1F0PA

Mycobacterium tuberculosis antigen 85b with trehalose
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
284
structure length
284
Chain Sequence
b'SRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIGEN 85-B
publication title An interfacial mechanism and a class of inhibitors inferred from two crystal structures of the Mycobacterium tuberculosis 30 kDa major secretory protein (Antigen 85B), a mycolyl transferase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 105
structure length 284
sequence length 284
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2000-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1f0pA00
1WB6A 4W1PA 3WK9A 4G8CA 5FRDA 4B0OA 3FWHA 2WIFA 3R3XA 3O95A 1UXOA 5ALEA 4MEBA 2OG1A 5CTAA 1IZ7A 2DHEA 2QRUA 4QWMA 2JGLA 4MQLA 3QITA 1CQWA 4GLBA 4S0XA 4ZREA 3TRDA 3QPCA 2I78A 1JI3A 4FLFA 4H35A 1T4MA 5JAOA 4CI9A 1S8OA 1MX5A 1UOPA 3GA7A 4HXFB 4BZWA 1UK9A 4B0PA 2HFKA 4X91A 1JJBA 1C7JA 5KWIA 4KE7A 5JALA 5T4BA 1ZGBA 2I3DA 1NU6A 3R3VA 4K6HA 2JGFA 5EI5A 4J0KA 1ZI8A 1XRMA 3FLBA 5FKJA 2AJCA 2Y1KA 3DYIA 1LZLA 1XZKA 2I03A 2ORYA 2DR0A 4KJXA 2JGEA 4H18A 3A2MA 5CH3A 1GPLA 3H2GA 2PKYX 3WYNA 2CBGA 4J0JA 2ONCA 5H3HA 1OXMA 2BGRA 5AP9A 2DSNA 3D2BA 2XMRA 2CB9A 1Q84A 2AJLI 2VTVA 4U2DA 4L0CA 4X71A 2XDWA 1SC9A 2HRQA 2JGMA 4B83A 3FAKA 3BJMA 4ZI5A 3R3YA 2WHPA 2WG2A 3FYUA 4UBKA 4UBIA 3M82A 5D3KA 2GBFA 2XLCA 2WUFA 4GDMA 1QIMA 5ALYA 4CG3A 1YS2X 2BJHA 3I1IA 3C6YA 1CUZA 3V9AA 4WY5A 2V97A 3G9UA 3H04A 4BYMA 1SCQA 4GI1A 4QWWA 2HM7A 4CCWA 1NU8A 3X3HA 4F60A 2ZVDA 1R50A 2Y2VA 3C6XA 3FCXA 1VLQA 3G9TA 5AKIA 3F9CA 5AM4A 5K3DA 3BF7A 4X92A 1SFRA 2CKMA 1Q83A 3IUJA 1EINA 1K4YA 1W75A 4AQDA 5HK9A 4LKOA 2HL6A 1XZMA 1MAHA 2XUJA 6YASA 4YX9A 5EHQA 4LYDA 2H7CA 4CCYA 1B41A 4BVLA 1H22A 3H1BA 3SWWA 1XQXA 3DQZA 1W52X 3GFFA 1CQZA 2X5XA 2V96A 1LPOA 5BV7A 2D5LA 3V48A 2DHDA 2WJ6A 5K3FB 2WILA 4J3JA 3WWDA 1CUHA 1Q0RA 4J03A 4UHCA 4B85A 1QIIA 4BB0A 1CRLA 3STXA 2QMQA 4EA6A 4TPKA 4JYPA 4QZVA 4Q3OA 2J4CA 4PSCA 3AFIA 2WHRA 5ALMA 2XT0A 3VXKA 3STWA 4G1FA 4AN0A 2J4FA 3QH4A 3QMMA 3FOBA 5DTIA 1K8QA 4C6HA 3EBLA 3WJ1A 5AICA 5JD5A 1VA4A 1XZJA 3ICWA 4DSZA 3O4GA 5HF5A 4X7BA 5JD4A 1E3QA 4DMFA 1VOTA 5K5EA 4WJLA 1TKRA 1QONA 1W1IA 4C88A 1LPAB 5FUMA 4G4IA 1BCSA 5DYYA 1DU4A 4IO0A 4N8DA 3WZMA 3EF3A 1J1IA 1UWCA 4ZWNA 5IVDA 3W05A 4BRZA 3C5VA 4KACA 1USWA 5HCUA 3KXPA 1CPYA 5DNUA 3CN7A 2DCMA 4P08A 4LXIA 4AO7A 3G9XA 3C45A 5D6OA 1F0PA 5AK6A 5AKGA 4PV7A 4H7JA 2Z8XA 5EIAA 4EY5A 3F96A 4Y2XA 3IB3A 3BL8A 1EH5A 3FVRA 4HXEB 3I1YA 5AKHA 1M33A 4UBMA 4AMYA 1L7AA 4PSUA 4XWGA 2HFJA 3HZOA 4MJ3A 2DHCA 3WKBA 1XLWA 4PF1A 3PFBA 1QIEA 1MAAA 3D2CA 2Z3ZA 2XMDA 1TCAA 4WY8A 4BDSA 5KREA 4I3FA 4UHEA 3WL5A 1BN6A 1GQSA 4AXBA 1OILA 3IIIA 3PICA 1XRQA 2OCLA 2VSQA 3PUIA 4EHBA 1VKHA 3I2HA 3I2GA 1CLEA 5BWCA 4BVKA 2G5PA 4FWBA 4U2FA 1EVQA 4Y2PA 4GXNA 3QVMA 3W2TA 3D5EA 3QMVA 4ZV7A 1XZLA 1ZIXA 3WZLA 5A62A 1E89A 3ILSA 3KOOA 4QDOA 4JUIA 5AKYA 1R9NA 3YASA 1EHYA 3EQ8A 3B3QA 5ALOA 3CN9A 3QZUA 3FSGD 1B6GA 3WA6A 1LPMA 1HQDA 2GZRA 2JBWA 3WK7A 1QGED 2RHTA 3I6YA 4NMWA 4DNPA 3IVMA 1EX9A 5E4TA 2VEOA 3Q0TA 4KR0A 1F6WA 4U2EA 3R41A 2OGTA 4EY4A 4N5HX 1FFEA 5C8VA 2C5FA 5JANA 2VT6A 2VJBA 1BN7A 2WIKA 3AZOA 1LBTA 2IITA 3A2LA 1GKKA 5AI9A 1UOQA 3AIOA 1LPNA 2OPHA 5IVIA 3HEAA 3R40A 4E14A 2ZJ6A 3STUA 5AIAA 4H7EA 5T4EA 1VA5A 1OCEA 2O7VA 4OSEA 2VF2A 1R9MA 1QZ3A 3G8YA 1XQYA 3LIPA 2BAGA 2HHAA 5AI0A 2QT9A 3DNMA 4IH4A 4X93A 5HF9A 4A23A 5AKLA 2HA4A 4HAIA 3I6ZA 1XFDA 4B9AA 1UKBA 5FOQA 2WJ3A 3U1TA 2WG0A 2Y2UA 3WWOA 2WFZA 2QXTA 3L1JA 2K2QB 3VJMA 4JEIA 2Y6UA 3AZQA 1WPRA 5ALDA 1WCYA 5IVKA 1FJ2A 1YASA 3O4JA 1XZIA 3OG9A 1AX9A 4FKBA 2RI6A 2ZSIA 3G0IA 1XZGA 1MN6A 2WHPB 5AOBA 3FYUB 3BXPA 3ZV7A 1QTRA 1JU4A 1ZJ4A 1QIDA 1LGYA 5DTJA 1AUOA 3KD2A 5ALKA 3TEJA 1W6RA 4ROTA 1XQWA 4XX1A 2WU4A 4FBLA 2WTMA 3AZPA 4V2IA 3G02A 1WPXA 3WWEA 1DX4A 3ZI7A 4MWSA 4EBBA 1CEXA 4KE8A 4DIUA 5A6VA 5LKRA 1FFAA 4J7AA 3C87A 2G4LA 4OCZA 1XZHA 1XZDA 3MUNA 3O4HA 4UFOA 1ISPA 3ESBA 3CCCA 4XIIA 4ZXFA 5AKZA 5LP1A 2ZYHA 1EK2A 2HU8A 1G5FA 4Q34A 5K3BA 1BU8A 1P0QA 4MWTA 5F4ZA 1HPLA 1DWQA 2XUAA 5A7HA 1H23A 1GGVA 2IIVA 1XZFA 5CH5A 3T4UA 1CUJA 2WU3A 3QBJA 4OYLA 5AM3A 4Y2JA 4Y2SA 4KRXA 3VJKA 2HA3A 3IUNA 1CUVA 5HQ3A 1HBJA 3DEAA 2GBCA 1DWOA 2BFNA 1ODSA 1BCRA 2PM8A 4CCYB 3GELA 2X76A 2XMSA 5CT8A 4OPMA 3FSGA 2HA5A 4MYSA 2ZSHA 4I4CA 1EA5A 1N5MA 2GBIA 5JATA 2XMBA 3WA7A 1KU6A 4D9JA 2XUOA 4Y2VA 1BEZA 5C7YA 2XUDA 4INZA 1F8UA 5AI6A 3K2IA 4UHDA 1R88A 2RHWA 5A7GA 1DT5A 2XQJA 3A6ZA 1ZD4A 3D59A 1EVEA 4UFNA 3EQ9A 1JMKC 1IVYA 3FBWA 1XKLA 1ZGCA 4G8DA 2WFLA 3DKRA 3H19A 2C58A 2OGSA 4G4JA 4FDMA 2J3QA 4BVJA 4BP9A 3JYHA 2WUDA 1IZ8A 3E3AA 5HKBA 5E4JA 3RARA 2WG1A 5CW2A 2PSFA 1MX9A 2WFMA 3UUFA 4QA9A 2WM2A 3FVTA 1K5PA 5JD6A 1I6WA 5AHXA 1FFCA 3BDIA 1QIJA 5CT5A 2WQZA 1Y37A 3STVA 4B81A 4BAGA 1ZJ5A 4EB0A 1HKHA 5AI5A 1G42A 1SOMA 1ZD3A 2JGKA 1JFRA 4FFWA 3LIIA 1J07A 4X6YA 4RE5A 3STTA 4KAJA 3ZWQA 1FSSA 2ZYSA 3S2ZA 5KWJA 5FXMA 1XLVA 4U2BA 1X70A 2X8BA 3LCRA 2XUQA 2XB6A 1TCBA 3M81A 5ALNA 3L1IA 3S8YA 4LHEA 1NX9A 1YCDA 4ZV9A 4BCBA 3Q8WA 3C43A 3R0VA 4IHAA 