6LDHA

Refined crystal structure of dogfish m4 apo-lactate dehydrogenase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
329
structure length
329
Chain Sequence
ATLKDKLIGHLATSQEPRSYNKITVVGVGAVGMACAISILMKDLADEVALVDVMEDKLKGEMMDLQHGSLFLHTAKIVSGKDYSVSAGSKLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKHSPDCIILVVSNPVDVLTYVAWKLSGLPMHRIIGSGCNLDSARFRYLMGERLGVHSCSCHGWVIGEHGDSVPSVWSGMNVASIKLHPLDGTNKDKQDWKKLHKDVVDSAYEVIKLKGYTSWAIGLSVADLAETIMKNLCRVHPVSTMVKDFYGIKDNVFLSLPCVLNDHGISNIVKMKLKPNEEQQLQKSATTLWDIQKDLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined crystal structure of dogfish M4 apo-lactate dehydrogenase.
pubmed doi rcsb
source organism Squalus acanthias
molecule tags Oxidoreductase(choh(d)-nad(a))
molecule keywords M4 APO-LACTATE DEHYDROGENASE
total genus 100
structure length 329
sequence length 329
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1987-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 6ldhA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 6ldhA02
3TRIA 2Y1OA 5TRTA 4NI5A 5L45A 3WMXA 4D0RA 1Z45A 2X0NA 4RCVA 4ALLA 4YJHA 1Y81A 1XHLA 3IJRA 1A4IA 2FR0A 2YDYA 5ITVA 2Q45A 3GRPA 1P44A 4B4OA 5G4LA 1JWAB 4R9SA 4I9UA 2A92A 4A5OA 1GZ6A 3AOEA 4J2HA 4YRDA 3H5NA 1I8TA 3NGLA 3JV7A 2Z5LA 5IXYA 4DTIA 2B35A 1ULSA 4BNUA 2B36A 2AHRA 4E3ZA 1O94A 1Q1NA 3JCZA 2Y1CA 2ZB3A 2E82A 3GN2A 1WLYA 4HKTA 1DIRA 1GCOA 4QSMA 1R6DA 3WGQA 3U09A 4R3NA 4KUEA 2J3KA 4FGWA 1UZNA 3INGA 3WYEA 1JQBA 3BMOA 3L77A 1HZJA 4D46A 5C5IA 4WNIA 3GZ4A 2WD7A 5B37A 1ZSYA 4DLLA 1YB4A 1WDKA 4ZRNA 2Q3EA 1LBEA 4CQLA 1YL5A 2FSSA 4WUVA 4YXFA 3PYMA 4A10A 4RVSA 1R12A 2VRCA 2EJVA 1PR3A 2PFGA 2UUOA 3MJCA 1Y1PA 4W6ZA 1KEWA 4BNWA 3C1AA 4PN3A 4Q9NA 4R4JA 3VDRA 1UP4A 4BQRA 2OZPA 4CMHA 3NAQA 3G17A 1ISGA 3A28A 3FNHA 5CDYA 2WDZA 3MJ4A 3PWKA 1WMAA 1MG5A 1Q0QA 2ZTMA 1Q0HA 3MWEB 1YBVA 5IZ4A 2J3HA 4I5GA 1VRWA 3SLKA 4ZQHA 3V8BA 2Y93A 4YJFB 2B0JA 3HZZA 1PJTA 4XD2A 1P33A 4U0JA 4R69A 4DQUA 4OQYA 1UXKA 1DRUA 3QHAA 2C59A 5JAIA 5GY7A 5KOIA 4GQAA 3UGKA 4BNIA 4JX8A 5LC1A 2VYVD 3W8DA 1LJ8A 1E6EA 4ZA2A 4E2YA 2AEMA 3NDJA 4J49A 4B79A 5L95A 3RUAA 3KTDA 3GFBA 5AXBA 1BSVA 4A7PA 3H2SA 4ZN6A 1GYRA 4J9VA 4RPKA 2PWZA 5JC8A 5L4SA 1BGVA 3Q9UA 2GZ2A 1YH3A 5L7YA 4NBRA 3WICA 4E2WA 4PLHA 4AL4A 1IPFA 3KUXA 1MV8A 1ENOA 1ZSVA 1PJSA 4AJOA 1MFZA 2UAGA 3U4CA 1A27A 2X58A 1OFGA 3GNSA 5LCXA 4CM4B 2O3RA 5JO9A 5MDHA 4D43A 5JY1A 5BT9A 1BXGB 4IJUA 4GWKA 3KVOA 4I1IA 1PJCA 3LF2A 2IXAA 5DBGA 1Z7EA 4U7WA 5TQVA 3LF1A 1DO8A 4GWGA 4M55A 3ZWOA 4QT0A 3ZHXA 1U9JA 3C1TA 2Y1DA 1UJMA 3A06A 1GY8A 4J0EA 5BNTA 2YFHA 1O8CA 3L0DA 4PZEA 1QP8A 1QRRA 1YVEI 1A9ZA 3JQ7B 4WLUA 3PHGA 3C8MA 4XDYA 2DT5A 1NX6A 5A04A 3TWOA 4ALNA 5C37A 4QX6A 4D3DA 4ZICA 4CLOA 1YOVA 1O95A 1IE3A 2QRKA 4BNFA 4NDNE 1NVGA 3ZNNA 2FPGA 3WGOA 1O6ZA 4GL4A 1P3DA 4UUPA 9LDBA 4IM7A 1EE9A 3TZQA 2V6FA 4ND2A 5TJHA 1M67A 3FR7A 3FPLA 4FB5A 3E5RA 2RBEA 5JS6A 1IZ9A 1GDHA 4AJ4A 2GLXA 2GUGA 1JKFA 5TJ9A 1BXZA 4PG4A 4F3YA 2QG4A 3PK0A 4YAIA 1FMCA 3ICPA 5A03A 5FI3A 1H2BA 4FC7A 2DFVA 2CDBA 2C07A 2DBQA 1U8XX 1VSUA 4FQ8A 1VJ0A 4UVHA 4BKQA 2DKNA 4CR7A 4EUEA 2ZTVA 1DSSG 2X6TA 4M54A 4J16A 3AI1A 5F5LA 4TQGA 3JD1A 3DAGA 3E8XA 4HFRA 4LSMA 3OJOA 1YXMA 3RC9A 2NVBA 1C1DA 4HADA 3K2EA 4NJMB 3RFTA 3OH8A 1EK5A 3GY0A 3O8QB 3C3XA 1BWSA 4QQRA 3KV3O 1P31A 2X9VA 1OBFO 1UDAA 1GUZA 3OM9A 4E0BA 5C3MA 1GL3A 1I2ZA 4I5FA 4IJWA 3VH2A 3BMNB 5KVQA 4BO8A 5KJ1A 4TRRA 1B16A 4ZHSA 2VWQA 3AUAA 1FDTA 2UUPA 2VYVA 3RSHA 1C0KA 4U0KA 1B8UA 2FN7A 1B0AA 5T6BA 1UZLA 4P8RA 3I4FA 3WIEA 2VT2A 3GRKA 2NADA 2D1YA 3GUYA 3PEFA 2V6MA 5I9LA 1KOLA 1K2WA 2DTEA 3DFUA 4BO3A 4BO2A 4I9NA 4CM6A 3KYDB 4FOSA 4XIYA 2UYYA 2BGKA 1ZNQO 4X54A 5EMHA 5COBA 3GPIA 3BMCB 3QE3A 4AJLA 2I99A 4GGPA 5T64A 4WOKA 3ZCXA 2NQTA 3GDGA 5IDXA 4IDEA 3GAFA 2O7SA 5DP1A 2NM0A 3EAGA 1VPDA 4YRBA 3ZWVA 1ONOA 3RC7A 3PTZA 3DMTA 5BNFA 5KVSA 2OOSA 2PD6A 2QHXA 3E6AA 4XYLA 4L8VA 1TXGA 1DFIA 1Y5RA 3UFXA 4CMKA 3EDMA 5JC1A 3WDSA 3SLGA 4LN1A 4MVJG 4MVJI 2BGMA 3SJUA 1D1TA 5HWSA 1MGOA 3LZ6A 3JQEA 3F4BA 1TA4A 1KEVA 1ADBA 2Y1FA 1N7HA 4WGGA 3KHUA 4MO2A 4CUJA 4FJ2A 5TNXA 3I4CA 4D0SA 3N7UA 2Y67A 4PLTA 1GYPA 1N9GA 4QFCA 1ID1A 5K9ZA 2FPPA 3GQVA 2B5WA 3BTOA 4OQZA 1NR7A 5BSFA 1Q7GA 1CQIA 4CLHA 2HRBA 3WGZA 4CQMB 3GLQA 3S2GA 5G4KA 1YL7A 1KIFA 4JIGA 3TNLA 4OKIA 3OEYA 4W7HA 2A9FA 4UVIA 4CM4A 4XGNA 1IHXA 3QVTA 3ZWXA 1GU7A 1V3UA 5JSFA 1HDXA 4GPD1 4XWYA 2DBZA 4CUKA 2HK9A 2IYPA 2ZTLA 2JL1A 4M89A 2ILTA 5I7EA 1T1SA 4BNTA 5TT1A 3LSYA 5CFZA 2PZLA 3FD8A 4NBTA 2FSVA 1B8PA 2O3SA 4WCFC 4JBHA 3F46A 3Q3CA 4NU5A 4IDFA 5CEJA 2IRWA 2Y0DA 3RROA 2GN8A 2GSDA 3ROQA 3HUDA 4YCAA 3U4DA 1NQ5A 2Z1NA 5ADHA 1ZH8A 4GMFA 1C0IA 2J8ZA 4GI2A 3W6UA 2Z1MA 1T2FA 4AJJA 2C29D 1ZFNA 4URFA 1U2DA 2CSUA 3Q2IA 2JHGA 5G0WA 1TT7A 2NTJA 2FPIA 4GSKA 4YACA 3JQAD 2SCUA 4EDFA 3N74A 4WPGA 2H5LA 3VTFA 4PLWA 4ILKA 4W99A 3AW9A 3TZHA 1BVUA 4KUGA 4B4WA 1P1FA 4K6FA 2NQ8A 4WOJA 4IUYA 3GT0A 4OOFA 4BKOA 3H9GA 4H16A 1SNYA 4Z9FA 3WYBA 2QX7A 3DZJA 4NBVA 1KEPA 4BNMA 1WZIA 3TJRA 4AJHA 3L6DA 1N2SA 4BUCA 5BNIA 4NJMA 4HWKA 3QJ5A 3EZYA 3HQ4O 5JLAA 4Q3CA 3K5PA 4PLCA 3AU8A 3O26A 1I30A 1U3UA 3RUDA 1C0PA 1P1RA 