3UKDA

Ump/cmp kinase from slime mold complexed with adp, cmp, and alf3
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
191
structure length
191
Chain Sequence
b'SKPNVVFVLGGPGSGKGTQCANIVRDFGWVHLSAGDLLRQEQQSGSKDGEMIATMIKNGEIVPSIVTVKLLKNAIDANQGKNFLVDGFPRNEENNNSWEENMKDFVDTKFVLFFDCPEEVMTQRLLKRGESSGRSDDNIESIKKRFNTFNVQTKLVIDHYNKFDKVKIIPANRDVNEVYNDVENLFKSMGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLMONOPHOSPHATE/CYTIDYLMONOPHOSPHATE KINASE
publication title Structures of active conformations of UMP kinase from Dictyostelium discoideum suggest phosphoryl transfer is associative.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
total genus 73
structure length 191
sequence length 191
ec nomenclature ec 2.7.4.14: UMP/CMP kinase.
pdb deposition date 1997-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ukdA00
3CR7A 3EZ6A 3GEEA 1ZMXA 3B1YA 3CR8A 1Z08A 1G7RA 2I1QA 2ZQ5A 5EXSA 3HPQA 3V00A 4EPYA 4PC1A 2FU5C 3IEVA 3DOFA 2KBEA 1DPFA 2W2VA 3HJNA 2V1UA 1QVRA 1HE1C 3BORA 5IF9A 2CJWA 2XSZA 3CWZA 4QBFA 4TSFD 5J4VA 4JKYA 3M0EA 3I61A 3RWOA 2VYFA 3THYA 2YC4C 1DO2A 1Z0JA 2G0NA 4PAMA 3UK6A 1X6VA 1FQJA 3TSWA 3CF2A 4Q1FA 3FVQA 2J0SA 3CRRA 3K70D 1J70A 3K70C 4XD7A 1S0UA 4B48A 3WXMA 5UKDA 4GPTA 4JVSB 4LBZA 3WNCA 2QMUA 1NJGA 2HDNB 1AM4D 4OJKA 3GLGB 3VR4A 3H84A 4HEJA 4LPKA 2ODBA 4JBYA 2Y8EA 3BXZA 2IYVA 1TU3A 3KKMA 4N3NA 3SR0A 4WZBE 3K9LA 3GLHB 1PJRA 4DIEA 3NVAA 1DARA 2F43A 1R7RA 2ZANA 4UNNA 1SXJE 2W2TA 5C4MA 4WXPA 4W7SA 1TF5A 1YZGA 4CEHB 2FEMA 1SHZA 4AD8A 2G77B 5FOWA 4QJ3A 4Q9KA 3LW8A 3SHFA 1CU1A 1NSTA 1R5BA 3F5FA 4M1OA 1ZINA 3M6AA 1U9IC 3QQ5A 5J40A 4EPVA 4Z54A 2AWNA 5EE0A 5FUWA 3TSZA 1OT3A 4TN1A 1ZCBA 4IRUB 1S3SA 4MRVA 4OHVA 1KI3A 1S3GA 8OHMA 4ZIRB 3ZGXA 1US8B 1LS6A 3FOZA 2XB4A 4ZO4A 4LRWA 2IYYA 2MSEB 1RKBA 3LXXA 1E4YA 4MRNA 4KLNA 4KSCA 5IK2A 1E2LA 4WZ6A 3VQTA 1N6RA 1KSGA 1GM5A 3OZXA 1E9DA 4QNRA 3U7GA 1G5RA 4QBIA 1KAOA 1NN1A 2CHGA 4I1OA 5FPKA 1RRGA 4M2LA 1I4DD 5L3QB 3U44B 2A3RA 4B34A 1T8TA 1NIPA 3P1JA 4V0LA 1KSJA 1F2UA 2GVZC 4TMXA 3WP0A 4CT4B 1GOTA 1UBFA 3NIBA 2IHBA 4F7WA 4ARZA 1DADA 1N5KA 2EWWA 4M53A 3R9IA 2YYZA 5FOSA 4C0BA 5CB6A 4JIMA 2F3RA 4AG5A 4Q66C 2FJUA 3TR0A 4BLQA 5CITA 2IX3A 1KMQA 2SHKA 3MRSA 4CGZA 2IT1A 1P61B 4DLTA 4Q7MB 4HYYA 1Z0IA 1GVNB 1ZM3A 1VIYA 1SQ5A 4G5OA 2GILA 1LVGA 2IK8A 4BLRA 1E9FA 4LV5B 3EA0A 1Z63A 3BH0A 2QTFA 3AKCA 4HB4A 1VHTA 2OBLA 4M1WA 5JLJA 3IHLA 3TK1A 2ANBA 4LHXA 4D4JA 4HAVA 3BFKA 3B1ZA 3Q7PA 4IVPA 1W0KA 4UNQA 1Z29A 2W0MA 3NBXX 1OXUA 3U3RA 3OEHA 4G0NA 4QGGA 3DO6A 5KPDA 1NLZA 3GLIB 1G3QA 2ZE7A 1EFTA 3ZVRA 1Q3HA 2XGJA 2I4IA 4FN5A 2C99A 2FPMA 4HSEA 3T35A 4I1VA 1W36D 3QVUA 5AJZA 1YR8A 2WV9A 1G3RA 1W0JA 1ZD1A 2OILA 3I62A 3K0AA 2FFQA 4BLSA 1OXTA 1BMFA 1U81A 2FA9A 3IBGA 2ZS7A 4Q03A 4CYMA 3L0SA 1N6OA 2H17A 1ZNXA 3E1SA 2WKQA 4QBGB 3I5YA 4C7OA 1T5IA 3VNVA 3I73A 1OFHA 1GKUB 1XZQA 4EJSC 2HUPA 1T8UA 1CXZA 3KJHA 6Q21A 2ONKA 2PX3A 3Q5DA 1E98A 1M1YE 3CRVA 2CE2X 2HYIC 2VP9A 1KZ7B 4RZXA 4TSFA 1N5JA 1VTKA 1CEEA 1DBSA 4KFTA 2BDTA 1G8FA 4NH0A 1KK0A 1R5OA 2NZJA 1ZYUA 1E1QD 4RZUA 3R9WA 5DISB 4LC1A 2JLZA 2FNAA 5JEDA 5L3SB 4EFMA 3E2IA 3PEVA 4PO8A 1RRPA 2NO7A 5FUYA 5TV2A 3VR1A 2ZJZA 3PEYA 2ZJ8A 1V5WA 4C4PA 3CNOA 3NG1A 2ZJBA 4FI3C 2WMNB 421PA 3N5CA 3I1FA 4D0LB 1UKZA 1OH6A 4A2PA 3VKWA 1C1YA 1ZW6A 3REGA 2WWXA 4TL8A 3ICQB 2HV8A 4DWJA 3L0IB 4HUQA 2F3TA 2C9YA 3T1VA 3KUCA 1N6LA 2JIZD 1NBMD 3P27A 2Q3HA 1ZUNB 1NMZA 4OHWA 2WWHA 621PA 4ZI3A 2QBYB 2YC2C 2O8BA 1R0XA 2QG6A 2A5FA 3A36A 5CDFE 3K9NA 2QPAA 4A6PA 4EUNA 2BEJA 2FSFA 3BJIC 2GF0A 4NL4H 4D4LA 5FOVA 2CL0X 4AYTA 2KI5A 3EARA 4U7DA 4RKEA 1T5LA 1U9IA 1KK2A 2R6DA 2WMOB 3ZZ0A 4JLNA 1ZM4A 4DDVA 1XJ0A 2W58A 1M7HA 3JVUA 4C0JA 3B78A 3OESA 3CRMA 2WJGA 3QXXA 3WY9A 5KU1A 1WRBA 1UAAA 4D82A 3DM9B 4Y0AA 1RVDA 5BQ5A 3WNBA 2VP0A 4Q1DA 1EGAA 2KJQA 5HCNA 3BERA 5JWOA 5CK5A 2KSQA 4MDEA 2EFEB 4DEYA 3X1DA 4KFSA 1E2NA 5K8LA 1Z6TA 2IL1A 1CKEA 4P33A 4ZV4A 2RGGA 3AVPA 2QGZA 4ITRC 2GJ8A 4FMBB 3VAAA 1OYWA 4WAUA 3KUDA 4NCNA 5BYJA 5LBIA 2J1LA 1H8ED 2BEKA 2GEDA 1Z8FA 2OFWA 4ZDIA 5CDFA 4JT2A 3I72A 4BEJA 4GI7A 3R9XA 2ZRGA 4PC3A 5EXTA 5L3VA 1WCV1 1DAFA 5AJVB 2CDNA 1PZNA 5GVRA 3ADCA 3JZAA 3AVVA 2CNWD 3KX2A 2O8CA 4P3YA 2D06A 3C5HA 3QF7A 1B23P 1UKYA 3LV8A 2OHFA 1JPNA 2RGCA 2DHRA 1YZUA 4Q7JB 2P65A 1JJVA 3AVQA 5KDLA 4A8JB 4A1FA 1GNQA 3QXHA 4CEJB 4M9ZA 5B30A 3RDPA 3RC3A 3K8YA 4F4IA 1Q1ZA 2CE7A 1E9EA 3TE6A 4BASA 2RB4A 2W0SA 3CKLA 3I8XA 3FTQA 1VKJA 2C9CA 5JCZA 3KB1A 4DDWA 4D80A 4L9SA 3KXIA 4GBMA 2IEZA 1OXXK 4B3BA 2AXPA 3B9PA 1XDBA 5KSPA 1JB1A 4V0NA 4NONA 3D3QA 2OV2A 3THWB 2XZLA 2DPXA 4CF7A 3BS4A 2G83A 2D62A 1Z3IX 3O8CA 1N6KA 2OUKA 1MKYA 4XVRA 4LJAA 2D3WA 2IF2A 2H7VA 1XP8A 1M7BA 2GVDC 2XZOA 3GLGE 1HT1E 2RGAA 3VKHA 1XJQA 1IJEA 4EJSA 2J87A 3W5JA 2CL6X 5GJVC 3K9HA 2QE7D 4D0GA 1YR9A 4V0OA 4R9UC 2D4HA 4YONB 3CM0A 3TUJC 3FMOB 3W90A 3GLHE 5FL3A 2Z83A 1TU4A 5CYPA 4C0KA 2JLRA 5JJIA 1G19A 1N6IA 3C16C 2NO9A 4AURA 4BFTA 2C98A 2BMFA 5CIQA 3VR3A 3K0FA 4XJXA 1XTJA 3OHMA 4KAXA 3L2OB 2R9VA 5LB4A 4Q7LA 4JLDA 4E5UA 2ZSDA 1G41A 1W4RA 4GP7A 1CBUA 2GCOB 2CCJA 2ZJ2A 2RH5A 2FZLA 3ZVNA 5JJLA 1K5GA 