1MNAA 5HK8A 3M3DA 2OCIA 2JF0A 1O6FA 5LZ8A 4X95A 5C8ZA 2BCEA 3OPMA 3IA2A 4UBNA 3FLEA 4FTWA 4WCVA 3O0DA 3CXUA 4I19A 4DNFA 3A70A 2VA9A 3G0BA 1XRLA 2D0DA 1QO7A 4O08A 4ETWA 2W6CX 5AM2A 2QJWA 1RP1A 1ZICA 2G5TA 4Y7DA 2OQVA 2PSEA 2AJBA 3PI6A 3D7RA 2VATA 5HF8A 1EDDA 2DQZA 2JGJA 3CCBA 4PQEA 5AM1A 3H1AA 4DGQA 1DX6A 2QOEA 5AOCA 4FBMA 3PE6A 1ODCA 1DQYA 1ZOIA 1U4NA 1BEEA 3I6MA 3I2JA 5LZ9A 5AK3A 4C89A 2OXEA 1A7UA 2P8SA 3ED1A 1AKNA 5C81A 4F0JA 2ES4A 4MYDA 5HKAA 1QOZA 2QKYA 3IUMA 2DQYA 5AM5A 3BIWA 1AURA 3C5WP 4J0GA 1TQHA 2HA2A 1QIGA 2HA6A 3VVLA 1SCIA 3VISA 4NVRA 4Y2RA 2H7YA 1GPNA 3DDUA 1DTEA 2HA7A 3OTQA 1D07A 3BF8A 3OM8A 1WOMA 3K9BA 4OB8A 1ODTC 1XZCA 1EDEA 3ZLUA 2Q0XA 1ZI9A 3LP5A 4B84A 2R8BA 3WK5A 4TGLA 2PU7A 4RGYA 3R3UA 1AZWA 3HSSA 4ZRDA 2W22A 4ARAA 1AGYA 4RE6A 5EIHA 3AJAA 5HFAA 3GBSA 1QE3A 1XZEA 5DNWA 5A2GA 5DLPA 3IURA 4HRYA 5FLKA 3KSRA 3V1LA 1KEZA 3G0DA 2AJDA 2XQIA 3SK0A 3DOHA 3KWJA 2XUFA 5AIBA 3WI7A 1FFDA 3DJYA 5LLSA 4QLAA 3F67A 4P93A 1MTZA 1XRRA 5ALIA 3H2IA 3E1GA 3WKAA 4DMHA 3MUOA 4E46A 5JARA 4CG2A 3T52A 2XUPA 5DYWA 4J0HA 4BDTA 1ETHA 4C4ZA 2YYSA 4AX4A 1ZI6A 1P0PA 4KEAA 4DTCA 3TGLA 1TRHA 3G9ZA 4X00A 3N0TA 5DWDA 1QIFA 1X2BA 3H0CA 3DLTA 3F97A 4MEAA 3PF8A 3W9UA 4M0MA 2NW6A 4BCCA 3RLIA 4N5IX 2HADA 3E0XA 1MT3A 5A7FA 1MPXA 5D7BA 3QPDA 3HLKA 4MQMA 4DYHA 4E15A 5ISMA 3OOSA 2BKLA 5JAUA 2HDWA 1F0NA 2EDAA 2JEZA 4UFPA 4FMPA 1THGA 2ROQA 3TJMA 1WB4A 5CT4A 2WKWA 1A8QA 4F21A 1JJFA 4G9EA 5LZ4A 1E8DA 2Z3WA 4EY8A 1XLUA 5AO9A 4PO3X 2VAVA 4BZZA 1DQZA 1HLGA 4UHBA 3WKEA 1VE6A 3D0KA 3WIOA 4RPCA 5CXUA 4QDZA 5KBYA 4FHZA 4IQ4A 4Y2QA 1QLWA 3R3ZA 3C6BA 2C0QA 2BUAA 2VJAA 4GWLA 5ALUA 2XUHA 1DINA 4GEGA 1L7QA 4BATA 2HA0A 4FNMA 4X6UA 4W63A 3B12A 1L7RA 1X2EA 5EHXA 3WK4A 3M83A 3I2KA 1P0MA 4X85A 2RGUA 3ESAA 1E8NA 3I2FA 3U0VA 3BWXA 5C8XA 1WHSA 1GT6A 2WIDA 1UK6A 4QDXA 4ITVA 3FNBA 5ALPA 2VJCA 5AKKA 3G0CA 5AK4A 2WFLB 5ALHA 4Y2YA 3C70A 1CUXA 4W1QA 4J0IA 1AC5A 4K5QA 1QO9A 2QJRA 2FX5A 5E4YA 3H17A 5LYYA 3QM1A 1CUEA 1PJAA 2XQFA 4OB6A 4A5SA 1UT6A 2AXEA 3JW8A 1UKCA 5EGNA 2OQIA 3ANTA 3HABA 1LPPA 3G7NA 3H2JA 3STYA 4NS4A 2J3DA 1H2XA 2CJPA 3AILA 2HIHA 1YS1X 2VT7A 4LIPD 2OAGA 5LZ7A 5ALWA 3FYUC 3BJRA 4JYMA 2GBGA 3B5EA 1YAHA 4UBJA 1DT3A 1THTA 1XQVA 3DD5A 1CUFA 4WFIA 3DKKA 4Y9SA 4H7KA 3MVEA 3GUUA 5CRIA 4F5ZA 4EY6A 2FJ0A 4YASA 3RM3A 1ORWA 4BC1A 3LLCA 4Q3KA 4DNQA 1YR2A 1GZ7A 5CH8A 3FLAA 5EFZA 2YASA 4UUQA 2UZ0A 3KDAA 2IX9A 1UKAA 3AIKA 3RKSA 5K3EA 4J0CA 4OD0A 5CURA 4JNCA 4BP8A 3LS2A 4QE3A 3L1HA 7YASA 3WMRA 4K2AA 4UHHA 4Q82A 4CIBA 1RYYA 2QS9A 2YXPX 4IH1A 3BIXA 1EI9A 2WLSA 2B4KA 4L72A 4P92A 3WLAA 4HRXA 2EEPA 4OYYA 2XUIA 1BE0A 3H2KA 1PV1A 3ICVA 4AO6A 3HYSA 3V1KA 4M0EA 5I8PA 1LPSA 3DYVA 2PU5A 5CMLA 4E11A 1MO2A 4N8SA 3C8HA 4K6GA 3VDXA 5I9IA 4P9NA 5DNVA 3HRHA 5EHZA 4G8BA 5ALRA 5J3JA 1G4HA 5A71A 4J0DA 4N8EA 1Y7HA 1R1DA 1BS9A 4BRSA 4C4YA 4B82A 4WDRA 2WTNA 3HXKA 1CUWA 4OUKX 5LIPA 4IH9A 5FPPA 3QPAA 3IULA 2C7BA 2PUHA 2O2IA 5ALXA 2WUEA 5EHNA 4JH0A 3IUQA 4LYEA 5YASA 1EDBA 1ZD2P 5SYNA 5DYTA 3HACA 3IBTA 4AZ3A 5AI8A 5JZSA 3WYDA 3WKCA 4CFSA 1DWPA 1KU0A 2Y6VA 1VZ3A 4AN1A 1N1MA 4DMKA 1N8SA 2OGZA 3WK6A 2CZQA 1J2EA 4ARBA 4RNCA 1QFSA 3OURA 1LLFA 5ALLA 1R4ZA 1VJ5A 1AMNA 1A88A 3A2NA 4WFJA 1CR6A 2XMZA 4G9GA 5JIBA 5ESRA 4W1RA 1CUUA 2RIPA 3HC7A 1UK8A 2XE4A 1GQRA 4GBGA 1EB9A 2JIDA 5FV4A 1R3DA 3HJUA 4X94A 5JAHA 2Z8ZA 3ZLTA 2VJDA 1JMYA 3DL4A 3UUEA 1XZAA 4DM7A 2PBLA 1IMJA 1FFBA 2E3JA 4LXHA 4QLOA 4QDTA 4QNNA 1K6EA 3ESDA 4Y2UA 4A16A 4NZZA 5EIEA 3GROA 2HU5A 4BAUA 1ORVA 2XQKA 1T2NA 2H7XA 5IH7A 4XVCA 1P0IA 3PF9A 1EXWA 3QMWA 5AM0A 2FJPA 4X3CA 5CT6A 4U2GA 3SC2A 3F8SA 4Y2TA 2XI4A 5T4HA 4FLEA 4H77A 1TAHA 1UOOA 1CUAA 2V9ZA 4X97A 4L9AA 4GECA 1GXSA 1LZKA 2B61A 3GZJA 3NGMA 5JZ9A 1O6GA 1K63A 2VAXA 2WJ4A 4X90A 2WSLA 2WIGA 5AK5A 1JJIA 1U2EA 4B6GA 4DLNA 5K3AA 4HS9A 1CUYA 3V1MA 5T4FA 1XKTA 1CUGA 4BC0A 4EUSA 1Z68A 2H9YA 1Q0ZA 4H7FA 4UBOA 4Z49A 1WHTA 2B20A 3WL7A 1J06A 1A8SA 1YA8A 4C4XA 1VE7A 2BGNA 1CUDA 4CG1A 1JT2A 2ZYIA 2ZJ7A 4BBZA 4UPDA 4PSDA 2G63A 4WFKA 2GYVA 4FNGA 5AH0A 3RK4A 5FDFA 1BRTA 3AUKA 3IDAA 3WWCA 3E4DA 5IVHA 4BE4A 1HDEA 2FUKA 4C87A 4LXGA 2AJ8A 1CFJA 2JEYA 1BROA 1E5TA 1W4LA 1W76A 1E66A 4DNOA 2CEKA 2O7RA 3OC0A 2PUJA 2PX6A 1LPBB 4XJVA 1WM1A 2LIPA 2Z5GA 4EY7A 5LKAA 2WHQA 4AB1A 1CVLA 2C4HA 4ZGBA 3DS8A 1VZ2A 3PUHA 5AKJA 3NWOA 5JAPA 4Q1VA 3EQ7A 5SYMA 3W9BA 2ZYRA 4OU5A 1WB5A 3DOIA 2ACEA 1QIHA 4GHWA 3AINA 2I3ZA 2B9VA 2BUCA 3PDCA 4C01A 3EIOA 4YPVA 2RONA 4FLMA 3H2HA 4Q3LA 1U65A 5E2IA 2ZJFA 4H7IA 3C8DA 1XRPA 4KE9A 4BCDA 2XLBA 4HVTA 1ZD5A 2YH2A 1G66A 3AIMA 1TK3A 3FYTA 4G4GA 4B7ZA 1VXOA 4FFVA 3WKDA 1YB6A 2XUGA 4DMCA 1CIJA 5ALTA 2PSDA 1YAJA 1MU0A 2XQGA 2XUKA 2PSJA 4CIAA 2WIJA 2PL5A 4QEKA 5ALJA 5FP0A 1QJ4A 4KAAA 5ALZA 2DFPA 3W04A 1XRNA 3NUZA 3BE8A 5K3FA 3PFCA 4WDQA 3G0GA 1Y7IA 3C6ZA 4M0FA 5LZ2A 5AKEA 2R11A 2XMCA 4H0CA 2QR5A 4K6KA 3DL7A 2PVSA 4H7HA 4UHFA 3NOXA 4BE9A 3R3WA 2GYWA 1UZAA 4PW0A 2GZSA 3WWPA 1H2YA 5AI4A 1JU3A 1QFMA 2HRRA 1JKMA 3D3NA 3ESCA 1GPKA 4G5XA 5AKXA 5FPQA 2HU7A 1CUBA 4HXGA 2V98A 3WJ2A 4X6XA 1VXRA 2QXUA 5JZBA 4GW3A 1A8UA 3WL8A 3WIBA 5JYCA 1H2WA 2GYUA 