1F0PA

Mycobacterium tuberculosis antigen 85b with trehalose
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
284
structure length
284
Chain Sequence
SRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An interfacial mechanism and a class of inhibitors inferred from two crystal structures of the Mycobacterium tuberculosis 30 kDa major secretory protein (Antigen 85B), a mycolyl transferase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords ANTIGEN 85-B
total genus 105
structure length 284
sequence length 284
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2000-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1f0pA00
2PU5A 5ALJA 1C4XA 4EBBA 2W22A 2WFZA 1EK2A 3ESCA 5ALHA 3C70A 5FP0A 2WU3A 3OOSA 1VLQA 2HM7A 2OAEA 3H2IA 4LXIA 5I8PA 3ED1A 3A2LA 2WM2A 1HQDA 3G9XA 4AZ0A 5AO9A 2JGEA 4ARBA 3AJAA 4M0EA 2JIDA 1VA5A 5FUMA 5JATA 3QITA 3B3QA 4DMCA 3C6XA 5T4FA 4Y2SA 2VQ6A 3VDXA 2C0PA 3ZLVA 3FLBA 3T52A 2WFLB 3D7RA 4OUKX 1CUCA 5AKJA 5ALOA 1R1DA 5LZ2A 2O2IA 1ZD4A 4C87A 2XLCA 2FJ0A 5A2GA 3JW8A 3UMJA 4BBZA 1Y7IA 5AKGA 5CT5A 3OTQA 4B82A 4HXEB 4OU5A 2XQIA 1U4NA 3R3VA 4WY5A 4HS9A 4U2FA 1LPOA 3H2KA 3WZLA 4C88A 4UHCA 1DINA 2XB6A 1QIMA 4QNNA 2JF0A 3H04A 4HAIA 1GXSA 2PVSA 5AOCA 3STXA 3VVLA 4UHHA 4EZIA 1BU8A 2Y6VA 5JADA 1BEEA 2ONCA 3VKFA 3E4DA 4X95A 1XZDA 1IZ8A 4UBOA 5ISMA 1TAHA 2ZSHA 2QXUA 2GBGA 1FJ2A 1GKLA 2HADA 4Y2QA 2XUAA 3HC7A 4FLMA 4E14A 3QMWA 1DWQA 1JMKC 1IMJA 5H3HA 5LKRA 2XMZA 4H35A 4L72A 5EI5A 4QLOA 3ESAA 1YSCA 2X76A 4Y2RA 3O4IA 5JIBA 4FFWA 4PSCA 2XDWA 3WIOA 4DM7A 5SYNA 3V1KA 5BV7A 3MUOA 1ZI9A 5AI4A 3BIWA 2JEZA 3H18A 1S8OA 2RI6A 1QFSA 3M82A 1QIFA 3DD5A 3DDUA 5DNVA 3VJMA 1DQYA 3IVMA 3TEJA 4EUSA 4AO7A 1A8SA 4N8DA 3IB3A 1PJAA 1EB8A 2DFPA 2JBWA 1FFEA 3WWCA 4H7EA 1HLGA 1B6GA 2WIDA 4QDTA 3V1LA 3G9TA 1E66A 1UOQA 4WFKA 1OILA 2OGTA 3K9BA 5DYYA 5ALPA 1CUWA 4KEAA 1VE6A 3GROA 4KE8A 2JEYA 4W1SA 3DL7A 5ALIA 4FNMA 1R4ZA 4H7KA 4MEBA 2ZYHA 4C01A 3FOBA 2GBCA 3FAKA 3STUA 3DNMA 4J0IA 2CEKA 2C4HA 2WUEA 3A2NA 3IA2A 5C81A 2G63A 4P92A 1GPNA 5E4JA 3HXKA 2AJCA 2GYWA 1CIJA 4CG1A 1QLWA 5JALA 1EA5A 3I2GA 3ZI7A 4BVKA 2VEOA 4UHFA 3FLAA 1VOTA 5LKAA 3ZWQA 2G5PA 2HA0A 1VE7A 3E3AA 3AIOA 3STTA 1GKKA 4K5QA 4FNGA 4G8DA 2QUAA 1ORVA 3DKRA 1W76A 4TPKA 1BCRA 1MN6A 2PBLA 4AN1A 3WI7A 4ROTA 1CUSA 1U8EA 1DT3A 5FKJA 4DNQA 4EA6A 1W6RA 5EFZA 2CB9A 5AJHA 4DYHA 3WJ1A 4I4CA 3H2GA 1EH5A 5CH8A 3D5EA 4E46A 3O0DA 1CQZA 2H1IA 1XZAA 5EIAA 4N5IX 4HXFB 2XQKA 1CRLA 2VSQA 3HYSA 4WFJA 2BGRA 2R11A 4BZWA 3W04A 1W1IA 5A7GA 4AN0A 3H0CA 5AK6A 