3UKDA

Ump/cmp kinase from slime mold complexed with adp, cmp, and alf3
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
191
structure length
191
Chain Sequence
SKPNVVFVLGGPGSGKGTQCANIVRDFGWVHLSAGDLLRQEQQSGSKDGEMIATMIKNGEIVPSIVTVKLLKNAIDANQGKNFLVDGFPRNEENNNSWEENMKDFVDTKFVLFFDCPEEVMTQRLLKRGESSGRSDDNIESIKKRFNTFNVQTKLVIDHYNKFDKVKIIPANRDVNEVYNDVENLFKSMGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of active conformations of UMP kinase from Dictyostelium discoideum suggest phosphoryl transfer is associative.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
molecule keywords URIDYLMONOPHOSPHATE/CYTIDYLMONOPHOSPHATE KINASE
total genus 73
structure length 191
sequence length 191
ec nomenclature ec 2.7.4.14: UMP/CMP kinase.
pdb deposition date 1997-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ukdA00
2FN4A 2H5EA 1JPNA 1AS0A 4UXIA 3PR1A 3A58B 1SKYB 2OE2A 4XWAA 4Q01A 2G83A 1QG4A 2RB4A 4PQFA 4Q7JB 2J87A 3GEHA 1S9HA 4QOSA 2AN9A 2GF9A 3HPRA 3M6AA 2FX3A 1U9IA 1YR8A 5FUYA 5JHGB 3ADKA 5L3SB 1IXSB 1G4UR 3CUEF 1HE1C 2OILA 5SZIA 5BQ5A 221PA 2ORWA 2QQ0A 2OV2A 3ZIAA 2YOGA 4B76A 1YR6A 4Q1AA 1E1RD 2ZROA 4A2PA 4RFVA 3Q5EA 1KHTA 3NKVA 1EXMA 5C46F 1NMXA 1E2EA 1E2JA 4ZI3A 3TVTA 4LYJA 3MUFA 3VQTA 1JR3A 1AS2A 4BLSA 2PZFA 2AWOA 1N0WA 2MMCA 1AKEA 1CRPA 3O8RA 2X8AA 4I81A 2O8FB 2WJVA 2WHXA 1N5LA 1NSTA 2O8BA 4B3BA 3AF4A 2ZUCA 4BEJA 1K6MA 4A8JB 2QZ4A 2Q6TA 3I62A 2BKEA 2Z4RA 1RRCA 5TDHA 3FPAA 4DC9A 3TUZC 1XB2A 3UK6A 1LW7A 5D3QA 2XNDA 2MSCB 4X8HA 4D81A 2ZRDA 4K81B 1G7RA 1U98A 4OI4A 1RC8A 1HQCA 1Z5ZA 2DY1A 2W6ID 4TMXA 3W6NA 4GZMA 1NG9A 2G3YA 3G0HA 4IOJA 5BW8A 3T1OA 3CPHA 5FL3A 4DRZA 2BMJA 3L43A 4P4SB 3WBKA 3K70B 1EX7A 2ZI6A 2IF0A 4BWYA 1P61B 4M1KA 3SR0A 5E3HA 1CF4A 4ZV4A 2ZRFA 2O8FA 3PENA 1OXXK 3IBYA 4Z8XA 1GFIA 4M1WA 3UMRA 2CJWB 4NYIR 2I3BA 2H18A 1EWQA 1W44A 5CJPA 2Q3FA 4L5BA 4JL5A 1RVDA 1XFAA 5C2JB 2IYVA 1DADA 2BM0A 3ND8A 3QF7A 4HLQB 1WXQA 2ZQ5A 1S2MA 2OM2A 4IOLA 1YQTA 2FA9A 4S2EA 3REGA 4XWOA 4LDJA 2WWFA 4US0R 3RDPA 1ZUHA 2ODNA 4UXHA 4DCNA 4JYCA 2IEZA 4M53A 3C7KA 1LS1A 4DDWA 2Q3MA 2WJIA 4QBGB 3B6EA 3A8TA 2JJ2D 4JJZA 1RPZA 4QG7A 4RZ3A 2R9VA 4H1VA 1EFHA 1SXJE 4BFUA 2WKRA 4NL4H 1OB5A 4I1VA 2HT6A 5AJYA 1ZD9A 3A1SA 4Q4JA 3KKQA 1BMFD 2G88A 1FZQA 2CHQA 2V7QA 5EP2A 1Q3HA 1T4GA 4Q1EA 1TPZA 1G6OA 2IBMA 5F9HA 3Q8XB 1CU1A 1H8EA 1IOZA 4B6FA 2QBYB 2GETA 4OK3A 5TMPA 721PA 1DG3A 2LWIA 5FTLA 4BE7B 3KTAA 4DEYA 1BKDR 5FFMA 3PJRA 2QPTA 4Q9KA 1OF1A 3KQLA 2ZR9A 4B44A 1CKEA 5K8TA 5JRZA 3D7MA 2CLDX 3I4LA 1OW3B 4U5XA 3CR7A 3SYNA 2IHYA 2ZRIA 1XXHE 2QP9X 4IW3B 1N0UA 5SZJA 2HDNB 4RD0A 2IYRA 3CIOA 1R2QA 4PPFA 3ZVMA 4MKGA 3GJ3A 1SVWA 1U0JA 2QE7D 2WKPA 2RGNA 5KUTA 3VX3A 2H17A 5KTYA 4DJTA 4DLSA 1VG8A 2ZJZA 1EK0A 3C4JA 2KI5A 1DEKA 1AZSC 4OL0A 3T12A 2P2LA 2QMUA 4Z1MD 2VIIA 2WPDD 1NN0A 1O87A 1G7SA 2B6HA 3GD7A 4R9UC 1Z0DA 1BS1A 4E03A 5GVRA 5C4MA 5B2ZA 5IRCD 4PHFA 1TU4A 1CJMA 2GJ9A 2H92A 1VKJA 4P0TA 2ODBA 4DCSA 2RGEA 3GLFB 1OXTA 1P75A 3LDAA 3NC0C 2Q9CA 4A0GA 2BEKA 2VHTA 2C03A 4Q4AB 1X8LA 3ZGXA 5FPKA 2XGJA 1II0A 3NEJA 2WMOB 3FVQA 5AK0A 2CL7X 2GJKA 3WBJA 1N5JA 4FCWA 3BGWA 4NCKA 1A4RA 3QF4A 3C5CA 4BEBA 1KAGA 4U00A 2G77B 4Q7LA 3L0SA 2QPAA 3RS4A 5JECA 1CBUA 1YKSA 3EARA 1US8B 1NKSA 1QHNA 2IYYA 4HZUB 3B2EA 4R2IA 1IBRA 4ZDIA 3RS3A 3B1YA 1KDTA 4PTLA 2OLKA 4NONA 1N6NA 5DHAA 1KYIA 1P9NA 3KFXA 3ASYA 4ZO4A 1OH8A 5DI9A 1ZBDA 2CHVA 4NBSA 4OJQA 5DLQC 3E70C 4OKSA 2IYWA 3UWKA 2F1RA 2V9PA 2R6FA 2CEAA 3K9GA 4LCBA 1L4UA 3O8DA 2YWFA 5HZHA 3ZZ0A 4JLBA 1L7VC 1M1YE 1KDRA 5L3QA 2BOVA 1GITA 5EZ6B 1E9DA 1HE8B 2QG6A 4MRSA 3JVVA 4QBFA 4EIWA 3SU8A 2NQ2C 2RAPA 4XD7A 2ASEA 5J4LA 1SVLA 2ZPTX 1IXZA 3N2EA 2ONKA 4BQSA 3UG6A 4A15A 3NTUA 4JLVA 3ZQJA 2G0TA 2GEVA 2Q0HA 4M1TA 3P20A 1KI7A 1QHYA 4FINA 2ATVA 3EZ7A 1X1SA 1Z0IA 3O8CA 5FBWB 4K46A 4HAXA 5EQTA 1S3GA 1KDPA 1YRBA 4JBWA 3QKSA 2IF2A 3KQNA 4GMXA 4XVUA 3TVDA 4QHYA 5L3VA 2ZI9A 2FWRA 2R6GA 1OFTA 3TQCA 2CCKA 1NVXQ 5EUMA 1W0KD 3AUYA 1VDZA 2IWRA 3SQXA 2DCUA 4TYPA 4TMKA 3K0FA 1SHZA 4JLMA 2ZJ8A 3TUIC 2ZJYA 5IK2A 4CEIA 3CKLA 4LHWA 5CB6A 1KK0A 2XB4A 5HKKD 3R7WB 4LI0A 4RJLA 2O8DB 2ZJ5A 1W0JA 3K0AA 2FZ4A 3TAHA 1U0LA 5ANRB 1PV4A 3W8NA 2I1QA 1E2FA 4JLNA 2IYSA 1P6XA 3TIFA 3MRSA 1FTSA 4DSUA 1P9RA 3E2IA 4YQFA 1GWNA 4WXPA 2JLZA 1Q12A 1GM5A 3JZAA 3PFIA 2ERXA 3KQHA 3IDQA 1Z0FA 1S1CA 3ASZA 4KFRA 3SJBA 3I92A 5DHFA 4EUNA 1II9A 4L9WA 1J7KA 2FOLA 5LB4A 2O0KA 1OT3A 1PZNA 4Q66C 4XVQA 5DN6A 1E0SA 4Q9JA 1G8FA 2ZR7A 2X19A 4JBYA 1ZM4A 5M04A 1E79D 3LNCA 4YMWA 1E2DA 1T3LA 1XMVA 2BV3A 3LWNA 4JVSB 3LW7A 2Z5FA 3LLUA 2OG2A 3F5FA 2W6JD 1GAJA 2ZAOA 5CDFA 5FH9A 4LOAA 3TAUA 3BB4A 4LJ5A 4B74A 4KFUA 2PX3A 3FOZA 1DO0A 4C30A 4LYHA 4URZR 5E7MA 1A5TA 2NO9A 1DAKA 5KU1A 4LJYA 2QEQA 2R44A 5H70A 3VU9A 1TUEA 4B2LA 1WE2A 3EPHA 1T3HA 2NZJA 1MH1A 2OXRA 2BJWA 1SXJD 3U3MA 2ZR0A 4DLWA 5E95A 2PT7A 1AGPA 1ZM3A 3B78A 5A0FA 1NBMD 2ZUDA 1WP9A 3CX6A 4Q18A 5JWRA 2F1JA 5IK2D 2P5SA 3RNLA 3ICEA 4FMBB 2IS1A 3I8XA 5AR1A 5JEEA 5DI3B 4NZYA 5HKKA 2KSQA 2VLIA 1E9AA 1GTVA 3IIMA 4XTCS 3C16C 1ZUIA 3AB3A 4KLZA 2AXPA 4ZKDA 5GJVC 4UNNA 2GXAA 4LJ7A 2P67A 3DZ8A 2GBLC 4P4SA 4PC6A 