6LDHA

Refined crystal structure of dogfish m4 apo-lactate dehydrogenase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
329
structure length
329
Chain Sequence
ATLKDKLIGHLATSQEPRSYNKITVVGVGAVGMACAISILMKDLADEVALVDVMEDKLKGEMMDLQHGSLFLHTAKIVSGKDYSVSAGSKLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKHSPDCIILVVSNPVDVLTYVAWKLSGLPMHRIIGSGCNLDSARFRYLMGERLGVHSCSCHGWVIGEHGDSVPSVWSGMNVASIKLHPLDGTNKDKQDWKKLHKDVVDSAYEVIKLKGYTSWAIGLSVADLAETIMKNLCRVHPVSTMVKDFYGIKDNVFLSLPCVLNDHGISNIVKMKLKPNEEQQLQKSATTLWDIQKDLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase(choh(d)-nad(a))
molecule keywords M4 APO-LACTATE DEHYDROGENASE
publication title Refined crystal structure of dogfish M4 apo-lactate dehydrogenase.
pubmed doi rcsb
source organism Squalus acanthias
total genus 100
structure length 329
sequence length 329
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1987-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 6ldhA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 6ldhA02
4WCDA 4RQTA 3ZU3A 3ZCXA 1BXGA 2DBRA 2Z1NA 4CODB 4RVDA 4JBGA 1MFZA 1KVQA 1GYQA 1RM4A 4JX8A 3AY6A 2XXBA 2X23A 3OH8A 3F5QA 4BO1A 1DLIA 3HQ4O 3TRIA 4HKTA 4O1MA 3OMLA 1VPDA 4U0JA 1LRJA 3S55A 2PTGA 4OQYA 1WZEA 1BWSA 1ENZA 2R6JA 1ENOA 4BB6A 1LLDA 3PYXA 5ER9A 1NR1A 1ZFNA 2IZZA 3AUSA 3QWBA 2XAAA 4IDFA 1R12A 2R00C 2WYVA 1H93A 1GQ2A 4YBZA 5L51A 2JKVA 1Q0HA 3K73O 2JFHA 5A9SA 5DCWA 1U9JA 2LDBA 3LU1A 1E7MA 5TJHA 1FDSA 2OOSA 5DBGA 1A4IA 2PV7A 4DWVA 4CMEA 3U3XA 4CM7A 4CV3A 4BL5A 4GPD1 4XGNA 5JMWA 2X7HA 4B79A 5ES3A 4GVXA 3INRA 3GUYA 4BO0A 2HMTA 1JA9A 4ZQHA 1H6AA 3WQRA 1LJ8A 1VM6A 5IFLA 1DXYA 3OF2A 1DHTA 2ET6A 2I66A 5HA5A 1HRDA 2BGMA 1JKJA 4XB2A 1NBOA 2W2KB 1O9BA 5B1YA 4CQMA 5DOVA 3G49A 3GZNB 1HDOA 2EJWA 4BMNA 4GLLA 4IQ0A 1P3DA 3FR8A 4J1QA 3RCBA 3UW3A 3VKUA 3WQQA 4DLLA 2CD9A 3NJ8A 5BSHA 3DZJA 1LDYA 3GGPA 3EVNA 3EYWA 1QXSA 2B83A 3FR7A 3ZNPA 3I4CA 3KEQA 3VZSA 5KJEA 3ABIA 3TZKA 3U49A 1O6ZA 1SEPA 3KEOA 3GDOA 4CQLA 3H8VA 3W8EA 3GPDG 3GNSA 3DOCA 2Q4BA 4U5QA 2OP0A 1IZ9A 4CLEA 1XIVA 3IAHA 3LF2A 3I83A 4Z9YA 4IJKA 1WLYA 4MO2A 1NQAO 2AQ8A 4XYBA 1KEUA 3H7AA 4M1QA 1HDZA 2ZB8A 4N18A 1E7RA 1H94A 3M1AA 4P4NA 1HE4A 4KUHA 3BXXA 3C85A 1VJ0A 2A92A 4K1LA 3BMNB 1U8FO 5I7VA 2O3JA 3CPSA 3H5AA 3L9WA 5DNAA 2CY0A 2PKQO 4OAQA 2H1SA 1IHXA 1NVGA 3ZV4A 2NQTA 2VYNA 1RYEA 3GK3A 4QSMA 5TNXA 4GWGA 1PJSA 4TQGA 4RPJA 1LC3A 1XEAA 1P1HA 1HKUA 1PJTA 4R41A 1GPDG 4XQEA 1J4AA 4JJGA 1XYGA 5JO9A 1C0KA 5KKAA 5IN4A 1YH3A 2O50A 1K5HA 1YGYA 2NTJA 3O8QA 4W82A 3RASA 4Y9DA 1XGKA 4PG5A 4OYRA 3ICPA 4K28A 1BG6A 2OHXA 2D2IA 2GN8A 3PIIA 2V65A 4QT0A 1OFGA 4GSLA 1QP8A 3VH2A 1M75A 2JFFA 4I5EA 5A9TA 3GGGA 3DAPA 2IZ1A 2DPHA 4CUJA 1YQXA 3JCZA 2OBNA 1C0PA 1NQOA 1ORRA 4E2YA 5L45A 8LDHA 4JBHA 3WNQA 3PQEA 3WYEA 4BGIA 3B6ZA 1R6DA 3L9XA 4ND2A 3K6JA 1LXCA 4WE3A 4IZIA 4J49A 3KUXA 3T7CA 4AJ2A 4CM8A 1B8UA 4YRAA 1SAYA 3W1VA 4EJ0A 2FPGA 4MVJF 5EQFA 2DT5A 3V8BA 3AM4A 4FOOA 3ROMA 4TZKA 1Y5MA 3OP4A 3FN4A 3SEFA 1GADO 4ZJUA 4R1UA 4R3WA 2AQKA 4NHEA 1DFGA 3ZWXA 2DBQA 2RH8A 4XB1A 5JYEA 1WMBA 1YE3A 1T4BA 2B37A 1L1FA 2EF1A 2O3RA 3V2GA 5FEUA 4BHTA 1KETA 2H5LA 1EE2A 2HLPA 2NVWA 1NASA 2X5JO 5A05A 3HNPA 1I3KA 1F8FA 3KYCA 3HZZA 2NVUB 4DQXA 2E48A 3BAZA 5F1PA 3IJRA 5T5QA 2Y68A 3GH3A 1HZZA 3JQAB 2RBEA 3GG9A 4URFA 4OM8A 1WNTA 1P33A 1LSSA 4BS9A 3UHAA 1B26A 1DAPA 2HU2A 5IDYA 3H3JA 1TI7A 4R51A 4A2CA 2J6IA 2GPTA 2TMGA 1ISJA 3WGOA 1LTHR 3H9GA 1N2SA 3U0BA 3ZZNA 3DMYA 4IMRA 4CLXA 1IHYA 1KY4A 1OC4A 2EP5A 1E6WA 1EBFA 2HKIA 2JCVA 2ZYAA 3ONFA 3TN7A 2VQ3A 3A28A 3N58A 4EJ6A 3OBBA 3ZV5A 3GDFA 1JW9B 4NBTA 1HDRA 1Y7TA 3GF4A 3GGOA 3F6YA 1KC1A 2D5CA 4AJ1A 3TQHA 1B0AA 5BSGA 3KV3O 2ZJ1A 5IZCA 4GH5A 4DL9A 1JDJA 2J8ZA 3H2SA 3ZDFA 1B7GO 3GY0A 1Q7GA 4XR4A 5L7WA 4JN6B 4U0KA 1E6UA 4L74A 3DBLA 1C0IA 2Y93A 1PL8A 5TF4A 1RM5A 3F4BA 3FWNA 3JYPA 2O3UA 3RC1A 4S3MA 1WZIA 3GEGA 3GEDA 5F1KA 4NBRA 4WKGA 3PLNA 2R2GA 4GAEA 3WGZA 1MUUA 2A35A 4CV2A 5TT1A 1QYVA 2PD6A 3MOGA 1UP6A 3VH1A 1IL0A 4ZRMA 4DGSA 2J5RA 4QXMA 4AL4A 3PP8A 4HUJA 1N1EA 1UXIA 4XDZA 4CM4B 2D8AA 3SJUA 2QG4A 1D1TA 4BNLA 1S7CA 1E6EA 5JDCC 3KB6A 3E03A 5COQA 1R4NB 3JQAD 3F1LA 1B2LA 4GX0A 4KWIA 1OOEA 4Q3BA 1ZUD1 1LDGA 1ZJYA 4N5NA 1JAYA 1HT0A 1QYDA 3E6AA 2O3TA 4IDEA 5T6BA 1KYQA 5JAIA 3W4JA 2P4QA 1MXHA 4LK3A 2UUPA 2NUAA 2Y0DA 4YA6A 3GC6A 5G0WA 1UZLA 1PIWA 3WJ7A 3IMFA 4Z3DA 1TT5A 5B4VA 1HDCA 5GZ3A 2BKAA 3A1NA 5F1OA 1JN0A 1AHIA 2ZYDA 3QRWA 4PZCA 5JCJA 1LSUA 3RUHA 2W4QA 3TSCA 2FHSA 1K6XA 2O23A 2BFOA 2C59A 2Y1DA 5KJ1A 2J5KA 1Y8RA 4WNIA 5BQFA 1JQBA 5HS4A 4R1SA 4J1SA 4FJ0A 3SXPA 2HAEA 1BVRA 3R6DA 3BZUA 4M49A 4IIVA 3EVTA 3AW9A 3GMSA 4FFNA 3FI9A 3GVHA 1M67A 2AG5A 2W8ZA 1SC6A 4WK6A 5C37A 3OQ6A 2Y1OA 4DC0A 5A06A 1TVEA 1R0LA 2OP1A 4IDGA 4DQVA 3H3FA 1HLPA 1NPDA 1U2DA 1YB4A 3VPSA 1EE9A 2I99A 3GVIA 1E92A 3NEPX 2OGUA 3PJDA 5KVSA 3PXXA 4IPTA 1GCUA 3QSGA 4YAIA 1L7DA 1I32A 4EZBA 1G1AA 4YT4A 3ZHBA 2XF8A 4M89A 3IP3A 2JAHA 2Q2QA 4W9NA 3ZNOA 5DBFA 1ZZEA 5JLAA 4J9UE 3HE3A 4R16A 4EW6A 1C14A 1FDUA 4BNGA 3RUCA 1DC6A 4B3HA 2VHXA 1PZEA 3P2YA 5AXCA 4R1NA 3OIFA 4ZQEA 2DC1A 2IEDA 3VH4A 5KVCA 2DU8A 1E1MA 3WFIA 1VJ1A 3GRKA 