3UKDA

Ump/cmp kinase from slime mold complexed with adp, cmp, and alf3
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
191
structure length
191
Chain Sequence
SKPNVVFVLGGPGSGKGTQCANIVRDFGWVHLSAGDLLRQEQQSGSKDGEMIATMIKNGEIVPSIVTVKLLKNAIDANQGKNFLVDGFPRNEENNNSWEENMKDFVDTKFVLFFDCPEEVMTQRLLKRGESSGRSDDNIESIKKRFNTFNVQTKLVIDHYNKFDKVKIIPANRDVNEVYNDVENLFKSMGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLMONOPHOSPHATE/CYTIDYLMONOPHOSPHATE KINASE
publication title Structures of active conformations of UMP kinase from Dictyostelium discoideum suggest phosphoryl transfer is associative.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
total genus 73
structure length 191
sequence length 191
ec nomenclature ec 2.7.4.14: UMP/CMP kinase.
pdb deposition date 1997-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ukdA00
1E94E 1WRBA 1FNNA 3E5HA 5FFMA 2QAGC 3QXSA 1N0VC 3CWQA 4MYHA 1DADA 4NCIA 3R7WA 4G1UC 2VF7A 1E69A 5IK2A 1XMJA 2IYRA 3C4JA 1UFQA 3C7KA 2PEYA 3THXA 1Z07A 2AK3A 3I72A 5FPYA 2G3YA 2CLDX 4KJZA 4BLTA 1D2EA 4GI7A 1IQPA 1XP8A 5DHAA 2GBLC 5FL3A 2RH5A 4AKHA 4IXNA 3GLFA 1D9XA 3FB4A 4US1R 1NI3A 5BN4A 1SVMA 1OH5A 2GJ9A 2IYZA 3VHXA 2N42A 4R9UC 5G53C 2CJWA 2BBWA 4Z54A 1Q20A 3FYHA 1DAFA 1P2SA 3RLFA 4A2QA 4HUQB 3KZ1E 3PJRA 3O8DA 3UWOA 2YOHA 4OI1A 3SJBA 1W4AA 1RRGA 4NKRA 2NMVA 3CW2A 5CYPA 5AUQA 4FMDB 1N6HA 1E2MA 4GMXA 3DEFA 1YJ5A 3KTAB 4EFLA 4IDPA 4IXMA 4M1KA 2JLXA 1ZYUA 4XWOA 2ZRMA 1E32A 3U6BA 1E0SA 4Q21A 1T3SA 2RGXA 4G5QA 4DEYA 4ZDJA 1GG2A 3E1SA 3Q72A 2JLWA 4KFTA 5SZJA 2EWWA 2GCOA 1N6PA 1OW3B 4ESHA 2ORWA 1XEXB 5BQ5A 4BFZA 2B8WA 1SXJA 3D7MA 2NGRA 4JYBA 2UVQA 4RFSA 2XGJA 1NNEA 3M0EA 4IOLA 1ZNXA 1CKEA 1BIFA 2QE7D 1XD8A 2J87A 2C03A 3CB4A 4KFRA 2P3SA 1MV5A 3AM1A 421PA 2JLSA 4B48A 4B3GA 1QHGA 3B9QA 3U7HB 2RGCA 2IXGA 3F3YA 1U8AA 1OYWA 1XD9A 2D2EA 4LZZA 1G8FA 5J5CA 5BYKA 1EFRA 4A0FA 3TIFA 3LVQE 1KAGA 3U7EB 4JLPA 4N1AA 1LF0A 3CF0A 1CEEA 3PFIA 4PC6A 4WAUA 1JEDA 3H2YA 4DT1A 3MSXA 3GP8A 1UDXA 2P6UA 3QJYA 1TQ6A 3KQKA 3NIBA 1KI8A 3H86A 3IIMA 3FTQA 5SZHB 4B6EA 2H7VA 1FL9A 5HR5A 1TF7A 5EE9A 2H16A 3GLIE 1GL6A 4IDNA 2GCPA 4LJ5A 5K8UA 3NBFA 4JSYA 4C7OA 1NJFA 2CBZA 2J3EA 2FA9A 4LOAA 4AKIA 2BIFA 3UIEA 5D3MA 3VX3A 1S0UA 4DCTA 3LD9A 2CNWA 1TQ2A 2J0UB 2K5UA 4US0R 4GL2A 1G3RA 1A2BA 5HTKA 1U0HC 3A37A 4ESVA 3ZZ0A 1W47A 3ZVRA 3VKHA 4YDHB 2BBOA 4EKDA 1CR1A 1OXUA 5CDFA 3GJ6A 2NO7A 2VHQA 4S35A 1K5GA 2AKAB 3P27A 1F2TB 1G5PA 4M1MA 4LBZA 2V6IA 3BGWA 4HZUB 4D26A 3FKSA 1E4VA 1DARA 1VECA 3SYLA 4WOPA 1RIFA 1VHTA 4DLZA 4HLUC 2REXB 4JLNA 1R10A 3QEOA 2J0VA 3FHTA 1HY3A 4LX0A 4Q48A 4P4UA 3BOSA 1KMQA 4YDSA 5KSYA 2KB0A 3MRSA 1WQ1R 3THWB 5EE5B 2B7CA 3ND8A 4I4LA 1DTSA 3MLEA 4MDFA 1R5OA 1LV7A 2ZE6A 2ZS7A 2ZVPX 1G6OA 4MRNA 5FUWA 2BM1A 4B75A 5FI0B 1NBMD 4TLDA 1EWRA 3TW8B 3Q8XB 5A0FA 1Z6AA 4C0QC 3VR6A 3AGPA 5CK4A 1KK0A 4JLAA 5LD2B 1OB2A 1WB9A 2O8DA 4ARZB 1CJVC 3CM0A 3PIRA 4NONA 1Q57A 1NVUQ 1U99A 2XTZA 2CHGA 4KSBA 4OQLA 3WHLA 2IWHA 1KI4A 1IBRA 3H4MA 4QHYA 1KJZA 2BMFA 2JLQA 3VR5A 2XX3A 5HCNA 5L3SA 2QSYA 2Q0HA 2QZ4A 3P20A 5J40A 3U44A 1PVOA 1XFAA 2FWRA 3GEIA 2QAGA 2R6GA 1COWD 2WJVA 2B7BA 4BUJA 3KFXA 1IJFA 3A58B 2NO9A 3W6OA 4IOJA 2J7PA 4XVUA 4HLQB 4WA7A 4QGAA 2WIBA 3QXHA 2C5LA 1O3YA 2EFCB 2GBLA 3GJ5A 4QBFA 1FQKA 1AGRA 2OXRA 2GRJA 3LVRE 4LJAA 3SBEA 1CXZA 3AUYA 2P5SA 3DKPA 4TMVA 4TTRA 5FR2A 4B6FA 2ZJZA 1ZCBA 2EFHB 2XOKD 3IEUA 2OBLA 1QHNA 2QGNA 3I73A 3AKDA 4LY6A 4FMCF 1JECA 4MH0R 5G3YA 1N2CE 5SZKB 4XVQA 2WWXA 5EXTA 1Y3AA 2ZU6A 3PUXA 2OFOA 4LYJA 3OIUA 4Q1CA 5JI2E 1A5TA 1JR3A 1OV4A 2HEIA 4BZQA 3DOFA 4PHFA 2C77A 1YZNA 2GILA 4HAZA 4Q9HA 1NMYA 1J7KA 1SQ5A 2ZJOA 1GNRA 1UDWA 2PJZA 2Z6VA 2YINC 3CONA 1UPTA 4Q9IA 2FG5A 221PA 3AVPA 4V03A 4LV6A 2J59A 2WZQA 3CR7A 2BBSA 2ZSFA 4UNNA 1JJVA 1ZBDA 3BFXA 3K09A 1KI1A 4DB4A 4OQXA 1QHXA 3UXMA 3OEHD 2REOA 3IUYA 4AC9A 1IONA 4QKQA 2XNDD 3NXSA 3V4RA 4B32A 1ZUHA 4TLAA 2P65A 1DG3A 4GRAA 4FXPA 2NO0A 1S96A 4C3ZA 3ZDQA 3RS2A 1LS6A 3GLGB 2XNSA 3C16C 2HCBA 1HH4A 1SKQA 2VYFA 2A5GA 4UNPA 3GLFE 3QY0A 2V6JA 1KY3A 4G3XA 2DBYA 2QU8A 3H0KA 5FI1B 4ZIRA 1HT1E 3W5IA 2EU8A 2RGBA 4OK5A 3CIOA 3IQWA 3GJ8A 1FNMA 1CJMA 1MOZA 4M9ZA 2GJSA 4C30A 1G19A 3N70A 4BZPA 4GZMA 2ORVA 1MABA 1Q0UA 2ZI7A 3GEEA 4DCNA 1I4DD 2XTMA 4UNQA 5FTLA 2CEAA 2I4IA 4AK9A 4QFMA 2JLUA 2ZRLA 1XMSA 2IHYA 1OF1A 5DN6D 1DAKA 2GWHA 2DFKB 3L0PA 1XU4A 4IDHA 4BLRA 1FOEB 3FVQA 1CIPA 4YONB 3MUFA 4Q4LA 5C18A 3HYRA 4M1WA 2QMOA 3R8FA 1KDOA 3DO6A 4K8OA 1KK3A 3S1AB 1KI6B 4I1UA 4MGZR 2ZSBA 3BWDD 2QMHA 3ZD7A 2KWIA 1DOAA 3WRYC 3QE0A 1EK0A 3IGFA 3GMTA 2WSSA 3LH5A 3CZQA 4IFEA 1W5TA 1JXMA 1KI9A 3ZS8A 3F5FA 5JMTA 1Q3HA 5EE0A 4F91B 4M8NE 3CNOA 2EFEB 4CRWB 2EQBA 4NH0A 1G7RA 5IDVA 3AP2A 2O8FB 2X2EA 3K70C 1KZ7B 4Y0AA 2MSDB 4B3DA 2OE2A 1XD2B 4KAXA 5FL7D 1TU3A 2PBRA 3EC1A 3L2OB 4MA4A 4CIDA 3KL4A 4QM6A 2RGDA 3QKSB 4EPVA 3Q7PA 1M7HA 4OQFA 3KUCA 4PC2A 3U4QB 5BN5A 4HAUA 4BEBA 5HKKA 1L4YA 2ZUCA 3ZZUA 2BHRA 4GMDA 5DLQC 2QNRA 1XBTA 3L43A 3RS0A 1IAQA 1OIXA 2DHRA 1TUEA 3K53A 2C95A 3MMPA 1DS6A 3NBYC 4DDVA 5IRCD 1OLOA 4V0MA 4U02A 3U3OA 1G8GA 4HLUA 4TL6A 4M9SA 1NKSA 2WWIA 3FE2A 4GPTA 1ELOA 