3UKDA

Ump/cmp kinase from slime mold complexed with adp, cmp, and alf3
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
191
structure length
191
Chain Sequence
SKPNVVFVLGGPGSGKGTQCANIVRDFGWVHLSAGDLLRQEQQSGSKDGEMIATMIKNGEIVPSIVTVKLLKNAIDANQGKNFLVDGFPRNEENNNSWEENMKDFVDTKFVLFFDCPEEVMTQRLLKRGESSGRSDDNIESIKKRFNTFNVQTKLVIDHYNKFDKVKIIPANRDVNEVYNDVENLFKSMGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords URIDYLMONOPHOSPHATE/CYTIDYLMONOPHOSPHATE KINASE
publication title Structures of active conformations of UMP kinase from Dictyostelium discoideum suggest phosphoryl transfer is associative.
pubmed doi rcsb
source organism Dictyostelium discoideum
total genus 73
structure length 191
sequence length 191
ec nomenclature ec 2.7.4.14: UMP/CMP kinase.
pdb deposition date 1997-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ukdA00
4AKEA 2V7QA 4I1VA 3N70A 1COWD 1UKZA 5JCPA 3QIAA 5P21A 2AKYA 2W58A 4PR0A 2I3BA 3KFXA 2BBWA 1VIYA 4QXAA 1KI8A 4W7SA 2FGKA 2WM9B 4IDHA 3OFND 4BWYA 2ZJAA 2B7BA 3V4RA 4BLPA 1BS1A 3FHTA 4C7OB 1TTTA 2G3YA 2IXGA 4NU0A 4KI0A 5KNBA 1HQYE 1HV8A 3L0OA 1GRQA 3BD9A 3PEVA 3CRW1 2WPDA 4JLJA 1SVKA 1ZP6A 1EESA 1W7AA 2ZITA 3AVXA 3OHMA 4TMZA 3D6TB 5B30A 3BH0A 4G5QA 4PANA 4DXAA 1P62B 1J7KA 2OSBA 1YZQA 1E98A 3KFVA 5AJXA 2X8AA 4Q1EA 221PA 2FSFA 4PC6A 5L3RA 1E0KA 1RYHA 1WMSA 4DLTA 1P61B 1JJVA 2CLCX 2R6AA 1VHTA 1SKQA 1G9XA 2A5GA 2ZRBA 3K09C 5FI1B 3PUWA 2X77A 4TT3D 1AZTA 4A2WA 2ZRHA 1KJYA 1VYTA 3KL4A 4PC3A 4D82A 1L2TA 1NBME 1N0VC 1G1MA 3C16C 3GEHA 1ZM2A 4NCKA 5IK2D 3X1XA 5EQTA 2VHQA 2GCNA 3X1DA 3X1YA 2IEZA 2NZJA 1W0JD 2O52A 4IFEA 2IA5A 4PO8A 1VCNA 1XZPA 2CJWB 2G83A 2GCOB 5DHAA 1W36B 3RRZA 2ZJ2A 3W6OA 3TQCA 4TLAA 3IO3A 4O25A 3OF5A 1P9RA 2DBYA 2EU8A 3K0AA 4R2IA 4IDNA 4Z8XA 2JLYA 3A6PC 1XTQA 2QBYB 3A1TA 3RS5A 4PO1A 3IPXA 4QBGB 3WRYC 5DN6D 2GJKA 1OFTA 1EFUA 2YOGA 3CRMA 1MO4A 4Q1AA 4YC7A 5EE1A 1G7RA 2ZI5A 3NBZC 2J45A 3EZFA 3CKLA 1T4GA 3U3KA 3QY0A 5GJBA 1HH4A 1DAEA 1W2HA 1DAHA 4WZ6A 1L7VC 4MGIR 1GAJA 1ZCAA 3VR3A 4LPKA 3THYB 5HZKA 1XTKA 1FNNA 1SHKA 2HLDD 3SZRA 5KNDA 4HAXA 3P1JA 4TSFA 4EJSB 2OV2A 3K53A 5L3VA 3C4JA 4KAXA 4FIDA 4Q9KA 3IQWA 3Q8XB 3I73A 1YKSA 2XX3A 2ZYTX 2VA8A 1E0JA 2AHOA 2CK3D 3QXJA 2ZAMA 4DIEA 3CIOA 1NRJB 4OI2A 1KDOA 1LF5A 5F98A 5BQ5A 1Z6GA 5H8WA 3SNHA 4F4IA 2FJUA 4ILEA 4G1UC 2K5UA 1T5IA 1XRJA 2ZRFA 4Q9HA 2ZETA 1WB9A 1U9IA 2NPFA 1IBRA 3QOFA 1EFRA 2QG6A 4V0MA 3WHKA 1U0JA 5EP1A 2GJSA 3UWOA 2J87A 1YR6A 5DISB 1FW6A 2J1LA 3KKPA 3KJHA 4OL0A 1G3RA 1OW3B 1GP2A 3F5FA 1X1SA 4LJ6A 4DSNA 2Q3MA 4UJ3A 2D7DA 1NJFA 1UKYA 1XEWY 2YC2C 1ZUHA 2EFCB 3A1WA 5EE9A 2ORVA 4D0LB 4EPYA 4PZZA 2BOVA 2OLJA 4PZLA 5L3QB 1Z3IX 3ZH9B 1BIFA 1E9BA 2OEPA 3B6EA 2HT6A 4Q1BA 1ZU5A 2QEQA 3U7FB 1CBUA 1E1QA 2CNWA 4A82A 4JSTA 3MFYA 1EFHA 4NYIQ 3CNNA 2GF9A 2XOKA 4AG6A 2ZI4A 3THXA 1WBDA 3AKEA 3HJNA 2XZLA 4TTQA 4ZKEA 3SYKA 2XAUA 3IDQA 1A1VA 1E99A 1E2GA 2J7KA 5KUTA 4RKEA 2FPKA 3CPJB 1UEIA 1KAGA 1F2TB 3JZMA 4P4UA 1WE2A 3EX7C 5KO2A 1P9NA 4XWAA 5L8VA 5KSZA 2NTYC 2P0EA 3T06B 4ZCIA 4KV9A 4YMSA 3AQ4A 2HF8A 4MKHA 3WYAA 4AYWA 3GLIB 3RDPA 4C30A 1W0KA 1OHHD 4RVCA 1TPZA 2WSSD 1TF7A 4Q66C 1G291 2WKPA 4HDCA 3CX7A 2ZTSA 3W3ZB 3VR5A 5HPYB 4UXIA 5K8IA 4B34A 1CJKC 2JIZA 2DB3A 1CIPA 3OAAA 3UATA 1NMXA 3HDTA 3B5JA 2QP3A 2E9SA 4KBGA 3EWAA 3A4MA 2WBLC 2PL3A 2H92A 2IW3A 3SBEA 5EJEA 4UNRA 5DYGA 3PQCA 2AK2A 4DLVA 4AKIA 2OT3B 4M1TA 1TQ2A 1EGAA 2OAQ1 2QUZA 4Q9IA 2G88A 2QAGC 4QBFA 5TXGA 3MRSA 2VO1A 1IY1A 1DADA 3MG9A 4YONB 4M22A 3VR1A 1SVLA 2FWRA 3PUZA 1CRPA 2JJ2A 2N42A 3PUVA 4KBFA 1XU4A 3TUIC 2WJIA 3FWYA 2BDTA 1SXJD 4EKDA 2NO1A 1TQ6A 3NH9A 4IDQA 5EXTA 2CVHA 3FB4A 4PQYA 1EFCA 2JJ1A 4G0NA 1N5KA 2DPXA 3L2OB 2GHIA 1XZQA 4WZBE 3LXRA 4IJMA 1VYUA 1XTIA 2PCLA 3U2QA 4DRZA 2X19A 2XXAA 1S9HA 2AD1A 1KKMA 1ODFA 1HQCA 1N3BA 4DLRA 1N2CE 1IN7A 2ZUDA 3LVRE 2ERXA 4LJAA 3KQNA 3TE6A 2L0XA 2YC4C 2ZRAA 1W47A 1Z22A 1KMHB 3SU8A 2REXB 4B76A 1GRRA 2VIIA 3LWNA 4ASUD 2GNOA 2VP2A 4TL9A 2PT5A 4HDOB 1KMQA 3JZAA 5D3QA 3TIFA 4NL4H 4DDWA 1YJ5A 2BVNA 2ASEA 3NH6A 4AYTA 1F60A 1J8MF 3R8FA 5AJVB 1CJUC 1FX0B 1QBKC 1ZCBA 2WMOB 4KLZA 1W4BA 3QPUA 1QHYA 1JQLB 4RY2A 4BGDA 3X1ZA 1NI3A 1S4QA 2D62A 4RZXA 3LH5A 2ZVPX 1GILA 2IS1A 2EWWA 4M1SA 3NKVA 2JATA 1RYFA 1KI1A 1AA9A 2IEYA 3K0CC 4YMWA 4E07A 2DFLA 2ZE6A 4US0R 4LCBA 4MYCA 2IL1A 3EAQA 5EE0A 3X1WA 1NJGA 4LX0A 3C15C 2D2EA 3FDIA 1LF0A 3IIMA 2Q3FA 2PH1A 4ABYA 4CIDA 1NKTA 1XXHB 2WWIA 3HWSA 5FTJA 4LHVA 1EX7A 3QQ5A 3CF0A 2W6JD 3RWOA 2GXAA 3QXCA 3VQTA 3EC1A 3BIFA 5SZKB 1QVAA 3BE4A 2ZUBA 3ZQ6A 4W5HA 4UXHA 2O8FA 1T9HA 1CXZA 4I1OA 1UADA 1UBCA 4LPSA 5EP2A 3TK1A 3GLGE 3THWB 5C4MA 3R9IA 2Q9BA 4LI0A 2BWJA 3SQXA 3GJ6A 2REOA 4GSYA 2FGJA 2FU5C 4AIIA 4Q47A 3QXHA 3BB3A 4JZKA 2H16A 3OEEA 3VMFA 4PHFA 4TQAA 5FFMA 2HDNB 4ZO4A 3ZZTA 4B32A 1JPJA 1AS3A 4S35A 2F3TA 2F1RA 1TF2A 3NBXX 3VU9A 1OFUX 4IOMA 3SFVA 2JA1A 3IHWA 3C7KA 2VTKA 3A4LA 3RRNA 4B3XA 1L4UA 4F92B 5FBQB 4A8JC 1KI2A 3VR4A 1IXRC 3AV0B 3RC3A 4C2UA 5GJVC 1E4VA 4GOJA 4G5OA 2LWIA 3CZQA 1J90A 3MD0A 4PSKA 1ZNYA 4UKDA 4Q9LA 1NF3A 3N5CA 3UANA 2IYXA 5CJ2A 4W9MC 3IUYA 1B23P 3SJZA 1XX6A 4C7OA 5FTLA 4EFNA 