4MDFA

Structure of bacterial polynucleotide kinase michaelis complex bound to gtp and dna
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSNFCRGLVSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of bacterial polynucleotide kinase in a Michaelis complex with GTP*Mg2+ and 5'-OH oligonucleotide and a product complex with GDP*Mg2+ and 5'-PO4 oligonucleotide reveal a mechanism of general acid-base catalysis and the determinants of phosphoacceptor recognition.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase/dna
molecule keywords Metallophosphoesterase
total genus 66
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4mdfA00
1OH7A 3AQ4A 3K0AA 2VHTA 1T5IA 2BC9A 3GLFA 1E9SA 1DTSA 3KKPA 1H8HA 2EFGA 5UKDA 4B32A 1YU9A 4XSGA 1OSNA 5KSOA 3THYB 1VKJA 1G21E 1JALA 4D80A 4TYNA 1E9CA 2QAGA 2RAPA 4NCNA 5JWRA 1KGDA 4URZR 2PJRA 3VR5A 4LHWA 4U7DA 1KJZA 3K0FA 2QAJA 2VQSA 3B1YA 1IXRC 4HZUA 3TSOA 1KO8A 2BJVA 3O8RA 1E3MA 5FPKA 3M6AA 3FFAA 2OFWA 2P65A 4Q4HB 4Q1AA 3LA6A 1J8YF 3AVYA 3LBNA 2V7QD 4HZUB 3EW9A 3M0EA 4Y0AA 4M8NE 5EP3A 2QUZA 1JB1A 4D4JA 1DAIA 1BH2A 4DBLC 1LV7A 3TW4A 3MAAC 1JQJC 5FBWB 1TL7C 1QHNA 5JECA 5JEEA 2ZRDA 2ZJZA 1CXZA 1AZTA 5CDFE 1XMIA 1NLFA 3L8ZA 4OK5A 1G8FA 4KLZA 4B43A 1Z0JA 2WTUA 2QAGC 3K9LA 3MCAA 3RRYA 2PX0A 1F2UB 4NKRA 2RGNC 4II7A 1YHNA 2GAAA 1GITA 5AJWA 2IF2A 1GRNA 3PIRA 1SVSA 5JJKA 1Z6XA 1F2UA 2XZPA 3U3JA 4LCBA 5TB5A 2CMKA 1HT1E 1NG1A 3CR7A 1E99A 2NZ8A 1KKLA 4TWZA 2YC2C 3QF4A 2QBYA 3LW7A 2HV8A 5J4HA 4E5UA 3EA5A 1SKQA 1IONA 4UJ3A 1UDXA 2GDJA 3NBYC 3SI7A 3I72A 1XNJA 5ELXA 2CL7X 5FOSA 1KSHA 3B85A 3EPJA 4FMBB 1R0WA 3EASA 4NZYA 4NTZA 1VDZA 4N0EA 3L2OB 3M1IA 2ZXUA 2DY1A 2ZM5A 3MUFA 1ETUA 1G3MA 2FWRA 4B2IA 4HB3A 2O0KA 1KYIA 3AP2A 5CYPA 5J4YA 4GDFA 1Q0UA 1SXJA 1AN0A 2ZI5A 4CYMA 2HJVA 3I4LA 3L0OA 4FW9A 5F9HA 2FSGA 1E2LA 1N6NA 2NO7A 4X8MA 5C2JB 1IBRA 4BFYA 4Q4AA 3GD7A 3VX4A 1EGAA 2EFCB 4DLRA 2R62A 3CX8A 1D6JA 1G4AE 4V02A 3WMEA 4UNNA 2DYKA 1KSGA 1UKZA 2TMKA 4GNKA 1GRQA 4Q4AB 2IEYA 3G82C 4JSTA 2JLYA 2RCNA 2GJ9A 1XP8A 3U60B 1SXJE 1W7AA 4BLOA 1QHYA 4KHZA 3WY9A 3T06B 3EZ2A 3GJ7A 5FPTA 1WB9A 5GJBA 2AWOA 2R8RA 1N6OA 2GETA 4CW7A 1NF3A 3UXMA 5GJCA 2Q9BA 3TH5A 3PJRA 2N1BA 3TBKA 4A0GA 2W6JA 1ZMXA 3B6EA 3OF5A 2ANBA 1QHHB 4KO8A 5LB2A 1XEWY 2NTYC 2ZROA 1N6IA 5FTLA 4HI0E 4JJZA 1WE2A 2AK3A 3PUYA 5CDFA 1KZGB 4LI0A 2IF0A 1G3UA 1ZCAA 4Q7LA 4C0LA 4HATA 1VG1A 1QDEA 2H1LA 1I2MA 4OHVA 5CB8A 1XTJA 4D0NA 4PAQA 2ZRFA 1VCOA 3RLFA 3GLGA 3ICEA 4QG7A 3NBXX 2ZE5A 1Z07A 3W5IA 3AKEA 4DCNA 1ZVQA 5D3MA 1E69A 4PFSA 1KK0A 5GVSA 1E2PA 1SQ5A 2EYQA 3H1TA 2HDNB 5DH9A 1N3BA 2EQBA 3CLVA 5DHFA 3KUDA 3VNVA 4KSBA 3LBHA 2H8KA 4MUAA 3AUYA 3AEZA 1W5SA 1IN8A 3O8DA 2QNRA 1DVRA 3BH0A 1X6VA 1OXXK 1WBDA 1SVWA 3ICQB 4Z8YA 5SZJA 4D81A 3RVBA 1XD8A 1EG7A 1HY3A 2WIBA 4GP7A 4MRSA 2V1UA 1CJVC 3FTQA 4U02A 3BS4A 4AC9A 2XSZD 3RAPR 3REGA 2BM0A 4PO9A 4M1SA 2QA5A 5G3YA 4ACAA 1LY1A 1XTKA 4US0R 3K0EA 5A5GA 4ZCLA 4CF7A 1Z2CA 4QJ5A 1SXJD 1J90A 1TU3A 4B2PA 1FNNA 3EX7C 2ODWA 4PHGA 1JXMA 3EG5A 3SEAA 4KBGA 1YZLA 2WMOB 1YRBA 4BZXA 5FBQB 4PZLA 3CUEF 3LVRE 1N25A 3RC8A 4JLKA 3LNCA 4MQBA 4K81B 1ZIPA 4Q1BA 1XU4A 3PEVA 1UAAA 2FGKA 5A4JA 2Q6TA 1X8LA 2Z5FA 4QM6A 2IS6A 1T6NA 3KKNA 1SVIA 2VP5A 1U0JA 4M4SA 4MITA 2ERYA 5LPNA 2IYQA 2WPDA 3FMIA 5JHHB 1D2MA 4QL3A 4TSFD 5AWFC 1BO6A 1A1VA 2Z4SA 2VA8A 3SBDA 4EPRA 1OIWA 4W5WA 4XH9B 3W3AA 5BWMA 1CLUA 2BEJA 1SKYB 2YWGA 5EE1A 3X1ZA 3EZ9A 1KMHB 1ZUIA 3P4XA 1H8ED 1DARA 2OXRA 5IHPA 3FDIA 1IM2A 2ZR7A 2XEXA 1T9HA 3SC3A 4AI6A 4TLEA 4HEJA 2V9PA 3CRVA 1X86B 2BDTA 1KHTA 3QY0A 5EJEA 4NONA 1XD2A 4G5RA 4DSNA 1QG2A 2VSOA 3QUSA 2QY9A 3AVVA 1GUAA 621PA 2GNOA 3AVOA 1HQCA 4JLNA 4LJYA 1U8ZA 3LBIA 4D4KA 4M1KA 3K70D 1UKEA 2GVDC 5B64A 2OUKA 1C4OA 5E7IA 2GHIA 5C18A 1ZYUA 2WAYA 2JLSA 4BFVA 3TGPA 4B2LA 3D31A 3I3SR 3FKQA 1Q3TA 3U4QA 4YMUA 3AV0B 5FUXA 4CEJA 2W83A 1KAOA 3IIMA 4A9AA 1KKMA 1Q1QA 2VHJA 4JT2A 4BFXA 4F4IA 1DS6A 4LYAA 2G6BA 3WNCA 1E2NA 4IDHA 4YXWA 2H18A 5G3ZA 3GJ4A 1KDRA 3U7HB 3C8UA 3AF4A 1OYYA 3L43A 4B3DA 1M2OB 1KI3A 2VP6A 2W2VA 3E1SA 4H9GA 3TR0A 3W9YA 2PEZA 3I5YA 3VR3A 2IYYA 3BIFA 3I5XA 4OI0A 4BFWA 2IBMA 1AKEA 2RMKA 2QRZA 2OLKA 1GIAA 1IJFA 4R9UC 2CE7A 3QXSA 4Q48A 1NVVQ 1XEXB 4Q9HA 2IT1A 2GEVA 4A82A 3SQXA 4BLTA 3PUWA 1G16A 2HT6A 4PPGA 3DDCA 1DAFA 2B92A 1MH1A 1ZW6A 5FTNA 4DRZA 1KO1A 5DYIA 1NN0A 3W3ZB 1P61B 1NSTA 1R0ZA 2H92A 3BH7A 3V4FA 3Q7QA 2J0UA 2P6UA 1LB1B 3K1JA 4I1UA 4U00A 3MLEA 4TMWA 1YRAA 1E1QA 4DLXA 4V0MA 2JLWA 1DAMA 1OFUX 5L3QB 1Q21A 3Q5DA 4HLQB 3B13B 3OEEA 5K8IA 3LY5A 1WF3A 4QFMA 4EFMA 2QMEA 2ZJ2A 4ESHA 4C0SA 4PXAA 1MV5A 3KQHA 3WBJA 5KSZA 1W1WA 5FL7A 1KJWA 3GCGA 4D0LB 2ZI6A 3CZPA 3QKRA 4EPXA 4RKFA 3SHWA 5CJ2A 5EQTA 1TQDA 3MD0A 1HEIA 3AGQA 1G7SA 1FUKA 1FUUA 2C9CA 3FWYA 4MKIA 4NBSA 1BYUA 4WBSA 2OILA 2IYWA 4NYMR 1E2HA 2F9MA 3RRNA 2OV2A 1TUEA 2QI9C 5LD2C 1TMKA 4DVGA 5CIWA 4GZLA 4IDNA 1OH6A 2Z6VA 4DCUA 4J0QA 4HDOB 4KVGA 5L3RA 2OESA 2C9YA 4M1MA 4YDHB 4AKEA 2RGDA 1OFHA 2DFLA 4UQOA 4HDQB 2KWIA 2ASEA 1DAGA 2R2AA 4I1VA 4M0LA 1OXVA 3PUZA 5HCNA 2J0UB 3X1DA 1T0JB 1KOFA 2ZYUX 4DDVA 4ACBA 2VF7A 4LV5B 