3U4HA 3WX0A 3OEWA 3TZCA 3DBRB 2G5CA 5JDCA 2X9NA 4Z0TA 4BO7A 1Y9AA 4TVOA 5JAZA 3BMOB 3PP8A 3PIDA 4YJGA 3WXBA 1Q0LA 4OXNA 5JDIA 1Z75A 2DAPA 4R51A 1NPDA 3ONFA 4GLLA 4N7RA 4WLNA 3PI7A 3WWYA 3HDHA 1X1EA 3GUCA 1EVJA 2B4QA 3O4RA 3QSGA 4DRYA 2R2GA 1E6WA 1FDUA 1E3JA 1X15A 5TT0A 4PLVA 2P68A 4ZRMA 4GSLA 4WEQA 1P45A 2HK8A 5KJEA 3KETA 1ZEJA 2NV6A 2X1HA 4YJHB 4ZD6A 4MJLA 4BMSA 2EEZA 2ZCVA 1ZCJA 4IZHA 4PFJA 5GMOA 4GVLA 3ITDA 4L9RA 3PLRA 4IY1A 4Z0PA 5DT9A 1ZW1A 3MJSA 4BV9A 3FTPA 3LC1O 3HN7A 4NJOA 5A3VA 3ZWAA 4ROSA 3GNTA 4E6PA 2JD2A 1S7CA 3AOEC 3O9ZA 3HFGA 1O5IA 2Q1TA 1FDSA 3GMSA 1G6KA 1BRMA 1UXHA 1PGOA 3C7AA 4IPTA 3VC7A 3EGOA 1GUFA 4YAEA 2OXIA 1MXHA 3OECA 2B69A 1B26A 5L53A 1BXKA 1NFFA 2YHUA 2A94A 4AJEA 2HMSA 1VL0A 1IB6A 1NR1A 3RUIA 3NRCA 4MINA 1DFGA 4BGUA 3RASA 1XR3A 4XA8A 2HMWA 3JQGB 3TOZA 4IBOA 4CODB 1PTJA 1Y8RA 2VWHA 3HSKA 2BH9A 1E5QA 1Q7BA 3HFSA 4MVJM 3RAJA 4J7CA 4UVDA 1QYVA 2VNAA 3G79A 4D42A 5B4TA 4Q3EA 4DLAA 2PGDA 1ZBQA 4DL9A 3CMCO 4R16A 4GX2A 4RV9A 3LC7O 5HS6A 3TPCA 2WYUA 3RFVA 3K73O 5DCWA 4XQ9A 3PZBA 3GG2A 3ETGA 1RM3A 4ND3A 5JE8A 2BMAA 1K6XA 4CLOB 4YBZA 3QWHA 2NWQA 3W4JA 3LDHA 4ZQBA 1QYCA 4RF2A 6ADHA 4RORA 4E4YA 3HJAA 2HJSA 5EQFA 1MA0A 3OJEA 2EERA 3PPIA 1VJ1A 2PKQO 2DC1A 5T8KC 1I33A 1SB8A 4FOOA 7ADHA 4F46A 3VAZA 4FR5A 2YV3A 3ZU4A 5L4NA 3ON5A 2DVMA 4A03A 1ISJA 2NUAA 2PD3A 1ML3A 1VM6A 3EHEA 1UR5A 4BO0A 2X0JA 1B14A 1VJTA 1XKQA 1E3SA 2J3IA 2NTVA 4D44A 3L07A 1QR6A 3R3JA 1XYGA 4HX5A 4FIZA 4XX0A 4Y9DA 3VVBA 5FFFA 1ZXBA 2P2SA 5ER9A 4BO5A 5IZCA 4OIMA 1KY5A 2YZ7A 4J1NA 2EP7A 5CEFA 4TWRA 1HDOA 4Q3NA 1HE2A 1NXQA 1TT5A 1X13A 1H6BA 5F1PA 4JBGA 4KWIA 4FJ1A 4Z9XA 1RPNA 1HL3A 2DU8A 2WYVA 3ANNA 5H82A 1E1KA 3PDJA 2AMFA 3RFXA 2NU7A 5I7VA 2GNAA 2DBVO 2I67A 4XYMA 1T24A 3RBZA 3HNPA 3HDJA 4EJ0A 4DLBA 1I5RA 3G49A 2IODA 2HK7A 3DWFA 3KLPX 3P2YA 3DTTA 2GASA 1IPEA 4BB6A 4D79A 1EFLA 4G2NA 4BB5A 3BYZA 5L7TA 3JD2A 3MZ0A 3QWFA 1OI7A 3X2EA 2D59A 5A9TA 4JGBA 3DOJA 3F6YA 1T2DA 4ZU3A 4E5PA 3HB5X 3E03A 5JYEA 3JD4A 4IQ8A 1U3VA 1I3KA 2XXBA 2YV2A 4IMPA 3WR5A 3KYBA 4WE3A 4PG6A 3V2UA 2BD0A 5DCYA 4UVEA 4EYEA 4DIOA 4JLWA 4XR9A 1ZZEA 5FYDA 4HFJA 5DDIP 3CPSA 1WPQA 4J91A 3CTMA 4RZHA 2Q4EA 3OJ0A 5CG2A 3NT4A 1QYWA 3RD5A 4WLVA 2AG5A 1V0JA 4IDDA 1TI7A 4WCFA 1P9LA 2EHDA 4JP3A 4UUMA 1WZEA 3GVIA 5AYVA 2PZMA 1EDZA 3K6JA 4B3JA 3A14A 3JQFA 3NGXA 5AQ1A 2W2LA 3INTA 4RVGA 4EBFA 1SAYA 1B15A 1DJNA 4CM9A 5A9SB 5U4QA 1RYDA 3QIVA 2F00A 1ULUA 3VPGA 2Z95A 2HU2A 4YJGB 3S2IA 3ASUA 1QXSA 2YJZA 5ILGA 4BOYA 2EGHA 2A35A 5CEEA 3NTRA 4YYZA 3JQAA 3I6QA 4R41A 3SBOA 1IOLA 3BMQA 3IS3A 2GN4A 5HBRA 1NHGA 4YEDA 4H7PA 2AW5A 3TQHA 2OUIA 3CSDA 3U5TA 4NNJA 1T26A 2VHVA 3K96A 1R0LA 4FJ0A 1GEEA 2YYYA 3CEAA 3WFIA 2VRBA 3I23A 4KTVE 4CMIA 1HT0A 1ZSNA 2CUKA 3P19A 1QV7A 1XLTA 1MX3A 2IXBA 1C1XB 4ZQFA 2JKVA 1E1MA 1V9LA 4FFNA 4A2CA 3LT0A 4RPLA 2HJRA 3DZGA 4CPDA 3OJLA 3PJEA 4JK3A 3DBLA 3WJ7A 1SCUA 1N8KA 1PGPA 3B1FA 4J7UA 4J90A 3FWZA 1WMBA 1DIAA 3GDFA 3GVPA 4W9NA 4HP8A 1CJCA 1E92A 5DBIA 3GEMA 3BHIA 2JFGA 4O6VA 2E4AA 3QWAA 4UEOA 3WLFA 1WNTA 3M2TA 5L51A 2NVUA 1TEHA 2VN8A 3O03A 5G0UA 3WS7A 3LLVA 4O0LA 4CM1A 5A9RA 1Z7BA 2VOEA 3MJTA 3T4EA 3RVDA 3GOHA 1ISMA 1CEQA 2XAAA 3COSA 1QLHA 4DC0A 1GUYA 5I7SA 1X0XA 1KETA 3D3WB 3OICA 3U0BA 3QRWA 1EQUA 3EYWA 3RJ9A 4CM5A 1IUKA 3T7EA 2Q1WA 1P74A 4BO6A 2EV9A 3G3EA 3PJGA 4IS2A 2PZJA 4RVUA 3NDRA 3F47A 4B8WA 3EUWA 1F14A 3WGTA 3JQ8B 2X8LA 2RAFA 2JCVA 2IDZA 5CPFA 1E5LA 1SOVA 5CAEA 4WECA 1ENPA 2AE1A 3AI3A 1QKIA 4Y6RA 4B7XA 4J3FA 1K6JA 1HYHA 1SMKA 5AVOA 1SB9A 3M2PA 3OP4A 1AHHA 3AFNA 3KSZO 3OIFA 4FFPA 1JU9A 3IJPA 3JYOA 3EZLA 3RU9A 5HA5A 2D3TA 2NU8A 1FXSA 2JFHA 4ZQEA 2E37A 4DGSA 3I3OA 1EK6A 3NJ4A 2VTDA 1JAXA 3HG7A 1B7GO 2FRDA 3GVCA 4YQZA 4YAKA 4J4TA 3ZWYA 4GKVA 4K1LA 1T1RA 2FR1A 2OBYA 3SJ7A 1YO6A 4BNKA 4WLFA 3GZNB 4ALIA 2QYTA 3WTBA 1PS8A 2BI7A 2UDPA 1D7OA 1LLQA 1ZK4A 3M1AA 4EUFA 3DXFA 1H6AA 3JYPA 3H65A 2Q4BA 3FPCA 4YDRA 4GAEA 5I8ZA 3WOHA 1U5AA 3BA1A 4XQCA 4UVGA 3WJAA 1Z73A 2OORA 2EF1A 1DLJA 2W8ZA 3AI2A 5I7FA 3UCEA 1GD1O 2VUSA 5IAAA 3OSUA 1EMDA 4XQGA 2Y1EA 2ZB7A 3OETA 1HEUA 4JJIA 4CV1A 5ITWA 2BI8A 1V3TA 3T4XA 2AEFA 2CFCA 2G1UA 3KLMX 3MEQA 4PLYA 2IEDA 1XQ1A 3NTOA 1ZKMA 3WSWA 1U4SA 1DB3A 3D0OA 2OP1A 4Y6SA 1U7HA 1BDMA 1LDGA 2FMUA 3KYDA 2XF8A 1K5HA 1GFSA 1MUUA 3D4OA 3S55A 4LISA 3BTUA 3TZKA 1M6HA 5KVVA 3KYCB 4ND1A 1B8VA 3F4LA 5T5QA 4U6QA 3T7CA 2EG9A 1YJQA 4PZDA 4NBWA 3GDOA 4P22A 5BQFA 3F5QA 1F8FA 1C3VA 4JBIA 1D8AA 5JCJD 1E7QA 2VYNA 4RF5A 1E77A 1IYZA 3I9JA 1EFKA 4YT5A 1SEVA 3DBVO 4IDGA 1Q7CA 1YS4A 3OIDA 4BHTA 2FP4A 5JO0A 3C24A 1ONPA 1S6YA 2WSBA 3D4NA 1EUZA 1HRDA 2O3TA 4HUJA 1PEDA 4RJTA 4II2A 2JD1A 3NKLA 2PA3A 1DFHA 4ONEA 2LDXA 3DAPA 4DBVO 3JQCA 1HDCA 3Q1LA 5ES3A 5ILOA 3PHIA 4P38A 2O3JA 2VUTA 3K30A 4YQYA 3AY3A 4E33A 1YONA 2HAEA 4OSPA 1EBUA 1CQJA 1XCBA 4GH5A 1XSEA 1CERA 3DBHB 1CIVA 2FWMX 2V65A 2WD8A 3H3JA 1JW9B 5TSDA 2PZKA 4AICA 2O4CA 1R4MB 3QLJA 4FFMA 5FEUA 4P4NA 2JAHA 4CMGA 4F6CA 2IYOA 1KEUA 3JSAA 3OQBA 4AJKA 3ZV4A 2C7GA 4MIEA 4PRKA 4M8SA 1PJQA 2EXXA 3JYNA 4XGKA 2P5UA 1PQWA 1LLCA 4BO9A 3GA0A 1RWBA 3QVOA 4BNVA 8LDHA 4XQEA 2Q2VA 2YQ4A 3WBBA 2CF5A 4CMAA 5KJFA 1K0UA 4CV0A 5DN9A 