1I4TD 4C0LA 2QN6A 1TNDA 2QZ4A 2HXYA 1GL9B 4HLCA 4Q02A 3ASZA 2YOFA 3L0SA 2GJ9A 1TEXA 5C1BA 2ORWA 4GI7A 2JLRA 4Z8YA 1P4SA 4BFXA 3AP1A 3ADDA 1N25A 1U2RA 3LX5A 3UG6A 3T1TA 3U4QB 3TR5A 1SVMA 1KI3A 2AK3A 1NBMD 4KO8A 4D4MA 4JBWA 4Q00A 2VP4A 3Q7PA 4B74A 1L4YA 4GL2A 2QP9X 5BYJA 5J4HA 5H70A 3M0EA 2DYKA 4A8JB 2RH5A 3WNBA 1P2SA 1W2GA 1KK3A 2QROA 4TLCA 3QKSB 4DLUA 1GNRA 4IVRA 3CWZA 2ZJZA 2Q3HA 4BRUA 2RHDA 1S2MA 5HCNA 4N3NA 4MQBA 2ZPTX 2CBZA 4S2EA 4V0LA 3OZXA 521PA 1E9FA 4YQFA 2J0VA 1UJ2A 2CJWA 2GCOA 4LV5B 4M9XA 5KDOA 4QM7A 1FTSA 2WIAA 2O8BB 2P65A 1DEKA 1GZSA 3U44B 2ZU0C 4MDEA 2RGGA 4LJ4A 2R44A 4FMCF 1ESMA 3CW2A 2JDID 2QA5A 1GSIA 2ZRDA 4TL7A 2GJAA 4HI0E 1EXMA 2CL6X 3FMIA 4Q1DA 2WWXA 3FMFA 3MSXA 3UPUA 2YKGA 5FUXA 3KZ1E 1OKKA 2V1UA 2JAQA 4GRAA 1FNMA 4HAYA 2NO0A 3RABA 5HR5A 4DB4A 3GPLA 2IUSA 2VYFA 2KWIA 2HJVA 3QENA 3KJEA 5EP4A 2KJQA 2WOOA 3K09A 4Q48A 3ZQJA 1VKJA 1Z28A 1VG0B 1K5DA 1XMJA 4Q4LA 4UNNA 4B3DA 4XJXA 4JLPA 2VHJA 1Z2CA 3BB1A 3THYA 3ONWA 5CDFE 4GP7A 4X8MA 5IDVA 2D06A 3FMPB 3B1YA 1IAQA 3BFVA 3EW9A 3M1IA 4EJSA 3IO5A 1E4YA 2ZSEA 1XJ0A 3Q7QA 1AZSC 2ZJ8A 5JFGA 1VCMA 2OFXA 3DZDA 1ZIPA 3L0IB 1RVDA 1SQ5A 5LDDC 2Z83A 1YZLA 2ANBA 2CDNA 1FUUA 2AFHE 3TLXA 1OYWA 4IXNA 4JSYA 3KQHA 1E69A 4IRUB 2QU8A 1PZNA 3W9YA 4B73A 1SGWA 1VIAA 1WP9A 3MUFA 1A2BA 4I99A 1G5PA 1KDRA 2IT1A 3BS4A 4M1OA 5D3MB 2ZEJA 5HKKA 1KI6B 2W2VA 3PV0A 3VX4A 3EASA 3HPQA 1N5JA 2XTZA 2WWYA 4FI3C 4GFDA 1R8SA 1XDBA 1NG9A 4CGZA 3IKJA 3P27A 4PAOA 1WRBA 3SJBA 3BWDD 5FBRB 3CPHA 1T3LA 1E0AA 3WNDA 3QXXA 2E1RA 2BEJA 2A9KA 2Q9CA 1DOAA 1U0LA 2ZR7A 4PXAA 3A37A 4C0JA 2YWFA 2V6IA 2TMKA 5L3QA 2ZAOA 3CRVA 1F5NA 1G41A 3U7EB 3M4YA 1D2EA 3NXSA 1XCGB 5CM9C 3X2SA 2OUKA 4EQ6B 3BRWD 1KHTA 4TZ6A 2HYIC 4DKXA 4A36A 3CM0A 1IXZA 3KUDA 4CZ2A 1BMFD 3B9QA 4HZIA 2W00A 3EC2A 3AGPA 1F2TA 4WA7A 2ZM5A 1Z0IA 2FSHA 4LRWA 3U6BA 2IK8A 3UMSA 1AIPA 1O87A 2GJ8A 1LS1A 4C0SA 2A5FA 4RJLA 1D5CA 1ZM9A 821PA 5KSYA 2PMKA 3K0FB 3GLIA 2ZS7A 3MJHA 1LTQA 2CL0X 3CNOA 5B58C 2MMCA 3KTAB 4EFLA 4D25A 2JLWA 4JVNA 5DI3B 5LB4A 2Z5FA 4ZDWA 3TMKA 2DR3A 2VLIA 3SJAA 1Z6XA 1FOEB 2OCYC 4DUGD 2PEYA 3IQXA 1W44A 3QVUA 4TYPA 3FE2A 1OH8A 3I62A 5AR1A 3AF2A 4LV6A 3SR0A 4QRHA 1R0XA 2AR7A 1TQDA 3IGFA 4DLWA 1FUKA 3RS2A 2H18A 1G8GA 3NHBA 1FPMA 3D8BA 3IBYA 3QBVA 2REBA 4XD7D 5SZHB 3SDZA 4IHQA 4GMXA 2P6UA 4URUR 3OIVA 1Z0FA 1RIFA 1KI7A 1RZ3A 5JLJA 3A1SA 3W3AA 5BWMA 2GESA 4ZV4A 2J3EA 1JPNA 1E2JA 3Q85A 4FWIB 3TRFA 1XJCA 1OJLA 4ESHA 5BN5A 1KK2A 1GIAA 4R7ZA 2A2ZA 2EWVA 2GCPA 4XSGA 3RYTC 5G3YA 1TF5A 3E5HA 4QOSA 4MGKR 3ZZ0A 3QE0A 3DZ8A 2KB0A 1XMIA 3A1VA 1DPFA 2BBSA 4XVRA 3W90A 1LNZA 1ZINA 4F91B 2I4IA 2F9LA 1E3MA 1W48A 1N6PA 2BM0A 2WMNB 4K46A 3FMOB 4Z1MD 2WTUA 2OCPA 1DVRA 1RKBA 1M7BA 2JEOA 2BJWA 4M4SA 4A6XA 5GADl 5ELXA 1UBGA 1KMHA 3W34A 3KJGA 3DKPA 1GKUB 2OZEA 5C4GB 4BFSA 2PEZA 2XEXA 1G3QA 1QF9A 1HY3A 2FE4A 4XVQA 4TMXA 3SC3A 3MWYW 4K81B 5IT5A 1XD9A 3KKOA 1FX0A 4B43A 2IYUA 1E94E 2YYZA 4PHGA 3FGNA 2AN9A 4TLDA 4BZPA 3SEAA 2QL6A 2VHUA 3GQBA 1G17A 4V02A 3THOA 1D9XA 1AQYA 3ZLJA 2ZIAA 5FOVA 3QEJA 3WNCA 4QJ4A 1E1RA 1TU4A 1R5NA 2UVQA 4KITB 4V0ME 3VHLB 2WJVA 1AKEA 5EZ5A 1PUIA 5K8LA 3I4LA 1E9CA 1ZUIA 1OE0A 1A7JA 4BECA 4B75A 5BYKA 1S96A 4QG7A 3TNFA 4QBHA 4JL8A 4P4TA 2IXFA 3AVTA 1XXHA 4BLQA 2XGJA 1I4LD 3B9PA 5TARA 4CRWB 2XNDD 1GUAA 1TQ4A 2GEUA 2NGRA 2Z43A 2WJGA 5KNCA 1YQTA 2DY1A 4IOLA 4WXPA 1E9DA 1T0HB 3T5DA 2MMGA 1NNEA 1NMYA 5JWRA 2QE7D 4TMKA 3THWA 1XMSA 1CJMA 4K8OA 5EE5B 4B6EA 2GXUA 2ZE8A 3LBNA 3TW4A 4D4LA 4IEEA 4LJ8A 3A4NA 5A5GA 4TZ0A 1VCIA 4L4UA 1Z6TA 2J46A 2FSIA 5J5CA 4FWTA 1XCMA 1E96A 2HEIA 3U7GA 2B8WA 3GLHB 2RGBA 5F9FA 2ZYUX 1HE1C 1ZBDA 2ZSFA 3FHCB 3G5UA 3IEVA 2QMEA 2R6GA 2P3SA 2QM8A 1BYIA 2FZLA 3CRRA 2J0SA 3K0CA 3TBKA 1W36C 1SVSA 4PSVA 1LVGA 1G18A 2QM7A 4Q5IA 4D2IA 3FFBA 1RW4A 1E9SA 4LYJA 4ON9A 3RANA 1ELOA 3QKRB 4BFTA 3IHLA 5J47A 3DO6A 4RD0A 3A8TA 3Q9LA 4TN1A 1OXXK 4D6PA 3IEUA 4NYJR 4D0NA 3A36A 1G8FA 2XJ9A 3I92A 2R6CA 3VNUA 5JI2E 1JB1A 1XTRA 1CP2A 1G6HA 5SZIA 2BMJA 4OHYA 2R65A 2IWRA 3U4QA 2IYSA 2QMUA 1IHUA 4YXWA 1ESNA 4GOKA 1CR2A 4NCJA 2QSYA 3PR1A 4OK5A 2CHGA 4OK3A 1ZNXA 3C8UA 4EJSC 1AS2A 1GKYA 1QHHB 2GBLA 2CHQA 3ZJYA 3U60B 3C5HA 1NVVR 1YZNA 3HU1A 4A8JA 1J99A 1M2OB 5FTMA 2GEDA 2C9OA 4Q21A 4IVPA 3QKSA 3NC1C 5B57C 1M34E 4ZCLA 3B7GA 1KZGB 2WWWA 721PA 1MRNA 3ZDQA 1LY1A 4EIWA 1GM5A 1VG9B 4M9ZA 5H1YA 3SE0A 2O8DB 3ECCA 1WA5A 2DWPA 4JYCA 5CLQA 2NG1A 4LHWA 4NKRA 3SN6A 5HTKA 4HZUB 5AUQA 4B48A 3PJRA 1G8YA 2O8BA 3U44A 1GITA 3C14C 2QPAA 2ZU6A 4AC9A 1NSTA 4WAUA 3CH5A 1R0WA 3MWLA 4XWKA 3FOZA 2MSDB 2JJ8A 4X8LA 2VSOA 1CLUA 3PCRB 4DLSA 1IONA 121PA 3T35A 1KJWA 4AURA 5FL7D 2DFTA 4JVMA 5FTNA 2CL7X 2BM1A 2XSZD 1T8TA 5E7MA 5KYKA 2GVDC 4ARZB 1D2NA 2YWGA 3WYFA 4YDSA 3VKGA 5FUWA 4A92A 3KJIA 4JVSB 2IC5A 1ONBA 2OFWA 3OEHA 3AEZA 4HLUA 4PHTA 1PLJA 2YOHA 1OF1A 4MGZR 4DLYA 4Q4JB 2WHXA 4L15A 2XTNA 1QZXA 5JECA 1E2PA 3O8CA 1XWIA 1G7TA 2Z6VA 2HXSA 3T1QA 2IYZA 4OQMA 2PMDA 3LNCA 2QSZA 2C03A 3CR7A 3EWSA 3P26A 1OYYA 1G21E 2V7QD 1MRSA 5DIFA 2O0JA 4HB4A 4IFBA 3PEYA 2C95A 1QHNA 1JR3E 3CPEA 2XNSA 4Q1CA 2V3CC 2J7PA 4PHHA 2FFAA 1ZM7A 4F93B 1XPRA 2PZEA 3W8NA 4DCNA 1KIMA 