3DVLA 5DNYB 2ZRJA 2C8VA 4I99A 2WBLC 3IIKA 3QOFA 4NL4H 3U7FB 3B1XA 4RCYA 4DB2A 4CZ2A 3AKYA 3RSLA 4EPYA 4C0QC 2ZSDA 1E2DA 3VR1A 3ADCA 1XRJA 3D6TB 1BS1A 2PLRA 1A82A 2ZE8A 1VYUA 3QKRB 4URVR 4OJKA 4WZBE 4QHYA 5DI9A 3U5ZB 1XTIA 4ZI3A 3GEIA 4MDFA 4TSFA 3A36A 5SZKB 4GT1A 2WPDD 2F1JA 1YE8A 1Z22A 1P2SA 4QBFA 4F93B 4ZCIA 2F55A 1GP2A 4WAUA 2OBMA 2R65A 2DWQA 3L0PA 1NMYA 2J3EA 3OEHD 2Z43A 1PLLA 2P5SA 2BKUA 1GG2A 1KI9A 1X1SA 1AM4D 2F6RA 1RW4A 4Q47A 3CH4B 2XJ4A 2D4HA 2CBZA 1HYQA 1LS1A 2YJTD 3Q3JB 2AL7A 1XCPA 4PHTA 1N5IA 4YONB 2ZQ5A 3U3MA 3I1FA 2OT3B 1W4AA 2OCAA 3KFXA 3LLUA 3NG1A 3UPUA 4I4LA 1M1YE 4TYQA 1FL9A 4V0ME 3B78A 4LX0A 4MKGA 2ZRCA 2FA9A 1C1YA 3HP1A 4PC3A 4XD7D 4GBMA 4K8OA 2CHGA 1TTTA 1TAGA 2BHRA 4E09A 4DJTA 3BB1A 4Q03A 3GJ8A 3SYKA 3WP0A 3A6PC 1XDBA 3UKDA 3HR8A 1Z3IX 2QEQA 1ZIOA 2C9OA 3QVUA 1W36B 4WVFA 1G8YA 1U0LA 1EFTA 2D2FA 4JJKA 3R9WA 2IYVA 4TTRA 2W6JD 5BXQC 1R4AA 5KUTA 3U7EB 3EXAA 1P62B 2V4ZA 521PA 4KYIB 2AXPA 2WWIA 5GVRA 3CKLA 1SXJC 4XD7A 2QBYB 1UDWA 3UANA 4DT1B 1ZNXA 1VIAA 4I1OA 4X8LA 5IF9A 1KNQA 4HSEA 4B6EA 1OB2A 2OFXA 1E0KA 3N2IA 3TVDA 5KSYA 3GLIE 2DB3A 4Q4JB 2QGNA 2EWWA 3PEUA 4MRRA 4PZZA 1FZQA 4LJ5A 4RD3A 3SU8A 1N5JA 2GZAA 2JLZA 4D25A 2BMEA 5DYGA 3AVUA 4Q7MB 1G4UR 2BBOA 2DPXA 2PT7A 2YOHA 4LJ7A 6Q21A 2UZIR 2MSEB 2JIZD 1DAKA 3CRQA 3T1TA 1KNXA 1AS0A 1DAEA 4IEEA 4C0JA 4TT3D 4LSGA 3KQNA 1GZSA 1SXJB 3SHFA 2R6CA 4CEHB 1TADA 3RC3A 2ZRGA 4N0DA 2QMHA 4ASUA 2ZRAA 4HAVA 4AURA 1IQPA 1BIFA 2ZRPA 3GJ0A 3B1ZA 3VX3A 2O8DB 5IK2A 4OI1A 1E2JA 4BZQA 5KU1A 2Z0MA 2KI5A 3FOZA 1AIPA 2JAQA 3KUCA 4I1SA 4LV6A 4BQSA 1VCNA 1LVGA 1NN3A 4Q19A 5HPYB 2IS1A 1EX6A 4TLAA 4DLYA 3OAAD 5FBVB 2LKDA 1ONBA 1YZNA 1PLJA 2DCUA 1UEJA 3OFNA 1NMZA 2IHYA 1Z63A 4Q18A 1NG9A 2G3YA 4PQRA 2R6AA 4B3GA 4Z54A 2GESA 5LB4A 4OI2A 1L4YA 2ZSFA 3NXSA 5E4FA 4PTLA 5FL7D 4EPVA 5JSZA 1N6RA 4DZZA 3AF2A 1OKKA 1OHHD 4OHWA 3QBVA 3THXA 2C98A 2ECKA 2ORVA 3H0KA 1K6MA 2XITA 2CCJA 3I92A 2J7KA 1W0KD 2IWRA 2H17A 2F9LA 3EAQA 3ZDQA 1GVNB 1XZPA 3X1WA 1NBMA 1CEEA 4V0NA 4IOKA 4XWOA 4UKDA 3PCRB 3FMOB 1P4SA 1UBCA 2WWFA 3AVXA 3CH5A 1Z47A 2ZYVX 3M4YA 1GDDA 3QXXA 2PX3A 1JNYA 3BD9A 4ZO4A 4JL6A 4HAYA 3GPLA 1G8PA 4LBZA 4A1FA 2A78A 3B1WA 4XJXA 3RYTC 1L2TA 1TUIA 3AP1A 4XWKA 1S1MA 1LF5A 2OG2A 1Z8FA 3ZIAD 2O8DA 3CPJB 4CEIB 3BBPA 2CHQA 4OKSA 4LRWA 2F1HA 1HE8B 1P6XA 2YVUA 3GQBA 3DKVA 4LGMA 3WP1B 1E4VA 3NEYA 4HDCA 4O2RA 1RKBA 3DO6A 1G9XA 1FPMA 1N0VC 4HUQB 4CEIA 2FOLA 2IYZA 1SHKA 3NHAA 2G1KA 5D3MB 2UKDA 4JLVA 2A30A 3LLMA 2KBEA 4LK2A 4GOJA 2X1VA 1FOEB 5CYOA 4JKYA 3L0SA 2A5JA 2VO1A 1YZUA 4NYIQ 1QBKC 5EXSA 2ATVA 1XX6A 2GVZC 2VYFA 4ZKEA 4AIIA 2ZREA 5IT5A 1TQ4A 4B34A 5TDHA 4OHYA 2SHKA 3L0IB 1E1QD 4ZDWA 2R6GA 3UMSA 4KYUA 4WW0A 5JSZB 1NSFA 2BBWA 2NQ2C 3NDPA 2IW3A 1UEIA 2J5XA 1Z08A 2GILA 3C14C 4MYHA 2FFHA 4RJLA 3SYNA 3SQWA 2WVJA 2AFIE 1KK1A 3JZMA 1ZM7A 5JFGA 1W0JA 2OBLA 3TMKA 3W90A 1QZXA 4JLJA 4OL0A 1KDTA 2BMJA 2ZE7A 3NC1C 2K5UA 1W0KA 3BH6A 5DN6A 2EFHB 1LF0A 4AG6A 4GFDA 1HE1C 4RD1A 5IK2D 1MR3F 1EFRD 2CK3A 2Q3MA 4B6FA 3BFVA 4KITB 3JVUA 3EPLA 2A5FA 5CITA 2B7BA 2NPFA 2G0NA 1G8GA 3VKHA 2RKOA 1JPNA 2GCOB 3DKPA 3C5HA 3GFOA 2N46A 1LS6A 1G3RA 1GKUB 2QM8A 1NI3A 1OIXA 1JAIA 1KMHA 1N6PA 4DEXA 3QPUA 2VLIA 2YOFA 4US2R 1OH5A 3K09C 2JLUA 1CULC 2Q9CA 2QN6A 2QMUA 3LD9A 121PA 1XJ0A 3CB4A 4IRUB 1IN5A 3SS8A 4XVUA 2O8CB 1Q57A 2VIIA 3AM1A 2ZVQX 2QTFA 3O8BA 4M9SA 3H4MA 4NPHA 3FKSA 1XD2B 2EFEB 2VH5R 1CR2A 1G7RA 4UXHA 4ASUD 3IKJA 5FOVA 2O8CA 3FPAA 2X77A 1ZM9A 1MO4A 3K9NA 3DOEA 5IDVA 2WJJA 2GF0A 2F3TA 3QKSA 4PAOA 4RSGA 4V0KA 2ZJYA 3U7GA 1U9IC 3K0FB 2C78A 1G291 3U4QB 4CEJB 421PA 3QBTA 2FFAA 3VNUA 1U8AA 1Z0KA 3LQRA 3QE0A 1OIVA 4R2IA 2O0JA 2ZRNA 1EFRA 1QHSA 2CK3D 4A6PA 4PC6A 5FBLB 1WMSA 3A1TA 3PENA 4EJSC 2QTVB 5DN6D 1FFHA 3EPHA 2VHCA 4JVLA 1YR8A 4B73A 4TYYA 1P9RA 2H57A 2ZJBA 1JR3E 3P26A 1G7CA 2QT0A 4MYCA 1U98A 3X1YA 1H8HD 3H84A 2NZJA 3Q5EA 3FB4A 2WJIA 1EWQA 2ZR0A 4IDPA 2FF7A 2H5EA 1Z83A 1S2MA 1R7RA 5LD2B 2P6RA 3GLIB 5JI2E 1LW7A 1SVOA 3H86A 4FINA 1N5LA 1XWIA 4PHFA 2A5GA 1P60A 4PSVA 1CP2A 2OAQ1 2ZUCA 1M7BA 2KBFA 4P3YA 5EZ5A 4Z1MA 1X1RA 4ZDKA 3UIEA 2WMNB 3Q72A 1NKSA 2VTKA 3OEHA 1MT0A 3I61A 1LTQA 4IXNA 1S9DA 4RCZA 2QMOA 4C3ZA 3BB4A 4BFSA 2GZDA 4DLTA 3ZD6A 4L15A 4DDWA 1DG1G 2YC4C 4HAUA 1I4TD 3NVAA 2XJ9A 3T35A 1RRGA 2FEMA 1ZNWA 4IHQA 3C5CA 4QXAA 1F48A 4P31A 3UMFA 1NN1A 3E70C 3UK6A 3K0CC 2BBTA 4HZIA 1MRNA 3U44B 2CHVA 2AD1A 3CNNA 2L0XA 4WZAE 1XTQA 3K0SA 4NCKA 1MO3A 1W36D 2QG6A 5E7MA 2MMGA 3CX6A 3TQFA 2PEYA 5C1BA 5FR1A 1PZNA 3SFVA 2GTPA 1G64A 3MG9A 4BLRA 4IDQA 4L5BA 4KODA 4BLQA 2IYSA 1OW3B 2G9NA 1KO7A 5FUWA 4EKDA 1L7VC 2JJ1A 4B47A 2OLJA 1JXOA 3LDAA 3NH9A 5AJYA 3UG7A 1RRFA 5J47A 3T5DA 2E1RA 3BAFA 3IO5A 2IYUA 2VSXA 4L9WA 4PQYA 2GK6A 1W46A 3NIBA 1G5PA 3V00A 1NKTA 2WZQA 3A37A 2BKEA 4JIMA 2OEPA 5KDDA 2JDID 2PH1A 2WIAA 2ZSBA 2GCNA 1G19A 1AS2A 4GL2A 4E22A 4G0NA 2I3BA 5TVKA 2IYLD 4M22A 5G53C 1N6HA 4A15A 1QVRA 2DHRA 2P0EA 4JSYA 2G77B 2JLRA 1HUQA 1V43A 4MKHA 5B30A 1EK0A 1NL3A 1G18A 1H65A 1D9ZA 1I2DA 2GEUA 2NPIA 2VSFA 1NNEA 2QRNA 3CPEA 1RFLA 3PITA 3HU3A 2ZSAA 3ZS9A 4A8JA 5TMPA 3RS0A 3W34A 1IOZA 