4W9RA 2PSHA 3V1NA 3QYJA 5ALFA 5HQ3B 3D2AA 5BOVA 5CT9A 5JASA 1QTIA 3N2ZB 1EB8A 5IKXA 1UK7A 2VQ6A 1C7IA 2BUBA 1CUCA 5HZGA 2QUBA 4KRYA 4W1SA 4BAZA 4B9EA 2XMQA 4UBLA 2QTBA 4EZIA 1N5RA 3ZLVA 4AO8A 1C4XA 5HF6A 2XMGA 1MJ5A 5D3ZA 5HFNA 5ALGA 5CXXA 1RWQA 4AZ0A 5LZ5A 1CUIA 5JADA 1AQLA 3I2IA 1E8MA 1LNSA 2OCGA 3ZPXA 1TCCA 3O9VA 4YK7A 1ACJA 3BDVA 2ACKA 4L3WA 3K6KA 2EDCA 2O2GA 4KE6A 1YSCA 2QZPA 3FCYA 4HTAA 3VVMA 1H2ZA 5ALSA 2RAUA 3F98A 1MNQA 1CUSA 4U2CA 3W06A 1ACLA 4DSAA 3D4LA 3UMJA 3O4IA 1PFQA 2OCKA 4BTVA 3HI4A 1XZBA 4OB7A 1UFOA 4QDUA 1IUOA 3H18A 3MGAA 2QM0A 2WUGA 3O9MA 4KAFA 1U8EA 5DJ5A 4PNZA 3WL6A 3I28A 3WK8A 1IUNA 1EK1A 4TVKA 3DCNA 1GKLA 1SCKA 1IUPA 3KWFA 4BTLA 1HL7A 5AOAA 5BWBA 2C5GA 2CMFA 1ZIYA 3ANSA 5ALVA 1CV2A 5I7UA 4AMZA 2C0PA 3WQHA 3VJLA 5AJHA 1YB7A 4HZGA 1YA4A 2JGIA 4MXDA 5CBKA 2PPLA 2QVBA 2H1IA 4FOLA 2OLEA 4Q05A 2ECFA 1MX1A 4H7DA 1QIKA 3VKFA 4KYVA 5ALQA 2O2HA 1LBSA 3P2MA 1TIBA 4OU4A 2CUTA 2OAEA 1XROA 4B80A 3SX4A 3JWEA 5K3CA 2QUAA
chains in the Genus database with same CATH superfamily
1TKAA 4W1PA 4G8CA 5DNDA 3CYFA 2KLHA 4CKCA 3A1WA 4RF5A 1L5HB 1WO8A 3TJZA 4PG8A 4JQYA 3R3XA 4NBUA 2H8GA 3A32A 4L02A 5EJAA 5GTDA 3DMHA 3OA2A 1SXQA 3KLBA 3TKLA 1VLMA 2ID7A 1HFJA 4Q03A 4RDXA 2XNHA 3HUFA 1OVMA 3N58A 4LPSA 1NP3A 2WMDA 3QU7A 3QW2A 2PH3A 4QHTA 4B7CA 4FYYA 1N5JA 2PX4A 1T5OA 4JJZA 2CVZA 4ZN6A 1CG6A 2OXFA 3AUYA 3F6RA 4NL4H 3CZAA 3RTCA 4I1UA 3RUPA 4HBZA 2X3UA 2VP3A 4KXWA 3EDCA 3QLTA 4S0XA 4GLBA 3RJMA 4D8VA 3MK31 2DLDA 3QPCA 2IYZA 4KQJA 3V8VA 4IJUA 1TTQB 3CGGA 4HY3A 1PJRA 2OVBA 5HIJA 4K9RA 4YIKA 3E2MA 2YOFA 3E8SA 1KH3A 1FX1A 5JEEA 3HKBA 2VXOA 1S8OA 1MX5A 3MZ0A 2RC6A 3Q3HA 1SA0B 1Z4IA 3EFOB 3EAFA 2I4MA 4QBTA 3LP6A 1NASA 2AA3A 2B3TA 2JNWA 5C1IA 1X7ZA 2HFKA 1TF5A 1WRBA 1Y3CE 3N2YA 1C7JA 4N7MA 4KE7A 3OJXA 1YFKA 3ZWXA 5HR5A 5KWIA 1ZJYA 3L0CA 2QR2A 2YFQA 5T4BA 3WDMA 2XEDA 1ZGBA 4LGCA 4YRIA 1N6HA 2LV8A 3JQAD 2I3DA 2W6IA 5LQMA 1PWEA 1WHTB 2GERA 3R3VA 5U4XA 2F9FA 3HBMA 4DWJA 4FDTA 2FPMA 3HU2A 4A6EA 4OBXA 4MLCA 3D0QA 1YR7A 3LNTA 2RIRA 1T2DA 2D4AA 4F46A 1XRMA 1UFVA 1U3GA 5BMVB 3FJYA 4ABYA 3HLYA 3QWIA 1F3OA 3FF4A 4N7BA 3KSMA 4MNTA 3DYIA 2DFDA 2I03A 3EGCA 3TRJA 4KJXA 4H18A 4NARA 1UANA 3UMRA 1YKFA 3QE3A 3ZW8A 1M6WA 4AIIA 5JZVA 5CH3A 1O94D 1W96A 1GPLA 5KQMA 3KBOA 4ZYXA 3DZIA 2WKQA 3COZA 2PGJA 1KQNA 5JNWA 1RT9A 4FS8A 4JUFA 4ZQCB 5FOSA 4YREA 4A2CA 1Z5UA 2YJ6A 3F3SA 1S5PA 4MS4A 2BGRA 5AP9A 1T13A 2VI5A 1JBEA 2O23A 1NVAA 4M8NE 4RA9B 4WUTA 2KS6A 4HUQB 4B5KA 3HCWA 3DB1A 2ZCVA 3IJ5A 1XQ9A 1QO0A 1GPWB 2WD7A 4MOWA 2OUKA 5IEJA 3PLAE 2X22A 4L0CA 2Q3FA 4UUMA 3K9QO 2EBHX 4LJYA 2GHQA 1XD2B 1SC9A 1F4PA 2MR6A 4BWFB 5ENDA 5E8JA 4NENA 1FP4A 2QQGA 4IVQA 4K9KA 2JGMA 4E4RA 3ZHQA 4ZI5A 4IHQA 1OX6A 3R3YA 1H8EA 5LBTA 4D5GA 4HZUA 2QP9X 4L5BA 2WG2A 5B57C 1MO4A 5JXHA 1ZPDA 2ODPA 3HA5A 3R24A 4OA5A 3LBFA 4UBKA 1E3WA 3KR9A 4JLNA 2VF5X 3B52X 1MRSA 4CLRB 1GN9A 4IDPA 5G2OA 1K0FA 2JH8A 2IBTA 3W5VA 3RC9A 4KYTA 4AUNA 5HUQA 1W25A 1GV0A 1P7CA 3SZUA 3HNPA 4M0CA 3R9KA 4WI1A 3QE9Y 1G5PA 3AY7A 3L7DA 3WBFA 1AF7A 3ONVA 5CB0A 4Z4GA 3ND7A 2XCUA 2HU2A 4TTJA 3LMKA 2FWBA 4L5YA 5ALYA 4V39A 2OYCA 1W94A 2XNKA 5F35A 1YS2X 1PR4A 1KNQA 1TK2A 4TXJA 2X0KA 3C6YA 3HFSA 4WY5A 3ZY5A 2B5OA 3UMCA 3TQSA 4A8JA 3HLTA 1SEVA 3CGWA 3HJBA 5AYVA 5G0WA 4LY6A 4U63A 3PJGA 4F2WA 1SCQA 4GI1A 2FFRA 3DAHA 5CB4F 2EBWA 3DA8A 3H8JA 4IEIA 2CLMB 2JKVA 4Q9NA 1V9LA 3F9IA 3KG2A 2HM7A 1KE1A 5DP2A 2E5FA 1NZJA 2WJWA 3M5PA 3RBVA 3WYBA 1NU8A 3D8SA 4BMXA 3Q3GE 5BV2P 3WRWA 2IPAB 3PWKA 2ODNA 3R8CA 3FJ1A 1R50A 1D2CA 2YZ2A 3FWYA 3EK2A 4MCAA 4ZJZA 4E2WA 4MYHA 3UQZA 5I47A 4AJOA 3BERA 3F9CA 1UUFA 5C1PA 1D1TA 4KR2A 4YDQA 3DV0A 3BF7A 4IILA 2IIBA 2PH1A 3K9LA 4HQ6A 4IX1A 1MZVA 4UCWA 5KQSA 1W9MA 2VYVA 1KEVA 3LFTA 5EP4A 4OK5A 2I4TA 4TYWA 1DPFA 1IE3A 1Q83A 5J59A 2FW0A 2C2HA 1QRDA 3ST7A 1LY1A 3RV3A 3WDLA 1K5HA 1QR2A 1N8KA 4DLAA 5CR9A 3EVZA 4GQAA 5HK9A 1YF3A 3FKSD 2A4MA 3TCNA 5FF9A 5JU6A 1F8YA 4F5EA 1OXKB 5COBA 1XZMA 2YX1A 3AEZA 4YNBA 3WOVA 1J9GA 4ZK6A 2XUJA 3QUBA 4XSVA 2R6CA 4TQGA 2PS0A 1GD1O 2CWDA 2H7VA 4YX9A 2VK4A 2YWHA 1KAHA 2QIOA 4KH0A 1XEFA 3M4JA 1QDLB 2BKUA 2H7CA 3OZCA 3OMLA 1RLIA 3RTGA 3S5JA 2IUSA 2RHHA 4EF5A 4BO2A 1BDIA 4LCJA 3LKVA 4C76A 3P9YA 4KKXB 4RKYA 4YEDA 2FVXA 1JW9B 4UVHA 1JXAA 2OORA 1DEAA 2BEWB 1BHQ1 4WOJA 2M6KA 5AVTA 2G7MC 2NNLD 4PXSA 4G24A 1PEAA 1CVIA 1HE8B 3SYRA 2WD9A 4WZBA 2GYYA 4J1SA 1N75A 3D54D 3VZQA 1BWRA 3GPBA 2WJ6A 2FR8A 3KUCA 2XT6A 4DILA 3LFHA 1VCOA 3FPAA 5JAMA 2ZEJA 4MUEA 3SF8A 4F3KA 3ETEA 1QAMA 1U7ZA 4J3JA 4KYUA 4OGKA 4B85A 4AJIA 4EMBA 2UXDB 1QVWA 1Z2OX 2J7KA 3HM2A 5HM6A 5LMZA 3AVWA 2ZJ4A 1RPTA 1WUTA 5ERXA 1K8XB 5SYAA 5IHXA 3QKWA 3STXA 4OUDA 2QMQA 3WRVA 1C9YA 1A71A 1VSBA 3AEUB 4UVEA 4EA6A 7REQA 3D7MA 4JYPA 5EXSA 1E59A 1ENOA 4CEIA 2J4CA 2P6UA 3QFHA 3M89A 3TZHA 4A8TA 1O5OA 2ETXA 1HT2E 2O1WA 3PDJA 5DW0A 4TV8A 3KZKA 3R5XA 3WOHA 1EG7A 1I9GA 1RIIA 3QOXA 2F3RA 2IYFA 3EFEA 5ADVA 4G1FA 3HJNA 1SQ0A 1E9AA 2ZTHA 1VKNA 3EMBA 1G8YA 1QCDA 3KZNA 1NMEA 3RU3A 3K92A 2VDMB 3FOBA 1MJGA 3FA2A 3C6KA 3MC1A 1ECJA 2PRJA 1RC1A 3SHFA 3LL7A 4C6HA 1NI3A 2A88A 2HIMA 4EA8A 4QVIA 4R3NA 