1P60A 2W2XA 2DCUA 4DLZA 2W6IA 3SQWA 3BORA 2IF0A 5D3MA 3ZS9A 1KI6A 2R9VA 3GLHE 2VP0A 2WPDD 1CS4C 3AKDA 1YU9A 4RD6A 4FXPA 1R5BA 1TUIA 5AJYA 4MUBA 3WRXC 1DELA 1N6KA 4I1SA 5DO9A 1UDWA 3R8CA 4XTCS 1RRGA 2AXNA 1RRFA 1G6OA 2Q0HA 4QFMA 4BLSA 4FD2A 4CT5A 1KAOA 1KY2A 1X6VA 2Z4RA 1XD2B 4LBYA 5BN3A 4GPTA 1G19A 1CRQA 4EQ6A 3DOEA 1OT3A 5KDDA 1CJVC 5TB5A 4ACBA 1N6OA 4M0LA 4ZDIA 3T1OA 2WAYA 3CONA 2EYUA 3GD7A 4OQXA 1VG8A 4LBWA 3RHFA 2WKRA 3AF3A 3SYNA 2GETA 2J59A 1E6CA 2V54A 1C4OA 1ZIOA 4YMUA 4BLTA 3GMTA 1E2LA 5HZHA 4LBVA 1HE8B 2BIFA 2BV3A 2C99A 3EA5A 3LW8A 5H68A 4ERNA 3K0FA 4ZI2A 3FHOA 1NVWQ 3L43A 3UG7A 3KTAA 4QC2A 3V4FA 4D0GA 3AP2A 1T0JB 3D7MA 4YDHB 5DI3A 3IILA 3GJ7A 4BASA 1G4UR 1R2QA 3QUSA 1R7RA 4ZDKA 2ZI3A 4EUNA 1WDTA 2NMVA 4LY6A 3B2EA 1VHLA 4XVUA 3AVUA 1ANKA 2X1VA 3VKHA 4MYUA 1N0UA 1NKSA 3I72A 2OESA 3H84A 4Q4AB 1H8EA 3PVSA 4BLOA 5JZVA 4US1R 2GA8A 1DTSA 3VTKA 1KJZA 1NLZA 1LB1B 1NL3A 1UKEA 1Z5ZA 5B2ZA 2C5LA 4TLBA 4A6PA 4R71A 3B1WA 2QAJA 2OBLA 2ZI7A 2GZDA 4DT1B 1J2JA 3NEYA 1M1YE 1QHIA 2PBRA 3FKSA 1W4RA 1II8B 3PIRA 3U6KA 5FUVA 4TYWA 3F8TA 4D26A 4KYIB 4TSFD 2O8CA 2ZXUA 1Z08A 5FPYA 1OIVA 1R4AA 2FG5A 5JBQA 4GDFA 4IKEA 1AKYA 2ZE7A 1E2QA 4EPWA 5FTKA 4U7DA 2JLVA 1G3UA 4TL6A 1KI4A 4JLNA 1NSFA 2JLQA 3I3SR 2OG2A 1YRBA 1MO5A 2P67A 2WIBA 3K9LA 2IYTA 2QMHA 2GDJA 3TUZC 4OI4A 3K9GA 2F43B 4HYYA 2G1JA 2OBNA 1CU1A 3LRPA 3VX3A 3LXXA 2BCJQ 2VF7A 4RD3A 4TQUS 2PX0A 4WXRA 5FPHA 4LYHA 3BFKA 4JT2A 1EFRD 2ZRGA 1QHXA 3GJ0A 5DSZA 2WOJA 1S9DA 3W6PA 1QVRA 1BOFA 1X3SA 2RMKA 4I4LA 5JMTA 2OM2A 1QG2A 2MSEB 2KBFA 2VQSA 2RCNA 1E2IA 4B47A 1NIPA 4FMDB 1DBSA 2JDIA 3GLFB 1KK1A 3N2EA 2ONJA 3TVDA 5JSZB 4B3GA 4RD4A 1V5WA 1GKIA 3DOFA 4LV8B 4WVFA 2OLKA 3LY5A 1OPXA 5AUNB 1E1QD 1XEWX 2CNWD 4CVNA 4B6FA 4Q19A 2XOKD 4PZYA 2ZJYA 5KU1A 4UQOA 1RC8A 2XB2A 4QHYA 2DHRA 3W8RA 3OE7A 3PEWA 2UKDA 2Z4SA 1OH6A 1JXMA 1XD8A 5BW8A 3I5YA 1HA3A 3ZVMA 3G0HA 4DDUA 2BKEA 1Q1BA 1NVUQ 2NPIA 3VFDA 4CEHB 1JR3A 1XTSA 5HE9A 4A15A 1RFLA 3OIUA 2HYDA 2C77A 1UDXA 4XWOA 1YRAA 3RSLA 1P3JA 4WIAA 1F3OA 2VBCA 5CK5A 3NDBB 1W0KD 2GBLC 4JLBA 1E79A 4D80A 4IOKA 4EAQA 4PQFA 1L8QA 2J9RA 4NMMA 6Q21A 4BEJA 3GLHA 3TR0A 1GL7A 2JIZD 2ZANA 2ZRMA 1O3YA 1YE8A 3OAAD 2HUPA 5AUPB 4V0NA 2CLSA 2GKSA 2FSGA 3GLIE 3DL0A 1PUJA 3CF6R 3RS0A 4IDOA 3IPYA 3AB3A 3QKTA 2VP6A 3ADKA 1EK0A 2N46A 3BBPA 3QEOA 1U98A 4LYFA 1D8TA 3LBHA 4OQNA 2I1QA 1KZ7B 4PPGA 1IQPA 1WXQA 4HDQB 3KKNA 3QKRA 1SKYB 1MT0A 2V4ZA 2JJ2D 4N1AA 1E2MA 4IXMA 1LFDB 4C0KA 4P31A 1Z29A 2PLRA 2ODWA 1Y63A 3ND8A 3B1ZA 3ZD6A 3QF7A 1FFHA 3DMNA 4M1WA 4DEXA 1K6MA 5JS8A 4PAQA 4PPFA 2JJ1D 1NLFA 1CEEA 1W5TA 2WJYA 1NMZA 1AQUA 1TEVA 2A5YB 2QRNA 1SXJC 2G77B 2BMFA 5LB2A 4YMTA 1JI0A 1XP8A 2XTMA 4HLUC 4QNMA 1EX6A 1GNQA 2CCKA 2XZPA 5E7IA 1Z0JA 2EFEB 2KBEA 5K8TA 4JL5A 4PC2A 2D74A 4M21A 1I2DA 1E2EA 3WYGA 2B92A 4KXFB 2OE2A 4XOIA 3WY9A 2J0UB 1KDPA 1KY3A 1M7GA 1KDTA 1E2FA 3AVQA 4QKQA 4BPBA 3WMFA 1QHHA 1IOZA 1UM8A 2JCSA 3REGA 4NPHA 2CCJA 3EXAA 2OAP1 1NVXQ 2BBOA 3H2YA 4Q4HB 5CLLA 4JKYA 2OXRA 1BKDR 2RGXA 5E4FA 3LLUA 2IS2A 2DWOA 4E03A 1KYIA 4NDZA 1KI9A 3QG5A 4JBYA 4UNPA 3P4YA 4BUJA 1KKLA 1E32A 4B3BA 3GJ5A 3NDPA 2QPOA 2CXXA 1Z2AA 2O8DA 1A5TA 2BC9A 1H8HA 3T61A 1US8B 4NYJQ 4HZUA 5FOXA 1VDZA 3RS3A 1FP7A 5JS7A 1BYUA 1OSNA 3GFOA 4ACAA 3B1XA 1KSGA 5IRCD 1FQKA 2ZRPA 3U3JA 1SXJB 1X1RA 2PX3A 1MOZA 2QGZA 1G4AE 1GG2A 1UF9A 2UZIR 4GNKA 3BXZA 1GWNA 2QMOA 3WMGA 1TU3A 1HEIA 2ZRNA 1A4RA 1KO8A 4PFSA 2ZREA 1S3SA 4ARZA 4BQSA 1XFAA 5JRJA 3HU3A 4L16A 4L5BA 4P3YA 1CR4A 4URWR 3A1UA 3IIJA 3SI7A 4NONA 4TMWA 2ZRIA 1XXHE 3R9WA 2OO7A 1V43A 2CE2X 3SHWA 3K1JA 4Q4JA 1Q21A 2GZAA 2YV5A 1M6NA 3OEED 5E7JA 2KI5A 2ONKA 4BLRA 2E87A 4EPRA 4BFZA 1DAIA 4NZYA 2A30A 2D4HA 1ZD9A 4AKHA 2EYQA 1G3MA 3GJ3A 1N0WA 5FBWB 2WAXA 5BN4A 1IN5A 5F3WB 1NP6A 2R2AA 3E70C 2IHYA 3DMDA 4DWJA 4MKFA 4PQRA 3DM9B 4BFUA 3SOPA 4TLEA 3HPRA 4FCWA 4HSEA 1ZJ6A 1KO7A 4QNRA 4PSAA 3GEIA 2QPTA 1G20E 3O8BA 2EQBA 4MRVA 4MRNA 2KSQA 5FPKA 2R8RA 4O2LA 3I5XA 1CKEA 1M7HA 3QVVA 3FVQA 3I61A 4I81A 1OLOA 1T6NA 2GTPA 5CIWA 3ZIAA 4AWXA 1KGDA 4EPVA 4GOXA 1OXSC 1CJTC 4TQ9A 5FPTA 1E2KA 4LBZA 3TSZA 2YHSA 2PZFA 3BJIC 1AS0A 3TKLA 1XCPA 3HYTA 2AXPA 3UMRA 5GJCA 1QHGA 1XD2A 4HUQB 4IEIA 2HCBA 2YVUA 1FL9A 5AWFC 1SKYE 1Z83A 2AFIE 4D4KA 1D9ZA 4DEYA 1E2HA 3EG5A 4OHZA 1WQ1R 5J4KA 3DVLA 1WBBA 3B1VA 1XF9A 3BB4A 4Q01A 3TH5A 3GJ8A 4JLOA 4MRRA 4US2R 1ZYUA 2V1XA 3CNLA 3R20A 2RGAA 3QNUA 4Q7KA 3BK7A 3EPLA 4QGGA 5FH9A 2IYVA 1COWA 3ZGXA 3CBQA 4C2TA 3ASYA 1JAIA 1MABB 4RSGA 4O3MA 2W83A 4P0TA 4B2LA 5GVSA 1VECA 1QDEA 3H1TA 4JJZA 4MRPA 1W36D 1AGPA 2H1LA 4ZIRB 2BMEA 1VG1A 3QJYA 3OFNA 3PXGA 1IN8A 3NG1A 3PUXA 2P5SA 4OI0A 3WBJA 4D81A 2CVFA 5A0FA 4LYAA 4U00A 2PT7A 2ZYVX 2P6NA 3RRYA 1U8YA 1G5RA 2RGDA 2RGEA 1Q1ZA 5K8UA 2FF7A 3M6AA 4URYR 4EDHA 1OKKD 1JQJC 3TSWA 4PTLA 3MAAC 4MRSA 4LOAA 4Q4AA 1GL6A 4A0FA 2AKAB 4JS0A 3KQKA 1NN3A 2O8CB 3CX6A 3REFA 3GP8A 1XEXA 5FPSA 4ZKDA 4DT1A 4A0GA 1TUEA 4A9AA 3AGQA 3QKUA 1I4DD 1MV5A 1F2UB 4TMTA 5E95A 1N5IA 1II8A 1KNXA 5LD2C 1RJ9B 5J40A 4MKIA 1CR1A 1EFTA 1XB2A 5A4JA 2B6HA 4TT3A 1B0UA 4AY2A 1Q1EA 4MA4A 2GXSA 3UMFA 2IYRA 3MCAA 4F38A 2QRZA 3LA6A 2FFQA 3ICQB 