA 1IE3A 2PWZA 3W4JA 4CMIB 1CWUA 1I0ZA 3RQSA 1KVRA 1Z7BA 1Q7CA 2O7QA 3Q2KA 3CZRA 4IGFA 3KYDA 4J7XA 4CM5A 1U9JA 2PFGA 2X9GA 3H9JA 4RVDA 4E2YA 2FY8A 4LW8A 4CJXA 1GCUA 3RFTA 4XD2A 1MP0A 1HE5A 1VL8A 1NAIA 4PCVA 3NDRA 1U5AA 1MLDA 1YS4A 4YEDA 1EUZA 4E2XA 5JXWA 2FP4A 2ZJ1A 1C0IA 3GVCA 1GEGA 4R3NA 3V2UA 4XYEA 1YOVA 3NT5A 3KETA 3PJDA 3U0BA 5DOVA 3ROPA 4DC0A 3PJGA 1R4MB 2VHYA 3ON5A 1WNTA 2P91A 4N5MA 3WXBA 4XYGA 3FCOA 5L7YA 3ZWMA 1KVUA 3PQDA 2TMGA 2FPPA 5DCUA 5KIAA 1ISJA 1V6AA 2HKIA 1K5HA 3ZU2A 3M2TA 4Z9YA 2EGHA 3WTCA 2NU9A 2R00C 3KYCA 5GY7A 1HL3A 3ROKA 3WFJA 4CUKA 1NQOA 1U4SA 2C5AA 2VTEA 3DC2A 3H5NA 3LZ6A 3WNVA 3DFZA 1H6CA 3AY3A 4H3VA 3ANMA 3QV1A 4MO2A 1HDXA 4R5MA 2HMTA 1GZ6A 2BKAA 3S1LA 4FFMA 4LN1A 3DZJA 1HYGA 4FFRA 4AG3A 4D42A 2PV7A 3PHIA 1PGJA 2FWMX 5G4LA 2OO5A 4NFYA 1E7RA 2DUWA 1A9YA 3VDQA 1NFRA 3W4IA 3VTZA 2QYSA 2IZ1A 1IOLA 4BNHA 5KVCA 2Y93A 4L75A 3TOZA 1YL5A 4YR9A 1NFFA 1V9LA 4GKVA 4J2HA 4KZPA 5FWNA 1M67A 4R3WA 2YHIB 1WAMA 1E7YA 3QIVA 5FI3A 4DYVA 4WNCA 4AJ2A 3HADA 3PQFA 2QZZA 3NDJA 1Y8RB 5JAIA 3SBOA 1N2SA 3C1TA 4I5FA 4J7UA 4MIOA 1KVSA 4YJFB 3QA9A 1M66A 1U8FO 4XQGA 3GF4A 5DN9A 1JWBB 2O3JA 5LCXA 3LC2O 5JCJD 4LVCA 2AEJA 2BGLA 3ASUA 3KSDO 3QWIA 3LT1A 4WLEA 5KJCA 5HBRA 5L53A 1KOLA 3MJCA 4UVIA 3BYZA 4XDZA 1GD1O 3WQRA 1EDOA 4U0JA 4XYBA 1UDBA 3QP9A 2FSVA 2GDZA 2DQ4A 1YBAA 3BTVA 3EYWA 4I9UA 4B7XA 3MJEA 4BNKA 4TZTA 1DPGA 3KBOA 5JMPA 2DC1A 3EDMA 2EW8A 2OBYA 4L74A 2NSDA 2R00A 1DOHA 4IQ0A 2NLOA 2VZ0A 4J6FA 2ZTLA 1BHSA 4B4UA 3H9EO 2OUIA 3ZV3A 1WMBA 1PJBA 1LLUA 2PGLA 3FWZA 4BGUA 4JJGA 2OP1A 1NHWA 3TFOA 4UVHA 1PJSA 1EK6A 1RJWA 2Q2QA 3AU9A 3MJTA 1CQJA 3I52A 1PS9A 3K6JA 3BZUA 4NU5A 2W2KB 1UR5A 3UN1A 3VOSA 3JQAB 3ROQA 5C7OO 4QX6A 5EJ2A 5A05A 1XG5A 4JROA 1E1MA 3AM4A 2Q99A 3AI1A 3PDJA 3WYCA 1B3BA 3IUPA 2GO1A 1NWHA 1Q7GA 2FSSA 3I1JA 4RV9A 4CMKA 3GDGA 2RAFA 4KQXA 3ZN2A 2I99A 3JD0A 4MVJM 1FJHA 1T25A 4MVJH 4GKBA 1TEHA 2B4TO 3ICCA 3I23A 2B83A 4YA6A 3VZRA 4NU6A 1GEEA 4TSKA 3ZNPA 1N7HA 3KVOA 3ZV5A 3MJVA 2P5YA 3VZPA 2EKPA 2Y99A 2ZYDA 5JAQA 3ETGA 1I3KA 7ADHA 4MIYA 3NX4A 1LSOA 3VKUA 3TN7A 1V3VA 4PLTA 4K28A 4NPCA 2X5OA 1PS0A 3LK7A 4MVJP 4ZQHA 2BFPA 3OJFA 1UH5A 2X58A 5T8KC 3HFSA 3CE6A 3X2EA 3D3WA 4GVXA 5CDYA 1C14A 4I9HA 3WYEA 1JLLA 2G82A 4XQ9A 1XKQA 3SVTA 2XAAA 4BO6A 4MVJE 1KEPA 4MKRA 5TIIA 4NJMA 3U09A 4R1SA 3PYXA 3V2GA 2GN9A 1LDMA 1GV1A 4YJGB 3PLRA 4BNYA 3KSZO 1PL8A 1H94A 4BL5A 3QSGA 2C59A 2B4QA 3UUWA 1GFSA 4FFOA 4J49A 2HMUA 4LSMA 5AXAA 5FI5A 3ZU3A 1DSSG 1T2AA 4Y6SA 1U4OA 3RBZA 4PLWA 5KVSA 1XA0A 1K6IA 3AK4A 4GLOA 4EEZA 1LQTA 4Z9FA 3AOEC 1AN9A 5C3MA 1SO8A 3BA1A 1LSUA 2NVUB 3LF2A 3NTRA 4BO8A 3EC7A 4ZN6A 3ZWVA 2H5LA 4IUYA 1AGNA 2VOEA 3HN2A 5DBIA 3OHSX 2NU6A 3S2IA 5I8ZA 4B79A 5CDUA 5TRTA 4Z6KA 2D1YA 3VH1A 1ZEMA 2BFMA 4I9NA 5JLAA 5L7WA 4CUZA 5HTOA 2QZ9A 1PZGA 1QMGA 5TGDA 4F45A 4I5GA 3H5RA 3QRWA 4KUGA 3Q2IA 4WKGA 2VZ8A 5EQDA 2POQX 4KDEA 1PSDA 5IAAA 5FYDA 1JAXA 4I08A 1VI2A 3FPCA 2PH5A 2Y1CA 4BNUA 4BO0A 1HDRA 4ZJUA 1H5QA 3F6YA 3IJRA 4Q3DA 4IJVA 1JKJA 2CD9A 2HQ1A 5G2OA 3INGA 5IDQA 2AXQA 2VQ3A 5K6AC 1Y5RA 4J1TA 3H4VA 4HBGA 5COBA 5ILGA 3VC7A 2HSDA 3BTOA 4ND5A 1XYGA 4JP3A 4NNJA 8LDHA 3D4NA 1SBYA 2VOJA 2C2XA 1N8KA 2DVMA 3QWAA 4K9DA 4WCFC 4ITUA 4J43A 5AXBA 4CV1A 2GZ1A 3RAJA 3WOHA 4NIMA 4OXKA 4WJZA 5A5FA 1LRKA 1QV6A 2X0NA 4GWKA 1LDYA 1Y6JA 3AOEA 3DOCA 2UVDA 4G65A 4DQUA 3CINA 5BR7A 4CM9A 4P4NA 4CMAA 3DZBA 2VUUA 1DB3A 4W7IA 5JC8A 2O3RA 1EVIA 4L9RA 4TMFA 2GPTA 2IXBA 2PZJA 3JYQA 2GF2A 1C0PA 3IOYA 4CLOB 1LDEA 1HYHA 3BMNB 1ULSA 4XRRA 1GL3A 3DBLA 4MVJI 3EMKA 4GX5A 1BWSA 2W98A 3H65A 6LDHA 4E6PA 4P8RA 4DYDA 4MIEA 4QECA 4B4VA 3QHAA 1Y8QA 3S2GA 4Y8VA 1LLQA 5A9SB 2I76A 2O3UA 4UUNA 2CUKA 1AUPA 4UULA 3NKLA 5T6BA 4J7CA 5AQ1A 1LRLA 3H6KA 5K0ZA 1I24A 4E3ZA 4NBTA 5MDHA 1LLDA 3Q9UA 1VRWA 5J23A 1KIFA 4G2NA 3F4BA 4FCCA 4E13A 1ZMTA 4L4RA 2EV9A 3RUAA 3TPCA 5B4VA 2ZCVA 1E3JA 3A06A 4AJEA 2EP7A 1BDBA 4WCFA 2IEDA 3DBHA 3OM9A 5IDXA 1HF3A 3OA0A 3I5MA 2NM0A 1J49A 3G49A 3FSRA 4R1TA 3ANLA 4UUMA 3VH4A 3LSYA 1ZXLA 3D0OA 2B4RO 5JY6A 4E31A 4A03A 4TKMA 2FR0A 3ETEA 3L4SO 3FI9A 4RO0A 4XZ3A 5C37A 4XX0A 4BO3A 4YAJA 5JNLA 5GMOA 4AJOA 2B36A 2DBZA 3BHJA 2PD6A 3NV9A 3F3SA 4PLGA 3ZNOA 1UP4A 3PYLA 4AVYA 2VHWA 2HK7A 2R6JA 1Q7BA 2YYYA 5KJEA 4LRTB 3TL2A 3H8VA 2VUSA 3WJAA 4LRSB 4BHTA 3RU7A 2CF6A 2BF7A 2VN8A 3IP1A 4GQAA 3OBBA 3I9OA 4D79A 3GG9A 1GU7A 1FDVA 4E21A 4CM4A 1K3TA 3WIDA 2Q1SA 1GQ2A 1O9BA 2H63A 2VHVA 1ZK0A 2HCTA 3JD3A 4I8XA 1ISMA 1OFGA 3VH3A 1YB5A 2DFDA 1NP3A 2WE7A 2Y67A 5G4KB 3A28A 1EZ4A 1OC4A 4MOWA 4NH4A 4BNVA 2P2SA 1CYDA 3TDKA 4YAEA 1GZ3A 2WYVA 3DEYX 1SCUA 1E7WA 1GQYA 4JBGA 1F12A 9LDTA 4WASA 3JQAD 1NVGA 1MC4A 3GZNB 3RC7A 2FR8A 3MZ0A 3WQQA 2EG9A 1MA0A 2OZPA 2YV3A 1B3RA 3NT4A 5A9TA 4W82A 5F5LA 2NVBA 4MVJG 5G0UA 4C7JA 1QSGA 3L77A 2BLLA 4MVJF 4MJLA 3ZWXA 3DBRA 1E6EA 5ITWA 2AE1A 2P9EA 5A03A 3R0IA 1IY8A 3BMQA 4EDFA 3HQ4O 1Z45A 1P1FA 2D5CA 