1F0PA

Mycobacterium tuberculosis antigen 85b with trehalose
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
284
structure length
284
Chain Sequence
SRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ANTIGEN 85-B
publication title An interfacial mechanism and a class of inhibitors inferred from two crystal structures of the Mycobacterium tuberculosis 30 kDa major secretory protein (Antigen 85B), a mycolyl transferase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 105
structure length 284
sequence length 284
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2000-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1f0pA00
5CTAA 1HBJA 1XZCA 4EA6A 4WDQA 4HVTA 1ZJ5A 1JMKC 2PPLA 3SC2A 1ACLA 3I1YA 1E5TA 4K6KA 3GZJA 1VE7A 4BZWA 3IIIA 3DYVA 4UBLA 5HF8A 2ZJ7A 1RYYA 3DKKA 3NOXA 2Z3ZA 3HC7A 3I1IA 1XLVA 3IB3A 1W6RA 5YASA 1Q84A 2XMRA 2YASA 4P08A 2ORYA 3CCCA 4AQDA 2H1IA 2H7XA 3NUZA 4WFKA 1QIFA 2K2QB 5BWBA 5C81A 1AZWA 1HQDA 4IQ4A 2PM8A 1ODCA 2UZ0A 2VATA 5JALA 4D9JA 2OCIA 4G4IA 2OAEA 1GQSA 4AO7A 2HA5A 1ZGBA 1MT3A 1YA8A 5LKAA 2I03A 4OSEA 3ESCA 1IZ7A 2QS9A 3IURA 1EDEA 5SYMA 3PI6A 4NS4A 3MUNA 3EQ7A 1CUIA 4XX1A 3C6XA 2XI4A 4J0JA 3A2LA 1QTRA 4FLEA 3TJMA 2BKLA 1R3DA 2QTBA 3KDAA 3ZLVA 3H2IA 5AKLA 3TRDA 2PSHA 4LXHA 3FWHA 2EDCA 1QOZA 4NVRA 5A7GA 4UFOA 4XWGA 1XQYA 1JKMA 1UXOA 3RARA 3FNBA 3BIXA 4WCVA 1P0QA 3QH4A 1ODTC 4KYVA 1HPLA 3H2KA 3ICVA 5AK6A 3DNMA 2HA3A 1TIBA 4UHFA 3T52A 1LLFA 1YAJA 1TRHA 5DNVA 2ZSIA 2ZYSA 5HFAA 4QDTA 5HKBA 3Q8WA 5DTIA 1EI9A 4CI9A 3C87A 1ZD3A 4L3WA 4BRZA 1CUUA 2HA2A 4C89A 1ZIYA 3ANSA 1AQLA 2H9YA 3E3AA 2WHPA 1W1IA 5AM4A 3G8YA 4H18A 1DWQA 1KEZA 2WG1A 5CRIA 2VJCA 1E89A 5D3KA 2Q0XA 4X3CA 5EIAA 3WWPA 5LZ7A 3C6YA 3FVRA 4BCDA 4B0OA 5JZBA 3STXA 2OCLA 4Y2VA 1MU0A 3Q0TA 1CPYA 4AZ0A 2DQZA 4BAZA 1LBTA 4KRYA 3FOBA 1JU4A 4ITVA 1EB8A 5JD5A 1JJFA 1O6GA 2WJ6A 4DSZA 3QVMA 4L72A 1X2EA 4QLOA 1XZAA 3W2TA 5AM5A 3RM3A 4UBOA 5EHZA 2ZJ6A 2XUKA 3G9XA 4EY6A 1CUDA 2H7CA 1VKHA 3H04A 2JGJA 4BDSA 4FBLA 3VJKA 4JH0A 3V9AA 1IZ8A 2O7RA 4B80A 5AM1A 1J1IA 3FLBA 4G9GA 4Y2JA 4PSUA 4PO3X 4KRXA 4FMPA 1MX5A 4TVKA 3DYIA 3PFBA 4OB8A 4LIPD 1N1MA 3G9TA 2I78A 5DYWA 3IUMA 1QTIA 2OGZA 1QIMA 4BCCA 1SC9A 3SX4A 4EB0A 3WK5A 3D3NA 4I19A 3R3WA 3VDXA 3U0VA 4U2GA 2QXUA 3V1LA 1S8OA 5AIBA 4HAIA 1THTA 4G1FA 3H1BA 1AKNA 3F9CA 5H3HA 1D07A 3C70A 3HEAA 4KE7A 5HQ3B 2WILA 1WOMA 2XMCA 2VAVA 3D7RA 2DSNA 1YAHA 4W9RA 1GT6A 2B20A 5AK4A 4J03A 5ALFA 4KE8A 1E8DA 3D2CA 5AI9A 2C58A 2WG2A 4P9NA 5KBYA 1W4LA 4OD0A 3AZQA 3G0IA 2BAGA 1SFRA 4KACA 5CT4A 3R41A 2VT7A 3TGLA 1QFMA 2QM0A 3WK7A 4N8EA 3LP5A 4BAUA 4P93A 4A5SA 2VJDA 3HI4A 4B9AA 2CBGA 4ZGBA 3O4JA 3ZV7A 5EHNA 1XRRA 1JT2A 3I2GA 4FKBA 4W63A 3LIIA 4UFPA 1DTEA 1MTZA 2VA9A 4B85A 4UHEA 4UHCA 3W04A 3KWFA 5ALHA 4Z49A 4FNMA 4N5HX 4BP9A 3B5EA 5LZ8A 3F98A 4IHAA 1K5PA 3IDAA 1A8SA 5IKXA 3WKEA 2BUAA 2Z8ZA 4G8DA 1U4NA 1BEZA 5FP0A 3D5EA 2HFKA 1JJBA 3FCXA 3WA7A 4ZRDA 1P0IA 1EX9A 2XB6A 3BF8A 5ALNA 3BL8A 1JMYA 4DMKA 2WFMA 3VVLA 4ZWNA 4IO0A 3IA2A 3KOOA 1XZEA 2XUIA 2QZPA 5EFZA 2J3QA 3D0KA 4Y2TA 2WKWA 1DQYA 1USWA 5D7BA 4BC1A 4B83A 4KR0A 2VF2A 3YASA 3WK4A 4KJXA 2O2HA 2GBIA 4X6YA 1JU3A 1FFAA 4IH9A 5JAOA 4Y7DA 2RGUA 3F97A 3IUJA 1N5RA 3DEAA 3I6MA 5CURA 4U2DA 2FJPA 2XUOA 1G66A 1DWPA 4F60A 4A16A 2AXEA 4HRXA 4FNGA 5AKZA 4J0HA 3VXKA 4E14A 1IUPA 3QPCA 5ALMA 1ZGCA 1BEEA 2WTNA 4QDUA 1R88A 3BDIA 4H7DA 2O2IA 4CFSA 2QR5A 5AI0A 4AO8A 1CUYA 4Y9SA 3WWCA 1BN6A 4DNQA 2EEPA 1EK1A 4BE4A 5AHXA 2GBGA 4Y2XA 5EIHA 3OG9A 2G4LA 1CV2A 4F21A 5HK8A 1E3QA 1E8NA 1FSSA 2C0PA 3H1AA 4J0KA 1XZIA 2QT9A 2X5XA 3UUEA 2DR0A 3WI7A 1ZD2P 4RE6A 2JEYA 3QM1A 5FLKA 1T4MA 1OILA 2V96A 5A2GA 3CCBA 4DMCA 4EY4A 1NU8A 3JWEA 2WHPB 5T4EA 5DLPA 1XRQA 4PV7A 1CEXA 5A7FA 2W22A 3OOSA 1ISPA 2OGSA 1F8UA 4G8CA 1AMNA 2XMGA 3MVEA 4ZI5A 5AK3A 4DNOA 3I6YA 4Y2UA 3STTA 1CUFA 5AKGA 2O2GA 2JGMA 1MPXA 2WU4A 5IVHA 1VE6A 1BS9A 2QJWA 2BGRA 4C4YA 1MX9A 2BUCA 2QOEA 2HU5A 1QIJA 1M33A 2PUJA 2JF0A 3PE6A 5AOAA 5ALYA 1CUZA 2WFLA 1YASA 4DMFA 2XMBA 2W6CX 4MWSA 2RHWA 5CH3A 2VTVA 3W06A 5K5EA 2OAGA 2HHAA 4W1RA 3AILA 5DYTA 3A6ZA 2XMDA 5AKHA 4J0IA 4UBKA 1UFOA 3H2GA 3N2ZB 1CFJA 2PSEA 1WPRA 2FJ0A 5HF9A 1WB6A 2J4CA 1TCCA 3R0VA 2OQVA 1AGYA 3OURA 1DX6A 3WL6A 4X93A 1U65A 1XZGA 4WFIA 4ZREA 4JYMA 2XLCA 1QONA 4QDOA 2O7VA 3AZOA 2V97A 5JD4A 2OCGA 1DINA 1CRLA 1UK7A 3T4UA 5ALXA 1DX4A 5JAPA 2D0DA 1A88A 5LIPA 3O9VA 4I3FA 2H7YA 3OM8A 5DYYA 1ETHA 4A23A 1H2WA 3FYUA 2WTMA 1Q0RA 2ECFA 1CUWA 4HXEB 3BXPA 1UKBA 1VLQA 1GZ7A 4MEAA 1GKLA 1H22A 1XKTA 2QRUA 1L7QA 4EY5A 1IMJA 3NGMA 5LYYA 2XT0A 5E4TA 4CCWA 4FFVA 2C5FA 5HKAA 3B3QA 3QYJA 3QITA 4GWLA 1ZJ4A 3PICA 5AKYA 1XZFA 2HRRA 4QDZA 4KAAA 4BE9A 2WIFA 1F6WA 5AOCA 5DWDA 2XUAA 4Q34A 3LIPA 3AUKA 4J7AA 4KE6A 4EUSA 5KREA 4OB7A 1E66A 2RI6A 3B12A 1GPKA 3ED1A 5EGNA 3VKFA 3JYHA 2ZJFA 5BWCA 4Y2QA 5HZGA 5JARA 1LPNA 4X94A 1CQWA 1CLEA 2ES4A 4Q05A 2Y6VA 4GHWA 1BU8A 1QZ3A 1X70A 1GXSA 4AB1A 3L1JA 5ALDA 1Q0ZA 4YASA 4CIBA 2WU3A 5JASA 2FX5A 3WJ1A 4QZVA 1WM1A 1W52X 2WIKA 1AURA 2PU7A 5DNUA 5CMLA 5AK5A 1LPAB 2XUGA 3D2BA 3FSGA 4X91A 3M3DA 2XMZA 2WFZA 4WJLA 4GW3A 