1VYTA 1M2OB 1W47A 1XMJA 2JJ8A 3QG5A 5LD2C 3MSXA 1UDXA 4ZPXA 1FPMA 2J9RA 2GTPA 1P3JA 1G64A 3FHOA 4KI0A 2IC5A 4B75A 3M1IA 5JCPA 5EP3A 4IOKA 3EPHA 1KSFX 1KI6A 1UBCA 2J0UB 2LCFA 5JSZA 2QSZA 4BPBA 3GLGA 3WP1B 4BZQA 5EE3A 1SHKA 5KNBA 2VHTA 1NBMA 1DELA 3VTKA 1RRFA 4KITB 1EX6A 1P62B 4O2LA 1CJTC 4HAXA 4A92A 4ZKEA 5TARA 1E0KA 1ZU5A 1E9AA 2WWFA 4MKIA 5FOXA 2ZSEA 5FPYA 3RS4A 2ZJ5A 4W5WA 4F91B 1EWRA 4XVUA 1E2IA 4NYMQ 3SE0A 4B3XA 1OH5A 4HB3A 1SKQA 1JECA 1ZNWA 3GQBA 1OFIA 1JI0A 1Z5ZA 4NPHA 4ZCIA 5DHFA 721PA 1EFCA 1C4OA 4B44A 2VQSA 1OSNA 5DSZA 5JS7A 1ZD8A 4M1YA 4NHOA 4BWYA 2N46A 4C2TA 3VMFA 3CH5A 4YMUA 2QM7A 4Q1AA 1X1SA 2JJ1D 1JEDA 1PLKA 4CIDA 2ZRCA 4ASUD 1AS2A 2ZYTX 1EXMA 2NIPA 4RVCA 4KFUA 1E69A 4ON9A 1G291 2O0HA 5JHHB 2OEPA 4DLVA 1NN5A 2Q3MA 3I92A 1MV5A 4URYR 4ZIRA 2MSDB 4I1SA 4DB2A 2BHRA 1US8A 1SVIA 3RWMB 3PJRA 2R6FA 1H8EA 2V6JA 3KJEA 4PHTA 3FYHA 2FV8A 4JL5A 2QNRA 4B3GA 3RS2A 4Q19A 4MH0R 1NVWQ 1HV8A 2BBOA 2OCYC 1KJWA 2PH1A 2HXSA 4HAUA 1S2MA 2CLSA 3BK7A 3EXAA 2X2FA 3GCGA 5KOYA 1N3BA 4FXPA 3QPVA 5J4LA 2G6BA 3RVBA 1IHUA 2WHXA 3U3KA 2WVJA 1PV4A 4DC9A 3GLIE 2CNWA 3QEOA 1NMXA 1DS6A 3LNCA 2JDIA 5JRZA 4II7A 1UKEA 1TPZA 4PHHA 4IKEA 1W2HA 2E9SA 3NBFA 1X86B 4FD2A 4E07A 2FGJA 1X8JA 3ADKA 2O0KA 2ATXA 4IDQA 4XD7D 1AK2A 3GJ6A 3QEJA 4QGFA 4V03A 4DLXA 2ZYVX 1WF3A 3THXA 1NP6A 3GP8A 1TUIA 2QUZA 5H68A 2QRZA 4V0KA 1Q3TA 4OYHA 3P26A 1GKYA 5AUQA 3C41J 2NO1A 2AX4A 4JZKA 3FHCB 2ZYUX 4D0NA 3U2QA 2QN6A 2ZRHA 3G5UA 3QIAA 2XEXA 5BN4A 3AVXA 5FBWB 1E1RA 2PLRA 4TYPA 1TQ2A 1DAMA 3S1AB 1IXZA 1YZQA 4JBXA 4Q4HB 4EKDA 1KMHB 3KFVA 3C4JA 3NH6A 4E22A 4GL2A 1HURA 2IYZA 5JZVA 5EXPA 2ORWA 1GWNA 1OB2A 1AS3A 2QQEA 5GJCA 1FX0A 4ZKDA 1F48A 1VG8A 2ZEJA 4RD1A 4NTZA 1ZM2A 2WJYA 4NCHA 2HXYA 1DO0A 2QT1A 4YDSA 2PEZA 4TMWA 1YZNA 2RMKA 3SOPA 3A1SA 4PAQA 3K53A 1OB5A 4PX9A 2WSMA 2OBNA 1L4UA 2PMDA 2WKPA 3PUZA 4IOMA 1UBGA 1NIJA 1CJKC 4GMDA 3DOEA 4DSOA 1PLLA 1ETUA 3ZS8A 4AK9A 2QE7A 2ZYWX 4EDHA 121PA 2Z0MA 1BYUA 1MT0A 4TQUS 1O3YA 4CT5A 5H8WA 1XMSA 2REXB 3MCAA 1WBDA 3LD9A 2AHOA 3KJIA 1TMKA 5AJYA 5ELXA 3UPUA 3QY0A 2LKDA 4IDNA 3TJZA 2ZU6A 4P4SA 4PQYA 3EC2A 4KCGA 2FH5B 2BM1A 1WBBA 1Q57A 4PC6A 2GXSA 5AUNB 5EZ5A 2ZRDA 3AKYA 4HDOB 4X8HA 2ZI7A 1RYHA 1NG9A 1NI3A 3CWQA 4GZLA 2CXXA 3BGWA 3EWSA 2HF8A 4KFRA 1SXJD 1TUEA 1SXJC 1N0UA 2QA5A 1GRRA 4G1UC 2B21A 5TY0A 5L3SA 2NO6A 4MQBA 2ZI3A 4Q02A 1DAIA 2R8RA 4O2RA 5HE9A 4Q9IA 1DG1G 4GP6A 1D8TA 4NYIQ 1MRSA 2GBLC 4FCVA 3NKVA 4WZAE 3EWAA 3EW9A 1NVVQ 3MMPA 2OT3B 2CMKA 2Q0HA 5CLLA 3KDSE 3FKQA 3W6NA 1TQ4A 1KO8A 3IGFA 1YE8A 5L8VA 2XTZA 4MGZR 4TLDA 4RCZA 5KNDA 1DE0A 1Q44A 5FBLB 1OXSC 2IWRA 1J90A 4TZ0A 3FMIA 3N70A 1F5NA 2MMGA 4BFYA 1JR3E 3O8DA 4HLCA 3LBNA 5C46F 2CLCX 4MITA 4TL7A 4UJ5A 2WOOA 2QBYA 3AF3A 4RFVA 4NE2A 5G41A 3TUZC 2OZEA 1W0KD 4BRWA 1FUKA 4PO1A 5CM9C 2UZ3A 2FF7A 2JJ1A 2G1JA 1NSFA 2AXNA 3OEHD 4KV9A 1CP2A 1MRNA 2FWRA 4ASUA 4KHZA 3SJBA 4EAQA 5AK0A 3L0PA 4MGYR 4M21A 2JJ2A 2ORIA 5A4JA 1BO6A 3KKPA 2V3CC 2GJ9A 5DHAA 1XTKA 4US0R 4DSUA 1E96A 2GZHA 1DAKA 1OIWA 1W0JD 1Z83A 4RSGA 2FEOA 1M74A 5E7MA 4IXMA 1KK3A 3MAAC 5G40A 1IJFA 4TMTA 4Q4JA 2QPOA 1YVDA 3MFYA 4JLAA 2J41A 4K81B 5K8UA 2F55A 2O8EB 1Z6GA 4EPTA 4TYWA 4KU4A 3HPRA 4EQ6B 2H1LA 4L5BA 1OV4A 1G9XA 3KJGA 1ZM7A 2ZRNA 3PG5A 3SFVA 1FW6A 4DCVA 5C4GB 1IAQA 1Z6AA 4ERNA 1MABB 3B82A 5F9FA 1KTVA 3MG9A 4BZXA 1Z07A 3UG6A 1JR3A 5FI0B 1AQUA 2V8OA 1XEXA 1QHHA 3PQCA 4FMDB 1FMLA 4TQAA 3JVVA 1RRCA 1LV7A 2NMVA 4FCWA 3PEUA 2CHVA 4R71A 2NOAA 2H5EA 4DLWA 5A5GA 1XXHB 2NGRA 3LY5A 3AKEA 3OAAD 5F9HA 1LF0A 1IOZA 1M34E 3NH9A 4TLEA 2MMCA 1ZM9A 2ZE8A 3EZ7A 4QGHA 3MWLA 4P4UA 4OI0A 4XSHA 3EX7C 1N6NA 5DN6A 4URUR 2O8FB 4NKRA 5JWRA 3BWDD 4DLZA 2ODEA 3OIVA 4JMPA 1R6BX 1NN0A 4DXAA 4ILEA 5C1BA 1VDZA 3RSLA 2JLUA 1T0JB 3EAQA 1EFUA 2C96A 2WJIA 4Q1BA 4DSTA 3MD0A 3U7HB 1FTNA 2ZETA 2OAP1 3TUIC 2IYXA 4R2IA 4ESVA 1O87A 2BMEA 2J3EA 2K5UA 4AI6A 3W9YA 1G7CA 2VP5A 3WMGA 1FNNA 2V9PA 2PJZA 5KO2A 3WYAA 1VYUA 3SJAA 2EFCB 3IDQA 3K09C 4CRWB 4DRZA 2XB2A 5F2EA 4PHGA 1NY5A 1SULA 1Z22A 3KKNA 2UVQA 4PTLA 1X3SA 2XITA 4LGMA 2IUUA 3IILA 3M4YA 4OJQA 1ZD9A 4BFWA 3KKQA 4NMMA 2HEIA 3B6EA 4LCBA 4CZ2A 4Q21A 2BKEA 2EYQA 3NDPA 1ZUHA 4UNSA 4DHEA 3I8SA 4URWR 2B7CA 3DMNA 1K6MA 4PPNA 3K0SA 1QHXA 4BFUA 4RD2A 4RD6A 5ANRB 3SFZA 4DKXA 1G5TA 4S35A 2WICA 3EIEA 4KJZA 5DI9A 1E9RA 3CZQA 1VECA 3X2SA 2F6RA 4Q9LA 2ZPTX 1D2NA 2HJGA 1SXJA 3BB4A 2A5DA 2ASEA 2IYSA 2P2LA 3ZLJA 2OXCA 1P7CA 2OLKA 4GFDA 1AQYA 4OQLA 4B6EA 3DZDA 3RYTC 3LFUA 4JLJA 2IW3A 1T6NA 2GBLA 4Q7KA 1COWD 1KGDA 2GAAA 1T0HB 4IXNA 4PPQA 3ZIAA 4PZLA 2BCGY 1P2UA 2RGDA 4Q1CA 3CH4B 2GK7A 4AG6A 3LBHA 1KI7A 4K8OA 4OL0A 2RGXA 1U94A 5BYKA 2O8DB 2OCBA 5FL7A 5FR1A 4OQMA 4QM6A 1YZKA 2J45A 4JLBA 4YXWA 1OYYA 4NYMR 4OBEA 2GA8A 3SDZA 3AF0A 1ZCAA 4MKGA 1D2EA 3H4MA 3VNUA 4RFSB 3Q85A 4IFBA 4Q4LA 1P9RA 4HZUA 4Q01A 2PL3A 4TYQA 1T3HA 3FFAA 2HJVA 2GK6A 1TAGA 2P0EA 5EE9A 3QKSA 4D6PA 1L7VC 3TMKA 4LOAA 4GZMA 1ZIOA 2WJJA 2YKGA 2ZROA 4Q9JA 2ATVA 4MUAA 3TSOA 5C2JB 1NLFA 1OIVA 4IVQA 3QXJA 3GEHA 4M9SA 1U99A 3DDCA 4UXHA 1MO4A 1G8GA 1QHIA 3UWKA 1ZBDA 1WXQA 2VSXA 2P6UA 1GKIA 4BQSA 3TAUA 4F93B 3QI2A 5B57C 3IQXA 4DJTA 1W5TA 