2UV8A 5JAZA 1P31A 2BGMA 1DFIA 1K2WA 1TT5B 3ZWYA 1ZSVA 2XOXA 4BMNA 2X86A 2Y0EA 4DIOA 1IL0A 1J5PA 5F5NA 3D4OA 2VUTA 3OQBA 2I5PO 1ZK4A 1XEAA 2B37A 3DHYA 4R16A 5CPFA 1C1XB 3AU8A 4YAGA 3C1OA 4R5HA 3G3EA 3ZU4A 1XR3A 5LDGA 2EKLA 1E1NA 4LSWA 1I2ZA 4PIVA 5ENVA 4KP7A 4Q3AA 4D44A 4YDRA 1JA9A 3PWSA 1CETA 3QLJA 4ZQEA 4LK3A 4QO7A 4ND3A 3JQ8A 4YB8A 3KEQA 1EE9A 3A9WA 1G0OA 3QJ5A 3DHNA 2OXIA 4HFNA 3IMFA 1J0XO 4XR9A 2JL1A 4EJ0A 2GZ2A 1KY5A 1PZFA 1XGKA 4FC7A 4FQ8A 2LDXA 3UCEA 2V7PA 2QHXA 3WB9A 4RPKA 2J6IA 3T7EA 4CM8A 4DVJA 4EITA 3WNQA 2FR1A 1WP4A 3NRCA 3RSHA 2WD8A 2QRJA 2HMVA 5JAMA 1KERA 3OICA 1SOWA 4ZRMA 1LI4A 4ZHSA 4W9NA 3AUTA 5IJZA 1U2DA 1LSSA 3P2OA 5LC1A 2JHFA 3I4CA 3JQ7B 3KZVA 3OQ1A 4FN4A 3OSUA 4ZD6A 5G0TA 1CERA 3DZKA 2RHCA 1S6YA 3RKRA 4A27A 3AJRA 3ZH2A 1KVQA 1D7OA 4MP3A 2HUNA 4B7CA 1I10A 2NTNA 4YJHB 4BQPA 4Q9NA 1EUCA 1ISFA 3PK0A 1ZMOA 4BIIA 1NX6A 4AFNA 4FPXA 5BNFA 1HSZA 4WECA 2AEMA 3ZWCA 3HB4X 1B8UA 4GSLA 4Z9XA 1Q2XA 1DC4A 1NTOA 3ZHYA 4F46A 5KVVA 1DO8A 3C7CB 1DIRA 3DZIA 3MWDB 4JBIA 3JQDA 4PG6A 3TZ6A 2IE0A 2IRWA 2UAGA 1ZVMA 2BH9A 5IDWA 4W4TA 5BSFA 1T4DA 3FBTA 4BNIA 5DDIP 4MVJA 3CMCO 1ULUA 3C24A 4MPDA 2HAEA 3EUWA 5CG2A 3JYOA 5A06A 5KJ1A 4ILKA 1P74A 5DULA 2O7SA 1V3TA 4ID9A 1E92A 3LLSA 1SC6A 5THKA 3WGGA 3C1AA 4R1UA 1QLJA 3RBVA 5DP1A 3E9NA 3L9WA 3ITKA 1EVJA 4Q3BA 3KLMX 5T67A 4CMIA 1TVEA 1JW9B 1BW9A 4YBZA 1EE2A 2YY7A 4OQYA 3BTSA 4YACA 3UH1A 1PJ3A 1QYDA 2AHRA 1X14A 2FHSA 4IXWA 1Q0HA 2NTVA 4IJUA 4FOSA 2YV2A 4YPOA 4DLLA 1KVTA 2ZB8A 2C07A 2J3KA 2PR2A 3AWDA 1ZK1A 4J4TA 2HRBA 1NPDA 5ENDA 4YRDA 3HSKA 3ENNA 3I6QA 3ZZNA 3NJ8A 5I8WA 3PVZA 2XXBA 1W0CA 2DTEA 3NDIA 1ZNQO 2CSUA 4RVUA 4CV0A 3RFXA 2Z5LA 5DF1A 1RWBA 4WGGA 4WLFA 4D3FA 2I66A 3PJEA 4CLEA 5JYEA 2HJRA 4IJKA 1MFZA 4K6CA 1K89A 2UUOA 3FTNA 3W1VA 2NNLD 3R3SA 3ZWBA 4PLVA 4ZU3A 3CXRA 1CQIA 4A5OA 1RPNA 3I9KA 3GUYA 3ZNNA 1HZJA 1WDKA 2WJPA 4NK4A 3MJ4A 5HA5A 3WDSA 3LF1A 4P4LA 1BVUA 1P1JA 4Y6PA 2PGDA 1EEHA 5BSEA 4NBUA 4R1NA 5AVOA 5TT1A 3VPXA 3COSA 4FJ1A 4R68A 1WXDA 2CNBA 4J90A 4E2ZA 4II3A 4E5MA 4F3YA 4TRRA 5COQA 5TSDA 4CLRB 2NV6A 4Q3NA 3V1YA 5KOIA 3DONA 1T2CA 4QEDA 1GADO 5F1OA 5ICSA 5ER9A 1HDCA 4E32A 3KOUA 4D45A 1ADFA 1FF9A 4WLVA 1QRRA 3PWZA 5IN5A 3V5NA 1WDMA 4J1QA 2YHIA 4BO9A 4OKIA 5JDIC 2EERA 4CM6A 1AXEA 3IKTA 2IYOA 5FF9A 2X8LA 1I5RA 3FF4A 1Y8RA 2VCYA 3TOXA 1WVGA 1M2WA 4RF2A 1V0JA 2WMDA 1VJTA 3DHEA 1AHHA 2D5AA 1DHTA 3GH3A 3GFGA 4CLHA 4YJFA 2CDCA 4TRNA 5FFFA 4CM9D 3OA2A 3UCXA 1E3EA 1N9GB 5BT9A 1NQTA 4CQLA 3GG2A 4YQYA 2QIOA 5JMWA 3RFVA 3QVTA 2IZ0A 4HV4A 3U62A 4ND1A 1I3LA 3GNTA 1H9BA 4DREA 4URFA 1IYZA 3AI2A 2BELA 5A3JA 2B35A 2C2YA 3E8XA 1E1KA 1DIBA 3ORFA 1DBVO 1M75A 1R0SA 4WOJA 4XDYA 5GZ1A 2GN8A 2P9GA 4M86A 1WW8A 1Z73A 3VVBA 4HKTA 2JFHA 1BXGB 2ZK7A 2Z1MA 5DP2A 1YJQA 1E3WB 4OAQA 2W2KA 4FD3A 4HNGA 4IDBA 4XYLA 2ZIZA 5CHEA 1CEQA 2YV1A 4HWKA 1NBOA 3DZGA 1ADGA 2O2YA 3KYDB 1KETA 4OOEA 4BNLA 1VL6A 4G81A 4A10A 3AM5A 4M87A 1B26A 2YDYA 2J3IA 4JN6B 4BB5A 4DPKA 3SC6A 4ALMA 3GN1A 1U7HA 1H2BA 4FOOA 4LMRA 1XELA 3KRTA 4L8VA 4NFHA 2BRUA 3V1UA 4J91A 4PVCA 1R16A 3R6DA 3ZHXA 3DMTC 3LQFA 2X0JA 3B6ZA 4KWHA 1V8BA 1QKIA 3LYLA 3S2EA 4II2A 4W6ZA 3IS3A 2VHXA 1WPQA 2PGJA 3H9UA 3OIDA 3TF5A 1XCBA 4TZKA 1LU9A 1G1AA 1O8CA 2ZTVA 1IPFA 1HE2A 2O50A 1PIWA 3AI3A 3W8FA 3KYCB 1VLLA 5EQFA 2DFVA 4DLBA 4DTIA 4UEKA 5TNXA 3FHLA 4H15A 5CEFA 5HRUA 3ZI0A 2QYTA 2ZQYA 3PFWO 3UW3A 2GYYA 3DDNA 3WIEA 3GAFA 1PTJA 4OQZA 3SLKA 3WQSB 2I3GA 5JFOA 1P0CA 4WE3A 3NTOA 4AJNA 3E9MA 3DAGA 1W73A 4FFNA 4QFDA 3DAFA 1MXHA 4JCOA 3ZV6A 1GYRA 4J3FA 5TJ9A 3BMOA 3PHJA 1E1LA 4ZQFA 1FMCA 2AEFA 1DLIA 1JU9A 3HJAA 2ET6A 1LDBA 1U28A 3DQPA 3F47A 3I9JA 4B4WA 2JCXA 1AXGA 1IUKA 1ZKMA 1YBMA 4IDFA 5B37A 1ISGA 3F4LA 3RWBA 4W99A 2OL4A 2EGGA 4CQMD 2BI8A 4DGSA 4IS2A 3RIHA 3SXPA 3GC6A 1ONNA 1VJ0A 4RPHA 2AQ8A 4A73A 4A7PA 3DMTA 4RDIA 3DAPA 5HWSA 3GPIA 1HTBA 4PG4A 1CF2O 4TVOA 4RZIA 2RHRA 4L0QA 2D8AA 2D59A 3E18A 4XGKA 3F1LA 3ZV4A 4NG5A 3GUCA 1H6DA 3PDUA 2E6UX 3GDOA 3WX0A 3GA0A 4MKZA 4X54A 3QVSA 5CDSA 1VE9A 2V6GA 2Q46A 4ALKA 1RM3A 4C7KA 2CY0A 4GSKA 4EJMA 1NYTA 1W6UA 3B20A 1J6UA 2GLXA 4BO4A 3RUDA 4EYEA 3WBFA 3H7AA 3K2BA 4DMMA 4RL6A 1EBFA 4D43A 4XIYA 3WS7A 1KEUA 5DBFA 4OMUA 3OQ6A 2VRCA 3T7CA 1PR9A 3H2SA 1ZIDA 4NJOA 2I67A 2O2SA 3GRKA 3JQCA 3ZWAA 1UXJA 1E3SA 2HLPA 4U8GA 5B4TA 5I9LA 4RPLA 1L7EA 1KBZA 5KNLA 4XEHA 2VYND 4D0RA 4J2OA 4DBZA 1Z74A 1F06A 2AG8A 4HUJA 2X23A 3P2YA 2EWMA 3UVEA 2YJZA 1T2EA 1NM5A 3KB6A 4NI5A 1O94A 4XB1A 3N58A 2VT2A 1ZSYA 1DIGA 3C7AA 3EZYA 3SJ7A 3TJRA 4BKRA 3AM3A 1MV8A 9LDBA 4JXKA 5EL0A 4FJ0A 1LC3A 1C0KA 2VYVD 2HO5A 4KDFA 1U1IA 2QRKA 3L4BC 4ZQBA 4Q3CA 3EZLA 3C7DB 4JIGA 2PK3A 1ONPA 3N7UA 3CIFA 1E3IA 1R15A 2VWPA 4ALIA 3OP4A 3CH6A 2EF1A 3IIEA 3WG9A 5T8KA 2J5KA 2VNAA 3FNEA 4I5EA 4UEJA 4CLOA 3UGKA 3GZ4A 3M1LA 3BMNA 2G0TA 2GNAA 2QRLA 3E9QA 3QVXA 4TKLA 4QXMA 3OIFA 4EEXA 4QQRA 1A4IA 3LC1O 2WTBA 1T1RA 4F6CA 5THQA 