5I8ZA 4BNNA 2UVDA 3ROPA 3AK4A 4GKVA 1LSOA 2VUSA 3LT2A 4JK3A 2DAPA 1H9BA 4D44A 3H6KA 3MOIA 1GZ4A 3PHGA 2XPCA 4JP3A 4AG3A 3GDGA 3JQFC 4I5FA 4PLCA 1NQ5A 4ONEA 1HE5A 3GZ4A 1C1DB 1E7WA 1SBYA 3DHNA 4D3FA 4NNJA 4DRYA 1IB6A 3D5QA 4J2OA 1X7GA 2ZATA 3ETGA 3OM9A 3W8DA 4RQUA 3F3SA 2DFDA 3QW2A 4YJDA 4YAGA 4XIJA 1U3TA 4J4BA 2IYOA 4E5PA 1XLTA 1BTOA 3TFOA 1PR3A 3VOSA 1UXGA 3W8FA 4PVCA 2VCYA 3ZW9A 1RM3A 3I9NA 1M6HA 3ZHZA 4KUGA 3V1YA 2ZK7A 3KO8A 4LSMA 4XKJA 2B4QA 2ILTA 4ND3A 3C1TA 2BD0A 1N9GA 3K92A 4CMAA 4II3A 1YL5A 4MVJP 4NFYA 3E9MA 2C7VA 1C1XA 4MIOA 2HMWA 3E1KA 2BELA 2IXAA 3KSDO 5COAA 3EK2A 4BKUA 4I8XA 4YWJA 2IYPA 3CMMA 1PJLA 1YL7A 3C8MA 4II2A 2NU7A 1QMGA 2P68A 1QLHA 4UEJA 1MG5A 1DPGA 1PJQA 2BH9A 2EKQA 3GA0A 4EDFA 3BMOA 4CM9D 4GSKA 4OL9A 5HRUA 1HETA 2P91A 4BV8A 1YQDA 2VOEA 4R9RA 3WYCA 1BW9B 4RPGA 4BQRA 1LC0A 4E6PA 4UEOA 4Z9XA 4BNZA 4JXKA 1EUDA 4CM1A 4YEDA 4HXYA 2RH4A 2UUOA 3I9MA 4Z0PA 1ULUA 3ZNQA 1LDMA 3GVXA 3VDRA 3ZWPA 2Z5LA 2Q2WA 2NTNA 4JIGA 1YOVB 2EHDA 1QYWA 5BSFA 3T7EA 2JJYA 2DLDA 3QVXA 1YJ8A 1UXJA 4ZICA 2EWMA 3O9ZA 1XELA 4QO8A 5DOZA 1E3WA 4RVGA 3VPFA 4G5HA 3BMCB 1LDBA 2FMUA 3ZWWA 4MVJH 3RC2A 4YT2A 4CUZA 4W7IA 5MDHA 4TROA 4WLUA 1BSVA 4NZ9A 3VPGA 1DIHA 4XJSA 2PH5A 1PS9A 2YYYA 3ZN2A 1HYHA 4ZQFA 4ZN6A 4O6VA 4CLOB 1FDTA 4E12A 5K9ZA 3ZWCA 1P44A 3TZCA 3D64A 1PJBA 4ZGWA 4Q3DA 4A03A 3DTTA 3VZPA 4OO3A 1A7KA 3TOXA 5K6AA 1ISIA 1RWBA 1T26A 1NHGA 1WXDA 4B8WA 3JQDA 1U4OA 1DRVA 2O48X 3G17A 4QECA 3QV1A 3N74A 5EINA 1ISGA 4BNXA 4FC7A 2JD1A 1TLTA 4YT8A 1PQPA 2D3TA 3CZRA 2NQ8A 2HO5A 2Q1UA 4YAKA 4LMPA 3FPLA 2X0NA 3MJVA 2EGGA 1PTJA 3P5SA 3EY4A 3D4OA 4N5LA 3MWDB 4WECA 4OJNA 4IXTA 3WGHA 3C24A 3DL2A 1K0UA 1U5CA 3GFGA 1O5IA 4U6SA 3EZYA 5IXSA 5JFOA 4PLFA 4E4YA 3NUGA 1V35A 5BSEA 1LQTA 1RPNA 1YJQA 3LT1A 4I08A 2CNBA 5CHEA 4RF2A 2PNFA 3H65A 3QWHA 2BMAA 1B8VA 2A4KA 2VWQA 3KM0A 4TKLA 5FI5A 1JWAB 4LGVA 1X1TA 2GD1O 2IRWA 4I9HA 4BVAA 5G4KB 1DOHA 1DIGA 4FSHA 1JAXA 3CTMA 4CR8A 3ETEA 1UH5A 3PTZA 1DFIA 3NYWA 3RFTA 5EJ2A 4WLFA 3ROKA 2BRUA 5C3MA 1NM5A 3EW7A 8ADHA 2FR0A 4DXHA 5EN4A 1EUZA 3LZ6A 4H16A 5THQA 4EI2A 1XU7A 3HDQA 1EVYA 3OETA 4L9RA 2E6UX 2D5AA 2X58A 4NK5A 2QZZA 5A9SB 1I2BA 4K6CA 3NT5A 4E3ZA 4A10A 3C7AA 3HADA 4RVSA 2FSVA 4Q39A 1MX3A 4NPCA 4U7WA 2WE7A 1HF3A 3O4RA 4Q3NA 4IIUA 4AJEA 2PKRA 4J0FA 4XCVA 4RVHA 4KZPA 4CR7A 2PZKA 3A06A 4P4GA 1G6KA 2TMDA 1CYDA 1QV7A 3P19A 4D7AA 4ID9A 3DBRB 4PGFA 4Y98A 2A9FA 3PFWO 4XWYA 2ZQZA 3GRPA 1QYCA 2OZPA 4YDRA 1YONA 1QRRA 3I9KA 2B0JA 3D1LA 1I0ZA 3MJTA 4K9DA 5CEEA 1MP0A 3WTBA 3S2EA 4LVCA 4PRLA 3MTJA 3VVCA 2P5YA 4ZVVA 5HS6A 1CRWG 2W2LA 2VT2A 4DIFA 4XYGA 2EKPA 4IINA 1H2HA 2HQ1A 5JE8A 3OECA 4FFMA 3ETDA 5A04A 1Z7BA 4IUYA 1I8TA 4LMRA 4NBUA 3ADPA 4MVJI 3WIDA 3HN2A 2RHCA 3PJFA 4CQLB 4BNUA 1B8PA 3AI1A 2HK9A 2X8LA 3DZFA 1HLDA 1VL8A 3PFFA 4WCFA 5LCXA 3BIOA 3RUEA 1Q7BA 3CSDA 3JQCA 3TNLA 1PL6A 5JYDA 1MB4A 1XU9A 3ZWMA 2YUTA 4OKIA 4CL3A 2NV6A 4OXYA 1F06A 4W7HA 2X0RA 2FZEA 3NDJA 3RFXA 1U7HA 3NDRA 4PLTA 3WG9A 2GASA 2ZTLA 4A0SA 3KYDA 3V1TC 1HE2A 5GY7A 2IDZA 3LT4A 3QJ5A 4RDIA 4EUEA 3RUDA 3JYOA 5LDGA 3B70A 5L7TA 1SB8A 1LRLA 2HCTA 5EESA 1GL3A 4OH1A 4ROSA 4PLHA 5A02A 1ZNQO 4GMFA 2C0CA 4IDDA 2VHYA 4JJFA 4OGWA 1K6IA 3ON5A 4OOFA 3EDMA 3QVTA 1K3TA 5TS3A 1XWFA 1YVEI 3DZHA 1T2FA 4RDHA 5F3RA 4R69A 3OA2A 2HMUA 4N7RA 1I3NA 4W6ZA 4OQZA 4EYEA 1T2CA 1RKXA 3DBHB 4G81A 3DMTC 4AJLA 3LLSA 5A4DA 3AU8A 1SOWA 1XCBA 1EK5A 1MFPA 2SCUA 2EGHA 3C1OA 5DF1A 1LA2A 3K31A 4UVDA 3WXBA 4WLOA 1A27A 1H2BA 3ZU5A 1QKIA 3NV9A 5AXDA 4J3FA 3MCVA 1V9LA 3Q2KA 4O63O 2BI7A 4XQ9A 1Z73A 1HXHA 3JQ8B 1I2ZA 2EKLA 2J3KA 3TWOA 2C5EA 2B5WA 3KZVA 1FF9A 4WNCA 2IZ0A 2O3SA 2QX7A 1LBEA 3ZWNA 1E3JA 1H6DA 4HWKA 4R1TA 3UCEA 5KJCA 2JCXA 3LC7O 4UAGA 4JNKA 2DPGA 5JO0A 3PLRA 3IDSA 2DBZA 3CKYA 2YV3A 4IDAA 4CM5A 2D59A 4F46A 3RUIA 3DZKA 1UZNA 4CMIB 3SLKA 1HEUA 1Q1NA 5JNLA 2CVOA 1MGOA 3KLPX 2FWMX 3I6IA 3AM3A 3RROA 4U8GA 3LC2O 3G79A 3D3WA 4L4XA 5CAEA 5ER6A 3C7DB 4UVEA 1P0FA 5IN5A 2PWZA 1ISMA 3OJOA 4NQZA 3VH3A 3RAJA 2YV1A 4ILKA 5U9CA 4IQ8A 4RGBA 1IYZA 3ITKA 4UREA 3G1UA 3KSUA 1LDEA 2QRKA 3GNTA 1NQTA 2Y1FA 4IJUA 2FP4A 2R00A 2V6GA 4EUHA 4YPOA 5CEJA 1P1IA 4TZTA 2WDZA 3F9IA 3RIHA 3HUDA 2AEJA 3S2GA 2C7GA 1AXGA 3PWZA 3KETA 1NX6A 4TKMA 3DONA 1LLUA 1JKFA 3QE3A 1X0VA 1PZFA 1PGQA 4QTZA 3Q2IA 3I52A 1MA0A 3I9LA 2DTEA 3RU9A 4TSKA 4A73A 5TRTA 2VWPA 4BNVA 3JQ6A 2NNLD 3DMTA 1CDOA 4INAA 2GYYA 3DHEA 5KJFA 1ZSVA 1DB3A 1V3UA 4BKQA 3DAFA 2CFCA 5B12A 1EDZA 4DBVO 3HDHA 1B16A 1NWCA 5JSFA 3RKUA 4Z3KA 3O38A 3L77A 3GZNA 4BNTA 5T64A 2OL4A 1TEHA 3HFSA 1WWKA 2F00A 3AOEC 3Q11A 4J7CA 3EAGA 5DDIP 4IMPA 4D0RA 5K0ZA 3NDIA 3AI3A 4PFJA 1QLJA 4PVDA 4NU5A 4FFRA 2JFGA 4FR5A 4IGEA 4YTEA 5LDHA 4MJLA 3ZWOA 4DLAA 2VZ8A 3VZQA 4DVJA 2G1UA 4E2XA 1BGVA 1HZJA 2PZMA 1PWXA 2UAGA 4M86A 4MP6A 3EMKA 2NSDA 3NGXA 1W4ZA 4B4VA 3ZWYA 1G0NA 4GBJA 2Y1GA 2H6EA 4I9UA 4RLSA 2GR9A 4WLNA 3Q6IA 4XX0A 3IJPA 3PRJA 2VRBA 3ULKA 1XG5A 3PHLA 1A9ZA 3D5TA 2WE8A 2YDXA 4HNHA 3ROQA 3SVTA 1KVUA 2CF5A 2I65A 3U4DA 4BQPA 3E9QA 1YRLA 2G82A 3C1AA 3AU9A 3QWIA 4MP8A 3LVFO 2O2SA 3WJAA 4YVFA 2H63A 1GY8A 1U7TA 1AXEA 4R5MA 3KXDA 4ALNA 2J3IA 4FPXA 3WR5A 2DQ4A 4KDFA 3DOJA 