1ZD9A 5FUYA 1XPOA 1Z0KA 1FFHA 2VA8A 1NMZA 2CLCX 2RGEA 1L8QA 3AB3A 4HB0A 2OXCA 5ANRB 2AR7A 4B47A 1SGWA 4C0JA 3EW9A 1UAAA 3RC8A 5DI3B 4DLTA 3U3RA 1NVXQ 3FKQA 1U2RA 3G82C 3BAFA 1R4AA 3VR3A 4DIDA 5GJWC 1AJEA 4JT4A 2Z5FA 1G8HA 4NYJQ 3DOEA 5CIQA 1N25A 5D3QA 4JVMA 1NSFA 4G5GA 5BWMA 5LBIA 2PZGA 2ZREA 1T3HA 3B1YA 1JNYA 2QTHA 5FBVB 2O8BB 4F4CA 3A1UA 3WNCA 2V54A 4A6PA 2CCGA 1ZP6A 3CLVA 2VL7A 5JWOA 1ZVQA 3U3KA 4TMKA 5L3VA 3QKTA 1ZNYA 2ZE7A 3RS7A 2AXNA 2JIZD 4LGMA 3CF6R 1XJQA 3IPYA 1J8YF 4EJSC 4PPQA 2O8EB 2CK3D 5FTNA 2DCUA 3EA5A 1FQJA 4F92B 1ZUNB 4A8JB 1IN8A 4HAXA 4XSHA 1G21E 3EZ6A 3CH4B 2ZS9A 3CRVA 4Q1FA 3SS8A 2P2LA 4Q66C 3C8UA 3PXGA 3TR5A 4AWXA 4D4KA 3U6KA 5EE1A 2LKCA 3GCGA 2C2HA 3RYTC 3K9LA 1J90A 2XSZA 4Q1EA 1D5CA 4A82A 2HF9A 5K8TA 2OLJA 4PX9A 2BM0A 4A9AA 1W4BA 2ZTSA 2QORA 2W6IA 4P4SA 521PA 2FMXA 3U5ZB 4C0LA 2WJJA 2GA8A 1W0JD 4H9GA 3T12A 4NCJA 2NIPA 5JJKA 4Q1BA 3U3MA 2QBYA 3CF2A 2Q6TA 4Q00A 3ZQ6A 1GUAA 4M9XA 1UBGA 1AS0A 2AKYA 3NHAA 1NG1A 2F3TA 2W83A 4GOXA 2ZRGA 1N3BA 5A4JA 1DELA 3QKUA 4M1TA 1ESMA 2IS6A 1W36D 3W6PA 4ZI2A 1YR7A 2H18A 2ZSEA 3T61A 4ASUD 4RZXA 3P1JA 3RANA 5CJ2A 3O47A 4LHWA 4UXJA 2W58A 4QBGB 3IBYA 1CF4A 1A2KC 5FOSA 4E5UA 1R0ZA 3IILA 3OIVA 2OCPA 1SVIA 1KK1A 2R44A 3QQ5A 4PSVA 4QJ3A 4TL9A 3SI7A 5P21A 1NN1A 4QNMA 3ADBA 3ZIAA 1TTTA 3G0HA 5KO2A 3EZ7A 1K8RA 5AK0A 3NC0C 3ADCA 4FD2A 2CE2X 5L3QA 1G8PA 1B23P 4QRHA 4JL6A 2R8RA 3E70C 4IFBA 1CULC 1M7BA 2ZSDA 4YMWA 2RHDA 4CEJB 3O8CA 2JDID 1RJ9A 2ODNA 3ONWA 2EFGA 2IS4A 4MYUA 4BQSA 4IVPA 4JLVA 1JR3E 1E6CA 5IF9A 1YR6A 5CLQA 3CNNA 4B3BA 2WICA 2WWHA 4MKGA 1JPJA 1E79D 3QG5A 5TV2A 4EFNA 1VCMA 1W4RA 1AS2A 2WJYA 2QUZA 4XVRA 3H1TA 3VU9B 1NKTA 2P6RA 1JQLB 1YQTA 1R0WA 4XIGS 4BFYA 1OH8A 4MRRA 3I8XA 1IN7A 3OAAA 2C9CA 3HU1A 3U3JA 5EZ5A 3BERA 5TB5A 4DBLC 2A5JA 2ZQ5A 4D4JA 1NLZA 3ZVLA 2WPDD 2PZEA 2RB4A 2GNOA 2IEZA 721PA 4TLBA 2HXYA 2PMDA 5DISB 1M74A 4XD7A 3PEWA 2O8CB 1KO4A 2HUPA 2DPXA 3MWLA 1H8HD 1H8EA 4JLJA 3RDPA 1OPXA 2Z83A 5HCIA 1QRAA 4LV5B 3RABA 1GSIA 3KJIA 3W5JA 1Z63A 1E9EA 1T6NA 1Z0AA 2OAP1 2OEPA 3K0EA 3CO5A 4OI4A 5FBQB 5DNYB 4B33A 4W9MC 3SYNA 4LJ4A 3CPJB 4B3CA 4KITB 2JA1A 2BMEA 4UJ5A 4LPSA 3RRYA 3WMEA 4OK3A 3BD9A 5JSZB 2AK2A 1P6XA 4QG7A 1KNXA 2CL0X 4DC9A 4B2LA 4KBGA 2D2FA 4JL8A 1KDTA 2ATXA 2NG1A 2CCKA 1H65A 2F1JA 5TDHA 3SOPA 4M1YA 2F6RA 1VYUA 1II8B 3TW4A 3RWOA 3X1DA 3I92A 4PO1A 2IYXA 1J99A 2WMOB 2FPLA 1XRJA 1W36B 1UF9A 2QGZA 3A1WA 5DO9A 3VR2A 3U7GA 4LDJA 2TMKA 2ZJ8A 4CDGA 1XXHB 1I2DA 3LX5A 2VBCA 4LHXA 1KMHB 5KNBA 2B21A 1VMAA 4TN1A 3WP0A 2OV2A 3AVXA 1ONBA 4V0NA 1HEIA 1IN4A 5CITA 4KV9A 2PLRA 3H84A 4DLWA 2AWOA 2KJQA 4ACAA 3W8NA 3VFDA 1CJKC 4EJSA 2JJ8A 3JVUA 4OL0A 3SFZA 1NLFA 2FGJA 2XZPA 1TX4B 2QP4A 4IHQA 4Q18A 1KO7A 1BKDR 3PEYA 4ERNA 3NG1A 1MRNA 1RYFA 1SXJD 2HJGA 2IL1A 5SZIA 1TU4A 1GTVA 3GLHA 2CHVA 4GOJA 3WYAA 1GRNA 1EESA 4LJ9A 1U0LA 2V9PA 5JLJA 3M6AA 5CB8A 3EWAA 2AD5A 4BLQA 5C4MA 1AN0A 2ERXA 4MDEA 1E1QA 3A6PC 1UKVY 1S3GA 3FMOB 1FW6A 1WMSA 3TSZA 4RSGA 5KUTA 3NTUA 4KVAA 1SVOA 2NPFA 4A36A 4AG6A 4JLBA 2PZFA 1F60A 2V8OA 3F0TA 3K0AA 1EFCA 4QJ4A 2H17A 1EFRD 4H1UA 2KI5A 2WKRA 3HDTA 2RGGA 1Q3TA 2ZRCA 4PHGA 3DMDA 3A8TA 1DAMA 4PFSA 1IOZA 1OHHD 3QI2A 5F2EA 1QHSA 1NN5A 2SHKA 3CPHA 1C1YA 1VCNA 3P32A 4R98A 2G77B 1ZC3A 2IT1A 4O0MA 4C2TA 3Q85A 1RRPA 3A1VA 4M53A 1ZD8A 1Q22A 4OHZA 4EUNA 1P9NA 2EYUA 4YMTA 4EPWA 1XJCA 4DCUA 3EAQA 4JSTA 5LD2C 4HZIA 4ZDIA 1WBBA 2FDCA 2AWNA 2JLVA 1UEIA 5JS8A 3SJCA 2GVDC 2YOFA 3R9XA 4RCZA 3R7WB 5JCZA 3DKVA 3KJGA 1P7CA 2VP9A 4RFVA 2CNWD 2UZ3A 2ZRJA 3W6NA 3THXB 2J0QA 1TUIA 2I3BA 4FINA 1XCMA 3VHLB 4YC7A 4JBWA 4M22A 4URZR 3OESA 3QUSA 2ECKA 3KFVA 2QL6A 2IA5A 4M21A 2GZHA 4LJYA 3EG5A 4WZAE 2IHBA 3AVVA 3FKSD 1KDRA 3TR0A 3NBXX 4DDUA 2VP5A 3TGPA 3EZ9A 4EPTA 1I4LD 1ESNA 1E2FA 3I32A 1Z83A 2MSEB 3EC2A 4DJTA 1AS3A 1M7GA 4QL3A 4Q4JB 1OIVA 1W1WA 4NHOA 1U9IA 2JJ2A 2VF8A 4HB2A 4ZKEA 1N6KA 1NVWQ 1N6RA 2ZR7A 1Y63A 4ZO4A 1U94A 5E95A 3SEAA 4A4DA 1OSNA 2GJAA 4U5XA 4DHEA 1PV4A 1EX7A 1HT2E 1T91A 4Q9LA 1KOFA 2R6AA 2BBTA 4DDWA 3SHWA 3QBTA 4HUQA 5FOTA 2IYSA 2IXFA 3NEJA 4TT3D 2ZJBA 2XB4A 2FSHA 4XTRA 4JKYA 5EP1A 3LDAA 1ZCAA 2QG6A 2QN6A 3T1QA 3QNUA 4LJ6A 3RRMA 2I1QA 4PC3A 2P67A 5FTMA 5HE8A 2YVUA 4IEEA 3TE6A 2VO1A 1TQ4A 2GXQA 4TZ6A 3K0CC 5B64A 1TQDA 1Q12A 1ZUIA 1TADA 3LBHA 4TWZA 2ZJ5A 1G5RA 3RSLA 1CLUA 4BFTA 3MAAC 1YRBA 3KUDA 4OBEA 5JJLA 1G5TA 4CEIB 1ZD1A 2J7KA 4PO9A 1XEXA 1U90A 2VP4A 4Q7LA 4RD1A 1QHHB 1SULA 2VIIA 1TF2A 2YC2C 2HYDA 2RCNA 4AG5A 1P4SA 2A5DA 2J7PD 4JBXA 3WYFA 3L8ZA 2QAJA 4M9QA 2WWYA 2ZEJA 2HDNB 5KNDA 2FSIA 1KNQA 3SU8A 3L0SA 5CYOA 4MGKR 2XTNA 1Z08A 1PUIA 4E03A 2ZANA 2YNMA 2E87A 4GBMA 2G1KA 2FE4A 2FFQA 2W0SA 3HR8A 2CHQA 4C0SA 1OH6A 1GWNA 3OE7A 4E22A 3L0IB 2O5VA 1TMKA 2WBLC 4OQNA 1JR3D 1YZKA 1FTSA 5FH9A 3QXXA 4HB4A 5FUVA 2H8KA 3I1FA 2G88A 2CDNA 5JWHA 3SJAA 2XXAA 1G16A 4XTCS 4EPXA 5D3MB 2Z43A 2IX3A 1L2TA 4TL7A 1BOFA 4XWKA 2FFHA 1IY2A 2QPAA 3JZAA 3KKNA 3B8HA 1RRFA 2BJWA 1KI7A 5L3RA 5E3HA 1GM5A 1E0AA 2RHMA 5J4VA 3ZVNA 1IM2A 2B8TA 1R8SA 2NOAA 1OFIA 4C0KA 4QOSA 3KXIA 1N5IA 1WA5A 1QBKC 1EFHA 1VG9B 3I5XA 4LWZA 5LDDC 2BOVA 2YWGA 4BFXA 621PA 4Q7MB 3HPRA 4TYPA 3KKPA 