4MDFA

Structure of bacterial polynucleotide kinase michaelis complex bound to gtp and dna
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSNFCRGLVSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords Metallophosphoesterase
publication title Structures of bacterial polynucleotide kinase in a Michaelis complex with GTP*Mg2+ and 5'-OH oligonucleotide and a product complex with GDP*Mg2+ and 5'-PO4 oligonucleotide reveal a mechanism of general acid-base catalysis and the determinants of phosphoacceptor recognition.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 66
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4mdfA00
4I1UA 3AVQA 1NVWQ 3QG5A 4JLMA 1IN5A 3LO5A 2QMHA 2HF8A 1KMHB 3K53A 3G0HA 4L9SA 1W0KA 4UNQA 4HAXA 1W44A 3QQ5A 2XNDA 1KMHA 5B64A 4PXAA 2YOFA 1CRQA 1HT2E 1WMSA 1YE8A 3I8XA 2FX3A 2QU8A 4MKHA 3W90A 3T5GA 2QP3A 2VP2A 4PHFA 2QQEA 3CUEF 1DE0A 5F9HA 2O8BB 3KXLA 2OEPA 4A9AA 1HT1E 1F2TB 1LS6A 2YVUA 1OB2A 1E69A 1PJRA 3CM0A 2ZRPA 4NH0A 5KDLA 3LBIA 2DFNA 2WAXA 3AVVA 2ECKA 4A8JA 2TMKA 4WIAA 3M6AA 1SVWA 4H1VA 2J45A 2H16A 1JAIA 1G291 3VX4A 4LHWA 2JLUA 1G7TA 2ZJYA 2ODWA 4J0QA 4JLNA 2Y8EA 4A2PA 1II8A 4PSVA 2FZLA 1XEXB 3AP3A 2X1VA 4GZMA 4P33A 3GLGB 3I73A 3EA0A 4ZDJA 3BRWD 1D2NA 2YWFA 1VCMA 1XTRA 2VHCA 2WOJA 4JSTA 1CRPA 3GQBA 2R62A 1NN3A 3O8BA 4MGIR 4B43A 1SZPA 1DAHA 4D2IA 2FSGA 5GADl 1BO6A 3I8SA 2HLDA 2V4ZA 1WP9A 5LB4A 2V55B 3HYRA 2ZJBA 3T1TA 4B73A 4TYPA 4DCNA 4ZPXA 3RANA 1YZLA 2WKPA 1PUJA 3ZLJA 2O0KA 2RGEA 3IHWA 4BLOA 3KX2A 1XB2A 3V4FA 4OQLA 2H7VA 5FPSA 2D7CA 2NTYC 2ZRNA 2WZQA 5DN6D 2PZGA 1Z63A 2ERXA 4BEJA 3E5HA 3QKUA 4MRVA 4KAXA 4XJXA 1U8AA 4C2UA 4PR0A 2WWXA 2V3CC 1E1RD 3WY9A 4ASUA 1IQPA 4CEHB 2ZYUX 3ZQJA 2XZPA 4RKEA 4MRNA 1RZ3A 1GZSA 5GJWC 3UMRA 2IS2A 2ZJ5A 1OYWA 3OE7D 3CLVA 1ZD9A 2FE4A 2H17A 4C0SA 4JIMA 4PPFA 5HE9A 1CIPA 2AD1A 4G01B 3ZIAD 4UJ3A 4FCVA 1R5NA 3U5ZB 4TYQA 2GJSA 1BMFA 5G3ZA 1ZJ6A 2JEOA 3KJIA 2GJAA 2ZRKA 3IPYA 3WRXC 1DARA 1CTQA 2ZI3A 1MO4A 1OKKA 4NU0A 4CT4B 4PX9A 4MKGA 3CF0A 4Z8YA 1V43A 1Z06A 4DB2A 4AIIA 4OI2A 2ZM5A 1ZCAA 3QXJA 1XXHA 4B2IA 4Q9HA 3TUIC 4X8LA 1W46A 4B6EA 2C96A 4PANA 3ZZTA 4MH0R 1NVXQ 3IUYA 1X8KA 3AVUA 3GEEA 1US8B 1Y63A 4QHTA 4E22A 1XTSA 2VEDA 1N5KA 1GL6A 2PJZA 3MJRA 3NC1C 1TL7C 5EQTA 5FH9A 2XX3A 3IQXA 1UBCA 4YMUA 3AVTA 3UATA 2H18A 4POAA 2AR7A 5IK2D 3AV0B 4Q1FA 3LLMA 4R98A 1FTNA 1KY2A 2N42A 3ICQB 3B5JA 1W4RA 4MYUA 2P5SA 3QEJA 4B44A 3PUWA 1A4RA 3MMPA 1XBTA 2W0SA 4M2LA 5EJEA 3SJAA 4A36A 1G16A 4TLCA 1TEVA 2OHFA 4M4SA 3P26A 4IVRA 4FWIB 4YXWA 1MT0A 2HLDD 4DHEA 5KDDA 3REFA 1VG9B 2BOVA 2IWRA 4CDGA 1IN6A 2OFWA 4ZDWA 1KDPA 4RZUA 3EWSA 4G5SA 1CBUA 4Q03A 4QHSA 1XWIA 4KBFA 2QG6A 2P6RA 4HAWA 1JXOA 3EPKA 2D4HA 1M1YE 4XD7D 2I3BA 1P61B 5IHPA 1SGWA 1Z0DA 4M22A 1FUKA 1N6PA 4KXFB 5CJPA 4BZXA 1V5WA 1Z6TA 4D6PA 3QI2A 5JJKA 5JJIA 2FFBA 1G21E 1KI8A 1IY2A 4L8GA 2GK6A 5DI3B 2VP9A 4JYCA 2ZU6A 1E0JA 4GSYA 3W6OA 1KKMA 3FMOB 3PEWA 4MITA 3F5FA 2IBMA 3THOA 3UKDA 2GJ8A 1YJ5A 1VCIA 4B32A 3WYFA 1IXSB 1W36B 3LV8A 1N5IA 2YJTD 3PR1A 1BMFD 4QM7A 1S2MA 2FU5C 2QT0A 4HUQB 1M8PA 4DDTA 2IXFA 2RGGA 3UK6A 4GRAA 1ODFA 1YU9A 2GCOB 2BEKA 5F3WB 4TSFA 4HUQA 3NKVA 4PC6A 4KSBA 3X1WA 1KK1A 1R10A 1XDBA 1GNRA 2VP6A 1P2VA 1JJVA 3QNUA 4K8OA 1D5CA 3MSXA 5E7MA 4OK6A 1GITA 5JSZA 3CZPA 1E9DA 5FBQB 1KI7A 1AKYA 3VHXA 3THWA 3B13B 5L3QA 2VP5A 3CRQA 3TR5A 2FEMA 2GEUA 4DIDA 1MABA 1DAGA 2ZAMA 4RVCA 2GWHA 4QJ5A 3CF6R 3DMDA 2O8EB 1U90A 2MMCA 4HZUA 4HAYA 3MLEA 4FMBB 1CJMA 3CX6A 4NPHA 1ELOA 1SVOA 1M34E 2QTFA 2FG5A 3U44B 3KKQA 1PVOA 1E2PA 2KI5A 3NH6A 1UEIA 2C9YA 2BBOA 2ZYWX 3W3AA 1J70A 1N6RA 1SVLA 4KFRA 2ZSAA 2DFTA 4C30A 4DDWA 2PCLA 3MJHA 1XZPA 1ZUHA 2A9KA 4P32A 1SKYE 3U3JA 1CR1A 1UBFA 2ZSDA 5C46F 4QGAA 4YXWD 5EXSA 1AJEA 1NLZA 2GEDA 4M9XA 4V0MA 3SEAA 4QG7A 5FOXA 1UKEA 4CW7A 3THYB 3RLFA 3CIOA 1F6BA 4OYHA 3K09A 5L8VA 1GL7A 4LV6A 3LH5A 5DLQC 3A8TA 3M0EA 3IBYA 1U98A 3GLFA 1NN5A 1GG2A 3WNBA 3DOFA 2WOOA 3NC0C 1E2NA 3RS2A 5FUWA 5JS8A 1NIPA 4JS0A 3VMFA 4D26A 2HF9A 1KAOA 1T0JB 2Q9AA 4Q1EA 3AVXA 4BLPA 3C8UA 3VKHA 4QBFA 3TIFA 4DLXA 1G3IA 3QBVA 2OAQ1 1QHIA 1ZIPA 1EWQA 4F93B 4NYMQ 3VAAA 3WHKA 4NP6A 4WW0A 2ZROA 5AUPB 1DADA 3Q5DA 1IY1A 1OLOA 1UEJA 3M4YA 1DAEA 4PC3A 1OXUA 4YMVA 3VU9A 4BZQA 4G1UC 2J7PA 1EESA 1JR6A 3I92A 4D4KA 1LF5A 1EXMA 3IILA 4Q66C 1E2JA 1JQJC 1KK3A 1R0WA 2EYQA 2LCFA 3UIEA 1W4BA 4I4LA 4RJLA 1KIMA 2EFGA 2QGZA 1ZINA 2IYVA 2A30A 2PX0A 4Q7JB 3ECCA 3GD7A 2O8DA 4HUTA 2J1LA 2D62A 4QXAA 3VR6A 1NNEA 4R9UC 1E2HA 3Q85A 5KSOA 3HYTA 3HR8A 4HLCA 1R7RA 5HE8A 3B6EA 5KNBA 1NLFA 3B2EA 5IF9A 2V1XA 1GDDA 1W47A 2OXRA 4KVAA 3HR7A 2J0SA 1GSIA 3H4MA 4DEYA 3U4QB 1A2BA 1X1RA 2XOKA 1XEWX 3EZFA 3WYGA 2SHKA 4DB4A 3BH6A 4IOKA 1MRSA 2ANCA 3GJ5A 3H1TA 4BFYA 2CVFA 1TEXA 2J9RA 1CP2A 3BK7A 5JRZA 5K8IA 4OK5A 2WSMA 1DTSA 1YR7A 5EXPA 4LC0A 2GZAA 2IS6A 2FSFA 4OQNA 4O0MA 4GDFA 4Q48A 1G3MA 2CL7X 1NSFA 2DWPA 3EZ7A 1OH6A 3NH9A 4KFSA 2BBSA 1UAAA 1KO1A 2Z83A 3RABA 3T1OA 2W6IA 2FFQA 1XPRA 1ZM4A 2QTVB 4IDOA 3LW8A 2ZR9A 3ASYA 2WWHA 2VRWA 3CWZA 3QBTA 1YR6A 1XXHE 2BVNA 1GAJA 2VH5R 3RYTC 4B3GA 5CK4A 1VTKA 2DFLA 3N5CA 1A1VA 