1F0PA

Mycobacterium tuberculosis antigen 85b with trehalose
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
284
structure length
284
Chain Sequence
SRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIGEN 85-B
publication title An interfacial mechanism and a class of inhibitors inferred from two crystal structures of the Mycobacterium tuberculosis 30 kDa major secretory protein (Antigen 85B), a mycolyl transferase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 105
structure length 284
sequence length 284
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2000-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1f0pA00
5CH5A 1CUSA 2CKMA 4UBLA 3AIKA 4B9AA 4LKOA 4U2CA 1DWPA 4YK7A 2ZYSA 2VQ6A 3V48A 1THGA 3HABA 4GDMA 4RPCA 1U8EA 3DOIA 5CT9A 4M0MA 1N1MA 5ALRA 3BF7A 2PM8A 1W6RA 1T4MA 5JADA 4Y2RA 2OXEA 5BOVA 2O7RA 2BGRA 3LP5A 4J0DA 2PUHA 1EI9A 3C8DA 3H2IA 1C7JA 4B0OA 1A8QA 2WKWA 2Y6VA 1LPMA 3BF8A 3FYTA 1Q84A 3FLEA 5CURA 1CUJA 1MJ5A 1J1IA 4XIIA 2HU8A 4P08A 2QMQA 4J3JA 2HA3A 1DU4A 1WHSA 4S0XA 2ONCA 3RM3A 3F98A 1QJ4A 1TQHA 2OCGA 2CJPA 4N5IX 4AMYA 4GW3A 5D3ZA 3FCYA 3O4GA 4JUIA 1KEZA 3O4JA 3W2TA 3G9XA 4OYYA 1QIIA 1YA8A 4PQEA 3F67A 2Y2UA 3WZMA 2B4KA 3BL8A 1MX5A 1DT5A 2WHPA 4FKBA 3FWHA 1NU6A 2WU4A 5HK8A 2PBLA 5JAPA 4FNGA 4B7ZA 5JAHA 4JNCA 3M83A 1CUHA 3DD5A 4X6YA 4Y2YA 1XQXA 3L1HA 2VJAA 5K3BA 5CH8A 1E8MA 4EY8A 1M33A 4FLFA 4V2IA 1XROA 3ZLUA 1WB4A 3WJ2A 4G8DA 1YR2A 2QRUA 3BIWA 3W9BA 4L9AA 2O7VA 5BV7A 2JEZA 5LKRA 2XUJA 2H1IA 2IX9A 4BZWA 1J2EA 4RE6A 4IO0A 2XUPA 1USWA 4CFSA 4BRSA 4FLMA 2QJRA 1R9MA 1HPLA 4DMKA 1MTZA 1IVYA 3H2HA 4UBJA 3D3NA 1THTA 2AJDA 4W1QA 3ZWQA 1WB5A 2XUFA 4QLAA 1EINA 5CMLA 5BWCA 4H7FA 4KAJA 5DYWA 3ZV7A 5JD4A 3WK7A 5FV4A 1L7QA 4BRZA 2WUEA 4A5SA 5FXMA 4UFNA 3P2MA 4GECA 1N8SA 4Y2VA 1CR6A 3GELA 4Q1VA 4L0CA 4XJVA 3PICA 3M82A 4OSEA 1EX9A 1CUZA 1CUDA 3ICWA 3A2MA 3LIPA 1AGYA 4UBIA 1DQZA 3G7NA 2BKLA 2XUKA 5AM5A 4WY5A 3WWOA 2OCLA 5FOQA 5HKAA 4F60A 4HZGA 5LYYA 1VE6A 2HFKA 5I7UA 2HA4A 3R0VA 2CUTA 5K3DA 4B81A 3M3DA 4BVLA 4QE3A 2WG2A 2OAGA 4PNZA 4B80A 2R11A 5YASA 4FTWA 4UBKA 5AI5A 4PO3X 2C5GA 1IUOA 1P0IA 2WUFA 4QNNA 2RONA 1AKNA 4E14A 1ETHA 3LCRA 2ZYRA 3AJAA 2XE4A 3SX4A 5AM1A 3STUA 3A6ZA 4KE7A 1QZ3A 3QVMA 3C45A 4KE8A 2HIHA 1XZCA 5CT5A 2O2GA 2PX6A 2B61A 2WQZA 2RGUA 2GYWA 1OCEA 4O08A 4ITVA 3E1GA 4X6UA 4DNQA 3G0DA 3U1TA 1MNAA 1K4YA 5HF6A 1FSSA 4ZREA 2C7BA 3KWFA 2DHDA 3BJRA 1N5RA 1EA5A 5K3AA 3FVRA 3F8SA 2BUCA 2WSLA 4GLBA 4L72A 3ESBA 1UK8A 2RAUA 3I2GA 4IH1A 4QDOA 1CFJA 1X70A 2XMSA 4X91A 2ORYA 1G5FA 3T52A 5KWIA 2RHWA 5HKBA 1C4XA 2HDWA 2HRRA 4BCCA 1WHTA 3IIIA 1UOQA 2QKYA 4WFIA 4U2FA 5AM0A 1BN6A 2R8BA 1LZKA 1QE3A 1UKBA 5DYTA 1BRTA 2WJ3A 4QEKA 4C4XA 4OB7A 1L7AA 4U2DA 5CXUA 3B3QA 4KRXA 3PUIA 3SK0A 3WJ1A 1VKHA 2EDAA 3WMRA 4Q3LA 3H0CA 1LPOA 3FYUA 3WQHA 4CCYB 1VE7A 1YAHA 2WU3A 2WFZA 2QTBA 5AKEA 3RARA 2XUAA 5HF5A 3STVA 5CXXA 2PVSA 5E4TA 3JWEA 3EIOA 2QR5A 2WG1A 1XKLA 3ZI7A 2XB6A 1HLGA 4DLNA 1XLUA 2WFLA 4BE9A 4MYDA 1W52X 1P0MA 3R3XA 4H77A 5AKIA 4FHZA 1E89A 4CG2A 4X00A 3IUMA 5JD6A 1LPAB 5J3JA 3ZLVA 4CIBA 1RYYA 1QO9A 2JGJA 3WLAA 1DX4A 4WY8A 3E4DA 5AKZA 1EDDA 2FX5A 3A70A 3HXKA 3VISA 3D2CA 3I28A 3PF9A 1PFQA 1U65A 3OTQA 1ZD2P 1ZJ5A 3ED1A 5AKGA 1VXRA 2XQJA 4AZ3A 4HRXA 4G4JA 4ARBA 2Z3ZA 2FJ0A 5DTIA 2J4CA 2WIGA 2QS9A 4B9EA 2JGLA 5EIEA 4DSZA 4B84A 3EQ7A 3HRHA 4FLEA 4Q3KA 4AO7A 5FLKA 4Y2XA 4BTLA 1EVEA 1GXSA 5HCUA 3VJMA 4K6GA 1O6GA 2X5XA 2VT7A 5ALNA 3CXUA 2PL5A 2HA5A 1BN7A 4L3WA 1CUYA 3WYDA 1VLQA 2WILA 2QXUA 4OPMA 4AQDA 3R41A 1R9NA 4Q3OA 1XZLA 4MYSA 2Z8ZA 2C4HA 3WIOA 5LKAA 4ZWNA 1VZ2A 2OGTA 1GPKA 5HFNA 1MT3A 3ESCA 3DCNA 5ALSA 4RE5A 2QUAA 3R3UA 1A8UA 5HK9A 3CN7A 2JBWA 4LIPD 4H35A 1QTIA 4YASA 3DL7A 2V96A 4YX9A 3B5EA 4F21A 1DTEA 3HLKA 1WPXA 2OQVA 1QIJA 3TJMA 4QLOA 4B0PA 5SYNA 4Y2UA 5LIPA 2XMGA 3MUOA 3LLCA 4ZGBA 3JYHA 1PV1A 3DNMA 5FPPA 5C8XA 2EEPA 3F96A 4FOLA 5ALWA 4N8DA 5K3FA 2G5PA 5LZ8A 2YXPX 3RLIA 1ZD5A 1QOZA 1LZLA 4ZV9A 5E4YA 2QXTA 1E3QA 4QWWA 3KWJA 5EHXA 3G9UA 1SOMA 5AI9A 4G8CA 3KD2A 5FRDA 2HADA 3FLBA 1CEXA 1FFDA 1E8NA 2DQYA 3D4LA 5AOAA 1CUCA 1S8OA 1SC9A 4X3CA 4WFJA 4Y9SA 1FJ2A 1JMYA 1UOOA 1XRNA 5DLPA 1K63A 4G4IA 4Q05A 3WKDA 1B6GA 3O4IA 5JANA 5DJ5A 4DMCA 3SC2A 3WWEA 5AICA 5AJHA 1QIGA 1HKHA 1EH5A 2VJCA 1EB9A 3WK8A 3UUEA 2ES4A 4EZIA 4MXDA 5ALPA 1CUIA 1MX1A 3IUQA 5LLSA 3BIXA 5AIBA 1MAHA 4J0GA 1XZIA 4WJLA 4KE6A 3C5WP 5DNWA 4G4GA 3C6YA 3DJYA 4B83A 1G66A 4CCWA 3O95A 3WK5A 5JYCA 3G0BA 2OGSA 1XFDA 2W6CX 5IKXA 4PSUA 3ESAA 2CMFA 4NMWA 4OB8A 3ZLTA 4BYMA 1VJ5A 1XQWA 4Y2TA 2XLCA 1GPNA 3QBJA 3LIIA 4A23A 3G9TA 3G0CA 2ZSHA 4LXGA 2QVBA 3H2KA 2JGKA 4BC0A 4HS9A 4PW0A 5BWBA 3BE8A 3ZPXA 3O9MA 2CBGA 1CV2A 1GZ7A 4NVRA 5IVKA 5C81A 4Y2PA 4M0FA 1WCYA 1XKTA 3WL7A 1XRMA 2QZPA 3WA7A 4UPDA 1CUUA 2G4LA 4UBMA 1UOPA 2OGZA 1CQZA 1LPNA 2XMBA 1W76A 5ALGA 3T4UA 3BDIA 4OU5A 4BP8A 3GA7A 2PSDA 1ZGBA 3G9ZA 4FNMA 4EY4A 1HDEA 1ODCA 5JZBA 5AKHA 5A7GA 3DL4A 3EF3A 1JKMA 1CUEA 5HQ3B 1WB6A 5EHNA 1GPLA 2HFJA 2HU7A 3N2ZB 4PSDA 1UXOA 3GROA 2WFMA 3GBSA 4BCDA 1QIHA 3FNBA 4FFWA 4ETWA 5C7YA 4XVCA 1P0QA 4UBNA 1CPYA 3DDUA 