1AUOA 4ZREA 1JT2A 2J4FA 1CUIA 1YS2X 1H2ZA 1K4YA 3F97A 3QPDA 4PW0A 4L9AA 3U0VA 3OC0A 2Z8XA 3PF9A 2CZQA 3C5WP 1PV1A 3VXKA 5CT8A 3WZMA 2B61A 3M83A 5JD4A 2WQZA 5FLKA 3WK4A 2HA7A 4LKOA 4EY4A 1R88A 3AZQA 3NWOA 4J7AA 1RWQA 3LLCA 2GZRA 5AM1A 3A70A 1GQSA 3FNBA 4LYDA 5E2IA 4L3WA 1JMYA 2Y2VA 2GBFA 5T4BA 3IUNA 5IH7A 1LPSA 2B9VA 1J07A 1MO2A 3NUZA 7YASA 4BE4A 4C6HA 4PSUA 1AKNA 2QXTA 2WIFA 1LBSA 4GBGA 3W2TA 5AKYA 1HKHA 4MXDA 5CBKA 1LBTA 2YXPX 3C6YA 3G0CA 2HU8A 3I2JA 4G8BA 2BUBA 1DT5A 3SX4A 5KREA 3EQ8A 2QUBA 3RK4A 4QA9A 4KAFA 5AKZA 2WILA 2GZSA 3C43A 3CCBA 2RHTA 3GA7A 1FFCA 4H18A 3D59A 4GW3A 1Q0ZA 5F4ZA 4HRXA 3I1YA 3F67A 3HJUA 1EINA 4MQLA 4QDZA 2B20A 4OYYA 4F21A 1Y7HA 1A88A 1FSSA 1DX6A 3DS8A 1R3DA 1PFQA 4UHDA 1UFOA 1H2XA 1AZWA 3AZOA 4UBKA 1DWPA 5JAUA 1QIEA 1CEXA 2OCIA 3QPAA 1GGVA 5AM2A 5JZBA 1JI3A 3V48A 4BVJA 1GPLA 1MNAA 3I1IA 3KDAA 3LIIA 2XT0A 4BCBA 2QJWA 3WYNA 2WG2A 5C8XA 3DLTA 2W6CX 3OPMA 5JYCA 4AX4A 1J2EA 5JZSA 1DU4A 2D5LA 4B80A 1K8QA 1UKBA 2PUJA 1LGYA 1LZKA 3NOXA 1KU6A 5C8ZA 3QH4A 4J03A 4ZXFA 4FKBA 3PDCA 3MUNA 5AM4A 2XMBA 1TCBA 5K3FA 2ACEA 5ALTA 2OG1A 1JJIA 2XMGA 5AI9A 1E3QA 1YCDA 4TVKA 3HSSA 4AO8A 1QIHA 1BEZA 3C6ZA 5AP9A 3R41A 5DYTA 2BAGA 2XMDA 4G4IA 3FYUC 1QONA 2NW6A 4J0GA 4BATA 4D9JA 3JYHA 2PX6A 2Z3WA 4UBJA 4DGQA 3O9VA 4B81A 2ZVDA 4U2DA 5AK5A 5AKHA 2FX5A 1EX9A 1TCAA 1CUYA 5A7HA 3BL8A 3R3YA 1GZ7A 4ARAA 4HTAA 4MQMA 3ESBA 1DTEA 5FPPA 5HQ3B 1XLWA 4H7FA 4H7HA 5FRDA 3TJMA 4EY5A 1TIBA 3FYUA 3SC2A 4LIPD 3VJKA 1LPMA 2E3JA 4QEKA 1IVYA 1QIIA 1XRRA 2OQIA 1ZICA 5JAPA 1UK8A 2VAXA 5ALXA 5HCUA 1ZI6A 1TK3A 5BWBA 1MNQA 1MT3A 1W52X 4Q05A 2R8BA 2WFLA 4YASA 3A2MA 4KR0A 3AIKA 2VF2A 3BF7A 4DMFA 4YPVA 4Y9SA 4F0JA 3DL4A 3KXPA 4GHWA 1UZAA 2XMQA 3WL5A 4GLBA 4S0XA 1O6FA 2LIPA 1MU0A 4ZI5A 5CT9A 1XZKA 4PSDA 4MEAA 4G8CA 1P0IA 1Q84A 3FYUB 5AOAA 5HF6A 2Z8ZA 3L1HA 2C5GA 1UWCA 2JGMA 4W1QA 4HVTA 2C58A 3AZPA 2XUQA 5FOQA 5AM3A 2ZJ6A 2CBGA 4DMHA 4WDRA 4WCVA 4NS4A 3E0XA 1XZEA 2QS9A 4HXGA 5IVDA 1ACLA 1JKMA 3WA7A 1MTZA 3Q0TA 4X3CA 1MJ5A 2Y6UA 2WUGA 3L1IA 4JEIA 1YR2A 5J3JA 5AI0A 4KAJA 2WIJA 5JASA 4X91A 4UHBA 4OCZA 3N2ZB 4FBMA 3C8DA 3O4GA 1XZLA 4KAAA 2HU7A 2Q0XA 5LZ9A 1DWOA 5ALZA 5DTJA 3DJYA 5DNUA 1QTIA 3Q8WA 4Q3OA 4U2GA 3R40A 4MWTA 4A5SA 4H7JA 1UK7A 5BOVA 3UUFA 5K3EA 4UFPA 4RE5A 4KE6A 1ISPA 3HI4A 3W9BA 4H7IA 4K6HA 1XZFA 1VZ2A 2PL5A 5LYYA 3H1AA 3V9AA 2WJ3A 2Z3ZA 2WHQA 1QTRA 1VZ3A 2JGFA 4B85A 1CUGA 4U2BA 2XUFA 3FWHA 2XE4A 3IUJA 4MJ3A 1ACJA 1YASA 2O7VA 1XRQA 1H2WA 2BCEA 5ALVA 3DOIA 1HPLA 4Y2XA 5IVKA 1QJ4A 4DLNA 1CUHA 3HZOA 2BGNA 4MWSA 