1ID1A 3W6ZA 3L4SO 3PQFA 2ZTVA 3QHAA 1E7SA 3I23A 4P22A 2JD0A 3DZGA 5I7SA 3LQFA 2WEKA 2J3JA 1P31A 3KYBA 1UDBA 1A4UA 1I3MA 3UICA 1DEHA 4DBZA 1NFQA 2DVMA 2X22A 4KTVE 1E77A 4NU6A 3GHHA 3DDNA 3STHA 1Z82A 2UV8A 5JAMA 5CDSA 3EGOA 1O8CA 1A9YA 1IZ0A 1DLJA 4LVUA 4WOKA 5LC1A 1GEEA 5B4UA 5TIIA 2CMDA 1Y8RB 1TT7A 2C20A 3OJFA 3TFQA 5GZ1A 3AWDA 4NMHA 3UAGA 1ARZA 1ENYA 5HTOA 1CWUA 4G65A 2ZB4A 1ADBA 2BHLA 2PA3A 4BNJA 4DUPA 9LDTA 1F12A 1KERA 1QYXA 3H5NA 1NP3A 4YJHA 3ZGYA 1LDNA 4J7UA 3CIFA 2B36A 1ADGA 4FDAA 1BXZA 3WIEA 2G0TA 2GN9A 4R4JA 3ZU4A 3O26A 4QO7A 4J43A 4CLHA 4K6FA 2GDZA 4L8VA 3PEFA 2X86A 4NG5A 1CQIA 5T8KC 3WX0A 3AFMA 4DIOA 2JL1A 3VTZA 5L4NA 3H4VA 3INTA 2XOXA 3WGIA 5DP2A 3DO5A 4D43A 1OC2A 1T1RA 2DBVO 2PK3A 1GFSA 1GYRA 3KLMX 3TF5A 2EG9A 3ASVA 4UVGA 1CETA 1ZEMA 3LDHA 2WD7A 3MTGA 1U28A 1ZK0A 2FY8A 4MKZA 2P2SA 4N54A 3IUSA 3GVPA 1EMDA 4GI2A 2IXBA 3NT2A 4BO9A 5G0UA 1X13A 4QFDA 3AI2A 2CDBA 4NJMA 4MPDA 3GOHA 2F1KA 2NVUA 1R4MB 4TVOA 1U8XX 2OXIA 3WMWA 1OI7A 4FFOA 2WD8A 4R01A 3HWRA 2CF6A 2RHRA 3GAZA 3JQAA 5DN9A 2I3GA 3OJ0A 4RF5A 2VOJA 1DIBA 3PZRA 1UAGA 1R0SA 1YQGA 1LEHA 3JQBC 5A1TA 2QRLA 1H6BA 3M2PA 4YRDA 1LLQA 4IQGA 1YBVA 4HFJA 3DFZA 1VRWA 4FIZA 4MVJA 4MIEA 4NI5A 5IF3A 3N7UA 4B4UA 3JQ7A 3MJ4A 4P8RA 5I9MA 2ZJ0A 3TDKA 1E1KA 3R1IA 4IGFA 1Y1PA 2FPIA 3T4XA 3FNEA 3MWEB 4AJPA 2VUUA 3EC7A 3KRTA 4B7XA 4MINA 4B3IA 2GERA 3GMDA 3JYQA 5L9AA 4RPHA 4QEDA 3VPXA 3RBZA 4EGFA 1SZJG 4PLVA 4Y6PA 2YY7A 5JDIC 1P74A 4GMGA 3H2ZA 5JAZA 4IBOA 3OEWA 1YDEA 1X7HA 1EQUA 1E5LA 1DHRA 2PD4A 3UUWA 1N9GB 4YJFB 1KEPA 1EK6A 4EUFA 1VKNA 1ADFA 1QR6A 1PZHA 1YS4A 3OICA 1MC4A 4E31A 4KTTE 1UXHA 3V2UA 2YHIB 1SO8A 4TRRA 3ZHXA 2VYVD 5JPIA 1DRUA 1Z45A 3I1JA 3QIVA 2C5AA 1X0XA 2C07A 3E18A 4GGPA 4HFMA 1LLCA 4IJWA 4J90A 5FF9A 3SLGA 4E30A 4E5KA 4IS3A 3TJRA 1NHWA 3ST7A 1EVIA 3WBFA 1IY8A 4GX2A 3PIDA 1AHHA 4FFPA 4YRBA 2EJVA 2VRCA 2PLAA 3BTOA 4CM4A 5JDCA 2ZCUA 4D42A 3K9QO 3NTQA 3WYBA 1GAEO 1KS9A 2UYYA 1V3TA 3U5TA 2GN4A 2X4GA 2Y1CA 2V7PA 4JCOA 5AYVA 3QWFA 1VE9A 4L75A 5C7IO 1BRMA 1Y8QB 4HFRA 2ZTMA 3IIEA 4D3SA 3SC4A 1A72A 2QHXA 2Q99A 4XA8A 2WYWA 2POQX 4HP8A 2I3AA 1GZ3A 4OMUA 3F5SA 1VL6A 2EEZA 4I5DA 3PVZA 5I7EA 3OFSA 1PS8A 3NGLA 4D46A 3BYZA 1E1NA 2JAPA 1RJWA 2NU8A 4ND5A 2Q1SA 3U4CA 3TZHA 5TSDA 5KKCA 3B20A 1EUCA 5T57A 3D0OA 3HJAA 4KUEA 5TGDA 2QZ9A 1DO8A 1K89A 1ONPA 2PZJA 3BHJA 1G0OA 2E82A 1F17A 2Q4EA 2B4TO 3E5MA 4BNWA 5JW6A 2QIOA 3MJCA 1KIFA 2JCYA 4AJJA 2HDHA 3ZWBA 1U3WA 3BMQB 5KVQA 3FTPA 5BNFA 1WDKA 4ESOA 4PG6A 3MJSA 2WYUA 3DHYA 4Y6SA 6ADHA 1N7HA 1WDMA 4O0LA 2EV9A 5FFFA 1HE3A 1ZMTA 2CSUA 1GU7A 1UUFA 4IXWA 1ZVMA 2FOIA 4B4WA 3KSZO 2PGLA 2RCYA 4YB8A 4M54A 4EEZA 3IL2A 5F21A 4RF4A 4EEXA 4ZU3A 3BHIA 4BKPA 1RYDA 3K2BA 4XJTA 5IG2A 2VZ9A 2VUTA 4LW8A 5C7OO 1EFKA 4M55A 1Q0QA 2E49A 3EHEA 1H5QA 1PJ2A 4RJTA 1LRKA 3TOZA 4BGEA 4Y8VA 2NADA 4DPKA 1J5PA 4BO3A 4J9VA 2OUIA 4Y6RA 4E33A 3GQVA 4NBVA 1ULSA 4BUCA 1NXQA 3ENKA 4KOAA 3DB2A 2ZTUA 4UVHA 4XQGA 3UCFA 1T2AA 3L6EA 3WMXA 3HDJA 1GPJA 3JQFA 3VPHA 3D3EA 4L0QA 2O7SA 4L76A 1UP7A 3V2HA 3BTSA 4FGWA 1Z75A 3GR6A 4CM6A 3K96A 4RV9A 2AW5A 5GZ6A 5FI3A 3HDYA 1C1DA 3F4LA 5H83A 4UEKA 5U1PA 1P77A 4A27A 1O0SA 2YDYA 1X15A 5A3VA 2Q1TA 4PLGA 4BO2A 2NTVA 4BKOA 2VHZA 2X0JA 3PJGA 1EVJA 1ZK1A 4YAJA 4UUMA 3E5RA 2BGLA 3ONDA 5THKA 3QY9A 2VNSA 1E3IA 1SPXA 3ZU2A 1XQ1A 3U09A 4ZQGA 1CQJA 4XYLA 3PYMA 3IUPA 4MKXA 2DTXA 5TJ9A 1RM0A 3H9JA 3INGA 3S2IA 4E21A 3I3OA 3L4BC 2NLOA 1LUAA 4FN4A 1WMAA 4ALJA 4HV4A 3KHUA 3JQGA 2YQ4A 1ZK2A 4E5NA 1BXGB 4YJGA 1GYPA 1YWGO 3JQ9C 1UAYA 1ZEJA 3GN1A 1PQUA 3L0DA 1JWBB 5IDXA 3E82A 4B3JA 5ADHA 3X2EA 4J1TA 4JBIA 1BW9A 3PQDA 4CL8A 5AXAA 4JP2A 5B4TA 2QYTA 3GHYA 1GV1A 2EIHA 3Q9NA 4RORA 4IM7A 3F1KA 4BNFA 4CMKA 2ZCVA 4W99A 5A9RA 1D4FA 2WMDA 4E13A 3HB5X 4CR6A 5KCZA 2AXQA 2B4RO 3JQEA 4PLWA 4RPKA 1YOVA 1Z6ZA 4OKNA 1IUKA 3PGXA 4PZEA 5FWNA 2ZIZA 4MVJE 4Z0TA 3NAQA 4F6CA 1NFFA 2BF7A 2PKQP 1O94A 3LF1A 4WOJA 1GDHA 1W8DA 2HSDA 4XRRA 3S1LA 1M66A 3EZLA 5IXYA 5U4QA 1FK8A 2AMFA 3R0IA 4FQ8A 1YDWA 4Z6KA 4EBFA 1BVUA 5DBIA 2GZ1A 4IDBA 5IDWA 3OIDA 3WNVA 5EQDA 4XGKA 2VN8A 4W4TA 4CMBA 3ENNA 3GVCA 1EBUA 3JD1A 4MVJG 4PCVA 5DZSA 4CV0A 4CQMB 3R3JA 4J7XA 2VWGA 3WLFA 3PYLA 4WJZA 3E48A 5L4LA 1VC2A 4NDNE 5MGBA 1KOLA 4KP7A 5FYDA 4PG8A 3AUAA 3UN1A 4F6LA 2JHGA 3NT4A 1UDCA 3T4EA 1KVTA 2VT3A 4DIBA 5TC4A 5CDTA 2QRJA 4BMSA 4HFNA 2OFPA 4UUOA 3AY3A 2VNAA 1JVSA 4AJHA 3TZ6A 1PSDA 2CUKA 4CLRA 1GQYA 5I9LA 4XIYA 3FD8A 3DWFA 4EITA 1PR9A 4U6QA 3HFGA 3BHMA 4RCVA 4E2WA 1U4SA 1ZSYA 5DCYA 3ANLA 1AN9A 4GKBA 5AVOA 4BKRA 4DMMA 4RVFA 3L6DA 1UZMA 1JLLA 1D1SA 4MKRA 3DBVO 5CFZA 3JD4A 1HSZA 3CZMA 1I30A 3D3WB 3JQ9A 4R54A 3U4HA 1ONOA 3WS7A 1F0YA 5GMOA 3AY7A 1AUPA 1PX0A 1S6YA 1UDAA 3C3XA 4J2HA 1VKOA 1XHLA 4DPMA 3ZWVA 4YT5A 5BT9A 5A03A 2PGDA 4K26A 2YQ5A 2IEBA 5G4KA 1Y9EA 5H82A 4DC1A 2HJSA 4FCCA 4H3VA 2HMSA 4FJ1A 3UCXA 3GNQA 1XQ6A 1Y9AA 1TB4A 3VTFA 1IPEA 3PPIA 4MVJM 3V5NA 3WSWA 2EXXA 2EP7A 1J0XO 4NH4A 4Q3CA 5CPBA 4YYZA 2WSBA 4FS3A 2ZB3A 3PZBA 1EDOA 5TQVA 3BA1A 5ENVA 2O4UX 1E3LA 4XGIA 3RSHA 3O8QB 3GN2A 1Z7EA 2Y0CA 2P5UA 2I5PO 3ADOA 3D4PA 4MIYA 1FDVA 4AVYA 2CDAA 3IP1A 2WM3A 2AEFA 3ANMA 3SC6A 1D3AA 4PZDA 1I2CA 