6LDHA

Refined crystal structure of dogfish m4 apo-lactate dehydrogenase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
329
structure length
329
Chain Sequence
ATLKDKLIGHLATSQEPRSYNKITVVGVGAVGMACAISILMKDLADEVALVDVMEDKLKGEMMDLQHGSLFLHTAKIVSGKDYSVSAGSKLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKHSPDCIILVVSNPVDVLTYVAWKLSGLPMHRIIGSGCNLDSARFRYLMGERLGVHSCSCHGWVIGEHGDSVPSVWSGMNVASIKLHPLDGTNKDKQDWKKLHKDVVDSAYEVIKLKGYTSWAIGLSVADLAETIMKNLCRVHPVSTMVKDFYGIKDNVFLSLPCVLNDHGISNIVKMKLKPNEEQQLQKSATTLWDIQKDLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M4 APO-LACTATE DEHYDROGENASE
publication title Refined crystal structure of dogfish M4 apo-lactate dehydrogenase.
pubmed doi rcsb
source organism Squalus acanthias
molecule tags Oxidoreductase(choh(d)-nad(a))
total genus 100
structure length 329
sequence length 329
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1987-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 6ldhA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 6ldhA02
2DUWA 3F1LA 4M1QA 3EW7A 3FNEA 1E7WA 2Y99A 3CZRA 4DQXA 3ANLA 4S3MA 2Y66A 4QFCA 5AXBA 3TPCA 4MPDA 4J6FA 3A4VA 3RC2A 3TNLA 3W8DA 4YB8A 2JD0A 1ONPA 1XWFA 3OECA 4GL4A 1R4MA 1E3SA 1PJSA 1Z74A 4B8WA 5TNXA 2D0IA 3HN7A 4BO5A 1I8TA 2F1KA 2FR1A 4UEJA 2C2YA 2ZATA 1AHHA 3CPSA 4NFHA 3RC1A 5IXSA 3RCBA 2DQ4A 2NQTA 2HRBA 2PGJA 4MIEA 4XIJA 4XRRA 4Y98A 2IZZA 1Y8RB 2FMUA 1B8VA 3MWEB 1U3WA 3KBOA 4GKVA 4LMPA 4OSPA 1SC6A 2VZ0A 3KLMX 1MX3A 1P44A 3ZHBA 4YYZA 1DB3A 4PLYA 4Y8VA 1OAAA 1MXFA 3TOXA 1B16A 3AK4A 1Q7BA 2CDBA 3U62A 3X2EA 1B14A 3IIEA 3QE3A 5THQA 2WE8A 3PLRA 2X1HA 3PFFA 4DLLA 3CEAA 3GVCA 3PLNA 2DVMA 4GGPA 4IIVA 1FMCA 5THKA 3OP4A 3MJEA 3NRCA 1WDLA 5TT0A 4KUEA 4FFRA 1ZEJA 2AE2A 5CEEA 1XQ1A 5L95A 1DAPA 1P1JA 1FDWA 1O94A 3WLEA 1LQUA 5L7TA 5HS4A 3FHLA 2VUSA 1LRLA 2BKAA 5G0TA 4D45A 4BV8A 3H5AA 1U8FO 3ORFA 1NWCA 5I9MA 3NT5A 4F45A 1Q7CA 4Z9YA 1L1FA 3I4FA 3JYQA 1JKIA 5KNLA 4XDZA 4CV1A 5JXWA 2JJYA 2QX7A 4W9NC 4PG5A 3ST7A 1HDOA 3VH1A 1DDOA 2LDXA 5KKAA 3F4BA 4YJGB 4EW6A 1DFIA 1H6BA 5TQVA 4YCAA 1E5QA 3C1OA 3F5QA 3JQEA 1WMAA 5TF4A 1E77A 3M1LA 2O48X 4TZTA 3E8XA 1I3KA 3DAFA 3SBOA 3U3XA 2RIRA 2VCYA 4FFLA 1AN9A 3Q6IA 2J5RA 1KEUA 3HB5X 4G65A 3D3WB 1U4SA 1DIAA 4AJNA 4AJ4A 3UHAA 4BB5A 2Q2WA 4E6PA 3RJ9A 4MVJP 2I5PO 3JQ7B 2OZPA 1FXSA 4XYEA 3WGZA 2BGKA 4A0SA 1V35A 2B4RO 3DZKA 4P38A 5KIAA 4IDDA 1O89A 1WAMA 4OSOA 1UP4A 1ISHA 2D1YA 1RKXA 4AFNA 1N9GA 3U0BA 1P9LA 2VRCD 5IFLA 3RROA 5H83A 1BHSA 2TMGA 3EVNA 5MDHA 3C8MA 2VOJA 1WXDA 2YHUA 5TGDA 4YRAA 4ZGWA 1H93A 1QKIA 3CKYA 1P31A 3ZHXA 4WLUA 1MG0A 1WVGA 2VQ3A 3ZV4A 1UDBA 3QWIA 4Q3CA 3RQSA 4BQRA 1U28A 3BIOA 4J0EA 4BGVA 1E7MA 1B2LA 3H6KA 5FI3A 3EVTA 2P91A 2H6EA 3OIGA 2Y1GA 1EDZA 2ZTLA 3LSYA 2IYPA 2XF8A 1NAIA 1GEEA 2QRJA 5CG2A 1U2DA 1HDRA 4OQZA 2VHZA 1PJ4A 4CMIA 2D5CA 1FDUA 2XXBA 4TKMA 3K5PA 2GN8A 3AWDA 4B7UA 1ZK0A 2C5EA 1ZXBA 3K2EA 2ZCVA 1LQTA 4PLTA 4R1NA 5F1KA 5L7YA 2X9GA 3RVDA 5I7EA 1IOLA 4Z0HO 1ADFA 1NXQA 3I9NA 3NAQA 1LRKA 3OA0A 4CLEA 1KC3A 2HJRA 1PGJA 2BFPA 3Q3CA 5HWSA 4J7UA 4OL9A 3PHHA 2G76A 3ZGYA 4CPDA 2VYNA 4ID9A 4CQMB 4YR9A 1MC5A 2IEBA 1U3UA 4WLFA 3WIDA 4UUPA 6LDHA 3OSUA 3PI7A 4PIVA 4M54A 5CAEA 2CD9A 3OM9A 1BWSA 4WCFA 2Q99A 3DMYA 3WXBA 1EVIA 3OJLA 3MWDB 4RPHA 1JKFA 5CPBA 1YGYA 2Q49A 2RCYA 4ESOA 4E13A 4TVBA 1HL3A 3CXRA 1PGOA 3GPIA 3KEQA 1UH5A 4KWHA 5DP1A 3F47A 3KYDA 5C7IO 5I7VA 1LTHR 5ITWA 1LDNA 1WDMA 4WLEA 3DZBA 2RAFA 1TVEA 3TOZA 4DWVA 3DEYX 4MVJG 3WSWA 1QSGA 1IYZA 1UZLA 4XGNA 3S1LA 4CJXA 4A27A 4BO9A 3JQ8A 3RBVA 1E6WA 2BRUA 3OFSA 4GVLA 3K30A 3LYLA 4UREA 1PJ3A 3EZYA 5JDCC 1U2GA 2XAAA 1K5HA 4R5MA 3WYBA 3WGQA 2ZYDA 4BNJA 3ASUA 3ICCA 3F3SA 3VVBA 3D4PA 1YL6A 3AUTA 1MUUA 3JYNA 4AG3A 3DMTC 3QRWA 3ZN2A 1ML3A 4EUEA 5F21A 4DUPA 1MFZA 1WNTA 5DOZA 2PGLA 5EERA 1H9BA 4CLOB 2HCTA 3DZIA 2VWHA 4BKUA 4YDRA 3A06A 4MVJH 4KTTE 4HFNA 3UW3A 2Y0EA 1O0SA 5I8WA 5GMOA 2ZYGA 3CIFA 4BNTA 2EERA 4TRNA 3SXPA 3H4VA 4UUNA 5KJCA 1DJNA 2NACA 3E9QA 1GQ2A 4YAJA 3WFIA 2DBRA 1PQUA 5B4UA 3LC2O 2C7VA 4D3SA 4GWKA 4HP8A 1K6IA 3ZWVA 2YV2A 4LSMA 4EBFA 1E3WB 3JQAD 3LK7A 1DIHA 3GEGA 3A28A 1A71A 4TROA 3G79A 1ZXLA 2PZMA 4BNNA 1DXYA 3L4SO 4K6CA 4D43A 3HE3A 3ZNNA 4R16A 4O63O 1VL6A 3DFUA 3JSAA 4ZRNA 3K73O 1ZSYA 4C4OA 1HE3A 3K9QO 4J3FA 3UUWA 4DYVA 1T1RA 2NU7A 3C1TA 1YB5A 2JFFA 3DOJA 1NR1A 4NBUA 4XR4A 4YA6A 5CDYA 1DRWA 4PLPA 1U5AA 3U4HA 2WWRA 1I3LA 2EGGA 2YJZA 3IS3A 3GDOA 5DN9A 3WFJA 2X22A 3R3SA 3EGOA 4IJWA 4IM7A 3TF5A 4LISA 4ZHSA 1YBVA 5ES3A 1JQBA 1X7HA 4ALKA 3LLVA 2CF5A 3VKVA 2X5KO 4AJLA 4BNKA 5DCWA 3CTMA 1VM6A 4Q3EA 4BNZA 4B3IA 2IDZA 1IHXA 3UFXA 2O3SA 1KYQA 4QTZA 1PZEA 4EZBA 5B4TA 1O6ZA 2UDPA 4HV4A 4D3DA 4R1UA 2VZ8A 4JBGA 2NWQA 5BNTA 1F8GA 4Q39A 1KEVA 2DTDA 4BQPA 1GV0A 1KEPA 4G81A 5BSFA 3BTSA 1M6WA 1EZ4A 3T7CA 1HYEA 2RHCA 4RQTA 5KVSA 5AOVA 4ND1A 1I3MA 2DKNA 3V1TC 1A7AA 3TJRA 1XSEA 1ARZA 3VH4A 4K26A 2B5WA 4K1LA 3ZV6A 3ZU5A 1MFPA 1BTOA 1C0IA 2FZEA 3DAPA 3GRPA 4XIYA 7MDHA 5ER9A 5G0SA 4R4JA 4MP3A 1E7RA 2X8LA 3DZFA 2NVBA 1KVRA 1B15A 4BMVA 3VPXA 1GD1O 3E18A 4ZD6A 4P8RA 5FYDA 1N7HA 2AEMA 2WYUA 1HDCA 2GD1O 1AE1A 1EEHA 8LDHA 2ZB3A 2I66A 5G0WA 3DBLB 