4BATA 3IUJA 1ACJA 1H22A 4BVKA 1CUVA 5LZ5A 2XMQA 5DWDA 1KU0A 5I9IA 4OYLA 4NS4A 1AMNA 3D2AA 1ZJ4A 4JEIA 5LZ2A 3DQZA 4C87A 3I6YA 1QIMA 4EUSA 2BUAA 1O6FA 1XZMA 1F6WA 1ORVA 3WIBA 3WA6A 5ISMA 4X71A 5ALLA 5AKJA 5AI0A 2JIDA 2GZRA 1BEZA 4H7DA 4LXHA 2WUDA 4MWTA 2VAVA 1QGED 1Y7HA 1XZDA 1QIKA 3I2KA 3A2LA 3ESDA 4B6GA 1ACLA 3IURA 4AN1A 2OPHA 3AIOA 4P9NA 5DNVA 1JI3A 4MQMA 2ZVDA 5HF8A 5T4HA 1XZHA 2C58A 4H7KA 1PJAA 2X76A 5EIHA 3UMJA 3PI6A 4X7BA 5IH7A 4GBGA 3FCXA 1TCCA 4EBBA 3I2HA 5C8VA 5DYYA 5IVDA 1KU6A 3WKAA 1AUOA 1LBSA 3V1LA 3CN9A 1N5MA 2HM7A 2I3ZA 3VDXA 1CUXA 1K8QA 2OCKA 4BAZA 1DQYA 2Z8XA 4OUKX 1EXWA 3C70A 1UKCA 4Y2SA 4OD0A 5ALIA 3OM8A 4ZXFA 2XUGA 3A2NA 5A62A 5ALXA 1E5TA 1SCKA 4IH9A 3R3ZA 1F0PA 5ALJA 5KREA 3D59A 4H7JA 3CCBA 2OAEA 3R3VA 4FMPA 5JZSA 4U2EA 3H04A 3R40A 2DHCA 1K6EA 1B41A 4IQ4A 2VT6A 2GBCA 2B20A 5F4ZA 1UKAA 4K2AA 3IB3A 4AO6A 3AIMA 2ZYIA 3FVTA 3NGMA 3C87A 2WHRA 4UFOA 1XZGA 3F9CA 4WFKA 2XQIA 1QIEA 2XDWA 2XUQA 4KR0A 1FFAA 1FFEA 3C6XA 2C5FA 4Y7DA 1IZ8A 5EI5A 1VXOA 1ZD3A 4CCYA 1RP1A 4WDRA 5LZ4A 1ZD4A 5ALYA 1JU4A 5JAUA 5CRIA 2BCEA 2J3QA 4H0CA 3O0DA 2YH2A 3QPDA 7YASA 3RK4A 1XZKA 2JGIA 5A71A 3MVEA 4J03A 4HRYA 4QA9A 2JGFA 5AKKA 4QDXA 4N8EA 2ACEA 5FDFA 5K5EA 1JJIA 5AI8A 1R1DA 3FYUC 4FBMA 4X85A 2PPLA 4OCZA 2VTVA 5AOBA 5FKJA 4JYMA 1QIFA 3H1BA 3OG9A 2PKYX 4FWBA 2OQIA 1TK3A 5ALMA 5AKLA 3MUNA 2ZJ6A 4BBZA 3AUKA 3C6ZA 1FFBA 2HA0A 5JAOA 2AJBA 3AFIA 2IIVA 3R3YA 4X90A 4W1SA 2BAGA 4J7AA 3Q8WA 4P92A 5A2GA 1MU0A 1J07A 4PSCA 3WI7A 4TPKA 2ROQA 3QPCA 1A88A 3QMWA 5AM4A 4RNCA 4QDZA 3WWPA 3RKSA 1AQLA 1L7RA 1CUBA 1AZWA 3FOBA 1DWQA 4KRYA 4GI1A 3I6ZA 5AK3A 3KDAA 3WKBA 3X3HA 1A8SA 1LBTA 2VF2A 5FUMA 1TIBA 5AOCA 2V98A 5AK4A 5AH0A 2WUGA 5ALQA 5JD5A 4UHFA 1J06A 4FBLA 4BB0A 2Y2VA 4W1PA 2J3DA 1JMKC 1H2WA 1W4LA 3H18A 4G5XA 4ZRDA 5CBKA 5AK6A 5LZ7A 2IITA 5AK5A 1OXMA 4TGLA 4DM7A 2LIPA 5AO9A 3I6MA 1XRLA 1YB6A 3S2ZA 6YASA 2WG0A 5EHQA 3BXPA 1EDBA 1Z68A 4WDQA 1TRHA 2AXEA 1JU3A 3O4HA 3TEJA 4OB6A 4BC1A 1HL7A 1CUWA 4KAAA 1AX9A 3I1IA 1EVQA 2YASA 2BJHA 2JEYA 3TGLA 1GKLA 4KAFA 2UZ0A 3HZOA 4C88A 5ALZA 1JFRA 1VA4A 1CQWA 2QOEA 4F5ZA 1BE0A 1G42A 2GBFA 1CLEA 4W9RA 3K6KA 2BGNA 3C8HA 1P0PA 4N5HX 4AB1A 4DNPA 4MJ3A 2PSJA 1GQSA 3L1JA 2O2HA 1SFRA 1H2YA 1R50A 3FSGD 1Y37A 4H7IA 5T4BA 4GWLA 4F0JA 2CB9A 1DWOA 3IUNA 4D9JA 2HA6A 5C8ZA 3BDVA 1DT3A 1LPPA 4EY5A 5AKYA 3DYVA 3QYJA 3WYNA 1LPBB 3WZLA 3W9UA 1A7UA 1CRLA 3BWXA 2AJLI 1Q83A 1QTRA 3VVMA 1EHYA 4ZV7A 4C4YA 3IBTA 2OG1A 5D6OA 3PDCA 1JJFA 2XQGA 3STWA 2X8BA 1LNSA 4ROTA 4EA6A 4W1RA 3O9VA 2Z5GA 4J0JA 1ZI8A 1K5PA 4WCVA 2XI4A 1MAAA 3H2JA 2PSFA 1XZFA 2W22A 3YASA 3PF8A 3TRDA 1X2BA 3SWWA 2DR0A 3STTA 2HA2A 4K6KA 2XUOA 5AM3A 4X92A 4B85A 4J0KA 3Q0TA 5EFZA 3AZQA 4G8BA 2D5LA 3WWDA 1UT6A 3HYSA 5CW2A 4AN0A 2WIJA 1WOMA 5HZGA 5IVIA 1U2EA 2Y6UA 3I2JA 4I4CA 2QJWA 1VOTA 5CT8A 3G8YA 4BE4A 4X97A 3LS2A 4CG3A 5LZ9A 3W05A 5JALA 3ANTA 4C89A 5K3CA 2VEOA 3D5EA 5AI4A 5IVHA 1I6WA 4EY6A 3EQ9A 4C4ZA 2JGEA 3HACA 2DFPA 3OPMA 1BCSA 4AO8A 4BAUA 3HEAA 2HHAA 4XWGA 2PU5A 5FP0A 2WHPB 4X94A 3K9BA 2GYVA 4QWMA 1NX9A 4TVKA 1BU8A 2CEKA 1GQRA 3HSSA 4CIAA 5LP1A 1XLWA 4AX4A 1QO7A 5HQ3A 4UHEA 5AKXA 5EIAA 4UUQA 1UK6A 5AP9A 5A6VA 3VJLA 2GYUA 4PF1A 3QZUA 2FUKA 2C0PA 4QDTA 1TCAA 2DSNA 3V1KA 2WHQA 3DLTA 1BEEA 2FJPA 1EK2A 1W75A 3PFCA 5ALTA 1GGVA 1ORWA 2QM0A 1XLVA 4BP9A 5JATA 1QONA 4M0EA 2OCIA 4HAIA 3QM1A 3WL5A 2DCMA 1FFCA 2PUJA 3W06A 3D7RA 2G63A 4HXGA 4DIUA 2XUIA 2GBGA 4LHEA 1Q0ZA 1G4HA 3VXKA 2JGMA 4UHCA 1CUAA 4KJXA 1MPXA 1E66A 1UFOA 1XZEA 1E8DA 2H7YA 2QUBA 5AM2A 1ZICA 4KE9A 1CVLA 4AXBA 1YS2X 3FBWA 5JZ9A 3DKRA 3JW8A 1HQDA 1QFSA 3EBLA 2ZJ7A 2AJ8A 3B12A 4RGYA 2XMZA 5D3KA 1IMJA 3U0VA 4ZI5A 4I3FA 4UHHA 4BAGA 2B9VA 4EY7A 1XRRA 3D2BA 4MEAA 3HI4A 3DYIA 3QITA 5T4FA 2GBIA 4A16A 2ACKA 4NZZA 5DTJA 2JF0A 3H17A 3EQ8A 4DGQA 2ECFA 3WL6A 1SCQA 2WLSA 2RI6A 1DX6A 1XQVA 2YYSA 3G02A 4U2BA 1OILA 5AI6A 3E3AA 4JH0A 4N8SA 4PV7A 1CUFA 4DNFA 4GHWA 1R3DA 3C6BA 2WIFA 4X6XA 5D7BA 2XQFA 4X93A 4H7EA 1XQYA 1UZAA 2PSHA 3F97A 2GZSA 1TCBA 5DNUA 1DINA 4DMFA 1UK7A 4DMHA 4KEAA 1MX9A 5A7HA 4ARAA 4BDSA 1SCIA 3KSRA 3M81A 5E2IA 1GT6A 3KOOA 4DNOA 3OC0A 2HA7A 2ZYHA 3WK4A 1IUNA 4Z49A 5KBYA 1YCDA 1WPRA 2P8SA 4EHBA 5ALVA 3QPAA 3IULA 3OURA 1MN6A 5AHXA 4UBOA 3ANSA 4FDMA 3PUHA 4B82A 1UWCA 2WTNA 4QZVA 3FSGA 3W04A 2ZJFA 1W1IA 1MO2A 5K3EA 5ALOA 2Y1KA 3WWCA 2QT9A 3KXPA 1TAHA 5ALDA 2XMCA 3V9AA 3ICVA 1U4NA 1QIDA 5JASA 4J0CA 4HVTA 5CT6A 2WM2A 4INZA 3WL8A 4UHBA 2K2QB 4JYPA 1D07A 3DEAA 3WK9A 4HTAA 1JT2A 4EB0A 5E4JA 1IUPA 4AZ0A 2PSEA 2HRQA 3I2FA 1YSCA 2DHEA 3MGAA 4CG1A 5A7FA 3STXA 1LPSA 3G0GA 3VVLA 1F0NA 5CT4A 4BZZA 1Q0RA 2VATA 2CZQA 1ZIYA 3C5VA 1ODSA 1ODTC 1H2XA 1QLWA 3H19A 1BROA 4U2GA 4UFPA 3FYUB 3VJKA 3L1IA 1YA4A 2VAXA 3AILA 4I19A 1T2NA 4BTVA 2XUHA 1XZAA 1QFMA 2PU7A 3NOXA 2H9YA 3D0KA 4K5QA 1ZIXA 1YAJA 1VZ3A 1EDEA 4GEGA 3AINA 2XMRA 3OOSA 2WFLB 5ALHA 4C6HA 4J0IA 3ILSA 1LLFA 3H1AA 3PE6A 3HJUA 4Q82A 1H2ZA 1BCRA 3R3WA 4DSAA 2VJBA 2VSQA 3UUFA 1ISPA 4HXFB 1H23A 1ZOIA 2Z3WA 3GUUA 5ALKA 3BJMA 4DYHA 3FLAA 1UK9A 2DQZA 1LGYA 2XT0A 3NUZA 3IVMA 2I78A 1C7IA 5KWJA 4G9EA 1CUGA 1EB8A 2NW6A 