6LDHA

Refined crystal structure of dogfish m4 apo-lactate dehydrogenase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
329
structure length
329
Chain Sequence
b'ATLKDKLIGHLATSQEPRSYNKITVVGVGAVGMACAISILMKDLADEVALVDVMEDKLKGEMMDLQHGSLFLHTAKIVSGKDYSVSAGSKLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKHSPDCIILVVSNPVDVLTYVAWKLSGLPMHRIIGSGCNLDSARFRYLMGERLGVHSCSCHGWVIGEHGDSVPSVWSGMNVASIKLHPLDGTNKDKQDWKKLHKDVVDSAYEVIKLKGYTSWAIGLSVADLAETIMKNLCRVHPVSTMVKDFYGIKDNVFLSLPCVLNDHGISNIVKMKLKPNEEQQLQKSATTLWDIQKDLKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M4 APO-LACTATE DEHYDROGENASE
publication title Refined crystal structure of dogfish M4 apo-lactate dehydrogenase.
pubmed doi rcsb
source organism Squalus acanthias
molecule tags Oxidoreductase(choh(d)-nad(a))
total genus 100
structure length 329
sequence length 329
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1987-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 6ldhA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 6ldhA02
2AW5A 1T1SA 3LU1A 1Y6JA 4DQXA 1Y8QA 1P9LA 4YTEA 4EYEA 5ER9A 3OIFA 1U4SA 2WE7A 3B20A 2AG5A 3BXXA 1A27A 1JKJA 1PS8A 3I5MA 4WEOA 1TVEA 1SB9A 3D3WB 3RBVA 4YBZA 2B0JA 1R0SA 3OJ0A 4E12A 4ZQEA 4J7XA 1G6KA 4Y9DA 2HAEA 1ISGA 1PJBA 3FPCA 3ASUA 5BR7A 5TX7A 3UW3A 3GVPA 5K6AA 4WK6A 3GFGA 4AJEA 4RF4A 1UH5A 4IUYA 4ND4A 1YL5A 1SB8A 3UUWA 1MLDA 2C07A 3D3WA 4BQRA 2EERA 4DYVA 1VC2A 1Y7TA 2Y67A 5IG2A 1YQXA 3GMDA 1HDGO 1NR7A 2NACA 4PG7A 3MJEA 3P2OA 4JP2A 5G4LA 3CE6A 1JLLA 5CDGA 2CNBA 3P7MA 1QMGA 3RUFA 1B15A 4ROSA 1X1TA 1GY8A 4RPGA 4FJ2A 4ZU3A 2EIHA 4M1QA 1DLIA 1EEHA 1ZK2A 1I2BA 1T2DA 4II3A 3UVEA 3U62A 1PZFA 5C7IO 3AWDA 2FSSA 5I9MA 3WGQA 4OYRA 4CR8A 1LRJA 5DCYA 5IJZA 2CDAA 3RKUA 2WM3A 3F5QA 3H3JA 4PG4A 4EGFA 4XQEA 2ZTMA 2HMUA 1T1RA 4CM9A 3MJTA 3G49A 3QJ5A 3HN2A 4UVHA 1P1KA 2DT5A 1R4NA 3CZRA 3DZGA 3TZ6A 4BO1A 3RVDA 4I8XA 4LRTB 4YB8A 5ENVA 1BW9B 4DIOA 1HDZA 3HNPA 2TMDA 3PJGA 4L4RA 4JJGA 4TWRA 4BNIA 3CUKA 4CMEC 4PG5A 1RM3A 1YKFA 4D43A 1OC4A 2RIRA 4JNKA 4D44A 4U0KA 2A4KA 3GFBA 4BGEA 4B7CA 3B70A 1Q1NA 4EUHA 3ZU4A 1SBYA 1HXHA 1CQIA 3PQDA 1BW9A 3I9KA 3EW7A 4ZRMA 3CMMA 1U5CA 3FTNA 1DC6A 2J3JA 3QE3A 5I9LA 4RZHA 3ZV3A 1R6DA 2IE0A 5I7VA 2VUSA 3GHHA 5KVCA 3B1KA 4DYDA 3E9MA 2E37A 2POQX 1AUPA 1QORA 4MVJD 4GVXA 2ZYDA 4DLBA 3JQ9C 1R0LA 9LDBA 1CQJA 1I10A 3JYOA 1GQQA 2VHWA 2VRBA 1LSSA 1ISJA 1Z6ZA 3ROQA 5CPBA 3FHLA 1KEPA 4YQYA 3FWNA 1WNTA 1FDUA 3I52A 2Z5LA 1H6AA 1UZMA 3BMQB 4WCDA 2RHCA 2Y0EA 3K9QO 3WNVA 4CM3A 2NTVA 1GADO 1PGNA 1R0KA 4IM7A 3O8QB 3RKRA 1E5QA 1ID1A 1JQBA 1ZMOA 3GN1A 4EI2A 5CDTA 1EFKA 4RDIA 4RZIA 4XZ3A 3PZBA 1NASA 1FJHA 2HK9A 2HMSA 3DB2A 3FBGA 3FNEA 4LSWA 1ISHA 3HFGA 4RORA 3UN1A 4AG3A 2V7PA 3QY9A 1VKNA 2NU9A 1RM4A 4QX6A 4IS3A 3VPGA 3PVZA 1CRWG 1P45A 1MXFA 3SJ7A 5BNIA 4BGVA 2Q46A 3BMQA 4D45A 1R37A 3ROPA 3F47A 3L9WA 4KWIA 4EUEA 4PCVA 1IOLA 2F1KA 2HQ1A 3O8QA 3WFJA 1FF9A 1U28A 4HNGA 1C1XA 1DC5A 5JDIA 3C7AA 3GAFA 3H8VA 4AJPA 4Z9FA 1C3VA 1KERA 1R4MB 4ITUA 3GF4A 3VHRA 4BV9A 4L4SA 3A14A 3NJ4A 4XYMA 4YWJA 4LW8A 4WCFB 5IXYA 3KYCA 2HUNA 1N7GA 5JE8A 3OQ1A 4KWHA 2O4CA 4GWGA 3ETEA 4G81A 2XF8A 3WYBA 4TQGA 3UAGA 2CD9A 1HLDA 5AXAA 1UP4A 1K5HA 3C85A 1GYPA 2OBNA 1E3EA 3K2BA 3PHGA 4RPHA 4HFMA 5TF4A 1R4MA 3JYPA 2OXIA 3JQ6A 2GDZA 1CERA 1PEDA 4KUGA 4F6CA 4LGVA 3DZFA 3H9JA 4WCFA 2VYND 1HEUA 1IUKA 4CLDA 3INGA 2FP4A 6LDHA 5FFFA 4GX1A 4B4VA 3AI1A 3IP3A 4O1MA 1MG5A 3UFXA 1W0CA 4BKRA 3EVTA 4E0BA 1YBVA 3FD8A 3GEGA 5HBRA 2C82A 5A9SA 4IDBA 4E4YA 3AY3A 2O3UA 1CEQA 3U4CA 1HDOA 3PTZA 1EK6A 3M6IA 2Q2QA 4ONEA 1Q0LA 3RWBA 2G0TA 2D0IA 3QQPA 2B5VA 4DBVO 1YJ8A 1ONOA 2Q50A 3K5PA 1JKFA 1PGQA 1ZK0A 4B4OA 4DGSA 4WLUA 1WXDA 2AQHA 3G3EA 3NGXA 4W9NA 4MVJH 4FDAA 3ZWMA 2W8ZA 3DR3A 3H65A 4ZVVA 3ZHYA 4FN4A 2W4QA 3H7AA 4ZD6A 4GMFA 4ZJUA 2X9GA 3LLVA 3AJRA 3FR8A 4R41A 2JCYA 4D3SA 4BUCA 1NVMB 5DZSA 2Q2WA 1PL7A 1N9GB 3IIEA 1VRWA 2HJRA 5ES3A 5G0TA 3O38A 1HDCA 2ZATA 4CLEA 4NBWA 3COSA 3ABIA 2Y1DA 5L7WA 4PGFA 4RDHA 1CF2O 5DCUA 2Q1TA 5KKCA 3DFZA 1DRUA 1P3DA 2QRKA 2VHYA 3ZNQA 3KO8A 1BMDA 4A7PA 1XQ1A 5JW6A 5COQA 4AJLA 2IEDA 2P9CA 3S8MA 5JCJA 1IZ0A 3QVOA 4RVHA 3KYBA 3SC6A 1N9GA 3DZBA 1NAIA 2NVUB 4Z0HO 3GN2A 4CMHA 5G4KA 1E7YA 1AXEA 2YDXA 5EESA 4AJ4A 1JA9A 2B37A 2V6MA 5CP8A 1SC6A 1ISFA 3UKOA 1OAAA 3NDRA 3V2GA 2DPHA 3ZI0A 4ZQHA 4YAIA 1XA0A 4XYBA 4DMMA 1J4AA 3KV3O 3VH4A 3Q1LA 2PH3A 4D3FA 3WNQA 2EXXA 2NVUA 4HUJA 2GPTA 2PZMA 1GCOA 4GWKA 1DHTA 5EIOA 2OUIA 5F5LA 2PZJA 3WICA 2HKIA 5I9NA 5KJFA 1M6WA 2X9NA 3WGGA 4PRKA 4YJGB 1KOLA 1RM0A 3TOZA 3FNGA 3K6JA 1JTVA 4LCEA 4FC7A 1KIFA 2QW8A 2QG4A 1LJ8A 2VYVA 3CEAA 2PD3A 3HFSA 3HZZA 4EEZA 4RV9A 3RU7A 1DO8A 4GH5A 2YQ4A 3ZCXA 2Q1UA 2P4HX 3LT2A 4WEQA 2HK7A 4WNCA 5TS3A 2VRCD 3HSKA 4IQ8A 4YJGA 4YT5A 5G0SA 1NQ5A 4AJIA 2VNAA 3H9EO 4EJ6A 2GD1O 3Q2KA 5CAEA 1NVTA 4A0SA 3OFSA 1PS0A 4BNGA 4YXFA 8ADHA 3K31A 3M1AA 2ZTUA 1ZUD1 4LVUA 3ETDA 2JCVA 5GY7A 1YL7A 4FOOA 5L7TA 4BQPA 1CWUA 5KNLA 3GK3A 4CPDA 4U0JA 2VWPA 4CM9D 4TZKA 1NQOA 4Q3BA 2FR0A 2NU6A 1Q0HA 2Q99A 3GGGA 3L0DA 1WZIA 1ZXLA 1EE2A 4FFNA 1NM5A 4FW8A 5IZCC 1XQ6A 2DPGA 4EEXA 1Z45A 1MP0A 1Y81A 2B83A 1CJCA 1QXSA 