4JJFA 4ZICA 1E1LA 4LMRA 2QIOA 4YJDA 2WYWA 4BGEA 1BW9B 1O8CA 1C14A 5AQ1A 3HDHA 4BVAA 5JAIA 1S6YA 1CETA 1P0CA 4BO7A 5EL0A 4U6SA 4ZQGA 3S2GA 3OQBA 1UZNA 3N74A 4A2CA 3LVFO 3JQ9C 4JJIA 3LT0A 4S1VA 1V3TA 2ZJ1A 5AVOA 1Y9AA 3DBRB 3ZWMA 5L53A 2PD6A 5IF3A 3T7EA 3Q2KA 2QRLA 3DOCA 5I8ZA 4J4BA 2BFAA 3ICPA 5JO9A 2BLLA 4XJTA 3WGOA 5IDQA 4GX2A 1HLPA 3ZW8A 1X0XA 4FFMA 1A27A 3WR5A 2AG5A 3WYEA 2BGMA 1V0JA 1EVJA 5ER6A 4O0LA 3ZWPA 5JYEA 3U5TA 4QQRA 3WJAA 1T2CA 3H5RA 4UVDA 2GN9A 1Y8QB 3DZJA 3UCXA 3GK3A 1YO6A 1LX6A 2O3TA 3SJUA 3K96A 4FQ8A 1GUFA 1HXHA 4E32A 5IDYA 5A9SA 3G0OA 1UUFA 4UVHA 1FDVA 5AYVA 4CMJA 1CWUA 4M8SA 5IXYA 3KYCB 5KCZA 3AUAA 2G82A 4B79A 1ULUA 3IJPA 3PJDA 3DDNA 3LC1O 2OO5A 3QVWA 4J90A 2RH4A 1ZK2A 4ALIA 1QP8A 4ONEA 1BSVA 5G4LA 3GG2A 3Q1LA 2HMWA 4IDCA 4BNGA 3GH3A 4URFA 2B35A 4BNVA 1PJLA 4LRSB 3EYWA 4JXKA 4NNJA 3VPGA 4PG8A 3OQ6A 1YE3A 4R51A 2OXIA 1R12A 3ROPA 4DTIA 3DBHB 2CDAA 1YOVA 3JYOA 5G4KB 3KEOA 1EMDA 1XYGA 1XDWA 4L4XA 3FWNA 4NG5A 1SPXA 4WNCA 2PR2A 2OBNA 1W6UA 1PX0A 4E33A 2WE7A 1PZGA 1P1IA 5HRUA 4OQYA 4KQWA 1ZIDA 5LC1A 4NIMA 2BI8A 3DHNA 1I33A 2SCUA 3DOOA 4Q9NA 3ZCXA 4DGSA 3QVSA 4HFRA 4IJUA 4I1IA 4A26A 2X58A 2NVUA 4JP2A 5BSHA 4CQLB 1VJTA 5I9LA 1KC1A 4I5GA 2NSDA 1T4BA 3PHLA 2OP0A 4QXMA 1XG5A 1X13A 2RH8A 1KVSA 4XWYA 5JMPA 2BHLA 3LC7O 3DB2A 1Y81A 2Y0DA 3UOGA 5IDWA 2Q1TA 4IDFA 3NDJA 4WLNA 2O23A 4CM3A 5JYDA 3JQBC 1VC2A 5L7WA 4IQ8A 4R9RA 4B7CA 2Y1EA 5JCJD 2YQ5A 4NU5A 4O1MA 1EUZA 3LDHA 4NBTA 5JBIA 1EE9A 5ICMA 1LSSA 1GAEO 3HB4X 5G4KA 2GZ3A 4MKRA 4ND3A 2OFPA 2E82A 1PL6A 2R6JA 4L76A 4J0FA 1R16A 4GSKA 4YJFB 3ZWCA 2BELA 3DWFA 3PK0A 2R00C 4CM8A 1L7DA 4XQGA 1UJMA 5H82A 1HWYA 4EJ6A 3QWAA 4CMAA 4BMSA 3GQVA 1F17A 2DLDA 3WWZA 1SNYA 4E2WA 4DREA 3I5MA 2H5LA 1Y6JA 4BHTA 1E7QA 3I9LA 1E1NA 5BSGA 3UF0A 4Y6RA 1EFLA 5L4LA 4Z6KA 2Z1NA 2ZJ0A 4B8ZA 2WDZA 5CDGA 4P4LA 2UUPA 2VT2A 5DOVA 2ZTUA 4CL3A 3MZ0A 2R2GA 1KERA 3RUHA 4TMFA 3CE6A 3OBBA 4AJPA 3FWZA 2V6MA 5ICSA 3I9KA 2GLXA 1DIBA 4GX1A 3TZHA 2EJWA 4ZN6A 1PJ2A 2PD4A 3NT4A 3GGGA 3BXXA 2Y05A 2X7HA 4NDNE 4CMCA 3P2YA 2DFDA 3WYCA 1B3BA 1DSSG 4BO1A 5GZ6A 2J3HA 3GNQA 4WOKA 5EESA 3GN2A 4WCDA 2DTXA 2WEKA 1HE5A 4TRRA 5J23A 2JAPA 5C37A 2P5UA 4XQEA 1J0XO 4E2ZA 4GGOA 3RUIA 1B0AA 2AEJA 1UDAA 1ADGA 1KS9A 3BA1A 5TSDA 3GFGA 3OICA 4KMSA 1BDBA 3UN1A 3V2HA 4DYDA 4M86A 1HZJA 1JW9B 5U4QA 2JAHA 1HRDA 1YDWA 2O2YA 3FBTA 1Q2XA 2CVOA 3NJ8A 3W8FA 5JDIC 1XGKA 3WGHA 4E5KA 3EK2A 2EEZA 2FPPA 4FN4A 4BNHA 1NVTA 1VE9A 3FF4A 4KTVE 1FDSA 4UAGA 3WJ7A 5DDIP 1XU9A 2O4UX 1EQ2A 4NFSA 1JN0A 4WLVA 3JQFC 4LCJA 2EP5A 4Q3AA 1E3EA 1DPGA 3BTOA 3D4NA 3GG9A 1U1IA 4CL8A 2WD7A 5JC8A 1E6UA 3KLPX 1NFRA 2NNLD 3WS7A 4PG4A 5JY6A 1MC4A 1AXGA 1CQJA 2O3RA 3ZWAA 4ND2A 1QLHA 3VVCA 2NADA 4L0QA 5ENDA 3RUAA 4I9HA 1ID1A 2HQ1A 3OJ0A 3GHYA 1ENPA 4J1NA 4EEXA 5A5EA 1DHRA 3ADPA 3X2FA 3ZU4A 4A5OA 3JV7A 2NU6A 3SC4A 4MDHA 3FBGA 1M2WA 4QO8A 1XA0A 5ILOA 1D1SA 4U0JA 1ZZEA 1NHWA 3EZLA 1HDGO 4Z0TA 4PFJA 4WE3A 1IPEA 3LLSA 4MP8A 1ZMTA 2EHDA 4Z9XA 4DL9A 3I1JA 4J9UE 4WKGA 3GVIA 3WICA 5K6AC 1KEWA 2YFHA 9LDTA 4JBHA 1HZZA 4XX0A 2C20A 1PR3A 2GF2A 2YUTA 3C85A 5T6BA 1FF9A 1A9ZA 2P4QA 1LLDA 1K6XA 4HFJA 5JCJA 3HFSA 4AJ1A 1I2CA 3PXXA 1OMOA 4BNMA 4YAGA 3PVZA 3F9IA 1NBOA 3MEQA 3HJAA 3W6ZA 1D4FA 3OIFA 3AOEA 2JFGA 3BTVA 1X14A 1QYCA 1Y7TA 2JD1A 2AE1A 3PTZA 3ONDA 3UKOA 4F6LA 5A4DA 1NVMB 4J49A 4MP6A 3G3EA 1IL0A 2DTEA 3DHEA 4LRTB 4IDGA 4CM4A 1GUZA 2XXJA 3FSRA 5FFFA 4E5PA 2GGSA 1V9LA 3C1AA 4J4TA 3ZV3A 1M66A 4XGIA 3OHSX 3GA0A 4JQCA 3ONEA 4XYBA 2X0JA 2C59A 3JYPA 3L9XA 3LF2A 3JD4A 4ITUA 5KJFA 1OFGA 4MVJE 2VN8A 2EG9A 3GUCA 3ZWOA 1ZSNA 3PQFA 1DEHA 3ANNA 5JAMA 3ROMA 2AXQA 3F4LA 2LDBA 1VJ0A 3FTPA 3MOIA 4WOJA 3GNSA 4ZQBA 1GU7A 4CMBA 4TSKA 8ADHA 4NPCA 4IGEA 1ZK4A 3QV1A 1CRWG 1N9GB 2QHXA 1NFFA 3DZGA 1ORRA 2PNFA 3WGGA 4EJ0A 1ZJYA 3PEFA 3GOHA 4CMEA 4PCVA 4GVXA 3CSDA 2Z1MA 1FDTA 1ISJA 3DQPA 4MO2A 2E4AA 1JVSA 4WLOA 4RO0A 1WDKA 4YQZA 3RC9A 2AEFA 1C0PA 2DC1A 4OIMA 5T8KA 3AUSA 3B6ZA 2VNSA 5KJ1A 2I65A 3IAHA 3CMMA 2WD8A 1ZEMA 2C07A 4HADA 3O8QA 3QP9A 4B4VA 3I9OA 4CMIB 3KOUA 1M67A 1PJBA 5GZ1A 4IQGA 4BKPA 1WMBA 2GR9A 4NJMA 3K92A 1NAHA 4F6CA 3RKUA 1NASA 4Q3BA 1P33A 1PZHA 4TWRA 1HSOA 2QZZA 1Z6ZA 4BMNA 4CLHA 5GZ3A 4YAEA 4PGFA 2FR0A 5DNAA 4IS2A 2VWQA 3I9JA 1IHYA 4MVJD 4NR0A 5F1PA 4AJIA 2FP4A 3WQRA 4H3VA 1DFHA 1PL8A 2O7QA 3O9ZA 4R01A 1X1TA 3RUFA 3K2BA 4J7CA 4RORA 3DTYA 4E12A 4EITA 4HXYA 3WG9A 2Q2QA 4PLVA 1ZKMA 3GVHA 1MG5A 4FC6A 1W0CA 3W4KA 1LUAA 1PIWA 1UXJA 3MJTA 4HX5A 4WCFB 1N1EA 1RYEA 1GZ3A 3L6EA 5U9CA 4C7JA 2EV9A 5T5QA 2BFOA 2XOXA 2FPGA 4IUYA 3GMDA 4JIGA 3FPLA 4YVFA 1OZAA 3BTUA 2BI7A 1DC5A 1M76A 2W8ZA 3L0DA 5CP8A 3KYDB 4AJJA 4BV9A 1NTOA 1DOHA 2VHYA 2YV1A 1UAGA 4TKLA 3MJSA 3AFNA 3LF1A 2CSUA 1EUCA 4W9NA 4CLRA 2IZ1A 1I3NA 1YWGO 3E03A 4NBVA 3JQ8B 1YS4A 4FR5A 4DPKA 3C7DB 3E1KA 5U1PA 3RFTA 3S8MA 2ZIZA 4XYMA 1EBFA 1B26A 4DLAA 3KVOA 2PV7A 3LZ6A 2E48A 3PZRA 5F3RA 5COBA 1IUKA 4OH1A 3H9GA 5JAZA 2YZ7A 3GY0A 1YJQA 5A05A 1AUPA 4FJ2A 2E49A 3D3EA 5BR7A 5K9ZA 4GSLA 3GGPA 3PFWO 4IY1A 5F5NA 1G1AA 3ZV5A 2PD3A 4L9RA 5BQFA 1P1FA 2FOIA 3DZHA 4IDAA 5DBFA 1HYGA 1T2FA 1T25A 2ZCUA 3KSUA 4TRJA 3AM5A 1V8BA 2GSDA 4IINA 3W4JA 