1F0PA

Mycobacterium tuberculosis antigen 85b with trehalose
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
284
structure length
284
Chain Sequence
SRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIGEN 85-B
publication title An interfacial mechanism and a class of inhibitors inferred from two crystal structures of the Mycobacterium tuberculosis 30 kDa major secretory protein (Antigen 85B), a mycolyl transferase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 105
structure length 284
sequence length 284
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2000-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1f0pA00
5CH8A 3M3DA 2V96A 5ALNA 5HK9A 2FUKA 1EVQA 5CMLA 3DL4A 2XE4A 1BS9A 1CQZA 1M33A 4J0IA 1JJIA 4UHDA 1BN6A 3HABA 4BRZA 3V1MA 2ES4A 3I2FA 4L3WA 2QKYA 5ALJA 1EI9A 3WYDA 4BZZA 4Y2UA 4X90A 1BCSA 3GELA 2XUOA 4W1RA 4Q1VA 2XUGA 1P0PA 1QE3A 1ISPA 5CBKA 4TVKA 1DT5A 2IX9A 3LCRA 4LXHA 3R3XA 4ZWNA 2ORYA 2JGFA 2FJPA 2VTVA 2PPLA 1P0MA 2GBGA 1DQZA 5AI8A 5AM4A 4OD0A 1QO7A 2JGMA 2CUTA 2WG0A 3ED1A 3KSRA 1B41A 5JYCA 3FWHA 4FLFA 1EX9A 4C4ZA 1WB4A 4U2EA 1J1IA 1PFQA 5DTIA 5ALYA 3I2HA 5AI9A 4C4YA 1JMKC 5JD5A 2CEKA 3O95A 1X70A 3KWJA 3R3WA 5JD4A 3TJMA 2AJBA 1HPLA 2AJCA 3FYUC 5AOAA 3WKCA 1TQHA 2WUDA 1MAAA 5EHNA 2BJHA 3NOXA 1W1IA 4CCYA 5E4YA 3OG9A 1W6RA 3FLBA 1XLUA 4KAJA 3HC7A 3LS2A 4EY4A 3JYHA 2R8BA 5AM0A 2ACKA 3VXKA 3EF3A 2VA9A 1FJ2A 1MT3A 1ODCA 3DCNA 3RK4A 2OQVA 2V9ZA 3I6MA 3G7NA 2I3DA 3S2ZA 5DNWA 1EDEA 3C5WP 3G9XA 1BCRA 4B6GA 4EB0A 4Y7DA 4UBLA 1E8NA 5ALWA 1WB5A 4N5IX 1DTEA 5HK8A 4W1SA 2XLCA 4PSCA 5ISMA 2QS9A 1TCBA 2HM7A 4BBZA 4CG3A 4D9JA 1C7IA 4KYVA 3F9CA 4HVTA 5LZ9A 3E4DA 4UHFA 3IUQA 4RPCA 4KJXA 1FFCA 1XRQA 1XZLA 3P2MA 1GXSA 2IITA 2VJAA 4L9AA 4WFKA 3ESBA 1DWOA 5FP0A 1S8OA 1VKHA 4HRXA 5JZSA 2XUPA 1U8EA 1GZ7A 3FCYA 1TK3A 4J7AA 4AB1A 4JYPA 1H2ZA 4ZV9A 2DHEA 3FCXA 1BN7A 1ZJ4A 2XUQA 4AN1A 1AMNA 3WL8A 4B80A 2DFPA 5CTAA 4DMFA 3NGMA 1VA5A 4UBMA 4E15A 1XFDA 2Y2UA 3DOHA 4X7BA 5CW2A 3BWXA 3ICVA 4F60A 3WZLA 4BCBA 3WA6A 3FLAA 3FSGD 2O7VA 4IH9A 4KE6A 5HF6A 1LZKA 4FNMA 1J06A 2Z5GA 4EY7A 2RI6A 4AO7A 3RM3A 2B20A 2PSFA 2XMCA 4ZGBA 4Y2XA 3HSSA 1LNSA 4UPDA 4AQDA 4K6HA 3C6XA 2XMSA 4RE5A 5KBYA 4XX1A 5AP9A 5K3BA 5LZ2A 4GW3A 5IH7A 3E0XA 2EDCA 2CZQA 4AZ3A 4K5QA 3C87A 1GGVA 1A8SA 2OGZA 2VATA 4BP9A 3A2LA 2WLSA 1ZD3A 2RAUA 4AX4A 4JNCA 2GZRA 2JBWA 1AX9A 3ZLVA 5JANA 4PF1A 2Z8XA 1QTRA 3NWOA 4S0XA 5IVDA 2VAVA 3WKAA 1QGED 1DWPA 2PSDA 5AKHA 2YH2A 3EIOA 1C4XA 3CCBA 1LPMA 1YB6A 4U2CA 2O7RA 3HJUA 5I8PA 2C7BA 2HL6A 4BAUA 1TRHA 4F5ZA 4B9EA 2X8BA 4HZGA 3SK0A 2WFZA 4OU4A 4X6UA 4XWGA 5LKRA 4X71A 4DNPA 5HCUA 3C6YA 5ALUA 3GUUA 3HRHA 5JZ9A 1CLEA 5FDFA 1PV1A 1QIJA 5AOCA 4QEKA 4KE9A 4W1QA 2PUJA 5IKXA 1XZBA 3QITA 3V48A 1CUJA 4FDMA 3H18A 4UBOA 5ALXA 4LYDA 1D07A 5SYMA 4KRXA 3WMRA 4UBIA 4OU5A 4BAGA 4ZRDA 3STUA 2BAGA 4FLEA 2AXEA 5C8ZA 4N5HX 4K6GA 4AMYA 3T4UA 3D3NA 4ARAA 4B84A 5ALTA 3A2NA 1E66A 5ESRA 7YASA 3MUOA 5DYTA 2B61A 2XUHA 3QVMA 1ZIXA 4AMZA 3ESDA 5EHQA 1CUSA 1VE6A 4FMPA 4GDMA 4INZA 1XQYA 4B82A 3H1AA 2XUJA 5HKAA 2ZYHA 5FXMA 3A2MA 1XZHA 4P93A 2Y2VA 3WL7A 3F8SA 1E3QA 3IURA 4MQLA 1QO9A 3DYIA 2Q0XA 1AGYA 1UKCA 3WWOA 3WWPA 1UK7A 3QPCA 4G8DA 1QIGA 2WIKA 1YASA 3GBSA 1LPNA 2DCMA 1YA4A 1IMJA 2ZYRA 5CT8A 5FUMA 3WJ1A 4N8DA 2PSJA 2WIDA 5JATA 4G4JA 4DSAA 4CG1A 4ZI5A 2QOEA 3VVMA 1ZICA 4WFJA 2WJ4A 1BEZA 5ALRA 5ALKA 3N2ZB 4QNNA 4GECA 4DMKA 3BXPA 2ZVDA 1JJBA 3GA7A 4ZREA 3QMMA 1VOTA 3K6KA 4DNFA 1XZEA 3LIIA 4FTWA 2XI4A 4DMCA 5AKZA 3D7RA 5FOQA 2XMZA 4MYDA 3STXA 5A7HA 4UHEA 2ZJ7A 2NW6A 4U2FA 2XUKA 1P0QA 2VJCA 1DWQA 1CV2A 2HRQA 5JD6A 2WUGA 1UXOA 1DX6A 1BU8A 3D0KA 2OLEA 4V2IA 1GKLA 3AIOA 5CURA 2OQIA 3C8DA 1ZD5A 1UZAA 3DEAA 2VSQA 4BB0A 1LZLA 4BCDA 2G4LA 4EY5A 1JMYA 1ZD4A 3V1KA 3BL8A 2OCLA 2W22A 1XRLA 4EZIA 2J3QA 1EB8A 4C01A 4W9RA 1CUEA 3Q0TA 4BVLA 2W6CX 2OPHA 4W63A 4M0MA 1U65A 3FVRA 3CXUA 1R50A 1QIFA 1TCAA 4CCWA 1GPLA 4A16A 1W52X 4FKBA 3AFIA 1YB7A 4C6HA 1CRLA 4FFWA 1QONA 3UMJA 1GPKA 1DT3A 1IUPA 3OTQA 1WPXA 3WK4A 1CR6A 4BE9A 3DJYA 4ZXFA 5LLSA 1H2XA 5HFNA 1QIMA 1WOMA 1AKNA 1XZIA 3QMWA 3I1IA 5AI5A 4CFSA 1ZD2P 3IBTA 4B0PA 2HA7A 4Y2TA 2BUCA 5CT5A 3M83A 1TAHA 5AICA 5ALDA 4DLNA 3W04A 2WHQA 1E8MA 1VZ3A 3PUIA 5KREA 3WL5A 1QLWA 4QLAA 1CUIA 5DYWA 1QZ3A 4UFOA 1CUWA 1WHSA 2WU4A 1H2WA 4BTVA 2B4KA 4F21A 1QFMA 2I78A 3OPMA 5AK3A 2HA6A 4PNZA 1UOQA 3E3AA 2WIJA 2GYVA 1G5FA 4J0HA 2GZSA 1ZOIA 4AO6A 4GWLA 5T4FA 3QMVA 2ACEA 3H19A 2QMQA 3DQZA 2BGNA 5HKBA 1ORWA 4AO8A 1Z68A 2JGKA 3HXKA 2C0PA 2VAXA 3WQHA 3EQ8A 4GBGA 3O9MA 1QIEA 2JF0A 1NU8A 4BVJA 1EINA 2DQYA 4KAAA 2ZYIA 4K2AA 5FPPA 4BCCA 1TCCA 5EI5A 5K3EA 1IUOA 3I2GA 4C89A 5AOBA 5AM3A 2HU8A 3WK6A 2XT0A 3IUNA 3HLKA 1R9MA 3WJ2A 2VT6A 4PW0A 1XQXA 3PE6A 4EHBA 4PQEA 5A2GA 4FFVA 4IH4A 3B3QA 1EVEA 1CIJA 5AJHA 3X3HA 2WKWA 1OXMA 1XKTA 4BYMA 1LGYA 3KD2A 1XQVA 2PU5A 3R3YA 4H35A 2XDWA 3QYJA 4L72A 2QXUA 5AIBA 4BTLA 4PSDA 3WZMA 4KE8A 4A23A 1YR2A 3W2TA 5HF8A 3STTA 4Z49A 4MJ3A 4QWMA 3AINA 1F0PA 1A8QA 3H2IA 1G66A 2PM8A 1J07A 5JAPA 5ALLA 4QLOA 3AILA 3BF7A 1YAJA 1Q0RA 1IZ8A 1EK1A 5IVHA 5IVIA 1JU4A 1SCIA 