4MDFA

Structure of bacterial polynucleotide kinase michaelis complex bound to gtp and dna
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSNFCRGLVSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of bacterial polynucleotide kinase in a Michaelis complex with GTP*Mg2+ and 5'-OH oligonucleotide and a product complex with GDP*Mg2+ and 5'-PO4 oligonucleotide reveal a mechanism of general acid-base catalysis and the determinants of phosphoacceptor recognition.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase/dna
molecule keywords Metallophosphoesterase
total genus 66
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4mdfA00
3DMDA 4LDJA 3RRMA 2VHUA 2AXNA 1DAEA 5KU1A 1CJMA 4M1KA 1E2QA 5KSPA 3RWOA 4EQ6B 2ZR7A 3VKHA 2VO1A 1E94E 2TMKA 4JSTA 4DCNA 4JLKA 4EFNA 2XZOA 4M1MA 2J46A 1P5ZB 1G291 3AP1A 2ZANA 1VCNA 1HURA 2WIBA 1AGPA 2VP5A 4MKHA 5G3ZA 3Q7PA 5F3WB 4TZ0A 2IUSA 5GADl 4E07A 2FWRA 1KI7A 4KODA 1GKUB 1IN4A 1KI8A 3OFND 3NKVA 4QBHA 3VKGA 3CPEA 5EP1A 4KFRA 3NHBA 2KBEA 4HZUA 1KO1A 1VPLA 5J4VA 2D7DA 2XXAA 5K8LA 2Q3MA 2CEAA 1Q3HA 2PL3A 4RCYA 3IPXA 4A2QA 3RRYA 1RRPA 1OIVA 1JEDA 4V0OA 3THYB 3U3OA 4KLNA 2N46A 3E5HA 4BLRA 1K5DA 1DAMA 5BW8A 1GM5A 5FPYA 2FOLA 4A6XA 4LRWA 4YQFA 1W36D 2IS2A 4PC2A 2R44A 4PSAA 4NL4H 3BB3A 4B32A 2ZYVX 1ZYUA 5FPTA 3P4YA 3PR1A 2A30A 4HAUA 4OK5A 4A0FA 3MJRA 1DE0A 3OEHD 4PZLA 2IYTA 1IM2A 1CF4A 2CNWA 2WICA 5DO9A 5DI3A 4NONA 1OIWA 2FSGA 2XOKA 4NYJQ 2ZREA 4P4SB 4GOJA 4MUAA 1P61B 4QBFA 3AUXA 3IHWA 4C0LA 4DLYA 2G88A 4FWIB 3RHFA 1U2RA 3GD7A 4F92B 3GLIA 5JJLA 3HP1A 2HXSA 2VHCA 2RGCA 4EJSC 1Z06A 4M22A 1Z2AA 3NEJA 3M6AA 2PMDA 1QVAA 2WWWA 4DHEA 3UMSA 2F1HA 4AKGA 1ZC4A 2XNSA 1TQ4A 1CP2A 4Q1BA 2W2XA 3ZQ6A 4A4DA 1G8FA 3C15C 3LBIA 3V4RA 2ZI5A 3BH7A 2DWOA 2YC4C 5C46F 5E3HA 3U6BA 1ONBA 3PXGA 1UBCA 1T5IA 1W2HA 3GLFE 1C1YA 1KTVA 3MD0A 4URZR 3GLGA 4BASA 1XD2A 2D3WA 2JLQA 1YZTA 4JLOA 4QHTA 4GMXA 3W34A 3QXHA 4JIMA 2FEMA 4DC9A 1NVVQ 2GJAA 1JQJC 4DSUA 2PBRA 4KJZA 2GXQA 4ZI3A 2QSZA 2OFWA 1ESNA 3FWYA 3R8CA 4RCZA 2AR7A 3L2OB 1XTQA 1R8SA 1M7BA 3BD9A 4G5OA 2B6HA 2NPFA 5BN4A 3VAAA 5EJEA 1U0LA 2P67A 2FFQA 2GZAA 2G77B 1KIMA 3NH6A 1OB5A 3THYA 2F9MA 2GAOA 1R0YA 2RMKA 1VYUA 3OFNA 2BMEA 5DI9A 5GVSA 3OIVA 4NYIQ 2GCOB 5BXQC 1W4BA 1NSFA 3EXAA 2BBWA 5FUXA 5DYGA 1Z63A 4PQFA 1KKMA 4HI0E 2IWRA 4L15A 1CRQA 2G0NA 2V7QA 1ZAKA 4CF7A 3GLHE 2VHQA 1YZQA 3MCAA 5AJXA 3W5JA 2QORA 5IT5A 1YZKA 2P6UA 3AKCA 3CH5A 3SQWA 4RD1A 4IDHA 2X19A 3H86A 4IFEA 4R7ZA 1F2UA 5KPDA 3IBGA 4EPVA 2IEYA 3CPJB 1G17A 1TF2A 2CMKA 3MSXA 1D9XA 4ZI2A 821PA 4KBGA 3B13B 3CR8A 4S2EA 4ZIRA 1NY5A 3OIWA 5JMTA 2OT3B 1X8JA 3B1YA 2IS6A 3VX4A 1HT1E 3AKEA 3I3SR 2QM8A 1E32A 4TSFA 3OEED 3LY5A 3VU9B 1TEVA 1GP2A 1HT2E 3Q9LA 4NH0A 4ZDJA 4EUNA 1XFAA 1ZUNB 1P6XA 4B2PA 1DOAA 2W6JA 2QMEA 1M6NA 3C5HA 3IHLA 4DVGA 3O8RA 3WY9A 1X3SA 4ZKDA 1JR3A 1Q1EA 3OIYA 2IYWA 4M1OA 1SXJA 1VCOA 2CE7A 2HEIA 1YR8A 2QSYA 4WVFA 4TMZA 1QHNA 2RGNA 1JI0A 1Z0FA 4JYBA 2HT1A 3FKSA 1KMHB 4EPRA 3RS4A 4RFSA 4HLCA 4L9WA 1OSNA 4FI3C 1FUKA 4V0ME 1Q1QA 2GWHA 1OFTA 3LVQE 1KSJA 1NSTA 1G8YA 4LJYA 2VF8A 4BFZA 1N6KA 1M1YE 1HEIA 3VQTA 4BFXA 1NBME 4QJ5A 1N6NA 4ASUA 1RYHA 4O2RA 4DEYA 3CUEF 2QPOA 3QEJA 3QPUA 2A5YB 3KJEA 4C0AC 4LCBA 1QDEA 3THWB 3TUJC 4MQBA 1Q20A 4M1TA 3RS2A 4N3NA 4DKXA 4LK2A 3EZFA 4ZDIA 2JJ1D 3A4NA 3AEZA 1Z07A 5DH9A 2ZAMA 3B2EA 2WJVA 3BH0A 3K0FB 3M0EA 1XJCA 1XTIA 1HTWA 5CIQA 3HR8A 3KDSE 1CJKC 1L4YA 3QXXA 4LJAA 2RAPA 2W6IA 1TX4B 2C04A 3SS8A 3W3ZB 3AVQA 5H68A 2CCGA 5CLQA 4A2WA 2ZRBA 1D2NA 1NN5A 3BFXA 2BEKA 2WM9B 5HCIA 2GESA 3BERA 1G41A 2WWIA 3BFVA 4EFMA 1OW3B 1G7TA 1NLYA 1FMLA 1AZSC 1CBUA 5HZHA 4AK9A 3CIOA 4B3DA 1N25A 2JATA 1W0KD 1U8YA 2B8WA 3AGQA 2HF9A 4B71A 2O8FA 4BPBA 2R6CA 1OT3A 4DB4A 4TSFD 1EFRD 1XTRA 1ZM4A 1FX0A 3WHLA 3B60A 3K09C 1UKZA 1XEXA 1SVLA 5BWMA 1G5TA 1W0KA 2ORWA 1E4VA 4NYMR 1N5KA 1VHTA 3EASA 2Y8EA 2YWFA 4M1SA 1N3BA 2BCGY 4YMSA 3QKUA 5H1YA 3SOPA 2P6RA 3A36A 2DB3A 1P73A 1XEWY 4D82A 5DHFA 3FHCB 1W49A 2ZSBA 5L3RA 5JHHB 2DFTA 1F48A 2WOJA 1AS3A 2ZQ5A 4EPTA 3PITA 3GLFA 1US8A 5FOTA 5GJBA 1BO6A 1NY6A 4PHHA 3SZRA 1YHNA 2XTZA 1G1MA 1NIPA 4GNKA 3QF4B 1PUIA 1R2QA 2ZRAA 5JFGA 2PX3A 1WDTA 1E2MA 2CK3D 2WKPA 4Q7KA 3BH6A 3THWA 4MGZR 3H0KA 3LH5A 3FYHA 2DFKB 2F3RA 1EX6A 3U7HB 3LXRA 2WPDD 1FP7A 1T8UA 2DY1A 1QG4A 1FNNA 2N1BA 2XOKD 4NCHA 4DDTA 4MITA 4QRHA 1NLFA 1Z6TA 2KWIA 3ZH9B 1MV5A 4QHSA 2HYIC 4DLUA 4Q4HB 5JWOA 2OO7A 3LXXA 2MMCA 1C4OA 2BC9A 4BZPA 2GF0A 4G5GA 1IHUA 2RGBA 2ODWA 3T15A 1CULC 1JBKA 1GL9B 3WXMA 4NBSA 4LHWA 1UADA 2GAAA 2ZYTX 2HV8A 2QAGA 1BH2A 1EX7A 3LVRE 4ZCIA 4W7SA 4Q9LA 5EE9A 4IW3B 5LBIA 3AP2A 3MUFA 3UXMA 1GZSA 2AX4A 3CZPA 2OBMA 2XTMA 4TLAA 5HKKD 1II8B 1HE1C 4NYJR 4HAYA 4I1VA 3RWMB 3O8DA 2ATVA 3DMNA 4Z1MD 2RGGA 5JWRA 3SYKA 3OE7D 3TH5A 3ADBA 4Q01A 1EFHA 2EFEB 4QGHA 2OAP1 3AVVA 3ZVNA 5HCNA 1E9FA 3PEWA 3T61A 1I4LD 4EJSA 1XRJA 4G01B 3VFDA 3AM1A 1G7RA 3K9GA 1P7CA 3GJ7A 5DN6D 4AY2A 4CW7A 5FTJA 1W36C 1TMKA 4EJSB 1P9WA 3ZVMA 1E2FA 4HDOB 5EE5B 2PLFA 3B82A 4RKFA 2OAQ1 1FZQA 3U7GA 1V5WA 1F60A 3ZIAD 1U81A 2IHBA 2J7PD 3A4LA 1U98A 2F1JA 1T3SA 1R10A 1XCMA 