5IK2A 2WZQA 2ZRLA 1G16A 3TVTA 4CYMA 1R8QA 1DG1G 2ZROA 3AF4A 3Q5DA 4OI1A 5DNYB 2P2LA 1W0JA 3WP0A 1U8ZA 2EFDB 3VNVA 2VF8A 3AP3A 3WBKA 4DLXA 4L9WA 3KB1A 2CEAA 3BERA 3K0EA 3T15A 1P5ZB 3QPVA 3SFZA 3HU2A 3U5ZB 2IBMA 2F43A 3FFAA 3RC8A 3PG5A 2A3RA 3FTQA 2G6BA 2P6RA 2AWNA 2ORIA 5HKKD 1DARA 4LK2A 1K8RA 2IYQA 4QM6A 5DN6A 4RD2A 3UXMA 3FYHA 2OXCA 1QHSA 1DAGA 1TAGA 3QF4B 2ZS9A 2VP5A 1NY6A 4KVGA 1G8HA 3NBFA 5TVKA 1II0A 2W0MA 2VL7A 1OB2A 4TMVA 3GLFA 2JLSA 5LD2B 2J5XA 5JSZA 2VHCA 3RWMB 2WICA 5KSOA 5GVRA 5KHOC 2ZJOA 2RGNC 5FUYA 2VRWA 3R7WB 2NOAA 2OCAA 3KXLA 2QTFA 5GJWC 4XSHA 1Z06A 2YNMA 2OFOA 4JBXA 2HLDA 1ZD8A 3EARA 1HURA 2C9YA 4LJ7A 2WJHA 4CEHA 1QG4A 3HR8A 4Q7JB 2C2HA 1T5LA 3F3YA 3N2IA 5DLQC 4LWZA 4TYYA 3ZVLA 1HT1E 2FPLA 3CF2A 1ZVQA 3TJZA 4JLAA 2CK3A 3BH7A 1E2NA 3KXKA 3K70C 2PJRA 4BFYA 1CR0A 4MYTA 3NTUA 2WV9A 1U0HC 4QJ3A 1Z0AA 5FR1A 4F4JA 1VTKA 4BZQA 4HAWA 4B2PA 4MUAA 2H5EA 3KQLA 2A5DA 4KHZA 1U8AA 2ZR0A 5EUMA 2FEMA 4XTRA 3EIEA 5FOWA 2LKCA 1P75A 2J41A 3K8YA 1XEFA 3ZVRA 4AD8A 4A0HA 3ADBA 5DGXA 1OB5A 1N6NA 1JXOA 3FKQA 2HF9A 2FNAA 3P4XA 1IJFA 3AUXA 4LGMA 4Q18A 2JLZA 5LBIA 2BMDA 2ZJBA 1KNQA 4X8OA 3I32A 4E09A 4OYHA 1ZU4A 1D2MA 1TL7C 2N1BA 1EWQA 1ZAKA 2C96A 1KO1A 3RNLA 3LQRA 2V9PA 3IIKA 2YINC 5FOUA 3K70B 2YWHA 4UXJA 4PPQA 1S3GA 621PA 4Q1FA 2VEDA 3U61B 3AKYA 1UKVY 1P2VA 4RFSB 2NIPA 1OXUA 3F0TA 4M1YA 5G53C 3EA0A 2FH5B 1OHHA 3AKCA 4UNSA 2J0UA 2FMXA 2WSSA 1W1WA 2ECKA 4IDPA 3HP1A 4NH0A 3GJ4A 2JLXA 2LKDA 2QTHA 2CHVA 2IXEA 1Q57A 2A78A 1YR9A 4Q4HA 2C8VA 1SVIA 2UZ3A 2FEOA 4FCVA 4LUCA 4CEJB 4N0DA 4KLNA 2PJZA 2FN4A 2O8EB 1T3SA 4KSBA 1E1RD 1US8A 4ZPXA 5CITA 3GFPA 4JLKA 3VR2A 3LAWA 2D3WA 4WW0A 5JWHA 2B7CA 2ZQ5A 3J81k 1SXJA 2HCJB 1X86B 2QORA 3CRQA 2FPMA 4MH0R 2BCGY 3CLVA 4B33A 4LHYA 1D6JA 4M1MA 2MSCB 4PO9A 5UKDA 1JALA 1M74A 3MLEA 3TW8B 2J0QA 2ERYA 5L3SA 5FL3A 1E9EA 2C98A 5DH9A 4B3FX 3OIYA 4M53A 4DDVA 3AVPA 4LSGA 1UPTA 4O2RA 2RHMA 2IYWA 2H7VA 2GZHA 3PUYA 4FN5A 1UAAA 2F3RA 4KCGA 4FW9A 3UK6A 3IBGA 4C9BA 3RSOA 4ASUA 1E9RA 2HT1A 2NO9A 5DE3A 4RFVA 1J70A 4LJYA 1T8UA 3TGPA 1G7SA 1XTJA 4KFSA 4CF7A 4W5WA 2DFKB 4YLGA 2IX3A 4OK6A 2PZGA 4RCZA 3LQQA 3S1AB 1KO4A 2ZSAA 1JR6A 4WZAE 1S8FA 2WVJA 4B35A 1S1MA 3QPWA 3B8HA 4HAVA 2LCFA 4ITRC 3CUEF 4QGFA 4QJ5A 4NCNA 4JMPA 3HYRA 3O47A 2VH5R 1RRPA 1KO5A 3GLGB 1F48A 5JWOA 4JIMA 4U02A 2W6JA 3B60A 4DCVA 2QENA 4RZ3A 5M04A 4DSTA 2IYYA 3T5GA 1E2DA 3ZYCA 1JECA 3B78A 2W0SA 4YXWD 5CB8A 1BO6A 2F1HA 3AF0A 3VR6A 1P2UA 1XJQA 3WP1B 4HUQA 1YVDA 3ADCA 1NN5A 3OESA 5EXSA 4NYMR 1C1YA 2R6FA 5FI0B 2KE5A 4KFTA 4C0QC 2DWQA 4KSCA 1R5OA 2O0KA 3CX8A 421PA 1PVOA 1IY0A 4LC0A 3UKDA 1PLKA 4CEIB 4ESVA 4HB0A 1IN4A 2PLFA 3TUJC 3SS8A 4MYHA 3DPUA 1P9WA 2GWHA 1MABA 1X8LA 4B71A 4FMDF 2NO6A 4NE2A 4ZIRA 1YZTA 1OH7A 4F7WA 2G9NA 3EIQA 1BH2A 4QBIA 1ZUNB 2PCJA 1VMAA 2IS4A 3L8YA 1H65A 3CR8A 3U3RA 1YZKA 1G64A 1XEXB 1DAKA 2WWHA 2I1VB 3QXSA 2F7SA 4FCTA 4OHWA 1DG3A 1Z63A 1IJEA 3EZ6A 2C78A 1N6LA 5JJKA 5KOYA 4H1UA 4Y0AA 1R0YA 4IVQA 5SZJA 1Z8FA 3ZS8A 3EPKA 3LLMA 4OJQA 1II9A 3RVBA 1PV4A 1IM2A 4A1FA 1N6HA 3KQUA 3OEHD 2DFNA 1NBMA 2X2EA 1UEJA 3DKVA 2ODEA 2X2FA 4GT1A 1GOTA 1F2UA 4J0QA 4M8NE 3BGWA 4BFVA 2ZVQX 1RJ9A 4HUTA 5JEDA 1CULC 2R62A 2R6DA 3A58B 1FQJA 1SHZA 2A5JA 3L8ZA 5J4LA 4TYNA 2GK7A 1VPLA 3L82B 2A7QA 5CM8B 4D4JA 3D3QA 3EIHA 4GMDA 3W6NA 1AK2A 1FZQA 1W49A 1HUQA 3ND9A 5AJWA 4DIDA 2JGNA 3SHFA 3SJCA 4ZDJA 5EUQB 1NG1A 2J7PD 5B64A 5FBVB 3OIWA 1YZGA 5KDLA 3ZVNA 2CMKA 5EE3A 1G7CA 2ATVA 4KFUA 3HR7A 1ETUA 1ZW6A 1AM4D 1Q0UA 2OHFA 5FR2A 2QAGB 1W46A 1YHNA 1ZM3A 2ZI9A 2W6ID 2C9CA 1XMVA 1PJRA 2XJ4A 4C0HA 4UJ5A 1JJ7A 1DE0A 1XNJA 2QY9A 4DCTA 3LVQE 1KOFA 1GTVA 3B13B 3MWKA 1OXTA 2NZ8A 4C0BA 2G0TA 3TQFA 2WWGA 1GVNB 2OBMA 4JL6A 2AD5A 2IUTA 3QF4A 3W5JA 1G8PA 2GK6A 3KDSE 2QGNA 3PFIA 3H0KA 4HB2A 3BFXA 3D31A 4MITA 4RD1A 1G3IA 1Q12A 5KPJA 4TWZA 4DDTA 2CE7A 4G5GA 4DZZA 5F9HA 5EXPA 4H1VA 1OIXA 3GFTA 5E3HA 4Q7LA 3H86A 3R7WA 2CLDX 1ZD1A 3AF1A 3MMPA 3C41J 3NVAA 4WBSA 1ZNZA 3QG1A 2GILA 4E5UA 2O5VA 4P4SB 5EP3A 4C3ZA 2FV8A 4RKFA 4ZCMA 1CF4A 1LV7A 1Q3HA 2EFGA 5G41A 2ZRCA 1E9AA 2QTVB 1MR3F 1GDDA 2NQ2C 4BEBA 2FFHA 3AUYA 1FTNA 2VHTA 5HE8A 4M2LA 2C04A 4OJKA 2XZOA 3P20A 3QI2A 2H57A 5LPNA 3EPHA 1KTVA 5JCZA 2P5TB 4URVR 4C4PA 4E22A 4YMVA 4G3XA 1JNYA 1TMKA 1OIWA 5JI3E 4MDFA 1ZC4A 3B85A 4OQLA 2FDCA 1OXVA 3KUCA 1EG7A 4Z51A 2AX4A 1DO0A 1OV4A 4HATA 1VCOA 3NHAA 4LHXA 1R0ZA 1R10A 1NN1A 1P72A 1ZMXA 5J4VA 2Q6TA 1W5SA 4GBMA 4DHEA 2FZ4A 5CYOA 5TDHA 3DHWC 2RGNA 1H8ED 2GAAA 1WCV1 4TTPA 1OFHA 2BHRA 2VSFA 2QQEA 2G1KA 2D7CA 3GCGA 4JJKA 1FP6A 5EXXA 3AVYA 4NBSA 3QBTA 3BC1A 1OFIA 1K5GA 4R2HA 3VKWA 5TMPA 3FKSD 3CO5A 3TAHA 4JVLA 2FX3A 3NWJA 2F55A 3CB4A 1FMJA 2Q9AA 4IOJA 4HAZA 3WXMA 1GRNA 2Z0MA 2OILA 3UIEA 1A2KC 1F6BA 1BMFA 2QQ0A 2ZJ5A 3NIBA 3VHXA 5HCIA 4JKIA 1C9KA 3T34A 4C0AC 4KYUA 4KU4A 1HYQA 2D2FA 3Q72A 1Q1QA 1RPZA 4Y0VA 2RGCA 3RS4A 4RFSA 2IWHA 5G40A 2ZR9A 3LFUA 5TY0A 4OHXA 3KKMA 1XPOA 2V55B 2ATXA 4P33A 2BJVA 2GAOA 3K0AB 4NHOA 2GF0A 3Q5EA 5KPDA 1Z47A 4DCSA 2ZUCA 4QGHA 4EFMA 3DEFA 3ZZUA 1IXSB 1SULA 2IUUA 1U90A 4GP6A 4DUGA 5FOSA 3ICEA 4M9QA 3KXIA 1P2TA 4A4DA 5C2JB 4CEJA 2IYLD 2ZRKA 3K9HA 5JEEA 