4YJHA 3L6DA 1IE3A 1UXHA 2V65A 1WPQA 4OM8A 3NX4A 2HO5A 3DXFA 3I6QA 5TS3A 2B4QA 4AJ2A 1P1KA 1QV7A 2ZQZA 3MJVA 4Y6SA 5DBGA 2PGDA 5A06A 1I2BA 1T1SA 4F3YA 3L4BA 4L75A 5L4NA 1NM5A 4BO2A 4EEZA 3JD1A 1PS8A 2EKLA 1PZFA 4E2YA 1PGPA 1C1DA 2W2LD 1LSJA 5ADHA 3OF2A 3N58A 1LI4A 3KETA 1N2SA 3NEPX 5BNFA 3INGA 3QLJA 2B4TO 4RL6A 1IZ9A 3TZKA 3S2FA 5JPIA 1VL0A 4GMGA 2V6GA 3AM3A 4BS9A 4BKRA 1Q1NA 2PKQP 1EK6A 1SBYA 4LSWA 5DZSA 4N5NA 4DPLA 4OOFA 2YW9A 1A5ZA 3AI2A 4II3A 1DRUA 2BH9A 4FFOA 4DA9A 2DT5A 1CERA 3CMCO 3AY3A 4I9UA 3KXDA 4CV3A 1DC4A 4NK4A 4QECA 5KVVA 4XJSA 3CH6A 1VKOA 3WQSB 4IBOA 4K28A 3OMLA 2AQHA 5K0ZA 1Z45A 1ZMOA 5ITVA 4P22A 1ULSA 2FSVA 2VHXA 1E3IA 4L74A 3PJFA 4DIBA 4UULA 2VWPA 4JLWA 1P3DA 3O4RA 4GX5A 1C1XA 2GERA 2IZ0A 3U4DA 2ZYAA 4GBJA 1Q0QA 4KQXA 4NK5A 4DXHA 2Y68A 1H94A 2X23A 3QWFA 2X4GA 5FF9A 4RF3A 3WTBA 3ITKA 5KWEA 1ZBQA 2P9CA 2GDZA 2WM3A 2AMFA 2RBEA 4U0KA 3WNQA 3AU9A 3LT2A 5IN5A 1LXCA 1H6AA 1K3TA 1ZUD1 2YY7A 4QSMA 3EDMA 4H15A 1PJTA 2PZLA 3BMNA 4IJKA 1RJWA 1VL8A 1QR6A 2JCYA 1W8DA 1ZCJA 3V1UA 4YRDA 1BXKA 1PWZA 4PZDA 4U8GA 2Q46A 3H9JA 1U4OA 4BL5A 5TC4A 1K0UA 2EJVA 4RDHA 1KOLA 5JS6A 1OBFO 5H81A 1MLDA 3PWZA 5KVCA 3UCEA 1UDCA 5C5IA 3BZUA 3F1KA 4FOSA 1I36A 5KOIA 4R3NA 3QWHA 4BGUA 4Q3NA 2VRCA 4A73A 4W4TA 1MA0A 3V5NA 4XQ9A 2ET6A 3DL2A 4HUJA 3GC6A 4IS3A 3NDIA 2D5AA 4GLLA 3PHJA 5LDGA 4ZJUA 5I7FA 3VTZA 3RU7A 3E5MA 2HK7A 3NGXA 2DAPA 2FY8A 4XYGA 2Q4BA 2JFHA 2W2KB 4M55A 4RZHA 5CEJA 1HETA 1OC2A 3F6YA 3LU1A 3L07A 1SEVA 1J4AA 4I9NA 1K6JA 4BNXA 4CR6A 1N7GA 5T57A 3WGTA 3KUXA 5IJZA 2GUGA 2DPGA 4IDBA 4DMMA 4ROSA 4DIFA 1I10A 3PQDA 1A72A 1YKFA 4BIIA 3H9EO 3RUEA 1NQTA 1C0LA 4OYRA 4DVJA 2YHIB 5IDXA 4NBWA 5A9SB 3TWOA 4CM5A 4HNGA 3WTCA 3PIIA 4LK3A 3IC5A 3DFZA 2A35A 2YYYA 1H2HA 4QUKA 3RC7A 3I83A 2CVQA 4PRLA 3IOYA 3KO8A 2ZTMA 2J6IA 2EWMA 3B70A 3VHRA 1HDZA 3DAGA 3IKVA 5F1OA 1L7EA 1LLQA 4R5HA 2NTNA 4BB6A 2FHSA 3PPIA 5EN4A 2IXAA 3IKTA 2X86A 3ZU2A 4NQZA 2W2KA 1PEDA 3GR6A 5G0VA 1YONA 1YOVB 1GFSA 3ZHYA 4HFMA 4KDEA 2GCGA 5EPOA 4AJEA 3GNTA 3BHIA 3MJCA 1EE2A 2PA3A 4EUHA 2G5CA 4ZQHA 1DLIA 4QX6A 1YXMA 3ETDA 4RVUA 2UUOA 4ALNA 1V3UA 1KVQA 4ILKA 4A03A 5IN4A 1HDXA 2AQIA 2GO1A 1W4ZA 2YHIA 3HNPA 4CMHA 2NVUB 4IMPA 3HG7A 2X6TA 1NR7A 4IXTA 4CUKA 2Q1UA 3GVPA 2I3AA 4JBIA 4D44A 3NKLA 3OJEA 1YRLA 4TVOA 3ONFA 1Q0LA 5L40A 1X7DA 4QEDA 1BG6A 2EP7A 3Q2IA 4OXKA 5COAA 3GRKA 4WK6A 5CDTA 1LSOA 2NTVA 3PHIA 4IJVA 2HMVA 3GDFA 2AQKA 4N7RA 1DAOA 2HU2A 4IDEA 5A02A 3ITDA 1J6UA 4O5OA 4QO7A 1H6DA 2B0JA 4ZQEA 1M75A 4WEQA 2OUIA 2W98A 5EINA 4WJZA 1ISGA 4OOEA 4HNHA 3WOHA 4B4OA 1JWBB 3RJ5A 2W90A 3FR8A 1LDMA 1WWKA 4MIOA 3JQAA 2CUKA 5FWNA 4RF5A 4CM8B 4OXNA 5JCXA 2JCVA 1JDJA 2GN6A 5B4VA 3MJ4A 3RASA 1N8KA 2O3QA 2ZKLA 3V1YA 1R0SA 3PHGA 4D7AA 1F06A 3FN4A 1GEGA 4K6FA 3FD8A 1EDOA 1JLLA 2DFVA 2GZ2A 3AM4A 2JHFA 1D3AA 2F00A 2D2IA 2OL4A 2UYYA 2ZB8A 5KJEA 3TZQA 1JVBA 3UVEA 3GT0A 1VJ1A 4DLBA 4YPOA 4DBVO 3HHPA 3OH8A 2P5YA 3PDJA 4W7IA 5A9RA 4MKXA 3UAGA 3C7CB 2P68A 3COSA 3MTGA 2IYOA 4YTEA 5EQDA 4RF2A 4YBZA 1VSVA 1T2AA 1Y5RA 3PWKA 1PJCA 4MVJM 4I5DA 2B36A 3ROKA 3Q0EA 4CM1A 5IG2A 1TEHA 4HY3A 4MKZA 4YXFA 3INTA 2Q4EA 4L73A 1VSUA 2B83A 3A9WA 5A9TA 2CMDA 3MOGA 4N5MA 1BMDA 1F8FA 4OGWA 4NHEA 2BFMA 3NYWA 3SLKA 1JAXA 3GZNA 2X5OA 5L9AA 5JLAA 5KVQA 3RUCA 5TRTA 3JQDA 1TLTA 2VUTA 3DTTA 5JFOA 4ALJA 1PQWA 2PTGA 1Z75A 2C82A 1I30A 1G0OA 4B3JA 4A10A 3N7UA 4UUMA 2IRWA 3AI3A 5A3JA 2OHXA 1R66A 3GZ4A 2X9VA 3Q9NA 2ZB4A 4E5YA 4RVFA 3M1AA 4N54A 4WASA 3WBFA 1XKQA 4GWGA 2GRAA 3H65A 1LLUA 1QMGA 1E1MA 4I5EA 5CPFA 2CY0A 1IZ0A 5CHEA 2PWZA 4E21A 1YBAA 4FC7A 1LDEA 4PVCA 3KSZO 1G6KA 1LA2A 3EC7A 2WYVA 4YRBA 2A92A 1KBZA 2Y93A 3OJOA 4XCVA 1GDHA 2HAEA 1A4IA 3GAFA 3ZNQA 1ADCA 2WD7B 1YQXA 1ZK1A 1Y9EA 4FGWA 5A04A 1NPDA 3K6JA 3H8VA 2E6UX 2GPTA 2Q45A 3PGJA 2PKRA 3AFMA 4KP7A 2DPHA 3EMKA 1E7YA 3FNFA 4DC1A 2V7PA 5MGBA 4RVGA 1FK8A 3QW2A 4LGVA 3ETEA 4OJNA 3W4IA 4KUHA 4EYEA 2UV8A 3GMSA 3QVXA 1P74A 4XD2A 1I32A 2QRKA 2C7GA 1MB4A 1PSDA 3ZHZA 3GLQA 4GI2A 2FPIA 2D59A 4L8VA 4XZ3A 3AUUA 4I5FA 1QV6A 3KV3O 4JJGA 1R4NA 3BMCA 2XPCA 4FJ1A 4XRGA 3BMOB 3WQQA 1QG6A 3CUKA 3QHAA 2YV3A 2R00A 5CG1A 3T4EA 5BT9A 1O5IA 5IAAA 4PLWA 3VKUA 3AW9A 2Z95A 4J7XA 3BHMA 2O3UA 5FI5A 3SX2A 1ZJZA 4WPGA 3WMWA 4FB5A 1GPJA 4E3ZA 4UVGA 4MVJI 1JU9A 1PGNA 4RCVA 1KY5A 4XYLA 2FRDA 2PZKA 1UP6A 4RDIA 4FS3A 4RPLA 4WGGA 3WB9A 4BO4A 3SVTA 2OOSA 3RKRA 1OOEA 2J8ZA 2GN4A 4EJMA 3WGIA 1NNUA 1N92A 5T64A 4KOAA 3HUDA 2EW8A 3AOEC 2VHWA 5JE8A 3GVXA 2GZ1A 1GYRA 1NQAO 1XHLA 3NTRA 4YEDA 1RM3A 4ZQFA 3D5TA 3H9UA 5A5FA 1RM4A 4M49A 3TL3A 3TQHA 4RPKA 3NDRA 2POQX 2C0CA 3PDUA 4CM4B 3WWYA 1HKUA 2HSDA 5AXDA 3BMOA 1HF3A 4HWKA 2DUUA 2O4CA 1KVTA 1CEQA 1T4DA 1P1HA 2J5KA 4Z9FA 2HLPA 5DF1A 3RBXA 1EVYA 1I24A 4ND4A 4UEKA 4JNKA 4CUZA 3AOGA 3OETA 2X5JO 2A9FA 1MP0A 1RM0A 1V6AA 3B1JA 4DC0A 2O2SA 5DULA 4E4YA 5JDIA 1YDEA 4W82A 1LC0A 3WIEA 2P9EA 1P1RA 4FDAA 1A4UA 3G1TA 4CMEC 2HKIA 1TT5A 5IZCA 2I3GA 2O3JA 2PFGA 2O7SA 3BMQA 4RLHA 1PJQA 4AJKA 5G2OA 2I76A 4UUOA 4PG7A 1ISMA 1IB6A 3JQFA 5T8KC 4J2OA 1NP3A 1GCUA 2YDYA 3DHYA 1NWHA 4II2A 3VZRA 4WEOA 4F46A 1B3RA 4QT0A 1DHTA 1Z7BA 1UAYA 5FEUA 1IY8A 1P77A 3O8QB 1GPDG 1ZW1A 