3P4YA 2F6RA 4MRPA 2JLXA 1KI3A 2JIZA 2BIFA 2VF7A 4OJQA 2FA9A 2OBLA 2YC4C 3QUSA 3GFPA 2IYSA 5HKKA 5JS7A 2JLWA 5FPKA 2VP0A 3JVVA 4B6FA 1DO2A 1YQTA 1Z6AA 3K9HA 1PLKA 5D3MA 3RS5A 4F4CA 3GLIB 2A3RA 2HXYA 4F91B 4QRHA 2QSZA 3SNHA 4BASA 4Q4HB 3AF2A 4KSCA 1S1MA 2HJVA 1U9IA 4NCNA 4W9MC 4A6PA 4DSNA 3NDBB 3U7EB 2P0EA 3MWYW 1ZD1A 1VYVA 1S3GA 5K8UA 1C9KA 4BRWA 4DWJA 1FFHA 1ONBA 2YOHA 1TQ6A 5E95A 2GKSA 2W2XA 4HEJA 2J7PD 4LYFA 1LV7A 3LW7A 1OFTA 3JVUA 1UPTA 5L3RA 1HE8B 2XXAB 1KDOA 4EPRA 3X1ZA 3DZ8A 3TE6A 1N0WA 2XTZA 4ZIRB 4LV5B 4GL2A 1XPOA 4B75A 1OV4A 1MO3A 4GMXA 3QEOA 3TAUA 5CLLA 3ZVLA 2P67A 1U0HC 2JJ8A 1SHZA 2FOLA 2PT5A 1LB1B 3X2SA 3K1JA 4ARZB 5LDDC 3R8CA 1ZM3A 5KTYA 4N1AA 3ETLA 1DOAA 3C7KA 3LDAA 5FI0B 4IVQA 4QBIA 3GLHA 4AD8A 3Q3JB 1G8YA 2C9CA 2XOKD 4IOMA 1E9RA 3MD0A 1FZQA 2ZS8A 2WTUA 3BGWA 1H8EA 4R7ZA 4QJ4A 3D6TB 1KSHA 2NZJA 3EZ6A 1Z3IX 4G3XA 2EFCB 1OSNA 4OQMA 3SHFA 3DVLA 4TWZA 2IT1A 1S3SA 2GRJA 4EIWA 2WSSD 5JI3E 1OPXA 2FNAA 1L4UA 2IYLD 4JLJA 4TT3D 1TQ2A 5HCIA 1KY3A 4RD0A 1YVDA 3ASZA 5KNDA 3CNLA 4DUGA 2QPOA 3KB2A 2PH1A 2AKYA 1NY6A 1VKJA 3T06B 1S9DA 1Q12A 3K0AB 4CEJA 5FFMA 4L9WA 4P4SA 1EFRA 2IXEA 2EWWA 4BFWA 1YRAA 2OESA 2WPDD 4BFVA 2QEQA 1RRGA 1OIXA 4IVPA 4KLNA 1GRRA 1U94A 5UKDA 1TUEA 2ZITA 2Z43A 2QRZA 1F60A 1WF3A 1XTIA 2HJGA 2PEZA 4YDHB 3PENA 5SZHB 3KUCA 5KO2A 2JJ1A 3R9IA 2A5YB 4LHXA 2WHXA 5J4YA 2AKAB 2YZ2A 2Q21A 4WVFA 5TB5A 1ZVQA 4RSGA 2ODNA 3QG1A 1J99A 4OI0A 2FJUA 3T15A 1UF9A 2CJWB 2FWRA 3MFYA 1G8HA 3SU8A 4JL5A 4EPVA 2F1HA 3V00A 2FFHA 4QBHA 1AS3A 3CPHA 2NG1A 4FXPA 3R7WA 1NIJA 4D0LB 1XCMA 4WAUA 4V0ME 2QI9C 2A2ZA 5KOYA 1G8GA 1EWRA 1DS6A 1FMJA 1E32A 2F9MA 5FBVB 1TUIA 3I5XA 4A2QA 1BOFA 1NKSA 1UJ2A 1IOZA 1VYUA 2DPXA 3BAFA 2GHIA 3BS4A 3Q9LA 3WNCA 1F3OA 3TAHA 4YMTA 4NTZA 3GLFE 2WVJA 3K0EA 3K09C 2XGJA 4X8MA 4JVMA 2GZDA 3GFTA 3QXSA 4JL8A 4M9SA 4YLGA 3T1QA 1Z6XA 5JCZA 2RHMA 4JLVA 4XVUA 1W48A 4DCVA 3IGFA 2WWGA 4KI0A 2V6JA 4PAQA 5KSPA 421PA 2JLYA 1CULC 1KAGA 1ZIOA 3AUXA 3V4RA 1W5SA 3Q5EA 4NCIA 4W5HA 3AVYA 2G1JA 2WMNB 4AY2A 2OCBA 3UMFA 5BYKA 2PBRA 2R44A 5G3YA 4BLRA 1WCV1 1HY3A 3T34A 4EQ6B 1J8YF 3AKCA 1UM8A 3SR0A 1X86B 2PT7A 2QBYB 2KSQA 2O52A 1WB9A 2V1UA 3QIAA 2RGDA 1G7RA 5EP1A 2AK2A 2QBYA 4B33A 1M7HA 1T91A 1T5IA 2ZE5A 3TSZA 5DE3A 5GJBA 4DLTA 2WIAA 4XSGA 2GDJA 3BH0A 1D9ZA 5JRJA 4ACAA 4BE7B 4DLSA 5BXQC 3RRZA 5B57C 2IYUA 2J7KA 2QL6A 3EWAA 3B1YA 1T4GA 3DKPA 5CB8A 3DZDA 1P2SA 1XJCA 3B85A 4AKIA 4D81A 3CH5A 2CMKA 1NG1A 4WBSA 4Z1MA 4ILEA 4OHXA 4HLUC 4ERNA 1XD2B 4B3BA 5EP4A 3TH5A 4BFTA 2ZETA 1NMYA 3S1AB 2ZS7A 3REGA 3W9YA 4N0DA 2HYDA 1CR0A 1N0UA 2J0VA 2JJ1D 4LC1A 3MG9A 5G40A 3K70C 2O8FA 4AG6A 4URXR 1P7CA 1EK0A 5SZIA 5EZ6B 4RKFA 4P31A 2QAJA 2V7QA 1N3BA 2ASEA 4BFUA 2FGKA 5JMTA 2AX4A 1HTWA 3NBFA 4B76A 4HATA 2AN9A 4PHGA 3T61A 3DDCA 4ZV4A 4DRZA 4ZDIA 2PX3A 4CGZA 4PQYA 1COWA 1AGRA 1ZMXA 3ZVRA 5HTKA 1YRBA 1N6NA 1TU4A 2CCKA 2X8AA 3GCGA 5B58C 1G7SA 1RE0A 3DM9B 1WQ1R 2PL3A 3VQTA 3HDTA 3NTUA 1E9SA 3RAPR 2QRNA 1GILA 2OE2A 4BFSA 3A1WA 4OJKA 4DSTA 4LZZA 2NOAA 4A0GA 4MYCA 1DAMA 2OUKA 4PZYA 4Y0AA 2CE2X 3LX8A 2LKDA 3SN6A 4Q21A 1MO5A 3GJ0A 4QOSA 2OCPA 3NWJA 4TQAA 3PIRA 2ZPTX 4XVRA 3D31A 4ZKEA 2H1LA 3NG1A 5AJZA 1AKEA 2IEZA 2QTHA 4YONB 1UADA 1I4LD 1GNPA 2ZE7A 4JL6A 4WOPA 2Q9CA 3DM5A 3NHBA 5JBQA 2ZXUA 5KPDA 4IDNA 3OEHA 8OHMA 1HQCA 1HV8A 2B92A 4LWZA 2R6DA 2O8BA 2F43B 4RZXA 1U9IC 2LWIA 2C95A 1F2TA 521PA 1E79A 1KSFX 3EG5A 5FTKA 2IYXA 4S2EA 2BJVA 4LUCA 2ATVA 2GXAA 3PXGA 3NBXX 1LS1A 2PMKA 2XJ4A 2DBYA 2Q3HA 2E9SA 5J47A 2AXPA 5KUTA 4UNNA 4GZLA 4C0BA 121PA 1XTQA 3RSOA 3ZGXA 1Q21A 5TDHA 1E9BA 1XEXA 3GLGA 1J7KA 1FP7A 4C7OB 4Q7MB 4US0R 4X8OA 1DG3A 5EXTA 5SZKB 1TADA 5FTJA 1TF5A 2ANBA 5JJLA 2Z6VA 4Q1AA 1Q1QA 1IBRA 5KU1A 4URVR 1NJFA 4YMSA 3N70A 2CXXA 4LOAA 3F3YA 1EFUA 4PPNA 3TR0A 3GLHE 4U7DA 1C4OA 2DWQA 4QJ3A 4F92B 1N6IA 4M0LA 821PA 4XWOA 1W2HA 1T9HA 2B7CA 2BBTA 2CVHA 3EIHA 4GFDA 3A1SA 2ZRDA 4MQBA 2YC2C 4HAUA 1VIAA 4P4UA 2NGRA 5CJ2A 1U81A 4JLAA 2QN6A 5DYIA 3K0CC 1T3LA 3W6PA 4E07A 2C99A 5GJCA 3PEUA 5TXGA 4AKGA 2BKEA 1Z5ZA 3EPHA 5JLJA 4C2TA 1Q3TA 4DLRA 1WBDA 2WM9B 1I2MA 2V7QD 4Q1DA 4W7SA 4D25A 3GJXC 3TJZA 3GPLA 4IDHA 5EP3A 4CEHA 4TLBA 2CDNA 4AYTA 1GRNA 3SBDA 4PO9A 5CM9C 4E5UA 1COWD 4QGGA 1G3QA 1KMQA 3THXB 3RWOA 5EXXA 4L4UA 4LYJA 1XD8A 3SS8A 1W2GA 5FUYA 3Q7QA 4IEIA 2VL7A 1IN7A 3NHAA 4GBMA 1W0KD 2P65A 1N6HA 2Q3MA 3LNCA 1Q0UA 3I5YA 2ORVA 2F1JA 1VPLA 2XNDD 4RCZA 2F3TA 2GBLA 2QZ4A 2VQSA 2PZFA 2QPAA 1AK2A 4LBZA 3BB1A 4MGZR 3SC3A 4NHOA 4DLYA 1CJKC 4Q1BA 2FGJA 1GL9B 1MKYA 1ESMA 1TU3A 1TF2A 4QL3A 2WMOB 3KTAB 4Q9KA 4ESVA 1FQJA 2DY1A 4OBEA 2OBMA 3DKVA 1KGDA 3BH7A 1P6XA 4DCSA 2IA5A 5BN3A 2OCYC 1VECA 3WMEA 4YC7A 1E0SA 1GTVA 1US8A 2CNWA 4JLBA 5BW8A 3TQFA 3I62A 4QM6A 1MH1A 5JEDA 5JCPA 3EIEA 2OFXA 2ZI4A 4M9ZA 1M74A 2R6CA 4BRUA 3TKLA 5A0FA 5JWRA 3KKMA 3AGPA 3IQWA 4Q4JB 5AJWA 2XSZA 3HU2A 2QQ0A 2IX3A 1W0JA 3FKSA 3OIWA 3AKYA 1R6BX 1ZW6A 1E0KA 5TV2A 3W5JA 1QHXA 4Q01A 3C5HA 3BC1A 2CCJA 2ZRHA 4HDQB 4I81A 3L0PA 3WMFA 4M1OA 5JHHB 1Z47A 2XJ9A 2BDTA 2GXQA 2ZRJA 2RMKA 5B30A 1ZNXA 2G0NA 4R2HA 4F4JA 1R4AA 2RKOA 1VHTA 2A78A 4OQXA 1KI6B 1N25A 