6LDHA

Refined crystal structure of dogfish m4 apo-lactate dehydrogenase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
329
structure length
329
Chain Sequence
ATLKDKLIGHLATSQEPRSYNKITVVGVGAVGMACAISILMKDLADEVALVDVMEDKLKGEMMDLQHGSLFLHTAKIVSGKDYSVSAGSKLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKHSPDCIILVVSNPVDVLTYVAWKLSGLPMHRIIGSGCNLDSARFRYLMGERLGVHSCSCHGWVIGEHGDSVPSVWSGMNVASIKLHPLDGTNKDKQDWKKLHKDVVDSAYEVIKLKGYTSWAIGLSVADLAETIMKNLCRVHPVSTMVKDFYGIKDNVFLSLPCVLNDHGISNIVKMKLKPNEEQQLQKSATTLWDIQKDLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined crystal structure of dogfish M4 apo-lactate dehydrogenase.
pubmed doi rcsb
source organism Squalus acanthias
molecule tags Oxidoreductase(choh(d)-nad(a))
molecule keywords M4 APO-LACTATE DEHYDROGENASE
total genus 100
structure length 329
sequence length 329
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1987-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 6ldhA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 6ldhA02
2HMUA 3NGLA 4NHEA 1B26A 4II3A 4RZIA 5FF9A 1I3MA 1XQ1A 3ZH2A 3VVBA 3VZQA 3VKUA 1E92A 1GCOA 2IZ1A 5AYVA 5G4KA 4AICA 3G49A 4ALNA 2DU8A 2O3TA 1PGOA 1Y5MA 5EINA 5JCXA 2BH9A 3S55A 4GLLA 1QRRA 4CPDA 2NACA 4O1MA 3PHHA 1CEQA 4L4SA 3UXYA 1YOVA 4Z0HO 3GEMA 5EESA 5A1TA 3RIHA 3UCXA 2QYTA 2C20A 3DHEA 2J3HA 4BO4A 5KJCA 1YH3A 1VI2A 2GR9A 1Q0QA 4IJWA 3HDQA 3CTMA 2PZKA 3LC2O 3N74A 4L4XA 4BNGA 2FHSA 1DO8A 1IL0A 2Y67A 1KS9A 2EIHA 3E9MA 1U4OA 3NDIA 4ZN6A 1X1EA 4J9UE 3EHEA 4HFNA 4DIFA 1Q0HA 1O89A 3PJEA 3JYQA 4AJLA 1LLQA 2Y1DA 3AY3A 2FSSA 1WDLA 2NQ8A 1PSDA 3OFSA 4WLOA 4BOYA 4J1NA 2VHYA 3R3JA 3BAZA 1Q2XA 1UDCA 3RUIA 3H9EO 1UH5A 3SJUA 4RF2A 4YT4A 2EGGA 1XGKA 2OHXA 1I33A 2O3SA 4H7PA 4RORA 4CM8B 2QZZA 5ICMA 2DM6A 4UULA 3GDGA 1C1XB 4AJOA 1DLJA 5BSEA 3RKRA 3RUEA 1I8TA 2CSUA 4W7IA 3M2TA 1DOHA 1IE3A 5F3RA 4J90A 4WUVA 2PH3A 2PZMA 1OBFO 3DBHB 4I08A 1ZSNA 2W90A 1VSUA 3INTA 3E6AA 5F5LA 5EIOA 3DL2A 1LQUA 1EE9A 1PX0A 2CMDA 1VSVA 4BB6A 1N1EA 1DAPA 3OIGA 3DR3A 3NDRA 2W4QA 3MJTA 5B1YA 2VUTA 4YJHB 4E0BA 1SB9A 1OC2A 1RPNA 3F4BA 2ZB4A 2CVZA 4DA9A 4A03A 3MJCA 1HDYA 4J2OA 4OOFA 1PGJA 1X7HA 3WTBA 2D59A 4I8XA 4M89A 5LDGA 3I3OA 4IMRA 2DT5A 5BNIA 4E30A 4E2XA 3PWZA 1BDMA 2Y05A 3AOEC 2EXXA 3RFVA 3GVHA 3DXFA 3AUUA 2HSDA 4E3ZA 1UXKA 1AXGA 3F1KA 1DRVA 3HB4X 1NAHA 4W9NC 4HX5A 2G1UA 1JA9A 1D4FA 1A5ZA 4FN4A 1PTJA 3KETA 3H6KA 5TQVA 4MKZA 4I9NA 4E5KA 3JCZA 3ICCA 2RCYA 3GUCA 4YT8A 5CDSA 3OIDA 3AWDA 4GX0A 2DUUA 3ADPA 5CG2A 2GUGA 1ZEJA 2ZTLA 5IF3A 4Q3BA 5JMWA 4UUPA 5JDCA 4GMGA 1U3WA 1T2AA 3PPIA 4O0LA 4FDAA 5CPBA 4YWJA 3ZU2A 3QWBA 2AG8A 5IDXA 1DC3A 5A9TA 1P77A 1E1MA 1LU9A 1N2SA 4YQYA 2LDBA 4RPKA 2Y0CA 3UH1A 1PGQA 1XDWA 1PJ3A 3PFWO 2Q2WA 1G0OA 2IEDA 5A05A 3VDRA 3KBOA 4WOJA 3RBVA 4AJNA 3HG7A 3ROMA 3LDHA 3GRPA 1VLLA 3TWOA 4M55A 4N54A 2J3IA 1PR3A 2FZWA 4BHTA 5CP8A 4IZHA 5DF1A 1RM3A 5DOVA 2V6FA 4LN1A 4B3IA 1E3EA 1C0IA 2C59A 1P1RA 4LRSB 4XQEA 4FFLA 5K6AC 4RLSA 3WYEA 3PIDA 4EBFA 3AOEA 3BMQA 3BIOA 5F1OA 3KVOA 1CERA 2IODA 3CZRA 1ISJA 1EK6A 1QR6A 2PD3A 3O8QA 2R00A 4GI2A 4KWIA 5I7SA 1LA2A 1DJNA 4PRKA 1B3RA 4PLZA 1YL6A 2C7GA 3WLEA 3SC6A 2DLDA 1OI7A 4BO6A 5DCWA 3B70A 3DBRB 3E5MA 5DP1A 4D7AA 2DTDA 2AW5A 3ROQA 5JC1A 4KDEA 2C2XA 3LSYA 2H6EA 3QVXA 1MG0A 4S3MA 2G82A 3L9XA 3HQ4O 4MINA 5JXWA 1T2EA 3ONFA 1AUPA 5HA5A 1EVJA 4RVHA 3MJVA 4D79A 4HY3A 3LF2A 4HNGA 3VH1A 4FJ2A 4J1QA 4YT5A 4XR4A 2NVBA 3PQEA 4Z0TA 4FD3A 3RQSA 3T7EA 4R16A 4KUHA 3OF2A 1DLIA 2ILTA 2NUAA 1DFGA 2AG5A 4JGBA 4R3NA 3WLFA 3FPCA 1GEEA 4NBUA 1DXYA 1I3NA 3HB5X 1M67A 1O95A 1WPQA 3MZ0A 2Q4BA 1B14A 4A5OA 3I9OA 4JJGA 3W8DA 3DWFA 3AI1A 3C85A 2X4GA 4Y98A 4ALJA 1KIFA 1GV0A 3CIFA 4Y6RA 4YJHA 1A4IA 3SXPA 4B7CA 1NP3A 1SEVA 3WIDA 4K6FA 3TRIA 2EERA 1U5CA 3KSZO 4AJ1A 1HE5A 2Q1TA 3MOGA 4MVJP 4A7PA 4LVCA 4E12A 4HFJA 3WOHA 5KIAA 1JWBB 3JQEA 5CDUA 1M75A 4CQLA 6ADHA 1ZNQO 3NX4A 2PA3A 3PHJA 4IGEA 4YAIA 1TLTA 1E1LA 5IXSA 2GN6A 3D4PA 3PI7A 3JTMA 1PJ4A 3KSUA 4CMIB 5A9SA 4CM8A 2YQ4A 1GUFA 1AHIA 1JKJA 4RVSA 2O7QA 1O8CA 3C7CB 1E7YA 2VT3A 4KDFA 1H2HA 1KC3A 1V3TA 4MIYA 1PL7A 2ZK7A 3C24A 1KC1A 4J0EA 5JLAA 3WQRA 4B4VA 1UDAA 4LRTB 3M1AA 4RQUA 3V2HA 1OC4A 4BS9A 3DO5A 3DOJA 2Y1FA 3NT2A 1NNUA 4OXNA 3EVTA 4ND1A 4PG4A 4XD2A 3WX0A 2OZPA 2ZTUA 3NT4A 3QIVA 3PDJA 1NPDA 1UXJA 2UYYA 2VUSA 3G79A 4Y8VA 1UXIA 5G0UA 5L4NA 1KETA 2DBRA 1Z6ZA 2IXAA 1X7GA 5A02A 5I8ZA 4PGFA 3H5AA 1H6CA 3AU9A 3O26A 2AXQA 3WGHA 2C2YA 4GX2A 4PLYA 4WPGA 1HE4A 3DAFA 5F5NA 4FFPA 3JYPA 1K6XA 1NFRA 1Q1NA 4BNNA 4P8RA 2O3JA 1HDXA 2JAPA 3ANNA 3NV9A 3ENKA 3FRJA 4QX6A 1R4MB 4MVJI 4D42A 4DPMA 3GNQA 2Q50A 3IQDB 1IOLA 3HDYA 2X7HA 3ICPA 4L74A 3JQCA 4AL4A 1U5AA 4J91A 2DBQA 1PQWA 3DMTC 1OZAA 3K31A 2W2LA 1Q7CA 1QLJA 4F46A 1HKUA 2GZ1A 1C0KA 1P9LA 2XXJA 5I7EA 3PYXA 2WE8A 4PZEA 2Y0EA 4CQMB 3DOCA 4PFJA 3ZHZA 2XXBA 1EQ2A 1U7HA 2WD8A 3VH3A 5DBFA 3LC7O 4LVUA 3MJ4A 4LMRA 3CMCO 1H93A 5JDIC 1A72A 1YS4A 3DZGA 5IG2A 3EW7A 3VPFA 4OQYA 4BNWA 2V6BA 3ZCXA 3DOOA 1XQ6A 1VL6A 4P4LA 3JQFA 4HWKA 3S2EA 4YRBA 4ND3A 1ONNA 3MJSA 3D4NA 4RVGA 4A2CA 1ZKMA 1EQUA 2B37A 2Q1WA 2VWQA 4WCDA 2EEZA 2YHIA 1JN0A 1LDYA 3ZI0A 1V35A 4YRAA 