1HV8A 2BBSA 1KSGA 4EPVA 4EPTA 4EFNA 1UPTA 2ZEJA 4Y0AA 1OXSC 2OBLA 2Q9BA 4UKDA 4NYJQ 3TNFA 4B47A 3SJCA 2C78A 5LD2C 2IYQA 4JKYA 4KXFB 1ONBA 2WAXA 3UWOA 3TW4A 4A1FA 1MO5A 2A78A 3WY9A 3DKVA 3AEZA 4IFBA 2BEJA 4HSEA 1LY1A 2WWYA 2B21A 4OQMA 1Q1ZA 3LX8A 5C4GB 1OSNA 2C9OA 1OHHD 4MITA 5J4VA 3TSWA 2LKDA 3FHCB 2F3RA 3T35A 2ZSEA 1F6BA 3SBDA 2W00A 3U3JA 2XSZA 2VO1A 4IDNA 5JSZA 4QXAA 3H86A 2GJSA 5EP4A 1M8PA 1R7RA 1ZYUA 1YZQA 2CK3D 5FPTA 1OXVA 5JCZA 1F2UB 4AWXA 2QMEA 2F3TA 4NCNA 1C9KA 1J8MF 2B8TA 2J7PA 5AUNB 1XPOA 3EZFA 2O8CA 1ZUNB 4GL2A 4C0SA 4QBHA 1YZNA 1P4SA 3U6BA 4QHSA 1BMFA 3BE4A 1GP2A 1SQ5A 3BORA 4R98A 4V0KA 1Q20A 1M2OB 4JL8A 4PO1A 3GLGA 2N1BA 3I32A 1DTSA 3RHFA 4QRHA 2BCGY 4Q47A 3VR3A 3WXMA 4BFXA 3AKDA 4HAWA 1VYUA 4PX9A 1SXJB 4BZXA 1XCGB 1RRPA 3T5DA 2JLUA 4Q9LA 5FUWA 3RYTC 3EWSA 5SZHB 2Z83A 3W3AA 5FBQB 1QHXA 3KUCA 1NN5A 4BFTA 1OE0A 2C95A 4ZCIA 4N0EA 4B3DA 3LO5A 1YRAA 1WB9A 3THYA 1NNEA 4TZ0A 3N70A 2QU8A 2ZU6A 1FP7A 1ODFA 1G8YA 2OFWA 3EPKA 4CEJA 2CLCX 4JT4A 4PQRA 2H1LA 3VKWA 4F4JA 1XTSA 2EYQA 4QJ5A 1Q0UA 1C4OA 3A1TA 4RZXA 1TNDA 2GILA 4OI1A 4P4TA 1HYQA 3ND9A 1JAHA 4Q1CA 3P27A 1FPMA 2JATA 4LV5B 4PR0A 1NLZA 4LJAA 4MDEA 3LFUA 4B6EA 2AX4A 1YHNA 1TMKA 3OEED 4NMMA 1MT0A 2HLDD 3BH0A 2W0SA 5IHPA 2JIZA 1I4LD 2ECKA 4FCTA 4V02A 2GXSA 4M9QA 2QM7A 4MDFA 3F8TA 1FQJA 3SYKA 4WBSA 2XB2A 3ADBA 3M4YA 1KJWA 4RCZA 4TLDA 3ZD6A 3VU9B 4DWJA 5J4HA 1N6RA 2VP5A 1XPUA 1XTRA 5FOWA 3CZPA 4JLAA 3QEOA 1IAQA 4TLEA 3QI2A 1S3SA 4D0LB 4GP7A 3CNNA 4LYAA 3SDZA 1UBEA 3PEVA 4Q03A 5FOSA 3H1TA 3B9QA 2ZJ2A 4PQYA 2AHOA 1M7GA 3LX5A 3QNUA 1NLFA 2H7VA 5EE3A 621PA 4URXR 1G18A 1JR6A 2QTVB 2FEOA 2FU5C 2J5XA 3U3OA 3HU3A 2KBFA 4QJ3A 2V1XA 2UZIR 3RSOA 4PHTA 5C1BA 5BN5A 4LJ8A 3MWJA 5E4FA 3GFOA 3P1JA 1EGAA 1UDWA 3GEEA 2QSZA 3BH6A 4BFWA 421PA 4P4UA 1KJZA 1VG9B 3BS4A 4LBZA 1R0WA 2N42A 5GJCA 2VTKA 5J47A 3NHBA 2QQEA 1BO6A 1RRFA 2VA8A 1HQYE 3LD9A 4TMTA 3U44A 1JJ7A 2ZXUA 4G5RA 4UNPA 1XRJA 1XP8A 2JLVA 2B7CA 3IILA 1MR3F 2BMDA 2QL6A 4DSOA 1W4BA 2OUKA 1FMLA 2BKUA 2I1VB 4C9BA 1P2VA 4PAMA 3AP2A 5D3MA 1U81A 1E9CA 4FN5A 3IQXA 4E22A 4DDVA 1KO7A 1P2UA 1CIPA 1G3MA 3I3SR 4DLTA 2WJJA 4B73A 1KAOA 2V54A 4DT1A 1JECA 2ODEA 2ZYVX 4TL8A 3OEEA 4GBMA 2A2ZA 1LF5A 3E1SA 3GJ5A 4EDHA 4Q19A 1D2MA 1KJYA 4UNSA 3VHLB 4DDTA 4AKIA 2JJ1A 1ZP6A 4FMDF 4E07A 3UKDA 3DKPA 3IBGA 2DPXA 2J0SA 1HUQA 1E1QD 3AP1A 1JXMA 3PUWA 4ARZB 2V1UA 2GDJA 4BFSA 1ZD8A 4R71A 4ESVA 2CNWD 1KSHA 1VG0B 2GJ8A 1CR2A 4MKFA 2NG1A 4IOMA 4DLRA 1XEWX 1NLYA 5JFGA 4PO8A 4WVFA 2NPIA 3WNCA 2VP0A 3WYAA 2J41A 3EC2A 3KKOA 3QG5A 5B64A 2ZUBA 4MYUA 4A0FA 2J45A 1OLOA 2PL3A 1S8FA 4B75A 1FX0A 4QNMA 1FOEB 1YE8A 5TV2A 4A92A 1H8HA 1R8QA 5J40A 4HATA 3QOFA 3WYFA 4D26A 1II8A 3WMGA 3QE0A 1V5WA 4A2WA 3W8RA 1MKYA 3GJXC 2GXUA 2OCYC 2REOA 5DIFA 1FW6A 1G3IA 3DM9B 3TGPA 5DYGA 4DVGA 3L8YA 3RC8A 1CJTC 4RD6A 1Z6TA 1AGRA 2ZANA 4GT1A 1N6HA 3CRMA 2KE5A 1OB2A 1CTQA 1DAEA 1ETUA 1VPLA 4IDPA 5IF9A 4JKIA 3U7GA 5F98A 3VAAA 3ZIAD 5J4YA 1TF2A 3VR4A 4LY6A 3NG1A 3A1UA 1R5NA 1KO4A 4F4IA 4KVGA 2ZS8A 4ZCLA 2A5FA 5FI0B 5DE3A 4C2UA 4O2LA 4C0BA 3GLIB 2WWGA 4A36A 4MRVA 1ESNA 2QROA 4KYIB 1EFRA 2QRNA 2W6JA 3P26A 3WRXC 5DNYB 2CCJA 2YHSA 1JJVA 1KO1A 1TF5A 1WCV1 1JEEA 2CXXA 3CONA 3FWYA 3GJ8A 4IDOA 2RGGA 4B35A 1OV4A 3QBVA 4MQBA 2AXNA 4AG5A 4KYUA 1ZCBA 2PEZA 521PA 3TKLA 4C2TA 1Z6GA 3SZRA 4IJMA 4NYMR 1G4AE 5UKDA 4E09A 2GA8A 3R9WA 2B7BA 5FBRB 1GOTA 3UMFA 3W5JA 1LV7A 1CJKC 1NBMA 4A6PA 1XXHA 4A9AA 3BB1A 4D4LA 1Q1EA 3JVUA 1N6IA 3IPYA 4OQNA 1Z8FA 2J0QA 1W1WA 2P6UA 1Z0JA 1E2GA 1YZUA 2R65A 1G8PA 1SVSA 2PCJA 3AGPA 4FW9A 3T34A 1XPRA 1Q21A 2HYDA 1JQJC 4BFYA 3U4QB 3JZMA 6Q21A 4L8GA 2ZRNA 1NY5A 3MAAC 1G8HA 5AJZA 4XTRA 2A5DA 3ZYCA 2REBA 2IC5A 3B82A 5CK5A 3SFVA 1PUJA 2ONJA 1VHTA 2WSSD 1TAGA 1YZGA 3OE7D 2H16A 3AKCA 1Z22A 3HYRA 3FMOB 5HTKA 2IX3A 4ASUA 1D2EA 3BOSA 2WOOA 4QHTA 3SNHA 3WRYC 2FPLA 5EUQB 1OPXA 4QGGA 4TLBA 1SULA 3PVSA 4TN1A 4HAVA 3NEYA 5K8UA 5G53C 2PMDA 4RZUA 3HP1A 5KHOC 2QP3A 1UBCA 3W90A 4LC0A 4LHYA 1XD8A 3X1XA 3Q72A 1MOZA 1UFQA 3V4RA 2VYFA 1CP2A 2JIZD 1GNPA 2HCBA 4B48A 2O5VA 3EPLA 3W6PA 3T1VA 4JMPA 1KMHB 1HT2E 5G41A 4PXAA 4W5WA 2C9CA 1QHHB 2GZAA 4G3XA 1T6NA 1G7TA 5AJVB 4ZDKA 3THXB 1T8UA 1XMJA 2C9YA 3BB3A 3HYTA 2YJTD 2YWGA 4YDSA 1Z63A 2DR3A 2GCPA 1W5SA 2ZYWX 1OIWA 3QPUA 4AYXA 2OESA 1IN7A 4OHYA 1AA9A 4I4LA 4PC2A 1XD2B 3L0OA 1NVWQ 2QE7A 3EZ2A 3HPQA 4PPNA 4RCYA 4CT5A 4PO9A 2Z4SA 4B2IA 4KODA 3PIRA 2OXCA 5JS8A 2EFCB 4XH9B 3RLFA 1FFHA 5FI1B 1GL9B 2XZPA 1Z6AA 2O0HA 3C15C 3NDPA 3X1WA 1HT1E 1XX6A 3THWB 3CRVA 1N25A 3QG1A 4PPQA 1CR1A 4FD2A 2DFLA 1AKYA 4FWIB 3SN6A 1VECA 1M34E 1KK1A 2EFDB 2XJ9A 2GCOA 1OIXA 3A1WA 4L15A 1ZRHA 2YYZA 2VF8A 1EFTA 5JWHA 2WIBA 4KVAA 4PANA 2QY9A 4WXRA 3MGCA 3OAAA 4Q4AA 5AUQA 2QT1A 4M22A 3S1AA 4CIDA 3LW8A 5CB8A 3HU2A 3Q85A 4TMZA 3QXHA 4BLPA 5CDFE 1OH5A 2YOHA 3HR7A 3I72A 3MWYW 3A4NA 4LBYA 4TWZA 5F9FA 2HLDA 1KZGB 1CXZA 2P6RA 1OKKA 3DOEA 1UEJA 2IYLD 4N3NA 1T5IA 3DEFA 2IXFA 3RVBA 1UAAA 3K09A 5E7JA 4HAYA 4EPWA 1A1VA 1FL9A 3CM0A 1IN6A 1L2TA 4D6PA 3D6TB 3SBEA 1GKYA 3GLFE 2IW3A 4DUGA 1XDBA 3DVLA 3MG9A 3G5UA 2ZJAA 2VH5R 1WA5A 1TQDA 1DS6A 4GDFA 1DAFA 3IHWA 5JRJA 