3WK8A 2FJ0A 3FBWA 4OB7A 1KU0A 2GBFA 2QXTA 4UBJA 1XZDA 2RHWA 1HQDA 2WFMA 2HDWA 1ORVA 5AKYA 1JFRA 2H9YA 1WHTA 1YS1X 3C45A 4OYYA 4BE4A 1ODSA 1KEZA 2O2IA 4UFPA 2OAEA 3H2JA 4X6YA 5FLKA 3WWEA 2ZYSA 1CUYA 4NZZA 4MYSA 2H7YA 4LXIA 1SCKA 4DM7A 3I2JA 5AKXA 3H1BA 1N5RA 3I28A 4QDXA 1XZCA 4ROTA 1YS2X 3PF8A 4H7IA 1XZJA 2G63A 4WDQA 2XQIA 2VEOA 1U2EA 3DOIA 5K3FB 1AQLA 5C8XA 4CIBA 2Y6VA 4MQMA 5ALHA 1QIKA 1MX5A 4N8EA 4Q34A 4G9GA 3TGLA 2XUDA 1R1DA 4BZWA 1AURA 4CIAA 1AUOA 3V9AA 4WCVA 3DNMA 2HA5A 1H22A 3HZOA 5DNVA 4QE3A 1FFEA 1TIBA 2XMBA 3IUMA 1Q83A 4LXGA 3OURA 5DWDA 4RNCA 3KXPA 1GPNA 2JGEA 4DIUA 5I7UA 1R3DA 1SCQA 2HIHA 1JJFA 1CQWA 2ZSIA 1W76A 3EQ7A 4IHAA 5AKLA 4X92A 4BAZA 2G5TA 5AM5A 2V97A 4J0CA 5CH5A 4KACA 1B6GA 4LKOA 3JW8A 1XRNA 2OGTA 3D59A 1CUVA 2AJLI 3C70A 3FOBA 4E14A 3AZQA 1CFJA 4GI1A 2XQFA 1MJ5A 3ZI7A 1EHYA 4UBKA 1Q0ZA 4X91A 3D2AA 4QDZA 4WY5A 1QOZA 3WKBA 5LYYA 5JAOA 2QUAA 4QDOA 4WY8A 3KDAA 2WJ6A 1K5PA 2HU5A 2WIFA 4ARBA 1NX9A 2WHPB 4OUKX 3WIOA 3C6ZA 3TRDA 5FV4A 5ALZA 3IA2A 3PICA 3RKSA 4QZVA 1A7UA 2PSHA 4KRYA 3LLCA 5D7BA 1CUCA 1QIDA 4HAIA 5SYNA 3WL6A 3NUZA 4LHEA 3AUKA 4AN0A 1VLQA 3HEAA 4H7EA 1FFAA 5LZ7A 4DSZA 4BDSA 1EDBA 4GEGA 4WDRA 1SC9A 1Q84A 5C81A 5AKJA 3CN9A 1BRTA 5HF9A 3I2IA 4O08A 3QH4A 5LKAA 3WIBA 4C4XA 4E46A 2CMFA 1CUUA 5LZ4A 4J0KA 5K3DA 5T4EA 1K63A 2HFJA 4K6KA 1E8DA 1U4NA 2QT9A 4Q3KA 3JWEA 5BOVA 2DSNA 5JARA 2WQZA 4H7HA 4B7ZA 3BE8A 3L1HA 1MN6A 2GYUA 3DLTA 4UHCA 2Z8ZA 4FWBA 2DQZA 2XMGA 1WCYA 1QTIA 1UKBA 2G5PA 4IO0A 5DYYA 5LP1A 2C5FA 2H7CA 3CCCA 5JAHA 2GBIA 3G0CA 5EFZA 3H2KA 5A7FA 1SOMA 4UHBA 1GT6A 3WLAA 3WK9A 5FKJA 4LIPD 1ODTC 2CKMA 1H23A 3HACA 1DX4A 3BIWA 1XQWA 3LIPA 4CI9A 2XMRA 4U2DA 3WYNA 3DKRA 1CUXA 4FBLA 5AO9A 3SWWA 4MWTA 2GYWA 1LBTA 2X5XA 1X2BA 5AK6A 1LPPA 1USWA 4EY6A 1CVLA 1HDEA 4DMHA 3QZUA 1XRMA 2QM0A 4Q05A 3B12A 5DTJA 2VT7A 4I4CA 3FYUB 5BWBA 3KWFA 3WWDA 3I6ZA 1NU6A 1JU3A 3LP5A 2RHTA 4X3CA 2BUBA 4OB8A 1ACLA 3DS8A 1CUHA 2D5LA 4HS9A 2P8SA 4X97A 2QTBA 5JAUA 1VZ2A 4KE7A 4J0GA 5AK5A 3IIIA 5ALOA 3EQ9A 1IVYA 3QBJA 3GZJA 4PSUA 5K3AA 2Z3ZA 5KWJA 4Y2RA 5E4TA 3BF8A 4Y2JA 1DINA 2Y6UA 5H3HA 1RWQA 3G8YA 5DJ5A 1IZ7A 4FOLA 2EDAA 4HXGA 3A6ZA 1CUFA 1ZGCA 1TKRA 2VJBA 3ANTA 2OCIA 1ETHA 4N8SA 3C6BA 4FNGA 1Y7HA 1A8UA 4NMWA 5ALGA 3W05A 5CRIA 4OPMA 3R41A 3PDCA 4M0EA 3QPAA 2VJDA 5EIHA 5J3JA 2JEYA 1XZGA 3U1TA 4Y9SA 1K4YA 2HFKA 4QDTA 1MX9A 2BCEA 4KAFA 1VXRA 4Y2QA 1DQYA 1XLWA 4HXEB 4BVKA 2QRUA 2OG1A 3GFFA 1UT6A 1DU4A 4MEBA 3BIXA 4JEIA 5DNUA 2VF2A 1L7AA 2BGRA 2JGLA 3MGAA 2RONA 2YYSA 2J4FA 4C88A 2C58A 2GBCA 3QPDA 1GKKA 2CBGA 3FNBA 4HXFB 4RGYA 1IUNA 5CT9A 4ITVA 2IIVA 4E11A 5AM1A 3RLIA 1XLVA 2HA3A 3R3VA 5E2IA 1OCEA 4W1PA 1FSSA 1HKHA 5HF5A 3YASA 3R3UA 4YX9A 1HBJA 5EIAA 4JH0A 4G4IA 4WJLA 5K3FA 2WSLA 2XUAA 2WFLB 1THGA 2PVSA 1T4MA 5LZ5A 2Y1KA 2YXPX 3BDIA 1JI3A 1CPYA 5K5EA 2DR0A 3O4IA 2PSEA 3WI7A 4X95A 1MX1A 1YAHA 4U2BA 4DNQA 1XZFA 1AZWA 4OYLA 4QDUA 1ZJ5A 3R3ZA 3H04A 2HA4A 1YSCA 3VJLA 5CH3A 1CEXA 2WG1A 5AH0A 4YPVA 3AIMA 1T2NA 5HQ3B 1E89A 2XMDA 5A6VA 3DKKA 1MO2A 4L0CA 3IUJA 1I6WA 4C87A 2I03A 3PFBA 4M0FA 2VQ6A 4P92A 1MAHA 4MWSA 4BP8A 4YK7A 2WIGA 2XLBA 3AZPA 2ZJFA 3SX4A 2PUHA 1WM1A 4QWWA 2XB6A 2C0QA 1K6EA 2LIPA 1Y37A 2O2HA 3ESAA 1UK8A 1F6WA 2PKYX 3ZLUA 3C5VA 3IULA 3CN7A 3EBLA 2ZSHA 2BFNA 3DYVA 3ILSA 5JALA 1CUZA 3RARA 3W06A 4B85A 3S8YA 5ALFA 2ECFA 2Z3WA 4X93A 4TGLA 2B9VA 1LPBB 4P08A 3O0DA 1EA5A 3Q8WA 4UHHA 3VVLA 2OGSA 3FYTA 4J03A 3W9UA 2XUFA 4H7JA 1W75A 1J2EA 1VA4A 4PO3X 5JADA 1RYYA 2ROQA 1P0IA 4OCZA 2BKLA 2WHPA 4HTAA 3D2BA 3DD5A 1HLGA 4FLMA 2QJWA 1EXWA 2HRRA 3ANSA 2AJDA 2XMQA 4Y2VA 3AIKA 4H77A 1UFOA 4DTCA 1EDDA 1UWCA 3L1IA 5FRDA 4DNOA 1ZI6A 5ALIA 4P9NA 4JYMA 1VE7A 4HRYA 4XJVA 4EBBA 1G4HA 3L1JA 1H2YA 3G0GA 2E3JA 3ICWA 1O6FA 3C43A 1LBSA 3OC0A 1GQRA 3PI6A 5AKKA 2JGIA 2PBLA 4CCYB 2DHCA 1F8UA 3C8HA 2WU3A 3AZOA 3WWCA 5BWCA 1LLFA 3OM8A 2V98A 1AC5A 4B83A 5A62A 2XQJA 3G02A 5AM2A 3PF9A 4GXNA 2WUFA 3VJKA 4EY8A 2X76A 1QIIA 2WTMA 4ZV7A 1MNAA 3D5EA 1XZAA 3B5EA 3G9UA 1ZI9A 1Y7IA 4J3JA 4I3FA 4GHWA 2PX6A 4H18A 2I3ZA 5F4ZA 3TEJA 5LIPA 2AJ8A 4IH1A 3U0VA 2H7XA 4BC0A 4H0CA 4BC1A 2OXEA 4QA9A 5T4BA 1VJ5A 1THTA 1CUDA 2J4CA 5AKGA 1LPOA 5ALVA 3K2IA 4Y2YA 5JZBA 1L7QA 5K3CA 2OCGA 2WILA 1UK6A 5EGNA 3F96A 3IDAA 5I9IA 1E5TA 2R11A 3BJMA 3OOSA 1QIHA 1R88A 5DLPA 3O4JA 3F97A 1XRPA 2O2GA 4I19A 4NVRA 3KOOA 4CG2A 3V1LA 2QVBA 4GLBA 3WK5A 5AI0A 4AXBA 5AHXA 3I6YA 5A7GA 3IVMA 3FSGA 4B0OA 4JUIA 5D3ZA 3ZPXA 3FAKA 3STVA 1ZGBA 4J0JA 3FVTA 1MNQA 3UUEA 1CUAA 5CXXA 1A88A 2C5GA 1XRRA 5AI6A 3DDUA 4X00A 5AKEA 2QR5A 1EH5A 4G1FA 1PJAA 3FYUA 3VJMA 2HU7A 4H7DA 2XQKA 3ESCA 3O4GA 3V1NA 4KEAA 5FPQA 4FHZA 4Q3OA 2WM2A 5LZ8A 3D4LA 3E1GA 1SFRA 2XUIA 2QJRA 3G9TA 2C4HA 1UOOA 2K2QB 3O4HA 1UOPA 4DYHA 4FBMA 3ZLTA 2RIPA 4MEAA 3G9ZA 3R0VA 3ZWQA 1WB6A 5HZGA 1UKAA 5C7YA 4UUQA 4X85A 3WA7A 4UFNA 4XIIA 1EK2A 1LPSA 4BATA 3D2CA 4PV7A 3G0BA 4YASA 1L7RA 1XKLA 2BUAA 4LYEA 4H7KA 3UUFA 1QJ4A 1CUGA 5ALSA 3N0TA 4MXDA 4EA6A 2DHDA 5D6OA 5EHXA 1ZIYA 5CT4A 3WKEA 5KWIA 6YASA 3STWA 3GROA 2OAGA 4J0DA 5D3KA 3R40A 3WK7A 4IQ4A 2JEZA 5A71A 3I2KA 1BE0A 3QM1A 3ZV7A 5AIAA 3PFCA 