1FXSA 3OA0A 4GX5A 3RBXA 1SEVA 3DXFA 3G1TA 4CQMD 2WJPA 5CDGA 2Z95A 1K2WA 1H6CA 3B1JA 5JCXA 4CPDA 5B37A 1EEHA 2RAFA 5L4SA 1N92A 3QVSA 1PWZA 3DBRA 3W4KA 3DZIA 4HADA 5CDYA 1NWHA 3RJ5A 5L95A 3RUFA 2Y67A 1A71A 3NTRA 1KVRA 5ENDA 4AJIA 3ZW8A 3FBGA 2C2XA 5G4LA 1U1IA 1CEQA 2Q46A 4CM8B 4UULA 4WUVA 4AJOA 2OORA 4Z9FA 4A26A 1IULA 3PDUA 2CDCA 4E0BA 3RVDA 3FBTA 2P9GA 3PGJA 3FCOA 4D0SA 1O95A 1M76A 4D41A 5JC8A 2JHFA 1LX6A 1ZH8A 2HRZA 3DEYX 1ISHA 1ZXLA 4C7KA 3LSYA 4R9SA 2X5KO 3OHSX 2O3QA 3H9QA 4TRMA 1TXGA 2C29D 1NPTO 2CVQA 4QUKA 2E37A 2VYND 1YO6A 3KYCB 1DC4A 4KWHA 1VLLA 2Y66A 4BMVA 2XXJA 5L40A 3FSRA 1OBFO 1YKFA 2ZKLA 1B3BA 1B3RA 3L6OO 4RPLA 1T4DA 4KMSA 2Q2VA 3LT0A 4CUKA 4DTIA 4YR9A 5BNTA 1OZAA 4TRJA 3KVOA 4M87A 4NR0A 4RVUA 4J91A 3UKOA 3W6UA 3WGTA 2PGJA 1YB5A 1ZSNA 4DQUA 1GUFA 1PGJA 1WAMA 2BI8A 3WWYA 4A5OA 3QVWA 4QX6A 4BO8A 2Y99A 1X14A 3NTOA 5EPOA 2I76A 1R37A 3FNHA 3GEMA 4GQAA 3JTMA 3Q1LA 2VHVA 1HDXA 3H5RA 1LNQA 1BXKA 2Q50A 1D7OA 2PY6A 3K2EA 4IZHA 3IQDB 4CMHA 6LDHA 4P38A 3UXYA 3PK0A 4D79A 3U62A 2B35A 2FR1A 4CM3A 2VHWA 2VTEA 3PDJA 3DBHA 2DUUA 3DR3A 4FOSA 4CMCA 4R5HA 5IZ4A 4MDHA 3PHIA 1ZXBA 4XRGA 2DFVA 2DM6A 2IODA 2FR8A 2W2KA 4J6FA 4XDYA 4BO6A 4D45A 3IS3A 4Y67A 3K30A 3K8ZA 1GCOA 3AJRA 4BO4A 5IZCC 1BHSA 2P4HX 1A5ZA 5J23A 3JQ8A 1VJTA 3COSA 3DBLB 1P9LA 2HMVA 3FPCA 1SB9A 3CMCO 1W6UA 1WDLA 2NVBA 1JVBA 2C54A 2GLXA 4BNYA 5A5EA 2GNAA 3PHJA 1I01A 4I5GA 1Q7CA 3RI3A 3GT0A 3S8MA 3DC2A 4YJHB 4BNIA 4DYVA 3DOOA 5HM8A 3B1KA 2PR2A 5DCUA 5IAAA 3WFJA 4RO0A 3FRJA 4AICA 3WB9A 1WW8A 4IDCA 4CMIA 1EFLA 3M1LA 4ITUA 2W98A 1O89A 1MLDA 3RKRA 1DBVO 4IY1A 1I3LA 3DAGA 4J4TA 1I36A 1B15A 1R15A 2X6TA 5EIOA 5TX7A 2G76A 3HG7A 4XQCA 4YAEA 2H9IA 3G3EA 2HJRA 5CDUA 4WASA 4FBGA 3C7CB 3GPIA 3BMNA 2WD7B 3U4IA 5KIAA 4ZRNA 2V6FA 4HY3A 1NVTA 3IKVA 5KOIA 1HTBA 2QQ5A 4ZA2A 4NIMA 5ILGA 4R3NA 3CINA 4M8SA 3JD3A 4NJMB 1PS0A 3D4NA 3GUCA 5TLSA 2VZ0A 1P1FA 2BFAA 3RQSA 5TT0A 1GQQA 1J49A 1D8AA 4PLZA 2YZ7A 2GZ3A 3AM5A 3NJ4A 4KQXA 5G0SA 1WPQA 1M6WA 3L07A 1HSOA 5JXWA 1TT5B 4HNGA 1MG0A 2AG8A 1IE3A 3CEAA 1QORA 3ANNA 3GLQA 4YXFA 4E2ZA 3UOGA 5CG1A 2D4AA 3HHPA 1E7QA 3VDQA 3G0OA 3JQ7B 4FJ2A 4GX1A 2BFMA 3X2FA 3WBBA 3ZV6A 1YB1A 3ZNNA 2AQHA 1DIAA 4NK4A 4QFCA 2X9NA 3JYNA 1XR3A 4JJIA 5A3JA 3A9WA 4XEHA 1ZCJA 3V1UA 1YBAA 1EQ2A 1KC3A 5F5NA 1IPFA 1QV6A 1E3EA 1PJ3A 4H7PA 4RZIA 4FC6A 1K6JA 1T25A 5L7YA 3AOEA 3O03A 1I33A 1NAHA 5KVVA 4GLOA 1P1JA 3M2TA 2D0IA 2EW2A 2Y05A 1IOLA 2X0IA 2Z1MA 4BO7A 1NTOA 3RBVA 2PZLA 1DIRA 4LRTB 2ZQYA 2V6BA 3ZHYA 1DJNA 4E5MA 2DKNA 4XZ3A 4JLWA 2CVZA 4Q3AA 4PN3A 4J4HA 4W9NC 3P7MA 1MXFA 4XR9A 4DYDA 4FB5A 1X1EA 3WGQA 1U2GA 4C7JA 2HK8A 1LU9A 3FTNA 3ITDA 4DPLA 2PD3A 4BGUA 3ASUA 1UR5A 4ALMA 1FDWA 5H81A 2I67A 2FSSA 1PJ4A 4WLVA 1N1GA 3HB4X 4LN1A 5BNIA 5EMHA 2X5OA 4GL4A 4PLYA 7ADHA 4S1VA 4J1NA 3WSVA 1Y5RA 1BDMA 2D1YA 4TVBA 4ALLA 4FFLA 5F5LA 1Z74A 5C7LO 3KBOA 4BIIA 5JCJD 1UXKA 4E32A 2GSDA 3PHHA 1UP4A 1P0CA 3I5MA 3RWBA 4BNKA 1I5RA 3QQPA 4Q3EA 3AFNA 1T2EA 4MVJD 3OQBA 1Y6JA 3JD2A 3NX4A 1HDYA 3UH1A 1ZK4A 1P1KA 2FN7A 4GWKA 3VHRA 1EVZA 4L4SA 3HN7A 1PGPA 2AA3A 3OIGA 3R3SA 4JGBA 1W0CA 2DUWA 4OXKA 2WTBA 4KQWA 4XYEA 4EJMA 2I6TA 3RJ9A 5HWSA 3CH6A 3MJEA 4WLEA 1GTMA 4F45A 1ZIDA 4GVLA 3F46A 3GAFA 3I6QA 5G2OA 1VSVA 4X54A 4XD2A 1PQWA 1JKIA 1C1XB 1VI2A 3E9NA 1HDGO 5HBRA 4MP3A 2G17A 1V8BA 2HRBA 2ZYGA 3VZRA 1NR7A 3PWKA 2Q49A 4UUPA 4AJKA 3NKLA 5COBA 3SBOA 2OBYA 1SOVA 5I8WA 2YFQA 3OEYA 4PIVA 3DTYA 5T8KA 1GEGA 3A14A 4TMFA 5C5IA 4F3YA 1VL0A 1E0DA 3BMOB 1NNUA 5DP1A 5G0VA 1KVSA 1U5AA 4J0EA 2W90A 2YW9A 3WWZA 1XSEA 3LC1O 2VYVA 2VRCD 3TL3A 1E1LA 5JBIA 4BO5A 3OQ1A 3Q9UA 5A5FA 1YL6A 1ZO8A 2PFGA 3H9UA 5JMPA 1YBMA 4D3DA 1R4NA 3JSAA 3OSUA 1T1SA 2UDPA 4CLDA 2VTDA 3WTCA 2AQIA 4UVIA 1PU2A 4E5YA 1PEDA 1ZBQA 1JU9A 1ADCA 3P2OA 2NACA 4YCAA 3A4VA 4DLBA 3Q0EA 1R4MA 2EERA 4AJ4A 1E3WB 3WOHA 1ISFA 3JQBA 1A7AA 3RU7A 2X1HA 1XDWA 3JYLA 2B69A 5KWEA 5ICMA 2J5QA 5ITWA 4FD3A 2YFHA 4B4OA 4ZQBA 4C4OA 3VVBA 3DZBA 4JQCA 3QVOA 1XA0A 2LDXA 4RF3A 4XYMA 3WGYA 4HX5A 4N5MA 5JAQA 1LSJA 4BNMA 1DC3A 2YJZA 4LISA 3FNFA 4DREA 4BOYA 2GRAA 1QG6A 2FPPA 1AGNA 2WWRA 5T67A 5ILOA 1KEWA 2I9PA 1M2WA 4LCEA 5ICSA 3RC7A 1FJHA 1DAOA 1R66A 4TRNA 1T24A 2NWQA 5JDIA 1SCUA 3CE6A 3Q3CA 5K6AC 5IJZA 1NVMB 1Y81A 3OJEA 2O4CA 4L73A 4LSWA 3UFXA 4CMJA 3RD5A 3ZV3A 1F14A 3IOYA 4OIMA 4G2NA 1P1RA 2HK7A 1DC5A 3IC5A 4WEQA 1GR0A 4HBGA 4L4RA 1MC5A 4YJFA 4RZHA 2DTDA 2J3HA 1PL7A 2GZ2A 4H15A 3OJLA 4WEOA 5EERA 1NFRA 4O59O 1V3VA 3PWSA 3U9LA 3WGGA 3TL2A 1ML3A 2YHIA 1E3SA 1KEVA 3VC7A 2FRDA 1C0LA 4WPGA 1L7EA 1FMCA 5L3ZA 3VAZA 1NYTA 2YHUA 3JQGB 2X9GA 1ZKMA 4Q9NA 5JY6A 2E4AA 5CPFA 1NPYA 3JV7A 4CM9A 1KBZA 4UUNA 1HL3A 1SNYA 4YJGB 4ND4A 2A94A 2V6MA 1VSUA 1W73A 1WVGA 5IDQA 5KNLA 1BMDA 1GV0A 5JC1A 2Q45A 1ZK3A 3QA9A 4KDEA 4YQZA 1P45A 4LRSB 3RFVA 4ALIA 4CMGA 2AE2A 3W4IA 5CEFA 2HUNA 1DSSG 5CG2A 1CIVA 3H9EO 2Y1EA 1Y8QA 3QP9A 4NJOA 4B7UA 3TZQA 3SJ7A 1CF2O 3ZH2A 1N5DA 2P9EA 4BNHA 1ZJZA 2G5CA 5EL0A 1LI4A 1E5QA 3GG2A 1PGOA 4TWRA 3KOUA 4WGGA 1HWYA 5I7FA 4OSPA 2YV2A 1CJCA 1GUYA 2Q3EA 3FHLA 2NU6A 1LQUA 3BTUA 2GGSA 1ONNA 1SMKA 3QLJA 2AHRA 3WICA 5BR7A 3PI7A 1R0KA 3RC9A 1NAIA 3ORFA 2GUGA 3I4FA 