2YWHA 4JVNA 1YVDA 1MRNA 1OKKD 2G1KA 1PJRA 4JLBA 1E0SA 3GLFB 4Q66C 1ANKA 2KE5A 3KKOA 2FG5A 1NIJA 4TLEA 1M2OB 1Z5ZA 1P72A 1UEJA 4JT2A 4X8LA 2UZIR 3I61A 5IF9A 2WMNB 1D2EA 3I92A 3VR3A 3HJNA 3D3QA 1O3YA 2PJZA 1KDOA 4RD2A 1I4TD 1VG8A 2RCNA 4US0R 4CEJA 1XXHA 2GRJA 2ZJ8A 4DLTA 3B7GA 2ZYWX 5TARA 3TNFA 2ZRDA 2ANCA 2J0UA 3CKLA 1E69A 3FMFA 4TMKA 4V0MA 3RS0A 3X1YA 3RC8A 4YXWD 1PVOA 3T5GA 4PC1A 4IEEA 2P5SA 2VHJA 1P9RA 1NVWQ 4DLVA 2YNMA 1G7SA 5CB8A 1VCIA 2WKRA 1P60A 2GZDA 3WP0A 5HE8A 4LJ4A 1QBKC 2IUUA 1XMVA 5EUQB 3QVUA 2J41A 4N0DA 3DM9B 1RFLA 3TRFA 1MRSA 4KBFA 5AK0A 5KUTA 1PLJA 3GPLA 4PSKA 1N6HA 1DPFA 1XD8A 5HTKA 5JBQA 2O8DB 3QKSA 2JIZA 3AF3A 3AF4A 3ADDA 2ZROA 2IEZA 2HDNB 4XWAA 1G6HA 4I99A 2OEPA 1KI6A 2ZSFA 3O8BA 4JLDA 2J0QA 2VL7A 1A2BA 3K0CC 1PUJA 2ZRKA 1ZW6A 3QG1A 4IRUB 3LX5A 3R9WA 5D3QA 4EPYA 5DE3A 5M04A 4DLXA 1NN0A 1ZM9A 4OBEA 1HYQA 4TQUS 4U7DA 4UQOA 2HLDA 3LRPA 2BBOA 3AVYA 3SJAA 1E2PA 2FFBA 3NG1A 4QL3A 1UFQA 3UKDA 1SKYE 4EDHA 5L3VA 2JEOA 2BHRA 4M21A 3VU9A 3LBNA 1A82A 2AHOA 2WBLC 4AC9A 1T0JB 3KJIA 4B43A 3IKJA 1JAIA 1UKEA 4LC1A 4MGKR 5KDOA 5JSZB 4YC7A 3U3RA 4R9UC 2ONJA 1YZGA 4C7OB 4TWZA 4L4UA 1S1MA 4PAMA 3C41J 1KJZA 3EIHA 1GITA 2I1QA 2C2HA 4CT5A 4F7WA 3X1XA 2Q9BA 3A1WA 2IYYA 2UVQA 2E87A 1V43A 4LJ5A 3KKMA 4TL9A 2IYRA 1W36B 1NL3A 4UJ3A 1XD2B 3EWSA 1J2JA 2ZM5A 4TLBA 4B3XA 4E03A 4HZUB 4JL8A 1Y3AA 4U5XA 1EFTA 4JL6A 2EFHB 4I4LA 3RANA 4B75A 2JLSA 2AN9A 3BXZA 3NDBB 4BRWA 2JJ8A 3LV8A 1P2UA 2O0KA 5FL3A 4OI1A 5C4GB 1P2TA 4B34A 4B6FA 3DZ8A 1LV7A 3LA6A 1F2TB 4B6EA 2QENA 1DAHA 3SJCA 721PA 1RJ9A 3IPYA 1U0HC 3GJ3A 4O25A 3P20A 4DXAA 1E2GA 3K0FA 1XCGB 1OH6A 2IYZA 3GQBA 2ZSDA 3TW4A 3PUWA 1JXOA 1WF3A 1XB2A 3GFPA 4AWXA 3OHMA 3ECCA 3SNHA 2GDJA 5J4KA 2D4HA 4O2LA 1JR3E 1IXSB 1N6IA 2BIFA 2C99A 1U99A 2QA5A 2WSMA 3NBFA 4JJKA 3TVTA 2XJ9A 5FOSA 2G1JA 1AQYA 1HV8A 1WXQA 4LBWA 2CBZA 3PUZA 5EUMA 4D81A 5CITA 4Q1FA 3KTAA 4ARZB 1KGDA 3RYTC 1Z0KA 1BMFA 3TR0A 2V7QD 4EQ6A 4RKEA 3R9IA 3VHLB 3D8BA 3BRWD 2BM1A 2V4ZA 3IO3A 5FUVA 1FX0B 1II0A 3A1SA 3REGA 5DNYB 3L0IB 3ICEA 3CBQA 4K8OA 1A7JA 3BFKA 2ANBA 2F1RA 3CX6A 3CR7A 3I1FA 121PA 2CVHA 3I5XA 1AQUA 1AKEA 2ZSAA 4DLZA 4FN5A 2ZTSA 2VYFA 4TL8A 5G3YA 2F7SA 2QROA 5EP4A 4N1AA 4B73A 1KK0A 1OLOA 5LPNA 2ZSEA 4D6PA 5F9HA 4PO1A 2C78A 4B33A 4MGYR 2NO0A 1FW6A 1JEEA 3GMTA 5C18A 1AS0A 2J59A 4B47A 1JJVA 2MSDB 3EZ9A 3KFVA 1T0HB 4EFLA 1EGAA 1AA9A 1KAGA 2CJWB 2MSEB 2ZR9A 3KL4A 3ZZUA 1JPNA 5L3QB 1LY1A 3L43A 4QGFA 1KZ7B 1Z29A 1E2KA 3PUXA 3RLFA 3FPAA 1YRBA 3BORA 3I32A 4P4TA 4Q9IA 4D25A 1E3MA 1QRAA 2Z6VA 4MRSA 1RRGA 4TT3D 1KK1A 2RGXA 3B8HA 4Q02A 1S0UA 2I4IA 5JRJA 3WNCA 3EZ2A 4WOPA 4HSEA 1T6NA 1M7GA 1M8PA 3CRRA 1UAAA 2ZR0A 5B30A 2ZI7A 4BWYA 4Q7MB 5EE0A 2IHYA 1CLUA 3X1DA 4YMTA 3H4MA 3WP1B 4GOKA 4IDOA 3LLMA 2A3RA 1KY2A 2ZI6A 3MJHA 1WE2A 5A4JA 1GL7A 4B2IA 1TUIA 4BRUA 2ZU6A 3ZZ0A 2FDCA 4BE7B 1JPJA 4DSTA 5BYJA 4DT1A 2MMGA 3ZS9A 1UF9A 3KJGA 3E2IA 1EFRA 4OL0A 2H17A 1XTKA 2CHQA 2QE7D 1OH5A 2NOAA 4PC6A 4XOIA 1G8PA 3AB3A 4OQNA 2BKEA 2GHIA 5EQTA 1OHHA 2FPLA 1KJWA 4DEXA 1UDWA 1SHKA 1ZIPA 2ZETA 5TB5A 1KKLA 2JDIA 4Q18A 1WRBA 1W4CA 1XXHB 3K0CA 4FW9A 4URWR 3KKQA 5FOVA 3OF5A 2JLYA 4A9AA 2IF0A 5E7IA 3T06B 4BEJA 2HJVA 5F2EA 5TV2A 4L5BA 4AYXA 4E5UA 3LW8A 5TY0A 1TTTA 3RS7A 4PHFA 3CH4B 4PX9A 2E1RA 1K5GA 4C0JA 5A5GA 4IOKA 4TT3A 2BEJA 1A4RA 2WAXA 2FGJA 4UNPA 3W5IA 2XSZD 1N6OA 3PEYA 3PEVA 1ZMXA 4WIAA 1FFHA 3O47A 5DI3B 2YVUA 1EFCA 2Q9AA 1CJUC 1MH1A 3AVPA 3DO6A 2A2ZA 1A2KC 3FDIA 3IGFA 1ZD8A 1KO7A 1Z47A 4B3GA 1U94A 2WWYA 4HZIA 1N5LA 2OFOA 4A0RA 2FPMA 4DDVA 1UEIA 1WQ1R 3SDZA 3HU1A 3VNVA 3C4JA 3DPUA 4ABYA 1EWRA 3N70A 4ZIRB 2A5FA 3OESA 2HLDD 1G9XA 2LCFA 1XEFA 3KUCA 1ETUA 1W4RA 4LI0A 3EWAA 2BKUA 2VA8A 3UMRA 3FKSD 5DSZA 1GRQA 4DB2A 1ZCAA 4POAA 2QAGB 4RD6A 4AKIA 3K8YA 4RD0A 2HCJB 2NO6A 4JBYA 4V03A 4A15A 3QI2A 1Q12A 4OK6A 4B3CA 5JS7A 1WA5A 3P27A 2ZJ2A 3MAAC 1R5NA 2DCUA 3EW9A 3Q8XB 4DLRA 4EAQA 2R65A 3QPVA 1GNQA 5DISB 4DJTA 2XGJA 2ZE5A 4B3FX 1TAGA 3QENA 2GXAA 2ZRFA 3EPHA 3NWJA 5A0FA 4NP6A 4OJQA 2VH5R 4P4UA 4Q4JB 4LV5B 4P33A 3HDTA 3W8RA 1N2CE 2IC5A 3QXCA 1EK0A 2EYQA 5B58C 1XPUA 1SXJE 4TLDA 4LHXA 4V0LA 1U8AA 4DCUA 5P21A 1QVRA 2QL6A 2WSSD 2X2FA 4LYAA 1KAOA 1E9CA 2F43A 2NO1A 1RRCA 5AJYA 2Z43A 2REOA 2CL6X 3OAAD 1OFHA 4JS0A 3SHFA 4TYWA 1J70A 2R6DA 2VEDA 1KI9A 2ZE8A 2NO7A 5HR5A 1ZJ6A 4P32A 4P31A 1L8QA 3B9QA 4XTRA 1N6PA 3NTUA 4A8JA 1SKQA 1GILA 2C5LA 2WWFA 4IOLA 1FQJA 4AD8A 2IYVA 3BAFA 3FB4A 4LBYA 4UNQA 1E79A 2W58A 2Z83A 3LLUA 4US2R 3U5ZB 2JJ1A 2QP4A 3ND8A 3TE6A 4PPFA 1GRNA 2HCBA 3KQKA 3VR5A 1XJQA 3K70D 2FSIA 4DCVA 4E22A 3SFVA 3GLIB 1PV4A 3THXA 2CL7X 3F3YA 2QMUA 3SFZA 1SZPA 4HUQB 2X2EA 2YKGA 5LB4A 3CONA 2X77A 3BOSA 3UPUA 2ZRJA 4O0MA 4QBIA 2VSXA 3TQCA 1D6JA 4RVCA 3IO5A 5AWFC 2D74A 2GNOA 3RDPA 1LS1A 2V6JA 2FGKA 5AJVB 3U61B 1XF9A 5HZKA 4C0QC 4WZ6A 4D4LA 5B57C 4PR0A 4DIEA 1GDDA 5DLQC 3TUIC 1YR9A 2ZVPX 2BMFA 1TADA 1E9DA 3FE2A 2FZLA 1E4YA 3EPJA 2IXEA 3LD9A 1BMFD 3RABA 4QBGB 4U00A 1NG9A 2BJWA 3AF2A 4Q7LA 1LS6A 1CEEA 1VKJA 4ESVA 1GNRA 3LDAA 3X2SA 4BFVA 3TMKA 2F3TA 2PZEA 5SZKB 4OYHA 1YR6A 3CF0A 3RAPR 2GF9A 4W5HA 2EVWX 4TZ6A 