1DBSA 1MABA 4I1SA 1ZU5A 4M1OA 1P2TA 2F7SA 2HJVA 4IKEA 2O8EA 2W83A 3BD9A 1OFHA 3BC1A 3DHWC 2ZSBA 4LRWA 2J0UA 1E94E 3RRMA 5EXSA 1EWRA 4IHQA 2X77A 1GZSA 3GCGA 3QKUA 2QN6A 2WV9A 2PX0A 2QBYA 3KFVA 3AV0B 3PUYA 4XIGS 1FTNA 2A7QA 2DFNA 1R8SA 2W0MA 1JBKA 4B3CA 2J3EA 4PZYA 2HJGA 5EE9A 3AVWA 3KUDA 1NY6A 4G5GA 1E2LA 1PLKA 1G7CA 4Z54A 2AL7A 4IVQA 1NRJB 1KSJA 1MRSA 1KI6A 1YR7A 3SOPA 4KO8A 5F2EA 5H68A 2D06A 5JHHB 1IN5A 3RRYA 1NL3A 1A2BA 1A2KC 1H65A 3KKNA 4NYMQ 3T5GA 4CEHB 3CNOA 3I73A 3W9YA 2IYUA 1VCOA 3K0AB 2GAAA 1UKYA 1A82A 3R7WA 4US1R 4MGZR 4EFLA 2ZRBA 4M1YA 4PC3A 2LCFA 3RRNA 2R8RA 3PEYA 4NYIQ 1Z29A 1UKZA 1TQ2A 1GILA 2ZRCA 1XJ0A 3QY0A 2ZRKA 2YWHA 4WZ6A 1JR3D 1W7AA 5TXGA 3SQWA 2QNRA 3QKRB 3QQ5A 3VR1A 1OIVA 4S35A 1ZNWA 3GPLA 3THXA 4DLZA 4HLUA 5EE0A 4OK6A 1W48A 4JLDA 4D4MA 4HB0A 2W2TA 3VX4A 3DM5A 3TQFA 3AVQA 2WIAA 4KSBA 4L4UA 5HZKA 5KDDA 1E9SA 3KB1A 3A6PC 2OFOA 3SJAA 3CH4B 2CLSA 4AKEA 1U8YA 1I4TD 2FSGA 4LSGA 4Q1BA 2X2FA 3G82C 2AD1A 2Z43A 4IVRA 4IXMA 4JBXA 3KX2A 3RS0A 4D82A 3B7GA 4D0NA 1XD2A 4HYYA 1XTIA 5TY0A 5CM8B 3SI7A 2PBRA 4JS0A 3VR5A 4FWTA 3TSOA 5J4KA 2FMXA 4GMDA 2NGRA 1K5DA 3CWQA 4GP6A 4L16A 4DHEA 3THWA 3SJZA 3PEWA 2UZ3A 5JMTA 5KO2A 1NBME 4X8MA 1B0UA 4ZIRB 2VP4A 3H0KA 1G20E 2ATXA 5A4JA 1E1RA 3KDSE 5AJWA 4EJSA 1RYHA 1OXUA 3QXSA 4CW7A 4DCTA 2EVWX 2DFTA 1M6NA 3C5HA 2VF7A 4P33A 3B8HA 2ORVA 2WJGA 1KDOA 4JLPA 4OHXA 2OHFA 3VR6A 3SFZA 2ZE6A 2YINC 1KI1A 3V9PA 5KNDA 2JLSA 3LH5A 2WTUA 4ACAA 2P5TB 5DI3A 4GSYA 4A4DA 4C0HA 3CR8A 4AY2A 3EA5A 1OHHA 1M74A 1KI2A 2W2XA 4NCJA 1YU9A 3IUYA 1XCMA 1DE0A 4WIAA 1QDEA 4YC7A 4I99A 4V03A 1COWA 3FDIA 3QKSB 4HDQB 1DPFA 2CK3A 2WICA 1W49A 4JVMA 3GLFA 4LV8B 4Q21A 3FFBA 4EJSB 1VYVA 2QMOA 5BN3A 2NO7A 1C1YA 1W2HA 2CE7A 1JEDA 1TADA 5L8VA 1AS3A 3NBXX 3NXSA 1CJVC 4Q00A 4R7ZA 3ZZUA 1J2JA 1NVVR 4TQAA 5J5CA 1NI3A 2QAGA 2J0UB 4LC1A 1LNZA 1ZAKA 5CJ2A 2I4IA 1JB1A 1KK3A 2D62A 2F43B 3GQBA 2VRWA 2K5UA 2DB3A 4MYCA 3CH5A 4HDCA 2H57A 5AUOB 1ZU4A 4OHVA 1Q44A 3B13B 1Z2CA 3MFYA 3TBKA 2IHBA 2AKAB 2ANBA 4AYWA 1OYYA 2ZE8A 4Q4HB 1S0UA 3OF5A 3N2IA 1F2TA 2BDTA 4R2HA 1GNRA 2KJQA 4TL6A 4NPHA 2J59A 5JSZB 3REFA 2F6RA 2HF9A 3OIWA 4LHXA 3W34A 1P60A 1KY3A 3CLVA 5HE9A 3BERA 3SE0A 4XWKA 3R9XA 3LBNA 4IXNA 2RHMA 4NP6A 4BRWA 1VIYA 1SVIA 4TT3A 4M21A 3FGNA 821PA 1NP6A 2WMNB 4G5SA 4I1OA 4LWZA 5BYJA 4HI0E 4TSFA 3P4YA 5HCIA 1VCNA 4URWR 4JLJA 1YVDA 4IDQA 4ZDWA 2FJUA 5LB2A 3DMNA 4HUQA 1IY2A 3KJIA 3SS8A 1Q22A 2HUPA 2MMGA 4ERNA 3J81k 2OZEA 5GVSA 3AVXA 5KDOA 1XU4A 4QKQA 1X3SA 5JBQA 4C0KA 1KGDA 1KOFA 1AM4D 2QGZA 2AR7A 1Z83A 2ZI4A 3KZ1E 1P3JA 4BPBA 2R2AA 1AIPA 4YONB 1MV5A 1NMYA 2HXYA 3ETLA 2W2VA 2BHRA 2ZRAA 2OT3B 4MGIR 5B57C 2GK6A 2RGAA 1G16A 4O0MA 4KBFA 1GRQA 4DZZA 1DARA 1I4DD 2XX3A 5DH9A 3T61A 1ZM2A 1G3QA 4ARZA 2NMVA 4PAOA 1RYFA 3DZDA 3EIEA 2NTYC 4US2R 4OYHA 1E2IA 3MMPA 3CZQA 3ONWA 1NIPA 3GJ7A 3THYB 3MJRA 2PEYA 4OQLA 3ZVLA 1E69A 4RD4A 1SGWA 5KSPA 2HYIC 4HLUC 4Q4LA 1BOFA 4YMUA 2XTMA 1A7JA 1FX0B 4JSTA 3D3QA 2ZRGA 2ZRMA 3K0CA 4BZPA 2JEOA 2WAYA 3WNBA 1W36B 1R4AA 4DXAA 3NH6A 4MRPA 5FPSA 4D4JA 4GI7A 3OIVA 5BXQC 3B1WA 4TMWA 3U5ZB 1SVKA 4DCUA 4M9XA 2XXAA 3S1AB 1RE0A 3NBFA 5GJWC 3R8CA 3QSYA 5A5GA 4JLKA 2QI9C 2A5JA 4QNRA 2GXQA 4W5HA 4B2PA 2Q3HA 2QAGC 4EAQA 4C0JA 2DHRA 3SEAA 1LTQA 5EZ5A 4A8JA 2CMKA 5FTKA 5H1YA 2HV8A 1XJCA 2C2HA 1D5CA 2OCBA 4IRUB 5EP1A 1KKLA 4YMTA 3K53A 3D8BA 2QUZA 1O3YA 4TYQA 2B92A 2GK7A 1ZNZA 1WDTA 1TL7C 3ZQ6A 2VEDA 4KV9A 4BLRA 2YNMA 3C14C 4FIDA 3DPUA 3GFPA 4IVPA 4EFMA 2VPPA 2WWHA 1YZTA 4BZQA 3KB2A 4POAA 5B58C 3CRQA 2KB0A 1CLUA 2REXB 4KJZA 3BK7A 3BWDD 2OCPA 2XAUA 2JLRA 2NO6A 4UJ5A 4Z8YA 1W36C 2GJAA 4E5UA 1E99A 1XMIA 1HTWA 4PC1A 3ZH9B 3TK1A 121PA 2F43A 4NU0A 3U7FB 3GFTA 3DOFA 3Q3JB 3PUVA 1ZJ6A 1IY1A 2D7DA 2IYTA 4LBVA 3I5XA 2F55A 1X8JA 4QGFA 2E87A 2FZLA 5FBLB 1MO6A 1KO8A 2ZSFA 5LD2B 4ZDJA 4U02A 1UJ2A 2RH5A 3QUSA 2FSFA 4M8NE 1EFCA 1XNJA 1XXHB 3IEUA 3D31A 3FMPB 1QZXA 2XOKA 2ANCA 4OK5A 2J1LA 1E2MA 1G3UA 1Q1QA 2VQSA 3K0FB 1G1MA 1G21E 3AF0A 3SYLA 2JGNA 3HJNA 5CM9C 3QJYA 4OQXA 2VHCA 2IS2A 4RVCA 4CEIB 1UF9A 1S4QA 4DIDA 3ZJYA 4Q1DA 4G01B 1R0XA 4C7OA 5HE8A 1F3OA 3I8SA 5B30A 1DO2A 1Y3AA 4W9MC 1KNQA 1M7HA 1RW4A 2QRZA 3KTAB 4MGYR 2BVNA 2ZS9A 3FE2A 2VHJA 4B34A 2V6IA 3EWAA 1P9WA 3QKTA 1U2RA 1UM8A 1TTTA 2RGBA 3QKRA 4Q5IA 2OBMA 4A8JC 2OAP1 3B60A 4TZ6A 1Z6XA 5DSZA 2D7CA 1N5KA 2FGKA 2FG5A 2CNWA 3FYHA 1RFLA 5FPHA 1PLLA 5JWOA 1R5BA 4QM7A 2GWHA 3OEHD 2Z0MA 3IKJA 1KI6B 4G0NA 4RD3A 4WA7A 4WZBE 3FFAA 3ZLJA 4BECA 2VSFA 4NE2A 1G8GA 3RS2A 3BIFA 1W46A 3H2YA 3PUZA 4N1AA 1E96A 3ADDA 1ZCAA 3MJHA 3KXLA 3LLMA 4TYNA 3CX8A 1H8HD 2ERYA 5JS7A 1GDDA 2WZQA 4A82A 4DB2A 1W4AA 2DBYA 3LXXA 8OHMA 1G64A 2FPKA 1KK2A 1VCIA 2EU8A 5FBVB 2FGJA 2WJHA 4Q9HA 1MO3A 2GZDA 2J46A 2BBTA 1KZ7B 4BFZA 3QXJA 3K70C 4YXWA 2G6BA 1JALA 3M0EA 1LFDB 5HCNA 2FNAA 4GNKA 4NH0A 3ZS9A 3R9IA 4F91B 4TT3D 4BASA 3PCRB 5G3ZA 1P5ZB 2CVHA 3GJ0A 4GOXA 2ZI5A 1SZPA 5KSYA 1OH7A 2JDID 4XSGA 1WBBA 2MSEB 4Q7KA 4URUR 2GVDC 3LAWA 4PSVA 1ZD1A 4B33A 3X1YA 1NSFA 3PV0A 5EE5B 1D9XA 3TE6A 3OZXA 3EIQA 5FTNA 1GSIA 1KI3A 4HZUA 4IEEA 3NDBB 3QPVA 5JJIA 4PPGA 1E0JA 1G5TA 2FE4A 3U6KA 4DBLC 2GEUA 1XEWY 