1MXHA 3CINA 2B4QA 1EVZA 4YYZA 1V0JA 3AW9A 3BHMA 1LLDA 4Y6PA 1UXJA 3NGLA 4QT0A 4MVJP 1YJQA 3I9OA 5JC1A 3AUSA 5LDHA 3PXXA 5TLSA 4BKOA 1ZO8A 1JN0A 3OHSX 5G0VA 1BSVA 1EBUA 3GDGA 1YBMA 4ND1A 3JQBC 3MJVA 1UDBA 4IGEA 4KOAA 3TL3A 3E82A 3PIDA 3I1JA 1NNUA 3MWDB 4RPLA 3ZNPA 4YT2A 1SZJG 2P5UA 3ULKA 1OZAA 1T26A 2PD4A 3PJDA 4AJJA 4G5HA 4C7KA 5CEJA 4R1SA 3F1KA 1ADCA 5KIAA 3D64A 4HKTA 4I1IA 3PWKA 4OOFA 4MKRA 2R00C 4QO8A 1U4OA 1NPDA 3UH1A 2YHIB 3HN7A 3W8FA 3T4EA 3U09A 4IIVA 1N7HA 1DLJA 1P0FA 1ZK4A 2HSDA 1GAEO 2WDZA 5KJ6A 2GZ3A 3H5AA 4MVJE 4PG6A 2GGSA 1IHXA 1AXGA 4L4XA 3FN4A 2G82A 3O26A 1LSUA 2V6GA 4J1QA 2ZB3A 2YHIA 5HM8A 4QFDA 1GD1O 3Q3CA 3OECA 5AXDA 2WD7A 5B37A 3K73O 1TEHA 4WECA 4CM7A 1C1DB 3VH1A 3TF5A 5ICMA 4P4LA 2DC1A 3OETA 2FPGA 2B4RO 4Z3KA 1HSOA 2PKQO 3PYXA 4N5MA 1ZNQO 4YQZA 1NBOA 4NK4A 3E9QA 4I5DA 3W4IA 2PK3A 4GX2A 1GZ3A 1M76A 4ZQFA 4FFOA 3N58A 4WOKA 1I3MA 3E9NA 1VJ0A 4XJSA 5FF9A 3VTFA 1C1DA 3I9MA 1MB4A 1Y8RB 4IZIA 5GZ3A 2A9FA 3E8XA 3HADA 1T4BA 4DL9A 1YBAA 4NBUA 2D5CA 3F46A 2NM0A 1QRRA 4R01A 1DFHA 4CL3A 2FSVA 2Y68A 3OQBA 3NEPX 1VSUA 4WASA 2OORA 1I32A 1KC1A 3GZNB 3MTGA 3T7EA 2PZKA 4L0QA 1GYRA 2B69A 2QX7A 5BSGA 3RQSA 4XIJA 1V3UA 1H6DA 3OM9A 5HTOA 4GI2A 1VM6A 1Y8RA 3D5TA 3R3JA 2EG9A 3IJRA 4JCOA 5T6BA 3HQ4O 4J1NA 1LI4A 4WLVA 2HRZA 4NPCA 3ZWBA 5JAZA 5C7OO 4URFA 3PRJA 4PLZA 3L77A 1ZBQA 4CUJA 5FI5A 4O0LA 3ZWYA 4PLCA 1TXGA 5EQFA 5I7SA 3RC7A 3GZNA 4WLOA 5KJ1A 1R66A 2PGDA 1F06A 1KBZA 2NNLD 4INAA 4O63O 1HE4A 2E6UX 2GR9A 3BYZA 4PFJA 3GY0A 3F4LA 3JQ8B 4IDEA 1GCUA 4UEKA 1NFFA 4K6FA 2AG8A 4YDRA 3KEQA 3ZWAA 2G5CA 2VTDA 1R15A 4NBTA 3WGOA 4YAEA 2VQ3A 2O4UX 1JDJA 1YL6A 3BAZA 5GZ6A 1F8GA 4IQ0A 2D5AA 3ETGA 1Z74A 2LDBA 3PLNA 4XEHA 1PS9A 3SXPA 4RQTA 2OOSA 2CF5A 3JQ8A 4XGKA 1Z73A 2E82A 5AVOA 4FSHA 1ZEMA 4TMFA 3OJOA 3GC6A 4QXMA 2VYNA 4OGWA 3OEYA 5JCJD 2O3JA 3G17A 3PDUA 4JP3A 3KM0A 5T8KA 3TJRA 4XIYA 3LDHA 4WLNA 3Q2IA 4BGUA 2GZ1A 4AJ1A 2EGHA 1WDKA 2Z1NA 1A9YA 4XRRA 4NMHA 2VN8A 3EVNA 3GRKA 3ANLA 3WS7A 1U1IA 5A3JA 4EUFA 4TKMA 2QIOA 5B4TA 3A4VA 2WSBA 3WBFA 2NQ8A 1XDWA 3T7CA 2X6TA 4CUKA 3W8EA 3I9JA 3ZWNA 1GV1A 4CQMB 3O4RA 1DDOA 3QV1A 5T67A 4DC0A 3VZRA 3KVOA 4WUVA 5DULA 1OMOA 3CSDA 1NVGA 3I83A 2NU8A 1T2CA 3W4KA 4M86A 3STHA 3U5TA 1X0XA 1U9JA 5L4NA 4RO0A 3QP9A 4BKPA 1QR6A 3TFOA 4II2A 5ILOA 2Y93A 1UUFA 2ET6A 1F0YA 3LK7A 1NXQA 3S55A 4DPMA 5JS6A 4CQMA 4D0SA 5JO0A 4AJKA 3LQFA 1N92A 3OEWA 3O03A 3LLSA 1LSOA 3QVTA 1LDYA 1RYDA 2UAGA 4JLWA 4CM4B 4YEDA 1IULA 4F45A 1LDBA 2EF1A 3ONFA 5JMWA 1K6XA 2DFVA 2DLDA 3JD1A 1NHGA 1P33A 4E21A 1YDEA 4J4TA 1QYWA 3U4IA 1K0UA 1T2EA 5DBFA 3WLEA 1KY5A 4W99A 1D3AA 1PR3A 1UP7A 3PYMA 4A10A 2Y1OA 1I3LA 4GPD1 4KDFA 3WX0A 3HB4X 1E5LA 1BRMA 1ZMTA 2NTNA 3IL2A 4Y98A 3GDFA 1N1GA 4CM4A 2GN9A 1MUUA 1NR1A 3C3XA 3INTA 4ALIA 2NLOA 1DJQA 1MV8A 4HNHA 3GH3A 4PZEA 2QZ9A 5THKA 3KB6A 3U3XA 3P2YA 4BIIA 4E2XA 3DC2A 2O3SA 4J91A 1CDOA 1HTBA 1JVBA 1BVRA 3K96A 3ST7A 4I5EA 5LC1A 4B3JA 3CTMA 4E5YA 1AGNA 1T4DA 1P1RA 2QYSA 3PGJA 3PLRA 2YV1A 3G0OA 3LC1O 1V9LA 4N5NA 3RFXA 4EJMA 4YJDA 3D1LA 4BL5A 3D7LA 3LSYA 1E1LA 2W2KB 2GNAA 1DAPA 1UZLA 3DOCA 3TOXA 2Y99A 3F5SA 1M6HA 3KTDA 2QQ5A 1PIWA 3HB5X 2CVQA 3PJFA 1JU9A 2IDZA 3W1VA 3GUCA 2VRCA 1AE1A 1WP4A 2R2GA 5A9TA 1N2SA 3ROMA 1C0KA 3VZPA 3DMYA 2GCGA 3AU9A 1E3SA 3IC5A 4NJOA 1PGPA 4KZPA 4LRSB 3GUYA 4D0RA 1ULUA 2FPPA 3IKVA 2W2KA 4AICA 3GZ4A 1LXCA 3FF4A 5I7FA 2I5PO 2D4AA 1BDMA 1RKXA 1TA4A 2Z95A 3L4BC 1LDNA 1LLCA 2DBRA 4A03A 1IZ9A 1A5ZA 1Z7EA 2D3TA 3WGYA 4R68A 4XCVA 3HHPA 3IP1A 2O2SA 3I3OA 2O7QA 3LC7O 4NFHA 4N7RA 5A3VA 4DTIA 1HZJA 4B3IA 2OO5A 2G76A 3WGTA 4I9UA 4A27A 4GMGA 1E3JA 1LQUA 1EMDA 1XLTA 3QRWA 1LRKA 5JYEA 2B5WA 1E1NA 4QUKA 5BNTA 3K2EA 4DREA 3OICA 1ZH8A 2A94A 3DMTC 1A9ZA 1NHWA 4HFNA 1YDWA 1PZEA 4FBGA 3BTOA 4RL6A 4TSKA 1U2DA 4WGGA 1H93A 3ICPA 3PYLA 5JAQA 1HLPA 1MFPA 1SO8A 1MG0A 4PLGA 2CZCA 3WSWA 4A26A 4A2CA 2HCTA 3EK2A 3JQGB 2PKRA 4PLYA 1DSSG 4IJWA 4RLHA 5AXBA 1P1IA 1SCUA 1LU9A 4L74A 1H6BA 3BA1A 4XR9A 3TNLA 1ULSA 3WBBA 2FWMX 2ZKLA 5DCWA 1XKQA 1OFGA 1Y9EA 1ISMA 2FOIA 1NFRA 4QQRA 1ZKMA 1Q7CA 3ITDA 2H5LA 5BSHA 1ADGA 2IZ0A 4XB1A 1PJ3A 2VWQA 3LT1A 1FXSA 3JQGA 2P5YA 4JIGA 4GQAA 4RVUA 1QYDA 2HLPA 3D4PA 3IMFA 4IY1A 1B3BA 3AI2A 2E49A 4FQ8A 2H1SA 4UULA 4TRMA 3T4XA 2CFCA 4CV3A 5IN5A 1KC3A 3JD4A 4CV1A 2DTXA 2JL1A 5JPIA 1DB3A 5B12A 1K89A 3UHAA 3U4DA 3Q9UA 3WXBA 3AI3A 2Q49A 3WYEA 3EZYA 3DZKA 3QLJA 5THQA 4CMKA 5DP2A 3WR5A 5ILGA 2VT3A 4L76A 2HDHA 4Z9YA 3DFUA 3S1LA 3B1JA 2ZTVA 5CHEA 3WTCA 3NT4A 2ILTA 4IDDA 3JD2A 2O23A 3OBBA 4OKNA 5KVVA 1QYXA 3EGOA 3WTBA 1R16A 2G17A 1X15A 3N7UA 5DF1A 1NPTO 3W4JA 3DTYA 1EVJA 4YACA 1BXKA 4BNMA 2W2LA 2D1YA 4OIMA 4LISA 2X4GA 5CFZA 9LDTA 2I67A 4AFNA 2D8AA 3JQFA 2OL4A 4L8VA 1U7HA 1U7TA 4E3ZA 3QVWA 5HWSA 3WIEA 4PIVA 2BKAA 4MP6A 2Y05A 5TJHA 3VH3A 3JYLA 2YZ7A 3NX4A 4UAGA 3KSDO 3GMSA 3RUEA 1C14A 4Z3DA 4E6PA 1TI7A 3ROKA 4O6VA 4PLHA 4B4WA 3ZH2A 1D1SA 1E7QA 3LF1A 3L6EA 1HZZA 1DC4A 1YVEI 4TVOA 1LNQA 3TZQA 1LC0A 2Q1WA 2AE2A 3CZMA 4MO2A 4XYEA 1EUCA 4YCAA 3KYDB 4MVJI 4FJ1A 5JDCA 2PY6A 2A92A 5FEUA 2ZIZA 4BVAA 1MX3A 4IDFA 2EJWA 4OOEA 1BG6A 3A9WA 3QSGA 1WZEA 4E5MA 3V1TC 3D0OA 3AY6A 5J23A 3ZHBA 4DMLA 