4R2IA 4NCJA 1IN8A 4JJZA 1N0WA 3AKYA 1COWD 3I5YA 4RD4A 2KB0A 2VIIA 1M7HA 2E9SA 3K0EA 4G5SA 2DWPA 4ITRC 521PA 3REFA 4HLUC 5B64A 3GEIA 2ONKA 5D3MA 2QRNA 4B48A 3GFOA 2O8FB 3IIJA 2QN6A 2CLCX 4TYQA 3VR2A 5KOYA 4F91B 2OBLA 1DG3A 4CYMA 1W2GA 2FNAA 4JL5A 2ZUBA 4CT4B 5SZIA 3SJZA 4QC2A 2GETA 3MGCA 5K8TA 3WYFA 4W5WA 4A92A 3IQXA 2ZS9A 1DELA 1F2TA 3TW8B 5GJVC 4M9XA 4IXNA 1IAQA 1F2UB 2WV9A 4PC3A 3U3JA 3MWLA 4MKIA 2VP0A 2FSHA 1AIPA 2Z0MA 1SVWA 1N6RA 5AUPB 3ZJYA 1L2TA 2CCJA 3O8CA 2ZEJA 3ZDQA 2JLVA 2G3YA 3VR6A 1Z83A 5EXSA 3GEHA 1LTQA 4C9BA 1W5TA 2ZYUX 3DHWC 5AUNB 3Q5EA 5FR2A 1UBEA 2IX3A 1GKYA 4DCTA 3T12A 1CU1A 1KNXA 1VHLA 3TKLA 1UBGA 4DT1B 3FHTA 4NU0A 4EPXA 1KDTA 3N2EA 4FXPA 3TK1A 2MSCB 3UANA 2K5UA 3MRSA 1J8YF 3KB2A 4KVAA 5JSZA 2IYLD 2AKYA 3H1TA 3LFUA 221PA 1QG2A 2D06A 3VTKA 2B7BA 3JVVA 2JLRA 2ZJBA 3THOA 4GOXA 1KZGB 1MABB 4KYUA 4RFSB 3TLXA 3U4QB 3DEFA 1G20E 1Q57A 4OI0A 4GDFA 5EZ5A 5UKDA 5JI2E 3BIFA 1RZ3A 3QUSA 4P0TA 3ND9A 1A1VA 4QOSA 1SGWA 2XJ4A 5J4YA 1CRPA 4PXAA 2YC2C 3U3KA 1AM4D 1K8RA 3BB4A 2GTPA 2B7CA 2OCBA 3UMFA 2ORIA 2LKCA 4HUQA 2GVZC 4OQFA 1E1RA 1JB1A 1VIYA 2BMDA 3EA5A 4KLZA 5L3QA 4N0EA 5FOWA 2ZRLA 4OK3A 2CL0X 3K53A 2GA8A 4UNSA 2O8DA 3ICQB 1WB9A 4IDPA 2XB4A 2PJRA 2GILA 4LBVA 4JLNA 4TN1A 4AURA 3T1VA 5KDLA 1IJFA 1VTKA 2P2LA 4LHYA 1TQDA 2H7VA 3TSZA 2NG1A 1U9IC 3CZQA 1OJLA 3G0HA 5CK4A 1S4QA 1VMAA 1FMJA 2QY9A 4P4SA 4M1YA 3PUYA 3SR0A 5L3SB 4LPSA 1UKYA 4HLUA 5DYIA 2HF8A 2Q9CA 3CRW1 2OFXA 2BDTA 1DARA 3H2YA 5CK5A 1KK3A 3B85A 1E9RA 2FU5C 1OFUX 3TSOA 2QTFA 4BFYA 1Z8FA 2YYZA 3R7WB 1J8MF 1S1CA 3L0OA 4BFWA 2QBYA 1FNMA 4F93B 5JS8A 3EIEA 3QOFA 4GP7A 1NMZA 1Z3IX 2DYKA 4URXR 3T1QA 2ZU0C 4JYCA 4JVMA 4RZXA 3W6PA 1EESA 2CK3A 4F38A 4W9MC 1ZU4A 2GJ9A 1UPTA 2AD1A 3CPHA 4IFBA 1S8FA 1CR1A 5AR1A 1OPXA 1XEXB 2OHFA 1UKVY 2HYDA 1P2VA 1IOZA 5JWHA 4QJ4A 3K9LA 2EWVA 3S1AA 4Q19A 4CDGA 1SXJB 2XXAB 5KHOC 1AZTA 1R0WA 3BK7A 3CRQA 3KKNA 3DKVA 5EE3A 4KCGA 3CF6R 2GEUA 2R9VA 4JLVA 4JVLA 3ADCA 3OE7A 2PLRA 1GNPA 1H8ED 2KBFA 2YOHA 2V1UA 5JJIA 1US8B 1U9IA 2IT1A 1G3RA 2D2FA 5JRZA 1E9BA 1NJGA 3T1TA 5K8IA 3RS5A 2WZQA 5ANRB 4G5RA 4CIDA 1Z28A 1Z6YA 2QTVB 3JZAA 4IOMA 5FOXA 5JI3E 2OXCA 4X8OA 5JEEA 1Y63A 4LUCA 1GKIA 5AJWA 4GMDA 3X1ZA 4ZDKA 2O5VA 3I72A 1ESMA 1W0JD 5FBRB 1E2IA 2GJ8A 3QKTA 4MRPA 4A8JB 1HQYE 4Z1MA 1CR0A 1CJTC 3SJBA 2ZAOA 1KO4A 2FEOA 1AJEA 4XWKA 1G8HA 4QM7A 2J87A 4RSGA 2AL7A 4M0LA 1SXJC 3CM0A 1E1QD 1NVUQ 2PT7A 3WNBA 3AVTA 4KFSA 1N5JA 2QP9X 4LSGA 2AXPA 1EG7A 3VR1A 4UNRA 5GVRA 4CEHA 1KSFX 5EE1A 2OLKA 2YOFA 2HJGA 1P62B 2OXRA 1ZINA 4NPHA 5ELXA 4CEIA 2HT6A 1G3UA 1ZNZA 3LAWA 3NBZC 2FH5B 4C7OA 2JJ2A 2VQSA 1B0UA 3WHKA 3K9HA 3AVOA 2RB4A 4OHWA 2IYSA 2OCYC 1XJ0A 3NC1C 4NMMA 2ZITA 1LW7A 5JCZA 1Z0AA 3P26A 1TQ2A 1M74A 1DG1G 4YMVA 3EAQA 3NHAA 2JIZD 2DWQA 3K9NA 4XD7A 1II9A 2NIPA 2DPXA 3RS3A 2JCSA 1YJ5A 4NKRA 4RZ2A 1DADA 3Q5DA 4X8HA 1F6BA 4Q9HA 5JECA 3AF0A 3SEAA 4GP6A 1YRAA 3DOEA 1R6BX 1ZD9A 3QE0A 4LWZA 4QNRA 2ZRHA 2R6GA 1T3HA 5F9FA 4Q4JA 1KOFA 1ZNYA 2OCPA 1NBMD 4V0NA 2CLDX 3DDCA 1H8EA 1CS4C 4L16A 2YJTD 4PAOA 1HH4A 5FPHA 5TDHA 3V00A 3GLIE 1IONA 4WBSA 3SBDA 5HPYB 2BCJQ 2BMJA 4LV8B 1KMQA 2IK8A 1UJ2A 1W47A 1XCPA 4XH9B 1IXZA 1Z6GA 1QZXA 1YE8A 3T5DA 1DTSA 2OLJA 3QXJA 4M9SA 3WMGA 1JECA 5FTKA 1E2DA 5KSZA 4MDEA 4HAWA 4PTLA 1NN3A 4V0KA 3BB1A 4QXAA 2CXXA 2FZ4A 2XZLA 4Q00A 3U3MA 2GJKA 1VDZA 2O8EA 1R8QA 5L3SA 3EPKA 4BUJA 4KYIB 1PLKA 1RE0A 4NCNA 3T35A 4G0NA 1W1WA 1R4AA 2GXSA 4PQRA 2IYXA 3N2IA 4NYIR 2ZS7A 3R8FA 2H57A 4MYCA 1YKSA 1UBFA 3VR4A 3L0SA 4D80A 4ILEA 2J7PA 1XEWX 4GZMA 5CB6A 5C1BA 2FSFA 4R98A 3EA0A 3MWYW 4WA7A 2QBYB 4KHZA 4CVNA 3U6KA 4QM6A 1KDPA 5K8UA 4QFMA 3ASYA 3IEVA 1YZUA 2XAUA 4IDNA 4NDZA 4IXMA 4G3XA 1VG9B 1Q21A 3GLHA 5FI1B 4F4JA 3K0AA 3LNCA 2ZRIA 4G1UC 2V54A 3FGNA 2WOOA 4URYR 5CDFA 1LNZA 1G16A 3CLVA 3GJ5A 5J5CA 3W8NA 4LBZA 1K6MA 3BJIC 1NMXA 4Q9JA 4D0GA 5EXPA 5G40A 3S1AB 1FL9A 1YU9A 2CNWD 4C2UA 3WYGA 3A1TA 1CR2A 1RIFA 3NEYA 2JJ2D 1BS1A 5DGXA 2Q6TA 1FPMA 4GFDA 4ASUD 3BWDD 2W83A 1G7CA 2IXGA 3U4QA 2DFNA 3QEOA 3R20A 4RJLA 2RHDA 3ZQJA 1P4SA 1G8GA 2PMKA 4MKGA 4RZUA 4WZBE 4CZ2A 3AVXA 3T1OA 4XSHA 1D9ZA 3P1JA 2W0SA 1R5BA 4AYTA 3EC2A 4LYHA 3HYTA 1XP8A 1ZM2A 4Q47A 5J47A 3PJRA 3GEEA 1I4DD 1KJYA 1MO4A 1S96A 5EXTA 1RPZA 2FE4A 3TJZA 3T34A 4YXWA 2QT1A 1XXHE 1KI1A 4PC7A 3NIBA 1TU3A 4BFTA 4B2LA 3M4YA 3CO5A 1BOFA 3OEEA 3KQNA 2VP2A 4Y0AA 3BE4A 5CM9C 4CGZA 1OXVA 2J0UB 3W90A 4Z51A 4Q7JB 1W4AA 3E70C 4BZXA 4Z8XA 5AUQA 2N42A 1YR7A 4A6PA 4CEHB 2HXYA 5F98A 2RKOA 2VRWA 4IVRA 3ZS8A 4TMTA 3TAHA 1IN6A 4R2HA 2V3CC 1IY0A 3MWKA 4HB4A 4GZLA 5D3MB 4Q1EA 1X1RA 1RYFA 1AKYA 3CX8A 1Z2CA 4KSCA 4D26A 2BM0A 2OM2A 2VHTA 1E2LA 4UNNA 1ZUIA 2DHRA 4BLTA 5KPJA 4LJ9A 4QGAA 4TL7A 5SZJA 4UKDA 1GL6A 4O3MA 5EZ6B 4NCIA 5FTMA 4OHZA 4X8MA 2REXB 4BLOA 1KK2A 4HB0A 3I73A 1RC8A 2FFAA 3IILA 2VTKA 2J5XA 1SVOA 2XZPA 1E2HA 4IHQA 3A58B 4K81B 2JLXA 4MYHA 3QKRA 4ARZA 1XX6A 4LOAA 3KQLA 3CWZA 3R7WA 2C8VA 2GBLC 4TMVA 1J90A 3A37A 1EXMA 1KI3A 3QF4A 4ZDWA 4NHOA 2ZE6A 4H9GA 1OXUA 3HYRA 4OHXA 1T4GA 4KV9A 5TVKA 1P2SA 4NYMQ 2GXUA 1UM8A 4TMXA 2C9YA 4HB2A 2WAYA 3F0TA 3QY0A 1P3JA 2G6BA 5EP3A 