2VJAA 3H19A 2ZSHA 3GBSA 4Y2YA 4HXGA 4OYYA 5IVDA 4PSCA 2PSFA 2WM2A 2VAXA 4PQEA 2WUEA 4H7FA 3HJUA 1BE0A 3G9ZA 4EBBA 2C0QA 3PUHA 3E1GA 1C7IA 2XUDA 4FFWA 2GYWA 1GPNA 1TAHA 1N5MA 4LKOA 5JZSA 5IH7A 1TCBA 5ALOA 3LCRA 5CH8A 3O95A 2XUFA 3KWJA 4KAJA 3EQ9A 2JBWA 5AM3A 1XZLA 2CJPA 1EXWA 1NU6A 3X3HA 1A8QA 1DU4A 4UBJA 5C8XA 1LZLA 5ALWA 3V1KA 3WK8A 1ZD4A 3BE8A 4CIAA 5FPQA 1HL7A 5ALUA 3ZWQA 4DNPA 1UK6A 1MNAA 1LGYA 4LHEA 4UFNA 1F0PA 2JIDA 3WIBA 4QE3A 4BVJA 1XLUA 1XRNA 4X90A 1PFQA 1QIEA 1H2ZA 4OYLA 4FDMA 5LLSA 5KWIA 4ZV7A 5K3BA 5A71A 4N8DA 5AJHA 4BVLA 3VJMA 3IUNA 3V1MA 1VXOA 4F0JA 3S8YA 5AI4A 5E4YA 2WFLB 3QBJA 3M82A 4H7EA 2ROQA 4UHDA 4GEGA 4C6HA 3I6ZA 2XQGA 5BV7A 5ALRA 1J07A 5JANA 3C43A 2JGFA 3R3XA 4JUIA 2PVSA 4H7KA 2AJLI 1SCKA 4E11A 3GROA 3I2JA 4AN1A 4X00A 1L7RA 1C7JA 3W05A 2RONA 5CH5A 3STUA 5AO9A 2HFJA 3HXKA 5FXMA 1BN7A 2XUHA 1VZ3A 3QZUA 4CG2A 5AH0A 2IX9A 4K6GA 4AMYA 4X95A 3WZMA 4MYSA 4H0CA 4UHBA 4ARBA 2BUBA 4YX9A 4C01A 1QJ4A 1VZ2A 4FLMA 1G4HA 2PBLA 4HXFB 1DT3A 3WL7A 1ZD5A 1AUOA 2OPHA 4GI1A 3C6ZA 3FAKA 2DHDA 2HU7A 2PKYX 3DJYA 3HRHA 2WG0A 1BROA 1YCDA 4RE5A 3RKSA 3DOHA 1UOOA 2J4FA 3HZOA 5AM2A 1ZOIA 3H2HA 2VEOA 1UK9A 4RGYA 3OC0A 2ONCA 4H7IA 5ALJA 5EHXA 4LYEA 4J3JA 5ALVA 2G5TA 2HADA 5JAHA 4FWBA 2WUDA 3I2HA 4XJVA 3ZLTA 1R4ZA 1AX9A 3DS8A 1XZBA 4AX4A 2XQKA 1EDBA 5I9IA 3ESAA 1XZDA 5CBKA 1XRLA 4XVCA 1HDEA 4UBNA 3KXPA 1JJIA 4JEIA 1QE3A 2G5PA 3R3UA 4Y2SA 3DQZA 3ZLUA 1BCRA 5ALZA 4GECA 1MO2A 4ARAA 4L0CA 3V1NA 2HU8A 4CG1A 1E8MA 1IUNA 4FLFA 6YASA 3NWOA 3G7NA 4BCBA 3DD5A 2GZSA 2E3JA 3L1HA 2D5LA 3WIOA 1CUJA 3K9BA 2HL6A 5HF5A 4E15A 5HFNA 3VJLA 2Z8XA 1EHYA 4Q3LA 3WKAA 4C87A 2Y6UA 3DCNA 3FYTA 4DYHA 5AKXA 1KU0A 2J3DA 4YK7A 5ALEA 3EIOA 1ORWA 4BDTA 3H17A 3H2JA 4MWTA 1UKAA 4XIIA 1BCSA 3G0GA 4QA9A 3ZPXA 2C4HA 2CEKA 3VVMA 1OXMA 4DSAA 3VISA 4U2FA 1EVQA 1DT5A 1B41A 5F4ZA 1XQWA 5KWJA 3AIMA 2ZVDA 1ODSA 2PUHA 1CUGA 3WL8A 2B9VA 3IUQA 4WY5A 3DLTA 4B0PA 4X6XA 4EY7A 3FYUC 2XMSA 1LNSA 1CVLA 1BRTA 4Q1VA 4U2CA 3M83A 2HA4A 4J0CA 4BP8A 1K6EA 4OCZA 4B81A 1MJ5A 2GBFA 2QUAA 2HIHA 3E0XA 3C6BA 1WB4A 1TQHA 2QMQA 4MXDA 3H18A 4DTCA 4PW0A 3WYDA 2ACEA 1XZMA 4PNZA 3HSSA 2QVBA 1R50A 4J0DA 3HACA 4Q3OA 2ACKA 3QMVA 1W76A 1DQZA 2X76A 1FJ2A 2GZRA 5EHQA 2WJ3A 4U2EA 3STVA 3R40A 2WUFA 2WHRA 4GDMA 4C4ZA 4FOLA 5FRDA 4WDRA 2Z3WA 4DIUA 1TK3A 1XLWA 5C7YA 5A6VA 3AINA 1MN6A 2QUBA 1P0MA 2EDAA 1FFDA 1CUSA 3ILSA 3PDCA 4QEKA 2B61A 3I28A 4LXGA 1QIGA 1GPLA 2HDWA 2XUPA 2YH2A 2IITA 5K3DA 2XE4A 3QPAA 1N8SA 3R3ZA 5AI5A 4G5XA 4C4XA 1EINA 3KD2A 4YPVA 2DCMA 3R3YA 5AI6A 4QDXA 1CUHA 5C8VA 4H35A 2VJBA 5CXXA 3WQHA 2HA7A 2OGTA 1ZICA 2P8SA 1YR2A 3TEJA 5DJ5A 2JGEA 4H7JA 3UMJA 2Y2UA 1G42A 4Y2PA 2HA0A 1WHSA 3G0CA 3WK6A 1WB5A 3G9UA 1L7AA 4P92A 1H2XA 2XDWA 1P0PA 2VT6A 1LPSA 3WKBA 3P2MA 3RK4A 4HRYA 4DNFA 2PX6A 4AXBA 5ALLA 1EDDA 4RNCA 3FVTA 1K4YA 4GXNA 3DL4A 4FBMA 3D59A 4EY8A 1EH5A 1Q83A 2JGLA 5AKIA 2OQIA 4OUKX 4B6GA 3I2KA 1EK2A 1UKCA 1XKLA 4U2BA 1XZKA 3A2NA 3PUIA 4AO6A 3C5WP 3IVMA 2GYUA 2BJHA 2I3DA 2WSLA 4MEBA 4UBIA 1EVEA 4OPMA 1CIJA 1HKHA 5LZ4A 5HK9A 3SWWA 1NX9A 1QFSA 1VOTA 3LLCA 1MNQA 1ZI8A 3ESBA 4Q82A 3DDUA 4W1PA 3WWEA 2Y2VA 3DKRA 2WHQA 4BVKA 5AKKA 4AN0A 2WIGA 2WUGA 4Q3KA 2ZYHA 1AC5A 2V9ZA 2VSQA 2XUJA 5FPPA 1RWQA 4OU5A 3FCYA 5ALSA 1I6WA 5FKJA 4IH1A 2RHTA 1XZJA 3G02A 3F67A 1A7UA 4G8BA 5I8PA 1Z68A 3U1TA 1R1DA 3GUUA 5AICA 3C8HA 3AZPA 4B82A 3GFFA 3G0DA 5FV4A 3W9UA 3M81A 2CB9A 4MJ3A 3WA6A 4BTLA 5E4JA 5IVIA 3S2ZA 4HTAA 4BAGA 4G9EA 1UOPA 2BGNA 1GKKA 3EF3A 3KSRA 2RIPA 3AJAA 3C8DA 4I4CA 5C8ZA 4BC0A 3WK9A 5EIEA 2NW6A 3QMWA 4IH4A 4INZA 2DFPA 5LZ9A 1ACJA 1UT6A 1CQZA 4K6HA 1VA5A 4M0MA 1EA5A 4X85A 1J2EA 4X7BA 4BATA 1ZI9A 1QIKA 3OPMA 4WY8A 3WKDA 4F5ZA 5T4HA 5JAUA 1Y7HA 3GELA 4DGQA 3BJMA 5ALGA 2JEZA 4TGLA 2WIDA 3O4GA 5K3FA 5JIBA 3N0TA 2I3ZA 5K3EA 2PL5A 5DTJA 4EZIA 4M0EA 4L9AA 3A2MA 1YS2X 4V2IA 4JYPA 5AKEA 5ALTA 4AZ3A 2RAUA 3MUOA 1GGVA 4BB0A 1XQXA 4PSDA 3D2AA 5FDFA 5CT9A 5J3JA 5AOBA 1LZKA 2VQ6A 4O08A 4ROTA 3E4DA 4QWMA 5D3ZA 3UUFA 5I7UA 3CN7A 3HLKA 1LPMA 4S0XA 1Y7IA 4KE9A 4TPKA 1YB6A 5ALPA 3FBWA 1QIIA 1FFBA 4CCYA 2HA6A 1ORVA 3WL5A 3G0BA 1CUAA 2AJDA 3CXUA 3A70A 4AMZA 1CUXA 3CN9A 2GYVA 2XMQA 4ETWA 4X71A 1ZI6A 1VXRA 4N8SA 2R11A 4NMWA 1W75A 1MX1A 5SYNA 4K5QA 1QGED 1LPOA 1UK8A 3OTQA 3WMRA 3L1IA 1FFEA 2XQJA 1XRMA 1Y37A 1EB9A 1GQRA 5AKJA 3SK0A 2C5GA 4UBMA 5JD6A 1IVYA 4LXIA 1R9MA 3QMMA 3FLAA 1C4XA 4MYDA 4DLNA 1X2BA 2XLBA 3I2IA 5JZ9A 4NZZA 1QIHA 5A62A 2OCKA 3WWDA 4UUQA 1VJ5A 1WCYA 5ALIA 5T4FA 3STYA 4DM7A 3ICWA 2Z5GA 5DNWA 1DWOA 4LYDA 2JGKA 2ZYIA 1SOMA 1FFCA 1VA4A 2GBCA 4GLBA 4BRSA 1LPBB 3FYUB 5AM0A 5LP1A 3H0CA 4CG3A 1QO9A 1R9NA 1F0NA 3O0DA 1SCQA 2WQZA 4HS9A 4HZGA 5AIAA 5EI5A 3DOIA 4J0GA 1J06A 2BCEA 4DMHA 3BJRA 5JYCA 5K3AA 4Y2RA 4H77A 4JNCA 4X6UA 4FTWA 5HCUA 2AJBA 1CUBA 2CMFA 3JW8A 4QWWA 3K2IA 4N5IX 4ZXFA 4RPCA 3DL7A 4GBGA 5IVKA 1KU6A 4UHHA 1U2EA 1TKRA 5CW2A 1LPPA 3WKCA 7YASA 2QXTA 3W9BA 4BYMA 1WPXA 1CUEA 4W1QA 1TCAA 3STWA 2X8BA 2QJRA 2OLEA 4KAFA 2HM7A 1YS1X 1THGA 3WLAA 1CR6A 2CZQA 1XFDA 2OG1A 2YXPX 3ANTA 4UPDA 3F96A 1QO7A 1H23A 3WWOA 2PU5A 2G63A 5ISMA 2ZYRA 1XRPA 1JI3A 