4YT5A 2YXNA 4TTAA 1I5OA 2PV7A 3DNPA 5KSWB 3GQBA 5ICMA 3ICQB 3HVRA 1TOAA 2OFFA 4DSZA 2RH4A 1MJNA 4ETNA 5HF5A 2R6HA 3R5KA 4DGSA 1LFDB 1C0PA 4OO3A 4OQ4A 5JD4A 5BV0A 3LVRE 2ACVA 2QMEA 3GCGA 5CLFA 1V6SA 1Z37A 2BONA 3D81A 3HO6A 5JT1A 4UARA 3L18A 2JZOA 1H9BA 1Y6GA 3IVRA 1SUIA 3KQOA 1PG5A 3EHEA 4ZYUA 3HQ4O 4L75A 1Z4JA 2ZR8A 4IQ0A 1SIBE 1QONA 1I7DA 3OO0A 2AF3C 2E85A 4WOCA 1TIKA 1XVTA 1AKVA 3RW9A 1RSZA 3RNOA 4C88A 3GB9A 2NAFA 4QPDA 5FI0B 1CJMA 1I1HA 4IUDS 3LPCA 5FUMA 3IR5A 1ZJ6A 3AM4A 3G2LA 3OX2A 1T5LA 2KBEA 3BBLA 3P2JA 3AG6A 3VU8A 5I7EA 2ZS7A 3KWLA 4KGXA 4JUCA 5J1SB 3OE7D 1K27A 1OX4B 2P41A 2XNJA 2YCLA 2HXYA 5CVEA 2WM9B 2FY8A 5A6SA 3FYCA 3EF3A 4EVRA 2GH1A 1V47A 5CNJA 3DM5A 3HVUA 2BFEA 4NBNA 2TECE 4GO1A 5ICFA 2FXVA 4OAQA 3ZDXB 1M3SA 1N3LA 2EIHA 4G37A 4DMGA 3O8BA 3NAGA 3B48A 2VJPA 3B1JA 1H05A 4D3SA 1USWA 2V6JA 3EXIB 3KAPA 3F46A 3ROXA 3PNQA 3KV3O 5DNUA 1PNRA 4EGAA 1KL7A 1VB3A 3NFYA 4YECA 2FZKA 2R6ZA 2X7HA 4LXIA 4AO7A 4I3HA 1EZ1A 3M2PA 5C2JB 1QSGA 3AK4A 2FPPA 4LF7B 1YZQA 4H4EA 2QROA 4KRGA 3C45A 1KPGA 4KTVE 4ROSA 3IT2A 1XZ8A 4Q9KA 5TARA 4RHEA 2JC3A 3OCVA 1YI1A 2FSGA 2QNBA 2FUG6 3RVRA 5KJFA 3NWBA 4QYIA 4FGZA 5FPKA 3E7DA 2IYEA 5EYPB 1R0XA 1WCIA 3T5MA 3D1LA 2R66A 2X2EA 3F96A 5BORA 3KOXA 1P7WA 3HUEA 4S05A 3PQ2A 3IB3A 2ZRDA 4LOJA 1C81A 1KYTA 5FQNA 1FS4A 1FTGA 4HQ0A 3OMXA 3ZOZA 2ZIGA 5JBQA 3RIXA 3AIIA 3M6FA 4YPVA 3GLGA 1E1KA 1M1NB 3GRPA 4EEZA 4XIFA 1G3UA 1M83A 1NVEA 4QHSA 3PXAA 4RMHA 1KDVA 4EYOA 2CJYA 4HEQA 5JMPA 4HTFB 2Z1NA 3I1YA 5AKHA 3RFUA 3IR6A 4J43A 1IPEA 4RQBA 4YAFA 5JWHA 3HZOA 1NQTA 5KEIA 3AQIA 2N75A 3W77A 4F3YA 3ROFA 4DWOA 1TJNA 4C5CA 3RU7A 4I4TA 2JAHA 3U2QA 4PF1A 3I76A 2EWVA 4F06A 5KNLA 3T3EA 2DPMA 1MAAA 2DM6A 3HMQA 4D5EA 1NURA 1EKXA 4OHYA 1D7OA 1V7ZA 3ABOB 4D25A 4EG8A 3TIVA 4FFPA 1L5YA 1C1XB 1Z6QA 4CIXA 4B3TB 5KWVA 1UC8A 5J2TF 3FF1A 4FQ7A 1Y0BA 1ZA1A 4W7IA 3WL5A 5FBKA 2A59A 1OIXA 4GNKA 4TLEA 1GQSA 2JJ1D 3LJKA 4QATA 2WJJA 3USZA 1JXQA 3PICA 1J0XO 2VJNA 4GI5A 4RVGA 5C9ZA 5AVKA 1IOLA 2JAXA 1KOLA 2HCTA 5GJCA 2BGGA 2XF8A 4D42A 2NO1A 5EXEA 1V1JA 3WP0A 4PYJA 2CNDA 4KW7A 2GJ8A 3D6UA 1GLGA 3F6PA 4EHBA 1VKHA 5AFSA 3KJEA 5BWCA 2C97A 4GLOA 4LOHA 4TVBA 4UZFA 3I92A 4RWEA 5EHIA 4U8HA 4BVKA 1NP7A 5J4LA 1M5RA 5D3MB 3MJTA 2OCYC 3M6IA 4M0DA 1EVQA 5A9SA 1PU2A 1RXYA 2JB9A 4H08A 4RLSA 3C7TA 3WL4A 1G38A 4P35A 2I3AA 4I6EA 1E2UA 5KU7A 3QVMA 3W8RA 5CBPA 2JIZA 1R16A 4CKZA 1BC5A 3I04A 3CNLA 4BNWA 2AQ8A 3QYAA 5KTKA 4KUHA 3DDZX 1ZIXA 2LZ0A 5JAZA 2GSWA 4GM0A 2OP0A 1V4BA 2JLSA 3E6AA 4G5YA 3ZK9A 3JQBA 3ZN2A 4CM8B 4QVGA 2ZRPA 1ISSA 1R12A 1Z3IX 4YRPA 4C4PA 3SIWA 1J0CA 3HWWA 3TSZA 4QDOA 4ER0A 1DUSA 3VC2A 3GH3A 3U13A 2HWXA 1Y9ZA 4BC1A 1KQOA 2ZPTX 5B2EA 3SFVA 2XJ9A 4PAWA 3RSGA 3GVIA 1GRQA 1UM9B 5AHWA 3YASA 1EHYA 2W8ZA 3E2PA 3L0YA 2FSPA 3V8BA 3X0DA 3KSUA 4RAOA 5A0FA 1V39A 3DSRA 1JLMA 2VZ0A 4L6CA 3DOJA 2NSHA 4Y6QA 3TK1A 1Z8FA 3ZQJA 3LDUA 5ALOA 2BDUA 3QZUA 1A4IA 4PX2A 2IXDA 1B6GA 2EQ5A 2OHXA 3KB6A 3OLWA 1M8JA 4F38A 1HDOA 4G56A 1I2CA 1LPMA 3T6KA 2HB6A 4RL6A 3X1DA 2Z0MA 2REBA 3LV8A 4RK7A 5BSHA 5IZ4A 5CCEA 2CVOA 5A4MS 3DYBA 4EJFA 1QYDA 4D74A 3LBIA 3A6KA 4QFDA 3OY2A 1QGED 4XEUA 3GI1A 2ZUUA 3IAS6 1E92A 3K0AB 3IODA 5JECA 3TPCA 2QN6A 1SCUB 1L7VC 3O4VA 4TLDA 2OK8A 1NVUQ 3EXHA 5F33A 4EJ6A 4P84A 4EG6A 5CG2A 5KU1A 4DFDA 1PR0A 2GBLC 2YRWA 4U2EA 5H59A 3CW2A 3R41A 4M3NA 5DLQC 3Q7RA 2GXSA 3GLHA 3OUUA 4HNSA 4UNNA 3M9WA 4TMXA 4D1YA 2E1RA 4H3KB 1KK1A 2X40A 1FFEA 3DQPA 4TKZA 2J85A 1QFZA 2G1KA 1TVEA 1HEYA 5FI3A 5G0VA 2X0FA 2G40A 3PENA 3C1TA 5JANA 3UGTA 1IWPB 2HV9A 4JAVC 2FH5B 5DF1A 3JWHA 4C0JA 4P34A 3TZLA 1PBTA 4ZVNA 2WWXA 3OZUA 1JTVA 2RHDA 2CT8A 2WOJA 1GKKA 1Y6QA 2CNLA 2KE5A 3FM9A 1ZHOA 1NX6A 3UCXA 5L4SA 3TXXA 4YUAA 3ENVA 3PQ3A 4NFYA 1UOQA 5LBUA 4RTPA 2O54A 3VAAA 2FV8A 4C0LA 3IPCA 2XE8A 3HN7A 3R0QA 2YVLA 3OEWA 1B0AA 5LDDC 2VNKA 2ZTSA 1L7MA 1MJHA 4LMRA 3K6JA 4ZO7A 3H4VA 3GRZA 3I9MA 2BGTA 1MH1A 2BM8A 1PBNA 1RCFA 4IOLA 3OD5A 4PLHA 4Z9AA 2DZDA 2ZUFA 4MLPA 3MF4A 4YUVA 1H1LB 4AJKA 1ZRNA 2V4ZA 3QFSA 4CEHB 5DTQA 2GZ3A 4LYFA 4OGWA 2H8KA 4OSEA 2IE0A 5BSTA 2VF2A 3QPUA 2A1UB 3VNQA 3AY6A 2AWNA 2D3TA 1IUKA 1R66A 2B4AA 1N4DA 2YWFA 4PRLA 5LN1A 4JLBA 1XJCA 4YJ2F 5AI0A 9ABPA 1SBHA 1BRMA 1MIHA 1A9OA 1PKEA 1RQNA 4TRNA 1U2DA 5EMHA 3UQYS 4Z54A 4CIYA 1EP9A 2OHJA 2ZU6A 3QEJA 4IH4A 4LAFA 4A23A 4B1FA 1JS1X 1GZ4A 1NXPA 4P82A 4L4SA 1WIWA 1KYXA 2HA4A 4BNTA 4X1OA 1AXEA 3CPJB 2IUUA 1QLHA 4EBFA 4KK4A 3P0HA 1QVVA 2Y99A 3S44A 3NASA 2H2HA 3OCZA 2VP0A 3BICA 3ELUA 2D1RA 3U1TA 2Y2UA 4HVLA 2LKDA 1T5SA 4DEYA 3LX4A 2QXTA 1B8NA 3HGMA 3U6KA 4ZC1A 2EEZA 4EHAA 1XA3A 4HPJB 4O4JA 3QUQA 5JPCA 1DOHA 1L1FA 2V7EA 1ZNXA 4ENUA 1W4BA 1OC2A 3N8GA 5IWAB 2XCSB 2OBLA 2XB2A 1DJOA 4QEDA 2TMGA 1ID1A 1N7GA 1T0UA 1UZLA 2DBZA 2Y6UA 2PLNA 1WCYA 3JAKA 4JEIA 4KN9S 4PE5B 2D0IA 2SICE 5ALDA 3K53A 4FPXA 1IDN1 2Z08A 1UBFA 2H16A 2RGAA 3O4JA 4RLFA 2MT9A 2Z2JA 4P7GA 1COWD 4BV3A 1NDUA 2XODA 4GLFA 4L2IB 4G86A 1TJ3A 2HSDA 4RAQA 5AVQA 2FN9A 4NLLA 2P79A 1KO1A 4MV1A 4UEKA 4WNYA 1AX9A 4YGXB 1P9WA 3VPSA 2ZSIA 4DLTA 4K46A 2ZRIA 1ULZA 5LQSA 3K71B 3DEJA 1UADA 2A9QA 4HZIA 3DEHA 4G0OA 3ZHBA 2WHPB 