1ENPA 4JROA 4BV9A 1HYGA 3QWAA 5AOVA 2OO5A 2NM0A 5G0TA 4B8ZA 2FZWA 4DA9A 2RIRA 3HSKA 3FNGA 4P4LA 3RUAA 1X7DA 2Y0EA 3LLVA 4GGOA 1MV8A 4J16A 5KTKA 1N8KA 1DFHA 4CV1A 3E8XA 3WQSB 3FWZA 5ITVA 1JTVA 1XKQA 3K5PA 4AJNA 3KTDA 1KY5A 4FW8A 5DULA 3UVEA 2GF2A 3D7LA 1I24A 2QYSA 2C2YA 3BMQA 4CJXA 4QQRA 3PJEA 2PH3A 1DRWA 9LDBA 1U3VA 3B1FA 3LYLA 2IE0A 4IJVA 1AE1A 4RLHA 3UF0A 4CLRB 3JD0A 4I9NA 4NBWA 3S2FA 4OXNA 3ZI0A 2C82A 1CERA 1Q2XA 4WCFB 3ZWAA 1OAAA 2QW8A 3M6IA 4B7CA 4WCFC 4OSOA 3F47A 4R68A 2CZCA 3GFBA 4FGSA 5DT9A 2O7QA 1PJCA 4OHUA 3KYDB 1BDBA 4DMLA 3ONEA 3IKTA 4PG4A 4ZHSA 4BGVA 3LK7A 4PLPA 1ZW1A 4Z0HO 5JS6A 1U3UA 5CP8A 1DDOA 2B5VA 3I9OA 3AUUA 3BMCA 2P9CA 2EW8A 2GCGA 1ZMOA 2BLLA 1E7YA 3DQPA 1QSGA 3MEQA 4CMEC 1DJQA 1HYEA 2BGKA 1H0KA 3CXRA 5AXBA 4RL6A 1R16A 3CUKA 4AFNA 1B14A 1J6UA 1TA4A 7MDHA 2VWHA 3BTVA 1EZ4A 4OOEA 1OMOA 4O5OA 4CLOA 4BB5A 1C3VA 1PZGA 2OMEA 2ZB7A 5L53A 4ALKA 4NFHA 3FF4A 3SX2A 2AEMA 5AQ1A 2JD2A 1V0JA 5KJ6A 3DFUA 2GN6A 1Q0LA 1UJMA 1GZ6A 3VKVA 5I9NA 4ZD6A 4YQYA 4PRKA 4I1IA 4ND1A 2GO1A 1I10A 4PG7A 1V6AA 2BFPA 2W2LD 4LCJA 3MZ0A 3NRCA 4NFSA 1PGNA 3UGKA 4A7PA 1YXMA 2Q1WA 1H9AA 1GD1O 3ICCA 3TPCA 1GUZA 4IS2A 3WDSA 4YACA 3WLEA 3L4BA 5JY1A 4MOWA 3EUWA 1N7GA 3I9JA 1T2DA 2O2YA 1F8GA 2AE1A 1WP4A 2X9VA 3AUTA 2NU9A 3AOGA
chains in the Genus database with same CATH superfamily
4DABA 4RQTA 1MRSA 4IOJA 2UZ4A 3ZCPA 3E9CA 1L5HB 3F90A 4OPMA 3A9TA 2Z1NA 4RVDA 1HNZB 1MFZA 1GYQA 1NR5A 4DM7A 2GCPA 3K7EA 5E4TA 3UXHA 1NULA 2BKUA 4B1FA 4U7DA 3PCXA 1E4VA 1F6BA 2BKEA 3F5QA 3Q8XB 3QNUA 4YAOA 2R47A 3UBTA 2F8MA 4FOTA 1QB8A 3S0JA 2JATA 3DO6A 1ZJ5A 3OMLA 4KO1S 3CRQA 4W7SA 1NUSA 4H0NA 3PQ5A 2QP3A 3R7LA 2H85A 4DY6A 4YS6A 4RULA 4GQBA 4ENRA 1WXQA 4JJAA 4PNEA 1X2BA 3IQGX 4PFQA 3G2IA 4K6OA 3VOAA 5MF6A 2R5NA 4LJSA 5LYYA 3OEED 2D5LA 1P7PA 2JS7A 5L51A 1K66A 1J70A 2ADMA 2JKVA 3C16C 1Q0HA 3PE3A 3KQKA 1M6VA 2JFHA 1CCWA 4LZWA 4ZYYA 3LLCA 1ZGJA 2BE7A 5DCWA 1HBJA 5LQRA 3LU1A 3EGEA 4R6XA 4Q3OA 1XKXA 1KKLA 2X5NA 5DBGA 3WHLA 4D8WA 2F8SA 1WMSA 4MB0A 1SFRA 4DWVA 4DV5B 3U3XA 1SXJB 4BL5A 5JMWA 3AY0A 3WV4A 1A4XA 4LBWA 1KAMA 3LNTA 2X7HA 4GGMX 3KVYA 4DA4A 1HQYE 5ES3A 1TW2A 4GVXA 5ED4A 3GUYA 3MJFA 3BJEA 3KQOA 1FNCA 4WZ6A 1SOMA 3WSTA 5J4HA 3JALB 1LJ8A 3D3QA 1V25A 3N6RA 2DLNA 5BUQA 1UQRA 1K4KA 3O92A 4BFYA 3RHFA 1P7YA 1DHTA 4NG4A 5LMNB 4DCTA 5HA5A 4HGOA 4M7PA 1AUXA 2ZSAA 4GXQA 2BFFA 4XB2A 1CB7A 3AUXA 1NBOA 2Q28A 4HZUB 1U90A 4ZO4A 1XMSA 2W6OA 5BP7A 5AVVA 1OB2A 1HDOA 3WHKA 4ACAA 5ADWA 4GLLA 2GZAA 3VKUA 2ISCA 1FMJA 1N2JA 2CD9A 2HZBA 1ZD5A 1R8QA 3DZJA 4PCLA 3JAMA 3ZIAA 3JWIA 4BVBA 2VHUA 1QXSA 3A6JA 3H75A 1WHTA 2VDKB 3LRTA 4YROA 1TLLA 2WWTA 1E0JA 1SVLA 1ZLXA 3IEMA 4D8TA 1GN9A 4JD5A 3NHUA 4MV9A 1YCHA 3ABIA 3R3XA 3TZKA 3U49A 4ARIA 3TTYA 4Y2HA 2C8KA 1RT9A 2QN6A 3GDOA 2QK4A 1OTHA 1IBKB 1CJSA 7ABPA 3GNSA 4CLEA 2OP0A 3D31A 3SSAA 1RJ9B 3IAHA 4Y18A 4JWTA 4G0VA 3I83A 1SHTX 3KKPA 1WLYA 4Z9YA 1YZFA 4XX0B 1NQAO 1UPFA 4XB6B 1MRNA 4OJQA 5CVTA 1TKBA 5FLXA 1NSYA 1HDZA 2P4EA 2ZB8A 2OV2A 3QVKA 3DOEA 2O1WA 1H94A 2YMPA 5D2CA 1GWNA 4L07A 2O8FA 2Y6UA 4KUHA 3Q3EA 5EMNA 4AF6A 4LBVA 1PSZA 3HXTA 2A5YB 2BFBA 1U8FO 4X20A 2DB3A 4EY5A 1B1CA 2QMHA 1EJ0A 2V7GA 5CRIA 3M3DA 4FDUA 1NLZA 4CBVA 1RYEA 4P58A 2XMZA 5TNXA 2WJYA 2PVCA 4GWGA 5JH7F 1KH1A 4RHCA 3NETA 1JQAA 4ZALA 1QDEA 4JBWA 1IXYA 4FBMA 3CUUA 1L4LA 3IIJA 2D62A 1PJTA 2G63A 1RKUA 2NZYA 5IAJA 2OFXA 3IYLW 1Y3BE 3LYUA 4GMDA 3JAKB 3SZ3A 3QH4A 4AZSA 5JO9A 1C0KA 2PYZA 2FFHA 1PN3A 1YH3A 4EX7A 3RB8A 1EDEA 2NTJA 2DHEA 2JAOA 2R62A 1MEJA 3HBLA 3PGLA 4TMYA 5ALYA 1XGKA 2Q2OA 4QODA 2J41A 3EVBA 4GO1A 4L3WA 4K28A 2IU0A 3WISA 1BG6A 2OHXA 3VR2D 1NY6A 1ZUNA 4QT0A 2V65A 5LVAA 1NN3A 1FDIA 1ZD9A 3G5LA 2Z4SA 5A9TA 2QD1A 5ADVA 3DAPA 1V2GA 1XZKA 3LBHA 2P2ZA 1PWYE 3JCZA 4DV6B 1A2BA 1RXUA 5AUPB 3WLTA 5KOHA 1V6CA 2FG6C 1JB9A 1ORRA 4E2YA 4PIMA 4HQKA 3PDCA 3Q5GA 4H1TA 3EEIA 4QPZA 4M1ZA 4TKZA 1JDPA 1NLUA 2QYOA 3KK0A 1L5NA 3FWPA 3M9LA 2QUIA 3S68A 1VHTA 2FPOA 4Y1EA 4IZIA 1YZQA 4J49A 2IA5A 4PQYA 4AJ2A 4ZZ3A 2BC9A 1K97A 4A1OA 4K2AA 3QBEA 3W1VA 3PC6A 3PNBA 4R2MA 5EQFA 3V8BA 3AM4A 4FOOA 2OBBA 2HFKA 4M76B 1CDZA 2EJUA 4R3WA 1NI3A 4RK7A 5DU2A 4KEAA 1NMSA 4JFAA 3UH0A 2V9CA 4R2LA 1YE3A 1T4BA 2B37A 2Q3LA 4FE7A 3RQIA 4EGAA 2R4TA 1J22A 4TSFD 1L1FA 1GPAA 2CLSA 3UV6A 5FEUA 2AZMA 2H5LA 2HLPA 3MF4A 1NASA 2CE2X 2PXHA 2OO7A 2ESRA 1F8FA 1R00A 3BH7A 1JG7A 3HWSA 1A9OA 3KU4A 2JGDB 3KYCA 3OCJA 3I5UA 3HV2A 4MR9A 5CMLA 5F1PA 3MCUA 4OU5A 4V0ME 1FZTA 5EE3A 1FNNA 3I8SA 4CKCA 3D02A 2UZ3A 3AL3A 2NPOA 1RWXA 2RBEA 4MYHA 4QDUA 1HQCA 2NO4A 3FUTA 4AN1A 1LSSA 2OECA 1THTA 2C7OA 3UHAA 1B26A 4NS1A 3E7PA 4KFCA 5HDQA 4LTDA 3WL6A 2J6IA 3SU8A 4MPTA 1SKQA 2TMGA 3PQ6A 3CVXA 4NE2A 5DHSA 2XI4A 3B60A 1VLQA 2MMCA 2PG3A 3N28A 1N2SA 1V4VA 4IIJF 3I6YA 5BQXA 3OPXA 5C8YB 4MQFA 3ZZNA 1J33A 1USIA 1P72A 1H8EA 4CLXA 5LKAA 1Y1LA 1IHYA 1W4LA 1EBFA 2HKIA 3F78A 2PLFA 3D6MA 4MUEA 4Y2VA 4UDXX 2R8EA 5DMXA 3LV8A 2FMFA 3ZV5A 3GLFB 3GDFA 1C8KA 3NAZA 2J6CA 4LZNA 4HF7A 5SY4A 3EASA 1BOOA 4D8XA 3GGOA 1JHDA 3AKDA 3KUDA 4CCYA 3BRWD 3ELYA 1WEKA 2I7XA 5EQJB 4AN4A 1Z17A 2QTMA 5BVGA 2OB2A 4HJRA 5EFZA 3VHLB 3D0QA 4QNRA 1FXWA 1SURA 2OCXA 