1BW9B 3FN4A 3PJDA 3RSHA 2JCXA 1ZFNA 1DFHA 3V1UA 3WYBA 5A3VA 1XHLA 2IZ0A 3KZVA 3RAJA 4I9HA 4B8WA 4EJ6A 2A4KA 3I9LA 3I9NA 4D46A 4BKQA 1CIVA 3QJ5A 1MGOA 5T8KC 1A7KA 3U0BA 1J0XO 4LK3A 4XX0A 4DWVA 2DQ4A 4OHUA 4QUKA 3FD8A 1VJ1A 1ZK3A 2AQKA 1E77A 1GR0A 1QYCA 4RVDA 1B2LA 4N7RA 4PG6A 4EUHA 1XCBA 4XA8A 1DDOA 4CV0A 1YB4A 3EY4A 5JW6A 4IDDA 2NU8A 1LC3A 3OM9A 2GGSA 4BNJA 4CMAA 5GZ3A 2P2SA 4CMIA 3I6IA 2O48X 3TOXA 3W8EA 1AHHA 1PL8A 5TT0A 2UUPA 1XU9A 2Y1EA 4NFHA 2ZKLA 2YUTA 4EI2A 4INAA 4R68A 1IPFA 4XRRA 5TF4A 3T4XA 4ALMA 5KJEA 1MC4A 1TT5A 3E9NA 4PIVA 4IY1A 1XG5A 2ZATA 2ZCVA 3QSGA 4TZTA 3LC1O 5ITWA 1U2GA 3RROA 2Q2VA 4D3FA 4D43A 1QG6A 3QLJA 1GQYA 1R16A 2A94A 2WMDA 3WYCA 3I52A 3JD2A 1DIAA 3F5QA 5C3MA 5MGBA 2Y1CA 2GRAA 3L0DA 4BNYA 3AFMA 3DFUA 4CLRB 4DBZA 3ROPA 3VC7A 4GMFA 3DQPA 3INGA 3GVXA 3PIIA 4J16A 1GD1O 4TRMA 4G2NA 5IAAA 4OXYA 4FFNA 4ESOA 4M49A 2NTJA 3FWZA 4WNCA 2X23A 3GPDG 3F1LA 2I99A 3HDJA 3L9WA 3EAGA 3OBBA 5ER9A 5JAIA 4QO8A 4RJTA 3GVPA 4XDYA 5B37A 4TKLA 2QIOA 3GG2A 4AJPA 2QG4A 3FHLA 3I9JA 4BV9A 5CAEA 2GNAA 1PL6A 3AI3A 4TQGA 1TI7A 1NVGA 3V1YA 2J8ZA 4TRNA 1BWSA 2P91A 1LDEA 4GX5A 3ZWMA 4WCFC 4CM3A 3GHHA 1ZK2A 1E6UA 5THKA 3UOGA 2AEJA 1LLCA 2E49A 2C0CA 3DHNA 1LNQA 2C7VA 2I5PO 5LCXA 3RBXA 1ZIDA 5FI3A 3KLPX 2YHIB 3OH8A 1SZJG 5A3JA 2FZEA 2VQ3A 2OP1A 4CM4B 4R5MA 2NU7A 3DBRA 3KEOA 3U3XA 4YDRA 4PLFA 3FPLA 4NNJA 1NWHA 1Q7BA 1SOWA 5L45A 3WWZA 1MXFA 3NDJA 3LU1A 5DBIA 5HRUA 2GD1O 2OXIA 3C7DB 5L53A 2GYYA 4MVJD 1PJTA 4K28A 2BRUA 4WGGA 3C8MA 1LC0A 3P2OA 5CDGA 3ANLA 1NVTA 4W6ZA 2IEBA 1YL5A 2G76A 2FRDA 1LDBA 4KQWA 1AGNA 2J3KA 1ENOA 3EVNA 5I9NA 2IRWA 3HUDA 4W9NA 3H9UA 2CY0A 1TEHA 1WAMA 5KOIA 2VYVA 2XAAA 4BKUA 4ZVVA 1KERA 4P38A 1QYWA 4M54A 2Y1GA 3GEDA 3AOGA 3L4BA 5DP2A 1Y5RA 1EFKA 4LMPA 2CDCA 3Q3CA 5EL0A 5EN4A 4CQMA 4CLXA 1PGNA 4OM8A 2B5VA 3N58A 1P33A 3IOYA 1J4AA 1O9BA 1R4MA 4OKIA 5JDCC 3S8MA 4UEOA 2GPTA 5K9ZA 4XWYA 2NVUA 5EQDA 4WKGA 3DDNA 3H8VA 3WG9A 1WDKA 1WWKA 3NRCA 5COBA 2FR0A 1YRLA 5A4DA 1I30A 4PCVA 2OBYA 1D8AA 1HZZA 3FSRA 4WASA 4I5EA 2EP5A 1LQTA 5KVQA 5C5IA 3G1UA 3OA2A 1FJHA 1D7OA 3OQ6A 1ISMA 2J5KA 1P1HA 4UVHA 2PWZA 2D8AA 4BO9A 1YGYA 4WLUA 2HJSA 3OQ1A 3CINA 3I83A 2JL1A 3PZBA 3WXBA 4DGSA 2POQX 3EUWA 1UP6A 3OMLA 5DDIP 1EK5A 2P9CA 2NVWA 3DONA 1LSOA 2GSDA 1PU2A 4UAGA 1EEHA 3PQDA 1ZVMA 5DCYA 5TIIA 1NPYA 2YFQA 2ZTVA 3L4SO 3CKYA 3IKVA 3O9ZA 3GZ4A 4W7HA 2R00C 2NVUB 4J43A 8ADHA 3ZV3A 1E0DA 3JD0A 4RPGA 5JAQA 2E4AA 1QV7A 2GASA 3E9QA 2VRCA 4JN6B 2IZZA 4CM6A 2DBZA 3V2GA 1MV8A 2PY6A 3E82A 2VWGA 4RGBA 4TWRA 1VKOA 3KB6A 3NTOA 3BMCA 3JQAA 4ZQFA 1P44A 3BXXA 3OJ0A 3O38A 3HFSA 2HK8A 1WW8A 3PGXA 1X0VA 3IDSA 3GY0A 4PZCA 4PG7A 4DYDA 4NK5A 4FIZA 1P31A 3A1NA 1RM4A 2JD1A 1RM0A 1VKNA 2DC1A 3DZFA 4BMSA 3HFGA 1EUCA 1RM5A 1YE3A 1SOVA 1M76A 5EPOA 3AY6A 3PJGA 4RF5A 3UHAA 3WWYA 3NUGA 1PJQA 3P5SA 5FEUA 4R41A 1U8XX 3LLSA 1U3UA 3GAFA 3B1JA 3TSCA 4NK4A 1WXDA 2OL4A 3ZW9A 4J4BA 3ST7A 3SVTA 4CMCA 4N18A 3WGYA 3W6ZA 1O5IA 2VZ9A 2WTBA 3JD1A 2E48A 3IP3A 2Q4EA 4IMPA 4ZQBA 4E6PA 4MP6A 1MFPA 1R0KA 2C54A 4NU5A 2X0IA 1P1JA 3IUSA 3R1IA 5JNLA 4C4OA 1LSJA 4FGWA 3KEQA 3RASA 1I36A 2BFMA 2NADA 4CM9A 4HXYA 4L0QA 1G1AA 1WZEA 4FFRA 1AE1A 3OHSX 4MJLA 5I7FA 4OYRA 4CJXA 3U4CA 4F3YA 3SLKA 1IYZA 1JVSA 2FPGA 4M1QA 3WMWA 5C7OO 4YAEA 4JJIA 4YRDA 3ZHYA 1VJ0A 2JCYA 4HP8A 4UVDA 2PD4A 3CSDA 2JJYA 4FFMA 4MVJM 5A9RA 1N5DA 3H65A 1E3SA 3PLRA 4H15A 1R0SA 3KYBA 3DAGA 2P5YA 4D45A 4OKNA 2NTVA 5CDTA 4DYVA 4C7KA 1XEAA 1CDOA 1L7EA 1FDUA 3EYWA 1Z75A 3AUAA 3RCBA 4CLDA 3A14A 1GAEO 2HKIA 1UUFA 3GVIA 4L76A 4EUEA 1LJ8A 3M2PA 1PS9A 3ROKA 1FDSA 2B83A 4TRJA 1SB8A 4KUEA 4UVIA 2WJPA 3JQAB 4J4TA 2DTXA 4XYGA 4XYMA 4DIBA 5CEFA 1VM6A 1EBFA 2OOSA 1O6ZA 4E2ZA 3SLGA 2AQIA 3JQ9C 3U5TA 5H81A 2A92A 4R1NA 2VNAA 3KXDA 3WGGA 4AVYA 3GFGA 2NNLD 5TRTA 2QHXA 1WP4A 1ZK0A 2EHDA 4E2WA 1IUKA 3EC7A 3GK3A 3ONDA 4ZA2A 2JFFA 1LEHA 2D5CA 3FNHA 4J2HA 2BFPA 5BR7A 2X0JA 4K1LA 2Q49A 1U4SA 3R0IA 3VPHA 2WD7B 1KYQA 1CYDA 3JQGB 4RVFA 4GVLA 1O0SA 3F4LA 2YHUA 3D3WA 3KO8A 3JQGA 5ILOA 2D0IA 2C29D 3LLVA 4TRRA 2BD0A 1YQGA 1YXMA 1CWUA 3BZUA 4NFSA 1XIVA 2B69A 3GC6A 5KKAA 3UFXA 4BGVA 3PJFA 4IDAA 3IAHA 3QVWA 2PV7A 2X9GA 5BSGA 1FXSA 5JDIA 3A4VA 2H5LA 5B4VA 1R6DA 2QZ9A 5T6BA 3F5SA 4R1UA 3FTPA 3TZHA 4ZHSA 1U2DA 1GYQA 4D3SA 4C7JA 2JD2A 1HL3A 3JQ6A 4QXMA 4GL4A 3P7MA 4YR9A 1HF3A 4YA6A 4RPHA 4BO3A 1KVUA 5KJ6A 5TSDA 5ENDA 1K0UA 3Q2IA 4WJZA 5L51A 3CZMA 3JQ9A 4BB5A 3RBZA 3ZWAA 2HMVA 4XEHA 2OGUA 3I5MA 1DPGA 1SNYA 2ZJ0A 3DBLB 2Q3EA 3H9JA 3TZ6A 4F45A 3KM0A 1VL0A 4XQGA 3JQBA 4JBGA 4UUOA 1N7GA 1VPDA 3WGTA 4B7UA 2NWQA 4BGUA 5KVVA 1DEHA 1XYGA 5IZ4A 1CJCA 1M6HA 4NG5A 3TFOA 2B4QA 2JHFA 1R12A 4BNTA 1P74A 5DNAA 4FJ0A 3H9GA 4J7XA 4Z9YA 1DHRA 3H4VA 4BKOA 1Q0LA 4AG3A 1IPEA 3EZYA 4FS3A 4IZIA 1Y8RA 4IDGA 4W82A 4WOKA 1JWAB 1SO8A 4BNZA 5I8WA 1H9BA 3ABIA 1A71A 3CEAA 1IHYA 3LK7A 2VZ8A 3RU7A 4CUZA 4XB1A 4DC1A 1WVGA 2AE2A 1GPJA 1PJ2A 3IP1A 2HRZA 3W4IA 2V7PA 3QW2A 5KKCA 1ZSVA 3OIFA 4D44A 1I2ZA 4OIMA 3WSVA 1T4DA 3NJ4A 5HS4A 4IUYA 2EW2A 5BNTA 3WDSA 3ADOA 1PWXA 1H6BA 2WWRA 1YONA 1GTMA 3L77A 3D64A 5AXBA 3CH6A 2I76A 2HMWA 1GYRA 1NQ5A 2C5EA 4XYBA 1N92A 3GFBA 4ZQGA 3ENNA 2GZ2A 4FBGA 