1EK5A 4ZU3A 1UZMA 4BNFA 5EJ2A 4ZRMA 4RLSA 2X0RA 2JHGA 1ZO8A 1SEPA 1VRWA 4NJMB 3FNGA 4BO8A 4BKOA 3P5SA 4GMFA 1ZNQO 3VH3A 4NFYA 3VZQA 4EUFA 1M6HA 4RPGA 1EUDA 2UAGA 2FR8A 3AU8A 3JD0A 4OMUA 3OJFA 3E48A 2QW8A 1ONNA 4KWIA 4H7PA 5LDHA 3HN2A 1J49A 3RU9A 5TJ9A 2GYYA 3IUPA 4J4HA 1YQDA 3BYZA 3GHHA 4OKNA 4CQMD 2VZ9A 1F14A 2Z5LA 2NTJA 1E6EA 1H2BA 1TI7A 1Q0HA 1NQOA 2ZTVA 3VOSA 1QYVA 3UXYA 3WNVA 5JW6A 4B4UA 4J1SA 1SB8A 2NU9A 1DIGA 3KM0A 5K6AA 1B8PA 3UCFA 3KHUA 5TJHA 1LU9A 1ZK3A 3HQ4O 4E31A 1OI7A 1ZVMA 1YL7A 4N18A 5KKCA 2GNAA 1LLCA 3L77A 4CLRB 5A03A 3I52A 4N5LA 1Y8RA 1HE2A 2EGHA 3VPFA 4IIUA 3DR3A 3GEDA 4E0BA 3IP1A 1LRJA 1MV8A 1ZSVA 1YQGA 2J3JA 1S7CA 3ASVA 4QFDA 3QIVA 5HTOA 3FTNA 3IUSA 2AQ8A 2J3IA 1EQUA 3ZWWA 1PR9A 5JO0A 3B1FA 3D1LA 3VPHA 4FFPA 4GH5A 3RBZA 4BO6A 1X1EA 1SZJG 5IZ4A 2PZJA 4YT4A 3RD5A 1GV1A 4FOOA 3DBVO 4WCFC 1F12A 1H9AA 4YJHB 2EKPA 4TQGA 3FCOA 2WJPA 4OHUA 4XB1A 5L45A 4FW8A 4W6ZA 3HZZA 2C29D 3E82A 3PRJA 4H16A 3ZNOA 4AJOA 2HMTA 1ADBA 4FCCA 4INAA 2HK9A 2VUUA 3L4BC 4D3FA 3SEFA 1DFGA 5I9NA 5C3MA 1WZIA 1WW8A 1YB4A 4JN6B 1ENZA 4YQYA 2YFQA 1Y5MA 4YJGA 4CM6A 1E7SA 4U7WA 4UEOA 3UH1A 1C1DB 1BXGB 3E9NA 4R68A 4ZA2A 4BUCA 1A9YA 4R41A 3VDRA 4DIOA 5A1TA 1JTVA 3P7MA 1E3LA 3O26A 2J3KA 5BSEA 2I99A 1CDOA 1HSZA 1XLTA 1LC3A 4CV0A 1U7TA 4EGFA 4BNYA 3D3WA 3U49A 2EKQA 3QWBA 5TT1A 2NU8A 4CR8A 3IL2A 3BAZA 3AI1A 1AHIA 2OGUA 3INRA 4GQAA 4PLGA 1H5QA 5TX7A 5DP2A 2C5AA 1ISFA 2I67A 3D0OA 3JQ7A 3QJ5A 3WMXA 1R0KA 1OC4A 1DJQA 3QY9A 3IQDB 2OP1A 3WLFA 1D1TA 3NGLA 1HT0A 1XIVA 1LDGA 2DBZA 4GPD1 3TFOA 1Y1PA 2JKVA 5HA5A 1C1XB 3RAJA 1HEUA 4K9DA 3GN1A 1BXGA 5L3ZA 4L4SA 3D4OA 1A7KA 3U9LA 3VAZA 1PQPA 2NM0A 1SAYA 2Q2VA 3OQ1A 4HBGA 4R3WA 1U8XX 1NX6A 3PGXA 3JQGB 5JY1A 2AHRA 2Q1WA 4X54A 1JA9A 3BMNB 2O50A 2VWGA 1LDYA 3KTDA 3R3JA 4KUGA 4U5QA 3C7AA 1U7HA 4RQUA 3TSCA 3U4CA 3ZW9A 4D41A 5F5LA 2P2SA 4DRYA 2Q3EA 2Y1CA 4OAQA 2NUAA 1PTJA 2AG8A 4BNWA 1CQIA 2VRBA 4TZKA 5JSFA 1PL7A 1DO8A 4WUVA 3S2IA 4CUJA 1ZFNA 3BHJA 3TZCA 1FJHA 3GUYA 1XCBA 4CQMA 2ZB7A 2CFCA 4XGKA 4PRKA 1I0ZA 5LCXA 1VLLA 1BVRA 3DONA 5CDUA 3AY7A 1XEAA 2UVDA 3PZBA 4P4GA 9LDBA 5EMHA 2D3TA 4CR7A 3L6OO 5AXCA 1K2WA 2E37A 1WZEA 3G1UA 4FFNA 3ROQA 4J91A 3I9MA 3PYLA 1GTMA 1EVZA 4B4WA 1JWAB 1CF2O 1KETA 3EAGA 3JQGA 4D79A 3TL2A 4RPJA 5TIIA 4J9VA 3P2OA 3K31A 4Z0PA 2G17A 4L4RA 1D7OA 2CNBA 2OBYA 1GCOA 4FBGA 1MGOA 3NT2A 2B69A 1U5CA 3PYXA 1ZH8A 3QVOA 4AICA 1ISIA 3UICA 2PKQO 6ADHA 4XQCA 1QYWA 2EW2A 3JQCA 5JDCA 1UXGA 5JMWA 4JROA 1BVUA 1H0KA 3NJ4A 2OMEA 4GAEA 2FZWA 7ADHA 4MVJA 4MINA 1WP4A 3KZVA 3IDSA 5I7SA 1Q7GA 4J43A 4ND5A 3DMTA 1RYDA 2Y1OA 1SOWA 3Q11A 3H3FA 2HJSA 5COQA 2ILTA 4CLOA 4W99A 3I23A 3OIDA 3V8BA 4WNIA 3RI3A 3PIDA 1YH3A 4I8XA 3PP8A 3WDSA 1G0NA 2HMUA 1XELA 3I4CA 3NTOA 3ADOA 3ANMA 1HTBA 4CM7A 4RZIA 4GKBA 4WECA 4PLFA 2I6TA 3ZH2A 3OEWA 4C7KA 1UXKA 2NVWA 2RHRA 1BXZA 1SO8A 3ENNA 4G5HA 4R1TA 1HYHA 4MOWA 4CODB 4GX0A 3ENKA 3WSVA 3B1KA 4BGIA 4CM9D 3TFQA 4IZHA 4KDFA 2FWMX 1LSUA 2QZ9A 1E3WA 4NJOA 4B3HA 3VH2A 1JKJA 4RGBA 1TB4A 4FJ0A 3M6IA 4NH4A 3WBBA 1TA4A 1R6DA 4Q3DA 3S55A 1HE4A 1Z73A 1LNQA 4M87A 4FD3A 3TN7A 1I01A 1VPDA 3ULKA 3QSGA 3VTFA 3H7AA 1PWXA 2J5QA 4R9SA 1N5DA 1RM5A 3IP3A 4O59O 2GASA 1ENYA 3STHA 2G1UA 1CIVA 4FSHA 1EFKA 2Y1FA 3ZWYA 3K8ZA 1UR5A 1LJ8A 3T4XA 4FGSA 4MIYA 3ZU3A 1U3TA 1BDMA 1YL5A 3FI9A 4O6VA 4ALLA 4EI2A 1X0VA 2VNAA 4PZEA 3FNHA 3SLGA 5C7LO 1UP7A 1LBEA 4E5MA 4AJHA 3O03A 3HWRA 3C24A 1YJ8A 1HLDA 2PY6A 3B20A 4IMRA 2VYVD 4R69A 4Y6PA 4J1TA 4E5NA 2PK3A 5EQFA 3P19A 4DQVA 1SCUA 1PU2A 3JQAB 4D0SA 3LQFA 3H3JA 2W2LA 4YACA 1AGNA 5HS6A 1DBVO 4OKIA 3D5QA 3JQ6A 5C7OO 5HM8A 2QYTA 3ON5A 1QXSA 4YT5A 3ETGA 3RUDA 1ENOA 1DC6A 3E5RA 3NTQA 4XKJA 1GUYA 2IEDA 5AXAA 2JL1A 2JD2A 2A94A 2C2XA 5L51A 2AW5A 3VZPA 4JCOA 1H6CA 3KRTA 2PLAA 4XB2A 4KZPA 4RVSA 1NHGA 1GQYA 1E1KA 3AJRA 4PN3A 3I3OA 4YAKA 2CVZA 2EXXA 3H2SA 3GPDG 4GLOA 4IZIA 4PLZA 4DPMA 3MTJA 4RF4A 2P9GA 4D0RA 5B37A 4CLXA 1IULA 4J1QA 2WMDA 2D4AA 1XQ6A 4LVUA 4Y67A 4Y9DA 4CMGA 1DIRA 2W4QA 3WGYA 1R15A 3VPSA 3A1NA 2NQ8A 3DBLA 2NLOA 4ZVVA 1LEHA 1U9JA 4ALMA 3TZ6A 2B5VA 3GFBA 3ZI0A 4D42A 3G49A 2H63A 1BW9A 1GY8A 1P0FA 2AA3A 4W7HA 1EBUA 2DBVO 2VT3A 1X7GA 4IPTA 3GAZA 1QORA 3W1VA 1DRVA 3IMFA 3GZNB 4XA8A 1GZ4A 3JQ9A 1R37A 4CMKA 5CEFA 3HDJA 3DBRA 2ZK7A 3ZWXA 2PH5A 4JK3A 5GY7A 3PQEA 3RFXA 1MXHA 2DM6A 1C0KA 1ONOA 2X9NA 3FR7A 4Z3DA 3ZDFA 1YBMA 3ZZNA 4A7PA 1RPNA 2QYSA 3KB6A 3Q9UA 3HADA 3R0IA 4NZ9A 4AVYA 2D8AA 1VKNA 4NI5A 3KSDO 4DBZA 1SB9A 1E3JA 3MCVA 3EUWA 1Y8QA 3LT1A 5KTKA 2Y0CA 4E2XA 1DLJA 1SMKA 3U09A 2TMDA 3PJEA 2YQ4A 2VTEA 3EY4A 4RV9A 3TRIA 2BGLA 3EHEA 3KYCA 3SJ7A 4M89A 4TRMA 5JNLA 5TLSA 1O95A 3I6IA 2C54A 3E6AA 1NFQA 3C3XA 3JD2A 5A3VA 1RWBA 1N1GA 3DC2A 4R54A 1P45A 1PS0A 4JGBA 4NMHA 2HK8A 1AXEA 2A4KA 1KIFA 3D64A 3DBHA 1DC3A 3PYMA 1HDYA 3V2GA 5L4SA 3V2UA 4CLDA 4OXYA 1IPFA 3A14A 4G2NA 1JAYA 1GADO 2OORA 2X0IA 2CF6A 4CM9A 4XDYA 3GF4A 3O38A 1KVUA 1R4NB 3BMCB 4LW8A 1NYTA 4RJTA 1K89A 4B7XA 2EF1A 5DCUA 2H9IA 3HSKA 2HDHA 3WX0A 3UGKA 3VDQA 2BD0A 1X15A 4I08A 5DCYA 4BNIA 4J2HA 4CQLA 4MVJF 4E30A 5T67A 2Q50A 3KYBA 4YWJA 1T24A 1LDBA 1GZ6A 4FIZA 5HBRA 5B12A 1O9BA 1NQ5A 1GYQA 2G0TA 2Y67A 3DO5A 