5GADl 1US8A 3AF4A 3IDQA 4C4PA 4DLXA 4O3MA 3HR7A 5AJZA 5CB6A 2WSMA 2NO6A 3GJ0A 3EXAA 2OCYC 2ZRDA 4DUGA 2ZAOA 4URWR 2Q9CA 4R71A 3C14C 1F2TA 1QHIA 3KQNA 2C04A 1FZQA 4XWAA 5J4KA 4HZUA 3VTKA 2X77A 1A7JA 1E2IA 1G7CA 4TYQA 1P72A 2EYQA 4RD2A 1Z47A 1OFHA 1XEFA 2RGNC 3Q5DA 3THWA 3AEZA 4JJKA 2ZROA 2XJ9A 3EASA 1KJWA 1DG1G 1Q1ZA 4D4LA 4V0KA 2FJUA 5EQTA 1W46A 4MKIA 1KI3A 2CE7A 2G6BA 5DE3A 4U7DA 3N2IA 4JLKA 1QVRA 3WP1B 2FFAA 3TUJC 3SQWA 2P6NA 2WSSD 5L3SB 3EPJA 2A78A 3U44B 4ARZA 4DWJA 4BGDA 3EIHA 2IYLD 3W8RA 3GLHE 1E2LA 1AZSC 2PCLA 2CL7X 3B1VA 3K8YA 3TBKA 4QM7A 5HE9A 2IEYA 3FMPB 4XOIA 4Q4AA 1GFIA 1IN5A 1FUKA 4R2HA 4NTZA 2W6JA 4KYIB 1W49A 3B9PA 1N0UA 4HDQB 4A8JC 2CVFA 2WAYA 5HKKD 2GDJA 4A0GA 3T5DA 4TL8A 4QBIA 5TMPA 1U81A 4QGFA 2DB3A 1PZNA 1NVVR 3SJZA 2GJ8A 3I4LA 3CUEF 1M34E 4HEJA 1TPZA 4MYCA 3QENA 2FZ4A 2PJRA 2GXUA 1NG9A 4I81A 4W5JA 2MMGA 4GP7A 1OKKA 1R8QA 3UMRA 5J47A 3TQFA 1SKYB 2IYTA 2CMKA 3IPXA 1P62B 2ZIAA 3LBNA 3NKVA 2D06A 3QSYA 1KSJA 2Q9BA 1Z0FA 4IVRA 2QY9A 1YZLA 2Z4RA 5EXPA 121PA 1P2UA 3O8RA 2AFHE 2G9NA 1S3SA 1V43A 2G0TA 2FV8A 3DPUA 2QT1A 1WE2A 5C2JB 1OFTA 2GK7A 5AJYA 1E9AA 1R6BX 1Z2AA 3IHLA 3ZZTA 5JCPA 5FPHA 3LO5A 1E9DA 4HAWA 3KQUA 1T0JB 2FN4A 2R6DA 4EQ6B 2AXPA 2YOGA 1G7TA 3K0CA 3L0OA 2VHUA 3I8SA 3EPKA 5AUNB 1C9KA 1F2UA 1XDBA 3VKWA 1D2NA 1SVLA 4PZLA 1G20E 3FFAA 4DLRA 3AVTA 2ZI9A 4PSKA 1XCGB 3AF2A 1ZMXA 3GLGA 3TNFA 3W3ZB 3ETLA 3K0FB 4TMXA 4KYUA 2KE5A 1XTQA 1DE0A 3G5UA 2IK8A 2LKDA 2XSZD 3QG1A 3UK6A 1Q21A 2CLSA 4NP6A 2RMKA 5CIWA 1MRSA 4GOKA 2X2FA 3IIJA 1OIWA 3DZDA 4Z1MA 3PV0A 2IF2A 2W6ID 4PTLA 1MO4A 5FPKA 2I1VB 1NIPA 3ZD6A 4Q02A 2FSGA 3OFNA 4JLDA 2HJVA 2FX3A 1Z6GA 3GJ4A 1W4CA 4ZI3A 3ZLJA 2PMKA 4KO8A 4OYHA 5GJVC 3T1VA 4HI0E 4B74A 3S1AA 3AVOA 1KI6A 4CF7A 1DEKA 4ILEA 1GL9B 3UPUA 4Q9JA 1MO3A 2GXAA 1MO6A 1P75A 4NMMA 4QBHA 4EDHA 1CBUA 1AIPA 3PCRB 4NU0A 3BH6A 4D0LB 2FF7A 3J81k 4PAMA 5J4HA 3PENA 3KX2A 5F9HA 3FMIA 5E7JA 2JATA 2A7QA 1XPUA 2O8FA 4RY2A 3NWJA 4TQAA 4B3XA 4IJMA 2ZI5A 4D6PA 2VP0A 1YR8A 5EZ6B 4IVQA 2C98A 4RJLA 1XD2A 4BFVA 4NYIR 3C5CA 3QKSA 2D74A 1ZW6A 3IBGA 1HTWA 3U4QA 4GFDA 4AY2A 4KLNA 4LI0A 3HP1A 5FPSA 3VR1A 4YLGA 5IHPA 2FPMA 1RW4A 3AF1A 3PQCA 1Z28A 4WW0A 2BDTA 5HZHA 3AP3A 2JGNA 4KFSA 1Q1QA 2VSOA 4D4MA 4ON9A 2NTYC 3TSWA 2BEKA 5KSZA 4ZCLA 1KSGA 4L9SA 3NH6A 2VQSA 4XJXA 4MITA 5B58C 2WWGA 4GT1A 1XTRA 2F7SA 2RGNA 3D6TB 4W5HA 4F4IA 2D4HA 5BXQC 5DI3A 3OAAD 2AL7A 4A15A 1BYIA 1HA3A 3LXXA 1A4RA 1G3UA 3FMFA 3OEEA 3R8CA 4DEXA 4B71A 1PLJA 5H1YA 3MG9A 3U60B 1XEWY 1W36C 4HUTA 2ZETA 2FFBA 3TKLA 4BLOA 3NHBA 1XTKA 4FW9A 3LW7A 2O8BA 1F5NA 4TQUS 2IWRA 3SC3A 1EFUA 1X8KA 1G3IA 2ZJ2A 2ZJAA 4XD7D 1JAIA 1E2DA 1W48A 4AYTA 2Z0MA 1H8ED 3K70D 4LHVA 5FPTA 2KSQA 1FUUA 5TY0A 4A0RA 3SYKA 4BLPA 2O8EA 3IEVA 1GNQA 1YRAA 2FSFA 3LWNA 4A8JA 1ZJ6A 3T15A 4PHTA 1G7SA 4QNRA 3OZXA 1E9FA 1G6HA 4FMDF 4TTQA 2QM8A 4OHWA 3RNLA 4DCSA 3IHWA 1IXSB 3FPAA 1G3MA 2IUTA 1NP6A 2QBYB 4AKGA 4JZKA 1VG1A 2ZRKA 2F43B 3K1JA 1KK2A 2Y8EA 3UMSA 1L7VC 4YQFA 2YV5A 1R2QA 3EIQA 1FP6A 1OB5A 2Q9AA 4FWIB 2GZDA 2OUKA 3DVLA 3IIKA 4PZYA 1NRJB 3MJHA 4MRPA 4NYMR 1GAJA 1E1RA 2JJ1A 4DB2A 4GDFA 2J5XA 1U8ZA 2GHIA 3KQLA 2ZRNA 1EFTA 1NSTA 4C9BA 4E09A 5AWFC 4B2PA 1UKEA 2GEVA 5EUMA 3QOFA 3B60A 4CEHB 1DAGA 5C1BA 5AJWA 1ZM2A 4P4TA 1VCOA 2BVNA 3HJNA 2EFDB 3VNVA 2IW3A 3WBKA 2DFNA 5BYJA 3QIAA 3TRFA 5F98A 4MYTA 2V1UA 1Z5ZA 2NO1A 1IXRC 1OXSC 1ZNWA 2ZYWX 1U0JA 1RPZA 2DWPA 3CR8A 3IQXA 5FTJA 2F9LA 5G3ZA 3CWZA 1YE8A 3MWKA 4WXPA 2QEQA 1YR9A 1E1QD 2QMUA 3PEUA 3QF4B 4TYNA 1LY1A 2VPPA 3TQCA 1LNZA 1NJGA 4CEJA 4TMZA 1FX0A 2PX3A 4KCGA 2C78A 2Q3HA 4G01B 3T1OA 2VLIA 1GIAA 4FMCB 1KGDA 1G3QA 2QM7A 5LB2A 4CZ2A 4D82A 5ELXA 2IYWA 2H57A 4P3YA 1AKYA 3GLIB 2GVZC 4DIEA 2D7DA 2V7QA 4Q01A 2H1LA 1W5SA 1GL7A 1FP7A 4AKEA 4OJQA 1AZTA 3OHMA 4OI0A 2WOJA 5E7IA 2B6HA 1R0XA 1V5WA 2PT5A 2ZE8A 3DZ8A 3P4YA 3RWMB 1GOTA 4OK6A 1M8PA 3BE4A 2Q3FA 3RS5A 1VDZA 2KBFA 5JRZA 4PHHA 4G5RA 1Z6XA 5FOUA 1P9WA 4QHTA 5H8WA 4DLSA 4RD4A 1UEJA 5EP2A 5IK2D 1XF9A 4BLSA 1HV8A 1FMJA 2PT7A 3GLGE 3GFOA 4CGZA 2O8CA 3V00A 4P33A 1EG7A 1X8JA 3KQHA 4F93B 4QGHA 1C4OA 4LC1A 3SDZA 3FOZA 1IY0A 4Q19A 5C4GB 3A1TA 3SHFA 2IS1A 4DDTA 4JT2A 2R62A 3THYB 4D81A 4BFUA 2ZI6A 5FOXA 1VTKA 1E4YA 1TEVA 1E2HA 2ZRFA 1E96A 4LYFA 2R65A 5LB4A 4AYWA 1NBME 4ABYA 2ZI3A 3SQXA 5J4LA 1DO2A 5K8LA 2IUUA 1D2MA 2OFXA 2WTUA 1GVNB 1MR3F 4NL4H 1Z06A 2A30A 1YU9A 1G41A 1U8YA 2JJ2D 4Q5IA 1II0A 3TUZC 2ZR9A 2F1HA 1AQUA 1E9SA 3QKRB 1NL3A 2F1IA 4ZCMA 4B73A 1E98A 2JCSA 2GTPA 2DFTA 3MFYA 1T5IA 2HLDA 1CRPA 1II8A 2C96A 5DH9A 3KKMA 3EX7C 2ZYTX 1IHUA 2EVWX 5KDOA 3DM9B 2RGAA 4ASUA 1F48A 2REBA 4MKFA 1JAHA 1XXHA 3BB3A 3AVYA 1KMHA 3QEJA 2ZRBA 3BJIC 4PANA 2XZOA 1II9A 3A4MA 1KJYA 4DKXA 2BMDA 2GZAA 1G1MA 1RYHA 4LYAA 4Q4HA 1XMVA 1G9XA 2ZSAA 4NCHA 2QPTA 4O2LA 3TMKA 4DZZA 4TYWA 4A92A 3B78A 4RCYA 2ODEA 3LW8A 4IRUB 3HU2A 3EZFA 4E07A 5JHHB 4ITRC 3LBIA 5JRJA 1P61B 3P4XA 1Z0IA 2IS2A 1KHTA 1Z0DA 1S2MA 1XNJA 1TEXA 4JYCA 1ZM4A 4PC7A 4FI3C 1ETUA 4NYJR 1N5KA 5EUQB 1BMFA 1L4UA 4M0LA 1RE0A 1G291 1G18A 2ATVA 1WXQA 4L4UA 4LSGA 2NPIA 2QTFA 4RKFA 4G5OA 2FPKA 4TLEA 3L8YA 2QP3A 4AURA 1E99A 2MSCB 2IYQA 3T1TA 