4PO8A 4M1WA 1MO6A 2W00A 4MRVA 2WSSA 1NJFA 5IRCD 3B1WA 5FFMA 1E96A 3KX2A 2A5DA 2CLSA 2BBTA 4DIDA 4PHGA 3CW2A 3ZIAA 4B35A 5KNCA 1GAJA 1P75A 3HPRA 1N6LA 1JNYA 4RZ3A 3QQ5A 5JZVA 5E4FA 2XSZA 1XBTA 2AWNA 4BZQA 1TEXA 1G21E 3SU8A 3LWNA 1GIAA 1W5SA 1YZLA 3CB4A 1OFIA 4EPWA 3FFAA 1YZNA 4IOJA 4JLAA 4LGMA 4BLSA 4LC0A 5FTNA 3A1UA 4LPKA 1II8A 1Q44A 3EARA 2GCNA 3DKPA 2Q3HA 3KQUA 1OIXA 3K0AB 5C2JB 1WBBA 5IK2D 2C77A 4DDWA 3U44B 4II7A 4QHYA 2JLWA 4YMUA 4PZYA 1T5LA 2NQ2C 1E2NA 3GJ0A 2ZJOA 4TYNA 3H84A 3U60B 2OG2A 2W6JD 4Q1AA 4AYWA 1KY3A 3JZMA 5CJ2A 4C2TA 2V8OA 3ONWA 4C0KA 5DHAA 2FX3A 1KMHA 2WIAA 2ZJZA 3C5CA 3IDQA 2VBCA 2Q21A 3K70B 4C3ZA 2CHGA 3B5JA 4TYPA 1XPOA 3GP8A 4PSVA 2LWIA 5KNBA 5JEDA 3DVLA 1CKEA 1Q3TA 2D62A 2F6RA 1X8LA 2AK3A 1NLZA 4BFUA 1YQTA 2P6NA 2A78A 3AVWA 4DUGD 1LVGA 1CJVC 2QRZA 1AGRA 4YLGA 3ZYCA 2H18A 3VMFA 4H1VA 5JCPA 5FBWB 4HAZA 3WRYC 2R6AA 2OCAA 4D0LB 3KJHA 3CWQA 4JLPA 1XMJA 1TU4A 2GEDA 2G0TA 1SVSA 1G5PA 3DZDA 4PAQA 4JKIA 1RKBA 4Q1DA 2WKQA 3QBTA 1XZQA 5EP2A 3GJXC 1OYYA 4A0GA 2QPTA 3PIRA 3I62A 1Z08A 1A5TA 1D8TA 3K0SA 3B6EA 3R9XA 2JDID 4TTQA 1QHIA 4HYYA 4I81A 5FH9A 1NBMA 3WBKA 4A36A 3PV0A 5J4LA 3A4MA 1MKYA 4JSYA 5B2ZA 2JA1A 2WWHA 2GBLA 2ZIAA 4US1R 4DWJA 1FP6A 3AKDA 4FMDF 2QUZA 1I2DA 2GCPA 3W6NA 4HUTA 3PCRB 5LDDC 5FL7D 2J45A 2FMXA 2WTUA 1LFDB 2X1VA 1G64A 4U02A 1J99A 3RVBA 2FN4A 2ERXA 4FMCF 5J40A 4HB3A 5KO2A 1E0JA 3W3AA 5FBLB 5H8WA 1DEKA 2CCKA 3WNDA 4K46A 1FQKA 1OE0A 1S3SA 1SULA 4DZZA 4R71A 2EQBA 4M9QA 4AIIA 5HKKA 1XTSA 5FPKA 3FMIA 5IK2A 2VF7A 4L9SA 2VP9A 3VNUA 1JR3D 4WZAE 5LB2A 1E2JA 2WMOB 2YINC 4IEIA 3C8UA 4ESHA 4KSBA 5JLJA 1SVMA 4EIWA 3LX8A 2EYUA 1E6CA 1L7VC 4NE2A 1AK2A 2ZE7A 4M8NE 3TSWA 2W2VA 3MFYA 4KU4A 1ZRHA 4Q4AA 5FBQB 3WBJA 1GUAA 4KFTA 3RSOA 3L8YA 2ZRPA 2IBMA 2Z4RA 4RY2A 4XVUA 3QXSA 4CEIB 1NF3A 4TTPA 4FCWA 2H1LA 3C14C 1OF1A 3FVQA 4TQAA 4LV6A 1CR4A 4PPQA 2W0MA 1G19A 1Z0JA 2PZGA 2QM7A 5GJWC 2AFHE 3CNLA 4B3BA 1XPRA 2QNRA 4G5QA 4WW0A 2IF2A 5FL7A 2YWGA 4UXIA 1KO8A 4DCSA 3K70C 2QMOA 2C03A 2PX0A 1N0VC 2GK6A 2PH1A 1GVNB 1JQLB 3GJ6A 5LD2B 2P0EA 1L4UA 5FOUA 1Z0IA 1ZM7A 2R62A 3W6OA 3X1WA 3QJYA 4JVSB 2XNDA 1Z0DA 1Q1BA 4D0NA 3C16C 3E1SA 3G82C 4HEJA 4QGGA 2QE7A 3JVUA 3IQWA 2QU8A 1OXXK 2OBNA 4FMCB 3BS4A 4IDQA 4TQ9A 2P3SA 2PT5A 4UJ5A 1NP6A 3UIEA 4QG7A 1X6VA 5E7JA 1O87A 2WHXA 1GG2A 1NN1A 3B78A 2D7CA 4MRNA 3RSLA 1OXTA 3FOZA 2RH5A 5KYKA 1TPZA 2V6IA 1Q0UA 3GFTA 4FD2A 2ODEA 4I1SA 1JALA 3SYNA 3TVDA 1ZP6A 2AKAB 2ERYA 1F5NA 3EIQA 4B74A 1BIFA 2VSFA 4KFUA 3L82B 4FMBB 1WBDA 2IXFA 1CTQA 1D5CA 1NRJB 3D6TB 1LB1B 3LBHA 1HA3A 2QGZA 3QKRB 2JLZA 1COWA 1GSIA 1PZNA 3FMPB 3NXSA 4WXPA 4MH0R 4OQXA 4LYJA 4BGDA 2CDNA 4ACBA 2O0HA 2ZRCA 3QPWA 1WP9A 1Z22A 2FFHA 1IY2A 4HLQB 3WRXC 2VP4A 2NMVA 4GRAA 2RGAA 3J81k 1UDXA 2QP3A 1VIAA 3KKPA 4HAXA 4XWOA 4MYTA 1IY1A 3L0PA 3NBXX 1GTVA 1XNJA 2NZJA 4MDFA 1DO2A 3TIFA 3ZD7A 1F3OA 2BBSA 4IVQA 3AQ4A 4TTRA 1G3QA 3QG5A 1VG1A 1W7AA 1IQPA 2BWJA 2KI5A 2PCLA 2BV3A 1MR3F 4M2LA 2VSOA 3KFXA 2J9RA 4BEBA 4Z54A 4NCKA 4LHZA 3FHOA 2V9PA 2ZVQX 2OZEA 4PHTA 4HATA 1WCV1 4FIDA 1JJ7A 4NTZA 4XTCS 1CXZA 2H92A 4YONB 1ZNWA 3Q3JB 2AD5A 4S35A 1XU4A 3PVSA 5KDDA 3FMOB 4L8GA 3U44A 2WPDA 4I1OA 1E79D 1ZCBA 4Z8YA 4QJ3A 3U7EB 4KITB 4MA4A 1TUEA 3UWOA 4D2IA 1Q1ZA 4BLQA 5CDFE 1ZBDA 3QIAA 5FTLA 2H8KA 2FV8A 5GJCA 4BQSA 3U7FB 3KZ1E 4Q1CA 2Z5FA 1KI4A 3MWJA 1SQ5A 4DLWA 4DUGA 5E7MA 1NVXQ 3D31A 4MUBA 2JLUA 1DO0A 2I1VB 4URVR 3OEHA 4D4JA 1M34E 3KTAB 4OHYA 3HR7A 1ZM3A 2D2EA 2O8CB 3QVVA 4D4KA 1CIPA 2H5EA 2Q3FA 1XZPA 2O8BA 4PPNA 2BOVA 5CYOA 2IUTA 5JHGB 1DAKA 3VX3A 3RNLA 2CHVA 1KYIA 1KDRA 1OXSC 1X86B 3GLGB 4M9ZA 1ZVQA 1TF7A 3DOFA 2W2TA 2HUPA 4MKFA 3TQFA 2ZUDA 2ATXA 1QHSA 4DDUA 2SHKA 2EFDB 3MMPA 2GKSA 2UZ3A 2RGDA 4BFSA 1VECA 1HQCA 1Z6XA 3KUDA 5AUOB 4JMPA 2F9LA 3NH9A 4GPTA 3F8TA 3W9YA 1H65A 1Z6AA 3Q72A 3HU3A 2A5JA 1ODFA 1S2MA 4MRRA 2EW1A 3PQCA 4AI6A 1FTSA 3VHXA 1GOTA 5FR1A 1E9SA 5KTYA 4V02A 1E1RD 2PZFA 1XWIA 2LKDA 1E98A 2YHSA 4C30A 4LZZA 2W6ID 1W44A 4LHVA 3MG9A 1GWNA 1E0KA 4OQMA 4XD7D 4F4IA 1G4AE 3OIUA 1OH7A 3FTQA 5G53C 1IXRC 3B1XA 2ZRMA 1BYIA 3LQQA 3NBYC 4B76A 1RRFA 3ADKA 3WMEA 4FCTA 2Q0HA 5KSOA 1MO5A 4A1FA 2O0JA 2WJGA 4XJXA 2OILA 3AP3A 2WWGA 1DS6A 3Q85A 4URUR 2ZUCA 2C9OA 2X8AA 4IVPA 4KO8A 1S9HA 3SYLA 2NTYC 4D4MA 1KI6B 3ZVRA 2NO9A 3IIMA 3IUYA 4FINA 4LX0A 1R0ZA 1XMIA 2GEVA 2GJSA 2QI9C 2C9CA 3Q7QA 4Y0VA 1T8TA 2ZI4A 1SVKA 4Q03A 1N0UA 3TAUA 1TL7C 2EWWA 5L8VA 2VLIA 1ZD1A 3CX7A 2G9NA 3UATA 1X1SA 2IS1A 3SQXA 3BGWA 3AUYA 2DR3A 1XD9A 1E1QA 3DL0A 1FUUA 2IW3A 3EG5A 4EKDA 1QHXA 4OKSA 1AS2A 2FA9A 1N5IA 1OV4A 1QHHA 1G4UR 2C96A 3IEUA 3PUVA 5FUYA 2IYQA 3ZLJA 1MT0A 4ZO4A 3N5CA 2QMHA 4RD3A 1TF5A 3CNOA 1VYVA 1QHHB 1XDBA 2ZJ5A 1W0JA 3K1JA 3TGPA 4OI4A 2WWXA 1S3GA 1R5OA 2QAJA 1VYTA 3SI7A 3VKWA 3V9PA 4Q4LA 2NPIA 4YMWA 4DSOA 3MLEA 2G83A 4GBMA 4BECA 2L0XA 3A6PC 1FTNA 1FOEB 2QEQA 1H8HD 1QHYA 3EC1A 2RGEA 4H1UA 1SHZA 4HDCA 2I3BA 2VPPA 4BLPA 4MYUA 1RVDA 4DBLC 4NZYA 2QT0A 3B9PA 3GJ8A 4Q4AB 6Q21A 4ON9A 2JGNA 2P5TB 3BC1A 1QHGA 4ACAA 1X8KA 4ZPXA 3SHWA 3LW7A 2CE2X 2ODBA 3AF1A 1D2MA 1NG1A 2J1LA 2F43B 2ZPTX 4PQYA 5DIFA 1MO3A 1W46A 2GCOA 