4BZZA 3C5VA 5AI8A 5A7HA 3C45A 5CXUA 4E46A 5HF6A 4KEAA 2CUTA 3PFCA 2WJ4A 4C88A 1CUCA 3GA7A 4B84A 1B6GA 1PV1A 2AJ8A 2JGIA 5LZ2A 1JFRA 1T2NA 1QLWA 5ALKA 1QIDA 3WJ2A 1CUVA 3IULA 1H2YA 3ESDA 1MAAA 1PJAA 1YSCA 2CKMA 3O4IA 5ESRA 3BDVA 1LBSA 1YB7A 1WHTA 3BIWA 4B9EA 3AFIA 4MQLA 5CT6A 2QKYA 1UZAA 4QNNA 3F8SA 4BBZA 5AP9A 4M0FA 3V48A 4X92A 5CT8A 5LZ5A 4X97A 3EQ8A 1K8QA 3I2FA 3AIKA 5BOVA 3RLIA 2XUQA 3EBLA 1G5FA 1U8EA 2HRQA 1ZIXA 5K3CA 1IUOA 4G4JA 2XQIA 3K6KA 4OU4A 1SCIA 2FUKA 3FSGD 5CT5A 3ZI7A 1MAHA 1OCEA 2PSDA 2Y1KA 1A8UA 2XQFA 2WIJA 3O9MA 2DQYA 5ALQA 1HLGA 4G4GA 3WZLA 4MQMA 2PSJA 2WLSA 4W1SA 2LIPA 5K3FB 4EHBA 1K63A 2IIVA 3MGAA 3PF8A 3QPDA 4QLAA 2OXEA 3BF7A 2YYSA 1UOQA 3PF9A 4WFJA 5JADA 2AJCA 2C7BA 4B7ZA 5LKRA 1XROA 2R8BA 3IBTA 5FUMA 2B4KA 5D6OA 4ZV9A 2DHEA 2V98A 1YA4A 3HABA 1O6FA 3D4LA 3O4HA 1XZHA 3LS2A 5E2IA 4PF1A 3BWXA 1UWCA 4H7HA 4K2AA 4FHZA 3WYNA 2DHCA 2BFNA 5JATA 1XQVA 3AIOA 4OB6A 5HQ3A 3FLEA 4CCYB 4BTVA 3HYSA 5FOQA 1RP1A 3R3VA 5T4BA
chains in the Genus database with same CATH superfamily
2R751 2IKQA 1WD5A 3C1UA 3RD5A 4EA6A 3MXTA 1CR1A 4P53A 4P7BA 2AYZA 3UWDA 1AY0A 1OC2A 1XYGA 3E58A 3PEVA 3FMVA 3TINA 1RRKA 1YRBA 1C0IA 1NNI1 3NATA 1IK4A 4BMPB 5DTQA 4OL0A 2GJKA 3HCDA 2GNAA 4JR2A 1PEKE 4TX1A 1ACLA 5LWHA 1XNHA 4GL4A 4J2OA 5E0OA 1ZPDA 3LFHA 5FNVB 1RCFA 1XCBA 4KQIA 4K6KA 3AF4A 2JKVA 3FZQA 3S6JA 4DJAA 2IBTA 1SXGA 3DYVA 1JLLB 5DN6A 5F4BA 4US1R 3T0IA 3RSHA 2ZDHA 5BSMA 1ZM4A 2WDZA 3V4RA 1NI3A 4QAJA 1VE5A 3WO0A 1PDOA 2ZJ7A 3DWFA 3DLAA 1RYYA 1F2VA 3UJ9A 3PYLA 3P0HA 1X7WB 2GN8A 4BQEA 3IA7A 1RZVA 3DJFA 5KTTA 4CU5A 3BH0A 2Z3ZA 3GH3A 3WGTA 3HC7A 2AZTA 1T36B 4FZVA 1XLVA 4QYWA 2GN0A 2FGKA 3UK2A 2YX1A 1FVOA 1WNFA 4KX5A 3A9VA 2CNWD 1D4ZA 1ZC3A 4KV7A 2JHGA 5FULA 1E4VA 3TI7A 2XMRA 3KSBC 2IZ0A 1TIKA 2ORYA 1IM8A 3GLSA 4EGAA 1X39A 4Z53A 3CCCA 1V26A 3OM9A 1T91A 4PONA 4F06A 5JSZB 1VLLA 3O5AA 4JFRA 1A4UA 2NOAA 1T5DX 2OORC 3OIYA 1PN3A 1PK8A 3NUZA 4MR8B 4TZTA 4U9UA 3GHYA 1WDWB 1QIFA 2UUCB 3THOA 3H84A 1MC5A 2K2QB 4DV7B 1JYSA 1M5TA 3F6CA 2YR0A 2Y27A 2H0RA 4KR9A 3W3AD 1BYUA 1HQDA 3A3OA 2PBZA 3AWDA 2CE2X 4WKPA 2PRKA 3MC1A 2JI9A 1PR0A 3NDPA 3ZHSA 4CQMA 1P7VA 1HETA 2FN9A 2XWPA 3QA9A 4P4NA 3U3KA 3DCYA 2PM8A 2QBYA 2PMWB 1E2JA 1YZLA 1J0DA 2FY8A 4BX2A 4Z5XA 3AI3A 4JCCA 5H3LA 1V16A 4FR0A 1UJ4A 3DBLA 3PD0A 1EBUA 1CY6A 3CF4A 3JRXA 2H5IA 3MS2A 4C2UA 3M5PA 2CFIA 1ZMXA 1U3UA 2Z43A 5E38A 1E9BA 2OAEA 7REQA 5BXQC 1IBLB 4PFQA 4Y67A 2WSBA 5DM60 1JFFB 2BMDA 3IEVA 1DWUA 2P68A 3F5DA 3A6LA 4D96A 3HNOA 4JB0A 4D9NA 4JBYA 1YF3A 1T2CA 1G21B 1ZGBA 4G0NA 4Q3BA 2VP2A 4G5YA 1YA8A 1E3LA 4N40A 1AUXA 1PS0A 3U4CA 4EYEA 1RIFA 5HRCA 3Q85A 2I03A 3TQIA 5KYWB 5LKAA 3B53X 2PXXA 4HDRB 2BDUA 1OAOA 2JJ8A 3CH6A 4I5FA 4IJKA 4YRZA 2UDPA 1K0UA 3IURA 1FTWA 1U1EA 2NUTB 2JARA 1NN1A 2EL7A 1UZMA 2P67A 3GCXA 4N5DA 2O8VA 1YVUA 2INGX 3SNHA 3PR2B 1OUMA 3BXZA 4EG5A 1LX7A 3UAWA 4X41A 3S5JA 3BHIA 3ZIUA 1FXSA 5KO2A 3KOWA 5F2OA 3T3OA 1WX1A 2HHLA 3HCCA 3MUNA 3TTTA 5F76A 1CUIA 4XX1A 1RM3A 3BZUA 3AI2A 3VBCA 1L5RA 2GPTA 2QP3A 1I2MA 2XI4A 3DOEA 3KJFA 1COWD 1LRLA 3A1WA 5LYJB 3A2LA 4OGKA 3CUTA 4ZI7F 4EF6A 3W6PA 2BKLA 1GPAA 1R3DA 1UFVA 2VDJA 3IHLA 2GLTA 1NVAA 3ZLVA 1UAYA 4UU8A 5AKLA 3RVSA 3TRDA 4BJ6A 4X3PA 3EQZA 1RWXA 2CZGA 5HCIA 1KDVA 2AS0A 2VZ9A 5DM2A 3H97A 2EDCA 3TW6A 5GJVC 3ZS9A 2ID8A 5IF3A 4NVRA 4RV9A 1X6VA 1EUDA 2YHBA 5BMVB 4KX3A 3I6IA 1TJNA 2Y1CA 5ESWA 4XWGA 1KMHA 1UXOA 2A6PA 2Q2WA 4EAAA 2PKXA 3I04M 3HL4A 2IH2A 3FNBA 2I62A 3BIXA 3I4FA 2YJ3A 4GLFA 4WCVA 5HMLA 2GVZC 4JOSA 3I9NA 1GA1A 1T9GS 2EERA 4D9GA 4G4SP 3WP1B 4O2AA 5CM2Z 3RUFA 4F2WA 5DLDA 1U8TA 3BPSA 1PNRA 2VDKB 3BC1A 1HPLA 1U0EA 2CDRA 3WOHA 5AK6A 2HA3A 5HS4A 1U2PA 1WXGA 1JYEA 1TIBA 4BFLA 4PRYA 1TE2A 1XU9A 4TMVA 3U3DA 4PAMA 1TB4A 2Q28A 1FW6A 3IJRA 4NBWA 3DO8A 4UU0A 3FVWA 5BQ5A 2Q5IA 3NTVA 3ZU4A 1R5NA 1TRHA 1DKRA 5DNVA 5IDWA 2NVUB 1HO3A 2Y68A 2QE7A 3WL3A 3TSOA 3ENZA 1CJSA 1JQDA 2XT6A 5HFAA 2XYVA 3RBVA 2DETA 3Q8WA 1N5KA 1EI9A 3FNHA 3FPGA 3KKNA 3ON5A 1WNTA 1P1FA 2UYHA 4TV9B 2CXSA 2PT5A 3QKIA 1SUDA 5EJMA 4ZGGA 1P4AA 2VCHA 3JALA 3O7MA 1QYVA 2X0NA 4YS6A 2I7DA 1CUUA 2Q9CA 2HA2A 3L7AA 3OZDA 4DL9A 4ZYUA 2HREA 1V8ZA 3ANSA 4DUGA 3E3AA 4Q15A 4PLFA 4OFBA 1JZQA 3G8YA 5DDIP 4REMA 3UQYS 4HN2A 4CU2A 4YRCA 5DNEA 4ND8A 1YTLA 3CZPA 1NIJA 1I4TD 2YS7A 4ALJA 2ISQA 3MXOA 4ZVTA 5JWHA 4IGFA 4B79A 3A06A 4ZTBA 5CDGA 2AOUA 1K98A 3VKWA 4CHGA 4IIJF 4OMUA 4X3CA 3QXJA 5KTOA 1NXQA 3TPFA 1P74A 1IB0A 1PUIA 3WWPA 1WHTB 3NOQA 2WT9A 5HSGA 1E5VA 1ZM7A 5JZBA 1Q0SA 4Q18A 5L3VA 3PU6A 1MCZA 3Q0TA 5AVTA 2QN3A 3A1UA 4AZ0A 1X1SA 5JG7A 4CDGA 2CZCA 5KOJB 5GZ1A 5CA1B 3A58B 3RFVA 3NAQA 3OBBA 3VR4H 1TZMA 4E1AA 4BAZA 4GG1A 1XD2A 2RGWA 3UW1A 3QKUA 3ZWNA 1Z5NA 5EE1A 5GJCA 1Z63A 4WECA 3ZX4A 4NY1A 2BY4A 3W5DA 4J49A 5EMHA 1DBRA 1IG3A 2RI0A 4X84A 3JATA 2QEQA 3K6JA 4Z8YA 3GRZA 1DAKA 4DA9A 4MV0A 3SBXA 1JJFA 1O6GA 2FPWA 5B3JA 2R6R1 1NW9B 4LZOA 4N76A 1XVIA 5BP7A 2EKQA 2HIGA 7AT1A 2J5QA 4YJHA 2V3CC 4L72A 5CG1A 3ZE8A 4L51A 5IT4A 3D8UA 3IV7A 3K94A 3LCUA 4LDZA 4QLOA 2PO5A 5IC6A 5FOWA 1XZAA 4H3HB 1Y6RA 4I4TF 1CJUC 4WK4B 5FA6A 1US8B 2VYNA 3EPLA 3GFOA 3V80A 