1B7GO 2GX6A 1QX3A 3FGPA 4UU8A 5DLYA 5B64A 1Q7GA 3V4FA 2DCMA 3EQ6A 2BEVB 1VYUA 2QE7D 3OPYI 4DAEA 4DGQA 4F4HA 1YTUA 3IQIX 3DBLA 2Y93A 3IHTA 1K92A 1NQXA 1QRSA 1FS5A 1TJ3A 4UOZA 3JYPA 2O3UA 5IK2A 3I4LA 5JQWA 4S3MA 5IC5A 1FOEB 1G9XA 3OZEA 5F1KA 3ZQKA 4Q1AA 4RYDA 1DXHA 4WQMA 3VNRA 2RGCA 3PLNA 2R2GA 5JH7A 1TUBA 4GAEA 5F64A 1MUUA 2A35A 1DVRA 2QX9A 1G3MA 4CV2A 4GU5A 5TT1A 3FROA 2QUKA 2KBEA 3TNFA 3MOGA 3SHOA 1TD1A 1E8DA 2P6UA 1OXTA 3NOVA 4ZRMA 1G64A 3OPMA 2F3TA 4P08A 4B35A 2WF6A 5FDFA 1J23A 2IV2X 3UWSA 5JOQA 3FGNA 2Z8XA 1P0QA 4Z99A 4F0JA 3QU5A 2QG4A 5DX8A 1D1TA 3SI7A 1FQJA 4BNLA 4ENQA 5LXTF 5FWXB 2I7DA 1SCJA 1OWMA 1T34A 2APJA 5DLDA 5GV8A 3UM9A 3EFEA 4ZTBA 3STWA 1R4NB 4LC0A 4RK5A 1J0DA 3HJTA 5FOQA 4R83A 3H11A 4DSNA 1OOEA 1ZX1A 1ZUD1 3KQVA 4EVSA 1E6MA 3OTOB 4RD3A 3PCTA 2WAXA 1JAYA 3E7WA 4FUQA 4I6JA 1QYDA 3WWDA 2O3TA 5BRJA 3DTVA 2YJNA 3LUAA 4A0QA 4PNPA 2EGUA 5T6BA 5JAIA 4PC6A 2NSLA 2G4VA 2FWNA 3Q7SA 3D4BA 2LP4Y 3GELA 3GRFA 2W6ID 2NUAA 3W2HA 2CXUA 5G0WA 3GC6A 3E22A 4CHGA 4GUAA 3C6BA 3WJ7A 2C7PA 1N2IA 3BSFA 4RFSA 2QGNA 4II7A 2BKAA 5DXFA 5T3UA 3QXJA 5HMLA 4DDUA 2XCRB 3EB9A 1T36A 2G77B 3WIVA 3VOTA 2ZYDA 3QRWA 1KQOA 2R1TB 4PZCA 1LSUA 2A3RA 2QJWA 3FH0A 4LJYA 2PVSA 2FHSA 4NYIQ 4TTRA 2NU8B 2NXWA 4P80A 2ENWA 3RJTA 2Z2IA 4QBFA 1WLSA 3K20A 1CJMA 3C6KA 4QWWA 4FR2A 3WO1A 3GEPA 5KPJA 4WVFA 4NOKA 1RZRD 4WNIA 1N2GA 4MWOA 4R1SA 3JASA 4FJ0A 3ZI7A 3JVEA 4Q24A 5K51A 3O1IC 1NJGA 3AHDA 4FZRA 4V2IA 4BX0A 1NVUQ 4MRRA 4FFNA 3FI9A 1M67A 3GGSA 2XQVA 1G38A 2W8ZA 1Q6ZA 1SC6A 5CIWA 2RARA 2Y1OA 1TVEA 1R0LA 2OP1A 4DQVA 2A1IA 1W87A 2I4IA 1XNJA 1TGVA 1SVSA 1O1YA 2BKXA 1YB4A 3A1VA 3L1HA 3VPSA 3IEUA 1OLUA 1XFAA 3AT1A 3EWSA 2CEKA 4IF4A 1AB6A 2BY4A 1VHQA 4I2NA 4ESVA 1AO0A 3DWIA 1XJWA 2A9RA 2AJBA 4N3BA 3TEJA 1CUAA 4YT4A 5TGZA 4M89A 2F1IA 3X3HA 2G80A 2JAHA 5EHZA 3SM3A 1VTKA 3IUEA 4W9NA 3ZDEA 4IIJA 2XKKA 1X38A 4U6NA 4D9JA 3ROXA 4J9UE 3KHKA 2AD1A 4W5NA 4I1SA 4GOXA 3SK0A 4B3HA 3GNLA 3RAPR 3SC3A 3H87A 4H6WA 1PZEA 1SKAA 4ETIA 1PFGA 1SUCA 1XTVA 4F4DA 2IEDA 5AKGA 1E1MA 1L3IA 3WFIA 1VJ1A 1KQ3A 2A7XA 4HQ6A 2LGJA 2ZU6A 3ZK8A 2BYTA 3H42B 2UVDA 1OFIA 3AK4A 4GKVA 1LSOA 1AQUA 2H52A 3LT2A 1TVMA 4I7EA 2DAPA 2FNAA 4O2RA 3IIIA 2G70A 3EE6A 4D44A 1BNCA 4V39A 3H6KA 3K6KA 3MOIA 4OB7A 5A1JA 4QE3A 3WLIA 4GKJB 3JPWA 1KAQA 1WY7A 5C5DA 4NCHA 5FOVA 3RRBA 3LP8A 3ZBUA 13PKA 2Y1LA 2XA1A 4GC5A 5AHWA 1U5BA 2FPMA 2E87A 4I5FA 4OGLA 5J40A 4BUZA 1P80A 4PLCA 4ONEA 3GB9A 3VJMA 3GZ4A 2WK1A 3T5GA 3NM5A 4B87A 1E2GA 4XCQA 5EZ6B 3MFQA 4GI7A 2AZDA 4QU5A 3AQ4A 2V5VA 2OXCA 1X7GA 3ETGA 3OM9A 3BJMA 3GIDA 3T9BA 5I3CA 1OZFA 3TLEA 1L7MA 5IVHA 4YAGA 1TL7C 1CR1A 1U0GA 4XIJA 4J4BA 4KH1A 4E5PA 3GRAA 1NVBA 3HJNA 3Q4GA 1XK6A 4N7MA 1BFKA 4Q4HA 4TWAA 3RYHB 3E5NA 2WU3A 3EEOA 2VCYA 3D1JA 1RM3A 3I9NA 2DQYA 3FKJA 2MSWA 4WXMA 5KYNA 1KQPA 4MW1A 4ND3A 1JYSA 1N9GA 3RLFA 3F5FA 4CMAA 2B61A 1YB2A 4YGYA 1YZHA 2VC2B 4MVJP 3BDAA 3AWIA 3E9MA 1DL5A 2C7VA 1W19A 5EJ9A 3F3YA 5EZYF 1KDRA 1MKYA 4EFDA 2IXAA 1YFZA 1HORA 2VJCA 3KLOA 3KSDO 3EK2A 3M9XA 4Q4LA 4I8XA 5F35A 1SUFA 5FBVB 4YECA 3CMMA 5KQGA 1YL7A 1AKMA 1Z6XA 3C8MA 1C5KA 1ES9A 5DBEX 3HJCA 3H9CA 4C88A 4F3RA 1QLHA 3PDIA 3PFGA 5B6IA 1QIJA 2HIHA 3D6TB 1PJQA 3FW1A 2EKQA 2CWWA 4MRPA 4QQKA 3TOVA 3BMOA 4HX9A 4MB2A 2P2NA 4KO4S 5EHQA 5IDVA 3OCWA 4AUEA 4CM9D 4EPWA 2P91A 4BV8A 3B3GA 3VRHA 3TXYA 1K4MA 1W93A 1Z5VA 1BW9B 1Y3CE 2WVGA 3GX1A 3OM0A 4XQ0A 4UZFA 4LFCB 3V33A 3ZDYB 4E6PA 4FEEA 1QVAA 4UEOA 4QJ3A 2G7ZA 3HJHA 4YEDA 4CM1A 1IRIA 2NZWA 2RH4A 2H5EA 1EVQA 2ZIAA 3GLGA 4Z0PA 4B3GA 1GKLA 4BDTA 1GT91 4L85A 3UAXA 1ODSA 2HA0A 2NTNA 3C6YA 1P4JA 2ATIA 4JIGA 2ZT6A 2H4HA 2I1QA 3T1OA 3LBIA 1ESDA 1YJ8A 2VPQA 1WXXA 1KMIY 1WCV1 5DISB 3T9EA 3ORHA 1LPAB 4E11A 3M83A 4ZICA 5C5CA 4F12A 1GZSA 2XNJA 1G8SA 4G5HA 3WLLA 3NHZA 4ZI7B 3HKDA 3ODGA 1HNWB 1DG3A 5EWJA 2CJYA 5DTIA 3PPYA 4TLLB 1VCIA 4EW2A 3ZWWA 3RSCA 2ZSDA 1EZZA 2GK7A 3CH4B 4BQIA 3T61A 1BSVA 3GUUA 3VPGA 5DM1A 1DIHA 2UUAB 1VHWA 3VOBA 4CIDA 1VL5A 4MLDA 3Q88A 1A9XB 1ESMA 1PS9A 3D6JA 3WMGA 3H2YA 1BMTA 2WTXA 4OUKX 3ZN2A 4DQ0A 4ZN6A 3Q3IA 4IRMA 3C0KA 1Z39A 1QG0A 5G1OA 1FVXA 3D64A 5FD8A 6GPBA 3S8YA 3AVOA 4B85A 5I7OA 4F3YA 4ZGWA 4R8SA 1N6OA 1Z9BA 4ZKEA 3I62A 3Q7RA 1QNFA 4Q0MA 4ON9A 2JFQA 1GG8A 3QA3E 5GGYA 2EZ4A 2DWUA 2FPSA 2JI9A 3ESYA 2Z9BA 2VUHB 4GSYA 4OCZA 5B1HA 2YWHA 1ADYA 1EDBA 1U7OA 3MLEA 4LDRA 1WXDA 5K3DA 1MHPA 4DV4B 1MO3A 5HQ3A 3EF0A 3ILXA 4A23A 1EHIA 4L8LA 4V0OA 2A7QA 3GLTA 1O6FA 2PX3A 1NV9A 2ZWOA 4YT8A 4LXQA 4I4CA 3B89A 4L5CA 4DANA 2O8DA 3EFOB 1IN8A 3FPLA 3MJVA 1RKVA 4FE3A 4LMPA 1ECBA 2H1FA 3C5EA 3EY4A 3D4OA 1X77A 3EGIA 3MWDB 4WECA 3HP4A 3BRCA 3WXMA 1RHKA 3WRXA 4BLSA 5AKXA 2XBLA 1R9MA 3EPPA 3OLXA 1O5IA 3CLTD 5ALEA 4HSGA 3EZYA 3LZDA 3FPFA 1EA7A 3NTUA 5K3FA 4J29A 1N6NA 4OXRA 2J07A 2AC7A 2JJ2A 5BV7A 4GOOD 3BXHA 1KYXA 1TM5E 2IF0A 4WNYA 5CHEA 4I08A 3ABZA 1C41A 1FLAA 2X6RA 3SDSA 2C5FA 2Q8PA 1Y7HA 4A6XA 4JDUA 2VF2A 3DL4A 2PGNA 2MJLA 4OI2A 4LGVA 3FMPB 5LMCA 1M34E 5JU6A 3Q40A 4JQZA 5LDDC 1DQRA 2H8KA 5CB0A 5G4KB 1P5FA 4FSHA 2BZ1A 4OUDA 1OXMA 5FI0B 1JAXA 1FFEA 1RMYA 1FX0B 2B7BA 3K53A 3VSEA 4CR8A 3UT0A 3AXTA 2OYRA 1WXIA 3CY6A 1DFIA 5FLKA 5AI9A 2P0YA 