5HPYB 2QEQA 3OE7D 3QXSA 4V0ME 2QAGC 4N0EA 4TYYA 3WBKA 1KYIA 3MJRA 2MSCB 3AP1A 4NCIA 3CX8A 4OI4A 2BBSA 1GZSA 3LBIA 4B2LA 4KVGA 3ZQ6A 4JS0A 3AUYA 3IBYA 1D6JA 4PR0A 5JBQA 2QU8A 3WMEA 3IEUA 3LW7A 5M04A 1CIPA 1J7KA 2WSSD 1YR7A 1Q22A 1YQTA 4WBSA 5FI1B 1KDRA 3OAAA 1OF1A 1KKLA 4CEIB 1E2EA 4FCTA 4MGKR 1UEIA 2BWJA 3R8CA 3WNDA 3EZ2A 1I4TD 1SVOA 4YMVA 5FUXA 1N25A 1UF9A 2IEYA 3EG5A 4BFSA 4B71A 1QRAA 1U0LA 3AM1A 3LX5A 3UKDA 1Z0KA 1E79D 1E2HA 5KTYA 3U6KA 5GVSA 2ZREA 4I1UA 4TL9A 3LX8A 4G5SA 4LC0A 2CEAA 1XMVA 4TTPA 3KXKA 5AWFC 3U6BA 3QKRB 3VHXA 1AGPA 1KO7A 3Q3JB 1G5PA 2VP6A 3OIYA 2OFXA 4ZCMA 2IA5A 3BAFA 1A7JA 4V0MA 3X1ZA 2ZM5A 4G3XA 1T3LA 3TIFA 2I1VB 4MRPA 4G5RA 4Q4HA 1AJEA 3RS7A 1G8HA 3BFXA 2RKOA 3K09A 1U8AA 5SZHB 2YWGA 4P32A 2FSHA 4XWKA 5HR5A 4C2UA 1W48A 5FBVB 4KBFA 1SKYB 2V54A 4P31A 3UG7A 5FTLA 4WIAA 1A2KC 4KLZA 2V6IA 1JPJA 2AKYA 4Z8YA 4DBLC 4AKGA 1CULC 3KTAB 4QJ5A 1K8RA 1EFRD 2D74A 4PQFA 3VHLB 2GJAA 2GWHA 1E4VA 3AB3A 1WDTA 4HDCA 4KSBA 2X1VA 4FW9A 1YJ5A 3FGNA 4OK3A 1N6HA 1SVWA 2W6JA 4AKIA 2G88A 3Q8XB 1GG2A 1LNZA 2IYWA 2L0XA 1XX6A 3AVOA 4W5JA 5DI3A 2BM0A 2R2AA 2OG2A 4LX0A 2ZVQX 1KNQA 4GOJA 1U0HC 5SZKB 3MWKA 1Q1EA 2PT5A 4HI0E 4AWXA 5DNYB 4K46A 3QG1A 2QP4A 1NF3A 1MR3F 2BOVA 4GRAA 4TLCA 4HLQB 3TR5A 1AA9A 3SYNA 1SVSA 5FPHA 4DLUA 1MOZA 1VIAA 5IRCD 3IKJA 1COWA 4KXFB 5EUMA 5SZIA 1Y3AA 3W34A 1J99A 1II8A 2CK3A 2BBTA 1KDPA 1S1MA 2JDID 1R5NA 2A2ZA 3NBZC 4JLPA 1UM8A 3QJYA 4KYIB 4BFXA 5BWMA 2EFDB 3AKDA 3HDTA 4HAYA 4URVR 4A36A 2LKCA 1MH1A 4NYIR 2D2FA 1XTSA 3LQRA 3VR5A 5D3MA 4HB2A 3PUYA 2PJRA 1NVVR 1AGRA 4B47A 3NXSA 1TNDA 2CCKA 3UXMA 1GAJA 4A2WA 2ERXA 1ZU4A 1XB2A 3F3YA 1E0AA 1HYQA 1KO4A 1E0SA 4AYXA 5BN5A 1KJYA 1QDEA 1FZQA 3A4MA 3D7MA 1A5TA 4IOJA 3PXGA 2ZUBA 1NMYA 3LO5A 1NVUQ 4PHFA 2B8TA 1E1RD 2IYUA 2F1IA 4MRRA 1A1VA 1BOFA 3SN6A 2V55B 1Z06A 1OKKA 1T9HA 3SQWA 1ZVQA 4PO9A 2F43B 3SBEA 1WMSA 3A37A 3U3OA 1UJ2A 1ZP6A 2CBZA 4HDQB 2AWOA 5EQTA 1ESNA 1XXHE 3RAPR 4ESHA 4LJ7A 4HLDA 4Z51A 2N42A 3VX3A 2GEVA 3C5CA 4A82A 4FWIB 4PFSA 3D31A 1R0WA 1HY3A 1VG9B 3LA6A 3OE7A 3SZRA 2QAGA 4TYNA 4GDFA 5FR2A 2XZPA 5LPNA 4XSGA 2A78A 4J0QA 5H1YA 3TAHA 4EQ6A 2EW1A 1S96A 1DG3A 1XTRA 2G1KA 2ZRPA 2G0TA 3KQNA 3O8RA 4BRUA 1F60A 2XTMA 4LYJA 3B1XA 1RZ3A 1J2JA 2BVNA 2HT6A 2QP9X 3H1TA 1OLOA 1MABA 4EFLA 2J0QA 1XF9A 4LJ9A 2WSSA 2QTVB 3N2EA 3ASZA 3FB4A 3PITA 4M9QA 1XFAA 4LJ4A 1U8ZA 2OESA 4FIDA 2CVFA 2GXAA 1N6PA 4B43A 4IOLA 3OEEA 3L43A 1E9BA 2PLFA 3D8BA 1E79A 3Q9LA 4URZR 1TQDA 1AS0A 1EK0A 1BH2A 4OHZA 1FOEB 1QHSA 4H1UA 2WTUA 2J59A 3T06B 4OKSA 3IIKA 2ZI6A 4D81A 1LS1A 2PCLA 4P0TA 4DT1B 1KOFA 1G20E 1Y63A 2BC9A 3QENA 4TZ6A 3W3ZB 2DWQA 4RD0A 3GLHA 1NG1A 2G3YA 2GETA 2R6AA 1ZUIA 2DYKA 2GKSA 5JWHA 4M0LA 4B73A 1GFIA 4LWZA 5KSOA 1OHHD 4LV8B 5DGXA 1OFUX 2FSGA 2QT0A 3B2EA 3KL4A 4FINA 3TRFA 1OXVA 1SZPA 3HYRA 2QZ4A 4CEHA 4LBWA 1W49A 5DH9A 2AD1A 3C7KA 2FSIA 4TTRA 1EFRA 1FMJA 1KZGB 1VCNA 2BBWA 4TMVA 2JJ2D 2RCNA 4EIWA 2VTKA 2IS2A 3FMFA 4OHYA 2GDJA 4OQFA 2RHDA 4MA4A 3RS0A 2FDCA 5EP2A 2AKAB 1FTSA 3B60A 5JS8A 1Z0FA 3Q72A 521PA 3T5DA 1EWQA 2CVHA 3EIHA 1UADA 2ZRAA 2OBMA 1KK1A 1AZSC 2DFTA 2WBLC 4MRSA 3DEFA 4OK5A 3SI7A 4PAOA 1G3MA 4C30A 4BFVA 2A30A 4TT3A 3RS5A 2HLDA 2LWIA 2PBRA 1W4AA 2GAOA 2VLIA 1G1MA 1A2BA 1G21E 3PR1A 1Z6XA 3N2IA 2IUTA 2REBA 3CF0A 2OCPA 3QNUA 3PIRA 4DB4A 1I2MA 2GXUA 2PCJA 1JJ7A 2REOA 1JR3D 4QL3A 4AKEA 4AKHA 1M7GA 5L3QA 1KI8A 4B32A 3U44A 4F38A 3ADDA 3RRYA 3V9PA 2W6ID 4YC7A 3A1UA 3QVVA 5EP1A 2F9LA 4POAA 4JSTA 1S1CA 3AQ4A 1QHNA 3K0CC 3BFVA 3CUEF 3CPHA 2GRJA 5JRJA 1Q0UA 2IF0A 3RS3A 1GL7A 2XOKD 2ZUDA 5FPSA 4B6FA 3K70B 4JVMA 3U3JA 5JECA 3VX4A 4C0SA 2AK2A 3GJ4A 2JLWA 4IW3B 5EJEA 3TQCA 3T15A 1E0JA 1ZNZA 3B85A 1NNEA 4M4SA 4Q5IA 2UZIR 2Z6VA 3DKVA 3ND9A 3VU9B 2QMOA 2AK3A 3PUVA 1KIMA 1NKSA 5DN6D 4MYTA 4LYHA 2W2XA 1NJFA 2WPDD 3LVQE 4A8JC 4JKIA 4MGIR 3KQLA 4BUJA 4NP6A 3ND8A 4A15A 2WM9B 1J8YF 1U2RA 2HF9A 4JJZA 3R7WB 4PQRA 3QPUA 5C18A 3HR7A 4M1SA 4DUGD 4HUQB 3EASA 4MYUA 5DYIA 3LLMA 3P32A 3EC1A 1QZXA 2CLDX 2ODNA 1RYFA 1XPRA 1OW3B 4TQ9A 2VL7A 1MO5A 2H16A 3T1TA 2O8BB 3GLIA 1G4AE 4PSAA 2O52A 3DPUA 2NO0A 3I32A 2PZFA 5TXGA 1NN3A 1XD9A 1YZTA 3QOFA 3ZDQA 1TF7A 1D9XA 5K8IA 2HCBA 2J7KA 2PX0A 2ZE6A 2ZJYA 3BH6A 3IPXA 4NCKA 3ZH9B 4BEBA 1FQKA 1VMAA 1XCMA 5J4YA 5AUOB 1RE0A 5HZKA 3U7FB 1ZIPA 3CZPA 4M9XA 4L4UA 5IT5A 3AP3A 1P6XA 4QHSA 4A0RA 1VCMA 2YWEA 5LB2A 3TNFA 4F4CA 2YOHA 5EZ6B 5P21A 4BLPA 1M6NA 1P2VA 1OJLA 3WRYC 3PEWA 1XTIA 2VP4A 3BOSA 2IXEA 2EYUA 1I4LD 1SVMA 3CNLA 4A4DA 1BIFA 3AV0B 2DFNA 3TVDA 4Q4AB 1U90A 2QP3A 1EX7A 1IM2A 3A1VA 1SKYE 2YJTD 4UNRA 2VO1A 3AUXA 2B92A 1DOAA 2NZ8A 4PANA 1WA5A 3RSOA 3I4LA 4Q00A 1CLUA 4NCJA 3ZJYA 3UATA 4JLVA 4RKFA 4B74A 3FKSD 4LJYA 3WHLA 2QRNA 3ZIAD 1W4BA 2ZR0A 3OFND 4QNMA 3U4QB 2J7PD 1GTVA 1GP2A 1FL9A 2R65A 1A82A 1JQJC 1YHNA 2GZAA 2VEDA 4JSYA 2O8CB 4MDFA 4O0MA 221PA 1XWIA 3CX7A 3A1WA 4D2IA 3A6PC 2IUSA 5KDOA 3IO5A 3E70C 4JLOA 1GNPA 1HH4A 4UXJA 1N5IA 3AGQA 3LH5A 3GJ0A 1OHHA 5FL7D 1KI2A 4C0AC 4D4KA 4DIDA 1KDTA 2QSYA 2VHQA 4OI2A 5EXXA 2DB3A 4YXWD 3CPEA 5TDHA 4DLYA 2DCUA 1P2TA 3MWYW 2EFHB 4DZZA 4GSYA 1MO6A 2NG1A 3BD9A 3DMDA 3F0TA 3SU8A 1E2JA 4B76A 