1R0XA 1M7BA 1XP8A 5BN5A 2WAYA 4NCJA 1YZUA 1P75A 2B7BA 4LGMA 3SI7A 1VHLA 4XWAA 1XMJA 1K6MA 2YHSA 4QGHA 3R20A 3KQLA 1CXZA 1UDXA 2XEXA 4LCBA 4PSKA 5DIFA 1PV4A 1VYTA 1JBKA 1E99A 5FPHA 4KO8A 2UKDA 3PV0A 3H2YA 2Q6TA 1FTSA 4EJSB 3F8TA 4C9BA 2OV2A 1JJ7A 2EWVA 3KQHA 4KVGA 2VSXA 1XCPA 2GF0A 4TZ6A 2I1VB 2ODBA 4KU4A 1R5BA 1KO4A 1XTJA 2XB4A 1AS0A 1FOEB 4ASUD 4BWYA 3LXRA 3SDZA 4C4PA 3DMNA 1BYUA 1E1QA 2EQBA 2C9OA 1I4TD 1UFQA 3A4LA 2P6NA 3GJ3A 5DI3A 4GI7A 1D2EA 1J90A 2FFAA 2ZREA 3BIFA 2GCPA 5FBRB 4EFMA 3R8FA 1OE0A 2QAGB 2PEYA 1Q1EA 2BJWA 2H57A 4P0TA 3TVTA 1VDZA 3EC1A 3OAAA 5K8LA 3B1XA 4IOJA 3U61B 1JEDA 5GVRA 4UXHA 2VIIA 3EIQA 4XH9B 1ZU4A 2ONJA 3AM1A 3BJIC 3WP1B 2N46A 5ELXA 3W8NA 1OKKD 1T8UA 1KNQA 2GCOA 5KDOA 1SXJB 1F48A 2G1KA 2CK3A 4H9GA 1ANKA 1KJYA 2V6IA 1SXJA 3EZ9A 4L16A 1E9AA 1AZTA 2ZUBA 4Z54A 1G64A 4PPQA 1NI3A 2H5EA 4ZCLA 1HH4A 4KODA 3W6NA 1LFDB 2GVZC 2ZRMA 4OL0A 1FL9A 3QF4B 3IIKA 1OXVA 4WZBE 1YZNA 4B48A 1K5DA 2J59A 1P2UA 4TMXA 3BB3A 2CNWD 4M21A 4FMCF 2YYZA 2AFHE 2VSOA 3K0FB 1L2TA 3X1XA 1S4QA 2O8EA 2QSYA 3DPUA 4UXJA 2QGNA 1UBGA 1ZD8A 3TW8B 2RGBA 2RGNA 2CLSA 2VSFA 3FKSD 5G41A 5L3SB 1JNYA 3V9PA 3ZD6A 1G5RA 3U44A 2C2HA 5A4JA 2FEOA 4NYIR 1ZUIA 5LD2B 5G53C 5FBWB 3U2QA 4URWR 2RGCA 3TW4A 5EE9A 3AF0A 4Q7KA 3DO6A 1DAIA 3R9WA 1OW3B 4FWTA 1Z0FA 2ZE6A 1NMZA 4ZCIA 2IF2A 1CF4A 1UKYA 4A0HA 3T12A 1F2UB 1JPJA 4I99A 4U5XA 4PZZA 3ADDA 1NVVR 1Z83A 5FOTA 3THYA 2IWHA 2WBLC 2EFEB 1G5PA 1KHTA 1DG1G 4LBYA 2CHGA 3OZXA 4DEXA 2R6FA 2PLFA 5BWMA 3EARA 3H0KA 5B2ZA 1P5ZB 4FI3C 5JZVA 1NBMA 2IYZA 2WWIA 3LQQA 4G5GA 5JI2E 3PJRA 2OO7A 4JT4A 2OCAA 4QGFA 3GLGE 4Q19A 1N2CE 3A4NA 3QSYA 4C0QC 1O87A 3W5IA 3PEVA 1G8FA 1KYIA 4OHYA 5E7JA 2DB3A 2ODEA 3L0SA 1AQYA 3BERA 4HI0E 4FMDB 4B2PA 4JVNA 1NSTA 1CR4A 1QZXA 2BM0A 1QVRA 2V9PA 3CONA 4X8HA 3J81k 1GNQA 5CYPA 3WP0A 3PUYA 3PITA 4JBXA 1J8MF 2BBWA 4TSFD 3O47A 2GXUA 2FMXA 3CX7A 2Q0HA 3T35A 1U99A 3K9LA 4GNKA 4AKEA 2G77B 1HEIA 1QHSA 4QHYA 3D8BA 1G6HA 4QC2A 4HLUA 3DOEA 3HU3A 4AC9A 1G4AE 5CB6A 1IN8A 3B8HA 3U4QA 3L2OB 1EX6A 4LHZA 2HYIC 4O25A 2F7SA 4A15A 3MWLA 1CJVC 2J41A 4NL4H 1XFAA 4QKQA 3DL0A 4PC7A 2OG2A 2VA8A 4H1UA 4GOJA 2J46A 2OFOA 3ZJYA 4Y0VA 3PUZA 5H68A 2Z0MA 5LPNA 2PCJA 4D82A 4Z51A 1EFTA 4YQFA 3HJNA 1P62B 4LJ8A 3EPJA 1D6JA 1XCGB 3K9GA 3LVQE 1BIFA 1P73A 1ZUNB 2ORIA 3KKPA 1MV5A 3A1TA 4B3DA 1RVDA 3A1VA 2GBLC 2BV3A 1C1YA 1E2FA 2N1BA 3E1SA 3ZYCA 3C5CA 2DFKB 1FP6A 1ZP6A 3M1IA 2BHRA 2IXGA 1T3HA 4XTCS 3IIMA 2YV5A 2X2FA 4DZZA 4IRUB 4NBSA 1W7AA 2GEVA 2R8RA 5E7IA 2FPLA 2IEYA 4LRWA 4DC9A 1G5TA 1E2DA 4CT5A 1Z6GA 4TL9A 2AFIE 2CLDX 2Z4RA 4JVLA 1QDEA 1G3UA 1W4AA 2HCJB 4TN1A 3EA5A 3NEJA 3IPXA 2P6UA 3GLIA 2A7QA 1NBMD 3RWMB 2G6BA 3RSLA 4Q4HA 3O8RA 2GTPA 5FUVA 3OF5A 3BOSA 4E03A 1NN1A 1SVSA 3OIUA 4FCWA 3TUZC 3FFBA 4URYR 2AXNA 2WKRA 3I1FA 4M1SA 2MSDB 2GZHA 3OIVA 4JJKA 5M04A 1NP6A 3GFOA 1KSGA 2NIPA 2UZIR 1YZTA 4PFSA 1OFIA 4UNSA 5K8TA 2X19A 4MRRA 4Q4AB 1Q1ZA 3TNFA 1S0UA 3SE0A 2XXAA 2IW3A 3LA6A 3ND8A 3OESA 4ZIRA 2GXSA 2BEJA 3LRPA 1JPNA 1P9NA 4CEIB 2A5FA 4MA4A 1A82A 1ZBDA 2IUTA 1G41A 4TLEA 2OBNA 3AF3A 1GUAA 3QF7A 1FX0B 4G5RA 1XZQA 4O2LA 4ARZA 6Q21A 4RCYA 4EUNA 2BMDA 3U3OA 2IYRA 1KNXA 4KLZA 1PLLA 2WJGA 4U00A 1WRBA 3K70D 4M53A 1UBEA 1D8TA 1Z28A 3K0CA 4NCKA 3PUXA 3AQ4A 5DSZA 2CBZA 4EKDA 1S1CA 1CEEA 3KDSE 2QA5A 4JKYA 1QVAA 1ZM7A 5GJVC 1B0UA 2F3RA 1E94E 4M1WA 1ZCBA 2YWHA 1E2EA 1ZM2A 1RC8A 4DVGA 4AKHA 2IYQA 1TF7A 4GP7A 3SYNA 2GCNA 2ZJOA 5E3HA 3U6BA 2W6ID 1W36C 1E96A 1DELA 2F1IA 2W6JA 5J4LA 1KOFA 2D74A 2F1RA 1SXJE 5C4MA 1NN0A 3K0AA 3LBHA 4RFSB 2ZI6A 3A4MA 4LJ7A 1MRNA 1SXJC 2JIZD 3U6KA 3K0SA 4UNPA 4LY6A 2AK3A 2VO1A 3AUYA 3LVRE 4Q5IA 4B3CA 4B3XA 4ZKDA 5AUNB 5HKKD 1K5GA 2WJVA 3QXCA 3U3MA 1M6NA 221PA 2EW1A 5DGXA 3P4XA 3FMIA 3UANA 1U2RA 3W3ZB 3KQUA 3CR7A 2RGAA 2JAQA 1XEFA 4XTRA 1GM5A 2OSBA 3CB4A 1QHYA 4BFZA 4KITB 2J0QA 2RGNC 2E1RA 3D3QA 3BXZA 3CBQA 2CJWA 4HLQB 5ANRB 2WJIA 2QUZA 4V03A 3A1UA 4TYYA 4OI4A 3EW9A 4G5QA 2W58A 4LHYA 5LD2C 2YINC 3GEIA 3I72A 1E4YA 2DHRA 3TSWA 4ZDKA 3SOPA 3C4JA 2FPMA 2HT6A 4I1SA 5DI9A 3IIJA 3FHCB 4AG5A 3QPUA 2OM2A 4EFNA 3B7GA 4MUBA 4C0HA 4F38A 4HSEA 1IONA 2QPTA 2FPKA 3AVOA 2ZRCA 4OHVA 5EP2A 1Q20A 1DAKA 1YZQA 3RRNA 3UG7A 2G9NA 2VP4A 3ZQ6A 1L4YA 4TYNA 2B8TA 5H70A 3VHLB 1NBME 1XMIA 2ZJ2A 621PA 1S96A 1RIFA 4G5OA 2KE5A 2AWNA 1H8ED 2DR3A 1XRJA 1FMLA 2BMJA 3CR8A 4US2R 2QT1A 4JJZA 3ICEA 2GJKA 3FMPB 3ZVNA 5LB2A 3HP1A 5C2JB 1J2JA 5HPYB 1Y3AA 3MWJA 4IHQA 4R71A 4EQ6A 1VCNA 2I1QA 4CRWB 4DT1B 4B34A 2MMGA 3FKQA 3G5UA 1P4SA 5TARA 3QKRB 5BN4A 1DO0A 1AQUA 2QNRA 3ZS8A 3VR2A 2REBA 1RJ9B 3CNOA 5AR1A 4DUGD 5GVSA 2GVDC 2W6JD 3QKRA 4B74A 5P21A 3BB4A 4E09A 4EPXA 1WBBA 1DEKA 3KKNA 4IFBA 2GAAA 1CJTC 4IDPA 1EFRD 3VNVA 4DCTA 1NY5A 2YOGA 3VR5A 4DXAA 5FL7A 4DIEA 4BLSA 2ZU0C 3A58B 3FYHA 2FDCA 4M9QA 3EC2A 3G82C 5J40A 3N2IA 3OEEA 4LDJA 1RFLA 4FIDA 2RHDA 2YWGA 4B2LA 3KL4A 1XD2A 2H92A 2ZEJA 1DPFA 1IXZA 1CU1A 2YWEA 4HLDA 1GKYA 2D2FA 4LV8B 1IJEA 3Q72A 3S1AA 4ACBA 3IHLA 4CYMA 2CLCX 3RRMA 2O0JA 1KKLA 4IKEA 5H1YA 4ON9A 2ZIAA 1ETUA 1GVNB 2RH5A 1O3YA 2W00A 4RD2A 4NCHA 1X6VA 4A2WA 1X8LA 2CCGA 3BWDD 5EZ5A 