2Y68A 2RBEA 2O2YA 1ZEMA 2AA3A 2OO5A 1E3WB 5BNFA 3KOUA 4ALKA 1FMCA 1GUYA 2HLPA 1QYDA 2RAFA 5CEEA 3GHYA 3WJAA 1E3LA 3X2FA 4BQPA 7MDHA 3PHGA 3DTYA 3QA9A 1Y9AA 5I7VA 1Y9EA 2J5RA 4A73A 3GR6A 4WCFA 4FFOA 2CNBA 2X5JO 4YJFB 4DLAA 5AOVA 5L7YA 3AW9A 3FF4A 1DRUA 1ZSYA 5L9AA 2P5UA 1CETA 4QECA 2XF8A 2YFHA 3E5RA 4R1SA 4MP8A 3I23A 3JD3A 4YTEA 1DC4A 5ITVA 1K3TA 1ZK1A 4J49A 1QXSA 1ZJZA 4KZPA 2NQTA 3MOIA 1IHXA 2WYUA 4Q3NA 3AUTA 3FR8A 5CPFA 3JQ8B 4KP7A 4BO5A 5K6AA 1D1TA 4R69A 2P9EA 4DUPA 1PZFA 3FNEA 1YKFA 4NJOA 4YJGA 3ZWNA 2HO5A 4D3DA 1J49A 1QLHA 4XRGA 1NQTA 1BGVA 3MTJA 4LSMA 3I9KA 4OJNA 3NAQA 3WSWA 1SCUA 3K73O 3WTCA 2W2LD 5T64A 4PRLA 1PJBA 2X0RA 4IM7A 3PEFA 1E3JA 3WQSB 6LDHA 1UXHA 3I9MA 1BW9A 1EUDA 3D3WB 4P4NA 1DIHA 4OH1A 3F9IA 1HYGA 1I24A 4ALLA 1OAAA 3KHUA 4Z6KA 5ADHA 4EYEA 4JXKA 3ZU5A 3R3SA 3L4BC 2JKVA 4EJ0A 4N5MA 1E5QA 1NQAO 1IZ0A 4E5YA 1HDCA 3FCOA 2VRCD 4DRYA 2V6MA 4GKVA 4AJEA 1ORRA 4R1TA 1ULUA 4Z0PA 3WQQA 2ZQYA 2Y99A 2X58A 1LDMA 1MA0A 3O8QB 2Q2QA 3TOZA 4ZRMA 4PZDA 1S7CA 4DL9A 3GF4A 4YACA 2Q45A 1XWFA 2GERA 5A9SB 1NPTO 1G0NA 3WB9A 5KNLA 4TVBA 2OUIA 3RUHA 4BVAA 4CMHA 3H5RA 5CFZA 4OSPA 1GFSA 2O7SA 4YAKA 2LDXA 1NR7A 1LLUA 4B79A 1N1GA 3HJAA 3RJ9A 2WM3A 4RVUA 3JD4A 1NFFA 3O03A 4RPJA 1YJQA 4ZD6A 1TT5B 4PLVA 1GDHA 3IKTA 4BL5A 3QWIA 4BNXA 2BFOA 2HRBA 4JP2A 1K2WA 3QWFA 3DB2A 1YB1A 1PR9A 5IFLA 4PLWA 4NH4A 1NAIA 1ID1A 1CF2O 2GZ3A 2GDZA 1JKIA 1DC5A 1PQUA 1EVIA 1U3VA 4TROA 1TVEA 4I5DA 5CHEA 1HXHA 4F6CA 4O5OA 4UEKA 1W0CA 1R15A 4HFMA 3OICA 3WIEA 1KVQA 4IQ8A 3GZNA 1BXKA 5EMHA 4FC6A 4XDZA 1PS8A 4EUFA 2VCYA 3WNQA 1ARZA 5HS6A 1IY8A 3DMTA 4MVJH 3BTVA 1QSGA 3ITKA 1VRWA 2WYWA 4ZRNA 3W6UA 4E5MA 3JQDA 2EWMA 2ZIZA 1ISHA 2FN7A 2YY7A 4B3JA 3GQVA 2W8ZA 4F6LA 1S6YA 3DFZA 2Z1MA 3GPIA 2ZYDA 1F8GA 2AEMA 1YOVB 4PLTA 4E5NA 5IN5A 3GGPA 5F21A 4XR9A 4FC7A 2PTGA 1R37A 1YQDA 5KJ1A 1Y8QA 4ZGWA 2B0JA 4FGSA 4NBTA 3PWKA 3GGGA 4ZICA 1VJTA 2YV2A 2R2GA 4XIYA 5JCJD 1WZIA 1W4ZA 4K26A 3GGOA 3JQ7B 2BGLA 3WMXA 2UDPA 3IS3A 4TSKA 2VWPA 1KBZA 4JCOA 2YDXA 5ICSA 4R4JA 1BHSA 1H94A 4J7CA 4R9RA 4Y67A 1B8VA 3A06A 1PEDA 5IZCA 2A9FA 4IDBA 3E8XA 3NEPX 2DPHA 5I9MA 5KVSA 4PLHA 3TZKA 2QRKA 3S2FA 4XB2A 3K2BA 2UAGA 1QORA 5TS3A 3ZDFA 3GA0A 2OORA 5A5EA 1SAYA 4DC0A 3L07A 4WEQA 2CDAA 2FOIA 1NTOA 5TJHA 4NJMB 5FFFA 1B15A 3ZN2A 1PS0A 3UKOA 4GH5A 2D1YA 2OP0A 2RH4A 1EFLA 2GLXA 2O3QA 3PK0A 4KOAA 4UUNA 4JROA 2JAHA 5ENVA 2EF1A 2G0TA 2HK7A 3LZ6A 5B4TA 1UDBA 1V8BA 4MIEA 1F12A 5C7LO 3FNFA 4RDHA 4O59O 4W4TA 5HTOA 1I0ZA 1N7HA 1HDRA 1N8KA 1T24A 3RC2A 1KVTA 2PD6A 1GZ6A 5DN9A 3RUDA 3WNVA 3QQPA 5L7WA 1Q7GA 3TJRA 4GSKA 4FR5A 4KMSA 2ET6A 4CR6A 1MB4A 4ONEA 1ZO8A 1NASA 3LF1A 3E18A 4A10A 4NIMA 5TJ9A 4FSHA 1WMAA 1WNTA 1NWCA 3WJ7A 1A9ZA 5B4UA 4MVJF 4DIOA 2VZ0A 4BUCA 4E4YA 1WLYA 4HV4A 5GMOA 1XU7A 3TZQA 4PLGA 3VTFA 3ZWXA 4EJMA 3B1KA 3NTRA 4IINA 1HE2A 1ULSA 4CMEC 4L4RA 1P3DA 3GRKA 4NQZA 3T4EA 4G65A 1YDWA 1BTOA 1LRJA 2B36A 3RWBA 5T8KA 4I1IA 4M87A 1ISIA 3ZU3A 1GZ3A 5HBRA 3PYMA 3D3EA 3M6IA 1XSEA 1HYHA 2HAEA 4XYEA 4PVCA 1PJLA 5KJFA 1NFQA 2QYSA 2YQ5A 4P22A 4J9VA 4IJUA 4CQMD 3GNSA 1XLTA 3BMOA 3QVTA 3EZLA 4Q3EA 4LISA 4BNVA 5C37A 3ETGA 2VWHA 3TDKA 2DPGA 4WLFA 5TLSA 4DVJA 4CMJA 1X14A 2Y0DA 3WFIA 5IJZA 1ZZEA 2ZB8A 5I9LA 1KEUA 3ZWVA 4Q9NA 4YEDA 4DBVO 3E1KA 1E7QA 4IJVA 1GEGA 1Y1PA 2X9VA 3DZKA 1NVMB 3QVOA 1W73A 3CXRA 1GYPA 4J1TA 3BTUA 2FR8A 1R4NA 3AK4A 3OA0A 5DBGA 4GVXA 1Y81A 4UVGA 4ZJUA 2X1HA 4XQCA 1TXGA 3ZHBA 4AJ2A 9LDBA 1MFZA 1PWZA 1LTHR 4G81A 5AQ1A 3I6QA 5JO0A 1H2BA 2BI8A 3W1VA 1GADO 2B5WA 4L9RA 4L75A 1YVEI 4NFYA 1T1RA 3KSDO 1U7TA 1JQBA 4L8VA 3D1LA 3B20A 3PFFA 1T4BA 4RF4A 4P4GA 1F17A 1ZK4A 3NGXA 4PLPA 1JDJA 1DSSG 1IZ9A 1NR1A 4OGWA 1F06A 4QQRA 3DBVO 2EKLA 1X7DA 1GL3A 4A26A 2GCGA 2Q1UA 4HBGA 3OECA 1A9YA 1FK8A 5DT9A 5H83A 2BHLA 1X1TA 3K8ZA 1YDEA 5LC1A 1B16A 2OFPA 3RVDA 2AEFA 4GKBA 2EKPA 2PZLA 1Y8RB 1HDGO 1EDOA 4QSMA 3GZNB 4IDFA 4Y6PA 1UAGA 4LW8A 2DUWA 1TB4A 4U7WA 4DQVA 5L40A 3IUPA 2NM0A 2O50A 1WMBA 5KTKA 1LRLA 2I6TA 1UP4A 3HDHA 5IDWA 5FI5A 3ORFA 4FPXA 1BVUA 1XA0A 2BGMA 2HK9A 5LDHA 3JQBC 4O63O 5JYEA 5G0WA 1G6KA 3OETA 3Q11A 2V6GA 1N9GB 2VYND 2EP7A 1E6WA 1DFIA 2AQ8A 4CV3A 4BNKA 1I5RA 2G17A 4MP3A 2DBVO 3ASVA 2XPCA 3SEFA 3VPXA 1BVRA 2E82A 4AJHA 4S1VA 4CV2A 3COSA 3LYLA 2VOEA 4BO0A 4CQLB 1GZ4A 2EG9A 4XIJA 1GQQA 1U8FO 3U62A 4R9SA 4ITUA 2PKRA 4LCJA 2VOJA 3PRJA 4CM7A 1HTBA 4U8GA 1T25A 4JNKA 3RFTA 1R0LA 1E5LA 4TMFA 1X13A 5THQA 1A7AA 2O3UA 4ALIA 4GAEA 4JBIA 4Q3DA 3OJEA 4GGOA 3C1AA 4XQ9A 1HRDA 1H0KA 4OMUA 4YAJA 3C1OA 1K89A 3GDOA 4BNMA 1D1SA 3ZNOA 3MEQA 1NHGA 1BG6A 1PIWA 2O23A 4X54A 2BELA 5JO9A 3RFXA 3WGQA 2X86A 2ZCUA 4J1SA 2CD9A 2D3TA 2TMGA 4EZBA 1PZHA 2PZJA 1JTVA 2WD7A 4NI5A 2BI7A 4NDNE 4WE3A 4CR8A 4DQXA 4IBOA 3RUAA 4K6CA 4Q3CA 3S2IA 3D4OA 2W98A 3FBTA 4Q3AA 2EGHA 2VUUA 3P19A 3L6OO 1J5PA 3DZIA 1RYEA 3ONEA 1WDMA 4I9UA 3MWEB 4IDCA 4RCVA 2Z95A 3ZV5A 4EDFA 1F0YA 1PZGA 4BNUA 4YJGB 4II2A 3AM5A 1GV1A 4OSOA 3GAZA 4RDIA 5ER6A 3CUKA 1UZLA 3PYLA 1YBAA 3INRA 4NR0A 5G4LA 4G5HA 1YWGO 1W6UA 1ZUD1 4WNIA 4KWHA 4BIIA 3PHIA 1RYDA 1V9LA 1B0AA 1FF9A 1T26A 3CPSA 5JE8A 1I2BA 3ULKA 1Z82A 3JYOA 4AJIA 4CL8A 1EE2A 4LCEA 4MVJG 4WECA 1H6DA 3DBHA 