4R1SA 2ZQYA 1VI2A 4BNLA 4EDFA 3JQBA 5JAQA 1QLJA 1CYDA 5DT9A 3HFGA 3W6UA 3F5SA 1E5LA 3GDGA 1NPYA 5CFZA 4PLCA 5DBIA 3ZNPA 2WTBA 2VOEA 3JCZA 3R1IA 3RIHA 4BKQA 2JCXA 2V6FA 1BGVA 1CJCA 3JD3A 3GGOA 3M2TA 1I2ZA 4DQUA 2Y1DA 1R0LA 1B7GO 1BRMA 4XR9A 2VYVA 3ABIA 3S2EA 2CDCA 3H9QA 4NBRA 4YJFA 1F0YA 1TT7A 1Z7EA 1NVGA 3HDYA 4IGFA 5KJ6A 4HKTA 1GR0A 4XEHA 3W8EA 5G0UA 3AY6A 3JTMA 4MJLA 3QA9A 1QRRA 4YT2A 1D8AA 1TXGA 3IJRA 3QVTA 1W73A 3VZSA 2H1SA 3NV9A 4U6QA 1PGQA 1GL3A 5ENVA 3OA2A 1QYXA 2FSSA 3CINA 4LN1A 2I9PA 3RSHA 1GYPA 3JYLA 3G17A 3ZWNA 3CZMA 3D7LA 4JX8A 1YVEI 1Z82A 3H2ZA 2IE0A 4Z3KA 4BO3A 3RFVA 4D46A 4IQ0A 3SC6A 2Q1SA 2BMAA 2VHVA 1T2DA 4BOYA 4RVHA 2DBQA 3F46A 5BNIA 1KY4A 1B8UA 2QG4A 1C3VA 3FPCA 1TT5B 5IZCC 2QQ5A 1GQQA 4NU6A 3BMQB 4FPXA 5JC1A 4RVDA 2WSBA 4PG6A 3PJGA 2PH3A 1E0DA 3NUGA 4OO3A 2P4HX 4DMLA 1T2EA 2EIHA 3HDQA 5ILGA 3ZWBA 4LCEA 1R4MB 1U3VA 2IODA 4IXWA 3R6DA 3TDKA 1QYDA 3E9MA 1J5PA 4CV2A 3H5NA 2YDXA 3OEYA 5CDSA 4P4NA 1XR3A 2VTDA 1WLYA 1V3VA 2IXBA 3QQPA 2HMSA 1NPTO 4UVEA 1UXIA 2DU8A 5EIOA 4PVDA 4JP3A 3FRJA 3VC7A 2B37A 2V6BA 3LT4A 4PZCA 2CZCA 1SOVA 1YB1A 3U4IA 3L9WA 3M2PA 4LVCA 1I5RA 1XU7A 4PLHA 4YAIA 4AL4A 4YT8A 4BO0A 2NV6A 4J16A 1E92A 3GEMA 5B1YA 2HUNA 3PWSA 4UVIA 1T26A 1PS9A 2BF7A 2HRZA 2X0NA 2VYND 2FN7A 3RWBA 4BNUA
chains in the Genus database with same CATH superfamily
4QJ4A 3ME5A 3F1LA 3TOSA 2M6KA 2VDKB 3T5DA 5JNSA 4HAYA 1E7WA 1H85A 3MCZA 2H5IA 3O1HB 4MV6A 1UBCA 5DIFA 5JTTA 1GSOA 2Y66A 3S7ZA 4MPDA 2WUVA 3TNLA 2X2PA 5K09A 1ONPA 1XWFA 2OXCA 4MS1A 3AVYA 3ESZA 4C7XA 4EB8A 3EZ6A 3T3EA 1PJSA 4Y1RA 1U9YA 2H1FA 1DUIA 1ID8A 2JGIA 1FW6A 4UKDA 2CXQA 2PRYA 2NPIA 4M1SA 2WHYA 4PS1A 5CYFA 4RTMA 2NQTA 4MIEA 2PGJA 3WAGA 4V2IA 4Z4QA 3QEMB 3EDQA 3U4QA 4AI6A 4KR2A 1EP9A 2RHWA 3TD2A 1QJCA 1Y8RB 1QU2A 4C9BA 4Y2XA 2V3WA 4X6LA 1DQSA 1ODIA 3KBOA 4MARA 1S3FA 4LMPA 1TJYA 3NVMB 4LDQA 3CRZA 3KLMX 4OSPA 2DQZA 1G2PA 4REMA 4YYZA 1DB3A 1CY2A 1JDSA 2X2OA 2EFEB 3A4NA 4G67A 4HVTA 4PLYA 4Y8VA 3TOXA 4BLRA 4D8UA 5CA0F 1OI3A 4PNPA 1Q7BA 2AOTB 4M9UA 3U62A 4QT4A 2O8DA 4XJXA 4AP9A 2BR3A 3X1XA 3R4CA 4GE3A 2IDJA 2Q7DA 4CTNA 3AF5A 5THQA 4RTQA 2PYDA 1XZEA 2WE8A 3FSGD 5A7GA 3PFFA 1BN7A 3WXMA 1XD2B 4GGPA 5AVXA 4PSVA 1KJJA 4NOLA 5THKA 1AQJA 1TUBB 3MJEA 2KM1A 4RY2A 5TT0A 3E70C 3T9EA 4FFRA 3O4IA 2Q0HA 5FTWA 4AMVA 3V8RA 1XCPA 3EH1A 3BHNA 1U5BA 2YRWA 3W2IA 1MJ5A 1XQ1A 5DK6A 3KDAA 3SXUA 1P1JA 1W87A 3R74A 1O94A 4Y1FA 3G9ZA 5A4AA 5E7QA 2XW6A 5CDFE 3M6VA 4RK4A 2ID4A 2FDRA 1Y5LA 2GBLC 3FHLA 4KLNA 2IEGA 3RRYA 4D45A 4F3CA 4GU5A 3IJEB 3U6KA 3LM8A 3H5AA 5C8YF 2O20A 3HI4A 5CBPA 2QTBA 2E5LB 1XVAA 4DG5A 3BQMB 1U8FO 1K7FB 1RWPA 2WB2A 3CN7A 3IBFA 1QH8B 3D6NB 3NT5A 4Z9YA 1L1FA 3JYQA 4D97A 4F45A 5KQPA 4O2BF 5LN1A 5LSAA 3TG2A 3RDPA 4DG9A 1N6RA 2FH5B 1HDOA 2E4VA 2CT8A 2C4VA 5EIWA 4TL9A 2P5TB 4YRIA 2LDXA 4Z4EA 1H6BA 4RWZA 3UJBA 1BVYF 5KNBH 3KJHA 2ECKA 2QX4A 1E5QA 1IXZA 2XT6A 2QTFA 1JHYA 3DCNA 3JQEA 4WZAA 4WXRA 2FWNA 4NNOA 3U3XA 1MENA 1YKSA 2RIRA 3R44A 1AN9A 3X3HA 3Q6IA 2BEVA 3KLNA 4G0UA 2ZVJA 4R2HA 3AJ8A 4G65A 1SC4A 2BFDB 4ED9A 3BGWA 2GWRA 4J0JA 1NA5A 3QU5A 5ARCA 4AJ4A 4D96A 1JIUA 2C3OA 2MYPA 3ANTA 2NU8B 4S24A 3VYVA 4A0HA 4C2UA 1HM5A 4BB5A 5LXTA 3VU3A 4F12A 5EJ4A 2PQ2A 4UTRA 1QBKC 3EGDB 4E6PA 3LKDA 1CX9B 2VRWA 3LMKA 5AM0A 2WVAA 5FTNA 4P38A 1AZTA 1E2IA 2ZXFA 3C6ZA 2QE7D 4K9RA 4BASA 5K4GA 3A58B 3INNA 5AVQA 4HRYA 2NW6A 3QUQA 1N9GA 1F8YA 3NHMA 4DDTA 4TMTA 2G1KA 1NYLA 1OV4A 3T7DA 1QJ4A 2BEJA 4Z51A 4JI6B 5MDHA 4GGMX 4Y0VA 1ONBA 3IT0A 5TY0A 3C3CA 2NYRA 2YHUA 5TGDA 4EW3A 1NM5C 4OHVA 1E6LA 1SHTX 4WY5A 3STTA 3JALB 1FY2A 5GVSA 2C7QA 3IUQA 3QWIA 1T9KA 3TVTA 3L1KA 5BN3B 3DE3X 3L8DA 2HF9A 3HXOA 3RIGA 4J0EA 1E7MA 4Q4JA 2FUG1 3EVTA 2P91A 1ESMA 2H6EA 3ACBA 4R8MA 2WYIA 4OATA 2IYPA 1Z38A 3D8BA 1KP3A 1GEEA 2JIZD 4RX1A 4RD3A 5DGHA 4LPSA 5CG2A 4TTJA 2JK0A 1LBQA 5FA6A 4Y7CA 3TAHA 1U2SA 4Y6OA 4O2AA 4CMIA 3CU5A 1S4MA 3D6JA 3QXXA 1JT9A 1ZK0A 1ZXBA 2OYCA 2ZCVA 1LQTA 2HWKA 3LAWA 1T5DX 2Z4SA 3IAM1 3RVDA 5I7EA 2HV8A 3GARA 1AH2A 1SU8A 2JDID 3NAQA 2GZMA 3L0BA 4RZUA 4CLEA 1KC3A 3A3NA 2W6MA 1W0JD 1ZGJA 1IK6A 1PGJA 2WUDA 3HKDA 3Q3CA 4KAFA 3ZLUA 5JWRA 1WETA 5HWSA 4B7AA 1X7YA 1CY0A 1E9VA 1YI8A 4DIMA 2XD9A 1KO4A 3PHHA 2G76A 1C7ZA 2I29A 3KWMA 3UMCA 3QBVA 1QANA 4L9AA 4FMPA 1U7OA 1GIAA 1CJTC 1T5BA 1MC5A 5HIMA 1KDYA 2IEBA 3RRZA 3UK2A 3O2SB 1PAUA 4NEHB 3ZBPA 5JNRA 4M8KA 4GM1A 4UUPA 1XCOA 3E8SA 3L7LA 3PR3A 4QUIA 4RAOA 6LDHA 4NH0A 5IAKA 4G9GA 2ECOA 2CD9A 3GAAA 2XGSA 2Q99A 3DMYA 1Z16A 1EVIA 4KFUA 4TL7A 1XZGA 2VSYA 3V8PA 3CFYA 3JWJA 3MWDB 2RAUA 2H7CA 2IWHA 1XNHA 1YBHA 4W1QA 3P4UA 2Q49A 4FNGA 1IRXA 1I2DA 1XP8A 4EHFA 2QTMA 4HLNA 3CXRA 7GPBA 5KDOA 3N2YA 1P0IA 4KWHA 4RZQA 3KYDA 1JXQA 1RC0A 5TGTA 2YV5A 5HRCA 5I7VA 2VATA 5JLJA 1LDNA 1WDMA 3O90A 3CZ5A 1OY1A 3RC3A 3DL0A 1QK5A 1SU7A 1TVEA 4LWOA 4QZVA 1OBHA 4G4SP 4Y2PA 5ALUA 3DEYX 5GQSA 5HHTA 1U3FA 4HRAA 4ID3A 3DWIA 1QX3A 2RGUA 3HJGA 3LGAA 4JU8A 3ZY5A 4DTCA 4CJXA 1NZJA 3FZGA 4A27A 1VPEA 1YMVA 4N5DA 3RBVA 4W8HA 3V4OA 1E6WA 1M8JA 1PT8A 3SDSA 1MC8A 2CXSA 5FL3A 3UWSA 4GVLA 4B33A 3SSNA 1O97D 2AX3A 4UREA 3EZYA 2ST1A 2C7RA 3SJAA 4O02B 5JNWA 4BNDA 3K0FB 2FW6A 3EFOB 1OHHD 