1LSJA 3UOGA 4LMPA 1DOHA 3G1TA 3ZU5A 3PQDA 3HHPA 5A5FA 4BNGA 4MVJH 4KP7A 2DPHA 2O3UA 3PFWO 4AG3A 3E9NA 5JNLA 1AXEA 4II3A 3R3SA 1YGYA 4LCJA 3UCXA 4DQVA 4BGIA 2I6TA 1H6CA 3B1JA 3IP1A 4NMHA 3CKYA 2H9IA 1Y5MA 4DIFA 1HDYA 2QZ9A 2VZ8A 4MVJE 2JCYA 2NU9A 2TMDA 1SZJG 2V7PA 1PJLA 3I9KA 3PHJA 1KC1A 3P2OA 2YW9A 4PG7A 3MWDB 4BKUA 1U5CA 4E12A 3CMMA 1C1XA 3AK4A 4ITUA 3BHJA 3KO8A 1HDZA 3TFOA 4G5HA 2A4KA 1QYDA 3INRA 1EUDA 1LLUA 4MP3A 4PIVA 5B4VA 3F9IA 3RC1A 1DIBA 3PDUA 4XB2A 2CDCA 4R3WA 1VC2A 3KSUA 3ROPA 4O5OA 4RLSA 3P5SA 3VPXA 2H63A 3PXXA 4MVJF 3TL2A 3Q2KA 2E48A 1HKUA 2VCYA 1U7TA 1PIWA 3V1UA 3BZUA 3VHRA 4BNZA 2C7VA 4L73A 7MDHA 4ESOA 3L6EA 3VZRA 1LQUA 1LDBA 1LLDA 1EZ4A 4A27A 4RQUA 1SC6A 1DPGA 1XU9A 2VRCD 3H2ZA 5JYDA 1PWZA 2WYWA 4RL6A 2BFOA 4XJSA 2P91A 2C5AA 1EBFA 4WLOA 3NYWA 2W90A 5EN4A 4RDHA 3EMKA 3I9MA 5JPIA 5JY6A 4E31A 4RDIA 4JXKA 2F1KA 2Q46A 4DA9A 3FN4A 3DOOA 1V6AA 4TRNA 4L4RA 4NFYA 4YT4A 3JYQA 1V3VA 4YVFA 5A1TA 5KNLA 1N1GA 4K28A 1HF3A 3SX2A 5C7OO 4S1VA 9LDTA 4WASA 2Y66A 4Y6PA 2HSDA 2D8AA 1PZFA 3OQ1A 4HY3A 3WNQA 1R16A 5T67A 1E3IA 3DMTC 3E18A 1XG5A 2RCYA 4KQWA 4AJIA 3TZ6A 4M86A 2OBNA 1PL8A 1O9BA 3AM5A 1UP6A 4HFNA 1YQDA 4GKBA 3VVCA 3NX4A 3VPHA 1PGQA 2VZ0A 4N54A 4TSKA 1D1SA 1HE5A 4J43A 4MP6A 2PH3A 3AJRA 4I9HA 4ND5A 4TRMA 5KJCA 1EDOA 3ZU3A 4Z3DA 1HE3A 1A4UA 3WQQA 3NJ8A 2POQX 1JN0A 5L3ZA 3M1LA 3ZHBA 3FBGA 2Y05A 1K89A 1SOWA 4ZJUA 5JW6A 2GZ1A 2QYSA 3I9LA 3OF2A 1NFRA 3FBTA 2H1SA 1R4NA 1EVZA 1T4BA 1Y8QA 2CVZA 1Y7TA 2QIOA 4Z6KA 1LDEA 3VDQA 3V1TC 1E7SA 1SO8A 4E21A 1GEGA 4KZPA 1JKJA 1WVGA 4IJKA 3GG9A 8ADHA 1X14A 1NM5A 1PZGA 2FHSA 3E82A 1YQXA 2O7QA 1E6UA 2OHXA 4HXYA 4RO0A 4FFLA 4EEXA 4BGEA 2X23A 3VKUA 3H4VA 2CNBA 3KOUA 4ALMA 1RM4A 2WE7A 2ZJ0A 3ENNA 1FDWA 3ZWWA 3LYLA 3TOXA 3V5NA 4YWJA 1KERA 3DR3A 1XEAA 3MOGA 5THKA 3GAZA 1PJBA 4BKPA 5BSEA 3RBXA 3LT2A 4IQGA 5JMWA 2D4AA 3IKVA 1K3TA 3EVTA 1HTBA 4RQTA 3WGIA 4DPMA 3ANLA 1CRWG 2JCXA 3NUGA 3AY7A 1KS9A 1GV1A 2E6UX 1NVMB 3TDKA 5FWNA 3P7MA 4N5LA 4Y67A 3FNEA 1AXGA 4FSHA 3KEOA 2HUNA 5IDYA 1M76A 2W2KB 3JQBC 3WYCA 5JFOA 1MC4A 2Q50A 1UP7A 3I9NA 2WWRA 3R1IA 3B70A 2AXQA 1Y6JA 2Y0CA 4GLOA 3ZWPA 4MKXA 1RM0A 3N58A 3BTSA 2Q99A 5A4DA 1C0LA 1L1FA 2HO5A 4TZKA 2CVQA 4K9DA 3V2GA 3VPSA 1ADFA 3TSCA 3MJVA 1YDEA 1E7MA 3DBHA 4FW8A 2PTGA 1ZMTA 1VL6A 1NNUA 3PYXA 3AY6A 2Q1UA 4BNLA 1BTOA 1E0DA 3W8FA 2O2YA 3U62A 3LVFO 1QMGA 4WNCA 5I8WA 3H6KA 1I0ZA 3WIDA 3JQGA 4U5QA 2DLDA 1NPYA 3CZRA 3MJEA 2DTXA 1I10A 3M6IA 2ZKLA 4CUZA 1B2LA 4UAGA 1LQTA 3F3SA 1Q2XA 4WKGA 1HXHA 1XA0A 4R68A 1PX0A 1YBAA 5KCZA 1T2CA 3CH6A 3KEQA 3NTQA 1I2CA 1ZK0A 5ENDA 1QORA 1N1EA 4CQMD 1CF2O 3AUTA 4YTEA 1A71A 4KDFA 5G0VA 2DPGA 4G65A 4PGFA 3B20A 3L4BC 4XYEA 5B4UA 3QWIA 1Z74A 5DZSA 1QSGA 2X86A 3E48A 1AE1A 1ISFA 1DC4A 2OO5A 1GTMA 1MC5A 5HRUA 1IL0A 1U3WA 2ZIZA 2X22A 3KBOA 3U4IA 3KRTA 5ER6A 4OGWA 5G0TA 2P9CA 4IZIA 3WSVA 4DMMA 4F6LA 3IUPA 4C7KA 1FF9A 5IDWA 2YFQA 3JQDA 3DZIA 1NHWA 5A06A 1PSDA 3TF5A 4DPLA 3R0IA 1R4NB 3C7CB 5AXAA 1KVUA 3DFZA 4XYBA 3L4BA 3ZNOA 3NDIA 4R1TA 2BFAA 3HDYA 4TZTA 1PJ3A 4AJ2A 1E7YA 3RIHA 2PKRA 3A1NA 2Q1SA 4L4SA 1NQOA 2I76A 3UF0A 3RUFA 4MVJP 4TVBA 4I8XA 3E9QA 1LRJA 3OJFA 3D3EA 5JMPA 3BAZA 6LDHA 4B7UA 3V1YA 2VWGA 4F45A 3WQSB 5TLSA 2E49A 4XRRA 3KXDA 5F3RA 1A7AA 3B1KA 5EERA 5IDQA 1PL7A 5JAQA 1W6UA 2V6GA 1IZ0A 3W4KA 1OOEA 4NG5A 4P4GA 3FTNA 1ORRA 1XQ6A 2YDXA 2EP5A 2VHYA 3FR8A 4RVHA 1GQQA 4UEKA 3DHYA 2QRJA 2Y68A 3STHA 5U9CA 4BS9A 3MTJA 4MIYA 1GR0A 3PRJA 3RUCA 3NT2A 4B3IA 2IZZA 2Q49A 3IQDB 2VHWA 3DL2A 3CIFA 3KZVA 5IN5A 3IUSA 4CMEC 4QO8A 1XWFA 5G2OA 5K6AC 3ADOA 2GYYA 4LRSB 2I66A 5T8KA 1E3WB 1Z82A 1O89A 4BL5A 3S2FA 3DC2A 4MOWA 4C4OA 3S8MA 4E5NA 3LU1A 3PWSA 4NFHA 1BW9A 2VHZA 4XRGA 5JAMA 4P4LA 1GZ3A 3PWZA 2P5YA 2HRZA 2HLPA 3E1KA 4TKMA 1QLJA 3DZHA 5T57A 4LGVA 3DHEA 3QVXA 5EIOA 2EW8A 4BNXA 4BMNA 4GGOA 1GZ4A 2ZQZA 4K26A 1J49A 1KVTA 2GN6A 4B7CA 1W0CA 2I9PA 3VZPA 2PLAA 4Y98A 3ZHZA 1F12A 1N92A 4JJFA 2X5OA 3Q0EA 5ENVA 5F1OA 3PJFA 1UAYA 2CD9A 4I08A 4JNKA 1UH5A 4OSOA 3RC2A 4XDZA 3ZNPA 2ZCUA 4W82A 1LDYA 4WK6A 2AQ8A 1DIHA 1YL6A 2BLLA 2V6BA 3I1JA 3ZI0A 2AE2A 3RQSA 5CG1A 1T2EA 2P9GA 2WMDA 1PGJA 1ADGA 1LTHR 5IZCC 1R0KA 1YRLA 3ITKA 1I3MA 3ASVA 4XJTA 5F21A 3VTZA 2RH4A 5DOVA 2GGSA 4XGIA 1JWBB 3PHLA 4AFNA 3ICCA 4L74A 4H3VA 2X7HA 1JTVA 3PFFA 3D5QA 1YWGO 1ZK1A 1F0YA 1GYQA 5G4KB 5H81A 4CQMA 2PK3A 3DONA 2CF6A 2WJPA 3DQPA 2VYND 1MXFA 2HCTA 4CMBA 1PJ4A 3UICA 3RU7A 1I01A 3ABIA 4QFDA 4CMIB 3CINA 2R6JA 4CM9D 1DAPA 4O1MA 1F8GA 5COAA 3C85A 1E1LA 5EL0A 1DEHA 1MFPA 1P0CA 3LT4A 2P4HX 1BHSA 2X9GA 3I6IA 3PGXA 3VH3A 1XDWA 4QTZA 5ICSA 1OC4A 4ALJA 3JQAB 2O3QA 3OBBA 5CDUA 4IQ0A 1NAHA 1MB4A 3NV9A 4K6CA 4DMLA 4CMJA 3PYLA 3FF4A 1JAYA 1ZMOA 1WXDA 3CXRA 4FDAA 3F5SA 3X2FA 2W2KA 4RZIA 3WGHA 2GZ3A 3QP9A 3KB6A 2X5JO 1YJ8A 1PZHA 3BXXA 4ZQGA 2D2IA 3D64A 4DIBA 1G1AA 2QZZA 4NBUA 4XR4A 2ZTUA 4CM7A 4BQPA 3PQFA 1DLIA 5DOZA 2VT3A 2X4GA 3H5RA 1EEHA 2J3JA 2H6EA 4J1TA 1SEPA 2HMUA 3GEDA 4IXTA 1BMDA 1T2AA 3ANMA 2OFPA 3E5MA 1L7DA 2IEBA 3V2HA 1OMOA 5EJ2A 1PQUA 2I5PO 3JQ9C 1RJWA 1LDNA 1R15A 2DM6A 4UUOA 5AXCA 3GHHA 1H93A 5F1KA 2AG8A 1NPTO 3GC6A 4GX0A 4XYGA 2GRAA 4AJNA 4ALKA 1J0XO 4MKRA 4DVJA 