1NU8A 3WKEA 4P93A 2XQKA 4E46A 4X95A 2G5TA 4K6HA 3NWOA 2V97A 5AIAA 5ESRA 2WJ4A 2ZSIA 3C43A 1WM1A 4Q34A 4KYVA 3H2GA 3V1MA 2WIKA 3QH4A 5H3HA 3E0XA 5HFAA 4E11A 3STYA 1YS1X 4CI9A 2E3JA 1EK1A 2EDCA 4LYEA 2BUBA 4QDUA 3K2IA 2VJDA 4IH4A 1Y7IA 1R4ZA 1ZGCA 5I8PA 2O2IA 2V9ZA 4AMZA 4GXNA 3WKCA 3IDAA 3WK6A 3S8YA 2C0QA 2I3DA 2XMDA 4G1FA 4HXEB 4LXIA 3QMMA 4BVJA 5JARA 4KACA 4J0HA 2D0DA 3IA2A 5JIBA 4Y2JA 2H7CA 2HU5A 4LYDA 1YB7A 4G9GA 3DS8A 4MWSA 4E15A 2BFNA 2OLEA 4YPVA 3CCCA 4MQLA 2WIDA 2RIPA 4BCBA 1XRQA 3AZOA 1F8UA 3DKKA 5CTAA 1IZ7A 1CIJA 5T4EA 1YASA 2I03A 4Y2QA 2RHTA 3I2IA 2WJ6A 3I1YA 1AURA 3FAKA 2XLBA 3VKFA 4OU4A 4FFVA 1AC5A 3G0IA 2XUDA 5K3FB 5SYMA 4C01A 3N0TA 1XZBA 3GFFA 3V1NA 1X2EA 1R88A 4IHAA 3GZJA 5ALUA 1VA5A 1RWQA 4H7HA 4XX1A 5HF9A 5EHZA 1MNQA 4W63A 3PFBA 2H7XA 5FPQA 2Q0XA 1JJBA 4MEBA 2J4FA 1XRPA 5CH3A 1ZI9A 1TKRA 1GKKA 3QMVA 4UHDA 1XZJA 5ALFA 3HC7A 1HBJA 5ALEA 2VA9A 5EGNA 4BDTA 1ZI6A 4DTCA 4H18A 1BS9A 3DOHA 2WTMA 2AJCA 3AZPA 2HL6A
chains in the Genus database with same CATH superfamily
2ZYUX 1MZPA 1R4NA 1WBBA 4V0RA 1KP3A 4UBLA 5G0TA 4C29A 1BDIA 2C4MA 5ICMA 4PZUA 1WCV1 3INRA 4U2CA 3RGWS 4RZXA 4R41A 3SSNA 1NRXA 3BCRA 2CHUA 4YK7A 3THWB 1ZQ1A 1RXSA 2CXTA 3G5LA 3IMEA 5LXTA 1FX0A 3HABA 2VXBA 3G6WA 3O5AA 1FDWA 2CYCA 2P6RA 4MRPA 2J0EA 4I8DA 1MR3F 2G71A 2XA9A 1T6YA 2CDCA 3VA7A 1I7LA 1N1MA 3ZBTA 4IOLA 3FRIA 2J9GA 1BJKA 2XE8A 1NYLA 3M4XA 2Q4BA 4QBIA 5EXEA 3IJ5A 4G8JA 5GIOE 4JBYA 5L53A 1GEEA 3ZKAA 2HCTA 5TMDA 1VHLA 3KWLA 1U7OA 3EZ6A 3UJAA 1B8NA 3NJ8A 1NATA 3GF4A 1F20A 1M2GA 2GKOA 1P2BA 4DQVA 3LP5A 1RI1A 4JASB 1JLLB 2J9YB 1GZUA 1CS0B 1VBKA 4J0DA 1T0PA 3U4HA 1Y7PA 3CRRA 2ZRKA 3UK7A 1PLKA 3H2IA 4XDZA 2VXCA 1CRWG 3P45A 1IYZA 4B0OA 1SUWA 1ATZA 2WKWA 2EG9A 3SE7A 1UXKA 3ORQA 4GLJA 3AERA 4FGUA 1Q84A 3EAFA 1QGDA 4HDSA 4KLNA 2BEWB 4LZZA 2IFTA 4R1LA 4XOIA 5JOQA 4DR7B 3K0AA 1CX9B 1SVMA 3LX8A 2HU8A 4XIIA 3T9BA 2IPOA 1OTXA 2P9TA 2C8KA 4K1LA 5CVJA 2BBWA 2BM8A 4CM9D 2HA3A 2ADFA 1KK2A 1WHSA 5C7LO 2UAGA 3GLVA 1XNGA 3WGZA 1FDTA 1POWA 1GGEA 2RAVA 2W0SA 2ZSDA 3CW8X 4P58A 4YP6A 4DM3A 4LDZA 5JBNA 3CLSC 2R6CA 4BKQA 3F98A 5BSVA 4OSOA 2OCGA 1CFZA 2CJPA 4FQ8A 3ZDXB 2F9MA 4GW3A 4A10A 2PZMA 5H4HA 4HAUA 4J94A 3ZHBA 2DKFA 4LSMA 1T4DA 4V38A 2PFSA 5HHTA 2C00A 1YA8A 2MINA 4I3HA 4PQEA 4UJ5A 1H3EA 4FEAA 2VN8A 3LBIA 4E21A 1S8AA 2JBAB 3DR3A 1T8YA 3GCDA 1NNSA 1R8YA 1RYBA 1U3FA 4M54A 4FKBA 1SVUA 1S1CA 4PYNA 3BD7A 1NU6A 2WU4A 3IOYA 5BVGA 3LKDA 5I8WA 4ZCQA 3ZK8A 4EUNA 5JAPA 4FNGA 4LVNA 5JAHA 1WXQA 4URFA 5IM5A 1GFSA 2TMDA 2W6PA 1CUHA 1L3IA 1XO1A 4QTZA 2WP8J 4YBZA 1SOAA 4HDKB 4DIDA 3A6DA 2F1OA 1E4YA 2I7TA 3Q9UA 1V4BA 4JKOA 3T7SA 2R25B 3ROXA 5BMVF 3CWQA 2YIJA 3SMVA 2DGDA 3JARB 3GLKA 3TPCA 4F5EA 4QU9A 5KJEA 2BEUB 3WISA 5BQOA 4MW4A 5D5QA 3WLMA 5ICCA 4LJLA 5CA1B 4CODB 1ZVQA 4ZO4A 1JEDA 3EMBA 4F72A 4JUAA 4M4SA 1M33A 4HQKA 2R8YA 2JJYA 1BGWA 4V2IA 3EHEA 4LBWA 2G06A 1BHSA 4RAQA 1NP3A 3IGFA 3T9EA 3COYA 3FVVA 1WB4A 3F8WA 4C43A 1NW4A 5FR1A 2NO9A 3OCWA 4DRXB 2FWAA 3CUTA 4CV3A 2GEKA 2FX3A 1YDWA 3OD5A 3GRUA 3PQ4A 1HT0A 2AOTB 5FBWB 1M2FA 4GIBA 4NJMA 3EZYA 1O97C 2IY8A 4NKRA 1EZZA 5JQGA 3JQDA 4ZOQI 3UBTA 2F1HA 3SIWA 4ZHQB 3KOWA 1B74A 3R24A 2YN2A 2AN1A 3I8OA 4FYMA 3C6MA 4KGZA 4CMIA 4Q4AA 5A3VA 3LPAA 3G5UA 7YASA 1QSGA 1Z4KA 3TB4A 2Q8NA 4HATA 2IZZA 1TTHA 1ZKMA 4ABYA 4FP9A 4G5RA 4IJWA 4P54A 3DEYX 2XUPA 4RE6A 4CQNA 2JVJA 3P4UA 4DR2B 1PJCA 1E58A 3HSKA 1L4MA 4CMJA 2G1JA 3K8QA 1R5BA 4QT0A 2IHTA 2I33A 2OGUA 3QVGB 4LZAA 4BKMA 4DLSA 1MTZA 2GJKA 3K20A 3DM5A 1BXGA 4PFJA 2HDHA 4TKMA 1XJ5A 4UE2A 4L5JA 2JLQA 3BIFA 5ITVA 2BMAA 4GZ6A 3MAJA 1A9RA 1DAIA 2PX5A 4U7HA 3UYKA 1E7YA 2AXNA 4P0QB 2X2EA 5HUHA 3PD1A 2OC4A 2OFOA 3MUEA 4HN2A 4QKQA 5BWCA 3RVKA 2WV7A 3HVHA 1RI4A 4MQ4A 1XPJA 2QRZA 4EYSA 3V8BA 4A0QA 1T6NA 3AVYA 5JD4A 1JFVA 2DJIA 2NSLA 2P2SA 4FKZA 4W5WA 2D59A 2EIHA 4U2KA 2NZVG 1Y63A 1NXSA 1G41A 1N2SA 5C80A 4R98A 7MHTA 2IUEA 1B0ZA 2ZBRA 4DDKA 3D4NA 3RO7A 5MGBA 1P3Y1 3DE1X 4UFNA 2FKAA 3ABQB 4A8JC 1XB2A 4JQCA 1LJ8A 2ID8A 3I39X 4R2XA 1I33A 4EUEA 3RADC 4Z9YA 3GELA 3U7HB 1NXWA 4RK7A 5I9BA 3V6LA 2NVWA 3GPBA 3HDQA 3ODPA 4RLSA 3WBFA 2GZ3A 1U8AA 3R0JA 4IIXA 4PVCA 4V0MA 1ZY2A 5UKDA 4XPZA 5AW5A 1DJQA 1T35A 4NXNB 4GPAA 3LIPA 3HJCA 2QAGB 4RYDA 3BB4A 4C0QC 1DQZA 2NZJA 4LJKA 3UGJA 1GNRA 4E4TA 3U44A 1J0EA 1NMXA 4LXXA 1JHPA 3NR2A 5DX8A 1MV5A 5HKAA 4F60A 5LDHA 5A03A 4P4UA 3V4OA 5LYYA 5L3ZA 4C30A 1U7HA 1U0LA 1W0KA 3TOSA 4MUIA 3QX7A 5EVCA 2HA4A 3R0VA 2HXGA 4BV2A 1OY1A 3A1UA 4O2BF 2B9EA 1I6MA 1UDAA 2JHAA 1RWKA 4XZ3A 3HWSA 5H9VA 4IUBS 1JZQA 5JDIA 1PD0A 2PTHA 4JQYA 1QZXA 4QE3A 4OI1A 2JAOA 2YOGA 4KQJA 4ZVPA 1ECFA 2O1XA 3AOGA 4EGQA 1L3BA 1ZK2A 4KOAA 5G4LA 1C1YA 3ONVA 4B80A 5YASA 1KRXA 3D8UA 3G8DA 4P35A 5KTSA 2VYND 2QORA 3JQGB 4MRMB 5AI5A 3L6RA 1F1JA 3DVAA 4RIIA 1P4JA 4L95C 1OW3B 8MHTA 5JCOA 3DVQX 1OREA 1GARA 2GZ2A 5FL3A 3OZUA 3LW8A 5EWMA 1AKNA 4F9FA 4RLFA 1GPWB 1KDRA 4ZDWA 1QH0A 2FHPA 3HKBA 3ANXA 1LV7A 3RFUA 2K6GA 2XWQA 4P2BA 1DG1G 1HQYE 3MT8A 3QLVC 3AVTA 4P0PB 3SX4A 2VS1A 4MKRA 1P7YA 2JZOA 3JQFC 2W8ZA 4Y6RA 3WNQA 2M6KA 2DY0A 3MMNA 3ZD6A 2FFBA 1V3VA 3GR6A 3PL1A 