3DLCA 4O33A 2C7QA 1P2GA 2B4QA 4NCIA 4FMDF 4Z6KA 4CV1A 1UDAA 4MQ5A 1SM4A 3Q1LA 4MJLA 5DIZA 3D6MA 4E33A 2J59A 2FCAA 5TQ2A 1UEXC 2EL9A 3H5RA 5JTUA 4B6SA 1QTQA 1RJDA 4PNEA 4B3RB 2JLQA 2EX4A 3KD2A 3D0RA 3K31A 4OJKA 1W6RA 4QX6A 1SUWA 3NHBA 1Z34A 1NJFA 3UOGA 3GCWA 3L2OB 1GEEA 3KAJA 4XX1A 2WU4A 2MYTA 3UOWA 4FBLA 1YR9A 3AZPA 2OHIA 3WRYA 1J22A 5FUQA 1X8JA 1DX4A 2W2LD 1QZZA 4G1VA 3RS5A 4KXFB 4CV2A 3AONB 4ZCIA 3FSRA 3BC1A 1YCFA 5FT9A 3AJ9A 3ZW9A 3BORA 1US8B 1UFRA 3BJEA 4BFVA 3NCHA 4V1CI 1OC4A 3QBTA 5H7XA 3TBFA 3ZYZA 2VYFA 3DTNA 1GHTA 4LF8B 1FFAA 4Q9IA 5HQJA 3RE1A 1BU5A 1AG9A 5KJCA 2QE7D 3H42B 4J9UE 4UDOA 1O08A 3TLXA 4NZYA 3R7DA 5DIFA 4OCZA 4OHWA 1Q22A 1KEEA 2BV3A 3MUNA 3O4HA 4UFOA 3WIVA 3ZWYA 1ISPA 4YAGA 4OX9Y 1A9TA 5LXTF 5AVUA 5H3LA 4XIIA 2IU0A 1CD5A 1Y82A 5FOUA 2P1ZA 4R2IA 4DVGA 2PBFA 1JNXX 4IUCS 5KX5F 4OHCA 2V03A 2X8JB 2ASEA 1QWSA 4JK3A 2D2XA 3RVPA 3FSEA 4TL8A 2EFJA 2ZB4A 2MINA 4BKQA 4C4RA 2HH9A 2RCNA 1H23A 1YUNA 5FH9A 5DYIA 3SZGA 1SBZA 3T4UA 1Z62A 3NT4A 821PA 4I0WB 1U2TA 3Q4GA 2RGWA 1P9LA 1FDTA 4QU5A 4RZXA 4EZEA 1DJQA 2SKCA 1UH5A 2B25A 3V4SA 5AM3A 4FNOA 4Y2JA 2DP4E 1N6OA 3RD5A 1P7PA 5J2TB 3M2TA 1YKGA 2P0EA 1AY0A 2XSZA 3IUNA 5KNBD 1TAGA 1LI4A 1Y6RA 3LLSA 3V8MA 3T7EA 4C4SA 5JHHB 3G6WA 2GPJA 2G9QA 4YCNA 4PC3A 1JKIA 3A1FA 4RDIA 3UXYA 1K6JA 1DWOA 3DE2X 3PGXA 4DRXB 1NV9A 1JKXA 4GL2A 3UK2A 4CCYB 2JKYA 4QOFA 5J40A 3G82C 1OY1A 3ISTA 5A5VA 4ZI7A 2H29A 2HSWA 1V71A 2X76A 2UYYA 5FA6A 2H6EA 5CT8A 1N5OX 3OM0A 3WXBA 5H81A 1EK6A 2DF8A 4XUGB 4U3JA 4MCIA 1X0XA 1KFCB 1SXJE 2ZSHA 3E9EA 1E5XA 4I4CA 3PITA 4J76A 1N5MA 1O03A 3BT7A 4E30A 2R4UA 4LDNA 3OIWA 4HAUA 5JATA 1PDOA 1KU6A 1W0JA 4L4ZA 3GPIA 3RIYA 4P32A 3NDPA 4ZYLA 4TLCA 1PKXA 5C7YA 3L8YA 1EAMA 4LZAA 3UO8B 3AC0A 3G5AA 4QXAA 4HDRA 4L5JA 2E4ZA 3R7LA 3K2IA 3IAHA 2J07A 4WKNA 3D8RA 1R88A 3RTAA 3O91A 2ZUVA 3GA0A 2JFHA 2R79A 1T24A 3LI2A 3D59A 2QD4A 1JMKC 1DAPA 2G77B 2JHPA 3K9NA 4TKMA 1EBFA 3FBWA 2GHTA 4BGDA 1TUBA 1EPUA 3OY7A 2CXRA 1A9XB 4IS3A 1E69A 3PHGA 3CLUC 2YJ4A 3ZD9A 4RPGA 2C98A 5SY6A 2WFLA 2YZNA 4KO4S 3RAFC 2DB3A 5IUKC 2XGMA 2ZAIA 5MGBA 2LCIA 4RVCA 3QUTA 4OXKA 4MB0A 4C3ZA 1SBQA 4PZPA 5GONA 4FDMA 3T5PA 1V16B 2W6JD 1F3LA 2J9FB 1RXUA 4ZDWA 3IT0A 1IIRA 5LWHA 3JQEA 3GJSA 1TI7A 2BZ0A 2DKNA 3RARA 3ADKA 3IBGA 2G71A 3EMKA 5JASA 1C14A 1JHAA 1JHZA 1GQ2A 3KQMA 3VRHA 5A1JA 5BOSB 3C1AA 4PHHA 1TD9A 4M0UA 3ZZ0A 1O6BA 1V6AA 1L7NA 1MX9A 2ZJ2A 3OQ1A 4JSRA 3KZCA 2G0AA 1EFVB 1ESEA 5HOQA 4J6FA 3PKJA 1T0IA 4FFBB 2DH6A 4YAUA 3T9CA 1IPHA 2J5BA 2YUTA 3K09C 2BM0A 3NX4A 3SS7X 1EHCA 4TMWA 3AKYA 1WDMA 1UKVY 5JD6A 1CNEA 3P0RA 2QGZA 3SHWA 1ZAKA 1ZJZA 1FFCA 2PANA 3RG2A 4EHLA 3C3AA 1VLVA 4TSFA 4KK3A 3BDIA 2YQ5A 3EULA 4IR7A 4MGZR 4MYUA 4QYXA 5AXBA 2NXCA 4DTIA 4BMPB 4DKJA 3EDMA 4HB3A 4HN4B 1DIRA 3E3OA 1Y37A 3DZCA 2A0FA 2P2GA 3ZQKA 1U7HA 4BAGA 1ZJ5A 3TTTA 3ZHTA 2NZ2A 3DBRA 1J8MF 4ZOQI 1HETA 1ZISA 2G17A 3AEXA 2NU8B 4G0VA 1GL7A 1GGFA 2EJUA 2Q8PA 1ZD3A 3LBAA 4XJSA 5FWXB 3DZGA 5KO2A 2OILA 4HAWA 5M2QA 4E2YA 4KQEA 2PGDA 1RKQA 3IPLA 1OH7A 4XGRA 3RI3A 4HMOA 4UCQA 4JI6B 2WF6A 1GPMA 1WU7A 3LSYA 5F4BA 3AF5A 2DWPA 1JFRA 3QLVA 4FFWA 4DV3B 3FFBA 4MVJD 4EHNA 4BBAA 2HNKA 3LIIA 3L7CA 4YRDA 2WPDA 5EJGA 1DKNA 4RZUA 3ZTTA 5MDHA 4HWSA 3PJDA 4DR6B 1XMOB 4MTLA 1TGVA 2YWJA 2IIQA 2PY6A 3PBKA 1J99A 1FSSA 4HF7A 2GS9A 2ID8A 3ZLBA 4W5QA 1I3NA 4YJ2B 1F8GA 1KDPA 2XD9A 2VDOB 3ZCVA 1KQFA 2ZIAA 4NNPA 3RBZA 2HNAA 3CKLA 4O2AF 5I7SA 1X70A 3JCZA 3OTIA 3AR3A 4YJ3A 1C3XA 1U04A 3N0WA 2ZUCA 1MVLA 3O1JC 3ZCPA 3HVJA 3HI6A 1RQGA 2DPYA 3FW1A 3PWSA 4NDNE 5JDCC 4PG4A 3RRJA 4B6EA 1GTZA 4EJSB 1UJ2A 5KTMA 1U0BB 1ZOOA 1KSGA 4OAPA 2NIPA 2Q0HA 4RQAA 3M81A 1FYDA 1OF1A 5EIBD 2NUPA 3ACCA 3L1IA 1R3UA 3V4FA 4ALKA 1XPOA 3A2KA 4YRSA 2XEXA 1JVNA 4YJDA 1SHTX 3KTFA 3AR2A 4OJTA 1YCDA 4I1YA 2EF1A 1U0GA 1TTTA 2J5RA 1JPNA 4N54A 4IHAA 1MNAA 3KKEA 2J30A 1SCJA 2W6ZA 4HC4A 1R10A 3W9SA 1Z5GA 3KLNA 2OO3A 6AT1A 1WS6A 3BG5A 1P72A 1ZN7A 2JF0A 3EZGA 4LVCA 4P83A 4DA9A 3N1UA 1NG9A 5K4AA 5FADA 3C4QA 1U1GA 3L0PA 1G8HA 2X2OA 3SG0A 5C5CA 1I7LA 4W4TA 2P40A 2EZ9A 3OBBA 4NNJA 2FFQA 3EG9A 2RJNA 3G6KA 3Q7QA 5JYEA 1DUIA 4MPPA 4R6WA 3DUFB 6ADHA 2VP9A 1ZLYA 4I19A 4P4NA 1UKYA 5EG5A 2VA9A 5EE0A 1NR5A 2FQWA 3EH2A 1GITA 1RLUA 1TZBA 5IW8A 3OP4A 4NCNA 1JSXA 4FMDB 1A5BB 5EE5B 1PR2A 4OHVA 1CRQA 3HHPA 2HQSA 5F78A 3UT5A 4UUOA 3IEUA 4QIHA 1T9HA 4GIBA 1U0JA 3VC7A 1JAXA 4LRTB 3Q8KA 3R6WA 5EIWA 5C32A 3G2IA 4K3UA 1ZK0A 3BJIC 4FVTA 2W6CX 3CTMA 4D81A 3IHWA 1OLSB 2PJRA 3QEKA 3ODGA 4U9HS 3VH2A 1HXHA 1D2AA 4A0SA 2E9SA 2LCFA 2WZCA 4G85A 4HH1A 4RLQA 5AM2A 3ZDAA 3F2IA 4O59O 3GJRA 4M2LA 3IBYA 4Q37A 3R9WA 2G5TA 2QN1A 3WNVA 4ZU1X 4MDEA 4EKIA 4W82A 1W49A 5JVDF 4L22A 2VYNA 1I2DA 4C6TA 2O0KA 1SC6A 3W1VA 2AUTA 3T9BA 4WXRA 2BEVB 2JW5A 4CE6A 1AUVA 2EBUA 1KJWA 1U7PA 2BEKA 5LDHA 1JQ5A 4JVNA 4Y0VA 3VNBA 3ZJTA 5DNEA 1HRDA 2FPGA 2NWQA 1UBRS 4KAXA 5EVJA 5B37A 4F4IA 5ITSA 5KZMB 2O8FA 3RRYA 5D3QA 1OQAA 1PR5A 5AM1A 5SY4A 4DGQA 3HKCA 1L8AA 1I4TD 2FK8A 4J1TC 4XQGA 2Q29A 3DL2A 2PUTA 2QOEA 2ZB3A 1T3LA 3SR4A 1DO8A 4FBMA 3VZCA 2VA8A 5CFOA 1N3BA 4CETA 5KX5B 3BXGA 4RMGA 1VMDA 4FFNA 4C03A 1R6TA 