3I4LA 1KHTA 3KB1A 4JKYA 1VG0B 4OJKA 1KI2A 3AGPA 4KXFB 2ZJAA 1ZNXA 2H16A 5AJZA 1RJ9B 3ETLA 3L8ZA 2AFIE 4JZKA 1ELOA 2Z4SA 4LYFA 1C9KA 621PA 5KNDA 4PPGA 2BJVA 3BBPA 4ZV4A 3NC0C 4KVGA 4Q48A 4PZZA 4QNMA 3I8XA 1OHHD 8OHMA 2NZ8A 2RGNC 2XX3A 1XMSA 3A8TA 4A8JC 4JLJA 2CVFA 2JAQA 2IL1A 4A0HA 2V1XA 421PA 1E0AA 2IYUA 1E99A 1IJEA 4TMWA 1G3MA 2DBYA 5DN6A 3ZVLA 5BYKA 4I1UA 3EZ7A 5FUWA 1NI3A 3UG7A 4XIGS 2KSQA 4DLSA 2J0SA 1HE8B 1DAFA 2VP6A 3FFBA 3EZ6A 3GLHB 3V4FA 4LY6A 5KSYA 1U0JA 3AV0B 5CLLA 4B44A 3WMFA 1GFIA 3K09A 2QG6A 4JBXA 3EX7C 1P9NA 3QKSB 2IA5A 2R2AA 1IBRA 2ASEA 4Q9KA 5JJKA 3RRNA 2NGRA 1SVIA 3PFIA 1XTJA 2JASA 5BQ5A 1I2MA 3CRMA 4AKHA 1JXMA 2ZS8A 2A7QA 4XVRA 4YDHB 2QQEA 3AVUA 1NKTA 3OZXA 3NDPA 1G18A 4Q21A 3SBEA 2FF7A 1T3LA 2ECKA 5HE9A 4AKEA 5BN5A 1NVVR 4HDQB 4GSYA 1OYWA 3D7MA 3PENA 4WAUA 5LD2C 1ZU5A 5H70A 3FKQA 4M53A 4TL6A 2C95A 3IIKA 4AG6A 3LO5A 3SE0A 2WVJA 1JR6A 2PEZA 2QQ0A 2EFGA 4ERNA 1E2EA 2QZ4A 1MABA 5CYPA 4C0BA 4CEJB 1EWQA 3CNNA 4Q4HA 4DSNA 1KO5A 1JAHA 1Q22A 2P65A 4PFSA 3PEUA 4ZCMA 4F4CA 4QKQA 2ZXUA 3AH8A 1G5RA 2J0VA 5CJPA 1LF5A 4LJ8A 1ZC3A 2ZI3A 2XTNA 1BYUA 2QAGC 1G6OA 2YZ2A 5FI0B 2XNDD 2O52A 2PEYA 3B1ZA 2OSBA 4C0HA 1HY3A 2BVNA 4P3YA 1WMSA 2AK2A 2FJUA 2ZRGA 3DM5A 3HU2A 4UXHA 3KXIA 2XITA 4C4PA 3QBVA 2CJWA 3G5UA 4A82A 1RW4A 3HWSA 2R6FA 4AG5A 5CIWA 1E9AA 1SKYB 2YOGA 2V55B 1OB2A 2A5GA 4XSGA 1DAIA 3UK6A 1PLLA 4HLDA 1KSHA 4MGIR 3GJ4A 1T91A 3LQRA 4YDSA 1J7KA 3UG6A 3SN6A 3IBYA 2WJIA 5TXGA 4M4SA 1OH8A 1MOZA 3HPQA 2QTHA 3RRZA 2B8TA 3ZD6A 4IKEA 1KSGA 5TMPA 2J7KA 4WXRA 2OE2A 4KAXA 4XVQA 2IWHA 2YV5A 3RC3A 4Q5IA 1TQ6A 2GZHA 1U8ZA 2ORVA 3A1VA 4LJ6A 4RFVA 3ZGXA 3EPLA 1QF9A 4LJ7A 5J4HA 1AN0A 2FPKA 2XEXA 1GRRA 1BKDR 1E9EA 3C7KA 3GLGE 3CRVA 4PO9A 3PG5A 4UXJA 2O8BB 2OV2A 5C4MA 2OESA 1R0XA 2ZRNA 4OQLA 4J0QA 5IDVA 2AWOA 3OAAA 5EXXA 1ZUHA 3QNUA 2EU8A 2WJHA 4KI0A 3GCGA 2B21A 1T9HA 2B92A 2IS4A 5SZHB 2RHMA 5IHPA 2OUKA 3KXLA 3I8SA 5E95A 3KQHA 2F55A 4W5JA 2ZJYA 1NNEA 1IN7A 2KJQA 2GK7A 2A9KA 1DVRA 2DFLA 4FMDB 1LF0A 3TBKA 4FWTA 1HUQA 1H8HA 5CM8B 4IJMA 3QSYA 2QGNA 4FCVA 3THXB 1ZIOA 4GI7A 2PCJA 1U90A 2YWEA 4C0SA 3KXKA 3P4XA 2WJYA 1W48A 2J3EA 4GT1A 3UWKA 4OHVA 3ZZTA 4ZKEA 1VCMA 3NVAA 3B1VA 5G41A 4TLCA 1IN5A 1SXJD 4HAVA 1R7RA 3F5FA 2F1IA 1TNDA 3WYAA 3CF2A 2ODNA 3SC3A 4TYYA 4JBWA 3P32A 3TR5A 2QPAA 4CRWB 2R8RA 3U2QA 4DRZA 2O8EB 2XB2A 3ASZA 3M1IA 4PANA 3TUZC 4ZCLA 4OI2A 2C98A 1S9DA 2EFCB 4JLMA 1EFUA 4JT4A 4E09A 2UKDA 1DBSA 4A2PA 1NKSA 1NMYA 2O8CA 3QF7A 5FPSA 1DAGA 5FBVB 2GVDC 1B23P 1KNQA 1G3IA 2REBA 1OKKA 2ZI9A 5BN3A 2WJJA 4GL2A
chains in the Genus database with same CATH superfamily
4LDJA 1R0SA 2Y6UA 3QITA 4QDXA 4G65A 1WUTA 5KS2A 3FGPA 1CJMA 1FCJA 3IAEA 3RJ5A 4DABA 2DHEA 2JL1A 4L5IA 4FEAA 4JSTA 3DO5A 2B8EA 4EFNA 2X8LA 4P81A 4M1MA 2J46A 3OU7A 2VJPA 4AKTA 1KIAA 1VLLA 4FHGA 2WIBA 2X8JB 4O5AA 3OQIB 3CW9A 2IV7A 1Z5GA 5E6RB 4CM6A 4M0KA 3Q8KA 4Q9NA 1TKBA 2P4HX 3ROKA 4E07A 2JRLA 1KI7A 4KODA 1KI8A 4YACA 4NOJA 4WXHA 1R6TA 5C8YA 3RUHA 2XXAA 1PSZA 3NHBA 4HZUA 3FLMA 1SFRA 3NNNA 1YUMA 5CX1B 3ZUPA 5M3BA 2D7DA 1MGOA 4GRDA 2VDQB 4EB6A 1T1EA 1Y7IA 3WTBA 4P22A 5KNBD 1XZKA 4ZQEA 1JEDA 3UK0A 4UVHA 1TK2A 3EZLA 4HNHA 3U3OA 3MINA 3E5HA 4KLNA 1DAMA 1MJ5A 1JFTA 6YASA 1RJFA 3CVYA 3M70A 1G8SA 3P0FA 4AMYA 4N5IX 1QC5B 1W36D 3IE0A 1XTZA 3M9WA 4IWYA 4PSAA 3QVLA 5DM70 1NOKA 1QRSA 2R11A 4P4NA 5EY5B 1L5LA 2A30A 3EQZA 1AG9A 1GCGA 2DZDA 3IAS1 4PIVA 4EOGA 2QN2A 5C8DA 1BVHA 2WICA 5DO9A 2DT5A 2W5UA 2PAAA 2WR8A 3SC4A 2F3QA 1AQJA 4C05A 3KU1A 4HNRA 3MWEB 3AIMA 4GOJA 4QO7A 5DEIA 5BWLA 3WICA 2DBRA 2PG3A 3L7DA 1RZVA 2BEVA 2G88A 1FYXA 2RKWA 3WGTA 5FJIA 3BBLA 3STHA 3R7FA 2JFPA 5JJLA 2ZUUA 3E7WA 4I14A 3HY3A 2OG1A 4MRAA 1ZHHA 2FPIB 3N2LA 3OUZA 4WJLA 5KMGA 1ZUD1 1Z2AA 2YXNA 1J97A 2M2IA 3PTLA 4FFPA 1L5RA 1ZC4A 4BGUA 3ACDA 4J0KA 1YTUA 3UUEA 4ZVNA 5GONA 3FN4A 2NN3C 4UUAA 2W2XA 4AVYA 5LJLA 1V41E 2L82A 1WEHA 4IH9A 2RH9B 3C15C 3DAOA 5KINB 3BH7A 2DTDA 2DWOA 5G1PA 1ONBA 1QFSA 5ALLA 3MD0A 3D8UA 5CA0F 3C6QA 4GC9A 2YNMC 2HCFA 3DTTA 2GRAA 2D3WA 4UZSA 5EMJA 4BASA 4U0JA 2F90A 5A71A 4E2ZA 4JIMA 3FXAA 4PS1A 1NVVQ 3WJAA 2PBRA 3JTEA 2QSZA 2AMFA 3WWOA 2G9ZA 3M82A 3FWYA 4PG5A 2VNSA 1XTQA 4KNVA 4G5OA 3VAAA 1EM6A 3P8ZA 2P67A 2FFQA 2WAOA 4Z9AA 5HUJA 5CBPB 2CDBA 1UJ4A 4NQZA 5I7HA 1O58A 5JQWA 3NH6A 4R2MA 3OJ0A 1JTFA 3U4IA 3FDZB 3TTUA 2RMKA 5DI9A 5GVSA 2BMEA 2GOYA 3KJNA 4JMLA 1M0SA 5BV8A 2AI2A 4NOLA 1SK9A 1Z5UA 3HEBA 2PX4A 4RHCA 4ZJYA 2FJ0A 3AO0B 2Y0CA 1NOIA 1TW3A 1RCUA 2G0NA 1N9KA 3MERA 2NZVG 5E3JA 3RYFB 5B7QA 4HBGA 5ALRA 8LDHA 4CF7A 3MCAA 1W35A 5AJXA 4BNFA 2GERA 2QZ9A 2VF2A 1FW8A 5IT5A 1YZKA 3SIXA 5FWDA 3CH5A 1WSWA 3D6NB 4RD1A 4NCAA 5CVDA 3B8EA 1CB7A 1Y1SA 4MVJF 2IOQA 1NYTA 1ZIXA 2WHYA 4R7ZA 2UZ0A 5ER6A 3VKVA 2XZDA 3ZWWA 3ZHUA 5KPDA 3VAZA 7ADHA 1CRLA 4ZXFA 4KE8A 1PDOA 4KDEA 3I5MA 4ARSA 4ONEA 1YBFA 5K51A 5FA6A 3K2IA 4M0CA 4P8RA 3GP5A 2H2AA 2BGWA 3LUFA 1GG8A 3C3YA 1VBMA 3C3AA 3UHAA 2ZT5A 2HHLA 1E32A 2OBBA 4TSFA 3GRCA 4U2CA 1TEVA 1GAEO 3I04A 1HT2E 1QU3A 4DNQA 1QZ3A 3EBPA 4QXRA 2RAVA 2TS1A 1QIDA 1XRPA 1ZA2A 2QMEA 1M6NA 1D0SA 5IKMA 2IDMA 1X3SA 4EY8A 3LCJA 4YR9A 