1U9IC 4DJTA 5AJZA 4AKGA 3C5CA 4CW7A 3FPAA 1MKYA 1Q44A 1UBFA 1PLLA 2QBYA 2O8EA 1ZC3A 1R6BX 2ZS8A 3LV8A 5G3ZA 5L3SB 1Q3TA 3AVOA 4XIGS 2RB4A 2QT1A 2W2TA 4XD7A 3TAUA 4BRWA 3DM5A 1QRAA 4I1UA 3ETLA 3AM1A 4NTZA 5AK0A 2F9MA 2QNRA 3OE7D 3GLFE 3P32A 1NVVQ 2ZI6A 3MWJA 4NYIR 4UNQA 5JJLA 5AUOB 3T12A 1JR3D 3TSOA 3GJXC 1Z07A 4G5RA 4GZMA 3KX2A 4Z54A 4GZLA 4Q7MB 1AGRA 4V0OA 5FBLB 1Y3AA 3I1FA 1X8JA 2YWEA 3CZPA 1XBTA 5CJPA 4WOPA 5C46F 3GEEA 1ZNWA 2JASA 1E79D 3QSYA 4Z1MA 4BE7B 3JVVA 4U5XA 1ZM4A 3I8XA 4NCHA 5JRZA 3AH8A 1CTQA 2ZRJA 1M8PA 3BH6A 1E0SA 1KSJA 4FMBB 4PC1A 4DCUA 4QGAA 1SVWA 3U7HB 5JJIA 3E2IA 1NLYA 4TYQA 4HLDA 2H17A 4B3CA 4H9GA 4JLDA 4HEJA 4HB3A 4DC9A 1N6RA 3JVUA 4JT4A 4DSUA 4Q03A 4X8HA 4IW3B 5DYIA 3S1AA 5TV2A 3DDCA 1U94A 4EPXA 1Q22A 4AG5A 2AL7A 4QHTA 2XITA 4DB2A 4F4CA 1W4AA 1DS6A 5CK4A 5DI9A 1T3HA 1KK0A 2EFHB 2Y8EA 4OBEA 2Q21A 3E1SA 2F6RA 4FMCB 1MO3A 3Q3JB 2ZSDA 4DVGA 1Z0KA 2GVZC 4O0MA 3SYLA 1NIJA 3O8RA 1TX4B 2ANCA 4II7A 4AK9A 4B44A 3THXB 3GLGA 2IHBA 3NC0C 4AI6A 2AWOA 2VSXA 5F2EA 1Z6AA 4L9SA 4OQFA 4LJ5A 1OH5A 2XNDA 3H4MA 4JLVA 2YJTD 2YZ2A 2VPPA 3PITA 4KVAA 4PC7A 2QE7A 1RRCA 2FFBA 2HJGA 1Z0DA 4LHZA 1N5LA 4PPNA 5CYPA 2GXQA 1G5TA 3SBDA 2F1IA 4POAA 5KTYA 3L0PA 4G01B 4NCIA 3K0SA 4BFWA 1U81A 4G5SA 2F1JA 3V00A 4ZI3A 4RZ2A 5FOTA 4R98A 1Z6YA 2OCBA 3K70D 3KB2A 3LD9A 3LO5A 3LDAA 1J8YF 4A2QA 3RS7A 2RAPA 4CEIA 1AJEA 1MO6A 5C18A 1S1CA 2QP4A 4V0KA 2FOLA 2WJJA 2ZSBA 3RAPR 4V03A 3B82A 1A82A 1Q20A 2G0NA 4KODA 1P7CA 1JEEA 1H8HD 5JHGB 2QT0A 4R9UC 4N0EA 1HT2E 1UBEA 1KSFX 4LDJA 5ANRB 2IF2A 2V6JA 4QL3A 3V9PA 3K9NA 2BEKA 1ZRHA 4A2PA 4LC1A 3ZD7A 4RZUA 4TL8A 4BZXA 1YR8A 2HV8A 4M1KA 1JAHA 5BXQC 4NP6A 4DBLC 2JLUA 2RKOA 1LW7A 4A0RA 1I2MA 2VP9A 5JHHB 2XXAB 3O8DA 4PAMA 1HTWA 1SXJE 5CIQA 3T1VA 3CH4B 3LW7A 4NYMQ 4PX9A 4HLQB 1NY5A 4CDGA 4KJZA 2GEVA 2WSMA 2H8KA 1S0UA 1WF3A 3UWKA 1IN6A 4EPTA 3CWQA 3EZ2A 4URZR 3BAFA 2QI9C 2ODNA 3MJRA 3EPJA 1U99A 4LZZA 3LBIA 4FINA 3G82C 5DHFA 1W4CA 1DO2A 3U3OA 4Q9JA 5J4YA 2ODBA 2EVWX 4P32A 1DAFA 1T91A 3RLFA 1AN0A 1JBKA 1SVOA 1VYVA 2BBTA 2ZE5A 2WKQA 3EZ7A 3PENA 3VAAA 4B2IA 1XPUA 1NN0A 1KSHA 1P6XA 2O0HA 4RCYA 2EW1A 3U3MA 2FA9A 4CT4B 2NO7A 4XH9B 4AYXA 4QHSA 3KKQA 3NBYC 4JYBA 2V8OA 1UFQA 4KFRA 1YR7A 1LS6A 1TADA 1DAMA 2QAGA 4TTRA 2CCGA 1IY2A 1N6IA 1EWRA 1YZUA 4L8GA 3EZ9A 5IF9A 1GNPA 1SZPA 3ZIAD 5IHPA 3W5IA 3AVWA 4DSOA 5FL7A 1RE0A 8OHMA 3NEJA 4M9SA 3RRMA 2XSZA 2GRJA 5CDFA 1JEDA 4JLMA 2B21A 2IS6A 3BOSA 5KSPA 3AVVA 2O8FB 2WWFA 4HAUA 4URXR 2B8TA 2ZYWX 4MKGA 4OHVA 2SHKA 1MH1A 3PEUA 5CB6A 4W5JA 4OKSA 5EZ6B 4MGYR 3R9XA 4LJ9A 1FMLA 2XB4A 3LX8A 2BKUA 1GFIA 3MGCA 3WHLA 3I8SA 3WMEA 1P73A 1X8KA 4P4SA 3VU9B
chains in the Genus database with same CATH superfamily
2IX9A 2AZMA 4IDFA 4S1VA 2FI1A 2FF5A 4HH1A 3EEYA 3IUQA 2IDJA 4Q3OA 3SIWA 3HKDA 3I9OA 3O2JA 3QIAA 2PKYX 4S1WA 2AKYA 2PVPA 3D3KA 3KFXA 4QXAA 4RL6A 1PT9A 1ICIA 2WM9B 2D2VA 2Y1KA 1P0QA 4HS9A 1PGJA 2A1TS 2WT9A 1JP7A 2Q0QA 1PSZA 2BPOA 1T0IA 3D2AA 3QOYA 3L9XA 2QVCA 3G0OA 1GSOA 1PGQA 4RTKA 4NU0A 1NM5A 1HQYE 4MVJF 5D1HA 3ETCA 3L0OA 1P0MA 2QNBA 3EVFA 1GRQA 2J9ZB 3BD9A 3PEVA 4JLJA 5F78A 1V1RB 5K20A 2PY6A 5FYQA 1OVGA 3RAEC 1Q5PA 1WZNA 4TMZA 4TPKA 1JH9A 5ENDA 2DH5A 5TS2A 3BH0A 3R3UA 5BSGA 2OBBA 4NBUA 4XPZA 1EJBA 1KPHA 221PA 2VN8A 3ZXXA 2FSFA 3AT1A 4R8SA 4TTVA 3VPFA 1RYHA 4KDCA 1WMSA 4DLTA 5JFTA 4YCBA 5E3IA 4ARCA 2IZ7A 3AEXA 2B8JA 3DZBA 4ZVSA 5JVDA 3EULA 4BO9A 5JAIA 1V3UA 1WMAA 4FYHA 2CLCX 4AMZA 3DZCA 4PRLA 2R6AA 3DPSA 4UC0A 3OQMA 1USIA 3RVJA 1G9XA 2ZRBA 1A1SA 4RMJA 1VGRA 3ZE0B 1RRKA 3IQZA 4QICA 5JAMA 2AKEA 1PVDA 3WR5A 4J3JA 4EW6A 5D3ZA 1G2PA 5D5QA 3VPXA 1CHDA 1L2TA 4B09A 4B2YA 3WSVA 2CNDA 1AZLA 4J7AA 4G1FA 1Q7BA 1V8FA 5D00A 4E3ZA 3X1XA 3WWYA 1WZ2A 2HIMA 1R15A 2VHQA 4TS1A 1QFJA 3KB8A 4UU1A 5FFNA 3RM3A 3X1YA 2NZJA 3ZNNA 1W0JD 2O52A 4B8WA 1UINA 1JRLA 5HBGA 1WZCA 1ZY2A 2AC4A 3AHCA 4JU9A 1W36B 1WUJS 3HO1A 3BKXA 5B4VA 2H00A 2CVOA 2H65A 1BXZA 1QS0B 2PGOA 4O25A 3OF5A 1KJ8A 2DBYA 5CVVA 5CRIA 5KQPA 1CZRA 1AXEA 4IDNA 4AJJA 4CG1A 3HCAA 1XTQA 2Z5LA 4G97A 5C3UA 2QBYB 3KS9A 2X86A 3JVEA 3MWGA 3C7TA 3WRYC 5DN6D 3GQVA 4PVCA 4D9HA 3FYUC 1E66A 1VRWA 1EFUA 2DBQA 3NBQA 1MO4A 3PQ7A 4H59A 5EE1A 1THGA 2QIPA 4LYDA 1G7RA 2HU8A 3NBZC 5EKUA 2J45A 1A8SA 3EZFA 3CKLA 3GZNA 3U3KA 3QY0A 3SE7A 4Z2AA 4RU1A 2PUTA 3UUGA 1DAEA 3JQFA 2X2OA 4WZ6A 2HU5A 3N0RA 2PFSA 3ITDA 2JK0A 3OPMA 1PQWA 4MGIR 4CCWA 1C50A 1TTQB 2QXUA 4YJKA 5AM4A 3U4AA 9GPBA 2NSJA 4LPKA 5K3DA 5A5VA 1WDMA 2WTMA 1JEQA 4MO9A 1XTKA 2FSPA 2QRVA 1KH2A 1FNNA 1Q19A 4F84A 4EO9A 1CP3A 2OV2A 1DJNA 3JWHA 2OO5C 5AIBA 2HAEA 4Q9KA 3Q8XB 3IMFA 1OU4A 3JPYA 2ZYTX 3LDUA 5BMOA 4IH9A 1T25A 3ZLTA 1UXHA 3DTVA 2O3UA 2ZAMA 5AQ1A 5LJIA 1FBTA 3NAQA 5JSQA 2ZIEA 4QVKA 3CIOA 2WG0A 2A88A 2J32A 4GXRA 4CMGA 1ZL0A 2AMJA 4RH0A 2GLUA 4C78A 1DRWA 3C1UA 5BQ5A 2R8BA 2X8JA 2FJUA 2ABWA 3RYIB 3Q3VA 3A9SA 1XRJA 1KYVA 4QXOA 1NVKA 2ZETA 3LK6A 3OJFA 5BWLA 1IBRA 2P35A 1AVTA 4B5LA 5IZCC 4RWZA 2QG6A 1FW6A 1GPLA 1X87A 3CKMA 3N1UA 2J87A 2A1TR 4GYJA 4UFOA 2J1LA 1XEAA 2ENUA 1R74A 1DZIA 2VAPA 3HCPA 3KUKA 4RKYA 4BCBA 2YIVX 4X45A 3Q7TA 1GPMA 2X40A 4LJ6A 4QWMA 4DSNA 2WSIA 3W7AA 4HNAB 