2QUJA 1M7BA 1BEEA 1U4NA 1H2BA 5GWXA 2ZTUA 5CYPA 4JJGA 4OKNA 1P17A 2HNBA 3CLTD 1NLYA 2AQKA 1KQGA 3SZRA 4AECA 2OXEA 2P8SA 1N3YA 2X3YA 3EYAA 4RF3A 2EAUA 1XZQA 2AG5A 1O58A 4PC2A 3QMPA 2XZTA 4IGAA 4R4JA 4E21A 3N7TA 5B3AA 3FNRA 4F0JA 4HB0A 4F4JA 1ZM9A 3WS7A 5F9FA 2HQRA 3ENKA 3IUMA 2GK4A 5KTTA 2HV8A 4OYRA 4JOSA 4EO9A 4YROA 3FPEA 3MWDB 5DMHA 5EUBA 5IT4A 3D3WA 4QGFA 1AQYA 1IJEA 1AURA 1Q2UA 2H65A 4BLSA 5ICSA 4GZLA 4LYJA 5MN4A 3WLRA 1TQHA 2HA2A 3QPWA 1N4AA 5CW1A 5B4UA 3KUDA 3VVLA 4HJXA 4DR7B 5IG2A 2Q6OA 2VIIA 2XDQA 2C88A 2FOLA 2Z2ZA 2WVGA 3KSZO 4G41A 4NVRA 3UK1A 3VPGA 1QV6A 1RM3A 4Q1DA 3W3ZB 1RADA 4ZZ3A 4HLCA 2JLAA 5L3QA 2C00A 3H5VA 4MAAA 2C7VA 5CVDA 3SSMA 2V4UA 3OTQA 3T1NA 3GLRA 3ZHCA 4DDWA 5I01A 1QFJA 4UNRA 2HT6A 1D07A 2DY1A 4NZOA 2IA5A 3V2GA 2OL4A 4ZVSA 2HLDA 5KHOC 4Z4FA 1F2DA 3LC1O 1SBYA 2BHLA 3V97A 1VPWA 1L7EA 5JV5A 2OKCA 1U7XA 1V8PA 3ZWNA 4BGVA 3VR4D 3OU7A 1V4VA 3H11B 5JH7F 4EEXA 3D4BA 4TN5A 1XAJA 1UCFA 1JR4A 2DYKA 4GRAA 1ZI9A 1RAHA 2VLIA 1B16A 3FOWA 5FOVA 5HMMA 2R8BA 1QBGA 2JLYA 1IHPA 1TA0A 3D4NA 3FMGA 3FH0A 4DREA 5KIAA 2X5OA 1CDDA 4ZO9A 3OJOA 4RSMA 4ZDKA 2D74A 1P61B 1AZWA 2QAGC 1L7DA 3HSSA 3N3AC 5ULLA 3AHHA 5T6MA 2X42A 3O75A 3NT5A 1ULAA 3U5ZB 1UKEA 4RE6A 5DGHA 3AJAA 4LZJA 4XD7A 5HFAA 4DW8A 1XZEA 2QV0A 3LBHA 5DNWA 5CNKA 2W6OA 2R6FA 2ZOSA 3IURA 1JR2A 4RW0A 3KSRA 3RDPA 1X1AA 5LPNA 1MC1A 4Q39A 3U3JA 3H9JA 1M6VA 3E35A 2L42A 3LUFA 3EDOA 13PKA 2OYSA 2BSXA 2HJVA 3B6IA 2CD9A 1DHRA 2A0XA 3DOHA 3KWJA 4OXNA 3SK0A 3RS2A 3TTUA 3PNSA 5DBHX 2B34A 2Q4TA 4UXJA 2ZRKA 1J0BA 3P27A 1AO3A 3VUEA 3RRZA 4EPRA 1X6VA 3KRTA 3ESZA 1ADBA 3GJXC 2GD0A 4RGQA 4DG5A 4JJEA 2Z9BA 1KYVA 2RHOA 3FTQA 3QX8A 1W73A 4EZBA 4AQYB 1Z8HA 2BI8A 1YQUA 1NLZA 2VK2A 1G0NA 4F6RA 3PP8A 1A8IA 2HJ9A 3VNVA 2GUGA 3BMCA 2BP7A 1A72A 4UNSA 1JNYA 3QSGA 1CQIB 2FR0A 4PC6A 5JZMA 5C3UA 4XA8A 4NPHA 4AJ1A 5BSFA 1OA0A 1IY9A 3GEGA 4LF6B 1KYYA 1YMQA 1I0IA 1SUFA 1Z3CA 2OSBA 5FBLB 4C4ZA 3H99A 3SXPA 2AEMA 2NO7A 1AQIA 1ZI6A 2LBPA 5G3YA 4CV0A 7GPBA 1P0PA 3AF3A 4KEAA 3ZR4B 2ECQA 3K15A 1TRHA 2EP7A 2C2OA 2FSHA 2I66A 3K2QA 3PXEA 3V2IA 3DMNA 3QEBZ 4FD2A 5JLJA 1EX1A 1DC8A 4U6NA 3ZGXA 4DVJA 1STOA 1ZCJA 3JXEA 4OMFG 1V5GA 4MQ4A 4EYKA 4LW8A 3H0CA 3I01M 3ZU3A 2CLHB 1D1SA 5SZIA 4CIDA 1EWTA 4CEJA 1KPHA 1FFYA 1YRBA 3BCRA 2QLNA 9GPBA 4YCBA 3W9UA 3FTNA 4NDAA 1ZMOA 2ZYAA 3W1WA 3OLVA 4NJEA 3RREA 2M2IA 1NVBA 2Q3MA 4HP8A 4YRTA 3T95A 2HADA 3AVQA 5E7QA 1R5BA 1M2VB 3RAGA 3DW3X 1WQ4A 3BMQB 1OZGA 4MVJM 2X8AA 2REXB 4O2AB 5D7BA 2QP4A 3PDUA 5G4LA 3QPDA 1ZESA 3TOVA 2D5IA 3IFSA 1R4AA 2TSYB 3MIIA 2D00A 3MS7A 3CUUA 3PUKA 4XLZA 2PE5A 1UXKA 2BKLA 4GS5A 1KK0A 3DVAB 1RJEA 2WHYA 2ADOA 3JQPA 3TFOA 4W7SA 1KMHB 3O8DA 2BZSA 1Z2CA 4UM8B 3E3LA 3GG2A 4UFPA 1JHOA 3L01A 4U1RA 4IIUA 1DCMA 4LFCB 2FQ1A 3VA7A 4D7AA 1RQRA 2C1EA 3ROMA 1SPBS 4ZZ0A 1SXGA 4UHJA 3BXZA 1A8QA 2HRZA 1KY3A 2JBAA 4TM7A 2F4NA 2X2PA 5JISA 4U5QA 2IX3A 4BMNA 4WKPA 5HIKA 1ZCAA 1BYUA 1T6NA 3WE7A 1E98A 3COWA 3QVOA 3WNBA 1VDMA 1ZFNA 4I8XA 1XLUA 5TF4A 2BSQA 3E0QA 5EP2A 2OBNA 2C3MA 5EGSA 1XB2A 1S2MA 3I72A 1XLTA 3O03A 4OG2A 1YZKA 1F8XA 1XWWA 4M98A 5CM8B 4B7AA 1UXHA 4INJA 2C96A 3RS4A 4MHOA 2XMPA 3PEVA 2ORED 4MWOA 2YV3A 1XTVA 2YIDA 2HOQA 4RPCA 2CNWD 2V7WA 3ZS8A 5EJMA 1I2ZA 1XA0A 2VO1A 4K9DA 4PFQA 3IEKA 3G2HA 3ABQB 4FHZA 1Y1PA 1GZSA 2FFHA 2WSSD 3KUUA 3D3KA 3PQFA 2P30A 4LXUA 3C6BA 5AVVA 3T5BA 5TEWA 2BUAA 1C8KA 3LF1A 1R0CA 2FSSA 1MIOA 5CLIA 5H8WA 3NI2A 4RA6A 4BATA 4GT1A 2YKGA 3RC2A 4IIVA 4CNQA 3KQYA 2PS3A 4BMDA 3NHKA 4FJ0A 3GK3A 1G5RA 4A91A 1LX7A 1CY8A 3PPVA 3D4OA 1B2RA 1MGOA 5EHXA 1L8OA 2E49A 5JVDB 5AESA 5HJ2A 1AO0A 2R85A 2PX2A 3A6EA 2ZE8A 3EXFA 3PD7A 3R7NA 1O9GA 2HKIA 3OX4A 2RGUA 3G68A 1KIFA 3UY4A 3TLZA 2I4NA 3G13A 1DFHA 4M86A 4JI1B 3H1EA 5K0FA 4G65A 2XGOA 5C8XA 2ICAA 221PA 1GGNA 4YXFA 3H5IA 3KYCB 2V74B 1KEWA 4IV5A 4DN6A 1UC9A 3DULA 4I55A 4QXQA 4B43A 5M7EA 1EVYA 3WWZA 1T6ZA 1KJJA 4E13A 4ITRC 4AKIA 5FTKA 4B73A 1R4MB 3OUZA 4LBWA 2DECA 4DLKA 3KT8A 3ENNA 3P9SA 3PUJA 4ZFNA 5H4GA 1SU6A 1V45E 1UK6A 1Q16A 1DQPA 1NOJA 1VCIA 3EZFA 3HB9A 3LHKA 3HDQA 5JE8A 5JQGF 1XKQA 2C7OA 2V9PA 2PUCA 1PX2A 2C1ZA 1SXJA 1IN8A 5AK4A 3TRKA 1E5LA 1KAQA 1XG5A 4LWPA 1WZ2A 3OX3A 3OPYB 2G9ZA 4IGIA 2QW0X 5DGCA 3KEGA 1G6KA 3ZWOA 3OTOB 2WU1A 3C70A 4HQFA 1E32A 2Y1GA 1MQ8B 3W2FA 3STHA 2XOKD 2QRQA 3IMKA 1BXRA 1GYRA 1YZNA 4IIXA 4IJWA 4KQ6A 2NUAB 2H4XA 2QJRA 3OCJA 4E5DA 2XNDA 1MO6A 4FCVA 2QRNA 3B1WA 3SQMA 3K5HA 5H68A 1ULBA 4RTLA 1X14A 3LKDA 5M3BA 2YV4A 3JVDA 3QF4A 2R2GA 1EFAA 1NTOA 4DMLA 5FBVB 5LYYA 2G72A 2G1PA 4DIFA 4MS4B 3P8ZA 4YT4A 3LYHA 3QM1A 2EIXA 3Q9UA 5E7MA 4GOLD 1XQ1A 1FS5A 3UZUA 2QM7A 1E1RA 3VR2D 1H6CA 2FNAA 3EEQA 4A5SA 2WD7B 2JAQA 3HDJA 4NE7A 3GD5A 4BZQA 2XYPA 2PDAA 2OQIA 4EGFA 1QG4A 1ZU5A 1E77A 2WIAA 4UPEA 2IHZA 1A04A 2M1XA 1CR1A 1DAGA 1L4YA 3GFSA 3H2JA 2FN3A 4R9SA 4TV9A 1BGWA 4WCFC 5TE9A 3IIJA 4XWYA 1DXQA 2Z2YA 1H2XA 5TQVA 1FZQA 4WKBA 2VT7A 2RBKA 3L4EA 2OAGA 4LIPD 3SSNA 4ZAWA 5LZ7A 3V55A 4AIRA 1GAWA 1PZGA 5D6NA 5FFMA 1QH1A 2QZZA 1Y3IA 3UNXA 4CJXA 1WWKA 3GY0A 5CITA 3BJRA 4I1VA 1MFPA 1NR7A 1WP4A 1PZEA 4IUBS 5DCYA 2ANBA 1SUPA 4NOLA 5JZOA 1QRSA 2Z6QA 