4MGZR 1WBBA 3W6PA 4F7WA 3FHOA 3EARA 3KTAB 3T12A 4TZ6A 1IY2A 1FX0B 1CRQA 3AVTA 2EWVA 2R6FA 4KFRA 4Q4HA 3LXXA 4N3NA 1RC8A 3Q7PA 4EJSA 5IRCD 4RKEA 2BMDA 3NBZC 2O5VA 3RWMB 3P32A 2A9KA 3KQKA 5FTMA 4A6XA 2H7VA 3HR7A 4DLVA 4DSTA 2V3CC 3OAAA 2G83A 4IFBA 4TYPA 1U9IA 2OBNA 2B8WA 2IC5A 4D0GA 3R7WA 1E94E 3OIYA 1XTSA 4LYFA 1Q22A 3MJRA 1Y63A 2DWPA 2W58A 1F2TA 5CK4A 1K8RA 4A0HA 1KY3A 2RGCA 5EXTA 3NHBA 2D2EA 1MRSA 4PPQA 5C4MA 1OJLA 2WSMA 1D2NA 5HCIA 4DC9A 5B57C 2LCFA 3AVQA 5H1YA 3QEJA 3CRMA 2ZS9A 5GJWC 4QM7A 4DXAA 4RVCA 5EE9A 5C46F 4Q4JA 1IN6A 3HDTA 4F4JA 4Y0VA 4URYR 2VEDA 2ZE6A 4QGFA 3K09A 1T3HA 1O87A 1ZD9A 3LXRA 3PQCA 4OQNA 1M6NA 3RWOA 1EFHA 1OH8A 2KJQA 4NCIA 2MMCA 2ODBA 1E79D 1HTWA 4QGGA 2GBLC 1Q3HA 3CO5A 2ZAOA 4C7OA 2QROA 1UBFA 1Q1EA 4KVAA 3A8TA 1CU1A 4DIEA 1EWRA 3QG1A 4FN5A 1GRRA 2IXEA 3X1XA 4ILEA 4JLOA 3V9PA 2HT1A 1B0UA 1W5TA 4GI7A 2JJ2D 5DIFA 1DG3A 2RGEA 1WCV1 3IBYA 4F4CA 3DM9B 1CF4A 4FXPA 4C4PA 4S35A 2ORWA 2N42A 2YNMA 1JR6A 1SVKA 3ASYA 1BKDR 3OIWA 4KAXA 3NTUA 5E95A 4JYCA 1VHTA 1S9HA 3PEYA 2RH5A 2FPMA 1ZC3A 5DHAA 4ARZB 2XXAA 1E9EA 1AK2A 1ZRHA 1GKIA 2W2XA 4YMWA 1XTRA 4FI3C 3KXIA 1G6OA 1WA5A 3GEHA 4HAWA 5HKKD 4B76A 4WIAA 4LYJA 4Q5IA 4LJ8A 1AKYA 2ZR9A 2B7CA 3GJ6A 3F3YA 3WXMA 5P21A 2RB4A 1WRBA 2J41A 2JATA 3BK7A 1GILA 4BLPA 4NYIR 2NIPA 3OIUA 3ONWA 4YC7A 3VU9A 4BZPA 4BGDA 1T0HB 3UATA 2QT1A 1ZAKA 4KFUA 4UXIA 2B6HA 4B3CA 3AF0A 2VRWA 1QHGA 2ZEJA 3OE7D 2CXXA 1XEFA 3SFZA 1ZU4A 2AKAB 3ZS8A 3FYHA 1Z29A 1F5NA 4G5OA 5B2ZA 2VP2A 5AJXA 5F98A 3BOSA 2A3RA 1TEVA 3B60A 2IXGA 4O2LA 5B58C 4BRUA 2WWHA 4US1R 4CDGA 5JS8A 4FMCB 3CWZA 1Z0IA 2CVHA 3C7KA 1IAQA 1K5DA 5FBRB 4C7OB 1F3OA 4DEYA 3QIAA 2HLDA 4NYJQ 3P20A 3AKDA 4IOMA 4EUNA 2O8BA 1XBTA 3DMDA 3QENA 3WMGA 3SJBA 2RGXA 4PC2A 2RGNA 4M1TA 4RD0A 5CLLA 4IJMA 2CNWD 2QORA 1GKYA 2HCBA 2KSQA 3DZ8A 5K8TA 4LDJA 2EVWX 3QI2A 1EESA 3U3OA 1I4LD 3AVPA 1NIPA 3U2QA 2O8FA 2V1XA 2IS4A 4EDHA 2ZRIA 4ESVA 2J0SA 4KI0A 1UM8A 2XSZA 1PUIA 1Z28A 1GOTA 1SHZA 2HLDD 5KPJA 2GXQA 3TE6A 2ONJA 4MRPA 4G5QA 5HKKA 3ETLA 4GP6A 1QF9A 1Z2AA 4LHZA 1ZINA 4L16A 2Q0HA 2C96A 5BQ5A 2FJUA 4B44A 4DLZA 1S0UA 1W49A 3ZGXA 3SNHA 2GRJA 3ZVNA 2JA1A 3WBKA 4DHEA 3CF2A 1GNRA 4JVMA 2PCJA 1DELA 1T4GA 5JJLA 2Q9AA 1R5NA 1ZJ6A 2OCPA 4E03A 5KDLA 4Q1DA 3RABA 3TLXA 2PL3A 4C2TA 1KI6B 4QKQA 2J1LA 1ZBDA 1HT2E 2WWGA 4FCWA 3ASZA 4HLUA 5JWOA 3KQLA 2EW1A 4TTQA 1E32A 3S1AA 4BFUA 4QC2A 1P9NA 4JLDA 5DGXA 3ZQ6A 5KNCA 4GPTA 3NDBB 3HYTA 4DIDA 1KI7A 2YYZA 1II9A 1NJFA 2BV3A 2OHFA 1XB2A 4RFVA 1IN7A 2AD5A 1NIJA 2VL7A 4AKIA 5DI3B 2WJHA 2ZI9A 3Q8XB 3QVVA 4TMKA 1TPZA 4FIDA 3GEEA 3KJGA 1BMFD 2BOVA 4RD6A 2H16A 4NU0A 5JMTA 2V6JA 1G5RA 4TLCA 3BFKA 2PMKA 1P2VA 4M9XA 2O0HA 5JBQA 1VHLA 4EQ6A 3MRSA 4Q7KA 1NN5A 1OYWA 3W6NA 4BPBA 1DPFA 2FFBA 2GCPA 1JI0A 1W44A 2XB4A 2W0SA 4JLAA 5F9FA 3Q85A 1U90A 3PVSA 4B33A 2WKPA 4JLPA 5EXXA 2KE5A 2J0QA 1W4CA 2IK8A 4IW3B 2ZYWX 3T5GA 2EYUA 1ZD1A 1CIPA 1EXMA 1XXHE 1LNZA 3E5HA 4P32A 1QVAA 1E9AA 2R44A 4G1UC 4M9ZA 4G5GA 4TQ9A 4JBXA 2HYDA 4TL8A 1S8FA 2WWWA 4ZPXA 1R5OA 2GXAA 2J45A 3ADBA 4TMVA 3JVVA 4QOSA 2PLFA 2BVNA 3EWSA 2EFDB 5FR2A 3QKUA 4G3XA 2B8TA 3TUJC 4JBYA 2NO9A 3A1VA 1U99A 1KZ7B 3VAAA 3WNDA 1EFUA 1JECA 1UJ2A 3IQXA 4RZ2A 2GBLA 1A7JA 2OXCA 4IKEA 1X3SA 4HAXA 2IEZA 4OK3A 2GJSA 4LBYA 5TV2A 3SN6A 1MO5A 3GLIA 2F1IA 3RNLA 2GJAA 2J0VA 5FOWA 1XJCA 3R9XA 1XD9A 3TR5A 4EPWA 3VKGA 1M74A 2ZJ8A 1E2FA 3RANA 2BIFA 2CJWB 2I1QA 5H70A 1KK3A 5KNDA 2ERXA 3CNLA 3VR6A 4LZZA 3DHWC 2IYRA 3OIVA 2YHSA 4L4UA 1CTQA 3AUXA 4KV9A 5KNBA 4QHSA 4OK6A 1YZKA 4TLDA 1VECA 2FSHA 2AKYA 1FTSA 3TAHA 3GLFB 4A2QA 2FSFA 4HUTA 5TXGA 5DO9A 2W2TA 1T5LA 3PXGA 3P1JA 2AK2A 4Q1CA 4IEIA 4GRAA 3DEFA 4OBEA 1GNPA 3KQUA 2E9SA 3K8YA 3FHTA 5JCZA 1N0UA 4QGAA 3C15C 3MWYW 4CT4B 2PT5A 4YQFA 1GL9B 3QNUA 4PHHA 2JIZA 2HXYA 1M7HA 3NKVA 1ZUNB 2KB0A 2AR7A 4XIGS 2JGNA 2ZJOA 2FSIA 3EWAA 4O3MA 1XXHB 1NVVR 2QP9X 2ONKA 1XCMA 4DLWA 3EIEA 2BMFA 2XTMA 4LC0A 3B8HA 4ZKDA 4NCHA 5TARA 4A4DA 2OCYC 4AYTA 4TQAA 1B23P 2IX3A 4HB0A 5JLJA 5BN5A 4TL6A 2REOA 4W7SA 4Z51A 3ZZUA 2P5TB 4WOPA 1KI4A 3EC2A 1CR1A 1CR0A 1TQ2A 3KJIA 5A0FA 1Q20A 2Q3HA 1Z6YA 3BRWD 2EU8A 3THOA 4JVNA 2QQ0A 5AJZA 5FOXA 3B82A 4A36A 1E2GA 3QXCA 4IDOA 2WKRA 4D4LA 1J8MF 2C2HA 3T15A 4A8JB 2GF9A 4IVRA 1II8A 3UG6A 4OHZA 1J70A 1YZTA 1R8SA 2Z83A 5AUNB 2QSYA 3LRPA 1JAHA 4V0OA 3U6KA 3PUVA 1ELOA 1HH4A 3ZIAA 5GADl 2QU8A 5EE3A 1MABA 4AKGA 4YDSA 4P0TA 3TIFA 1T3SA 4EJSB 4TL9A 1M7GA 1NP6A 1ZD8A 3CR8A 3C4JA 2PZFA 2DFKB 2ZITA 4JL5A 3TW8B 1UADA 4TQUS 4PO1A 3WYAA 5K8UA 4NYMQ 1O3YA 4Q00A 4AD8A 4P4SA 3LW8A 4QGHA 1G1MA 2YWFA 2HCJB 2Z4RA 2ZU0C 3EIQA 4O25A 1VMAA 3K0CA 4NCJA 1GWNA 3W8RA 1COWA 4URXR 2E87A 1ESMA 3AGPA 3CW2A 1OHHA 2O52A 2FMXA 1MO6A 1J99A 4BFZA 4C0HA 4ZDJA 5EXPA 1KI8A 1OT3A 1ZM3A 1RZ3A 3F8TA 4TLBA 2QPAA 3GMTA 3WYFA 1OLOA 3FGNA 5HTKA 1A2KC 2BCJQ 3ND9A 3L82B 2IS2A 4NH0A 4EFLA 4PSKA 1E2IA 3B1VA 4ABYA 1JPJA 3DL0A 2FN4A 3BB3A 2JLVA 3FVQA 1QHHA 2ZJAA 1FW6A 2GK7A 5KYKA 1U2RA 5EP1A 5FPSA 1WXQA 1XMVA 2ATXA 3EZFA 3I73A 3MWJA 5M04A 4N1AA 4PX9A 2FPLA 3ADKA 4C30A 1M8PA 1LFDB 1KSFX 5FPYA 4FWTA 2J7PD 2PJZA 3QPVA 4Q01A 5FOTA 1P7CA 1R6BX 