2D7DA 3FPJA 1TZBA 5EE9A 1EWTA 3WQBA 4B3HA 1HE4A 2D8AA 4JI0B 4PZZA 5L3QB 2HMVA 4Q1BA 1E9BA 2OEPA 2XY4A 2HT6A 3U7FB 3G85A 4A82A 3OE5A 3I4FA 1XKQA 2PH3A 4NYIQ 3DYIA 1YQGA 3DBVO 3RJ5A 2OR3A 2ZI4A 1O0BA 4DBVO 2JCBA 1JAXA 3ZWKA 1KMCA 4I2VA 3UTCA 4MVJI 2FUG1 3WLEA 1E6WA 1J8FA 4S05A 1WD7A 1XVTA 3ICOA 3MCVA 5CDSA 4Q1VA 1F14A 3FOFC 1UEIA 1KAGA 3S99A 1A2QA 1BFDA 3EX7C 3EFOA 3S40A 1TQ8A 3EGIA 1D2RA 4CTNA 3JWEA 3G5TA 3MEQA 3UH0A 4LRYA 4YMSA 1X0VA 4MKHA 4CCAA 4O59O 3A6KA 3WYAA 3N7TA 3CURA 2XMGA 4KO1S 1PSWA 3R3ZA 4MUGA 3SMVA 4RVCA 5CT6A 5HFAA 3U9SA 1HFWA 3IEIA 3E5NA 4NBWA 4QWWA 2PUBA 1L7QA 3HADA 1PTJC 3ISTA 3L92A 1VYHA 4HSGA 4MJXA 4V2IA 4X1IB 3REQB 3A3YA 1NRXA 1K1EA 4B34A 2JIZA 1C0KA 1JIKA 5D84A 1VB5A 2BE9A 3HZHA 3JY6A 4W5TA 2WBLC 2PL3A 3P9QA 1KEWA 2H92A 4UTPA 4UNRA 4LQLA 1O94D 5DYGA 4M60A 3BHNA 3T7JA 2DTEA 1R3DA 3PPWA 4DLNA 4TVSA 2OC9A 3O38A 1Y4SA 4NK5A 3INRA 1N1GA 4Q9IA 1JHOA 2FPSA 2G88A 4ZP1A 3ZTWA 2VO1A 3KOMA 1QDUA 3MG9A 4RQBA 4YONB 3V7WA 4AUNA 2FWRA 5TNXA 2HA3A 3OCUA 2FRVA 3PXCX 2PKRA 5DM2A 2VKTA 2WJIA 1QXSA 3FWYA 3QU7A 2BDTA 4U9IS 2DHQA 5JALA 2F3SA 3TCKA 1P8JA 2PXCA 2XTJA 2A0XA 1N5KA 4G0NA 5I4IA 1NMEA 2PGIA 2BGLA 1LPBB 5DNUA 1SNYA 2BFDA 2XCQA 5EQJB 1QZZA 4C4XA 2AD1A 4YDRA 3CZRA 2XXAA 3H2GA 4JCOA 3E15A 3GMIA 2RGRA 1XCOA 3WLNA 1N3BA 1TMOA 1N2CE 1ZGBA 1IN7A 1QCYA 3HB1A 2BEWA 2O2CA 3WGUA 4Q12A 3LVRE 3RTAA 4LJAA 2FPXA 5F51A 4RW0A 4XLLA 3PRKE 4ND8B 4E6PA 5E2BA 5FNVA 3JQAD 4WTOA 5KOHA 4JQZA 4ASUD 4D3XA 1U3DA 2VP2A 2C88A 2PT5A 3OM8A 5EIAA 3TIFA 4C2BA 3G8BA 1YJ5A 3SLKA 2GEJA 2MSLA 5D7BA 2E49A 5LLDA 5BVHB 5E6UB 1M6VA 2LNDA 3U4GA 5JAOA 5E6RB 3ZE6A 3UJHA 4G67A 3VUFA 3DFFA 4LXXA 3LH5A 5DGIA 4ZVVA 5IDWA 1TA0A 3MINB 5G4LA 2BCEA 1PP4A 1GAQA 2WG1A 4QQFA 1EZ4A 5BMVB 4YMWA 1K7YA 4U7JA 3EWNA 4KV7A 1A4IA 2DFLA 4US0R 4IGIA 5DTRA 5HX7A 5B7PA 3PRJA 3ZE8A 3TQTA 3COPA 5EE0A 2P27A 4G4SO 4IG9A 3X1WA 3MUEA 4COOA 4JI8B 4DMRA 3FDIA 1F4VA 1TJ3A 1JMYA 2HRZA 4KO2S 5IKPA 1YDMA 1T8PA 3GD5A 5EJ4A 1GLGA 3HVHA 2SICE 4WWHA 2WWIA 5FTJA 3UK1A 1EX7A 5JXIA 1L6IA 3Q6IA 1F9AA 1XZKA 1YIDA 3BIFA 1CQIB 1FXWF 4P4LA 5SZKB 1QVAA 4BMNA 4QSMA 3O31A 3ZQ6A 2R96A 1HDCA 4I9UA 4BJ3A 2OZLA 1CXZA 2Q28A 4F2GA 1UBCA 1FVHA 4MVXA 2IYPA 4RAQA 3KP1A 1HDXA 4W1PA 5G1PA 1ZG3A 4LI0A 1GFZA 1Z88A 4PLTA 2REOA 4GSYA 3FCAA 3BB3A 5AVXA 3F3MA 1NXWA 1RABA 4R54A 3VMFA 3HDVA 1AO3A 4MQLA 4DFDA 2HDNB 4FNOA 4YP6A 3WDSA 4KH0A 1JPJA 4HXFB 2YHIA 4OA8A 3V55A 2F1RA 1TF2A 2ZUFA 1R4NB 5AHOA 3ZCXA 1OFUX 3CVUA 3FTCA 3OSZA 3SFVA 3FSGD 5TS3A 1LBTA 3RRNA 2VSNA 1ND5A 1U0TA 4B3XA 4C3UA 4EO4A 3H2SA 3AV0B 4Z3DA 3RC3A 3ZEAA 1QRRA 4C2UA 1E4VA 4XIYA 1JJAA 1KP2A 4XRRA 4HWRA 3HJTA 3QVKA 5GWXA 1J90A 1Z25A 4PSKA 3M6IA 3VYSB 2HMYB 1DFGA 3BZBA 3UANA 4E46A 1TEZA 2FP4A 2XBLA 2IZ6A 3P71T 1JSRA 1LDYA 1W94A 3L8GA 4D8WA 4HNUA 1I4TD 3WIVA 4AJ9A 2MIIA 4UFPA 2JGAA 2QN6A 3TEJA 4ER6A 9LDBA 1QIHA 1E9VA 2HXYA 5IPFA 3E03A 4HLCA 4YLEA 3SVTA 3ORFA 1EAYA 1ABFA 4KMOA 4Q02A 2YOFA 2HQOA 3U3ZA 1EP9A 1PR3A 2JA2A 5C1BA 2ORWA 1RWNA 2HM7A 2HLPA 2Y71A 4Z8YA 3VU1A 4D3FA 4H77A 3W78A 3BE6A 5FJJA 5TQ0A 1U2RA 3LX5A 1J25A 3TB6A 3WA6A 3U4QB 3RD5A 2WRZA 1EXWA 2H0AA 2NTVA 3EUEA 4QT0A 4HDKB 5A5FA 1JDUA 4HGNA 4Q00A 4NY1A 4Y9TA 3CRZA 4EGQA 3GH3A 1L5VA 4YREA 2AG0A 2OCLA 5BYJA 3LS2A 3RKSA 3DBLA 1JAYA 3DWGA 4D3DA 1XZGA 1M5TA 3H1FA 1PW5A 5I9NA 3SPXA 4JJ6A 3UUFA 2OQRA 2B8EA 2DYKA 2NQTA 1H6AA 1EFKA 4ZI7B 2PXXA 1T1RA 1B7GO 2C61A 2I2WA 2YN0A 3ANNA 2B37A 3Q2KA 1RYMA 1R18A 3QTTA 4IVRA 4R31A 1S2MA 3QWAA 4ZAZA 4N3NA 2C5FA 2XA1A 4TKVB 3KELA 3N8KA 5IVIA 2J3DA 5KC8A 3ZGZA 2GCOA 4J16C 1QFZA 1X1EA 4KO3S 2OXTA 3TPZA 3D7SA 2E48A 2LDBA 3PX3A 2C9MA 2ZU0C 4NMHA 5C5DA 4LJ4A 4BNMA 1KEKA 1GXSB 4FMCF 5CAEA 1ESMA 3CW2A 3GLRA 4MQ5A 2WQZA 4G23A 1SUPA 2ZRDA 3CZ5A 2GJAA 3K9QO 2JH3A 1EXMA 1IZZA 2CL6X 5FFFA 1PJLA 2H3HA 2NWQA 3L40A 2CDCA 3RPEA 3R23A 3LT2A 2G04A 4DBZA 3WGMA 4DJJA 1M1YA 1CETA 2P9BA 2BFOA 3GGGA 1WUYA 2ZBGA 2WYHA 4HAYA 4LZNA 2NO0A 2X5KO 5JOQA 4DB4A 1LLUA 2VRNA 4O4LF 2I2XB 1TAQA 1TAHA 2HJVA 3QENA 4UM7A 3KJEA 2HEGA 1KMNA 2JGRA 2XLCA 3EIOA 3UHAA 2YVAA 3UAYA 3WK4A 4YI3A 2W6NA 3THYA 2AV6A 4JLPA 4XJXA 3IMCA 3MCZA 3P9XA 2PD3A 1W8DA 3N76A 3HBLA 1ULAA 3ONWA 4KDFA 3HVIA 1OASA 4LQ4A 3DAGA 3GJSA 1GTJ1 1H3NA 1XZMA 5EYPB 2OZVA 1NXVA 5DBGA 2JJYA 2NO5A 2YS7A 3OD1A 4MULA 3UBMA 1XXLA 1IAQA 3B1YA 3NTXA 2KQUA 4RJIA 3RCBA 4DCJA 7ADHA 3R75A 4EJSA 3NDIA 3N74A 1E4YA 2I8LA 2ZSEA 4PRZA 1Q7GA 4K3UA 3LUGA 1ODIA 4WDRA 1DOHA 2ZJ8A 1WLSA 2WEKA 2BD0A 2ZJ7A 1WUIS 2VDMB 1RQXA 2EP5A 3FCXA 4KVZA 4RK0A 5JD5A 4UAJA 4R6WA 2HPZA 2RJNA 3L0ZA 2AOUB 1KP9A 4IIVA 2Z83A 2V4UA 4JASB 4ZOQI 5K0EA 4OH7A 4XR9A 2AFHE 4PSUA 1OYWA 4TTJA 5HFNA 2QU8A 3WRYA 1PZNA 4BKUA 4B73A 2F62A 1SGWA 2WIGA 2C4NA 5BRAA 1JXAA 1V7QA 4EW1A 1AHIA 3WNVA 4DAEA 1NUQA 3BWBA 4DWWA 1YHZA 5HKKA 2BFEB 3O83A 2P0YA 3PV0A 2DUWA 3EASA 5DM0A 1V8BA 3PL5A 5COAA 9ABPA 5DT9A 4EGFA 2V7BA 1LA2A 4N01A 3UV7A 2OBFA 3DWFA 3SJBA 3UWDA 3BWDD 2P41A 2FN3A 1T3LA 1TCUA 2A9KA 2Q9CA 2MYTA 2ZATA 3N2GB 5DULA 3A37A 4KC0A 1PYDA 4C0JA 2YWFA 5F7OA 1ULTA 2EEZA 4Q93A 1KE2A 1ZJ4A 2WWTA 1ZA1A 5CM9C 4EQ6B 1H6DA 4TV9A 4WL0A 3BRWD 2XYRA 1E8DA 1U0EA 3P8ZA 