3WKDA 5JASA 4KR0A 4G5XA 1ZI8A 1RP1A 4EUSA 3H17A 5ALQA 2CB9A 2WTNA 3VISA 3DL7A 2J3DA 3F98A 2JIDA 5JIBA 5ALMA 2EEPA 3F67A 3M82A 4Y2PA 1BEEA 4X6XA 3H0CA 2WHRA 4X94A 3VKFA 4Q3LA 4RE6A 1ACJA 4TPKA 2FX5A 4AZ0A 5YASA 4UBNA 4ETWA 3HI4A 2XQGA 1FFBA 1R4ZA 1UK9A 2YASA 1WPRA 5AKIA 4DGQA 1N1MA 3PUHA 5IVKA 2HA0A 3I1YA 1C7JA 4BDTA 2ZJ6A 5EHZA 1F0NA 4G8CA 4XVCA 2PU7A 3BDVA 2HA2A 3MVEA 3W9BA 4B9AA 5E4JA 4BRSA 2OCKA 1BROA 3H2HA 4WFIA 3G0IA 5AK4A 1YCDA 1R9NA 3K9BA 1LPAB 1CUBA 5T4HA 3AJAA 1JT2A 4B81A 5CXUA 2HADA 4F0JA 2WFLA 3T52A 4OSEA 3MUNA 4NS4A 2UZ0A 5ALEA 1O6GA 1N8SA 3STYA 1KU6A 1MTZA 4U2GA 1K8QA 1YA8A 2CJPA 4A5SA 3IB3A 4Y2SA 1VXOA 1MPXA 1OILA 1XROA 5CT6A 2WUEA 4OB6A 5BV7A 4H7FA 1XZKA 2PL5A 3G0DA 1FFDA 5C8VA 2WG2A 3FLEA 5HQ3A 5HFAA 5EIEA 4G8BA 1G42A 2QZPA 2H1IA 1X2EA 1JKMA 1MU0A 5AI4A 2RGUA 2HHAA 3H2GA 1QFSA 5ALPA 3M81A 1EB9A 1W4LA 2D0DA 1N5MA 1XZMA 4G4GA 3HYSA 4Q82A 1GQSA 3BJRA 3VDXA 2ONCA 3A70A 3O9VA 2JGJA 2QUBA 3SC2A 2WJ3A 1HL7A 4G9EA
chains in the Genus database with same CATH superfamily
3AP3A 5CH8A 1JEEA 4EQ6B 1KHHA 2JFGA 4HUQB 1M2HA 3KEMA 5HK9A 1MQAA 1UAAA 3KX2A 5DIFA 1JQ5A 3DL4A 3K09C 3VR4H 3ZGOA 1XCMA 5TMPA 1W8IA 3PE4A 1JJIA 4FI3F 2IV7A 4DIKA 3WGVA 3RVBA 4BRZA 3OEHA 1A9PA 2PH5A 3S1LA 3CF4A 3I64A 4EEKA 2GRAA 3DNFA 1OFVA 4LC9A 4HAYA 5D7NA 5BW6B 1VRCA 1Z8DA 1FY2A 2ORVA 3KD3A 4YP7A 1T3LA 2ES4A 1CR4A 2O3QA 3I8XA 5ADWA 1Z2EA 3KALA 4NBRA 3ZWAA 3NWEA 2QSYA 3WDSA 3BWYA 2WSSD 3IV7A 4XIFA 5ALJA 4TTSA 3TW0A 1EI9A 3TMYA 3WYDA 4FW9A 2VYND 4LOKA 2BL4A 1E79D 2FX2A 3HBJA 2W6ID 2PMWB 1XMPA 2CL6X 1V4BA 2FU5C 2O4UX 3OQBA 1BCSA 1TA4A 3GELA 2JLWA 4OGFA 4A27A 1U0RA 1P0PA 2E18A 4L9SA 1XTIA 3AI2A 5KNCA 2AFIA 5E0KB 2C4MA 3P9IA 4O4JB 3K9NA 3AV0B 1BWRA 2IY9A 4LHZA 2IX9A 3DO6A 3FLMA 4E1VA 1MZPA 3R3XA 2Q9CA 4HH0A 2ORYA 3HWSA 2JGFA 4D41A 1V41E 2BGLA 3OFVA 3S5JA 1ORHA 1GILA 5EHIA 2R79A 5AI8A 4AY2A 3WLPA 4RAQA 4XOIA 2B6NA 3O8LA 4QLBA 5TMDA 3PPVA 1XALA 4FKZA 2CBXA 3ED1A 1RCFA 5FEUA 3KSRA 4FZ3A 4FLFA 5ECYA 3CISA 1EX9A 4RXUA 2ERYA 3HHEA 1Y3FE 1CY1A 4J1TC 1YK1A 3O7MA 1SD5A 1VYVA 4AKIA 2A9KA 1J1IA 3MTQA 4ME6A 2TRSB 3RRBA 3T1VA 4ZVTA 3CNLA 5IU6A 1JX6A 3CNQS 2R6R1 1JMKC 3N2NA 4IHJA 5JAIA 1W59A 4CKEA 3MWEA 3OZDA 1HE2A 4OL0A 4RQAA 5E3HA 2FSUA 4N6OA 1CE8B 1T15A 4DJJA 3CWCA 3O95A 2MYUA 4FWIB 5FIUA 2X1VA 2ZRLA 3QBVA 4EF4A 4YCCA 5JAMA 1NUUA 3FFXA 3ZHBA 1FTSA 1K88A 1O08A 1QCCA 3L0SA 4GSYA 4B3BA 4OHMA 2F3PA 3LXXA 1HPLA 1P9LA 3H4MA 3SC4A 5C7LO 5FBRB 1Z06A 2XDAA 2YUTA 3E3OA 4HEA6 4WEOA 2QLNA 4RZUA 5AOAA 3N7TA 3RG2A 2ZJ5A 1KJWA 1MAAA 3OHMA 4I5EA 1FDIA 2BEKA 3NVMB 4GP6A 5EHNA 2Z04A 4EAAA 4XRGA 1U2GC 5REQB 3CUSA 2P5TB 5EKUA 4MVJE 2H2DA 3PGXA 3FUVA 5EJ2A 3RAGA 2DERA 3H75A 3IIJA 5CB0A 1QYCA 2C9OA 2QM3A 3KUXA 4M8LA 1JPNA 3EFBA 1Y82A 2WKQA 4BKQA 2GDJA 2XXAA 2BEVB 2RFLA 5L8VA 5F9HA 3WQQA 1ZK3A 3HC7A 3LS2A 4DV6B 3TFOA 4W99A 1TLFA 5GM1A 4HDOB 2ACKA 5DX8A 2V4UA 2KHZA 3PHCA 4KQ6A 2FZCA 1FXSA 3HKEB 1P19A 1ZMRA 1MT3A 3DCNA 4JA0A 3C24A 2V9ZA 4KBGA 3I6MA 3RNLA 2I3DA 3COSA 4HDQB 2WF6A 4FX2A 2F9MA 2GUWA 3HA2A 1QVVA 4PN7A 4R1SA 1Z3IX 4V02A 2PMBA 3V33A 3FNQA 1Z33A 2HSDA 4Y7DA 3CMCO 3RSZA 3ZZ1A 3LXMA 4JK3A 4YAWA 3AKCA 4DLUA 3OCJA 3S1SA 2BFCB 2EKZA 4UEOA 4JJZA 2YVAA 3ILVA 4PAWA 1HDRA 3K0AA 4L0MA 4MW6A 2XLCA 4PSCA 4EHHA 2DPYA 2QS9A 3A14A 2FYTA 2AI3A 2JIMA 3UK2A 4DPLA 2HYIC 3K1TA 4G97A 4KYVA 2FW6A 1U8ZA 2A5YB 1X8JA 5ANRB 5THKA 3T7SA 1U0FA 4HVTA 3VR6H 4XXHA 2GZMA 1G8HA 4UHFA 1KRWA 3T3HA 4CYMA 1A7AA 1Z36A 2VNHA 1DG9A 1YUNA 4M87A 3EUWA 3LYHA 3FFBA 4ZVPA 2P2DA 2PX0A 4HOYA 3LUHA 1FFCA 4ZAWA 3Q3VA 1XRQA 3IO5A 4LK3A 4WJKB 4TS4A 4PFQA 1UINA 1NQOA 3N75A 2IITA 1EWYA 3HRIA 2OVFA 5DHAA 2D1RA 4LXQA 1L7BA 1OREA 1ZW1A 2SHKA 1T5BA 3AFGA 5FYDA 3UGJA 5KAPA 2ETXA 3R5SA 5KYNA 3H5OA 4ND8B 3WISA 3PRKE 5ADHA 2X5NA 4ZO8A 4HYYA 5ILOA 2VSFA 4DSOA 3AO0B 2XUPA 3OU2A 3CPSA 4MVJF 1BC5A 1FUYB 2GCIA 3NJ8A 3GYBA 1E2IA 2CLEB 3NCTA 1QNFA 5AJWA 2JJ8A 4NJOA 4ASUA 1S0UA 5EE0A 1B7GO 1BN7A 2QL9A 5M34A 1RXYA 1RI2A 4G65A 3SQLA 3CZAA 3DE7X 3QG1A 5DPMA 3V1YA 1FX0B 2IYWA 4C2TA 4QGAA 4XWTA 4B80A 3N0VA 3IT1A 1FDWA 3TO5A 3VR4D 2P4QA 3GFTA 4CL2A 4B47A 4LWPA 4OHOA 1ONPA 3O75A 2R7MA 4LZJA 2ZBVA 4ZFNA 4ZYWA 1OBCA 5JV5A 4J7XA 4HMPA 2FR8C 2H4YA 4BB9A 1A9TA 1KDTA 1R66A 1NZDA 4GI2A 1KJZA 5IC6A 1P3JA 3OJWA 4B2LA 2JA2A 1ZR4A 3F1LA 4LZOA 4PFKA 3U7GA 1OFUA 3BWXA 2H1LA 1RMTA 2N47A 1YDMA 2X19A 1Y34E 4NXNB 1T9DA 3D1JA 3AHJA 3V9PA 4ZEOA 4KIUA 2PLFA 4F60A 2X3UA 3C1TA 2XVXA 3AW8A 3WZLA 4PLFA 4MW5A 2ZM6B 3CNBA 4YJKA 4QUBA 3L06A 3WA6A 4HVCA 1Z8NA 3CG0A 1OBHA 2I29A 4RBNA 3U3ZA 2I9KA 3R6TA 3O9ZA 3JD2A 3EH2A 2O7VA 3AP1A 3KKPA 4R7GA 5E9QA 4AUKA 3NIGB 4J2HA 4D45A 4KE6A 1YVPA 2BF7A 4HFNA 1V1MB 1J70A 2QZJA 3TQTA 4AZVA 3H9QA 1GQFA 1YZKA 3T4XA 3A06A 2PKWA 4WX2B 1GCOA 3KE8A 3CEAA 1QCDA 1E1RA 4Y9DA 2JAPA 3HUUA 2A0UA 5B1SA 1OFUX 3ZNPA 1M6VA 2VH2A 3RM3A 4M3NA 4I36A 5MF6A 3V7UA 2ZIXB 5BY2A 1BWSA 3IEKA 5TV2A 3UJDA 4RKEA 4ZGBA 4Y2XA 1NW9B 3P0RA 4K3VA 2GK7A 4HH4A 1GU0A 4NG4A 1W0KA 2EFDB 2EYUA 3NHAA 4EABA 3VDMA 3DFUA 1Z7YA 3S6JA 2VP3A 1GUYA 5C80A 4X9XA 3UV7A 4F71A 2PWYA 3AR9A 4KW7A 4OHPA 5KYWA 4O2LA 