1LRKA 3Q6IA 4CL3A 4DMMA 3JV7A 2YYYA 3V2UA 2GF2A 3WS7A 4WCFB 4CV1A 1UJMA 3TN7A 1QKIA 3K30A 1IB6A 5L4SA 2JD0A 1M6WA 3BA1A 2IXBA 4GWGA 4MDHA 2HUNA 5IDQA 3RC7A 3TPCA 4DXHA 3ZWOA 2VTEA 5DZSA 4ZQHA 3ZWCA 3EGOA 3K2EA 5T5QA 3L6DA 4IIVA 1YQXA 4MOWA 3UVEA 4DMLA 3NKLA 1PZEA 2H1SA 3JYLA 3OJOA 5H82A 1Y8QB 7ADHA 2I65A 2BKAA 1B3BA 1E6EA 1X15A 3UICA 1HETA 2FSVA 1L1FA 3GMDA 1KY5A 1EDZA 4OOEA 4TVOA 2PLAA 2PKQP 3TZCA 1YBVA 3QRWA 2Y1OA 1B7GO 4HADA 2D5AA 5JSFA 3SJ7A 1PGPA 2IYPA 3JQAD 4URFA 1I3LA 3Q2KA 3TL2A 1Z73A 5TT1A 3C3XA 3WGOA 3FI9A 2GN8A 2Q99A 3AJRA 1UZNA 3LQFA 5TX7A 3H2ZA 1RJWA 2C5AA 3QWAA 3B1FA 3Q9NA 1P0FA 1HYEA 3VDQA 4MPDA 2Q1SA 2G5CA 3WGIA 3HZZA 2JHGA 1LLDA 4AFNA 4BNLA 1HSZA 1AXEA 5JMPA 2H9IA 2O4UX 2WDZA 2UVDA 1JLLA 4QFCA 4Z3KA 1R4NB 2YDYA 4MKRA 3NYWA 4DLLA 1NHWA 4NZ9A 1SEPA 4FOSA 4CLRA 4M86A 3B6ZA 3BHMA 4A27A 1DBVO 5B12A 3BTSA 5IZCC 1MG5A 3TQHA 1BDBA 3AM4A 1C1DB 1BXZA 2VYVD 5ES3A 2WYVA 4RO0A 4MVJE 2NU9A 4KTVE 5GZ6A 1QV6A 3UN1A 3O4RA 3H7AA 3DBLA 3GEGA 4IS3A 4Y9DA 1YJ8A 5L95A 2AMFA 2IYOA 4NMHA 4JK3A 5CDYA 3ZW8A 5EERA 4NPCA 5JYDA 2I67A 1CQIA 2F1KA 1ZXBA 3GG9A 1HWYA 1MP0A 1T1SA 3K9QO 3RUFA 5F1PA 3SX2A 2ZQZA 5JY1A 4J0FA 5TNXA 2O3RA 4CMBA 1LXCA 5CEJA 1MC5A 4D0RA 3ZHXA 2Y93A 1Z45A 1DC6A 1BSVA 3H3JA 5AXDA 3BMNA 2FPPA 4Q39A 4DPKA 2FP4A 3EK2A 3OJLA 5KWEA 1FDVA 5T57A 4I5FA 4IS2A 1P1KA 5J23A 1XR3A 1P45A 2VNSA 2ZJ1A 3DHYA 4DLBA 1V6AA 3BYZA 4R54A 5F1KA 3WR5A 4MVJA 3GT0A 4CMGA 1P1IA 3ETEA 1GPDG 1NQOA 3K5PA 2P68A 2DKNA 5U4QA 3QVSA 1ADBA 1HT0A 2DFVA 2I3GA 2JFGA 4CODB 3HNPA 1T2DA 2PH5A 2VHWA 5JAZA 1J6UA 3STHA 3W8FA 2W2KB 3FR7A 5BT9A 2FY8A 1ONOA 3OQBA 5AXAA 4FJ1A 1DB3A 2PGDA 2J5QA 4Y6SA 3A9WA 1M66A 4OL9A 3AY7A 4WLVA 1Z74A 4MO2A 1E3IA 1LI4A 2BF7A 1ADCA 4Z3DA 1UXGA 2WE7A 4OQZA 5DOZA 3VZPA 4BNHA 1FDTA 3WICA 1E7SA 4Z9FA 3BMQB 5HM8A 5TC4A 2X0NA 4GBJA 3ZV4A 5A04A 1XELA 4B8ZA 3UCEA 4NJMA 1ADGA 4E31A 1YL7A 4CLOA 5FWNA 2HQ1A 3ZV6A 4EEZA 3RC9A 3UF0A 2ZB7A 4JLWA 1EZ4A 5U1PA 1P1FA 3KYCA 1TT7A 3MJEA 4E21A 3I1JA 4L73A 2P9GA 3G0OA 3KLMX 1UR5A 4ND5A 2CVOA 1CQJA 3CMMA 3LT2A 1B8UA 3FTNA 2NLOA 1I10A 2E37A 3EDMA 1D3AA 1F8FA 2PGJA 2CZCA 2RH8A 4RZHA 4YQZA 3TNLA 3F47A 4GX1A 1C1DA 3JQ7A 3P2YA 4XJTA 1LSSA 4BGIA 2O2SA 3VZRA 4YAGA 4R51A 2CUKA 1ZMOA 4B4WA 3ASUA 2X5KO 3PQFA 2W2KA 3G1TA 4ND4A 3R6DA 2YZ7A 3OEYA 4YVFA 1F14A 5KCZA 1KVSA 3QHAA 1JU9A 3AUSA 1JVBA 4UUMA 1OOEA 4GWKA 3T7CA 5L3ZA 3VPSA 1NXQA 2C07A 1Z7EA 1IULA 3K96A 1V0JA 3GN1A 4B4OA 3UW3A 4XKJA 3DZHA 5T67A 1ENYA 1LUAA 3VKVA 3GMSA 4WK6A 1DHTA 4E5PA 4RPLA 5COQA 4J7UA 5ILGA 1KEVA 1NBOA 4CR7A 2VT2A 1B8PA 1ENPA 3BMNB 3VH2A 3H3FA 3I4CA 4RQTA 4YXFA 3D0OA 1NYTA 1PJSA 2UV8A 2IE0A 3ITDA 4U0KA 3WBFA 1DIRA 4J3FA 4ID9A 4BQRA 3UCFA 3QY9A 1E7WA 4HFRA 4ZU3A 2NU6A 5BSFA 4E13A 3LT1A 4M8SA 2CDBA 3KYDB 5AXCA 3PZRA 1UP7A 1UZMA 1VC2A 1EUZA 2YW9A 4H16A 2UUOA 2A35A 3U49A 3DAPA 3Q9UA 3ZWPA 5IXYA 4B4UA 3GDFA 2FMUA 4PG5A 2X5OA 3ETDA 2EW8A 4YJDA 1GU7A 2GN4A 3WBBA 1BRMA 2IDZA 4BNFA 1E7RA 3AU8A 1LX6A 2PKQO 3D7LA 1U1IA 1MX3A 2CF5A 1C0PA 3PWSA 4JBHA 4LGVA 3GH3A 8LDHA 2GO1A 2PGLA 5L4LA 2X6TA 4WLNA 5KVCA 4A0SA 1HSOA 4DQUA 3KYDA 4U6QA 4WEOA 3OEWA 3HN2A 3OSUA 3OP4A 3IC5A 1LBEA 4CUKA 1EBUA 1M2WA 2VRBA 2FWMX 3BMCB 4HUJA 4ND2A 4FOOA 2DTEA 3VPGA 4ZQEA 2PR2A 1PJCA 1HLPA 4CMKA 2EKQA 1YBMA 1Y7TA 5GY7A 1LDNA 5U9CA 1MLDA 2BLLA 3NT5A 1W8DA 4MKXA 1Y6JA 1KY4A 2BFAA 2NTNA 1K6IA 4MIOA 4RF3A 2EJWA 3H2SA 3S1LA 3SBOA 5G2OA 1BXGB 4WLEA 1DRWA 3HSKA 4PLCA 3VH4A 3D5TA 4PVDA 3HN7A 4UVEA 4BO1A 2XOXA 2DAPA 3CE6A 4JQCA 3TL3A 3UAGA 1PQPA 1QP8A 2RHRA 1SC6A 1V3UA 3M1LA 4HNHA 3IL2A 2RHCA 3RUCA 1C0LA 2VYNA 1AN9A 1HEUA 1HZJA 4R01A 1KVRA 3LVFO 3A28A 2J6IA 1OMOA 2HMTA 5G4KB 5JFOA 3WFJA 1DJQA 1C3VA 4U6SA 1HDOA 1NM5A 3QE3A 4CM5A 4DREA 3IJRA 2EJVA 3ZZNA 3RC1A 3RI3A 1ISGA 3HADA 2DFDA 2VHZA 3I4FA 4GGPA 1QMGA 4U5QA 3VOSA 3ZNNA 5MDHA 3RD5A 5A03A 4OAQA 4N5LA 2VHVA 4OXKA 3S2GA 2I66A 2H63A 4E32A 2SCUA 4YCAA 3F6YA 3GN2A 4NBRA 4E2YA 5JC8A 1ADFA 4RL6A 3PVZA 1GCUA 2QW8A 5BQFA 3U4HA 5FYDA 3RKUA 3JQ8A 3KV3O 2D4AA 1RKXA 1I32A 3ZU4A 4QFDA 3NJ8A 3TFQA 2Q46A 3ZWWA 1LSUA 2I3AA 3GOHA 4DPLA 2X9NA 4TZKA 3PGJA 3D5QA 2HDHA 3K6JA 1DAOA 3DTTA 3BHIA 3PXXA 4J6FA 4QEDA 4CLOB 2FPIA 3F3SA 4BMVA 3QWHA 4PN3A 4D41A 4I5GA 1DIGA 4FCCA 9LDTA 3GVCA 4GPD1 1C14A 1I3KA 3DZBA 3DEYX 4KTTE 4HKTA 2HU2A 2TMDA 5HWSA 3C1TA 1HDZA 3DMYA 5JCJA 4Z9XA 5JS6A 1KOLA 1U9JA 1JAYA 2QRLA 4U0JA 4W99A 5C7IO 3Q0EA 4AJKA 4BGEA 2CVQA 3OJFA 1JAXA 4BKPA 3G17A 3U9LA 2P4HX 1T2FA 4IDEA 4GLOA 2YV1A 4UREA 5BSHA 3IIEA 1E3WA 3PP8A 1EVZA 5TGDA 1T2CA 4QO7A 4UEJA 2DVMA 4GQAA 3VVCA 2O4CA 2JCVA 2BGKA 3ZWBA 4CM4A 1ZCJA 3DC2A 1ML3A 2ZB3A 2P4QA 3U09A 3C7AA 2B4TO 4O6VA 4R5HA 4BMNA 2WSBA 3AFNA 1ZW1A 3PTZA 4EEXA 1K6JA 4AJJA 4CUJA 1CRWG 4ROSA 4RV9A 4R3WA 3UUWA 5EJ2A 1R66A 1ZMTA 4N5NA 4BO8A 4EGFA 4CLEA 4GSLA 4FB5A 3V8BA 1H9AA 1GY8A 1MUUA 1BXGA 2X8LA 3JYNA 4CM1A 5IDYA 1L7DA 1NX6A 4QT0A 1JKFA 2VN8A 4PG8A 4QTZA 5G0VA 2QRJA 3FWNA 1HE3A 3JSAA 3DZJA 4IGFA 1JW9B 2QQ5A 3AM3A 3H5NA 3ZNQA 1EVYA 4BO2A 4XJSA 2Z1NA 2RIRA 1ENZA 5JAMA 1SPXA 1OFGA 4FW8A 4JJFA 1SMKA 2GN9A 3X2EA 2CFCA 5COAA 5AVOA 2HMSA 3E03A 1Z7BA 4JX8A 4CLHA 1YO6A 3BTOA 5JPIA 1UAYA 1ONPA 