1TKRA 1JJFA 2B4KA 2C0QA 3G9ZA 1LPAB 5A62A 4DMKA 3WK7A 5K5EA 1QE3A 3V1NA 4UBNA 3D2BA 2CMFA 2O2HA 4BTLA 5ESRA 1ODSA 1WB4A 2VT7A 4G4JA 4NVRA 2H7CA 5SYMA 1UT6A 5LZ7A 4AQDA 2EDAA 2V9ZA 1H2YA 4PQEA 5ALQA 1LNSA 4WDQA 5E4TA 4B7ZA 2P8SA 2WJ4A 1ZGCA 1Q83A 1XLVA 4OSEA 5LIPA 1T2NA 3SWWA 3QYJA 2Z5GA 1UOOA 3SK0A 2OGZA 3WKDA 1X2EA 2HA3A 1XRPA 3HABA 2XQFA 4P08A 2UZ0A 3WK6A 1WPRA 1SCQA 4ZRDA 3PFCA 1J1IA 1QO9A 4UBIA 5LZ5A 2DQZA 1RP1A 5K3DA 1HL7A 5AHXA 1CUFA 1TQHA 1WCYA 2VA9A 4BP8A 4G9GA 4BB0A 1BCSA 4FDMA 1CR6A 3WWDA 1W75A 4CG2A 2ZYSA 1USWA 1BROA 3D0KA 5KWJA 1QIGA 4ITVA 5HK8A 1CUAA 2PM8A 3KSRA 5FV4A 2OQVA 4LXHA 5IKXA 3QPCA 4J0DA 5FPQA 1XRLA 4GDMA 3N0TA 1XZMA 1XQWA 4C4XA 2WIGA 3O95A 2ES4A 1EI9A 4N5HX 3BWXA 3WWEA 3R3UA 1ETHA 4K6GA 1GQRA 2OGSA 1XZCA 3KOOA 1XRNA 4X7BA 4RNCA 5CMLA 2IX9A 1JFRA 5LZ8A 4X93A 4IHAA 3WL7A 1R50A 4OPMA 2HA2A 4GI1A 4A23A 1YA4A 4ZGBA 1H22A 4B84A 5EHXA 1UOPA 3WIBA 4HZGA 4CG3A 2HRQA 3PUHA 4YK7A 4BRSA 4BRZA 2WG0A 3WKBA 3FVRA 4Q1VA 4IH4A 1XLUA 1EHYA 4GEGA 4W1PA 2Y2UA 3FSGD 3L1JA 1K6EA 3R3ZA 1N1MA 1G42A 3C5VA 3U1TA 2AJ8A 1N5RA 1Q0RA 2WSLA 4DNPA 1KU0A 5I9IA 1W4LA 1C7JA 3C45A 1QZ3A 2OLEA 5HFAA 4J0JA 3RLIA 2XI4A 1N8SA 1NU8A 5CRIA 3WK5A 1ZOIA 2DHCA 5ALMA 1YS1X 1WPXA 4UFOA 3W9UA 4ETWA 3ANSA 1MX5A 4FFVA 1KEZA 1JU3A 1LLFA 1WB5A 2Y1KA 3G0BA 4PV7A 1AQLA 1XZHA 1EXWA 4BAGA 2WHPA 3FYTA 1EK1A 1G66A 2YASA 2V97A 3PUIA 4X90A 1VXOA 4BVLA 4C4ZA 2RAUA 3I2KA 4IH1A 3QZUA 1CVLA 4QZVA 3EIOA 3EQ7A 2GYVA 1P0PA 1XZJA 4PF1A 1XZBA 2J3QA 2BJHA 2O7RA 3BE8A 4H0CA 2ECFA 3WKEA 2QOEA 1P0MA 2XUDA 3AINA 5A7FA 3R3WA 5K3FB 3KWJA 3IIIA 1X2BA 4INZA 4X00A 3IDAA 3ICWA 1TRHA 2PUHA 4LXGA 1T4MA 2ZSIA 1I6WA 4V2IA 1SOMA 3FCXA 5T4EA 2YH2A 4Z49A 4UPDA 4BP9A 2VATA 3WLAA 3ZV7A 5ALGA 1CQWA 3H1BA 1EDDA 2WLSA 5IVIA 3IUMA 1L7QA 5ALFA 3QMVA 1WHSA 4RPCA 2QMQA 4UUQA 2WUFA 5YASA 4XVCA 1F0NA 3BJRA 4MYDA 3I28A 3LS2A 1E8DA 4K6KA 1X70A 2RGUA 5JARA 3MGAA 4X92A 5HK9A 3W06A 3C8HA 3ESDA 5CW2A 2OCLA 3HRHA 3A6ZA 2OXEA 3WL6A 4OU4A 3CXUA 3ZLUA 2H7XA 4KE9A 3DYVA 3M81A 4JYPA 2BUCA 1VA4A 1WB6A 1LPBB 1A8UA 4AB1A 4EB0A 1E89A 2J3DA 4FWBA 3DCNA 4QDXA 4PNZA 4DNFA 2GBIA 3CCCA 2PKYX 1YB7A 2XMSA 2PSEA 4BCDA 1MX9A 1NU6A 2WKWA 2XQJA 2JGJA 5ALEA 3WWPA 4Q3LA 5IVHA 3WK8A 1CUXA 4K2AA 4RGYA 4X94A 4QWWA 5EGNA 3M3DA 4F60A 3G0DA 2YYSA 5ALYA 5HKBA 3TGLA 4AMYA 1BN6A 4ZV7A 5I7UA 3GZJA 4HRYA 1IZ7A 1XKLA 4J0KA 1BRTA 4JH0A 3CN7A 3AUKA 4FMPA 1M33A 1UXOA 1JU4A 1R9NA 4Y2TA 4F5ZA 4RE6A 3H17A 4Y2JA 1A7UA 2HFJA 3D4LA 4KYVA 5HFNA 3IURA 5K3AA 1TCCA 1ODTC 4Q82A 4A16A 3I6MA 2QJRA 1XQVA 1N5MA 