2BMFA 4AYXA 5A5GA 1OH8A 2IYTA 5DN6A 2PZEA 2B8WA 1P9WA 3D7MA 3UMSA 1NLYA 3KXIA 4U02A 4EPWA 4ZI2A 2ZSFA 4ZI3A 1YR8A 3FOZA 1Q57A 1RPZA 1R0YA 4OHZA 3TRFA 4M1KA 1GWNA 1KZ7B 4Q47A 1Z07A 5CIQA 4LJ5A 4NE2A 2GF9A 3F0TA 3PVSA 3LFUA 2ZI5A 4UQOA 4Q1CA 4HB0A 4GOXA 2CE7A 3GJ7A 2Z5FA 4PO8A 1ZNWA 2OT3B 2G3YA 1HE1C 1Z08A 3KXKA 1XEWY 4JMPA 4Q9JA 2GILA 1EFCA 5FOSA 3GLIE 4PC1A 2QMOA 2JASA 3AF4A 1N6LA 1S8FA 3EPLA 5DISB 3O8CA 3FHOA 4EAQA 1P3JA 3WMGA 3FWYA 1D9XA 3KJGA 2BCJQ 2F43A 4WZ6A 2WJHA 4JBWA 1SKYB 1Z8FA 4TQ9A 4AI6A 2QE7A 3AKEA 1P60A 2JA1A 4D4MA 4PO1A 2EVWX 4DSUA 2GETA 2ZVPX 3O8DA 2MSCB 1OXXK 2R65A 2B6HA 2YNMA 1KK2A 3LAWA 3LBNA 1UDWA 3PCRB 4A8JB 4PC2A 2V8OA 1TAGA 2WKQA 4EPYA 1G3RA 3CZQA 4FMDF 1P2TA 2ZS9A 2HXSA 3SFVA 2ZYVX 1CR2A 1XMSA 4C7OA 2O8CB 4LJYA 3ND9A 3B9QA 1II8B 2NO7A 4AYWA 3TBKA 2FZ4A 2O8CA 5FL7D 5IK2A 4BFXA 5L3VA 2P3SA 3TVDA 4Z1MD 1IJFA 3OEED 5C18A 1KDRA 1OH5A 4LSGA 1G6OA 1NKTA 1Z6YA 3R9XA 5J4VA 3L43A 2XB2A 1WE2A 2DWOA 1KJWA 1TPZA 2L0XA 2XITA 1GRQA 2JDIA 3E70C 4KHZA 3WBJA 3B9PA 2HDNB 1TMKA 4FINA 4TMZA 1RYHA 2BKUA 5C4GB 1G4UR 3KKOA 4RY2A 1QHHB 1Z2AA 1LTQA 3BFXA 4JLDA 4KBGA 1NJGA 2D3WA 4PZLA 1OB5A 1XJQA 1MO6A 1QHHA 4B71A 2FSIA 1OYYA 4XD7A 3U60B 4ITRC 2AWOA 2NQ2C 2XZLA 1OF1A 4JLOA 5E4FA 4TYWA 4MRSA 3A6PC 3THXA 3PG5A 3TMKA 3AVWA 1II9A 3IEVA 2VBCA 5FOUA 1RKBA 4US1R 1JECA 1TQDA 3KFXA 2KB0A 4TLAA 3CKLA 4PHTA 4O3MA 4JKIA 2JATA 2OLKA 1JB1A 3H86A 3SYLA 4EDHA 1T8TA 1IM2A 1DAFA 2VPPA 3RRYA 1X3SA 2QM7A 3T1VA 3PEYA 3KTAA 2PMDA 3OFNA 3OEHD 2FF7A 3QY0A 1L8QA 2ZRAA 2OLJA 1R8SA 1E2KA 4BUJA 1S9HA 2DYKA 4GP6A 3FMFA 1E79D 2CL0X 3H84A 5AUQA 1RYFA 5FL3A 2NMVA 1CLUA 1XXHB 1VMAA 2HV8A 2QE7D 5HCNA 3ZDQA 3AEZA 1W1WA 3LWNA 5AJYA 2ORWA 1G9XA 5H8WA 1KI1A 3U3KA 1R0ZA 2VYFA 1U8YA 1OHHA 1X1SA 4IOLA 3TLXA 4Q4JA 2WWWA 3B1VA 2JLRA 3QPVA 1KO8A 4TTQA 4D80A 1ZC3A 3TSOA 1GP2A 1YZKA 1Z2CA 4LJAA 4PQFA 5EE1A 3P32A 1OIWA 3OIYA 1Q1BA 3QENA 4DLUA 1JALA 2QENA 4TL7A 4A82A 3LXXA 4II7A 3CNNA 4GT1A 1G18A 2VHJA 2MSEB 1IN4A 1G19A 2J87A 4V0OA 4DCUA 4PPGA 4AK9A 4I1VA 4A0FA 4PAMA 3B1WA 2WJJA 3QXHA 1KO5A 1N6OA 1KI6A 2GA8A 2NO0A 3KB1A 5FR2A 4D4LA 3GJ6A 2JJ2A 3P27A 5FPTA 3RS7A 3SJCA 1PLJA 1AGPA 2B21A 2XTNA 4DLVA 5AUOB 4IXNA 2VTKA 5CYOA 2IYWA 1LF0A 1LVGA 3KZ1E 2JDID 4RD1A 2IUSA 4EJSA 1Q44A 3AH8A 3P20A 4KFUA 2GK7A 721PA 3SQXA 2ZJZA 1EGAA 1E2MA 2IL1A 5IT5A 4LYHA 5FTNA 3B82A 2W83A 4JLPA 4MKIA 3CPEA 5FTMA 2XAUA 4V0LA 2K5UA 2ZRBA 3AVPA 3QOFA 4W5WA 1FNNA 3QE0A 3LLUA 3RDPA 2OILA 3NIBA 3KQKA 3UG6A 2QAGA 2FV8A 1U8ZA 3GEHA 4TLDA 4AWXA 1KK0A 4LJ4A 3SYKA 3QVUA 2ZRFA 1JEEA 5FUXA 3ONWA 2ERYA 5AJXA 4L5BA 4DBLC 2RGXA 4HB3A 3GJ8A 4S35A 5AWFC 5CIWA 4KJZA 3BBPA 2H8KA 4Q9IA 5KYKA 3VFDA 4WA7A 4NYIQ 1BH2A 4HDCA 5TY0A 4HAZA 1F5NA 2G88A 1N6KA 2OXCA 2ZYTX 3JZMA 4MGYR 2ZUDA 4DKXA 3LQRA 1R8QA 1ZM9A 3A36A 3OFND 2ZTSA 2EFHB 2IYYA 2W2VA 1AS2A 2C03A 3C14C 3WXMA 1OH7A 2R9VA 3SBEA 1BKDR 3GP8A 3GMTA 5JHGB 3CH4B 3QF4A 2IHBA 3ZD7A 1TNDA 3CF2A 2NPFA 1JR3A 1XMVA 5JSZB 3KFVA 3WNDA 2C5LA 2A5GA 4EFLA 5KSZA 1NVVQ 1N5JA 1SVMA 1KDTA 3THWB 2XSZD 1DBSA 3K0FA 5KHOC 1JQLB 5L3QB 1T5LA 1W0JD 1OHHD 3LY5A 4LHVA 4IXMA 1FPMA 1X8JA 4BLTA 4IJMA 5KPJA 2IS1A 1AA9A 1UKZA 1MABB 3X1YA 4M1YA 3LX5A 4DLWA 4V0KA 1Q3HA 5L3SA 3SHWA 4RZ3A 4HZUB 4PQRA 2C78A 2DCUA 4XIGS 5D3QA 4BEBA 3RS4A 1XTKA 1XPUA 4XSHA 1VG0B 2QP9X 3DHWC 2WWFA 3VX3A 3VNUA 1EFHA 4WZAE 4D0NA 3BORA 1MR3F 3GJ4A 3RC8A 1TQ4A 1AN0A 1IY0A 3SJBA 1F2UA 3T5DA 3AP1A 4PHHA 1W4CA 2ZSEA 2W2TA 4A92A 4FN5A 4GOKA 2JJ2D 2WWYA 2QM8A 1HQYE 2R2AA 4DDVA 3BD9A 1IHUA 4YDSA 3W8RA 3VKGA 2RAPA 3IEUA 1JAHA 1E1QD 2R6GA 2VF8A 5FBLB 5EUQB 3B60A 1QHNA 4QNRA 5SZJA 5CITA 2XZOA 3GLFB 2IHYA 4Q7LA 1KZGB 4QNMA 2ZE8A 4HYYA 3IO5A 2EYUA 1CKEA 1A7JA 1E2GA 4ABYA 2ZUCA 1UKVY 1WXQA 4A1FA 4R2IA 3VKWA 3EZ2A 1KI4A 1QF9A 3I61A 2AD5A 4F7WA 4A8JC 2IC5A 4O2RA 1G7CA 3OAAD 2RB4A 1Z0IA 4CF7A 5HR5A 1G17A 1BS1A 4ZO4A 3AKDA 1W36D 3PFIA 3BFVA 3FHTA 4P4TA 1G8PA 1E2LA 3ADCA 4B35A 2KBFA 1II0A 1T0HB 3VU9B 1VCOA 1KO7A 2KBEA 3IBGA 3TGPA 3TK1A 2CK3D 5DHFA 2PLRA 1SXJD 4MUAA 2NO6A 2FN4A 2JLSA 2IS4A 4I1OA 3TUJC 2HUPA 3C41J 2O8DB 2ZI9A 2HT1A 3QJYA 1VG8A 1N5LA 4K46A 2AHOA 2HEIA 2UZ3A 2IF0A 3L8YA 4ESHA 1E6CA 1Z0JA 3UPUA 4ZCMA 4TMWA 1JR3D 4NYMR 4LX0A 4MKFA 2ZJ8A 4JT2A 2JLQA 4N3NA 5CLQA 1E2IA 3VR4A 4WXRA 1YR9A 5JWHA 3K70B 2G0TA 1LNZA 1XJ0A 2GAOA 1QG4A 1RRPA 5FPYA 3WYAA 3VR1A 1OXSC 1NVUQ 1WA5A 4A0RA 4KYUA 4GPTA 2ZAOA 2XTMA 1KJZA 2X2EA 2WSSA 1RRFA 3RNLA 3EX7C 1QHGA 2ZI7A 5FI1B 5J4HA 3N2EA 2ZRLA 2KWIA 4HB4A 4Z8XA 4TT3A 2JGNA 2JLZA 4IW3B 1OT3A 4IFEA 1OFUX 1W49A 3BE4A 4URZR 4JZKA 5J4KA 5CDFA 5KSYA 3DEFA 4V02A 2ZR7A 4JVSB 3RC3A 3AP2A 1GKUB 1PUIA 4TL6A 3UWKA 3L0OA 1VG1A 2HCBA 2BWJA 1OJLA 4IDQA 3IKJA 1JXMA 3K8YA 1FQKA 1P72A 1TX4B 3EASA 2WPDA 3X1DA 1E9CA 1SKQA 1SVKA 3HWSA 3MAAC 4QBGB 3FVQA 4TMVA 1Z0KA 1QG2A 2E87A 1LW7A 3Q7PA 1MOZA 4Q00A 5JECA 3NEYA 2REOA 4RFVA 4JLKA 5D3MB 1GIAA 4C0AC 1I4DD 4M1MA 1ESNA 3CO5A 5DO9A 4Q4LA 1LY1A 1R5OA 2ZVQX 1XF9A 1D2MA 1T3SA 5F98A 5J5CA 2ATXA 3SZRA 2NPIA 3CWQA 1KSJA 2BCGY 4FCTA 1Z0AA 3LD9A 1SVIA 1E3MA 3MCAA 4RD3A 2KJQA 4OKSA 4Q4AA 2AL7A 5DYGA 3P1JA 2O5VA 4FD2A 