1CR2A 1M0WA 4E2FA 3GJTA 1YQWA 4YRCA 4Q93A 3ESQA 4REOA 2A1TR 3T1TA 5JC8A 3TF5A 2X4LA 3CE6A 1OU0A 3Q11A 1BHQ1 1XDBA 1R3UA 4YLEA 1EVZA 1ZMXA 4N82A 4TYQA 2BFDA 4OMUA 5LZ2A 3WWYA 1PYDA 3KL2A 5CNMA 1NF3A 3NTQA 2EU8A 1T2AA 2PL1A 1I13A 4FDUA 4NQZA 4WZ6A 5F78A 4CNBA 1VBKA 2CZQA 3LUJA 2GASA 3FNEA 2J5KA 1O58A 5TQ2B 2P4EA 1XJ0A 4D43A 1X42A 3CU5A 1C9EA 4GUDA 2Z2YA 4M0LA 2WC1A 4KQGA 4ZU3A 3RRFA 2QSJA 4LRWA 1VP3A 4MVJA 3TLKA 2VATA 4I8XA 3V8QA 5FUQA 3S2YA 5E2AA 1FOEB 4HNTA 3GHHA 2CGEA 3A2LA 1P7WA 2P2CA 3I9KA 4GKAA 3EAFA 4IHQA 4MRRA 4NBSA 1Y3CE 4QUEA 3T5TA 4AX4A 5AVVA 1TFRA 2CXUA 2JBWA 1JKFA 2JLBA 3H5NA 1UP6A 1FP6A 4LRXA 4BVBA 4LZLA 1F9EA 1ODFA 3COYA 4YAUA 1RD4A 1QTRA 3O1JC 2QMEA 3EZNA 5EIXA 4PWYA 1I1OA 1V2HE 2IH4A 3U4DA 3EZ7A 1O94C 3IXLA 2OD7A 1QGED 3PRYA 4M1TA 4YR7A 2PSDA 2TMDA 3K8YA 2PMEA 2J9GA 2VPPA 5K99A 3WGIA 1EFTA 1Y63A 2GPWA 4V0LA 3KQNA 2BFOA 1KK3A 3NC4A 5TS2A 4Z1MD 2GLUA 1E96A 2DFKB 4IKEA 3SDBA 3RAEC 5KU1A 3GLGB 2G80A 3WB2A 2O7RA 5I8PA 1W93A 5J43A 4DLZA 3M5PA 2I0FA 3QFSA 2WOOA 4KVAA 4LXYA 4F5ZA 2G17A 3VNVA 3FBTA 1M3SA 3W2GA 1YBFA 3T41A 3GNTA 4V1CA 1WHTB 1SA0B 2PGJA 3L6DA 2IPXA 7MHTA 4IS2A 3OF2A 1HWYA 4HDAA 3TLZA 3W6UA 1QHEA 2VOJA 4X71A 3L6OO 1NVXQ 1WVGA 3OX3A 4E5DA 3JQ8A 5LNK6 3R0ZA 3EDCA 4UOZA 4EHFA 2BZ1A 3G8AA 4OQFA 5CFMA 1V9SA 3LCVB 2A1IA 2WTUA 2NVUB 2V9CA 3GUUA 5K2MA 5BV1A 1TUBB 3QWIA 5K20A 2YJ6A 3T7IA 4DM3A 4LVCA 1IQUA 3NRJA 5BNZA 2MHCA 4O2BF 5FDFA 3HDHA 2P62A 4RVOA 3TYXA 2IBSA 3T12A 1G9SA 3VR6D 4Q48A 3IOMA 3ROKA 1DS6A 2XKKA 4QM7A 5AOCA 5F7ZA 3P9NA 4P32A 2D13A 4KE9A 4YROA 1O96B 1JEAA 1ZUNA 3IAHA 4XQGA 2IS4A 3JPYA 3LWZA 4N0MA 3MRVA 2EBWA 2G9RA 5KNCH 1P2TA 4QDKA 5DI9A 3X44A 1SHUX 1L4FA 3ECAA 3ZDBA 3F6EX 3KJXA 3GR6A 3LT2A 2OV4A 1CJKC 5C1PA 4JQYA 3S68A 5KHOC 5JJ5A 1SUFA 1JYFA 4NMLA 1TT5A 3E5RA 4UBIA 1OAKA 1M1ZA 4TMZA 3QVUA 5DLYA 3QVSA 1QORA 1OFTA 2FG6C 1C1XB 3FWKA 3TFQA 3IAS1 5FTLA 3STUA 2H31A 4FLEA 4BQFA 4U5XA 1QFJA 2FEXA 3PRHA 5E7MA 4A6EA 5C8ZA 1MPTA 4N5HX 1H3FA 1Q57A 4NV1A 1QG6A 4R7ZA 4NEQA 5FR1A 1T10A 3RK1A 4DA6A 4FHCA 1NW4A 1CEQA 2ZB7A 2ZQYA 2KB0A 1G19A 1HDCA 3A2NA 2INGX 3FHOA 1M2OA 3G2MA 3IBFA 3MUOA 2PD6A 4NDZA 3CUTA 1ZIDA 2B61A 3G2LA 3Q0EA 1T8RA 4WGGA 4AMZA 3BXZA 1KAOA 4PRZA 4EKGA 1CUSA 1PV2A 2LBPA 2ALJA 5ARDA 4RZXA 1JQAA 1VE6A 3WL4A 1E9BA 4CR6A 2HWYA 4N3NA 2FPPB 4J0FA 1UBFA 4HV4A 1M2WA 2XUZA 4TQUS 2B37A 4CMIA 3NTXA 4INZA 1XQYA 4B82A 3KQKA 1YRYE 2P9TA 3H1AA 4PX9A 2GD0A 4P53A 1UMCB 1SCBA 3V4VB 1Z4LA 2NP6A 2XWQA 1O6CA 1TYCA 3SM9A 1F6DA 3HJCA 3M6VA 4KDFA 3SG0A 4MP8A 2D7DA 3OUZA 1U3VA 2H17A 5BV0A 3G1UA 1C3JA 3KUUA 5IX8A 4KOEC 1LI5A 5B3LA 3A2MA 1OZGA 1XZHA 4RIHA 4B4WA 2ZBFA 2Y2VA 4Z0PA 4J76A 2B35A 3WL7A 1BE6A 3F8SA 3IHTA 1HM5A 2O4CA 4MQLA 3A4VA 4YP6A 1Y1PA 1AY0A 3EQ6A 3KT3A 1QO9A 4TXHA 1XZ8A 1ECCA 1JHUA 3ORRA 2D5BA 1OLSA 1D2MA 3DYIA 4MUYA 5B64A 1AGYA 1H9CA 3WWOA 4BMYA 2V7QA 2JKYA 2FZKA 2QENA 3QPCA 4TOIA 2Z1DA 1AK9A 1G0OA 4MB2A 3QENA 2EFCB 5B1YA 1GGNA 3LUAA 4JT8A 2GDZA 1LS6A 2DUUA 2C4KA 4TS9A 1NYRA 1XC7A 1UBCA 4WOKA 3VNAA 1YASA 3V2HA 3GBSA 4UVHA 2QVYX 3G3EA 1YA4A 1PNRA 1Y3DE 2ZYRA 4RF3A 2H2HA 2ZUBA 4LQCA 4Z0NA 5FUMA 4OL9A 1Q6ZA 2PYIA 3FTPA 4N8DA 3U48A 4EYQA 2FF5A 2X41A 5G53C 4U00A 3ZHYA 1XQ9A 1W85A 2PIDA 1OAAA 5AJVB 3BT7A 1M6NA 4EJSA 4EDFA 2JZNA 3AKDA 4WFJA 3MJRA 4L22A 2R2AA 2PG3A 4Z1OA 1JZSA 3N2ZB 4GECA 1ZESA 2ZYTX 3HYCA 3SOZA 3VMMA 4EUHA 5E6SB 5FORA 5HS4A 4XCXA 2X4IA 4JROA 1DC8A 1QZTA 2X4DA 4EL5A 2X8JB 4Y8VA 1Z3CA 5DFAA 5BSTA 4NOJA 5IKEA 4FZVA 2DJ5A 1W88B 3ABSB 5DDIP 4N4AA 4PZEA 4X7RA 3HA5A 1OYWA 2I67A 4ZREA 3QMMA 4TTJA 1M6EX 1TECE 3FVVA 4Y6GB 3T0IA 2OESA 4F6RA 1V6CA 3GK3A 4ARSA 3HSKA 3SD7A 3FVWA 1XX6A 4Q4JB 1QH9A 3FUTA 3GH3A 5FOQA 4IVPA 4MYDA 4S1PA 5C51B 2R1UA 1OH5A 3VR2D 2BIFA 2QTMA 3ZPXA 2OHOA 1ZK4A 4WBXC 3PGLA 5DHSA 3JZDA 3MZ0A 3R5FA 4RWZA 4Q9AA 2XUKA 4U2FA 1P0QA 4OLBA 1YZUA 1E77A 2O06A 1CV2A 2Y27A 4W5JA 2P0EA 1ZA2A 2VPWA 1CDZA 5KNBA 1US8A 2FMKA 5DO9A 5LQDA 2LW7A 3L1KA 2X5OA 3RF6A 3SHQA 1A71A 4OP3A 3FYHA 2XVMA 2JFXA 4JLDA 4MKZA 3WGTA 2ZRMA 2CV0A 4H2DA 2I6TA 4B6JA 1E4VA 1UXOA 2I4OA 3UT6A 1UDRA 4DIBA 4N48A 3DE1X 2XD9A 4HDSB 1KF0A 3Q72A 3V6LA 4TLMB 5DM60 1OJ7A 3WTCA 4C7JA 1Y6RA 3AETB 1NMQA 3VH3A 4II7A 1XDSA 3P96A 3ON5A 3WHIA 2CLIB 4FKMA 5JSKA 2IZ7A 4L9WA 4Q24A 1XMQB 2A9QA 4I8DA 3D8TA 1J0DA 4GPTA 2WQ7A 5JSUA 4CN8A 1C7RA 1UZAA 4ZI7B 4XUGB 2Y9MB 4LYGA 4WOPA 1RQRA 3KO8A 3SICE 4B46A 1L4BA 1XTPA 2VSQA 1KA9H 3DEAA 2NYAA 4BIIA 1E2UA 2BFAA 1E7MA 4H3KB 5CK4A 5EE3A 3M9XA 1P62B 4ZT4A 4YRMA 2OO5A 1LZLA 4R16A 4YP9A 5H16A 1F2UB 1SHJA 3R75A 2C5LA 3EISA 3BMOB 4DRYA 1U2DC 3AOEC 2I1WA 3PFNA 4PGFA 2Z30A 1HOXA 1YO6A 4I1RA 5JNSA 2R1VA 1M1YB 1EHIA 3GOHA 4QXQA 5JHGB 1E0DA 1EK0A 1T1EA 1QFXA 2DWOA 2N75A 3CEHA 3WYAA 1LDMA 1R9GA 3EWAA 1WTAA 2EJWA 5ERYA 3T95A 2J3QA 5IRCD 1EB8A 2XB9A 5KNCD 4GH5A 1W49A 1CQJA 4WXHA 2XITA 4L51A 3ONEA 4KIJA 3EIWA 4OM8A 3UHOA 4C01A 2M1XA 3DEKA 1CUEA 1YR3A 2VDJA 2AX4A 2RB5A 3NHSA 1LC3A 3CYFA 4KFUA 3TN7A 3VU9B 4B6PA 4BNVA 2PWZA 3BB4A 1WQ3A 2YHUA 3LRTA 3MWFA 2JC3A 2GEBA 4ZDWA 3HL4A 4EHIA 4LOJA 2CNOA 2HWKA 1FTQA 4ZOCA 1U65A 2FN4A 1ZM9A 4U7JA 5HDBB 