3WYBA 4OD0A 2JCSA 2ZYDA 3ASUA 4MV9A 1T5SA 2A1UB 4JT8A 3UJCA 4G36A 1V4VA 4OQFA 3IBYA 1PEYA 2YWCA 3B1VA 3WKCA 2R4TA 2FDXA 3OFJA 2JPDA 2R6CA 3NP9A 2WWYA 2AG1A 3ZN2A 4PPYA 4CF4A 4DCJA 4DUPA 1WNTA 4QBFA 1XYYA 2PGLA 3BH7A 2ZPUA 2OV8A 1DWUA 4G86A 2JCBA 2VWHA 5K51A 3RRBA 1W76A 1LI7A 1UPAA 4YDRA 1JLMA 1JEYB 1EINA 4MLZA 2MSLA 3I53A 2HHHB 4IWNA 4LTMA 4XX1A 4KX5A 3TLXA 3UW3A 4L7VA 4NHOA 5I8WA 2C8LA 5B57C 4F2WA 2EJCA 1OQAA 4TWBA 5A6SA 2FQ1A 4POAA 4EEKA 5KJCA 4HG2A 1W8IA 1EX7A 1TZKA 2FWIA 1OGJA 3E9QA 3EZNA 3IA2A 1VDZA 1JIQA 4JQYA 5AW7A 3HRHA 4EZEA 4MW6A 2CLLB 2O06A 1MAUA 2D13A 4GWKA 4HP8A 3WZ2A 1O87A 2NO4A 2V55B 3H2KA 3O2QB 2YV2A 2KPOA 1UMBA 5AOCA 1ESCA 4O25A 4LSMA 721PA 5AHKA 1O7JA 2H8KA 2JGMA 1M3SA 4KQ1A 5H59A 4A4DA 2CLDX 4B6EA 3JQAD 2P8SA 3I32A 3LK7A 3QEJA 5BORA 1Z4QA 4DJEC 3PSAA 5BYKA 4JH0A 4NIMA 4XOIA 3C87A 4V0MA 4F4IA 1ZXLA 4KQFA 4D43A 3OJWA 3KZMA 4KIJA 3ZNNA 2YMLA 1M2FA 2AKEA 2VPQA 2OESA 1ZN7A 3LH5A 3NHYA 5ELXA 4ZRNA 4C14A 1PR6A 2LIPA 4PPFA 4OX9Y 1HTWA 3LUDA 1HE3A 2CE2X 4FR2A 3OTOB 1WB9A 4OLAA 5F7OA 4DYVA 3MPUA 1E2HA 1T1RA 2CL0X 3C1TA 1YB5A 2JFFA 3D8TA 3DOJA 4MQLA 5DGTA 3SIWA 5JVDB 2IZ6A 4PGGA 1VJ5A 4NBUA 3RLIA 5CDYA 4QM7A 1HQCA 3ML1A 3ZZTA 2R6GA 4DUZB 1U5AA 3ELUA 3BORA 1X9IA 2OTCA 3U4HA 4D8VA 4DCVA 2EGGA 1ZIPA 3KTFA 4J8PA 2E55A 3DCYA 4MUXA 4P36A 1Z4MA 1C8BA 3CZ9A 2BKEA 3R3SA 2C2WA 4IM7A 5FNVB 3TD9A 1Z0FA 4BFXA 3NBFA 1MRSA 3IEPA 4ZHSA 1SBIA 4QODA 2JNWA 3MB5A 4Q1CA 5ES3A 4ALKA 1L5LA 1E66A 2XNHA 2F90A 2GETA 2CF5A 3AUJB 1GPNA 4TSFD 3PEUA 4BNKA 2WP8J 1N34B 3P32A 1N0VC 4B40A 4BNZA 1HG0A 4B3IA 3NIFB 2CUNA 3T1TA 3CGGA 1N77A 1SUCA 2ZE8A 3ETLA 3Q3VA 2C3UA 1U8UA 4U2CA 4JB2A 4HV4A 2LD4A 3S2UA 2GAAA 4JLMA 3QNUA 3Q0TA 4TXJA 4Q39A 2VO1A 4ARCA 3D4LA 1PTKA 3N59A 3GP5A 4B74A 1GV0A 4G81A 4J2TA 5J5VA 3LYUA 3T7AA 4P93A 4QDOA 5BN5B 5KTRA 1Y1TA 5C2JB 3U13A 4RQTA 3MT8A 3SQNA 2DSTA 1GPH1 1GQOA 1ECJA 1I3MA 2BZGA 2RKOA 1L5SA 4MRVA 1A7AA 3CCBA 3QE9Y 4K26A 2HUPA 4K1LA 4QUEA 4L85A 3ZV6A 1UOOA 1C0IA 3DAPA 4TTQA 4EKYA 1R2QA 4R4JA 3AZOA 5D7BA 3T9AA 5JDCA 2Z98A 4W5HA 3C3YA 4A91A 3O8CA 2DWQA 4FHCA 1G8MA 3VNRA 2A9RA 3BDAA 4BJ6A 4P8RA 4QBTA 1N7HA 1C2YA 1JFLA 4E94A 4HZIA 3IDZA 1TDJA 1YMUA 1JR3D 1R64A 2Z56A 1C1YA 5FBQB 8LDHA 2F1JA 1BC5A 2I66A 1XF9A 1FNBA 3DBLB 5LJLA 4ZO6A 3EPJA 3KSRA 4RFLA 2O0MA 1QFMA 2LKCA 2QIOA 1U2QA 3DMDA 4RTKA 1WXGA 4KEAA 1P6XA 2M6LA 1POXA 5DYNA 3UJDA 2FZVA 4BVAA 2XJ4A 4IH1A 5HTKA 3Q3GE 1EA5A 3G6KA 1X3LA 1P0CA 4QHSA 3ZQKA 3F78A 4U6SA 4BO7A 2E4YA 5EHXA 2IE8A 3FW1A 3JQ9C 2OBFA 3LT0A 3HZRA 5JI2E 3DBRB 3ZWMA 3EPRA 5CFMA 2J3DA 5IF3A 2V7GA 2VF4X 3OCZA 2P1DA 4A0FA 1TF2A 4U3JB 5CH8A 3C45A 4XJTA 2F1HA 5IDQA 4IV0A 2R79A 3ZW8A 4I1OA 3NWPA 1JQLB 4HDSA 4YROA 4GOKA 5FWDA 4ZZIA 5EGNA 4KLCA 2HLDD 3TBHA 1RHUA 1V0JA 1W6RA 3RYHB 3DKKA 4O0LA 3ZWPA 2QRVB 5JYEA 4MVXA 3A1SA 5WRFA 1E1RA 1LJUA 2KLBA 1NVWQ 4UVDA 4Y2TA 2GO7A 4QQKA 1N4DA 3GK3A 1RYHA 2ON6A 4JASB 4WINA 1TM1E 1L5HA 1EXVA 1XF1A 3SJUA 4FQ8A 5IKPA 3DYIA 3V1MA 4YJ2B 1TVMA 5AYVA 16PKA 4L07A 4CCYB 2G88A 3A70A 1CWUA 1EP3B 1Y9DA 4G85A 4M8SA 3RTDA 4GRDA 1E2LA 2G82A 5ERXA 1WHSB 1ULUA 2BFNA 3H8SA 3IJPA 3PJDA 3DDNA 5IJ9A 2XCTB 2DCMA 4RJJA 5SZJA 2OO5A 1O95C 4AQYB 2O7RA 1XMSA 3OZSA 4YHHB 1G5FA 5A71A 1II8A 4UNQA 2W0MA 4U9UA 4ONEA 3Q8KA 1BSVA 3OZRA 4JXJA 4RM2A 4ZKDA 3Q1LA 2Q1YA 1TO1E 2M6RA 3KSMA 4ZCPA 4BNGA 2QQ0A 1XRMA 2F8LA 3ISVA 4Q4CA 2UYHA 4LRSB 3TIXB 4LSGA 1JNYA 2OXIA 2BJHA 1W46A 3R3XA 1G66A 1DTWA 3JYOA 3LQ4A 1UJ2A 3T1YB 4Z2YA 2BMJA 2IXTA 1XDWA 3FWNA 1SPXA 2OAEA 2QTZA 3I64A 1U2PA 5DGXA 2PR2A 1I7LA 4DUGD 1GPAA 1ABEA 1DVRA 2LBPA 5C4GB 2VHTA 4CIWA 4DR2B 1ZR2A 2WE7A 2H2FA 1FFGA 1P1IA 1CJUC 4Z0NA 1OILA 1PV2A 1R88A 4HCJA 2VPIA 3PKZA 2BUCA 4L7QA 5EUMA 3WL7A 4QRDA 3NB0A 2UVQA 3BD7A 2VF7A 2FZGA 4CTMA 4Q9NA 2XA2A 4IJUA 1AKNA 1NBIA 3DNFA 3OFVA 4CDRA 4ZJZA 1D1QA 3GJXC 4JP2A 3EQ8A 3FF1A 4X97A 1N2CB 3ABZA 3KWFA 1NG1A 2NVOA 4R0MA 4GMHA 4ZI7A 5I9LA 5D5PA 2NO6A 2IBSA 3T94A 1EP2B 3COWA 2FSFA 4QXMA 1I1OA 2WFZA 3K20A 1CY7A 1PL0A 3BWMA 5CM9C 3T3IA 1BU8A 3EXHB 4ZDIA 2C0QA 1M6VA 1PZMA 1Y81A 4GOJA 5E1MA 1N9ZA 4R3UC 4YRLA 4IXDA 1PUIA 2O23A 2O8VA 2A5JA 2QRQA 2GJSA 3LDGA 4FLMA 4B45A 1H0RA 2D1FA 5F9FA 3LKZA 4M38A 5KNDH 2F9MA 3TW4A 5IC6A 4RSGA 4NU5A 3O75A 3OE5A 1ZY2A 4ZODA 3ZD6A 3HLKA 4WBSA 4JR1A 1EE9A 4FDTA 4P4SB 1GAEO 3EMDA 4OQLA 1T91A 2GZ3A 3UHFA 4DVGA 3ACCA 5KYNA 1N75A 2WVGA 4ND3A 4B43A 2QK4A 4MK4A 3WNZA 2C88A 3HCBA 2DUJA 1OZ0A 5DWDA 2BTQB 2QGZA 4PYIA 3QPVA 4Q02A 5LMZA 4GSKA 2VC2B 3DWFA 3SMVA 3BWEA 1EVEA 1IU9A 1S89A 3AJ9A 1SQ5A 4YRCA 1CQZA 1W4LA 5EFZA 2OE2A 3QLUC 1IFXA 1L8QA 3RT9A 1UJMA 2I4TA 1M2OB 2PQMA 3UMRA 4BMPB 3A36A 1FFDA 4CMAA 2Z30A 3GQVA 5B3LA 3DZCA 3WWZA 4KK3A 4DREA 2NUBA 3PEEA 1DE0A 3TMAA 4HQ6A 1Y6JA 4YPVA 4BHTA 1V8OA 4DBLC 2BIFA 2BC9A 3FYDA 2H0AA 4LJYA 4R81A 1RYZA 1AV6A 2JGLA 4OI4A 4B8ZA 1YRHA 2AJBA 2UUPA 3NRJA 3CYFA 1RE0A 2ZTUA 4HYQA 5EXEA 5H80A 5LQNA 2XOKA 3D2CA 3CE6A 1YNOA 3L3BA 3OBBA 2XQKA 3E61A 5KAMA 3FWZA 4AMBA 3THYA 5L3SB 4AC9A 3V00A 4JVNA 3M5CA 2JAWA 5HILA 1AKQA 4ZHQA 1KK2A 3ICOA 3NT4A 3BXXA 3EVAA 2X7HA 3GJYA 3R24A 5REQB 1CJBA 3WL3A 1Q0TA 3WYCA 4URWR 3LGSA 1KWGA 2X19A 3RVMA 2WTAA 4FOTA 