4ZI2A 2R6GA 5EP4A 4G01B 4E09A 4MYHA 1AN0A 1XPUA 1HEIA 3LRPA 2PT7A 2GCPA 3I3SR 3IIMA 3KFXA 3ZQJA 1W36B 3QF4B 1JAHA 4ABYA 2G9NA 1XTQA 1IQPA 1U8YA 2NTYC 1VCOA 2FPKA 2GCNA 3DVLA 1GDDA 2DY1A 5E7JA 2WAXA 1DAEA 2EQBA 4RD3A 1NLYA 2ANCA 4IJMA 3O8BA 1IBRA 2ZR9A 1IN5A 3H86A 3R8FA 5DIFA 1CR0A 2FPLA 3LWNA 1G8PA 2DWOA 1YRAA 3KZ1E 3ZYCA 1UFQA 1CRQA 2BIFA 3B8HA 3ONWA 2DBYA 3CPJB 4P4TA 2GJSA 2W6IA 4LJ8A 3K0CA 1FFHA 1FP7A 5FBRB 3CBQA 3RC8A 1E2QA 2XJ9A 3WYFA 4HUTA 5LDDC 1EFHA 2XOKA 1R8SA 3K0FB 2IYQA 1M8PA 3FFBA 4M22A 4Q1EA 3IUYA 3AF1A 2VPPA 4RJLA 1P72A 2Q9BA 2ZITA 3SJZA 3GLFB 1P2SA 1N0VC 1OPXA 5KPJA 2B6HA 4X8MA 3IQWA 1JALA 3QBVA 1MO3A 3DHWC 3GJ3A 1ZJ6A 1RW4A 3LXRA 4AC9A 3JZMA 5G3ZA 1IN8A 4H1VA 2Q6TA 1GRQA 1Z2AA 3ASYA 2JLSA 4A8JA 5GJBA 4LSGA 2WPDA 5FTMA 3L82B 4CEJA 3OIUA 3CX6A 3PUXA 4IDHA 2J5XA 1CS4C 1YKSA 2HYDA 4EPRA 1FNMA 1KI6B 2C2HA 4DUGA 3WHKA 3GPLA 5JSZB 2VHJA 3RRZA 3ZD7A 3FHTA 1CRPA 4NYJQ 1IY1A 3A4NA 2BJVA 2QPTA 2UKDA 1Q21A 5AJWA 3BIFA 4B3DA 4B2IA 2Q9CA 1G6OA 1VPLA 2ZS9A 2V7QD 5TMPA 4NBSA 5FFMA 2OCAA 2VHUA 2W00A 2XTNA 3THWA 1N2CE 3W8RA 1CTQA 4YDHB 3HU2A 1E2MA 4UNPA 3QE0A 1PUIA 1VG0B 4OK6A 4PPFA 1R2QA 1CJUC 5KHOC 2GJKA 2ZJAA 4TLBA 1D9ZA 3DM5A 1TEXA 1TX4B 5FOUA 1RFLA 4C3ZA 2F9MA 2JCSA 2E87A 4E03A 2ZJOA 3B9QA 4QGAA 4KO8A 4WVFA 3PV0A 1IONA 3IHWA 4Y0VA 2YNMA 1ODFA 1Z0AA 2W6JD 3U5ZB 3NTUA 1SGWA 1OIXA 3LAWA 4Z8XA 3TBKA 4DSNA 3VR2A 4LY6A 1HT2E 5KNCA 1RPZA 5G53C 1KJZA 5J4KA 3Q7QA 1LTQA 2OO7A 3OF5A 2WWGA 2ZAOA 4DLRA 1ELOA 4GT1A 4W5HA 2GCOA 2WWYA 1BYIA 2JA1A 2CCGA 4HAWA 3TW4A 2WIBA 4B3CA 3SBDA 1XPOA 1G18A 3D6TB 3SHWA 3FKSA 3QUSA 5GADl 2FX3A 4QXAA 5CJPA 2X8AA 1VCIA 2CK3D 2IHYA 4Q18A 3WYGA 1GITA 3OFNA 4WXRA 3AVWA 2J7PA 2NPIA 3RHFA 3FE2A 2ZSFA 4XVQA 4DDUA 2ECKA 5DO9A 5CM8B 2Z5FA 1CR1A 3NBYC 3P20A 4IVRA 4LBVA 3SYLA 2J0UA 3KQKA 4I4LA 2YOGA 4L16A 5DE3A 1L4YA 1FP6A 5AJXA 5E4FA 4DT1A 1BKDR 3THXB 1XEFA 1TF2A 1G3IA 1V43A 4XH9B 4AYWA 2KWIA 1HQCA 1TL7C 5TB5A 3W6OA 4DDTA 1R4AA 3RRNA 1RC8A 1WP9A 3K0EA 3A58B 2Z4SA 4N0DA 3AGPA 2D7DA 3U7EB 3ZVLA 2V4ZA 1GIAA 5B64A 4KYUA 3B1WA 2XNDD 3NC1C 1N0WA 4IEEA 4QFMA 3H0KA 3GFPA 1OKKD 1NL3A 3C15C 4BLTA 3AF4A 1BS1A 4PPGA 5A0FA 1LB1B 4UXIA 1DAGA 4M8NE 4PZYA 4PC2A 1FX0B 5FPTA 2WWIA 1E2KA 3UIEA 2C77A 1D2MA 3FDIA 3NC0C 1KDOA 1PVOA 2FFBA 1AKYA 2VF8A 1Z28A 1ZC3A 4V02A 3ZS9A 1XMIA 1XJCA 4EPWA 5JI2E 4QC2A 3TGPA 1E2DA 3BB1A 1NKTA 1W36C 3SQXA 3UANA 1KI1A 4JVLA 2VP2A 2C5LA 3CIOA 3EZFA 3GJ8A 1QG2A 1TTTA 2IXGA 2JGNA 3C14C 2OM2A 2Q21A 2ZRLA 4YMSA 2ZSBA 4D25A 3CNNA 3QKUA 4DCTA 4YQFA 1QG4A 3NHAA 3T1QA 1G4UR 1NVXQ 1QBKC 2C04A 2GF9A 1F2TB 1G17A 4TLAA 3X1YA 2VA8A 3HR8A 4HLUC 2QROA 2ZRMA 4P4SB 4Q9HA 4XTRA 4F4JA 1WB9A 2C03A 2OXRA 4XWAA 2BV3A 2EFGA 2H8KA 3Q5EA 2WAYA 2ZSAA 2YVUA 3AEZA 3J81k 3KQHA 5LD2B 1C9KA 2Z43A 1UPTA 2V1XA 3OEED 2R6CA 3TH5A 1Z0DA 4X8LA 2GHIA 3VFDA 1L8QA 2ZRJA 4GOKA 1X8KA 2A5YB 4JL6A 4UQOA 4BLOA 3T61A 2R44A 2QGNA 2YHSA 3KKOA 5KSYA 3U61B 1GL9B 3WMFA 1UBEA 2WOJA 4JJKA 1JNYA 1U98A 3VU9A 2QENA 4BZPA 1RJ9B 2V7QA 4M1MA 5B58C 5E95A 3S1AA 5GJWC 1Z47A 3QBTA 3QXCA 1KMHA 5CIWA 5BN3A 3R7WA 4QJ4A 1ZAKA 4AY2A 1XD2B 1OFTA 3V4RA 4LUCA 3SJCA 2F1HA 1Z2CA 3C8UA 2FOLA 1HUQA 4A6XA 3PVSA 1WQ1R 3ADBA 1TADA 3REFA 1KSHA 5JMTA 2FG5A 1W2GA 2KBFA 1XCGB 1G16A 4JYBA 3WRXC 4US1R 4FMCB 3GJ5A 5BW8A 4X8OA 3A8TA 4BECA 1HQYE 2BKUA 1JAIA 2E1RA 5B2ZA 1II0A 1ZRHA 2PEYA 2QMHA 3EPLA 1S4QA 1E2FA 2KE5A 3G82C 4TT3D 2HLDD 1AKEA 4Q4JB 4TTQA 2TMKA 2XXAB 1R0ZA 4U02A 4HB0A 4MUBA 2QY9A 1XD8A 2C8VA 2VSFA 4LJ5A 3I5XA 2OE2A 2ERYA 3ICEA 4JL8A 4LBYA 1CF4A 2FZ4A 2XJ4A 3MJHA 1II9A 4DCSA 4EFNA 1EESA 2JLXA 2X2EA 4Z1MD 2GXQA 2RGEA 3T12A 1T3SA 2ZRIA 1LY1A 2P6NA 4QHYA 5JI3E 2F1JA 1KKMA 3RLFA 4TMKA 2DFKB 2GEUA 3GMTA 2PZEA 4HAZA 4CW7A 1IN7A 3VR6A 1E2GA 2CJWB 4JBWA 1XEXB 3B13B 2FFHA 3MUFA 4Q4AA 2IS4A 1QHHB 3THYB 3CF6R 4G5QA 3W6PA 2P3SA 3PFIA 5HE8A 5J47A 3VKGA 1E6CA 5IDVA 3DKPA 5HKKD 2P6RA 4NU0A 5FTNA 3U4QA 3ECCA 2JASA 2VHCA 2N1BA 2IWHA 3MLEA 1IXRC 1H65A 4PXAA 2RHMA 1RIFA 1U0JA 1IN6A 1E9SA 3X1XA 2YINC 4PSKA 1F3OA 2XNDA 4U5XA 4ZDJA 4FMDF 1Q20A 3QKTA 3KB2A 2H57A 2QQ0A 5D3QA 1GSIA 3X1WA 1A4RA 1DVRA 3BE4A 3SS8A 4YMWA 1TEVA 2QM8A 5F3WB 1Q1BA 1CJVC 2QAJA 3L8ZA 4RCYA 2P5TB 4R2HA 2ZRFA 3SC3A 1DTSA 4LPSA 1X8LA 2ORVA 4WW0A 3W5IA 1WE2A 2A5JA 4JVNA 4MKHA 1XCPA 2RGNC 4A9AA 3GLFE 1P4SA 2AL7A 2IS1A 3BH7A 4M1KA 5JFGA 3NEYA 3QF4A 4M1TA 3GJXC 4MKFA 3THOA 1P73A 1KI4A 1E3MA 3PENA 2O8EA 4RZ2A 2GESA 2NPFA 5L3RA 2J0VA 3CLVA 1UEJA 2ZE5A 4MYCA 1GNRA 5E3HA 3W8NA 4H9GA 1E32A 4OQNA 5EE1A 2X19A 4XTCS 4RY2A 4R98A 3MGCA 1NBME 3RNLA 1R0YA 4HLUA 3UMRA 2J46A 1J8MF 1S8FA 4DLSA 2B8WA 3G0HA 4JLMA 1H8HD 5J5CA 4LDJA 2ZXUA 1E94E 4XIGS 4LHZA 2AFHE 5BXQC 2ZR7A 4R7ZA 1SXJB 4B3FX 1KI9A 821PA 1E1QA 1F2UB 2ZI4A 4JT4A 1VHLA 4LYFA 1IN4A 4ARZB 3CONA 4WOPA 3IPYA 1XXHA 1YU9A 1P60A 1L2TA 4BE7B 5J4HA 3GLFA 3ETLA 4QKQA 1HA3A 3EIQA 2F1RA 1FUUA 1P9WA 5AUPB 5KDDA 1AZTA 5CYOA 4BFZA 5CLQA 5G3YA 3K9GA 5CB8A 1XEWY 2O8FA 4KVAA 4QG7A 1P5ZB 4FWTA 3NDBB 4DVGA 2DWPA 2OLJA 3MWJA 2JLVA 1E99A 5FTJA 3DL0A 4NYJR 5E7IA 4W9MC 3ZZTA 2YOFA 2IS6A 3FWYA 2O0JA 1JXMA 4ZDKA 2JEOA 2VH5R 4I99A 4C0HA 4OI1A 2JIZA 4GMXA 2Q3FA 