1DXYA 3Q9LA 2X0IA 4HAZA 4M9XA 4PAWA 4LISA 2YMPA 3MILA 2PNJA 3CKKA 2R4TA 3B51X 2XUKA 3TB6A 3H05A 4P5DA 4TS1A 3RU7A 2XA9A 4II2A 5ECDA 6PFKA 4QTZA 4KNYA 4NLLA 2FV8A 2NV0A 3GV0A 1WETA 4J0EA 4LY0A 2YV2A 3W2EA 3DZ8A 4ZCMA 4HAUA 1D1PA 3NONA 3WGKA 2LVBA 4B17A 4Q4AA 2ATVA 3LTNC 3KLNA 4YTEA 1SHTX 4FBLA 1UUFA 2ZZMA 2IZ5A 3PDJA 2QGNA 4GMFA 4BNXA 5CIQA 4C07A 1BXGB 2WWXA 3PHIA 1OLSA 2V5VA 4MCAA 1KTIA 1IZ8A 4JOBA 4P3NA 2O7RA 5SY9A 1RYDA 1KFBB 4IIGA 2M9MA 2WM3A 1MQ8B 4OHYA 4YMGA 1RTTA 3LF1A 2C8JA 2HO5A 4PO3X 3CONA 4KRXA 4FMPA 5EJ6A 1W29A 1MX5A 1YONA 2JVJA 3PFNA 4TVKA 3THYA 4AKGA 5KNDD 3EF1A 3GJ7A 2XNDA 2BKXA 1LS1A 1T15A 1XVVA 1Q3HA 1EFRD 2WDPA 4HC4A 1P0CA 2W48A 5TRTA 1Z5ZA 4ND7A 3DDOA 4TLLB 1IBMB 3UW3A 2A9VA 3BMOA 1T9ZA 1DCFA 2RMKA 3SZRA 2I78A 2Y1GA 3SS7X 3T5AA 3PVZA 2AC7A 4EIWA 4S35A 4P3XA 1JVNA 4L4YA 5G1PA 1Y5MA 3HKEB 4KUHA 2Y8EA 1QTIA 4D74A 3IAXA 1RMQA 1Z6TA 4MO9A 2I1VB 3ZJYA 4BCCA 1SC9A 1MENA 2CVOA 3K53A 3SY8A 1R9JA 1IQRA 3KZXA 3RRJA 4C76A 2ZBQA 1PVOA 4I19A 4W4TA 5HTOA 3P9KA 1XLTA 4MQFB 2CK3D 5EUQB 4A0HA 2XCUA 3H5WA 1FDWA 3MLAA 3VDXA 3FPAA 3ZX5A 3U0VA 2C9OA 3RC1A 4MVCA 1HURA 1MG0A 3W8EA 3UATA 4J8PA 2BHTA 4BJ5A 4S05A 1THTA 4G1FA 1C7QA 3F5SA 3F9CA 3LC0A 1K9SA 1VI6A 1D07A 3SXJA 3U7GA 2X77A 1E2HA 1EUCA 3GP3A 3RBXA 2FSPA 5E6RB 3GVCA 1HT3A 4GYJA 4HADA 4IUYA 4QBIA 3I23A 4PLGA 4RHXA 3C70A 4CQJA 3OTHA 4KE7A 2V6FA 3DOJA 2WILA 3FXAA 1UP6A 1QMPA 3DAFA 4Y7CA 3TL6A 1X77A 3OSUA 4JL8A 4UM5A 5AW3A 3WHIA 2B20A 3GUVA 4ZOCA 5AK4A 3MBOA 4YT5A 1P4RA 3EXFB 5ALFA 1EDZA 3RYCA 1JSRA 2PL9A 3VPSA 4PU0A 4P4SA 2WFAA 4A8HA 1AK9A 3D2CA 5AI9A 3VTAA 1SVKA 2WG2A 3O4FA 3PP8A 4KVGA 1YFZA 1ZBQA 1R00A 2CHQA 2QUIA 3NETA 1VIYA 5ENDA 3ORHA 4O25A 4ZQBA 2Q99A 1OF1A 2RHHA 3H8VA 3N87A 3ADPA 4G0VA 4WBXC 1GTZA 4KOEC 1GUZA 4GT1A 3IP5A 5KYTA 3HFRA 4R2IA 2QD1A 1XVUA 3KETA 3WK7A 4F8EA 3W8FA 1XKXA 4MVJG 5HWSA 2OK8A 4LVNA 4PC6A 1J1ZA 4Y1FA 5KCZA 3UHFA 1AMUA 3D3JA 4G9BA 1NVXQ 4UUAA 2IY9A 4HEA6 3RFTA 1JHVA 4BKRA 2O54A 3CZ5A 2Z5VA 3ZV7A 4BFUA 3ZUGA 6CHYA 2PZKA 3HMKA 1XRRA 4NU5A 5FBVB 1H4QA 3WB9A 4ENQA 2FK8A 4US0R 5KHAA 4FWIB 4X64B 5IC4A 4BQIA 5F5NA 2RGXA 4R01A 3UKJA 2LZ0A 2VZ0A 5E1DA 2BF4A 4PZLA 3QVTA 2ZU0C 2PH1A 2ZSFA 4AAYA 4EMTA 3CRMA 4KBFA 3JTEA 2YUIA 4A0GA 4UFPA 1GTG1 4DVGA 1C1HA 1NBEA 2YNMC 2VA9A 3HCOA 3BHMA 1PLJA 2Q3MA 4NJEA 3RVJA 4AU1A 4QJ3A 1K66A 1Z17A 2SCUB 4YUYA 3UCEA 1KRWA 2F7SA 3H6KA 3Q7SA 3KWFA 4C4AA 1DAIA 1GPDG 2WSIA 1ISRA 3OPYA 3KJQA 2J0EA 4CQLB 2DKOA 2JANA 3I3OA 1NURA 2JHAA 3HTXA 2VDMB 2XZTA 3B5EA 3NNSA 4EFMA 1CWUA 5LQCA 3MINA 4CFYA 4X60A 2CNNA 3IPRA 5LXTB 2AN3A 4X5OA 4IHAA 5L3ZA 2ZB8A 5AJUA 4TQUS 1A8SA 5AW6A 2FP4B 2C2OA 3VYUB 5FWNA 1Q6YA 4MHTA 2BMFA 4G5OA 4G8DA 1FIUA 4YY3B 4NBKA 2P9JA 1GKYA 1WWKA 4LYJA 4KREA 1FQOA 4ZRDA 2EKLA 3R9IA 9ABPA 1PGPA 3ITNA 2VOEA 5EQFA 4EKGA 5HBGA 3HY4A 4IUCS 2D2FA 3T4PA 3PUKA 3TE6A 1ECFA 1L5VA 4A73A 1U7TA 4A7PA 2WFMA 4NU6A 5FYQA 5KYGA 2JJ1A 1I13A 5HEKA 4MWDA 3GLRA 4WW0A 5DLYA 4ZWNA 1XZEA 4HJRA 4OAPA 4F5EA 2OWEA 3A4VA 2FPKA 1KNQA 1NW3A 4FI3F 4YEDA 1WBDA 3NAMA 5BURA 2P2DA 3G7SA 2E5FA 4HWPA 4J1TA 4LJ9A 2MSKA 1GRNA 4Y2TA 3VTFA 1HH4A 1N5DA 3ANYB 4MB2A 5GZ6A 1SVNA 3REOA 2J4DA 5D7BA 2BFPA 1UBSB 3GVXA 3BGSA 4B83A 4IHJA 3CH7A 2NTNA 4KR0A 4MYHA 3X1DA 2H8KA 5JQWA 3M3HA 1SG6A 4DCOA 4ER5A 5I7AA 4KJXA 3OQVA 4N82A 3L46A 4KG7A 5E0KB 3T38A 3FRIA 3GGCA 3WICA 2O8CA 1CRPA 2O2HA 2OO3A 1UBFA 2VXYA 1G7CA 3AERA 3SHTA 4FHCA 5E6UB 4GDFA 4B4KA 3GRYA 4IH9A 4R1OA 1ZKMA 4LHSA 5B37A 1SC3A 1MC4A 3F97A 3RHSA 3V4OA 2GD6A 4AN4A 3EIQA 1QZXA 2NADA 2D1QA 1Q57A 3NEJA 5HIJA 5SY4A 1ENOA 1DRKA 3T0FA 3TCKA 4WNAA 2VF7A 4A16A 5KUTA 2YY5A 4L9SA 2OXCA 1IN8A 4BEWA 2JFZA 1V8PA 5A4JA 3TZ6A 5KDDA 4DABA 3EIHA 4U7DA 4D3ZA 3DV2A 3LKVA 4Y6QA 2BSQA 1FS5A 1W5BA 3NRJA 4IICA 1BE6A 2WYVA 3MMXA 4CPDA 5B6IA 5GVSA 5B64A 2HNBA 3F6RA 1K5GA 3R7SA 4XEUA 1IXKA 1F20A 1EJ6A 4LJSA 1VJGA 4MICA 5T64A 4POOA 3VUFA 1S0UA 1AXEA 8ATCA 1N2SA 2VYFA 3LCVB 2ODEA 1YR3A 1ZGCA 1C1DB 1YZFA 2HWUA 2PAFA 4IV0A 4HB3A 4P84A 1C9DB 2HQOA 4Q3NA 2WTNA 2HAEA 2UV8A 2AB0A 3O84A 2COKA 1U9CA 1T2EA 2D1FA 3BDIA 1VPEA 1Q0HA 4N54A 3L05A 3PHCA 4RK7A 4J2TA 1MV8A 2RHJA 3QVSA 4HZUA 2NGRA 5JJ5A 4AO8A 4HUTA 1BE8A 2OWDA 2JFFA 1CUYA 3PXAA 5A3QA 4W8GA 3HDHA 3BT7A 1Y8QB 3ZU5A 4WLEA 3TDMA 1BN6A 3JQ9A 2EEPA 4PZPA 3FTDA 4O4IB 1SHLA 4Y2XA 3UAYA 1QVZA 5HIIA 1EZZA 2IOQA 5IDYA 4ZHQF 2WQ7A 4J0KA 2C0PA 2C31A 3H1AA 3ANXA 4LDRA 3FKJA 3PXUA 4KTVE 5HZKA 2W90A 1QQAA 1Q1ZA 3UUEA 2BGIA 2WZBA 2N1MA 3QGMA 4JLOA 4BX8A 4EYKA 4UPVA 4MCIA 1ZD2P 4RE6A 2PCJA 4HVAA 1IY2A 1VJTA 5FEMA 3IQZA 4P0QB 3H16A 4WN9B 4FYXA 1T4MA 2O8NA 2AT1A 2Q07A 2V96A 2WC1A 3ECSA 4I50B 4Q9JA 4GFDA 4FINA 4TM7A 3R7FA 3ZQ6A 3CCBA 4DMCA 4TMFA 1NU8A 4GWGA 4WZZA 1YULA 3OZCA 3KB6A 5T4EA 1DKQA 2DQ4A 4GX1A 1CJTC 4RA9B 4XM1A 4H17A 5CP8A 5A7FA 1OHHD 1C50A 2GMWA 3FCUB 3JPWA 3OOSA 4YI5A 3DW3X 4JU8A 5FFMA 3A9SA 3FWNA 5IYZF 4QASA 1ESMA 3ROMA 2BGMA 3O73A 2ZVPX 1L4LA 2R1VB 4CUKA 4LJRA 3V4VB 2FPSA 3NFYA 1SQ0A 3BH6A 1CYEA 3DTNA 5EUMA 4YP6A 3I01M 3I6YA 4GOJA 3R9KA 2X2PA 4I1RA 1U3GA 4F7DA 3I45A 3STTA 3HWRA 2GF2A 1QR6A 5U4QA 1DC4A 4LE0A 4IWYA 4OMCA 