1Q7BA 2ZTLA 4GGOA 2J3HA 3KYDA 4G65A 1K2WA 1WMAA 4D42A 4K28A 4B3HA 4E5NA 5A04A 5CDUA 4MP3A 5DBGA 3ZWXA 2Q2VA 3CXRA 3WMWA 4QECA 1GPJA 3PPIA 1PJ4A 1W4ZA 1A71A 1B14A 2QRLA 4HX5A 3KHUA 4JK3A 4AJOA 4NQZA 3S2EA 3QHAA 1SEVA 4OQZA 4RVSA 2PNFA 2DFDA 4CQMD 4OSOA 2NU7A 4NJMB 5A03A 2B4TO 2EP5A 3ORFA 2Y0DA 1NQTA 4W7IA 2BGLA 2JHFA 4P4GA 4Q3AA 5MDHA 2ZYGA 2PH5A 2AXQA 5A05A 4D46A 3X2FA 1O94A 3GAZA 1IPEA 1G0OA 2PZLA 1E1KA 1UP6A 1ZZEA 1P0CA 1V35A 2X58A 1WAMA 1WW8A 2GLXA 3JTMA 5L40A 1IL0A 2WD8A 3G79A 2V6BA 4NJMA 4NBRA 4J1TA 1F8FA 4ESOA 5A02A 1SMKA 1U8XX 1M67A 3VKVA 3DOJA 4CV0A 1PR9A 1R12A 3QVXA 3GPIA 4CM8B 1VPDA 4CM1A 4BNTA 1BXZA 2Y1GA 1V8BA 4OSPA 4IJKA 1HDRA 1I36A 4Y6RA 4K9DA 4LK3A 5I8ZA 2J5QA 5B4UA 1PWXA 4CMEA 4S3MA 4PZDA 2FPIA 3ZU2A 4FFPA 2X0JA 3QWHA 1LDEA 1DIRA 3NAQA 3OJLA 2PGJA 4CM8A 1HL3A 2GO1A 5L53A 2ZB8A 4OXKA 4J2OA 4Z9XA 4M8SA 1FK8A 2E4AA 5ADHA 2OHXA 3ZW8A 4ND5A 3BTSA 3DBLB 1GFSA 4P38A 3KLMX 4CV2A 1B2LA 4IBOA 4E2YA 2J3KA 2VOEA 3DZIA 4L9RA 5EN4A 4QFCA 1MFZA 3JQAD 5KJEA 5L9AA 2BFPA 4XDZA 2FR8A 4GLLA 3KETA 4R1UA 5G0UA 1TB4A 2I3GA 3JQ9A 3RC2A 4BGIA 4GBJA 5BQFA 1U3VA 3UICA 4HFRA 1ZFNA 4R5MA 2BD0A 3DAGA 1O95A 1I01A 4ILKA 3ZW9A 5T8KC 2Z1MA 3TRIA 3WQRA 4D41A 5KVQA 2DUWA 3O9ZA 3PGXA 3VKUA 2HMWA 2QYTA 3AUTA 4IMRA 4AJNA 1PWZA 4MKXA 5IFLA 1X14A 3WGIA 1O8CA 5IAAA 3TSCA 1CYDA 2DBQA 1IYZA 4WPGA 1B8PA 4L75A 4BMVA 4ZGWA 5JAMA 3OF2A 4RQUA 4B79A 4XWYA 4J3FA 5ER6A 5B1YA 4MIYA 3QWIA 4FFRA 2P9GA 3OA0A 2I76A 3QIVA 3D4OA 2FMUA 4PLWA 3OJFA 2GN6A 3DBHB 3DL2A 2ZJ0A 4ALMA 3P5SA 2CMDA 3ANMA 3DAPA 4KTVE 5TNXA 4XKJA 4NHEA 2XXBA 3AUAA 4UUNA 5U4QA 3HJAA 4LVCA 2DTEA 3S2GA 4R4JA 4BO3A 2YHUA 3DZHA 2P2SA 3H5RA 1O5IA 4HP8A 1T24A 2X0RA 3NTQA 1K6JA 1LUAA 1YXMA 2AHRA 3PDJA 1ENPA 1X7HA 4R16A 3U9LA 2FY8A 2NTJA 4FS3A 4IDCA 1KYQA 3NT2A 3DBHA 2X0IA 1X13A 1CIVA 4WJZA 4ZICA 4JBHA 1Z75A 2YJZA 5U1PA 3H4VA 3A1NA 4N18A 3B1FA 4CLXA 4EJ0A 3LC2O 3C1AA 4ALKA 4MJLA 3GHYA 1XU9A 4BNYA 1IY8A 1QV7A 4PVCA 5JFOA 3BTVA 3RBXA 2XPCA 2ZYAA 1PQUA 1MC4A 5JXWA 2JCXA 3TZHA 4CMAA 1YS4A 4BKQA 3ZWOA 3ZNNA 4FC6A 2G1UA 1EVIA 1OC2A 4FFLA 3KRTA 1ZJZA 1H9AA 2PTGA 5CDYA 5A5FA 1M2WA 2QRJA 2AQ8A 1GV0A 4PLTA 4RPKA 5H81A 3H6KA 5K6AC 3HDQA 2BGKA 4DLAA 3RSHA 1WLYA 3DZJA 2EKQA 4B8ZA 5KJCA 1DC3A 5L45A 2W2LD 2FN7A 3VPFA 1E7WA 1LSJA 1NTOA 3VPXA 2GSDA 3GGOA 4P4NA 4J0EA 1DHRA 1P77A 4CLHA 1E6UA 2CSUA 3IQDB 3VZSA 2JJYA 5TC4A 1A4UA 1H94A 2BELA 3IDSA 4MDHA 1ORRA 4XGIA 4RF3A 3WMXA 4HV4A 5L95A 1WPQA 1WMBA 1DRWA 3MOIA 5IDQA 1YQDA 1XGKA 3BZUA 4FD3A 4DUPA 4W4TA 1A4IA 2DM6A 4PVDA 1QSGA 4U5QA 1KVRA 3NV9A 3VOSA 1E7SA 1KVTA 2ZQYA 3RI3A 3RUCA 4FGSA 4XRGA 3DO5A 3GG9A 2PR2A 5JBIA 3HWRA 4I9NA 1QP8A 3Q0EA 4Q3EA 1LA2A 4RCVA 4UVEA 1E7RA 4OKIA 3PHJA 1JAXA 1RM5A 3V2UA 3H2ZA 3PHIA 1U3WA 2WTBA 2IZ1A 4DBZA 4PZCA 2XOXA 3OJEA 3WFIA 4CMJA 3NDJA 2RBEA 3TPCA 3KBOA 1B26A 1DIBA 2YQ5A 2RHRA 3M2TA 1WVGA 4PLFA 1J0XO 3DBRB 5DOZA 1H0KA 3RUAA 2C5AA 4FR5A 2H6EA 1ENZA 1DIAA 1PL6A 5KVSA 4DVJA 3MJ4A 3ASVA 1NAHA 1ZW1A 1ENYA 4CMCA 1DEHA 3H9GA 4DIBA 1P31A 4BMNA 4E2ZA 2DUUA 1N8KA 3WB9A 1I8TA 1W8DA 2EGGA 2WJPA 3H2SA 1YB5A 1D7OA 1JVSA 3JCZA 3RD5A 4OHUA 3LT4A 3PI7A 3DBRA 1ZSYA 4QSMA 5C5IA 4ALLA 4MVJM 2FZWA 2RCYA 2J8ZA 1M66A 1TLTA 2YV3A 1HKUA 5K0ZA 3UCXA 4YT4A 3JD3A 2SCUA 1T2AA 3GLQA 4J49A 4RVDA 4B8WA 4CJXA 1E92A 3UCFA 2VCYA 1U2GA 4R1NA 5HS6A 3EZLA 2RH8A 3L6OO 3ZN2A 4BNFA 2NVWA 4D79A 2XXJA 3SC4A 1K3TA 4B7UA 2BFMA 2O7SA 2CDCA 3E48A 2HMTA 1VL0A 1X7DA 4S1VA 1Q7GA 1XEAA 2PWZA 5TRTA 3JYNA 3EC7A 4WLFA 1UAGA 5TSDA 2OGUA 4F46A 3ANNA 1ISIA 2DKNA 1T25A 5LDGA 3HDYA 4BO7A 4PG8A 2J5KA 2VT2A 1PZHA 4NU6A 5CEFA 3GPDG 4ALJA 4A5OA 1JWAB 5IZCA 3EY4A 2X5KO 2VHVA 2O3TA 1XCBA 5LCXA 2Q4EA 2O3QA 5EPOA 4E33A 3GVIA 2HMVA 2UVDA 2VTEA 3HE3A 4GSKA 1WWKA 2NSDA 3RJ9A 1PQPA 5C7LO 1P1FA 1DFGA 1LRLA 4Y6SA 3WGZA 3GRPA 4A73A 1UDAA 5JDIC 1DXYA 2OP1A 3VC7A 1HE3A 1XU7A 2WYWA 1I0ZA 5KKAA 3JD0A 3LVFO 2ZJ1A 4QO7A 4KMSA 4KTTE 1KVSA 3GVXA 3TL2A 2OFPA 3JQFC 4IDGA 1I5RA 3AOEA 3JQBA 1B8UA 2JD2A 3PWSA 4N54A 4XB2A 2J3IA 3WOHA 1EDOA 4OO3A 3VDRA 3X2EA 3KEOA 1XYGA 4PLPA 1NX6A 1UXKA 2ZB4A 1HYHA 3G1UA 3DQPA 1FDVA 5JY1A 1DRVA 3C7DB 4G2NA 3VH2A 4BO4A 1H6CA 2HK8A 1A72A 3QWBA 2AEFA 4R1TA 1GTMA 4ALNA 4D7AA 1Y8QB 3IAHA 5A4DA 1QYVA 2JKVA 1EUDA 4ZRNA 2EHDA 2YY7A 4WCFC 4LN1A 3JQEA 4UUMA 4BNJA 2R00A 1QLHA 1LBEA 3E5RA 5KWEA 2ZCVA 3EHEA 3S2IA 1HE2A 1F12A 3GDOA 3PK0A 2EKPA 1HT0A 1X7GA 2JFFA 2RH4A 3GNQA 5JDCC 2YYYA 1NQAO 3I9NA 3IS3A 2QHXA 4HBGA 4C4OA 4LSMA 4JBIA 1YOVB 3R3SA 1FDSA 3PP8A 3KLPX 3E6AA 5TJ9A 1ONPA 2VZ9A 1VE9A 1E3WB 3INRA 4CM5A 5GZ1A 2EKLA 3B6ZA 3C1OA 1QKIA 4Q3CA 4CUZA 4CQLB 3JQAB 1G1AA 3E5MA 3WYCA 4BKUA 3DHEA 4RGBA 3I9LA 3ONDA 4BS9A 3IJPA 4W9NC 2JAPA 2CY0A 2PGLA 4ZQGA 4CM6A 2JD0A 1BXGB 1PL8A 3L9XA 4E31A 1DJNA 5B4VA 1YOVA 3SBOA 2O50A 5BNFA 4KQXA 5HA5A 1E3WA 1PJLA 3TWOA 3V5NA 1XR3A 5HS4A 4DPLA 4BO0A 2X1HA 3OIGA 5JO9A 4MP8A 4WOJA 4CQLA 4DA9A 3FPLA 3JQAA 4HADA 4OXYA 2FHSA 2NADA 4YVFA 1EE9A 2X9VA 1KEWA 1SOWA 2PLAA 2C29D 5F1KA 5T5QA 3D5QA 3JQ7B 3LF2A 3NYWA 4NDNE 1BXGA 4FPXA 5FYDA 4F6LA 5IDWA 4YAGA 4OAQA 4RF2A 1D8AA 3RROA 3W6UA 2UUPA 2W98A 3JSAA 4RJTA 3DWFA 5U9CA 1CETA 4NIMA 1VJTA 3PHLA 4MKZA 