4RS3A 1MV8A 1RI3A 4M2LA 1E0KA 1SC6A 4EHJA 1DDGA 1W0CA 1L4GA 5AR1A 1GA6A 4PPGA 3P9IA 1VM6A 2YZMA 2DBZA 4LRUA 4XUGB 5KMGA 2ACWA 3LKZA 1V6CA 3O3OB 3EF0A 2B7BA 5FUBA 2HX1A 4HP8A 2PGNA 1KJWA 2ZJ8A 4Q21A 1KO5A 2ZFUA 4X6UA 3SM9A 1Y3AA 1HMYA 3PC8A 3LXRA 3AFMA 4B35A 1CZLA 1LLQA 2C9ZA 7ABPA 3TG8A 4TMZA 3R7BA 2X5NA 1M7BA 3I61A 4X7MA 3Q11A 1Z16A 3LBHA 4P22A 2AOWA 1NVMB 3KOZA 3AT1A 4CV1A 1U7WA 1NJ6A 4DCGA 1DGQA 3KTOA 3AUSA 4R01A 1YO6A 3PR1A 5BWMA 3S99A 1I32A 3R76A 1FMFA 3FPLA 2WSYB 2ILVA 3DL0A 1JQ5A 4EMBA 2R6R1 2DHDA 3JS5A 4G84A 1P1IA 5L3SB 1KERA 4A2WA 4M1ZA 1GQQA 1NULA 1O8CA 3RAJA 2EYQA 2GNAA 2QBYB 2QR3A 3Q0EA 4IJQA 3GJ6A 1JP7A 2ASVA 2CNOA 4BV8A 2NU7A 1YVPA 2Z4TA 1MHTA 1F2DA 3E7DA 4IH1A 2Q29A 5BSEA 1CFJA 3PC3A 1CP2A 2AMFA 2XMSA 3D6JA 1L5VA 2E7ZA 2ORYA 1JIIA 3ZHCA 4HF7A 2IYLD 5KWIA 2FDCA 1K86A 3M3HA 1WXFA 4CXMA 3ZI4A 4GKBA 5D3MB 3CRW1 5HKBA 3FOAA 2R2GA 4YROA 5DM0A 4Z3DA 1ZINA 2WVHA 3QY0A 1JF8A 1QV7A 3I0NA 2ZJOA 4Z4QA 2HLDD 1KQ3A 2AEMA 3A1CA 1R0KA 2IHZA 1UOEA 3RKUA 4DMMA 2GEFA 2D2XA 2JFHA 3LA8A 3P0JA 3RU9A 3Q10A 1KS2A 3ISVA 4D9EA 4WFIA 3OVMA 3GFSA 4HX5A 1RXVA 2I87A 4U2FA 2C29D 1BTOA 3NMUF 4KGVA 3BWBA 3HN6A 4GYYA 1GD1O 3WV4A 1J23A 1OZGA 2GARA 2Q4DA 3FVQA 3WRVA 4X7PA 3VR1A 2HJWA 1LNZA 4QEKA 4DXDA 1Z6TA 2NXJA 3LUGA 4RMHA 2WA1A 1DQSA 3ASVA 4EYOA 3BILA 1I0ZA 1S96A 3Q1KA 4OHVA 1PJBA 1BGXT 1D03A 3Q7RA 4WZAE 4JK3A 4IGAA 2JFFA 2JL1A 4Q3LA 3H0CA 1LPOA 2FX2A 3USCS 1UPUA 1I7SB 2GJSA 4XYEA 2LDBA 3EEBA 5BW5A 3VNVA 1IN4A 4QUHA 1LI7A 1ZDMA 1VMAA 1YAHA 2FZWA 3AHDA 3B7WA 5CU7A 2WFZA 2BHRA 4D25A 1Y1SA 1LDMA 2HSGA 2XVZA 4PE5B 1K08A 2V5VA 5KSWB 3VNUA 1YI1A 4TMFA 3AEKB 4XQ9A 2JKYA 3ZXXA 4BN5A 4FFDA 3CH4B 2RHMA 1GCIA 4BFLA 3AB7A 1U7ZA 3OEEA 1ML3A 2VBGA 1XP8A 2WSIA 4IDBA 4Z0TA 2IJGX 1NVXQ 3TINA 3UPDA 4BO1A 1D2HA 2DWPA 2QR5A 4H1TA 2B8JA 2WG1A 4O02B 2PXXA 1PWHA 2CMDA 4DFDA 5KS2A 2DKNA 3U17A 1M10A 2OSBA 1Z6QA 2W6QA 3CX3A 4PGGA 4B76A 4EHAA 3SLRA 1UMBB 4IF6A 5EMLA 4B40A 1CLUA 1SXQA 3DLBA 3ZJVA 4KI0A 4JLMA 3G2LA 3GJYA 1N77A 3IAS1 1NJGA 1BX0A 4BE9A 1M6YA 3Q8MA 3AF6A 2X22A 3RTGA 2N0SA 3I53A 5F35A 1IWOA 4JLAA 2OYSA 4UAUA 1QX4A 4WE3A 5EWJB 1G3QA 1AZLA 4XFJA 1CJTC 2QL7A 2XTNA 2Y77A 5KSPA 2WJWA 4I9NA 1L8XA 2D1FA 2DUJA 5FHRA 2J09A 1IOZA 3HGQA 1N78A 4E08A 4DC0A 1IWBB 2ZS8A 4XWWA 2D1RA 3V2HA 4WRRA 3L0YA 4JCCA 2NU8A 4ENRA 3WNBA 2YVAA 1CXZA 1UJ5A 3DZJA 3Q7TA 4CIBA 1RYYA 2NSDA 5F77A 1MO5A 2JGJA 1PZFA 5DDIP 5C1IA 3WLAA 1F38A 1YHZA 2PIAA 1WVMA 5AKZA 1EDDA 4CT4B 3A70A 7GPBA 4YIKA 3D2CA 1OKKA 4YQYA 3GZTB 1NQTA 1FMJA 4G41A 3T0IA 4RTJA 3DONA 2VP3A 1SQ0A 3HDHA 3CX7A 2FMKA 2NAPA 2AWOA 4LZNA 5T5QA 5B12A 1FVXA 3PNBA 1HNWB 4FYKA 1PEKE 3BTUA 4C07A 1RRGA 1N2CE 5HJEA 4GKKB 4QDJA 5FBRB 5KTKA 3U2QA 3GFOA 4OIFA 2I4IA 3HZHA 4R9VA 3ZE9A 2VHVA 2WJPA 3PNSA 4JS0A 4FE7A 1SBYA 5AKGA 4EDHA 5GJBA 1IJKA 1QV6A 3K15A 3NEJA 1KEUA 2E0IA 4UASA 5BRAA 1D8AA 1RLOA 3LK6A 3QVLA 2WWIA 1C7ZA 1PWXA 4F7DA 1SXIA 3H75A 3ZCXA 2RGRA 2V4MA 4FPXA 5M3BA 4MV7A 3GGJA 2XTAA 2PZEA 4L6AA 2RH4A 3EDRA 4Z2AA 1GNPA 3IPYA 1U2GC 3OPVA 2FJ0A 2I1LA 2Q2NA 1GG2A 3FPHA 1CEQA 1E4OA 3L0OA 4MVJM 4NFSA 4PZ9A 5DTIA 1E1NA 1LW6E 2A9KA 2X4DA 5SZJA 3TDNA 2GHIA 3GNSA 2G17A 3LU1A 3MJTA 3QOYA 3R5TA 1II8B 4FGKA 4RPLA 3K53A 1WNTA 4HDQB 3WWYA 1KQFA 4MUFA 1GZVA 2JGLA 1MQ9A 4UU7A 4V0NA 2I4MA 4DMUB 3PXCX 4A5OA 2QW0X 2DUMA 4UREA 3ZJ4A 2B82A 5JNRA 1JE1A 3D64A 2EYUA 2JJQA 1Z4LA 3I9KA 4J4BA 1XTUA 4DLTA 5IDWA 3QE2A 4WAUA 1O87A 4AO7A 1GL7A 5FLKA 4BTLA 2QVGA 1ZOLA 3BE5A 4KWEA 1HZZC 5CPFA 2X4GA 2FPIB 4DANA 5BXQC 1O4VA 2DYKA 1N8NA 3I45A 2JKVA 3K0CA 5AW6A 1TM5E 3GK3A 3P4XA 1Z7WA 2OBBA 3EN0A 5CUQA 4R8MA 5IJAA 3L7DA 4MS1B 4K6GA 1CQIB 1YRLA 3R3JA 2EERA 1O6GA 3HHPA 4HNTA 2VT7A 3HYNA 4KQ6A 5U4XA 3CXUA 1ESEA 3MWGA 3TQHA 3FTEA 4E2YA 1JW9B 1FXWF 1I9GA 7AT1A 1FNDA 3O82A 4LOLA 3R6GA 5E7QA 1CK4A 2QXUA 3PA6A 4L7VA 4EKGA 4JI0B 4MX8A 5BUSA 3TLXA 1YGPA 5HIIA 2RGGA 3MXOA 2BF7A 4TLAA 2H06A 4WXYB 5SICE 4AQDA 1UC8A 3ILXA 4MQBA 2QRKA 2XIJA 2PUEA 3BFPA 4XVQA 3WDSA 2BMJA 3OFSA 1PVDA 5HG0A 3FWPA 1BDJA 1U2RA 1XZLA 1DUIA 4P38A 3MNFA 4O1HA 1JLMA 1U5AA 4PGFA 5LKAA 2GD6A 3NHSA 4U6NA 5EQFA 1BD4A 4ZWNA 5EE9A 1GU0A 4LK2A 5IF9A 1GPKA 5KNDD 4BFTA 3SVZA 1YJBA 3AW9A 3OFND 5F64A 1AN9A 1H2RS 2FOLA 4I5DA 4QTXA 2IXTA 4U6SA 4YECA 5HFNA 5ALSA 3TZKA 2B37A 3GOQA 2QZ4A 4JX8A 4P6VF 3T3NA 4ZI7A 2VUIB 4A82A 3NJ4A 1FS4A 4WZBB 1OX4B 4ZEXA 4H35A 4F4JA 4TKUB 5AW7A 3MIIA 1WXIA 4CLHA 4YASA 1YONA 1EDOA 1NVBA 3QV1A 1YRHA 1F1BA 2PMFA 2DBVO 2HWYA 4YX9A 4I1OA 3UYLA 5JWOA 2HMUA 3URKA 5IN4A 4S1TA 4YUZA 2E82A 5EL0A 1L7PA 3E03A 4B45A 3VKHA 4CN8A 2PXCA 1JQEA 2YMLA 2XDQB 1Y1QA 1H6CA 2AEFA 2ZJBA 2ZYWX 2X8JA 4Q9AA 2ZRCA 1DFGA 2XMGA 3MUOA 3LLCA 5LIPA 4MVJD 3T7EA 1Z18A 5IAEA 1ELOA 3RK0A 2VDPB 3IKJA 3NIBA 4R6WA 4D3ZA 4B47A 1HC7A 4FK8A 1V2HE 4BQFA 3OIVA 3ZVMA 3PDIA 2XZDA 1Y7TA 4R2KA 2YWBA 3WHKA 3C0KA 1P5ZB 2VTEA 1NI4A 1Q1ZA 5FEMA 3QGMA 1RHJA 3FCEA 5ALWA 1J90A 1P2DA 3A4MA 4PZEA 4KQKA 5DH9A 3T54A 1WL8A 1A9OA 3DZGA 4YJ3A 3GRCA 5BQPA 1KI3A 3NHAA 1JEYB 2QQ0A 4LJ5A 3L4EA 2X19A 1E9FA 2RHRA 1QOZA 4HI0E 1W5BA 1Z62A 3K9WA 1IRXA 2RGEA 2IIPA 5DKFA 4ZV9A 3VDNB 1KR2A 