2IXFA 5E3HA 2XNSA 5JEDA 3AKCA 3SYLA 1VTKA 1S96A 2P3SA 1XMJA 3KB2A 4D6PA 2D06A 1YQTA 1JEEA 1UPTA 1BOFA 2OSBA 3REFA 2XGJA 1CR4A 2F7SA 3LX8A 4LJ4A 3IQWA 3SJZA 2XTNA 1OV4A 3CRW1 3AF3A 5SZIA 3DZDA 4BWYA 2JEOA 1NVWQ 2XZLA 2D3WA 2V55B 3LVQE 3VMFA 2FDCA 5D3QA 1J2JA 5BW8A 2QL6A 3R7WB 4LPSA 4JS0A 1P9WA 1YKSA 3D3QA 1R2QA 5J4KA 3TKLA 4R98A 2JJ8A 1RYFA 1VG8A 2CNWA 1RRCA 4OQMA 4BFTA 4CVNA 2J7PA 3VU9B 1FQKA 1ESNA 3UWOA 2JLXA 4K46A 1OFIA 2HXSA 2CL6X 5CK5A 3BE4A 1FMJA 1UFQA 3EZ6A 1AQUA 4YMVA 1FP6A 1ZNZA 4POAA 3MJHA 1TX4B 1W47A 2NMVA 2VF8A 1R0XA 4B75A 3VFDA 4BECA 3QSYA 3ZQJA 2F3RA 1OPXA 3KDSE 1NY5A 4A2PA 2XAUA 4M21A 3KFVA 3TUZC 4TZ0A 4I81A 4PR0A 2P67A 1AGRA 3R8CA 4KSCA 4M53A 3GLFE 4LJAA 4QRHA 2V54A 3SBEA 1YZGA 2J87A 4DLUA 2PCLA 1GL7A 4PAMA 1G20E 1ZU5A 1CJUC 2O8BB 4RD2A 2YINC 4Q66C 1D5CA 1NBMD 5CJPA 1IHUA 4KCGA 1VYTA 1R10A 1E2MA 1PLKA 3AB3A 1A4RA 3IEVA 2V6IA 1A2BA 1DO0A 1Z6GA 2WSSA 4FCTA 4P33A 2VHQA 4HLCA 4P4UA 2GCOA 3KB1A 2GZHA 2MSDB 821PA 2ODNA 5J4LA 5DLQC 3SR0A 2IYXA 3IBGA 4Z8XA 3MSXA 1F6BA 2XB2A 2GKSA 4OHXA 5F2EA 3KJHA 1G8HA 4KU4A 2O8FB 5AJVB 2JJ1D 3K9GA 4LYHA 1W36C 4QNRA 4LBWA 4ON9A 1UBGA 1J7KA 3THWB 1FNMA 2REBA 4ITRC 2OM2A 2QENA 3IHWA 2WOJA 1N5KA 1OKKD 3R8FA 3W8NA 1MKYA 1C9KA 3ND8A 1MOZA 4FWIB 3T1QA 4FMDF 2BJWA 4QJ4A 4IVQA 1PUJA 1VG9B 4IFEA 4KFSA 2VHUA 1RJ9A 4Q9LA 1E0JA 2BBSA 4X8OA 1KK2A 3VKWA 1XPOA 2FZLA 4GMDA 3OZXA 3DM5A 1S1CA 3KX2A 1JJVA 3N70A 3GLHA 4B74A 4OI4A 1RJ9B 5KDOA 4EAQA 4LOAA 3VHXA 4FD2A 5L3SA 2NO1A 4S2EA 1P3JA 4TL7A 3CZQA 3WMFA 3R9IA 2FPKA 4GZMA 5L3SB 1VCIA 1G3IA 3BFXA 3B7GA 5E7JA 2F43A 4MGIR 4OJQA 4B3XA 2RGAA 3QKTA 2NGRA 1R5BA 1YR6A 2ZIAA 2ZRKA 3W5JA 5BN4A 2J9RA 1DO2A 4RFSA 2A5DA 4QBIA 5DE3A 2QE7A 2DBYA 4BRWA 5KPDA 4TT3A 3U61B 1N6KA 3OFND 1YVDA 4ZIRA 1EX7A 2ZRBA 1Z6AA 2G0TA 4HUQA 5CM8B 4MDEA 3RS5A 3NEJA 4WA7A 1DAHA 2AN9A 5KTYA 1VIYA 2A7QA 3K70C 1KMQA 4OYHA 2P2LA 3QF7A 2CLSA 1KY2A 3BXZA 4AK9A 1GM5A 4LHYA 2WKQA 2ZI3A 1COWD 1E4YA 3AH8A 4CIDA 2FX3A 1XEXA 2ZANA 4M1OA 1GAJA 3HU2A 2XZOA 2QE7D 1E6CA 1L8QA 4GOKA 4Q9KA 2ZSEA 2BCGY 5EUQB 4IVPA 4U5XA 4FCVA 4XOIA 721PA 4EIWA 2WWYA 3QQ5A 5TY0A 3UWKA 4XSHA 1T8TA 3U3KA 1S3SA 1U8YA 4JT4A 1W48A 1VYVA 3DMNA 1DOAA 1KI6A 2PBRA 2W6IA 1TEXA 2FV8A 1US8A 3A1SA 3BWDD 4L8GA 1N2CE 2IUUA 4Q7JB 2AX4A 2MSCB 2DR3A 4A0FA 1GSIA 1Q1BA 1CJTC 1ZM2A 3RS2A 3EZ7A 1T8UA 3OE7A 4RD4A 4CGZA 5AR1A 1AQYA 3PG5A 2OCBA 4RY2A 1FP7A 3HYRA 3ZZ0A 3KKQA 1WDTA 4TYWA 4RFSB 3IO3A 1CRPA 2HJGA 3S1AB 4Q4LA 1NLZA 1YR9A 4M9QA 4ZIRB 4DDUA 2YWEA 1QRAA 3A4LA 3R20A 4PC7A 5HE8A 3SOPA 3A1UA 4JZKA 4NDZA 3H2YA 1L4UA 5DI3A 4Q9IA 1X8JA 4IOLA 4H1UA 3RRMA 4BEBA 3Q9LA 4XVRA 3N2EA 2X2FA 4NHOA 3NBFA 4W9MC 3TK1A 2PZEA 2XNDD 1XF9A 1OB5A 2PMDA 4HYYA 2W00A 2O8EA 1JEDA 2WICA 3WRYC 2WOOA 2IYTA 3C16C 2HYIC 4DWJA 3RRZA 3OEED 3W6OA 1G41A 3NC0C 3A4MA 3BJIC 4TN1A 3U3RA 4ZV4A 3V4RA 2YKGA 2O8EB 2ZPTX 5JI3E 4LPKA 3IILA 5CB6A 3WHLA 1KIMA 5F3WB 5L3VA 4A0RA 3ADDA 3D7MA 1HV8A 3MWLA 4L9SA 5LBIA 3O8CA 2GXSA 1US8B 2ZAMA 4D4MA 1RPZA 5H8WA 1KJYA 3GLHE 4CT5A 4QBHA 1RIFA 3QJYA 1DADA 4D2IA 4LV8B 4V0LA 3K70B 1OXTA 3SZRA 1DE0A 2WAXA 3ZZTA 1P5ZB 4TMZA 5FOUA 5EE5B 4HB4A 2QZ4A 2CCGA 3CONA 3B9QA 3CX7A 2ZRLA 1ZC4A 2CJWA 4NP6A 2A2ZA 3MGCA 1G5TA 3AP3A 3D8BA 3IUYA 2OE2A 1NJGA 4B35A 2ZS7A 2IL1A 1XPRA 1OFTA 1Z06A 2C99A 3QF4B 4LY6A 3SDZA 3SE0A 4M1YA 2BM1A 3P27A 3RDPA 1E0AA 3IPYA 2VBCA 3NWJA 2C77A 4YXWD 1N6LA 3HPQA 5CIQA 4DDTA 3K0AB 5EE0A 3CNOA 1XFAA 5JCPA 1GL6A 4IOJA 4QJ3A 3PEWA 1WP9A 1W2GA 2JDIA 3PR1A 1E2EA 4O0MA 5EP2A 4QNMA 1PVOA 3KJEA 2YZ2A 1ZCBA 2QAGB 2QSZA 3HWSA 3U44A 2OFOA 2VP4A 1CJKC 2ZUDA 4PSAA 1NLYA 2UZ3A 1VCMA 2IA5A 2IUSA 1QHIA 3U6BA 2ZRMA 4XWAA 1TF7A 3PFIA 2HEIA 3T1VA 3FHCB 1KI1A 2R9VA 2CVFA 3EPKA 1UBEA 2CE2X 2QP4A 3I32A 3T34A 4D82A 2YV5A 4UNSA 4Q02A 4TMXA 4PPNA 5JZVA 1X8KA 221PA 2DFNA 2IWHA 4BUJA 4PZYA 2XOKD 3ZD7A 5C4GB 5EP4A 2HUPA 2NOAA 4KFTA 5ANRB 2FFQA 1ZP6A 3CPHA 4R2HA 3B2EA 1AA9A 1Y3AA 1SULA 4JLBA 1D2EA 1PV4A 4Q1EA 3GJ3A 3TJZA 1RVDA 3THXB 4P4TA 2ZETA 4DKXA 1D9XA 2P6NA 2GEDA 2ZUBA 4JYBA 4W5JA 2PZGA 1E98A 1A5TA 5JRZA 1CS4C 4MA4A 5KOYA 4JLMA 4DT1A 3IEUA 3N5CA 5DSZA 5J40A 1U94A 1T3LA 2D74A 2C5LA 1II8B 3LV8A 5AUOB 3A58B 3KZ1E 4MKFA 4DSUA 2BWJA 4R71A 1MABB 3G0HA 3BC1A 5JRJA 1KSJA 4RZ3A 4JKIA 2V8OA 3O47A 4Q9JA 2WHXA 4XTRA 3KTAA 3C41J 1FX0A 2OAP1 3RSOA 2AWNA 3G5UA 2C95A 3GLGB 4LJ6A 4CRWB 5DISB 1ANKA 2RHDA 1W0JD 2FNAA 4CEHA 3UMRA 4DCVA 1CJMA 3GFPA 4LJ9A 5JHGB 2WM9B 4UJ5A 4OQXA 4WXPA 4MH0R 3WRXC 2FG5A 1R8QA 1GNQA 4OQFA 3NH6A 4E07A 3IDQA 4V03A 4PQFA 2VPPA 5AUPB 1XZQA 1IXZA 4RZUA 1RRPA 5HZHA 1G6HA 3I8SA 4GMXA 4RZXA 5EUMA 3QXJA 5H68A 2QTHA 1F2TB 4JL8A 2ORIA 3P4YA 1K5GA 1KO5A 4AY2A 5FTJA 1P2UA 1T91A 2ZYTX 4P4SB 2X19A 4G01B 3LO5A 4ERNA 1XEWX 1U81A 4A2WA 3FE2A 2FGJA 5FPHA 3AVWA 2NG1A 4G5SA 3WHKA 4AG5A 4B48A 1G17A 3ZVRA 5EZ6B 2C03A 1HQYE 3QXHA 3RS4A 3HU1A 3VR4A 3QPWA 4NE2A 1E0SA 4UXJA 5AUQA 2J59A 2G88A 4MYUA 1E79A 1Q44A 2B21A 1Q1ZA 3GFTA 3LQQA 2C04A 4AKHA 4ZDIA 3TNFA 1E9FA 4DLSA 4A8JC 5HZKA 3BERA 2W0MA 1U0HC 5JS7A 1OE0A 1JBKA 1SKYE 2CL0X 3F0TA 5GJVC 1IJEA 1TF5A 4FMDB 1TF2A 3X2SA 3GLGE 8OHMA 2YWHA 3GJ5A 