1T91A 2RGXA 4HZIA 4PFSA 2MSDB 4OBEA 3CX7A 5EE1A 4Q1FA 5FOVA 3T1QA 2V7QD 1NKTA 1RKBA 4TYYA 2UVQA 4YMVA 1XZPA 5FUVA 1HEIA 3U60B 3AVVA 2OCAA 2YV5A 3NVAA 3NBYC 2BBOA 2FFBA 4W7SA 4PHHA 3HDTA 2HEIA 1JQLB 1M7BA 2A5GA 3MD0A 1TEVA 3IQWA 1FUUA 1XBTA 5DYIA 4LHZA 3W6OA 5C18A 3IHLA 2WVJA 1UDXA 1XZQA 2ZSDA 1H8ED 4CF7A 4B43A 4JZKA 1IONA 1ELOA 1KNXA 2G0NA 5LDDC 2Y8EA 3MWLA 2GCNA 4HB2A 2GEDA 1QF9A 3KXKA 4TL9A 1U8ZA 4OJKA 4BLQA 2P6NA 1UBGA 2ZYUX 4JT2A 1CRQA 1DAIA 1U9IC 4AI6A 1XTJA 1HA3A 4TQ9A 4B3FX 4H9GA 1AQUA 2R6AA 1F48A 1PUIA 1E0KA 3LQQA 1Y63A 1V43A 4GOKA 1W4CA 1JI0A 3O47A 1G291 4KI0A 4DSNA 4MH0R 2VSOA 4U7DA 4HUTA 2AKYA 3LBHA 3THOA 1E9EA 3OE7A 3PITA 1ZINA 1TUIA 2O8EB 1Z28A 1G19A 1L4YA 1CULC 3MWKA 3QXXA 1J70A 2YZ2A 4DDUA 2VHQA 3U61B 4RFSB 2EFHB 3VTKA 5E7IA 4RD1A 1F60A 3UMSA 2GF0A 2BMEA 1I2DA 3F3YA 1IM2A 3HR8A 2BC9A 2C77A 2C5LA 3H4MA 4ZPXA 4DUGD 2EWVA 2J7PD 4ESHA 4TTPA 3CRRA 5GADl 1FP6A 1IN8A 1EX6A 2XJ4A 3KL4A 2ZE7A 2XEXA 5EXXA 3GEIA 4B32A 1E9BA 1WRBA 3GLHB 3ZVRA 1FUKA 1IY0A 3F0TA 4ABYA 4HB4A 4TQUS 4DLUA 1T0JB 1T8TA 4DB4A 1XD9A 1QVRA 4P31A 3TJZA 3PQCA 2V8OA 4JIMA 2OSBA 3GLGE 4X8OA 3AVPA 4LPKA 5F3WB 1W36D 4A0RA 1US8A 1YZLA 2V3CC 3AF1A 1PVOA 3Q7PA 2RGDA 3KKPA 5CIQA 1G17A 3LVQE 1DG1G 3AGQA 3K1JA 5BYKA 3RS5A 2FH5B 3EZ6A 4XSHA 3DL0A 5CYPA 3DMDA 4LJ6A 2QSYA 3RABA 3IPXA 4LGMA 3EPJA 1KO5A 3VHXA 5BWMA 1OKKD 2ZI3A 2PCLA 1E2NA 1KSFX 2QT0A 5SZKB 3GLIE 1QHIA 1J8YF 1TQ4A 1KTVA 2ZE5A 1IJEA 2C98A 1G3RA 4F92B 2GCOB 2JCSA 3DO6A 1HY3A 4LPSA 2F9MA 5EJEA 1P73A 3OESA 4GFDA 1NJFA 2VP9A 3C8UA 4QL3A 1XWIA 2EQBA 3WMFA 1KIMA 3KXIA 2AFIE 4C0QC 1IHUA 3AP3A 4XOIA 3SHWA 2VP6A 4HAUA 3FHTA 1QHGA 1E2QA 2PH1A 3EX7C 1DAGA 5FL7D 4M9SA 3VKHA 1G5PA 1LS6A 3EASA 2NOAA 1K5GA 1TEXA 1X6VA 2DWQA 2PZGA 2ZVQX 4RKFA 4NTZA 1ZM9A 3BFVA 2ZETA 1KI4A 2OLJA 2GBLA 4WW0A 3LA6A 1P62B 2F9LA 4LK2A 2IA5A 4G1UC 4O25A 5BN4A 3V00A 2QMHA 1F2TB 4QGAA 2BM1A 3A4MA 2HXSA 2HCJB 3KJGA 2YOFA 4CDGA 2AK3A 3A1VA 3AKEA 3AF2A 1E1QA 2OFXA 4OHWA 5FUXA 3ZZTA 1MABB 3NWJA 4WOPA 4J0QA 5CIWA 4MYTA 2VL7A 2DYKA 3WYGA 2R62A 4RKEA 2XNSA 3IIJA 5LPNA 4KBGA 1VIAA 4N0DA 2EFGA 3BBPA 1VG1A 1Z2AA 3U2QA 4RZ2A 3K70D 2A3RA 3EXAA 1N0VC 1UKVY 4IEIA 1VYTA 4A6XA 4KSCA 1E79A 1SKQA 3GJ6A 3QIAA 1P2SA 4BFVA 5FR2A 1VMAA 3VMFA 1ZC4A 5IDVA 3L82B 3DDCA 5KNCA 1KMHA 5D3MB 5JEDA 4QBIA 5KDLA 1JR3E 1JXOA 4P32A 5JI2E 4H1UA 2P0EA 1F2UA 1GUAA 1KMQA 4QM6A 1BH2A 1ZW6A 2VBCA 2GAOA 1TU3A 1ZMXA 1ZM7A 2QTHA 4RSGA 2A5YB 3UATA 3B1ZA 4HB3A 4D0GA 3CWZA 2YC4C 2XOKD 1EG7A 2ZYTX 1N2CE 1UBFA 2LKCA 3X1ZA 5DISB 2PT5A 1NMZA 5JZVA 1QBKC 1Z0KA 4AKHA 2AD5A 1T3SA 2NO1A 3KQKA 2B8WA 5DO9A 5G3YA 5IT5A 3VKGA 2OBNA 3RS7A 2O0JA 3L8ZA 4GPTA 2JLQA 2QTFA 4OHZA 3Q5DA 1HH4A 4CT4B 4PAQA 1R0ZA 3V4FA 4GRAA 1AK2A 2CCGA 3ZD7A 4NHOA 4YXWD 1CS4C 3A36A 4AIIA 3CRW1 4MUBA 3B85A 3PUXA 5KSOA 3Q9LA 2OEPA 1GL6A 3MSXA 3E5HA 1K8RA 1R5OA 4PSAA 4LHVA 4ASUD 1WMSA 3EW9A 3U7EB 3HWSA 1WF3A 2GZHA 3SC3A 3UPUA 2DWPA 2FFQA 2N46A 4A2QA 3OIUA 1KKMA 1E32A 2KWIA 1OFIA 4FMCF 5TVKA 1GL7A 1KY2A 4TL7A 1FNNA 2ZAMA 3R20A 1JNYA 3T15A 4DIEA 4MKIA 1S1MA 4I1UA 4MRRA 1Z0AA 2D2EA 3EZ9A 4QJ4A 4W5JA 4FCVA 1VCMA 4LUCA 3CF2A 4V0NA 3CBQA 1RZ3A 2ZS7A 4AYTA 4AURA 2C8VA 2WWWA 1Q57A 1LF0A 3O8BA 2YKGA 1QG2A 2NO0A 2RGNC 2QAJA 3EIHA 4CYMA 2PLRA 3LV8A 4YDHB 3TSZA 1FNMA 2IS6A 3T06B 3EAQA 4DLYA 2JJ2A 2WPDA 3FB4A 4O3MA 1PLJA 2RCNA 1RJ9B 2BIFA 2G1JA 5KSZA 4IDHA 1U0HC 3AVOA 4UXJA 1SVOA 1DVRA 1XEFA 2YWEA 2CJWA 2JA1A 3M1IA 4LJ9A 3VR2A 3CO5A 4DLXA 1EFRD 3WNDA 3FKSA 5KNBA 3LQRA 3LXRA 2EYUA 3BXZA 1IQPA 2XSZD 1RIFA 3ZS8A 1U94A 5AWFC 2GHIA 1E2PA 4LBWA 1T0HB 3AUXA 4DEXA 1LB1B 1N6KA 3LVRE 2O52A 4WAUA 3TLXA 4TLCA 5FOTA 3AKYA 4JYBA 3ADCA 3TH5A 3UANA 3B9PA 1WQ1R 5GJBA 2CDNA 4EQ6B 5HR5A 2AK2A 5P21A 3WHLA 2D2FA 1XF9A 1W5TA 1BYIA 2IT1A 3RRZA 2E9SA 4XVRA 1GRNA 2IXEA 1SVMA 2WJYA 3BJIC 1G5RA 4C7OB 4P3YA 3NH9A 2HT1A 2WWXA 4Q9IA 4O2RA 1W47A 3B1XA 2ZVPX 3GLGB 4ZI2A 3U4QA 1BIFA 2SHKA 4UQOA 1PJRA 1B23P 4HLCA 2VHUA 3WP1B 1XEXA 2F1HA 2QORA 3BH7A 3AM1A 3A37A 4TMVA 4URYR 5KOYA 2D74A 1N3BA 3H84A 2P65A 4M0LA 4BUJA 4TYWA 3BFXA 2W58A 1ESMA 1J99A 3TR5A 5FTJA 2FSIA 1E4VA 1KI9A 2ZM5A 3GP8A 3L0IB 2TMKA 2D3WA 4M4SA 1EFUA 1E6CA 1YZKA 3NC1C 3LRPA 2V4ZA 4G5QA 1E4YA 1L8QA 3L0PA 4BGDA 1Z6YA 3AVUA 3FHOA 1E3MA 3Q7QA 5LBIA 5L3SA 1RRGA 4ILEA 3UG7A 2EW1A 4Q48A 3WP0A 3KKMA 3QVVA 1W0KA 5EP3A 3RC3A 1S9DA 4KAXA 4YMSA 3FKSD 3K9LA 1XEXB 3LBIA 1D2NA 1ZC3A 1GNQA 1Z08A 2PZEA 2V55B 2Z6VA 5FOUA 5FPYA 2PMKA 4ACBA 2RGCA 3QXCA 2NPFA 1SHKA 2C96A 2RMKA 4V0MA 1GIAA 4UJ3A 4D25A 5G40A 4KU4A 1NG1A 2CE2X 2WKQA 3SHFA 1Z06A 2FPMA 2ZRLA 1TX4B 3AF3A 3QENA 4FI3C 4B71A 2JAQA 5TARA 3RWOA 1QHSA 2WWIA 3PEUA 5DGXA 2ZITA 4V0OA 3U3RA 3NIBA 3B1VA 4NYJR 2H8KA 5EXPA 4M1SA 1NJGA 1U8AA 2BWJA 2QPOA 2DWOA 4AG6A 3GLHA 2PJRA 1SXJA 1LVGA 4HLDA 2IK8A 2QA5A 1DAMA 1AQYA 1HURA 4ON9A 2D4HA 2X1VA 5DN6D 3WHKA 2IXGA 2J7KA 2XXAB 2E1RA 4OI0A 2ODWA 1NN1A 1G41A 2ZJBA 4FXPA 2C04A 1AZTA 1P7CA 4HEJA 2WBLC 3PXGA 4D2IA 3AVTA 1GKUB 5JI3E 1RJ9A 3FMIA 1T5LA 3K0CC 1VTKA 4EPYA 4AKGA 2ZRPA 4CVNA 1XCPA 2XITA 4PZZA 4CGZA 2VP2A 1IXRC 3CB4A 4C3ZA 1X8KA 2QP4A 3LY5A 5FTMA 5K8IA 4QFMA 4ZIRA 4KITB 1CEEA 