1LTQA 1XJ0A 1LVGA 3C15C 4TMTA 5DYIA 4LV8B 1N0WA 3WMFA 3BRWD 5JZVA 3OE7D 4QC2A 2OZEA 1JR6A 2OG2A 3LY5A 4G5SA 3EPHA 1JXOA 3BB4A 3OF5A 3NVAA 1M1YE 3T5GA 3I3SR 2LWIA 1KSFX 4YXWA 2RAPA 3W34A 5BW8A 4M4SA 3PR1A 3GPLA 4IKEA 4BE7B 1NVVQ 2O0HA 2ZAMA 2BEJA 3PUZA 1HURA 4X8HA 2O52A 3UANA 3WRXC 3QPWA 4LBWA 3ASYA 3UKDA 3LAWA 4FCVA 1D6JA 3CRQA 1E2GA 3N2EA 1HQCA 1PLKA 2F1RA 3RS4A 3GLFB 2YJTD 3CRRA 4DLYA 3FWYA 1Z6YA 2Q21A 3A1SA 4GSYA 4NDZA 4FN5A 4B2IA 5KHOC 2J9RA 2JEOA 4HLCA 3GFPA 2CJWB 2H92A 2XAUA 2DYKA 2ZI4A 3AKYA 4NE2A 3U2QA 2YHSA 4B44A 2WJIA 4QHSA 4K81B 4TSFA 4D80A 1XZQA 3KB1A 5FOWA 3QXCA 3EPLA 5DYGA 3X1XA 1XTJA 4DUGD 3WNDA 1PUJA 3TLXA 4URYR 3LQQA 3I5YA 3B1XA 4KHZA 2IF0A 3RS3A 1X1RA 4ACBA 1IJEA 2BC9A 1LF5A 4DSOA 1E2KA 3GJ7A 2C8VA 1XEWX 1D9ZA 1W0KA 4DCVA 3BS4A 3B1ZA 4MRVA 1NLYA 2GKSA 2HV8A 3WY9A 5DSZA 3NBZC 4L16A 4U00A 1E9BA 2GCOB 4Q4JA 1M2OB 2JLYA 2IUSA 2F9MA 3KTAA 3C41J 4TYYA 1SXJB 3ADDA 2B92A 4L8GA 5AJVB 1CTQA 2WOOA 3B82A 4Q7JB 4RFSB 2HYIC 2UZIR 3CRW1 3EIEA 3GJXC 4ZDKA 2WHXA 3K09C 1RRCA 1N5LA 4K46A 1GITA 2OHFA 1T9HA 3QXJA 2W2XA 4XSGA 1BYUA 2OBNA 1KO5A 1VHLA 3ZGXA 1VPLA 2DWQA 2QRNA 2V3CC 1BO6A 1KKLA 1KDPA 4FCTA 3CNLA 4RVCA 1HYQA 3AUXA 4GZLA 1S1CA 4UKDA 3EZ2A 3U7FB 1MT0A 4AYXA 4D0NA 4AD8A 2BCGY 2ZS8A 2OILA 1K5DA 3CX6A 2N46A 3FFBA 4URVR 2W6JD 1NN3A 3MGCA 3D3QA 4D0GA 3FHCB 1S8FA 4PPNA 1SHKA 2BV3A 4CEIA 4DT1B 1K6MA 1SVKA 2R9VA 2GAOA 1QHHA 5E4FA 3CX8A 2ZU0C 1R5NA 2CVHA 1VYTA 3B85A 1X3SA 3CPEA 1XWIA 3AQ4A 2ONKA 4RZ2A 4ZV4A 1VIAA 4C7OB 1RVDA 4DLUA 4TLCA 1OKKD 3SE0A 5JEDA 1YZQA 4US2R 1OHHA 4WZ6A 2AX4A 4X8LA 3VKGA 2XXAB 4R7ZA 1O87A 1T8TA 4IOMA 3CRMA 2ASEA 4NYIQ 1P2VA 5JEEA 5K8IA 2X1VA 3N5CA 4Z51A 1J8MF 3B7GA 4GNKA 2QQ0A 5JFGA 2L0XA 3IKJA 3SZRA 5CJPA 3A4LA 3V4FA 2XJ4A 3WMGA 3VR4A 3TJZA 5A5GA 2ONJA 2NZJA 1XB2A 2P5TB 1NF3A 2J0UA 3B2EA 1MH1A 3K9HA 3LLUA 1IXZA 1ZM7A 2VRWA 3B13B 1US8B 1JALA 3REGA 4N0DA 5JWRA 5B30A 3DDCA 3SBDA 1RZ3A 2WM9B 4LYHA 3X2SA 1JEEA 3KB2A 1QF9A 4P31A 5JI3E 1J2JA 1GKYA 1FMLA 3OIYA 1KSHA 1Q1EA 4TQ9A 3PUYA 1QVAA 4UNRA 4B43A 2IYVA 1FTNA 2QRZA 3E2IA 2ANCA 4ZCIA 4JS0A 2QMEA 1ZRHA 1DAHA 1DAIA 2P0EA 3TUIC 2O8DB 4PQYA 1AK2A 4RZUA 3KDSE 1X6VA 5EXSA 4Z1MD 2VSFA 4NPHA 2WJGA 4L5BA 3RHFA 5AUPB 2BWJA 1E9RA 2VTKA 1IN6A 1BS1A 3GFTA 1UBEA 1G8YA 3LA6A 4RKEA 4DLVA 4TT3A 1I4TD 1XXHE 3FDIA 3OFND 4A6XA 3TVDA 4YMUA 2QAGB 5FOVA 1UKYA 1P5ZB 3TSOA 4IDOA 1Q1BA 1E9CA 1SZPA 2CCJA 5AR1A 2C9YA 2VHTA 1OXTA 5KNCA 1Z29A 4CT4B 4D25A 1CRQA 2QE7A 3W9YA 4EFMA 2YZ2A 4M2LA 1T0HB 4Q4AB 4EPRA 3UATA 5EJEA 2BKEA 2AHOA 2IYYA 2GEUA 2IBMA 3C5HA 2A5YB 3I62A 3BH7A 2WV9A 8OHMA 4OI2A 4NYMQ 1TAGA 3LRPA 4CT5A 1ZM3A 2OBMA 3MD0A 1LS1A 2ZRIA 1S1MA 3VAAA 2WVJA 2WKQA 4HDCA 2W2TA 1YHNA 4Q1AA 3WHKA 4W5WA 1UM8A 2GXSA 4JL5A 1GRQA 3O8BA 5GJBA 5G40A 4OKSA 2CL6X 2QQEA 4IW3B 5GJCA 4LBYA 4PO8A 4BECA 4WIAA 4OQMA 2GAAA 1KY2A 3UG6A 4LJ8A 3JVVA 3AVWA 3Q7QA 1G4AE 1S4QA 3ZJYA 3LV8A 5G41A 4M1OA 5KDDA 1QG2A 3LXRA 1KAOA 4Y0VA 1OT3A 1SVSA 3OEED 1R5BA 2VP6A 4HATA 3WYGA 1KKMA 3WBJA 1JI0A 3CH5A 3REFA 5B2ZA 4ZIRB 1XMIA 3QPUA 2YC4C 1F2UB 4H1VA 4PPFA 5CK5A 3SN6A 3T06B 4P0TA 2XB2A 1CP2A 3THOA 5BN3A 1WBDA 4EPYA 3BFVA 5JJIA 1MABB 2VHCA 4RD0A 5DIFA 5UKDA 5JHGB 2FZLA 4EQ6A 3TAUA 3VNUA 3MJRA 4LHYA 4CW7A 4HYYA 3KXLA 1ZINA 4X8MA 4ZPXA 3TVTA 5M04A 4B76A 3D31A 3MWJA 1JPNA 4IOKA 2GEDA 1KZGB 5JS7A 4BWYA 3ZS9A 5KTYA 4J0QA 3U61B 4YMSA 2ZPTX 2ZE5A 3R9WA 1W2GA 3KXKA 2OAQ1 4HDOB 2NQ2C 2QPOA 1J70A 4DXAA 1RC8A 4NCKA 5KDLA 3BXZA 4URXR 2ZYUX 3CZPA 3K0FA 1NBMA 1ZU5A 4YMVA 4BASA 4I1SA 2ZRHA 4JLOA 5E7MA 2GK6A 4KLZA 3ZH9B 4A1FA 3Q9LA 1AM4D 4FWTA 4KU4A 5EE3A 1UADA 4OHVA 2AD1A 5KPDA 4BRUA 4JVNA 1ZC4A 2ERYA 3EARA 3LNCA 4LJ7A 3PEVA 4PQRA 3HPQA 4C0BA 4Q7KA 1G4UR 1P2TA 4V0OA 2C9OA 4URUR 2BKUA 3TK1A 3RRNA 3ICEA 3WXMA 1CR0A 1NY6A 4UXHA 5CM9C 4A2WA 2A5FA 1Z0JA 2R2AA 4N3NA 2PCJA 4L9WA 2J0SA 1S9DA 2D7CA 3VQTA 1IY1A 2J1LA 5B57C 1COWA 5AJXA 2ZXUA 4N0EA 1VKJA 1E1RD 2V55B 2JJ1D 2HF8A 3BBPA 1SXJE 3Q5EA 4GP6A 4MGYR 4PR0A 5F3WB 2DWOA 1X1SA 2QI9C 3AVQA 4JVLA 3ZIAD 2A3RA 1AKEA 5FBRB 1Z8FA 2GF0A 1XZPA 3MWYW 4HB3A 2C99A 3BORA 4DVGA 2YKGA 1CJUC 1U98A 1KTVA 3KJHA 1GILA 4F38A 1P3JA 1T3LA 5FR1A 3W90A 2XOKA 2VHJA 2ZRPA 4O2RA 1W44A 1OE0A 3AGQA 3VMFA 4IDQA 1PJRA 3AH8A 2XEXA 3V9PA 1DBSA 2HXSA 2OM2A 2JLZA 1OJLA 4BZXA 3T34A 1UBCA 1YKSA 4FCWA 3FGNA 2W0MA 2G83A 3TH5A 1OYYA 4W7SA 2EW1A 2OCAA 1WCV1 5F9FA 4TMWA 1E2NA 1N5JA 1X86B 2ZRAA 4I99A 3QF7A 1GDDA 3LLMA 1W2HA 2PEZA 4G0NA 3K0SA 3W3AA 3LFUA 4XH9B 2E1RA 4BRWA 2CXXA 5TXGA 1E2EA 2AFIE 4PAOA 1DO0A 1TNDA 3OEHA 3UG7A 3X1YA 2BJVA 5KOYA 2HCJB 2V7QD 2XNDA 3RVBA 4MRSA 4JIMA 4QXAA 4I1OA 4F4JA 2JAQA 2PL3A 5KYKA 1N6OA 3I61A 2N1BA 4JVSB 4B3FX 2KBEA 3AV0B 3KJEA 4D2IA 2BCJQ 4QJ5A 2IXEA 3AKCA 2DR3A 5FBLB 3B6EA 1JBKA 4BPBA 3F8TA 5CDFE 4OJKA 2AN9A 1KO1A 3IO5A 3EA0A 4PZZA 1GZSA 3RSOA 3B5JA 3PUVA 5H68A 4MKHA 4UNSA 3GEHA 1P9RA 1JQJC 5KSOA 1NMXA 2VEDA 3WNBA 3BC1A 1YZTA 1AQYA 4P4SB 2QTVB 4IEIA 4Q03A 5KSPA 2F55A 4CYMA 4AIIA 1AA9A 3Q3JB 3M1IA 1XX6A 5J4YA 5EP4A 1FPMA 5DN6A 1N6IA 4KI0A 4NBSA 5LPNA 4LUCA 3BB1A 2MMCA 4A2PA 1NY5A 1VG0B 5DHFA 1ANKA 3AF0A 2VSXA 821PA 2YWHA 4ZDWA 4PAQA 2A9KA 