1EMDA 2EV9A 4IXTA 1KEPA 4B3HA 3RU9A 3PLNA 4EW6A 4FQ8A 4YYZA 3PHLA 4IXWA 1GUZA 1MXHA 4LSWA 1QYXA 1SBYA 4BV8A 3MTGA 4D0SA 2VTDA 4YPOA 3GLQA 4JIGA 1DIBA 4B7XA 1P0CA 2WEKA 2ZYGA 4CM9D 3KYCB 4NBWA 4BO7A 5IN4A 4IJKA 2OBNA 2BMAA 1GQ2A 1C1XA 2F00A 1A27A 1H5QA 2C82A 3ANMA 1KEWA 2HCTA 3KUXA 2QX7A 2Z5LA 4YT2A 3K92A 3AI2A 4BNIA 3L6EA 2B4RO 4IPTA 4CMEA 5G0TA 1ZBQA 5A06A 1HLDA 3W4KA 1VL8A 1ZXLA 3GUYA 3LT0A 2JFHA 2ZTMA 4ILKA 3VHRA 4XYLA 2OMEA 1A4UA 3V1TC 2R6JA 1E1KA 3ON5A 2PNFA 5G0SA 3KRTA 3ZGYA 2PK3A 3F46A 3LT4A 1BMDA 1E1NA 2YV3A 3ZWYA 2AHRA 2I9PA 3IJPA 5JBIA 3W4JA 1V3VA 4XGNA 1E7MA 3IMFA 4TKMA 5DCUA 5CG1A 3N7UA 3QV1A 4EITA 5GZ1A 3U4DA 4J4HA 1K5HA 4AJ4A 3G3EA 4YBZA 4KQXA 3PDUA 3VTZA 3U4IA 3SC4A 1ZJYA 3E48A 3MCVA 3JQFC 3TF5A 3HHPA 3NTQA 4IQ0A 4OO3A 1ISFA 3VAZA 1YB5A 5DULA 2Y66A 1ZH8A 3FBGA 2AQHA 2X22A 3HE3A 4IQGA 4K9DA 1H6AA 4XGKA 3Q1LA 1QYVA 3FNGA 3UGKA 5JY6A 3H9QA 3GNTA 1I01A 1O94A 3EMKA 2NSDA 3HWRA 4XCVA 1TA4A 2PFGA 3VZSA 4BKRA 2FR1A 2V65A 4RLHA 1LDGA 4XGIA 1I2CA 1U28A 3KTDA 2AE1A 3BMOB 2VHXA 4NBVA 2J3JA 1X0XA 2NV6A 4KUGA 4XZ3A 1N9GA 1RWBA 3MWDB 4YB8A 3V5NA 1FDWA 3QP9A 2B35A 5EQFA 5K0ZA 4YJFA 1VE9A 1XKQA 1U3TA 2YJZA 5L7TA 4JP3A 3WGZA 4DTIA 2HJRA 3BHJA 4IIUA 2CF6A 2ZYAA 4H3VA 3RJ5A 2D2IA 4E33A 5A5FA 3ZNPA 2E6UX 4NU6A
chains in the Genus database with same CATH superfamily
2WJHA 3NGLA 5HR5A 3FGPA 5FF9A 1QBGA 1QIIA 3REQA 4Z1OA 3VKUA 1O96B 4HC4A 4WAUA 1QUFA 1EBBA 4V24A 5DNYB 4AICA 1GN9A 2AI3A 2EEPA 1JAIA 2X5XA 4MRAA 3T0IA 5EINA 1ESCA 2ZSHA 2BH9A 4GLLA 1R64A 4CPDA 2XD4A 1IAQA 1KQ3A 4IFTA 3H4TA 3O4IA 2SICE 4EBBA 1SZPA 3GJQA 4O1MA 3F6CA 3PHHA 3UXYA 4Z0HO 5KB3A 1SULA 3FJOA 4ZYYA 1WB9A 5TVKA 4B3MB 3D6JA 2UVQA 4WN9A 4PCUA 3AUKA 2CMGA 3L41A 1C30A 2FJPA 4P3OA 5ISMA 1YH3A 1R10A 4FNAA 4RXMA 1V7CA 5JASA 3VHXB 2IS1A 2ANCA 3PQ4A 2IYNA 1DO8A 1ZOOA 1W9MA 2XECA 4GC5A 1YR1A 4MUBA 2YVUA 3PTAA 1X1EA 1NBIA 4N0QA 5I7AA 2XQJA 1EGQA 4AJLA 3PJEA 1U8ZA 1CJTC 1LLQA 2Y1DA 5LQAA 4Y1GA 4PIPA 4BOYA 3CY6A 4J1NA 5IKEA 3BAZA 4ZVQA 5BSTA 3UWMA 5IF3A 1PD1A 1SBIA 3SNHA 1A3CA 4AI6A 1S2NA 4ZYUA 3UEOA 1N7IA 1XEWY 1XGKA 3BS4A 2O3SA 2YWJA 3L06A 4H7PA 1V8ZA 3W8NA 4ESEA 2AZDA 1SG0A 1V2HE 1W47A 2Q9BA 4Q4HB 3HEBA 4AJOA 3N9IA 3RUEA 3E35A 3BRWD 3IOBA 2BFBB 2RKBA 1F38A 3P8ZA 4M37A 5F3RA 5JXIA 4AO7A 5DWQA 5A0TA 5BW5A 1JE0A 2PH3A 5TY0A 3FGNA 4MH0R 2PZMA 2NO7A 5SY9A 4DNXA 2JCSA 3F8SA 4I08A 2MSEB 3IXLA 4MHOA 4OFXA 1ZSNA 3L1HA 1PW7A 1MAVA 4X6UA 1O0BA 4AUKA 4AAYA 1DVRA 4HL6A 2W2OA 4MMYB 4RBNA 4MHTA 1SXPA 1Q50A 1T9GR 1N1EA 1VSVA 2ZPUA 3OIGA 4QVGA 4N9QA 3IJEB 1XALA 3C1UA 1BKSB 3NDRA 3B13B 1TVKB 4F5YA 5CFRA 2O14A 3DDWA 3ZE0B 2VUTA 4YJHB 4DUYB 1SB9A 4FR2A 4QLBA 1RPNA 1AHPA 4KO4S 3EF0A 2HCRA 5GWXA 1OGYA 2CVZA 1C1YA 3AR6A 2NU8B 3KXKA 4HEJA 2GETA 1PGJA 1JMYA 5LR6A 3DVQX 2QM3A 1RZRD 1QVAA 5LDGA 4M89A 2QNIA 4YI5A 4IMRA 2WPDA 1HE8B 2YIDA 3PNSA 4ZCSA 4L1KA 2AJDA 4DCGA 4E30A 4RTKA 4Q1CA 4JVSB 2LCFA 2WAXA 3GVHA 3R3YA 5EKSA 5AT1A 3M6XA 2OYSA 5HOEA 4E3ZA 2BTQB 2HSDA 1Z4JA 2G63A 2NTYC 3GGJA 4NOKA 4HEA6 1P1CA 2PDAA 4DNOA 4OK5A 3GFVA 3TOSA 2BTOA 1GQSA 3OI7A 3ZEAA 2FFJA 3RSQA 4MGZR 2G1UA 4ZHQA 1GQFA 2RAPA 3KETA 2CEKA 3RW9A 1EX6A 2G08A 3KR1A 5F12A 1L1QA 4B33A 4E5KA 3UJDA 2EYQA 5IHXA 4QYTA 3L0PA 1QG2A 3QOFA 1QP7A 3GUVA 3DULA 4RTJA 4BX9A 4S04A 3W5HA 5E3JA 5B57C 2PL5A 2TECE 1Z12A 4M38A 2ZTLA 4Q3BA 1CZHA 2PUCA 5I7WA 5FFNA 4IDOA 4WI1A 2JGLA 4YYEA 4FDVA 1DX6A 3F96A 2CB0A 3CX3A 1UBFA 1T2AA 2H3EA 3GZTB 5TQ2A 4D81A 4HBZA 3OCXA 4YWJA 2GM3A 2JI4A 2NQ2C 1NDHA 1DC3A 1C3LA 1E1MA 1LU9A 2ROQA 3QIAA 3LGAA 5AOBA 4BRWA 2Y0CA 4RZ2A 1PGQA 3UYLA 4TWZA 1ELOA 1QFJA 1PJ3A 1XDWA 3M7IA 2Q2WA 1HZZC 4NU8X 5CCDA 1G0OA 5JARA 1L9KA 3KBOA 3RBVA 4OJKA 3F6PA 1LJLA 3OEHA 4WMLA 3GRPA 3T7RA 2QD2A 3K3PA 4OHCA 3C6MA 4M55A 3AEUA 2J3IA 4HGPA 5BPFA 1PR3A 3G5LA 4FMDF 4BHTA 2V7UA 2JLVA 1YGPA 1QC5A 5FBVB 2WU1A 3C45A 4REOA 3T38A 1U7UA 4YASA 1ZIOA 1FE8A 4AC9A 4LN1A 4B3IA 4HAXA 3PNKA 2J5BA 2X2EA 1G20B 2L2QA 3IILA 3R24A 4FFLA 4A9AA 3D9QX 4RLSA 1FYFA 3S2ZA 4RHXA 3LO5A 4JH0A 5F7XA 2IDJA 4O2BB 3EGVA 4QO8A 5BYBA 4EBFA 3BMQA 5D5PA 3VPAA 5CFQA 2QVXX 3KVOA 2VK8A 5JH7A 1JHDA 2IZ5A 5I8PA 1DDIA 1PT7A 1X1CA 1ISJA 1EK6A 1W2WB 2YMMA 3AESA 5EZQA 3O8QA 1NXSA 5J5AA 4F3NA 2R00A 4GI2A 4CNQA 5I7SA 4ZZ0A 1LA2A 1GNSA 1C5KA 2FK7A 3PDCA 2ZFUA 4PICA 4FYMA 1YL6A 4D82A 2C7GA 2B8TA 3H2IA 1VA4A 3EULA 5EZ6B 2C4UA 5G1PA 4I81A 4KIUA 1F7VA 3P26A 3I0NA 2GBPA 3B70A 3QVJA 4HB3A 1YZKA 1F8UA 2N46A 2SBTA 1XQWA 5CK4A 1N2ZA 3GRRA 4INJA 4OU4A 2CV1A 1ZMBA 4AYXA 2AW5A 3WO1A 3HCWA 2JFUA 2O2DA 1P61B 2XB9A 1LY1A 2C2XA 3DDCA 3ROQA 2ZYUX 4FK8A 4P4TA 1QH9A 3O7MA 1F1BA 1D2MA 4S3MA 1MG0A 3SY8A 3WLSA 1RQ2A 5MN4A 2JARA 3I37X 4NFLA 1N3LA 1B76A 3A32A 1T2EA 4RWEA 1QIEA 4D8XA 1ORDA 3ONFA 1AUPA 3RJMA 1SA0A 4BP1A 3UJ6A 1EVJA 2IY7A 2XMGA 5AJZA 3WOVA 4HY3A 3B1VA 1ZICA 3LF2A 5A0FA 4KE9A 3RANA 3PQEA 1MVNA 5BV0A 4I4LA 4GR9A 4X1OA 4PYIA 3N2LA 4R16A 4V0ME 1YULA 1T9AA 3QEMA 2QRGA 3VUEA 2Q3BA 4H6XA 3TW8B 4Q05A 3V48A 1AGRA 4FOTA 4NBUA 2IW1A 5AW1A 3P9QA 3QPWA 1E66A 1I3NA 2JFBA 2R6AA 4MARA 3OZTA 5ALIA 2FXVA 2Q4BA 4QEZA 3TBFA 5AKXA 4JJGA 2QK4A 2AOXA 3SIPA 1RHKA 3C85A 1GG5A 2F8LA 2FW0A 