2O0HA 3CRMA 1PZNA 1FNMA 2D2EA 4LPSA 1SULA 4CEIA 4NZYA 4W5JA 4M1TA 1ZYUA 1U0LA 2OAP1 2J5XA 4JBYA 4KYIB 4LBWA 3RS3A 4D0GA 3MGCA 2V54A 1FX0A 4BPBA 1G20E 4L15A 5EUMA 4EJSC 4BGDA 5EE5B 3SFZA 3FDIA 2W0MA 2ZJAA 3L8ZA 2JCSA 4LBVA 1W5TA 1ZAKA 3L0IB 3IDQA 4KCGA 4KFTA 2F55A 4LJ9A 4TMKA 2C8VA 1G1MA 1H8HA 2CEAA 1NL3A 3NDPA 4K81B 4B3FX 3GLHB 3FE2A 4NYJQ 1GOTA 3PQCA 1U0JA 5JFGA 4NMMA 3MWKA 5EE0A 1ZC4A 2QAGC 3MRSA 2ZR0A 1ZU5A 4NKRA 3CRW1 1OIVA 1OXTA 4YMWA 4MGKR 3I4LA 1E2QA 4JYBA 2D06A 4NONA 2BMEA 2BC9A 5IDVA 4KV9A 4A6XA 4Q02A 2JLVA 4C3ZA 1EG7A 3K9NA 2C04A 2QMEA 4V0NA 4CZ2A 5FTLA 1E98A 1K8RA 1H65A 3I3SR 1NF3A 4BLQA 5IRCD 4RFSA 2F9LA 3QKSB 4NYJR 2EU8A 3AB3A 2VHUA 2REXB 4N0EA 3UWOA 1B23P 4LYAA 3U7HB 4CEJB 4PSAA 4UKDA 3QKSA 4MDFA 1JR3E 4P4SB 5C1BA 3TQCA 1P9RA 4C0JA 2D7DA 1A5TA 4TQUS 4OHWA 1SHKA 1DVRA 5TVKA 5TMPA 1E9EA 1YKSA 4TTRA 1CJUC 3CPJB 3PUVA 4GMDA 4TTPA 4BZPA 3VR3A 3ZZ0A 5AK0A 3AF1A 5KNCA 4EPTA 5LBIA 3QKTA 3ZH9B 4URUR 3BFKA 1KTVA 3EXAA 2QP4A 4OK3A 2GJ9A 2ZSBA 3MUFA 3WBKA 2WIBA 2J0UB 1NG9A 1YZGA 2C98A 2XNSA 2FH5B 1XU4A 3AGQA 3FB4A 2X77A 2J0UA 1AZSC 4FMCB 4IEEA 4C0LA 1T6NA 1L7VC 4DSOA 1FUUA 2NO1A 2QMUA 3CRRA 5DNYB 3ZVMA 1GKIA 2A5DA 3VTKA 5DH9A 4CIDA 3WRYC 4QFMA 3W34A 3ZS9A 3R7WB 1QBKC 3OHMA 3HPRA 3RHFA 1CS4C 4TZ0A 4HZIA 3EAQA 3B1ZA 3L82B 1YHNA 5JEEA 4XOIA 2VHQA 1XD9A 1NRJB 2EFDB 1XX6A 4LK2A 2I4IA 2VLIA 3FTQA 2J3EA 2QY9A 2G83A 2QORA 1IXRC 5DHAA 2BM1A 3NXSA 4D4JA 2Z4SA 3CRVA 1HURA 3C15C 2WICA 1H8HD 2YKGA 3HU1A 2ZANA 4XVQA 2CHVA 3IO3A 2Q3FA 4PAOA 5CK5A 3UXMA 4NDZA 1KI9A 3NBYC 2LKCA 4MDEA 1I2DA 2RCNA 1OFHA 2FSHA 1Z29A 1HYQA 2C77A 2CL6X 2VHTA 4DT1A 3C16C 5BQ5A 5FOVA 3NVAA 3FGNA 3U7FB 3FFAA 1N0VC 1RJ9A 3HPQA 1HUQA 2NO9A 1GFIA 3U7GA 1KI2A 1M2OB 5EE3A 2WJYA 3I32A 4UNRA 1ZRHA 5FR1A 4UXIA 1E4VA 5FOWA 5HZKA 3ADBA 2CHQA 4CVNA 4DJTA 3QXXA 4G0NA 3KJHA 2P2LA 2QROA 5F9FA 3JZAA 2P5TB 4FW9A 1E9FA 5CM8B 4AURA 1AM4D 4RD6A 4JSYA 4B47A 4XWKA 1R2QA 4HAVA 2ZQ5A 1A2KC 1BYIA 3QPWA 4HB2A 4OQFA 2UVQA 3E2IA 3SQWA 1M7GA 3Q8XB 4HDOB 5HZHA 1NMXA 4WXPA 1RW4A 4OI1A 4F4IA 2ZRIA 3RVBA 2R6AA 4MYTA 3RS0A 1RRCA 2GESA 3ZZUA 5BYJA 4DLZA 3U3RA 4LJ6A 1Z22A 2A5JA 3QVVA 4LI0A 2OZEA 3CW2A 3WHLA 5AJVB 3FPAA 2O8FB 3CX8A 4Q9LA 4RD4A 3SJZA 2NZ8A 4TL8A 4C0KA 3KQNA 1AIPA 4Q18A 2IK8A 4A4DA 2WV9A 4BQSA 5JWOA 1VIYA 4MYHA 1TTTA 1ZNZA 4LPKA 2ZRGA 3NBZC 1FW6A 1E1RA 1Q22A 3B78A 4PTLA 1IAQA 3ADKA 2PJRA 1WDTA 4UJ5A 2GNOA 1EX7A 5F2EA 4M8NE 4DDUA 5CDFE 2ONKA 3KJEA 3OE7A 1E0AA 1QRAA 1XNJA 3KUDA 4TMTA 1ZNYA 3A37A 1SQ5A 2Q9BA 2IUUA 4RZ2A 3ZIAA 4BECA 1JI0A 4P3YA 1HA3A
chains in the Genus database with same CATH superfamily
4UCQA 1JKIA 3AVQA 4L08A 3QG5A 2GYVA 1WCIA 2QMHA 1KP9A 2I3AA 3PKZA 4JDUA 3D4NA 3FPJA 3OQJA 3KOOA 4EA7A 5AM5A 1WZIA 3H6GA 4JY7A 3QQ5A 2R48A 4OVKA 4C6TB 4PXAA 1MAUA 1HT2E 2JKVA 1WMSA 1FXWF 3H18A 1IB0A 2VP2A 5FF9A 3ZGZA 2QQEA 1NFQA 1EFDN 5F9HA 2O8BB 1PK8A 4YR7A 5CA1B 3V1KA 2BP7A 2OG1A 2XD9A 2YVUA 4FP9A 4YUZA 3DFUA 1J9ZA 2DFNA 2GFIA 4ZXPA 3AVVA 1PCXA 1KETA 1FLNA 1P4GA 2NUTB 3VA7A 5ECGC 4HQLA 3MXOA 3A3YA 3M3HA 4ZMBA 4OQYA 1HDCA 5MN6A 1QGZA 3DD5A 3PYXA 4QYXA 3VX4A 3FPEA 4HRXA 3AU8A 1Y80A 5B37A 1VHQA 2Y8EA 5DX0A 4UUNA 5EHQA 1CUVA 2JGFA 2FOXA 3TQRA 4PSVA 3FGZA 1NE7A 3DE3X 1I4WA 4P33A 4B7CA 3GLGB 2XE7A 4R1OA 4ZDJA 1YOVB 2FPGB 4OUDB 4WK4B 1NQTA 3N05A 6ADHA 2VHCA 1RP7A 1XTRA 4FHEA 3GQBA 2RH4A 3EXIA 3O8BA 4MGIR 1CUSA 3QJ5A 3UVEA 4B43A 2I3GA 2FSGA 1RXSA 2ETVA 3FCSB 2XCIA 2B69A 3K5IA 1BN6A 2QQ5A 1QYDA 4QOFA 3HDVA 4P83A 4B73A 3F1LA 4IH4A 2H54A 4YRAA 5BW6B 3MCVA 2PX4A 3ZW9A 2O0KA 3E3NA 3I01A 3CH7A 1AT1A 1E58A 1XB2A 3KX2A 3TTSA 2WTMA 1HDXA 1WCWA 1U0BB 3KT3A 1YTLA 3HXMA 4GOMD 2WZQA 2OCKA 5DN6D 2ZVJA 4TUYB 1KAMA 2EJTA 1Q7GA 3GRUA 2O3UA 3IUSA 3AI1A 4G41A 3KKLA 1OLXA 4MRVA 4BKUA 2XIJA 4KAXA 2VDUE 2FPIB 5I9TA 1TB4A 2WWXA 2XDQA 3ELYA 3TLGA 5AVVA 2V3CC 1IQPA 4CEHB 4LXIA 1WMFA 4MIOA 4R0NA 3FOBA 1RZ3A 1CLEA 1GGHA 2IS2A 2YXDA 4HH0A 2DE0X 1G8JA 3NTVA 3TRIA 4S04A 1H9CA 1VLJA 1OREA 3D3WB 4L3VA 1CIPA 1CDDA 4G01B 3ZIAD 1QIKA 2AF4C 4MWTA 4FCVA 4MIEA 3ZG6A 4H6PA 5AM3A 4DJEC 4BNGA 5K2OA 2Q8PA 4TYQA 2L82A 4RY0A 2CUTA 5FCDA 5G3ZA 4QREA 4TS3A 2XQIA 2ZT5A 1M1NA 1GGNA 4H3VA 4WK6A 4U4AA 2JZNA 1ZJWA 1CD5A 3CEPB 2I91A 3R3VA 3WFIA 5FWNA 4F7DA 2BN4A 1IZ9A 1QQTA 5JBIA 1OPRA 2LIPA 3OU7A 4HVCA 1Z06A 2FUNB 5AW8A 4BBJA 4L8FA 3JQAA 3UQZA 2NYAA 1K27A 1GU1A 4B7ZA 1X8KA 4DA8A 1WVIA 3LKDA 1Y63A 3BXFA 2FDXA 3RSCA 3CKYA 5C1PA 1XTSA 5EHGA 3G7UA 2VEDA 1EGQA 1Y42X 2PV7A 4ZOEA 3JQPA 4ARSA 1B41A 2FQYA 4U7TB 3VH1A 4FZJA 2WJAA 2P77A 3LK6A 4HQOA 2XI4A 3WNQA 2ZBPA 4IHKA 1ZHHA 1ZNQO 5ALMA 3GWGA 3AVTA 4Q0MA 4F4UA 1KF0A 1UWKA 4POAA 5LR6A 1QYCA 3ONEA 4G0OA 3V8PA 1GCOA 2M6KA 3ILVA 3ESQA 3ICQB 3LGXA 5BV2P 5BSVA 3H75A 2OKGA 4J0HA 5T8KC 5TPWA 1SUIA 4F8EA 4YJ2A 3PUWA 2DTDA 1EHYA 3MMPA 4MB2A 4C06A 3FVTA 4F04A 4B3TB 3T5CA 2RJNA 3MXTA 3Q3VA 4G1FA 1HDEA 4RPHA 5C80A 4A36A 1TUBA 2OHFA 3IAS6 3BL6A 1C1DB 3G0OA 5BN5B 2B2XA 3RSGA 5KDDA 1MOSA 4DHEA 3WGIA 1EUDA 1VG9B 1RXUA 3O84A 5FP0A 5A9SA 4I50B 5E2BA 3ACDA 1IN6A 4CDGA 2OFWA 4RL4A 1I80A 3DNPA 1AO0A 1TTQB 5AHOA 4G5SA 4BN5A 1OZ0A 4Q03A 1EFPB 