3AH8A 4LYAA 4RZ3A 4I81A 1ANKA 4HATA 2YWHA 4PSVA 3EZ9A 1ZC4A 2KB0A 2IBMA 2YWFA 2VRWA 3TKLA 3ZZUA 4A2QA 2JLYA 2O5VA 2FGKA 2WIAA 3SNHA 1PLJA 3HWSA 1DAHA 4L15A 4LZZA 1QVAA 1LW7A 2C9OA 4HZUB 4LJ6A 2QMEA 4NDZA 1NY6A 1JQLB 1G6HA 4CVNA 2IYTA 3CW2A 2FMXA 1XNJA 3QKSB 3NHBA 3K0AB 4B33A 4O3MA 4NZYA 1IXSB 2DFLA 4QRHA 5K8TA 2QTHA 3HU3A 1GILA 2AFIE 4IFEA 2BMDA 4D26A 4C7OB 1D5CA 1G3UA 2ZVPX 3LDAA 2ZI9A 1K5DA 2IXFA 2ONJA 1HE8B 3T5GA 2JLQA 2ZS8A 3CO5A 3U3MA 1XZPA 4AIIA 4C0QC 2XNSA 3A1TA 5DLQC 4Z1MA 1W46A 3BBPA 3LLUA 4PC7A 3RANA 4ZDWA 3SYKA 2F7SA 4BGDA 4QHTA 1SVKA 3EPKA 1GL6A 4Q48A 4G5GA 1GRNA 3BC1A 1CJMA 4XWOA 4QBHA 1JXOA 2HCJB 5HCIA 2WZQA 3CB4A 4TWZA 3T1OA 2EU8A 5CK4A 1CR2A 3IIJA 3PCRB 4OQXA 1I2DA 3B1VA 4B2PA 2H18A 5HKKA 1XBTA 4ZCLA 1G8YA 1JBKA 3CRQA 3L8YA 3K1JA 2XSZD 3HP1A 4UJ3A 3B5JA 1KAGA 1Z6YA 1F6BA 2PMKA 4LV6A 3GEIA 3R20A 2ZIAA 2WJVA 4YLGA 3BB3A 2O8DA 3IO3A 2BMJA 2DR3A 3GFTA 1UDWA 1QHGA 4LK2A 3T34A 2H92A 3AVYA 1ONBA 3UMSA 3L0OA 2A5GA 1KY3A 1E9CA 2HT1A 4PZZA 5CJ2A 3PUWA 4RFSA 2P5SA 2IYRA 1VYVA 2WJHA 4XOIA 3TVTA 2JAQA 1ESMA 3O47A 2RGNA 4LHVA 5FUVA 4A0GA 1UKVY 4F92B 1T4GA 4CDGA 5KSZA 3EPJA 2VIIA 1HTWA 1E2PA 2C78A 3ZVMA 4C0LA 1XRJA 2EVWX 3AVTA 3NEJA 1N5LA 4LHWA 1X1RA 1W1WA 2VSOA 3KQUA 4OHXA 5HZHA 1IY2A 1QHYA 2W83A 3BRWD 1KO1A 5FH9A 2VBCA 4KODA 3UWOA 1OH7A 2D7CA 4ACBA 4TMZA 5HTKA 4U00A 1R10A 2QORA 2ZI5A 2NQ2C 2Z4RA 5JJKA 2WKRA 3F8TA 1W7AA 1P75A 2QI9C 4LHYA 2A7QA 4JYCA 1G7TA 1P9NA 2WWWA 2CL7X 5AR1A 2YZ2A 3FPAA 1DEKA 4DEXA 1Q1QA 4ACAA 1T91A 2YV5A 2XAUA 1H8HA 2BCJQ 3H2YA 1XU4A 3AF2A 4Q47A 1LFDB 5DI3B 3SEAA 5KYKA 5FTKA 5F98A 2GZDA 3GD7A 1IY0A 1LF5A 4D4MA 3GJ7A 2I3BA 4DCUA 1KO5A 1F2TA 1YRBA 2ZUCA 4DCNA 3P4YA 3TQFA 5IK2D 4GOXA 4CEIA 1G7SA 2FE4A 4LI0A 3RRMA 2A9KA 2P67A 3DZ8A 4FMCF 4WA7A 4IHQA 3RABA 2FFAA 2GNOA 2X77A 1II8B 4S2EA 2RAPA 1PUJA 3HYTA 4A0HA 1YR6A 2Q9AA 2QL6A 4L9WA 1JEEA 1W4CA 4YMTA 5JEEA 3CRW1 1KY2A 4QOSA 3U60B 1CR4A 4US2R 5D3MB 2PZGA 3FMPB 4IDPA 2ZU0C 4L8GA 1XEWX 4B35A 2OAQ1 1OE0A 3P4XA 3QKRA 3QPWA 1R8QA 2ZTSA 5EUQB 1RJ9A 4KBGA 2ODWA 2B7BA 2JATA 2C95A 4RD4A 4O25A 2D2EA 1Q12A 4EPXA 5H70A 1XD2A 3E5HA 5FBQB 5KUTA 3LQQA 1VG1A 3V4FA 5SZJA 4N1AA 3LVRE 2IYLD 3KXLA 4URXR 4HZIA 5IHPA 3EA5A 2RGBA 2VF7A 3AVUA 1KHTA 1AIPA 2OFOA 1EG7A 2CHQA 1GUAA 2XX3A 5EE5B 3KTAA 1TQ6A 1NRJB 5FOTA 4UKDA 5JHGB 1W5SA 1JR6A 2AN9A 3HU1A 2AR7A 4A0FA 1QF9A 2ZRKA 4IDOA 1SVLA 3AP2A 1S9HA 3TLXA 3W3AA 2AD5A 2ZRBA 3B7GA 3NWJA 3UMFA 3QSYA 4EJSB 1S9DA 1YZLA 5TVKA 4C9BA 2BJWA 4TL6A 3A4LA 1BMFD 1B0UA 4GNKA 4QM7A 2ZAMA 2QAGB 2XXAA 1W44A 1KNXA 4IEIA 2EWVA 4JLKA 2OSBA 3ZD6A 3OIWA 3GFOA 2R62A 5DYGA 1OH8A 1ZNYA 2FN4A 3TW8B 3WBJA
chains in the Genus database with same CATH superfamily
1TCCA 1ZCFA 3CR7A 2X3UA 4EHLA 3WHIA 5KNLA 1ULSA 3PQ7A 4U9UA 4BBAA 1Z08A 1K1EA 4I4TF 3G68A 3HPQA 1UPXA 3V00A 2HPVA 5F4ZA 2FU5C 1CUSA 3DE5X 3KWLA 3ESCA 4R3NA 2KBEA 1T35A 2J5KA 3BORA 4EOGA 3MGGA 3HUTA 2CJWA 2XSZA 3CWZA 4QBFA 3T7SA 5IF9A 3F6CA 3M0EA 1V8OA 2D59A 3HNOA 1GUYA 1TT5B 2OWDA 5H4GA 5IXSA 1NBIA 2R8BA 2YC4C 4I55B 3GFBA 3TCXB 2A57A 3ICPA 3DA8A 2AMFA 1J70A 3E9CA 5G0UA 2HRDA 3TVYA 5KOJA 3FNQA 4G26A 3BEDA 2XA2A 4JVSB 1C41A 1P1JA 4LBZA 4AZ0A 4BJHB 4DG5A 4EG1A 5LXTB 3GLGB 1MXFA 3AW8A 2I78A 4KQ6A 16PKA 1C8VB 4HEJA 4M46A 4GMGA 4UCQA 3BXZA 4RTOA 5DRTA 1SMKA 1A97A 1OX6A 2Y9PB 3CE9A 1TU3A 1G8JA 2BLNA 1PT5A 4M0UA 4N3NA 3GRYA 1YJBA 2RHWA 3BBLA 5EIBD 3SR0A 5CXXA 4BC1A 3PP8A 2AFHB 4JCCA 1FYXA 4E1BA 3PXAA 1DV2A 1F8GA 1SU7A 2WF6A 4GR5A 1R7RA 1L1EA 2DR2A 3D8UA 3ACBA 1DWPA 1XZGA 4NAUA 3VZBA 4D3FA 4PCLA 4DQDA 1IXKA 1D07A 5B12A 4IG9A 3MGKA 3TTYA 2BTQA 1G42A 1Z56C 3DBVO 3OZVA 4QE3A 4L07A 1UMDA 4QJ3A 4NBTA 5AO9A 5E0KB 1NE7A 1OA1A 5EYPB 4G85A 1R5BA 2EX1A 3PTZA 4MQEA 1ZINA 5TPWA 2PKQO 1U9IC 2AWNA 2GN9A 1U9JA 1LDBA 3O1LA 5FUWA 3LBFA 4FOSA 4LVOA 1ZR4A 2HM7A 1VLHA 3Q5GA 4IRUB 3FDZB 4ID3A 2BGKA 1SY7A 3COVA 5CXQA 4AN1A 4JYZA 1EXDA 3RK0A 1NUHA 1PJBA 4EVQA 2GLXA 4HV4A 4DR7B 2Q5HA 3SAJA 3ZGXA 1EGQA 1US8B 5IVKA 2O8VA 2FZGA 4FKBA 3KXDA 5C0OE 1EM8A 4ALJA 4ZO4A 2FP4B 1J25A 2Q6LA 1RKBA 1OX4A 4QEZA 3U4GA 4E2ZA 1XI2A 5AKLA 2HQSA 3LXXA 1X80A 1J09A 2CC2A 3HEMA 5LZ9A 5TC4A 2CD7A 3IESA 3OZFA 3C3DA 4YASA 3P9NA 4HDKA 4OMDA 4INAA 3C3PA 4CN9A 2X7JA 1G5RA 3H2JA 2CHGA 2Y0BA 1DMRA 1HORA 1MAVA 2CFIA 3ECSA 3SVLA 1BQ3A 1NIPA 2W2KA 2Y1CA 3QWHA 2Y68A 2XYHA 3AEXA 4KLRA 1F2UA 3W7VA 4EA6A 3GT7A 5ENZA 3FFXA 3MLAA 4X91A 4BAUA 3KOUA 2QYTA 2PKEA 3LC0A 4KOEC 5KX5F 4JOCA 5FOSA 3EDOA 3OT5A 4J0EA 3JRXA 1JEJA 3QVOA 4JIMA 2DBRA 5AMXA 4BJ3A 4OXQA 4ER7A 3V7UA 1E5XA 1I2BA 3A9WA 1IRIA 5EPOA 1YB1A 1ESCA 2FPWA 3EODA 3L07A 5HM6A 4RTMA 1CUBA 4NBUA 4QO8A 3V4OA 3OCYA 3OEYA 4EHBA 2CVOA 3IOMA 4IQ4A 3CZCA 5CFQA 3AV3A 1J22A 2UYHA 4GVXA 1U8FO 1E9FA 1W75A 3EA0A 3SIWA 2C00A 2O50A 3AL3A 3BH0A 1T15A 3KYIB 4GPEA 1RWNA 2OBLA 4MR9A 3LUKA 3V2IA 5MHTA 3F6EX 1BFKA 1D0IA 4HAVA 3E9EA 2XUPA 4DMRA 4G4SO 4KPUA 3B1ZA 1ZH8A 4IVPA 4U3JB 5EGSA 1W0KA 1Y4DE 1TVKB 3A6DA 1JTEA 1YI1A 4ZEOA 4DAOA 2W0MA 4FB4A 3NBXX 1OXUA 3M49A 3U3RA 3UAZA 2BUBA 2OMEA 1M0EA 1VBNA 3E9RA 3LUDA 3DO6A 2J4DA 3B1JA 4G0NA 4GKVA 1FFAA 1MAAA 3FTNA 4QGGA 3SEZA 4CIYA 1W34A 