2WF5A 3GNQA 4B4DA 5EESA 1U8EA 4RPIA 4L15A 3O4HA 1ECBA 1HBJA 4KODA 1E1CB 4PRZA 3UAZA 1XDDA 3LTEA 2BJWA 1UKCA 4TRRA 5J23A 4X45A 5LA6F 2HRDA 1G8AA 5CK4A 1CQJB 1L3BA 2H00A 2YKGA 1XI2A 2QL9A 4HSEA 1KYZA 3KJXA 5DHQA 3RUIA 5DEIA 3I0MA 1WBDA 1IXRC 3TLZA 5JHGB 2KHZA 3E3NA 5TMDA 1CTQA 2NUPA 1LFDB 3GFGA 5JSQA 1BDBA 2NO7A 4L08A 2YV4A 4E2FA 4M86A 5HS4A 1YHZA 4HPWA 3MCAA 4AG5A 2ZPTX 4ETIA 1XOIA 2IS6A 3PT9A 3TSAA 4N48A 3W8FA 5JDIC 3TLEA 1CRPA 4ZV4A 3EWSA 5EZQA 3VU8A 3ROZA 3TMYA 3EK2A 4JKIA 3R4VA 2ZSBA 2P67A 3O4GA 2QPOA 3OKPA 5D3QA 1HY3A 4AY4A 1A0OA 2C1EA 1X7WA 3W1WA 1NU8A 3EVDA 2C9DA 2ZYVX 4Q9JA 3W6OA 4LF4B 2O4UX 2RGDA 2VA9A 2VTKA 1JN0A 3AIIA 4OM7A 2QAGA 1Q3TA 3JQFC 3JWPA 1RXWA 4GOLD 2CKMA 4DNXA 4F1KA 2OV2A 3JX9A 4Y1RB 1XQWA 2B9VA 3D4NA 3GG9A 5DXFA 2CBXA 4CL8A 2QAJA 3ADBA 4PSUA 5JANA 2WD7A 4L8LA 1KARA 5LMNB 3U40A 2N1MA 3KZCA 4FYMA 3U4QB 3KELA 3P2IA 2O1EA 1RFGE 4JT4A 3WS7A 4CBVA 3L18A 2XDWA 1YULA 5IVKA 1MOZA 1XHEA 2O3RA 3GEHA 4LA4A 1QLHA 4LGMA 3VVCA 3CA8A 2JLXA 5A5GA 1DBSA 5ENDA 3RUAA 3WYNA 2VKTA 2O8DB 1V6CA 1WVIA 3GHYA 3P0IA 1RI5A 3VR2D 3R9KA 3X2FA 1WF6A 4DOMA 3T5GA 4MDHA 1M2WA 3D3KA 4CU5A 1D1SA 3RAPR 1EUYA 4S2EA 3EZLA 4Z0TA 4GT1A 4JJ6A 1EQAA 1D0VA 3GGDA 3KOZA 4WW0A 3PGVA 3VISA 1BOFA 3LLSA 3SXUB 4OMFG 3KQLA 4WH0A 1C7QA 4G37A 3MRSA 3PLAE 4XSGA 1H5UA 4D6YA 5KS2A 1L1QA 5IKOA 3J81k 2YHBA 3HABA 3BIJA 4RTOA 2INGX 1MAWA 1KH2A 4QDXA 5CBPB 3E9YA 3WNDA 1G7TA 4XX0A 4FE4A 4HZGA 3RFFA 3VPAA 2H1IA 3BPSA 4TMWA 1FF9A 4BO9A 4FCVA 4CIAA 4H1TA 2JI4A 4HFJA 4UZEA 4XVRA 1J5EB 3D6HA 1DXQA 4B85A 4YAGA 1DAMA 3F9IA 1XFAA 3HJAA 4JUIA 1XNQB 3HJFA 4RENA 5HJEA 3AOEA 4F84A 4BWFB 3BJEA 4LHEA 1WCXA 2YFKA 4IEIA 4OHFA 1NMEA 4WZAB 2IV2X 3OIWA 1YUMA 1DI0A 2JD1A 1K7CA 4Q18A 1AQ6A 4UNPA 1J07A 5F2EA 1Y4UA 2QN9A 3GX1A 4X95A 5TQ0B 4AJ9A 1AA9A 1XP5A 2BEVB 1ELOA 2DTEA 4IKEA 3TKLA 5JZVA 4IDGA 1DZ3A 3IESA 4MGKR 1GUZA 1Q14A 2C9CA 2XXJA 3FSRA 3GYBA 4IICA 4C0KA 4TLCA 4BKMA 4J4TA 2R44A 4WK0B 4JQCA 4D74A 3ONEA 3SVZA 2JRLA 3JYPA 5LXTB 1VL5A 1X1SA 3EZ9A 3IURA 1UADA 2PRKA 2JBWA 2QN3A 4MXDA 3ZWOA 1J22A 1ZSNA 2VPPA 1DEHA 1IEWA 3ANNA 4TL6A 1AD2A 3KQTA 5JAMA 3FUUA 5I7OA 1FRVA 1VIMA 5HP4A 4WOJA 5HF6A 2AOXA 4CMBA 1W88A 3WLQA 1W29A 4WFKA 5IBRA 3AERA 1B74A 2IU6A 4ZEVA 3QV1A 2O5CA 4MKGA 4LF7B 2RHMA 4DDVA 1N9GB 4X7MA 3SM9A 1KPGA 1KP2A 3UKJA 3PG5A 1E79D 2HXGA 2A57A 3GOHA 2WU0A 3W1EA 1S7GA 2A9KA 3I0NA 4HOYA 4N65A 3ZIUA 5IHXA 3ER8A 1FS4A 2GHQA 2O5RA 4KI0A 1ISJA 4OGLA 5CX1A 1D2GA 1NVAA 1U0NA 1JVSA 1F2DA 1KY2A 2WJZB 2Z2IA 3AGQA 3L82B 2AEFA 2BISA 1PSWA 4Q4JB 4YQZA 5AK0A 2YYSA 1JECA 1B73A 3PSHA 5BV7A 3WOVA 1RKQA 2HBZA 4I3HA 1Z5OA 2VNSA 2H4JA 3K09A 3CMMA 1KEKA 2GUWA 4R2MA 1P18A 1RSZA 4GOMD 4Q05A 4UBJA 3QP9A 4INPA 2CXPA 4OYYA 1T4MA 4O2AB 1VL2A 1EUCB 3I9OA 4CMIB 5BN1A 1PJBA 1XK6A 2JLCA 4IQGA 1YKGA 1OIWA 3ZDYB 1ST2A 1XKXA 2X15A 4K3UA 3RKUA 4BLUA 4F5DA 4TWRA 1M2KA 1WQ1R 1QNLA 4BWGA 4FB4A 5C1BA 4KREA 1N2BA 2ZIAA 4Q00A 1KL7A 3EZ2A 3GCZA 4KO4S 1HQYE 1N2HA 1O03A 3I9JA 3HKDB 4EY7A 2ZULA 5CCXA 1IHYA 4CDMA 3EUFA 1RLTA 1X7YB 4YXWA 5F1PA 4PCAA 4BATA 2YTZA 3WQRA 4DLWA 3LP8A 1DFHA 2O7QA 3DJYA 3O9ZA 4R01A 1R8XA 5JG7A 5IWAB 3K2BA 1R6TA 2BV3A 4RORA 3U4MA 5DTIA 1X70A 4EY3A 3WG9A 2B21A 3OE1A 2RGGA 1ZKMA 3BKWA 2JGJA 4L6IA 5FUYA 1PIWA 1UXJA 1VHLA 2HJHA 2OFOA 4UHJA 2PO5A 4UQLA 2WV7A 1GZ3A 2AK2A 2REXB 4I46A 3UA3A 3WGKA 4C1NA 1CYEA 1EAMA 2PYZA 1Y1RA 3P9CA 4YJ3F 5CLGA 2MSKA 3GMDA 2R8BA 4YVFA 4CCWA 2YFYA 1K7XB 2W8ZA 4JY7A 4ZPXA 1VYVA 1Y1KE 1YR2A 2ATEA 1LWOA 1RMYA 2H7YA 2HT6A 1NTOA 2P0AA 3IPAA 3KYDB 4KBGA 3RPEA 2JATA 2WNHA 2CMFA 1EJ6A 2Y92A 1QHEA 4ER6A 4YS6A 1OX6A 4F8EA 2RSLA 4C3OB 4DV7B 3ORYA 3PU6A 5J5CA 2W71A 1MAVA 2CSUA 4RZSA 7ABPA 4OK6A 2J3EA 4BMOB 1WO8A 2IZ1A 3GLVA 3HA2A 5M04A 4JQZA 1YWGO 2GF9A 5J2TA 1G3IA 3COZA 1YS4A 1YAHA 3E1KA 2P9ZA 3AKYA 2FWPA 3QFTA 4LKOA 3OWXA 4HLDA 5BOSA 4UE2A 4EL5A 1EBFA 3D3NA 4BNDB 1SWWA 4DCMA 2PV7A 5ALZA 2Y71A 1QYIA 3HN6A 5COBA 3WO0A 2W6CX 5AM4A 2QR5A 4X00A 1M0EA 1NBHA 1XZPA 1YJQA 2EFYA 1P80A 3H42B 5GV8A 2ROQA 5AD1A 2C84A 2E49A 2E87A 2QUAA 2XEDA 3R40A 1TZ2A 1V4NA 2HA4A 2ZTSA 1BD4A 1G1AA 4GSLA 3VJKA 2JKZA 4L9RA 3ZE0B 1JXOA 2FOIA 4M1KA 2YX1A 4C3VA 1HYGA 3BJRA 3L84A 2QP9X 4PC1A 1INLA 1TRHA 2VF2A 3KSUA 3KPVA 4N5IX 4O4LF 3TQTA 3GQBA 4HATA 3F6CA 4YGYA 4YJHA 3L6DA 3V33A 3R6LA 1H23A 3AP3A 4Z86A 1PK7A 3PUKA 1RVDA 1WPQA 2V65A 4WV3A 3GZTB 3WLKX 4A23A 3HACA 1P1KA 3B5EA 1XZKA 3MJVA 1QIMA 1Q91A 2PGDA 5DBGA 1N3BA 2W2XA 4ERNA 1ZJ6A 1QHGA 2GS9A 4CG1A 2XADA 3M4NA 2O5VA 4L75A 4H3KB 4C20A 1UMBB 1NM5A 3W6NA 1UMDB 1GR1A 2GCIA 3JD1A 3P9QA 3G68A 5EHIA 4BQSA 1N5KA 5B7GA 2H07A 3GFSA 2EQAA 1PZFA 3IKJA 1VHTA 1XDGA 1PGPA 1U7PA 1C1DA 4R8SA 3L1VA 5DTJA 2J0VA 3OF2A 1QAQA 1D9XA 1O9GA 5FJIA 5GGXA 3G7UA 4JI7B 3DXZA 4ZOLB 4MV8A 1N2SA 2XEXA 3NEPX 3INGA 4WIAA 5EYPA 1RAGA 4EF6A 1Z6QA 1WQ3A 1IZ9A 2OBLA 3KYIB 4RL6A 4JENA 3TZKA 2FF5A 3S2FA 5JPCA 1BU5A 1WL8A 5JPIA 1VL0A 2WWHA 3K0CC 4GMGA 3COVA 2BFEA 1TQ6A 3N2GB 4BS9A 2PT9A 3NFRA 3V8QA 3HV0A 4LJSA 1W1WA 2OC4A 4XIFA 2Y6VA 4XSHA 2JLUA 3TW8A 2A58A 2PA0A 4OOFA 2YW9A 4RW0A 3HL4A 3VMFA 1H22A 2Z2XA 4YGXB 1DRUA 4BDTA 4DA9A 3CMCO 3H6GA 2R60A 4GOOD 1P29A 3KXDA 4CV3A 