4MDHA 2O50A 1NTOA 2J5KA 1J5PA 4R1UA 3VZQA 3WBFA 3AOGA 1X7DA 3AWDA 3I52A 1H94A 2PY6A 1LRKA 4W7IA 4H15A 1XIVA 1W8DA 2CDAA 4XEHA 5G0SA 4D3SA 2BELA 4RPJA 3UKOA 1NQTA 3FCOA 5IXSA 4PG8A 1W73A 4FBGA 1X7GA 4QUKA 4R9RA 1G0NA 1HE4A 4XZ3A 1PZEA 3BMQB 2QW8A 1GQ2A 4QECA 3JQ6A 4LVUA 1JVBA 5A3JA 1VL8A 3Q9NA 5EPOA 3JD0A 4NZ9A 5DP2A 1P1HA 4D3FA 3W6ZA 1WP4A 4YB8A 3ZWNA 5L40A 4FS3A 5CDTA 1XU7A 1BW9B 5A9SA 2BFPA 4E13A 3G1UA 2CVOA 2QQ5A 3ZWMA 4CV3A 5KWEA 5JBIA 3RBVA 1OZAA 1E3WA 1KYQA 3H3FA 4KMSA 5EINA 1NQAO 4UREA 1MP0A 3WGGA 3PGJA 3IP3A 1JKIA 2RHCA 4DC1A 1H9BA 3H9UA 2EKPA 3SEFA 4PVCA 1YOVB 3WNVA 4CMCA 3VPFA 2AQKA 1EE2A 1U4OA 3EC7A 1AUPA 3GH3A 2GCGA 3HB4X 3IMFA 3HADA 2O23A 4LSWA 2EJWA 4E5YA 2G17A 4NFSA 4RVDA 3WMWA 4XKJA 4S3MA 1VE9A 2I3GA 2OP0A 2Y1GA 3FWNA 3K31A 3KM0A 2GO1A 4CM3A 2NNLD 4QO7A 3IDSA 3HN2A 1ENYA 1GADO 1HDGO 3PIIA 3ZU2A 4O63O 3F1LA 1ENZA 2X0RA 4I5EA 4M1QA 1DXYA 1I32A 4CR6A 2XPCA 3LLSA 1H2HA 1TVEA 1PS0A 2R00C 1M75A 2OL4A 2RHRA 3D7LA 1ZJZA 1BXGA 1A7KA 4D41A 1JA9A 3EVNA 4MIOA 1LC3A 4EW6A 4MKZA 5K0ZA 1PR9A 2BFMA 2JD0A 4GX1A 1WW8A 4ND4A 3HE3A 1YKFA 1QYXA 4ZVVA 2G0TA 3ZWBA 2ZJ1A 1LUAA 3ZHYA 1V35A 1NWCA 3AM4A 1DC6A 1B3BA 1PWXA 5TGDA 2VQ3A 4A0SA 3ZW8A 4E2ZA 1NYTA 1YE3A 4J6FA 4WJZA 2AEJA 2PGLA 4WLEA 4BO4A 1NFQA 1DIGA 2FY8A 1MG0A 2B5VA 3GK3A 4MPDA 4YA6A 4B3HA 2ZK7A 4D7AA 1K6IA 1WAMA 5IJZA 1ZO8A 1LSOA 5KIAA 1NWHA 4AJPA 1LA2A 5BSHA 4YJDA 4FFOA 2YUTA 2AQHA 3W1VA 2D5CA 1ISHA 2C82A 4BIIA 1ZVMA 1D4FA 4B4VA 5IFLA 4IDAA 4O59O 3PJDA 2GD1O 4YRAA 1ZK2A 4IMRA 3K2BA 3TL3A 1UUFA 4DXHA 3BTVA 2C54A 4NK4A 1KVSA 2DTDA 4HFMA 4XIJA 4FN4A 3RCBA 1HSOA 4DQXA 1UXIA 3D5TA 2JAPA 2FZEA 1V8BA 1RKXA 2IZ0A 4J4BA 4Q39A 1AGNA 1EVIA 1LXCA 2VOJA 3EY4A 4PZCA 1DBVO 4YT8A 2O4UX 1E3EA 2DUWA 1VSVA 3R6DA 3VH1A 4B4UA 1BG6A 2ZYAA 3GN1A 3GF4A 1WDLA 3TFQA 2TMGA 3D1LA 4IDCA 3UH1A 1FDVA 1P1IA 1GPDG 3NT5A 2B4TO 2PV7A 3RUHA 5BSGA 1X1TA 1BDBA 2PNFA 3DEYX 5DBFA 4CQLB 1E7WA 1R4MA 4LCEA 3SXPA 5TC4A 3VOSA 1A9YA 4CLEA 1CDOA 4LK3A 3H7AA 3Q11A 5JCXA 1FK8A 3UVEA 1Y8RB 4W9NC 4PLPA 1HETA 4JCOA 1YB1A 2BKAA 3K9QO 1D3AA 5L7WA 3IKTA 1DRWA 4GMGA 3QY9A 2AQIA 3QV1A 1IULA 3L9WA 3GGPA 4LRTB 2C0CA 4FC6A 1U8FO 2EKQA 4XB1A 3DAFA 4UUNA 4B8ZA 4RPHA 3DO5A 4TMFA 3UUWA 3JTMA 4L0QA 1P77A 1PU2A 2ET6A 2YV1A 3I9OA 1KVQA 4XCVA 1KBZA 1VKOA 2J5RA 5GZ1A 3OA2A 4JN6B 5JDCC 4N5NA 2VWPA 4OKNA 4FFRA 1T25A 2EW2A 3AUUA 3RWBA 2YHIB 3CZMA 3FNFA 1U2GA 1ZEMA 3LT1A 4AVYA 4J1QA 3SVTA 3H9JA 5CPBA 2DUUA 3ZDFA 2C20A 2D5AA 4NPCA 3ROKA 2ZQYA 1M2WA 2PKQP 3RKUA 1WWKA 3E9MA 5F5NA 1BVRA 2CMDA 2JFFA 1UDBA 3OQ6A 2VTEA 1WDMA 2ZB4A 4EGFA 2EKLA 1Y9EA 3D4PA 4HBGA 5LDHA 4UULA 1Y8QB 1F17A 1UXJA 1M66A 3BIOA 4EJMA 1NAIA 4CM8A 4NQZA 1ISIA 3DDNA 3QWBA 1DRVA 4HNHA 4MVJD 5I9NA 4Q3BA 4NK5A 3RUEA 1IY8A 3MCVA 3GMDA 2C2XA 4Z3KA 3ONDA 2GPTA 1JLLA 4OXYA 4DYDA 4IGEA 5K6AA 1VI2A 2B37A 3ETDA 2B83A 3AU9A 2CZCA 5TIIA 1NBOA 5MGBA 1TB4A 4J1SA 4M87A 4GX5A 4IXWA 1NP3A 3GNQA 3ROMA 1G0OA 1AN9A 1UDCA 4BNHA 1NASA 3ZZNA 5KKAA 1PQPA 3ZH2A 4TKLA 4OM8A 4N5MA 5DF1A 2EGGA 1LX6A 3OIGA 2W98A 3EK2A 1R37A 3GR6A 2JHFA 4DBZA 3FI9A 5LDGA 2OMEA 2NSDA 2PR2A 3PQEA 5DNAA 2J5QA 4RF3A 1LI4A 1U1IA 1VKNA 2DQ4A 4GBJA 1LRLA 4ID9A 4Q3AA 3W8EA 4YR9A 4OH1A 3ZV3A 1ADCA 1GQYA 2VHXA 2GERA 3AUSA 3C1OA 4R1NA 4W4TA 4CLRA 1JDJA 4HNGA 1HSZA 4E5MA 4LW8A 1SPXA 3I83A 5AOVA 4JQCA 3QA9A 2IE0A 2NTNA 1LSSA 1E7RA 2GF2A 2ZATA 1OAAA 2W2LD 1T4DA 1DHRA 1HZZA 5C7IO 3ONEA 1R66A 4YAGA 3RKRA 3ZGYA 4TRJA 5A02A 3GEGA 4YT2A 3HDQA 4E2XA 3FSRA 4FD3A 3UAGA 5J23A 3LK7A 2J6IA 3NEPX 2Y99A 3JQ9A 3H9QA 5KTKA 3JYLA 5I9MA 1YBMA 4J7XA 4DWVA 5KJ6A 5HTOA 1PL6A 1CETA 1R0SA 4R5MA 4CLXA 3L4SO 4IIVA 5CP8A 1F06A 3GVXA 2UVDA 4WEOA 5IN4A 4BV8A 4L4XA 3ADPA 3D3WA 5ICMA 1GCUA 1HYGA 4PVDA 1I24A 1P0FA 3VZSA 3WGYA 4PCVA 4LVCA 4R01A 4DPKA 4C7JA 3L6OO 4E5KA 5L9AA 1HWYA 3OHSX 4EJ6A 4EITA 2C5EA 1CYDA 1YB5A 4KQXA 3OFSA 3DHNA 4OOEA 2D0IA 4M49A 2NVWA 4Z9YA 2OGUA 4QXMA 5HS4A 4PRLA 2JJYA 1YDWA 4RPGA 5GZ6A 2I3AA 1SBYA 2HMVA 4KUHA 2XOXA 2HKIA 2AA3A 1P1KA 1UAGA 3CUKA 4Q3DA 5L4LA 2XXJA 2QRLA 3AFMA 1DDOA 3BHMA 3UHAA 5TX7A 4R1SA 3H8VA 2FOIA 2PD4A 3OMLA 4FCCA 4NU6A 2GR9A 1JVSA 3JQFC 1OC2A 2FR8A 1DAOA 4CR8A 1VLLA 1UXGA 1DC5A 1YQGA 2EIHA 5AXDA 1N9GB 1E1NA 4JROA 4OHUA 2Q2WA 3DZBA 1C1DB 3S2EA 4CJXA 4Z0HO 1QV6A 3IAHA 2GN9A 5A5EA 5IG2A 4EUHA 3KYCA 4JJGA 4DREA 3LC2O 4BNYA 4QEDA 3DOCA 3GVHA 3DTYA 3S1LA 3U3XA 4R54A 2WTBA 1W4ZA 1KY4A 1TLTA 1I2BA 5FF9A 3H9EO 4KWHA 4CL3A 5KKCA 5BR7A 2WE8A 3JD3A 3ORFA 3WTCA 4DYVA 4KOAA 3ZNQA 3K8ZA 1KVRA 2O48X 1U3TA 1AHIA 4NH4A 1GV0A 4E32A 1LU9A 3I5MA 5KVCA 2P4QA 1M6WA 4TROA 5GZ3A 4OYRA 3WG9A 3TN7A 1FJHA 3WQRA 1HLDA 3ZV5A 5DULA 3FHLA 4EEZA 4IINA 1C14A 4FGSA 4BNJA 2WM3A 4OL9A 1E3LA 3G0OA 5IF3A 1EQ2A 3WB9A 1EVYA 4IDBA 3FNGA 2YQ5A 1I36A 3PVZA 4A26A 1X7HA 3OA0A 1U28A 4J9UE 3DBRA 3UW3A 4NR0A 4AJ1A 3JQ7A 5FI5A 1GAEO 1ONNA 4KTTE 4NHEA 1H5QA 3ZWCA 4RLHA 4RGBA 5CDSA 1IHYA 2C2YA 2NACA 1ARZA 3GPDG 3QW2A 3CE6A 4BNNA 1A72A 3IL2A 2EWMA 1ZIDA 1J4AA 1DJQA 3O8QA 4JP2A 3DB2A 2BF7A 1J6UA 4GVXA 4LMRA 4UEJA 3IIEA 4IIUA 2FZWA 1LDMA 4YPOA 5CDGA 3LQFA 4MP8A 4E30A 4OMUA 2Q2QA 4ZGWA 2ZB8A 4CLDA 3ENKA 3ZN2A 5EQDA 2HMTA 5HM8A 4CV2A 4OO3A 