2G07A 3JWPA 4LBZA 4HXYA 2PQMA 2QNRA 3RJMA 1DNPA 3GJ5A 4PZPA 4TLEA 3TRFA 3WWZA 2QXTA 3ZNPA 4BFWA 4KUHA 3MMXA 2PCLA 3OX2A 4MPRA 3FCAA 3KWJA 1KI9A 4ZOLB 1C81A 3A4NA 2C3YA 4ITUA 2DTEA 1XN1A 5IM4A 3VAYA 1LDYA 4RTLA 3N59A 5EHXA 3E9EA 1AUVA 2QLJA 4LKRA 3G9UA 4MGIR 4CQLA 3JSAA 1SOMA 4BXOA 2F4VB 1V45E 2R68A 4ENQA 2BRUC 3COPA 4R5HA 1UODA 3IQXA 4FX5A 1GLNA 4ZOAA 4MWOA 4AIIA 1TDJA 2I34A 2QJFA 2FDRA 3SS9X 4F2WA 3LCUA 3FSRA 3Q5DA 3QXCA 4PR0A 1CUCA 1SOVA 3ESZA 2HF8A 2F67A 4L02A 1AZSC 2C9OA 4DRYA 1VG1A 1Q15A 3AI1A 4NC9A 1MTOA 2HF2A 5TDHA 1AKEA 3QVOA 4X3CA 1V6SA 3ENQA 4KITB 1ZLXA 3KJNA 4TV8A 2VZ0A 4CTOA 1H2AS 1K63A 4ZT5A 3QIAA 5AVXA 1I7DA 3LX5A 1Y9EA 3EG9A 5K8TA 5IMBA 4Q4HB 4JQSA 2ZWAA 5FTKA 1J9EA 1FXSA 2Y0BA 3O4IA 4L8WB 3T06B 2CBZA 5JANA 1LF0A 1JNYA 2PMWB 2Z6VA 3EZLA 3FGZA 2Z8YM 3IMGA 4M8NE 3ZY3A 5CW1A 1PZMA 2YOHA 5AW2A 4OLFA 1WOYA 3I1FA 4G65A 5FOUA 1HKHA 2JVIA 1EH5A 1MIHA 4MUNA 4GSKA 1OH5A 3BS4A 1JR2A 1LDBA 2NYUA 2PO7A 4WI1A 5TEVA 2L2QA 2WT9A 4PQFA 1ZM4A 5DP2A 3WK8A 2WFAA 1BJTA 3K8YA 5HTOA 2KE5A 2QSYA 2Z98A 3OF2A 5EXXA 2BI8A 1XHLA 2NUAA 4EZIA 1PJ8A 2GXQA 3AEYA 3PGLA 1L5NA 3PIRA 2OP0A 5E4FA 1CUIA 1DXYA 2RHLA 4C6TA 5CA1F 4IS2A 5EXTA 4BB6A 5JXJA 5I7SA 2QL5A 3JAWB 4RA9B 1GITA 4GUAA 1NG1A 3L0SA 5AIBA 2RGYA 4EELA 1DWUA 3CV3A 5GGXA 2HNAA 2AB0A 2ZDGA 3QVVA 2YMPA 4R4JA 3V8PA 4WZAA 4BP3A 4WJLA 9MHTA 2QB5A 1VE5A 1Z74A 2X0NA 4TTRA 2H2HA 3GJ8A 4BFVA 1X9HA 1EFUA 2NV2B 3C6YA 3DJYA 4JN6B 3RASA 1G66A 4X0EA 3R5HA 2F8SA 2CV2A 2VTDA 3FTCA 3O95A 4NPHA 2OBMA 2HD4A 3G0BA 1XWWA 4P4LA 1XFDA 2BEVB 2RK6A 2P3LA 4TM7A 4V0SA 4XR9A 4D74A 2PS3A 4REQB 1TVMA 4XCXA 2QYOA 5IFKA 4J29A 2CMFA 2I54A 5ERGB 4ETNA 4WASA 3ZWMA 4ZHQF 1D2AA 1T2CA 5BN5B 1KGDA 1SEPA 1JG2A 1FW6A 4ESOA 4OB8A 4UTNA 1OYYA 3VZSA 5C46F 4BYMA 5ITZA 1ZH4A 5LNK1 1A3CA 1B6TA 1MD9A 1GPNA 1QH8B 3QBJA 5DHSA 4Z99A 5F5XA 1P2TA 3G9TA 4PO1A 3G0CA 3W6NA 4DN6A 1WV1A 2QVBA 2XD9A 5B7NA 2H4FA 2JGKA 1NF9A 2OAQ1 1N2JA 1DPGA 4PW0A 5BWBA 1ZVKA 4RGQA 4OX9B 3CUWA 5KNLA 1Y9DA 3RUEA 3WLIA 3NI2A 4EUHA 5C81A 1CU1A 1ISFA 4Y2PA 4M0FA 2AYYA 2YQ5A 2ZGVA 1G21E 3CIOA 3IDZA 4LMBA 4RPHA 1I6LA 4KQCA 5JMTA 1QBKC 4OQEA 5LSAA 2HEIA 2ZYVX 3BXEA 3LC1O 3HUFA 3W7AA 1R6DA 3J80A 1NAIA 3KELA 3RU7A 3WO0A 1RBYA 2CZCA 2G9VA 2QSUA 1NRIA 1Q3HA 3EGWA 5EG5A 1WKBA 5JPDA 4M9XA 8GPBA 1M0SA 2IUSA 2OGZA 3VH3A 3ZZTA 5BR4A 3NVMB 1G63A 3X2FA 1VDZA 3MWEB 4KQGA 3IT1A 2R6FA 3OA2A 4ZAGA 3WMXA 4D80A 4MJ7A 4J49A 3WQQA 3NONA 2GZDA 4EW1A 1S5PA 1H6DA 2VQSA 1CERA 1Q0SA 2AW3A 3FNRA 3GA7A 1UJBA 3WQSB 3HL4A 4Z1MD 2B1RA 3PNVA 4FNMA 3MCWA 4MR9B 3OKFA 3SAJA 1GRNA 5IG2A 1HDOA 2E49A 3DZCA 3OT5A 3AJ9A 3ZZNA 1E9VA 2N46A 1EFPB 2JGDA 3HB4X 3NU1A 4QLBA 1ODCA 1ZLYA 4KQIA 3KR9A 4YAWA 2V7GA 3TX2A 3VZQA 4QU0A 3AR5A 1GPH1 2V6JA 1IQ0A 2DH6A 2A14A 2PZAA 2ZZKA 2DAPA 2ZREA 3Q3VA 5K0BA 5KKNB 4GICA 1JSCA 2CFOA 2CYBA 2O05A 5JSKA 3ELUA 3MUFA 4QJBA 1IB0A 2Q49A 4FZJA 4YRMA 3VTKA 3HM9A 4RM3A 2P75A 1SJ9A 2CMGA 2IZ0A 2H1SA 1BO6A 3GBSA 3M89A 5C35A 1PR9A 3PC7A 4MWZA 4MRNA 2CLOB 1WXHA 1SUFA 1G8HA 4Y1FA 5DN6A 3WG9A 2BFEA 4DJEC 4EPXA 2C7OA 3LBFA 4HWGA 1RQXA 5GONA 4NV1A 2Q3DA 4FFNA 1QS0B 4OH1A 3DHYA 3EIQA 3WYEA 5IJ0A 3G13A 2Y0CA 3KHSA 2YWHA 3IUJA 3PDJA 2DT8A 5FNVB 3WBJA 2WMDA 1WD7A 4P3YA 4BVKA 3PRHA 1CUVA 4P53A 3ILYA 1P9LA 1VG8A 2FN8A 1U5CA 3P8ZA 1JQJC 1YRYE 2XMQA 3MT9A 4OQXA 3S28A 4BO6A 4C2UA 3NAGA 3VDRA 4ZVMA 5DWQA 3A0RB 1DG9A 2WPDD 1U7XA 3R0XA 4PXYA 2ZRHA 3GJXC 3NTLA 4L85A 4QO7A 4XGQA 5H02A 3DOEA 5EHGA 3TZ6A 5KQSA 3R5JA 1G1AA 1GZ5A 4CM3A 1QRRA 5I9IA 1HX7A 3LKBA 3FUUA 4ISBA 1I5RA 4P84A 3D2AA 4GLOA 3VO8A 3Q9NA 4DILA 1P2UA 1RLIA 3ZHZA 2GJ8A 1YB2A 2CLSA 1IAVA 1IBCA 2NSYA 3CLUC 3MCVA 3QKTA 5CHEA 5T6BA 4EUSA 4PG8A 3L0CA 1O6FA 2Y05A 1KR5A 5FL7D 3QKWA 5EKUA 2ZT8A 4YAEA 4JI6B 3N5KA 5BUZA 1UDCA 3DF7A 4QFMA 4IJUA 4S04A 3AOEA 4DLAA 3PNQA 4X71A 5ALLA 4YJKA 1UJCA 3WLOA 2QX9A 1L4HA 5AI0A 5FPHA 5B57C 1GPDG 1LSUA 1P8AA 1R27A 2GZRA 1PGNA 4MRVA 5AOVA 3SG0A 1GAQA 2V7QA 1O57A 5HZKA 2WUDA 4H1UA 3TVDA 1I8TA 2B8EA 5CIYA 1HDRA 4MVJF 2O2EA 2BFCB 5C8YA 1QGED 2RKOA 1T9DA 4Q7EA 3KP1A 4NBTA 1V47A 3T1TA 1K8ZB 3QEKA 4YT5A 4RHFA 2H59A 1QIKA 2QM8A 1QRDA 2Q2QA 3QSGA 4OHYA 5HGJA 5BPHA 4RIFA 3WNVA 3ENZA 4OKNA 3JQ7B 2GT1A 1L5QA 1WQ1R 4CKEA 2B94A 1E2EA 1O3YA 3FSEA 4XASA 1IEXA 4JODA 2ZCJA 3R7FA 2LWIA 1RNLA 2K5UA 1E2LA 2RIRA 3EGDA 4FEGA 4G4SP 4PX5A 3QKIA 4V2UA 5ELLA 2VNJA 1NN3A 1TD9A 1DRUA 2PO5A 2ONJA 2OXIA 1OD6A 1PJLA 5TF4A 3WMWA 1ZSNA 1FFSA 1XP5A 2PXAA 3HVJA 3AW8A 1XZHA 4IXWA 4LVOA 2C58A 1L9KA 3AU8A 2IS6A 1A72A 5BYKA 1Z56C 2H3HA 2JCSA 5K6RA 4QG3A 4IMPA 4JGBA 4MCIA 3UMJA 2DLCX 2CJWA 1NR5A 4P86A 4BJHB 4ZICA 2MT9A 2PT9A 4QXQA 1RR6A 4HAWA 3F4LA 5KYWA 2I1WA 3ZWYA 2JLVA 4DV2B 4QYTA 3G2OA 1X1BA 1GNQA 1IEQA 3L6CA 1L5GB 4KX3A 5JD3A 5ARDA 3EMVA 1P1HA 1AUOA 3CC8A 3ZBUA 3DDWA 4G4SO 4GAEA 4KTTE 2P6MA 4WIAA 3V1LA 2OBXA 2HNBA 4MH0R 4Q9IA 2HM7A 3RUAA 4RESA 5K8LA 1ZSVA 3NBFA 1CUXA 3KWMA 5EZYA 4DJ5X 1MJGM 3O1LA 4U0KA 4BKPA 3DKVA 1AK2A 1RYNA 2FW8A 4DPLA 1JH9A 1ID1A 4WSOA 4BAZA 1JV2B 2M1XA 3C3AA 2PHZA 1RRCA 4UUPA 3LYUA 1H0RA 3SYLA 2WYVA 3REFA 3VC3A 2NXCA 3W8DA 4GX0A 4EUFA 1OV4A 4YMWA 5JDIC 