4C0AC 2A5YB 2FH5B 4BASA 1I4DD 2CEAA 1NVXQ 2WJGA 3AF1A 3F5FA 1IN4A 1ODFA 2ZS8A 4PANA 5SZHB 1E1RA 1JR3A 1OF1A 4NMMA 2Q21A 1DBSA 3EA0A 1CKEA 2G1JA 2GJ8A 2WJYA 1XMSA 2QPOA 3ZJYA 3VHLB 4WXRA 2FEOA 4XVQA 2WWXA 1KTVA 1EFCA 4GSYA 2QPTA 4EPTA 1AZSC 4ARZA 1QHXA 1R0YA 2VP0A 2CCKA 3T1OA 3ECCA 2XXAB 3K53A 3LH5A 1KDOA 2ODEA 1E9DA 2OZEA 3TVTA 2D7DA 3RS3A 3RHFA 1KO4A 4KJZA 4TTPA 3MWKA 1FQJA 5KSPA 3DOFA 2GAOA 2IHBA 3SJCA 1TQ6A 4YMSA 3QKSB 2JLQA 2FE4A 2HF9A 4DSOA 1KI2A 1SZPA 3GLHB 2AHOA 3A1WA 3T61A 3FMPB 5J4VA 3CBQA 3BGWA 3KXKA 4DCTA 4DCSA 1KAGA 2F1RA 2OO7A 1XJQA 4LUCA 4PC1A 1F60A 4B3BA 5KHOC 4YLGA 5FUYA 3B9PA 1E2KA 4JVSB 2WJVA 2REXB 2D7CA 1N0WA 1ZM4A 4DUGA 4JBWA 1D8TA 2J46A 2ZTSA 3CIOA 1NY6A 1UKVY 4M1WA 2WSSD 4YMTA 1YJ5A 3TSZA 2F43B 3LAWA 1VPLA 3IPXA 4LBVA 2ZJ5A 4Q1FA 3SJAA 4LC1A 4Q21A 4MGYR 3CM0A 2R6DA 4BE7B 3RS7A 3B5JA 2ZI7A 1XPUA 1W2HA 1GFIA 4MRNA 3LWNA 1YZQA 4BEJA 4DB4A 2XX3A 2Q3FA 3ZYCA 3EIHA 3FFBA 1NRJB 4JMPA 1PJRA 5FFMA 3I62A 1W4BA 2ZRHA 2RGGA 3HJNA 5K8LA 1UF9A 4MGKR 4C0BA 3VQTA 4GOXA 3PUXA 4MRVA 3FMFA 2GJKA 4XTCS 3I8XA 4BLSA 4KXFB 2XNDA 1P75A 3CF0A 4ZCMA 4LHXA 4UNQA 1FTNA 2FU5C 2JJ2A 5HE9A 1BMFA 1BYIA 2RHMA 5FI0B 5LDDC 4MYTA 4URUR 3LX5A 4KBFA 3TRFA 5FH9A 1GTVA 2Y8EA 2I4IA 4Z1MD 2XOKA 3THWA 3GJXC 4FMCF 3TUIC 1E96A 5FTKA 5JJIA 1Z0FA 3VR2A 1NMXA 2QGZA 1Z0AA 2I1VB 3QEOA 2VP9A 1NVUQ 2LWIA 3QG5A 3E2IA 3KL4A 1ZUHA 1S4QA 5BYJA 3TQCA 4C9BA 1OXSC 3LFUA 1SVLA 1E9RA 1SVMA 3IHLA 3PV0A 4UNPA 1HURA 1V5WA 1SGWA 3K9HA 1KDPA 3MFYA 2CLDX 4DUGD 2ZU6A 3JZAA 2CDNA 2GWHA 5L8VA 1OXUA 1TNDA 1IY0A 3ZLJA 2BEKA 4QHTA 4D26A 3L8YA 1HA3A 2XTZA 2ZI4A 3VTKA 1P2TA 1XXHA 2D62A 4LHVA 3CF6R 2QP3A 2YOGA 1S3GA 2FZ4A 3KKMA 2AXNA 3OESA 5KO2A 2X2EA 4HAZA 3HPRA 2GXUA 5AK0A 3WYGA 4AYXA 2ANCA 4PPFA 5JWHA 5FL3A 1H8EA 4OQLA 5G40A 3ZH9B 4MUBA 4B3FX 4EQ6B 4F91B 2UVQA 4IXMA 1WQ1R 4AWXA 2X8AA 4HB2A 1FMLA 4UNRA 1QG4A 1IY1A 1CBUA 2ZVPX 2QQEA 3OHMA 5FUVA 4B71A 4M2LA 2W6ID 5FI1B 4A92A 1P72A 4QBGB 1E1RD 2JASA 3TAUA 2IUTA 5CM9C 3J81k 1Z5ZA 4R7ZA 1JR3D 1IXSB 2DFTA 1P73A 4H1VA 3IGFA 3IIJA 4LWZA 2QM7A 3TSWA 4AYWA 2RGBA 3CWQA 2HF8A 1ZNYA 4PO8A 1G7TA 4EFNA 1RYHA 3EC1A 4F38A 4NYJR 3A4NA 3DPUA 4W5HA 1UKYA 3MMPA 1VG0B 5L3QA 4TMTA 1E9BA 3WNBA 1XCGB 4KLNA 2V7QA 4ZI2A 1W4RA 1DEKA 2LKCA 5BN3A 2NO0A 1Z6TA 1E2QA 1JQLB 1NBME 3BORA 4X8HA 5J5CA 2CLCX 3ZVLA 5CLQA 3FKSD 4C0KA 1Z0DA 5HR5A 3ZVMA 1G3QA 1RE0A 4URWR 5G41A 5BYKA 2NO6A 4WZ6A 1TU4A 4HLDA 1AGPA 3GP8A 2JCSA 4F92B 1M34E 3KKOA 1AS3A 2GA8A 3KXLA 2AFHE 2DWOA 1II0A 1JJ7A 3CRRA 4HLUC 1Q12A 3THYA 4C2UA 1AJEA 2WV9A 1YR7A
chains in the Genus database with same CATH superfamily
3AQ4A 4L6IA 5BUZA 4PVCA 3OCVA 4DTCA 3ANXA 1DTSA 3KKPA 4HX5A 3IVRA 5DEIA 3WR5A 3JQ9A 3V1KA 3THYB 2G1UA 2GPNA 1G21E 1E3QA 1JALA 4EY4A 4YASA 5CRIA 4Y9UA 3P2EA 4NCNA 3U4GA 2HSJA 3TWOA 3FNRA 3F9CA 2OPBA 1CR6A 1N34B 4LHWA 1AK9A 1PR6A 1KJZA 4GX0A 3RRFA 3NT2A 4X65B 1GCIA 3B1YA 3R77A 3TSOA 4HZUA 1Y1QA 3PF8A 3WKDA 4UQLA 5K6RA 1QIDA 9MHTA 5AW5A 2NYAA 1JL3A 3CLRD 3L0DA 3O95A 2HW8A 3ME5A 4HH3C 3GDGA 1LK5A 3LP5A 3LUPA 4MQ4A 4KR0A 1X3LA 3EW9A 3M0EA 4WN9A 4KXNA 4Y0AA 4UAUA 5DV9A 4CUZA 5GZ3A 2O2IA 2ZT5A 2QUZA 4BX3A 1XZAA 1ABBA 1OOEA 1BH2A 1Q0PA 1V39A 3ZJVA 1PR0A 3RASA 2ONYA 1QTNA 2RH8A 2ZJZA 3TLMA 1OUMA 1XMIA 4OK5A 3L8ZA 1VJDA 5ENDA 3EGDA 5B4TA 1EDBA 1CY1A 1JGTA 1CD5A 2OHHA 2OZVA 3A9VA 3NHWA 4HQNA 3C7TA 4B43A 2WTUA 2XRZA 3G1UA 3K9LA 3NO4A 3RRYA 3L6BA 1F2UB 3EVBA 1HRKA 2RGNC 4CWAA 1XQ1A 3NP7A 4TLLB 5AJWA 4YCAA 4RPJA 1EX9A 2APJA 1GAWA 2I3DA 2Q6VA 2O3RA 4DIUA 1T36B 3D7NA 3UOAB 1HNZB 1WMBA 3G6KA 3PIRA 1GPBA 3LGXA 4IZOA 3OOJA 4R2WA 4V39A 5B6IA 4M9RA 5KQSA 2YW2A 2NZWA 4KEAA 4RMNA 2V7BA 3E8SA 3DFMA 1A7KA 1TD9A 4S3MA 2C29D 1E99A 3IDFA 4LYGA 3H3FA 1KKLA 3DVQX 4TWZA 2FZWA 3ASVA 2PTHA 4LDZA 3T99A 2QBYA 4ZO9A 4E5UA 1TM1E 1IONA 2CLLB 3I1IA 4IDGA 2GDJA 2YJ6A 3SI7A 5JR3A 5ELXA 1H4SA 2PUBA 4FMBB 3EASA 3H1AA 1M0EA 4I1PA 3P8ZA 3HV2A 4BVEA 4UDYX 3PNOA 1D6NA 2JI9A 4BLVA 4DKJA 3AWDA 4DV0B 3E61A 5C1PA 2DY1A 13PKA 3MAGA 3MUFA 3ABOB 4O4JF 4P92A 4MRMB 4XWYA 4QEKA 3JQBA 1SUPA 4FFLA 4IHKA 2FR0A 2O0KA 3QFHA 3NDRA 4KN6A 2D1SA 3K9BA 4LDNA 5T7BA 4UTXA 4U7WA 3T5TA 1SXJA 5CX1B 3O4RA 3ENKA 5CTAA 1MQ9A 3S8EA 1S8AA 2ZAYA 3TOCA 3Q3VA 4CTOA 4F5WA 1ZSYA 2WPNA 2ZI5A 3OEWA 2HJVA 3N87A 2EDCA 3I4LA 2H2HA 1O95D 5FJIA 5F9HA 3DUFA 1E2LA 1N6NA 2XECA 1Q1AA 3CE9A 2G4CA 3FWHA 3GDWA 3NTVA 4BFYA 3OCZA 1U7OA 2VRCD 4NZMA 2VPWA 1DT3A 3GD7A 4O2BB 3VX4A 4QTYA 4EVQA 5A5DA 4BY9E 1GZHB 2R62A 1TDJA 3COSA 2D6FA 2MDTA 4DPLA 4QTUB 4QQ8A 1XN4A 3OOWA 1PR1A 4GNKA 4Q4AB 2JLYA 1W1UA 2HPAA 3FIJA 4NMLA 3ISJA 4JP8A 4RS4A 2P0YA 1X13A 3BXGA 4S0ZA 1ODSA 3KLOA 2CXHA 3NC4A 5D5HA 1BW9A 3T06B 5I4IA 5B53A 2MWMA 2YXBA 5FPTA 3TTTA 1NM5C 1ECCA 3CURA 4DNPA 1WB9A 2R47A 5H3CA 2QYOA 4DV5B 3ZHCA 1NF3A 2ZULA 3D43A 4IIXA 1JJIA 1JEYA 3PJRA 1R88A 2D1RA 1LLQA 3HJBA 5LP6A 2H1OA 1ZMXA 3D4IA 3KR9A 1NVAA 4I4TB 2BH9A 2D5IA 2AEJA 1CYEA 3QV1A 1EGVB 2GO1A 2ZROA 5DYYA 1N6IA 5FTLA 5KC9A 3VHXB 4TKMA 5J63A 1EE9A 5CDFA 3SKVA 1U2EA 3EVTA 1HEYA 2WFAA 2KLHA 1DKUA 1UXJA 4JOCA 4Q7LA 5DCLA 3VI4B 4C0LA 1VG1A 1GHTA 3RFTA 1MJ5A 1ZGJA 