4IGFA 4YAJA 5TF4A 4BGVA 3JQ8A 1RYEA 1DC3A 1PGNA 2IZ1A 3ETEA 3H5AA 4PLFA 2ZYDA 1N7GA 4MVJA 3RI3A 2NLOA 3A9WA 5U1PA 1TT5B 4PG5A 3O38A 2ZYGA 5B1YA 3UXYA 4I5DA 3ULKA 2BGLA 3MTGA 4BO1A 3DMYA 3RJ5A 2DBRA 1A5ZA 1O0SA 1I3LA 3EW7A 2B4RO 3VH4A 1B3RA 1CWUA 4BKRA 3ZV6A 2W4QA 4OAQA 4G81A 1GPJA 2P9EA 5H83A 1HYEA 3B6ZA 1LNQA 1RM5A 1LC0A 1UZMA 1NVTA 5CHEA 4J2OA 4EZBA 2UV8A 4RF4A 1DHTA 2DFDA 4YJFA 2X5KO 2VNSA 5COQA 4BMVA 3JQBA 3GGGA 1P1JA 3QQPA 4Y8VA 5JDIC 5TS3A 2BHLA 3QVSA 2RH8A 5THQA 4PLZA 1I3NA 1LSUA 3U49A 1XELA 3GZNA 1Z6ZA 4R5HA 2YY7A 4CLRB 3UCFA 3PZRA 4U8GA 3MOIA 2RIRA 3SC4A 3WFJA 1ZUD1 1ZXLA 3GFGA 1PS9A 2X0IA 1H9AA 2GDZA 4J0FA 5A05A 4KDEA 1H6DA 4EI2A 2WD7B 5C7LO 3Q6IA 2VZ9A 2NU6A 4IJVA 2Y0EA 2G76A 4L75A 3VKVA 4NIMA 5DCUA 1ZK3A 1MLDA 3PHHA 4WCDA 2G82A 2O2SA 2PGJA 3DZFA 1LEHA 4RVFA 5EESA 4FPXA 4CMEA 1XGKA 2HDHA 3U9LA 4CL8A 3PLNA 3GHYA 4U6SA 4BVAA 3FRJA 2I65A 1X0VA 4D45A 3DZKA 4A73A 3UN1A 2HQ1A 2WEKA 3ZW9A 3BMCA 4PLGA 5JXWA 3AM3A 3QVWA 2BRUA 4CM8B 3K92A 3C7DB 2NVUB 5B12A 4HV4A 2LDBA 4DUPA 4WCFB 1H0KA 2CY0A 3F1KA 1KC3A 1ZJYA 3W4IA 1HLPA 1N5DA 4OXKA 1EUCA 4IS3A 3ST7A 3WWZA 3A4VA 2R00A 3IC5A 1PJ2A 3HWRA 3L9XA 4N18A 3KSDO 4INAA 3WLEA 1HDRA 1L7EA 1QG6A 3DBLB 3IOYA 4OJNA 3GGOA 4L76A 2PH5A 3BMNA 2VUUA 4J4HA 5JCJA 3SC6A 2YHIA
chains in the Genus database with same CATH superfamily
1RYMA 5E8JA 1D9ZA 1YDMA 2GXUA 2LKDA 3ORHA 2GZAA 3IO5A 3MWGA 3GJZA 4RWZA 1WUTA 1EBBA 1WIWA 3JRXA 5HRAA 4RCVA 4RLQA 4ALLA 3R8FA 2XVZA 1TYDE 3D6VA 3FKSD 5JBQA 4LBWA 1XHLA 5LA6B 3IJRA 3RG2A 2A0YA 2LXNA 5ITVA 3K94A 1EUYA 3VJMA 2I6QA 1TFUA 5L6MB 1FNSA 1ZUWA 1JEOA 2A1UB 2P79A 4YRDA 3DKVA 2Z5LA 5IJZA 2B35A 1ULSA 4FEYA 2JGEA 3NFRA 3DDCA 1UEXC 4LQLA 4BNUA 4DDUA 2AHRA 4FHGA 3JCZA 4B3XA 2E82A 2DFTA 3UY4A 3VBEA 1DIRA 2FAXA 4LDNA 4MQEA 3U09A 1XTVA 2J3KA 3LGXA 3ZHOA 3ZHVA 1VIDA 4BGDA 4OMCA 1JQBA 2MR5A 4OLHA 3ZIUA 4H0CA 1XD2B 2OM2A 1BNCA 5IAJA 4D46A 3ZE8A 1F6BA 4CQNA 2XQJA 1Y7IA 1ZSYA 3HGQA 5EHIA 1TZJA 2QDKA 4BVLA 4DLLA 4P2BA 4ZOLA 1VB5A 1Z5ZA 2XX3A 4PZYA 3V4RA 1O57A 3STYA 2UXBB 1FMFA 1T4CA 2HDNB 3HXQA 3H87A 3EIWA 2FGKA 1QFZA 2QG9A 1X9GA 2FSSA 3DMGA 4WUVA 3VISA 3U9TA 5K4HA 3QU2A 1XYVA 1N2OA 3LIIA 1R12A 1BIFA 4GKAA 3KT3A 1FFEA 2F3RA 1H65A 3M1IA 3MJCA 3IXMA 3AETB 4DG9A 1QHHB 3LCUA 4CKXA 1KEWA 3O90A 1N2EA 1PFWA 2ZRCA 3COZA 4OU5A 4UNNA 4R4JA 5FR2A 1UP4A 4J3NA 1Y82A 1IXYA 2X8AA 4PCLA 1XPRA 3DT9A 3V4PB 3IP7A 1S2GA 2DPMA 5JG7A 3MTBA 4O2BA 2WDZA 4JP1A 5CDYA 2HV8A 4F2GA 3FCUB 5HHTA 1MG5A 1Q0QA 1ZMXA 3L93A 4RE6A 1O5OA 1CVLA 2J3HA 2J7PA 1NC3A 3BCSA 4HVCA 2DX7A 2QUIA 3RS0A 1IN5A 1ST2A 3SM9A 4N7MA 3U3ZA 3VV3A 1JLMA 1PJTA 1ZZGA 1TJ5A 3FYUC 3PE4A 4R69A 3U1VA 4DQUA 4KQEA 3CUVA 2WWHA 4Z1OA 3KDPA 4NNPA 4UNIA 2PVPA 2BFEB 1QPBA 2ZRHA 4Q1BA 3RVPA 3Q8MA 1J90A 3R5HA 4IF4A 3EISA 4BEBA 4UHCA 1UJ6A 2VJQA 1V5EA 2DWOA 1N1MA 1JYSA 2EX0A 2Q2NA 4K88A 3W8DA 2Q4TA 3KPYA 1RHUA 5FLEX 4B6JA 2RGDA 4L22A 2HZ7A 4ND7A 4H4DA 2IFTA 1P4SA 4BDTA 4E2YA 5DSTA 2ZUEA 5KQGA 5L95A 4QJ5A 4P81A 1GA1A 2B8EA 4A7PA 5GIOE 1GYRA 4J9VA 5CGQB 2DR2A 3BK1A 4BX9A 5JC8A 3K0FA 2W6ID 2J3QA 4QYMA 1KEEA 5IKXA 1YH3A 5EGNA 4A2QA 2ZJ2A 3CRRA 1LW6E 1OI3A 3IKLA 1WJGA 4NYMQ 3SF0A 3WICA 2AK2A 2JFZA 3T7AA 3Q3GE 5KYVA 1AA9A 5FUMA 4C4ZA 1SVIA 3ZCUA 1L1RA 3LMKA 1A8HA 2G70A 3O91A 4YUAA 1ENOA 1ZSVA 5KZMB 2CL5A 1OVGA 1PJSA 1UF9A 2HRQA 1H0HA 4GOKA 1MFZA 2ERYA 5JTTA 2CVHA 2J6HA 3PWTA 1ZHOA 3BGVA 1E0KA 3ZD6A 4MARA 3HO8A 1ATIA 3LH5A 3SYRA 5JY1A 3H0CA 4KLRA 3MQ4A 2CWDA 2NPIA 3LF2A 3FPJA 3BT7A 1C30A 3AH8A 3HS3A 3RVOA 3SQLA 1YKGA 3U19A 2XEDA 1AKRA 4O4HA 3UW1A 4U7WA 5TQVA 3LF1A 3N07A 2I22A 4P3KA 2BJHA 2QZ4A 4QT0A 1S8AA 3OCYA 2CHVA 2Q3MA 5JQGF 521PA 4MQUA 4FGZA 4QYIB 4ED9A 4I19A 2WTMA 3L1IA 4HI0E 4AN1A 3LC0A 4C0AC 4MYHA 4D97A 1A9ZA 4LGYA 4GO1A 3JQ7B 4WLUA 2XDYA 1UWLA 5LKRA 4XDYA 1WLSA 3GV0A 4XARA 2XNDD 4JLAA 5KQMA 2VUIB 2RH5A 3IPXA 3CEMA 1FNNA 5AOBA 4GXTA 4D3DA 3ANTA 4FI3F 2B8TA 2R7KA 3BQ9A 3BC1A 2OFOA 2GESA 3K72B 1BFKA 1F4LA 3CH5A 3VA7A 5KDDA 2L82A 4FI3C 4NDNE 1Y98A 1EPUA 4NHOA 1NVGA 3QMMA 1AHNA 1O6ZA 4GL4A 4KSBA 4Q4HA 4XSHA 4OYYA 5E2IA 3MTEA 9LDBA 2WAAA 5KQPA 4EYOA 1M67A 3EMVA 3FR7A 2PA0A 3LUFA 4KRGA 3RS9A 4AN0A 5A4KA 1KJ9A 2V4MA 3DOHA 5BV1A 5JS6A 4UCXA 5G1OA 4BYGA 1QF6A 1IZ9A 5LKAA 2YXBA 3NVMB 1GKKA 3EXHB 3H4MA 5JS2A 4Y2GA 1ZJJA 3STUA 4G41A 3DW3X 3PK0A 2AV6A 2VXOA 4HZUB 3CVXA 2ZUCA 1H2BA 3KVYA 1U90A 3C3YA 3NONA 1YR1A 4FC7A 4PIMA 5FI3A 4RIIA 3WLAA 4FQ8A 4G1VA 1VJ0A 3M81A 4WNAA 1W85B 2PL9A 1E69A 2QTTA 4MW1A 3TD2A 3KHTA 1Q6YA 2IP2A 1OIXA 2JIRA 3RH0A 2A84A 1SBIA 1VCHA 2MYPA 3VSCA 3AI1A 2CFTA 4ARIA 1HFWA 2VP3A 4KYVA 4QPNA 4LSMA 1S9DA 5CT9A 3RC9A 2NVBA 1C1DA 3DULA 3K2EA 2QR2A 3EQ6A 4NJMB 2B2XA 4NY1A 1AZWA 3ZCPA 3I8SA 1MTOA 4D4JA 4I1OA 1XVTA 2F7SA 3FNQA 4MW4A 5K4AA 1EA7A 4Q00A 3QYAA 1P31A 1XN1A 1XRPA 2G1AA 2Y0PA 1GUZA 3LFTA 5CW2A 4JMLA 1J8YF 4KXUA 3IODA 3SQNA 1I2ZA 2C78A 4BE9A 5K0BA 5ECDA 3THSA 3D4BA 3DQZA 4DSNA 1L5MA 3OLVA 3T1QA 4V0RA 1VYVA 4EEKA 1BS2A 4DDTA 4ZHSA 3BFVA 4WFQA 3AUAA 2EVWX 2UUPA 5JZVA 3RSHA 3IA2A 2VTKA 4BMCA 2ZIAA 2FN7A 2OV6A 1B0AA 2MIIA 5JPCA 4K6HA 3I4FA 2OCKA 2YZMA 2XDQB 4B8YA 5CB6A 3GUYA 2V6MA 2ZBPA 4I50F 4R0VA 