2CVOA 3MOIA 1QYVA 3DFUA 3OJEA 1NQAO 1Z82A 5A4DA 5A9SA 2HK9A 1ZSNA 1SZJG 1EMDA 3D1LA 3SJUA 3HE3A 3GNSA 1HZZA 3OIGA 4YT4A 1HLPA 1UUFA 4NJMB 1OAAA 1SOVA 2E82A 3W4KA 4XR4A 3OEYA 5CDTA 1T2FA 2IYPA 3H9QA 2YW9A 1GYPA 3PQEA 1QORA 4NQZA 1ID1A 4PLHA 4RORA 4NMHA 4R41A 3ONFA 2VWHA 4DL9A 3PYMA 3WGQA 2PNFA 3JQGA 4WUVA 1B2LA 1QLHA 3FNFA 3AY7A 4DWVA 2FN7A 5TLSA 3LU1A 3MTGA 2OP0A 1B14A 3VDRA 3C85A 4IM7A 5IG2A 1TA4A 2X0RA 5TJHA 1VL0A 4KUHA 4CR8A 3L4BA 3PIIA 2A9FA 2OFPA 3AFNA 1X13A 4CLDA 4YRBA 1FDWA 1IHYA 5CG1A 2A92A 2A35A 4BO2A 1VM6A 1RM4A 1TI7A 3DR3A 1GUYA 3BMCB 1NXQA 1W8DA 3P19A 2WSBA 3F5QA 3I4FA 1XDWA 3WWZA 1N92A 1T1SA 1DFGA 4O0LA 1SAYA 4BGVA 2C7GA 4DQVA 2YQ4A 4RJTA 2Y1OA 4IDCA 3GGPA 1JN0A 1SEVA 2VNSA 4FSHA 5JO0A 5L4LA 2WM3A 2RIRA 2Q2VA 1DLJA 2PTGA 2BI7A 4A26A 3K73O 5K6AA 3BXXA 4XCVA 3F46A 3ONDA 3GGOA 3PGXA 4R4JA 1I01A 2DBVO 1LUAA 3DWFA 5I7VA 1D8AA 2GN6A 5G4KA 1G0NA 4O59O 1Q0LA 4YTEA 2FPIA 3BIOA 1ZJYA 6ADHA 3I6IA 1DEHA 3PZRA 2GN4A 2GASA 1FDUA 1NPYA 2D0IA 3JD1A 4PLCA 3GZNA 4YXFA 2F1KA 1DHRA 2Y68A 3PWKA 2BHLA 5I7SA 4J1NA 5BQFA 1E5LA 1I2CA 1E3LA 2Y1GA 4AL4A 3V2HA 1NPTO 2OORA 1LTHR 2DBRA 4DMLA 4HX5A 5JCJA 5TQVA 4RZHA 4CR6A 4ND4A 3L9XA 1YGYA 4N7RA 2X5JO 2I6TA 3ASVA 3D7LA 2NTJA 1ZXBA 4LCJA 2CMDA 3BHIA 1TT5A 1RKXA 1GCOA 4L73A 1HDYA 5ER6A 1B0AA 2CDBA 4HNHA 1EQ2A 3A1NA 1C3VA 5JDCC 3VKVA 4M89A 4JK3A 3FRJA 5CDGA 1W4ZA 1BXZA 2JAPA 4WLNA 1IHXA 3U4HA 4AJKA 1C1XA 4N18A 1GTMA 4D3DA 2EKQA 4XQCA 2Y0CA 3B70A 1BMDA 4NR0A 4OOFA 3UICA 5LDHA 2VHZA 1Y8QB 1PS8A 3KXDA 1Z7EA 1Z6ZA 4TWRA 4YQZA 2P5UA 4FJ2A 1BTOA 4HY3A 5AXDA 1PR3A 1O95A 3LLVA 2WDZA 2C20A 1DJQA 4C4OA 3KM0A 5A1TA 4BV9A 1ZCJA 4L4SA 5DBGA 2AE2A 4JP2A 5EMHA 1YRLA 4IS3A 2YZ7A 4XB2A 5I7EA 1H93A 4O1MA 2PH3A 3O4RA 4JX8A 2J3HA 3H5AA 1OOEA 3CPSA 4WCFB 3DBHB 5TC4A 4E5YA 5IZCC 1UP7A 1XIVA 5CEJA 4CM1A 5L95A 1RM5A 3JYLA 4YT2A 3NUGA 1DC3A 4RQTA 4JBHA 3VPHA 3RVDA 2ZB7A 1FXSA 4P38A 4E4YA 2NU7A 3D3EA 1ENOA 1ISIA 4OM8A 4UAGA 4XGNA 3OECA 1DFHA 2Z95A 5FEUA 4YWJA 3ZGYA 1X7DA 5H81A 4RF3A 4YRAA 3W6UA 4FB5A 3ONEA 1DIHA 3RC9A 4HFRA 4OIMA 1BVRA 3ZWOA 5JDCA 1KC1A 1MUUA 3D5TA 2ZTUA 4IINA 4YJHA 1IZ9A 1GV0A 4MP8A 3S8MA 1P9LA 1E7MA 4NBWA 4D0SA 1ZH8A 5CFZA 5BSHA 3HN7A 3RUHA 4XRGA 4GMFA 4NDNE 1V35A 2WEKA 4HFMA 2AQIA 4J9UE 5AXCA 1M6WA 3JYNA 2NADA 3R3JA 4UUPA 4M54A 1U3TA 1VSUA 1MGOA 4FR5A 1DRVA 2YUTA 4EI2A 2EJVA 4OL9A 2EP5A 1QG6A 1JVBA 4WLOA 2P4HX 3VAZA 3ICPA 3O8QB 5IN4A 2O3SA 3ST7A 3AUSA 2D2IA 2NU8A 3AY6A 3H9GA 4EUFA 5L51A 4K26A 4XKJA 3WGTA 5L40A 3DZHA 5GZ3A 3C3XA 5DCWA 4Z3KA 2PA3A 3S55A 2RBEA 3FR7A 1JDJA 4OXYA 3GK3A 4GL4A 2ZYGA 3GMDA 4KOAA 4IMPA 1PGOA 3TWOA 3LT4A 2YDXA 4U5QA 4TROA 3ROMA 1IULA 5A02A 3M6IA 4LCEA 1HT0A 2IODA 3FPLA 1P1IA 1G6KA 4CQMB 3PIDA 4MKXA 1P1KA 4P4GA 5JSFA 1X1EA 4RVFA 4N5NA 2PLAA 3DBRB 4EZBA 3L07A 1I33A 1JKIA 4DXHA 1E0DA 3FNHA 3BMQB 1R4NA 2JD1A 2O3TA 2Q4EA 1EVZA 2DLDA 4ZQGA 4B3IA 4DPMA 2GSDA 2H6EA 3QVWA 1E7QA 1HDZA 3I9NA 2PZKA 4ZICA 3G1TA 4NK5A 1PWXA 1ZBQA 4GH5A 1P1RA 3DO5A 3ZNQA 3RUIA 1EVYA 4BB6A 5I9MA 3VH2A 5T5QA 3X2FA 3NGLA 1X7HA 1A27A 3RROA 3O9ZA 1DAPA 2EXXA 4FFLA 5KCZA 5KTKA 4FW8A 3U4CA 4BGIA 5GZ6A 1T26A 1B16A 1GYQA 3WMWA 4BV8A 2H1SA 3NT2A 1UXHA 4AJIA 3INTA 1HLDA 1S7CA 2CF5A 2GERA 5ITVA 1VSVA 4OO3A 2HK8A 1YONA 3NTQA 3WJ7A 4CM8B 1PGPA 2W90A 1TLTA 3OH8A 1LDGA 4RF4A 2VZ9A 4DRYA 1EDZA 3FWNA 4NHEA 4FGWA 1UP6A 1I3MA 3AUUA 4RLHA 4ALLA 4UVEA 5U4QA 1R37A 1DIAA 4O5OA 3VPGA 3JQFC 4R9RA 3DTTA 1P3DA 4M1QA 4H16A 1GDHA 1JTVA 2W8ZA 1T2DA 2W2LA 4QFCA 3ADOA 3ZWNA 1NAHA 3GVXA 2AQKA 3HDQA 4TRJA 1Y9EA 3KYBA 4AJLA 4KMSA 3RUFA 1D1SA 2OOSA 1QYWA 2EIHA 3JD2A 1EK5A 3KSUA 1R4MA 4GPD1 3CTMA 3UF0A 2X5KO 2E4AA 1XHLA 2J5QA 1PZHA 4Z0PA 2YFHA 3GPDG 4ESOA 2Q1TA 4BNJA 1QP8A 1D3AA 4GAEA 3CMMA 2DBQA 4DIFA 3NAQA 5T57A 1N9GA 3RBXA 3GR6A 1C1DB 2PKRA 3KLPX 2AG5A 1QYXA 3KO8A 5TX7A 3FNGA 4DQXA 4E5NA 1KEWA 3ETDA 3GY0A 1DC5A 3WGIA 5A9RA 3RD5A 5KJFA 3CSDA 1WWKA 3PTZA 2B5WA 4KUEA 5L3ZA 5DZSA 3SX2A 3JCZA 7MDHA 4QT0A 1LXCA 2DPHA 4BKUA 2BFOA 4GGOA 3Q6IA 2IDZA 4IPTA 5K9ZA 1E6UA 1X1TA 3G17A 5AYVA 4CMBA 3GHHA 1LLCA 3GHYA 3QWFA 1TB4A 3UAGA 3WMXA 1OI7A 3ULKA 3PLNA 1BXGA 2FZWA 4XWYA 2H9IA 3RUEA 3QVOA 4CL3A 1E3WA 1D1TA 1LDNA 1PGNA 3K5PA 2WD7B 3RJ9A 2JJYA 3EAGA 3TZHA 3Q1LA 5ADHA 3W8DA 3QE3A 4XGIA 1PJLA 3EVTA 1KC3A 1MG0A 1U5CA 3WICA 3D64A 5COAA 1BW9B 3RC1A 2WWRA 3D5QA 2EHDA 3E48A 1Z75A 5EESA 3W8EA 5DNAA 1YB1A 3GMSA 2JAHA 3PI7A 4UVDA 4AICA 1EFLA 4YT8A 5IDYA 4NBVA 5CPBA 2Q2WA 2QW8A 1HE3A 1RYEA 5MGBA 1YKFA 1M6HA 3U9LA 4ZVVA 4S1VA 4N54A 2QG4A 2Y05A 1P1HA 4OH1A 4U7WA 1O0SA 1ZK2A 1DC6A 1XSEA 3L6DA 3PHHA 4YVFA 4O6VA 1U7TA 4J4BA 5IFLA 4HXYA 4CM7A 4RDHA 3WGOA 3DOOA 3CEAA 3ZWWA 1QXSA 2YHUA 3I9LA 2QX7A 3OEWA 4PRLA 4R9SA 3U49A 4BO1A 5BNIA 1JKFA 1YH3A 3PXXA 3IAHA 1U2GA 3HB5X 3Q3CA 3I83A 5EPOA 5KVQA 5C7LO 1XQ1A 5CEEA 1EBUA 1YL6A 2XF8A 3HG7A 4OSOA 4YYZA 2ILTA 3QWHA 3JQAA 3NGXA 3O38A 3ZHBA 3V8BA 2EW2A 