4JMPA 1L7PA 2LP4Y 4XJSA 1E2MA 1VKOA 4IBOA 1GDTA 3FGOA 2B7CA 3QLVA 5JJLA 1IY1A 1Z45A 2O59A 2WIAA 1QZTA 1WPRA 2BUAA 4ES6A 1GQFA 2ODQA 1ULSA 3CWZA 4D9NA 1C7IA 2WUWE 4EELA 2V1XA 2YVLA 3CGWA 1Z2AA 1T2UA 4UULA 1MU0A 5FBLB 2R8EA 3AR6A 4H1WA 3EPHA 5G3YA 4FEYA 2PAAA 4PYNA 4OAOA 3ELBA 4G4SO 5GVRA 4Y1EA 1C1XA 3QOWA 3U4DA 4AM8A 1K2VN 2HGSA 4P3PA 4DXHA 1H94A 3R7WA 2PKEA 3K9CA 3Q3JB 3QWFA 5B6PA 3L92A 4ECAA 4RF3A 4LFCB 4RKEA 4IUBS 3ITKA 4RESA 4ACAA 3CVUA 3O4JA 3ZDCA 2GDZA 1I51A 4TWIA 1JQEA 1ZCAA 2RBEA 3RVBA 3WLLA 5JTUA 3AHCA 3WNQA 1THTA 1LXCA 1ODCA 2D2FA 5I3CA 2GBFA 1ZUD1 3M7IA 1A76A 2WSSA 3FLAA 4HX9A 5K3CA 3PCRB 3PKIA 2V7EA 2WAXA 3K1AA 4IJKA 4IWYA 4JI3B 1U8AA 5LB2A 2YVQA 4HAXA 1Q0UA 1Z5NA 3AQIA 4U8GA 1LQ2A 2I87A 1N2CE 3B6KA 3UGTA 3H9JA 3BK7A 3ZCSA 5DT2A 1K0UA 3EIXA 3VVMA 5JS6A 4LZLA 4TTVA 2DZDA 1DOAA 2YXNA 3F8WA 1KJQA 4RUKA 5I8PA 1IXKA 3PWZA 5JCPA 2QDXA 1UDCA 3BZUA 3EG9A 1IXSB 3F1KA 4PAGA 5EJMA 1XNRB 1D2RA 1E9BA 4HGQA 1SXPA 4NL4H 4Q1DA 3V7UA 4D9IA 5JSYA 3L4KA 1T0PA 3M3PA 4CF5A 3AR2A 2ABWA 2IPXA 4XSVA 5JZ9A 2VJKA 4HUJA 4IS3A 4X8LA 2IS4A 2D5AA 4PZ9A 4GLLA 5LDGA 3PNQA 4IRUB 1M54A 3IP7A 1I6MA 4MNTA 3E5MA 2C9YA 2HK7A 4XYGA 4AG6A 5T7BA 3KL2A 4ZO4A 4DKXA 1HETA 3GL9A 1OC2A 4G0ZA 3F6YA 3HXKA 2ADMA 2WU4A 1SEVA 2DULA 5KCMA 1K6JA 1S3IA 2FRXA 3E7DA 3ILHA 1UBMS 3GLFA 4YMVA 3OAAD 5DCLA 2ZR8A 2CBGA 2UYGA 1SVIA 2DPGA 4DMMA 4OHOA 1IJFA 3ABQB 4RM3A 5D84A 2NZYA 1I10A 2XWJI 3RVQA 3PQDA 1E9DA 1L2TA 2G3YA 1CULC 3QI2A 1ZLXA 1NW4A 2E0IA 4Z4HA 1A8IA 4GZMA 3RUEA 2AVDA 4MQ5A 4PAOA 4M1TA 4RJLA 5BSRA 2QY6A 4OYRA 1IZZA 3DOHA 1L5HB 4YMIA 4D46A 5CFLA 1CCWA 3DLCA 2EBWA 2W22A 4AECA 2DPYA 4CM5A 1UF9A 3FHOA 1NZFA 1I0IA 3WTCA 1KRWA 2HN9A 3PIIA 3IC5A 4Z9BA 1TTTA 2WHQA 1UJBA 2Y2VA 3ECAA 1SQFA 2VLBA 1H2HA 4JOBA 1FYXA 5JD5A 1NN3A 4AN1A 4AZVA 5IJ9B 3I83A 3D3JA 2CVQA 2JLSA 1EWQA 1TUEA 4JBNA 5ALOA 2JFVA 5ALJA 4DMHA 4N7BA 1G16A 1II8B 1EFRA 1RAAA 2ZTMA 3OF5A 1L7QA 3SGLA 3B70A 3VHRA 2M1XA 1LLQA 3O82A 3R0JA 5T41A 4BB6A 2FHSA 1GNVA 4UBOA 1OXKB 1USGA 2X86A 1NDHA 4HB3A 2ZSJA 4XXHA 1Z5GA 3WGVA 2HBRA 1DTWB 5JEDA 2G6TA 1LFAA 1O1YA 3Q8XB 1S2IA 2CFOA 3GAMA 1M1ZA 2FGKA 1NE2A 2FOLA 2GCGA 4BBPA 2WHEA 2ZS7A 4DWOA 3GNTA 3W05A 3HLYA 2WC1A 3BHIA 3MJCA 1EE2A 1CUXA 1OWNA 2VHJA 3E4DA 4Y30A 1AZLA 1N1MA 1DLIA 3FDIA 2XKKA 4Q01A 1YXMA 2VPZA 3O0TA 3LW7A 5FLKA 3ETDA 1P5RA 2JHCA 4WZ6A 1VQ1A 4ALNA 1KVQA 3Q10A 3CG4A 1ML4A 4UXIA 1KZ9A 4FHZA 2BL4A 1QVZA 4F21A 3HU2A 4LXUA 2HF2A 3LLMA 2NT4A 4H1UA 1Q1AA 3WK9A 1EFPA 3EMBA 3F73A 3H5TA 4U2FA 3T9DA 1CUCA 3ESRA 3FRIA 1TJPB 3HG7A 3VO8A 4MQ6A 3TRFA 1GA4A 1XTVA 2NPOA 2Q1UA 3LBNA 3REQA 3GVPA 3NH9A 4BVEA 4IJQA 3WK5A 2N42A 1H3NA 2D7DA 4DJFC 2RK4A 1YRLA 5EA2A 4WKCA 2O05A 1KO5A 5ALNA 4NCHA 1K3UB 1RYBA 3MYYA 1X7DA 3ONFA 1G59A 1G20A 1M6VB 2EP7A 2DJ5A 5DM60 3FLMA 3GRKA 3C5WP 2ID9A 4WK6A 2BWJA 3DW3X 3JRWA 3X1YA 2LCIA 1VIYA 3JQPA 4KNYA 1RYMA 2HMVA 2HO4A 1KAOA 2AQKA 3FMVA 1L4FA 5AKLA 2G5TA 1QP4A 1GGFA 2HU2A 1ABBA 5EP1A 2CXNA 1C3EA 1ZRSA 3A4TA 3BWVA 1H6DA 4JL6A 2ZRFA 1B8NA 3E7WA 1IONA 5J9FA 1M75A 3KWJA 2OUIA 1V8FA 5EINA 1LVUA 4JHLA 4B3XA 4WJZA 2W2VA 1W30A 3P9ZA 3G2MA 3L40A 4OVKA 4MUGA 4CIVA 1P7VA 4YRTA 1JWBB 4UC0A 3D31A 4FBLA 3FR8A 3R7SA 1WV0A 2AH5A 1WWKA 1W44A 2HNAA 3A10A 3KJEA 1CVRA 2VUIB 3NHFA 4WBNA 3P9RA 1IEXA 5DYWA 3X1ZA 2RAVA 5DHAA 3UHJA 3ZEIA 1Z25A 4C21A 4S1OA 2JCVA 1JDJA 1HT1E 4QG3A 2VQ6A 4NXMB 1MJHA 2IYWA 1N8KA 1F6DA 1PBTA 2O3QA 5EZYA 3V1YA 1AK2A 3PHGA 5HW0A 4NYMQ 3FKSA 4K6FA 4XWTA 5ECWA 1SU4A 4G41A 2ZI4A 3BB3A 5F5XA 4YV2A 5TPWA 3MSXA 4UAUA 2VBCA 1Q1GA 2GZ2A 3N3BC 5AJXA 2JHFA 1D3AA 3TI7A 1R3UA 2R84A 4R7TA 2UYYA 4IOLA 5KJEA 3FIJA 1JVBA 1L6IA 4Y2JA 4YFVA 4BUZA 1VJ1A 5LKAA 1MR3F 4BEVA 4XTRA 3SSOA 2ZI5A 4KVGA 4V24A 4HEA6 3QNMA 1C50A 5KSPA 3NHAA 2HDOA 4W7IA 3THYB 4F96A 1TEVA 2V7UA 3UAGA 2YICA 2ATCA 3AHEA 4ZHQB 3MTGA 3A31A 3T5BA 4YTEA 1E89A 2PTHA 3W9SA 3D6UA 5E0KB 1CHDA 1T2AA 2G80A 5CT6A 4PAQA 1Q77A 3ZK8A 1F6WA 3ROKA 1RMQA 5IG2A 2DGDA 3UJHA 4G5QA 3I73A 4PX9A 3INTA 2Q4EA 4XLLA 3ECCA 3A9WA 2B83A 1X1QA 3OLXA 4FFBB 5A9TA 5JAHA 2CMDA 2IHVA 3MOGA 5HIIA 3V8MA 4XW2A 1PVVA 4OGWA 4Y0AA 2BZ1A 4ME6A 4WZAE 4LGYA 4ZCQA 1L5KA 3V32A 1KRHA 5J4YA 5JLAA 4PU0A 3X2SA 5IVHA 5H0IA 4FYVA 3VNBA 4AROA 3L02A 3WYAA 5DLDA 3UGJA 2GXQA 1U7ZA 4RY8A 2BOVA 1JQ5A 5C1OA 4MCHA 5JFOA 4V0KA 4ALJA 3V4FA 1P6QA 2NUPB 2C82A 2DPLA 4IWXA 4D4IA 1G0OA 3IBGA 4B3JA 4UUMA 2WG0A 2IRWA 3IELA 1G55A 1R66A 1V7CA 2X9VA 3B6EA 4X63A 1P9WA 3VYTB 4D9HA 2XMSA 1Z62A 3A32A 4PS0A 4RVFA 4FD2A 2FX5A 5EJ8A 1A7JA 1P9OA 3NPAA 4Q5IA 4YP6A 3B3QA 3DFIA 5FUXA 3AVQA 5FQNA 1Q0RA 2R25B 3H65A 5DN6D 1ZRMA 4RCYA 3KDSE 1LLUA 2D1SA 4RAQA 1X7WB 1CF9A 5CPFA 5B2ZA 1IZ0A 5TVGA 4RHUA 4LHXA 5E9AA 5FXMA 4KV9A 1LDEA 1O94D 3NEYA 3KSZO 1BE1A 1ZD2P 2ZDHA 3FWPA 3LVQE 3EC7A 2PMDA 2WUGA 3DG9A 4TTIA 2C5GA 3OJOA 3WRXA 1GDHA 1RXYA 1YZNA 1NVVQ 3IDQA 4EPXA 4BYMA 1Z8FA 2WD7B 6REQA 1HV8A 1YQXA 2QENA 3EOBI 4DNPA 1FDRA 3VC2A 1J2TA 2E6UX 3H8VA 4GLJA 3TLBA 4AIIA 5JZMA 4ZKEA 1NF2A 1FJXA 3UGQA 4HLUC 1T9DA 3LXRA 2V7PA 5HKOA 1R0WA 5MGBA 4DSZA 4M9ZA 3QW2A 1FXWF 2B94A 5IBQA 1KP9A 3GWZA 2MWMA 4KUHA 4DT1A 4NE2A 3DSRA 1C29B 1SXHA 2H18A 2YCLA 1I32A 4XD2A