3RUDA 4B4UA 4ARUA 4CEIA 1XPUA 3K92A 5BWNA 1R50A 1ZEMA 1QIFA 3DPIA 4K9DA 4LK2A 4TROA 1K7EB 3HB1A 621PA 4YMHA 3KB8A 5HM8A 1TCAA 2A0WA 2QN9A 3ETHA 4O63O 4Y98A 1AQNA 3D6NB 3ZW8A 4BV2A 4QT4A 1S3IA 1OLOA 1W52X 2EFYA 2W2VA 4P36A 1WV0A 1YB7A 4DIFA 2R84A 5BRAA 2R68A 1HE8B 1QONA 2P35A 3WRWA 2QVZX 2WM9B 3UMJA 1J56A 5JO9A 2MR6A 5CBPA 5CEEA 5C31A 3FPKA 3UJ6A 4Q4LA 5JEEA 1DT3A 4K9OA 2AKYA 2FKNA 2F67A 3FPLA 2I99A 3MJHA 4LOAA 2BI8A 3BUSA 3VGJA 3QQ5A 5IVPA 4YHHB 2E5FA 1GTG1 1ZH4A 5KX5F 5F64A 1E3WA 1VLMA 2I6SA 4HUJA 1FNMA 5HZHA 2Q9UA 4MMZB 2PBFA 4OFZA 4E70A 4BE9A 3Q0IA 5IM4F 3TLGA 1SOAA 3L4EA 5HR5A 1T1RA 2A9OA 2IF0A 3KQLA 4MVJH 1RLJA 3VPXA 1RLTA 2DJIA 1LQ2A 3EIXA 4R2JA 2O57A 4G56A 4BZQA 1AGPA 1XZIA 4MUNA 1ILWA 3LDFA 3HGMA 3I1IA 3Q85A 4QGFA 5AI5A 2IK8A 2GCOA 1ZD2P 5DXFA 3IQGX 1UWKA 5DOZA 1BG6A 3DBRA 4B0PA 2RSLA 4BZXA 2ZCUA 5SZJA 4Y2TA 5HPYB 1E4OA 3K9LA 5JJBA 4RA9B 4P86A 5K3OA 2GCGA 2K7FA 1C1DA 1C4KA 3I8OA 3N70A 3WIUA 5J23A 3EX7C 2IUTA 5ALDA 4CL8A 2X0RA 2ZUVA 3FDFA 4AJPA 2BFPA 1UFVA 4MKFA 2WSIA 3R9WA 1JZQA 3FI0A 2BDEA 3LPDA 3TGPA 1QZ3A 3EVAA 2GEKA 2ZJOA 3P2EA 4MI1A 2C8KA 4BLOA 2C2ZA 3HU2A 2IXGA 2VFAA 3VJRA 3N58A 1EJ6A 4PG8A 1F0YA 1P9OA 1YIDA 2A9VA 4US1R 3HZRA 2H11A 1SWWA 4XIYA 1QFMA 3HN6A 4R3WA 1UJBA 1W35A 221PA 3CUUA 4G0YA 3WGNA 1KZ6A 3M7IA 2UDPA 4BX2A 3ZJUA 4I8IA 5E4FA 1L5ZA 4GMFA 5AK3A 3MSCA 4QG7A 4NYJR 1AU9A 4UPEA 5JQGF 2UZ1A 2WKSA 3L77A 1N8KA 1UOQA 1OXSC 2W98A 3IUEA 1ZA1A 1CKEA 1JQDA 3O8DA 4GRIA 4YB8A 3AESA 1OR8A 3BILA 3KV3O 3LPNA 2GYVA 4J0HA 4MW2A 4Q01A 4DW8A 4PHGA 3KE9A 1GZDA 1M8PA 1U9YA 2C07A 2ZWOA 5ITSA 5DH9A 1S4MA 2RK3A 1NJ5A 1TKBA 2DX7A 3QMVA 3RV3A 3C3BA 2CUZA 4TXMA 3T5GA 4AJ2A 3DQZA 3DYBA 3PSAA 1UC8A 1Z0KA 4JP5A 4DCSA 1Z56C 5HKBA 1PGQA 2NUTA 3SKXA 4BYGA 1J6UA 4YPFA 2JGKA 2JH8A 5EMMA 3TG8A 1Y5RA 2C0PA 2VAXA 3RF7A 4ZZ3A 5IJ0B 3F5QA 2PZFA 2ZI3A 3HLYA 3HCDA 4DADA 3PX2A 1N7GA 2P69A 1QIEA 1V9CA 4D6PA 1A4XA 1QKJA 1CX9B 1N3BA 4C3UA 5TIIA 5C9ZA 5DYNA 4DV4B 2XZLA 4IUDS 3L0PA 2JFQA 4LC0A 4FM9A 1YZQA 4MAMA 2MSWA 4I9GA 1Y1TA 3I9V6 3HMQA 4BCCA 2O7SA 3UWMA 5BURA 3O94A 4MHTA 4I3GA 2WVGA 1IUOA 3BMNB 3BOSA 4Q7EA 4QASA 1A9XB 1V9LA 1U7WA 5E6RB 5JRJA 2PBRA 2VS1A 2I7DA 3KZKA 3C3CA 4X1OA 2XVAA 3HN2A 2JJMA 2H8GA 3WBFA 5EJFA 1WXWA 1FDVA 1V6AA 4J2OA 3FUCA 3MRXA 1XXHE 1R9MA 5F77A 1FTWA 1Y7PA 3HCEA 2O8VA 2NNWB 3WJ2A 4ASUD 2G1UA 2VT6A 5FI3A 1QX3A 1Q19A 3GWGA 4PW0A 4YWHA 5DX0A 1NHGA 2GZAA 3E3LA 3TVYA 1WVIA 1JQJC 2FOIA 2IEYA 2B36A 2IZZA 1LV7A 1VTKA 3GJ8A 3L4BC 3FOZA 1DXHA 4FK8A 3EXEB 2XTMA 3DUFB 4HGOA 1PE0A 2CBZA 3RRZA 5MN6A 3GWZA 3EE6A 3O47A 3U1VA 2ZU0C 3BYZA 1EVEA 3LY5A 1RIIA 1BHJA 1WOYA 3LH5A 1XTZA 4P7FA 3VVCA 1VMDA 5LB2A 2D2VA 3WQSB 1U3WA 2GN6A 3T1NA 4M0PA 3PNYA 1LB1B 1GAQA 3P0HA 3WSTA 1VYHA 3VNQA 4CMJA 4W7HA 1M10A 1RWMA 1QX4A 3KR1A 4YFYA 1DEXA 2UVPA 1LKZA 4OBWA 1YR7A 3U80A 2QZSA 1OY1A 4ZOEA 2JFUA 3N86A 4R7TA 2FHPA 1XQVA 2B94A 2NPIA 2PU5A 3TNDA 1T0JB 2QVXX 1RJGA 4MQFB 2G0NA 1A2BA 4BP1A 4CU2A 4S1NA 4B73A 1KKLA 4LVOA 2GPBA 1FRQA 3H1PA 5JQGA 1XXLA 5K8IA 4YJGB 3DMFA 2QXUA 1NY5A 1E1RD 2IZ6A 3L93A 4QFDA 3RODA 4PSDA 3LF1A 3LW8A 4HNHA 5ILQA 1L5OA 2N3ZA 3WZMA 4A23A 1YR2A 4OIFA 4DCPA 5GONF 3F71A 4UNPA 3ZHZA 4RMNA 3DLCA 3A4TA 4YQEA 2GA8A 2H59A 3C3KA 3WGYA 4YV0A 1NJFA 4ZCQA 2QV0A 5F2OA 1A8QA 3H2IA 1G66A 3MTBA 4KQCA 4MB0A 3X1XA 1HT2E 1J07A 1I30A 1PR5A 2GCPA 4LF6B 2QN6A 3ZI4A 3HV0A 2I4RA 3OT1A 5D8DA 3VR3A 4QLOA 3AILA 4OMDA 3BF7A 4YDHB 4CIYA 3UOAB 4ARCA 2O2ZA 3BDAA 3UOGA 4NP6A 1IZ8A 5EKTA 1DBRA 1EK1A 1PZXA 1XRSB 2DPMA 2Y4NA 3KOXA 3N3BC 5TGDA 1IJKA 3SPXA 2OC4A 1QC5B 1QR6A 4YGYA 5TEVA 5JXGA 2W37A 3CLSD 1NOKA 1GUDA 1JDVA 2V7XA 3BGOS 3QF7A 4HWOA 3DGEC 1JG7A 2PKQP 3HXOA 3M6WA 1EGVB 4RD3A 3WK8A 1O0BA 3D64A 2QN3A 2DT5A 2HN9A 2O6HA 2E7ZA 3QPUA 3MGKA 4OB7A 2XADA 4WA7A 4RSMA 2GBFA 4W7SA 1DEAA 2QXTA 4ZCLA 5EWLB 3DZFA 1TX4B 1WCIB 2ZGVA 4R0VA 4UBJA 3FHTA 2ZJZA 1EJ2A 2PUVA 4K28A 4MVJD 1OXUA 4PYOA 4MYTA 1UBRS 4J43A 3G49A 2HDWA 3X1WA 3AUJB 5T41A 3ANNA 1Y89A 3OF5A 3DVRX 5CGZA 4CI0B 4L6IA 1WB9A 4TV9F 3VHQA 3RAPR 3NP7A 4JOQA 4Q7MB 1X8LA 3IODA 4WZBE 3T1OA 4OYYA 1PW7A 1QYIA 1NYTA 4QJ5A 1HG0A 1LTQA 4MO9A 3SLKA 4D4HA 1YZYA 5C1BA 3JD1A 5JROA 5KNBH 3H6KA 4N7BA 4OVKA 3W4JA 3DPSA 2OB2A 3NRBA 4Y1GA 2O8FB 1SOVA 1Y9DA 4NZZA 3N74A 3V97A 1FLVA 2ZR8A 3AEUA 3CMMA 3KLPX 4JR2A 3UGKA 3H0EA 4LXIA 3ZZUA 3M6MD 2JAUA 5D5HA 2QRLA 1JBQA 5F5XA 5KJFA 3DBOB 4Q7LA 5J2UA 5I7EA 1NUQA 1J8VA 2JD1A 2PLRA 3I28A 3NKVA 4XUCA 2X7HA 1L4LA 3QWBA 4EEZA 1XZCA 1LFAA 2Z57A 4ROTA 1MA0A 3K3PA 2HF7A 1LJ8A 2PXXA 1YS2X 3EC2A 1W29A 1GZ6A 3F90A 1T4CB 3Q2OA 4YC7A 5ILGA 3SXUB 3MOSA 2OE2A 3NT4A 4C9BA 1B16A 4PLGA 5A02A 3TGWA 2V7GA 4C30A 3WDKA 1GCGA 3OE4A 3Q41A 1K7YA 2QMHA 3K5IA 1HXHA 2CNLA 3CNOA 3EGCA 3BCHA 3IDSA 4RFSB 5GONA 1VI2A 4KDRA 4JI6B 5CDUA 1N32B 3D3JA 3GLFA 2V7EA 4D8YA 2YIVX 3GZNA 4H3SA 4TUYB 4AS3A 5IYZB 5DISB 1Z6QA 2D1TA 3KTOA 4L15A 3IAS6 3C8MA 4W6ZA 2BKUA 4CIBA 1RJDA 2WF9A 1Y6QA 2Y6VA 4HWRA 1GL6A 3G2PA 3L7JA 3NIDB 4TWAA 4DV0B 1GTL1 3PPXA 1QRRA 2QU7A 4N8EA 4GD3Q 3TGLA 4QFMA 1W25A 1ORRA 1AUOA 1T0UA 2EF0A 2ETVA 3LBAA 3MEQA 3C6MA 2EZUA 3P9RA 4H6XA 4Z86A 5D6NA 