3RS5A 4BNJA 4HNTA 5L9AA 4OIMA 3UB3A 1ZONA 3V4ZA 1U6JA 4BO2A 1J8MF 2N0SA 3T3EA 3ZXYA 1PZHA 2QOEA 3EIUA 2HU5A 1EFPB 5F78A 3VU0A 3EUAA 3TPCA 1NJSA 3DEYX 2NO6A 1QIJA 1JN0A 4LHVA 5I7EA 1TEHA 3E4CA 5C3UA 3UJ8A 2PUJA 2JF0A 3PE6A 1V3QE 5ALYA 3WAKA 2PH7A 2FSVC 1YASA 4MRRA 4MW6A 3RVOA 4AC9A 1ZRMA 4ON9A 3DAPA 3GMTA 4D8TA 1AS3A 3H6GA 3N8KA 5FD8A 4KXUA 5CH3A 1UZNA 5FOVA 3Q11A 4KCGA 1V6SA 4NZNA 1UKVY 3G1TA 5EESA 4YLYA 1OLXA 1TC2A 4TLEA 5K5EA 3QVGB 4EHJA 5LMUB 3ZJUA 2X19A 5F21A 2QRHA 2GPNA 3CSSA 4A0RA 5KQGA 3UVEA 2YRXA 5JY6A 3GFVA 5KYXB 5AKHA 1LSSA 4LHZA 2W0SA 4J0IA 5CK4A 1F1BA 2XE6A 1LI4A 2WJVA 4OOEA 1FXWF 1RPZA 3K70D 1QUFA 1G8GA 1UFOA 1QQ5A 2QIOA 1P2SA 3MZ0A 3BQNB 2GSWA 4R2KA 4FDAA 4RZ3A 4BFZA 2IDJA 3UXMA 3LVQE 1GZ4A 2YW2A 2BFBA 4KYTA 4O4LF 4OJYA 3TIFA 2PMFA 5JH7B 5K0EA 2PL1A 3I72A 4JBWA 3RANA 1WB6A 2WSSD 1TCCA 3AF5A 2Q1UA 4JVNA 5CCEA 2R6FA 1NJ2A 1FLAA 1N4AA 4GP9A 1XEXA 3LGSA 3R5TA 1DX6A 1SUIA 4F9EA 1DRVA 1RJFA 1V8BA 4LV6A 3UMYA 2HSWA 3ILVA 5DEIA 4ABYA 4AD8A 3AKYA 2BW0A 2X22A 3CXRA 3UV3A 1XE3A 1Q3TA 3NEPX 3AGQA 4ZREA 3QG5A 5DHRA 2NNWB 2H6EA 2ZETA 4FNAA 2WSMA 3F6BX 5H82A 2NU8A 4P3PA 3VR2D 4DN6A 3V2UA 5AXDA 2A1UA 1S3IA 1CHDA 3N6XA 2ZSEA 3OY7A 4IXWA 4IIXA 4GZLA 3AVVA 1SCJA 4CWAA 2DR3A 3TCNA 2ZBEA 2V6BA 2GETA 2ZRCA 4XSHA 2OCGA 2E55A 3E70C 3K09A 1DINA 3QF7A 4PIVA 3SFTA 1IEVA 4TKMA 1QG0A 1DX4A 5JAPA 4JIMA 1Y4ZA 4JDUA 3BTVA 2A0KA 2H51A 1A88A 2QRJA 1TVMA 4AY2A 3IB6A 3HM9A 3K8YA 2OHIA 5LBTA 3S55A 3IELA 1KHTA 2H7YA 3EXAA 2FQ1A 2O1SA 4U5QA 3GLFE 3P45A 2FSSA 4KMSA 4WI1A 5DYYA 3CW8X 3GLVA 4GOXA 3Q41A 3C24A 4WN3A 1Z6XA 3TAXA 4ZI7B 1ETHA 2HRCA 4A23A 4B6RA 1QV9A 2VJLA 2EWWA 3IE2A 3LUJA 1E1DA 2B8NA 4M86A 2OTCA 2QJFA 3TZHA 3U17A 4Z3KA 2ZQ5A 3TLMA 3P9YA 4JJEA 4DLXA 2UXBB 3E1SA 3AF1A 4Y1EA 2C0CA 2YVKA 1VPWA 1UFKA 1UBEA 4HXEB 4LBWA 4DLRA 3NJ4A 3H9GA 3SIXA 1HDXA 1VLQA 3KHKA 4KFTA 3BCUA 3SQLA 1M7HA 1GZ7A 1GLGA 2QLMA 4JN6B 4ZVQA 4A8JC 1GKLA 1UDRA 4GMXA 1H22A 1C4WA 1RBMA 3WQQA 2NXWA 4N0QA 2GEFA 2AUTA 4OI4A 3SMQA 4BEJA 3D1LA 3WB2A 1IMJA 1JHRA 3ZZ1A 2ID4A 3AFNA 2QPLA 3MCTA 4REQA 3QWFA 4XM2A 3B1YA 4M4SA 4Z9AA 5E4TA 3V2IA 4C4TA 3HGMA 3R7DA 4D4GA 4YRKA 2FAXA 1XWIA 4MS4B 3QITA 4Q12A 5DLEA 3ZTYA 3WC4A 2FMTA 4BBPA 2C3UA 4J7UA 4UE3S 1TYEB 1OV6A 2ZZKA 1XA3A 3G85A 4R6WA 5JYDA 5KTPA 5TS3A 3LKZA 4DR1B 1K3TA 4ZQGA 4JI7B 2V1UA 2ZVJA 1U2DC 1C3EA 2JK1A 2B30A 3FROA 5HOEA 4BE9A 1WQ1R 1VHTA 2GEVA 1XELA 4OQDA 1F6WA 4LSWA 5LJIA 1ST2A 4V0SA 4TKVB 1JAXA 2X41A 5FNZA 3W79A 4Q34A 3LIPA 5HILA 5LBIA 1Q16A 3LBHA 5GIPE 3F3SA 2AA3A 2QPTA 3AUKA 4PHFA 5JR3A 2HXSA 3RKUA 4TSRA 3FR7A 2KHZA 3W5UA 4J7AA 4JQYA 4D46A 1CP2A 2BFWA 1N6KA 2Y1XA 1PFVA 2W93A 1FLNA 1Y7PA 2LPMA 2HU2A 1T8TA 4EGQA 5BPHA 3BUSA 2O0LA 4KPUB 5DHAA 4KQXA 4ZDIA 4WTOA 2GWRA 4QBFA 1HDOA 3ZV4A 2RI6A 5L7WA 1NMZA 4ED9A 3HKBB 3H13A 3TNJA 4XWOA 1NYRA 3IDSA 3L7IA 2XOKD 2JG3A 3EPJA 2HCRA 4GGMX 2RAFA 4FFNA 5EGNA 5AHKA 5JLAA 3NOOA 1X1TA 4I6GA 5ECWA 5GTDA 1ZJJA 4HPWA 4MPJA 4HDSA 3UTDA 1SVLA 3U16A 2YBDA 3GCDA 1FDSA 3DBHA 4G23A 2ID9A 2ZIFA 2HJVA 2E5WA 2W98A 2Y99A 1LPNA 1II8B 1Z2PX 1O94D 1OI7A 3SQXA 1TYAE 4AP6A 5LA6B 2QV7A 2WE7A 2J7KA 1NW8A 1QZ3A 1X70A 1N3YA 1ZA2A 2I71A 3BFPA 3OIDA 1OX4B 3L1JA 3FG9A 4JUBA 4MYUA 5TE9A 3W0LB 1OQAA 4AP9A 3TZCA 1Q0ZA 2QY9A 3JQFA 4L15A 2BSAA 4R8VA 2JHPA 3KQWA 1ULBA 4OHPA 3KKQA 4JEMA 5DBHX 2FX5A 1J4AA 2OZKA 3DMTC 4C0AC 4K9OA 1WM1A 2AV6A 4Q7LA 2DKNA 5SZKB 1W52X 5I48A 2OG2A 1QDLB 1JW9B 3QJ5A 4GZ5A 4CLHA 4CV0A 1A9OA 1U98A 3B1XA 3P0EA 2GVNA 2XUGA 3OQ6A 4PXYA 3U3JA 4BIMA 5KVCA 3RT1A 3T7EA 3MWDB 3CEMA 3GGPA 3NHRA 4FHFA 3M3DA 2JCSA 2BFAA 1EZ1A 1R3UA 2CYBA 2R5NA 5ES3A 1IULA 1MABA 4F3RA 1QFYA 1ECGA 3Q72A 2G7ZA 5ERXA 2FDCA 3GBSA 3OMXA 2O5CA 4Y2YA 1WF6A 4KR2A 5JS8A 2WRZA 2GF9A 1Y89A 1TADA 4BLVA 1URPA 1PD1A 4PQFA 3PIIA 5A4MS 3A6EA 2N1BA 2PSFA 4GPD1 2BI8A 4ZVPA 4ZDWA 5K8LA 2VAXA 4PQEA 2ZLBA 3L07A 2D1TA 3HWX1 2Q9UA 4B3TB 1GHTA 3HJUA 2O6HA 2FEPA 2R87A 1H8HD 1GTL1 4F3KA 4RF3A 3UWKA 1V11A 3JR3A 5DGXA 3TB4A 1R6AA 1R8XA 2ZRGA 3G9ZA 4KNWA 2C0QA 4LK2A 3B1VA 4A1OA 4B34A 3PUHA 1EWYA 3H8WA 2OOKA 3DOOA 5AW9A 1C7IA 1TVKA 4JJAA 4UE2A 3UV6A 3UAXA 1NZFA 2OC9A 1JMVA 2VG8A 2YJNA 3GIWA 1TAHA 1TX4B 2A5YB 3CZ4A 1LDNA 1YQ9A 3EH2A 4KXYA 1C3OB 5MN5A 3IT2A 2F4NA 2QLJA 2BFEB 3PGA1 2A5GA 4PE5B 5JHGB 5DCLA 4I55A 3KT8A 2QROA 5ALOA 4UU7A 3I5MA 1X9GA 1TKAA 2HK6A 5DYNA 3DLHA 4BNFA 2NZJA 4HSEA 3KWJA 4GLJA 1KPHA 2GXSA 4UUMA 1VCHA 2VPYA 1BXRB 5BWMA 1LEHA 2EIHA 3VU9A 1LS6A 3UMMA 4OGFA 2OO7A 3NOVA 1N3IA 2YZNA 4GC9A 5AM3A 2GTPA 1LVHA 1VSBA 4JNKA 2QYHA 4O02B 3SJCA 3TOCA 2RC6A 1VJCA 2HMVA 3ZQUA 3M1AA 1DU4A 3HDYA 1SUWA 1RYMA 2Z58A 3AL3A 1USIA 1H9CA 1K92A 1CDEA 1Q0UA 1VMAA 1CF2O 3DF9A 1DC5A 4GPTA 5FX2A 1W47A 1NBWB 2ZWPA 3KKMA 3TFWA 1DQNA 2BBWA 4OM7A 1E3IA 4UUOA 5HXAA 3W2GA 1UC5B 1DJMA 2HZBA 1GPBA 2ORVA 3CF4G 1AF4A 5ALUA 5EKUA 1SCAA 2ZRPA 3D6HA 3U60B 1CR4A 4A6PA 4ND4A 1SIWA 3MMPA 2XVXA 1MNAA 1N2JA 1LGYA 3A4LA 1G9SA 3NBYC 1QZTA 3OOEA 2X8JB 3DKVA 4YROA 3U4HA 4DLYA 4BY9E 1JPUA 2R8XA 4LV5B 1L5SA 4ZOLF 3ND6A 1TCUA 4PLCA 3B1WA 1Q1QA 5AJTA 4LF5B 3C0KA 1XNQB 1FNCA 2FZCA 2O4UX 2PFKA 2KWIA 1PFQA 1QIEA 