5EJ2A 1CUWA 4V0NA 4JL6A 3RDPA 1Z07A 3ROKA 4K8RB 5D3ZA 5C3MA 1L9KA 3GRYA 4A92A 1HE1C 3B8EA 4PXAA 4BVEA 3KWFA 4Z4EA 4H16A 5THQA 1NXPA 2ZR8A 3COPA 2FRXA 2CT8A 3HKEA 5JRZA 3HPQA 3MB5A 5EZYA 2E6UX 2X58A 2HNKA 4K6CA 4L4YA 4ZZ2A 4QL3A 4DLXA 4U1RA 4E3ZA 5LL6P 3C7AA 3HADA 3IEKA 4H08A 1E6KA 4IEIA 2WLTA 2FSVA 5IBPA 1MX3A 3SF8B 3C5WP 2WE7A 2QMYA 3WQBA 4XSHA 5KYXA 1I3CA 1W5SA 3OTIA 1CS0A 1F0PA 2WHPA 4PE5B 2PKRA 4X60A 4FYWA 4YYEA 3QMMA 4RVHA 4KZPA 4L0DA 2ZJ2A 4PCAA 4ZU1X 4ZV7A 3A06A 4N0QA 4P4GA 2TMDA 1CYDA 3LX8A 4FYYA 1KP2A 1QV7A 5AMXA 2QY9A 1F8UA 4Y98A 1XALA 2A9FA 1UODA 3NHPA 3I28A 4Q16A 2WT8A 1M2HA 1JLRA 3W3AH 2D2EA 4ENTA 1QRRA 2D0OB 3UAZA 1IMOA 1I0ZA 5EMLA 2HADA 3TO5A 3QVMA 4PNZA 1O57A 1RCUA 2Q62A 3JZMA 3IE1A 2I0FA 1RWMA 3KUUA 2ZWVA 4ZVVA 4MGZR 3MD0A 2H65A 1POWA 4GIBA 2SHKA 2W2LA 1F60A 3KJXA 4L1KA 4KXVA 2OORC 2VT2A 5ALQA 5CNKA 1QDLB 4KQIA 1RQ2A 1PTKA 2R1VB 2GWRA 3LBFA 3OECA 5JATA 4KPYA 5A04A 1XTSA 1Z7BA 1VKHA 2G88A 4DY4A 1I7NA 4KQ9A 4NBUA 4MVJI 1MQ8B 3LTNC 3QE4A 1MPTA 1YT5A 4ZVTA 5HKOA 2HK9A 2JFYA 3RUEA 4WCFA 3TNLA 1IIBA 2WZBA 2P35A 1PL6A 1M7GA 2F9LA 1PF7E 3C39A 4OKIA 3ZWMA 4YMGA 4EUKA 2W7TA 5AVWA 2ZM5A 1F06A 4RS4A 4O4LB 2GAOA 1GPYA 3GBPA 3P9CA 1Z56C 3NDJA 3RFXA 2ZYUX 3NDRA 1T3HA 3WG9A 2GASA 1ZA1A 1ZOSA 2BFBB 2EARA 4CL0A 3QJ5A 2NT3A 2DFPA 3KJEA 4RDIA 3UTDA 1CUZA 4EK9A 4EUEA 3AERA 2XUJA 4X20B 1H42A 2GZMA 2CMGA 4RACA 4LRUA 5K0BA 3DDWA 3QPVA 1I0IA 1IXRC 4OH1A 1E2NA 1I6LA 1YI1A 4H1HA 1FMTA 4NZOA 2JFVA 1VHDA 3TFWA 2C0CA 2E5WA 1RZUA 4NPHA 3UGTA 1Z22A 4OOFA 3GPLA 1SIBE 2HCFA 5DIFA 3PXAA 5TS3A 4ZVLA 4JKYA 4KI0A 2QNRA 3UV7A 2XYQA 5JZSA 1YKSA 3DJYA 5IULC 4JL5A 4LHVA 3KJZA 1THGA 3R6TA 2GEJA 3BSSA 4Z4HA 4EYEA 3L7YA 1M2KA 3D7NA 2ID8A 4R8KA 3L7LA 1SOWA 2C2ZA 4D0GA 4E46A 5BN4A 2RB5A 1N57A 5JYBA 2VDRB 3Q8KA 1BKYA 1OVGA 3K31A 4UVDA 2MSLA 4P3NA 1H2BA 3QX9A 3ZU5A 1KI8A 3ZXSA 1EXMA 2V54A 4V38A 1IY0A 4J3FA 5AXDA 4EO7A 4MMYB 2HWYA 1KEZA 2FLVA 2FR8C 2WJVA 1KHHA 1IZ8A 3QU9A 3QU2A 1JKXA 4IDHA 4JCCA 5K1ZA 2C04A 1I2ZA 5DMHA 4DWJA 1EFPA 1OWOA 2O1EA 4GQIA 4N6OA 4DNPA 3KZVA 1FF9A 4EB6A 4JGGA 4WNCA 4RTLA 4RWEA 2IZ0A 5KOHB 1L3BA 1RPAA 3V9AA 2ZRJA 2FWAA 2Z8YM 3I45A 1W34A 2J46A 4DYHA 4UTRA 1XZPA 3VPCA 5JI2E 1V1MB 5FNVB 1JR4A 5EKSA 3BILA 5HUHA 4F4CA 4CCSA 1YRBA 3PLRA 3IDSA 4HB4A 4HNRA 4AMBA 2HSJA 3DZKA 1AZSC 2PYIA 3ENZA 4CMIB 1M73E 3DV2A 4JL8A 2CVOA 4FGJA 1TCAA 2FWMX 3LUKA 4KGZA 2XCOA 3RROA 3DLBA 3GLGE 4EVIA 2O8CB 5BURA 3PXBA 5TEWA 1Z15A 2MYNA 4IICA 4PZAA 4X7PA 2B20A 1TYEB 2DCUA 5FLEX 2JLUA 5ER6A 2XAUA 4UVEA 1P0FA 4LECA 2PN1A 2PEYA 1TX4B 3EQ2A 3MSCA 4HVTA 1KZ6A 3O2JA 2VAMA 2YV1A 1XZAA 3PWTA 4BEBA 3ZQ4A 3K0HA 4ZYVA 5T4FA 4X8LA 4BFSA 4H7FA 4Q82A 5E4YA 1DOZA 2QTCA 3G1UA 4UREA 3V7FA 4TVSA 3UW1A 1G8FA 1Z4OA 1KJ8A 4RY2A 1NQTA 1PR1A 4N3CA 3WK9A 2C9BA 3ZD6A 2QZ4A 1D0IA 1DO2A 1XFDA 3CZ9A 2BLNA 3DF7A 4EW3A 1IBMB 2R00A 2V6GA 4QUHA 4CKCB 5D51S 4BP3A 5CEJA 1GCAA 1Y5NA 4WJLA 2WDZA 3LW7A 4BLRA 3GUZA 1QX4A 5AVSA 3RIHA 3HUDA 1TJ5A 3S2GA 1MJGA 4YCLA 4EZIA 3L7DA 2VZEA 4M9UA 5CXXA 1A82A 1JSCA 2IHBA 4RBNA 2Y4NA 3H1AA 3DONA 3MWJA 4EVQA 3KT6A 4UW9A 3K0BA 5DRTA 2WHYA 5AUNB 1I1OA 3LKZA 1PZFA 2XTAA 1EFCA 1PGQA 4IQ4A 3VVMA 3Q2IA 3MMNA 1PHPA 4DJTA 3LPMA 1VJ5A 2WJ6A 1GCGA 1MQ9A 2FFRA 2WHRA 1XCPA 1QHXA 3TIXB 3D7RA 5KSYA 3JQ6A 3FZEA 4G4IA 2V1UA 4Q1BA 3LM8A 2MWMA 4INAA 4E1BA 5HF6A 2XBMA 1WEHA 2HN9A 4KLZA 4HZGA 2WMYA 2NYUA 3DAFA 4DLUA 1G5RA 3QX3A 3O31A 1TW3A 2CFCA 2IW3A 3FIJA 3IAXA 4XJXA 3QKRB 2HA6A 4Q9KA 1VL2A 4QXRA 4FHZA 4MR7B 4LZZA 1WABA 3GW8A 3GZNA 4IEEA 4TTIA 5AOCA 1TM2A 1Q50A 1J39A 1CZLA 4BNTA 4WOPA 2F00A 1WSAA 5JD5A 2LTAA 4BY9E 5F3WB 4N5HX 3VR4H 4DR1B 2XQGA 2P78A 3QENA 2Z98A 3R3WA 4IMPA 1XDBA 2KJQA 5DDIP 3NDIA 5AHXA 4D0RA 4UNSA 3L0ZA 2QM8A 2GPAA 3UC9A 1CU1A 2CLEB 3FHJA 4YRLA 4D0NA 4FR5A 2BEJA 2B9EA 4TV9F 5KS2A 3ZD7A 1AF7A 1WU7A 3A3OA 3VZQA 4DVJA 1TUBB 4ZCIA 1BGVA 4U5XA 3UUGA 2OYSA 1VB3A 3II6X 4MP6A 4NABA 3EMKA 1SCNE 2W4MA 1Z0JA 2JLWA 1W4ZA 1G3UA 2FEXA 2XOKD 4RLSA 2GR9A 1G5IA 3Q6IA 4TUYF 2EQ5A 4JQYA 3PRJA 3ECAA 1XG5A 3HBNA 2F7SA 4GEKA 4XWTA 1APBA 1BRTA 1JSLA 4HNHA 3C15C 1VL1A 2F3SA 5BOVA 3UMJA 5KNBD 2V0NA 2HRRA 3C1AA 1Z33A 3AU9A 2BL4A 2P3LA 1QIKA 2G5TA 2O2SA 5DW0A 3VISA 3H11B 4Q9HA 3KXLA 4HTFA 3S1SA 1KPIA 4FPXA 5E2AA 2D1QA 3CRZA 1XF1A 3BICA 4FZJA 4GXNA 1US8A 3L82B 2ZUVA 4KDFA 1DV2A 1O54A 3EGDA 3JW8A 2JGRA 4PWZA 2X4IA 1WZUA 1M34B 2PTHA 3PQFA 2ZTVA 2ZYHA 4E07A 2X2PA 1IZYA 4F5ZA 1IVNA 1FMFA 5KOJA 1G9SA 4HX2A 4MLZA 5I7SA 3KLNA 4LKRA 4OXIA 5JBNA 3HSSA 3E22B 3FOWA 4B3TB 3A6FA 1A4UA 3LFTA 5J4KA 3KQWA 4RFSB 4X90A 1GNSA 2GWHA 5KTTA 4FXOA 2B8NA 2DVMA 4ME6A 1WB4A 1WSWA 3EMBA 3FB4A 3UHPA 3EZFA 4R0VA 2QLTA 3STHA 3L6CA 4BFZA 4JJ8A 1KOJA 4RMJA 5JAMA 5CDSA 3FMGA 3MIIA 2HHJA 3HI4A 2Z2YA 1MZPA 4WOKA 3C74A 4PGHA 2AH5A 5B4UA 4AS3A 2I54A 3GARA 4PZ0A 1FFSA 1XA3A 2V8OA 3U19A 1K6EA 3HUTA 3R6LA 4I4IA 4BDSA 5EKDA 4NMHA 1D2AA 1ENYA 1OFUA 3L4KA 2AG6A 2P41A 3X1ZA 1WVMA 3VNUA 3DE4X 1KY2A 3HRKA 1MCZA 3K0SA 3KKQA 1ZL2A 1NP3A 3FMIA 1QRAA 1LDNA 5K45A 3T5MA 4LDPA 2HI0A 1XRMA 3AHGA 1E4EA 5CW1A 1CZKA 5LM3A 2G0TA 4R4JA 3ZU4A 1M7HA 1R4AA 3JVVA 3OZGA 1YRHA 1FSGA 5T8KC 5EIWA 2PL9A 3REGA 5L4NA 