4MUAA 5HZKA 4RD3A 2FGKA 2GJKA 2XITA 4KODA 1EXMA 1N6LA 4BEJA 1RKBA 3SFVA 4Q1DA 1R7RA 3ASZA 2ODBA 4LPKA 1OXVA 3B1WA 4NZYA 2F43A 1Z2CA 5TVKA 2YYZA 2W00A 1DVRA 1ZM9A 1NIJA 2HLDD 4HAYA 5FL7A 5TARA 1ZIPA 2ORIA 4KVGA 2WKPA 3NC1C 2UKDA 1RFLA 1G64A 2F3RA 4II7A 1GNPA 5L3QB 2HT6A 2OCBA 3GQBA 1HE1C 1CR4A 2GESA 4PQFA 5FTKA 1B0UA 1RJ9B 1N6NA 4KBFA 3L82B 3X1WA 1XCPA 4PC1A 4BFSA 1PLLA 1AGPA 2JLRA 2ZYVX 3PITA 5L8VA 5EXXA 1E2JA 1OFUX 2X8AA 1ZNZA 4LBVA 1UBFA 1SHZA 4QGGA 3FHOA 4CEHA 1DAEA 5KU1A 1EWQA 4PSAA 1YVDA 3PUWA 2G0NA 2GCNA 1CS4C 1E0JA 1GRRA 2R6CA 5H70A 3UMFA 4I1VA 3TAHA 4UJ3A 1LFDB 2FEMA 1WP9A 4PPGA 3K9NA 3NEYA 1FX0B 1QG4A 1BMFD 2YWEA 4C2UA 5AUOB 4Q47A 4HAVA 1ZAKA 2R6FA 3R20A 5GVSA 4POAA 1T4GA 2V4ZA 2GETA 3A36A 3SR0A 3T35A 1SVWA 2E9SA 1MO5A 1WF3A 3VU9A 4KSCA 1SKYE 2LCFA 2OESA 3QF4A 2EWVA 3VX4A 1U9IC 3ZQJA 2WMNB 4WBSA 2ZR0A 1Z6TA 1VG8A 4MGIR 5KPJA 1E2QA 4UXIA 5JECA 5JBQA 3X1ZA 3QVVA 3K70B 4LC0A 4B34A 2JIZA 2BMJA 1XTIA 3QBVA 4DSNA 1GP2A 4YXWD 1S9HA 2CK3A 4OHYA 3NDBB 3OIWA 3GLIA 2H5EA 3K9GA 2Q3MA 1SXJC 1UKZA 2YWFA 1JB1A 3JZMA 3DM5A 1CJTC 3AKEA 2FOLA 4LCBA 1P60A 1ZIOA 4JLMA 4L15A 2V1XA 3UWKA 4EIWA 2J45A 1EX6A 4DRZA 1HE8B 3AP1A 3RRZA 1DPFA 1NN0A 5GVRA 3CKLA 3ZYCA 4R2IA 4Z8XA 2Z4SA 2QSZA 3M4YA 4CVNA 2IYUA 3LQRA 1YZUA 1QDEA 2G1JA 2OSBA 3NH9A 2FEOA 2DY1A 3DMNA 2ANBA 4TSFD 1W0JA 4JJZA 5FBWB 2NZ8A 5JSZA 1EGAA 3RAPR 4JBYA 3ECCA 2ZITA 2QA5A 3THYA 2WIAA 2O0KA 3R9IA 2QENA 1VYVA 6Q21A 2ZUDA 3PG5A 4Q9KA 3AF3A 1Q44A 1A82A 2PH1A 1ODFA 3BIFA 2D3WA 1GKIA 3ZVMA 1LW7A 4LRWA 1QHYA 1UJ2A 2J41A 4DSUA 2WWWA 5DGXA 1W0KD 2OT3B 4ZKDA 4A0HA 4EJSB 3QVUA 2ZJYA 1E0KA 4EAQA 2FH5B 3NDPA 2QROA 2FU5C 1I2MA 2D62A 1LB1B 2PLFA 2J46A 2W2VA 1HQYE 3IO3A 3LX8A 1OXXK 1JJ7A 3EWSA 2VP2A 5IT5A 3QKRA 3GLHB 2A2ZA 1YZGA 4C0HA 1QZXA 5CM8B 1CR2A 2O0JA 2VH5R 4WXRA 4Q4HB 2ZVQX 1XTSA 3ADKA 3D8BA 4RZ3A 3GJ3A 4PXAA 3QPVA 4FIDA 4V02A 3HWSA 2DFLA 1W7AA 3DL0A 3KKQA 4S2EA 3BK7A 2IC5A 1X8LA 3BH0A 3KKOA 1F3OA 4JMPA 4RD6A 1CU1A 1KI2A 2JDIA 1KYIA 4P32A 1TL7C 1TF5A 1VCIA 4WVFA 4LHZA 4OHXA 4V0LA 4BFWA 4M1SA 1F6BA 4C0AC 4HSEA 1E3MA 4V0ME 4O25A 1Z3IX 1E2PA 3K0AB 5DI9A 1HUQA 2JASA 4MQBA 4B35A 4DSTA 2ZM5A 2HT1A 1BH2A 1P73A 1T8UA 1A1VA 1KO8A 3ND9A 4MUBA 3ICQB 1T5LA 2WJHA 1E79A 4KFUA 5EP3A 4F7WA 2WWFA 4TTPA 1OH7A 3AVUA 1GKUB 4JKIA 4TZ0A 2RKOA 5C46F 1G17A 4Z8YA 2OO7A 3CBQA 3RC3A 4X8OA 3HU3A 3MCAA 4KXFB 3DHWC 4NCNA 3P26A 1ZU4A 1D8TA 2OLKA 3BFKA 3CX7A 2FNAA 1WDTA 5CLLA 3GD7A 1Z22A 2OFWA 5HPYB 2XZLA 3PVSA 4AI6A 2ZUBA 2WPDA 3HYTA 5FUXA 4WZBE 1M6NA 1KIMA 1XPRA 2PX0A 3SNHA 2GF9A 1MKYA 1VIYA 2ODWA 4HLDA 2QT0A 2QP9X 1R0YA 1H8HA 2WAXA 4FMBB 4UQOA 3A4NA 4LK2A 2X19A
chains in the Genus database with same CATH superfamily
1AQIA 1V39A 1O89A 5FFMA 1N0VC 3ZCPA 1MZPA 1P74A 3HKEB 3LUPA 2XUZA 2IYRA 5IK2A 4JI3B 3FLMA 4NX2A 3L06A 3FJOA 2Y66A 3AUFA 3EG9A 3LOQA 5AVWA 2EFYA 3NU1A 2BFPA 4FB4A 5C8XA 1PRYA 1C29B 2YN2A 4BLTA 1KP3A 5J58A 1UBOS 1UP7A 1XP8A 4NE9A 1G63A 4BMYA 2GBLC 4C7XA 5LZ9A 3U26A 4US1R 2Z8YM 2FDXA 4EW2A 5BN4A 2HC9A 3JQ7A 1ZGHA 3QVJA 2BYTA 3F46A 5EGNA 4HR7A 4YT4A 4KFCA 4F6LA 5IPFA 2BBWA 2VPWA 3ENNA 4C6TB 2VRCA 3EH2A 3ILYA 1VL8A 1G8AA 4OY3A 3RLFA 4BL5A 3KZ1E 3E58A 2YOHA 4OI1A 5ITSA 3SJBA 1A1VA 1RRGA 4QAQA 4MMYB 2PA3A 3EXIA 2C7BA 2CMDA 4CWAA 4P5PA 4GYJA 5HKLA 1EP1B 2ZATA 1P0QA 4LVNA 4YI5A 1N6HA 1DBQA 2OVFA 3ZXSA 3DEFA 3WAGA 3V32A 4WX2B 5JBIA 2QIPA 4LEIA 1YTUA 2V8BA 1ZYUA 4X1OA 4XWOA 1L7PA 1Z88A 1EJ6A 2Q6KA 4G6ZA 5E8JA 3GRAA 1RSZA 2DGDA 2H06A 1ABEA 4LG1A 3IP1A 1NVDA 3M33A 4QASA 2AG1A 5CB4F 1EFAA 1CZUA 3R3UA 5LBUA 2D1TA 2EWWA 3ZLUA 3TIIA 3KBOA 1X19A 1MP0A 2VDNB 2XT6A 5DOVA 2ORWA 5BQ5A 3DYVA 1DCFA 2JJYA 1H0KA 4ESHA 2VC2B 1NRIA 2B8WA 2FPXA 3NCTA 2MSNA 2UVQA 3VTAA 2ZQZA 3QWAA 4IOLA 4ZARA 1ZNXA 2HREA 2C84A 3BHIA 3GUZA 4YRJA 1BS2A 1CKEA 3C87A 1WCXA 3V6MA 2I33A 3GNTA 1KRWA 3CB4A 1EAYA 2KLHA 4G63A 3F5DA 3ILXA 1E58A 3IC5A 5K45A 2HFJA 1E3IA 5KVAA 1QYDA 3BILA 2RGCA 3L6CA 2DTXA 1AKRA 2VJQA 3F3YA 3U7HB 1C81A 4FBLA 1FFEA 2PIDA 5G1NA 4EG3A 1OYWA 3I01M 2OO5C 3KU1A 4B84A 3S1SA 2BGIA 4QWWA 4A0FA 1DFHA 1ZIXA 1C4WA 3J7TA 3VPXA 3EAGA 4N1AA 4NFLA 4QOFA 1LF0A 4EJMA 1Y9ZA 3IOMA 1NVAA 1XUOA 4PC6A 1KEEB 2XCUA 4UZFA 3MSXA 3I9MA 3DMHA 3QJYA 3VYVA 2JB9A 4YMHA 1LH0A 1KI8A 1TM1E 4NU8X 5ARBA 1H85A 3G85A 3D2AA 3EXHC 1A4IA 4MVWA 1FL9A 5SZHB 2GO1A 3W7AA 2JRLA 3AERB 3CLUD 3E9RA 1S3IA 4IDNA 1SBTA 1F1JA 2L2QA 3AIMA 1PGPA 4LOHA 2J3EA 4C7OA 5BQOA 5BSRA 2FA9A 4DWVA 3NTVA 2BIFA 3UIEA 2FPGB 4RWZA 4EYSA 3WGIA 3MTEA 2V4MA 3WJ1A 2ONCA 4B5LA 1O6FA 1TQ2A 2J0UB 1JHMA 1V1MA 2GKGA 1G3RA 4CMGA 1P7PA 2QJTA 3R0IA 4YUWA 2YUTA 4ESVA 1W47A 3T9AA 3ZVRA 1QGUA 4PLYA 4YDHB 1GPUA 3OD1A 1W581 4H4CA 3BMCB 1CR1A 4KRYA 1Z4LA 5CDFA 1HLDA 2QYSA 2NO7A 4OM8A 5LZ2A 5MGNA 5HIIA 1U0NA 3PD7A 3QH4A 1YOBA 3OX4A 4B7ZA 5TLSA 2GZ1A 2V6IA 4LBZA 3HA2A 1TZJA 1IY9A 2WD7B 2XNKA 4HZUB 2R47A 1Q1AA 3FKSA 4BO8A 5KQGA 3ETDA 2NXNA 5FT9A 1U7ZA 2YASA 1SUDA 4DLZA 1A5BB 3OOYA 2Y93A 5JAPA 2C7OA 1JEQA 2Q50A 3LWZA 4CBVA 4LX0A 4P4UA 1HDIA 2B78A 3IR6A 5CT6A 3UNXA 1ZVVA 1ZH0A 4YDSA 2AFRA 3MRSA 3OCYA 3ND8A 1CZNA 3R8XA 1G60A 1J7JA 3ESCA 3RFTA 1UBJS 1KJ9A 4UULA 3HXKA 