3IKVA 5GONB 1EUQA 5FWDA 2FR8A 4R1MA 4U0JA 4ZEOA 2I2FA 3ECCA 3AR6A 1RRGA 4MQUA 2VPZA 2Y4NA 1SN7A 1A5SB 3DDZX 1UIMA 5KWIA 2IYYA 1GDDA 5LWQA 4ZV7A 4Z4GA 1Z5VA 2Z57A 1RS0A 4MQ4A 4EJSA 4OLBA 1JDUA 2X5JO 4TMXA 3PGLA 5DIZA 5JXGA 3IUNA 3ZWDA 2XADA 4OFZA 1TNDA 4CI0B 3V1MA 3JV7A 3B2QA 1L7PA 2ZWOA 2XTAA 1NQ5A 2W6JA 5AI4A 5E7MA 2D54A 1OJLA 4FZRA 1VG0B 4PFSA 4CM4A 2GD1O 2AYYA 1WXFA 3N59A 3QBJA 3GRCA 1HE5A 3MYRA 3EDCA 1IHDA 2OUIA 3H11B 2P8JA 1YHYA 1Q7BA 4H7EA 4UCFA 3R75A 5TARA 3CUVA 1QCDA 3N2KB 1YQEA 2ZE7A 3I6ZA 4E31A 4Z3DA 3D4BA 1E2MA 4FX5A 1WDLA 2EFHB 1UPCA 5H0IA 4KR6A 3C43A 3E53A 2BMAA 2JGFA 3H5AA 1IAQA 3R3XA 4WESA 2I2CA 1TIPA 2GILA 2V7WA 5FOSA 3E2IA 2PIAA 4E3WA 5A4KA 1APBA 2J09A 3B9QA 1SCKA 2I8LA 4TVOA 2XRZA 3LUPA 1KI3A 1U9IC 1O97C 3LOUA 4AZVA 4RQUA 1K88A 3LP8A 1NNEA 3JPYA 2FQXA 1II9A 1DTWA 2H2AA 3D6JA 2B36A 4IGEA 2GAFA 3B6ZA 3Q2IA 4HTFB 5J5CA 1SUBA 1XX6A 1T0PA 1VHWA 3FIUA 4Z7NB 2OBXA 1XQ1A 3RYIB 4RXTA 1PJTA 2WZDA 4BUJA 5AO9A 4MDFA 1HFEL 3HXKA 2VHVA 3T7IA 4D43A 2P7HA 1CK4A 1KY3A 2P2GA 1VZ3A 4GP6A 3TTXA 1PYDA 3JQPA 3K0HA 4FDVA 4X95A 2GZMA 1SOUA 3SS9X 1P2GA 2WNHA 3EZYA 1R6VA 4IJMA 4WZBE 1Q15A 2BUBA 5EZQA 1X3SA 1JKJB 2HLHA 4C01A 4DA8A 1VZ2A 2AXPA 2FHSA 3GD7A 3LL4A 1EXNA 3UN1A 4C7XA 4LXYA 1N3LA 1QGZA 1U0JA 4OA5A 1NXXA 4F46A 3D5QA 1DT3A 1TM7E 3WL7A 5KVSA 2ZPTX 5K0LA 4WOKA 5DYGA 2G0NA 1LK0A 4QPCA 4TMWA 4LJ7A 4KSBA 1A9RA 3FAKA 2DHDA 2FW7A 3CFYA 5IARA 1RHJA 2VHJA 1IN4A 5HPYB 4S1PA 4MUJA 2VDNB 3DAYA 2RGEA 3L0YA 5IJ0A 5BOSA 3QVWA 3CLUD 3OC6A 3TIGA 5FUQA 2GBLA 4PM4A 4QQKA 1FYDA 3RRXA 1YCDA 1YDWA 2QU8A 4NV3A 2G1AA 3FTNA 4GF5A 1Y7LA 1YL5A 2AGVA 3D8SA 3DL2A 4UPEA 2OD9A 3L43A 2MIIA 3G2PA 3ZHZA 1UOOA 4MVJI 2ZGVA 4TL9A 3LVFO 2TMDA 1OTYA 3S5UA 3M6IA 5G1OA 1N2OA 1NOIA 4LQ4A 2J33A 2KS6A 3BX1A 2FMIA 2RHMA 4CR6A 1K0FA 4F6RA 5I9NA 3OC0A 1XBTA 1FNMA 1UMDA 2M6SA 1Z7GA 3AL2A 3RUEA 4BQSA 4JLAA 3JVUA 4D0RA 5EHXA 1GG2A 3IQWA 4LYEA 4M76B 3WQBA 4XWTA 1KDOA 2AR7A 2WM8A 2YMQA 1GADO 1O5OA 2GEBA 1T0IA 2H4FA 2WHEA 3AF0A 3CEPB 4J3JA 3HSKA 1TMGE 2HADA 3RBZA 4YUAA 4L22A 3NWBA 5KC8A 2F59A 2FJUA 4LBVA 4FWBA 4NBTA 2WUDA 3I2HA 4EELA 2J45A 1C8BA 1D9XA 1E1CA 1R4ZA 2NVBA 4MWGA 1KY2A 2IU0A 4BNZA 3W6UA 3HB0A 2OOSA 3GJ8A 4F38A 5KEIA 2GD2A 5GOZA 1NOJA 3WLSA 4U7GA 4A27A 3QVLA 5LYJA 1XZDA 2ZQYA 4FGLA 3KCQA 5L6LB 1UBKS 5AVRA 1HX7A 4B8ZA 1ZNYA 4BP3A 3BIOA 4FK8A 2IHVA 4RFSB 2GHTA 4FYMA 2G9QA 2PZMA 5HDBB 5IXJA 3HK2A 3KWMA 2FSHA 2AN9A 3I34X 4MGZR 4X20B 2E1PA 4YCBA 5EWMB 4DMUB 3SVLA 3FDXA 5BT8A 5C1BA 4CM9D 3T1TA 1T6XA 2WY2D 1KDPA 2R00A 3L8DA 3R3UA 5JYEA 4MITA 3EF0A 4FN4A 2LP4Y 3GYGA 3DTVA 2WBLC 4V0NA 3VO1A 5L4LA 3GFSA 3ZLUA 3Q8LA 4HDQB 2YHSA 5BSRA 5EZ5A 2IHZA 1U7OA 3C8UA 4TVSA 3C1AA 1ZR2A 4R9RA 1KY4A 2PQMA 4V1CA 5HE8A 2HU8A 1JA1A 4CG1A 4XXHA 1IUNA 4K9SA 3W34A 1V4VA 1CY4A 3P4YA 3NWOA 5H1YA 5JCXA 4NU8X 1QFJA 2JL1A 5IULC 1LC0A 1JG4A 5IYZB 5L3SB 5LQRA 3I30X 3L8FA 4YUVA 1I7LA 1TYCA 1Z15A 2VYCA 1TOAA 2VN8A 4NH4A 5FBRB 3DZFA 3VNAA 3PHGA 4F9TA 5KOIA 3T3IA 4B4VA 5K1ZA 3OMLA 1BW9A 5HF5A 2QTWB 1T9BA 2VUHB 3IC5A 5GJBA 1ZJ6A 3EW7A 4WIAA 5GJWC 3QY9A 5HFNA 5J2UB 3VJLA 5JWOA 1HEUA 3S8MA 2WU0A 4FE7A 1U7PA 3TW8B 3VKHA 3WGLA 1MOQA 2QRKA 2QORA 3L1UA 5K0SA 2DBVO 3OQIB 1FLVA 5IJ9B 1I2ZA 2O7NA 4G5SA 4IGKA 3WKAA 1GXSB 3OT4A 4U7WA 5M34A 2QTNA 1Z47A 4HLCA 2B6HA 1RYHA 1WMEA 1C30A 2IRWA 4RANA 3UA3A 1KU0A 5ANRB 4NBSA 4HAYA 2WTUA 2H9AA 2J3DA 3EZXA 5DMXA 2QUZA 3N2GA 4BMDA 4W9MC 1ORWA 2GJ9A 3LCCA 3OEHD 3GZNB 3WS7A 1JL3A 2X6QA 5KSOA 2JFNA 3V6LA 2AZMA 2ZUEA 4PZAA 3OKPA 2REOA 4EY3A 4MV5A 2CWDA 4MWTA 4TQGA 3AR2A 3NKLA 4J7CA 3H3JA 4RH0A 2DAPA 2VP3A 3T1NA 4U6NA 4ZCIA 5HM6A 3BG5A 1F2UB 3ZNQA 1FYVA 3FNIA 1W73A 1C1XB 4P80A 2IH4A 4RCVA 4A2CA 4YRIA 1JZTA 3VVMA 1OXMA 3S29A 4DSAA 1SD5A 3VISA 1ZGJA 3R7NA 4KIFA 2O0HA 1PSDA 4C6TA 4F2PA 3GJRA 4RY2A 4GYWA 4A8JB 3ABQB 1ZGZA 3F9IA 2E18A 3LQRA 1XQWA 1XHFA 2ZE5A 3ZQKA 2R2GA 4ZKEA 4MWZA 3V5NA 3H0EA 3RAGA 1M66A 2FVYA 3PIRA 3Q7EA 1R9GA 3O8LA 5CK5A 3OF2A 1R7RA 3WL8A 2B9VA 4YAEA 1OY1A 3GJ6A 3KL2A 4HMOA 3K30A 1DBPA 1IM2A 1RAIA 1Y82A 2JAWA 4JKOA 1CX9B 3OQOA 5I7RA 3F4LA 2B35A 3ZWYA 2Q41A 4IY1A 4Z7QB 4QICA 1OYOA 3TLYA 5J2TB 4NYJR 3GGSA 5DYIA 4W5RA 2ZUWA 1M1NA 1YH3A 2WT4A 3VGPA 1UPAA 3IAAA 3SCZA 3IKTA 3HZHA 4C5CA 4YO7A 1XALA 2HA4A 3KK0A 3G89A 2RGGA 4MRMA 4NF2A 4BRWA 3CLSC 4BP8A 3B70A 3BRQA 2GKSA 3PFWO 1KFCB 1P7CA 1WXWA 4AG5A 4B81A 3AF6A 4HDCA 1GGJA 2ZJ8A 1BFDA 4MWOA 1OBVA 5I4BA 5JXIA 3MCAA 3TLGB 2GBFA 3IJEB 1JPVA 2BM9A 5L6MB 1MO4A 3FZYA 3VPXA 1QH1A 4XQGA 2J59A 4I9GA 4A91A 1L5QA 4NICA 2B9EA 2F43A 1U9ZA 3DAOA 4MKHA 5DNWA 1ZH8A 4R8LA 1NRWA 2HIHA 6LDHA 1UANA 3A1DA 1BXGA 1FCJA 1ZY2A 2CXUA 4PBSA 4KJZA 3HCAA 4K2HA 3QBDA 1RXSA 4GAEA 4MR7A 3UB2A 2FG6C 2QMQA 1CSEE 2VUTA 3ELBA 4QU5A 4P4TA 2Q5JA 3QNUA 3WLFA 1H3EA 3UV7A 1NR1A 3LZDA 4DSOA 3H6HA 3WYDA 5A9TA 1U6KA 2Q4EA 1XTQA 1U0LA 1Z38A 1CF9A 4B7AA 1RC1A 3P52A 3DWEX 3F2IA 5KSWB 2W5UA 4B8YA 3QE9Y 3HSSA 4Q4DA 1FNDA 2BD0A 4IIEA 1QRRA 3M5CA 1NFRA 2P4HX 3FPCA 3IX7A 1M2JA 2IWHA 4Q3OA 1L4HA 4Y1RA 1ZRNA 4UDNA 4W99A 2NZYA 3LGAA 3G2QA 3REGA 1DO0A 1NUQA 2PGLA 1DQZA 2X76A 3FKSA 2W6ID 3I83A 4KSCA 3GO4A 