3BHMA 5A04A 4DUPA 3HWRA 4ONEA 4XYMA 4BKQA 3INRA 4B8ZA 3R1IA 4CMGA 5I7FA 2PKQP 4O63O 4PVDA 4KWIA 4Q3EA 2PD3A 4OYRA 5JDIA 4BUCA 4DIBA 4PFJA 4QUKA 2HMWA 5EERA 2UDPA 4CMHA 1RYDA 1YOVB 1UZNA 2HRZA 1H9AA 3K30A 4BKOA 1ADBA 2GD1O 3WR5A 1GZ4A 4EGFA 1E5QA 1H0KA 3IDSA 3IKVA 3U4IA 1P77A 4IZIA 4J9VA 1P45A 2RCYA 4NFSA 5EINA 2BD0A 3GEMA 2PZLA 2TMDA 4RVSA 1L1FA 5KJ6A 4AJ1A 1BG6A 1Q0QA 1YQDA 3T4XA 1WZIA 3LDHA 1UDAA 3I9MA 3MOGA 4WK6A 1YWGO 5F3RA 4CQLB 4DLAA 3G0OA 3LVFO 4GX0A 4CL8A 1IB6A 1F8FA 5TT0A 5L7TA 5H82A 3SEFA 4PLPA 1NR1A 3IP3A 2G5CA 4XQEA 1IZ0A 4J4HA 3KEOA 1LRJA 1O89A 2JHGA 2ZB4A 3JQ9C 4BNXA 3S2FA 4BNWA 3OJLA 3PRJA 1SB9A 2G1UA 3KTDA 4PZEA 1NVMB 4ROSA 4YJGA 1LQUA 1O6ZA 1KEVA 1UXIA 4EW6A 1YBVA 5L4SA 2J3JA 3UFXA 4E2WA 4E5KA 3GLQA 2OBNA 4HP8A 1K6JA 2A94A 8ADHA 1NASA 4WLUA 5KKCA 2Z1NA 1ZJZA 3C8MA 1UXKA 1ZEJA 3PHLA 1F8GA 4OHUA 4PG5A 4IIUA 2J8ZA 2C5EA 1K0UA 2CDAA 4ZRNA 5A5EA 5HS6A 3KHUA 1NQ5A 3H2ZA 3ANNA 5A3VA 2NVUA 3V1TC 2RH8A 2BMAA 4I5DA 3PHGA 2HMSA 1YB4A 2X9VA 2C82A 3DBVO 1A71A 3IC5A 2X9NA 3PGJA 1ADCA 1CIVA 4M49A 4BNTA 1R0KA 1TXGA 1PL7A 3GQVA 1F0YA 2WE8A 1ZW1A 5U9CA 3GOHA 2J5RA 4RF5A 1LX6A 1DJNA 3VHRA 3IL2A 3ZCXA 1B8PA 4R51A 3GVHA 4M55A 4RQUA 1X7GA 3PZBA 1YJ8A 5AOVA 5BNTA 4RGBA 1XU7A 4CODB 1ISHA 3WLFA 5B1YA 5C7IO 3E1KA 3IQDB 1PZEA 4PG7A 3TZCA 3EVNA 5B12A 1YE3A 2Y66A 4JGBA 1YQXA 2V6BA 2DU8A 4OGWA 4F6LA 3E82A 3MCVA 4BOYA 3GT0A 2C54A 5KKAA 4CV3A 1DAOA 2FZEA 3JQ9A 1B7GO 4Y6RA 3JV7A 3K2EA 1LBEA 2W4QA 3QWBA 2ZB3A 2PKQO 5L9AA 2O48X 1PEDA 3U3XA 4DC1A 2IXAA 3ZHZA 2HU2A 4J0FA 4A2CA 3BMOB 1FDSA 2VTDA 3WGZA 1A9ZA 3I3OA 3U5TA 3FD8A 4P22A 1A7AA 4E33A 3TZQA 3JQEA 3GEDA 1YL7A 4DBVO 4Z3DA 1P0FA 3GVPA 5L4NA 1T24A 4UVGA 3RASA 4NZ9A 4BMVA 3AUAA 4IDAA 4IDGA 2GCGA 2V6MA 3OMLA 3D4PA 3JQBC 2Y1FA 3PP8A 3DL2A 4CPDA 3IUSA 1EUDA 2Q1UA 2JCVA 2PY6A 3AW9A 4DA9A 1HDOA 4IGEA 4OKNA 3WSWA 5CP8A 2EEZA 1BDMA 4Z0TA 1UDCA 4JQCA 3PJFA 1Q1NA 3BMCA 1E77A 3D3WB 3DMYA 4JJFA 1X0VA 1BRMA 2O4UX 3EK2A 3CKYA 3OFSA 3VVCA 3JSAA 1PQPA 1ZK3A 4FFPA 5JPIA 1GQQA 3E6AA 4INAA 2O23A 3HDJA 2EJWA 4HADA 4R69A 2AMFA 3CZMA 5JO9A 3LT2A 4Y9DA 2JFFA 4ALJA 1HEUA 2E49A 1FK8A 2O4CA 2VT3A 1PWZA 4WEQA 2CFCA 4ZA2A 2X1HA 1U3WA 3AFMA 3HNPA 2NQ8A 2XPCA 1JVSA 1SEPA 4MVJD 3K96A 5JCXA 1CJCA 2AQHA 4AJHA 3VPSA 1N7GA 2JKVA 1RM0A 4WOKA 1LC0A 5BSGA 2G76A 1I8TA 1QR6A 1YO6A 2D3TA 5F1KA 4LMPA 5CAEA 1HXHA 1WLYA 2FPGA 1PJ4A 3QQPA 4TQGA 5G0VA 2JCYA 4BNZA 1P33A 1PJ2A 1O5IA 4GGPA 4IDDA 1WDLA 3ADPA 1VPDA 4LGVA 4D41A 4UUOA 1ML3A 1LJ8A 2P68A 1V3UA 2I9PA 5T64A 3JQBA 4YAKA 1L7DA 2BGKA 4PZDA 1OZAA 3K92A 2B0JA 2W2LD 3KUXA 4B8WA 3M2PA 2C0CA 1GUFA 4GI2A 2RH4A 4IMRA 4U6SA 1HKUA 4NBRA 4YT5A 5HS4A 1EFKA 4JLWA 3RUCA 4CMEC 3G79A 1J4AA 1XLTA 1K6XA 4B4OA 4KQWA 4E30A 5H83A 4CMCA 2JD0A 4PG8A 2DUUA 1HRDA 3GGGA 2C29D 3NEPX 5JE8A 4GX1A 1TT7A 2C7VA 3VZSA 1OBFO 2PZMA 4UREA 2AW5A 3Q0EA 1AE1A 3PPIA 3U4DA 4W7HA 4GX2A 1C0LA 4LISA 1VC2A 4CMJA 4Y98A 1NNUA 4D46A 3FN4A 4RPJA 5HM8A 3QW2A 2V6FA 4BS9A 1NWCA 1Y5MA 1I36A 1Y7TA 1PGQA 2VWQA 3GVIA 3TRIA 1SB8A 1BSVA 3LC7O 4IZHA 2YQ5A 1DRWA 3JQGB 3RC2A 4J16A 1YQGA 1MC5A 4OJNA 4AJ4A 1XWFA 3ZDFA 1Y81A 3ITDA 1LEHA 3FTPA 4RVHA 3NJ4A 4KTTE 1PJQA 1NFQA 2ZQZA 1N5DA 5TS3A 4K1LA 1F14A 2DT5A 1MX3A 3JD4A 1T4BA 1DRUA 4BQRA 4EJ6A 5JC1A 3EY4A 2NACA 2UYYA 1JAYA 3Q11A 4BVAA 1ENPA 3DBLB 4PGFA 2P9CA 4Z0HO 3WTBA 3A4VA 3WFIA 1BGVA 5TF4A 2CVZA 1N1GA 1B8VA 1HDGO 4BNGA 1PQWA 1I30A 1EQUA 1DXYA 4CMEA 3WGYA 1HSOA 3MTJA 3UHAA 2A4KA 2GZ3A 4YCAA 4A0SA 1GUZA 1FDTA 4FIZA 4GLLA 4HFJA 5ILOA 3H3FA 4N5LA 1UZMA 4GBJA 4PLZA 1ZO8A 3A14A 4CV2A 4EUHA 3WGHA 1M76A 1JWAB 3L6EA 4XJSA 5IXSA 2CVQA 4XJTA 3TQHA 1MXFA 1AHIA 4FC6A 4CLXA 5C5IA 3RCBA 4PN3A 2ZJ0A 1PX0A 1ENYA 3O8QA 4GMGA 4J0EA 4OSPA 1F17A 4XA8A 5G0SA 3DB2A 4EUEA 1BXKA 2NWQA 2B69A 3B1FA 3VZQA 4ALNA 3E5RA 1YDEA 1HWYA 5JW6A 1KYQA 4YJDA 4CUJA 2WYUA 4D7AA 2PD4A 3GRPA 2JFGA 4BNNA 3WWYA 1GAEO 3ZWPA 2X22A 2WYWA 1OC2A 3Q9NA 4BO5A 1H6BA 3TL3A 3LT0A 2GR9A 1Y9AA 3JQ7A 1ORRA 3CUKA 3O03A 3UCFA 5IZ4A 1JQBA 4CQMA 3PFFA 4H7PA 3HUDA 4W9NC 1I32A 1LNQA 2QQ5A 4XIJA 5DT9A 5U1PA 4IJWA 3SLGA 4ND2A 4E0BA 4MINA 2Q3EA 5B4UA 1U3UA 1VKNA 2AA3A 4J1SA 4Y67A 1YDWA 4M8SA 2X6TA 4PZCA 3HZZA 3O26A 4E5PA 1XQ6A 4CM4B 4LVUA 3ZU5A 3H3JA 1CRWG 1UZLA 3ABIA 3K9QO 1NHGA 2IEBA 4WNIA 4BNMA 3HDYA 1ZZEA 4RPGA 2OHXA 1YXMA 2GUGA 3STHA 3L0DA 4RCVA 3RJ5A 3TNLA 3EW7A 3OJ0A 4L4XA 1P44A 2ZATA 3EGOA 3F5SA 3FBGA 4UEOA 5EIOA 4B7UA 4FDAA 4PLFA 3JYPA 4GWGA 4GVLA 3K8ZA 2Y1DA 3DTYA 1NVTA 4R01A 1SNYA 2GGSA 2Q49A 3HHPA 4IQGA 4AJJA 3RKUA 3M1AA 1ONOA 5EN4A 1VJ1A 2VYNA 4YAIA 4TRMA 4U0KA 2R2GA 3F1KA 3TFQA 2D4AA 4QO8A 4L76A 4WEOA 5IZCA 3AOGA 3DZFA 4B3JA 2SCUA 5F1PA 1CDOA 2E37A 2Y1EA 1I3NA 2X0IA 1HETA 2DPGA 3P7MA 1PL6A 4IIVA 1IPEA 3E5MA 2NQTA 1X15A 2ZCUA 3VTFA 3DXFA 2VYVA 3GDFA 4AJPA 1E6WA 5ICMA 3GEGA 1DDOA 3B1JA 2NVWA 3ENKA 4E12A 4CM3A 4PLYA 4G5HA 1H6AA 2OGUA 1X0XA 2IZZA 1B15A 1PJTA 1R0LA 3VPFA 1LA2A 3MWEB 3B1KA 1HE4A 4RVGA 4FGSA 5JBIA 4S3MA 2DAPA 3ZW8A 3HDHA 2DTXA 1MG5A 5G0WA 1E7SA 4Q39A 1UAGA 1PJCA 2V65A 1WMAA 3WYBA 3K31A 4BMSA 3JQ8B 2JD2A 4BO7A 3L6OO 3OETA 5I9NA 1MB4A 5F21A 3BAZA 2DTDA 3GFBA 3QY9A 4R54A 1PU2A 4K6FA 2VWGA 3WBBA