1G3QA 1ZRSA 2FFJA 2ZE7A 4RF3A 1EFTA 4AMZA 4GYKA 3GEDA 2A1TS 2XGJA 1VPTA 2Q1XA 3T35A 3NO4A 1P5HA 2FPMA 4HSEA 3ZR4B 1YZYA 3ZWPA 1G3RA 4Z4FA 3KTOA 1TDJA 2OILA 1UDBA 1UEXC 4L95C 3K0AA 4JH0A 2FFQA 4BLSA 5JFOA 1U81A 4RV9A 1XNHA 2EFJA 2P1ZA 1N6OA 4YRQA 4NZPA 4D57A 4S1WA 3LBAA 1ZNXA 3TYXA 1TI7A 3DE3X 5FXMA 1DIAA 2R1TA 1HEUA 3K1YA 3P0EA 1T5IA 4QBGB 3L7BA 4C7OA 1JMKC 4R83A 1CVLA 2C5GA 3HCDA 3SHOA 4REQA 3CUUA 7YASA 4P86A 4K05A 5TMDA 4WADA 2H1HA 4BUCA 4PNEA 4G4JA 1I2AA 3QVWA 1PBNA 1VPWA 1RBMA 1MP0A 2P3QA 3WA6A 3Q5DA 4GPIB 4YHBA 2KW5A 3H3FA 3CRVA 1CG6A 4UBNA 4F2DA 3N2LA 3BL6A 2MR6A 4TTSA 1APBA 1TJPB 1XQWA 1DBSA 4KFTA 2JFHA 4TN5A 1FQOA 3DDZX 1KK0A 2NZJA 1ZYUA 3EQ6A 3LUBA 2G28A 3G23A 3TKYA 3VR3D 3ZJ5A 4EFMA 1PL7A 5L3SB 4RANA 2HK8A 5DX0A 4AJEA 1RRPA 5KYGA 3RIXA 3VR1A 2ZJZA 3FNEA 4M9UA 3ZTTA 1U0TA 4EGJA 3PDUA 2VUTA 1IAVA 2X5KO 3EZYA 3NG1A 2A4MA 1Y3FE 2ZJBA 1C0LA 5CX1B 2WMNB 1U3DA 4RVUA 4M99A 3RPEA 3F5QA 1WB4A 2OGTA 3CLHA 3I1FA 1QYIA 3IQHX 3E8XA 2KM1A 1DRJA 3KYDA 3D4IA 1UPCA 1BU5A 3NM5A 4UVHA 2B30A 4WKGA 1X7GA 3VKWA 3DBIA 1ZW6A 3R2JA 2PUBA 4TL8A 4CJXA 1H5UA 1L5SA 1SCKA 2VHVA 3L0IB 3CTMA 3L8DA 2OPBA 3QEKA 2C9YA 4WLEA 5AW3A 4TS4A 1E7WA 3KUCA 3F9CA 2H2WA 3FGZA 4QVGA 1NBMD 1HM5A 3P27A 3U7JA 1N9GA 1FEZA 4W5TA 4ZO7A 1WDKA 1XZCA 3LP6A 2YC2C 3DT6A 4GWGA 4JVOA 1MJGM 1IZ0A 4PQEA 4B3IA 5CDFE 2HDOA 2QW0X 3K9NA 4XGQA 2C8KA 3RS9A 5I7VA 5FOVA 5AK5A 1NNSA 5CDGA 3PD7A 3C6MA 3OPYA 3PGKA 2P9FA 1J2RA 2JW5A 1CVRA 1U9IA 4KUGA 4LX8A 3ZZ0A 1U3CA 2CNBA 4CKWA 5KYNA 4ZC8A 2OXIA 1DFHA 5C7OO 3PRJA 4HFNA 1XJ0A 1RR6A 3JVUA 1M7HA 1PGQA 4IYRA 1QIKA 2ZTMA 3B78A 3CRMA 4HGRA 1RYNA 9LDBA 3ER9A 1LPNA 1Q17A 4YJHB 3QXXA 4XJTA 5CUQA 4NBRA 4V2IA 4ZYTA 5KU1A 1WRBA 1N7JA 4IIDA 1UAAA 2AOTB 3EB9A 1ECJA 2VJMB 4FHCA 5F5XA 2XQFA 1DEXA 2VP0A 3OLCX 4WZAB 5BQ5A 1QWOA 5K3FB 1V7QA 4ICIA 5CK5A 4FDMA 4NQRA 1V39A 2JHAA 1UWKA 1PL0A 4BP8A 2PR2A 4WKPA 3X1DA 2FK8A 4ENWA 3H99A 1Z6TA 4XQ0A 5A3SA 2QRLA 1CX9B 2RGGA 4GSLA 2QGZA 4HGPA 1ONNA 4P33A 4AW9A 4C4OA 1DJPA 4OIFA 4FMBB 4OL9A 3CYFA 3VAAA 3A9TA 2VF4X 3VC1A 4ZJPA 4NCNA 1MMFB 3GRRA 1BZYA 3JD2A 2BEKA 2DUJA 2OXFA 2PO5A 4QVKA 4ALIA 3HCRA 3GBSA 4DCCA 4ZDIA 4Z5XA 5BNWA 1B6GA 4BMSA 3SQDA 3R9XA 1VSTA 2ZRGA 3D9QX 3L7JA 4LRTB 1WCV1 4QYSA 4EK9A 1Z4PX 5BR4A 4NEHB 3BGVA 4NAHA 1PZNA 1NP7A 4Q39A 2F8MA 3B8EA 4OX9B 4N3GA 1P44A 2JIQA 3JQGB 3AVVA 3AHHA 3R0JA 1WS6A 1ZJ4A 2GBPA 2CNWD 4ITUA 2O8CA 1TA9A 3KJZA 4CR8A 2D06A 2BL4A 2OHJA 1IOLA 2WYOA 4YQZA 4RVOA 4J03A 2RGCA 4TV8A 2QQGA 3KSDO 3TW6A 1XF1A 2PVPA 4ETWA 1U5BB 2CSUA 1CEQA 5BOSB 5DCYA 3RDPA 3RC3A 5LMNB 3QWFA 4ZEMA 5B6JA 3TE6A 3WLMA 2RB4A 1H5QA 4XCVA 1ZVJA 4CKXA 5K0SA 1VFNA 1WMAA 1LBEA 1QSGA 2W6CX 3G6KA 4PYMA 1RABA 4QQ8A 1BX1A 5D3KA 3KB1A 2P1DA 4J0JA 2EL7A 4L9SA 2GD6A 3KXIA 4GBMA 3PGXA 4P4GA 4LRQA 3S40A 4ZOLA 4B3BA 5KBYA 5C8ZA 4DXDA 5E8JA 3MCVA 5MDHA 4MVJH 1ZN7A 3TTSA 1JB1A 1NBOA 2EJCA 3OPNA 3SLKA 1U7XA 5ADVA 1GAEO 5IXJA 2HXGA 3JQRA 1V6SA 1EUQA 2DPXA 2O2CA 4R2XA 4CF7A 3OQHA 3OT1A 4EB6A 3DKKA 2D62A 1SOUA 2GSWA 4K9QA 5M2QA 4WH0A 3UWMA 1WQ4A 1THMA 2PR7A 2PY6A 4Q05A 4ENSA 4HPXB 4LJAA 4XB6B 2H7VA 1XP8A 2ZBVA 3LY8A 3PGMA 5I7OA 2PMFA 4XX0B 2XZOA 3GLGE 2V0GA 4HRYA 5F35A 3VKHA 1ZMRA 3FPGA 4IHJF 2H9IA 4IWNA 2I7XA 1KORA 1V2GA 3QYAA 3W5JA 2UUOA 1PR1A 3ZC3A 2CL6X 2IX9A 2D2XA 3K9HA 3N8NA 3R6LA 1QIDA 4FYJA 3WNZA 5AVUA 4R9UC 1WPXA 1ZDMA 2UUBB 4YONB 5FCDA 3CM0A 5IZCC 3FMOB 4HSGA 1XQ1A 2Z83A 2IJGX 1XKXA 3TW8A 4CLDA 3C16C 3HA3A 4AURA 3QIVA 3AEKB 3VR3A 1EB8A 4OYYA 4YBRA 1WDLA 4KAXA 3L2OB 3PVZA 1UBRS 5CGQB 2P2ZA 4JLDA 1EJBA 2ZSDA 1W4RA 3OZAA 1CBUA 4PSDA 3TMAA 3V1UA 3WR5A 5IG2A 4QXQA 2CCJA 2ZJ2A 5H3HA 1CPYA 2RH5A 5CYFA 1X7WB 2IXTA 4B2YA 2H5IA 3ZVNA 4B6PA 4DR6B 1C3EA 1SIWA 3BULA 5B7QA 5LIPA 3RJ9A 1U2TA 1UDXA 2AOUA 4L9RA 1FPMA 4ZO8A 2C7QA 3D02A 1MDFA 1T2CA 3FETA 3VU1A 3EPHA 4NMHA 1PP4A 2H4JA 1KSFX 2B0CA 1KI6A 1MIHA 1UBCA 5KREA 5JSZA 2EKBA 3P71T 5AK3A 3U40A 2BR4A 5CFRA 3KPVA 3TLJA 1SHKA 5KNBA 5ALEA 1NBMA 4KITB 3I05A 1B00A 1LLFA 3MQ2A 4RTSA 5KMGB 5TARA 1LH0A 1ZU5A 1E9AA 1MVNA 2ZSEA 1GA6A 3LOUA 4NYMQ 2W11A 4FDUA 5GOTA 4X3CA 3SE0A 2PUVA 4ND6A 5HKBA 1IUPA 1G1AA 3GEPA 3T7IA 1U3WA 1C4OA 2G4LA 4YN3A 4BO7A 5CNMA 1YRQA 5DSZA 5ECWA 4Q6BA 1EDBA 2C2GA 2JGLA 4M1YA 4BWYA 3DXFA 4MS4A 4PVCA 5AW2A 1PDVA 2G5TA 3E7PA 4HL6A 1RWPA 3R3SA 2WTXA 1X1SA 2XDQA 1M5TA 4CIDA 4DNFA 1AS2A 1U7ZA 1ZHFA 2HSDA 2ZYTX 4FS3A 1HZZC 4UU7A 2NIPA 4NXMB 4IGKA 4ON9A 1G291 2O0HA 1FTWA 4HEA6 3TDKA 2ZUWA 4DLVA 3ZLBA 5AK6A 2ATCA 2QZZA 5H83A 5FFFA 4YRAA 4LZOA 4TYMA 4ZIRA 3ELWA 3WKDA 3ZGVA 3IP7A 3SNKA 3NNNA 4IJWA 3VH2A 4E4RA 4LZWA 4P93A 4OQPA 3RD5A 1I2ZA 3NETA 4PHTA 3DB1A 4HNVA 3FYHA 3W0LB 3WWCA 4B3GA 3GDGA 2ZFUA 1K2WA 4G36A 3PHIA 5FUBA 3WDLA 3KQQA 5KZMB 3AONB 2BBOA 2X8BA 1KJWA 3ZK7A 5JANA 3Q3EA 1S2MA 4NBVA 3BK7A 3GROA 4YNBA 5DFAA 5JAIA 3D59A 1NVAA 2CF6A 3UKOA 4IMIB 5K8JB 5K6TA 2J3MA 3LZ6A 2OHIA 4FXPA 1KXJA 2EATA 1LWOA 2WHXA 4J90A 2FX2A 3VTZA 4B80A 4ZYXA 1PV4A 2CNWA 4WLNA 1EI9A 1DS6A 3QH4A 2B82A 1DKLA 1IHYA 2A9FA 4N7RA 1ULBA 4B31A 1TPZA 3B3GA 1A4IA 4N3CA 1SZCA 3RC7A 4CG0A 1XLUA 3H5IA 4D42A 4DTCA 5IU6A 1Y9ZA 2WD7B 4E07A 5CLFA 2FGJA 1BC5A 1HDRA 