1R4NB 5JCXA 3BMNB 1Q2XA 1X1EA 1PGJA 4I9HA 4XJTA 2ZQZA 4J4BA 4XQCA 1OI7A 3Q9NA 4R3NA 4O5OA 5MGBA 4JROA 3V8BA 4J16A 1P44A 2IYOA 3H9UA 1YB1A 3JQ7A 5JSFA 1YGYA 1LX6A 4QEDA 1DPGA 3EMKA 4CLRB 2CUKA 1L1FA 3FTPA 4BB5A 3I23A 1JAYA 4YR9A 3WGHA 3WIDA 1HYEA 2WYUA 2Y1EA 5DNAA 3AY7A 1VKOA 3ZV5A 5ITVA 3BMNA 1WDMA 1E3IA 2O2YA 4CODB 1AN9A 4FB5A 3ICCA 1U8FO 2AE1A 3ZZNA 2JFHA 5L4LA 3OMLA 3PJEA 2BHLA 5G0WA 1GEGA 1I24A 2VZ8A 5AYVA 2GUGA 3AUUA 3IOYA 2GRAA 4Y67A 1ZSVA 1H5QA 1XWFA 3VDQA 4J2HA 4CLRA 4UUPA 4H15A 1YO6A 1I3KA 4YRDA 2HRBA 3MEQA 5DDIP 1GYQA 4EZBA 1DAOA 1HETA 2TMGA 4HXYA 5T64A 3TQHA 4BO5A 4M49A 1V6AA 1C0IA 1AHHA 4NU5A 1UAYA 2DVMA 3F4BA 2CF6A 1ZSNA 3FR7A 2JAHA 4CR6A 1GR0A 4TVBA 2I3AA 1NYTA 3PQFA 4M89A 4KQWA 4WKGA 1B7GO 2I65A 3RUIA 3BMCB 3QVSA 5FI3A 2PKQP 1I33A 4WNIA 3BHIA 3VZQA 5DOVA 2IEBA 3PIIA 3GNSA 4BNVA 4U8GA 2DBZA 1KETA 5TT1A 2QZZA 1DIHA 1BGVA 5F5NA 4R3WA 3RUHA 1UJMA 3NTRA 2C2YA 2JD1A 1PJCA 4MPDA 1ENOA 3WWZA 5EL0A 2C54A 2YFHA 5CDSA 1RYEA 3BMCA 2VHZA 4Z0PA 1HYGA 4UVDA 4IDAA 1Y5RA 1GEEA 1O6ZA 4BB6A 4O59O 1ZK1A 4TKLA 2Y66A 1P1JA 2P4QA 3ZU3A 1Y1PA 3PWZA 5AQ1A 1EVYA 4J7CA 1DBVO 3H3FA 1C1XB 3VPHA 1PTJA 4IJUA 3GVHA 4DQVA 1IHYA 4IS2A 3DXFA 1D1TA 3LYLA 3C8MA 5H82A 4ID9A 5DT9A 1B8VA 5ITWA 3KYCB 4LMPA 1FDWA 1GL3A 4BO2A 5FWNA 4R9RA 1NPYA 1B16A 3R1IA 2EW8A 2C2XA 2Q3EA 5ICSA 3OH8A 3GG2A 4XQGA 2D2IA 4XGNA 5IDYA 5EERA 2I66A 1L7EA 3EAGA 4WLEA 4HWKA 1E3LA 3M1LA 4ZQBA 3U49A 3PFWO 3TZKA 3AU8A 4H3VA 3FNHA 2E48A 4CMGA 4FGWA 3C7CB 3JQDA 2BMAA 3C24A 1LTHR 2F00A 4MIEA 1PX0A 5DN9A 2RAFA 1BWSA 1Y9AA 2P9EA 3PEFA 3ZV6A 5A9SB 1YQGA 1ML3A 1JKIA 4NFYA 1PSDA 1FDTA 1U3UA 2FR1A 2AQKA 4IINA 4OJNA 5GMOA 1I2CA 2X5JO 4J90A 3DDNA 5IN4A 3DEYX 5DBIA 1EZ4A 4DC1A 5HRUA 3RBZA 2ZK7A 3ZWVA 3M2PA 2XAAA 3QW2A 4CL8A 1YRLA 2YUTA 3CMCO 4BV8A 5I8WA 4UEOA 1H2BA 4FFMA 1XIVA 3DBVO 3UGKA 1VI2A 2X86A 2VOJA 1E0DA 2X7HA 1GUZA 2CVOA 3MTJA 5I7EA 2VNSA 4BO8A 3GA0A 3K92A 1X0VA 2NVBA 3KOUA 4DLLA 3DHNA 2OBYA 3WQQA 1UXIA 1YWGO 3WSVA 4YJHB 4XQ9A 4AVYA 1EQ2A 4IGFA 2BFAA 3E18A 2EJVA 4OH1A 1JW9B 2H63A 5COAA 2BRUA 3AOGA 4H7PA 3VVBA 5L4SA 4W7HA 4W82A 1GUFA 2I9PA 3VVCA 1C0LA 5BSFA 3UF0A 3CH6A 3S2FA 4NNJA 2PV7A 1EBFA 2C5EA 2V65A 2JHGA 2AEJA 4K1LA 4YJHA 2H9IA 3ADPA 3PHHA 2PFGA 1GPDG 3FWZA 2IXBA 4GKVA 5G4KB 3QWAA 1MGOA 4R54A 2X23A 2WE8A 1IE3A 4XD2A 2BGMA 1QV6A 5JY6A 4F3YA 1HDYA 2C20A 3C1TA 4XYGA 3ONEA 4P22A 3F9IA 2VUTA 3L4BA 3DOOA 3KSUA 2NV6A 1OOEA 1PJQA 2GYYA 2GN8A 4UVGA 2VWGA 4NR0A 4ZN6A 6ADHA 4NK5A 1BVUA 1G0NA 1ZJYA 2AA3A 1JWBB 1WDLA 4UEJA 2ZB7A 4RF5A 3A06A 3PQEA 1FMCA 4BNXA 2DTDA 3N74A 4C7JA 1HSZA 1GDHA 2PD6A 2AMFA 4IXWA 1UXGA 4BNWA 2GASA 1ZIDA 5C37A 3FRJA 3DMTA 1O9BA 1SNYA 3OA2A 3CKYA 1PJSA 5A06A 3BTUA 3AFMA 5H83A 1KEUA 2DU8A 3GOHA 3MZ0A 4CMIB 1SAYA 4LCJA 2EEZA 5EQDA 4R9SA 1J49A 4PN3A 4IXTA 4J4HA 3SVTA 5IDXA 4I5FA 4B7XA 3WJAA 4IJVA 4KUHA 5EJ2A 5JYDA 1EFLA 1T2FA 2J5RA 7MDHA 1QLJA 3NT5A 1IB6A 4M55A 1I30A 4XX0A 4YRAA 5G2OA 4CR7A 2UDPA 2OMEA 1H2HA 3V1YA 4GX0A 2X0NA 2Q45A 1V3TA 4CMIA 3UOGA 2Y1CA 4JXKA 2WWRA 2EV9A 4XA8A 4RVFA 3DBLA 4NZ9A 1EDZA 4BOYA 3ON5A 1GQYA 1GUYA 3GGPA 3R0IA 1EK5A 4HFJA 4NH4A 5L3ZA 2P68A 3BHJA 3WJ7A 4B4UA 1GQ2A 4FOSA 4K26A 4YJFB 4UREA 5IXSA 2UUOA 2IZZA 2IODA 4M87A 3WWYA 3G1TA 3OSUA 1VJ1A 5F3RA 1NFQA 1XHLA 1QYCA 5A1TA 2D59A 1C0PA 1J6UA 3V2HA 5JMPA 3SEFA 3P19A 1UDCA 2AQIA 2BF7A 4TROA 1BDBA 2HU2A 1GZ6A 2C0CA 4IIUA 1NWHA 1LEHA 1SOVA 4FJ0A 1ARZA 3GR6A 4NG5A 4DQUA 1SEPA 2VHXA 1DOHA 3MOGA 4CLOB 5DP1A 4OMUA 3WG9A 5JLAA 1LC3A 1B3RA 4YJFA 3FNFA 1N5DA 4KDEA 1O89A 3TFQA 4DRYA 3EDMA 3R6DA 3ZGYA 3JQCA 1YH3A 4ND3A 2X5OA 1UR5A 2BH9A 1YONA 4HY3A 1XELA 3ENNA 3NJ8A 1SPXA 3CIFA 3W6ZA 2YW9A 1F14A 1ONNA 4CLOA 3RC1A 5T57A 3NRCA 5IF3A 3FSRA 3F6YA 3NUGA 3FCOA 3JV7A 4TZTA 5L51A 1LQTA 4ZA2A 4NI5A 5JAIA 3MJCA 3AOEC 1DIGA 1U3TA 4Y8VA 1HE5A 3EUWA 2NUAA 3HDHA 4EW6A 4OXNA 4BNLA 3NTOA 1Z7BA 3OIDA 1KVQA 3EYWA 4BO9A 2O3RA 5C3MA 1PZGA 2JFGA 3ADOA 2HO5A 4MVJF 4XYLA 3Q11A 4EITA 3GVCA 1ZVMA 3RFVA 2GF2A 2IXAA 2V6FA 3L6DA 3QA9A 4TRJA 3HUDA 1ZK3A 5A5EA 1LDMA 5F1PA 4E32A 3BIOA 5ENDA 2EP7A 4YAJA 2WMDA 1RWBA 3GEMA 3IUSA 1W6UA 2HJSA 4BMSA 2WD7B 2BI8A 1RJWA 3H9QA 1KVUA 4JX8A 3GEDA 1EQUA 2C59A 3CPSA 4BNKA 5TGDA 3W8DA 3SX2A 1EUZA 4U7WA 3E1KA 4KUEA 4J43A 2DQ4A 4EDFA 4J9VA 3SJUA 4TRRA 3ITKA 5L7YA 4BNUA 1Y5MA 5CPFA 3ZNOA 4R5HA 2O48X 3V1UA 5F21A 2DAPA 3DHYA 1BTOA 2IRWA 5JNLA 1DFIA 3PZRA 1VL6A 1RPNA 4L73A 4D3DA 3JYQA 1KEVA 4P8RA 3ZWPA 3OP4A 2VZ0A 4GSLA 1A7KA 2EW2A 3I4CA 1KS9A 4DWVA 3UXYA 2I99A 5TIIA 4MINA 1L7DA 4BNZA 1I3NA 4J0FA 2WYVA 1TT7A 3SLGA 1IPFA 2UYYA 2Y1FA 4EBFA 4YAKA 2X22A 2YFQA 2YDYA 1PJ2A 4WE3A 1P74A 3L4SO 1TT5B 4JJIA 4MVJA 4ZHSA 1PGOA 2C7GA 3RAJA 1MA0A 2DBVO 3I6IA 4I5GA 1YE3A 2NQTA 3RU9A 3WQSB 3RUDA 1Q0QA 1U5AA 1J5PA 3NDIA 2FRDA 4U6QA 5EINA 1S7CA 1XSEA 3RCBA 4RLSA 5K9ZA 5CG2A 3RASA 1ADFA 4Q3NA 4BHTA 2PA3A 1P1HA 2ZCUA 3AM3A 2NWQA 1TT5A 1N1EA 2X8LA 3L07A 3VAZA 3H5NA 4IQGA 4GAEA 1A7AA 3BMOB 4E2WA 3ZHXA 3KSZO 4NFSA 4R51A 1PJTA 3FI9A 2OP0A 1ZCJA 2BI7A 4IMPA 4E13A 4MIOA 3ZWWA 4Z0TA 5AOVA 1LDGA 3WDSA 1HF3A 4MOWA 1PU2A 3U0BA 4W6ZA 3GNTA 1E77A 3GQVA 4LMRA 4AJHA 4Z6KA 4CMBA 4DXHA 4IPTA 4YPOA 3D3EA 