1YS7A 2AYYA 2VDJA 1NRIA 4EEKA 3GN1A 1S7GA 1JI3A 1JXOA 4HAWA 4O4IA 4EB3A 2VFAA 1HDYA 3IV6A 8ATCA 1Z0DA 4HTAA 1B6TA 1N6PA 1PR5A 3AOEC 4ISBA 4KXFB 3DLTA 4TZKA 4BX8A 1SWWA 3HWX1 1T4DA 4L28A 1DUVG 3FX2A 3FPSA 3JQFC 2GBFA 3M83A 5G4KA 5JJIA 4AJKA 5DHTA 4L8GA 2XWJI 2GK6A 3NBQA 3IPAA 2H2WA 1RJDA 1PQ4A 2QRVA 2DH6A 3FMOB 4BU0A 2JFBA 1BGWA 1ESEA 2WIKA 1BKSB 1K7XB 1Q11A 2KPOA 3MF4A 3OICA 2GJ8A 3QVJA 4F84A 1CUYA 2FQ1A 4B32A 1KWGA 1L5HA 1IXSB 1W36B 5BR4A 1EP2B 2YJTD 3BMQA 3RBVA 2H08A 3OCWA 1NXSA 2CXUA 2FU5C 1LBTA 2QT0A 3KE8A 4HUQB 5HGXA 2UUCB 2WF9A 2IXFA 3MWEB 1V6SA 5JH7F 4CV2A 4FFMA 4EB0A 1HETA 2GCOB 4S1WA 2JJYA 1RHKA 1NMEA 5F3WB 1E6KA 1GFSA 3C1OA 1KK1A 1XAHA 4TKMA 1GNRA 1SBCA 2VP6A 1P2VA 2YVKA 3HJUA 3LCCA 4WXYB 2JJQA 4DIKA 3OIDA 3MSXA 4OK6A 4QO7A 4ZAXA 1NYRA 2EDAA 2CEKA 2V45A 1E9DA 3D7NA 3OQ1A 1RYYA 2FPPB 2JAHA 3JQAD 3WGJA 1KI7A 5D8DA 1AKYA 3THWA 3TLYA 5HIIA 3CKMA 3O7MA 4B1FA 1XHFA 1XVVA 2G7MC 1LLCA 2GEUA 1TM4E 3GT0A 1MABA 1YI0A 2TS1A 1XRRA 2ZAMA 3WQBA 4Z4HA 4QJ5A 3AHJA 3DTVB 3O4IA 4X71A 3RH0A 2RI0A 1A72A 4ZJZA 1FJGB 4HAYA 1M8FA 4CIDA 2CWDA 1QWOA 3QYFA 4NPHA 1IG3A 1KJQA 1M34E 1SVOA 2PUGA 4MOWA 3LKBA 4C7MA 3U44B 3E84A 4Y6LA 2Z8YA 4YDRA 3WS7A 3Q87B 1E3JA 5GZ1A 2QF7A 1E2PA 3ESBA 3BZUA 1R6DA 3NCTA 1V8FA 3OZDA 1ZL2A 2R1VB 1G6Q1 1UEIA 2C9YA 4UHCA 1TO1E 1WXHA 4ZANA 2G82A 7AT1A 5FWAA 2VJMB 1PWXA 3W3AA 1N6RA 2W9XA 5HS6A 2BUBA 4C30A 2I4TA 2YVLA 4IHJF 5ALLA 3MJHA 4BIMA 4N76A 1ZUHA 4P32A 1L1EA 1OZHA 1UBFA 3K9CA 4RY8A 3TJRA 2AKEA 5KOJA 5KVCA 3WIOA 1JUDA 5FOXA 4QLBA 1FNSA 1VJ5A 4AL4A 3THYB 3RLFA 3T3GA 2JGJA 1B8OA 3GYBA 1QR6A 1F6BA 1X3LA 3K09A 4DM4A 3T95A 3BQMB 1GL7A 4QPNA 1Y7PA 3A8TA 3NTXA 2WT9A 4RHYA 1A5SB 3WNBA 1EWVA 2IHVA 1SBQA 3P8ZA 3QSGA 3NC0C 3B7PA 3UWPA 5JXGA 5L40A 2ZIXA 1USVA 1E2NA 1K9SA 1S2OA 1THZA 3NTQA 5AOVA 5F76A 4YMLA 1H5QA 1NIPA 4JS0A 4D26A 2FG7C 2COUA 2TSYB 4Q1EA 5F51A 5KWEA 4BLPA 1BWRA 3C8UA 4D4GA 3DKIA 1CVLA 4GZ5A 1Y1LA 4F1JA 2QL9A 1EWQA 3WJ2A 1MJ5A 2QN1A 2WEKA 2BDEA 5FJIA 3VAAA 4YHBA 2ZROA 2ZWMA 3NVMB 2CUNA 1BD4A 3E9QA 2FF5A 3EIUA 4PIMA 4R8RA 2MYNA 5TEWA 5L7TA 3TJMA 3KWFA 1U3UA 5KTSA 4EQZA 1PT7A 4BZQA 3IVMA 2PH5A 3I92A 4PONA 3S2SA 4D4KA 2Q49A 4O4JB 1KDVA 5TR9A 1FF9A 5IXSA 1LF5A 3E5RA 3N2GA 4N18A 1U4OA 3IILA 3SG0A 1BMQA 3OOYA 1KK3A 4AQDA 4F1KA 5L3QB 1IBLB 1KOGA 1NM5C 3H2SA 1RAEA 1RMTA 3ITKA 4NF2A 2W42A 2I3ZA 2Q1TA 2QRMA 4WLUA 1ZINA 2A30A 1XCOA 2PX0A 3AFGA 3QVWA 1PL6A 2FVYA 4Q7JB 1MP0A 2B2NA 2XE6A 4UE2A 4QXAA 3T4EA 5KKAA 1K63A 1XNQB 4KVZA 4R9UC 4HLCA 5HE8A 3ZLTA 1VP3A 4J16A 1XZIA 1NZFA 1XDZA 2H1VA 4R1QA 4AKSA 1N78A 1HSOA 1W47A 2OXRA 4ZQGA 3WWEA 2J0SA 1GSIA 2SICE 3F5DA 4E7PA 2QGFA 4EATA 2N9UA 1A2BA 2XOKA 3G02A 2C7VA 3HABA 3EZFA 3NB0A 4EOGA 4BFLA 1GDHA 4TRRA 4EHBA 3L0CA 3EWNA 4DB4A 3AFIA 1ORRA 2J4FA 3H1TA 4BFYA 5FBKA 1PQYA 2CVFA 2PYDA 2OY0A 1VJ1A 3LKVA 5DBFA 2DBZA 3ZOKA 4I1PA 4H6VA 1LDBA 2P4HX 2P9ZA 4PAGA 4ZOAA 3SS9X 3V97A 3WLIA 2WSMA 4RTSA 1DTSA 3IP9A 3ZDEA 5EXPA 1NPYA 4LC0A 2X8WA 2FWMX 2WIDA 4HRAA 5F52A 4WDQA 5KQPA 3IT3A 4PICA 4Q48A 1O0SA 2Z3VA 3BGIA 3V4LA 4LRXA 3GJRA 3H05A 3D2BA 9ATCA 3PQFA 3NH9A 4FNOA 2WLTA 2XGGA 5J1SB 2AOVA 1QV9A 1K75A 2MYUA 2FFQA 1H6CA 2ID4A 1Z4IA 4IDOA 1A1SA 1V6AA 1DCMA 4OHBA 3KNZA 3HB1A 4PG7A 4YPFA 3ASYA 2OD9A 2BM9A 3ZQKA 1IY9A 4QTYA 2OPBA 2I78A 2Q4RA 4JCCA 1I1OA 1ORHA 1XXHE 1YR6A 2BVNA 3CSUA 2VH5R 3RYTC 5JQGB 3IMCA 3OKAA 1HOTA 4B3GA 3N5CA 1EQAA 4HWGA 5K4AA 2C00A 4IDGA 3CMMA 4MRPA 2JLXA 4C07A 2EJUA 2JIZA 4K03A 3H2BA 4LZNA 1I7NA 2PBZA 5I7HA 3JSAA 2FA9A 2OBLA 2ZQZA 3OLYA 4GZ3A 1LPBB 1EUCA 3GFPA 3JQRA 3SVTA 1WULS 4YRZA 4BEVA 1ECGA 1DO2A 2XODA 2LW7A 3K9HA 3NHPA 4UVGA 1PLKA 1FTWA 3ROTA 2F8MA 3CUTA 3GLIB 4PLCA 4F91B 5DM70 4RORA 3W04A 4BASA 5GOZA 4Q4HB 9ABPA 1U9IA 2HJVA 3NTRA 2HRRA 2XMZA 1QP0A 1C9YA 1RQRA 3JQBC 3CZ5A 3WR5A 3M6UA 1XR3A 3QLJA 3ZTYA 3UFXA 1VYVA 4BQIA 1KERA 3C3KA 3ODPA 3IUQA 2A4MA 3LQYA 2YHBA 1EP9A 1CEQA 2I2CA 2QOEA 2YOHA 4M9RA 5LDHA 3FCXA 4UM9D 2W2XA 1VGQA 2GPWA 4LYFA 1UPTA 2P2ZA 1TA9A 1EK2A 1V8BA 1HE8B 5L3RA 3JY6A 4QGBA 2AOWA 1CDOA 3CCBA 2OORA 4YTEA 4ZIRB 4L22A 1BW9A 1YK0A 2A9FA 2GFQA 2OYCA 1QQAA 4LISA 1AUXA 2PUVA 5DK4A 4F72A 2FMHA 2HKIA 4YMHA 4L9AA 5C32A 3QEOA 3TAUA 2GD0A 5CLLA 3T54A 5LP1A 1ZJZA 3O75A 6REQA 3OTQA 3PS9A 2XYQA 1V16B 3MWGA 2R1UA 5FD8A 1LB1B 2XDWA 3MTQA 3PB3A 4LE0A 4AJ2A 3H04A 3FI9A 3X2SA 4ARZB 5A5FA 3DZIA 5LDDC 1N2GA 2I29A 1ZM3A 5KTYA 3ETLA 1DOAA 1TYCA 4AD8A 2VJAA 3ED1A 3WOHA 3Q3JB 5BUZA 2CY0A 2XOKD 4IOMA 3MD0A 2WTUA 1YQWA 4N7JA 5AVQA 4ITVA 5F2NA 4OY3A 1I2AA 2YX1A 1Z3IX 3PDCA 2A84A 1H2RS 4YP0A 4QODA 4OQMA 1S4MA 3DVLA 1W1IA 5A4KA 1ULBA 4MXDA 3SHTA 2B20A 4H3KB 2FX5A 1M8GA 2N75A 1VPWA 1NUSA 1OPXA 3N3BC 2VI5A 3BL8A 1PVDA 2X9LA 4BNNA 4D0RA 4TT3D 5HCIA 2GO7A 4GNRA 4RADA 1EVIA 3WGUA 4ZT7A 4G0WA 5TV2A 1KY5A 3NAGA 4BO2A 4KBYA 1FVHA 1YVDA 1IBCA 4HBZA 4BCBA 1K8XB 3LIIA 3ASZA 5KNDA 3ND7A 2E2WA 4S12A 1J2TA 1CQIA 2PX8A 2PZAA 1V9LA 4H59A 1KFJB 2AKYA 1FFWA 1VKJA 2ON6A 1S9DA 2PH1A 1G59A 1JDVA 1QCDA 2H5LA 5EEHA 1DT3A 1F4VA 5FFMA 3HLTA 5ES3A 1MENA 1SBYA 2ZJ4A 4Y1RA 4BFWA 1IHXA 1W75A 2OESA 3WRXA 4EWLA 4P38A 3GH1A 1RRGA 4OYLA 