3KWLA 4M1OA 4DQXA 4E6PA 1NTOA 1DJQA 4Z4GA 3C97A 2CE7A 1SG9A 2HEIA 1YR8A 1LU9A 1GYQA 1UBNA 2AZTA 4KQIA 1WXGA 2RGNA 4GX5A 1T8YA 1Z0FA 5F2KA 1GTG1 4L07A 3FKSA 3QHPA 3ABSB 4RYDA 3Q2OA 2R68A 4EPRA 4Y2TA 2Y3IA 4HLCA 4UD2A 3R3XA 1VHJA 1XTVA 1FUKA 3UJ6A 2B1GA 3ZG6A 2IYOA 4CG3A 1MENA 2WEKA 4PICA 2IHVA 4BFZA 1ZH8A 4XWGA 2FETA 4BFXA 3IERA 3NANA 4WOJA 1N6NA 4GEGA 1Q0LA 4DEYA 3CUEF 3DDWA 2ZBPA 3TCNA 1I7QB 3ZNNA 3CA8A 4Z4HA 1FUEA 1JFFA 3IRVA 1VMIA 2XVZA 4E5MA 3P2IA 2BDUA 5FQNA 4IYRA 1OA0A 4I4CA 4LK2A 3EZFA 3FI0A 4XM1A 2ONCA 3VZPA 5B3KA 2PR2A 3VZDA 4ZDIA 4JC4A 2C2XA 3TEFA 3OWHA 1T5DX 1ZJZA 1MQAA 1ABFA 2CFOA 3INRA 3K0FB 3M0EA 3THRA 2C8JA 1U3FA 2NV0A 2CD7A 3GX1A 5HP4A 3FBGA 2PA3A 4O0LA 1YSCA 5B12A 2AX3A 2PSEA 2RHRA 2GF2A 5AK3A 5IJWA 3NMUF 3BYZA 4EM6A 1ODSA 2Y0BA 5CLQA 3FD8A 2OD9A 2RIRA 3V8VA 5M34A 1AX9A 3DF9A 1EUYA 5JASA 2GZ3A 3C3JA 3GDWA 2NUPB 4HN4B 4K9LA 5LJIA 1DGQA 3BERA 3IH5A 1G41A 2BFFB 2Y99A 3G2IA 3NV9A 4QDUA 4XDHA 3HL0A 3OPVA 5LBUA 3Q8LA 5JD4A 1AZSC 1V4NA 3AFHA 1O89A 3UGJA 3FPJA 3FNEA 3FY4A 3U81A 5DNWA 1JG3A 1T0BA 3E81A 2HF9A 3NLLA 5AI8A 5EJ2A 4AMUA 4RM3A 1WEKA 2R6CA 3R7DA 2GUWA 2ROQA 3BMQB 2H59A 1QIFA 2YV3A 1M8KA 3LXUX 2A94A 5AVKA 4F1KA 5K20A 5T41A 4ZT2A 4J43A 1WMAA 1UKZA 1VMDA 1SVLA 1RC0A 1XEXA 2H5LA 2RAFA 2WNHA 4HTAA 1W0KA 4JYAB 5D1HA 1Z35A 1E4VA 4M6WA 1CUWA 2AOXA 1Y4ZA 2X4GA 3PHHA 5AJTA 1VHTA 5E4YA 1TZBA 2QTNA 4M1SA 2YVAA 5DPMA 1N3BA 3SOPA 3ZK9A 3QKUA 5HF6A 1P73A 1XEWY 4JDPA 1GDHA 4H17A 4D82A 5DHFA 2QE6A 1NHGA 3R4CA 2GJ4A 2DFTA 4YTEA 3MTJA 1Y7HA 4IMRA 2JFZA 1M67A 3JR3A 4X20B 4BJ1A 3AR5A 1AS3A 3NS7A 1U2DA 2OORA 4GPBA 1L5HA 3PITA 1HTBA 2Z5GA 3QA3E 1N4AA 4EPTA 4L4YA 2A8YA 1A95A 3A70A 3ZE2B 4M37A 4CUKA 5HTOA 2NTNA 1I1NA 3FHJA 3QF4B 4IV8A 5D1NA 4E11A 5JFGA 5G4LA 4XGNA 4K2AA 2WKPA 3WA6A 2VKQA 2G4LA 3DCNA 2C7PA 3DCIA 3JWPA 2QRVB 3LH5A 2DFKB 2FZGA 1EX6A 2MT9A 4M87A 4DHWA 3AU9A 5IDWA 5JJBA 3QE9Y 5EIBD 1FP7A 2DY1A 2XOKD 1QG4A 3CVXA 3ZHVA 4CR7A 4QRHA 1D5WA 4NX2A 5HGXA 5HJ5A 5LM3A 2X1HA 2KWIA 4HTFA 2V45A 3NV7A 2GZ1A 4Q4HB 2G09A 2CMGA 5GAJA 3VAYA 1C5KA 1DX9A 2GAIA 4IIXA 5IN4A 4HOYA 3F78A 2V5AA 2W4IA 3X2EA 1SC4A 4RTJA 4BZPA 3ZBPA 4G5GA 5H82A 2JEYA 3EXFB 4H1TA 4LSWA 2GD6A 2FWBA 5B7NA 1CULC 1CP3A 4RVGA 1ONNA 1A1SA 2VDNB 1SG0A 4RELA 4EG1A 3QVSA 4S0ZA 4OHFA 2QAGA 1EX7A 2GTHA 2J0EA 2O4CA 4NBRA 4W7SA 1N2ZA 4Q9LA 1DT5A 5EE9A 1JZSA 1P0IA 2JBHA 1NRWA 3UXMA 2FX2A 1GZSA 4OBWA 1B6SA 4PFQA 2XTMA 3SS9X 5HKKD 4G1FA 3E6AA 1EK1A 1EB9A 4HNAB 3IE1A 3RWMB 3DMNA 2QJWA 2C4TA 4D79A 4N3BA 3IQIX 3NAMA 3OE7D 3TH5A 2X2OA 1AVTA 2OAP1 3AVVA 3NYQA 1NQVA 3ZVNA 3U40A 5K4GA 1E9FA 3CX4A 5HF5A 2QV0A 3FCAA 4G01B 3VFDA 3AM1A 3K9GA 2C83A 3L8CA 1P7CA 5EJAA 4WLUA 1FLNA 1PSDA 1PZFA 2YHAA 1P9WA 1FUIA 1XVAA 4EJSB 3ZVMA 1U7HA 5EIXA 4LSMA 4DJDC 1PBTA 4RKFA 4IHAA 5KWIA 2F8MA 4B3JA 2PRYA 1V5WA 1F60A 3WNZA 4MW5A 5LQCA 1J07A 1WAMA 3A4LA 3JRWA 1DBVO 3DMFA 1R10A 1XCMA 1C3VA 4FFDA 4JVNA 1YVDA 2I99A 2PBLA 4PU0A 5T7BA 4MVXA 4P35A 3QFSA 3GLFB 1XU7A 3W0LB 4CTKA 4RABA 2JKVA 3DE7X 4ZVUA 4EG4A 1TB4A 1X2EA 4ZU1X 4ZVKA 3R77A 3U37A 1CVRA 5I45A 3D02A 4X8LA 2UZIR 2A1IA 1I0ZA 1KERA 2GZRA 3C3EA 1D2EA 2TMYA 3I92A 1PVVA 3LDUA 3OSUA 1JLHA 3WSWA 3NUQA 1SU4A 1EVKA 3D6JA 3Q9NA 2PJZA 1K7SN 2NZYA 4AZ0B 1V7CA 1UBMS 1I4TD 2BUCA 3JQGB 1QOPB 1SC1A 4F8EA 2C7OA 3R6DA 4KMRA 4YFYA 3UXEA 1LSJA 2D0OB 2UZAA 1FFXA 2GARA 1XWWA 2ZJ8A 4EFDA 2O7VA 3B7GA 2ZYWX 3SLRA 1KYZA 1W5EA 2XA9A 1U7DA 2HRBA 4JXJA 4QPZA 3CRNA 4AL4A 1PVOA 5T3UA 4IEEA 3WLEA 1WUIS 2VHJA 4EKEA 1EVIA 3DR3A 4DR7B 2PUVA 2VCYA 2Z9CA 5CB8A 1ATIA 3H9QA 4BO1A 2E4ZA 2CN1A 3TCKA 3U19A 2JS7A 3M4NA 1XL1A 2IUUA 1YQGA 4KPFC 3TOSA 4YJHB 2J41A 1C2TA 1EJ6A 1T6ZA 1YR2A 3DM9B 2QNBA 3NCTA 4N0DA 1F8FA 1NUQA 2ET6A 1JWAB 1UBOS 2VJCA 3A31A 3TLEA 1KTIA 3H97A 1SZDA 2A0YA 5AK0A 5KUTA 1PLJA 2AN5A 1N9ZA 1O8CA 1I9CA 2XT6A 1POWA 3B3FA 3KQQA 3O8QB 1T5OA 4DS3A 1ZJJA 2QR3A 2W6OA 1Y37A 4HD8A 4PCVA 5EKTA 5JSYA 2HDNB 4XWAA 1G6HA 1TO1E 2W37A 4W8GA 5C8VA 5JVDF 2C5SA 2XHEA 2QTMA 2IZ6A 4JLDA 1JNXX 3OOJA 4CIWA 3AR2A 1ZVKA 1A2BA 3OCYA 1SKUA 2P77A 4R8VA 4X92A 3L92A 4ZYWA 2YFYA 1D1PA 2ZTLA 3IQZA 3L0CA 1A5SB 1EYZA 5A6VA 1SHJA 4CIVA 4CV0A 1NN0A 1E5TA 3CY6A 3DZGA 4CWAA 1HYQA 4ZOLA 5HJ7A 1MC4A 2JGDA 4UQOA 4BMXA 4JXKA 3SJAA 4OMFG 5EJ6A 1Z82A 3O83A 1IPFA 1FFEA 4QL3A 3D6FA 1SKYE 3G2NA 3AI2A 2W2QA 3JYOA 3STUA 2FN3A 3WFJA 1KP2A 1ID8A 3H1EA 1A82A 2AHOA 4XM2A 3PL1A 3UXHA 1CY8A 2GFHA 3J81A 2HK8A 3KAQA 1JEOA 1K3TA 4MGKR 5AYVA 3F2VA 5IVIA 1KFBB 1U80A 3K9FC 3G5AA 2ONJA 1Y5RA 3FPKA 4A8JA 1Y8QA 4C7OB 1RJGA 1GFSA 4PAMA 1WULS 4RQUA 4IFIA 1UDAA 4ZRMA 2XRYA 1HYBA 2ZBVA 2C2ZA 3TOZA 5AQEA 2Q9BA 2KYRA 3EPRA 2IYYA 2NU9A 2PO5A 2E87A 4U7GA 1YCDA 2JNWA 4BO4A 2ECPA 1KJ8A 1V43A 3ACCA 4GLLA 1XR3A 2WFAA 3HU5A 4S3MA 5B7GA 3EMDA 1W36B 1NL3A 1J2JA 2ZM5A 1Z17A 4UOQA 4E03A 10MHA 2V7VA 1ATZA 3HYCA 3RNOA 3ADPA 4HGPA 1EFTA 3BN3A 4IWXA 1A0OA 2PMWB 1IZ8A 1O94C 4DNOA 1QV6A 1O0CA 2D5IA 2F64A 3BXZA 3EZXA 2NUPA 3ZE0B 2H29A 1W96A 1Z7GA 5FL3A 3VR5H 2P9TA 5C4GB 3TRDA 1FDVA 1P2TA 3VH2A 4TYMA 4B34A 5I48A 4B6FA 3H4TA 3LA6A 1F2TB 3K4HA 3EVGA 1T9AA 2QENA 3NHSA 2QHXA 1NGSA 3B5EA 