4PSKA 3OEHA 3W3ZB 3ICQB 5FL7A 3AQ4A 3U3KA 4AK9A 4D4KA 4V0ME 2FEMA 4TTRA 5JLJA 4Y0VA 4MGKR 2ZSAA 2P3SA 1E2HA 4K8OA 2F1IA 4ZCMA 3I61A 3NBZC 3EG5A 2ZIAA 5JJKA 3EC1A 4DT1B 3X2SA 1XJQA 5FR1A 2XTZA 1GG2A 3C41J 3KJHA 4PC7A 4AD8A 2GVZC 4LV6A 1UEIA 2GNOA 4FMCB 2XNDD 1N6OA 4DKXA 1DELA 2CL0X 3K09C 1F5NA 1P72A 2GTPA 2W6IA 4HUQB 4F7WA 2CHGA 2YVUA 1SKYE 3K9NA 1XTKA 1G9XA 3R8FA 1Z07A 1G6HA 3CF6R 4JVNA 4UNQA 3VFDA 3CF0A 3CPEA 1JPJA 4BLOA 1GRRA 4II7A 4PZLA 5EXTA 2IWHA 3OFNA 5KPDA 3AVYA 3A4LA 1N5IA 3ZDQA 1GKIA 4X8LA 1XMSA 3RSLA 4MRNA 2G1KA 3GLHE 3UXMA 2NZ8A 2IUUA 1SXJC 2ZI7A 3OHMA 1YJ5A 4FMDB 2CBZA 2O8CB 2V6JA 3W5IA 3P32A 5AJXA 2A9KA 4NCHA 2Q21A 2CL6X 4MKHA 1Q3TA 4Q4JB 1E0AA 4OQFA 3RWMB 4F38A 4DLVA 1II8B 5K8LA 4ITRC 4TTQA 4KFSA 2JJ1D 1I2MA 2QAGB 4MYHA 1U90A 4C0LA 5JCPA 3BRWD 3U7HB 1NVVQ 1W4RA 1Z3IX 2FFAA 4Z51A 1ZIOA 3OFND 3X1DA 4HDOB 5CITA 2JLYA 4L9SA 4F4CA 1CJUC 5TB5A 2IUSA 2JJ8A 5H8WA 4M2LA 3T1TA 1D8TA 4A0HA 2X2EA 4LX0A 1ZVQA 3K9HA 4WZAE 4CRWB 1R6BX 4G5OA 1JAIA 2WM9B 2QGNA 2IYXA 2ZRHA 4NCIA 2ZRJA 3EA0A 3OIYA 4C0AC 4NDZA 1OH6A 2WSSA 3ZVNA 1Z47A 3KJEA 1NN3A 4RFSA 1D6JA 4Z1MA 2YC2C 3KQUA 3FMFA 4LYFA 4DSTA 2WOJA 4C4PA 1DOAA 2IS4A 3CNLA 2PJZA 4CEJB 2OO7A 2GRJA 5L3RA 1QVAA 4KHZA 1N6LA 2QENA 3IIKA 1U99A 2R6CA 4MA4A 1DAHA 2AWNA 4QC2A 4JJKA 1COWD 1TF7A 2DFKB 3MLEA 4TSFD 1BYUA 2OAQ1 2FF7A 2IUTA 1ZNXA 3TW8B 3B5JA 2PLFA 2JLWA 1R10A 4RY2A 2WSMA 3QVUA 3QPWA 3I5YA 5L3QB 3FTQA 5ELXA 1ZNYA 2HF8A 1OYWA 3K0EA 1WBDA 5AUPB 1KI8A 3IO3A 2ZTSA 3QF4B 1MO4A 2EWWA 5KYKA 4QGHA 2XTNA 1E2KA 2FFHA 4EJSC 1AJEA 2ZREA 2O8BB 2CVFA 4Q7MB 4CZ2A 1UADA 3GMTA 4UNRA 3IGFA 2JDIA 3QBTA 4NKRA 2ORIA 2AFHE 4OI2A 4Q02A 3UIEA 4BRUA 4EKDA 3QEJA 3WMEA 1X86B 2L0XA 1MRNA 3I1FA 1UKEA 2RKOA 4MUAA 2RHDA 3TUJC 3P4XA 1FMJA 4B3XA 4EPXA 1QRAA 4HAZA 3PG5A 1IN4A 1GVNB 1J90A 5CLLA 3NHAA 2Q9AA 4KFTA 1W2GA 4KLNA 5CK4A 3N5CA 4D80A 3U44B 3GLIA 3FKQA 3IO5A 2FV8A 4YLGA 4JLOA 1OJLA 1FQKA 2ZJOA 3TR0A 1NVUQ 1CR0A 4IOKA 3TMKA 2QM8A 2C99A 4V0LA 2O8DA 1E9FA 2FSHA 1XTQA 3RAPR 4M9ZA 3K8YA 4PHGA 4ZKEA 3BAFA 1R0YA 2NIPA 3MCAA 2EFEB 2G9NA 4BLTA 2IL1A 1D9ZA 1T9HA 2KBEA 1W0JD 3RANA 3HU1A 2XZOA 2BJVA 4M1MA 4F93B 2JASA 2FDCA 1S96A 3VNUA 5CYOA 1ANKA 1YR9A 3K0SA 4CEHA 2IYZA 3TRFA 4Q4HA 1E98A 4XJXA 2ZU0C 1QHHA 2JLXA 2VSXA 3ECCA 3CPJB 1CR4A 4EQ6A 1NIJA 2IEYA 4DCVA 1ZIPA 2R6DA 5KPJA 2BCJQ 4EPRA 2XZLA 1OFUX 2BBWA 5JJLA 4URVR 2J9RA 2GESA 3L2OB 2J0VA 4JSYA 1EESA 5CLQA 4JL6A 4XD7D 4GOJA 4KCGA 3IEVA 2A30A 4TLAA 2GKSA 3BFKA 2UKDA 3VNVA 1X1RA 4B3GA 1NF3A 1IJFA 3AH8A 3GJ4A 3OAAD 5HPYB 4LJ4A 1VHLA 4LZZA 5FOXA 4GZLA 1Q1BA 3CW2A 2BMFA 1E9RA 1N6PA 4RD2A 4AC9A 4IFEA 1TQ6A 4JVLA 1AN0A
chains in the Genus database with same CATH superfamily
1YCDA 2FN4A 2YFKA 1IUKA 1AS0A 4MR8B 4UXIA 2QTGA 2O3TA 2L69A 3PR1A 3VBCA 5I7FA 2O5EA 1CJSA 1EVIA 3ROPA 4KRFA 1U11A 3KSBC 1WUHS 1J33A 3EGCA 3MUNA 3ZBQA 3PNQA 1B16A 1VLQA 2R751 1YOBA 2FX3A 3NALA 4JUCA 4KTVE 2XCIA 2W2PA 4ONEA 4P3XA 4RIIA 4RBNA 4X1KB 5KKAA 3ADKA 1MUUA 1Z4KA 5KNCD 2YVQA 4MS1B 4OHFA 4QVKA 3CZMA 4KOAA 1LBEA 4MS4A 4O6VA 3S99A 1EXNA 2JH3A 2QQ0A 1X7WA 4B76A 2FLVA 4XLZA 1E1RD 1IEQA 2O1EA 3B8EA 3AR6A 3MOSA 3A1DA 5CXSA 5D1NA 3TXXA 3V4ZA 4A2PA 4ZTUB 5KJEA 2C83A 2HUNA 2XGOA 2CFOA 3PSAA 4MUXA 4Q6BA 4B6QA 1EXMA 1LEHA 2VWHA 4IGAA 3ZX5A 5KNDH 4R2WA 3VQTA 3MUFA 1KEUA 2P9GA 1XF1A 3UMBA 2YHUA 1WMAA 4OFXA 3BHIA 1Q74A 5E9AA 4QOGA 2R8XA 4I6EA 4ZGBA 1OGJA 2O8FB 1NW6A 2EEZA 3C6YA 4Z4EA 4YHBA 3C74A 1LZKA 2IP1A 2G8NA 4D43A 3BRWA 3QE2A 2O54A 3AF4A 1ZIDA 4N3BA 1JG3A 5JSKA 3EYAA 1K6MA 3ZGOA 5BQ3A 1KJJA 1N2SA 2NYRA 1AKUA 2IYOA 2WLTA 2X4GA 1KH1A 4DQKA 1NC3A 3G89A 4GI5A 3R4VA 4KK4A 5C34B 3K9FC 4YAIA 1RRCA 1T35A 2HHJA 2XTJA 3FPAA 1GU0A 4WEQA 4QPDA 3UK6A 2RGUA 3ZHUA 3NHJA 3CJTA 1RQ7A 2XNDA 1CDDA 4D81A 2ZRDA 2H00A 1G7RA 3AF6A 1SN7A 3Q7SA 1YACA 3SPXA 3WICA 3OI7A 1HQCA 2DY1A 1SR8A 3L6EA 3OKPA 5BY2A 3OPNA 4BWVA 3CPHA 3UJBA 3PK0A 4DRZA 3K05A 4G8JA 1FFSA 5CCDA 5EHGA 2AZTA 4HDSA 3GW8A 4BXOA 2WIJA 5G1PA 3H9CA 4V1CB 1HNNA 1YOVA 3TOZA 4Q16A 3PENA 3UHFA 3VUFA 1GFIA 5CVDA 3UMRA 3FPLA 2BGKA 3NKLA 1SD5A 4J1TC 3L8GA 2I3BA 1FDVA 1WVMA 2H18A 2VT7A 4MEJA 2PN1A 3F7MA 1OZGA 3JWPA 2ZTMA 1A5BB 1J1IA 4RQTA 3UXMA 3WA6A 1MAAA 4DC0A 5JCJA 3VISA 3RF7A 3AYXB 2ZQ5A 3L4EA 2B4YA 3LUBA 4F4FA 1DJOA 2OM2A 2TMGA 1TJPB 1XZCA 4IOLA 1C81A 2YHIA 2CLKB 3X44A 4K05A 2HMTA 5HUJA 4LDJA 1QXSA 2WWFA 2BTQA 3PC2A 4DCNA 1JLSA 1U3FA 1FRQA 3SF0A 2P9JA 3C7KA 1G8SA 1FTWA 2VFAA 1LS1A 2ODAA 3YASA 1SUIA 2Q3MA 3NNDA 4G56A 2ZJ6A 1RPZA 1XZIA 3D43A 4EHLA 3IT2A 2R9VA 4H1VA 2W8BA 1EFHA 3VYWA 1U0FA 4BFUA 3IDSA 1DXOA 5TNXA 1PBTA 3IKVA 4NL4H 1WHSA 3BE6A 1EK6A 3VA7A 5AJYA 2IEIA 1RPAA 2M1XA 4L4RA 4R31A 4RGVA 3TOSA 4B83A 4ZZ3A 3AU8A 4YUWA 4JA2A 4FFMA 2DLCX 1FZQA 5EP2A 1YFJA 2QTZA 5E3IA 4DS3A 1DB3A 2R7AA 2IBMA 5DNCA 1AZLA 3RRJA 4CDNA 1KR5A 5LQSA 1XOIA 3M4NA 4JCCA 1YXMA 3HZOA 1IOZA 4TZKA 2BFFA 2BR5A 4JYMA 3WC4A 721PA 1KYXA 2CVQA 2VNAA 3IVCA 4BE7B 4YRFA 4XVHA 4OEHA 1BKDR 3C6ZA 1ADYA 3E18A 1OF1A 3PHGA 1WSAA 2ZR9A 3FSRA 4HDMB 2HF2A 3GAFA 3KQLA 1EXDA 3HJFA 3WRYA 1ZI9A 5K8TA 5ECDA 2W6OA 1YS7A 1LPMA 4ZYUA 3I4LA 3UUEA 3CR7A 3A31A 3A6EA 2ZRIA 