3H2JA 5K3BA 4NMWA 4KRXA 3STVA 4QE3A 2FJPA 4OD0A 1CV2A 4CFSA 2ZYRA 5A71A 1ORWA 1YAHA 2DHDA 4FOLA 1OXMA 4KRYA 2XUHA 4X6UA 1VJ5A 1ZJ5A 2VJDA 4GECA 5CXXA 2J4CA 5DNWA 1CUJA 3T4UA 2AJLI 4XJVA 1UK9A 3KD2A 3WQHA 4UFNA 3F98A 4UBLA 1O6GA 1LPNA 1ZIXA 2HL6A 2I78A 4BDTA 2HFKA 2H7YA 3KWFA 3D3NA 1E8NA 2BKLA 4JUIA 3AFIA 5LP1A 4LHEA 1AGYA 5FDFA 1VKHA 3QBJA 1THGA 4NZZA 1XQYA 3BF8A 4BC1A 1SCIA 3WK9A 4BC0A 3RM3A 2XUJA 2HA4A 2CKMA 1F6WA 4I3FA 5HF9A 2QT9A 2PSHA 4Q34A 3RARA 4P93A 4TGLA 3HACA 1P0QA 4FLEA 4Q3KA 5DLPA 1QIJA 4Y2PA 4J0HA 3H2HA 4IQ4A 2WIKA 3PF8A 2VAVA 1EB9A 1MAAA 2O2GA 5D7BA 1CUUA 4O08A 5DYWA 4ZWNA 4B6GA 3ZLTA 2K2QB 3WWOA 1K5PA 4B9EA 2VTVA 3G02A 3BIXA 3CN9A 3IUQA 1OCEA 2C7BA 4AXBA 4EY7A 2AJBA 2XLBA 2WUDA 3O4HA 3I2HA 1NX9A 1L7RA 2PPLA 2WG1A 4Y2YA 5C8VA 5C7YA 3WKAA 1JJBA 2OAGA 4OYLA 1IUOA 3STYA 4B0PA 1QO7A 3VVMA 1GT6A 4OB7A 5DTIA 3DEAA 4U2CA 4BZZA 4DSAA 5AIAA 4AO6A 1QOZA 1ZGBA 1SFRA 2D0DA 3VJLA 3FSGA 2BUAA 3WA6A 3WMRA 4AZ3A 4I19A 2BFNA 2DR0A 3PI6A 4EY6A 4DSZA 1VXRA 2X5XA 3C87A 1CUZA 4QDUA 3D2AA 4BTVA 1U2EA 3S8YA 2VT6A 5HF8A 4DTCA 2XMCA 5JZ9A 1CFJA 2VJAA 5ALRA 5DJ5A 3S2ZA 5EHNA 3F9CA 2QTBA 2WTMA 3PFBA 1SC9A 1XZGA 1DQZA 2JGLA 3RKSA 5HQ3A 1Y37A 3BXPA 4B0OA 4BE9A 2ZJ7A 1WHTA 2VJCA 1QGED 4QWMA 5EHQA 4G1FA 2ORYA 1EDEA 1ODCA 3NGMA 3OG9A 4G4GA 3X3HA 5CH3A 2XUIA 2FUKA 5DWDA 2DQYA 2DSNA 4CCYA 3D2CA 1BE0A 5ALKA 1LZLA 1L7AA 2PSJA 3BDIA 5AKXA 4XWGA 4G9EA 3R3XA 1HDEA 5CTAA 3WYDA 2HA6A 5AI5A 2ZJFA 4X6YA 5AM5A 4C89A 1BS9A 1UKAA 4KACA 1CUVA 4H77A 1J06A 4E15A 2G4LA 1QFMA 3IULA 1AMNA 1THTA 2HHAA 5CXUA 2I3DA 3QVMA 3AILA 4JYMA 3G0IA 3FCYA 4BDSA 1EVQA 4MYSA 4GWLA 1CPYA 3HLKA 1GPKA 2G5TA 1IUNA 4W1RA 1LPPA 2QM0A 2ZYIA 1EVEA 2EDCA 1XFDA 3JWEA 4IH9A 3HEAA 4Y7DA 5CURA 3EBLA 6YASA 4GXNA 4CCYB 1B41A 5AI6A 3I2FA 4EHBA 5HF5A 5HZGA 2I03A 4XX1A 2XQGA 4J3JA 3PICA 1YA8A 4XIIA 3F8SA 1SCKA 1ZIYA 5EIHA 3PE6A 5ALUA 3ILSA 1G5FA 5CH5A 3OM8A 3B12A 2OPHA 4X85A 2QZPA 2AJDA 4M0FA 1H23A 4J0CA 3WL8A 5AI8A 5FXMA 4N8SA 5JANA 4M0MA 5BWCA 2HRRA 4N8EA 1D07A 3WJ2A 4BCCA 3K2IA 4E11A 2XUPA 2PSFA 1AX9A 1ZD3A 3R0VA 1YAJA 3YASA 5EHZA 3V1MA 5E4YA 2V96A 5KWIA 1QIKA 4FTWA 1FFBA 2WU4A 3O9MA 5ALSA 1MPXA 4WJLA 1BN7A 5ALDA 4FHZA 4JNCA 5AIBA 4AMZA 3FLEA 1MX1A 2DCMA 1WM1A 3FBWA 4FLFA 1F0PA 1XRMA 2QVBA 3AIMA 3FVTA 3GUUA 1E8MA 1HBJA 3QM1A 2RONA 2XUKA 3H19A 3GELA 1ZI8A 2RHWA 3WKCA 2OCGA 1F8UA 4QDOA 3W05A 5AICA 4ZV9A 1ZD5A 5JD5A 1C7IA 3O4JA 4W63A 2JGKA 3C6BA 4G5XA 5HKAA 5AH0A 1EDBA 5AKLA 5LZ4A 4PO3X 4YX9A 2WTNA 2PU7A 5CT4A 5KBYA 3DYIA 3P2MA 3I6ZA 4EY8A 2I3ZA 1FFDA 