1LVHA 1T4CA 2Q6KA 3HDGA 2CEAA 3G0CA 4BFXA 2CHEA 4L8LA 1NP3A 1XD8A 2C4VA 1MABB 4HSGA 1NYRA 1EFPA 2TS1A 3SDBA 1NI3A 4C6RA 3K9FC 2ZI7A 1JXQA 1U5CA 2PMCA 2OBBA 1ZD2P 1Z2EA 3KSZO 5EJIA 2QT0A 2ZYRA 4IF6A 4LVCA 4IIHA 3QA3E 4NZOA 4DMFA 4E12A 3G5MA 2ETVA 1QJCA 4EDHA 2LCIA 1JWBB 3JQEA 5CDUA 3SYRA 3WJ1A 3BXZA 3KB2A 2LCQA 4ITVA 4DG9A 1YMQA 1ZNQO 1RLTA 2REBA 3C3JA 4QFMA 4YUAA 3Q12A 4FYXA 4YAIA 4JT8A 1E1LA 2BJHA 2NAFA 4FSDA 2GN6A 1PVOA 1C7IA 2FWRA 3PI7A 1HA3A 1QGDA 2OGZA 3RTCA 5BWMA 4QFBA 2H17A 2JGAA 1E6CA 1JKJA 4RVSA 1Z15A 5J4YA 2O7QA 3G2PA 3GAMA 2VT3A 4KDFA 2C1XA 2HTFA 4HG2A 1IXYA 3OCYA 2YOHA 2J9FA 2A9PA 2P4EA 1DKLA 1V3TA 2QAJA 3ETJA 4H6VA 4J0EA 1O1YA 4MIYA 4BAGA 2PT5A 5JLAA 3KPWA 3VQTA 4E88A 4JAVC 1NN3A 1ZJ6A 2OAQ1 2P1RA 2Z9BA 4PZUA 4GP7A 3MB5A 3NT2A 2XE8A 3B89A 4OXNA 1U9YA 1V5FA 1WD7A 3FWPA 3WLOA 1SQGA 2BN4A 4PG4A 4Z4CA 1ZNZA 2ZTUA 4DG8A 1G5IA 3P45A 4LY9A 4UTVA 5IK2D 1NPDA 4ZU1X 1HG0A 2B4YA 3G79A 1UXIA 4MUAA 2X0FA 1YFLA 4BZXA 3NVKI 2W2NA 3MNFA 2IH2A 2DBRA 5KNDD 5KNDA 4PQFA 2ZU6A 3IPLA 1XNQB 1KJJA 1GPH1 1M8KA 5KHOC 5AK5A 4JA0A 2OHVA 4UTPA 2QL5A 5CFLA 4F3TA 1XVAA 1UZUA 3IE2A 4BDSA 4PLYA 4Y1RA 1E2FA 4MGIR 4WPGA 2R1VA 3RT9A 4K0RA 1RSZA 1PFYA 2C4WA 1OR8A 2H92A 3G2OA 1Q1NA 2ENWA 3PNMA 4RLQA 1KRHA 3M49A 3KLOA 1H2FA 1BMQA 1T0PA 4P8RA 4PPYA 4YRZA 4U3JB 3ZDAA 4G5XA 1V1RB 1HDXA 4E5YA 2PXAA 2IYEA 1FP4A 1LFDB 1R4MB 1KORA 4IDPA 4MVJI 5HIMA 4LHVA 4D42A 2NNWB 5A1JA 2YXNA 5D7NA 4C7XA 1ACLA 4R2HA 4OXQA 3IQDB 2IS4A 2Y4OA 1IOLA 2X7HA 1KP9A 1W88A 2VDKB 3JQCA 2H29A 3O4JA 4AL4A 1EG7A 2ZJ8A 3OTQA 3DMTC 3DWGA 4P82A 1OZAA 4F46A 3HWWA 5HF5A 1RWOA 3MT9A 4BE9A 4ICIA 1IEWA 1P9LA 4OI0A 4OBEA 4MUGA 2WE8A 3PQCA 1CUUA 3TCKA 3A2KA 4ARBA 3ZHZA 3LXMA 2OYRA 3U37A 1A8SA 2WD8A 4I1VA 5DBFA 2RGWA 4LMRA 5JQGF 3CA8A 2H08A 5K01A 5DM2A 3WIOA 4CHGA 3NWPA 2FE1A 2PH1A 4IIXA 4C5CA 4N1AA 2ZJZA 3SC3A 4CYMA 2V6BA 2WFLB 3FH0A 4GR5A 3ZCXA 1L1RA 2FUCA 4LFAB 4AM8A 3AINA 3BCRA 3QF4B 2C78A 2PUHA 1YDFA 4MQEB 5KYYA 3G2MA 3SQMA 1L5WA 4K8OA 4D56A 2UU9B 2LUOA 3SYMA 3BSWA 1KIAA 2ECOA 4WOBA 2R85A 3ER9A 2Q1WA 1V4NA 1MC8A 2CXNA 4JBWA 2Q0QA 2QM7A 5HP4A 3BDVA 1YFKA 2JF0A 4M0UA 1IRIA 2YXLA 3EOZA 4K6MA 4LJ7A 3FN4A 5BSRA 3VFDA 4E6EA 2AS0A 1UFQA 1AO3A 1H8HA 4E51A 5ALXA 3ESRA 1ZFNA 1R27A 4EATA 2OLKA 4TYPA 4DV5B 4N4AA 3ELUA 2COEA 2PGXA 4MW7A 4R8RA 1CVLA 3F73A 4JKYA 4EFLA 1F8XA 4S12A 4AF6A 4LC0A 3D0KA 4G0OA 3U56A 2WPNA 2ZRMA 1TC1A 1QRAA 1QDEA 3QVGA 1PEAA 2NUBA 4BDTA 3GRFA 4UE6A 3I9NA 3HL4A 1CIVA 1JIQA 1R0ZA 3U0BA 1J0XO 5CFOA 3TD2A 4DWVA 2GRJA 1NN1A 1T9KA 1KJYA 2Z43A 1SRQA 1VJ1A 1T0JB 1TKRA 4Y0AA 2CFOA 2A0WA 3HV0A 1QYCA 3GCGA 4NMMA 3WQBA 4AN1A 1XL1A 4EUHA 3RVPA 3HU3A 3UENA 4UE3S 4CV0A 3SZ3A 5E6SA 3Q88A 5CGZA 3ZGNA 1ABBA 2YJNA 4XGRA 1XN4A 4V0RA 3BL5A 1CUEA 1OZ0A 1XMIA 2C5HA 3OM9A 1HYQA 2VJNA 3KPUA 5GZ3A 5GV7A 1NN5A 1QOZA 2NO6A 5L6MB 2JVKA 5IJAA 2VJOA 1EVKA 4HQ6A 5CB0A 1CQIB 2F3TA 5I48A 1QNFA 1XC7A 5CLGA 1EFRA 2BM9A 2RJOA 4EI9A 4G0WA 2XOKD 3IV9A 2XMSA 1Y3IA 3ROZA 3NYIA 2ZKLA 2IV7A 3L7DA 1DTWB 4LG1A 4Q19A 2IH4A 2RGRA 4JZKA 4MQBA 3E7FA 4MS1A 4XRRA 3D7KA 4RTPA 1MC4A 4KREA 5KTTA 3QYPA 1VMDA 2C4KA 2GXSA 4IY1A 4PIVA 4DM7A 5KYGA 1QQAA 3P2EA 2ZYIA 4M0MA 4DAOA 1ZMXA 5LOVF 2RI6A 1PHRA 2AJTA 4RJLA 3F6BX 3HJNA 1GQYA 1R16A 5EIBC 1PQYA 3WYCA 3IT1A 3JD2A 3MJFA 2QIPA 3NU1A 2QYOA 3QBTA 2GRAA 5HKKA 1I2AA 3SQNA 3VPDA 1Z2AA 3DQPA 4V2UA 4BYMA 1GD1O 1TA0A 4G2NA 5DTEA 1GLVA 3VR6A 4J0QA 5HFJA 2GBLA 3DF7A 3U31A 3LKBA 3F1LA 1EM8A 1WA5A 2I99A 1Z6YA 5BYKA 5ER9A 2A6PA 3OBBA 2W58A 2F43A 2R44A 3GFRA 3K15A 1PF7E 2OBFA 3Q6MA 3BF8A 1A82A 2YJGA 4G8CA 4XDYA 2OYCA 1FTGA 1QVZA 4HNSA 2WI8A 4Z4QA 1BZYA 4XJVA 3L46A 2QG4A 5SY4A 3R7DA 3EVAA 3HVJA 1PL6A 1GFWA 1U65A 2QU8A 2X1MA 1YASA 2J8ZA 3CNOA 4IO0A 1BWSA 3K1AB 4IUCS 5CNJA 4ZVPA 3PRHA 1LB1B 2X7JA 4J0CA 2EP8A 1N2CE 2GNOA 3ZD8A 1GG2A 3PC3A 1WY7A 3TPZA 1RC1A 4A16A 5CLJA 2DFTA 2ERYA 2X3YA 1J90A 2BHSA 5TE9A 1XVTA 3NALA 2VDWB 3IEMA 4MQ5A 3PKJA 3EAQA 1ZIDA 4P5PA 3VOBA 3IA2A 1ZZGA 3FTFA 1FBTA 3KLPX 2APJA 1G2OA 1NW9B 1SZJG 4L5JA 4BTLA 3ZHVA 1T8TA 2R1TB 3K09A 5EHIA 3QPAA 3TMKA 4C76A 2GZDA 3KEOA 1P1BA 4DILA 5AI8A 1Q19A 1GUBA 2A9VA 2G7MC 3AY0A 4CT4B 1BO6A 3H5OA 5TVGA 1V11A 5L45A 2WSMA 1MXFA 3NDJA 3O2JA 4D9KA 2XLCA 2GD1O 1F4VA 3PD1A 3C7DB 1AB5A 5SZIA 4WXHA 2X42A 4OFWA 1U63A 4M0CA 4K28A 2OFXA 4WGGA 1JLRA 1LC0A 1XRJA 1ICIA 2ONYA 3C8MA 3HUTA 3P2OA 3TB6A 4BQOA 1MR3F 3HVUA 5BXQC 1UPAA 1L7QA 5LQCA 4BXOB 3RK4A 4V0KA 1EAMA 1LDBA 1IUOA 1SKAA 4KFUA 3EVNA 3SX0A 1YR9A 3EIFA 3QX9A 1L5LA 5I9NA 5K2OA 5AVXA 2IRWA 4OQPA 4EK9A 1FMJA 4IX1A 4LI0A 5IFKA 4LDQA 5KOIA 2VYVA 5IDVA 2QL7A 5BV2P 4BKUA 4X61A 4ZVVA 1IWOA 1Y3FE 1BN7A 2I4TA 2Y1GA 1RHUA 2VG8A 4LMPA 5BQOA 2FTKE 5EL0A 1JECA 3F7MA 3PUWA 4KLAA 3KKMA 5EN4A 4NCAA 3LCCA 5LQMA 2PX3A 2B5VA 5IAJA 4MMXB 1AF4A 4QPNA 2F8MA 5C8VA 4JQOA 5B6JA 1O9BA 3TLYA 4EY8A 1U98A 3DHVA 3PC6A 2KW5A 5AVKA 3VX3A 4UM9B 1X7WA 2Q4TA 1H2WA 3DDNA 1D6NA 3NHBA 4Z1MA 5UKDA 4J2TA 3NRCA 4S1NA 2QUJA 1KJ9A 1LNZA 2IXDA 2FR0A 1XB2A 1YRLA 2YC2C 4RKWA 4EA7A 1JKMA 2OBYA 1HZZA 4MR9B 1INLA 2C31A 4I5EA 3LPNA 4O4JA 4BJHB 3IEUA 4B7ZA 4DRZA 1D7OA 1M6NA 4UVHA 1P1HA 4PF1A 2PWZA 4PSKA 4ZVRA 4YMUA 