4IW3B 4DMCA 1I24A 4B1FA 2PSDA 2QLLA 4LMPA 4RD0A 3LUGA 5CT4A 1CRZA 5FA8A 4I66A 2Y3IA 2RI1A 1V9CA 5CIYA 1U0JA 2QE7D 2WKPA 3PDIA 4R1OA 3I9V1 1QRUA 2WIDA 3L9WA 2RGNA 3ZHSA 6LDHA 1XPJA 3V1LA 2H17A 4MCHA 3W8EA 2X3YA 5ULLA 3ZX4A 1L4BA 4B87A 4DLSA 3G2IA 4EKIA 13PKA 4ID3A 3SVTA 3TLKA 4PCLA 1DEKA 1PR1A 1A8QA 4ZAVA 4QFDA 1QYCA 5JSFA 4Z1MD 1FPQA 4NABA 4ZV7A 4OATA 1DNPA 2WM3A 2QUIA 1N2ZA 3P7MA 3A0UA 2SNIE 5IBPA 4GMFA 1TIKA 1DKNA 1UXJA 2CJXA 4IZIA 4Z9FA 3OC0A 5GVRA 5B2ZA 3U3DA 5C4MA 1CJMA 1E6MA 3DE5X 1LPOA 4YS6A 1EE9A 2ODBA 4R0NA 2RGEA 1NQTA 2YWCA 4JLSA 1NZJA 3ZW7A 2Q9CA 5DBFA 3UBTA 4C7BA 1K66A 4HDKB 1JDNA 2C03A 1SCUB 1X8LA 5FPKA 2FSVA 3EGWA 1II0A 1NTOA 1E7QA 4UATA 2NWQA 1H2BA 3CE6A 3FVQA 5AK0A 1QH8A 2B82A 2VJYA 4NCKA 4BEBA 1U1FA 2YW9A 1KAGA 3KOWA 4U00A 4Q7LA 4BMSA 1BCSA 4NQRA 3ROXA 1KS2A 4RE5A 5EIFA 1E6LA 2OVFA 3R23A 4IO0A 5JQGF 3JX9A 1WXGA 4G0OA 4RY9A 1Y42X 3ENZA 1M6EX 5KOHA 4C4SA 3RS3A 3B1YA 3EVGA 1A9YA 1KDTA 2CDBA 4NONA 5DHAA 5FWDA 2YN2A 1HM5A 3DQZA 3KFXA 4QTXA 4WLOA 1KE2A 4F9TA 4KMSA 4BKOA 3AU9A 1ZBDA 4NBSA 5DLQC 1G2QA 3GCWA 5CNJA 3WLQA 1T8YA 2O4CA 3KHKA 1SVNA 1EMDA 4WJKB 4MZDA 2YXNA 2F1RA 4W7HA 2UVPA 2R6FA 2CEAA 3K9GA 2HY7A 4P58A 3IERA 1L4UA 1Z7GA 4FXOA 3OWXA 3O8DA 4YWHA 3RSQA 4OPMA 4CQLA 4OGLA 3O1LA 4JLBA 1L7VC 1M1YE 2Y93A 1GITA 4D44A 1E9DA 3GNQA 2FG6C 3EXHB 2QG6A 3HYSA 5K4GA 4EIWA 4QBFA 3HVKA 2P4QA 1Z2DA 2Y9PB 3H6GA 2CW5A 5TS2A 1AU9A 1VL0A 2P9YA 3WGIA 1MOSA 5FAKA 3N2EA 5CA1F 4A15A 4KGDA 4FX5A 2YHBA 3KCNA 3NBAA 4L22A 4TROA 4YYEA 4DMKA 5DTRA 1YZHA 2GEVA 3P20A 3E5MA 2Q5JA 3EZ7A 3F6SA 1MTZA 4FINA 3AHJA 2KLHA 5EC8A 4E5KA 4CTKA 5DN9A 5C52B 4GKVA 3LHIA 1KDPA 4NLLA 3V2HA 4OYRA 3RTEA 1JBQA 3UJDA 4AZVA 1T15A 2AW3A 1DXHA 4LFCB 1NE7A 3S0JA 2AIRA 4MMZB 1QIKA 2YTZA 4WKPA 1G20B 2JFHA 1I7QB 1Z0ZA 3VPBA 1IRIA 1OD6A 3H1BA 4V0RA 3EXEB 5FJJA 4HNSA 1TOAA 4JLMA 1C9NA 2YYSA 1I4OA 1PL8A 1IY8A 2Z9CA 3PIDA 2OO3A 3SFTA 2P91A 4AS2A 4BJ6A 2GWRA 5IK2A 4CEIA 3CKLA 5DYNA 2FK7A 1NPYA 1CNFA 3GEPA 1RYMA 3MF4A 4LHWA 3WI7A 5CB6A 3INRA 2IPXA 3O8QA 1FRZA 3TLBA 4WY5A 4XEHA 1GGJA 4FP9A 4BIIA 4XUCA 5HKKD 4X20B 4F2HA 4FYIA 1REQA 2ZJ5A 1XN1A 2R79A 4UEQA 2J5KA 5KYWA 1OBVA 4EVQA 5ANRB 4AZ3A 1AMOA 1SBZA 3P9ZA 2O5CA 1C9JA 1E2FA 2KLBA 3IDZA 3M6WA 4XASA 4RVSA 4ALIA 4EB6A 3TIFA 2VDPB 9ABPA 1HYEA 4P7FA 5LLTA 1T9BA 2HHCA 4WKCA 3M6LA 4PYOA 4DSUA 2X40A 3A11A 4O1MA 3TEJA 4YQFA 1GWNA 1XAGA 2DQZA 4J0KA 1ETHA 2Q2WA 1M54A 1Q7BA 2R8YA 1VZ2A 5DYYA 1K7EB 3RARA 2HRZA 4EUHA 1SELA 4KFRA 3SJBA 2ZBQA 4KLAA 2WYVA 3CA8A 2NU7A 4HVCA 1QE3A 2FN8A 4IXDA 2FOLA 2Y1EA 5LB4A 3W1VA 4ZHQA 3ZBUA 2FJPA 5AM5A 4Z3DA 1ZR4A 2WJ6A 1F0PA 1ZH4A 1K6XA 9LDBA 1ZM4A 3E9YA 3MWGA 3LPNA 2C7VA 1AQJA 3CURA 1J00A 1QVWA 4K9NA 1T3LA 5EKDA 5ALUA 2E6KA 3VU0A 4U9IS 1GV1A 5K2MA 3O4HA 1XNRB 5EN4A 2E89A 2W6JD 4F5YA 1VA4A 3MERA 10MHA 1JHRA 2FWJA 3R3YA 2EQ5A 3FSGD 3IEPA 4NX2A 1RQLA 1M76A 4MP6A 4E15A 1LGYA 4ETWA 3DZKA 1UJ4A 4EM6A 4P0QB 4X90A 7REQB 4DG8A 1JXAA 2FMUA 3TZHA 4MWBA 4XYGA 2WSYB 1A5TA 2GERA 4DLKA 4LJYA 3D6MA 2R44A 2VZEA 3EXIA 1VJCA 5L3QB 2PAAA 5ICFA 4CL2A 1MHTA 4ZAYA 2OXRA 4AP5A 4CLOB 2C9BA 3CV3A 1H4SA 1C2YA 2H1FA 4UM7A 1Z5PA 3HFJA 1ZM3A 3OKCA 4PLCA 5A0FA 3WKBA 1KGSA 3LHDA 2BI8A 2ZUDA 2ZBGA 3CX6A 3P2OA 3QHAA 2YX1A 3R0JA 4REQB 4TRMA 1FNSA 3ZJ4A 4FMBB 2QM3A 2IS1A 2J9FA 1G5HA 1GTVA 4CKBB 4CF5A 3R7NA 3W8DA 4CETA 1RS0A 2YFQA 3AFNA 4WCFA 1NV9A 3ROZA 2AMLA 4G97A 4PONA 2JFWA 3F1KA 3ZDZB 4F6LA 1JNXX 2QRGA 3D1VA 3L7KA 2AXPA 4KLZA 5GONB 5GJVC 5KWEA 3Q15C 1PFVA 1M1NA 3SJ7A 1SXHA 1B0ZA 1DBWA 4HGQA 1UL1X 3FMVA 4P4SA 3DFUA 2I5PO 2OO5A 5D86A 2H7CA 1KFKB 1WCIA 4ZOAA 4NBVA 1TRKA 3KWMA 2OBLA 2Q9BA 4AZ0B 2ISQA 4UKDA 1DT5A 1RCFA 2AMJA 3K2IA 3EXHA 4WLEA 2OY0A 3SQOA 2VXOA 2QR3A 2VT3A 1U3VA 1NNLA 1IU9A 4LY0A 4W6QA 3TNFA 1A88A 4B47A 1QP8A 4EL5A 3REOA 5LD2C 2XH8A 2OZKA 2WAXA 5CHEA 2BZ1A 4L4ZA 4B3SB 1U7HA 3KYCA 4ZEVA 1UBOS 1THTA 3RIXA 4BNDB 3ZKWB 3WY9A 2JJQA 2JHGA 4IFBA 4M0UA 4MI6A 2QPLA 2OAGA 1VL2A 2WWYA 2B21A 4MR7B 1VL8A 1AUXA 2WTMA 4MITA 4M9CA 4QOHA 4O4HA 2UVDA 1LK7A 1RYBA 1XIVA 2ENWA 2O0MA 3FHCB 2GPNA 3GDHA 2ZSEA 1F6BA 3I0NA 3NUZA 1PGQA 4G5YA 3N8GA 4OOEA 1LI4A 1RQRA 2VO1A 5KVQA 4U7JA 3WJ7A 4ZHQF 4IDNA 1YU6A 2Z6AA 1M8PA 5FCDA 1H2AS 4FOTA 1SKBA 3SC2A 4CFZA 2PHZA 2F3TA 5K3DA 5ELLA 5BSMA 3GEGA 1XI2A 2FTKE 2JIOA 3QE3A 5AUNB 2V5UA 3EZFA 4FGJA 1KU6A 1TZKA 4GL2A 2L17A 1Y9JA 2GTIA 1ZQ9A 3O94A 1P4SA 4X1KA 1FDWA 1N2CA 3BE4A 3AB7A 1T29A 3ZNNA 5EYPA 4MS4B 3DE1X 4PO1A 3MCUA 4UW9A 4A73A 2N1BA 3I32A 3N3AC 1QNFA 5F33A 3QVJA 5BWNA 1XQVA 2BCGY 3VR3A 1LCIA 2NU8B 4BFXA 1XDDA 2K2WA 2NP6A 1QTIA 4R8RA 4ESOA 3T1HB 1I7DA 5H3LA 5C3MA 5FUWA 2MDTA 3Q8MA 4CU2A 4OFBA 1X1EA 1CE8A 1V45E 3PUHA 1NF2A 3PXXA 3W3AA 3FOFC 1O97C 5FBQB 2UZ0A 3BVPA 4I2NA 2FRVA 3BXFA 5JARA 3KUCA 1NN5A 4WXHA 2Q7OE 1OE0A 4X94A 4EYGA 4RAOA 4O4IB 1YRAA 2JGIA 4RESA 1MVLA 2QU8A 3ZCUA 3ETDA 1FP7A 2OFWA 3CNEA 3EPKA 4LDRA 1U2TA 3WGLA 3NUGA 3W5UA 3ER8A 4LTNA 3VI3B 4UFNA 1PX2A 4IWXA 3AJAA 1TNDA 5KYVA 4AX8A 5HX7A 3D6JA 3JW8A 2P5YA 1JAHA 3N2ZB 4L6CA 3M5WA 4XPIA 5BP7A 5JZMA 1NLZA 1PG0A 2LIVA 4Q3BA 3F6EX 1JFFA 4XCXA 1TMKA 1E3DA 5ALQA 3J7AC 5DCUA 3LT0A 2W0SA 5IHPA 