3E1GA 1A8QA 3LP5A 1YB6A 4UBMA 1IUPA 1G4HA 3STWA 1AURA 2V98A 1CUEA 2X8BA 5JAOA 2H9YA 4P9NA 2WFMA 1CUDA 4OB6A 1XZIA 2JGIA 2GYUA 1R9MA 3DKKA 4L0CA 5AKIA 2QR5A 2XUGA 5ALNA 2XMRA 3BDVA 5AKKA 4WFIA 3I6YA 3QMMA 3GFFA 5AOBA 4OB8A 4LYEA 1DX4A 2HDWA 4CI9A 4BAUA 4X6XA 1XROA 2HU5A 2QKYA 3UUEA 2HIHA 3G7NA 3K6KA 2PSDA 2RIPA 3GBSA 1AC5A 2XUOA 3ICVA 2AXEA 3G8YA 3ZPXA 3DOHA 5K3CA 4U2EA 3G0GA 1UK6A 1U65A 3ANTA 3EF3A 1XQXA 3LIPA 5AK4A 5CT6A 1UKCA 5D6OA 3IBTA 2WHPB 2EEPA 4X71A 3I2IA 1RYYA 2CUTA 2VJBA 1E5TA 5ALWA 1CUBA 2IIVA 4UHEA 5A6VA 2WJ6A 1Z68A 4DIUA 4DNOA 1ZJ4A 4Y2VA 3OURA 2CJPA 1MAHA 4H7DA 4CIBA 3MVEA 4X97A 3VISA 1XKTA 4CCWA 4WY8A 2OCKA 5AK3A 5AM0A 1QIDA 1FFAA 2DHEA 3G9UA 5D3ZA 5D3KA 4W9RA 2HA5A 3DQZA 4Y2UA 1ZD2P 4BAZA 4B83A 5AKEA 3TRDA 4CIAA 1WOMA 3BJMA 2IITA 4FBLA 2ROQA 4C4YA 5JAHA 5EIEA 5ALLA 4IO0A 5T4HA 3EQ9A 4B9AA 2QRUA 1CLEA 3F96A 1K63A 2ACKA 3B5EA 4KE7A 3LCRA 4BYMA 2WHRA 5JD6A 2C5FA 4KJXA 4QLAA 5LLSA
chains in the Genus database with same CATH superfamily
2WNSA 5ALJA 4DMLA 3R75A 4DQ0A 1XNHA 1ZD9A 3O31A 1ZH0A 4EBBA 3U3JA 3FRHA 3OUZA 3ASUA 4Q0MA 4CMBA 4CMEC 5JH7F 2RGDA 1EK2A 2X15A 1T0HB 3ESCA 4O4HB 3SX0A 1NW7A 2QTGA 3QBEA 3PFGA 4KRGA 4B7CA 3MQ4A 3OOSA 2P7IA 5TC4A 3NNDA 1VLQA 3I4FA 5AW8A 2JLUA 4GP6A 4B33A 4MO2A 4WJKB 4XRGA 2OAEA 4YIKA 4FFNA 4L9RA 4PZUA 1T5SA 3IH5A 3GRFA 2YHUA 3A9VA 4FILA 3SYTA 1I7PA 1LV8A 5BT9A 2MSKA 1ICIA 5CA1F 4NZNA 4TLLB 3MJCA 4ZU3A 1FFGA 2C1EA 1R0XA 3EAFA 2QPAA 5F5XA 5K3OA 2YUIA 4B35A 1QFYA 2BFDB 5KVQA 4O29A 3ADCA 1VA5A 5K8LA 1JAZA 2YV5A 2Z43A 2JZCA 4XDGA 2MOKA 3EN0A 4GYKA 1C7EA 2QJFA 2I5PO 1C0KA 2CYAA 2Z2JA 1KI6B 4L5IA 4N39A 3VDXA 4AMGA 4PO1A 4M46A 4ZO7A 5DN9A 1SH7A 4OKNA 1YRLA 5AJZA 2OMKA 1K8YB 1TM5E 4S0ZA 1RHRA 1CULC 2WFLB 5FBVB 1P4SA 4F7WA 3ID6C 2C4NA 3D7RA 2BVNA 3OE7D 1KAGA 1SIBE 1EFVB 4LYFA 1XXHE 3CH4B 3I8OA 1GL3A 4C21A 1CUCA 3AI1A 2O2EA 5AKJA 1TA0A 2EBUA 3S1AB 3GLGE 4JP1A 1OREA 3LWDA 4NFHA 4Z2AA 5LZ2A 2JVJA 2DPYA 3IQHX 4RY8A 3ZJ5A 3WJAA 1NNSA 3LLSA 2W2NA 2AOUB 4HVAA 2FMFA 2DRIA 3FPLA 4KQ9A 5DHRA 2WPDA 2P1DA 3IXMA 4U1RA 2XLCA 4Q1BA 4WZ6A 4D43A 1Z22A 1KOLA 3PSAA 1EK5A 1Z5VA 3K1AB 1U0TA 4JAVC 4LZOA 5EESA 4BBZA 4DA7A 1X8LA 2ZJBA 1P18A 3P2JA 2DM6A 4OU5A 1B6TA 4AD8A 2V6BA 1Z6YA 4ENPA 2B3TA 2FVYA 4K05A 4GG1A 5FTKA 3E8XA 2C07A 3TZBA 5IABA 4BMZA 1RWMA 3E7FA 3JD0A 1VJ1A 3PITA 4MDFA 1FCJA 1DQNA 2GXQA 2QLTA 2Z95A 1W46A 3B6IA 2FZLA 4I4LA 1LPOA 1TD9A 4I8XA 3WZLA 2ZI3A 1NSYA 5A02A 1MJFA 4L4RA 3HUEA 4X66B 3PR2B 4M7RA 4CKZA 3I01A 4YQFA 3H04A 3WLOA 3KZNA 3FKQA 1R6DA 2Q1XA 2IELA 