chains in the Genus database with same CATH superfamily
2C3PA 5T4FA 1EUQA 4KSCA 2HQBA 2P3SA 4IGAA 3RU9A 1SIWA 3NYWA 2JS7A 1L2TA 2CZCA 1PYDA 1CULC 5BRNA 3OM8A 1EP3B 3NCHA 3RYHA 1WXHA 5IF3A 5CB4F 1FX1A 1K08A 1N36B 3A6JA 1PN3A 2Q7DA 3R0XA 4IBOA 4XLLA 5CA0A 2ODPA 2ZB2A 4G0MA 1TEVA 4PRKA 1KBQA 1GNSA 1YNSA 1OJ7A 4Q7LA 1DAEA 2I3BA 3GD5A 5I7RA 3G82C 5CLHA 3WIBA 1GRCA 3QMPA 3STVA 5JRZA 3ICQB 1KH3A 4KKVA 1DE0A 1A72A 3KJHA 4CLRA 4I55B 4BP8A 1UJMA 3TW4A 1QYCA 5DK6A 3CPEA 1NZDA 4Y0AA 4YMTA 5EPUA 1OX4B 4MV9A 4HATA 1S3SA 4B84A 3W8EA 3ZDAA 1TTPB 1F0KA 3EB9A 1H2HA 5BWMA 1XROA 1S1MA 3KXIA 3UHOA 2Q9CA 1D6MA 2YXNA 1HC7A 1U3VA 4KTVE 1S4QA 5CLIA 1JDBC 1QKKA 4IV5A 3O31A 3SC4A 5JYDA 4BKPA 4YAUA 3FDFA 4TVBA 2YJ6A 3DM5A 5TF0A 2BMWA 1R4NB 2ODQA 3WLEA 1HR0B 4EATA 2F00A 1M8JA 1KDVA 4ZHQF 1G6Q1 1VKOA 3DOJA 2RC5A 1MTZA 1N2CE 1P19A 2HB6A 4DJ5X 3RHZA 5J2UA 4BE4A 4FBGA 5K05A 1GPDG 1M2VA 4XWGA 4U6QA 4OXNA 1CY4A 1M7HA 2FETA 2FOIA 3GAZA 1W88A 2F8LA 2I80A 2J87A 4IRUB 2VXBA 4IY1A 5G40A 3TX6A 3G0CA 4FS3A 3R75A 5AHXA 3QX7A 2FEOA 4KXXA 3L0ZA 4N0MA 4W1PA 5AUPB 3ZD6A 2FGKA 2IU6A 2PR7A 3ZW9A 4K9SA 3RI3A 4OTZA 3RBAA 4BWFB 1NUSA 2WFLA 4BNFA 1QO9A 2ENWA 1HFEL 3PEFA 4LJ5A 1PDWA 3BM5A 4Q4JA 4AZ3A 1QJCA 2ACEA 4IDEA 4UHDA 4WCDA 3RYTC 4MPJA 3FJ1A 4Q18A 5JSHA 3IJPA 3P5SA 4PHHA 5A6SB 1ECBA 1SPXA 1J24A 1JDTA 3E0XA 5JTUA 1AU9A 2D7CA 2I65A 4BGEA 4OI2A 3MHTA 1MFPA 5IT4A 1GKIA 1VBNA 5JT1A 5JY1A 1Y9JA 2R8OA 4QKQA 4N40A 2Q50A 3R23A 2I6XA 5I48A 1F0NA 3FPSA 2GYVA 5BMVA 3D3QA 3LGSA 2BSAA 3R41A 4JXZA 1JG1A 2XCQA 2WU4A 3DCNA 3UBTA 4AJKA 1IE3A 1G38A 3QVLA 4DNFA 3UNXA 3W4JA 1I6MA 2ZLBA 4JT4A 3WRWA 1QANA 2GZHA 3DV0A 1OKKD 3ZX4A 1WHTA 3IP8A 5ADUS 3R40A 1VL1A 2CVFA 4RVDA 4E2YA 2ZRKA 3IEXA 1GCUA 1KYWA 2J0VA 1RJFA 3HRKA 4XIFA 1VL8A 1NAIA 2FQ1A 4PCVA 1W36B 1TPYA 1MLDA 1YS4A 1QRAA 2ZUTA 5JXWA 2ZJ1A 5AFSA 4IFIA 3ZJVA 1XLUA 4Q37A 3PLAE 3A6EA 1MEOA 1YOVA 4XYEA 4WT7A 1Y37A 4L5BA 2MDTA 5EP2A 3PJDA 4PGMA 3RRMA 5AVYA 5F23A 5JD5A 2HSJA 3AB8A 5DOVA 4DC0A 3O9VA 4YRLA 4DMKA 4OQDA 3ON5A 3ADBA 3RADC 1V5WA 2P91A 3E27A 4N5MA 3EQ6A 1E2BA 4DZTA 3FCOA 1S1CA 1XCGB 2R60A 4M9UA 3ME5A 4G23A 5DYIA 3WK6A 1RLIA 2CLIB 3OZDA 3MAAC 3PQDA 2TMGA 4DXAA 5DCUA 4QIHA 5CB4A 4DDMA 1NKVA 1KZ1A 1LPNA 1THGA 2BE7A 2XE7A 3AUKA 2Q8NA 3P27A 1W34A 4H7DA 1DUIA 4Z9YA 2EGHA 5ALZA 4DR3B 3RJMA 2O2EA 2NU9A 3ROKA 2HC9A 1RZUA 1PQ4A 1BDIA 1CQIB 1PUIA 4N65A 3WNVA 4LEIA 3LZ6A 1SWVA 2OAEA 3DMPA 3AY3A 4NYJR 1DTWA 5FBQB 3SOZA 3B78A 4FYHA 4MO2A 4B47A 4EI8A 3IIIA 1RD4A 4KOEC 4RXMA 3VR5D 2DWPA 2O0KA 2HMTA 2XUGA 3AQ4A 3FPGA 4JOSA 4A6XA 3KKLA 4DF3A 1IFXA 3DZJA 4ZAXA 1C4KA 2CNKA 3Q7SA 2FWMX 3V34A 1GUBA 1IWPB 2AK3A 3OCCA 5G4LA 3BE6A 4HN4B 2OGZA 5HZKA 5ALQA 5CCXA 1BS1A 1NFRA 1RLTA 1Z0KA 2C5GA 3DUFA 4MPTA 1NXWA 2QYSA 3T7DA 5KNBH 4HB4A 1WPRA 3IQEA 4L75A 4PHTA 1YL5A 4V0MA 4GKVA 2A7XA 2QMEA 3QVMA 4J2HA 3OPYB 2IV3A 2PJRA 3O74A 4ZHQA 4R3WA 1WAMA 1NG1A 3QIVA 1SKAA 2B4AA 5B3AA 3KJZA 3UV6A 4IX1A 4AJ2A 1NJGA 4R2LA 3IVCA 2WHYA 4OA5A 4NMLA 4BFWA 3C1TA 4I5FA 4MIKA 1YZLA 1C80A 4V3CA 2HWKA 2QUZA 1KVSA 4UJ3A 5H9VA 3TTTA 2BEVB 3QA9A 4KLNA 1BHJA 4L50A 2DR3A 4B6PA 5DN9A 1JWBB 2B82A 1L6IA 1YFKA 1GPMA 1ND6A 3COPA 2BGLA 4WLEA 1L9KA 2PUTA 3QWIA 3UOWA 5I45A 1KOLA 1KI7A 2JAWA 1T5LA 2O6LA 1JHXA 3BYZA 3ECAA 3KL2A 3MJCA 3CNHA 3EULA 4UVIA 4I3HA 3UENA 4DNOA 2WFZA 5C81A 1SURA 2HW8A 5FPYA 1FMFA 1WXFA 1VE1A 3BWEA 1F48A 1PKEA 4RAQA 1UMDA 4RYLA 1NU6A 1ODSA 3E7XA 3I8SA 3K7EA 2O8EA 2OQ2A 3NTUA 1QIKA 4PPGA 4L74A 1C2YA 2NSDA 1HFKA 1TQDA 1RKQA 4X7PA 2X15A 3FWHA 5JXHA 1BHSA 2WIAA 2NMVA 2AZXA 2OUIA 4JLBA 1WMBA 1FJXA 3OZUA 1XTPA 5J4LA 2PGLA 4V0OA 3KPYA 1FNCA 3FWZA 4PN7A 1VZ3A 4JJGA 1VSQA 3RFCA 3ZI7A 1SD5A 1VG8A 4G0PA 2V9CA 2XMQA 3AU9A 4B3XA 3F7NA 3EGVA 3TAHA 3K6JA 4JLAA 5DGCA 4AG6A 2W2KB 1FRVA 4FMDB 3FUWA 3SC3A 1S8OA 1T36B 1FP4A 4FKMA 4QELA 4DV4B 4MGIR 5A05A 1XG5A 2IV2X 4WH0A 1E1MA 5KKNB 2PMKA 1NBHA 1RFLA 3AI1A 3ISTA 4QGGA 2FQXA 5SY4A 4A0FA 3B9PA 4N6OA 4MRRA 2BP7B 1YFZA 1YR8A 1Q7GA 2HCFA 3QI7A 3I1JA 4RV9A 1D2EA 1JEJA 1M33A 2PL3A 2QRVA 3CWZA 3LBNA 3GDGA 4ME6A 3UMVA 1T2VA 2MMCA 3HXLA 2I7XA 5HCUA 4HEHA 4C7VA 1T25A 5K20A 1GKLA 3B6JA 4GKBA 1TZ2A 4MUGA 2VDRB 1A9XA 1BROA 3VZRA 4D4HA 1OIXA 2WWIA 1E5XA 5BRAA 2DFNA 4NU6A 1TJYA 1ZNZA 3PFHA 1CYEA 3F2IA 4TSKA 5KDOA 4FFVA 1N7HA 3ZV5A 4LFCB 1JB9A 1SOUA 2P5YA 1KFCB 2XZDA 2Y99A 1UFQA 1SPBS 3AHFA 3G8YA 3NR2A 4OGKA 2Q6TA 3TGLA 4Z4GA 1E2PA 2BFEA 1OLUB 2XYPA 1BXRB 5P8WA 5ESDA 4R05A 3MWYW 5DHUA 3QTLA 5HOEA 4IV8A 2XGMA 1UKBA 2JFPA 3D4LA 3LE8A 1V3VA 5HUJA 1T8UA 1MOQA 3EGEA 2ZT5A 4S04A 1PS0A 3LK7A 2CXSA 4MVJP 2ZBRA 4ZU6X 1KFEB 2BFPA 4AX4A 1UH5A 2C8VA 2X58A 