1F4VA 1KFJB 2JIZA 3FR7A 2ECKA 4FCTA 2XCUA 4OM8A 4M9QA 1P33A 2Q3BA 5ALLA 3F8TA 3MT9A 4OQYA 2C4KA 1XMQB 3W7BA 5HILA 3M4YA 4EYSA 4Q3KA 1JLKA 2VF4X 3EXIB 3RJZA 1XSEA 2B98A 4DWJA 3QFHA 4DCJA 4MUHA 2WLSA 2VP5A 4ML3A 2VAPA 3OOEA 1APBA 1BA3A 3CZPA 4LF4B 3O4VA 3AHHA 4JLAA 4YB8A 1Z7WA 3WLRA 3QI2A 5AKEA 4O4JB 3UK0A 3UJAA 3SDZA 4LNAA 5FOSA 3AR3A 1GQFA 2AHOA 3VI4B 3ST7A 1FZTA 1NLFA 1MJ5A 2DT5A 3U81A 621PA 1L5VA 4UM8B 1JR6A 2QW0X 1IQ0A 1FS4A 4XXHA 4RVHA 4AN0A 3TIXB 3P94A 1GYQA 4KQJA 2E4AA 2UUAB 5PGMA 1O95A 4BLWA 2W2LA 2PAFA 3RQIA 2ZXFA 5C1BA 4IQ0A 4JNCA 1DFGA 1L1RA 4LJ8A 3H04A 2L2QA 3O38A 1Y9ZA 2HRDA 3GFOA 3BDIA 3Q0TA 1EGAA 3RT1A 1PX0A 2VH2A 3GEEA 3KXPA 4KEAA 4BFWA 4TV8F 421PA 1KRWA 3D4LA 4P4UA 3ISJA 1QP0A 4JJEA 1N7IA 1NRXA 3ROGA 3BCRA 3U3ZA 1UOQA 2ILVA 3G0DA 3NHBA 1BO6A 1DWPA 1JDBB 3AJRA 4G24A 3TD9A 1KJ8A 2JK1A 4TMTA 1F5SA 5EIHA 5F12A 2YIMA 4I2VA 1K7CA 3WQBA 4IDBA 3QW4B 3ZQUA 4G5RA 3KBOA 3C3KA 2PSEA 4NQZA 2OB1A 2BW0A 1XP8A 3QHPA 1RTTA 1ODIA 2XXJA 3K7EA 3GU3A 1J22A 4FFLA 4K1XA 4OSPA 1C3EA 2RHOA 4HDAA 4R3WA 3UT0A 1PN3A 1DV2A 4MQFA 2ADOA 3OQNA 1ND5A 1E9CA 4FN5A 3IQXA 4G09A 2IZZA 3DNMA 3V46A 1MNAA 1KO7A 1UK6A 1P2UA 1CIPA 1YMVA 3BTOA 3QFRA 1I6LA 1KPIA 1JR2A 1U9JA 3OLQA 3GJZA 1RSZA 3FY4A 2GEFA 5J2TA 3F6BX 1JECA 2PWBA 1DKQA 1GGKA 3A27A 4JSRA 2YCLA 4PZUA 4TL8A 1OOEA 1NXXA 1L4HA 4NZOA 1LF5A 3DO8A 4WSOA 4Q19A 1UZAA 5CU7A 3WIVA 5H4HA 4RY8A 3ENQA 1ZP6A 3RIEA 3CNBA 3FI9A 4E07A 1CVRA 2O3QA 3DKPA 3F4LA 3IBGA 3WADA 3VYRB 1E1QD 1BJTA 3AP1A 1T36A 1IEXA 2ZT6A 3OCWA 3PUWA 5IBRA 3RVPA 4H0FA 4OMUA 4YASA 2I55A 5TT0A 4EG8A 1POWA 2XE6A 3T5CA 3FLEA 4BNGA 2HBQA 5BQFA 4KN8A 4MKFA 1VIVA 2EJUA 4R0VA 5A4KA 2DFPA 1NLYA 2QJFA 4PO8A 4PSDA 3WYAA 2OC4A 4D9KA 2J41A 3EC2A 1TKBA 3BJZA 4YAOA 4KQEA 3ZWBA 1S8FA 4ZQIA 1ORTA 2NU8A 4B75A 4P36A 3HMKA 2PUWA 3MXOA 4JT8A 1H8HA 3FVWA 3M33A 3NTRA 4L27A 3WYFA 2VG8A 5IMBA 4BBZA 1II8A 2G6TA 4MVJI 3WMGA 4DCMA 1CS0A 4UAGA 4OU5A 1Y6FA 1CQJA 1V5WA 1QUFA 2EL7A 2R25B 2GZ1A 2D2IA 2GB4A 3GJXC 3T4XA 2GXUA 3DZGA 4M1QA 2I99A 2JGMA 3I1JA 1R0CA 1W5FA 2B20A 2YUIA 4KAFA 4BLUA 4CLEA 2QM0A 2YL2A 3WMWA 4DVGA 3RC8A 3QX8A 3X0DA 5ENVA 1ECFA 2NO4A 1R9NA 1O1YA 3COZA 3PJDA 5GMOA 3S44A 3CVUA 2RSLA 5EJ4A 2ZB2A 4O63O 2AN4A 4C4OA 3DEKA 4PGFA 2XNCA 3OQIB 1Q5PA 4RMNA 3Q12A 5HEKA 1P2FA 3KQYA 1LPPA 4EY7A 5KQPA 1R3DA 3TB4A 1VFPA 1SCDA 1MD9A 2QZJA 3PGKA 3OZFA 1WJGA 5EJ8A 2EEPA 3W79A 3VAAA 2BH9A 4OXRA 5JJCA 4RL6A 4KE7A 4C22A 4WY8A 4BY9E 2ADMA 4LY6A 1QFMA 1R5NA 1R4MA 3H8WA 3O84A 4OHKA 5IW8A 3WGNA 2BEWB 2YZKA 4ZCLA 2A5FA 1C3JA 1Y98A 5DE3A 5FI0B 4Z3OA 3ZLTA 1VE1A 3BD6A 9GPBA 3AXSA 1MB0A 2JVJA 2WWGA 2X42A 5JT1A 1ESNA 2MSLA 3FPKA 2QROA 4PE5B 2W6JA 5ALEA 2ID7A 4AF8A 4FFVA 1HXHA 2YHSA 2I7VA 2NU6B 3DE3X 1GYRA 3KEOA 3QFCA 3H2KA 1KO1A 4OU4A 2CXXA 3CONA 3FWYA 5FI5A 4DA0A 2RGGA 4G4SP 3C0KA 2J5RA 2JAWA 4ZVPA 2GO7A 4B35A 4YT2A 4ZXFA 2C42A 2C4TA 3LUPA 5IDYA 1OASA 1E2BA 1R37A 2XUDA 2NV0A 5DGIA 3AOGA 4GLOA 4W1QA 4UHHA 2NUBA 3ZZ1A 1EQUA 1XLVA 1UMCB 1RC0A 3AJEA 4NCXA 1O4VA 4LNHA 4IJMA 1T9ZA 3ABSB 3BPSA 2WYUA 3OG9A 1G4AE 1IG3A 3HI6A 3O1IC 3HBMA 4CMEA 6PFKA 3WAJA 1IMJA 2VS1A 3R9WA 2YWRA 4DSAA 3W5JA 3UMFA 5A62A 1CJKC 2G4CA 1G20A 4R16A 2PD4A 5ALFA 2JJYA 3DC2A 1NXTA 1Z16A 5JDCA 2XCRB 1Y82A 1N6IA 4FSDA 1PF7E 2V5VA 2XT6A 1NUHA 4L5YA 2CDAA 1RBZA 3KOZA 2J0QA 2A0FA 1Z0JA 3FFXA 1E2GA 1QF6A 1OLSB 4G8CA 2R65A 4C7XA 2PCJA 1NWHA 1ULSA 3AGPA 4E3ZA 3ZZMA 5EXDA 5K99A 3D0KA 4REQA 1XZFA 3JSAA 1NKVA 1U31A 5AKGA 3T5PA 4REMA 2IW1A 4ALLA 4UPEA 5F7ZA 1CY1A 6GPBA 2COKA 3MC1A 2ZRNA 3DBLA 3KU4A 5JS6A 2J07A 4H7HA 2REBA 3SFVA 4BJ5A 3V34A 4UTOA 5BSHA 3TQSA 2WSSD 4UMDA 4J16C 3IVMA 3L41A 3H5TA 1BE6A 5HTKA 1TC1A 4KO4S 2X22A 4ASUA 1TUBA 4I1RA 1ZEJA 4UTXA 1ZMOA 4BATA 4QXPA 1C0EA 3OY7A 4MJ7A 1IPEA 4E5DA 5IVHA 1O6GA 3HCBA 1SULA 3CN9A 2WB4A 4HAVA 4TLMB 5EZQA 3W77A 5G53C 1E59A 1VP9A 3B20A 4WNCA 1KVRA 1UCFA 1YS2X 1NVGA 3WKDA 4YV1A 3G13A 3QJ5A 3T8YA 4LYEA 3OMLA 1MOZA 3ME5A 3VC3A 1ZD3A 4HWSA 2E49A 4RDIA 5F23A 1CP2A 2FZEA 2P69A 1GNPA 2HCBA 1ID1A 4IBOA 4LXUA 3W4IA 3KC2A 4B48A 1DI0A 3VH4A 5C7IO 1Z5VA 4ZYTA 1Z5WA 1F0KA 4PXAA 1QHHB 4QUBA 3W5AA 4WGGA 3RC2A 3EG9A 2WFMA 3P4UA 3SYTA 3NOQA 4ZEOA 2XW6A 3I05A 3OLWA 5TPZA 4RYDA 2PDAA 5FLYA 1I9GA 4E5SA 4G23A 5B1EA 4P6VF 2CNLA 1V2GA 3AFIA 3R40A 5DX1A 4ZMSA 2GCPA 5EJFA 1OZAA 1V16B 1XYVA 4FYVA 2ZYWX 4MA5A 4TVBA 4EMSA 5AQEA 1I8TA 2W98A 1IN7A 1LBHA 4E32A 1TT7A 3D1LA 4RS3A 1UZLA 4X9XA 3CXUA 1XD2B 2CNDA 1DC7A 1S2LA 1NYRA 5ED4A 1H2WA 5JY6A 2QE7A 1I3LA 1EVYA 1DKPA 3ZN2A 3HPQA 1KL7A 4CT5A 2LNDA 4PO9A 3KETA 3PIRA 2OXCA 4FDAA 4RWEA 1GL9B 1PD0A 4DKJA 4MQ4A 3IUMA 4RGQA 4DV5B 3U4HA 3ZNQA 3UTDA 4YCSA 1JQ5A 3IQHX 4BVEA 1KA9H 1XVUA 1Y6QA 3HWRA 4LF7B 8ABPA 1UFOA 4FR5A 5KUTA 1CR1A 2DFLA 1AKYA 1DBPA 4X0EA 2EG5A 3SN6A 2C7PA 1M34E 2EFDB 4EG7A 2FQ1A 3A05A 3A1WA 3IP8A 4H7FA 1TVMA 1EFTA 4YV0A 1FYVA 5DB4A 3AX6A 3UUWA 4YXFA 4RTLA 5EHQA 4CJXA 4D5GA 3WDKA 3ZJUA 1Y7IA 5AUQA 2QT1A 2EKZA 1FJ2A 5IKOA 3HU2A 4YCMA 1UMBA 1ZXXA 2ZATA 3QX7A 3QXHA 4K6OA 2WD9A 5KCMA 2PJDA 1ZVMA 3HXLA 4LZOA 4EZIA 3MWYW 3A4NA 4LBYA 1DZ3A 1K7XB 1O54A 2Q49A 2Z3ZA 4FBGA 3ED5A 4L4YA 4C14A 2YJ5A 4KQWA 