2JJ1A 2QRVA 1P2FA 2ZK7A 1U8YA 4JT4A 4K0RA 4RX1A 4AUMA 3P2YA 1UOEA 4G1CA 1WDWB 3JD1A 3TOZA 1NW6A 3QGMA 5DSZA 1K6JA 3V2UA 1ECPA 4NMXB 4TROA 4KLCA 3MWLA 1B2LA 2D1QA 4RJTA 4QUHA 2GZ3A 3HGTA 3I9KA 5HIAA 2IYFA 4IP0A 2H31A 3E18A 1M8PA 2CVQA 1G8KA 2E6UX 2QRQA 5H0IA 1DPGA 1UBTS 2GASA 3JYQA 2F3TA 4X95A 1XZDA 2X4LA 1SVSA 3EIWA 3DDZX 3KQTA 4UBOA 2R6R1 5HW0A 1SUCA 3QVTA 1QH1B 1X3SA 1QGUA 3IHWA 2QRPA 2X13A 1CY8A 4ZC8A 5E1DA 1FJ2A 1LBIA 3ZBQA 5LP6F 4RKFA 1DKOA 1I5RA 4Y2QA 3X1YA 1MW8X 2PS9A 1BVUA 5IXYA 4MNTA 1E5DA 4FYMA 2B6HA 4M0DA 2P9JA 2VPTA 1F3LA 4FLMA 3LHDA 4IM7A 4E14A 2EFHB 1JIJA 1DAHA 3VKUA 2C96A 4HO1X 3TPCA 3R8FA 1JMKC 5EXEA 1IMJA 4QOEA 2XCLA 2JDIA 2XMZA 3IUBA 3OFSA 2RBKA 5FYDA 4M9CA 2BFBB 2YYYA 4PPYA 1M67A 2J5QA 3CNLA 3PC6A 1P9WA 2Q2VA 3QF4A 2EF1A 2FN7A 3AR8A 5KQSA 4IGIA 5SZHB 2X41A 3ENKA 1RKVA 5HDQA 1BX0A 4B73A 2XDWA 3C6MA 4LJSA 4PGGA 3AETA 5G4KB 4JR2A 3N2NA 4EKNB 5BV7A 5LLTA 2VK2A 5AW7A 2GM9A 2BEVA 4EQ6B 3LVRE 5KO2A 1W0KA 1EM6A 3QBTA 1EQUA 4YV7A 5IEBA 1GRRA 3DDUA 2ZUSA 3HHEA 4GPZA 4J16C 5E7JA 1DQYA 1JKIA 1UWKA 3LL4A 3P2EA 1G4UR 2DJ5A 3LSTA 2RKWA 1ZH8A 3KQVA 3UB2A 2J3KA 5HM8A 1MFPA 1V8DA 1FDRA 2CY0A 4W7SA 3G2QA 3KJXA 1JPVA 1V1MA 4DF3A 2XNDD 3JTMA 3FZNA 4HFJA 3GZNA 2DFPA 1F6BA 1D4FA 1NP7A 1OT3A 2JBWA 1QYCA 1NXQA 3BTVA 3BYZA 4IDGA 2DC1A 4KDEA 4QVIA 3ZGNA 3ZVNA 4PIVA 3HCRA 1BHO1 1OGJA 1ORDA 1GNTA 4K9LA 3HU3A 1QR6A 3G9TA 4A8JC 3Q3EA 3NRJA 5L9AA 2AUTA 3MD9A 1RRGA 4HEA6 1RJEA 5JT1A 4WFKA 1BX1A 4MHOA 3LA6A 4JKYA 4OXQA 2BFDA 1L8QA 4G0QA 3NAQA 4RHEA 1G5HA 1COWA 1DJQA 4L74A 1OILA 4O0LA 5KDOA 3K9BA 1YC5A 5DGTA 5CB6A 3LNCA 4RVFA 1U8XX 3GROA 2C3OA 3OJXA 1WD7A 4KV9A 1S2OA 2BOVA 2DUNA 3GFOA 3OZCA 3L1KA 2EGUA 1DO0A 1Q11A 1TM4E 2C4WA 3DL7A 4B8WA 2GRUA 4BQRA 2ZQ5A 4MPDA 4C0SA 3IEUA 3TZKA 3FI9A 1W44A 4HWRA 3HCBA 4LE0A 5TNXA 2R8OA 3DR5A 4ZAZA 4Q1FA 4C43A 3RANA 5JE8A 1IJKA 1U4SA 5HTOA 4DDVA 4XQ0A 5DZSA 2FPXA 2PL3A 1YB4A 2OZKA 2GBCA 2IIQA 2XOKA 1LFDB 4HFRA 4XGKA 4Y0NA 4QTYA 3I4LA 1JR6A 3DH0A 4GIBA 1IEXA 4Q6BA 3T15A 4LSGA 1EDZA 5L4SA 2G5CA 1L1FA 4LBZA 4MOWA 1NSTA 1RXVA 3GCDA 3NH6A 4PFKA 4MWGA 2J8ZA 4UE6A 1DZIA 3TIIA 5BW6B 2B25A 1PJLA 4L0MA 3VTKA 2ZRBA 3W6ZA 1CIJA 4UUBA 2GD2A 5CLHA 1XZ8A 4PAQA 2IYYA 1Q19A 4I46A 4A10A 2AKEA 1QLWA 4DA8A 2C3YA 4J94A 1HRKA 3VR4H 1D8AA 1Q17A 2O20A 1I7QB 3TQOA 5JRDS 5IYZF 3THRA 2QSUA 3QU4A 2VEOA 3KJHA 4XQCA 1VOTA 5IT0A 2FN4A 3EW9A 2BE9A 4BEJA 4YUWA 4BNKA 2IWRA 3OQBA 4ND8B 2J67A 5CYPA 1CCWA 2G5PA 3BGSA 3TCKA 3E3AA 4EFMA 3STTA 2MMCA 4PZAA 4FHFA 1J42A 2GESA 2FPGB 4M55A 1DG1G 1IY8A 2VHXA 