4KB5A 1OIXA 4AJOA 2OP0A 4RS4A 1TUEA 4KLAA 3HVRA 3J7AC 3Q6MA 1WF3A 1VRCA 3MQFA 3C4QA 2KHZA 4YK7A 1V1RB 3PENA 3KUCA 2VNIA 3KKKA 5KYYB 5HRUA 1EB8A 2ZBVA 1KKUA 2O2EA 2VDRB 2IELA 4I6JA 2QLJA 4R84A 3WTBA 2A5YB 5AD1A 5BQFA 4QOHA 3P9ZA 3UXEA 3P2JA 1EWYA 1N4DA 2Q21A 3EE6A 4MINA 4OQEA 1KFBB 3O9ZA 4WVFA 3MRTA 4GLFA 3TB4A 4KR2A 1Z88A 3I2JA 3QG1A 2FJUA 4RA9A 4LFCB 1ZJ4A 2WZBA 4KN6A 2IUFA 1JG3A 2WJPA 3T15A 4B84A 4D4HA 4DOMA 1O6CA 3I42A 3OU2A 1CUCA 2J0EA 4MW0A 3RRXA 1RAIA 3DLBA 1PS8A 2FFHA 1AURA 2D1RA 4KO3S 3JD2A 3QITA 5HUQA 1JAXA 1MHTA 1KYXA 2ZVDA 1HTBA 3FRJA 2Z2ZA 5DXAA 2FK8A 5D1HA 1X39A 2WFMA 1UBHS 2QN7A 1VC2A 2A2ZA 3HE3A 3I6BA 3PDIA 1G8GA 3BKWA 4CFSA 3FYCA 1K6EA 1QKKA 4QYIA 4F4FA 4RV9A 4NBNA 5FBHA 2H1OA 2R47A 4GDMA 1W5AA 1RC0A 1DI0A 1QG6A 1SC4A 1NKSA 1UJ2A 1NBWB 3BS4A 3Q2KA 3Q9LA 4MW4A 4CMGA 4KQJA 1PTKA 2JIMA 3NW9A 3K0EA 3UXHA 1K8YB 1Y7HA 2PFKA 1RWXA 2CGEA 2I87A 3GFTA 4X8MA 5HMMA 3AY7A 1EIWA 4K3VA 4N47A 3ZX4A 2ZB2A 4C22A 3A2KA 3B6KA 1QIIA 4NECA 1XNGA 4JLVA 4IJ5A 4XGIA 5IH7A 5LMNB 3PK0A 5JTTA 2WWGA 1U2TA 1PSZA 5KSPA 5CYGA 1V5FA 5F78A 1J8DA 3AUXA 1W5SA 3OZTA 1V3UA 2Y0DA 2YBEA 3D4PA 2V03A 3Q5EA 1ADCA 2OCBA 2J9ZB 4WXMA 4DWOA 3D81A 4V0SA 3C3MA 4R16A 3AW9A 5CA0F 3VC3A 3ZHYA 4OHMA 3SGLA 5K3SA 4BLRA 4DLKA 1HY3A 1J8YF 4MUYA 2R6JA 3AKCA 1UM8A 4QTZA 1IY8A 1JQEA 2JCYA 4TV8B 5D51S 2KSQA 1L5LA 1XTTA 2QTAA 3NALA 2FUG1 1XDDA 4EGSA 1CS0B 1M2OA 1RYBA 3AM4A 2FEAA 5JR3A 3O8OA 1G7RA 3CNQS 4EGAA 5FV7A 3Q0TA 4P1ZA 4OB8A 1W34A 5TF4A 4ND1A 5EIFA 4CI9A 4EZBA 5LQAA 3NHKA 4PV7A 2CJXA 3DHVA 3EXHC 3BH0A 4WEOA 2NZWA 1CZRA 3EGOA 3F9CA 4QJIA 5KNDD 4DLSA 2IYUA 1Z6QA 2QL6A 1CP3A 1J5XA 3UF0A 3EXEB 3QA3E 1YMQA 1X2EA 3DKPA 4WY8A 3OLQA 1ZJ5A 1XJCA 3B85A 4L4RA 4R54A 1GCAA 3GY0A 4UVDA 3F6RA 1F4LA 2V7EA 1F8FA 3GMIA 1V11B 1GZ4A 4U1RA 3TZQA 3TTTA 1OGIA 1E6LA 1ZPDA 2FN7A 1CR6A 1Q17A 5BSTA 1XD2B 4OHPA 5DLYA 3TH5A 4B3BA 2Q4DA 2A0KA 3DPIA 3CLHA 4FQ5A 1HK7A 2VJCA 1NMYA 2ZETA 3AY0A 2ZS7A 5IBRA 4BFTA 5BSEA 1DRWA 4BLUA 1CR0A 4LRYA 1HMPA 2J0VA 4LQ4A 2GN9A 4LKRA 3WQSB 1VL5A 3O2NA 5KTMA 2O8FA 3H6HA 3GHHA 1TA4A 2W2KA 2PMEA 2V7TA 4AJIA 5TE9A 1L1FA 1A8QA 3KWLA 4GICA 4BHTA 1EK5A 2Q46A 1P31A 4QPCA 5G02A 4RKFA 4P31A 2QAJA 1ZGHA 5HG0A 1SURA 1KMMA 4BNUA 3ZGOA 4XASA 5J5VA 4BFUA 1GTMA 1A7AA 4OLHA 1ZH2A 2R7AA 4K6KA 1K8QA 4HDRA 5E9QA 4ZDIA 2PX3A 1CY6A 2YJ5A 4WI1A 1COWA 1ZMXA 5HVNA 1DBPA 3BD6A 5AVOA 1G6KA 1YRBA 3GCGA 1TU4A 1WNFA 5I4CA 2JI4A 3DM9B 3VQTA 5CB4A 4WD3A 1XMQB 1TJ4A 2JI6A 3LHDA 4K0RA 4EF6A 1E9SA 3RAPR 2QRNA 1GILA 1OAOA 2QI9F 1SELA 2BRUA 4HH4A 2ZQYA 1XHEA 2F3UA 5GGYA 2NOAA 3S7ZA 4A0GA 4WJLA 1DAMA 4ZEMA 3RAEC 2VDNB 2CE2X 2GRAA 3SN6A 4C7JA 1U3CA 3JYOA 3IIIA 4Q21A 3ROKA 3E3AA 1IWPB 1C9NA 4XVRA 1IWBB 2ZPTX 4DLNA 1SN7A 1UC5B 2W8BA 3D31A 3NG1A 4NBKA 4ZP1A 4OXYA 4IKPA 2VPYA 2OGSA 5K51A 1I4LD 1GNPA 5E1MA 4JL6A 3DM5A 3LZ6A 4GVXA 1OYVA 1E1MA 3KT8A 1CFZA 1HV8A 2B92A 5HKBA 4NZNA 1VIDA 3JPWA 3OFSA 1F2TA 3K4QA 2G67A 2JCGA 2ONYA 1UMKA 2IYXA 3FVVA 1CF9A 1IXKA 3EJ6A 5ALZA 3TWOA 4LUCA 3ZHVA 4C20A 3UB3A 2OZPA 3PXGA 2WYVA 2ZUFA 1CY8A 3QHQA 2PMKA 1R6TA 1TT5B 3PPWA 4HQ0A 4RF3A 3Q10A 1RDFA 2H06A 4QUJA 3SQOA 4EYEA 4CKCB 5J47A 3GT4A 1MB2A 5KUTA 4GZLA 1JHOA 4DZRA 1NVAA 3G49A 2EQAA 3HY4A 3PE4A 3RSOA 1T15A 1ST2A 4KKXB 3ZGXA 3OQIB 5EYPA 2H65A 1E9BA 1N7HA 3B6IA 4DLTA 1XEXA 2VNJA 2DR2A 4JC8A 1GPDG 4US0R 5EXTA 1DG3A 1VL6A 4PNZA 3LU1A 2CLKB 2F9FA 2JFFA 3ESDA 1TF5A 4PLGA 1KJ9A 5FTJA 1LQUA 3OCUA 3RJ5A 1Q1QA 5AW7A 2VAWA 1EH5A 1ML4A 1NJFA 3MUEA 4YMSA 4XJTA 4GMGA 2H1CA 4PPNA 3GLHE 1MJHA 4HAIA 2D00A 4HMOA 1NQ5A 3HADA 4QU0A 2XWSA 4M0LA 5CBKA 821PA 5ITWA 1T9HA 2VNKA 4XX0A 1XQ1A 2PZKA 2PDAA 1A76A 3R9XB 3DONA 4MQBA 1WVGA 1JG4A 2J08A 2R7NA 2YC2C 1FCJA 3MUOA 4P4UA 4QXMA 2NGRA 4UEWA 5CJ2A 1TKAA 1BFDA 3T9EA 3DMFA 4D9IA 2HHAA 1MG5A 3JQ8A 2I6SA 1U2EA 2NSYA 2QX6A 3G8CA 1T3LA 3DV0A 3PCTA 4GKJB 3OQBA 4E07A 2C99A 3PEUA 1U3GA 4G5FA 5I47A 5K3FB 2WU1A 5JLJA 3S40A 1Q3TA 1Z2PX 4K6CA 1EP1B 5IAEA 3IAXA 4IDHA 2YWRA 4O59O 1MDBA 1DO8A 3VGJA 1XVAA 3DHNA 1O94A 3T3IA 2BL4A 4AYTA 1WEKA 3SBDA 1C0LA 1COWD 4D9MA 4OX9Y 621PA 1X7ZB 1Z45A 5EXXA 1JQ3A 3SS8A 2ZTMA 1SHTX 1W2GA 4LFAB 5JMOA 1P3DA 1TIBA 3HVIA 1UANA 2X9QA 3I9MA 3QWIA 1XU7A 3NHAA 2VPTA 2CMGA 3FCCA 4FMPA 5JSHA 2XLCA 3MTAA 1QONA 4N6GA 4XDZA 2ACEA 3RYIB 5M3BA 3VR4H 5SV2A 2WAAA 2QD1A 2Q5HA 4NBWA 3R0QA 3QPDA 4MGZR 2EC5A 3SC3A 1M5UA 5JQGF 1RACA 5K8JB 4BXOA 2R97A 1CB0A 4J0GA 3EEOA 1YZYA 2UUAB 4BO6A 2JRCA 3CT6A 4D43A 4EO4A 3DXFA 3VSAA 1R8YA 1AMUA 4LXUA 4RU1A 4EW1A 3HI6A 3STYA 4KR6A 1DC7A 3DKVA 1Q16A 2ZCJA 2QX9A 1E3DA 5L95A 3CURA 5GQSA 5BN3A 2OCYC 3KL2A 4YC7A 1PW7A 1DB3A 3HKCB 3HY3A 3L6DA 3RVRA 3SAJA 3TQFA 5JEDA 4QM6A 2RDMA 2X7HA 3KXPA 3EIEA 3L6CA 4AP6A 2OFXA 3A2LA 1PHPA 3KS9A 1F6DA 3AETA 3EEYA 2R6CA 4CMHA 1L9KA 2NU9A 2QUHA 1KOLA 3CE9A 1VL2A 4J0EA 4XRGA 3TD6A 1YI1A 1C0KA 5AJWA 1F06A 2E4ZA 2JGDA 3HU2A 4JP2A 2QQ0A 1FB5A 2GCEA 1GKKA 1V8ZA 2IQ5A 4RDCA 2COEA 2NO5A 3AKYA 3CUUA 1R6BX 4MMYB 5GM2A 4YHHB 5JAZA 2ZRHA 4HDQB 4BN4A 5JAIA 4I81A 2D0DA 4XUCA 4MUHA 3QX9A 1TCBA 3E1KA 1Z47A 1J0AA 1K08A 1NU6A 2XUQA 5HILA 5KJ1A 2BDTA 2W6CX 3DOHA 1NC1A 