2P91A 4J7UA 5IZ4A 1VLLA 3D4NA 1D4FA 3BMOA 1MC5A 2CDBA 2Q1SA 3HDJA 1LLUA 3A28A 2R6JA 4DIFA 1F17A 2FZEA 7ADHA 4PLVA 2UV8A 3MWEB 4BNNA 4RPJA 4TRNA 4E30A 4GKBA 4JQCA 4YRBA 4NBVA 5KOIA 4H16A 4AL4A 2Y0CA 3NKLA 4YA6A 4PRLA 5BSEA 3KXDA 2GZ2A 4JN6B 1KY4A 1ZXBA 3KZVA 4BO6A 5JC8A 1S6YA 4J6FA 4M54A 5AXCA 5COBA 3UCEA 3MJSA 2IYPA 2BLLA 1Z82A 4QTZA 3ZHZA 1K6IA 2WEKA 3LT0A 1HRDA 3F3SA 1V3VA 3TDKA 4KP7A 3WLFA 3FBTA 4Q3DA 3PFFA 2B36A 4IZHA 3TZCA 3U4HA 3SLKA 3AK4A 1GU7A 3VTZA 4JJFA 2I6TA 4U6SA 5BT9A 5TQVA 2Q4BA 1ADBA 4GL4A 3ZU5A 4MVJG 5KCZA 2W90A 3K8ZA 4GX5A 1VSVA 4JBGA 2EWMA 4I08A 1H9BA 3OQ6A 1PQWA 2YV2A 4FIZA 2GERA 2C7VA 4OL9A 5TT0A 1UZNA 2VWHA 3AM4A 3I6QA 4AJ2A 1VL8A 3ZWCA 4E5PA 4XR4A 4XDYA 2GN4A 1E6WA 3LZ6A 2OZPA 2CVZA 3Q6IA 3VPSA 4K6CA 3GT0A 4UVIA 4BNHA 3DAFA 1ZEJA 4X54A 3RC9A 4E5KA 5CG1A 3ZV4A 4DPKA 1B0AA 3I4FA 3RJ5A 3MCVA 5F1OA 3AM5A 3HG7A 4JGBA 5KTKA 3AFNA 1AHIA 2LDXA 1E1MA 4R69A 3F1LA 1O0SA 5A9RA 1QG6A 3K30A 3IUPA 5CEEA 2A35A 2VYVD 1NP3A 1NWCA 4Q39A 1HWYA 1OBFO 4J1SA 3QWFA 4GVLA 4Q9NA 2J6IA 1HDXA 3DONA 4OM8A 4RVGA 4ND2A 1I2ZA 2AEMA 3KUXA 3IKTA 1M75A 3RIHA 4GGPA 3E03A 2BFOA 3DTTA 3RFTA 5EMHA 2VUUA 3ZDFA 4OQYA 1GZ4A 1YB4A 3ENKA 1LLQA 4UUOA 2B35A 1BHSA 4J9UE 4YT8A 3TN7A 1W73A 4N5LA 8LDHA 1E6EA 4GLOA 1UXHA 1E7MA 4FCCA 1XG5A
chains in the Genus database with same CATH superfamily
4YCSA 1W4CA 3LHIA 1T1SA 2WU3A 3LU1A 4JI3B 4DQXA 4RHXA 3FTQA 1L7QA 1BU5A 1I2DA 3BXXA 4TLAA 1TZKA 3RJMA 1IEVA 5LD2C 1Z5WA 4QEZA 4OHCA 3TW0A 3D3WB 2CK3D 4YBZA 2LP4Y 5K0NA 4D8UA 1R0SA 4LOJA 2DKFA 1RCFA 3HNOA 1QIHA 5J9FA 4Y9DA 1OLUA 3LCRA 4KLRA 4RBNA 4BQNA 1Y1QA 1PJBA 4CCSA 2QVBA 3FPCA 1J9GA 2BHNA 2NXCA 4ZJZA 3MWLA 2KE5A 3PXCX 3ASUA 4DDUA 3GMIA 3WLLA 4XTRA 4JI7B 3UW3A 3GVPA 5KTOA 2UUAB 5HKOA 3GFGA 3PGKA 1VA4A 2QOEA 1CZOA 4RF4A 4ZPXA 4BEJA 4UM7A 4GXTA 3OM1A 3ROFA 2GN0A 4OF4A 5A4AA 2GAFA 4ESEA 4ND4A 1YIAA 3SVLA 1YL5A 5K6TA 1FFXA 2AFIE 3UUWA 4MAFA 4B31A 2A0WA 5CGQB 2EERA 1Y1KE 3QFHA 5EXTA 4DYVA 4EL5A 3K0HA 2ZJ8A 4ZVUA 4F4CA 5IG2A 4KSBA 5IVPA 1YQXA 3K9GA 4R7ZA 1ZD2P 2NACA 3QM1A 3MJEA 1ZISA 2ZI9A 3CE6A 1JLLA 2J9RA 4IRUB 5CDGA 1QHSA 2FDRA 4HEJA 5JI3E 3DEHA 3DEZA 3NHRA 2C96A 4KH0A 4FJ2A 3LNCA 3QKSB 4M1QA 1EK0A 2XGOA 3T7AA 3LV8A 2JBHA 4JVSB 1DLIA 3H6GA 2LWIA 3KQLA 1I2BA 2P4SA 1K4MA 3E9CA 1XVUA 1AA9A 4IIJA 4NJEA 3U62A 3EVEA 3AWDA 3UVEA 4ZYTA 1DKRA 1ATZA 4RIHA 3VBCA 5IJZA 1UZUA 2QQ0A 2CMFA 3HZHA 3OX3A 3RKUA 5YASA 4KITB 2C4TA 1SIOA 3H3JA 3CRQA 2NZYA 4J1TC 3OQVA 2G40A 3DBOB 1BEUB 4L2IB 3KC2A 3CEPB 4LJRA 1GKIA 1SZCA 1U02A 2Y76A 3FE2A 3PNSA 4I7EA 4B45A 1EPUA 5CB6A 3MBKA 4EB8A 4DG9A 4GQBA 2P6UA 2W6ZA 4UTVA 3KTFA 2ONYA 3DZGA 2DUMA 2AF3C 4LYGA 4JEHA 5DI3A 1QONA 1SBIA 4UEWA 4WK4B 4I8XA 3LNTA 3PFNA 5THXA 1JTFA 1BW9B 4DIOA 3DGFC 4L4RA 5B3AA 4F92B 2W2XA 2H2FA 3ES9A 4TWRA 1NDQA 4Q1EA 1TIKA 4C4XA 4BNIA 4MV4A 2YW2A 2XE6A 1EFPB 1RM3A 4D43A 3K5WA 2CD7A 4M1EA 1ZOSA 4K3UA 1RQPA 1Z4KA 3AC0A 4D44A 2XWBF 4ZHQF 4ZMBA 1WP9A 4U0KA 1FYFA 1ZITA 3GFBA 2YJ4A 2JFBA 2PKCA 1MD9A 4S0XA 4KR0A 3CO0S 3BN3A 3M9WA 3RQIA 1I4WA 2G63A 4X94A 1AKUA 1CQIA 4FYXA 4P98A 3EW7A 1MDBA 4ZRMA 1ORHA 2Z8YM 4BFYA 1A8SA 2Q6OA 4MVYA 4TUYF 2ZRLA 3QTLA 4YMGA 2XBLA 2XUKA 3HB1A 4HS4A 2DFKB 1R6DA 4NYJQ 4QEKA 4LZNA 1GRNA 3X1WA 3ZV3A 5KCMA 1NLFA 4CKCA 1JR4A 3N0WA 1T3ZA 2VUSA 1J23A 1IQ0A 4PXAA 2AK3A 4RMIA 5AOAA 2RBGA 3TQRA 2Q1XA 3E9MA 1OA1A 1ZVKA 2J9FA 2PX5A 3KJIA 2XCQA 3QVKA 1MHTA 2QTLA 2Y77A 4HWTA 2AJDA 3T3MB 3EUFA 1KK0A 1U7UA 1Q84A 4HMQA 2PZGA 4U7PB 4UHEA 3OWXA 2ZYDA 4I2NA 1TKCA 5H16A 3JQ9C 1KYYA 1R0LA 4R31A 4TTJA 4U2KA 4ZYUA 9LDBA 2PUFA 1A2QA 3JRXA 2FLVA 1ZONA 1DKPA 3BIFA 1F3LA 5LOVA 4M9QA 1L5LA 2CXNA 2J85A 5SZHB 2Q6LA 4YQYA 5NULA 3FWNA 1Z15A 2QR5A 4DUGD 1UZMA 5IABA 4WCDA 2RHCA 4RD1A 5DE3A 5C1IA 3RIXA 5AQEA 3WNVA 1EJBA 2AZ4A 3CZ4A 4BVBA 2YCBA 2NT3A 4NSNA 4FXOA 1D4AA 4JOCA 1G66A 4OXXA 1G7CA 4ZMRA 2B5OA 3PZBA 3FNEA 1FJHA 2C9BA 1DG9A 2HK9A 2IUUA 1ISHA 1QIKA 3BS4A 5JSZB 2V7PA 4C0LA 1T8RA 1CUSA 2NU9A 1T1IA 4XAQA 2ADOA 2C4NA 3CR3C 2O59A 3B1XA 3VPGA 1A3CA 1M83A 3PVZA 1M74A 4D3YA 1P45A 3AVYA 1IBRA 4MYSA 5TV2A 2NO4A 3KOZA 1L7RA 1GOTA 1U7ZA 3F47A 3RK0A 3EH1A 4EUEA 4PCVA 3IQFA 1IOLA 1B23P 3FYUB 4MUMA 3HI6A 4L3VA 4HNGA 5LP6C 3RYFB 5AVQA 1KFCB 2EYQA 4EMSA 2PBZA 1RAIA 1JHMA 3C7AA 4IG4A 4MKFA 1QGYA 3DMNA 3EG9B 3U9TA 1BFKA 1KERA 1R4MB 5FNVA 1ZICA 2H2HA 4DCNA 4YCMA 4YIKA 5KX5A 1CBUA 2VT6A 1P7PA 1YE5A 1DJOA 3KPVA 4HL6A 4YWJA 5JE8A 4XIFA 1LZKA 2DCUA 2O4CA 5AUQA 3UWMA 3LUGA 1OBCA 4UDYX 3ETEA 1NY5A 4G81A 4PQGA 2QM3A 4GR9A 3W5SA 3ZQ4A 3JAWB 2GEKA 2XVMA 5AXAA 3LXUX 4WKNA 4X6LA 3UTDA 3TTXA 2NUTB 2O2HA 4YRLA 1SCKA 3K2BA 4M8LA 4R84A 4GI7A 3JYPA 1CEXA 2OXIA 5LL6P 5C46F 2PGNA 3BL8A 3IBTA 4DVGA 5IVKA 3QPDA 2GOYA 4WCFA 3H5WA 2VYND 2YIVX 3R4CA 5BSUA 4NEQA 1IUKA 4KQHA 1IY1A 2R65A 4ZQIA 2JFOA 3WAKA 4R1QA 4GX1A 5FFFA 3AI1A 5AUOB 4O1MA 5BV7A 1Q1EA 2D6FA 3OAAD 3UFXA 4CHTA 1FC0A 1IBLB 3GEGA 4WACA 2C82A 3AKZA 2WR8A 1GTL1 3Q3IA 2ECPA 3AY3A 2O3UA 2QZSA 4IDBA 4E4YA 3TEFA 4Z54A 5CLFA 4Z0NA 4V0OA 3M6IA 3Q7RA 1OROA 2CHFA 3HXTA 3RWBA 3I9FA 1TMOA 4CW7A 5AW4A 2D2VA 2G0TA 4IW3B 1IZ7A 5I9IA 2J0UB 3SDSA 3IRVA 4PYJA 3BWYA 1GQSA 2HDOA 4QQKA 1XQXA 