1KOLA 4CKCA 4U7JA 2PCLA 3KYDB 3WK7A 5MN4A 4HEJA 2UYYA 1GFIA 4KPUB 2IKSA 2ODEA 1WW2A 1SXIA 2D1QA 3QI7A 1Y80A 5JCOA 1PFGA 3WIVA 1BDHA 5COBA 1SUAA 2XKBA 3BMCB 2WICA 3QE3A 2I99A 3TE7A 4DDVA 5KWSA 1TD9A 1U28C 1VJGA 2QV7A 4ZCIA 5LMZA 1HFKA 3AVVA 3OJWA 1QYIA 2NM0A 4HWRA 2HSEA 4BLRA 1M1YE 3ZWVA 2MSNA 3FDXA 3RC7A 3T5DA 4YDQA 3TYXA 4ZO9A 1CUUA 5CB4B 2NZXA 2OOSA 3AT1A 3E6AA 3HY3A 4MZXA 4XYLA 4A82A 4FFVA 1SKAA 1TXGA 4UBOA 3BGIA 2VO1A 1Y5RA 1VP3A 2V7VA 3ND9A 4CMKA 2L2QA 4WY2A 2BCGY 3WDSA 3SLGA 1H2EA 3X2SA 1JV2B 3A6FA 2FXIA 4WKNA 4QGFA 5FPQA 3LYAA 1SU7A 4IV8A 5HWSA 1JFTA 2WKSA 2F1RA 1TA4A 4N82A 4OHVA 2KS6A 4GUDA 3UA4A 4YDSA 5JSHA 2Y1FA 4FUQA 2NPOA 1SELA 4QEKA 4AM8A 1SHLA 2BE9A 2V7QD 4A0FA 1LI5A 4KPFC 3KZXA 1P4GA 4LV5B 4QPZA 3GARA 5TNXA 3UYLA 4PLTA 1W88A 2YRWA 5BQ5A 1N9GA 1J00A 1ID1A 2XZPA 5K9ZA 4B84A 3NLLA 1L3BA 1N32B 1SHZA 4OQZA 1DU4A 2OG2A 1RWNA 2WM2A 3U39A 4Z49A 1XDUA 5LOVF 1COZA 1EH5A 2D62A 1Q44A 3B9QA 3R24A 4WZAE 4CQMB 1XMXA 1NDQA 2RGRA 1HI9A 2AFIE 3DV2A 5FTJA 3N2ZB 4MV1A 1GPH1 1XVUA 4W7HA 4MQ5A 5JMOA 2VLBA 1UPFA 1JQAA 1LJUA 3RRYA 1E59A 4UAJA 4S1OA 3TFWA 4DEXA 3CVWA 4DYHA 4BQIA 4GICA 4JENA 3B52X 3EAFA 2VHTA 3ZUPA 4D81A 2ZE5A 2QTVA 1GXSA 4GPD1 5AHOA 5TF0A 5T4HA 3A1VA 2GCNA 1BCRB 1SXJC 2HK9A 4OJYA 2JL1A 4M89A 3WLRA 3N70A 1F3LA 4EVQA 5I7EA 3H99A 4C1NA 1JX6A 5TT1A 2H17A 2PZLA 3W6OA 2SECE 1GG9A 1SR8A 2QSZA 3OQMA 3P2JA 1HEYA 1OKKA 1UT8A 4EY3A 1K7XB 2VK4A 2EQBA 1NT4A 2Z0MA 1F20A 2IHTA 2PZGA 2GN8A 2GSDA 4MI9A 4KH0A 3DO8A 5HKBA 1G3UA 1VBNA 3CO5A 4XVCA 4U8HA 4G3XA 1FFWA 1ZH8A 1WKCA 1AUQA 1NATA 4LOKA 2Z5FA 2V7QA 4XJVA 2Z1MA 4WXPA 3M89A 2C29D 1W4CA 3OX4A 3K0EA 3UJ6A 2ZIFA 1J2EA 1X6VA 2FPIA 3D7SA 5FHQA 4ARZB 4EDFA 3C3WA 3QUAA 5IVDA 4MS3A 2H5LA 2ZRKA 2ZROA 3H2HA 3EOBI 3VTFA 1JR2A 4CDMA 2XWBF 4BCBA 5IT0A 4KUGA 3Q2OA 3WA7A 1P1FA 2OBBA 1GAQA 4MUXA 1U9IA 1IPHA 2Q6VA 3H8JA 1RZRA 2JIDA 4WOJA 3KCQA 1N0IA 1N2ZA 2VHUA 5JARA 7MHTA 5BMVB 4H16A 1CQIB 3RYHB 5CFQA 4Z9FA 2AN4A 3HCBA 4TGLA 1NBWB 2QX7A 4R1OA 2ZUSA 2F8TA 1UK9A 4WZ6A 1WZIA 2P9BA 2O0MA 3LUBA 2CNKA 3SQWA 1WU8A 1N2SA 2IHBA 1LTQA 221PA 4MRNA 4LRWA 4NJMA 1RP7A 1L7MA 1QIGA 3SSMA 4DAEA 3AP2A 3EQ2A 5JLAA 5BWNA 3K5PA 3BH0A 4PLCA 5DVZA 1SD2A 3O26A 1U3UA 1C0PA 2OEPA 5KYGA 3PKIA 4U2FA 2VAXA 4Z0TA 1WR8A 1Y9AA 5TPWB 2D0OB 1FZTA 5JAZA 1M2OB 3PP8A 3RGGA 4F2PA 1E0SA 5DLQC 2PRYA 1Q0LA 1S4QA 2W11A 1Z75A 4ZIRB 4FW9A 4ASUD 1ULBA 3MK31 5KI6A 1UKVY 4MGZR 3N75A 3HDGA 1D5CA 4PV7A 2PVSA 3JZDA 3DAOA 3LX8A 2ZWVA 1NQXA 1W2GA 1YZHA 2G5TA 5TXGA 3ZVRA 1EVJA 3ZDAA 2W6MA 3DG9A 1ADYA 4J7AA 4KG7A 3I2JA 3QSGA 2O8EB 3IOMA 3VPCA 4DRYA 3OCVA 1FDUA 1TAHA 1E3JA 4AROA 1T43A 1DUVG 4YREA 2O2HA 3WE7A 1QIMA 2CYCA 3NVKI 2ZFUA 3E0QA 4IAOA 3T54A 4KXVA 4ZRMA 3STWA 4DLVA 2GJ4A 5KJEA 3KETA 2NV6A 1RHKA 4MJLA 1ORIA 2EEZA 2ZCVA 4PU0A 3H1BA 3LO8A 5FNVB 2QTZA 5JCZA 3RWOA 4PFJA 1Q92A 4GVLA 3ZHQA 2AG1A 4L9RA 2WR8A 3RAEC 4GU5A 2WJWA 4IY1A 1M5RA 4X7RA 3WMGA 1IN1A 1JG3A 1ZW1A 2Z56A 1A3CA 5DT2A 3DPIA 3IHKA 4DCJA 2WMYA 2ZRPA 1CUIA 3GFSA 4NJOA 4QXRA 4CNQA 2NZWA 3CRZA 2B98A 1GKLA 3FDFA 4MPPA 4EB0A 1IBLB 1YAHA 4JXZA 1QGUB 2J0UB 3O75A 3O9ZA 3EF1A 1OH7A 1O5IA 1FDSA 4JB2A 4LZAA 1O8BA 1R10A 3MGAA 3HY6A 4JEUA 3SMVA 1G6KA 1BRMA 1JZTA 1VMKA 2PGIA 3WWOA 4UQLA 3CPEA 4IPTA 4CKZA 1O97C 2ONKA 5K51A 3CLRD 2Z4SA 1EFAA 1JHRA 2RFLA 2VAWA 3AEKA 2OXIA 5JNSA 3OECA 4LRUA 4RANA 1NZJA 3RF7A 4DNXA 1PEKE 2VEDA 2KYRA 1MAAA 3CUSA 2AN3A 3GBPA 2YHUA 4K05A 4LHSA 3RVSA 5DASA 5L53A 4YCNA 3KSAC 3I4LA 1IB6A 4HLNA 1EJ0A 4AMZA 5B64A 1TMOA 1DFGA 4H7IA 2Q7OE 4C08A 1XR3A 4EKDA 1JA1A 4XA8A 4YBRA 5LP6B 3TOZA 2JDID 3NTXA 3W34A 1CQZA 5AW8A 3E3OA 2ODNA 1Y8RA 2IW1A 4HH1A 1WY7A 4QGGA 2BH9A 1E58A 2I2XB 4MVJM 4UMFA 4UVDA 3WLQA 2XYPA 2W6JA 5IT9A 2JCGA 4JL5A 4Q3EA 3RYIA 5CLIA 3NBQA 1IZYA 1R6BX 4GR4A 4YCCA 1Z18A 2WFLB 2CBGA 4R16A 4GX2A 5JAOA 2WUWE 1OWOA 3LC7O 1QVVA 5HS6A 3TPCA 1BXRA 1IONA 4ZV7A 1L5HB 4UE2A 3K73O 2BM9A 3WWPA 4XQ9A 4AUKA 2BDEA 1Q57A 3ETGA 1RCFA 4BJ3A 2PFSA 4CLOB 3GP8A 1GGKA 3QWHA 4Q21A 2HF8A 3FHCB 2NWQA 3MFQA 3GRFA 4YMWA 2WC1A 2XXAB 4OQNA 2BBSA 4UNQA 2DEUA 4RF2A 2O07A 2OCLA 4KQMA 4E4YA 2HNKA 3HJAA 3PQ7A 3OJEA 4ZJZA 4JVOA 1I2MA 1Z0FA 4AC9A 3B12A 1CR1A 2VEOA 3NPAA 1VJ1A 1WPXA 4MZDA 3B7GA 1ZWLA 1BU5A 4GOOD 4QPJC 4U2KA 3OJCA 1BMQA 1R6XA 2OR3A 3FDIA 3GCWA 5CITA 2QLJA 4UE3S 5EVCA 4FR5A 2KE5A 3GL9A 4US2R 2YBEA 1J42A 4TLDA 4K6KA 3SYMA 1FLNA 4X1OA 3W9YA 2IPXA 1VM6A 5F4ZA 1NZDA 1OE0A 1UR5A 4RXTA 4BO0A 4COOA 4H27A 3UMRA 3G8BA 4BLTA 1J9GA 1TEXA 1VJTA 4Z4GA 1XRMA 4F4UA 1L5OA 1YRHA 2VKQA 3I01A 4K8RB 4D44A 8OHMA 3L07A 3O4IA 3RVNA 4C0WA 1C3OA 4BASA 1V1RB 1P1CA 4M98A 3W6NA 2XD4A 1JBQA 3M3PA 3W9SA 1RTTA 2RH9B 4OIMA 1XCLA 4UUBA 1B8OA 5IZCA 3I05A 1FX0B 2EP7A 4J1NA 5AVKA 4AY5A 2WU1A 1T15A 1SK9A 1TT5A 1DT3A 2W6QA 4ZODA 1Y1QA 2IUUA 2BGGA 3SQOA 2VP9A 3O4VA 3QU5A 2DU8A 1VRVA 4AX8A 5EIWA 4QOGA 2JLBA 1DX9A 3PDJA 4RY2A 5H82A 4EG5A 5BV8A 1G19A 3SEAA 5CVUA 3I04M 5DYNA 4IXNA 1AF7A 4XDGA 1OXUA 1D2AA 3IIJA 3O3NB 4HYEA 4DLBA 3G49A 1MB0A 1ECGA 2IODA 1PT9A 2HK7A 4H1UA 4JU8A 5HUHA 3P4YA 4WACA 3KK0A 3DTTA 1PJAA 2GASA 4NYJQ 4OHCA 2XJ9A 5G41A 1CDEA 4IKEA 5L7TA 3BYZA 4RWEA 1G38A 4HN9A 2VSFA 3DLIA 