1X15A 3M6UA 4IH4A 3C3PA 5CX4A 1X92A 5B58T 5KREA 2DQYA 2PRZA 4EW2A 4FYMA 1XTJA 2P9ZA 4FYKA 4G0XA 1DFHA 3KT0A 2PNFA 3RLFA 2VA9A 1XF1A 4FYYA 4EHKA 1NYRA 4CL0A 2ZE5A 4NPAA 2SCUA 3HI6A 4HC4A 3UW3A 4CN9A 3D2LA 2P91A 1EJBA 2Q28A 4DBLE 5JZMA 1SQ5A 1POXA 3H1TA 3AFHA 3NT4A 2BEWB 2EQBA 4XRRA 5JD3A 3VNVA 2J4CA 3JX9A 1KJIA 2HUNA 5ETJA 4MXDA 1W5SA 2PX2A 3WAKA 1SZJG 3WZMA 4CR8A 5JNRA 4PGFA 2QNRA 1VB5A 4YH1A 4LIPD 1JE1A 2GTIA 2XAAA 3S68A 1DU4A 5IT9A 1NDUA 1SVWA 3ZWNA 3F6EX 1LGYA 4RORA 2WNHA 4FNGA 2HDHA 4PZPA 2V5VA 4L8LA 3TLCA 5SYAA 4AAYA 2PXAA 3ZHRA 3B3JA 3D2BA 1KVRA 3FRIA 5H9VA 4J03A 2XSZD 3LCJA 2BM0A 2W6ZA 1HF3A 4G97A 1T8YA 5JC8A 1XVUA 1FTQA 4FNOA 3RQSA 1DIAA 1UR5A 2XOXA 4ZCLA 2AZXA 1Z2CA 3W78A 1ORVA 2BFPA 2OCXA 3JW8A 4WCFC 3RFUA 1SXJD 1XRSB 1TU3A 4DZTA 5KYWA 3OH8A 4G4JA 3RADC 2SKDA 1B8NA 3U4IA 2ODWA 4PHGA 2G0AA 1JXMA 5TQ0B 1ISHA 3OMXA 4F4UA 2H52A 1YRBA 1IC6A 3E3OA 1PDWA 5LA6F 3E3AA 1N25A 1W87A 2IHKA 2YV4A 4BAGA 4B7AA 1U0EA 3JWJA 5KVAA 1XOIA 4MQBA 4WZBB 4TXNA 4MARA 3BZWA 4FGUA 4UDXX 2Q6TA 4PFKA 1T6NA 2BP7B 3ZDAA 1KFBB 4PNHA 3RTGA 3MYRA 2HA3A 2JS7A 2VP5A 1U0JA 3CB2A 1C9EA 4M4SA 4P4NA 3IEMA 1LSUA 1E7MA 2OZLB 3QOYA 4OHBA 4QL3A 4TSFD 5LJLA 1Y9ZA 4A10A 1IB0A 3SBDA 3VMMA 3CH6A 1YS4A 3ZZNA 3K2IA 5CA1F 2G5GX 3VSBA 1A2QA 1J49A 3K32A 5KC8A 4O08A 2ECPA 1KMHB 4U2BA 1I9GA 2AJBA 3P9NA 1G4HA 1NSYA 1P6QA 1QR2A 1VA5A 5IHPA 2WB4A 1SMKA 1ZLXA 1YCGA 1T9HA 1BWPA 3SC3A 4LDRA 3UT5A 1XL0A 1AQNA 3WA7A 1J06A 5MGNA 4B6RA 2WZCA 3CRVA 2BDTA 3U4MA 1KHTA 1TW3A 4L2IA 4B2YA 5EJEA 3IL2A 4FU0A 3WFIA 5JS1A 2VPTA 4KDEA 1NHWA 1UQRA 4DSNA 1DC5A 2VSOA 2XMGA 4IV5A 1MT3A 4X62B 2YQ5A 4O8CA 3VZRA 1QVWA 4JLNA 5G4LA 3LBIA 3LUKA 5D6OA 3IT3A 3V8PA 3EQ7A 4D4KA 1JFFA 4ZCRA 5L95A 3K70D 3EXHB 3O2SB 1ZYUA 5LOVB 4JUCA 4GO1A 1UFOA 3IQEA 1V26A 1W8DA 4QDKA 1ZHFA 2I80A 4RU1A 2TMYA 5K3FB 5ALTA 3FKQA 3DDWA 3U4QA 2Z6UA 1FQOA 5FUXA 3RFFA 1WXDA 5D1HA 1KAOA 1RM4A 3IIMA 4KDRA 4A9AA 1NNI1 1Q1QA 4RTPA 1CUXA 4QDUA 4L28A 1GQ2A 1Y33E 4JJIA 4BFXA 3M7IA 3MWDA 4F4IA 5FPQA 4LYAA 5GV7A 1IZ7A 1PEAA 4QGBA 4BNUA 1Z6ZA 4TX1A 3B3GA 2HF2A 1KEVA 4B40A 3U7HB 1Y8RA 3LVFO 2BFBB 2FSPA 3DVAB 3F9RA 3C24A 3GNQA 5IKMA 4B3DA 1FEZA 2GEJA 2YJ3A 1KI3A 2H06A 4I1RA 1GLVA 1DXOA 2VP6A 1N2BA 2RC5A 3W9YA 3QVKA 3WFZA 4BKQA 5A2QA 3I5YA 3BIFA 2I3GA 3V1YA 4YJFB 1N92A 2R96A 5HIMA 3SPXA 4FFVA 1IH8A 1YULA 1IJFA 1JVBA 2NUPB 1U1CA 4YJGA 4MR9A 2HY7A 4Q9HA 1VE7A 2GEVA 2IT1A 4DADA 5MFZA 3ER6A 3UWDA 3CNHA 1R66A 1T1JA 2PRKA 2PUAA 2AJDA 4AJ2A 1G16A 2WHQA 2O3JA 4OVKA 3WOHA 2BZ0A 1UFRA 5IVDA 4Y2VA 3DDCA 1DAFA 2X40A 3LCRA 1EZ1A 1MH1A 4O1IA 2R1VB 4O4JB 5AKZA 5IARA 4HD8A 1FK8A 4IGKA 4DRZA 1KO1A 4LVUA 1EWTA 2XZTA 1E6WA 4NRDA 3W3ZB 3WA6A 4R41A 2HU8A 5EIFA 4YPOA 1R0ZA 1K88A 2H92A 1MDBA 1RWVA 2H3EA 1O4WA 3ROFA 2J0UA 1LB1B 3HFGA 4I1UA 1GUBA 1I7LA 1KMCA 2WHPB 1YRAA 2YRFA 4Y8VA 5JD5A 4DLXA 1OFUX 2TECE 4TWBA 3TM4A 1QIEA 4G1CA 4BYGA 5DK6A 3SSNA 3Q5DA 4HLQB 2MR5A 4QJBA 1KEEB 2XCIA 2GX6A 3JCZA 4ZREA 2HSGA 1BVHA 2G17A 2GB4A 2QDXA 1DEOA 2BFDA 2QRQA 5K8IA 3WNZA 2W8BA 4R2XA 4XIJA 5ALQA 2DR0A 2QMEA 5F52A 5G1OA 4EMUA 2N0SA 3I6ZA 3PZBA 4Y6LA 3W2FA 3CJRA 4C0SA 5CXQA 5JY6A 4NFHA 3E9EA 4ZI5A 3LHSA 1B0PA 1KAMA 2B9VA 4C06A 1KJWA 3GCGA 2JVKA 3HCEA 3QUQA 4NK5A 5FULA 2H1SA 3RVRA 4K1LA 2C7VA 3QKRA 2AS0A 2H4WA 4LXYA 1TQDA 3ILXA 4S1TA 5EQTA 3MD0A 2HH9A 3ELWA 3AGQA 3IEXA 1FUKA 2PPVA 1FUUA 1TK2A 5IVPA 2PT6A 4MB6A 2ZBDA 5HG0A 1NJ6A 3K6SB 1IPFA 1E3SA 1P5RA 3CGWA 4L4SA 5TMBA 5HMMA 4O4HF 2F3PA 1R6TA 5K6AC 2NLOA 2ZJ6A 2LXNA 2OILA 3L6OO 4WBSA 3U7QA 5HQ3A 3F98A 1E2HA 1AKNA 4ZHQB 1A5BB 2C5GA 4D92A 2OV2A 2ODQA 1TUEA 5LD2C 3BJRA 3JD0A 1WXWA 1ADBA 4GZLA 5L4LA 2G4LA 1HTBA 1RMTA 3JQRA 1CUCA 1E60A 1NP3A 2P9HA 3AL3A 4M1ZA 4J0QA 4RIEA 1UJ5A 3K8QA 4Y6PA 3C98A 5F12A 1MGPA 5ADUS 4CIYA 3KLPX 2OESA 4TTJA 2NU6A 5I9TA 2JA2A 1N2HA 1IATA 1Z6PA 2DFLA 2H1FA 1GRVA 3L7LA 4M83A 4YXFA 1S5PA 5AVVA 1DAGA 4DMFA 5A5FA 3CCCA 3RGWS 1UC8A 1DBPA 4YGYA 1FMFA 1X80A 4L3WA 1A9ZA 2E4WA 4LHSA 1FE8A 2HV9A 3PUZA 1T4CA 2J0UB 4LGVA 4LNAA 1AF7A 2P6PA 3JZIA 1WBJB 2VFAA 1NHGA 1Y48E 2BR4A 3LUBA 4QU5A 1QRDA 1OLXB 4RVUA 3SMQA 4DN6A 4ACBA 1ZVVA 2QUAA 2V8BA 3NDIA 4D79A 4ZPJA 3LG2A 2P4QA 3DVLA 4LN1A 5DNYB 1TLTA 4ZANA 3DCIA 4MMXB 5SV2A 2GH1A 1GGNA 2ZRJA 2PLAA 3B3QA 2WBLC 2F3QA 4WHMA 5B4UA 3LWDA 1T0BA 4BTVA 1KPHA 1MAUA 2HCRA 4RLSA 1ZK3A 4KZKA 4MW1A 4QOJA 4WY2A 4CZ2A 4X63A 5A1JA 1QH8B 3PNQA 3RSLA 3P2JA 2ZSDA 5KNCH 3VR1A 3EEYA 4DMLA 4DJAA 3ADCA 2R87A 1OWLA 3DQQA 1SU6A 1VYUA 5AYVA 1SOMA 5FNVF 3QKRB 4NI5A 3ZU2A 1N32B 1X94A 1X1BA 2G7MC 1ONOA 4OJKA 1A5AB 4OJTA 4QHYA 3G2PA 1XTIA 4WZBE 3FNBA 6LDHA 4S04A 4JC4A 4KPYA 1THMA 1X42A 3BG5A 3ZWQA 1XNQB 1P8JA 4GT1A 2WPDD 4N6GA 1UL1X 1BE0A 4WY8A 3FOAA 2FZKA 3S1LA 3H5IA 3WHPA 3GUUA 4F93B 2F55A 2VHWA 1GP2A 2FDRA 3BQNB 4WAUA 2BAGA 1U3WA 1P0IA 2DWQA 2VUUA 2RHOA 1BHQ1 3OEHD 4PGGA 2Z43A 1GDTA 4X5OA 1X1SA 2QR2A 1ZJYA 1Y4SA 4CLRB 1RW4A 2QX6A 3QFCA 2Y6VA 2MTBA 1BWSA 3I01M 4GC9A 1AUVA 1ZXLA 2NXWA 5IKPA 1VDMA 3IRVA 5AVTA 2DHQA 3F1LA 4YJ2A 3PSAA 2NU6B 1LRKA 1RACA 2MYUA 1W4AA 2OCAA 3I1FA 3KJQA 4JBNA 3WLSA 2QKYA 5EZQA 4NEQA 4DTIA 1TVKA 2FOIA 