2MYNA 3HFSA 1U0LA 2ON6A 3KPUA 1LGYA 1SA0B 3N05A 3X2EA 5BSKA 1ATZA 2G88A 5CDYA 1UWLA 2ZT6A 1FFWA 1PBNA 4Q93A 4RPIA 4XQ9A 2F43B 3NEJA 1RSZA 1KEPA 5H5JA 4MKRA 4UU0A 5TIIA 2PL1A 1Q14A 3KJGA 3D6FA 4J0DA 3USES 2HNAA 1X6VA 3TNDA 2P90A 1M0TA 3UZUA 2GN9A 5B1EA 1GDTA 4PXYA 5ELLA 2NZUG 3AJ9A 3OTGA 4KNWA 4YROA 2VL7A 1VBFA 3GFRA 1NX9A 3KLBA 2BGNA 4KQEA 4O1IA 1VHQA 4M1OA 4RFSB 4J1TC 4NDAA 3TSOA 3PLRA 4BNYA 1N25A 3RYFB 4DWWA 3NVMB 1NL3A 2RAVA 1BCRB 4JJ4A 2I9KA 5K3SA 5K4AA 2PBFA 3TQQA 5J3JA 1GFSA 1W9HA 5CD9A 4FFSA 4J49A 2HMUA 4LSMA 5AKYA 3E5NA 5EWMA 4BU1A 1DSSG 4YCLA 1P2DA 5KVSA 1SK8A 1WUYA 5EXSA 1PT6A 4EEZA 1YBHA 1LQTA 4W8GA 4A27A 3L4JA 1AJEA 3MMXA 3THSA 2JI9A 4ZU1X 1QHIA 4FMBB 1U1FA 3BA1A 3L8ZA 5HXAA 1IHUA 3HU1A 4NEGA 4Q12A 3TAXA 2OO7A 1O4WA 2XNJA 4WK2B 3ZWVA 2HRRA 3PU6A 4NLLA 2GTIA 2YJ4A 2JANA 1LBQA 5AI6A 1AGNA 3BCHA 3IMCA 3E2MA 3OHSX 3JAKA 2HK6A 4W7SA 1MC8A 2P40A 5F2EA 2ZYHA 5I8ZA 3BF8A 3EGDB 3L0CA 4IEIA 4MULA 5TRTA 3RSSA 3MAJA 4DZRA 4Z6KA 4URVR 1AS0A 3B48A 3W7VA 1ILEA 4CUZA 1KYVA 3O6VA 4RXUA 4GRDA 3R6GA 4YRSA 1ZINA 5AYVA 3IAS1 4KUGA 4WKGA 3RVJA 2RKOA 4FFDA 5DNDA 4KDEA 3Q8WA 5CB0A 2RE8A 4U2GA 1V6CA 2BFWA 3KTAB 4A0GA 4CEHA 2CNDA 4X95A 5JSZA 5GIOE 2V45A 2AG1A 2WJZB 1XTBA 2R47A 1FNSA 1OT3A 3D43A 2P6UA 3FTQA 2APJA 2G77B 2Y1CA 3AEQB 3NPMA 4BNUA 4BO0A 5AW7A 1ABFA 2VTBA 5EHNA 3M82A 1JFSA 4GD3Q 3AB7A 4MWGA 2I4RA 3FAKA 4YRFA 4IJVA 3S1AB 2CD9A 5KSOA 1SZDA 4KN9S 2NO6A 4J1TA 1H4QA 1AIPA 1UL1X 3BL6A 3H4VA 4HBGA 1M8GA 3DJFA 2HHCA 5ILGA 1DAGA 2AMVA 3BCRA 1X8LA 3GRAA 3IR5A 4R8SA 4DV1B 1FLVA 1V7CA 1XYGA 1VP9A 2PQ0A 3IAM1 5GOZA 4D9FA 3TAUA 3D4NA 3ND5A 5FULA 5BV7A 2VOJA 8LDHA 4JUBA 4PYIA 3QWAA 3V4RA 4K9DA 4PPQA 4ITUA 4J43A 2PKXA 3OLVA 2PLRA 1FPQA 3D3NA 2GZ1A 3EWIA 3HSYA 4NIMA 4ESVA 3ETJA 5J5CA 1XQXA 1X7XB 4YLGA 2HRQA 4KO8A 4LQDA 2UVDA 3K1JA 4G65A 1W8IA 4QUDA 4AQYB 4TWIA 5DW0A 3IAUA 3QTBA 1UPTA 3B9BA 4CM9A 1PNOA 1YUBA 4P4NA 1RTTA 4Q4HB 2EYUA 4Y0NA 3HC7A 4K6GA 5IJ0B 2VUUA 2QGNA 5JC8A 2OXCA 3GWGA 4N01A 3TVYA 2AUTA 1EVIA 5SV2A 4L9RA 2IXBA 2OORC 3JYQA 1NDUA 1NGSA 1C0PA 4KO4S 4KYUA 4EB6B 4NS4A 3GFPA 4MI6A 1HYHA 5E2IA 1KZYC 4DCTA 3F73A 5K4HA 3D7RA 1JBQA 2VF5X 3HZRA 4DWOA 3M3PA 4AUNA 1Y3HA 2Y2VA 4KGXA 2I2BA 3OF3A 5BXYA 3H65A 3LUPA 4HMQA 1H0SA 1W6RA 4PXAA 2PQ6A 1F51E 4QECA 4B4VA 4Q01A 1RFGE 5A9SB 1T6NA 2OCDA 4DAEA 5HF6A 3JVEA 2CJWB 2O6HA 4UULA 2Z3ZA 4TSRA 3JALA 4J7CA 1UBRS 1APBA 1E5DA 4QVGA 1EFHA 3T1OA 1YZUA 1I24A 1F2TA 1TYZA 5AVKA 4J0GA 5J23A 4M1TA 4E6EA 3DZDA 4GSYA 3GD7A 1WUTA 1T9ZA 2O8DB 3RUAA 1O6CA 4E7PA 5B4VA 1SKYB 1M8FA 4EHLA 1JIUA 3FPHA 4UZEA 3IUQA 1SR8A 4AJEA 4JUAA 4HXFB 1DKRA 5DKFA 3ZE6A 5C5EA 1HNNA 1KOFA 5IDXA 2Q6KA 3B7WA 4BTLA 4TTTS 3ROXA 1J49A 3JRWA 4R1TA 5CU7A 3VH4A 3S2SA 3FVWA 2FUKA 3NEYA 2W48A 1SBNE 2ZJ8A 3IVMA 3B85A 3L4SO 4RO0A 2P2NA 2WP8J 4BO3A 4NNPA 5JMOA 4AJOA 3R20A 2B36A 2DBZA 3UJCA 3F3SA 3ZKAA 3ZNOA 3PYLA 2IHNA 5TJ9A 3WP1B 2HK7A 2R6JA 4N0DA 4TTJA 1PVVA 2CWWA 1AB6A 1RQXA 2YYYA 2ZYVX 4AT1A 2HREA 1MR3F 4MZDA 3DE2X 2JDIA 2F8TA 4ZWNA 3TL2A 3WJAA 5DYYA 3UMSA 4BHTA 3IP1A 3EGIA 1RDFA 4GQAA 2O8FB 3EFOB 4I6EA 2OUKA 5EGNA 2VP5A 4RJJA 3WMRA 4CTMA 2CNOA 4ZOLB 4OGLA 4E21A 1P4SA 4CM4A 3P9CA 3N6XA 3DNFA 4JKIA 3T5MA 2NPOA 1RI3A 2X8JB 4JYCA 2H63A 4GZMA 1ZK0A 2HCTA 3JXEA 3PC3A 4KPYA 4LBYA 1G20A 5CIYA 3FAZA 3ORHA 1NP3A 2R8YA 3NHZA 4MB0A 3PD1A 1GZHB 3NO4A 4G3XA 5IKPA 1QFXA 4RFLA 1TCCA 1XN1A 3QTTA 1SUCA 4PBSA 1MQ9A 1OC4A 4FD2A 3DKRA 3EQZA 3OU6A 4KPFC 1X1CA 3CNLA 4MQ5A 2CV1A 5FBRB 2SHKA 4YAEA 1GZ3A 4UXJA 1NVEA 4TYPA 1E7WA 4Q9IA 4UOZA 1U7UA 2XCOA 3IGFA 4MHOA 2VC2B 3JQAD 2YXBA 3TEFA 5ALMA 3JATB 3ESAA 3U3JA 3VAYA 4HDNB 2Y1WA 4M1WA 4RXTA 5FQOA 2VS1A 2G7ZA 3WQQA 1QE0A 2EG9A 3COVA 5BWLA 2FW9A 4RTJA 2HJWA 5FLKA 4TKUA 4YC7A 2W8BA 4OL0A 1BEUB 5A3SA 1FFYA 2XDYA 2ZVPX 2OYCA 2WUEA 4M0CA 3A6PC 2VPZA 4B45A 4LBVA 1Q20A 1D2HA 3SXUA 5DHQA 4EG4A 4O2AF 3WLAA 2AE1A 1D6JA 1NQWA 1W85A 4N82A 2P9EA 4EUSA 3EWAA 5BPHA 2PUHA 3AR3A 1K7YA 2D5CA 4JJ7A 1RLJA 2UV8A 1Y1SA 3V7WA 4M9ZA 2B8TA 3ED5A 1VI6A 3ZWYA 2ECKA 2Y0EA 4H0CA 4ITVA 4JDPA 4DIOA 1IL0A 2WU8A 5F5NA 4DILA 3D4OA 2VUTA 2I5PO 4H3SA 3VYVA 1PK7A 2VZEA 4XIIA 5ECWA 2NO9A 2V98A 4OHKA 3LS2A 3O1JC 4R16A 2YS7A 5BMVF 3LQKA 2HA3A 3VZDA 4BRZA 5LDGA 2EKLA 5C4MA 1FL9A 3D9QX 5AUQA 1CZHA 3DHVA 5CCEA 1WW2A 1HQCA 4OGFA 1JA9A 1E9BA 1RP7A 4WZAA 3TPZA 1TCAA 5KOHA 2OKGA 4OJQA 1U0OC 2FW8A 2XOEA 4Z54A 4PC7A 3A9WA 3I6MA 1ZHFA 4KQKA 2FVXA 2WTUA 2IS2A 3DHNA 2OXIA 1I13A 2VPTA 2WQZA 5HIJA 4HFNA 4YECA 2NV2B 4N8DA 3F6SA 5AM1A 3IP9A 4EJ0A 4MV5A 1CDEA 4GOJA 4JITA 4PWZA 4KW7A 4BMYA 3BXZA 1M6YA 4BQFA 3NBXX 4FQ8A 2F8MA 3UCEA 3WB9A 2Q8PA 1J2UA 2JEYA 2QMZA 4RPKA 4ZTBA 4ZC8A 2PO7A 4DVJA 4EITA 4CEJB 3PR3A 4MUAA 4E5DA 4M38A 2HU8A 1DCMA 1ZNXA 3DGEC 3QF4B 4IZ6A 4R3UC 4Y6OA 2WD8A 1MEJA 5EY5B 2H11A 5FNVB 4X1KB 4G5FA 3T7KA 4JLVA 3M3DA 4QAQA 2PHZA 3UMCA 1II8A 4L5JA 1SOWA 1U0NA 1LI4A 3EGXA 2IV7A 3SI7A 