3H4IA 4GVPA 2WYUA 5F5XA 1H05A 3SEQA 3GEDA 1KARA 1YA6A 1XKTA 5DM4A 4H7PA 4MSUA 4I50B 4A36A 4M88A 3D6HA 2C0QA 5T6MA 3TL6A 3ZWNA 3CM0A 3CYFA 3D8HA 3F49S 4OY3A 4LGYA 2Z9DA 3VU3A 3H2ZA 3ZK7A 5CG2A 2XB8A 3AXTA 2FPGA 2DHCA 4MUEA 4WA7A 5F76A 3PCXA 4R1QA 1ISHA 4N0QA 3C6YA 1OZ0A 2IK8A 4IO1A 2JANA 2HSWA 4EG3A 1AIPA 5B4UA 1LS1A 3PKZA 4RJLA 1ZM9A 3L6UA 3PFKA 2CZQA 3GLIA 2ZS7A 4DN6A 3EPRA 5ALJA 3CNOA 5B58C 5IZCA 2MMCA 5SV2A 2IHTA 4EFLA 3O2QB 3O84A 1GV0A 1BA2A 3M6LA 3VPGA 4DIBA 4UTVA 4JVNA 3FHJA 5DI3B 2BZGA 1E63A 1SUAA 2DPMA 2Z5FA 3BXOA 4ZDWA 2C9BA 3PQ6A 3UFXA 3A3NA 4AJKA 5DHQA 3AWIA 2O7SA 1Z6XA 2OCYC 3OIGA 2QD1A 4GIBA 3UC9A 2QY6A 3E3NA 4LSMA 5F21A 1KQPA 1R37A 2PEYA 3QVUA 4CMHA 1C5KA 4J7UA 1OH8A 2XKAA 1QH8A 3BGOS 4GYYA 1L7PA 3EXG1 3AF2A 3MT0A 1K7SN 2HK8A 2VZ8A 2IW1A 2QR5A 3MIZA 5LNK1 4DA8A 1R0XA 4OP3A 1DQSA 4FNGA 1D6SA 1LBIA 5AK4A 5A3SA 3ROKA 4YP7A 3GFRA 3GPBA 2MWMA 3IGFA 4DLWA 5BORA 3K96A 2XCIA 3RS2A 4DCOA 1I7DA 3HTXA 1FPMA 2ALJA 2QTTA 4XD7D 1XQYA 2REBA 3CNHA 3LFTA 3R0VA 4IGKA 4GMXA 3RJMA 3DMFA 1AKWA 1XAJA 4URUR 2FEAA 5C8ZA 5GZ1A 3OIVA 1R4MA 1XJ5A 1RIFA 3QVJA 2ZBFA 1Y3CE 2FYTA 3A1SA 3W3AA 2UU9B 3TIXB 4ZV4A 2BEWB 2ZWAA 1YRLA 1RM3A 5BN5A 3TRFA 1SXGA 2VQEB 4ESHA 1KK2A 1OVMA 1PX0A 1LWNA 1RBYA 2M2IA 2VA9A 3QVWA 4XSGA 2GCPA 2H63A 1ZRNA 2JRCA 2NVWA 3COZA 3NBMA 4BYMA 4QOSA 4MGKR 4ZQBA 1RJWA 2Z30A 3TQOA 1R6UA 1A95A 1XMIA 3A1VA 1ZR4A 4L2IA 5ILOA 5L6LB 1PTJA 1LNZA 1MN6A 3Q12A 3RIEA 5JCJD 1JHZA 1W48A 1Z9BA 2BM0A 2PT6A 4OU4A 4TUYF 2FEWB 3FMOB 2QWXA 4GXNA 3AIOA 3JD2A 3RVDA 1M7BA 1Z2OX 5ELXA 4C07A 4HS4A 2I0FA 1KMHA 4F5ZA 5E9QA 3W34A 1Y7PA 4KWHA 3DKPA 4BJ1A 1GU0A 1QF9A 2GM4A 5ILGA 1HY3A 4E2ZA 2YCBA 1T5OA 4FYKA 3D3WA 4XLZA 5IT5A 1FU4A 4ZOLA 3RUAA 3WGLA 5BSTA 4B43A 2VJKA 2R25B 3RFCA 5DTEA 3G2KA 2EGGA 2YYZA 2RC5A 3BJZA 5ECYA 4BZPA 3SEAA 4TKZA 2WZDA 1AQYA 2ZIAA 1ZCFA 1PQPA 2FCAA 4LVCA 4DG8A 3QEJA 4X3OA 2PMWB 1E1RA 3P0EA 4KITB 1SKBA 1IC6A 1XG5A 2WJVA 1AKEA 4IO0A 5B37A 5G4KA 1PUIA 3SLGA 5K8LA 1PBTA 1N8SA 4QTXA 1E9CA 3ABZA 1EIZA 1RM4A 3DWIA 3M6FA 3RHSA 2AMLA 4AICA 2PAFA 3S29A 4JBHA 3HYNA 3IQDB 3N2ZB 4D9EA 4CETA 2EW8A 4ZEVA 3VNAA 3WGHA 2BMAA 3O2SB 1U63A 2J5BA 1QGDA 4P4TA 1J1IA 2IXFA 4YLYA 2YWXA 6PFKA 2PRKA 2VNHA 4MJLA 1KETA 2PSJA 1TM3E 2XNDD 1GUAA 2NGRA 3HYLA 4CRWB 2W2KA 5DNEA 4HQKA 5AOCA 1Z0UA 4X20A 4BN4A 1E9DA 1CC1S 3KR2A 4RA6B 1NMYA 3F7MA 3OJEA 3W79A 2FZKA 3JRNA 2FE1A 3VOBA 2A35A 5I48A 5BSRA 4DCMA 1JU3A 5BUCA 3KJFA 5I3CA 3OPVA 4IEEA 3OX1A 3GYBA 2CV1A 2FHPA 1OCEA 1QP7A 3F9IA 1OTYA 2FSIA 5J5CA 5G0TA 1XCMA 4P7FA 3EVCA 2HEIA 3QX3A 1HE1C 2VPXA 4LZPA 4H7IA 4YO8A 4BO8A 4KWIA 1VJGA 4YFVA 1I3OA 3RBXA 1YVUA 3ROQA 4BO7A 2FZLA 5GZ3A 3ZXYA 3TBKA 1W36C 3MUNA 1LVGA 5KKNB 3ZI0A 3R5FA 1LD3A 1GNVA 4LXGA 2HLNA 1FDVA 4NWIA 3RANA 4ON9A 1T6YA 3QKRB 5GQSA 4BFTA 3IHLA 4EW3A 1XDUA 2NZ2A 2HO4A 4RD0A 5AESA 2UZAA 2ET6A 4TN1A 1OXXK 1KMMA 1V11B 4Y9UA 4R9VA 3IEUA 3ROZA 1ZN2A 2ZJ6A 3F7NA 4NYJR 1J4AA 4XYLA 1QTQA 4JLUA 3CUVA 3A36A 3AXSA 3FNIA 5EJFA 3CZ4A 1N3YA 2OM6A 3E18A 4UHDA 1EE1A 1VPEA 3SC6A 4ENRA 2Z3VA 1ILEA 1AX9A 2G4CA 4YV2A 4ZT5A 1CP2A 1G6HA 1NAHA 3DBLB 3GP5A 3IVCA 1W0CA 1A96A 4CJXA 2C00A 4OHYA 1SCDA 1WDLA 5AIAA 4FU0A 4MEAA 1KR2A 4AS3A 4Y6RA 2FPWA 2ZPUA 4D3ZA 1IZ7A 2IYSA 2OUIA 2XYQA 4YXWA 3UHPA 4GVLA 1FDRA 3PGMA 1T9CA 3ND7A 4EB0A 4EYSA 2P0AA 2FX5A 1CR2A 2BFFA 3NJ8A 3PR1A 4OK5A 2X4LA 4NEQA 4EUKA 5F12A 3WFZA 1UWLA 3C8UA 3HGQA 2BP7B 5CH3A 3V32A 3C5HA 4HPWA 4U2FA 4JUIA 5FTMA 5LA6B 1PWEA 2GEDA 3V8VA 1LWOA 2C9OA 4CMBA 4PG8A 4DSAA 3QKSA 2B2XA 4K3VA 3HKBA 4I55F 5B57C 3GRUA 2BJHA 1C1DA 4JJ7A 4U7WA 3WGOA 721PA 1CZNA 3PDWA 2UYHA 4G89A 2JI6A 3BM5A 2P6MA 3KHUA 4Y2HA 4M9ZA 4G2NA 5H1YA 3SYTA 4HGQA 3WJ2A 4BC1A 2DWPA 2NG1A 4C14A 1RZVA 1WLYA 4G0ZA 1A7AA 1PYGA 3PJRA 3QSGA 4CMEC 3U44A 1MC4A 4L9AA 4LHEA 3N2LA 1UQTA 1E6KA 3FCEA 4PZDA 1DXYA 3CH5A 1Z2PX 2D1SA 1ORWA 1TOAA 2VSOA 3U40A 1UDCA 4YJ3F 3ONEA 1ST3A 3HYSA 6REQA 1KJWA 5FL7D 2DFTA 3E27A 2FW0A 1UZLA 4MW9A 2O57A 5DZSA 3AI2A 2Y67A 2NUAA 2O8EA 1KU0A 5E7MA 4ARZB 1FDUA 1IHOA 3MTBA 4YJGA 5HQ3B 1AG9A 2EATA 2YWGA 2WG2A 1EK2A 1UDAA 5FUWA 1BSVA 3ZGNA 4GKJB 3KETA 4JVSB 4PAGA 5D6OA 1ONBA 1O5IA 3AEZA 4QSHA 4M0PA 5F33A 4KN5A 3AM3A 2NN3C 4DLYA 4X66B 1L7DA 3DE5X 2XTNA 3K5PA 4G0XA 1E2PA 1ECJA 1TIPA 4I08A 1V9SA 2WD7B 4KIUA 3LNCA 2QSZA 3CR7A 3P26A 2O3JA 2XA2A 2QRQA 2V7QD 4J16A 1VFNA 1NE2A 3G79A 4IQ0A 5BN4B 1MRSA 4UBIA 1I94B 1TLLA 3JSXA 3OUTA 3V33A 3KDPA 2XNSA 3Q88A 4C5CA 2ZBEA 2VG8A 1E7QA 4FUQA 5EKSA 5HGJA 3GEMA 5E38A 1KQNA 2FFAA 2HFKA 3LPCA 4ZV9A 1IULA 4F93B 5HK9A 1QH1B 3GX1A 2PSHA 4RYLA 2X0FA 4XDHA 2FW8A 1P60A 3QPCA 4O1IA 1SOAA 2HJ9A 5JQGA 4GI2A 3L1KA 4P7GA 5ISMA 4GX5A 2NSHA 3CEAA 4JJEA 2B20A 3T4EA 2DCUA 3UOWA 2R1TA 1RKVA 4HDMB 5AXCA 4L7VA 5KNBD 4KPYA 2ZDQA 5D3MA 1KI6A 2CJFA 3IJEB 1BFUA 2VP0A 1Q83A 2VQDA 1F7VA 1U2EA 1N5OX 3BIWA 3N53A 5CCBA 2FXVA 3AKDA 3TG8A 1A50B 4LOKA 5BT8A 5JC1A 1R5BA 1TUIA 1FFCA 1MGPA 1NT4A 2L69A 1W76A 2VDNB 1YDFA 3FG9A 3NFRA 2XWJI 4J4HA 4UVGA 5DO9A 3R8CA 4V3CA 3OJXA 2A94A 4RLHA 1A72A 3ZCPA 4K6MA 2WK1A 2Q0HA 4IIJF 3VO8A 1QOZA 2W48A 1WCYA 3K94A 3RYHA 3AHDA 1JG7A 4CT5A 5JY1A 4KPUB 5BN3A 2Z6AA 