4K5QA 4EUKA 2C3PA 4UM8B 3WL3A 5AK0A 3WGVA 3NFRA 3KPUA 3JZIA 1DAIA 3O3NB 2F90A 5JRJA 1ONBA 1P39A 4XR4A 2A92A 1PYGA 4PCUA 2DWCA 1A5BB 1IXKA 1N2EA 3EZGA 1QDLB 2OKCA 5CIYA 4K81B 1V7CA 1OXBB 2XDQB 3N2EA 1YV9A 1UT8A 2PBLA 13PKA 2OCAA 3AW8A 3B1KA 1GUZA 3HL4A 2AOVA 4DPKA 3W4JA 4WXRA 1CJSA 1DLJA 1MG0A 4RUKA 2H00A 2DWOA 5M04A 4NR0A 2Z2IA 4C14A 3RU2A 2UZ4A 1QYRA 4TMWA 3F73A 2AMYA 5CEEA 2YR0A 5LN1A 1GRVA 1M3SA 1EHIA 1ZDMA 1F4VA 3CVJA 1YNOA 3KL4A 4FMCF 4E46A 3W5CA 4DC0A 1PD1A 4EA9A 3OE1A 4L5YA 3K1JA 3WBKA 2RGXA 2WF8A 6ADHA 1ABEA 1E1QD 1ATZA 1QB7A 1WMFA 4BGUA 3C6KA 3CHYA 1Z0JA 4O1HA 5FD8A 4MTCA 3MAAC 4JKIA 1VYUA 3SBEA 1UQUA 4MDHA 1JG2A 1NY5A 5I01A 2CGEA 1FP6A 1DSSG 2J07A 4R69A 3W04A 3WOHA 2OO7A 1AK1A 5A7GA 2HTEA 3H0CA 1CQIA 5AK6A 3JZDA 3DE5X 4ZREA 3AETB 1JT2A 3PS9A 2DFVA 4JI0B 3U17A 1EE9A 4J2HA 3BMNB 1RZVA 4LGVA 2CFOA 2R00C 2VKQA 1MC1A 4K88A 4UUMA 1MHPA 4TTAA 4PW0A 4DG5A 4LCJA 5TQ0A 5MN6A 4MROA 1E7SA 1HDXA 1VIYA 2Z8XA 4CTKA 5KOYA 2V1XA 3NLLA 3EPHA 1UDAA 2QIPA 3WAKA 2CZQA 3C5WP 2HI0A 1YQTA 5EUBA 4PG8A 1PV1A 5CPFA 1C9DB 2CXQA 2V8BA 1Z0DA 1N77A 2CJXA 4QGAA 4HUQA 3F8WA 4IL5A 4JC5A 1YQUA 3M83A 4M6WB 4R8SA 4CV3A 3JTEA 1QVVA 4H35A 4DDWA 5BPFA 5KQRA 5B2ZA 1P73A 3JR7A 4LUCA 5FPSA 1FRVA 1R88A 1SG0A 5HIIA 4ER6A 3KOYA 4EARA 3O47A 4HQNA 4QBTA 2NTJA 4G25A 1U9YA 1R6XA 3I6BA 2GZRA 3II6X 4JLVA 2XTAA 3B2NA 5AM1A 2UZ1B 1GA6A 2O1XA 3PU6A 3LKZA 4F3CA 5E2IA 2RK6A 2O8CB 2FX3A 3IKMB 3PX7A 1JMYA 3T52A 3KYDA 2PGDA 4O0MA 3FPKA 2PA0A 1QX3A 2CLSA 5T4BA 2BDUA 2FRDC 1WXHA 3OWXA 4FFMA 2QLBA 1EFVA 1SBTA 3EOBI 1UFVA 4WKNA 4BE4A 4UOZA 3GFSA 4GL4A 1AKNA 1X1SA 2P11A 2QXTA 1ENOA 1EUCB 5CBPA 1LBSA 3BA6A 4BO7A 1KFBB 3B9PA 3NXKA 1IM5A 2HMAA 3LPMA 4CL2A 3OZDA 3BGIA 4ZCTA 1ZAKA 3PC7A 1GR0A 1JTEA 1LFAA 1M0SA 4KGXA 1VJCA 4DLXA 2DFLA 3ZVRA 2YXPX 5LQRA 4JI8B 4FDTA 4G8BA 5E38A 1KFCB 2ONKA 4HDRA 1DPFA 1JLSA 1GWNA 4M9UA 4Q7EA 3IDZA 3FZYA 3KEQA 4DSOA 3EQ8A 3H2YA 2EBHX 2GKGA 3HP7A 4QA9A 3RADC 1HM5A 1UBLS 2WILA 1CJUC 1THMA 1LSJA 2HLDA 4YXFA 5J5CA 4A7PA 4CN9A 3G2PA 3BT7A 2C57A 2BE7A 3V7WA 3PQDA 4H3SA 5TV2A 3GY0A 4C6TB 2FDRA 2XVAA 3AHGA 2X0FA 2YHAA 4OHWA 5CX1A 3D59A 1Z4OA 3VSEA 4EMUA 1ZK2A 4Q9AA 4UEQA 2FZEA 4UU1A 1DX9A 2CFCA 1VIDA 4HRXA 4YRIA 1PAUA 4LK2A 3ZGLA 1XAHA 4JKOA 1BH6A 3OM1A 3K9LA 2JVIA 4BVBA 1MOSA 1YGYA 1ZVKA 5IJZA 1ZR4A 2YY6A 3HJUA 1GGEA 2GF2A 1FFWA 1ISSA 1RLUA 2GN9A 2VDJA 4Y9TA 4QDZA 3ZG6A 1IU9A 1JWLA 1A88A 2QRVB 3DOCA 2PUVA 4R71A 4PYJA 1NLMA 1HE8B 2II6A 1V11B 3TI9A 3K35A 2CXTA 5DFAA 4YAWA 1NGSA 4WOKA 4HNQA 3UV6A 3Q8KA 1YDFA 1TZMA 4C7OA 