4FFDA 2PE5A 5I8PA 2D59A 2VDLB 5JD4A 3R6GA 2P9QA 4G0UA 4DLYA 1ZA2A 3HB5X 3UM9A 2E1PA 1E18A 4IHJF 1VSBA 2FEXA 5FPHA 2XXBA 4IMPA 5JISA 5AI0A 1CY0A 2ATEA 4JSYA 3WR5A 1IM2A 3IMEA 1M0WA 3OD5A 5DCYA 2ZJZA 3V2UA 2A1IA 1E2PA 1TQ8A 2IKQA 4I1SA 4XR9A 1YVUA 1SVUA 3GLHB 4E1AA 1V25A 5DDIP 3H11B 3CU5A 1WPQA 1MX9A 2Q4EA 3K32A 4HNAB 2HQOA 1NXVA 4BLUA 5CG2A 5C4MA 4NSNA 1QYWA 2CUTA 4WLVA 1RD4A 3UB3A 6REQB 1Q22A 1V0JA 3C45A 3L7LA 4MGIR 5E4TA 5FOXA 2BMJA 4HAVA 4ZDIA 5JANA 5KOYA 3GPCA 2YIVX 5JAPA 3Q7IA 2B0CA 4RFVA 3RS4A 2WIKA 1EDZA 3K6JA 2PS1A 3IVCA 3RAGA 5IK2A 3S29A 3WJ2A 1GQOA 2O06A 5AQ1A 1HY3A 2GK4A 1CT9A 3IMCA 4PO9A 3NM4A 5IYZA 2C4UA 2PSFA 1DJNA 3X3HA 1GIAA 1RE1A 3R41A 4I4IA 5KINB 3KB2A 2VXYA 1JEQA 4X00A 3VTAA 2I2DA 5DO9A 2JRCA 4U5XA 2XMZA 5AK3A 1E5DA 5B1SA 4YJGB 4M0FA 4Q0MA 4OREX 3ASUA 4BOYA 4D5GA 1JJBA 3WRYC 4MV5A 1KQOA 5EUCA 1EFUA 5CEEA 1JDTA 1P2TA 3JQAA 2AEEA 1E1DA 3BRWD 4R41A 1VLHA 2WDPA 4LIPD 2AH5A 3IS3A 3BGOS 1SC9A 5B3JC 4CEJA 2VF8A 4RA6A 3T35A 3OLXA 1G291 2AW5A 1G8HA 1R4ZA 2AT1A 4BLSA 3V9PA 2FUG6 2DWQA 1T26A 1WF3A 2DKOA 1WE2A 3O6VA 2B9VA 3QZUA 1SD1A 4KGDA 3WMFA 1Z2CA 2IYWA 3IDFA 4HQNA 4LGMA 1MMFB 3CEAA 2FB9A 2GX6A 2VRBA 1EUDB 4RDCA 4JLMA 3DE6X 2CLCX 1HT0A 1XV5A 1K9VF 1EM8B 1ND6A 1N5LA 4Q4LA 2WJGA 4QVGA 4UD2A 4Q47A 5K99A 2IXBA 2VHCA 4K86A 3GJ8A 4M1ZA 2JKVA 3MN1A 1E1MA 5CDHA 2CXSA 1V96A 4BVEA 2HJRA 4WFJA 2HH9A 3OJLA 4JK3A 4MQMA 4EELA 1SCUA 1PGPA 1LS6A 4J7UA 3N5KA 4J90A 1J8DA 4O4HF 1RAGA 4C4XA 2P6PA 3M3HA 4KN5A 3TOVA 3GVPA 1FJXA 1E92A 5DBIA 3GEMA 3OLQA 5ERGB 4QWWA 2PQ0A 3V4SA 2OC4A 1V95A 4O6VA 2C4NA 4W5HA 4RTPA 2GF0A 3IKMB 4I2VA 4BX2A 2A57A 2ECKA 1P6UA 2ZE8A 1M5TA 3CJRA 3PQ5A 1LW7A 4UEOA 3WLFA 1TZ2A 3M2TA 2QVXX 2TMYA 3NIFB 3JATA 3EDQA 3FZEA 4UD6A 3SIXA 1PFVA 4IQ4A 1G9SA 4XGRA 1FTSA 2P3SA 4XLLA 5JROA 4H6XA 4O0LA 4FMCB 4RAQA 1QIKA 2ZB2A 1ZH4A 1ZOIA 3S8EA 4N48A 3N39C 1ISMA 1Q3KA 1OILA 1T8SA 3PXCX 4I1VA 1CF4A 1MB3A 4O8ZA 4G0NA 4HQOA 1X70A 3U0BA 3QRWA 3ZXXA 4TKUB 5CJ2A 4G0WA 3H2BA 2EJTA 1ZGGA 4JWTA 4GMXA 2B34A 5LLSA 4KO8A 3G3EA 1U2QA 1PVDA 1SZDA 2PX5A 2PZJA 3C3JA 2WF8A 3OIUA 1YHNA 3NIGB 3E27A 4RVUA 4BE4A 4XOIA 5K01A 3AL3A 3ZLBA 2QLBA 4GMHA 4F8EA 4DKXA 1A9PA 2AE1A 5LQUA 3GLGB 1PK9A 3A9VA 3SSNA 2RGBA 4YRGA 1KJ8A 1XZLA 2V0GA 1P29A 3CKMA 1F4PA 4EUKA 2ECOA 2YQZA 3AFNA 1Q0SA 1PUIA 1UBTS 3OQNA 5CT8A 1DKQA 3CZ4A 2FRXA 2N9UA 1QDLB 5AHXA 1QUEA 2XZDA 4KPEC 3P0EA 5J63A 1NLUA 2N75A 1KYZA 1SUEA 5CT6A 1A8QA 4QARA 1N4AA 3VX3A 3K0AA 3QX8A 4H08A 3R4VA 1AMNA 3NALA 3STXA 3OMXA 4G0PA 4K6GA 4YQZA 3DQQA 4ZKEA 2GEBA 3ZWYA 5DM60 1K63A 1E6CA 3L84A 3ASZA 4K1LA 1J2UA 4BNKA 3OZRA 1E4VA 1N3BA 4ZT2A 2QGZA 2V7UA 3FTQA 4PYKA 4C4RA 4MHOA 4EF4A 5LL6P 3HJRA 4ALIA 4P1ZA 2QYTA 2BTOA 4R0NA 2QMZA 4QM7A 1KU0A 2Z3WA 4EUFA 5KCMA 4WBXC 2H08A 3OOHA 3OO0A 4M1SA 3DXFA 4M6WB 4AS2A 1JH8A 1H6AA 2BHSA 3H65A 3JYPA 3OEEA 3SP1A 3FGOA 2Z2JA 5I8ZA 1E2FA 3WOHA 4FZ5A 2BCEA 4XQCA 3DLAA 4RHEA 3WJAA 2CXTA 4XD7D 4NENA 2G5PA 4L4SA 4RFSB 2V3CC 2EF1A 4UHJA 9ATCA 3VU0A 2JLRA 1Q0UA 4TVKA 2GF9A 4RZUA 3QA3E 2VUSA 3NCHA 3NIWA 3AEQB 4X20B 3N2LA 3J7TA 3KAKA 1TM2A 4JLNA 4XJXA 4JJIA 4EFLA 5IJ0A 1BJKA 2YTZA 4ZTZB 3STTA 1U3FA 1WL8A 3IAFA 4Q16A 1RADA 4WAUA 4R84A 4CV1A 1G8AA 4EW3A 2L69A 1BH2A 2E0IA 2H4HA 3RYFA 5FDFA 2I4MA 5FTMA 1M7GA 2VNKA 1P4RA 2W2PA 1AKEA 3QQ5A 2CFCA 2G1UA 2HBZA 4RGVA 5BSRA 2IEDA 3FLEA 1M34A 3A2KA 5T7BA 4QZVA 4U6NA 4V0NA 1U4SA 3O8NA 4AT1A 4Y6SA 2FSUA 3SFZA 1LDGA 3BCRA 4C9BA 4CI0B 5BORA 1YZFA 5HSGA 1UFKA 1M2KA 4AKIA 1K5HA 1E2DA 1PG0A 2OLEA 4MUIA 5AKYA 3WZ2A 3W5IA 1XDSA 3OKFA 2PUCA 3E7WA 3P9PA 3S55A 3VDXA 3RRBA 1RQLA 1N3LA 3TTXA 4B9AA 5KVVA 1TPZA 2G4LA 3AERB 1PT8A 5JJBA 3DPUA 4ND1A 5DNDA 3ZCQA 3SI7A 2LIVA 4I81A 4EPYA 1KNQA 4FYJA 3TLKA 2EG9A 3ZWQA 2CD7A 1JYFA 2C2GA 3WMRA 4GW3A 3QLUA 4P22A 2P3QA 1PI3A 2BTQA 4HHEA 1SG0A 1T3SA 1C3VA 1FRZA 1GPBA 1C7JA 2VBCA 1QH9A 4G23A 4JITA 5DHUA 1U8ZA 5AQEA 4I3HA 4CKWB 4RF5A 2DH6A 4DARA 1EFKA 3EWIA 4MW9A 1VCOA 4JLVA 4V0QA 4JMPA 4F60A 2ZYSA 3HSSA 2INGX 3OIDA 2ZPUA 4BHTA 2G4CA 2DKFA 2FP4A 2HSGA 4V0ME 2XA2A 3EY9A 5AKXA 1UBLS 3WRXC 3T9AA 3D4NA 4H4EA 1PEDA 4NKRA 4IQFA 2ES4A 2BDTA 5JIBA 2ZW9A 1OT3A 3COYA 3NKLA 2HM7A 1GGNA 3GQBB 4ONEA 1QTRA 1T9CA 2LDXA 5BUQA 3B3FA 4HDMB 2ZZNA 1ZRSA 4X24A 4F0JA 4DNOA 3VOTA 3VR4H 1EJBA 2FEOA 1AMUA 4FWTA 3EQ8A 4BLWA 4BWGA 1JAZA 2O8BB 4IFTA 5NULA 1K08A 1XSEA 2H4WA 2FWMX 3W5JA 2KM1A 4G5FA 5TSDA 5I3ZA 3AI7A 4JJZA 4AICA 4BPBA 2QX8A 4L3WA 1E60A 1R4MB 1A2QA 4IIDA 4FFMA 5FEUA 4OMDA 3TJZA 4DJDC 2WPDA 1XMIA 1EGHA 2B99A 1GNTA 2OGWA 121PA 1VIAA 1RMYA 4MIEA 4PRKA 1PUXA 3W1EA 3JYNA 1ZX1A 4ZDWA 3U56A 3R77A 1PQWA 1MO6A 1LLCA 1SXJD 1QAMA 1D2NA 1SH7A 4FONA 3U4QB 4OQPA 4RK0A 4FNOA 1H4QA 4XQEA 4N8DA 1FPMA 2Q2VA 5AKZA 4C7XA 5BWBA 3LPLA 1B4DA 1U0SY 2HF2A 4DZTA 5MHTA 2BUBA 3ZCSA 4Q66C 4TS1A 1IXRC 4WXYB 4NBLA 3P32A 3W05A 2R6DA 3R5FA 1AS2A 3ERCA 2IP1A 2QIPA 3BB4A 1RFLA 2ZI9A 5A5FA 5SYMA 1YBFA 3JALA 4MVJH 4Y1RB 5LR6A 5JSQA 1AD2A 3MLAA 4KP7A 2DPHA 5J5AA 3G0BA 5JNLA 4YROA 4AS1A 1R8YA 3KJEA 1W1WA 1YGYA 2NT4A 1F60A 2I6TA 1UMCA 3V00A 1DWQA 5DWQA 5B7QA 2JC3A 1UPUA 2WJ4A 3IP1A 1I5OA 1VG9B 2ZWPA 2R8RA 3PJRA 2QZ9A 1ILEA 2JCYA 2XTMA 2JEOA 