3AIIA 4ARZB 1TDJA 3MUOA 4R2MA 1RRGA 3RS7A 3F6CA 4TSFD 5LPNA 4FDAA 3O9VA 2W4QA 5HGJA 4ZD6A 3FCCA 4GMFA 3SZ3A 2KQUA 1T13A 1SCIA 4R41A 2ZUCA 3AJRA 1Y7LA 2NN3C 2RK3A 3FCEA 3FR8A 1PAUA 2BFEB 3IT0A 3JWIA 2Q0QA 4RKWA 4WZAA 1N9GB 2HJRA 2O0JA 3FVRA 4BQQA 5M7EA 1W2GA 2PH1A 2ZATA 3Q1KA 3BGIA 2OXFA 2I55A 4ZVLA 4LFBB 4NBWA 2QLLA 3COSA 3K35A 2VTBA 2RHDA 1MIHA 1NOIA 5ALLA 4RSRA 5L7WA 4E09A 3IP8A 4NX2A 1O0BA 2VHQA 5KB3A 3PUXA 1M1YA 4C22A 1W34A 4E3WA 2EQBA 3B13B 2G9RA 1RQGA 4P7JA 2ZPUA 1XQ1A 4A7PA 2NO5A 5JVDF 1FBTA 1Q19A 3ISVA 4LC0A 3DAHA 4EFLA 4EG5A 4U39A 5JCJA 2Q3MA 1IZ0A 4CEHB 1QHYA 3KYBA 4KRXA 3BEDA 4M9UA 2Z3WA 2OCPA 2IUEA 1UPBA 5JZOA 2FPKA 1ILEA 1GN9A 2HTFA 3FFTA 3OPYA 4Z0HO 4EVRA 4N3AA 2IDMA 1RMTA 3E2IA 2QG6A 2XNSA 4QVGA 4X3OA 4DDWA 4DBLE 3F8SA 3QLTA 1L2TA 3EAQA 3UT0A 1LVGA 1ISFA 4E4RA 1OAAA 3GAAA 3OZAA 4JSTA 4LF7B 2WVJA 3FHTA 3V2GA 3DJFA 3LX4A 3NYRA 2WA2A 3FTEA 1D6NA 5KYVA 1J4AA 3KV3O 3NEAA 2YJTD 1YIDA 2FETA 3IV7A 4F60A 2EXXA 2OO3A 1IEWA 5F1YA 3OTHA 1L8LA 4UUAA 3PC3A 4MQBA 4WHMA 3CX7A 1CX9B 4GWKA 4LXHA 2P2YA 3ETJA 2ZRNA 3CR8A 5K8LA 1ZUHA 2BIFA 4I4NA 1DAMA 4EY6A 5EIOA 3MQFA 3HXOA 3PL5A 3RSCA 3WICA 5F5LA 2P6OA 1F6DA 3LWNA 4QL3A 3E8SA 1V5EA 3QU4A 1U8ZA 1VFPA 1M6WA 2X9NA 3LQRA 3NYIA 2I87A 4Q66C 1MB0A 1Z5GA 4Y1RB 3WGGA 1J24A 5KNDH 1KOLA 3TOZA 2Z6VA 1JTVA 3W5IA 3HRIA 5HQ3B 2VDKB 4FINA 2X2PA 2HFJA 5CAEB 2QW8A 1RPTA 2VYVA 3U3KA 1B0ZA 1GUDA 2HIMA 3KKNA 5FTWA 3MSCA 1Q11A 1LFAA 1RAHA 3G9UA 3JRWA 1UBSB 2I4OA 1NI4A 2R11A 4GC5A 5BW4A 3HKDA 3SC2A 4D8YA 1DWUA 1VBNA 4TXNA 1Z63A 2XB8A 4KHZA 3GLGB 1FVOA 2Q1UA 2O7VA 2VDOB 1IXZA 2QB5A 1C81A 3KEMA 1GLNA 3O74A 4F4DA 2XMSA 5H9WA 1FZTA 3HSKA 1RRVA 1V5FA 2NU6B 4JEMA 1FP6A 1NQ5A 1YSCA 4ZYYA 1WMDA 2WMNB 3JQPA 3OY7A 3EYAA 3ELUA 4K6GA 1W29A 5HF8A 3KKZA 3UG7A 3VR6H 5JI2E 4IQ4A 5LDDC 8ADHA 1WS6A 3OFSA 4YRPA 3WL7A 3QYFA 4BNGA 3T9FA 4TYQA 1BX1A 4LVUA 4YMSA 3VNBA 3ETDA 3HBLA 3U16A 1RCUA 2IS6A 2AI1A 3HV0A 3OCZA 1DBRA 5AVYA 2FK8A 1D6SA 3GFSA 3A6JA 3GK3A 4H17A 3W9BA 4CPDA 4U0JA 1SVIA 3UT5A 4CM9D 4KXMA 1FXWA 1XRSB 4RKRA 4TZKA 3A9CA 3M82A 4JZKA 2OBMA 1A5SB 5FPTA 1GNLA 4TL9A 3TRFA 2C00A 1G6Q1 1FNDA 1EHYA 3FB1A 5AW3A 1RAAA 3GGGA 2FGJA 3E84A 2FFJA 4LF6B 8AT1A 1PWEA 4FFNA 2P27A 3FSJX 4FW8A 2IYVA 1SD1A 4CTOA 1U8EA 2MDTA 3BRWA 4GMKA 3IOEA 3DYIA 1XQ6A 1L9XA 1F5SA 2AUNA 4JQYA 2RHBA 5EIFA 4XTCS 2Y0BA 1YA4A 4R0VA 4EEXA 5CFRA 4GOXA 1Z45A 5KMGB 3OX1A 3IR7A 4LHYA 3CR7A 3MMNA 2XUZA 1MXHA 2B4QA 1IOZA 3OTIA 4C5AA 1YRWA 2I0FA 4G5SA 4YYZA 1ZXXA 3C1UA 3BHMA 4YJ2A 1LLDA 1PR6A 2O2ZA 2JLRA 4QJIA 4Y6PA 3NZEA 1I7LA 4ZU1X 4ZC8A 4M22A 3NGLA 1J8MF 4DCTA 4U3JB 3FLBA 1N4DA 5LDHA 1V43A 1RZRD 5K45A 4PYKA 2JVIA 3TAHA 5DN6A 4ZAYA 5KDLA 2OGWA 5C1DA 1JN0A 3A6ZA 3GDGA 2JI6A 4X1KA 1T4GA 3WIUA 4COOA 1KOFA 5KYUA 3KVVA 3W5CA 1JVNA 1GP2A 3L05A 4GI1A 2PYIA 4R98A 1VLJA 1JG3A 3C8UA 5DYYA 4KOAA 3BL5A 4D9GA 3V3TA 2JGIA 2ZUWA 4ND6A 4RPLA 1U0NA 1E69A 4JC0A 2WJ3A 1BWRA 4OV6B 1BOFA 4BAUA 1OZAA 1T26A 4UU8A 4MV6A 2RE8A 4Q03A 4Y2UA 3EFBA 4C7KA 4YUXA 5CEJA 2JIZA 1RJ9B 2JZCA 3BC1A 2WJ6A 1OXXK 3E4DA 3KTAA 2R8EA 4LWOA 5M04A 1JBEA 1MIOA 2ONZA 2N75A 4W8GA 2ADMA 1SC1A 4QJ4A 2NG1A 1DCKA 2F67A 4MEJA 1EU1A 1UQRA 3W8FA 1YQTA 4JJ6A 5EWLA 3ZLTA 4KAJA 4LKOA 2OA0A 2PCJA 3EH2A 2QX8A 1E8NA 3IODA 4ZJYA 1P0FA 2O5RA 2QLMA 2UYHA 5GGXA 4IFIA 4KVAA 4PS1A 3H5AA 3RRYA 4KR2A 2D2FA 1D5CA 2I1QA 2RG1A 1H8HD 1EESA 1C7ZA 1T6NA 3UGTA 5I4IA 3EWNA 3NETA 1CUDA 3OM0A 1JHQA 1RPAA 2EDAA 4OHWA 3TTWA 1ULTA 3ICEA 4ARIA 2ECOA 4Q4AA 1QE0A 2ZB3A 3B9PA 4JB2A 1TAGA 3OEHD 2HTEA 3OECA 1N34B 2V7WA 2ZI4A 4EOGA 3K73O 4Y18A 2C31A 2B0CA 1BS2A 1C1DB 3MCTA 5HMMA 2GK3A 4O4LF 2JDIA 5ICMA 4P4LA 2YJNA 4Y6LA 1AK2A 3LVBA 5KSYA 4Q37A 1Y6FA 2PZEA 2DERA 2WKPA 4F2DA 1MMFB 5H80A 4BLVA 1BA3A 4N5MA 3BVPA 5E1BA 1R6BX 4G0QA 2C4UA 4NK4A 2N46A 4G97A 4Q24A 4QQNA 4R2KA 1X77A 5CM2Z 4XJXA 4YPFA 3I62A 1DJMA 3UG6A 3C5EA 1XD8A 3G2IA 1I4LD 3JVVA 4RNDB 1UMCA 3G82C 3C4VA 3MQ4A 4ANFA 5D1NA 2QTTA 3E9NA 3LBYA 2YC4C 1KMNA 2WABA 1J9ZA 2VTVA 1CY4A 3O4JA 1JB9A 1TA9A 4B2LA 4OLAA 4QXAA 2Y0PA 4U7HA 2CB9A 3GZJA 4BWYA 1JBQA 5DXFA 1QG0A 1YBAA 2QDKA 2B98A 2JVKA 2G4VA 5LU8A 2RHLA 4RGYA 2ZAIA 3O4IA 1JJ7A 1G18A 3K8YA 4Y2SA 4GQIA 1ZQ9A 1IG0A 3ZJ5A 5EJ8A 1MH1A 2FWNA 4BX8A 3A6EA 1G41A 3KP1A 4L0QA 3EIFA 3VM6A 3MYRA 2JJ2A 3S2SA 5BSGA 1Q0ZA 2KI5A 4J16C 1XJ0A 5C8ZA 4BBJA 3NHMA 2ZE5A 5AK5A 4D4HA 1H6DA 4MA0A 4PAGA 4QBKA 4QDUA 3AHHA 3RVOA 1Z4QA 2OKCA 1Q20A 1R5JA 4P3KA 5C4GB 4B80A 1PW5A 3OHPA 1LI4A 4MQ4A 2HRZA 4NPCA 1K7YA 4C43A 5P8WA 5C7OO 2CBXA 1EFTA 2YX1A 3OFJA 5TVGA 2WPDA 1ZBQA 4IVQA 5CGZA 5BVHA 5BO5A 1OX6A 4PLCA 4EI8A 5I7SA 4HDSB 5CFOA 2JHCA 1FX1A 3MCZA 4LJ9A 2LKCA 2ZRAA 2E5FA 1KBZA 2HGSA 1GNVA 1OIWA 3UKJA 4DCSA 1HE4A 1IZ8A 3F4LA 1QAQA 2CVFA 3ISJA 3JQ8B 4QYXA 3QE0A 5JFGA 3IAAA 3QKRB 3VU1A 2VHUA 5CURA 5H59A 3PVSA 5TQ2B 2VTDA 1SC3A 4EQZA 1BS9A 2AVNA 2W6ID 3FSEA 1VG8A 5E4FA 3FTFA 3A6KA 4EK9A 1FYVA 2WWHA 2WZCA 2D5AA 3QFFA 3ETGA 4YECA 4JI2B 4GE0A 5FUQA 1Z74A 2REQA 4KX5A 2JAWA 3ZDBA 3T1HB 3DAOA 1UL1X 1FEZA 3RJTA 2ROQA 3DEKA 1L9KA 1KMIY 2VQEB 4GPIB 2FGKA 4GZ6A 4ODIA 3THYA 1P0QA 2C7QA 1X9IA 4TT8A 2IX9A 3X1ZA 4QZVA 5KDOA 2WWYA 3RHZA 2WJHA 5B36A 