1X8JA 2WDZA 2AC4A 3ADKA 4BPRA 3FROA 4BMPB 3QEJA 3MJEA 3TLCA 4V03A 4EO4A 4LRSB 2QYHA 1QV7A 1WF3A 1N75A 1NP6A 1Y3BE 1EM6A 2CY0A 1Z7YA 2NSLA 2QX7A 5FWXA 3VR4D 3T4PA 3QRWA 1L5KA 2IGTA 1Q3TA 4JC4A 2G7ZA 4MW7A 3C41J 2Q4OA 3ZV5A 1N8SA 3O83A 1OGYA 4LF5B 1UPAA 2EZ8A 2XEXA 2VDJA 5BN4A 3IEIA 2DBQA 5FBWB 2GFIA 4TYPA 1TQ2A 2UU9B 3FB1A 3E9MA 3AR2A 4QLOA 2VDNB 4EKDA 3DZCA 4Q4HB 2V6FA 2O9JA 2WTMA 3E3LA 5I4IA 3CVXA 2XUAA 2IYZA 5KPDA 1R0SA 1RI2A 2ORWA 3TTVA 2GYYA 3G2PA 4JDPA 4XIYA 1OB2A 4GVPA 5GJCA 1FX0A 5JHHB 4OVKA 3HR4A 1F48A 3ILYA 4GYYA 1LC0A 1D6SA 1RADA 3H8VA 4Y7CA 3PTLA 3G9XA 2WLTA 3NBQA 4RIFA 4YDSA 1GUFA 2H54A 2XBMA 2RMKA 5E9QA 4ZHSA 2YJ4A 3HDHA 1NPDA 4HHEA 1L7OA 2CHEA 3AHEA 2CFSA 4M1EA 5GONA 4ZYWA 4MW9A 3HKCB 3N2GB 4BGEA 1NIJA 1CJKC 4C0XA 1GV1A 4KK4A 4DSOA 4MUJA 4DV1B 4ZCRA 1PAUA 3HUEA 3HWWA 3ENZA 4F85A 5IZCA 3TX6A 4W1SA 1F2DA 4HQ0A 2FR8C 2WM2A 5BV8A 5LQCA 1BYUA 4TQUS 4CT5A 2O7VA 1H2HA 3LD9A 3GGDA 4PG7A 3AR7A 5AHOA 1AMUA 5AJYA 5D5PA 2APJA 2MOKA 5ES3A 3HBNA 3A1FA 2NTJA 3AIKA 4KK3A 2LKDA 3TI9A 3TJZA 2ZU6A 4PQYA 4TM7A 5DGIA 4KCGA 1HRKA 1SXPA 1X0VA 3FAKA 5ERYA 3QBJA 4WJZA 4G8JA 4IV5A 2AHRA 2YASA 2HMAA 2GXSA 4KEAA 5AUNB 1QRSA 5JAHA 4NFYA 5BMVF 3AKYA 5GWXA 1MQAA 1J9GA 2ZI7A 1EPUA 4DNPA 1NG9A 3U9LA 2EL9A 3RT9A 3WS7A 5C1PA 4RTQA 2Z9BA 1PD1A 3A4IA 1B76A 4MUNA 1RSZA 1N77A 4I36A 2QA5A 3RIGA 3GOHA 5IVHA 1QR2A 2EJBA 5ICGA 3BWYA 4QYXA 1M33A 2IITA 3ZQUA 1H6CA 1JWAB 3E58A 3OTGA 3F2IA 2BF4A 1H94A 2VXBA 2EOAA 2GBLC 4FCVA 1LSSA 4WZAE 3EWAA 4PVDA 5DX8A 3N0XA 2P35A 1NVVQ 2YXPX 5CLLA 4CM4A 2EP8A 3PFBA 1TQ4A 4YRKA 2VZEA 3EIOA 2Q5FA 1PR0A 4Q37A 1AKQA 3EDMA 1YFZA 1JAXA 1P45A 1DE0A 5FBLB 4RJTA 5D6OA 4QQRA 3NHSA 2EDAA 2OBFA 3REQA 4FOPA 3O8OB 1HNXB 1ZL0A 5JASA 1JR3E 3NUGA 4G9BA 3ENQA 3TL3A 4BX2A 1ACJA 5KHAA 2H7CA 1MB0A 4TL7A 1FS6A 3TOCA 2QBYA 4RFVA 3WIEA 3V1NA 4A23A 4OJNA 2OZEA 2BGRA 1BFUA 4PU0A 3AIIA 1G6KA 4R68A 4L3VA 1U0BB 1GLVA 1NSFA 1Z5OA 4FLMA 2CVQA 4KV9A 1CP2A 3KR9A 1HZZA 2FWRA 3CLUC 2R60A 4G0YA 4KHZA 3MWFA 4U6NA 4WVLA 5AK0A 2AA3A 4LFCB 3S8MA 3ISJA 4K9RA 3H5OA 5IJ0B 2JJ2A 4NOLA 4DA9A 2QLNA 4PCVA 1VE3A 1BO6A 2FQ1A 2WP0A 4MR8A 1E96A 2GZHA 1T1EA 1W0JD 1Z83A 3MJDA 1J1ZA 3MRTA 4K9LA 4RSGA 3LCVB 1GPNA 3MAAC 1MG5A 5G40A 4UAVA 1RAIA 5AKGA 4XD2A 1P8AA 2PQMA 5FA6A 1YVDA 3I52A 3MFYA 2J41A 3AY0A 3MTEA 4EPTA 4KU4A 4P83A 3WIDA 3CN7A 4N8SA 4EJ2A 3HJCA 3PUHA 4KMOA 4MQFA 1SXHA 5FHQA 4NATA 2HTFA 2AIRA 1G9XA 1NGSA 3H17A 3R75A 2ZRNA 4DABA 1FJ2A 5NULA 1A9TA 4FUTA 5DCWA 4TV9B 1ENOA 3IUQA 1OI3A 1TZJA 5F9FA 1CY4A 1DDOA 4BZXA 3BAZA 2ZPAA 1T8SA 3UG6A 5FI0B 1QFSA 4E46A 1AHPA 1AQUA 1I1OA 4Z1OA 2QMQA 4A8TA 4KIUA 1IBMB 1FFSA 2FRXA 3I9NA 5H4HA 1GEEA 1QHHA 1QIJA 4CTKA 3AFOA 3N6VA 3OQ1A 1TQHA 4QDTA 1L4KA 3SZOA 4FMDB 4DSZA 5ALVA 4P80A 1RZRD 3N0TA 1O94A 4DR1B 5HW0A 1ATIA 2X1MA 5IDYA 1RRCA 3IP9A 3MILA 5JH7F 1VJ1A 3FZQA 3PEUA 5KU7A 2H5EA 1Y3HA 5EERA 3X0DA 4ZICA 3AC0A 1XXHB 3FVWA 3FPSA 5HJ5A 2IRWA 3WDMA 2OZPA 3LY5A 3AKEA 2BI8A 3GH1A 4PG5A 5KCZA 4XJSA 2A9QA 2VBFA 2X5XA 4I50A 1XNGA 3T3DA 3KLNA 5IYZA 5F9HA 3NH9A 2MMCA 2ZE8A 2JZOA 2FW7A 3EX7C 1WHTA 2PZJA 4NKRA 5JWRA 1IHXA 1VPDA 4DLZA 3OIVA 1R6BX 2B4QA 1CDDA 1NN0A 1NYRA 1Z4KA 2G71A 2WVAA 3LK7A 3MJTA 4FJ1A 4DS3A 2TYSB 4DXAA 4MCHA 4YRIA 3BWEA 3W5HA 2YWRA 3I9V6 3M3DA 3WK4A 2JLUA 1ZQ9A 1Q2XA 4PG6A 4WFQA 1I36A 4DZRA 1DCTA 4DSTA 3PNQA 4FDVA 2C4NA 3U7HB 1FTNA 4IMPA 4RPHA 1EVEA 3RSZA 3TLKA 3QYFA 4DZTA 2LDXA 3JV7A 1F38A 4QULA 2DT8A 5TX7A 2HY7A 4ENTA 7GPBA 4KQCA 2JGFA 5A5FA 1DRUA 4JOSA 4YUXA 2F90A 4HN4B 1GJRA 5KO2A 1ZSNA 8GPBA 1P1IA 4MKZA 4TKMA 3SJAA 4XSVA 3JATB 1XCOA 3G2KA 1EWKA 2H59A 4WACA 4DRZA 3RFTA 4EKEA 1RQXA 2XPCA 1KS9A 4YRLA 5LP6B 5LZ2A 4G84A 4HD8A 2FR8A 1JDBC 4XDZA 1NY5A 1Z22A 2JB9A 2HL6A 4TQGA 1LVUA 2UVQA 5EWLB 4PZ9A 4UBLA 1KEEB 4WKNA 4KZKA 2HQRA 1S2DA 1EK2A 1JG1A 4JP8A 4LGMA 4LXHA 2IUUA 1F0NA 1ZG3A 4UM9B 2IP1A 5FYDA 1DI0A 5TJ9A 3KKQA 5DLDA 1SUCA 2HU2A 2VZLA 4LCBA 4PLWA 4QFDA 1ZI6A 1VFPA 4HH3C 4RA9A 1QVVA 2EYQA 1ZCZA 1V16B 1IPHA 1O6ZA 2B7CA 4EGCB 3ZVKA 1QHXA 2I87A 3QV2A 4G5YA 1FB5A 1BWRA 1Y7TA 3L1JA 4S35A 3OSZA 1EZZA 3S99A 1UBLS 5KOHB 4WXMA 3SMVA 1OI2A 4AZVA 4ESOA 3EIEA 4KJZA 4QELA 2PGLA 3LT2A 4H18A 1E9RA 4CV3A 4JX9A 1RS0A 2VQFB 3BB4A 3ETHA 4UARA 4QRIA 5F73A 4WOBA 1HI9A 5ARDA 3MNFA 3WQRA 2W42A 4J07A 2AUMA 3U4AA 4BQNA 2O48X 2VJCA 4GFDA 1AQYA 4JLSA 4EGQA 1ZRNA 1QPGA 1CK4A 1E5QA 1PG0A 3DZDA 3TZKA 5JSUA 3LFUA 2ONCA 4JLJA 3QHAA 4OTZA 2GBLA 3O93A 4FYVA 1COWD 4HPWA 1G0OA 2AI3A 3JPYA 4M86A 4TSRA 1M2OA 1QLWA 1T9CA 2V7UA 4DY4A 5I7SA 5JROA 3FTFA 3UB2A 3K35A 4H3SA 2G1AA 4JKOA 5FOQA 4PZLA 3UT5B 1TKCA 3UO8B 1E1YA 3KRTA 1P2UA 3AHFA 4MIYA 4DR5B 2RGDA 1W5FA 4Q1CA 4C87A 3MYRA 2BFBA 2RHTA 2GK7A 2AX3A 3SE7A 4BKMA 3PA8A 3R40A 2XHEA 1KI7A 4AG6A 4RLSA 4FDLA 2PNJA 3WK5A 4UTVA 1U94A 2O8DB 2OCBA 1MLDA 5FR1A 3UAVA 4OQMA 3LWBA 3ZEIA 3QVLA 3P2OA 1WM1A 5AP9A 1XRLA 4YXWA 4NYMR 3LNTA 4ETNA 3T9CA 3C98A 1W29A 2FOXA 3HCWA 2UXDB 4XXHA 3WMXA 3GJSA 1RLMA 4E5YA 1Z73A 4F11A 5BW5A 3SHQA 3P97A 1ODSA 3ZKWB 3O90A 4HZUA 5IKPA 1D2RA 4Q01A 5BN1A 5FORA 4Y3UA 2DUMA 4DOMA 5JRDS 1TAGA 4RETA 1C7FA 2P0EA 3QKSA 3K16A 2DERA 4WNYA 3PUJA 1SIBE 