3KHSA 4TYQA 4Y2YA 3UPUA 2ZQYA 1CY7A 1IEQA 3O1JC 3UJCA 1VE9A 1GAXA 4FYPA 4XM1A 1O54A 2E37A 3ZGVA 4UM9B 1Z4JA 2W71A 4RK0A 1PQ4A 3DE0X 4BNLA 4K8OA 3B20A 4OYRA 1TAGA 4B5LA 4DREA 3Q3CA 1TTTA 4OL9A 4E09A 1GPKA 2QTNA 5ITSA 1C1HA 3RJ9A 1IBKB 4NK4A 4L3OA 1GY8A 1QVZA 4MW2A 3SM9A 4QOGA 3QVUA 3CU5A 4FFOA 1E1DA 4PGMA 1EFTA 5K0EA 3AV3A 4P84A 4WXHA 4D9HA 1N2CB 3ZDRA 4C3UA 1NPDA 3E7PA 3R9WA 3S99A 1KBOA 4CKCB 5CB0A 2DBZA 5DBIA 3G9XA 2WSIA 3LQ2A 4PAWA 1V4NA 3JQ8A 5FI3A 521PA 1EWVA 4KX5A 1JSZA 3EGDB 2AXPA 2IIPA 4G6ZA 2JEYA 4Q16A 4X1OA 1WZNA 3CKLA 5I9BA 4E94A 4UUPA 2EJTA 3UWMA 4D4HA 2QBYB 2I0FA 5HJ2A 4DQUA 3DE7X 5HW0A 4ENUA 2E82A 2GD1O 4HSEA 4B6EA 5IF9A 3N2IA 5K7SA 4FNAA 4WEQA 5KSYA 4MRRA 2EWWA 3PEUA 3KCNA 4RD3A 3VPGA 4LJ5A 1OI2A 1N5JA 3MVEA 2WV7A 16PKA 3BFJA 2BMEA 1QYRA 3OQ1A 4WNYA 5JAZA 5LQCA 1G4UR 2BBOA 2D1FA 2CD9A 3D0KA 3GXOA 1CUVA 4M0KA 2ZUVA 2DPXA 3HM2A 3MMZA 2HGZA 4Y1EA 4LJ7A 1WPXA 2UZ1A 1FIUA 3L84A 3K31A 2MSEB 4G9EA 2PRSA 4YUXA 5IG2A 5H02A 2XW6A 3T1TA 1KNXA 1O57A 4QUDA 4A0SA 4OHMA 4C0JA 4RA6B 2E49A 1QB7A 1ID1A 1SXJB 5CX1A 1E3WA 2EAUA 2QMHA 2FMIA 4MW6A 4QXRA 5J5AA 1IQPA 1CFJA 4NCAA 1BIFA 2GNPA 1ORHA 2BKLA 3GJ0A 3FVVA 1NXSA 4OI1A 4OJYA 3WLFA 1CDOA 8LDHA 2A0FA 1RC0A 1KKUA 3HKEB 4BQSA 4FTWA 1VCNA 3ZQ4A 1LVGA 1OLSB 2P1ZA 4MCAA 2FUNB 4Q19A 4QQFA 1UFKA 3WWPA 2IS1A 4YROA 5FD8A 5CA1B 2JI4A 4TLAA 1A76A 2UVPA 5FBVB 1UAYA 2OQ2A 3U9TA 1A71A 1LBHA 4BRZA 5C53B 1PLJA 1UEJA 3OFNA 2JK0A 3D8SA 3GZNA 1GU0A 4YPFA 1HTTA 1Z63A 1NG9A 4PQRA 1DKMA 4Q9AA 4Z54A 4B3GA 3DYIA 2GESA 2NAPA 4E31A 5HK9A 2HMWA 5C8YF 1XRRA 3MS2A 2DUMA 5JJ5A 1Q84A 2VDOB 3AXSA 3MELA 4EPVA 1D7OA 1UK9A 5JBIA 5JSZA 1OHHD 4OHWA 4MVJA 1H66A 3D4NA 3I45A 2D3TA 2OZPA 2XITA 3GL9A 2PBLA 4BIIA 2F9LA 1EGQA 3ZDQA 4AF8A 4B4OA 1XZPA 1AKUA 2OLEA 5IZCC 2QRVA 1XZHA 4CM4B 3OCJA 1USGA 3V42A 2J31A 1Q0RA 3KWJA 3ZY6A 2QD4A 1BKSB 3O8OB 4FDVA 4UKDA 2C2BA 2RAUA 5JWOA 3DCJA 4WACA 3AVXA 1S89A 2BGLA 3QTBA 1GDDA 1KEUA 2LUOA 3VPSA 1NBIA 2BCEA 2GYUA 4TOIA 4JA2A 3P9CA 1C7FA 4H18A 2XT6A 1N5RA 4HNRA 3B38A 3AP1A 1S1MA 2A94A 4HWRA 1LF5A 2C5HA 4UAVA 3C3DA 1CP3A 1NKVA 4U3JB 2I8AA 3EFOA 2R4TA 3CPJB 4OKSA 2CHQA 4ZPXA 4LRWA 3VU8A 1P6XA 4CM7A 3T1NA 3QVTA 3VC1A 1B1CA 2C2GA 3DO6A 1A9YA 3CLSD 3QHQA 4KQ2A 4Z9FA 1ULBA 5DN9A 3JAWA 4I6GA 5G0SA 1RQ2A 1ZOPA 1RWKA 2IYZA 2B2CA 3NIGB 5ECDA 3GELA 4JR1A 1FVFA 4MB2A 2CJPA 3Q8LA 4JLVA 3I6IA 2KBEA 4LK2A 3QK7A 3T3PB 2X1VA 1FOEB 2YYAA 2A4MA 2BEWA 1W4LA 3KE8A 3PJEA 3AINA 5L3ZA 2ZVDA 5A9RA 2Q50A 4NYIQ 1JPUA 2ZREA 2P69A 2YWCA 5TDHA 1FXSA 1YACA 1NP7A 3PQ8A 4Q12A 4ZDWA 2ZPUA 2R6GA 4CT0A 4WW0A 1DRKA 1MVLA 1ZD3A 5JSZB 4JJFA 1C9MA 1VA4A 1JQKA 3C14C 4JWKA 3A0UA 1K8YB 3T4EA 2IVFA 1ZM7A 4K3UA 2E4UA 4RHYA 2JI8A 2HIGA 4IH9A 3BCRA 4QU9A 3W90A 5L40A 2ECFA 3K1AB 3EUAA 4MYRA 4OL0A 3WJ1A 2ZE7A 3CLUC 3WLHA 3N8IA 2EFHB 2O3TA 1CDEA 1R6UA 3FYUC 4AZ0A 2R2GA 4J9VA 4BQQA 2GAIA 3LP8A 2V4UA 4KITB 3EPLA 3WHKA 4DC0A 3D6JA 3HDQA 3ITNA 4NCXA 3ETCA 5FFNA 5B1DA 3Q11A 3S81A 3NAGA 1JPNA 4LVOA 4XVHA 3DKPA 1M1YB 2QD3A 3GFOA 2N46A 4YIHA 2GT1A 3ROZA 3H2HA 2YASA 4PG8A 1QC5B 5MDHA 2NADA 1KMHA 1JHUA 4DEXA 3QPUA 4RDCA 4P83A 2Q9CA 2QN6A 2FQXA 3QPAA 3GFGA 1JLRA 1G0OA 1UBJS 3LPDA 4EY5A 3MJVA 3O3NB 1YRQA 2HO5A 2JGFA 3JY6A 2GPSA 4IRUB 3IAEA 4XPIB 4ZVOA 4XVUA 1BEUB 1YBAA 1LW6E 2O8CB 1V25A 2JCGA 1GD1O 1ZQ9A 4HVAA 5KYXB 1PE0A 2DQSA 3O8BA 4ARUA 4CQJA 5JDCA 4U7JA 4JLSA 1K8QA 2VH5R 1G7RA 4N7BA 4AFNA 4A23A 1X14A 3ZE2B 2O3SA 3PPWA 3PPIA 1JIKA 1Q7BA 1SCAA 3ETHA 4TQGA 3SR3A 5JAIA 3K9NA 1Q6YA 3LWZA 3CVXA 2FP3A 5IDVA 2WJJA 1I6WA 1ML4A 3HWRA 3ICCA 1JDTA 1U8FO 3KFLA 4PZEA 4RH0A 5TQVA 5CA0F 3D9QX 1CZKA 4V0KA 3O38A 7GPBA 2ZJYA 3ZDFA 2MINA 4XR4A 5JZOA 3ZH2A 1U9IC 1LXCA 2R85A 3L4BC 2X42A 1V9LA 3OOHA 4MCHA 1NVBA 4MVJE 1G291 2CMFA 2DPYA 1YS7A 2CNKA 5K3AA 2ZYAA 5FHQA 3MS7A 1Z0KA 3FBGA 3LQRA 4RYDA 5REQA 1EFRA 4F4HA 4PC6A 2OGWA 2Q1SA 4JZYA 1ZK2A 2RK3A 2Z30A 5BQ3A 1WMSA 2PGOA 4L22A 5DHTA 4J3NA 3ZXYA 4EJSC 3PRHA 3VTAA 5BVHA 2Y05A 1UJMA 2RD2A 2P1DA 1P9RA 1JR3E 1WMDA 2FRDA 2QT0A 4FHZA 3QUAA 3IMKA 2QTVA 4KE7A 3H84A 2NZJA 3Q5EA 5I9SA 1EWQA 1SC4A 2ZR0A 3EHDA 2FF7A 1S2MA 3B9RA 2XE4A 3LWBA 3RT7A 3GLIB 5MHTA 3I3OA 2G07A 5A02A 1GTSA 1B41A 1JEQA 3EFHA 3H86A 1XWIA 4IDEA 4BO5A 1P60A 2GS9A 1XROA 1CP2A 3G5TA 3H1FA 1M7BA 1V16A 4L5JA 1X1RA 4BVFA 1C1DB 1NKSA 3FMGA 1H1LB 2BSXA 3II6X 1Z2EA 4IXNA 4OXYA 1LSSA 3H8SA 4MW7A 4RCZA 1LWNA 1YL6A 2AJCA 2O07A 2SICE 5F5NA 4AY4A 2GZDA 5HRAA 4CCSA 3LK6A 4L15A 3LSTA 1O5IA 1LC0A 3FAKA 3GAMA 3GLTA 2P8JA 3A9CA 4ZI7A 3GT3A 4EYKA 5E1OA 3RAEC 4IHQA 1T9GS 2LCIA 3RUPA 2IE0A 3BL5A 5K99A 3OJFA 1FPQA 4S1WA 4GMKA 5BO5A 3K0CC 4MMZB 3B89A 1N7IA 4BQRA 2BGUA 5EL0A 3G2OA 2XUZA 3P9RA 3OQ6A 1XTQA 2OXFA 4IG9A 4W1PA 4WZAE 4CLHA 4DMKA 3K0SA 4LOHA 3QPCA 5KQLA 2Q7DA 2MMGA 2VDJA 4LXHA 1UMDB 3UJ3X 1ILWA 2NSJA 4RDHA 1PZNA 3MGAA 3P2KA 4KP7A 4OQYA 4QXMA 5FF9A 4M0CA 1ENPA 3BKXA 1G64A 4DQKA 4E88A 3FGOA 1VPEA 5BY2A 4IEFB 3UK0A 4N3GA 1XJ5A 3R0VA 1Z5NA 2IYSA 2ZG6A 2I6XA 3T5AA 2PFGA 2PD4A 4I66A 1KJJA 4B47A 4YRDA 4ZQEA 3QZUA 3O3CA 2BFDB 3E84A 2ISCA 5J47A 1CUDA 1QQAA 3PRKE 1X1TA 2IHNA 1XMQB 3TB4A 4BQEA 2Z8ZA 