1HNZB 4CLOB 2AT1A 5L9AA 2JDIA 1V8DA 3S2EA 1VL5A 2F4NA 2ZWOA 1N5DA 3P20A 3F7OA 5K3SA 1EVIA 3OLWA 2YTZA 1Y1RA 2O8NA 1E3SA 4P3KA 1A4IA 1XSEA 4BGEA 1UJ4A 1G2QA 5HMLA 3HGTA 1FNBA 2GCNA 3I37X 3DMDA 4IDDA 1ZAKA 5MDHA 5EOVA 2XUGA 2OXTA 3HCWA 2DJ5A 2FUG6 1E5TA 4MV3A 1GGJA 2J3JA 2X3UA 3GD5A 3JQBA 4JP5A 1T3GA 3R3ZA 3ZH2A 5JCOC 1TQ8A 3OOEA 13PKA 1QX3A 5KREA 3B1YA 4H7JA 2XAAA 2XB9A 4BZPA 5C3MA 1QQBA 3GLHE 4NNPA 4RS4A 1N6NA 5KQLA 1PNTA 3MOGA 3KD3A 1FCJA 2HMYB 2B2NA 4I1PA 2Y93A 4GXRA 2ZR9A 3Q12A 3SQLA 1K3UB 1LWNA 2ETVA 3BH7A 3OPQA 4LYJA 4PNPA 3RSFA 1R00A 2P6NA 2PVCA 2PH7A 2ZWIA 4I08A 3AM1A 5BN3B 1B2RA 4N49A 1KYQA 2HCJB 1OWMA 4URZR 5D2CA 1DB3A 1BDHA 2ZETA 1UKAA 4IF4A 1M1YB 4P36A 3EGVA 3A6FA 2IYNA 1UBLS 1UEXC 2X9VA 1UXJA 2GF0A 1K5DA 2AFVA 3KHTA 1G4AE 2AEEA 1TKCA 4D45A 1QK5A 1F6BA 1YS7A 3DE4X 3SM3A 5A3QA 4MLPA 4Z2YA 5FPYA 3PC8C 4QYWA 5JG7A 4UFOA 1XZGA 2XZLA 1ONSA 1GZ3A 1J8FA 1ORIA 2XQIA 1A9XB 3QWFA 1MA3A 4HG2A 3TW8A 4KZKA 2D4AA 1CULC 1XWFA 2XDWA 3QKUA 4LXQA 3UT5A 1SBZA 3LC2O 2WI8A 4V3CA 4K9PA 3UMSA 4QYIB 4D6YA 4KR0A 1QPZA 1QHNA 1JWBB 2J67A 2MSDB 2OP1A 1FLVA 3WGTA 3A6HA 3LBYA 1U3UA 2NX2A 2NQTA 4YCDA 3AKYA 2UXCB 1YS9A 4HGQA 1A9ZA 1G7RA 3CPHA 3A9UA 1QVAA 2WAAA 3LNTA 4TVBA 4KNVA 5LJIA 1IVSA 3PUZA 3MJSA 5FBHA 2WWGA 3L79A 2O8CB 3T15A 4R7GA 1RMTA 3E9DA 1QG6A 1QU3A 1Y34E 1MFZA 4W5HA 5JWHA 1ZRMA 3VUEA 1WCXA 2JFGA 1GO2A 4CCYA 1U63A 2IYXA 1HI9A 1ZFNA 2Q4TA 3OCZA 4QOGA 5D01A 4HB2A 4IDQA 3GZNA 4D6XA 4RKQA 4B8YA 4XQEA 3NFRA 2PRZA 3CO5A 5BQ3A 2OT3B 4KGDA 2AN9A 2PUGA 3K31A 2BCEA 2W11A 4LXUA 5GZ6A 2HV9A 1FSPA 4J2OA 1SHKA 3KPJA 3O0DA 3TOXA 1TMOA 5INTA 3COSA 3NVDA 4WADA 3QPDA 3RK4A 3K5HA 1FJHA 1XVAA 2IZOA 1I9CA 2PAFA 1B0AA 4JEUA 2UKDA 3UB4A 1OLXB 2IEZA 3UT0A 4CF7A 4E5SA 3INNA 3R9IA 1B8UA 3TSYA 2E4ZA 5IXJA 2RK3A 3MVEA 1J0DA 2O5VA 1FA9A 3QFFA 4JXKA 5JI3E 3ZHUA 3Q9SA 2P1ZA 1YVDA 2HYDA 1SXJD 3QUSA 4GPD1 4L2IA 4NG5A 4RU1A 4BPRA 2X4LA 4PBSA 3NBXX 3O21A 3O8QB 2Q4RA 5FWXA 1SVOA 4JBWA 1I51A 2P5YA 3DAPA 4EJSB 3N58A 4N8EA 4UZSA 1WUTA 5E1MA 3KFLA 1G21B 4M7PA 5K5EA 4TWAA 1VL1A 1SKQA 2NPOA 4QQNA 1UBOS 1IJEA 3QNUA 5AJUA 2ODAA 5JAMA 4CM9A 4NONA 1ID8A 4M1OA 1UH5A 3V80A 3N0WA 2JAWA 1JBKA 1P9WA 1A9PA 3OZ7A 1JI0A 1G8KA 2ZTLA 1T1IA 1MX3A 4OOEA 4AYWA 5AOBA 2JS7A 4JJKA 2P40A 2VZ8A 2ZTSA 1CY7A 1T4BA 4CCAA 1QIFA 1DBVO 3PGXA 1AKRA 4XGNA 4TLLB 4HAOA 5IMSA 1MGPA 1OXXK 4B44A 3VSCA 2AN5A 2YX1A 2VDWB 1TK3A 5A4JA 2ZJ6A 2GFQA 4R1PA 1VCOA 4FJ2A 2IDKA 3IXLA 2C2XA 4BZQA 1FFBA 1BXKA 2BJVA 1TCVA 3L8FA 5B7QA 5JAOA 3EDQA 2PR2A 2FXIA 2UVQA 4ZAYA 3RUFA 2AV6A 4G5OA 4CIXA 1K75A 5EN4A 1PJSA 4XUCA 2E2WA 3T1HB 3WB9A 5GJVC 2BAGA 4ZQEA 2GPTA 3R8XA 5ANRB 4F3TA 3KKEA 4QBHA 4BO0A 4D46A 1J9ZA 3GFVA 4BHTA 1SIWA 2I65A 3O26A 2PT5A 1YDGA 4OF4A 2B92A 3Q8WA 3NIGB 4EF6A 3BBLA 1OH8A 1JXAA 1J8DA 2VUHB 3AI7A 2OHIA 1FUIA 1G9XA 1WXXA 3HPRA 2DVMA 3ICCA 5A2GA 2BYTA 4PYJA 5JSHA 1J07A 2V7BA 4A6XA 4PCLA 3KLNA 4J4TA 4JCOA 2A9VA 2FR1A 3CUVA 4L0MA 3GPDG 3GEHA 3R74A 3TK1A 5LWQA 2DPYA 4N40A 4MUGA 5H82A 1KA9H 1N0HA 3CB4A 3PYMA 4JKIA 2A88A 2F00A 3QA9A 4RNCA 5LPNA 3D3JA 1AQLA 2M32A 3GLUA 1TKBA 4AT1A 5JS6A 2OZVA 1HSOA 2BFFB 3M9LA 3RRFA 4M8IA 3WLQA 1M8GA 1F5NA 1UWKA 4XTRA 3ZHRA 1AQUA 1KMMA 3I6ZA 2YINC 2FJUA 2UDPA 3MPUA 5FPSA 4J3FA 5T41A 2I7CA 2WM3A 3TTUA 1M5TA 4JLOA 4MNTA 3V8RA 6REQA 4CLRA 2YWDA 3T1QA 1T5DX 4TV9F 3ZHVA 4G0XA 3GA5A 5DW3A 2G1KA 5DHUA 6ABPA 3OPXA 3PUJA 1A8SA 3L06A 4RIHA 2P78A 1TIBA 3KOYA 2Y66A 3RH0A 5J5AA 3TLEA 4DJTA 5JSYA 1QGUB 3K0FA 3UZUA 4FSDA 2XXAB 1HRKA 4R68A 3Q3EA 5AVYA 2J6IA 2XVMA 1Y8AA 3NAMA 3ZY6A 4Y30A 4FBLA 3MSCA 1U9YA 4NX2A 4P34A 4Y18A 2Y2VA 4W1PA 4J9UE 3TZEA 4PQYA 4MV5A 1T1JA 3QFSA 3OIDA 1H2WA 5LYJA 4R0MA 3OOWA 2NIPA 5LZ7A 4D8VA 4LTNA 5IJWA 2IYAA 4ZOLF 3HDTA 3X1XA 3F9IA 4DM7A 1KAEA 2H65A 2XTMA 2A3RA 4IM7A 3SHTA 5JCXA 3L7YA 2I4NA 3JYQA 1TM4E 2P5TB 1R0SA 1B0UA 3R0ZA 3H8JA 3MF4A 4Q7JB 3QBEA 4X1KB 2VSNA 4M88A 4YC7A 2WG0A 3B1KA 3LZDA 2AGVA 4QHSA 2OXFA 1Q2XA 2I1QA 2ZCVA 2XVAA 3BSWA 3CE9A 4GR9A 4DVGA 3FAZA 3GQBA 1SXPA 4JUDX 4ALJA 1TYDE 3A1SA 3TLCA 5KJ1A 4WDQA 1HOXA 1MA0A 1P4RA 4M53A 3QF7A 4DLPA 4EEZA 1JDJA 5F9FA 3K0CC 5EIXA 2Z5VA 4MYTA 5HM6A 4RVHA 3RFXA 3S1SA 4J0QA 1OLSA 1TYCA 4KREA 4II3A 5LOVA 1P4HA 1DCFA 4FE4A 1J6UA 3ROQA 3S44A 1KK1A 1NN5A 2AXEA 1R6TA 3BK7A 4B34A 4OLHA 5JWRA 1JVNA 1ZK1A 1I94B 3HDJA 3W5AA 5EE5B 3EULA 4DMGA 3T7DA 4QNMA 3MYYA 1OGIA 2GF2A 2JW5A 4C7OB 1HL7A 4KAAA 4MS3B 1AX9A 3T5DA 1GRCA 4CDRA 1GPMA 2WJIA 1TU3A 2EXXA 3AQ4A 3I0ZA 3EIXA 3IT2A 1G38A 3E15A 1V7PC 1ZM7A 2BMVA 2IU0A 1MB4A 2OHOA 5D85A 2UZ0A 2X3YA 4DQ0A 3UVEA 4S2UA 1SURA 1E7RA 2B25A 4HDRB 1PDVA 4F4FA 3KUUA 1DRVA 2CC2A 3EXFB 2IL1A 4LWOA 4XLTA 1JFRA 4R69A 3TN7A 3H5RA 1VA4A 2JEOA 4RFSB 4ARZB 4D4GA 4FGWA 3N74A 2KJQA 4F5ZA 4G0VA 4NL4H 5GV7A 4UNQA 4Q02A 1I4OA 3LSYA 4IZ6A 1TJ4A 2DULA 3S4YA 4DLLA 3KAQA 1FXWA 1CZNA 3ZBPA 2BGNA 5F76A 3WDLA 3RYHB 1WEHA 3H9JA 4L4ZA 4DIKA 2R0QC 3WO1A 1KYZA 4MROA 1BS2A 1P0PA 3S2IA 1KYIA 1TLFA 3EXG2 1A71A 1XMVA 3MMPA 1ML4A 4W8GA 2JFQA 3R4VA 3QVWA 4DNPA 2VQEB 4Y9TA 1QM5A 2EL9A 2W70A 1EAYA 1CJCA 4FI3F 4U5QA 3UMYA 1NR1A 1VYUA 2FP4A 3DJFA 4HGYA 3N3AC 