4ZDIA 1J2EA 1U63A 1H8ED 3EJ6A 3L0PA 5IJZA 1CS0B 3P9ZA 1LSSA 4AZWA 3AC0A 4R2KA 3WL6A 1FCJA 2FI1A 4C4ZA 4FU0A 4YP6A 3D8TA 4MMYB 5ALYA 3ZIUA 1A9TA 1ZGGA 1E0SA 4YRIA 1H3FA 4FN4A 1USIA 1H2WA 2O5VA 4G8DA 5E9QA 3IEIA 5G0TA 1HT2E 3MJFA 3BGIA 1J7KA 5CVEA 4FWIB 3VNAA 1WXIA 3ZPXA 2C1XA 4NSNA 3L8CA 2BM9A 3G2NA 2HUNA 1BEZA 1IBMB 2VUIB 2PKCA 3SVZA 3TLYA 4ACAA 1B23P 4YJHB 4C2TA 4Q9NA 2CHFA 1BE1A 4XASA 1MV5A 3PK0A 4AKHA 2CLDX 2HSZA 4LF8B 1QKJA 2ZXUA 1NX6A 2KS6A 3GQBA 3OFNA 1HSZA 1G5HA 1J90A 3H99A 4WECA 4F5DA 2IYSA 1RWOA 1TYEB 3UT5A 1RRMA 2WWTA 1DC4A 3ZHYA 1FNDA 1N8SA 2ATEA 4I0WB 1QWOA 5CDHA 1DIRA 3QYPA 4V0NA 2QYOA 1IXYA 2EOAA 3ZJUA 1TCUA 4YFYA 3IKMB 4OGGA 1ZVMA 3SJAA 3NOVA 4ZCIA 3M33A 3PNSA 4QA9A 4YUVA 4BFZA 2LNDA 2HR1A 3DVAA 3MBOA 5BSFA 4LJAA 4HYYA 2JIPA 2PX0A 4P4UA 3ETCA 4RSHA 5E0OA 3RRYA 4ARUA 3CMCO 2XZOA 3CVUA 4MCJA 3IEVA 4GYWA 1KJ9A 3C24A 4KBGA 2HAEA 1D2MA 2OSVA 3W2EA 1YD7A 2CMHA 4O2AA 2J3DA 1F3OA 3E1SA 3A0RB 5KJ1A 2OCLA 3U7GA 2O7SA 4N9WA 2Z58A 4MYCA 2HGZA 2OOKA 4X62B 2FFAA 1A5BB 3LLSA 2N0SA 4M8KA 4LJ6A 3UJ8A 4AP5A 1QMPA 4DM3A 3H1AA 3KT0A 2ZJZA 3CFYA 3E9NA 3L9WA 3RWMB 5T67A 2FFRA 1A95A 4XUDA 4QWWA 3WI7A 4CMIA 1JW9B 4DLRA 3R3UA 5GJCA 4YBZA 1YUNA 4OQYA 3BTSA 5GM1A 4AG5A 2JGJA 2RGWA 2XGJA 3EJWA 4GKKB 2RHMA 2XSZA 4JVOA 3PPXA 4ABTA 3GBSA 3AI7A 1WE2A 4LTNA 1AX9A 2DX7A 1X14A 2CBGA 4PS0A 1TAQA 1Q0HA 4RMIA 2OCYC 4ZOQI 4FOSA 4P36A 4R2IA 3SDSA 4AY5A 1JUDA 2QPTA 3F98A 3IUMA 3AWIA 3QEMA 1X86B 4NX2A 4PM4A 2VQFB 2AVNA 3SZ3A 1RRVA 1TO2E 2C07A 2ZB8A 3JASA 3NXKA 3N0VA 1ZK1A 2Y0PA 4J4TA 2CZGA 3PQ5A 2GOYA 2VP6A 6REQA 3HSKA 2UXCB 1XTKA 3B7GA 5KQSA 1U7PA 5H80A 2XXBA 3CWQA 1ZNQO 2QN6A 2ZYTX 1FTNA 2Z5LA 1RWBA 3IAFA 1WU8A 2GK6A 4OJKA 1Z6GA 3GROA 4WLFA 3V1KA 4AUEA 2I66A 3TIGA 4D3FA 3W5DA 1PW7A 1IQRA 1SUFA 2Z43A 1KAHA 4IJKA 2VA8A 5CYOA 3WGJA 1KO7A 1Q0TA 3FTNA 2H4XA 3EN0A 2AX4A 2Z8YA 3R3SA 4KO1S 3HLYA 3UJNA 3ORRA 4A5OA 5EC8A 1HYQA 4D4GA 3NNNA 1WEKA 3Q8KA 3DLCA 4G4JA 1HZJA 2DFTA 4LWQA 1WDKA 4O8CA 4N3NA 1PHPA 5LD2C 4P58A 4L9AA 1P1JA 2C5HA 2BV3A 3EBLA 5BSEA 1KIAA 2B2CA 2XJ9A 5TT1A 1N0WA 4JI6B 1RABA 1VE3A 3COSA 2O20A 1T2UA 4R68A 4J90A 4GECA 2C5FA 3IKLA 4I19A 5KNDH 4LYHA 1G5IA 2WM9B 3G5TA 4NPHA 1WY5A 1CR4A 1PUJA 4F3YA 5TSDA 2H57A 3CRVA 1E5VA 1QONA 3QITA 1QC5A 4ZCPA 3V1YA 1S8NA 3H86A 5KOIA 1VLHA 2YCBA 2JLVA 1U11A 4ZI3A 2XVMA 5K0EA 2CLSA 4P2GA 1DVRA 4C0WA 2P78A 4WLVA 4JFAA 3PWZA 3KVNA 5SYAA 4W5TA 4X85A 2XT0A 1QOZA 3NVAA 4QBKA 3ZQJA 5IJ9B 4U2FA 3AGQA 4M76B 1Q44A 1Y4AE 2WKQA 1O58A 1Z5PA 2F3QA 4UU7A 4ZYUA 3P4UA 1SC1A 1M2WA 4EW1A 2QJTA 3D1VA 2D5AA 5LXTF 3F0TA 3O3OB 3SKXA 4CLHA 4YJFA 4AMYA 2CDCA 4TRNA 3ZIDA 3UCXA 5DM2A 3I2JA 1GILA 4R98A 2CHVA 2J41A 1UMBA 4BLRA 4DNXA 5A3QA 4C03A 4G25A 1Z47A 4YQYA 2QIOA 1EI9A 2G3YA 5EMLA 3RFVA 4C4TA 2IHBA 5JMWA 1Z0IA 3QVTA 2NUAB 1TYBE 2P9JA 3ZXXA 4HV4A 1YZGA 2YRWA 4FXOA 1IM2A 3GNTA 3GT4A 4H31A 1OD6A 4ND1A 5EHGA 3SICE 4YV1A 2XDQA 3VR3D 2G5PA 1OPRA 3VNRA 1FP2A 4GPAA 4URFA 5BYAA 1KQGA 4XTCS 3VR0A 3AI2A 5BOSB 2BELA 5A3JA 5E4FA 1S4MA 1N2GA 2BEWB 1U6JA 1OREA 1CJMA 4JNCA 4RE5A 5CNIA 1SCDA 4HNSA 5IVIA 2PPVA 4MARA 1KXZA 1LPOA 3PFBA 4G86A 1OA0A 3V2IA 4RH0A 1DBVO 1M75A 1R0SA 4WOJA 4XPIB 4E2FA 4XDYA 5KAMA 5GZ1A 1FDOA 1JIQA 4JQSA 4M86A 1VE6A 1WW8A 4AZTA 3GI1A 3HTXA 3I2IA 3C3AA 4BFXA 1KO8A 2Z1MA 4PYLA 4RZQA 1AKNA 1NYLA 2HJVA 1YJQA 4HDOB 4HNQA 4HTFB 4HT3B 4ZEVA 5KTTA 5ALNA 1L7XA 3MRTA 4QDZA 4KL8S 1KDOA 4YAWA 4FD3A 3ENQA 1NY6A 3LPMA 5KC9A 1TKCA 1DKQA 3MMSA 5CT4A 2GO7A 4IUBS 5DNVA 4DEVA 4JZKA 1UBTS 2WKPA 3GBPA 3KYDB 4HAUA 1VL6A 4Y1FA 4A10A 4A82A 3W2IA 4ZOCA 2IU0A 4Q4AA 1B26A 2QAIA 5DSTA 4ETNA 1X1SA 3LP6A 5E6RB 4KFCA 3CZCA 4NZYA 2B0CA 1Y3BE 2E4YA 3SC6A 4ALMA 3GN1A 2QL7A 1KWKA 2DPLA 3ND7A 1BDJA 3OLYA 4LMRA 4WNAB 2BRUA 2E1RA 4KRXA 3V1UA 3ZDYB 3OX1A 4LF5B 1ODCA 1PFWA 4PVCA 2PRIA 1U65A 5K03A 1U7ZA 2YWBA 3LQFA 1J5EB 2OXFA 2IEAA 3R24A 2QW1A 5C8ZA 4RIIA 4KWHA 1UM9A 1RVV1 4GW3A 5AQEA 3SF0A 3H05A 4DDWA 3H9UA 3JZMA 3KUKA 1EIWA 5DJ5A 2BWJA 4TZKA 3QBJA 2XDWA 1LU9A 5TMEA 3W5VA 1AM4D 3T3NA 4M0MA 1HE2A 4LSGA 2ZZMA 1PIWA 1ZMXA 5A0VA 4H3KB 4WQMA 3KYCB 4KH1A 1NW6A 5EQFA 2DFVA 3NAGA 1VYHA 1XJWA 3QFFA 1HORA 5CVCA 4ZT4A 1I3OA 1WCV1 3KBBA 3IT0A 2BHRA 1OI2A 1OR8A 1ZCBA 2X2FA 3M8KA 5CEFA 1QE3A 5I7HA 3ZI0A 2WV9A 3ELBA 2W2XA 1Z5WA 3N86A 4D82A 1U3CA 1H1LB 2GYYA 3FJOA 4QOJA 1JIIA 4DQLA 4P86A 5CIQA 1S9HA 2FDCA 2Q29A 2RFLA 3VSAA 2X42A 3ABOB 5KYUA 3WQSB 1EFRD 3U80A 4CQJA 1P0CA 4HVAA 4QUAA 2IXDA 4WE3A 3CM0A 1OA1A 4AJNA 1WF6A 5IU6A 1KRWA 3T8YA 2F7SA 3E9MA 2VQEB 3U4QB 1MZVA 1JG4A 4FFNA 4QREA 3ZGLA 4E51A 4P08A 1CEYA 4H7IA 3PHJA 2WUWE 1O94C 1THTA 1LDBA 4YRKA 5AKHA 5LXTA 3C97A 4P82A 4B4WA 4P31A 4DWJA 3QEOA 2PSSA 4YO7A 2YCLA 3RWBA 1UMCA 3QG1A 4I6GA 4XE5A 3KC2A 4LFBB 2EGGA 1Z25A 4IS2A 2IQIA 4W5RA 1AQIA 1QGAA 3SXPA 2VBIA 1CY7A 5INTA 4ZT6A 3L8GA 3UAVA 4A5SA 4EG7A 1P5HA 1WQ4A 5BSVA 1MJNA 5AOAA 1H1TA 2ST1A 4HQNA 3LDFA 