3IPYA 5TR9A 3GJ3A 1I7SB 3N6VA 4AY4A 4ZYYA 3ORYA 3MBKA 3W9SA 4D3YA 1OH6A 2C88A 2IYZA 1WABA 1MGPA 3V4ZA 4BX9A 1JJAA 2O2HA 4O2AB 4KREA 3PUWA 1RBQA 1WF3A 1XB2A 3EY9A 3C1UA 3R0VA 1TFRA 3NDJA 5L53A 2O7QA 1Q2XA 3ZJTA 5E9AA 3A25A 3IESA 1IXSB 4Q37A 1U99A 5EPOA 4EFKA 2YXDA 2DHQA 4TVOA 2G1JA 1AQYA 4YQZA 1IJBA 3WYEA 4ZAXA 3NHPA 4ZEOA 4QNNA 1RXYA 1Z13A 4B8ZA 4XEHA 4BZZA 1UXJA 4D81A 2XQIA 2FI1A 1CUGA 1P1BA 2JFYA 2ZJFA 1BMFA 1MB2A 2I2XB 3CKKA 3MJEA 3RF6A 3SIPA 1H4QA 3TR0A 2BKVA 1EM8A 3PR2B 2VPIA 4QLOA 3K30A 4RKEA 3PGXA 4UTVA 4KDFA 3GUVA 3AHGA 2ZJ7A 1UP7A 4CM4B 4QOHA 2V4ZA 3M33A 1FX0B 1NMSA 3BSYA 1II0A 3GG9A 5L6MB 2QVGA 3L0IB 1A9ZA 3LT2A 5BT9A 4PYMA 3AHHA 2QKYA 1H0SA 4JSRA 1C30B 5LDHA 3W5AA 3OURA 1GGEA 3BT7A 4L5AA 1A7JA 4TXHA 3RTAA 4HNUA 3QYPA 2CVHA 4D42A 1AQUA 2I1WA 2PQ0A 4ZT4A 4N8SA 3RTEA 1BS2A 1MV8A 5KTTA 3HE3A 3I53A 1JKIA 1HSZA 2QROA 3BIJA 3PU6A 1JSZA 1L8AA 5DTQA 5G0UA 3GUHA 4KUGA 3T3PB 1SUBA 4Y2YA 2G63A 2VUHB 5HJEA 1XYYA 1A9XA 1L9XA 1MP0A 3A1DA 1ZHOA 3SIWA 2C78A 4P0PB 4MGYR 2Q0SA 5ELLA 3GMTA 1U1GA 1U2ZA 1XAHA 1DOZA 2PN1A 3GRZA 4S12A 3VV2A 1USWA 2J59A 3AUKA 3HKEB 2O8VA 5PGMA 2GYWA 2JI8A 5C18A 4U7FA 1SUWA 2MSEB 1ONOA 3ZZUA 4XPZA 3DZFA 5FO0A 2XE7A 3HR4A 5JXWA 1LY1A 4YI3A 4YRRA 3L43A 1OFVA 5KJ6A 1Z29A 4MWEA 3PUXA 3RLFA 3N2YA 3U7QA 2PRJA 3FPAA 1GPJA 1ZSVA 3PC4A 4P4TA 1TMOA 4Q9IA 5DBFA 3RYIA 4D25A 1D2CA 4EG5A 3BA6A 2WUWE 1DHTA 1RRGA 4OG2A 5DCUA 1F12A 5C80A 4H0CA 4L4XA 4Q02A 4N8DA 2WQ7A 1SC3A 2IYAA 2QV7A 3EZ2A 1RU3A 3RWBA 4HSEA 2XW6A 3V5NA 2BFFA 1M7GA 1OX5A 2FP3A 2WKWA 1UAAA 1T2AA 4ZXPA 4BWYA 4Q7MB 1RI4A 2FUG6 3V80A 2M98A 1T6BY 4CKBB 4IDOA 4IJUA 5KC8A 4QFDA 1VSTA 2ZI6A 3EY4A 5FBZA 4F3RA 1OZAA 1YJQA 4U8HA 5JNUA 1CIVA 1WE2A 2VH1A 3FCSB 4U1RA 1LNQA 2ZU6A 3GZ4A 4BRUA 3DE5X 4POOA 4ER3A 2EWMA 4O59O 4MUIA 3HV2A 1JR2A 1PFUA 1UF9A 1MVNA 1XTKA 3OZUA 2Z6UA 1HDYA 2QE7D 3S2UA 4PC6A 5F73A 1E1YA 2PJUA 4OQNA 3W8EA 3ZXSA 5A9SA 1ID1A 1PYOA 1NW5A 1UDWA 1Q0RA 2G5PA 4IRXA 5IZCC 5TB5A 1SOUA 1IVYA 3FDJA 3OJOA 1DKLA 1GPWB 2ZSIA 2LUOA 3PIIA 2Q4EA 1DMRA 1YVUA 4Q18A 4URWR 4ZQBA 4ZAZA 4F60A 4B45A 1SEPA 2JLYA 3PXEA 3PDCA 2A9QA 3U4CA 4A9AA 4KR3A 3DMHA 4HC4A 4YJGA 1LDEA 3ABOB 4MS4B 2J3LA 4B4KA 1VA5A 2HJVA 1APBA 4HNGA 4QQKA 4ZAGA 2P27A 1T9BA 2QRHA 4FT2A 2Q07A 2QLFA 1LUAA 5F4BA 3RS7A 2RK3A 4PHFA 3CH4B 4WLFA 1HL7A 5IXSA 1LV8A 2BEJA 4TKUA 3B1KA 1M6HA 3TJRA 5DP1A 5EQDA 3CCFA 1FLAA 4DG5A 3OM9A 1ZMXA 3WGMA 4HGYA 1WX1A 1MH1A 5ELMA 5EUBA 2VYCA 3DO6A 4DPKA 3E7PA 5EIFA 4DZTA 4B3GA 1U4NA 4OLFA 1CR6A 4NY1A 1NXSA 2G36A 4MUNA 4PO3X 4RHUA 1N5LA 2OFOA 5F78A 3GVHA 3WA7A 4KAJA 1TECE 4DDVA 2X3FA 3ZDDA 4RA9B 3D0KA 2WG1A 1WB4A 2ZBFA 3N70A 4L4RA 4WK6A 1C1XB 1H2XA 4RFLA 1SXQA 1KARA 3BWMA 4XLTA 2RHGB 2OP1A 3KHUA 4UEJA 5GZ3A 1C8BA 5KC9A 3JARB 1V95A 1ETUA 5JQGF 4C7XA 5ISMA 3OFSA 2PZKA 1Y7TA 5BN3B 1YRWA 3RQSA 2Z2YA 4AKIA 2QAGB 2ETXA 1P3DA 3K8YA 4LF6B 2I4LA 5M5BA 2ZJ3A 5HA5A 1M2JA 3E05A 2HSGA 3FJYA 4LRXA 4NESA 3QI2A 3A2LA 3G8CA 5F5NA 1Y3CE 2EFJA 4DLAA 2HGZA 1S5PA 3GNQA 1FTGA 2C5BA 4QUHA 1M83A 2J48A 1GTJ1 1R5NA 3G0OA 3Q8XB 4EAQA 3CVJA 1Z8DA 4OGKA 5DISB 4DJTA 3U3XA 3F7MA 4HXEB 3LTEA 3WGYA 1Z5PA 4RJKA 2OHHA 1ISPA 2GEKA 3ROFA 1TAGA 1TM2A 1ZN9A 1KYWA 2H9YA 2OWEA 3AIKA 3I4CA 1JXQA 3KLBA 4JB2A 5AKKA 2BMWA 3WRWA 5IT4A 4P33A 3W8RA 2C3OA 4ATNA 3JPYA 2IC5A 4S1OA 4EA6A 1WKVA 3DZCA 2EYQA 1XPUA 2PR7A 4MMYB 13PKA 4TLDA 3ZV4A 1ZRNA 4RMJA 4ZCQA 1ZL2A 4ZMSA 3AR7A 1LLCA 3DTVB 3JYQA 2WSSD 3KU4A 4LQCA 5P21A 1DXOA 1KAOA 1SXGA 2PH7A 3HCNA 3R2JA 1NRIA 1L1EA 2F43A 2M6RA 3JCZA 3NBMA 5I7AA 3SPXA 3WB9A 3ZDBA 2OCLA 4BVHA 3ONNA 1B1CA 2P2NA 2FR8A 3E7FA 1ZK1A 3LA8A 3TQRA 5DN9A 4B79A 3PWZA 3OC0A 3M4JA 3UOWA 4HLNA 3KZMA 1DUSA 1O7JA 4X91A 2J31A 3CJTA 3JQCA 4FKZA 1JA1A 4V2UA 5DXJA 2G1AA 3G2KA 1ISRA 1L8QA 1N6PA 1SKQA 2R4UA 1PEYA 1JAZA 1PT8A 1Q84A 3BAFA 1LPOA 4F3CA 1JH8A 3KALA 3SD7A 5KIAA 4PFJA 4E5DA 1G8JA 3TE6A 4OM7A 1KP3A 3KQKA 3VR5A 1G6KA 2I3ZA 1ORIA 2HMWA 2EF1A 3T4XA 5CFQA 2GEJA 3PE6A 5B1SA 1FFWA 2YS7A 2EARA 4RHEA 4RF5A 4E22A 1Q0PA 3F49S 1N2XA 1FSFA 3OIDA 1VP3A 4YO7A 3N0XA 4BNUA 2QMUA 3SFZA 1SZPA 3U1TA 4GYJA 5LB4A 1ULUA 1CF2O 2P69A 1JLLA 4YT4A 5MDHA 2ONZA 2NO4A 2RFLA 3D6UA 3OJFA 4JJAA 4O0MA 2HA7A 5E6SB 1MBZA 3Q41A 1SCKA 4TRNA 2PPVA 1NX6A 3Q98A 1JU9A 4JEIA 4M7RA 1CB0A 3BL5A 1D6JA 5DWQA 4RVCA 3TQCA 3TQOA 1A8PA 2HO4A 3ESYA 3QM1A 4AMBA 1BN6A 3PC8A 3RVSA 2JGLA 3BL8A 2IZZA 3HKDB 3JQ8A 3MS7A 1C9JA 2O8NA 1LS1A 2YV2A 3ZWDA 1XTBA 1YVEI 1YH3A 2VRCD 4D9JA 4DG8A 3BL6A 3EVDA 1XF9A 5HZKA 3VTFA 2LP4Y 1AV6A 3HTXA 4WZ6A 1GCUA 4JD5A 1IQRA 3VC3A 2X9VA 3DVAB 4IDGA 5GQSA 3EJ6A 2VZEA 4NQRA 2O3SA 5K3CA 5DLQC 3PK0A 3TUIC 2VYVD 1XMPA 3DDSA 4DIKA 3TOXA 1T8RA 4Q6BA 5AW9A 1E9DA 2I34A 5EJMA 1TM1E 2FZLA 3MNFA 4YEDA 5IJ9B 3EPJA 1BMFD 2WK1A 1PZXA 1XLWA 2NXJA 3N3BC 3C6KA 1A9TA 1CEEA 4DNFA 5AVTA 3LDAA 4E7OA 5LOVB 1BFKA 1JEYB 3QVTA 5JCJD 4YMIA 4TKUB 4XQCA 1QIJA 3LLSA 4AG3A 4PYRA 5AW8A 2IZ5A 5IH7A 2YJ6A 1UWKA 2F3TA 4OYHA 1TCUA 2QTBA 3HN6A 1YR6A 2HHAA 1MOSA 1T1GA 4KH1A 2HJHA 4U7HA 3PFBA 1C29B 1PR2A 4N3CA 4RPHA 4Y7DA 2NU6A 4W5HA 4LE1A 1P0PA 4RAOA 1Y8QB 1AH2A 1P17A 2YXEA 4QVKA 1OC4A 2GN6A 