4RL6A 2UUOA 3ML1A 2V6GA 1SZPA 1MW9X 3AL3A 4MR8B 3MJ4A 2B83A 1LF5A 2OO3A 4QEDA 4WCVA 4D6XA 1K68A 3AT1A 2B1QA 1Z4KA 5GMOA 1H22A 1SBZA 2JAQA 4OKNA 3MS2A 4INAA 3LP6A 2VDMB 4NU0A 5KVSA 2FPXA 3HXLA 4QE3A 1FFEA 1X1EA 4YRLA 3W5SA 3PKJA 2IGBA 1FNDA 3TMKA 3Q7IA 2ID4A 4R83A 5BQXA 3MCTA 3IUMA 1N3IA 1Q83A 3W7VA 3L7OA 4BLQA 2P6MA 3DW3X 1I7DA 4RAOA 2HMSA 1BXGA 1TK9A 1JLRA 1PFVA 4LXGA 2KS6A 3OURA 1VE5A 3TLAA 1D2HA 5FADA 1R5OA 3QV1A 1T3TA 4YAFA 4RW0A 3WLLA 1YCGA 1L5LA 1L4HA 1GPNA 5FPSA 3FPBA 3CVXA 1IN5A 3DEIA 1ANKA 3KYCB 2PO7A 4J0EA 3IAAA 4D3FA 4HAXA 4JBHA 5JSQA 3C5HA 5B5SA 4P0TA 2QTHA 2CLKB 2Y1FA 4XEUA 2VJOA 4Q9HA 1W76A 1GEGA 1NY6A 4V03A 4NPAA 2IPNA 1JHAA 3WIVA 1DC3A 4DLXA 3EOAI 4X92A 3FPGA 3KEGA 1Q0QA 2Z58A 2EFHB 3RJTA 1TU0A 1ZW6A 2J9RA 4J0CA 3RRXA 4DKXA 5CH5A 1VDZA 1M0TA 3C48A 4IKPA 5TEWA 4KACA 2H1HA 3UIEA 3A1FA 1B6GA 1J0CA 3PNMA 3F3SA 3IR7A 1Z37A 4OJMX 5G02A 3TSAA 1XRNA 1ISSA 2PMKA 3EZ9A 2HH9A 2C88A 3ET4A 2AJLI 2Q27A 2X4GA 1I36A 1R5NA 3NFYA 2GAAA 5BUZA 1Z2OX 3HBAA 4CF5A 3KZMA 1JIXA 2FZLA 4MAFA 3VU1A 3QVWA 5E7IA 4C4TA 2Q3JA 3TH5A 4E7OA 3AZQA 3LP8A 1MJGM 1YZNA 2P9ZA 1MJ5A 1FTNA 2FH5B 2V7VA 3ZI7A 4CUZA 5IANA 2EVWX 4QOSA 3E9YA 3Q6MA 3VTFA 2GXQA 2VSXA 5GIPE 5EHGA 1WBJB 3AKYA 2FUG1 4FBGA 1KQGA 1U8CB 1GOTA 4CLDA 2GB4A 5IJAA 4YNBA 1AB5A 1H4VB 2QUAA 4F2PA 4PZZA 4UASA 1M6WA 3OQPA 1PI3A 4IGEA 3GJRA 2WIFA 4P3KA 4UUBA 2A5LA 4R2WA 2FPIB 1ST3A 2OBNA 3C6ZA 4XQEA 4D9KA 5KSWB 4FUTA 5EZYF 2H1OA 3MAAC 1GN8A 2GJKA 1QZZA 2C9YA 1FNBA 3NHLA 1UJ5A 2D5AA 1YVEI 1FYFA 3GQBB 5JCPA 3THYA 3NEYA 3RKSA 3K1YA 4ZDIA 2R8ZA 3IOYA 4WZBA 2VHJA 3DAGA 3NYQA 4URUR 5KYTA 1WO8A 1U0LA 2ZT7A 3EZLA 3PQ8A 4RHEA 4YJ2B 3QTLA 1RZ3A 3LK7A 2JIQA 2X86A 1CUCA 1VCNA 1EVYA 3HKDA 3LBYA 4FP9A 4IWYA 4MUEA 4OHBA 5D5PA 3UVEA 3UXHA 3FUUA 3IPRA 3DBIA 2AUTA 4FFBB 1R18A 3HDJA 5JG7A 5HILA 3IP3A 4JLJA 1N5IA 1MABA 2GJAA 5ICFA 4QHTA 4O6VA 2W0MA 3FKSA 4AIIA 1U9CA 5KOJB 1I7QB 3VPCA 5KYUB 1N5DA 4XB6B 3NKLA 3ZH9B 2OHVA 5KNBD 3I5YA 3AUKA 4NZNA 4B2IA 4CM6A 1T5OA 1PBTA 1VLQA 3DBHA 2L82A 3K7EA 4GM0A 4ON9A 1K6MA 3JTEA 3KLMX 4NJMA 2ONJA 4P58A 3DFKA 2PV0A 5DU2A 3QXXA 1VMAA 3O73A 1FP7A 3BCSA 4JJ6A 4MGHA 2R8OA 2B4QA 2SECE 4BDSA 1BFUA 3ONVA 4OQDA 3L1UA 4XQ9A 2VP6A 3BK2A 5E8JA 1W5BA 2VIIA 4BEWA 2BVNA 2HXYA 1XNJA 2JIZA 5JYEA 3I58A 3OO0A 3ROEA 1N2ZA 3D9QX 1LSSA 2BDTA 2C5EA 1XA0A 2DUMA 4CBVA 4FFSA 4II2A 5IW8A 2HUNA 1DJPA 1FUEA 1BRTA 2IYXA 3F6SA 3MM4A 4ND3A 4NCAA 1DHTA 3SZLA 4XLTA 1WZEA 2C57A 4OBBA 1REQA 2IYTA 4R2MA 1OFGA 4KO1S 3V7NA 1EWRA 1NF8A 1ULHA 3E05A 2HSEA 3QLVC 5LKAA 2QLBA 3OZAA 3ZK8A 1NXOA 2ZTMA 2W93A 4M83A 2X40A 1BVHA 4E0BA 1CUUA 4G86A 1V8DA 2V4ZA 3NBQA 3R7NA 3TVTA 2NU6B 4WLNA 4YT4A 1JIKA 3VI4B 4WD3A 1XSEA 3ICCA 2CYCA 4AG6A 5ER9A 4AYTA 5BW5A 5JW6A 2GZ3A 1FNCA 3UPDA 1DKUA 1RABA 4Q1DA 3K70B 3VZPA 1Y1QA 5EXXA 1NRJB 1QHXA 4UNNA 5DHUA 1U3CA 1UEXC 2ZT8A 3JQ9A 1EMDA 1GL9B 1P80A 4LVUA 4MIYA 4D8VA 1IZ9A 4ONEA 1JL3A 1AD2A 4GYJA 3UT0A 4G5QA 1U4SA 1RAAA 4IIUA 4MA5A 1MHPA 2VK1A 4AJHA 2G9NA 3GFPA 1BFKA 4B7ZA 1OX6A 3OQOA 1BGVA 1F5SA 3R2JA 2X0EA 4OJKA 1R4NB 5B6IA 1QZXA 1N0HA 1EGAA 2QAJA 1KQ3A 4M21A 2MU1A 4BX9A 1YDHA 3D8BA 3PNSA 3ZEAA 2W90A 2Z8ZA 4PO9A 4RXMA 3UAOA 2C3OA 1QTIA 4HRVA 1C1HA 4NZPA 3RYFA 1U7TA 2OPBA 3CH6A 2F3SA 2I3AA 4IXNA 5DYYA 5EJAA 3VHLB 1ELOA 3AVOA 1JLMA 1Q16A 2QL5A 5JO0A 1JFFA 2WU1A 4NY1A 2VNKA 5FAKA 1CZRA 2GBIA 2QJOA 3ZW7A 4IG4A 3HCOA 1HSZA 3ND6A 5LP6F 3BCRA 4QPJC 1OBVA 2O48X 3HDVA 3LUGA 4JXJA 2ZSKA 5A7FA 1VJ0A 3N2GB 3WK9A 4HGQA 3DLPX 1BD3A 3NATA 3C7TA 3S28A 2CKMA 4TT3A 1NBOA 2YBEA 3QKIA 4AIRA 4CW7A 3TAXA 5BRJA 3UMYA 2JAHA 1XDGA 2SBTA 1R0XA 2XMRA 1GTVA 2L19A 1XAIA 4OUDA 3WYNA 1IH8A 4IILA 5L51A 2RAPA 4A3SA 4F72A 1R8JA 3KSAC 4HPWA 4KSYA 3SWWA 4NE9A 4MWTA 5K8VA 4G6ZA 4IWNA 1ZCBA 3H1TA 1LBTA 4EHAA 1UQTA 4LN1A 1DDIA 3FR7A 3KHTA 1LPPA 2J0SA 3OHPA 3B85A 3OCWA 4F9TA 4JT9A 4KX5A 2YWHA 4IO1A 3IVRA 4AJ9A 3G17A 1BX1A 1CVLA 1A5SB 1GGFA 3K5PA 2AEFA 1A0OA 2I9PA 5EJGA 3T3DA 1F9AA 4J29A 4ZYTA 1Z45A 1JNYA 1Y8AA 1CXZA 1G5RA 4EY3A 1UP4A 5JLJA 1XTRA 1FU8A 4DMHA 2QXYA 4D80A 1S5PA 1XRMA 3DXXA 3FOCA 5LDDC 5HNKA 2HPAA 2PT7A 3R6GA 4I14A 4Q05A 1EQUA 5EMNA 4ZZ0A 1NDQA 3FTQA 4ND1A 2JAWA 3B12A 4QGHA 4DA9A 1RZUA 2EQBA 1YACA 1A9OA 2CLSA 2GFHA 4EVIA 4NOMA 2A7XA 2GKGA 4UHJA 2G09A 4KPEC 2YVKA 1NSYA 3R4VA 4GKVA 2ZRDA 2X0FA 3ZHOA 1E1CA 2IYNA 2ZP1A 4HDNB 1J23A 1R4MA 2G83A 3NH9A 5EP3A 1CRQA 4TRMA 4COKA 1FDRA 3VTZA 3QX3A 4D97A 1G6OA 2WDZA 3ZJ4A 1FL9A 4KRGA 1IPHA 1KQPA 3RREA 4E21A 4S05A 1H3NA 2RHTA 3BTUA 1QVWA 2P77A 3NGXA 5KTMA 2BUBA 4C7KA 5KC9A 1UC5B 4IJQA 4CETA 3NM5A 4R68A 1J8QA 2VK4A 3IRUA 1P7YA 3LWBA 2O2DA 4FFOA 4CIDA 3J81k 3BRSA 1CQPA 5MN5A 2WABA 1VQ1A 4P3OA 3KU1A 3KQSA 4JSYA 3WLSA 4E1AA 2C4VA 1LWNA 2QD5A 2C4TA 3RWOA 4A8PA 2GO1A 1VZ2A 4J0GA 5EJ7A 4UU8A 4J16C 4CUJA 4ERXA 4S3MA 4D8XA 1AA6A 1YQEA 2QRNA 4NESA 4X84A 5KHAA 4ACBA 3IIIA 2YN2A 5ALOA 3EQ9A 3EAQA 4IDAA 2NQ8A 4P7JA 2GPNA 3C74A 4WLOA 4EARA 1RAFA 3AR8A 1Z47A 4ZP1A 3R0JA 3KQMA 3P52A 4DIMA 2K5UA 2GD6A 5LP6A 2HWXA 1QDLB 2VKTA 1NTRA 1KYTA 5B1IA 4YMLA 2WWYA 3BF8A 4GWGA 3JALA 4O4LB 3MTIA 2IEZA 4Y2JA 1JLKA 1UBJS 2FSPA 