3K6RA 4E15A 3E05A 1ZNXA 4ALLA 3A1DA 1XDGA 1Z16A 3WB0A 1R4AA 1VKZA 3R6WA 3OTOB 1JH9A 4IJVA 3AUJB 1R0XA 2OAEA 4M6WA 2W7TA 1M7BA 2P6PA 2JVJA 3RROA 3KHSA 1RAAA 4XWAA 1XMJA 4PG8A 2HOQA 2XEXA 1UBMS 4CLOA 1PV4A 2C9ZA 4D9FA 4RA6A 2Q6VA 3GPBA 4FUTA 4CKWB 1IEVA 3D64A 4BMNA 1GQRA 4NOLA 5JVDA 1H6BA 5LN1A 4OH1A 4WNIA 4Y7CA 4E3WA 5F5LA 1T26A 2NXNA 2XKKA 4ZA2A 3OQMA 2OV2A 5DTJA 5IJ0B 4ER3A 4TZ6A 4RM2A 2I1VB 2UXCB 1CERA 3BMXA 4K9NA 4TKLA 2BLNA 4C4PA 2EFYA 2C9OA 3VPGA 3UMYA 1EJ6A 2IX9A 3ZJUA 1NR7A 3AFNA 4HWPA 4KWIA 5ALFA 4ZHSA 2BTOA 2XV1A 3B36A 3PHHA 4Y2HA 3H13A 2DT8A 3KLOA 1O94D 2QD5A 2VJOA 3DV9A 4N49A 1VIVA 5KZMB 4EFMA 5IM5A 4GXTA 3R8FA 1TD1A 4KJXA 4MWGA 3RR2A 2HDOA 3E9YA 2PEYA 1M8KA 2BJWA 2H57A 3JWPA 4P0TA 5AICA 3DBLA 3SVZA 2FQQA 1EPUA 1PSWA 1WB6A 5JAMA 3AW8A 3E82A 1P17A 3AJRA 3GLQA 1A96A 3B1XA 4Y6SA 5K8LA 3TG8A 2BGUA 5GVRA 2BTQB 2PZ8A 4HFNA 2Y27A 4UXHA 1GTL1 1NMSA 3EIQA 4XH9B 2ZYAA 3CC8A 3KQWA 1DRVA 2JBAB 3BJIC 3BRSA 3EVAA 4UTXA 5ELXA 3LDUA 3P2OA 1SXJB 3Q3HA 4R2KA 4OLAA 3NYQA 2CK3A 2WU0A 2FRDC 1EMDA 2J6BA 1ANKA 1VB5A 2G07A 1NUPA 2C0PA 2OQRA 4YJKA 3A9TA 4AZWA 1I24A 4PPQA 2C3PA 3C4VA 5HOEA 3TGWA 4Y2YA 3LM8A 1XDUA 3I8OA 1LFDB 4TKUB 2GVZC 2ZRMA 4RKRA 1A8UA 1P91A 4G25A 3QF4B 2IOFA 1GQOA 3IIKA 1YZNA 3ZXYA 2EP7A 5ALIA 1EXWA 1P2UA 3FOFC 4WUTA 4Z0PA 2C0CA 5CH3A 4AG3A 3K05A 5ALJA 1EDDA 1I33A 4FMCF 3I2IA 1BVUA 2VSOA 3K0FB 4DDKA 1S4QA 5TGDA 3R0ZA 1FP4A 1P29A 4UXJA 2FCRA 1NDQA 3BMCB 3GFRA 2RGNA 2WHQA 3LY7A 2CLSA 3DJYA 2GAJA 2VSFA 2Y6VA 2WFZA 4JC4A 1LJLA 3QFRA 1R15A 2J4DA 4MGHA 5L3SB 3ZD6A 5A4JA 1FMFA 1Z4JA 1PJ2A 3U40A 1VSQA 2JAOA 2JHCA 4N40A 4QUDA 3U2QA 4ETMA 4URWR 5BWCA 1XI2A 3ZLBA 2P9JA 2IPNA 2TMGA 2Y99A 2RK4A 4NK5A 4Q7KA 1DAIA 4HXYA 4QEKA 4IO0A 2A0UA 3OT1A 2BTEA 4TV9A 2C94A 4FWTA 1SG9A 1WSAA 5K8VA 4X61A 4OLFA 2Q1WA 4AICA 2B35A 4P5DA 1AUPA 5T3YA 3U80A 1CVRA 2QWXA 1WQ4A 1N8NA 5ABPA 5IMSA 1OQAA 3HXLA 3LC7O 3D7SA 4F06A 4RJ2A 1G5PA 2CNDA 1DG1G 2W4MA 4LBYA 2CHGA 1X13A 2H2AA 4HNRA 3A3NA 4DEXA 1O58A 1D4FA 3KDAA 3OBIA 2PLFA 3R77A 2R68A 1I2CA 3OZSA 3PUIA 1UMBA 4MR8A 1NW7A 2GBIA 2ORYA 2WUGA 4P08A 4WBXC 3TQTA 3JAWA 1P19A 1B42A 1ZXLA 3ASUA 3JD1A 4WKPA 1IMOA 2WWIA 4N7RA 1CNMA 1A4IA 1T1RA 4PZUA 3VPSA 5JI2E 2OO7A 3L8FA 2VF4X 2CLLB 4QVGA 5CEJA 1Y6FA 2FEKA 3GLGE 4NXMB 4O4LF 1DFHA 3HJHA 4FGJA 2BKAA 1JQ5A 1G8FA 2CXPA 4HDSB 4K1LA 4LYYA 3CN9A 4TV8F 3RIHA 4MQ4A 2P9FA 4LYEA 2ODEA 3L0SA 4B7UA 1LTKA 1XTZA 1ZN2A 4ZI7B 5BWNA 3H17A 3SEZA 4B2PA 3EZNA 1NSTA 1XZLA 4YRLA 5IDQA 2BM0A 2ODQA 2J3IA 2NQTA 4X8HA 4E2WA 2YV4A 3LQ2A 4TWIA 2WF6A 3GV0A 4QEDA 3WP0A 4MVWA 1K5PA 4M60A 1FQWA 1SU8A 3M4JA 4BB6A 5L53A 3O47A 2C4VA 3PDWA 2OB1A 3D3KA 4O08A 2GEFA 4U2CA 4BZWA 6PFKA 1PL0A 2WQ7A 2XUFA 1USGA 4J3JA 2HF7A 1IVSA 4AKEA 1ZOSA 1QHSA 3GF4A 1QB8A 5TSDA 3L1JA 3TOCA 3D8BA 1J1IA 2GB4A 1DIGA 1A4UA 2R00A 4QNNA 4HNAA 3VO9A 4LF4B 3Q8WA 3DOEA 2BW0A 4PINA 2ZYIA 5BR7A 2G9VA 2OV4A 2CFCA 2BSAA 1E89A 2CYCA 2VG8A 3G2QA 1QG0A 3KUUA 3O0TA 1G4AE 3W5UA 1PGNA 1Z34A 4JP8A 1M6HA 2GTIA 4IIEA 1E1KA 1JTVA 5CR9A 3R7DA 3U4IA 1YJQA 3TD2A 3UN1A 3L2OB 3PICA 3U4QA 2PH3A 1N8TA 1S2GA 1EX6A 3QW2A 4LHZA 1RWVA 4ATNA 1J0EA 5LLDA 3JRNA 4PO3X 2PR2A 3GEGA 3MWLA 5BPFA 2PD6A 4H7EA 3H1GA 1SKAA 1YIAA 3HB9A 1EVZA 1KBQA 1MMFB 4I5IA 4LDQA 1QQ5A 3TLMA 2J46A 3L8GA 5D85A 1P7ZA 4Y0VA 4YI3A 3RRJA 3H7IA 3RD5A 4L0CA 3P2MA 3QE9Y 3IKTA 2FFRA 3QVOA 1X80B 4NAUA 5JG7A 2OPHA 5FLXA 1MO2A 2AOTA 5LIPA 2FVXA 1RM4A 3UV3A 3EPJA 5JZSA 3LVBA 4HH3C 3VOBA 3A1FA 1ZUNB 4DSZA 3A1TA 1G63A 5AVJA 3A6EA 1C3JA 3C97A 5JNVA 2Z09A 2EF1A 2Y1OA 1GTRA 2PXAA 3ZYCA 2BF7A 2DFKB 2ILTA 2NVWA 3R5JA 2G9ZA 4DA6A 2GPTA 2VKTA 1TK3A 1T4BA 4R2MA 5LU8A 5E6UB 3TXAA 3V3TA 4BNWA 1JWLA 3UICA 1GN8A 1W2WB 4LA4A 4ROSA 2IHUA 3PLNA 1OFVA 3TNJA 4BO1A 4DFDA 4DC9A 1G5TA 3WO1A 3QBEA 1SUPA 4FQ8A 2D54A 4NU6A 2CLDX 1PZEA 1BX1A 2Z4RA 2QVGA 4GRIA 5ALGA 2G5TA 3LUBA 5LQDA 2IEDA 1G3UA 1W4AA 2VF2A 5HJ2A 4YCAA 2BFCA 2H48A 3EVDA 4TVSA 4L9RA 5BUQA 5KHAA 1THGA 2BSXA 1JKXA 3ZE6A 4J2HA 4B3JA 2FQWA 2GTPA 1UC4B 1DKUA 1XC7A 2JCXA 2VAMA 3TW0A 4E03A 4DSAA 3LDHA 4FCWA 3C74A 1MCZA 3DLPX 4OOEA 3TUZC 2V7GA 3K1TA 4EHKA 4MHSA 1M6WA 4YIKA 3J81A 1RHRA 2AXNA 3EUEA 3N6VA 3I1FA 1Q1GA 1XMXA 4M1SA 3UNXA 2QUBA 3OIVA 3CT4A 2WE8A 4H77A 1VI5A 2DQSA 2FZGA 2OQ2A 3EDQA 2QNIA 5DGCA 1YZTA 5CXUA 2X19A 2OLEA 1Q1ZA 2R2GA 4B4UA 2XXAA 1AB6A 2IW3A 4UOEA 3S2IA 3ND8A 3TEMA 4RMIA 1CUZA 1F1JA 3RASA 4COOA 4EB6A 4DILA 2GXSA 1RHMA 1K7SN 5AOAA 3BZBA 1NRWA 1P7PA 2AN3A 2G40A 1QIEA 3NT4A 2V97A 4TRMA 1C4XA 1L7RA 3CRZA 2JD1A 3Q40A 5IAKA 3U4HA 4D41A 5CLJA 1G41A 1O6ZA 3FLAA 4TLEA 3AF3A 3MAGA 2TRSB 1HMYA 5G0VA 3ORRA 3IALA 5AI0A 5EFZA 1QORA 5K0CA 4P92A 2VXYA 2ZOSA 3NJRA 4KLZA 2RI6A 2BGRA 3OPNA 4W5OA 2WJGA 3CW8X 3MMNA 4G26A 4U00A 4U2BA 3ESYA 4M53A 1X1BA 5MF6A 2XNKA 4RVNA 5DSZA 4LOLA 1CEEA 1CCWA 1SCKA 1KGSA 1T36A 3KDSE 2ACWA 1J7JA 1ZM7A 4DJDC 5GJVC 3JVIA 3OT4A 5K5EA 2QB5A 5BVGA 2O5EA 1U28C 4WK0B 4PGFA 3EJWA 2IZ5A 3CINA 4C2BA 4DVGA 4AKHA 4XWGA 2O5RA 1GGVA 3DMTC 1TF7A 2GQ0A 3AR4A 3SYNA 1V4VA 3KE9A 1YQGA 3LHIA 3H7AA 3OJCA 3WV5A 5C8ZA 2W6ID 3FROA 2YJ3A 5AI8A 3AV3A 3OPMA 1W36C 4JJIA 1Q74A