4GVPA 4E0BA 4EKYA 4LV6A 5DEOA 3DZIA 1PUJA 2VJPA 2VYNA 1PDWA 3NBYC 3OMLA 4YAJA 4DA4A 2D1QA 3GJRA 4A4DA 3FSGD 4WY2A 3FPEA 3A27A 1DI0A 2GNPA 4LC0A 3B9QA 4DBLE 2GBPA 4WMLA 3F6CA 4M7OA 1NVDA 4OBEA 4QXAA 4RSGA 1GN9A 1PR4A 3AEUB 4MCAA 4RANA 5ENVA 4F0JA 2Q5IA 4O59O 3GAAA 4O4HB 3KPWA 5CX1B 3R2JA 4A1FA 1KOFA 4ZK2A 2JATA 1JJAA 1OXBB 2YWRA 4OXQA 4RKWA 3FPCA 4DJAA 1V9CA 4LX8A 5AVKA 4D9JA 4AKIA 2EZ9A 4BJ1A 4I9FA 3E8MA 1CZRA 1DT3A 1G6HA 2DFKB 2P9BA 3B51X 3O74A 4IEFB 3BGDA 4W6ZA 1G2IA 1QC5B 3FFWA 3GLHB 4I9GA 2Z08A 3BXOA 3KLBA 3JSXA 3ZU3A 3KVVA 4AUEA 4GZ3A 2XB4A 4M0CA 3K2EA 1IZ9A 3LUJA 3PU6A 3HS3A 1I1QB 1NIPA 2D0OB 1XJCA 2VCEA 2YCBA 1Z37A 4PRYA 4D97A 4EPWA 2I6FA 2GK6A 3WZLA 4PHGA 4RADA 5IRCD 3LUDA 3E48A 2C98A 4XM0A 1A1VA 2WWTA 4EATA 4URUR 3QF4A 2AJLI 3N39C 4IOMA 1X0XA 2Z2JA 3DBRB 3P9CA 5E6UA 3PIDA 2P0AA 3IVAA 4KQ1A 4KO4S 4UEOA 3D8RA 3OC6A 1XU9A 4MO2A 1CVIA 4ZP1A 5F1PA 4ZKEA 3IBTA 3PDCA 5BSUA 1TF7A 1AB5A 1JJFA 3AQIA 3NDRA 2I7DA 1L5LA 1JX6A 3EVTA 3MN1A 4G0WA 1GAWA 3AUXA 4A0HA 3NXKA 4HWKA 3RB8A 2G36A 2YJ3A 5K8JB 4W1RA 1SRQA 3B5IA 4KXVA 5J23A 2JLBA 3GCWA 1RW4A 4BNGA 1DARA 1FFHA 1GYQA 1P9RA 1Z88A 3NHUA 3P26A 5HKOA 4Y2GA 5MHTA 1TD1A 3IP8A 1EBBA 4AMGA 2PSFA 3L8MA 3EWIA 1ZUWA 2VAMA 3UAZA 4OA5A 3UH1A 2DR0A 1KTIA 3L7MA 4IG9A 3STTA 5LL6P 4K6KA 3QXSA 3LLVA 4Z4IA 2BSQA 3BCHA 1QO0D 3RWOA 4B85A 2IEIA 4P3OA 2HH9A 1LDGA 2VP9A 4V03A 5G4KB 3W4IA 1XVVA 2DPHA 5LMNB 3RVBA 1PT8A 1KIAA 1U1IA 4G8BA 1B3RA 1CT9A 2P4HX 3F49S 3FZNA 4YRFA 4DQXA 3G68A 1JYSA 3CG0A 4FFBB 5EINA 2PX8A 1UT6A 2ERYA 1SB9A 1KEEB 3R8CA 3HDYA 5FOXA 3ZDRA 4B4KA 2GX6A 2QZSA 3LOUA 4OHBA 1D6MA 1KMQA 5AJWA 2RMKA 1GUDA 3W5UA 1Z4NA 2WIJA 2OTCA 2DFDA 4INOA 1C3EA 3O92A 4DLXA 5C5EA 4R8VA 1W2GA 1Z0ZA 2EEZA 3ODGA 5HZGA 4UOEA 4YCNA 1Y4ZA 2Y6UA 3I2JA 4C9BA 1F7VA 5FNVF 4NOJA 3ZWPA 5EUQB 4HS4A 4B5KA 4PHHA 5CT8A 3G8YA 3EEYA 3GCXA 1I10A 4P3NA 1NOIA 2TECE 2O3UA 1ABBA 1LXCA 3JALA 3LRTA 3LS2A 4CG3A 4F8YA 5LZ9A 1WXDA 3B9RA 3DHVA 3K30A 3SKVA 5JALA 1W59A 3ANTA 3M6VA 4ED9A 3RKRA 3EIHA 5FUVA 1TLTA 5K3CA 1OU4A 2VEOA 1W47A 3DEKA 5AI4A 1I6WA 2RHGB 3ROFA 3EQ9A 3KKMA 1WAMA 1UM9A 3LWBA 1Z73A 2DFVA 2FEKA 1NBAA 2JGEA 4U7PB 1V1RB 3NGLA 1ISSA 4X3OA 3D81A 3OMXA 4CDNA 5C37A 2D13A 3FCSB 1P45A 2O52A 3AF4A 1YF3A 2PU5A 4FW9A 1G291 1TEXA 2GN9A 1KMHA 3NBKA 4JLWA 3AI2A 1NMSA 4UUMA 2V9PA 1I24A 1CNMA 4J7CA 4X94A 4NCJA 5COQA 1ODJA 2Q6OA 5IT0A 3KU4A 2APJA 3OZGA 3M34A 4OM8A 4UARA 2WWFA 1NI5A 2Q45A 2PX0A 2Y4NA 3K4QA 2CDBA 4Q9HA 4C3OB 4F3CA 3GMDA 4AY2A 4PAQA 4UNPA 2X15A 4HDAA 2DUNA 4LRSB 3HN7A 3C16C 5TLSA 5L7WA 3I5UA 3HY3A 3V4PB 2UU9B 3DLAA 1B4DA 4DT1A 3KB8A 1H4SA 2Y9MB 1JTVA 4NLLA 4M8KA 1YMVA 2R3SA 1NLMA 2F8LA 3D7NA 3JYLA 5F3WB 4R9RA 5SV2A 1S4QA 1XLWA 3UWPA 2FQYA 3OU7A 3KUDA 4H17A 4Q24A 4AX4A 1V7CA 2BGUA 4GOJA 2W4QA 4PTYA 3L40A 3P94A 2A1TS 3QQPA 3MHTA 1W9HA 1UK6A 1MAWA 3L5OA 4MZDA 3TW4A 4ZYTA 1OV6A 4P5EA 1TT7A 3GO4A 4IDAA 3WYFA 5KNBD 1M0TA 3B53X 4V0OA 3NCHA 1LVUA 1BOFA 4CN9A 4N0EA 4PF1A 1PK8A 1TW2A 4NE7A 2Y4OA 3I09A 1L7EA 1ZW6A 2BPOA 2XCOA 3QZUA 1ONBA 3TWOA 1B2LA 1ABEA 1W5EA 2DSNA 2Z57A 3D4PA 3IVRA 1P4AA 4PZYA 5HIJA 4MVYA 4BLVA 3KJGA 1WMDA 2O8DB 5L40A 2OY0A 4INJA 3B7PA 2C8LA 2ZB3A 4HD8A 4FMCB 4RKRA 3WR5A 1YWGO 2D5IA 4LXTA 1OF1A 3K0HA 4JLKA 3SQOA 3OLCX 3QUQA 4CKBB 1XLVA 3NVAA 3TQTA 3DZFA 2ZRGA 3EDCA 1ZITA 4U02A 1JYEA 2FK7A 5JNLA 2QRHA 2VLBA 1DAHA 1R8JA 1TM1E 2JZCA 1V16A 3QM1A 2JFOA 2P9CA 1E2NA 3LTEA 5E9JA 4IKPA 5IU6A 2A84A 3L7LA 3VM6A 2IU6A 1YR9A 4CKWA 3LF2A 1L4LA 3NUQA 1ZZGA 1JA1A 2G63A 4HXGA 5KB3A 5F2KA 2XUIA 4EPTA 5B4TA 2GBGA 4LHEA 3Q15C 3RS3A 3FN4A 1YQUA 3TLGA 2J48A 1CUAA 3OPNA 4ZYWA 4KJXA 1NUTA 4JV5B 3TCXB 2CHEA 4N76A 3ELDA 4A91A 2CFSA 3INYA 2R65A 1VJ0A 4ROSA 3QBDA 1KI1A 3QEBZ 3OT1A 1NZDA 1T4CA 4GM0A 1BE1A 4DYVA 1E8DA 4DLVA 2D4HA 4RTSA 4LF4B 3JQRA 3CVJA 1IN5A 1RYFA 1NUSA 4M1SA 4EPRA 4YT4A 2F59A 1P44A 1UMCA 1TE2A 1TJYA 1IM5A 4G24A 4AZTA 2N75A 1U2QA 1GL6A 3RJ9A 3QK7A 2ZJ7A 1YQDA 1E1CB 1NOKA 4U7TB 3H5LA 4EQ6B 2UYHA 3JPYA 1B00A 1GTL1 2UZAA 4HNGA 4BGIA 2UXDB 1JHYA 2J41A 3E05A 3IPRA 1X8JA 4I3FA 3C5EA 1TVKA 1JFFA 2B9VA 4PLHA 5DBIA 1U3CA 2Z43A 5BP7A 3AVQA 4EY7A 2ODEA 4CEJB 4JP8A 4MEAA 5ELXA 1OWOA 3W5HA 5JBIA 1MHPA 4LSZA 5JTTA 4M89A 3TLMA 4S24A 4E88A 2CXQA 4BLSA 1WV0A 1NQVA 5FLEX 2FNAA 3INGA 1FRFS 3MS2A 5F1OA 4A16A 3H11B 1S7CA 2PV7A 4TQAA 2I55A 2JF0A 3H17A 3GVPA 4E32A 3EUWA 3LT0A 4L5CA 5JZMA 1BFKA 1NJFA 1YULA 4OIMA 4JI1B 4E3WA 1CQJB 3H84A 3AOEC 3G02A 4G0MA 4I2NA 1SHLA 2QYSA 2VDMB 2ZATA 3GRPA 5HOEA 2HLHA 1UBFA 2IZ5A 3DHWC 3O73A 4KLZA 5EIFA 1X8KA 3VU0A 4KBFA 4AJEA 5KNDA 2WJYA 3BE4A 2DPGA 4IGFA 3A6JA 2INGX 5EFOA 1CUFA 3OFNA 4FDVA 5B1YA 3U6BA 2BFAA 4CFZA 1E3LA 3AB3A 4DNFA 3QYPA 1Z38A 1XUOA 1W4CA 2QD3A 2VK1A 4L51A 3BHMA 5J1SB 2X1MA 4XTCS 2YDYA 2K4MA 3H13A 2HJVA 4M46A 4X6XA 1G8FA 1EQ2A 4C7VA 1JAXA 2Z3VA 3EGXA 5FTJA 1TM7E 4DCOA 1FW8A 3W4JA 2H5EA 1LBIA 1EZ4A 4OA8A 1F48A 3OJXA 4H7EA 1NXXA 1UBKS 3IRVA 1D4AA 1YRBA 3F97A 4C0KA 4Y6SA 4KVZA 4RDCA 3RTEA 2ZSAA 2Y76A 1DINA 1VPDA 3FUWA 4M7RA 4PZDA 4M9ZA 1S3SA 3N3BC 2NUBA 4NBWA 4P5DA 1X8LA 3QE0A 1ENZA 5H1YA 1YU9A 4DMHA 2EZTA 4OK5A 5THKA 