2Y6UA 4H59A 5H3HA 5DJ5A 1WIWA 5AFSA 1ZMOA 5D5QA 1G8SA 4QPZA 5T57A 3V5NA 1T36B 4ZYXA 2FMTA 1QP0A 2GGSA 2X6TA 4D7AA 1GTSA 4JXZA 4Q4AB 1P2FA 4HXGA 3ROPA 2R4TA 2QNBA 1W36B 5BSEA 2ZS7A 2QROA 2CDRA 3HKBB 3PFFA 1UBSB 3PNVA 4O25A 3U56A 4KI7A 2CF6A 2CK3D 1TKRA 4CHTA 4HQ0A 5K3EA 1TQDA 4C6TB 2XCUA 4QUJA 2BRUA 3UNXA 1PZGA 2B1GA 1EGHA 5IXYA 1VFNA 3ORFA 2FWJA 5HWSA 4NYIQ 3HEMA 4TKUB 3IMKA 4LUCA 3NJRA 1A8UA 4AJNA 3A37A 4FJ1A 4AS2A 4ARVA 2VJKA 1NJ2A 1ZJYA 2PN1A 2ZSEA 3MS7A 2O2CA 2WD9A 4UW9A 3TBFA 3UT5A 3W05A 1EE2A 3AGQA 1Q20A 8MHTA 3UV6A 2IH2A 1NM5C 1USKA 4UAJA 2O0HA 1VPDA 5I7SA 3AUFA 2B78A 3R0XA 3SVTA 3KETA 2NZVG 4ZVRA 1L9KA 2JVJA 3PDCA 1GNVA 3IX7A 2N9UA 2GHQA 3CRQA 2ORED 4KQIA 5EIHA 3UK0A 1RZRA 1PEKE 1ZHHA 1Y5MA 3FNGA 3MWKA 1POXA 3KPWA 4OKIA 4FSHA 3JVIA 3UKDA 1NVVQ 2Q07A 1K4YA 3NBFA 5BOSA 5JYDA 2BWJA 1MJHA 3A31A 3ESRA 1V8ZA 1KE2A 1ZBDA 4R1MA 9LDBA 2XYRA 4RGQA 1WSAA 3ZQJA 1BVYF 1IB6A 3ABZA 3EVNA 1L8LA 4H15A 4C4RA 4MKIA 1EFCA 1DQYA 1MX3A 1K0FA 1BHSA 3LCCA 3MB5A 5DN9A 1JILA 3B1JA 3NO4A 3K70C 4YQYA 4BVKA 2RB4A 3OP1A 4CQJA 1T0HB 3PXGA 2OG1A 4BWGA 3GFFA 4CV3A 2X0IA 1UUFA 3PK0A 2EFEB 1TM5E 3K0HA 4IIJF 1CC1S 3Q15C 1DU4A 2JDID 4KH1A 4W9NA 1KBQA 1BXKA 3EMDA 1Z4PX 3VR3D 3B1XA 1HQYE 1N2OA 3MMXA 4I2VA 4HKTA 3UMFA 1FYXA 4AZWA 3O21A 1A69A 2Q5IA 2VF2A 4M9RA 4MCJA 1L7AA 3KHKA 3M34A 1GGMA 4JDUA 3BJEA 4UJ3A 1Y98A 2VZ0A 2VCEA 5EKXA 1ESDA 1JH8A 4PO1A 2V58A 2PYDA 3GDOA 4A92A 4UM9B 1DFHA 4NCIA 2CXTA 4PBSA 1UMDA 4RPIA 2QY9A 4TMFA 3C5CA 4KV7A 5I7AA 2HJVA 1B76A 4BEVA 2B2CA 1L2TA 3AUYA 1QGAA 2RHRA 1B3RA 1OIWA 3AF2A 4FUQA 3U13A 1UP7A 4B3MB 5FFFA 4NBLA 3L2OB 3PITA 4YBRA 4WKGA 1EAMA 2J4FA 5LXTB 4BLSA 3BZUA 4CLOB 1IJFA 1VBFA 1JAXA 1Y4AE 2GBCA 3T7KA 2ODQA 3AJRA 2CBGA 4P3NA 4MX8A 2EAUA 4GZ5A 2EBFX 3ZQ4A 4ZYLA 1DDOA 5GJBA 1GDDA 1Y3HA 3QI2A 4RGYA 3QKWA 1IUNA 4LY0A 1UWVA 1JHPA 4DWWA 4ITVA 4L75A 4NCXA 2WJAA 4JZKA 4CQMD 2GKOA 2Q1SA 4HN4B 2D1FA 1S8AA 2ODWA 4BMNA 3DTYA 3RLIA 2PRKA 2FK7A 5E2IA 3Q3IA 2YCLA 3EHDA 4X3PA 4BVHA 5BSWA 4HPJB 1P5RA 4E51A 4X20B 1MQ8B 1PJLA 1HKHA 1H2EA 1C14A 1D6JA 1T3GA 2XWPA 3OQIB 4H4DA 4KXMA 4S35A 5EJ5A 1NXWA 1XRJA 4BE7B 3E7PA 3CO0S 3R3UA 4IVNA 3T0GA 4DCMA 4TV8B 1HX7A 3WQBA 1RYFA 3R6DA 1RLUA 1VIMA 2DTDA 3FA2A 3ZWNA 4RWEA 5EIAA 4CMEA 3K6JA 2VR1A 1C8BA 4BNTA 3CW9A 1SXPA 1TTHA 2PUWA 1CF4A 4V0OA 1XPJA 2WSLA 3NAGA 4JMPA 4Q66C 2BMEA 4PHTA 3PRJA 4G41A 5HX7A 4TKZA 2NUAB 3TECE 4GR4A 1VJTA 5BQ5A 1TJ3A 1YC5A 2BP7A 2PVSA 1JG1A 1U7HA 3X1YA 1Z39A 2FXIA 3BDIA 4JLUA 1KZ1A 4TXLA 2VYCA 1GRRA 4I99A 3L8DA 4E2ZA 5GGYA 5JDIA 2RDMA 1ADBA 2WT9A 2FW7A 3ZU5A 3M6LA 1KY4A 2JJ2A 1DBPA 2BBSA 3QVVA 1OHHA 1MX1A 4JQCA 2D8MA 4ZEVA 1APBA 4JLVA 4G2NA 4LRSB 1KIAA 1TYBE 1XZFA 4DNQA 4ESEA 4YMUA 1AZWA 4ZHQB 721PA 1ABFA 3CH4B 4QJIA 4Q9NA 1ZJ5A 4LF4B 1T5TA 3H04A 3THOA 1Z5GA 1ZQ1A 1EFVA 2HRZA 3VJLA 1L5VA 5F23A 2P6OA 5CH3A 1LS1A 1QQ5A 3AIMA 1PL7A 2IYLD 3IVXA 1TB4A 4XDHA 2HBQA 3RHTA 3WE7A 3CLRC 5C53B 1CDOA 3HUTA 5TNXA 5A6VA 1NYQA 1CY7A 2IW3A 2QD4A 2C95A 4EZBA 1U7OA 4G81A 5ERGB 4BHTA 5CDHA 5IUJC 4C87A 1YQQA 4RTKA 1JP7A 2JH3A 5I9LA 2KLBA 3KS9A 4M0FA 1MAHA 3GEIA 3ZQ6A 5DMHA 1JSLA 1HYQA 1DIRA 1UEJA 4R0MA 1PNQA 2IFTA 4YK7A 4YACA 5K7SA 3A4NA 3W5CA 4MS3A 2Z1MA 3HP1A 1KTIA 3AZPA 1KOLA 3SX4A 2PUHA 4KR7A 4QWWA 2F6RA 1ADFA 4XSHA 2C0CA 3LG2A 4EWLA 2PBZA 2FMIA 1C0PA 4EA9A 1HC7A 2ENWA 1FDOA 1J42A 1ZHFA 2C9ZA 1OWMA 4WY2A 3KKQA 3FOEC 2NPFA 1T13A 1GPBA 1QG0A 3KJEA 1VRWA 2DMRA 2SKCA 2ZW9A 4DKJA 2YWRA 4WAUA 1XU7A 3HB4X 4U3JA 2WYUA 2XJ9A 4GBJA 5D3QA 3UAWA 4ZHSA 4D0SA 4ZJYA 4JENA 1N0WA 1WUKS 2BFNA 1TZKA 4PINA 2CXSA 4N3BA 4OXNA 4MZDA 4Y6LA 3ILSA 1K75A 5C32A 3CEJA 4K8RB 1U94A 4TSKA 1C81A 2OG2A 4W5WA 2YY5A 4HLDA 3U7EB 3W06A 4B85A 3S8YA 2ZRCA 1SQSA 2ECFA 2IOFA 3RC7A 1OZAA 1G6Q1 1JT9A 3BWDD 1CYDA 5HE9A 1JQEA 2Q50A 2Z3WA 4HT3B 3ROQA 3R3HA 3SEZA 4BVEA 3ILXA 5ULLA 4I1IA 5KQRA 2J4DA 1C8LA 3IKMB 3TIGA 1KEEB 3CJQA 4LVNA 4P08A 3O0DA 1T4BA 1EA5A 3MQ4A 4I66A 4L8GA 3WSWA 3JQAA 4MGEA 5DGXA 1QJCA 2R47A 3JATB 2P9EA 2VYQA 3N07A 3VVLA 4IUYA 5BSKA 3Q8KA 3E9RA 1QANA 2DY1A 1UZNA 1DRKA 2QTZA 3H42B 3LSYA 4LMRA 4OHWA 4US2R 2W7TA 1NC1A 4R8KA 3EGEA 1MFPA 3T4PA 5BSVA 3QLUA 2VRNA 4PANA 5L6MB 1W75A 2WM3A 4OJYA 1E9SA 1VA4A 1GZUA 1OFHA 3Q87B 3ZIUA 4AICA 5C7OO 1DTWA 1X80B 4IJVA 3TK1A 1GA4A 4LZNA 5GZ1A 1IHYA 4PO3X 1ML3A 2C5BA 4U7WA 5JADA 2WMYA 3PQFA 2ROQA 4ZVNA 1UPTA 3PXXA 4E6EA 4FGUA 4PTZA 2WHPA 3B82A 5A3VA 1DJMA 1ADGA 1YJ8A 1M74A 3A6EA 4HDKA 5SICE 3T3EA 1J0AA 5AW1A 2G1KA 4MWOA 4AP5A 3GDWA 2QJWA 3NALA 2M6RA 5F3DA 3UTCA 4C1BA 5CA1F 4OQEA 1QWSA 2A3RA 2HRRA 3CEPB 3QNUA 3B51X 4HX5A 4QPPA 3VDRA 2BTQB 2CXRA 1P2VA 1XCGB 3OLCX 4BO8A 1LF0A 2FMUA 3A6FA 2QHXA 1X38A 3MAJA 5ADUS 2ZUDA 3GARA 5JZVA 1E0AA 1Z74A 1FS6A 3D5TA 3I6BA 5HIKA 1NI4A 3BSFA 1UMBB 4RY9A 3WL3A 1CEEA 3UQZA 1MAWA 3WHPA 3KIPA 1CQIA 4G24A 3ADDA 4EHNA 1EDDA 1ID8A 4KP7A 3TRIA 4F2HA 4D56A 2IBTA 5L3QA 1ZI6A 2ZXFA 2RGDA 4YP0A 3OJLA 4JT2A 4ZVKA 1VE7A 2PT6A 3DZBA 3SF8A 4HRYA 3KQVA 4HLNA 3WBBA 1NE2A 4RSGA 5ITZB 1ZUD1 3IOEA 3AB3A 4LYHA 2IEAA 4OHFA 1G4HA 1K7XB 5HRAA 2NQ2C 1T91A 2IELA 2WSBA 3FPHA 4C20A 4HTFA 2OP1A 3HJTA 3UB2A 