3R5JA 1G19A 1H1DA 1LK0A 3OLVA 4P1ZA 3BQ9A 4GZ3A 1VJ1A 3DFIA 1CJVC 4IIGA 1A5ZA 4H16A 2WD8A 3OU7A 5DBEX 3WVNA 1UK8A 3K7EA 3T1OA 3DD1A 2WAYA 3TLJA 4QAJA 4OQXA 4RGQA 1X92A 3O3CA 2C2KA 3W8RA 1DJQA 3W9BA 1XDZA 3LQKA 3LLVA 1UBNA 2J59A 2P3OA 3BWCA 3I1JA 4BS9A 1ZIOA 5DYTA 3B6JA 3S2EA 4YMUA 3T7KA 5IVDA 3IT0A 3WE7A 1CUGA 3HKEB 4B6PA 1E2LA 1QYVA 2BIFA 4LBVA 3LW8A 3E3LA 4EM6A 1QH8B 5EJGA 5CURA 1CE8A 3PHBE 1NVWQ 4PG5A 4Y2JA 3KTAA 2W6MA 5EWLA 3R9KA 4AUMA 2ZWMA 1T0JB 3CVYA 3D7MA 1QQ7A 1PG2A 4WZZA 3TZLA 3IILA 4BNNA 4WBNB 3GJ7A 4LN1A 2HWXA 3ZC3A 1WSWA 4GKBA 5H59A 4ZDKA 1CUUA 1WDTA 2J6CA 1E6UA 4K9NA 4AQYB 2ATEA 2OSVA 4J0EA 1R4MB 1TM5E 1ANKA 3MJ4A 4XVUA 4HNRA 4DXHA 3VC3A 2IYNA 4MYUA 1YZHA 1XZEA 4D9BA 1N0UA 1I0ZA 3WLFA 4PG7A 2LP4Y 1VXRA 2OESA 1MTOA 1H8EA 3Q1KA 4JP1A 2VJNA 5IKEA 4YV0A 5C1DA 4BLOA 4Z0NA 1ZEMA 4US1R 2LDXA 3VTKA 2XT0A 1SKMA 4O4IA 1LB1B 4NJMA 2O7QA 5B2ZA 2C5LA 4A6PA 4C0XA 3B1WA 2C1XA 2CLHB 1CD5A 2SCUB 2CXSA 3HUUA 3O9VA 4DT1B 1N8NA 1M1YE 1ZXBA 1IEQA 5LDHA 3QX7A 4IWNA 1DI0A 4JI6B 1JH8A 4R81A 5C8DA 1KQOA 2V45A 1II8B 3AUKA 4LFCB 2R6ZA 3PIRA 4RLQA 4H1TA 1SCBA 1X3LA 2YYAA 3IBCA 4ADSG 1CZKA 1SBZA 5A0VA 1PBNA 5FPYA 1R4AA 3WKEA 4E70A 2QRMA 2YICA 4IKEA 4P22A 2C31A 2QE6A 2ZE7A 3AV3A 3KJZA 5TX7A 3UY4A 2J30A 2X4IA 2YR0A 3I5AA 4LRQA 3TAXA 1K86A 4CCYB 4ZJUA 2I7TA 1EGQA 1PT5A 5K3SA 4F4FA 4IINA 3HJFA 5DGTA 2PIAA 1V96A 5CG1A 5I7HA 1HORA 1U7PA 4BX0A 3KEMA 3BUSA 2NXJA 2QMHA 2XB9A 2NADA 2OOSA 4ER0A 1WKBA 2APJA 2GSWA 4R1LA 1D04A 3GVIA 3IULA 3LRPA 3VX3A 4DGSA 5AW4A 4NXMB 3D0QA 1EP1B 3LXXA 3GEGA 4LECA 4W8HA 5L40A 1O4WA 2F90A 1AZWA 2FG6C 4WLFA 3EVAA 2VXCA 4MWBA 3R7BA 4JT2A 2CFIA 2ZRGA 1QHXA 3LL7A 4H18A 1QQ6A 1J5XA 3KYIB 1GZ6A 3ZCUA 4FN4A 4DV4B 4YA6A 3F6EX 3N2NA 3QY9A 3JD4A 4I4LA 1PK7A 1PQYA 4OXYA 5DRYA 5JMTA 3TFWA 1YJBA 2RGWA 4KLAA 2OM2A 1QP4A 2MSEB 2VQSA 1GFSA 1ECFA 3LUFA 4L8YA 1QVZA 1CUDA 3UYLA 1AKMA 1V3QE 4E4RA 1JLSA 4CQMD 4HGZA 2W70A 1XL0A 3TVDA 5KQMA 1Q14A 3C3XA 4RVNA 2JPDA 5AKHA 3DEIA 1U65A 1OPXA 4NIMA 8GPBA 1ZK2A 1XK7A 1Y1TA 2PH5A 8LDHA 4MV5A 3UFBA 4RULA 2OP0A 2XOKD 2ZJYA 4UQOA 4MI9A 3BMNA 3DD5A 1BHO1 5HW0A 2Z4SA 1JXMA 3FGOA 3I5YA 1HA3A 3L7IA 2IEIA 3E7DA 2BKEA 3H5WA 4RSRA 4YAEA 3WYNA 5LMZA 2GN0A 1XTUA 4CEHB 4GM1A 3L5KA 1H3EA 1JR3A 3CLUD 1AKUA 2Z58A 3DW1X 1U11A 3OIUA 1NBAA 1EUQA 1N9ZA 3UJ7A 3MW8A 4WIAA 4R6XA 4LXQA 3JQ6A 1RQNA 3OCVA 5CK5A 1ZICA 2K6GA 2XD9A 1J33A 2GBLC 3U5TA 5J2TA 2RGYA 4S1PA 2WFLB 4EAQA 5LOVA 4N6NA 2W22A 4D56A 5FWXA 6Q21A 3GVCA 4R1SA 1T4CA 3VR5D 1DINA 3DG9A 3LCVB 2P3QA 2ZANA 1ECCA 1NV8A 1O3YA 4MS3B 5B53A 2ES4A 4EX6A 3FAZA 2FSGA 3G59A 3GLIE 1ZQ1A 2XEDA 3HCFA 1FYXA 1PUJA 3CF6R 4UDOA 3AB3A 3HRKA 3QKTA 4C4TA 4ENQA 3GUHA 4UU8A 4Z99A 3S68A 1OLSB 1DQZA 2N46A 3BBPA 3KPVA 4LYFA 1GGMA 2RH8A 1D8TA 1EM8A 2A9PA 2YFQA 2V7WA 3KWLA 4OQNA 1U7HA 3UAVA 3B9BA 1KZ7B 4L6AA 4LAFA 3P52A 1WXQA 4IRMA 4FFVA 4HDQB 1Y5NA 5CLHA 3AG5A 1KAHA 3INGA 3D4LA 5GOZA 1P0FA 1E2MA 1L5HB 1WDKA 4N7RA 1Y3DE 1G55A 2D13A 1WXDA 2PLRA 3QXGA 2H2DA 3IH5A 1LGYA 3TKYA 2X0JA 1L5ZA 4BNXA 1QK5A 3DMNA 4DEXA 2RAUA 3JAKA 3L7MA 4MWTA 5REQA 3KZMA 4E5SA 4PPFA 2JJ1D 1NLFA 1ZX1A 3G6WA 5K0FA 3ZD8A 2BFFB 1FYWA 3FPFA 3JR3A 5CW1A 2A5YB 3W7VA 5ITZB 1SXJC 2BMFA 4PFJA 4YMTA 1XP8A 1JWBB 2QGFA 4HLUC 3KAKA 1RZRA 1EJ2A 2YMQA 4I5EA 3V80A 4CUJA 2FZWA 1EX6A 3A1NA 2XZPA 4QBTA 2B1IA 5E7IA 3V1MA 3PX7A 5E9AA 4XIFA 2GASA 5K8TA 4TLLB 4JL5A 4ZT6A 4YPOA 2HA6A 3V1YA 1T3GA 1MJNA 3UGKA 1KDPA 4IIYA 4Y67A 3SZUA 4AJNA 2H5IA 3AVQA 4F8EA 4QKQA 2GYUA 5HIAA 4K87A 1QHHA 2PD6A 4MAAA 5CJJA 4C76A 1IY8A 2CCJA 3EXAA 2PKEA 3H2KA 1BDHA 4W99A 2BBOA 2FOIA 4R1TA 3AETA 3A1DA 3WK8A 4JC8A 4MPDA 5HGXA 3I28A 3LLUA 1U3VA 5AW9A 3SEZA 3ICPA 4NDZA 1BTOA 3LUPA 4IEFB 4DR3B 3P4YA 3GVXA 1XZNA 2EX1A 1C9NA 2XCOA 1KKLA 2V0NA 3NDPA 1AK1A 3AHIA 4YJ2F 3P94A 3DP9A 2P5YA 4EA6A 4DUPA 1GA6A 4Q34A 1U3FA 1R0RE 4HZUA 4NG4A 2HREA 5H82A 3C6MA 3CLTD 4W4TA 3RS3A 1FXUA 3K15A 3DCJA 4ZT4A 3SXUA 3W4JA 3ACDA 5JS7A 3DAHA 3FZGA 1KBZA 1OSNA 3GFOA 4TVBA 1KSGA 4J1TC 1B16A 1EFVA 1CDDA 5DN9A 2PX3A 2WPNA 1OFUA 3T7CA 3TWOA 4EBFA 2QGZA 1G4AE 5KYWA 4HXYA 2TMDA 3B3JA 2XR1A 4QDJA 1T36B 1TU3A 5LP6C 3K0KA 4LF8B 3GJTA 1YL7A 3R7LA 1J1UA 4YCCA 2J5QA 1KO8A 3ADOA 4GGMX 1XAHA 1L4GA 3K2BA 2ZREA 1S3SA 2ERCA 1HDZA 1XFAA 2PN1A 3R7FA 1WP4A 4JODA 4BQSA 1K98A 1JYFA 1Z7EA 4P3YA 3QH4A 2WVAA 3OO1A 4ICIA 2CLLB 1B00A 3A1UA 3WO1A 4PLZA 4MUJA 2R1VB 1V43A 4UUOA 2D54A 3K1JA 4Q4JA 4QYIA 3JQAB 2YV5A 1QF6A 1EP2B 5MFZA 4BXOB 3L0DA 1D3AA 3FUXA 1IM5A 2E87A 3C87A 4BFZA 4EPRA 3SBXA 2WYOA 3S2UA 3S4YA 3ZHYA 4F6LA 1HWYA 3EIUA 3ZWAA 4Z0HO 5JXWA 4CM8B 1FC0A 2IP4A 1IN5A 1BCSA 4CMEA 5BV2P 3NHRA 3C6BA 2PKWA 4FR0A 5DHSA 3VR4D 1CDZA 2PUAA 5F9MA 1AKVA 3VHQA 1UMCB 3ACBA 3FCSB 5JCOC 1HRDA 1H2HA 3CWCA 5CM2Z 4OMCA 3ZDDA 3GAAA 1BVHA 3DM9B 1M6HA 3SAJA 4RTPA 4FCWA 3KPYA 3ODPA 1KO7A 3VVLA 2ZWVA 3O8BA 5G02A 2VQ3A 2I7DA 2Z8YM 4DMHA 4MRNA 1VLLA 5B64A 3AR6A 3I42A 4O2LA 5ARCA 1YZ3A 2XMCA 1AMNA 4XKJA 4BDSA 4Z7OB 1L7BA 4AWXA 1SEPA 4PYLA 3PFWO 4G8JA 2CVZA 1KGDA 2QR3A 4FQ5A 4GOXA 1ABBA 1OXSC 2C4VA 4Z9XA 4FD3A 4G1VA 4G56A 1ES9A 3A9CA 4TQ9A 2K2WA 1VLZA 3URKA 3S8EA 4LBZA 1V2HE 3SHQA 5AVTA 1DFHA