1E2LA 1BGWA 2A9OA 2GEDA 4OGWA 5ARCA 3CVJA 3SXJA 4LRUA 4BMXA 1ESZA 2WYOA 2I1LA 2FPMA 4PY2A 1L7BA 1V2GA 1Z6GA 3TJRA 4HYTA 3VR4D 1T6BY 2XD4A 3FM9A 4V0KA 3UAYA 3PT5A 3U44A 3T3IA 4D9NA 3EVNA 3ESDA 2YH2A 5JALA 2HPZA 3RVBA 2E2WA 3H11A 3UC5A 3I9V6 2W6NA 3Q9SA 2QIOA 1KKUA 2G0NA 1WKCA 2BV3A 2RGEA 2EKBA 2WICA 3A4VA 3DA8A 4N40A 5IFKA 3VR6A 3OZEA 1TM2A 2TSYB 2A33A 2WJGA 3MRXA 3NOVA 5FI0B 1NUPA 3NO4A 5LYJF 1TQ4A 1YJBA 4OGGA 3MJRA 1TJPB 3O4RA 4DC0A 4LZWA 3QVJA 1P1BA 1T43A 2ZYHA 1E3QA 2GM4A 2AJTA 4WUVA 5DULA 4LJKA 4I8DA 6AT1A 1OYYA 4NOMA 4WXEA 2I2AA 2FUNB 2FX2A 3UA3A 2NU8A 1T2CA 1KDVA 4M86A 3U5TA 1RRFA 5BN4B 3DBIA 3ZY4A 1U9JA 1L4FA 5E8RA 2ZBDA 3SZOA 3DTVA 4EKGA 2DCMA 1QR6A 1ZA1A 3MC1A 3NALA 2MCFA 2CDNA 1RLIA 1EJ2A 1SQ0A 4ZOLB 3ODGA 3P9KA 3PUZA 1XZKA 4DDMA 4V0SA 4CEJB 1CYEA 3TSZA 5D86A 1UBEA 3RRNA 2OAP1 5CUQA 5JS6A 1G98A 4CQMA 1YK1A 5AW7A 1ZD4A 3IT3A 1TIPA 3QJGA 2NPFA 4WFJA 4AJKA 3LQFA 4F91B 5JZBA 1N92A 2P11A 3O03A 5EFZA 1OTYA 3L0ZA 1HX7A 3AT1A 4Y2YA 1XXHB 1KARA 3C7KA 2XUDA 4F9GA 3N0RA 3ME5A 1UCFA 4ATNA 3CNEA 5B55A 2APJA 4KQ9A 3GRVA 2JEZA 1IZZA 3GUZA 3QE2A 4IIHA 3EQ9A 4F45A 3RK4A 5FWYA 1K6XA 2DFVA 1U1EA 4KBFA 4RENA 4Y6GB 3DT6A 2DLDA 2WIBA 3A1FA 1UWCA 1YDEA 3R3UA 4V2IA 4BLTA 4J4TA 3E35A 3HCNA 5JWHA 1U3CA 1D2NA 1MAVA 2BGJA 1PR3A 2ID9A 2WAYA 4JVMA 2Y1OA 4A10A 1EXWA 1I3LA 1QS0A 4GI3A 4KDFA 4UBMA 3L4EA 5JNUA 3R0VA 3IR6A 2W2TA 1ODCA 1UT8A 2O7NA 4CWAA 3IL2A 2C99A 2CVPA 2GESA 2ZIUB 5HCNA 4WJLA 4MWGA 1OBHA 5AI5A 4CM4A 3X1KA 2GN9A 4X92A 2B3DA 4FNOA 1AU9A 1EAYA 1NR1A 2NO1A 3C3XA 5IARA 1R0CA 4ZAFA 3VX4A 1ZH4A 4HWOA 1AO3A 5THKA 4PN7A 1T5LA 4MCAA 3EODA 2XITA 2QAGA 2VPWA 3SDBA 1PSWA 4X1YA 4LF8B 1YZVA 4FYIA 5JD4A 4B3JA 3CTMA 2OOKA 4D4LA 2Q8NA 2OQ2A 4AZTA 4Y1GA 1P1RA 3EMBA 3LO8A 3IVMA 4KE8A 4NMLA 5FL7D 3K70D 4B3XA 1QQTA 5FTLA 5JH7F 2IS1A 1YR3A 3SZGA 4O33A 4N5NA 1GPYA 2DECA 2JC3A 1QH8B 3D1LA 4BL5A 2NVOA 2XGMA 2AOTA 3QBDA 4TLEA 3BL6A 1UZLA 3SYRA 2W6OA 3RAGA 1XFAA 3SOZA 3H1AA 2ZBFA 3HRKA 2Y99A 1XPJA 4XUGB 3QHQA 3TOXA 1WD5A 4IOKA 2F3TA 4ETWA 3PQ5A 5IP5A 1UKBA 1M8PA 2Z57A 3ETLA 3KTDA 5CYOA 1RQRA 3OIYA 1A8QA 3PJFA 1HQKA 5DI9A 3SN6A 3QY0A 1X1BA 1F8UA 1S8AA 2VRCA 3T34A 8GPBA 1WABA 3VU8A 4CIBA 2CJXA 3B2NA 3U09A 1C2TA 3IBGA 4NJOA 5K0TA 3EISA 3ZVKA 1F9AA 3ZDYB 4EG3A 2HD4A 3GUYA 3LQ1A 1ULUA 2J7PA 4MICA 1JHAA 4D0RA 3IKVA 3UJ6A 1Z5ZA 4DADA 2OSVA 3UB4A 4AICA 5LP1A 2J0QA 2WG0A 2Z0MA 3FF4A 1KQGA 4NNPA 3OCWA 1BDMA 4H1TA 2Y1WA 2Z95A 4NMMA 3L4BC 4F3CA 3O8CA 1LDNA 1LLCA 4WVLA 2C8JA 1SY7A 1UC9A 1GZSA 1WKBA 4JYCA 4OI2A 4XCVA 4DB2A 4H1HA 1P9RA 1N2XA 3IP1A 2VP3A 4KNVA 1AURA 1PDOA 2O2SA 5A3VA 1DS6A 3MT9A 2UZIR 5DLPA 5AVTA 3H83A 4K86A 3WGTA 2V9ZA 2FFQA 4OQNA 3PFCA 3WRXA 2PX4A 1QZXA 4L57A 4DA4A 4GMGA 1DAEA 2J45A 4QAQA 2E5WA 5HOQA 1E1NA 3RS2A 4TS9A 4OYLA 4P86A 1ZH8A 3DMTC 4KYUA 3TQFA 5AK4A 2PIDA 4G85A 1NHWA 4UHCA 1KP2A 3QPBA 1U2DA 2ISCA 2QN6A 3O0DA 4RGVA 4XB6B 4YRFA 721PA 1Y9JA 3CVWA 3PYLA 1WW2A 4A8PA 2NSJA 1G20B 2CNOA 1CUHA 2D3WA 7ABPA 4D1YA 3QELA 4A26A 2HCTA 3EK2A 3JQGB 1JE1A 2PKRA 3OZGA 4HRYA 4IJWA 4M7OA 3KWMA 5LA6A 2QPLA 3NWOA 4Y30A 3LPDA 3GCDA 1SCUA 2CNWA 3NU1A 3TUJC 1XCMA 1ACMA 3IAS1 3KSBC 4ZEVA 3D81A 1PD0A 4PSAA 1ULSA 5EFOA 3WBBA 1X7YB 2XIJA 5JEEA 4FEAA 4DDVA 2DRIA 2ZKLA 3KJGA 3MT7A 4B6GA 1ZKMA 2IXEA 2G09A 2H5LA 1A9XB 4O4HA 1RVV1 4JI6B 1UM9B 4MARA 3VYUB 1TM4E 2IV3A 4BNDB 1PT7A 1DX4A 1BFUA 2DQSA 3L6CA 1PZMA 3BCRA 4UBOA 3FOZA 2C2GA 5C5EA 3ZEAA 1VPWA 4LQ4A 1V8PA 2HLPA 1F20A 4AP9A 4PEVA 3LBHA 5AFSA 2H1SA 4D2IA 4TRMA 4DLXA 1E9SA 5JSZA 1JYEA 4DR5B 4JQOA 1VGQA 2OQVA 1Q1AA 3EHDA 3SYMA 3JD4A 2FQWA 1MVLA 2BFFA 2W7TA 2GM9A 4OQPA 1Z07A 3CNLA 4OXIA 3DVAB 4PYQA 2EJCA 4ZIRA 5LQKA 4NZYA 4G0PA 4RPCA 1HFEL 1NG1A 3OIUA 3LSTA 3L7AA 3QLJA 1P2FA 1R9GA 4CMKA 4Y2VA 1WUIS 4LG1A 1ST2A 3T7TA 3WR5A 1PUIA 2Q3LA 3FGOA 1HFWA 2VUIB 3DFUA 4ME6A 5CD9A 4K8OA 1ZIPA 5CT8A 4HNUA 2I1VB 3WTCA 5GTDA 4IHQA 3TZLA 1YHZA 3HJTA 5JMTA 4KR6A 3N0XA 3T0IA 3LHSA 3MHPA 4LXTA 4AWXA 2QTVB 1QYXA 3VSCA 4OK5A 2P77A 1OU4A 3W4JA 2WJIA 2P6MA 1QGDA 5B7GA 1PYGA 3DTYA 5AI6A 2JASA 5AVSA 1BXKA 1JNYA 1ZNXA 2W2LA 5REQB 2D1YA 4OIMA 3MW8A 4LISA 1XQVA 1YMVA 3NRJA 4Q3OA 1QM5A 4NDZA 3SZMA 1WCIA 2IYYA 2ZRKA 4L9AA 3SQMA 5AW9A 3OURA 2BKLA 1DQZA 1CVLA 2B1IA 3DQQA 3EFHA 1IJBA 2ZW9A 4LHXA 4LHVA 4XPIA 5AHWA 3JQFA 5B6IA 4CIAA 3M5CA 4L8VA 4NENB 4W1PA 3FHJA 1NBAA 3T3PB 1IBKB 1S2LA 1U7TA 1Y4AE 2FLWA 2PMFA 2ZRBA 2ODNA 3LGSA 5FAXA 3RVNA 3JVUA 3M1IA 3ACDA 2Y05A 3EVFA 5AI4A 3TLAA 3NX4A 2D8MA 3H4TA 3KZNA 4UAGA 3F6PA 2JFWA 1DTEA 3GMSA 2ZUBA 2QY9A 3ROKA 4PLHA 1ES9A 3ZH2A 1UPFA 5E9AA 1MJ5A 3H0CA 2GAJA 5I5GA 5LD2B 1YVEI 2VNHA 4KIFA 4XDHA 2H08A 5KZMB 4G25A 1HFJA 3CZMA 4QYWA 4G26A 4I1SA 1RXVA 1JTEA 3SQOA 3ZBTA 2QRVB 3R9IA 3CRMA 5JV5A 3VC1A 4FJ1A 5JDCA 2A92A 3WZLA 5JJKA 1BFDA 2BHRA 3EQ8A 1H2ZA 1WXQA 3C3DA 4L8YA 3FB4A 4YREA 4C89A 1CULC 4BVAA 1INLA 3PICA 4MR9B 5AJZA 4OOEA 1QYRA 1P3JA 1US8B 1XJQA 5KPJA 3V1TC 3IJ5A 5F64A 3W79A 1QFXA 4GD3Q 4WFKA 3ZHBA 1M2OA 2Q0SA 3JS5A 2FN4A 1ZGCA 3ZJVA 2VHJA 1GQRA 4RD4A 4GGOA 2IP1A 3HLYA 2QJTA 4MQ5A 5AO9A 2XYPA 3A6LA 1EX9A 4G65A 4LMBA 4L7QA 4D42A 1JDPA 3N2EA 1I9GA 4P34A 4B3HA 4E5NA 5KNBD 3TGPA 5A04A 