4JHLA 1XB2A 4PQRA 3ACDA 6Q21A 1U5BB 3S8MA 2OLKA 2KI5A 3G0GA 1Z83A 4FN4A 4Q7KA 5JTTA 1OBOA 3EZYA 3VH4A 2QRGA 1F8YA 1BDHA 1WZNA 3TS1A 3RK0A 5C1DA 2GH1A 2ZB2A 3GY0A 2DM6A 1I4LD 4WNYA 1RI5A 1KYXA 3FKSD 5C18A 1D6SA 13PKA 3W79A 4ALJA 3IP6A 4F91B 1Z6YA 1IJEA 3ZUGA 2DVMA 1URPA 3ZHTA 1D04A 1TO6A 2WU3A 3AZOA 3C8HA 1E6UA 1S7GA 3WWCA 1LLFA 1D2RA 2P40A 2RARA 3VM6A 4E08A 2X1LA 2IH5A 3JASA 1AC5A 1XI2A 4HQ6A 4M99A 2DAPA 4B83A 2XQJA 5KU7A 3UWOA 2P78A 1QKKA 4O4HB 1QVAA 2POQX 2VXCA 5ICGA 2P0AA 2R96A 4NCNA 3SCZA 1GZ5A 2VHUA 2JD2A 2NZYA 5TQ0B 3RVPA 5JBIA 1GWNA 2EIHA 2X76A 3MD0A 1D4OA 5K0JA 2VHXA 3D6JA 3ECCA 3D5EA 3IOCA 3VSCA 1JQBA 4PG7A 2GNPA 4HGNA 1FTYA 5IUKC 4DA0A 5F7OA 2YRXA 4DDUA 1BO6A 2A57A 1ZI9A 1Y7IA 2GPSA 2ZAMA 3AWDA 1NFFA 3PE3A 2GSWA 4Q3DA 1JXMA 2J3EA 4NPHA 2QB5A 3RJZA 2WA1A 4HSEA 1SH7A 3DFMA 4WCFC 2WZQA 1IFXA 4ZU1X 4DY4A 5LMUB 3PEEA 4LDAA 3W8FA 1U0NA 1RPAA 5CVCA 2GWRA 2H7XA 1IHXA 4H0CA 4MQUA 3KT8A 4PM4A 4QO7A 4NV3A 4UM5A 3FWYA 1ULZA 4BFXA 5IHXA 1O6ZA 3N8IA 3Q12A 5FWDA 2BGJA 3A6HA 5JUWA 4KIWA 1I4TD 3DZKA 3O1LA 4RHFA 5JS1A 1M72A 4H0NA 4RESA 3JQ7B 4XGQA 3R7WA 5ICEA 3GPBA 3IS3A 1H2AS 3A3KA 3EMKA 3FMOB 5H4HA 3R7FA 3DC2A 4AKSA 2FE1A 1QF9A 2M32A 4YJHA 1T1SA 2PGOA 1P5ZB 4GNRA 1AKUA 5AQ1A 3GEGA 3K2IA 5AW8A 1UKVY 4YALA 4TTAA 1GHTA 3GLTA 2P27A 4TL8A 2ZE7A 1UK6A 4H6PA 2IXDA 3QIVA 3DLIA 4E5SA 4FZJA 1L5GB 3KYBA 1UFKA 4ALNA 2EGGA 3NBMA 1HEUA 1X7XA 2X2EA 4OKSA 2QM8A 4E94A 4ENUA 5HKKA 1NNLA 2QUIA 1PNOA 2NNLD 2P65A 4R1NA 3P9YA 3HA3A 4TMVA 2N1MA 1DO2A 1VM6A 2Z5FA 3RSGA 4PFSA 3ISTA 1XDWA 1R88A 1NLMA 1XRPA 5H68A 5T64A 3NAMA 4I19A 1R6XA 2FVYA 1V71A 4XUDA 3FOWA 1LLCA 2JAXA 4PONA 4DWJA 1BJRE 2G88A 4HB0A 2IZ0A 3RYIB 1YKSA 3WICA 2PZMA 3FH0A 2QVBA 1ULSA 2OCBA 1M9NA 3A0UA 3RS0A 3ZUPA 3QWAA 5AHXA 2CDCA 4BIMA 3OZBA 2EGHA 2JBAB 1T0IA 1Y1KE 1B15A 1V3UA 1YVDA 2P7HA 2ZRQA 4KFRA 4MROA 3H8VA 5T8KA 3TJZA 4C5CA 2GD2A 1FJXA 5LQMA 3JD0A 4X8HA 4DR2B 3UYKA 1QUFA 4N1AA 4R81A 1II9A 1WNTA 3UUEA 2G0TA 3U49A 3IEUA 3JD4A 4PCUA 1A88A 2WIBA 1U8FO 4TT3D 4YIHA 1PS9A 5JXIA 1A76A 3AP2A 5JYBA 4BNYA 1N5LA 4Q03A 5F5LA 5LQRA 1XRRA 2E9SA 3WJ7A 2PO5A 2X8LA 3L6CA 1M2GA 1RWOA 2QR5A 5ELMA 1V7ZA 1X7DA 1X1QA 3IMGA 3FYUA 2VDKB 1NVUQ 4FYHA 3IA7A 4E4RA 1NXVA 4Q7JB 1KMHA 2RGWA 2XW6A 4RA6B 1TD9A 1IXRC 1HZZA 1OGIA 2PH3A 4H7DA 4CIWA 2UXDB 2PT9A 2A30A 2YV2A 3G8DA 1KJ8A 3GPIA 2JLQA 3LU1A 2REXB 1QS0A 1RPTA 3LZDA 4KEAA 4M6WA 5ER6A 3VNSA 2YHIB 3Q5DA 2ZJBA 4RADA 5BN5A 3BMCA 1Z15A 2DGDA 4C29A 2ODNA 2HB6A 1PR6A 5G0WA 4YRAA 4CKCB 1JEQB 4NECA 4DQXA 1O4WA 3WRXA 1ZISA 2CB0A 1IYZA 4JVMA 2QTFA 3SIXA 1CTQA 1NJSA 1ZJZA 2IHBA 3A9VA 2JCVA 5E6UB 4PZAA 3TNYA 1R8QA 3G9TA 3QPWA 4FGKA 1DJNA 4A82A 5E1OA 3G88A 2VJMB 1QDUA 4BNJA 4WIAA 4HRAA 2WU8A 2C4HA 4BO7A 3T5AA 4U8HA 5HS6A 1L1QA 4QUHA 3TSYA 4MP3A 1YDFA 4K26A 4ZCSA 1UOPA 2E5WA 1KDPA 4FBMA 2ZSJA 3ZLTA 3AJEA 4J7CA 3RUFA 4HFRA 5AJUA 1SNYA 4MEAA 3G9ZA 4QYTA 3R0VA 3O83A 5FUVA 3ZDYB 1WB6A 1EUDA 1V1JA 1UKAA 1TYDE 1ZPDA 2ATCA 2FQQA 3FNRA 4M1WA 4MS4A 4PPGA 5C7YA 2DR2A 3AUXA 1O0CA 4IOJA 5DW0A 3QU2A 4UFNA 3UICA 4LV8B 1JIQA 2R44A 3ESZA 4U63A 3WP1B 4QBKA 1W4RA 2AXPA 1JG3A 2Z9CA 3AONB 3DJFA 4AJIA 4ETMA 3HR8A 2X0KA 2C5SA 3N8DA 3LY7A 2LP4Y 3HYNA 2JFZA 2PRSA 3E9CA 1P9RA 1I2ZA 4J0QA 1QJ4A 1EWQA 2IYQA 1K8XB 2F1KA 2WIAA 3K35A 1XMSA 2H0RA 4BUCA 4XX0A 3R3JA 5EJ6A 1WY5A 5EVJA 3ZNQA 2CXHA 3GFGA 1ZJ6A 3K1AB 2X6QA 2FR1A 3AFNA 1U2QA 5EHXA 3L07A 4Y6PA 2DH6A 3ILHA 3M0EA 4IV0A 3TRHA 1AHPA 4FYVA 2QW8A 1KBZA 3OECA 1YOVA 5CT4A 5KVVA 2WR8A 6YASA 3JWPA 3UM9A 3BM5A 3F6YA 3D3QA 5CNJA 3ZDCA 3L0IB 2CSUA 1P7VA 3V1UA 5BWMA 2ZJ1A 3L6BA 1W34A 3IP1A 4IQ4A 2HV8A 3L0BA 1DQRA 2PQ2A 2WAYA 1QK3A 4AW9A 2WPNA 3H8JA 2CL5A 4DR4B 2W2KB 2AN4A 3QM1A 3PQ5A 1WUIS 2ZYDA 3OM9A 4KNVA 4Q1CA 3JQGA 4IOKA 1TPYA 1J09A 5JSHA 2FHSA 1FMJA 4KR0A 3PTZA 3ZZ0A 4HDCA 1MEJA 3F78A 3I9JA 5CITA 1YBHA 2G7ZA 4DJTA 3D8SA 2A67A 4MIEA 2ZPAA 1Z4JA 1VGVA 1RP1A 3IBYA 4MVYA 4TKVA 4EUSA 4L02A 3H17A 3BHMA 1Y8RA 3C3WA 1UM9A 3OT4A 1TEHA 3NWJA 2NOAA 4PVCA 4QULA 1KRXA 4XB1A 1N34B 2Q5HA 1OWNA 1WLSA 2YVQA 1KPHA 1T2VA 1VKZA 5GVRA 2CUNA 4RPJA 1XPRA 2Y93A 3FI9A 5JIBA 3A25A 3IDFA 5ALMA 1RZRD 3D7MA 1D09A 1LEHA 2OORC 1BEEA 4RDCA 4X6XA 3T9BA 2Y77A 3LA8A 3U4QB 4DBLC 2G9ZA 1MXFA 3DV0A 1ZMTA 4N3CA 3U6BA 3Q6NA 3VKFA 1ZH6A 2O9JA 2PZBA 2AJTA 1ACJA 4YJ3F 4N03A 3MGGA 4KJZA 4DBZA 2O3TA 2QLTA 4EYKA 3KKEA 1TJNA 5CHEA 5FJJA 3OIGA 1NR5A 1R64A 1F60A 2XQGA 2ODEA 3ZWVA 2BPOA 2HGSA 2XQVA 1DBQA 3GNLA 3N76A 1HG1A 2ZRNA 4BKRA 3G5TA 5DKFA 4JP3A 3OOHA 2J7PA 3PUHA 1O0SA 3BXEA 3A26A 3JZFA 3TOSA 2C1EA 2HA0A 3DQQA 4DMLA 3I1YA 1LVUA 2BN4A 4BO2A 1W5AA 4GL2A 4M8KA 1XK6A 5BN3B 5EHZA 1K3UB 1F0NA 1S9HA 1VE3A 3FY4A 1M34E 5C8DA 3U44A 1QOQB 5M3BA 2HQSA 4OTZA 4A2WA 2XAUA 2I2AA 3MWGA 3VNBA 4DY6A 2JI7A 5E4JA 1OROA 2NTEA 4KVZA 4EW1A 5KMGA 4NG5A 5EQDA 4GPBA 4IIGA 3E9DA 3M5DA 4IFTA 2D62A 4XZ3A 4N49A 4BRSA 2I6XA 4X63A 2FPLA 5C8YB 1Z4OA 3VKGA 1FYDA 3CVVA 1YCDA 2CNBA 1EVKA 4PYMA 1NOJA 3AY6A 3MS4A 3GP5A 3QKSA 1NQAO 2QI9C 3L9WA 4HN9A 5D2CA 2IHVA 1Z6GA 1CUBA 1ZWLA 3W8RA 4OJNA 1JXOA 2OBMA 3IALA 2Q46A 1XCJA 2WZCA 1Q1QA 3QBEA 5EFOA 1DHRA 2Z6QA