2D8AA 5KNBD 1QH8A 3HXKA 2IHVA 2VP3A 1RKBA 3KT6A 3KPVA 1V7QA 2HQBA 2V7VA 3X44A 2CFSA 4ZDIA 1R1DA 2HJSA 3O0TA 4ZI3A 3WHLA 1CUVA 2JL1A 3WXBA 4DGSA 3QLEA 3EE6A 4V0NA 1QZXA 2P9CA 1R9MA 2NVWA 3E9YA 1LSOA 1J0AA 1EEHA 4BLQA 2E3JA 2FFHA 2PLFA 4WADA 1NPYA 1G42A 2ZTVA 5E38A 5E4TA 5A71A 1YS9A 1U5BA 3FTCA 3IKVA 4UBKA 3ZHUA 1FFYA 1P17A 3O9ZA 1EWKA 2ZITA 2R00C 4B6FA 3FMFA 3N6RA 2VDMB 3T7JA 1USVA 4BQFA 4BCDA 1D04A 1QV7A 2BGJA 3AVOA 1TTPB 1GAJA 4JN6B 4POAA 2OZLB 4L02A 1MB9A 3V2GA 3TM5A 3HRKA 5CW1A 2VWGA 3EGEA 3QHQA 3FFAA 5DRTA 3RFUA 3PBKA 3WKAA 4G41A 1Q44A 4BTEA 4HLDA 4DABA 3EQ9A 1B6SA 1VIYA 2CNKA 4AS3A 1PX2A 2OCBA 3SJCA 1GTVA 1HORA 1OU4A 5HTKA 1EXWA 1H3FA 1X0VA 1SCDA 5EMNA 1GNQA 5JFOA 2KM1A 2JK0A 1BC5A 2I2BA 1JYEA 4MJ7A 4ZU6X 2X13A 2X0DA 2BEWB 4JHLA 4NK5A 5CCXA 3EISA 2IHYA 1F8YA 3A1NA 2OORC 1RM0A 1ODTC 4BMSA 2CJPA 4EARA 4CEJA 3GFTA 1YE3A 3MXOA 2CLDX 5KDOA 4KQ9A 1SOVA 1M76A 3PJGA 1RRFA 2RGYA 2Z8YA 2JFNA 2HIHA 3P5SA 2G7ZA 2R7MA 5HIIA 2ZRIA 3HGTA 3K9NA 4MYDA 3TSCA 3U0VA 3EWNA 4INOA 4JJZA 1TZBA 2XTMA 3AH8A 2FJ0A 4LWPA 4J4BA 3ZW9A 3SF8B 1BWPA 3ETNA 2X8JB 4O2LA 5CURA 2AC2A 2PEYA 2EKBA 3WGYA 4CMCA 4LF7B 2VZ9A 1O57A 2G28A 2WTBA 2E48A 1XAIA 2WT8A 1UBEA 4IMPA 1T35A 1ULTA 2VPQA 3EBPA 1MFPA 2E55A 2C54A 2HDWA 1FS6A 3NQ41 4O1HA 4NU5A 2DJIA 1FU8A 4FYHA 3K7EA 2BFEA 2ZW9A 4X1KB 4C4OA 2PRJA 4ZQIA 3RWMB 4XX0B 5BNZA 3QJYA 1ZMRA 4BQEA 2OMKA 3I5AA 3L6UA 4C2TA 1I36A 2KHZA 2ZI4A 2NADA 3DXZA 5LA6A 1BFDA 2C58A 1PNQA 1CJVC 4INZA 4ZEOA 4E09A 3PWTA 3DBOB 2XNDA 1Z2OX 1G1AA 4U9IS 5AJXA 3OHSX 1XPRA 1OJLA 5CXSA 3LYHA 4LDNA 4QASA 4TTAA 5I7FA 5KYXA 3OZSA 2JASA 4MIKA 4F3YA 2AOTB 4M1QA 4F4DA 1OILA 1Z2CA 5JADA 3ZHYA 1T3SA 1I9GA 1VJ0A 2ZPTX 4V0MA 5DLPA 4ZHQF 3RK1A 2VP0A 4H77A 3MTAA 4S24A 3E3MA 1E3SA 4QULA 1R0SA 2KQUA 4LEIA 4MPTA 2FZCA 4R31A 1TF5A 1VTKA 3PC7A 5LQRA 2DLCX 2IS2A 3MTQA 4OKNA 5JNUA 2NTVA 1YR2A 3A1DA 4UHFA 3Q8LA 2Z1DA 4FBMA 1ORTA 1Y48E 2P0EA 2M1XA 1CDOA 1ECGA 4I46A 3S4YA 4UTNA 2GCEA 5E7QA 3DMDA 1VI5A 1L7EA 2VCHA 4RX1A 1HFKA 3ESYA 1C9NA 3AHIA 3RCBA 4M1YA 3A14A 4BNDB 5J2TB 1UUFA 2BKVA 3G5UA 2WJZB 1CP3A 3UJCA 3M2PA 5EXXA 3R9KA 1PS9A 4ER6A 3ROKA 3ICEA 5AW6A 1MEOA 3AZOA 1JJVA 4M1KA 4TRJA 5D3ZA 4XYGA 1IHDA 4UAUA 2F48A 4DIBA 3BD8A 3DEJA 4D8TA 1NSFA 3OTGA 3CISA 4R98A 4XE5A 1HMYA 4E2ZA 2V7XA 3TKLA 3U5TA 1P6XA 1YZ3A 2GBCA 3B2NA 4C3ZA 5H81A 1KSGA 3HM9A 3ER8A 2J0UA 2A92A 2PMKA 1GZUA 4R84A 5EHQA 4I4IA 4K6GA 4X3OA 5CA0B 3UC5A 1WP4A 1ZK0A 1Q14A 2W6QA 2AKYA 1TPYA 4TL6A 3EC7A 4RY2A 4HLUA 4ZA2A 1CJKC 2PZFA 2D5BA 4KSCA 2ST1A 1C81A 4B82A 3RTBA 1YR7A 2FFBA 1V5EA 1COZA 2A7XA 1EGAA 3OAAD 4YJ3B 4Q24A 3CSUA 1S2MA 3SHWA 1OAOA 1KYQA 2X41A 5BQPA 3O47A 1YVUA 1M7BA 1O0SA 2IE8A 4GF5A 3D3WA 1GPLA 3JQGA 1HNZB 2D0IA 2C29D 2E21A 4WBNB 4HWGA 1YQGA 1YXMA 4Y2UA 1G8YA 2ZAOA 2G88A 1XIVA 2HOQA 4PW0A 3JRNA 1DWUA 1P9RA 4HDSB 4FYPA 4BGVA 1XTVA 3T9CA 3CBGA 5HJ5A 1E96A 4IFBA 1AQLA 1WCIB 3BZWA 2O2EA 1GHTA 2X9GA 3DPUA 4HH4A 4PCLA 4Q7QA 5BSGA 2A5FA 1VHLA 4F9EA 4JT9A 3OLQA 1BE1A 2QZ9A 4ZDKA 2YYAA 3RARA 1J8MF 3MCWA 1JR6A 4ZHSA 3BN3A 3PXAA 5AOAA 3V8PA 3N8HA 3LHIA 4L50A 4QXMA 1MMFB 4GL4A 4DSUA 4H4CA 2J41A 3CUTA 2WZCA 3MW8A 3EXIA 3OOJA 4YP9A 1E9BA 1THGA 4G25A 4RPHA 1XEFA 2WAAA 1N3IA 1K0UA 2F3PA 4MA4A 4WJZA 1NVWQ 2CD7A 4Q3OA 1POWA 5L3VA 5L51A 4F5ZA 3A9SA 2ZRLA 4BB5A 4MAAA 3ZWAA 2ZRPA 5KTOA 5KVVA 1N2GA 1JB1A 2RCNA 4IWNA 4PAWA 4ZEMA 1Q0TA 1T8UA 1OX4B 4US0R 3DBLB 5AI6A 3AP1A 2ACEA 1VL0A 5C31A 2CLEB 4QODA 4ZI7A 2DX7A 1RBYA 3EFOB 4B7UA 1EA7A 2NT4A 4BGUA 2AK3A 3QMWA 4ER0A 1TD9A 4RKEA 1MEEA 2A2ZA 4C30A 2B4QA 4W1QA 3WL3A 2PMFA 3ZDXB 3BIWA 1ND6A 3JWIA 4AP9A 5H3HA 1P74A 1IN1A 3H9GA 4URHA 4P2GA 2ZRDA 1T3TA 4V1CI 1Q0LA 3GJTA 3MM4A 1V8PA 2IYZA 3A2NA 3RPEA 2OD7A 1IPEA 3E2PA 3L6BA 3PS9A 1QJ4A 2UYGA 3EZYA 4JLNA 2C7QA 2JATA 4YO8A 4IZIA 4YAWA 1T4MA 2Y0PA 5D3MB 1GA1A 1G5PA 1Y8RA 3C98A 4IDGA 4WOKA 5DI9A 3GT4A 3AYZB 3DEAA 2NU6B 2AMVA 2OHHA 4RELA 3A25A 4A6DA 4DIDA 3ITEA 1WXHA 1TL7C 3HK2A 2FR8C 1Z6AA 1D9XA 3BFVA 1T36A 1GPJA 2XRMA 3OPMA 1XOIA 2DFKB 2EZ8A 2H4WA 2HRZA 3A2MA 3IP1A 2JK1A 1TX4B 1P8JA 4PRZA 3TI9A 2UXBB 4D44A 4OIMA 2EX1A 5I47A 2XWQA 1GNRA 4XCQA 1QZUA 2EW2A 3EDCA 4QOEA 4Z8XA 4B83A 5IASA 5GINE 1GARA 4JJEA 2ONZA 4XVCA 2IYSA 1PWXA 2I2FA 3ADOA 4IDHA 4LWQA 4TV8F 1XPOA 1BJTA 2FKNA 2Q21A 3L77A 1EXNA 4JGIA 2OWEA 4M22A 4WZAE 2HMWA 3E2MA 4LTDA 1RC0A 4Q0MA 5F7OA 2C5EA 5KSZA 1G7CA 2QAGA 3HBAA 4XYBA 3GFBA 2BGGA 3ENNA 4FBGA 4G2TA 3E1SA 4RHTA 3I2GA 5HZKA 3G85A 5AIBA 3K0KA 4M1EA 1UOOA 3WIUA 4QLAA 5HUQA 4RZUA 4RABA 2OO5A 2IKQA 2DPYA 2C3YA 1FIUA 3NBMA 4XJXA 1Z47A 4CGZA 4KYTA 3MD9A 3ZGLA 5HQTA 3FSGA 1GUYA 3ESCA 2QD5A 3PU6A 1GT91 2XITA 5EFZA 5HK9A 2H2DA 1PJZA 1Q77A 1RRCA 4X1YA 2PSFA 3T5MA 4RTMA 4HQRA 3LKDA 5AUQA 5CXQA 5AJHA 3ZXUB 4MAFA 1CUWA 1MC1A 2M1ZA 2F9FA 2PPLA 4ARZB 4FQ5A 4DADA 5DYGA 1MF7A 3PKIA 1N34B 3NDBB 2G5TA 4D57A 4Z86A 1E63A 4YRLA 4W9MC 2X5JO 4UFNA 2QN7A 5AOVA 4AUNA 4MA0A 3AW9A 4OP3A 4M1SA 1DRUA 4MRVA 5BMVF 3D8RA 1JFTA 1CETA 1OHHD 2I4IA 3FB1A 2P41A 1ESMA 1RTKA 3FPSA 4MP8A 3I23A 3ZH9B 3KQSA 1WDTA 1K3TA 1Y89A 3V1LA 2FLWA 2BW0A 2PA0A 1IHXA 3MOIA 4YXWD 4GMKA 4EPRA 4DV6B 5GJBA 3FR8A 3ZGVA 4AQ7A 3JQ8B 3WK8A 