3N0TA 5D3MA 4RQBA 4PY2A 1TPZA 3IODA 3FVVA 4MW7A 2HN9A 3BJEA 3CG0A 4TVOA 2A9PA 2Z57A 2QZJA 3MUEA 2ZRJA 3UMRA 4KG7A 3E18A 3PNKA 2RGDA 4LF9B 1WZNA 3DE6X 4Y2TA 2A3NA 3GDOA 1IATA 3IOCA 4QNNA 3GA0A 3MBKA 2OWEA 3AONB 4XVUA 1XZIA 4BJ1A 4ALKA 1H2XA 5C53B 5BO5A 1KMMA 4C7KA 4GSKA 4CN9A 4DA6A 3RVMA 1AB5A 1M6VA 2OXEA 1DOZA 1DO0A 4HQ0A 2GLXA 4WNYA 1R0CA 3RUDA 3HKEA 5TPWA 3WBFA 4IHAA 4NU0A 1KKMA 4JI4B 3JW8A 4KV9A 2MYUA 3AXTA 3UHJA 4D43A 3T7CA 3OQ6A 1I1OA 3DQQA 5IP5A 4MPRA 3DMDA 3W9BA 2PE5A 2I67A 2O2SA 2Z5FA 3KYJB 5F51A 5I9LA 4RPLA 1YS6A 1PWEA 4D0RA 4J2OA 5LZ4A 1Z34A 3KFLA 3NGMA 2BKVA 2TYSB 3DMHA 3VX4A 1ZN9A 1F06A 2AG8A 3G2QA 4GR5A 4B31A 4G4IA 3UVEA 1SXHA 1WP9A 2JW5A 4Q1EA 3LBAA 5GV8A 1V4NA 1UBEA 2DH5A 3KB6A 5HJ5A 5HQ3A 3AVVA 5TB5A 4NI5A 2C4WA 4EPVA 1O94A 2CKDA 2YYZA 3R3XA 4XB1A 4LY9A 3L84A 1QX3A 2VT2A 1E2EA 1ZSYA 3EZYA 5FI1B 3TJRA 3TJMA 4BKRA 3EVDA 1DXOA 1MV8A 4Q1BA 1OZHA 2PJUA 3QEAZ 4EWLA 2ECFA 3HGTA 3K1AA 5EL0A 2NOAA 2DF8A 5A4KA 5F35A 1C0KA 1JEDA 2JK1A 2OAQ1 2VYVD 2F67A 1J21A 5E3JA 4CU5A 4KDFA 1XL0A 2QRKA 3L4BC 3I5AA 5JUWA 3EUFA 3J81A 2P7HA 1XXHB 4ZQBA 2CFSA 3EZLA 2QTAA 2ID7A 3U7QB 5AESA 2AR0A 4JIGA 1YJCA 4KWCA 2C9BA 1W2GA 3B1YA 3CIFA 3ZQ6A 1GTL1 5TXGA 2IKSA 3P32A 2IZ7A 2WU3A 4IVQA 3U3RA 4QJ5A 4UHEA 2Y1XA 4EA8A 3L5OA 1WW3A 4Q16A 3FNEA 1QVAA 1K9SA 2VNAA 3D4IA 4UEJA 2JFNA 4UM9D 3UGKA 3PGKA 4CE6A 2JVKA 5K6RA 2Q3DA 2IP2A 5FOXA 1IBKB 4QXMA 3GJ8A 2B94A 2ERCA 3H0CA 4MA4A 5ETJA 5HMLA 4MYDA 3HKDB 5THQA 3S5JA 1DUSA 1GPH1 3AKDA 3DFUA 4RS4A 4YDHB 3W2FA 1NQAO 1M8KA 2YZKA 5JISA 1JLLB 3VYSB 4TLCA 3JYHA 1ZSNA 3H1EA 1YB2A 2D0PB 4G5RA 1JHOA 4G0UA 4JB3A 3N7TA 1HLPA 1JAIA 1YA8A 3GFFA 3NI2A 3RVSA 4CNBA 3THWB 1GVHA 3P9QA 1QX4A 3GU3A 2E82A 4G9GA 1MRSA 1Z5VA 1T2FA 2IYPA 1ZUNA 2VSOA 2YW9A 3H9QA 4YHBA 2CL6X 1X9GA 4B74A 4S1OA 4ED9A 2UZAA 4NQZA 3I34X 1ID1A 3ITNA 1NU8A 4NMHA 4ILEA 4RLFA 2B9EA 4WUVA 5CNKA 1QFMA 1YZHA 4DCVA 2E3JA 5JD3A 1QH1B 4MWSA 3AY7A 1QRSA 2H1FA 4F2WA 3DR5A 3LU1A 5FOVA 5FTLA 1NSTA 3EIHA 3VDRA 1DTEA 3OCZA 4UBJA 5FCDA 3T54A 2PTHA 2PX2A 4WVFA 3ASYA 3NM6B 4RENA 2V7QD 3GLGB 1OZFA 4IL5A 4N3GA 2JLBA 3LWDA 1EX1A 5H0IA 3L4BA 1Q22A 3LUDA 2R6FA 3DE4X 3IHWA 5LR6A 3ZXIA 1EUDB 2GA9A 2WJ3A 2QNRA 3OX4A 3V55A 3PUXA 4E32A 1AY0A 3ACBA 1M9NA 3EY9A 2A35A 2WF8A 4FDVA 3X1KA 2C2ZA 4PYJA 1F5NA 5LB2A 3RAEC 4TYQA 1GTG1 2D74A 1GUYA 4KIJA 2H5JA 3D7KA 2IKQA 3P19A 3SQWA 3AHCA 1U98A 3HEBA 4DLNA 5IM4F 2PUFA 1IJEA 1SCIA 1N92A 1DFGA 1K4KA 3V3KA 4A3SA 2OGTA 1AG9A 2QNBA 4DQVA 4D6PA 1M1NA 3WHKA 1B6RA 1M2JA 2FG5A 4GR9A 1EHCA 1DEOA 1SWWA 3VO9A 1DTSA 3QBTA 2XHEA 4LJ8A 1LY1A 3B6MA 2AOVA 5EVJA 5L4LA 2PCLA 3WSTA 1R8XA 4V39A 4DMGA 2RIRA 3RTDA 2PTGA 4BZWA 2WPNA 1A2BA 1K6MA 4NH0A 5B7NA 5K6AA 3ESBA 4XCVA 3ND9A 4ZI7F 2JLXA 1EEXB 3CKLA 5ICGA 4XGQA 1RJ9B 3GGOA 2WIFA 4R4JA 1TGYA 2DBVO 2IPAB 4A2PA 5DSZA 1BFUA 1D8AA 2BM8A 1GQOA 2EX4A 4F2PA 4NCAA 4L4UA 4F84A 5D8DA 4QJIA 1PG0A 2H1WA 2OBMA 4IKPA 3CV3A 4YRTA 1RHQA 1L5HB 1VL2A 2XTJA 4RW0A 4KRGA 5H16A 3TKAA 6ADHA 1LBHA 1JDNA 1JZSA 3I6IA 3LUBA 4P93A 1JH9A 1A1VA 2DERA 3LZDA 3BRWD 4B0PA 2GN4A 3L0IB 4LVOA 4DCGA 1NPYA 4YPVA 4YXFA 2WDPA 3QA3E 4FN5A 3UJ7A 2XMRA 4N76A 1BU8A 1RMQA 2VHCA 1KJQA 1D9ZA 4H77A 3COYA 4UZSA 4J1NA 4ZRDA 1S5PA 4D99A 5BQFA 3P1JA 1AXRA 2F1JA 4RA6B 1I2CA 4X20A 3CUTA 4NENA 4AL4A 1LV7A 3FVRA 1SQ5A 4ZKDA 1E1RD 4BRWA 1NPTO 2CEKA 5EI5A 5JHHB 3GNLA 4HX5A 4GWLA 1MPXA 1QO0D 4A4DA 2OECA 3QIAA 1NQVA 1O4VA 1OBCA 2H00A 5HPYB 1M83A 3P9KA 3WA7A 2Q3FA 2ZSIA 1GKUB 3TTWA 2W6JA 1OCEA 3X0DA 4MMZB 3U48A 1LTQA 4JLDA 1QIFA 1XZKA 3BULA 1TT5A 4CEIB 4KR3A 4XQ0A 1UWCA 4FSXA 4V2UA 4BNDA 5ENZA 4EP1A 1C3VA 4DJAA 3NUQA 1NXTA 1GPAA 1RXIA 3AL2A 2ZVJA 3FRJA 1BXZA 2JAPA 3JR3A 1IHXA 3EGCA 4PSDA 4S24A 1C1XA 2QJOA 4J6EA 2GHTA 2FX2A 4HB0A 2E5LB 2E0IA 1BMDA 4OOFA 3DWGA 4C0KA 4C3UA 3LTNC 2GAJA 2VAWA 3HBNA 2EL9A 3KXDA 1I7DA 4ZAYA 3B60A 3E70C 3KOYA 4YQZA 4LYFA 3ILXA 4OP2A 5GADl 1YVUA 3LUCA 4AP6A 5G1OA 1AKUA 1U99A 4EA6A 2ZS7A 1BOOA 3EIFA 1PR3A 3EQ9A 4UC0A 4Y18A 1TOAA 2FN8A 1J7JA 3AUXA 3NBMA 3ROGA 3WKBA 3QNUA 1T43A 3ND8A 3U6KA 1R10A 4BV9A 4R0VA 5AM5A 1KI4A 3H2YA 2AE2A 1WF3A 5EMHA 1GRRA 4IS3A 5EZYF 3GMIA 5LYJF 3FNRA 1ZOLA 3LBHA 2DULA 2JH9A 1V43A 3F6EX 4FYYA 3WYFA 1SZPA 3IILA 1O87A 4RK0A 2ICAA 5TMBA 3IJ5A 1A69A 3ZBTA 4WCFB 1SU6A 3DBHB 4LC9A 1JSCA 2QY9A 3IMEA 1MH9A 2NUPA 2AWNA 5GVRA 4E5YA 2AOUA 2PT9A 1J56A 1JR4A 1PSZA 4OK5A 1UP7A 3HWSA 3G8DA 5FTMA 5EKUA 4MTCA 4L8FA 1CE8A 1RM5A 4YT2A 1NJSA 1EFUA 3A4NA 3PR1A 2G9RA 2Z56A 4ENPA 1D1PA 4XX0B 2WF5A 4ARZB 4JBHA 5IM4A 1GL6A 1QF9A 2BW0A 2TMYA 4DJDC 1E2UA 1JLMA 2ZB7A 1FXSA 4P38A 3LWBA 1R6TA 2OLKA 2AEEA 3D3EA 2A5YB 1ISIA 1R6VA 3LJKA 5B1HA 4B3CA 2FEWB 2R66A 4XGNA 3OECA 4XSVA 2Z95A 2OFFA 4BEWA 5FEUA 4UDNA 3DKPA 5H81A 4FYPA 1KHHA 2BTQB 4J03A 3UM9A 5BN1A 3ONEA 3DFFA 3OZWA 3QG5A 4JKYA 4OIMA 3ZWOA 4GM4A 2WLSA 1RKUA 3D5TA 4IINA 2ILVA 4MP8A 5EXTA 2J07A 2W58A 1G7CA 4ZI7A 1E2MA