1LQTA 3DONA 1YAHA 1K6MA 1J42A 1QE5A 4FYJA 1OD6A 1YONA 4O6VA 1THTA 4GOXA 4U7PB 2W00A 3RYFA 4XASA 3TQFA 4QO7A 3UEOA 3UTCA 4CMAA 5KB3A 5LR6A 2WT4A 5IJWA 4WFIA 4L16A 1OPRA 4H7KA 4Y9SA 3TR0A 3NJRA 5KYWB 4K9PA 4NCAA 2VCEA 1D4AA 2VJYA 3TMKA 5JMTA 3QEOA 3FDJA 3GUHA 3K72B 5DDIP 3L06A 3K0FB 4NSNA 3JVVA 4U4AA 4UAVA 2V6FA 3F5QA 2IELA 4EY6A 1Q5PA 3D6FA 1UDWA 2XUZA 1ZBDA 4K1XA 4UMVA 4FGUA 4DSOA 2WF8A 5BQFA 3ZU2A 1ORWA 2WA1A 2DPLA 3IQFA 5DT2A 4B4DA 1KAOA 2P5TB 3GVXA 4Q1FA 3EEOA 4LBZA 4IV8A 1Y8ZA 4IAOA 5DHFA 3G8BA 1YR2A 5EZQA 4IHJF 4BN4A 2ZRGA 2R87A 2WB2A 4JEMA 1ZKDA 3GNTA 3NOVA 1BD4A 1HG0A 1XALA 4LHVA 1NQUA 1TJPB 5FTJA 2ZWMA 3VBEA 1QS0B 2YASA 1T8RA 2VWQA 3C3XA 1FE8A 3S1SA 5HIMA 4ACAA 1Q1EA 3E70C 4UUQA 1PFWA 5BSKA 3HBJA 2NU7B 1E3DA 2CSUA 2HMAA 2HPHA 2UZ0A 4YAEA 5H02A 3PG5A 1UKAA 4A15A 3U17A 4J0CA 2CNNA 4QYSA 3OJ0A 1Z12A 2GARA 4JNCA 2NZYA 4BP8A 1JR3D 4ALIA 2C4NA 3GZ4A 3UJBA 1S1MA 1TEVA 1UWVA 5F52A 4UHHA 2D1QA 3BGVA 1Z7EA 4TMZA 1RYYA 2OHOA 3N0VA 4II3A 5FL7A 1QK4A 3ELWA 2YOGA 4D9BA 1NMYA 3KZVA 2ZYVX 5KKAA 4WERA 3DXXA 3JRWA 1EI9A 2WLSA 3GWGA 4JP5A 4ND7A 5EQDA 1ZH8A 1AGRA 2NPFA 3FN4A 1N1EA 1FRVA 1YDMA 3H4TA 3NIBA 4LRUA 4F8JA 1AQJA 1UQRA 4UQPA 4NABA 2LIVA 2QX7A 3ICVA 3ER9A 1RQ2A 4IJ6A 1Z0UA 3NCTA 1N6LA 4YCAA 4M0EA 5P8WA 3GJ3A 1U1FA 4HDCA 3CVVA 1I51A 2P65A 4IDHA 3LLVA 2FN8A 1S3IA 3CRW1 3QOYA 4TS1A 4H15A 4TTQA 4IHKA 1YUMA 1E4YA 1U6IA 2PD4A 1IN6A 1P5ZB 1NBWB 1RXSA 4BE7B 5DYGA 4EO7A 2VHQA 3VDXA 2ZWIA 3NORA 4MPJA 3RS8A 4KUGA 5FCDA 1NE7A 4P9NA 3ZGNA 1R5NA 4XYMA 4IZOA 3SF8B 5EHZA 2ADFA 4G8BA 5ALRA 2Z4TA 1KZ9A 3AUSA 2C3YA 2N0SA 2QLJA 3E9ZA 3X1MA 3DBOB 1ND5A 1C29B 1YJBA 2QVGA 3B8EA 4LDRA 3M0EA 2GCOA 1H6BA 3AESB 2PMWB 2AJTA 3TZKA 3JVEA 1OWLA 4CL0A 3G2OA 5T8KA 1JEOA 3OECA 1GIAA 3AL3A 4HMQA 3TLYA 4C4YA 4CEIB 4DT1B 2QY6A 2UVPA 2B1QA 4WDRA 3SJUA 2ZM6B 3FTCA 3HXKA 3ZX5A 5CJ2A 4PYRA 4F6CA 2YZKA 1PJTA 1FUIA 4UAUA 4BVGA 4IH9A 1NMXA 3CPHA 3FBGA 5IMBA 2I4OA 2IV3A 4BX8A 3IULA 1DDGA 4DSTA 2XRFA 2WMYA 2C7BA 3KIPA 2PUHA 5IUJC 2J5QA 4R2WA 2GAJA 3TTXA 3JAWA 1M6HA 4ENPA 4R1NA 5EHNA 5IYZF 4TVOA 2ZYGA 2NTNA 2JFPA 3LVQE 4BFZA 1F0KA 4U7WA 2VQEB 1EDBA 3AI7A 1Q20A 1F6DA 1ZDMA 1ISHA 4F92B 1WXWA 4MKGA 3W34A 3IBTA 4YAJA 4AZ3A 4CTMA 3NPAA 2YDYA 4EQ6B 4ZK2A 4CFSA 2OMKA 1Z22A 1DWPA 4DPLA 1XCJA 2B2XA 5I9NA 3K0HA 1U4SA 4CFZA 3LOQA 3LRPA 3F9RA 5IK2A 5ARCA 2CDRA 1AUXA 2IZ5A 1N8SA 3OPQA 3IXQA 4WINA 1V3TA 1U0TA 3VYSB 1I8TA 5FWYA 4OYHA 3T9DA 2CZQA 5BSEA 5IKMA 3MT7A 1KF0A 1TM3E 2PT9A 4HFJA 4MRRA 4WRRA 4LY9A 4C07A 4W6ZA 4Y9DA 5CNMA 4F96A 1P60A 4MIOA 1GFIA 3NTOA 1FNCA 3GCDA 3I4CA 4I1RA 1GAJA 1P75A 1PGNA 1PAUA 4CQJA 2ARKA 2A9KA 1VJ5A 4JA0A 4RV4A 1A88A 4WFJA 7MDHA 1EP2B 2BFEB 2NQTA 3OEED 2W6MA 2YDXA 3O92A 5SZHB 4FINA 2XMZA 4G0XA 2WZDA 4KXQA 4BZXA 4G9GA 3IRVA 3MB5A 5JIBA 4W1RA 3WSTA 4KPEC 3K1YA 4AJHA 3CZ5A 4CZ2A 3W4KA 2CLCX 1CUUA 3HC7A 4BXOB 4PAQA 2IY9A 3OLCX 4AJ2A 4O8ZA 1MMFB 2CXPA 4O2LA 5A9RA 5LM3A 1O94C 5CDFE 5A5GA 4OL9A 3VTKA 3JRXA 2JIDA 1VJCA 1DG1G 4JKOA 3PRKE 5DM1A 1W35A 1MHTA 5AJXA 4DMUB 1DDIA 3VDRA 2Z8ZA 3ZLTA 4D6YA 1X3LA 1P1CA 2Y3IA 4I9UA 4RX1A 2IYVA 5L95A 4TQAA 1AZTA 1SBCA 1XZAA 4CHTA 2PBLA 3SZMA 3VDQA 3AVTA 1TAQA 5E6SA 2DQSA 3A6JA 4KQFA 1EE9A 2H11A 3GEHA 4TWJA 2C8VA 1UBJS 1WCIB 5DNAA 3VR3A 1NF8A 2GFIA 3O94A 3W8DA 5KYNA 1BVHA 3KTAA 4GE0A 4QJIA 1K6EA 2WE8A 3WDKA 5EE1A 4CM3A 2B8JA 4CLHA 1U6KA 2VDPB 3J81A 5EIEA 3CQ9A 3GROA 2G67A 2W0SA 3K05A 5MGNA 5KTOA 3KFXA 1KYQA 3HB0A 4DS3A 4QDKA 1ZBQA 3GLGB 5D8DA 2NP7A 2UZ1B 4YPFA 2W4QA 4Z8XA 3V8RA 4R9RA 4E7PA 1RWWA 4L15A 1N2BA 4DV4B 1TGYA 4KIWA 5JAQA 1LS1A 3QGMA 4BQOA 2H08A 1T8UA 4C7VA 2ZUEA 3FHJA 1IXZA 1TE2A 1T1JA 2XXAA 2H7XA 2AK2A 4HX9A 3W2HA 1P5JA 1UBEA 2K2WA 3H5TA 5FV7A 2BZ1A 1S8NA 2CXOA 3Q88A 4L6AA 1P0IA 1EGVB 1P3DA 1YD7A 2W83A 1G7SA 2FJPA 3MCWA 4I4TB 3UKOA 1PGJA 3L04A 5ECDA 1Y80A 3IT3A 5LB2A 3AM3A 5JY6A 5K0JA 2PCJA 2WEKA 4RMJA 5CT6A 1E94E 4TMVA 3GX1A 3SC2A 3FCSB 5IVPA 3NNSA 3AL2A 3GZNA 4HATA 4ER3A 2I3BA 1M2FA 2GK7A 5A4DA 4HNAA 3RVDA 3GIWA 2WWYA 4MROA 3URKA 1MKYA 2WAMA 4PYNA 3WFIA 2IYPA 2O5RA 1UOOA 3QF7A 3OKAA 1Y8QA 2PZMA 1V11B 2V9ZA 3OZVA 1J1UA 1ZKMA 2ONZA 3D0OA 5K8TA 1KP3A 1PT7A 1WAMA 4LECA 2DAPA 4RV9A 5HRCA 1R8YA 4OQYA 3D1JA 1NC3A 2PIDA 3HU5A 3EQ6A 4FIZA 1Z45A 2HMWA 1BMDA 1DO2A 4WN9A 3FHOA 4P8RA 3HXTA 3QA3E 1ZH2A 1QCZA 3L5OA 2AYXA 3L6BA 1O6GA 4ND5A 1IY8A 1DSSG 2CW5A 1UEJA 2PGNA 1L5GB 1B8PA 1YGPA 2JAUA 4BGUA 1JHQA 3MMXA 2JIOA 1H4SA 2LP4Y 4OHBA 4LJ5A 1YRAA 3COVA 5DBGA 4I99A 4YHHB 3DTYA 2XRYA 4CMHA 2WIGA 4PEVA 2H1WA 2YJGA 4ASUA 4DAOA 3PXXA 4JVMA 2NLOA 5K3AA 1XKXA 3USCS 3V1MA 1E61A 2QM8A 1XKTA 4WGFA 2BFMA 3F8TA 4YBRA 1L4NA 3E7WA 3KETA 5JCOA 2JZCA 2QK4A 1SB9A 2H9YA 1MEOA 2QL9A 3CEHA 2UZ3A 4TTVA 4AMUA 4BWYA 1Z17A 4WFQA 1Z73A 3AHFA 3REQB 1NOIA 5JXIA 3B60A 2C4KA 3F6EX 4IO1A 2H4ZA 3WHIA 1XRJA 5G41A 1SQ6A 1TKBA 3C5EA 5HUJA 1G7RA 1XJ5A 1VBFA 4P22A 1E6LA 2XECA 3O1IC 1MG5A 4IEEA 1JFTA 1VE7A 3FR7A 3IUBA 1CUDA 1U3WA 4R98A 2BOVA 3FWPA 3PWTA 1J2RA 2ZJ7A 1FNSA 4UPDA 4PSDA 3KR1A 1A1VA 4A8HA 1ZM2A 5J4YA 5KYXB 1G8FA 5AH0A 1XP5A 4AFNA 4P6VF 5H0IA 2OV8A 4JYZA 1BJKA 3CRRA 5FDFA 1KYZA 