5D5QA 5AM2A 1CFJA 4CIYA 4Z99A 3RS0A 4DUPA 4B71A 4GZLA 2PMDA 4NH0A 4FQ7A 3H84A 3PUVA 1DJOA 2CLOB 3Q0IA 3BERA 3PIRA 4D3DA 2FH5B 4OYHA 5IC6A 3QMVA 3D2BA 2QTHA 4MR8B 1BGVA 3EA5A 3GPBA 3TAHA 1CUIA 3H9BA 4LSMA 3T5TA 4AD8A 4BE7B 4WBNA 2WU3A 3NAQA 1WIWA 2X7XA 3E8SA 2EU8A 2JBHA 4TSRA 1FJGB 2IA5A 3F97A 2O07A 3WTCA 2XMBA 4LJRA 1BQEA 2GJKA 1Y8ZA 1E9RA 5T64A 4P34A 4ZO4A 4C87A 1AX9A 4P31A 2D0DA 4P3KA 4AWAA 4IM7A 3FYDA 2A9OA 4IKPA 4A8HA 3I9MA 1WY5A 4TSFA 1L3IA 2IHUA 2YJ3A 1DIHA 3CGWA 4D1YA 2VK1A 1M1ZA 1X1DA 2D7DA 3IOCA 2P9TA 1BQ4A 2VTBB 1OAAA 2Q29A 3KHUA 1GTRA 4EYEA 3MS7A 3AJ8A 4M0EA 5K0NA 3ZU5A 5AW2A 4C4RA 2NXWA 4EJ0A 3QE2A 2PT7A 1E5QA 4HDRB 4N5MA 2EL9A 5J43A 3DKPA 4UTOA 3QF4A 3KZOA 4I36A 2G40A 2QUAA 3FCOA 4P4UA 2V6MA 3RS3A 1ORRA 5JISA 1IG0A 4OSEA 4MGEA 4X20B 3ILVA 4TS9A 3S99A 3WYFA 2GJ9A 1AN0A 1QQ5A 1HURA 4AG6A 1MX1A 3HFJA 3DGEC 4DL9A 4ATNA 4F9TA 1ABFA 1BX0A 2Q45A 1RPAA 4DUZB 2ECQA 1RI2A 1CY6A 1K7EB 4TMZA 2JI9A 4L8WB 2RHBA 4RMJA 3A6DA 3S5UA 5CFZA 5AH0A 3PENA 3UAXA 3V4VB 1NR7A 1LLUA 2E89A 5EUMA 3VJLA 1X8KA 4B79A 1N1GA 2HR1A 1TTTA 2WM3A 3JD4A 1LPOA 1XVIA 4ZD6A 1YJQA 4KPGA 4B80A 1YS2X 3DBIA 1E9SA 1F3LA 2Z9DA 3CR3C 5BPHA 4BNXA 2BFOA 3QVVA 3FETA 4IV5A 5BW4A 4L72A 5AVTA 1J5XA 4KL8S 1M73E 3GRUA 1XZNA 2NZJA 3UC9A 3OFNA 3RE1A 4BP8A 1IH8A 3PSAA 4GT1A 4NH4A 4D97A 3WLHA 2W42A 1CF2O 4E3WA 5C8XA 4F93B 3R7WB 1P2DA 2H1HA 2OGWA 1EK1A 4EYGA 4ZVTA 1MO6A 1U3VA 4KXFB 1YZHA 3L7OA 1ZM3A 1HXHA 3KJFA 1UK9A 4UEKA 4EG5A 5BT8A 1AQUA 3PX3A 4A6PA 4HVAA 5K5EA 1U3DA 2YY6A 4Y1RB 2H85A 1Z0SA 2VAWA 4D26A 1WULS 3T3DA 5JS2A 2Q5HA 5CVVA 2EZ9A 3M5PA 4FUTA 4EUFA 1QRDA 4LAFA 4C4ZA 4CCAA 5HS6A 3MHTA 3DS8A 4Y1FA 4CIWA 4QUIA 2UVPA 3TZBA 3DMTA 4FYJA 1WB4A 2DP4E 2C8JA 1QHSA 2X4IA 3PR3A 4MVJH 3BTVA 4PC6A 4RHYA 1Z8HA 2IGBA 1I1OA 4OK3A 3DO6A 3QELB 5JLJA 2YY7A 2H4ZA 1II9A 3PC8C 3FHCB 2JH3A 3GQVA 3G2LA 2DR0A 4LJ6A 5J5VA 4CCYA 4F6RB 1OB5A 2GT1A 2Z1MA 3BWVA 1G6HA 5K45A 2AEMA 4B81A 1H05A 4R8LA 1W1UA 4PLTA 2J59A 3L1UA 4DIMA 2GX6A 5F21A 2NZYA 1XNRB 2PTGA 1R37A 1SCAA 1TCCA 4IUBS 1YNSA 3AG6A 2G0NA 3NUZA 4YCSA 3GGGA 4G5FA 2ALJA 3COJA 4OREX 3B7WA 5ALLA 5C7YA 3Q10A 3NC4A 1WZIA 1M2OB 4LZWA 2I8CA 3WAKA 3GGOA 3JQ7B 3O4VA 1M83A 4CDRA 4PO8A 2AG6A 5K7SA 1XDBA 1EFRD 2MSKA 1UFVA 4RSMA 1W5AA 1YNOA 4DHWA 4E7OA 4JBNA 1DXHA 4Y67A 5ARCA 3ZPXA 2XA2A 3KTAB 2AZ4A 3B7PA 3CVYA 4WXYB 3U7HB 3NBXX 2R7LA 4GBGA 1EWQA 1JEDA 4RCYA 2DR3A 2H54A 1BH2A 3HEAA 3P97A 4XI9A 5EEGA 5G1OA 4PQRA 4XB2A 3QYJA 3K2BA 1N5KA 5TS3A 2FU5C 3HUUA 4PFSA 1NJ2A 2PU7A 3D6HA 2CDAA 3DUFA 4JYCA 3ZLUA 1V8DA 5CR9A 2MSNA 1NTOA 2YZ2A 5E2AA 5TJHA 4CIVA 4EY6A 3ZN2A 2CLMB 5FFFA 4BLUA 3OIUA 1N8NA 1Y9ZA 1RLIA 2REOA 1TAGA 2W2TA 4GH5A 3MA0A 4X0EA 2OP0A 4IVRA 4Y3UA 13PKA 1YQUA 2W2XA 3ZC3A 3TSYA 2V7EA 4ZC8A 1SUIA 1YF3A 3LWBA 5JWOA 4KOAA 4I50F 3IPYA 1IFXA 1KAMA 5AUPB 4OYLA 3SYNA 3L0ZA 2EF1A 2HK7A 3KEGA 3GL9A 1J39A 3MT7A 3A37A 4M0PA 5AVZA 4GOLD 1M8GA 2CZQA 1WXGA 1U9ZA 1V39A 4PHFA 3OP1A 2HDNB 3KKKA 3G9XA 3UWOA 3EW9A 4DMHA 1T24A 2A3RA 2PGIA 2QMQA 1DAHA 2D74A 2ZI5A 4HDSA 3QQPA 2IX3A 4N5HX 4MCAA 2ZVPX 4UHJA 3TJRA 4AZ0A 3TQSA 4OKSA 1GZDA 4FR5A 1RAFA 2UYOA 2ZGVA 5F51A 1JPNA 2BISA 2ET6A 2GNPA 3PTLA 4GLBA 3UG6A 1AY0A 4HVLA 1HTWA 3A11A 4DCSA 3E18A 4M9CA 1WP9A 2FN4A 2OXCA 3VOAA 1XK6A 1TJPB 1DC8A 1WMAA 3OOEA 3SOZA 1NWCA 5DCLA 3V6LA 3WJ7A 4PO3X 1A9ZA 3AXTA 1MIOB 1NG9A 3B60A 5F33A 3EDOA 3ZWXA 3TZQA 2JJQA 2VCEA 4JQZA 2GAAA 5GADl 4MUNA 1JNXX 4NCNA 3LPMA 2A0YA 4L07A 4DJTA 2XDYA 5EHNA 2Y6VA 4LHEA 3GRKA 4AF8A 2XCLA 1YDWA 2J08A 4G65A 3D5EA 1LQ2A 2FPSA 1Z83A 1QAQA 4Y1EA 3O2SB 3U3RA 2FDRA 3P4YA 1C7JA 4WV3A 2VP4A 3U48A 1XZHA 3R7LA 4XYEA 1PJLA 1NFQA 3H0KA 4CQMD 4A36A 1A2KC 5CDGA 4O8ZA 2VJPA 4LISA 4BNVA 2P75A 1G3MA 4ZC1A 3ETGA 3ZZTA 3OT4A 2AMLA 3QK7A 3TDKA 1CR0A 4FR0A 3ORRA 5TLSA 2J45A 4DVJA 1Q20A 4RWZA 2BZGA 1CQPA 3EQ8A 4CMJA 3WFIA 4JYPA 3I34X 4QNRA 5FL7A 1ZZEA 3R3XA 2ZB8A 2BGIA 2A59A 1NXPA 1T6BY 2ZSFA 3DO8A 4Q47A 4BV3A 1S4MA 2HC9A 4YRPA 4KVFA 3D59A 5T3UA 2X0EA 3ZWVA 2Z5VA 3KTOA 2IIVA 3ETCA 3DFKA 5CD1A 3NM5A 4GIBA 1ODFA 2QKYA 5HF9A 2X8BA 4M99A 2FR8A 5D51S 5EGSA 1OLXA 1QCCA 1VE1A 2YWFA 3NKFA 4UVGA 1NLZA 2IIBA 1TGVA 1LTKA 3HLKA 3I1FA 4LXGA 5EUBA 1A9QA 3AXSA 3A31A 4AJ2A 2WZDA 4WESB 1PWZA 1NF8A 1LTHR 4N40A 3CRNA 4QGBA 1M74A 3F5FA 3W1VA 3BWYA 2X9QA 4O4IF 5F35A 2NUAB 4B6OA 1NC3A 1GADO 4L9RA 4TT3D 3NG1A 2FAXA 3C7KA 5CXXA 4TUYA 2I8AA 4TQUS 3RTEA 1Z6XA 2IEZA 3AR3A 3KOOA 2BBOA 5JZ9A 2MIIA 2J6HA 2QAIA 5ALFA 4Y9SA 1F17A 1ZK4A 2YINC 4JASB 5EJ9A 4PONA 1OE0A 2P5SA 1P7WA 1YRYE 3T9DA 2OFWA 4Y2RA 3WNBA 5HNKA 1OXSC 3PR1A 4O5AA 1X7DA 2F43B 4P7BA 5CB6A 2GSWA 3D54D 4RK6A 4HAUA 2OO5C 4HBGA 4ZYXA 2OAEA 2QY6A 3QPBA 4OFZA 3K9BA 3EG9A 1GL7A 1EWRA 3T7KA 1UJ4A 2CLIB 3N8GA 4IVQA 5LC1A 3U1BA 3GARA 3OF5A 4MJ3A 4FYKA 5B6IA 2GK7A 2PZLA 4HTFA 1OFVA 3Q7EA 4OA8A 1L5KA 1EDOA 1GKLA 4LW8A 3CZCA 4U7WA 4M4SA 3FLEA 1PYGA 3IUPA 5CK5A 4JYZA 1KO7A 5B53A 3BD7A 2QUIA 3NBYC 5J63A 4DA8A 1LRLA 3HDHA 4K87A 4P4SB 2HPAA 5IDWA 4KQMA 5BMVA 4O02B 1NONA 2QXYA 2KB0A 2Y9MB 1XA0A 3BG5A 2QSYA 3M1IA 1XJ5A 4GOXA 3K20A 5HCUA 5KNDH 3DLBA 4DDVA 4JYMA 2DQKA 2L17A 3JQBC 4O63O 3QI7A 1ZGHA 1UIRA 3Q11A 1I6KA 2KBFA