5KDLA 1PT7A 2P2CA 2ZJ4A 3GRAA 2JIQA 2HF8A 2V0CA 3O7WA 2P69A 1WVGA 2BL4A 1IEWA 2WHRA 4TXJA 4TYPA 5ERYA 4C4ZA 1HT0A 1AS2A 1JHYA 3M49A 4IR7A 2P65A 4YC7A 1IY9A 2A88A 1JWLA 1LI5A 1XLWA 1LUAA 3KV3O 4FFDA 1EVJA 2C9YA 3ZBUA 3CV3A 1OH7A 3COJA 5E3IA 1MN6A 1R6TA 4IXDA 3A1NA 1Z0DA 5LB4A 4U7PB 3VR3A 1JEYB 1SCDA 3TQSA 2QUBA 3RTGA 3I62A 4TTSA 1IVNA 1J7KA 1P29A 4AS3A 4QTYA 2W00A 3HKCB 3AJ9A 4CLDA 1D2CA 4LXGA 3I28A 1QIGA 3U80A 4CIXA 2CWWA 3P9ZA 5HR5A 2XE4A 3QPAA 4PICA 3IAM6 1ENYA 3KEFA 3ML1A 2EGGA 3OIUA 3SKYA 3NMUF 3HZZA 1GAJA 2HBYA 3DZGA 4K8RB 3KUUA 4G01B 4AZTA 1EINA 3AKDA 3NH9A 3P2YA 2BH2A 3AFHA 3QBEA 4NYIR 1AHHA 1USGA 1MC1A 4OTZA 5ES4B 5LCXA 3IEMA 5JSHA 1FMFA 1BRMA 3BJIC 4L73A 3HKDB 4OEHA 3BERA 5JNUA 3WLPA 4ZT2A 3DZCA 3FDIA 1Y4AE 3R3YA 5K3SA 4R1TA 1PJCA 5IDVA 4HH0A 5IW8A 3RWOA 5J4KA 3P9NA 2A84A 1DLIA 2IU4A 4PG6A 4Q9NA 1CUHA 1W6UA 3FPLA 4YBRA 1JIQA 5ICFA 3SP1A 1C41A 1RJWA 5C8VA 2VJBA 3ZW9A 4MV7A 4N3AA 3KOMA 1C9KA 3OLVA 5G0TA 1YQQA 3GJYA 3T9CA 2HA7A 1T2AA 4O33A 2GCOA 2R2AA 3RTBA 3F5MA 3TSWA 1NMSA 3WLJA 1WTAA 3MB5A 4RF4A 1IOZA 1G0OA 2C07A 1YR2A 2B1QA 2D3TA 3FDJA 3HUEA 5DJ5A 2G83A 3HO1A 1ZVJA 4JLPA 1RQGA 4UEQA 1WA5A 1E1NA 4KC0A 4I5GA 3SNKA 2XIJA 1G42A 2Y2UA 3UGJA 5IFLA 4Y2PA 2HA0A 3WK6A 4H6VA 4RTSA 1CJKC 1L9KA 1K75A 1SIUA 2EJUA 5KNCH 2RGNA 3UNXA 4BVGA 1LSUA 2WB4A 4JLDA 4P92A 1Z8FA 1DG3A 4IJQA 4IMRA 3RVPA 2F55A 5LUBA 3WMWA 4EI8A 2B1RA 3DPUA 4ACAA 2XDWA 4I4IA 2PA0A 1P0PA 3LK6A 4HUQB 4D8UA 2PG3A 4ND2A 1PIWA 4MGIR 3H2BA 3V7FA 2IBSA 4PYLA 2D4HA 3KAPA 4JC0A 3ST7A 5BQ3A 4JJ8A 5EP4A 2REXB 2GA9A 5ALLA 5CW1A 1GGEA 5HG0A 3TQHA 3PC7A 1CRZA 2E5LB 4GICA 5ER9A 2ZIAA 2CJFA 4NV0A 2LR0A 4B2YA 4DLPA 4EJMA 2XTZA 1H05A 3LBAA 4FBMA 4EY8A 4S12A 3T9EA 5FA5A 1C7ZA 1EH5A 2DPHA 2H8GA 3DO5A 5AKIA 1UAAA 1LVGA 3JD3A 4WY2A 3SEAA 4URFA 2OHGA 4OUKX 4B6GA 1PT6A 4WFQA 1ZDMA 2NUPA 1RI5A 4M7OA 1OYWA 2G25A 3CEHA 2DF8A 1N0IA 1XZKA 2C29D 3SZUA 3L0DA 4F04A 5AUPB 3HGQA 2XZLA 1SUAA 3PPVA 3OIGA 4YT4A 1LA2A 3F0TA 1FFXA 2XY4A 5EIOA 5HIKA 3EZ7A 1UKEA 5M3BA 2FEWB 2I3DA 1T8YA 2G77B 3ZZUA 2PANA 1USVA 2NXCA 3SR3A 3G9QA 4TL7A 3SLGA 5A0TA 1Z7BA 4AKTA 3KFLA 1W5TA 1HKHA 3PNYA 4EG1A 4ESVA 3IOYA 2I8CA 1X80A 1H94A 3A28A 1E2DA 3G8AA 3LRPA 3EOZA 5E8RA 3UMFA 4D6YA 4EG0A 5HK9A 3R09A 1H6CA 1ZKDA 1MEOA 1P80A 4BUZA 5B7PA 2FOXA 1PAUA 2BEUA 4X1IA 4OP2A 1EESA 3R3HA 4WWHA 1MNQA 1P2TA 1ZI8A 2PKCA 4D3SA 1SRRA 1XA4A 4N47A 3CJQA 4W1PA 5K01A 4TSFA 1KJWA 2NG1A 3DKRA 3NT2A 1JNYA 2DUMA 4QJBA 4ZQFA 2R7NA 3P2KA 4QG7A 3OSZA 2DEUA 2YFQA 3PENA 1QYWA 1HQCA 3RR2A 1P2VA 4QGBA 2A5JA 2DYKA 2ZBFA 5HA5A 2O3QA 3W5HA 1LDYA 2AKAB 3QNWA 2V9ZA 3LYLA 2VJOA 1XFAA 3CNLA 4F93B 2XVYA 1GFWA 3FMOB 3N8GA 4DDTA 1P1RA 3GGGA 4R2MA 1P72A 1VJDA 4QGHA 4JYCA 3IXQA 1FTNA 1RWQA 3L0PA 1WXQA 3OE1A 3MPUA 1JECA 4WEOA 2YC4C 1FRVA 2XYHA 5ALSA 3H3FA 1DC3A 1X87A 1N1DA 3CKMA 3B20A 1AMOA 3B38A 4G8BA 3DA8A 4LOHA 1EWRA 2G1KA 1R1DA 1TM3E 3GUUA 4K0RA 4EKNB 1KEEB 1P2UA 3IXLA 3MJ4A 5LC1A 2NXJA 3ZE2B 2HWYA 4R9NA 1KEKA 1OFHA 2H1WA 3GEEA 3ETEA 4LPKA 1KSGA 3WRVA 1VQ1A 4GEKA 1QHHB 1Z5UA 2IGTA 2IPLA 2WD9A 3F2VA 4ZOLB 3QYPA 4HAOA 3WYAA 3D31A 3AMVA 2EJBA 2V4MA 3M81A 2B2XA 1SB9A 2M32A 3G82C 4LOJA 3RVLA 3HM2A 2EHJA 4A5OA 1JAZA 2JH8A 2H52A 3UT0A 1N2HA 2BFCA 2WP0A 4IVQA 4NBLA 4MI3A 5IVIA 3S2ZA 3KL4A 4DIKA 4QM6A 3B8HA 4HTAA 3RU2A 4DG5A 3FOCA 1UOPA 1LNQA 1OZGA 3OKAA 5D8DA 2NZ2A 3EF3A 2RIPA 3C8DA 4B8WA 3BK2A 1DP4A 2QU7A 3CCFA 4KXVA 4BNUA 4KWEA 2J41A 2Y0EA 4G67A 3MN1A 3WG9A 3BFKA 3R6TA 1Y8CA 1DRJA 2OORA 2F1HA 1N0HA 5J23A 2YW9A 2B4TO 5DISB 1K06A 2AI2A 3HDQA 2ZIWB 4IS2A 4OXYA 3LV8A 3UGKA 2RAVA 2Z6QA 3LCJA 2I1LA 3DHNA 3QMWA 3DR5A 3ZKWB 2F9LA 5IC5A 4E2YA 2BC9A 2EBWA 2R9VA 2YOHA 3UT5A 1U94A 4C03A 4DBLC 1CQZA 3BSWA 4CDRA 1WUIS 1ZBDA 1N2CB 3S70A 1D4AA 1AUQA 2J7PA 2JLSA 4BV8A 1KP2A 3R8FA 4I1VA 2GPJA 3O2NA 1BCSB 3PQFA 4LNUA 1J2EA 4X7BA 4X8OA 5DRYA 3FHJA 1ONPA 5BVGB 4EFKA 2ZANA 3OPMA 1TA9A 2IYXA 4ARZB 4DILA 1NW7A 2PGDA 4OQQA 2Q49A 1FDRA 2O14A 3TLEA 4BBAA 4EO7A 1U31A 4F5ZA 1Y7HA 2WOJA 3GELA 1ELOA 4LX0A 2V4UA 2XWSA 3L0SA 3O0TA 1EK6A 4NEHB 4KQMA 5FBQB 4DGQA 4HDKA 4TGLA 5FR2A 1GRQA 4I99A 3O4GA 1K8RA 1VRCA 4B6FA 3SQDA 4Q3CA 4K28A 3WQSB 2PZGA 3HWSA 1LFDB 3DH0A 4CIDA 3ER9A 2PFSA 5K3FA 2A9JA 1BH6A 5IVPA 4Y6PA 1DAPA 1OLUA 2TMGA 5AWFC 4ZJZA 2V03A 1SHJA 2JCBA 4ZC1A 4F1KA 4JLMA 1Z5GA 2Y1WA 5EKSA 3AOGA 2I3ZA 3RJZA 5K3EA 4JFAA 2IQIA 1IBSA 2C92A 1KYQA 4CETA 4EZIA 3I9FA 4U9HS 4FEYA 1YS2X 3VJRA 1YJ5A 4Q3AA 4DJTA 4QX6A 5KVAA 2ZU6A 4INOA 4JYPA 2WM9B 3OE7D 2PUWA 4YJFA 3DLBA 4XWWA 2BKUA 1Y3IA 1GGVA 2Q7XA 1L7NA 4BB0A 1XQXA 3AVOA 4F8YA 2FOIA 1UBRS 3GJ3A 1KQPA 4PSDA 2D1SA 2OECA 5FDFA 3RUHA 3PGXA 4Z6KA 2GM3A 1P2DA 4W9NA 1GZHB 4O08A 1DXOA 2PKQO 4QBTA 3UYLA 3GA5A 2IW3A 3VPGA 4INPA 2VHEA 4HNHA 1E2UA 2ZUDA 5JNVA 3CN7A 1C3JA 1SA0A 4HZIA 5GMOA 5C34B 2C57A 3BRWA 3LQ4A 3K2BA 4J94A 1MC8A 4HX9A 4LWZA 1OXUA 1VRVA 4BO8A 4KE9A 1CNMA 3R8XA 4B3BA 4FFBB 4YCAA 4B74A 5KX5B 4U1RA 3KFXA 3RS4A 4M1KA 1FFBA 2CLDX 4TUYF 3KZCA 1XRJA 1YQDA 2ZI6A 3NDRA 4RJ2A 3RSFA 4MV8A 1HLFA 1TJYA 1J09A 3C3JA 4BWVA 4U5XA 1JXMA 4X1KA 3WL5A 3G0BA 4DCPA 1XEAA 3U7FB 1MDBA 1UJ2A 