4GWKA 4N3NA 4CM1A 1FMTA 1T5IA 1TQ8A 2WFAA 3MJDA 1O0BA 3K09A 3T7DA 4Q7QA 1F20A 1ST2A 3IE1A 4XZ3A 2FMTA 1NUSA 4HPXB 3NHSA 3CM0A 3HJHA 1VL5A 2HCTA 3IEKA 2CC2A 2Y1FA 3D6TB 5ITWA 1AJEA 1P39A 3REQA 4LXGA 3LWBA 3B52X 3FYTA 1C4WA 1HRDA 3U80A 1NMQA 2CXTA 4GDFA 1JHYA 3F6PA 5ICMA 1DAFA 1A8PA 5JRJA 1PHPA 4Y9DA 1DBSA 4H08A 2OV1A 4UBLA 2WD7B 4UQLA 1M0TA 1SC4A 2X8WA 3R5KA 5P8WA 2F7SA 2HJVA 2O8EA 4GXNA 2XI4A 2JGFA 3EVEA 2IXBA 3LBAA 2PL5A 1TCBA 1JDTA 4LOHA 3IS3A 1OFHA 3RKSA 4DRYA 4HS4A 1U2DC 2ZSBA 3LUFA 4LRWA 2J0UA 1E94E 2ZIUB 3T3IA 1EWRA 3GLVA 3NM6B 2VJOA 3RPEA 3KQOA 1O6BA 4RSMA 3KFVA 3SHVA 4XIGS 1WMDA 4C7MA 5JPCA 3H3XA 1BD4A 4M0FA 1ZW1A 4ZK2A 5ALTA 5FD8A 3EEIA 1LPNA 2PUEA 1R8SA 2J3EA 3NM5A 2HJGA 2PO5A 5EE9A 4IF6A 1Y6JA 2GHRA 2ZJ0A 4IIDA 4QXRA 2OZVA 3DBRB 2FRDC 4PV7A 4IVQA 1UJ6A 1UBNA 1MRSA 2WIGA 3HY6A 1OXKB 3IJEB 4MQ6A 5IP5A 3RGGA 5F2EA 3SOPA 1XRQA 4CFSA 1Z35A 1T4MA 1IN5A 4O4HF 5JHHB 4CM9A 1MB9A 1A2KC 4CEHB 1SQ6A 1OXMA 4QU0A 1M5TA 2G70A 4XJSA 5TJHA 3WL5A 3C70A 3CNQS 3I9FA 5FWAA 3VPAA 3DAGA 3PPIA 1EUCA 3K0AB 4BN0A 5LXTB 1A82A 1DHRA 2X0RA 2HJSA 3TLJA 4LISA 4EFLA 1FJXA 1GGHA 3K32A 5KOJB 1CY8A 2ZTHA 2EWMA 3GEDA 1SEVA 2AE1A 4B6OA 4ZOLA 1Q0SA 3FCYA 4J29A 1YIDA 1Z29A 3ACBA 1UKZA 2XVYA 2ZRCA 4WZ6A 1XJ0A 1USUA 2EATA 1Z4QA 1W7AA 2EIHA 3CUUA 3KT3A 3IOCA 4RJIA 4KIJA 4BAZA 3GGCA 3FRJA 3SQWA 1B8UA 1OIVA 2XUZA 4HX2A 4KDEA 4S35A 2YWJA 3F98A 2EERA 1OPRA 1ODTC 1RLUA 2Y05A 2OGUA 1JHXA 4HB0A 3VX4A 5EJ9A 4HTFA 2PH3A 4YGXB 3TSAA 4MUJA 4NE9A 3R3HA 5AHRA 4CV1A 4L4UA 3W6UA 4M0CA 3VYVA 4U2GA 2O2DA 3NZEA 1CQIA 3T7JA 4MCJA 2OVBA 2BFFB 4HWGA 1TVKA 4Q1BA 3T1NA 4UHFA 4MVJP 2AD1A 2ZWMA 3K16A 3NPAA 3KX2A 4TS9A 5LQKA 1CYEA 4FZ3A 1XD2A 1JJBA 1G2IA 3A4VA 1BXZA 1QLWA 5TY0A 1V35A 3EIXA 2PBRA 4Q3AA 4L75A 3VR5A 1Y7TA 4GBGA 2X9GA 4L16A 3CNHA 3CWQA 4DHEA 3BWCA 5F1KA 4KXQA 3PEWA 5JMTA 4QLAA 2BZSA 3TIVA 2G72A 3AEKA 4ZIRB 4NC9A 3TW8A 3H0KA 3K15A 1DRVA 4OQDA 3BSWA 2NUAB 5A4JA 2O2JA 4KC0A 5JG7A 4I55B 5H59A 3CT6A 1NVTA 4RLSA 1SC6A 4CW7A 1AG9A 2XQGA 3L8EA 3RUCA 3C5HA 4P33A 1GQYA 1W1IA 2B2CA 1N5OX 4EY8A 3A4IA 3N7AA 4U8GA 4WASA 3SKXA 3PJEA 4MNTA 3AFOA 1BWQA 2ZE6A 2BHLA 2GUGA 3I1IA 1XNHA 4G9EA 4WOBA 2JLSA 4OH1A 5H0IA 3UFXB 4S1PA 5TGDA 2IYNA 4DADA 3P0IA 4GSYA 1T2FA 2NSJA 1J4AA 2YXPX 4AY2A 2AZXA 1CETA 1JDZA 1OHHA 5LNK1 1KI2A 3HDHA 5AW1A 3WGVA 1Y1LA 1JTFA 3QEMB 2NQ8A 3OQIA 1C3XA 1AX9A 2GN0A 2ZTVA 3N0XA 5F35A 3LZCA 4CUKA 1QDEA 4WJZA 5HGJA 1F6DA 2CNBA 1LDEA 3PQ3A 4J7CA 1COWA 5B1DA 5JC1A 1DPFA 2CK3A 2WICA 1W49A 4ZZ2A 5CG1A 2AE2A 4LV8B 2I8CA 2PRKA 4Q21A 4X1YB 3FFBA 3BDVA 2OP0A 3FHLA 4PLHA 2EIXA 1YS9A 3PFWO 4BS9A 5KHLB 4H1HA 2Z2YA 1U5CA 5H9VA 2AYYA 1V3UA 3MLAA 5DYTA 2XQJA 3EQ7A 2FLWA 3ZGNA 1AS3A 3NXSA 3JQ9A 1CJVC 1M75A 1OZFA 2B8EA 2DTDA 1A5ZA 4J6FA 2JGJA 4XLLA 5ALHA 5GV8A 5J5CA 2QAGA 4LC1A 4PLYA 1L9KA 1YOVB 4QFBA 2W71A 1JB1A 4KQFA 4OUKX 4AUKA 2QVGA 1X7ZA 3JZIA 2ZR8A 3QLVC 1TA9A 3L7MA 2O6HA 4HDCA 5AUOB 1LRJA 4YROA 5AO9A 4MS3B 3ZUGA 2CDRA 3B13B 4JQYA 4HEA1 3ZU3A 4L72A 4D41A 3G23A 2BM8A 2HH9A 3P2MA 5HF8A 5GINE 2RARA 2HWWA 2Z58A 2I4LA 1I5RA 5IKXA 2BDTA 4MP3A 1GNRA 4PG5A 2KJQA 4R2HA 5JV5A 3EDQA 5IAOA 5JSZB 5EVCA 2QHXA 1ZGZA 4MYRA 4N7BA 3P9IA 2Q29A 3W34A 1P60A 5HBGA 5HE9A 3BERA 4XQGA 2QJWA 3QXGA 4D0RA 2HSEA 1MTOA 3MBOA 1K2WA 3PT9A 4NP6A 1Q16A 1UBUS 1VIYA 1UUFA 1PVVA 4HBZA 1T3GA 1YFZA 3FNGA 3N2GB 1X1AA 1PS9A 4ND8B 4LX8A 5HNKA 2BZGA 4KACA 3VAYA 5DTIA 2Y77A 1L5QA 3MTIA 3DFZA 3JYHA 1SUEA 1VCNA 4HI0E 2V9ZA 4MQFB 4ZDWA 3CMCO 4AJ4A 3AI1A 1BX0A 2CLMB 2ZVJA 4X54A 1Q22A 2HUPA 2BTEA 3BKXA 1FFCA 1AKWA 1RXUA 3P19A 4E2ZA 3OJWA 4YAWA 5GVSA 2DKFA 3J81k 2H0QA 3PQEA 1J0DA 2DTXA 2JAXA 4P0PB 3ELUA 5EIAA 1VE3A 5F52A 5CB4A 3Q3CA 5I9SA 3TQRA 4BO0A 3OZDA 2FWPA 3B1JA 2FW8A 5FV4A 2JF0A 1KGDA 4PEVA 1KOFA 1AM4D 4GOLD 3LI2A 2QGZA 1FFGA 1IATA 2AR7A 2OZPA 2RJNA 2E21A 2ZI4A 4L0MA 2A0XA 3I9LA 4RW0A 5IJ9A 4YONB 1ZSNA 3GAZA 2MOKA 2BHRA 2ZBPA 1IBKB 3L0ZA 3I2YX 2B37A 2H1CA 4HXYA 3UCXA 4KBFA 4YI3A 4DA6A 1DARA 1KETA 3WSVA 2XX3A 2NACA 2Z1DA 3PGMA 4O29A 1L7NA 1LLQA 3EE6A 4BNUA 3QEKA 2IV7A 1EFAA 3FM9A 4LZJA 4PAOA 2FPRA 4RHXA 4EGQA 4EABA 1RCUA 1RT9A 1UBLS 2NTYC 4WI1A 1KBZA 3MGKA 4NSNA 2IKSA 3UUFA 4G0UA 2NP7A 1EEXB 3V32A 4WRRA 1E69A 2FB9A 1AK9A 2HYIC 4BX8A 2XMCA 3A3OA 3FDXA 3IAUA 1B6RA 4TKVB 3VR5H 2G67A 3W5SA 2P40A 1BOFA 4WNAA 3TZKA 2FXIA 1OX6A 1A7JA 2O9JA 4JSTA 1WLYA 2ZRMA 4JFRA 5JROA 4TKZA 2I62A 3N05A 4D4JA 2WJ3A 4PYKA 4TMWA 1PR2A 2ZIXB 4DRXB 1I01A 1P1RA 1RE0A 3E2MA 3NBFA 3PFGA 4KO3S 4OB6A 5GJWC 3S1AB 3UK2A 3L8DA 3IV9A 4EX6A 2EBUA 4IIYA 3PPYA 4W5HA 2QKYA 5HQ3A 2R1TB 1U5BB 1O2DA 4BE4A 1B2LA 2W37A 4DR3B 4QICA 3ZHTA 1QQ5A 5FB3A 4YQZA 4CCWA 1MJHA 3AY6A 2IGTA 3P0RA 2R87A 3ESBA 1ACMA 1CB7A 1D5CA 4IRUB 5C0OE 4NF2A 4YMTA 5KMGA 1WSBA 4NV1A 4GU5A 4TYQA 4GRIA 1N4DA 2GK7A 2FFJA 3FB1A 4H6VA 2X1LA 1PFWA 1TL7C 1C7FA 1Z39A 5KOHB 2VNJA 4BLRA 4GWGA 2ECOA 1T3TA 1KZ6A 3F6YA 4MCIA 2P1ZA 3QEBZ 1M6HA 3GFPA 1UWKA 5JH7B 4EFMA 1LPSA 1U4SA 3IHKA 5U9CA 1O9HA 5BORA 3SEFA 1TIPA 4BZQA 1E1CB 1T9AA 2QMQA 3CRQA 3JQFC 4PSCA 1CLUA 1RHQA 1VOTA 2YDYA 4QFCA 1Z7BA 3LDGA 3BWDD 1FE8A 1XZEA 4YA6A 3NASA 3RAFC 2HR1A 1NW5A 2QRQA