2BGTA 2Q2VA 3CEJA 2O20A 4K9KA 1QZ3A 3WMWA 2V3CC 2XBMA 4ENWA 4BWFB 3O6VA 2IUYA 5I9SA 4ZEMA 3L8DA 1A71A 5IM4F 3KHUA 4BC1A 2DFLA 4CG1A 4EO9A 3ECCA 5BW8A 5AW0A 3AHGA 2VK2A 1AV7A 4X97A 3SMVA 1JDVA 2WTEA 4L07A 4OFBA 4RVSA 2IWRA 3T94A 2ZXEA 5AKIA 3SF0A 2JH8A 4P4UA 2OCGA 1RKQA 1UQTA 3KHKA 1BJKA 3BB1A 2A0XA 3L84A 1XC7A 5FBQB 5C8DA 2GPSA 2YWRA 1JQDA 2YZGA 3FPJA 1M5TA 4INPA 1B8OA 4E46A 3OOYA 2W6JD 2CCGA 2H5JA 1TU4A 1X1QA 4XVHA 3ZE9A 1NQTA 5CR9A 2QRGA 2PV0A 3HU2A 4P4GA 2ACKA 1VJ5A 4YO8A 1LF5A 1Q16A 2Q3HA 2ZYGA 2R6GA 4L4ZA 1Y8AA 4G3XA 5LUBA 2Z8XA 5HJ7A 4S0ZA 2RHWA 2UUBB 2O8NA 4AWAA 5I48A 4OI1A 3A9SA 1IPEA 2Q8QA 3TTTA 1G0OA 4GMDA 1UP6A 3OTWA 2PZBA 2X58A 2QTBA 1E79D 2WZQA 2VDMB 3G85A 4O02B 3TXYA 1U63A 3Q87B 2IPMA 2WD8A 2PRZA 2V6BA 4RTKA 2NV0A 1QRTA 2JRLA 1RC8A 1PEYA 1NGSA 2MMGA 4LZOA 1U8XX 2VP6A 1JDSA 4LYEA 5F7ZA 3TTVA 3VKVA 2FG6C 4CCWA 1R12A 3W90A 2NYAA 2FFRA 3I5AA 3QVXA 1RLMA 1YB2A 1K5DA 2COEA 4O2RA 4CM8B 5B1EA 3EY9A 2VNKA 1RWWA 2HPHA 1E0JA 3DZDA 4MR7A 1BXZA 5G40A 4XPZA 1V8BA 4X90A 2F3PA 4MMYB 4LJ8A 4FVTA 1UINA 3GT7A 4FS8A 5HDQA 2IT1A 4Y6RA 1RXCA 3CNHA 4K9DA 3T41A 5C53B 1CEYA 4GZMA 2R87A 1UM8A 4KAFA 1BKSB 3WMGA 2J5QA 4CMEA 1BROA 1Z0UA 3CZ5A 4KAXA 2BAGA 3AILA 2QT1A 4LZPA 1YMUA 4OCZA 3QK7A 4DIUA 4CKEA 4F8YA 4IEFB 1N7IA 1LDEA 3E70C 3GLGA 3TS1A 2PLWA 2GO1A 1P1CA 1PLJA 2HIAA 3R7AA 3G6KA 5ADHA 4OMCA 4TTSA 4QM7A 3PQ8A 3ZW8A 3OVMA 5EJMA 1Y6RA 2HU7A 3AW8A 4MA5A 1NE7A 2OZVA 3AY0A 1GFSA 5TMDA 5LQAA 2W83A 3AKYA 3WGNA 3IPXA 2O8EA 1VCIA 2J3KA 3N2LA 2AN9A 5CW1A 1U2PA 1RJFA 2VOEA 3AUFA 4NCHA 5FKJA 1DRJA 1U2EA 3DMDA 4EVSA 3H1BA 4PAOA 2AN3A 3GAMA 4PM4A 2FPOA 3G0DA 2QVGA 1JUDA 3DVRX 1UBMS 4K6KA 1DGQA 1P4HA 1FFDA 2FR8A 2P78A 2E1PA 3GLKA 3HCPA 3MXOA 1T29A 4GLLA 1JAIA 1R9MA 1USWA 2I3GA 3HYRA 5FLYA 3T4UA 2BUAA 3ZIUA 5BQFA 3FHOA 4M7PA 4KO4S 1DAFA 2BD0A 2XMZA 2FW7A 2CLKB 2ZBQA 2ZU0C 2BFCB 3ZW9A 3K1TA 3SBEA 1D2HA 3C98A 3TRIA 3ER6A 4FW9A 1J2JA 4HLQB 4E1BA 4D41A 2NP7A 2J9ZB 5KVQA 4TMKA 2DUWA 3AHFA 5CCDA 3QKTA 1RAGA 2H1CA 1EP1B 4GPBA 1TU0A 2HSWA 1ND6A 2IC5A 1ANKA 3FNQA 2LIPA 2QNRA 2VYFA 5LP6B 4ZEXA 4KE9A 2Q7OE 1ISPA 4XJVA 5JAMA 4L75A 4JQZA 4MB0A 4OFZA 5PNTA 3KWFA 4X41A 3WISA 4TWZA 3DP9A 4NWIA 4XWYA 1V6CA 3C74A 4HH0A 3QWIA 4FFRA 1PFUA 4BRWA 1NXSA 1V11B 3G9XA 3HUUA 3U7IA 3U37A 1HQCA 2GMWA 1HV8A 3NH9A 4KQ1A 1CIJA 1J2RA 2ZOSA 3V1NA 4B3GA 4UCWA 2JVJA 2CMDA 2PQMA 4YUVA 3RADC 5TNXA 1R3DA 2NZJA 3VUEA 4F71A 3R44A 5BUSA 2XR1A 1GTZA 2RH9B 1J09A 2DTEA 1TRKA 3HJAA 4LVCA 2P2SA 4DA7A 3G7UA 1N2OA 3IVGA 3NTQA 1O96A 4O1IA 2JB9A 4OHMA 3OE7D 4GLFA 4IFEA 2K7FA 3PDJA 1I51A 1SVWA 1ENPA 2NTJA 1WIWA 3ML1A 2O06A 1KYQA 3CO5A 3DBHA 2C3PA 2FB9A 1TUBB 2NYUA 4RHEA 1OAKA 4IMIB 3H4VA 2G08A 5K2MA 2QMZA 3H8WA 1RI5A 2J3EA 4DUYB 5CU7A 1NW8A 4L4YA 3PD0A 1XA3A 3NWJA 4I1UA 2HK6A 2MSLA 3C1AA 3OPMA 3L8MA 4N8SA 2YIJA 4KMRA 3VYSB 1T5OA 2XUOA 2I71A 3ONWA 1XTSA 2YHSA 3UAXA 4BNYA 5ALEA 2XWJI 5JPDA 3TVTA 4QXPA 2BH2A 3RBXA 2OVBA 1G21A 1QH9A 2PMKA 1TM3E 4CMAA 5AM4A 4V39A 4BKQA 4UHBA 4Z4CA 1U8CB 3ZNNA 5EVJA 5J4LA 3GLIB 1C9DB 1WSDA 1Z5UA 2B8JA 3DZCA 2G1UA 1KR5A 3B2QA 4HD8A 4OQLA 5ERYA 2YWXA 3OJWA 4JUDX 2X7XA 1J33A 3UK0A 1H9AA 3C6BA 3PUHA 1CF4A 3U26A 4WADA 3L0YA 3NFRA 5A5FA 3UMJA 4H60A 3R5XA 1P2BA 1D2EA 4PLTA 3F2IA 3PGVA 5H81A 1MN6A 1N5RA 3S8EA 3BF7A 3HDQA 5CNMA 4KKXB 3ZY2A 3DZJA 3G2PA 1Z88A 2P9JA 3JR7A 3ZGVA 4B8ZA 1DC3A 1IM5A 1TUGA 4KXYA 1M5RA 1YQEA 3VPFA 1T6YA 3GGOA 4P4NA 5IUNC 3H5OA 1P77A 4CLHA 1EM8A 1FYDA 1NBEA 1NNI1 2OC4A 2O9JA 4OQEA 5BMVA 2XQKA 4QD3A 5BSVA 3NH6A 3FOFC 1AJEA 1H94A 2DLNA 2ZQ5A 1WZCA 3A6GA 3GP3A 3DNFA 4RSHA 4EY3A 4HGYA 4I55F 4LNHA 5K6RA 3F71A 3O4HA 3A7DA 1HQDA 1QHGA 1E6LA 2A9JA 2J67A 5CVVA 1YQDA 2BCGY 2YFKA 4ZAWA 2PM8A 4FD3A 4TXLA 1B4DA 4ZVOA 1WOMA 5JADA 3K1YA 3IQIX 4U5QA 4ECAA 3NV9A 4AYTA 3GU3A 5KO2A 1ZIOA 1ZCFA 2QXUA 4O2AB 3K20A 1O9GA 4M7WA 3PX7A 3DO5A 4LDZA 4DA0A 2JLSA 4BYGA 4CN9A 4FU0A 4IKEA 4BP9A 3KR9A 4I9NA 4U5XA 2VC2B 2E89A 3IPRA 1RM5A 3P9PA 3OWHA 4C4SA 2IZ1A 3NGMA 5F78A 2XOXA 2PMEA 1CRLA 3WFIA 4L95C 3W8RA 1ODLA 2WWXA 3DVQX 4CMJA 4H3HB 5JS8A 3T5GA 4FMDB 2HQOA 2Z3VA 3TPCA 3KBOA 4YP7A 3V4RA 2VI5A 2X8JA 4L8FA 1J2UA 2PUHA 4PIPA 1XF9A 3K7EA 2GJ8A 4KCGA 2D1RA 2VJKA 3DBRB 5D2CA 1H0KA 2HSEA 2QTFA 3CUUA 3WVNA 1H22A 1HH4A 2H6EA 3P97A 3RSSA 1DIAA 1FZQA 1PL6A 2ODBA 2WAMA 3UHPA 4J0KA 3B1WA 2C2HA 3IEIA 2FPLA 1ENYA 3FFWA 1P72A 2HL6A 1X94A 4R40A 3ZDDA 1IWOA 1X3LA 3HPRA 4EGQA 1DEHA 4DIBA 1P31A 2QMHA 1N8KA 2BP7A 4IEEA 3F8WA 3QE4A 1W8DA 2J0VA 2PGXA 1Z2DA 2RGGA 2E9SA 2Y3IA 4N6NA 4PNZA 2QRPA 1ESCA 2DR0A 2JZOA 1M0SA 5CX1A 1YB5A 3MYYA 5FCDA 2GEJA 3LT4A 3HKEA 3OQIB 1GGFA 1FTQA 1ZSYA 3SJAA 3TR5A 4HPWA 1PDVA 5C5IA 1BWQA 1NVKA 2P0YA 2ZPTX 2B78A 2VEOA 4KU4A 4MVJM 1VG9B 3TQOA 5LM3A 3TRKA 3OKCA 1U81A 2PJUA 3QFTA 2YFYA 2WTXA 4ZDIA 2Q3CA 1RZUA 3LUKA 2IYTA 2Q7XA 4PANA 4KFCA 1YQUA 1BYIA 3ROZA 2PMDA 5KHLB 3GLQA 2G04A 2WKQA 2OSBA 3H1TA 4D8VA 4DCOA 1H4QA 4B8WA 4JU8A 4PZPA 1MU0A 1RYBA 4HDMA 4KQ2A 2BE7A 2WT9A 3WLOA 4POOA 2IFTA 2O54A 2BFMA 4AZ3B 2ZAMA 4PCUA 5M34A 5JU6A 5CCXA 1NN5A 2HWWA 2XNDA 4XFJA 3HXPA 2C0PA 3ZOKA 2BKUA 2VA8A 1FDOA 1Z8HA 3WL5A 3DV0B 2FWIA 1XEAA 1ZM2A 4HEQA 4FMBB 4HO1X