3TMKA 4LOAA 4XASA 3H5WA 2CD9A 2ZROA 3L7AA 4RQTA 2PT9A 4Q9JA 2B94A 2ATVA 3LSTA 4MUAA 4C29A 1NLFA 1OIVA 3JZFA 5J58A 3ROKA 1U7TA 4M9SA 1T1SA 3G6WA 2I3ZA 4YCMA 5BNZA 1IZ7A 2H51A 3UWKA 2IHJA 4XUGB 4TXLA 2I8LA 1GKIA 2VWQA 5E1DA 5IEJA 1LFAA 4TLMB 3IQXA 2JGDA 1SBQA 4AJKA 1W5TA 1BMTA 4D45A 2X42A 1AHHA 5HPYB 2QEQA 3OE7D 1QZUA 4KN9S 4P53A 3QXSA 1XKQA 4OHCA 1MC8A 3SKYA 4BVGA 1N8NA 1KVTA 4YO8A 4TYYA 3CKKA 4OFZA 1PZGA 3MBIA 4NCIA 4OI4A 3GU3A 4XPIA 2CJYA 3E2PA 3MUOA 4KE6A 1B8OA 1GD1O 5JBQA 4YCBA 4NJEB 3P9XA 4NE7A 3WMEA 3KQSA 5DV9A 2JI4A 2NUPB 3LW7A 2QX4A 3K7EA 4WCDA 4EB3A 3TOXA 3HWRA 2OFPA 3K15A 2BFFA 3MJFA 1E2EA 4BQQA 5A4DA 2I4OA 3D0QA 3CNBA 4NJMB 4D3ZA 4IO1A 1PRYA 1QOPB 2BISA 1B43A 1QIHA 4BTLA 1SVOA 1REQA 1XVLA 2NXEA 2XBUA 3QI7A 2H63A 4FNOA 4P3OA 5FUXA 5JS2A 3WK6A 4C6TA 2PXAA 1QRAA 3OEWA 1V5FA 4R1SA 3CRZA 1DX4A 5JSYA 2HSJA 3DVRX 3VZDA 4LTDA 4LXXA 4BVFA 4ZZ1A 4LF6B 2WT9A 1Z0KA 3GDHA 3VH4A 1E79D 2IHKA 2W71A 3G9UA 3GGPA 2ID4A 5KTYA 3D64A 1MG0A 4L6AA 1A7KA 3U6KA 1QYXA 4XCXA 4XLZA 4OMCA 2Y1GA 2H85A 3GFFA 3INGA 5C81A 1XMVA 5HFNA 5JDCC 3KXKA 5AWFC 3YASA 3TD2A 2X5NA 3QKRB 3U6BA 3N05A 3Q3JB 3ESYA 2GDZA 4P3PA 4CM7A 3OIYA 3X1ZA 4BNWA 3O0DA 5JQGB 1I5OA 4EYQA 3U19A 3DMHA 4TKUA 1HE2A 2I1VB 3GFRA 4LSZA 4MRPA 4BO9A 1HL7A 2QRGA 2ZIEA 1L5FA 1YS2X 4NNPA 1LJ8A 3MJCA 3NP7A 4G89A 4EZBA 3LLSA 1EBFA 1GN9A 4P32A 2P30A 3LT4A 2FSHA 4MAMA 2G63A 3NANA 1KVQA 1V0JA 4XWKA 5HR5A 4C2UA 2V54A 1MW9X 1JSZA 1YQDA 2AF3C 3OKCA 4WIAA 4NPAA 4I7EA 4Y8VA 2PS1A 2J9XB 3P0FA 1T6BY 4LGYA 3ZCUA 5DM4A 4Z8YA 3ZV6A 4FDAA 4CV2A 2JCBA 3KTAB 1GPJA 3A3PA 4GOOD 4H7DA 3TD6A 1ZZGA 1Q83A 2GWHA 1IPFA 2JD2A 4HDCA 2J3KA 3EGDA 5EWJB 4IDGA 4KSBA 1OLSB 2P7IA 1FBTA 2ZT6A 4BP1A 5DM0A 4IH9A 3H8SA 4QPNA 3SEFA 1BDMA 3LX6A 3FGNA 5AHKA 2YYSA 4OK3A 1ODLA 2YWJA 2MU1A 5A4KA 4AKIA 4P5PA 3CJTA 2D5AA 3KD3A 5LA6B 4YMGA 2OG2A 1Z34A 3EOAI 4DIBA 1KNQA 2CNKA 3G9TA 4PYOA 1A04A 4KRFA 4MWEA 2O2IA 1Q1EA 1YVUA 4IFTA 5DNYB 3RADC 1VMDA 2FZVA 4JJFA 1RC1A 1NF3A 1MR3F 4O4JF 4HLQB 2DHCA 1Q16A 1AA9A 2GZSA 4MO9A 5FPHA 3CISA 3TTTA 4BNGA 2XGMA 4YRBA 5KTSA 1FLDA 1COWA 2IH4A 2I4LA 4KXFB 4EO9A 1ENYA 2PRJA 4TTIA 3CUYA 3IV6A 3A6JA 1KMIY 2FP3A 2CK3A 4WSOA 1L5VA 2J08A 1TYZA 3FTCA 4UHHA 5K01A 1FUIA 2EFDB 3AKDA 4URVR 3F7MA 2B8EA 3GZNB 3BG5A 1MH1A 3IUSA 5EHIA 3DUFA 3V1YA 3VR5A 4BDTA 2BHLA 5D3MA 2FW8A 1DINA 1USVA 2PJRA 1NVVR 1Q7CA 1GGKA 1TNDA 2PAFA 1GG9A 2B3DA 5CH3A 4A91A 4B46A 1ZU4A 3HKBA 3ABIA 1VM6A 4RK7A 1HYQA 1X9IA 2KQUA 1BA2A 5SYMA 3NEAA 4CDRA 2HA4A 1KJYA 1QDEA 1YCHA 2H9AA 1HDCA 3A4MA 3E61A 2ENUA 2ZUBA 3C3WA 1NMYA 3HU5A 4CG2A 2LW7A 1M6YA 1RKVA 2JZNA 3FRIA 3NB0A 1CT9A 1O4VA 1E1RD 3I23A 3ZHTA 2ETVA 2G0AA 3C4VA 4G4IA 1KYWA 2P68A 3MN1A 4JGGA 5D00A 4EJ6A 3HDGA 3DWEX 3SN6A 2ZUTA 1HNZB 3TJRA 4AY3A 4U9HS 3A28A 1U8CB 4L2IB 3SQWA 1OU0A 2LXNA 1NUQA 4TXMA 2HMUA 3WK7A 2F43B 2VUHB 3RJMA 3LKZA 4F72A 1Z0SA 1KMNA 5THQA 2PGOA 5K0GA 5EQTA 1ESNA 1X1CA 1XTUA 1XXHE 1E89A 3HGTA 2OC4A 3AXSA 4LJ7A 4HLDA 4GHWA 1SUAA 4Z51A 1ZEJA 1B8VA 3K2BA 4QPZA 4XWYA 2GEVA 4Y2UA 5PGMA 3VX3A 4AX8A 4FWIB 2OK7A 3ET4A 2BR3A 5FLKA 3CA8A 3B52X 1QH1A 1VG9B 3OE7A 2F9FA 2WFLB 4FYMA 3QU9A 3SZRA 3GXBA 1V48A 4J0QA 3C3JA 3OX2A 1E6EA 2G0TA 1XALA 1L5GB 1QB8A 3MINA 1KYZA 1FFEA 2EHDA 4GRIA 4AJ4A 1J2JA 3RJ5A 5DT9A 2O1XA 3RTEA 4J75A 3C1AA 4NECA 2YBDA 5AM2A 1JIKA 4GGPA 3NONA 3ASZA 3L49A 3ONDA 3BMOB 1V6AA 3HYCA 2WA2A 2CDAA 1TT5A 2NQ8A 4M9QA 2D1FA 2FYTA 1T9GS 3LK6A 4KH0A 4L8VA 4MPTA 3CSUA 2WSBA 2GK3A 2ZXEA 4RULA 3I58A 1KOLA 1EVQA 4B43A 2O57A 4QUDA 2X23A 3L43A 2JFUA 2PLFA 3H9QA 3PS9A 4ZCSA 1KF0A 1W30A 1HSOA 2C5HA 2VKTA 4NULA 4UNIA 4M6WB 5ALNA 1E79A 1MORA 5LXTA 1RACA 5KJCA 3FSGD 1TC2A 2MYPA 2FZKA 2JF0A 2J59A 1GPDG 5AESA 5JDCA 2P4QA 2Y1OA 3DOOA 5CRIA 3SY8A 3HUUA 4QFBA 1EBUA 2VNKA 1LS1A 3PICA 2UVPB 3QENA 2G06A 2HF2A 4TZ6A 3N8IA 4RD0A 3LQ1A 4ME6A 1GNLA 2VJKA 5A5EA 2GETA 1JKJB 2QJTA 2R6AA 2DYKA 2GKSA 3W8FA 3WLOA 4JT9A 1K9VF 2P8JA 3IIEA 3IUMA 4RFLA 1F5SA 4OXYA 1RKUA 1CFZA 1GFIA 4B73A 1MTZA 4LWZA 4E7OA 5IBQA 2K7FA 1NA5A 3K1ZA 4ZGBA 1U5CA 2GK4A 1O6BA 5H80A 3G2JA 3KSZO 3VTAA 2QR3A 4DNQA 3KL4A 3TRFA 1PVOA 1RXEA 2WY2D 2CFRA 3AI3A 1W49A 2QSUA 3C7KA 2PJUA 1B26A 2IUYA 3FGOA 4TTRA 3UVEA 5EYPA 5A3QA 1E1DA 4FB5A 5JY6A 1JJIA 4X1KB 5ADHA 3U56A 1JDVA 6CHYA 1N2SA 2IS2A 1T0IA 2VTKA 1GO2A 1T2VA 3DGFC 2Z08A 4PS0A 5IMBA 5K5EA 2FDCA 3WIBA 3M2TA 1T1RA 2AKAB 1FTSA 3B60A 3IS3A 1Z0FA 4ISBA 4D9JA 4O5AA 2I71A 2WE7A 3EIHA 2O7RA 5HKAA 1A9OA 2FMKA 2OBMA 2WBLC 4KRXA 4OK5A 2XBLA 4LIPD 4PLTA 5J2TF 4OM7A 5L95A 5E6SB 1QTRA 4XGKA 4LWPA 2I7CA 3W4KA 3HG7A 2HLDA 3L6CA 3LECA 3W9SA 4NQZA 2BEUB 2Y4OA 4HWRA 5BVGB 4IVNA 1JBEA 2QDKA 4ID9A 1T25A 4DR2B 5EVCA 4HWOA 3K6JA 1Z6XA 2GERA 3P0IA 3ETJA 1K27A 1PJ4A 3OFJA 3GVIA 2PCJA 1Q7EA 1RAHA 2GXUA 2JGJA 5BSUA 2Q4DA 4FQ7A 3T7KA 1JJ7A 2REOA 1JR3D 3E4CA 4AKEA 5F5NA 1M7GA 3GCXA 2W37A 4F38A 2QRKA 3U09A 3V9PA 3HE3A 3BWBA 3QVVA 5EP1A 2F9LA 1XQ6A 4ED9A 2REQA 4JSTA 4Q3AA 3K0CC 4U2BA 2UYYA 3BFVA 1YSCA 3CUEF 3DFFA 3O8NA 4KXXA 5JRJA 1MX9A 2QL9A 3FJYA 3ZN2A 2PGJA 3GGJA 3H9BA 4GKBA 3T5PA 3ZDCA 3DL2A 4MV9A 4CBVA 4B6FA 5L9AA 3K70B 5HDQA 4EKYA 5K1ZA 2JLWA 2I62A 1NRXA