5GINE 1OLUB 4X7MA 1XYYA 1U0FA 3B1YA 1FU8A 1REQB 3DEKA 2XOXA 1OXVA 3NHKA 3VAYA 4QGGA 5LQAA 1ZG3A 1GYRA 1H1TA 4C1NA 2VI5A 3B9RA 4JT8A 4X1OA 2F9FA 4KX5A 4JUBA 4DCVA 2ZQ5A 1PG5A 4UVGA 3PENA 3LDHA 3TECE 1KTIA 3RWOA 4MWSA 2FY8A 4HDMB 4J0HA 1A69A 1BA2A 5D01A 2OOKA 2BEUA 4N54A 2DR2A 1P2GA 1WF6A 1FUIA 3MCAA 3D2LA 3GVPA 4TYMA 1K8YB 1X13A 5DFAA 2WSMA 4YCBA 5JSZA 1SXPA 4NXMB 1PEKE 1VB5A 3L1JA 4ZPXA 1CJBA 2F1KA 4TVOA 1R4MB 1Y4AE 1QQTA 1U8XX 4F5YA 5B2FA 2WD8A 4R01A 1MV5A 2LNDA 1I7LA 1JDBB 3CUSA 5JFTA 2J85A 2JI4A 3JQAA 2QQFA 4B83A 2ZIWB 3ZE7A 5BN5A 2I3GA 3OJ0A 4V1CI 4GD3Q 2VDLB 1EWYA 3PRYA 4E22A 3PZRA 5CA0A 1U6IA 2VAWA 3RS2A 3TW0A 2IYLD 1MNQA 5TY0A 2CUZA 1D5WA 1DELA 2D1RA 3AF4A 3M2PA 4UNIA 3D6UA 4EGCB 5KWJA 4AZWA 3CNQS 4JJ7A 1BMFA 2R8PA 1L6IA 3CB4A 4XFDA 5C9ZA 1ISPA 2IOFA 4S0ZA 4YBRA 4KHZA 4ACBA 2WYIA 3A4MA 1P9OA 1STOA 3BCHA 1BE0A 4KMOA 3JQ7A 3W8RA 1N6KA 2ZJ0A 1E1KA 1ZNZA 4US0R 2JCSA 4JLUA 3HXLA 4MSUA 4PGAA 1GCIA 2QP4A 3ZXUB 3N8DA 4DCMA 4DLNA 3MWEB 5A7HA 1FDRA 1JFFA 3N59A 1MO2A 1WPGA 2C84A 2ZJZA 4B7XA 4IXNA 4EHIA 4MINA 5EIEA 1TD9A 1UBLS 3RGGA 5ISMA 1EM8B 4I9FA 1EH5A 4QEDA 1KAHA 4XX1A 2FQWA 5EP3A 4Q4HB 3VPXA 4EGFA 3AVUA 2DSTA 1KTVA 4Y6PA 3N0XA 3OQIA 4TUYA 2E0IA 3GT4A 3IIMA 1UK9A 3CLUD 1Q22A 1YDEA 2K4MA 1EQUA 3PSHA 2IUYA 3GGJA 4H6PA 1NE7A 3UUWA 1N9GB 3LBAA 2PMFA 4YJFB 3TLGB 1CSEE 3ORRA 3RARA 4EUFA 4FDMA 2X42A 1XF9A 1EVKA 4YIKA 5A0VA 1ADFA 4UTVA 3SJCA 4WBNF 1YS4A 5K0SA 5FPQA 3LQRA 4J75A 1EWKA 2W22A 4E31A 1DCFA 1WMEA 4FZ5A 3V2UA 4G8JA 2H2WA 2YHIB 3PU6A 4XVUA 5JPIA 1Z45A 4OG2A 2XWBF 2C5AA 2C07A 3E18A 2RI1A 3LOUA 4J90A 5FF9A 3CU5A 3SLGA 4DZRA 1BROA 4E5KA 3OEHD 2ACWA 2HWKA 2QN8A 3PDIB 3G0DA 4IS3A 2ADFA 3LI2A 2WF9A 2VK1A 3HVJA 2ZUBA 3WBFA 3L1VA 4A16A 4UTPA 5JD3A 1TTPB 3GRVA 4K9OA 3ET5A 4GX2A 2WFLB 2BFEA 1ZGAA 3ND9A 1RLUA 4QJ5A 2ZRHA 3L0YA 4FFPA 4C4SA 5HNKA 2EJVA 2QBYA 1ULTA 4AI6A 5T41A 1XCMA 3BTOA 1KP9A 3ZGVA 4RVCA 3VSBA 1VXOA 3KXPA 2Z6AA 2O8VA 4P32A 5JVDB 3NTQA 1QE5A 1W5FA 2VSQA 3D8BA 2QTHA 4JLMA 5HOEA 2XTMA 3K05A 2ZRPA 3SQXA 1T0HB 3GRUA 2GN4A 2X4GA 3OTGA 2V7PA 4JCOA 4QDZA 4UZEA 5AYVA 1DIOB 2X7JA 1VE9A 3U3JA 1CY2A 3VUEA 4BMXA 2PQMA 1BDJA 1SCAA 1LPBB 4CU2A 1PI3A 4PC1A 4QTXA 1JEAA 2WKWA 3T7KA 1X3SA 1O6GA 4JLPA 5DN6D 5KYUB 1TYAE 5DI3B 1A72A 3QJGA 3ZDBA 1E9RA 4DMMA 5TR9A 2W2QA 2KM1A 4GR9A 4AUNA 1YBHA 4XA8A 3N2NA 3QF7A 1GZ3A 4OMUA 3EEYA 2GCOA 4D4LA 5HFJA 3S2SA 1T9DA 2GK3A 2QIPA 2EWWA 2WJJA 3TSYA 4S05A 5ALFA 2ZI6A 3PVZA 5AJWA 5I7EA 5IAKA 2MCFA 5JMOA 2G3YA 3AC0A 5C81A 1HLGA 4ESHA 3PRHA 2WJAA 3CEJA 3QFSA 2WUWE 1TFUA 3U4CA 3N3AC 2HJVA 4TL6A 5TSDA 4U02A 2ZSEA 2C3UA 4JYZA 2IY7A 1TZCA 3HJAA 5KWSA 3KWLA 1RWQA 3RHSA 3BIJA 1U7DA 2CHGA 4MCAA 1DO8A 1BE6A 2PZJA 3W3AA 1QK4A 2Z8ZA 1P6QA 5DSZA 5F3DA 2OHHA 2RFLA 1B0PA 3Q9LA 5CDFA 4BNWA 3U16A 2ZVPX 3SLRA 1QFYA 1KIFA 2GMWA 1R8XA 3SIWA 2HDHA 3IBYA 3PUZA 4AJJA 4ZDJA 4TT3D 3GJ0A 1FS4A 5AK0A 3PL1A 1QS0A 4ESOA 1OHHA 3MJSA 4HLNA 5LKRA 1T8YA 2R2AA 2B1QA 3C6ZA 3NV7A 1HE3A 2AW3A 4W1RA 1YR9A 1UUFA 4C03A 3OAAD 2WFMA 1XXHA 2VP6A 1F2VA 2PGLA 1ZMBA 4M54A 3PR3A 1CUHA 4Q01A 3TOCA 4EEZA 1WCIB 1XVLA 1CD5A 3AIOA 4FCTA 5F21A 5K3FB 4BKPA 2YWEA 1N2BA 3Q12A 4XJTA 1M2OA 1LTQA 1MD9A 1EKXA 1B43A 4P82A 3U6KA 2ZI9A 1RC8A 3SS7X 4M55A 3U2QA 1XD2B 1OWNA 1PLKA 2P3QA 3LFHA 4ADSG 2JDID 4B4UA 3EHEA 3CW9A 5LNK6 2OCYC 1M2NA 2M6SA 5K3CA 3SC2A 2XKJE 3T34A 1XRJA 1H3EA 1P61B 3IVAA 4FS8A 4YH1A 4TZ0A 2R7MA 1E64A 2IEIA 3D6VA 4HN9A 4RH0A 1J5PA 4BO3A 3DVRX 2HR1A 1N5KA 4E33A 4S2EA 5NULA 2C8VA 2ZTUA 3H2IA 4JDPA 5ALRA 3UCFA 4BQEA 1T2AA 4W5JA 5E3IA 1R9GA 1P0PA 2AGVA 1G20B 2OCAA 2YWFA 4OHMA 4OLBA 1TKCA 4YONB 1UP7A 3V2HA 2IWHA 1ND6A 4U2EA 2VDWA 2VAVA 4B75A 4WBNA 4JS0A 4KZKA 3W6NA 1W29A 4CM6A 2J5XA 1ECLA 3G8AA 3JVIA 5E6RB 3RIMA 5FI3A 4Z7JA 1DQSA 1C1DA 3F4LA 1Z0AA 4UEKA 1W0JD 4A27A 3ZGOA 4HEJA 4V0KA 3T3DA 5KYXB 4QXOA 2Q1TA 4PLGA 4QGAA 1CS0B 2ZUWA 2WHPB 1W46A 2HIAA 3CNNA 5IT4A 3H5TA 1F6WA 3D7SA 4DLSA 1NX9A 2IYQA 1OA0A 4P5PA 2X15A 3MRXA 1SCBA 3AF2A 1EVJA 4EPTA 5CA0B 2K7ZA 1IVYA 2L0XA 1C29B 1A2QA 1H2WA 3E5RA 4KVAA 2H7CA 1QBKC 1O4WA 1XCOA 4F5DA 3U7GA 2A33A 3QE9Y 1E3IA 1R0CA 4HOYA 3IMEA 4B2IA 3AVYA 1SPXA 4HSEA 2PU5A 3SM9A 2HJ9A 3N70A 3MQFA 1P8AA 2H29A 1CQJA 3IUPA 1H0SA 4ZVRA 1HY3A 4FZ3A 4EY6A 4JYAB 3BSWA 4HRVA 1T9GR 3ESQA 2DTXA 1L5LA 3ZLBA 1NZFA 3INGA 3I3OA 5DGDA 4AG5A 2HBZA 5BW6B 2YXDA 3GGCA 4P36A 2NLOA 1LUAA 2REQA 1WMAA 1XN1A 2ACEA 2HUPA 5AK6A 2PZ8A 4M22A 4QUDA 1M9NA 4U8HA 4ALJA 1QAOA 2YBDA 5JJIA 3EULA 1ZH2A 4HDAA 1BXGB 4YJGA 2I4OA 5TQ2A 3VZDA 2QTZA 4CHTA 1PQUA 2UZ0A 1L4YA 3L0DA 3W7AA 3TQCA 3WK5A 3E82A 5IDXA 4I66A 5EWMA 2V59A 4HUQB 5DJ5A 4B3JA 1P4RA 4CL8A 3HABA 4D0LB 2GAAA 5AXAA 4XOUA 4JP2A 5B4TA 2Y2UA 1GV1A 1II8A 2EIHA 3MILA 3Q9NA 3K70B 4CMKA 2I55A 2ZCVA 4W99A 1QGUB 3BGIA 1D4FA 2HGZA 2NYAA 1HI9A 3C8HA 4I8IA 3SE0A 5KCZA 2B4RO 2JF0A 1A76A 4RPKA 1YUNA 1U2SA 1Z6ZA 4OKNA 4PTYA 4V2UA 3AERB 3OLVA 1YMVA 3I0ZA 2IOYA 3F6CA 3MWGA 3WGNA 1KK3A 4BMOB 1ZNWA 3KQLA 1NFFA 1MX1A 2JFNA 2OLKA 4XH9B 4KGDA 3IULA 3MB8A 3SZOA 5I9BA 1YCDA 1E5TA 2QSYA 4HWSA 4LGYA 5A5DA 3LF1A 4WOJA 2MR5A 2V7XA 4KL8S 1GDHA 1JPUA 1W8DA 2HSDA 4XRRA 1RBYA 2VATA 2VDQB 2Y4OA 5B3AA