3WKDA 1C1HA 4KACA 4ZANA 4AY3A 3NWBA 3UO8B 4E3WA 1K27A 4EGJA 5I48A 3B8HA 1OXKB 2I4OA 1SCJA 2YW9A 1KKUA 3IQGX 3P2OA 4LI3X 1RRCA 3CMMA 2CHFA 4ZC1A 4KO2S 3KO8A 1N0VC 4P0QB 4LJYA 2IUSA 1M6NA 4MP3A 1ZG3A 3ITEA 3VC1A 1VCIA 4Y2HA 4U7TB 5HP4A 1F2TB 2D6FA 1J0CA 3F9IA 3LHDA 5D2CA 3B6EA 3RC1A 4PN7A 3DF9A 4B48A 3UMCA 1D0IA 2Q07A 3FOZA 1WXGA 3AB8A 3GLSA 3P5SA 4MVJF 2BZ1A 3IO3A 1KMMA 1ZL0A 2E48A 5CVEA 1HKUA 4CF6A 3EUAA 4DJAA 3V1UA 3BZUA 1FFXA 3IUYA 2GT1A 3SZOA 2M1XA 2JLVA 3VZRA 3OT5A 1LLDA 4CCSA 1WXEA 4FMDB 4M37A 4EAAA 4OB6A 3ISJA 3GNLA 2BOVA 4ZOEA 4BQFA 1WM1A 4KXMA 4YRNA 1IH8A 3ZE7A 4FFBA 3TVTA 4DLKA 4O4JF 2P91A 4LVOA 1I0IA 1LWNA 1EBFA 3K5IA 3GI1A 6GPBA 2P4EA 2NXCA 2WJAA 1FOEB 3FHJA 4HUQB 1KJWA 3EMKA 3F8TA 3I9MA 2A0XA 1ZINA 4XEUA 1ISSA 2LD4A 4HXFB 4NNOA 5HVNA 4LSZA 3IPCA 4RDIA 1YRAA 1WB9A 4XVHA 4ZYTA 4G9GA 1EFRD 2F1IA 3WLSA 3D0RA 4D4MA 5FAKA 1V6AA 4L4RA 4UJ5A 5KDOA 1AKUA 3ADKA 2L19A 1CXZA 1HF3A 4F2DA 3OUZA 3VKWA 4WZBA 2AUMA 3GJ5A 2CCGA 2W43A 4Y6PA 2D8AA 4J16C 4LXHA 2GHQA 3R6WA 4C88A 3ED1A 4UHEA 1QGOA 3A8TA 3TZ6A 4LAFA 3PD0A 1QNFA 4OAPA 1QHYA 3S2ZA 5IHPA 1O6GA 1PL8A 1UQRA 5IVHA 4K9SA 4Y6QA 3AC0A 1IEWA 1YQDA 1O96B 3IESA 3NX4A 4B3BA 5ALHA 1KYYA 5JRDS 1VYTA 1XNRB 5CFRA 1W9MA 3P27A 4MP6A 1CQPA 4I9HA 1GZ7A 4ND5A 1FLDA 4QDZA 4KAAA 5EP1A 3EX7C 3ZU3A 1OSNA 2XMCA 3VR6D 2PXCA 3E8MA 4RIEA 3O4GA 2H1FA 4J1TC 2YRFA 1QBGA 3WQQA 4C0JA 1IY2A 1JN0A 1XTPA 5L3ZA 4IVPA 2HCRA 1K89A 3GXOA 2EJCA 1F0NA 4JHLA 1SOWA 3LQ1A 5IFLA 2ZS9A 2A0KA 3IDAA 5JW6A 1XZAA 2XHZA 3F7TA 5CFMA 1CZLA 2Z83A 4U7FA 4KBGA 4NZMA 3NXSA 4I1RA 3FBTA 4CDRA 3P0RA 5H4HA 1T4BA 3ZBUA 3FE2A 3DNPA 1QWSA 3L7YA 1AKNA 1Y1LA 1SJ9A 2VK8A 3W8EA 2I9KA 4C4TA 2YJTD 4LPKA 1LDEA 3VDQA 3WXMA 4WCVA 1L4YA 1NXOA 2GZRA 2OVBA 4HGPA 5DLYA 4M9XA 1ZN2A 4A6PA 1UBKS 1GEGA 1ZVVA 3DZCA 2O1SA 2RHLA 3AGQA 3GG9A 8ADHA 4Y2XA 5DEOA 1ZIOA 4EYGA 2FHSA 4FNMA 4CGYA 2E4VA 2O7QA 4XUEA 3G23A 5BMVF 1E6UA 5BRAA 3PUKA 1MJNA 3FFWA 3L92A 2I6GA 2VDNB 4E22A 4FFLA 4BN0A 4W9RA 1TCVA 4GP7A 2UVPB 4DLZA 4OH7A 4ALMA 3KOUA 3OZUA 4FCTA 3OZIA 2VAVA 4MWDA 4N8SA 2WE7A 1FDWA 5D00A 2EL9A 4KSYA 1CR6A 1F2UA 1OBVA 3LYLA 3N8GA 1ESMA 3TOXA 3V5NA 1KERA 3LGAA 3MOGA 2F17A 4YRIA 5JXHA 2I4TA 1EUCB 1E8DA 3LT2A 4I55B 2P1ZA 3IKVA 2YN0A 1HTBA 3EVTA 2BMDA 3IAEA 4ENUA 1U3DA 1QJCA 2VA9A 4TSFD 1CRWG 2XQIA 1KDZA 2NSYA 2JCXA 3HPRA 1RMQA 3AY7A 3BWYA 4I36A 4NECA 2IBSA 1CF9A 2R7LA 4BU1A 5ADVA 1PO7A 1RHMA 1NVMB 3C3MA 1MEOA 1DAEA 3A1CA 6AT1A 1A97A 1DBRA 1OU0A 2QVLA 2Y1XA 4RHYA 4Y67A 1CUWA 4US0R 4WTOA 4ER6A 1Z4QA 4WZAB 4RMNA 2M6LA 2NUPB 1TW3A 1EAMA 5AJYA 2HA7A 3RV3A 4Z51A 1GPLA 4RL4A 1A98A 1N8TA 1QOZA 1UP7A 2QN6A 2IK8A 2WWRA 2Y2UA 4GNRA 4X5OA 5TR9A 4KLZA 4MPTA 3AUKA 1EZZA 1DV1A 4QT4A 5JZMA 1IG0A 2Y0CA 3Q9LA 5K6RA 1PNRA 2QVYX 2EFYA 3RFUA 3ZWPA 4J0JA 1XLVA 2ISSD 3O3OB 2B82A 4GP6A 4MKXA 3N58A 1NVVR 2WWTA 2VDWA 1U7ZA 3OP1A 4E4TA 5HFAA 2HO5A 5CNIA 1PBTA 4TZKA 2CVQA 3QKWA 4JFRA 4MYTA 3VPSA 2WM8A 3CG4A 4AU1A 5C8VA 3O9VA 5HKKA 3E2PA 3IALA 2C97A 3L7AA 3JZMA 1E7MA 1COWD 4GZ3A 1TJNA 2LGJA 3HKDA 4GFDA 1ZMTA 3OPQA 3P96A 3PYXA 1BTOA 3JRWA 3P2MA 3U62A 3WYDA 3OT1B 5FQOA 3U60B 3ZVNA 3THWA 1QMGA 1M0SA 3CR8A 5I8WA 3ET5A 3H6KA 1I0ZA 1V41E 3G6WA 2IIBA 3WLJA 4IIXA 3BGDA 3JWHA 5AW9A 3M6IA 4YMHA 3T38A 4CUZA 1KIMA 4P5EA 1Q2XA 1HTWA 2YL2A 4WKGA 4JC8A 4IDNA 5LN1A 4PPNA 1PX0A 5KHOC 3EVBA 5ENDA 1N1EA 3SMQA 4NG4A 3QH4A 1NONA 1J0AA 3GLTA 3IB3A 3PEVA 4OHFA 2R1UA 4YTEA 1A71A 1IM8A 1EU1A 2BEVB 2G7ZA 1RC0A 4RCYA 5A5GA 5JEDA 4UMDA 2X6QA 2RHBA 3L4BC 1Z74A 1OR8A 3N59A 4JYBA 4M9RA 4YJ3B 5E9QA 3E48A 4NXMB 2WAOA 3BXHA 5KO2A 4DRXA 4GEGA 1PR4A 2RHHA 4B32A 2OO5A 2H2WA 2PUAA 4EGSA 1MC5A 4FZJA 5HRUA 1JDSA 1JHDA 1U3WA 2GNPA 3F3KA 3JPWA 1ZESA 4GVPA 3KBOA 3F6SA 4WK2B 3QKSB 1D6SA 2QPTA 4IOKA 3WMEA 4QUEA 2PQ2A 3NHBA 5TB5A 5G0TA 1YRWA 2P9CA 2UVQA 2XR1A 5FBKA 1AQLA 3KPUA 2QUHA 1EA5A 4B4KA 2MCFA 1DTWB 3UKDA 1ZHFA 3JQDA 3VAYA 4EI8A 1KMHB 1XDBA 3N6XA 1Z13A 1V26A 4MAFA 3R0IA 5AI5A 2DQSA 5AXAA 4LYJA 1KVUA 3D3KA 3Q3VA 4XYBA 4UBJA 3ZNOA 1LFAA 3NDIA 3SIRA 1MH9A 2BFAA 2ZYHA 1KI9A 2ABWA 2ST1A 1EK1A 1JQKA 3HDYA 4DJFC 5CH3A 1NNSA 5F7JA 1JBKA 3TAHA 3UJCA 4AJ2A 2PKRA 2PWBA 1TF5A 2Q1SA 2JJQA 2XIQA 3A1NA 2YZNA 1ZM7A 2H85A 3HYCA 4HD8A 5IYZF 3QLEA 3RUFA 4M3NA 3UF0A 4DSOA 4ETWA 2AJLI 2ODQA 4KFSA 5H02A 3BAZA 4ZOBA 3OE1A 1YF3A 1IRIA 2PBRA 2VS1A 5F9MA 2AZTA 1I3OA 1NT2A 1S01A 3VYSB 3O7MA 4ND6A 4FYXA 5AJXA 1NOKA 3EJ6A 5HEKA 1G3MA 1U0RA 2JBWA 2UYQA 1N3IA 3DT8A 5EERA 3PSHA 1TAGA 5J1SB 1VI6A 3D3JA 3PQ2A 5IDQA 2H3EA 1J70A 1ZRHA 3COJA 3W4KA 2Q6TA 2IEIA 1K86A 2QA5A 2QOEA 4D4KA 1CD5A 1JS1X 2YDXA 2EP5A 4Z3OA 3FR8A 3Q1KA 4RVHA 1G64A 2VP5A 4N7JA 1H22A 3DHYA 3IP9A 1V7QA 2Y68A 2ZSHA 3STHA 3U3DA 4QQ8A 2ORVA 1E79A 3DE0X 5U9CA 3ZIDA 1PRYA 4ZMBA 2QU7A 1TYCA 2IZZA 4HG2A 4WN3A 1PN3A 4ZVNA 4YRJA 3RYTC 4GXRA 1KS2A 4GPZA 4CMEC 3G9TA 3U44B 2G1JA 4D9IA 1QH8B 4XWAA 1PNTA 4UHDA 5CLLA 5T8KA 4YCBA 4FDTA 5J1TB 1E3WB 1YJAA 2RGGA 4H1WA 5SZJA 4MOWA 2WVAA 3NVDA 3PWSA 4LF9B 2J48A 1BW9A 4G8JA 4FE7A 4NCKA 3COPA 2V7BA 3B13B 3EJWA 2HR1A 2FEWB 4YR7A 2H57A 1T9AA 1YMQA 4P4LA 4QOJA 1QRSA 3Q72A 1XCPA 2I33A 3FYDA 4DV3B 2ZTSA 5DTEA 1OI4A 1CJBA 1DXQA 3DZHA