2GVNA 1IOLA 3OZGA 4HEQA 1PZXA 2HA2A 3FX2A 3A37A 3GJTA 3RVNA 1AA6A 1IVNA 3E53A 5KDDA 1OI3A 1A2OA 1G63A 2JIMA 2PH1A 1V71A 1NAIA 3AESA 1UPBA 3HA3A 3I2KA 1Z0ZA 2GCNA 1AS2A 1ULZA 4KQEA 5IAOA 4GL2A 1I0LA 4E22A 1W5BA 2I3BA 2WEKA 3F3KA 3IAM1 3ZXXA 1N6HA 3TRIA 2WU0A 2YXDA 1EM6A 2GZMA 4GOND 5EJGA 5C5DA 3U13A 1JEOA 4XXHA 2D7JA 3I53A 1F9EA 4YA6A 2GAJA 1NX6A 2I6QA 3U7QB 1EK0A 1WD7A 3C3WA 2VF4X 3GLRA 4UEOA 1H65A 1PR2A 3DEYX 2JEZA 1DRVA 5T67A 2NPIA 4ZI7B 2NZYA 1F17A 2BGMA 3DKIA 3W34A 3BJEA 4TKUA 1WBBA 3DONA 3HRHA 3EARA 4ZAXA 3T12A 1FX0B 1KIAA 1CRQA 1SJ9A 3PQFA 4NMWA 4FE7A 3VYUB 3D6AA 4FC7A 3DDOA 4I5IA 1B0ZA 1CERA 4XI9A 1RC8A 1MQ8B 1YS2X 4CXMA 1RBQA 1M0SA 2W6MA 1OLUA 2R8EA 3OD1A 3OTWA 3QELA 4TSKA 5BR4A 3TF5A 1E7YA 1L4EA 5BXYA 2A9KA 1QH8A 1PG2A 1NURA 2X4DA 3VPCA 2H7VA 2RJ3A 3HR7A 2V3CC 4UZEA 2VRNA 5ALVA 3IOMA 1U9IA 2RK6A 2IC5A 3P0JA 1P5HA 4BB0A 1E94E 1SIOA 3EDRA 1Q22A 1KJNA 4H7EA 5KQMA 5CK4A 1F2TA 4A0HA 1QIHA 2CVQA 2HB6A 5DW3A 5EXTA 4KMSA 2W2LD 3L6RA 3FPKA 4LZAA 5HCIA 2LCFA 5BVGB 3BGOS 3O8QB 1BH6A 1C7IA 5H1YA 3W06A 1VRCA 1N9KA 2QW0X 1SHUX 1TYDE 2PKEA 2CMDA 2WT8A 3ND7A 4R6WA 3IUJA 2V6MA 4MWTA 1Y6ZA 4RVCA 5JXIA 3LP6A 3A32A 5C46F 4Q4JA 3DEIA 5I7HA 1RZRD 1I8TA 4I7EA 1JG3A 4WUTA 5ALNA 2VEDA 3LT1A 1CWUA 3HA5A 1ZKMA 1YVPA 1YCDA 2JHPA 1N78A 1M6NA 1TVKB 1EDEA 4MWGA 4MR8B 3RWOA 1EFHA 5IEBA 2DLDA 3IAHA 3E3MA 2KJQA 1WPRA 5BRAA 1HETA 2L18A 2ODBA 3AG6A 3B70A 4MW5A 1C0EA 4X24A 2XMCA 4OHKA 1HTWA 1PT8A 1Q3HA 5JVDB 4U6QA 1YRHA 3TLBA 3MF4A 1BZYA 1T2CA 1FTYA 5IP5A 1HG1A 2P2ZA 4HWSA 1N9ZA 4G5XA 4XCXA 4UMFA 2B4KA 4KB5A 3G5LA 3A8TA 1CU1A 4PV7A 4CKXA 3QG1A 1Z0SA 5EFOA 4PQGA 4ILEA 1AHHA 3M4ZA 4JLOA 3PDWA 3KSBC 1B0UA 1J7JA 4GI7A 3VOTA 3JS5A 4XX0A 2XY4A 3UXYA 1WCV1 1LI7A 2BF4A 3IBYA 1TLFA 3DM9B 3IELA 3GEBA 4G1FA 3HFJA 1L5QA 2XCTB 1SVKA 4RZIA 4OGKA 4MK4A 1BMDA 3NTUA 5E95A 3TN7A 1JQDA 1S9HA 1VHTA 1TZ2A 4L5AA 5EC8A 2YMQA 4BWFB 3I58A 3IURA 5DHAA 4YUWA 1YQGA 3HY6A 2Y71A 1H2WA 1P0QA 1QORA 3FN4A 3UF0A 2IZZA 5IDXA 3KXIA 1G6OA 5DYTA 3FCYA 3D7KA 5LBTA 4LYJA 4X41A 4B76A 3UPTA 4Q5IA 3SQLA 2ENUA 2ZSIA 1KHHA 2WR8A 4EOGA 2VJYA 4GR4A 4OGLA 1EEHA 3JQBC 3JR7A 4QG3A 3E9CA 1T24A 2CSUA 2VHZA 2C9DA 4BGDA 4YC7A 3FPCA 3UATA 1J33A 4G36A 2PTGA 1ZAKA 2NPOA 4UCWA 3VPAA 1VL0A 4PIPA 4RSRA 5LMNB 2D59A 4F5YA 3QTTA 2ZEJA 1H0KA 3KR2A 5H83A 1JTEA 1XEFA 2VDWB 3LLVA 1MAHA 1WHSA 2AKAB 3FPHA 3ML1A 4D9JA 2QD2A 3L41A 2HIHA 2PQ6A 1YQWA 2XOEA 3JASB 4FLMA 2QZPA 4UBJA 1H6BA 1VE1A 4Y6OA 5B2ZA 4AF7A 4YHHB 5F98A 3KNZA 3LHFA 4GRIA 3E5RA 3W5CA 2CFOA 1CE8B 4MIOA 5JC1A 4H7HA 2DC1A 3PJGA 4US1R 1Y3DE 4ENPA 2TMDA 1SHTX 1Z0IA 2CVHA 3C7KA 3CWZA 1K5DA 2OC9A 3L04A 4FMCB 4BB6A 4GYWA 4EGQA 4NE7A 2PGXA 3HUFA 4N0MA 1XDUA 3AKDA 2O8BA 1OLSA 1TUBA 1UIMA 2QN2A 2FW8A 2SCUB 1R6VA 3DMDA 4LA4A 4NU5A 5ERGB 3O4JA 3UZUA 3ZBTA 3VBCA 1E3WB 3V7FA 4G0MA 2RGNA 4PFJA 5ESXA 3UV3A 2J5BA 4G4SP 3DZ8A 4XJSA 1GPWB 1ZSVA 4D41A 3QI2A 4DM4A 5KKNB 5AW9A 1EESA 1EJ0A 1I4LD 4E15A 2FWIA 1N77A 5EQDA 4EBFA 3U2QA 4QPZA 4J2OA 2IS4A 5B3JA 5TPZA 1KRXA 4R6XA 3FLEA 3KWMA 4D3DA 4MLZA 1FTGA 3KHUA 1RSZA 2HLDD 2I91A 1DJPA 2CFSA 2AEMA 3KUKA 2C7GA 4RPCA 2ZTVA 3G13A 3NQ41 2J0EA 3RIEA 3ETLA 4B31A 4E2ZA 5HKKA 1ZINA 5KYUA 1ZXXA 5BYAA 3E7XA 1P4GA 2DJIA 3DF7A 1VKNA 5E1BA 3ZGXA 1MGOA 2GRJA 3DV2A 4CV0A 3TSYA 4NLLA 4DHEA 2QQ5A 4OQQA 4QTTB 3EXIB 2I2FA 3K0KA 4P5DA 1T4GA 4BEVA 3JTEA 4P0QB 4KKVA 3RQIA 2LV8A 3AUKA 4IQ4A 1ABEA 4P3OA 2E89A 2EIXA 3P94A 1VCHA 3IUMA 4TV9F 4ZAFA 5KDLA 3WGQA 2RH9B 1P1FA 4R5HA 3TLXA 2P4EA 4L6CA 3SBOA 2WSLA 3HDVA 2C2KA 4MS1A 3WGZA 5U4XA 3MYYA 1ZBDA 4Z0NA 1FS5A 1OJ7A 1VL8A 1XRQA 4FCWA 5FWAA 2M6LA 2C2ZA 1FRFS 4PR3A 4PQEA 1C2YA 4RVOA 3RK1A 3Q9UA 1UINA 2BP7A 1R1DA 3Q7IA 4ZVLA 3DNFA 4R54A 4DIDA 4AG3A 3HO1A 2BV3A 4RFVA 5C5IA 2PGLA 1CQZA 2JCVA 2VL7A 1X7XB 2PZJA 3OG9A 1OAOC 3LYAA 5DI3B 4WDRA 5E1DA 3Q8XB 1BWRA 4P9NA 4PTZA 4KQFA 3GEEA 3KJGA 4GI5A 2GM4A 2OGZA 2C5FA 3HLKA 4EATA 5JMTA 3RIGA 5KWSA 4TLCA 3I83A 3KQWA 1G2OA 4WKGA 2O0HA 1DC7A 5JBQA 1YGPA 1JXQA 4MUNA 4BO7A 2I62A 4E3WA 4E4RA 4EQ6A 1NN5A 2FN7A 4TM7A 1SC6A 3GVXA 4EB0A 2B5OA 1DQYA 4N18A 5KNLA 4P38A 4G0UA 3RYIB 2W48A 5DGDA 4JLAA 5F9FA 5EEGA 5EWLA 5I9LA 1P81A 1DWPA 1VIMA 5EXXA 2KE5A 5DTRA 2ONCA 3D3JA 4IIBA 4DAOA 1W4CA 2IK8A 1WW2A 3T5GA 1ZD1A 3ZGYA 1CIPA 3UHPA 1EXMA 2JPDA 5C1IA 1XXHE 3HGTA 2J5QA 1VL6A 4OXXA 5F7ZA 1QVAA 2YNMC 1XDGA 2G71A 2B4TO 2P7HA 2OWDA 3Q87B 1U2TA 2HYDA 4CEIB 5KNCD 1ID8A 4GSKA 4K05A 4C1BA 3UOWA 3DMPA 2O5RA 1RZVA 2Y1OA 2PXHA 1T6ZA 4ICIA 3EWSA 3QX7A 5AH0A 5FR2A 3AONB 4F5DA 4BVKA 2XCSB 1Z45A 1XNHA 2J8ZA 1KZ7B 1B8OA 1EFUA 3CINA 3PSHA 4FKBA 2CLKB 2D0PB 5KS2A 3X43A 4M7WA 4RZ2A 2GBLA 4XWGA 1P80A 4O2BF 3REQA 5I9NA 2BFBA 3DEJA 3NDJA 1PL0A 1SU4A 1VBNA 3GZTB 4JD5A 2F1IA 4YRAA 2GJAA 1YIOA 4EL0A 2ZYHA 2P6MA 1XA4A 3VKGA 2HJWA 1LJLA 3LHKA 3QE9Y 3OX2A 2R00A 4BKUA 4EWLA 2AOVA 5CA0B 1HEUA 4YUYA 1MTOA 5ALDA 5KNDA 3CNLA 4ZZ3A 1O95A 3DHWC 1S8NA 2XQGA 2OD7A 4GXRA 4X6LA 3KVOA 4L4UA 1HNXB 4ZT2A 3TCKA 3VJMA 1XKLA 2QVXX 4XLTA 3E23A 3RNOA 4MUEA 5DJ5A 3WLOA 3GVHA 1YZKA 2HPZA 1VECA 3NHRA 3KOYA 3JALB 4XPIA 3CXUA 3E0XA 4AP5A 3TAHA 1ND6A 1NQXA 4A2QA