3MRVA 5DNAA 4HH4A 4BGEA 1RPTA 5TNXA 1IN8A 3GU3A 4FQ8A 2JHFA 5H4GA 2YV1A 3O82A 5CMLA 4EZIA 2ZTHA 3MXOA 4F6LA 1NQUA 4XW2A 5AM5A 5KEIA 4EARA 1EQUA 2KB0A 3K0EA 4X1YA 2VA9A 1NJ5A 4ITRC 1X92A 521PA 3KCNA 1V3TA 1I51A 3H2BA 4CM9A 3G9ZA 1E1NA 3HYSA 3NIFB 1NKVA 3GFOA 4CDMA 4CM8B 2O8FB 1JQBA 2P40A 2QN6A 2WUEA 4IDEA 4TYQA 4UMVA 2DEUA 1O97D 1YZFA 4XGKA 4JL5A 1H2WA 4M9RA 2NSLA 3K0BA 1W75A 2C9MA 4PAWA 4K03A 3HZZA 1QTQA 2VWPA 3I12A 1K6JA 3HUFA 2AR0A 3KSUA 4W5WA 4C01A 2CVOA 1V4BA 2QTCA 4UFNA 4WNIA 2PUGA 1DELA 1F2TA 2DQ4A 1KMMA 1H2YA 2OCXA 3OTWA 1IMOA 5H0IA 4CLHA 4QG3A 4FE4A 3OBBA 4UBNA 3EEBA 3STXA 3W2HA 3UFBA 4MUFA 5BW4A 1AIPA 3ZU4A 1JHZA 1SVWA 3D3WB 2A88A 4JASB 1N6RA 1JUDA 3VPHA 3D5QA 5H4HA 3U62A 2F59A 2P0YA 3KCQA 4PLVA 1DQPA 2HIGA 3N1UA 3N28A 2B7LA 2ZEJA 2XUQA 3LM8A 2JLVA 3VR6A 1QUEA 2JGAA 3B1JA 4O8ZA 1L7PA 3ICPA 4RXUA 4IIBA 1YJCA 3MD9A 5TSDA 4C9BA 5IX8A 1W5TA 1J0BA 2QD4A 5LUAA 3GGCA 5DWDA 4HPWA 3H87A 3HCPA 4Z7OB 1XKQA 4RNDB 3DS8A 3RC9A 1GKYA 4ENPA 1FTYA 3B3AA 2WE7A 1PJQA 2HU8A 2W2OA 4KR0A 3T4UA 1CU1A 3L6BA 3A10A 1EQ2A 1PJAA 2H2DA 2SNIE 2BI7A 3K0HA 1HORA 1KDTA 3RE1A 4JUBA 1XALA 2MSCB 4QDZA 4ETIA 1J8YF 3GBVA 1G0OA 2VCHA 3H1TA 3LFUA 1Q14A 4UMFA 1MOPA 1QG2A 2Z1DA 1FDRA 3MRTA 3WKBA 4PWZA 2ZJBA 3JYHA 1KZGB 4B5LA 5ALSA 3BCHA 3DEFA 3ZD9A 1O6CA 4F9GA 4OI0A 4KAFA 5DV9A 5JI2E 3WRYA 1DIGA 4GXRA 1R6XA 3BIFA 4WWHA 3QUSA 4P0TA 1HDRA 3RYHA 2XJ4A 3GDOA 2JHCA 3PUIA 4B46A 5J4YA 4OAPA 1EK2A 2Q6OA 4V0QA 3HN7A 3NGXA 3DQQA 3WWPA 1EFVB 3GR6A 3QFRA 1LBTA 1T9KA 4OH1A 1VSVA 5THQA 2CMFA 4F8JA 1C4WA 2BMDA 2XD9A 1FYWA 4N0EA 3PUJA 1WZCA 4M38A 2GHQA 1LSSA 4H77A 4OP3A 5BSUA 3VVCA 3MJFA 4DADA 4OK3A 4DDHA 1U6JA 2R751 1ZWLA 3GQVA 3OHSX 4P7JA 1NV8A 3SYMA 1YIOA 4TWBA 2XB4A 3CLSD 2CY0A 2TSYB 4MJXA 1RYBA 3IRUA 5EHNA 3WLOA 4TN1A 2A14A 2R6JA 4QREA 5B6PA 1AKUA 2P3LA 5HFJA 4G6ZA 3GH1A 2NG1A 1HLGA 1HF3A 5ADUS 1BDIA 4LX8A 2EQ5A 5FEUA 3G0HA 2XB8A 3PD1A 3MWEA 3TAXA 2Q7DA 1AK1A 5AICA 3PEEA 3WJ7A 5L3SB 5BR8B 3PC6A 5DYIA 2HF8A 1QE3A 4O1HA 2VTBA 2BDTA 1CUVA 2PUTA 4JI1B 2QLNA 4N0MA 4A1OA 3OTHA 3TSOA 1OFUX 1LQUA 2C7RA 4BFYA 2E18A 3RC1A 2YHBA 5ESRA 3GJQA 2AKEA 2QRQA 3ZBTA 4MW0A 1S2OA 1QPBA 5JS8A 3EIEA 1NMZA 3EFEA 3QLJA 2CB9A 2GPAA 4RKWA 3T1QA 2HMUA 5EZSA 1DLIA 4JVMA 2O54A 1EESA 4IX1A 2NQTA 1ZU4A 1UPTA 4J75A 5I7RA 2PL5A 5BQ3A 1DXQA 2NV6A 2DUMA 3TD9A 2OHFA 1UKVY 4WUTA 1QAMA 2NSYA 1X38A 2AYZA 2GCEA 5JWHA 4V1CI 1O1YA 1WVMA 2EWVA 3JVIA 3S1AA 4Q19A 4CDGA 1SXJB 5EHIA 2UUCB 3HB5X 3OT4A 1KOLA 1H5UA 2XA1A 1DIHA 3FYDA 1TA9A 2J5KA 1QGOA 3CF6R 4FX2A 1XMQB 1RC1A 1GNPA 2PGJA 2J9FB 3ZDXB 4JP1A 2KBFA 3UN1A 3AR4A 2XE8A 2NM0A 3QWIA 4ZRDA 3ZEIA 2E4AA 2YY7A 4AJLA 5CYGA 3DMTC 2VNAA 3EVFA 2IT1A 1ZH6A 4EHDA 5EIOA 1NJGA 5JRZA 5K8IA 1ZBQA 4LIPD 3BA1A 3VYTB 3HA5A 5JAPA 4C1NA 4D98A 1Z28A 1E4EA 1P6QA 2VAMA 4PX2A 4UAJA 1G0NA 4LJLA 3ICVA 1RTTA 4GGOA 3GN2A 2VOJA 2ZIUB 5ESXA 1Y63A 5JEEA 3O4IA 3T94A 3E5MA 4BAZA 4ZDKA 2ZYDA 4IUBS 2PZ8A 3ZBQA 2O5VA 1FSPA 1WZUA 4Z99A 4RHYA 2BRUC 4FR2A 2ACKA 3E35A 5FBRB 1E2IA 4MRPA 1QJCA 1NNI1 4BS9A 3CUWA 4D92A 1AMNA 5LDGA 4Z1MA 1GN8A 1CJTC 3ELUA 4IDAA 4PLFA 4B9AA 1YT5A 5F5LA 1G8HA 1HXHA 4GPAA 1P5FA 4NAUA 4RSGA 3VU1A 3FF4A 4QM7A 1U2TA 4M0LA 3CM0A 4C4XA 2C1XA 3LSYA 4LQLA 4PGHA 1FFCA 2A9VA 4P7KA 1PFQA 1Q50A 4LDAA 4LSGA 9MHTA 1KY5A 5AVYA 4LK3A 2C4UA 2Q6IA 3IKMB 3DE3X 2FMIA 2DOKA 4EUKA 2YV4A 3GFBA 2A58A 1MIOB 2PK3A 5ENDA 5A4AA 4B82A 5DVZA 3MQ2A 5G4KA 4G1MB 1BOOA 1XE3A 1BKSB 1C1XA 2HA0A 1PG5A 2OZVA 2YOFA 2Q6VA 3JALB 3S7TA 3RAEC 2PX5A 2ZUVA 3OM0A 1L7QA 3LAWA 4PLHA 1O6ZA 1XZNA 2QI9F 1QJ4A 1QWSA 2VQSA 3DBHB 1TCBA 3WWCA 2WA1A 1PZGA 3D2BA 1M0TA 3R41A 3JASB 3G79A 1X42A 1GTRA 3PD7A 3ORRA 4OHWA 2IYSA 3DAHA 1XJ0A 3NC1C 3IEMA 2R1TB 2YJ5A 5JCZA 5HVNA 3SC2A 5CX4A 2VZ8A 3NTXA 2WLTA 1ZKMA 4M1QA 4ARAA 5AM0A 2XKAA 2ZAIA 2C7GA 3R1IA 2PO7A 2C2MA 2ZJ0A 4ZFNA 4UHJA 1GSAA 2DPXA 2O6LA 4ZK6A 1U02A 4FFLA 3RS3A 4K9DA 2G28A 2J9GA 4NKRA 9ATCA 3VI4B 4LXQA 4KN5A 4L50A 4LF4B 1I5OA 5EPUA 1ZD9A 2QR5A 4UEQA 2R6GA 4Y2GA 2L2QA 4V0NA 1NW9B 5G0SA 4ARBA 2CLDX 3D43A 4L16A 5TDHA 1W19A 4WBSA 1NWCA 3GRAA 1LPPA 3SBDA 5HPYB 1ND6A 2ZUWA 3ABZA 3F7TA 4B3SB 4YP5A 1BTOA 1W47A 4CKEA 4Z7JA 1NQ5A 2SKDA 4XH9B 3IP7A 2FRVA 1T4DA 5EQJB 4KQMA 2YJGA 1CQIA 5BSKA 3WMGA 1GAWA 3BCUA 4BVJA 3W77A 1QF6A 2BZ0A 1E2DA 3CT4A 2GYVA 3ELYA 2V7PA 5JVDA 3N75A 3A11A 4R2KA 2FZ4A 1MDFA 2XZLA 4XDGA 3IKLA 3I37X 1VDZA 5D7BA 3RYFA 3U3MA 3UHOA 5HX7A 5L3SA 2VHVA 1HQKA 4D99A 1JKJB 1RE0A 3T35A 4G0NA 4L6IA 1W1WA 4M0MA 1BD4A 3KEQA 1SHLA 3N2IA 4NYIR 2ZS7A 2J4FA 4MYCA 5E9WA 4MIYA 2FMUA 5KJ1A 1N5RA 2H4HA 1AKVA 1DQYA 3L0SA 1U28A 1O54A 1XEWX 4GZMA 5DNDA 1NUAA 5C1BA 4ND8A 5B3LA 2QT9A 2CFCA 3EA0A 4QM6A 1KDPA 4R5HA 4EJMA 3H11B 1XI2A 5T8KC 1GKKA 3FOCA 1T26A 3GLHA 3GAAA 5FI1B 3ZHRA 2RG7A 4D9KA 4F4JA 3GRVA 3K0AA 2ZRIA 2E89A 3D8NA 4J1NA 2V54A 3QQPA 2OV4A 4XJTA 2VC2B 4G9EA 2E37A 3F46A 2FN7A 3GJ5A 1WS6A 1CZNA 3IMGA 2OQRA 4LBZA 4YECA 1IRXA 3T7SA 4CKWB 3GNLA 4QEZA 1P7YA 2DKOA 3MUNA 4QARA 1M34A 3S1AB 3A9TA 1Y42X 2X0FA 1XKLA 1OR8A 1YU9A 3WYGA 1B16A 1V6AA 2ST1A 3QYJA 4A5SA 3MTBA 3ZE9A 1KVQA 4DMFA 1CUXA 1N2EA 4WNAA 1DX4A