2DUJA 5FUWA 1X13A 5IKMA 3Q11A 5DWQA 2AVDA 4B75A 4B3JA 4F8JA 3LIIA 1Z3CA 4G1EB 1EK1A 4B9AA 3EGXA 3TW8B 4PONA 3Q8XB 2YHIB 4AMUA 5HUHA 1Z6AA 3K9BA 4C0QC 4QIHA 4JLAA 3SOZA 4BKPA 2XECA 2IH2A 1GZ4A 1PFVA 3CM0A 3SS7X 1NVUQ 4CM4A 2CVZA 5EERA 1XWWA 1YGYA 2GAJA 3LPDA 1Z5NA 1MEOA 4N5NA 4AP9A 2BR3A 2CZGA 1VIDA 3LKDA 5LDGA 2AEEA 5ICMA 3W8FA 5G0VA 1KJZA 3NWPA 1DQSA 2PSFA 2XX3A 1GGVA 1VYHA 4B6RA 4UOZA 1DBWA 5I9SA 4IJ6A 2B83A 1FNDA 3RQSA 3UV6A 1PVOA 2QAGA 2WJVA 2YQ4A 2UUPA 1B8PA 2JZOA 2BFCA 3KFXA 1IJFA 2TMYA 4HS4A 4MJLA 3ABSB 1RWNA 2FRDC 3E27A 4QFBA 3W6OA 2RIRA 1V26A 1AD2A 2ZKIA 1TFUA 3GLSA 4OAOA 4WA7A 4XIYA 5MDHA 1BGWA 1RZRA 3IQEA 2C5LA 3BN3A 1OLSB 4Z1OA 3GJ5A 5GP1A 2A9JA 3DFIA 1RACA 4L7QA 2GRJA 4Z99A 5LMCA 3RU3A 1CXZA 1LVUA 2P5SA 3AUYA 4LXYA 4PICA 4TMVA 4YRFA 3RSFA 5DCLA 2ZJZA 1ZCBA 2EFHB 2Q5FA 2QRMA 1JGTA 2OYSA 3DE2X 3ETNA 4LY6A 4QUBA 3OTOB 4M6WB 1DO8A 4Q3LA 4D8TA 1I3KA 2WTBA 5SZKB 5A02A 4EJ0A 5I9MA 2ZU6A 3RTEA 2OFOA 4B7UA 1EINA 3UF0A 2O2EA 4N3AA 4CLDA 4FNOA 5K0FA 2HZ7A 3O2QB 3KR9A 4RH1A 4WGFA 3RC2A 3ANXA 4PHFA 1QIKA 4G2TA 3QFTA 1GQFA 4Q9HA 1XZGA 1NMYA 1CB0A 3EXG2 4J6FA 2WAAA 1UDWA 1X74A 2PJZA 3CJQA 3ODPA 4FQ5A 3EOBI 5FOQA 2GM4A 5EWJA 1B74A 4Q9IA 3MPUA 4MAAA 4BN5A 1WW8A 2F00A 3KKEA 4Q6WA 2P4EA 1L7MA 3F4LA 1RBYA 3N39C 5ARDA 3W3AD 3HUTA 4XEUA 4GGPA 4MP3A 1ZBDA 2HA4A 3BFXA 3MTJA 4DB4A 1U8FO 1UEXC 3MZ0A 1QHXA 4MR7B 1FEZA 1TKAA 3M5CA 5HF5A 3D6AA 3PPYA 4AC9A 1XKLA 4B32A 1EWVA 4TLAA 2P65A 1DG3A 4Y9RA 3AK4A 3NASA 4L4XA 4M0MA 3ZYZA 1RCUA 1I7DA 2V7EA 1GLVA 2ZKLA 3D6JA 3CSUA 2P5UA 2FKNA 2FQXA 3B52X 1PR1A 3M1LA 1O08A 4M99A 5LXTB 1K2WA 3WB2A 2ZOSA 2JZCA 3M3HA 4RV5A 4UNPA 1GPMA 2A5GA 4UQLA 3QY0A 5EJ8A 4UZSA 2GM5A 3EGEA 4DS3A 4JITA 1Y8AA 3GCZA 5EZQA 2QTTA 3RVSA 2EU8A 1FTYA 2W43A 3CIOA 3KJNA 4CFYA 3EBPA 3THSA 1IFXA 2CLKB 2PPVA 3AHIA 1H9BA 2YVLA 1G19A 4C30A 3N8GA 1Y8QA 2O3SA 4ZHQF 4QT0A 2JCYA 3MYRA 1ZO8A 2AEJA 3ENQA 4X0EA 5J63A 2BFMA 2ZI7A 2XTMA 5FTLA 4KNYA 2I4IA 4AK9A 2BH2A 5AOVA 5ILGA 2ZRLA 4H1HA 2IHYA 5E3IA 1ODCA 4HFJA 1M1UA 1JWAB 2K6GA 4DZTA 3L0PA 2BHLA 3M4JA 3DZCA 3HY4A 2ZTVA 4BLRA 3QE3A 3L5KA 1CIPA 5D51S 3WGQA 2X0RA 3NO4A 1QZTA 4IWYA 4JSRA 4ZU1X 4CLOA 4H6VA 3BPSA 1L4NA 1MAAA 2B5VA 2F3SA 4QYSA 2C3MA 1B0PA 2J67A 2HBZA 3E03A 2ACWA 1Z0SA 2XT0A 3JATA 3NBKA 1R6UA 3DCJA 3NUGA 4YBRA 3UMJA 3OM9A 3G9QA 3IGFA 2D0IA 1OT5A 3LH5A 1Y6FA 4IFEA 1TD1A 1XO1A 3V3KA 4LF5B 4ZVSA 1TIPA 5JAOA 3OO0A 1NC3A 2JAUA 5EYPB 4Y6PA 1ZH4A 1UOEA 5F35A 2JI4A 1JFFB 5ES4B 1XDUA 3RFXA 5FBHA 1QFJA 3DLCA 4ARVA 4HNGA 1BQ4A 1T5HX 3FMVA 4TM7A 4B3DA 1N4DA 1KF0A 3N2GB 5WRFA 1NVTA 2PBRA 3L2OB 3N6RA 5BVGB 3KL4A 5CR9A 1SB8A 4DJJA 4HWTA 4XRRA 4ZAYA 1M7HA 1IWOA 1I1NA 3WB1A 2YVAA 1EDBA 1QVVA 4JJAA 2WM2A 4YWHA 3TIGA 1NV9A 2DC1A 3TLJA 3ZZUA 1R12A 5BV8A 5DLQC 2QNRA 2R8ZA 1VLJA 4FFBB 2J3LA 4MDHA 2IZ1A 1TUEA 3Q3EA 4EB0A 1DS6A 2WIKA 2NSDA 3RG2A 4U02A 1XMQB 3CH6A 3U3OA 3EVBA 3KPJA 3N8KA 3PXXA 1G8GA 4HLUA 2OZKA 3GGGA 3B3GA 4QLBA 4JI2B 3FE2A 4GPTA 3Q9SA 4JLUA 2XUJA 2MR6A 2J30A 4O6VA 1U1CA 4EF6A 4WCVA 3HB0A 3NHYA 1NMZA 3UAZA 2C2OA 2HHJA 3IXMA 2RGEA 2J5QA 3RUHA 3UKJA 1L8QA 2O07A 4R31A 4PNHA 1UAAA 4L73A 3EW9A 1ZIDA 1I7QB 1SC3A 4F8YA 3S2UA 4RIHA 3ZBPA 4DQXA 3LHKA 2DHEA 3G82C 3NHSA 4F3NA 1I7LA 2BEUB 3JQDA 4LXQA 3LQ1A 3V5NA 5KNLA 2CZQA 4JT4A 2W6MA 1GFWA 1M1YB 1I30A 1N25A 4QODA 1HDOA 5ILOA 3T5BA 4YAGA 1DQZA 4C7KA 4KVZA 1L0BA 4BTLA 5EC8A 3Q3VA 1POXA 3B1YA 1DT5A 3KWJA 1VZ3A 3IV9A 3WNCA 2IE0A 4FC6A 2JFPA 3CLVA 2GGSA 4ZOLF 4UPDA 2RHGB 3AFOA 5M34A 2O1SA 2CN1A 1ZNYA 1O8BA 2AXNA 2JIZD 4LGMA 3TM5A 5BMOA 3IPYA 2IUYA 1N0HA 2ZUWA 4I08A 4JOQA 4MKZA 3UV3A 2YWRA 2P9TA 3BG5A 1AH2A 4F92B 1ZUNB 4GPZA 4A8JB 3TX2A 3UW3A 4ANFA 1RDFA 3FIJA 4HAXA 4XSHA 3HHEA 1UC4B 5BW5A 1CT9A 3W8DA 1CFZA 5FA8A 3MWGA 2XYHA 2ZT8A 4U0KA 5CEFA 1KZYC 3CWCA 4Q66C 1OJ7A 1T0BA 4Q9NA 4X91A 3TQRA 1VB3A 4U7FA 3OTIA 1XNHA 2B2NA 2ZZMA 4P36A 4IUDS 3GCGA 1HNXB 1H23A 1Z2OX 5EIFA 1TRKA 4GI5A 3VH4A 1JDSA 1Y4AE 5IARA 4PWYA 2B36A 3HG7A 3AI2A 2I5PO 2IV2X 4HC4A 1D5CA 3EODA 5HG0A 4PYOA 1LBTA 1JG1A 1QH1A 1UINA 1DWUA 2BI4A 1MAVA 2HIAA 1DKQA 3QEMA 5IX8A 2FW8A 4LDRA 2W6IA 3RVNA 1IEWA 3D4OA 1KQGA 2XB8A 2PUDA 2PYZA 1DBIA 2WJJA 2GA8A 1RZVA 5H16A 1E20A 4Q6BA 5TE9A 4UARA 2CV0A 5H81A 4AQDA 3HO1A 1Z7WA 2XUOA 4YRMA 1FUIA 5F51A 5AOCA 4ZICA 3GWZA 1J42A 3HA3A 3DZGA 3I3OA 1MQ9A 1SOMA 3ZQ6A 1NV8A 3GRVA 3WWYA 3NHAA 1NFFA 1YD7A 2NYVA 3DB1A 1L5SA 1MJ5A 3S2EA 5JD4A 1N1DA 1Y3IA 3QKUA 3SSNA 3VKVA 3NJ4A 4OQPA 3B20A 4K3UA 3CFYA 3UT5B 3AI3A 1G2PA 3RV3A 3CURA 2HA0A 1CZHA 1JNXX 4E2ZA 1I36A 1ID1A 3V97A 1A9RA 1L3BA 4R54A 5K51A 1HBJA 2ZYIA 4QDJA 1DG9A 4LHWA 3A7DA 4UXJA 3RSQA 2Z5VA 4OAQA 4QUGA 5DKFA 3VYUB 1A2KC 5FOSA 1QYXA 1R0ZA 2ZUTA 2P4UA 5FO0A 2D2IA 2WIJA 1KK1A 2R44A 2XUHA 3HVJA 3O31A 2IKQA 4KR0A 5DF1A 3N8HA 2ESRA 2JF0A 5LN1A 1NN1A 3AHGA 4QNMA 1FUEA 5ADHA 1KYZA 3G0HA 1W85B 3FWZA 1K8RA 3ADCA 2CE2X 1Y37A 1B23P 1QLWA 3B9RA 4XM1A 3RYHA 2PUWA 4IFBA 2ZSDA 2WVGA 3U4IA 4QYWA 2ATIA 3GVIA 5LYYA 1QC5A 1XNRB 4MQLA 2PQMA 3ONWA 4HRYA 3DLPX 2XVZA 3RUPA 2R7MA 4DA8A 5BW4A 2QVZX 4RBNA 4S1TA 1E6CA 3BTOA 3DOJA 4EW6A 3H75A 2ZK7A 3CNNA 2EBHX 1SXGA 2WICA 5LQKA 2FSUA 