2CKDA 1G1MA 2MYTA 4RJKA 1KI2A 2DG2A 3ON5A 3MA0A 3SXJA 1XDZA 3BTOA 1T8PA 3EWAA 4ZAZA 5CG1A 5JRJA 4N03A 1BDMA 1QFZA 1R18A 1OHHD 3A9VA 4GPTA 3ZGLA 1EUCB 4PHCA 2W2XA 4X24A 1QP7A 1TZBA 1E2GA 3SNHA 3OQBA 4F3KA 3PQ5A 2XH8A 1U28A 1VHDA 1XTBA 3P0EA 3VO1A 2E21A 3CNNA 1QHFA 1XELA 3KSDO 5E2IA 2P1DA 1NPYA 2WWXA 5ED4A 1WF3A 4DNOA 4ZD6A 3VYSB 3MWLA 1KI7A 1O6BA 2NYRA 2YBDA 1D09A 2E4XA 3C98A 2ZJ4A 5L3QA 4RYLA 4UUBA 4WQMA 1GPJA 5IC4A 5ER9A 1IUNA 4HFRA 1T2FA 5KBYA 4AK9A 1OLUA 3EAGA 1HDYA 1JT9A 1N2EA 2O0KA 4XOUA 3UMGA 2IUYA 1R7RA 4F12A 5J4VA 3IV7A 2JI4A 1VE3A 4TTIA 3FMFA 4GOXA 4TMXA 4MVJI 1MN6A 4WOCA 3R7SA 2IHVA 3F6EX 4LN1A 4JA0A 5AHXA 4DCSA 1XXHB 4UBOA 1UDXA 2GD0A 4IICA 4FDMA 4G81A 4ID9A 2O5RA 2B0JA 4FX2A 1L5RA 5I5GA 1SGWA 5IK2D 2ZZMA 2K7ZA 3KG2A 4BNIA 2PWBA 3JV7A 1OFGA 2HUPA 5D3MA 4A9AA 3NYRA 4Q3DA 4G86A 3SSMA 4I1RA 3MQ2A 3FNEA 5ALOA 5J4KA 2WD7B 4TKVA 3WWCA 5IYZB 2G4CA 3SKYA 4RWEA 3W6ZA 1Q7CA 5HILA 4BLOA 5T8KA 4D9BA 1FTWA 1J4AA 1P91A 2XMCA 2VSXA 3CZ4A 4FJ1A 1RHKA 5JVDF 2CLIB 4E12A 2EARA 3FE2A 3MJHA 1XEFA 4UE3S 3E5NA 4WW0A 1Z83A 4N0DA 3VOSA 4C0JA 4B3BA 3IUBA 1E1KA 1SQ5A 5KYGA 1JLKA 1ZIPA 1CDZA 1TFRA 2OXCA 3EASA 3LV8A 4DIBA 4GI5A 4I0WB 4L16A 5K0GA 3WL8A 1FUYB 1MB0A 2IYEA 2KWIA 3KETA 4UHBA 4YAUA 1E3IA 4QECA 2FUNB 4N6OA 5A6SB 1E5VA 1B15A 4J1QA 3DEAA 2GK4A 4EB0A 1FE8A 4RKEA 4YCSA 2FLWA 1Z5PA 2G6BA 4B48A 3EISA 3TR5A 3DV2A 3I5YA 1JIJA 1YSCA 4IYJA 4GMHA 1XD8A 3IKVA 3TO5A 1G17A 1H2EA 3TPFA 2HN9A 4ID3A 4Y1EA 1JR3D 3KYIB 4G0OA 3VYRB 5A5DA 5JSZA 5CFPA 1H4QA 2IS4A 2R44A 4G0NA 4BVEA 4BQPA 1DKQA 1NVKA 2ALJA 4QXOA 2HQ1A 2RK4A 2CHQA 3RUCA 4CL0A 2C2GA 4D92A 4RVUA 4BZZA 2C4NA 2VT2A 3IB6A 4E33A 1W4BA 5A3SA 5K51A 2G0AA 1ZIYA 2EC5A 1HEIA 4HAVA 3OCCA 1Y6GA 4GP9A 1F17A 2VEDA 2ZU0C 4E1BA 4RVCA 1QLWA 3U80A 4YV7A 3X2EA 1Y8CA 2WLTA 4EHIA 3GG9A 3SZMA 1UFQA 1IN8A 5BNWA 3L1IA 2PNJA 1YCGA 3N0RA 3ZDDA 4Q1CA 3G79A 4UKDA 1U8CB 2YWCA 3W5DA 2GFIA 3AILA 4PAWA 4L4YA 3T1VA 2R85A 1AVTA 2R48A 3ZU6A 1QU2A 2J9RA 3RSHA 3UJ7A 3THRA 1FZQA 5AMXA 1TPZA 1QFMA 3HO6A 2PU7A 2R751 3MLBA 3SF0A 4DUGD 5K0JA 3PGVA 3ZNOA 3UOAB 1E2IA 4UOZA 2HPAA 3CUKA 3IIKA 4GGOA 1U04A 1DC4A 3L7IA 1LTKA 2GO7A 2QXYA 4LJAA 4K5QA 2X1VA 4IS3A 2BR5A 1VZ3A 2H48A 2J46A 4B3GA 3R6DA 1J2UA 4RHTA 1U2TA 3LPNA 4GEGA 4F3RA 4KIWA 1S9HA 1ZHHA 3UXEA 1JJ7A 4MHSA 4NCHA 2H16A 5FO0A 5FWDA 1E1YA 5DXJA 1QP8A 2PMKA 1HNXB 2J5BA 2Q62A 2J3HA 1DXQA 2R7LA 1QHEA 1MABB 1YBHA 4J0IA 4UJ3A 5LQAA 2PGAA 3ILSA 3MFYA 1L5SA 3WOVA 9GPBA 3KAJA 2GWRA 3RTBA 2ODBA 4MK4A 2EU8A 4ILEA 4Q82A 3EXHA 3F1LA 4M1TA 3TUIC 1BCRA 1E64A 1GTRA 1ONNA 4I4NA 4DSAA 5K8IA 3HVKA 3B85A 3UUFA 2IXEA 1Y5MA 1ULAA 1LK0A 3FCOA 2JKZA 4JU8A 1ZOIA 3GGSA 2CHVA 4FOOA 3C7TA 5JR3A 2JZNA 3KVYA 2F48A 1V1MB 2AXQA 2XTJA 3KYDB 3MD0A 2J4DA 3ME5A 2PUTA 4KXXA 5JYEA 2ZXUA 4DKJA 4MDFA 1QK3A 1UBRS 2G0NA 4DYHA 5AUOB 5EZSA 1SUSA 1DQPA 1TO6A 3WLTA 2ECQA 2Y27A 4ADSG 3VPAA 1UK9A 2DQZA 4QHYA 4JENA 2K87A 2V6MA 1P1JA 4F4CA 3NUZA 2C97A 4KUEA 1D5WA 4XM1A 3L1KA 2BWJA 1BD3A 4ND7A 4Z1MA 3SJZA 3QEJA 5TR9A 4G9EA 1EB8A 1GAEO 4HDOB 4EGFA 3BDAA 3QELA 1TTTA 2HKIA 2QUZA 5JMWA 4QUAA 5D6NA 2G5TA 2CFTA 3HFRA 3IEUA 4MVJG 1ZM3A 10MHA 3NWOA 1PL7A 2V97A 5C5CA 1IJFA 1QE0A 1UZUA 4LY9A 2Y1WA 4UDXX 1KKUA 3GJQA 4PWYA 4C20A 4CMCA 1PNRA 2DETA 2ZSIA 3DMHA 3C43A 1XA3A 2V45A 4GBMA 2Z58A 3OY2A 3X1YA 3KJIA 4CW7A 5J43A 1NBOA 1XLTA 5DEIA 4KYUA 4RV5A 1Y6RA 4C05A 2BLLA 4F9TA 4TROA 3F7TA 3SDSA 3DPSA 3GDWA 1Q57A 2MTBA 1AN0A 5BWOA 1ZNQO 2AE2A 2IZ1A 5FEUA 1PBTA 2WIKA 2E85A 2YHAA 3QH4A 3R09A 5H3HA 1CE8A 3FFTA 4ZN6A 3E0XA 2AC2A 4G6ZA 1E3WB 2AZDA 2JFYA 1N3IA 4JLNA 4AG6A 5K09A 4CI9A 1NJ5A 2BCGY 2PR7A 5JAIA 4LDNA 2V7VA 4GG1A 4R1QA 4EX7A 1QPGA 3C6KA 2GLUA 4NRDA 1MOQA 3WLKX 2A9OA 3V4RA 2X5KO 1OPXA 2JD1A 3AHCA 1MRNA 2H07A 1TU0A 2HIGA 1O8BA 2XA2A 4P4SA 3TIVA 5AUNB 1FLAA 721PA 4ACBA 3RVLA 1E2MA 1KVTA 3OZIA 4X5OA 4F4DA 1AF7A 1T36B 2WPDA 4QRHA 1B8PA 1OWNA 3LY9A 1EP9A 1X80B 3ABZA 4AMZA 1C4KA 2A4MA 1H4VB 3EDMA 2L18A 3RJ5A 4K6MA 3MGBA 1OXVA 3I9V6 2VG8A 4GXNA 4PIMA 4U39A 1PZEA 2YJ6A 3OHSX 4LMAA 3TLJA 1AKYA 1JKIA 4ZAWA 1E5QA 2AOXA 3LZCA 5FAXA 4O4HF 2CT8A 5FL7A 1BC5A 1TX4B 2FGJA 4F8JA 3OPYB 1W93A 1R6XA 1ZCBA 2DCUA 4HXEB 1RC1A 2W58A 5ESDA 5GZ3A 4JOSA 1LX7A 2YV5A 1ZGAA 5DGHA 3AJDA 3K9GA 5BVHB 1AGXA 1XA4A 4KACA 2P65A 4TL8A 2Z9CA 4FYVA 3ED5A 5A5FA 2IHBA 1FFGA 4R8RA 1U0EA 3DFZA 2B0CA 3VNAA 2OKCA 3WB2A 2YNMD 2XF2A 2P27A 3IH5A 3PRJA 4G36A 1H9CA 4TMYA 3PCXA 3PNPA 5A1JA 2JCVA 5EPUA 1IM8A 1KI6A 1JA9A 2FP3A 2WE8A 2QX7A 3E3NA 4EPYA 5JDCA 3DS8A 4ZYVA 1P17A 3KTAA 2NPIA 3UJPA 1JA0A 3FDJA 3MQ4A 4S3MA 1SVWA 2DY1A 3D0RA 3N05A 5DBOA 1A77A 2QVZX 4PS0A 3QENA 1XZ8A 3PENA 4TVOA 3TFWA 1R15A 3NLLA 3DD1A 3A3OA 3KUXA 4BCBA 1XRQA 4ONEA 3HJNA 4YB8A 2FCRA 4TQ9A 5L3RA 1F8UA 4F3NA 3C4VA 5CTAA 3S1AA 5LP6A 5T4EA 2I03A 4Y2QA 2WJ6A 3C3WA 4F2GA 3NM5A 1AURA 3PHJA 2ZIUB 2QD4A 4OUDA 5CJJA 1AC5A 3AR6A 4DB2A 3NYWA 3V5NA 3KLOA 3TQOA 2WZBA 2C7PA 1FS5A 4K9RA 5SYMA 2W6IA 1Z0UA 3N0TA 1XCOA 1RM5A 2AOUB 4YJFA 4E6PA 1RAEA 1L8OA 2ZANA 4W82A 3QVTA 3TOCA 1K7CA 4YI5A 4JT4A 3OE1A 2NZUG 3ANYB 3PGMA 3CWCA 3I8XA 1NONA 1XBTA 1KF0A 5ALUA 1DJOA