2H65A 2Q3FA 1CUXA 1MJGA 1R0LA 1AK2A 2GYVA 4YCJA 5DASA 2F1RA 2YVQA 1RYFA 1WMAA 3FGPA 4ETWA 1JF8A 2IW1A 2ZBGA 5JFTA 1ZI6A 5BSVA 1GCOA 2YZ2A 5E4FA 1VXRA 1XEFA 2AFIB 3TTWA 4D9IA 5TMEA 4HX5A 4N8SA 3WSTA 1KR5A 2G28A 3OZ7A 3PLRA 3G13A 4G0PA 4Q93A 4WNYA 3EOBI 4L5YA 1MX1A 1F3OA 3W3AA 1GFIA 2ZJ2A 1FQKA 3SAJA 1B7GO 1MAUA 4TLAA 1LPOA 1GCIA 1UK8A 4JLBA 1RM0A 3NPMA 4ZFNA 3CY6A 4KPYA 3F6SA 5KSPA 3L7MA 3KJXA 4BFVA 5BY2A 2BOVA 3HJTA 1XRMA 1LI7A 5AKJA 4ROSA 2C5GA 4WK6A 1B0PA 4UAUA 3N53A 3OIVA 4X9XA 4BOYA 1BU5A 3TR6A 2QT0A 3G5UA 3AF3A 5CEEA 1NULA 2VPTA 4ZHSA 2POCA 1RM5A 3M7IA 1E79D 2XH8A 4KMMA 4DXAA 1NP3A 1P2FA 1RI3A 4ND3A 4QXQA 4U6QA 5H70A 4I1YA 2OXTA 1ATZA 1IG0A 1MFZA 1NF9A 3FPEA 4O3FA 3WOVA 3HCEA 4RK5A 3HU5A 1X2BA 2QMHA 3JQDA 3K71B 4TT3A 3B52X 4NZZA 3NU1A 4BMYA 1MAVA 3ONDA 4HGRA 2EKDA 4MIKA 2AD5A 5A62A 4WEQA 3ISJA 3TIVA 4KH0A 1FU8A 4LGMA 2WJPA 1VJ5A 2GFIA 1Z3IX 3R1IA 2VHWA 1SIBE 3EY9A 4O4JA 5T4FA 2YIMA 2B99A 3A9WA 3IXMA 4H3SA 2O4CA 4GZ6A 3F3MA 3WNCA 4AJEA 3OUZA 1D6NA 1QH8B 2H1FA 1UBNA 2DCUA 3U37A 1DWOA 3CUWA 2FLVA 3O94A 4FIZA 4LYDA 4EUHA 1M1ZA 2PJRA 4JQZA 4RS4A 5JECA 1G8AA 1M9NA 4RWZA 3IEPA 3HXLA 2LCFA 4YRLA 3IKJA 3MFYA 1B3RA 2C59A 2D7CA 4GLBA 2B4RO 1HZZC 1O5TA 2P35A 2VQSA 1YO6A 1QFZA 3GA0A 3MSXA 1DAHA 5AM0A 1TAQA 2HXGA 4QXPA 5TPWB 1XMVA 5FUWA 3TRFA 3H0CA 3OCWA 1XQ6A 5G3YA 2FPXA 4NABA 2B6NA 3EFOA 4DDKA 4H59A 3ZK9A 1Y3HA 1KNXA 3I2YX 1DIHA 1CZNA 3ZNPA 5K0FA 4CKCB 3EEOA 4G36A 3NBAA 4ZVKA 3U49A 1M5RA 1PK7A 3ZCUA 4KYIB 2D0OB 3E9EA 3L4KA 1UCFA 4EJ0A 3WSVA 4TTRA 3U61B 2BCEA 1P4SA 1P5ZB 1WHSB 1A9QA 1QGUA 2JAHA 2OBMA 1DOAA 2A1TR 1E0SA 3D8NA 1VSTA 3LBYA 1GJRA 3BJRA 3E7PA 4DUZB 2IUFA 5JYCA 1CULC 4DIEA 2PUCA 4KIGA 3S3TA 1XDUA 721PA 2R84A 4EO9A 5EJAA 3MGGA 4MA5A 2C4VA 3BWCA 4GQIA 4KPUA 4YA6A 3TZLA 5FTMA 4MGYR 4ZIRA 4PPGA 4DV6B 1UMCA 4NE9A 1S4MA 4MV9A 1A97A 4RY0A 1NYLA 3E7DA 3ANLA 3JW8A 4CZ2A 4GVXA 1CKEA 2GS9A 4O0LA 1VKRA 2CJWB 1CQJB 2FEOA 1S3FA 3C39A 3DT6A 4KFUA 4QWWA 4U7HA 4W7IA 3SYTA 2EZ9A 3IDFA 5DXJA 3I9V6 4ZXFA 3U4DA 4GR5A 4RPCA 2ODWA 2B8JA 4PXSA 1XUOA 4FU0A 3RYHA 3WMEA 2AWOA 4FXPA 4WNCA 2QX6A 3AP3A 1LPPA 3IV6A 4GBMA 2AJTA 2XECA 1Q20A 5IKOA 4UVHA 3D6AA 3UHJA 1CT9A 5HJ5A 3MBKA 4POAA 2ZPAA 2G40A 2QXTA 3IVGA 1VGVA 3HJGA 4FYIA 2VOJA 4MZXA 2VUIB 4X8MA 4BU1A 4BYMA 1CUEA 1A04A 3QHPA 2C20A 2OBFA 4W1QA 4EGFA 4P5EA 4AF6A 4WBNA 1JXAA 2C04A 1TCAA 3DEHA 3PR3A 4OHZA 3Q4GA 3SIPA 4TN5A 4J0QA 4PRLA 4CXMA 2CSUA 4YCMA 2QLNA 2ZKLA 1NMEA 2FF7A 3I0ZA 5FAXA 3LK7A 5TS2A 1GA6A 1SO8A 3EEYA 2YHUA 3UJCA 1THGA 3WLAA 3LHIA 5BW6B 2CZQA 3SF0A 1XFDA 3VRHA 1LRJA 4FVTA 1QO7A 1A5ZA 2ODNA 4LWQA 4UCXA 1JFLA 1KS9A 1AK1A 2A9FA 4NZMA 2DH5A 4L1KA 4RSHA 1KYWA 3WV5A 2JFXA 2ZYRA 2OV1A 4KMRA 2F48A 4CGZA 1KSFX 1O4WA 4BZZA 4UTPA 1ULSA 3N1UA 4HRAA 5BSHA 2O8EB 4G8JA 5A7HA 4Z0HO 1VMKA 3L18A 3NEAA 3Q7TA 4KBGA 4BMOB 1CS0A 5FH9A 4DGSA 4YMTA 2J0UB 2AK3A 2E85A 4RIEA 4Z3OA 1M0WA 1MDFA 1VIMA 1WAMA 1XJ5A 4BVHA 2BWJA 5D51S 3OT1A 3ER8A 1AKEA 4EI7A 3EA4A 1DFIA 2FEXA 1ISIA 4NG4A 2H4HA 3UK1A 1N7HA 1OPXA 4ZI3A 5BNWA 5K20A 2PTGA 3QFCA 4RZHA 2R48A 1ES9A 1MB9A 1OMOA 1AF7A 2WF5A 1N7IA 1T3GA 3NTLA 2FN8A 3Q6MA 4QKQA 4GM1A 5BW4A 3EAFA 3A37A 4PG7A 1KORA 1OH6A 2CVQA 3RAFC 1U0HC 2R4QA 4RK0A 3CRNA 4ZO7A 1V5FA 3DV9A 4BLPA 2I4LA 3KKPA 3SSAA 4FE4A 1H3FA 1KMCA 2A33A 1J39A 3IULA 1Q7EA 1H2YA 2ACVA 1L4MA 4ZQIA 3SHQA 4YCSA 4ZHQA 4RHTA 1ZHOA 4KL8S 1R5JA 2A0XA 4DQKA 1PJAA 3B3GA 4XYMA 2CKMA 2VPIA 2ZFUA 1YZKA 3VSAA 3B9BA 4RYLA 621PA 1QE5A 4NH0A 3BBPA 3PE4A 1GNLA 3A4TA 4BNNA 1QLJA 1M8JA 4JSRA 4RGVA 3ZWAA 5TQ0B 2VHUA 2ZYDA 2ZUUA 4H2DA 1LJLA 1IBKB 2JLXA 1A77A 3KFVA 1A69A 1SU6A 3HO8A 3JRNA 2A3NA 1Y63A 1RPJA 2H06A 4K9KA 5J5VA 5A1TA 1YVEI 1JHUA 3DGEC 3ZV6A 1W5AA 1IPHA 3JQAB 1EFVA 4DDUA 2CB0A 5K8IA 3ZW7A 4L8LA 4ENSA 3HA2A 2HH9A 1F4PA 4X97A 1SZCA 2N9UA 2YNMA 4RADA 2YMLA 3UB4A 3ZG6A 3D3WB 3FBTA 4FDLA 1ICEA 4R3NA 4E03A 3TR0A 3LUDA 1KK3A 1UIRA 3HWWA 3K1JA 5KNDA 2QL5A 3RW9A 4ML3A 2Q8QA 4DDWA 1E7MA 1EFRA 3G0HA 1L5ZA 3BXHA 3ZW8A 3EBLA 2IXDA 2HRQA 5IUJC 2IE0A 1RJEA 1J97A 5TF0A 1ABBA 3AEKA 4A82A 4G4JA 1TTPB 3K6KA 3FI9A 4NCXA 4OU4A 1SCIA 1YDGA 3QXGA 3BL6A 1GU1A 3K15A 4RESA 4RAOA 2IKSA 2IY7A 4XR9A 1MHPA 2VYVA 3T12A 1QXSA 3QWIA 1HDRA 4L4ZA 4BVFA 4Q4CA 2YJZA 4DSTA 3M6WA 1H3NA 1MB4A 2AMYA 2H85A 4HEHA 2MTBA 1ZXLA 3ZI7A 1VJ1A 2DPMA 4GKBA 5L3QB 1DDGA 1EM8A 2UZ1A 4NG5A 4QOFA 4RETA 5KTMA 4EZEA 1J70A 4HNVA 1OCEA 2EF1A 5EJIA 2II6A 2P30A 1K6JA 2V8BA 4HWOA 2CD7A 3SHWA 2ZEJA 5B30A 4OQEA 5JHHB 4HVCA 4YRSA 1WP9A 2WF8A 1O95D 4JLWA 2OYSA 3ZE0B 5BNIA 2C1ZA 5DSZA 1L5LA 5ALQA 1TQ8A 2B5OA 3R0XA 1HLGA 4UJ5A 1D9ZA 1G7SA 1RJDA 4MVJH 4YJ2B 4YXWA 4C04A 5AQEA 1IB6A 2IHBA 3WZLA 4DPKA 1H0RA 2HB6A 4DV4B 4BFWA 2AI1A 1EWKA 3ZD8A 3T7CA 4AI6A 3DE7X 4BNVA 3BD6A 4HMPA 4WKCA 4CKEA 1ZH6A 1W34A 4PYOA 4UEJA 3ROTA 3O03A 3BWVA 3LQ1A 3R6LA 5C46F 5JBIA 3CLHA 3UH1A 3N2LA 3MGAA 3WIVA 4V39A 4BO9A 4GXTA 5AXBA 3ZV5A 1H8EA 3ZVNA 3LPMA 3EDMA 3RSZA 1S1CA 2YYSA 3RC9A 1E96A 1FSFA 4RA6A 3JQRA 2HC9A 4P2BA 3UZUA 4AZ3B 3EISA 4K9QA 3BMCA 2DWCA 4YQZA 1ADBA 1G5QA 4OQLA 3IKMB 2YFHA 5E3JA 1DAEA 4E07A 1XROA 2NN3C 2XJ9A 3EGDB 4P33A