2MYUA 3PNMA 4F4UA 3HB4X 2YS7A 4KQFA 4OEHA 5CH5A 4CV2A 2Y3IA 4MIOA 1LZKA 2DWCA 4YAOA 3ROGA 4X7PA 4IO0A 3W2GA 2P6RA 4FFPA 1JQLB 1YQTA 4OBBA 1BG6A 1DEOA 4TKVA 2C9CA 1N75A 4IRXA 4EGQA 1L8XA 2SKDA 5FFNA 1RWBA 2Q5QA 3SK0A 3A9UA 3ANNA 3O73A 4UUBA 4AUMA 1WXXA 1NM5A 3V7NA 3DL4A 1JS1X 5GPBA 2O5EA 3LL4A 4FI3F 2IBSA 1PQWA 4HLNA 2VOJA 3PF8A 1UFRA 2O3QA 2WPDD 1JU3A 2PZEA 3CLTC 1DL5A 4RA9B 3ZVLA 4TLBA 3FNRA 4HTFA 1B2LA 1J0XO 2PMDA 3BJZA 3KDPA 5DISB 2B9EA 4BC1A 1EP9A 4OHRA 3CUSA 4BWGA 4PTZA 1QPBA 3PE4A 2DUWA 3BMNA 3PWSA 1O6CA 1H8HD 3P9ZA 3IX7A 3BFJA 3W4JA 3RABA 3UENA 2NP6A 3TEJA 3KJIA 2WHRA 1QOQB 3N05A 3W2EA 5JC1A 1E9EA 1T6NA 2OEPA 4H0FA 1CK4A 5FBKA 2BELA 5DP1A 5C3MA 2VF5X 3FYCA 1L5HB 4B33A 3WG9A 5GM2A 4LJ4A 1XIVA 3X2EA 4EG0A 3H83A 5C8VA 2ECPA 3BEOA 3REQA 4KITB 3RGWS 4QXPA 4E2FA 5A4FS 2H3HA 4U7PB 1I0LA 4ECAA 5I9NA 3PICA 3WMEA 2H48A 3BD9A 4M7WA 5AVYA 2DY0A 5LYJB 2FZVA 4U4AA 1KNXA 1U4NA 3TLGA 5DM1A 3SYRA 2MSKA 3A3PA 4HWKA 4EY4A 4YJ2A 4JI5B 3STUA 4JL8A 2ATXA 4GVPA 2IQIA 2F1JA 2LE0A 1JMKC 3RYCA 2Q1XA 1QFXA 1QDUA 4IDEA 1DCTA 3LGSA 3X1DA 3I92A 2H4WA 1N3LA 4PO1A 2VHYA 3JQBC 1NJSA 2VNKA 2P1DA 3JQRA 5JBNA 1K68A 4LDJA 4I3FA 1Q83A 1JLLA 1J09A 3IEPA 3K6RA 1XXHB 1I2DA 3LPLA 4CIVA 4ND7A 1XDWA 4TMFA 1VMAA 2VDVE 1RLJA 4TN1A 2YDYA 3MRVA 1ONBA 5BMVF 3ANYB 1HEIA 4BJ3A 2GZ2A 5L4SA 1XU9A 2PLRA 3ORHA 3H84A 2FY8A 2AWOA 1FJXA 1P5RA 3HO6A 4ACAA 1O94D 5TQJA 4D46A 4EJSA 2VDRB 3JVUA 4H7HA 1Z4KA 4BX0A 3WISA 1TX4B 1Y3BE 3GBSA 2W98A 4IHQA 6CHYA 5DNUA 1SZCA 3NG1A 5J5VA 2IL1A 5CX1B 4WPGA 1TU4A 1XT6A 3FUWA 3GLTA 2CHVA 3AMVA 3OJCA 4I4TF 3RVPA 2RBEA 1T5BA 5AW0A 1EESA 1U0LA 3EQZA 1Y42X 1WZCA 3M3PA 5EN4A 3WGZA 5CB8A 2AD5A 1P77A 4BLQA 1OZAA 4Q15A 2HRDA 5C4MA 1YVUA 3EXFA 2CLOB 4RY9A 4NJMA 3FMOB 1D7OA 5IM5A 4ZVKA 1FW6A 5DW3A 1J2UA 4GXNA 3KSAC 3WNVA 1CNFA 1SC6A 1X9HA 3PWTA 4IJVA 2WSLA 4D9FA 5KUTA 1SVOA 1L8AA 4J91A 3L7OA 3WK8A 3WR5A 1AUPA 5J2UA 4I9FA 3WRWA 1LPAB 4JLBA 3IA2A 2H9YA 3BWBA 3HBAA 4CR6A 2V4UA 2KI5A 4XGNA 2XCRB 3OQVA 1Q3TA 5GGXA 4PHGA 3DMDA 3A8TA 3NDIA 4PFSA 5ESDA 1HNNA 4U8GA 1OBCA 4JEUA 4YT5A 5JNTA 1CE8B 2OOKA 1J8DA 5DRTA 3TRDA 1C1YA 1H22A 3CS3A 1OXMA 4FFSA 4O0MA 2QM0A 3ZZMA 4EO7A 3Q85A 2IYNA 3A1VA 3OETA 4FR0A 4M53A 4D99A 2FJ0A 1WDWB 4ZO8A 3MGBA 4FS8A 1EAMA 4BMVA 2RJOA 1NUTA 5EPUA 5ESRA 3V1YA 4EGSA 1WU7A 2IXTA 2AWNA 1TB4A 1UEIA 2C8LA 2O2CA 5JS8A 1EVEA 3DEAA 2BHNA 2WHQA 3U1TA 2ZBVA 3D3EA 3R9XA 1YI1A 3TSAA 3DKVA 2YHAA 3KJGA 5B3AA 3WB0A 4PNPA 5BP7A 2QYOA 3OOJA 4B81A 3W6NA 1F14A 3KT3A 3SBXA 2G08A 1MEEA 3IMEA 1VLVA 5EWLA 2J85A 2WFZA 4HQ6A 3DZJA 4QPPA 4R3WA 3VU1A 4M22A 1IB0A 2JFNA 2PHZA 1GZ3A 1DKMA 2IY9A 3IAFA 2QL6A 1IVYA 4LJYA 4IGIA 3VH1A 2V9ZA 5IAJA 1QFMA 2IHBA 3DUWA 4TVBA 1CUAA 3A4YA 5IJXA 4BXOB 2H5IA 3NHLA 1ISPA 1TGVA 3ZZ1A 1LI5A 1W5EA 3DKIA 4DDUA 3KNZA 1H66A 3OSZA 1NR7A 4KQ6A 5A3QA 1T2DA 3E3AA 3EZ9A 3U7QB 4EPTA 5ICCA 2WB4A 1AK1A 1ESNA 4TRJA 3VGJA 3I32A 4G5YA 4WRRA 1Z83A 4QRDA 4MV8A 3EC2A 4DJTA 1M7GA 4Q4JB 2HTEA 4RMHA 3IAAA 2JIBA 1N7IA 1U9IA 1YB6A 2M6SA 2OC4A 2VF8A 5ESWA 1DKRA 1NVWQ 3G8DA 1KIAA 2SBTA 4DSAA 2E4WA 2O2GA 4RMIA 1L5LA 4DHEA 1D2CA 1EBFA 4RDHA 1T91A 1KOFA 1USUA 1Q95A 1NJ5A 2R6AA 3SHWA 1ZKMA 4BB5A 4O2BA 1HQKA 5DFAA 2NADA 4CM6A 1I1QB 1A8PA 2FSHA 4JKYA 2WY2D 4ZZ1A 1ZCAA 3ZU6A 2AZDA 4KAJA 3IUPA 1V11A 2A9PA 3HNOA 3ZW7A 2XYVA 1HTBA 3RRMA 4LJSA 3TN7A 1GLGA 4PC3A 2P67A 5DHSA 3C3DA 2AF4C 5HE8A 1BZYA 4UMFA 3TE6A 4QPJC 1YCDA 4RZHA 3ZD9A 3TIVA 3N7UA 1P7WA 4J8PA 4M86A 3VO2A 2TMDA 1TQDA 2QZZA 3ONEA 5GM1A 5KTNA 1UK8A 1CLUA 5DM0A 1RRKA 1UXGA 3KUDA 4IEFB 1SELA 3BSWA 3VJLA 2QX6A 1ZD1A 1A9PA 3TJMA 4DQDA 3HXMA 4Q7LA 5EZYA 2GD1O 1GAEO 1T26A 3CG0A 4I14A 2VK2A 1TF2A 1T2VA 2QTCA 2EX4A 1P4SA 1N5DA 2J7PD 3AQIA 1OX6A 5HNKA 4V2UA 3ZZNA 2P11A 3CMMA 2W4IA 2WABA 2VLBA 4M9QA 1PJQA 2ZEJA 3TKYA 2HDNB 3ZNNA 2FRVA 5KNDA 1DAOA 1KNQA 3RRXA 5IVKA 3BX1A 1U8TA 5KKCA 1Z08A 1PUIA 2Q4DA 3IP8A 5CHYA 4KDEA 3F6PA 3IJRA 3OU7A 3Q40A 1N32B 1CY8A 1SK9A 2B94A 2G1KA 3FLBA 2W0SA 2XD9A 1OH6A 4MR8A 1C9NA 1OAAA 3OE7A 5F64A 2PFSA 4ARUA 4CF4A 3C6MA 3QFRA 3H05A 3UJ8A 2WBLC 4WKCA 2FMIA 3GC6A 1JR3D 1FTSA 1TOAA 5FH9A 3PX2A 1OU0A 3P7MA 3ZX5A 4NARA 5FUVA 2R8BA 3D2BA 5ENZA 2AFIB 2FK7A 1L5ZA 5M2QA 1E3WA 1UR5A 3R3XA 1SC4A 3ABZA 5JS6A 4XTCS 3ETEA 2BGGA 2XXAA 2Z43A 1J21A 3OU6A 1EK5A 4ND1A 1BOFA 4C4XA 3SEFA 4ZVMA 5ALDA 1ICEA 4CTOA 3KKNA 5L3RA 1YZHA 4HV4A 1KI7A 1YZVA 3EIXA 5K6AC 4OH1A 1E0AA 4R1MA 2RHMA 2I76A 2WQZA 1DMRA 2B8TA 1PTJA 1SBQA 3AOEA 2NOAA 1BKSB 2XBUA 3CSDA 3GOHA 5ALHA 4C0KA 1Y1TA 4DM3A 2R8XA 3D64A 3JARA 2FR8C 2WDZA 3HM9A 1N5IA 3CRZA 1TQ8A 1WA5A 1QBKC 1Z4PX 1Z45A 2LUOA 2R751 4FZJA 4OATA 3UUEA 4ZRNA 3V1KA 3HVRA 3I5XA 2Y1FA 1YL5A 3KL2A 3R76A 1BX3A 1DJLA 3E4CA 3QMVA 2GCGA 4BO1A 3PRYA 3O8OB 2BKAA 4TYPA 5KYUA 3AF4A 5K7SA 2OQ2A 4RVHA 5CB6A 5KOJA 1KVRA 1X1DA 4A6EA 2OCYC 2WTEA 3HN7A 4JUDX 3SJUA 3VZPA 2Q9CA 5CA1A 3ET4A 1V5EA 1YMVA 3OG9A 4XFDA 5LOVF 3HB7A 4KNWA 4DR3B 1QHIA 1U8EA 5KYTA 1REQA 4BAGA 1VI5A 3VTKA 2NZ2A 2JIQA 4XLZA 2X77A 2XDYA 3IKTA 1E2IA 4OX9B 3I2KA 1R37A 3UYKA 2AE1A 4D4GA 3T94A 3VRHA 2EYQA 1PJZA 1BSVA 3JWJA 1PZEA 2OHVA 3PXBA 2EP7A 4V0RA 5U9CA 2C1XA 4FB5A 4A0SA 