4D9IA 3VO9A 4FOOA 1W29A 3WWCA 3MGKA 4HGYA 2E4WA 3C85A 3E4DA 4ITUA 4RY8A 3U7QA 2C3OA 5IVHA 4TN1A 2C4UA 1WXGA 1NAIA 1SH7A 1AV7A 2PXXA 3NHAA 4NK5A 2DBVO 2O6LA 4LXGA 3SE7A 3I5YA 1UAGA 2JEYA 4KPGA 4TXLA 1WD7A 4WBNA 4LI3X 5DLDA 1HNXB 3UKDA 4AJNA 4DHEA 1IQ0A 1K92A 3WLHA 1E66A 2AEEA 3EGIA 4UCFA 2CEKA 2XR1A 3H75A 4KSYA 1CEEA 2V3VA 1D2NA 1JDPA 3VR5D 4RTMA 3IUPA 1V1RB 2FUCA 1DAEA 4JELA 4XJVA 1IJFA 2PUEA 3E22B 3H8VA 2ACWA 1H5NA 4FNAA 5LKAA 4CKYA 4ZVUA 1UT8A 3K7EA 4A6DA 1JQ3A 3W9YA 1KK2A 2VHCA 1CVLA 3IJEB 5FPHA 5TPWA 1MVNA 1THZA 3RSLA 4W9NA 1OWOA 2ZAOA 8OHMA 4BFTA 2EOAA 4H16A 5TY0A 3MINA 1URPA 4D3ZA 1RTTA 3V4RA 2OP1A 4P2BA 4ZGBA 1KEUA 1QYWA 4IJMA 2PXHA 3DC7A 2QL6A 1C1DA 4OKSA 4PGAA 1X0VA 5CA1F 3HA7A 2AOWA 2VTEA 2ZQYA 4IF4A 1VZ2A 3PGVA 5JQGA 4R5HA 2J4DA 2A0KA 2ZT6A 4Q19A 1OT3A 3CU5A 1EYZA 3ORFA 5BT9A 4A2WA 1S6YA 2O8VA 3W9BA 2HPVA 3UT6A 4P33A 1WB5A 3DOIA 2XCIA 3FPBA 3N5KA 4OM7A 5LA6A 1ZWLA 1NW7A 4JXKA 5HPYB 2BFPA 3EGEA 4MWDA 1XTKA 3ZBUA 2XVYA 3O7MA 2DPHA 4LZNA 4P4GA 4CQLA 1WHSB 5L51A 3A4NA 3GGJA 4HNTA 4Y6OA 3SR3A 1J8YF 4DMMA 1T9DA 4JL5A 4Q3LA 3UBMA 3WTCA 4H60A 4I9NA 4D3FA 1QGYA 5FTMA 2NTJA 1XRPA 2F2TA 3C8DA 4AN4A 1YZHA 4KZKA 4KTTE 4F71A 2ANCA 2W93A 1DKLA 2HZBA 2IP2A 5JRDS 4YRAA 3I9FA 1QNLA 4NOJA 1H0HA 1W4AA 3F6CA 2WAXA 1HDRA 4G67A 3AIMA 4Z7NB 2ZG6A 4M7WA 4R8SA 2XBLA 1YULA 1FP1D 2C1XA 3M49A 3NYWA 4UEWA 3PNPA 3WZ2A 4BFSA 3GJTA 1CZKA 2Q62A 3NALA 4PU0A 1YB6A 5THQA 2O2ZA 1ONBA 4E2XA 4TKUA 5CFQA 1JECA 1Y9AA 2JFVA 2PGOA 4O4JB 3L6CA 4BN5A 1T4CA 5KQRA 1YR8A 2Q8NA 2Y68A 3CF2A 3HFJA 3R1IA 4MI3A 4BLRA 1F4LA 3HKDA 1HTBA 3K9HA 3KOYA 4MW7A 2QYOA 3ITDA 5EN4A 9LDBA 1JIKA 3X2FA 4LV6A 4EG1A 2PSDA 3R23A 4GL4A 2HY7A 2V7UA 1JFFA 2QX6A 3KT6A 3L7AA 3ZZUA 1JH9A 1R15A 4BJ5A 1WXEA 4WESB 1FSFA 4J9VA 1TLLA 3ZHOA 5K8IA 4UM5A 5G0TA 3P9QA 1PEDA 5SZKB 2QF7A 2AFVA 2PAAA 3PPIA 4DCVA 4ER5A 4CIAA 4DV2B 2WIJA 4ENTA 4YWHA 3LZ6A 4UQLA 1JEEA 1N2EA 3A7DA 2DG2A 3Q0IA 3EX7C 5FP0A 1IG0A 3SSAA 4NH4A 3LUKA 3PXDA 1J7KA 4C08A 1O95A 3VNUA 3W04A 1XRNA 3NIWA 2PIAA 4GSYA 1QH8B 1NT2A 2HYIC 3MS4A 3HDHA 4G5GA 3SD7A 4X7MA 3U48A 5FQOA 5F23A 3FB1A 3PFWO 3I6BA 3EZLA 4GZ6A 4TXHA 4DM4A 4U6SA 1Y42X 1JDJA 1Y4AE 2A35A 2Z8YA 4UM9D 5TQ2B 4F9GA 4RTJA 4GOND 2GN1A 1WZUA 5F7JA 2V5VA 4WDQA 1KETA 2ON6A 1Y7IA 1ZOSA 4OP3A 4EAAA 4EL5A 4JROA 1W5BA 3S2GA 4M0FA 1R6BX 3W3AH 1M75A 4MA0A 2ZANA 2JVJA 4ICIA 1D2HA 4IHJA 1GGEA 2A9PA 4O1HA 3RR2A 5BN4A 3AUJB 3DDNA 2EWWA 3COPA 2WYVA 1E2QA 1GR1A 4IFEA 2ZUSA 3EY4A 4H0CA 4LF5B 5CFNA 1ST2A 3NJ4A 2YNMA 3FRHA 4OV6B 2P5YA 2QY9A 2Z4RA 3ORQA 4IFIA 1NI4A 2ZRCA 4ER6A 2F7SA 4LISA 2B30A 4D4JA 1WCV1 3FKJA 5TQ0B 4W9MC 3ANXA 4ZCLA 1JLRA 4HSGA 5T7BA 2ZP1A 2YN4A 5HVNA 2GJAA 3A36A 1Z13A 2H00A 1RBYA 1UZAA 2MSWA 2FZVA 5E6RA 2I1VB 4F1JA 4ZIRB 2P9ZA 3WWPA 2QR3A 4D43A 3CE9A 3FKQA 2ODBA 3VR4H 1OZAA 2HRRA 3D3NA 2DHQA 3NHLA 4G5XA 2P9FA 4DR5B 2BFBA 2GLTA 3I83A 2HU7A 2O7NA 4E7OA 2BDTA 2Q4EA 3F8WA 4MR8A 4X1IB 3T1VA 4B7UA 1ZVKA 2I71A 2V98A 5G1PA 4B6QA 4XGIA 2PJZA 3U09A 2X8LA 4X6XA 4ACBA 2FDRA 4JLPA 2R68A 4HAZA 3M6VA 3QFFA 2H4WA 1QV7A 2ZS8A 2QXUA 5L3ZA 3WNCA 4W5WA 5CVVA 4EJMA 1A8UA 4NDZA 5DHUA 4DBZA 4OA8A 1U2PA 4GX0A 2R8EA 3WIBA 1GDHA 5JYCA 1H2WA 3QVGB 3P94A 4N48A 3I4FA 2MR5A 3CF0A 3N59A 4P7JA 2A9FA 1ZGJA 3M6XA 4RC9A 3QYJA 3B82A 1OTXA 2ATVA 4BQPA 4ZAVA 4OXRA 3ZVRA 4COOA 2JD1A 1FDOA 4Y8VA 5BOVA 5CT9A 1IY1A 2KSQA 4QGSA 4AP5A 4LRXA 3GRYA 4IVPA 3WRXC 5BQXA 5E1BA 3TLBA 4RGVA 1JL3A 5C1BA 5DGIA 1POXA 5IKXA 2RB5A 4GM4A 5FEMA 1NGSA 3HPQA 2VQ6A 1C7IA 2PZJA 2ZRNA 1NVKA 3IJPA 4TT8A 4CODB 1D6NA 2W6ID 4YJHA 4ZI7B 4C04A 3SMVA 5HZGA 2QUBA 1OXUA 2ZRHA 1U2ZA 2EF0A 2QPTA 4KRYA 4ILKA 5GGYA 3ZK8A 4BAZA 1ZRSA 5CYOA 5F5LA 1YR6A 1ITZA 2XMQA 4UBLA 4ZAXA 3GNLA 4CR7A 1JFVA 3ZIAA 2OV2A 2PLFA 4QOJA 3PCXA 3KKQA 2DFNA 2EW1A 2EW2A 2P0AA 3ZLVA 1C3LA 4AO8A 3P7MA 5I7AA 2K7ZA 5J43A 4RTNA 1EZ4A 1YJCA 5CA0A 1KSJA 4M38A 2AKEA 1T43A 3JR7A 4HDRB 3SBOA 3WYAA 1MJ5A 4WJKB 3OQVA 3LCMA 1Z6AA 2GM3A 3H84A 4Y30A 5IYZA 5HFNA 1NI5A 5BUQA 4XEHA 3LQRA 3E5NA 3TDKA 1L5NA 4KWIA 4X8LA 5MFPA 4AZ0A 3U9TA 4UUAA 4QPJC 2BHTA 4AJJA 4EJ2A 3VKWA 3RYHA 3MGCA 2X9GA 1WNFA 4A03A 4D4GA 4HGPA 4F6LA 3UB3A 2IRWA 1BHO1 2F3PA 3RKUA 3I2IA 1QF9A 4YMVA 1OXBB 3JALA 2PSSA 1LNSA 2Q4OA 3M9LA 3PEYA 5HRAA 3BFVA 2ERXA 2OCGA 4QSMA 4BOYA 3J81k 1QO0D 3D2LA 1O8BA 1JG3A 4N65A 4Z4EA 1X15A 1GO2A 1ZNYA 4DJAA 2V58A 3RC1A 3ORYA 3HYTA 2O2EA 1BH2A 1ZA2A 2I29A 1ACJA 1XRSB 2Y0CA 3CB2A 2AEJA 2ONYA 5GONB 3BJZA 2PXCA 1G9XA 3TUIC 3KJFA 3FOZA 1H8ED 5JJCA 1CEYA 1UDRA 1GN8A 3M5CA 2IYYA 4LN1A 1YSCA 2BMJA 2AI3A 4TROA 1YJQA 1P62B 5DBFA 3O5AA 3R9IA 1HYGA 4UEOA 1YFLA 5MN6A 2BFDA 4PZLA 2PNJA 4XPIA 4DEVA 3PS9A 3Q8LA 2XT9A 1TT5A 5K51A 4FXOA 5FPTA 5D5PA 3F98A 1KSHA 1CUSA 2JARA 3AY3A 4A4DA 3EIQA 1YGYA 4FDAA 5BV8A 4MRMA 3E81A 3WHLA 1Z33A 2IH4A 1CK4A 2FQQA 3UMJA 1I10A 2OCKA 1N6PA 1RPNA 3L92A 2HBYA 4BTVA 3EIXA 2Q7DA 2PVPA 2YUIA 6REQB 1SUCA 2J45A 1YS9A 1W6UA 5HHTA 1JDSA 4XR9A 5G3ZA 4CDGA 3VOBA 1NVVQ 7ABPA 5MFZA 1XZBA 3HV0A 1U0RA 3Q5GA 3T5GA 2R1VB 3I42A 1QCCA 3FCCA 3NRBA 4CFYA 10MHA 3H18A 1MQSA 2QM0A 2X0DA 1N34B 1HE2A 2FZLA 4BKOA 5CA1B 3B9RA