4CKWA 2DPYA 3GDGA 1QKIA 3THWA 1IQRA 2ZROA 4OHCA 4MO9A 2X8LA 1KJWA 3OPXA 4NBWA 3VHRA 4ZA2A 1TDJA 3LE8A 3JD2A 3UC9A 2A9RA 3GRKA 2W2NA 4E5MA 2ERCA 3CNBA 1MTZA 4M0CA 4R8RA 4PWZA 1KI3A 4ENRA 1HNZB 2F64A 4JLKA 1QO0D 4YV0A 2QRVB 2FWAA 4MPTA 3F78A 4MJ7A 3R3HA 3JYLA 3U44B 1TYBE 3KXDA 4FLEA 4BGDA 3EIHA 2WWYA 1RTTA 2IYLD 4WNAB 2ZJ4A 5K4HA 4G85A 2I4NA 2CL7X 3CTPA 5J9FA 4UEKA 1PJ4A 3TBKA 1YWGO 4WY8A 1IG3A 3NUQA 3RYIA 4JBHA 2CF6A 3VVMA 3OX1A 3FDZB 4O4IB 2QW0X 1I5RA 3LY8A 3FMPB 3JWGA 5D8DA 5ECGC 5ALQA 4Q4AA 1XZIA 1V47A 2EGGA 4IBOA 1QV7A 2GSWA 3B9PA 3MINB 3NP7A 3ZLBA 1F8UA 2CVFA 4A8JC 5KYYB 3SX0A 3GMIA 1XRNA 2QRGA 2PLNA 5TMPA 1U81A 3KSDO 3K1TA 5B4VA 1PZNA 3SJZA 5A04A 3QKIA 3PR3A 1LBHA 2QVCA 3KTFA 1VXRA 2PQ6A 4JYAB 3PJGA 3Q0TA 1KFJB 1NG9A 1G38A 3EQ6A 4D8WA 4R6WA 2MMGA 4GP7A 3UMRA 1R8QA 4Y6RA 5JDIC 3BCRA 1B16A 4K9PA 2YXBA 1SKYB 5EIWA 5DSTA 4M8LA 4A5OA 4DJDC 3T1YB 3IPXA 2ZIAA 4TSRA 1TIKA 1A04A 3FIUA 1HQDA 2BTEA 1Z0FA 5AI6A 3LECA 2QY9A 4KQKA 2C29D 2XMPA 4D5EA 2OQIA 2O2JA 5ALPA 4HGNA 2X6QA 4MV3A 1YASA 4JASB 3JWHA 2AG6A 2E3JA 3KQQA 3O3NB 2G0TA 3DXZA 4YREA 2G9NA 2EJCA 3U31A 4EENA 5K0BA 1IC6A 1U3WA 3PSHA 4HZGA 4KMRA 1K1EA 5C2JB 3EFEA 1GZUA 1R6BX 3EAFA 3KZCA 3PD1A 4QQRA 2H2WA 2EX1A 4ROSA 2ICAA 4YRGA 5IS2A 3NATA 2ZIZA 3W04A 2PX5A 5ED4A 3LK6A 4DM4A 3L0OA 1W73A 4XPIB 1IY8A 1DBRA 5AUNB 4RDXA 5EJ4A 2QYTA 1C3EA 1SVLA 2F3QA 3DBVO 3R6WA 4I66A 4IZOA 2QUBA 3E2PA 3FAZA 4QELA 2P6MA 2YY5A 3AVTA 3O2SB 3PHJA 3IOBA 3AF2A 2JD2A 4QDOA 1JHOA 3NDJA 5JXIA 1MQAA 3K0FB 4MW9A 3WLTA 4DDMA 1ODIA 4EO9A 2F1KA 1CQJB 3RO7A 3CE6A 2BHSA 2IK8A 4L6AA 4X1KB 3LKVA 3QG1A 4YJKA 3TD6A 3R5TA 4BMDA 4I1RA 4NP6A 5CIWA 3IPAA 5A3VA 3IIJA 3DZDA 2Q07A 2WM8A 3PFWO 4MYDA 3STTA 5HBRA 4C22A 1MO4A 1ILEA 2BM8A 2VJOA 4HL6A 2M6KA 4DBLE 7REQA 1FA9A 4O08A 1XHEA 2NVOA 3HVIA 1NWHA 3LI2A 2FSGA 1IPEA 4MRMA 4C07A 4DUPA 5AW5A 3ZV7A 2XPCA 5KB3A 2UVPB 3P9CA 1WOMA 4NJEA 1K6XA 4TV8B 5H59A 1OWMA 1Z6GA 2BY4A 3GJ4A 5T7BA 3ROEA 3E22B 4CLRB 3EK2A 4C2AA 3CZRA 2RAVA 5H3HA 4B74A 3H3FA 3S1AA 3ZGLA 1KI6A 3EEBA 4RGVA 1E64A 1GL9B 3UPUA 2IEIA 1MO3A 2NU9B 4C6HA 1E3SA 3PE3A 3DYBA 2P40A 4NMMA 4QBHA 3CLHA 1CBUA 1AIPA 1SCJA 1SXHA 3PCRB 4RVFA 1AA6A 1TAHA 4RANA 5D7BA 1IK4A 5JH7A 3PENA 3KX2A 5F9HA 2C2BA 3G9UA 1YZ3A 1JE0A 2JATA 4OOEA 4DNQA 2O8FA 3NWJA 4HQOA 2R2GA 4KXMA 4AUNA 3RF7A 4D7AA 4E5VA 2VP0A 1LC0A 3GQVA 2A67A 1HYEA 2R97A 2HSGA 2RKBA 4IVQA 1L1QA 3OE4A 4V0SA 4BFVA 3F5MA 2ACVA 2E37A 3C5CA 3G2HA 3QKSA 2Q49A 5ALUA 4I55B 4M98A 3ELWA 1JW9B 3FPKA 1DUVG 1Y5MA 3HP1A 5IAAA 2GN0A 2JA2A 5HZHA 2DTDA 2BDTA 1JYFA 4NABA 3WLAA 5CBKA 3H4VA 3JPYA 1KVQA 3D3WB 3VNRA 3N58A 1M9NA 2QN2A 1RPJA 2NTYC 2R79A 3OECA 1YL7A 2JD0A 4B3RB 2BEKA 2RG1A 3LCVB 4ZCLA 2BFAA 4ZYXA 2UXBB 2VQSA 4P5EA 5B58C 3TFWA 4P5DA 3GUVA 4Q3NA 1NVBA 3RODA 1XTRA 2RGNA 2JBWA 4E94A 4F3KA 4ZV9A 4CM9A 5BXQC 1YJAA 1DMSA 1QV9A 4IIUA 3OAAD 2EL9A 4ES6A 1A4RA 1ZA2A 2X9QA 1WUJS 1PLJA 1NJ2A 1ESCA 1MORA 2GLXA 3RU9A 1D6MA 3GCDA 3TKLA 4BVFA 1Z18A 1PW7A 5DW0A 5IJWA 3TG2A 2FAXA 1GADO 2PGXA 4WJZA 4CM1A 5E4TA 3SC3A 3W06A 3IUMA 3N2YA 1G3IA 1DRWA 1NW6A 1OGJA 2BCEA 2G25A 2WP8J 1QFSA 1W48A 3ELYA 1IZZA 1EVQA 1RLTA 1VE6A 1YUMA 3OTHA 4ZT5A 1AVTA 3VU3A 2KSQA 4CMCA 2OHHA 3K70D 3QSGA 16PKA 3LRXA 2H2AA 4X90A 4WK2B 3IAXA 5LQNA 4PIMA 1YRAA 2BZSA 3LWNA 3UMCA 2ZYGA 3R3VA 2QVYX 5L40A 2FCAA 2NZUG 5JZ9A 1EUDB 4J49A 4L6IA 4DDHA 2K2QB 4EHBA 1PJ2A 2JFVA 1M6VA 4QNNA 1JJBA 3N0XA 1G7SA 2FZGA 5HZMA 5I45A 4WESB 1PR5A 5HS6A 1M2VA 2O14A 5TSDA 1KH1A 2UZ1A 3E3MA 1K7YA 2I34A 2XNCA 4XUEA 1IRIA 1I2AA 1MAHA 1Q6ZA 2EOAA 4PZUA 5GONA 1D2HA 4KO2S 1IXSB 3C3BA 1X7HA 1T6ZA 1G3MA 4BO2A 4JZKA 3RK0A 3UWMA 5KIAA 1VG1A 2ZRKA 1A8SA 2F43B 3BCSA 3HRKA 3IDSA 3RIGA 4O4HB 3KK0A 4MQEB 2C88A 2VPTA 4GXRA 1R2QA 1QZZA 2J32A 5A05A 2PFKA 5AI0A 1IL0A 1NNSA 4BNVA 3ELBA 2GZDA 1L7EA 3QPCA 1RYEA 4RJKA 3MUEA 5IVHA 4N48A 4TXLA 1BJKA 3DXXA 1E7WA 2HMWA 2BMWA 2E7ZA 5CG1A 5KNBD 4GDFA 1MX1A 2J5XA 3IPRA 4LMPA 1JDUA 5EHQA 4ZD6A 4BWFB 1FFXB 3WL6A 3TGLA 2PH7A 3FYSA 5DGCA 4C9BA 5IJ0B 3EVZA 4E09A 10MHA 1U3TA 4B2PA 1TK9A 5C81A 2PZKA 4OMCA 3HXOA 3F47A 2GUWA 2JHCA 3ZWNA 3CV3A 3G9ZA 2ZUEA 1ZM2A 4IZHA 2QL5A 2BVNA 2D7JA 4RELA 3B36A 5HF6A 3BZBA 2X0IA 2Z98A 2BRUA 1ML3A 5SYNA 4L5CA 4MEBA 3DOCA 2EBFX 4E5SA 3V3TA 3VYSB 1Z5ZA 3RFUA 4HDSA 2NO1A 2OYRA 1GPKA 2A1UB 4C21A 1M0WA 1VBFA 4KG7A 1OXSC 4E1VA 2OKGA 3WAKA 5C51B 5AKZA 2DWPA 3CR8A 5FTJA 4ER6A 5KZMB 1YE8A 2PR7A 1S8OA 2QEQA 3OLYA 3PEUA 5FORA 5BYBA 1EXVA 3FYUB 1LY1A 2GH1A 3TQCA 4ZGWA 1CUIA 1QAMA 4CEJA 1FQOA 4CTKA 5IFKA 2PX3A 1H6BA 4KCGA 2C78A 3C6ZA 1XA3A 2HXGA 4FMCB 3ROTA 1G3QA 4FYYA 2XCQA 2D8AA 5C7OO 4DG8A 1ZCJA 1RD4A 2YJZA 5A6SA 1YFKA 3I2GA 1P17A 1Z39A 2D7DA 2APJA 2V7QA 1U2GC 3EGDB 4Q01A 2A86A 1FP7A 1E18A 4H3KB 1AZTA 3SSAA 1FSFA 1UJNA 2WR8A 4JBLA 4RL6A 5DCUA 1V48A 1JKFA 5DYYA 3U3XA 4BQRA 4TVSA 3PDIA 4ZHSA 4OI0A 3WKCA 1GTJ1 1OROA 5HCUA 2DETA 4JHLA 4PLTA 2VPXA 4HWPA 1M8PA 2Q3FA 2PMFA 4MQFA 3WA6A 1ZMTA 1Z4IA 1XJ5A 2KBFA 3BZWA 3HKCB 4BJ5A 5FOUA 1P9WA 2XUQA 4RD4A 1E60A 3MS4A 4YGXB 4KH0A 1DT3A 2JHAA 2RBGA 2GPBA 1A7KA 3Q87B 5EP2A 5IK2D 4E32A 5K6TA 2W6ZA 2WDPA 1R4NA 2AEFA 2QTNA 4OFZA 5FO1A