4S1PA 2BEJA 4B7XA 2IS6A 1AZWA 1VKNA 4M86A 3JR3A 3AZOA 4UBKA 1N5LA 1DWPA 1NJGA 3EWNA 5JAUA 5KNDD 1RPNA 1PVOA 3GJTA 4H0FA 1Z6QA 1KAHA 4QYWA 1JEAA 1DC8A 3DLIA 3TNLA 1QQTA 5M29A 5JQGF 1CP3A 1PRYA 1Z06A 2JCSA 3RODA 5L7TA 5B3JC 4V0NA 5T3YA 2CCKA 1T8SA 2JH8A 3I30X 3P52A 1DBSA 2X0IA 4UD2A 4YDQA 4CXMA 3OKCA 3KDAA 4AS1A 4NFSA 4BCBA 4GSKA 4RZQA 3CX6A 5TPWB 5DM1A 3NDPA 4R2IA 4LAFA 2BR4A 4G81A 1Z4MA 3PDJA 1E2FA 4IZOA 3V8VA 3C8UA 1TYBE 4P81A 4MV0A 1XWWA 3DLTA 3OPMA 1GAXA 2V58A 4RD1A 4NSNA 2J31A 4QU5A 4V03A 1J2EA 1RYBA 2ZUUA 1SBIA 2CVPA 2JIQA 4G84A 4AX4A 1DU4A 4EG6A 5JZSA 3W4IA 4ZI3A 5A4JA 2Y67A 4Q16A 3JVUA 1LGYA 1C3OB 3GN2A 2QX6A 3QHQA 4KLZA 4QXPA 1Z34A 2JFBA 4NNOA 1KU6A 3R6LA 2RI1A 4R41A 4FCCA 1O8BA 2X7JA 4J03A 1TQ6A 3W5DA 2XDYA 1H2FA 3AV0B 3OD1A 3DBOB 2WMDA 2ORIA 4LZNA 4QNRA 3RUEA 3ZDXB 4FKBA 3W2HA 2BEVB 3PDCA 1E3DA 4RMGA 4V38A 3LSYA 3SZUA 3M2TA 2E4UA 2YZKA 2JHPA 4NWIA 2ACEA 4B74A 2ILTA 4UUOA 1LRJA 3GB9A 3KZOA 2EL7A 1PQYA 3I52A 5IAOA 1DADA 5BORA 3QF4B 2HNAA 1JJIA 2OWDA 3I4CA 3Q9LA 4R51A 4KPUA 1EFLA 3NIDB 3EXFB 5ESDA 1NUHA 1CZHA 2NU6A 3TZ6A 1NVGA 3QPVA 3ZX4A 1FNNA 1E3QA 3QVJA 1Z63A 2Q2NA 1QO0A 5DV9A 4Q21A 5DYIA 3WLLA 1DQRA 4TVKA 4UAUA 3U48A 2J3EA 4E2YA 3QYAA 3HSSA 4WZZA 3OCYA 4IHJF 1QU2A 4O5OA 4LMBA 1VC2A 1UP7A 4PQRA 1E9AA 4J4BA 1NT4A 4YQEA 1BEZA 4PCVA 1HURA 3ZWYA 4NFLA 1BYIA 1ZA1A 3RHTA 4N3AA 1J2TA 1SU8A 4L7VA 4OHUA 3FWKA 1TUBB 5EQFA 5DYTA 1T9DA 2E48A 1STOA 1H3FA 2GZ1A 2JASA 3WTBA 4RK4A 2FP4A 1U8CB 3VKVA 5JHGB 3UC9A 2IXFA 4A26A 3A14A 3THYA 3I73A 2XE7A 2C9OA 2G9RA 3IBFA 2ZU6A 4ZEVA 5LQCA 2XJ4A 3F3YA 3DONA 2GN0A 4L6IA 5CA1A 2AN3A 4FI3F 4QUIA 3T1NA 5CCXA 2OBXA 3TBFA 3D8UA 2BHRA 3OFKA 4ZYWA 5BN3A 2BDEA 2ODBA 4RKYA 1L3IA 2QSJA 3DCJA 4YJ3F 4YMUA 4RPLA 3DZCA 1W5TA 2EF0A 2PMFA 1M6YA 3BE4A 3K7EA 1L5SA 4D98A 4JQSA 1AQ6A 3VR5D 4FEGA 2UU9B 3AB8A 3GIDA 4G5FA 3O9VA 1Z0KA 4WEOA 3UHOA 1A4XA 4B81A 1KO7A 2ZVDA 3L9WA 4ZK6A 5AVVA 1MHTA 4D26A 2CNLA 1V3UA 4U2DA 5AKHA 3JQ6A 3RQIA 3QQPA 1WAMA 1QNLA 4K0KB 1MP0A 2OBNA 1JEYB 1GL7A 2FY8A 3OCXA 2BI4A 2LKDA 1PR6A 1TXGA 4G24A 3LHSA 1UBRS 5AWFC 5BN5B 5KNLA 3PJGA 3REQA 4OGGA 4F72A 3RTEA 5CLJA 3TW4A 4G0PA 4JBHA 5KTNA 4UM7A 2XHZA 4MQMA 3X1ZA 2V9CA 5EHIA 5B6PA 2A1UA 3TZQA 3NTXA 3T7JA 4TKVA 2X86A 2D59A 1A2KC 1ORHA 2VNAA 4H7FA 4H7HA 2HUPA 2GF0A 1JIQA 3LJKA 1VPDA 4MYTA 4G0VA 4YFYA 5K6RA 1MQAA 5CX1B 2AQ8A 3D7MA 3P0IA 4LIPD 1BJKA 5EJFA 3ZDDA 4IV8A 2E3JA 1X38A 1QIIA 1ZRNA 1Y1RA 2B0JA 4K9KA 5IWCA 4MRAA 3RJTA 1DBIA 2OD9A 1R15A 1XEFA 2V5AA 2YMLA 4FOSA 2CT8A 3CUVA 4KXLA 5JSZA 2XRYA 5HCUA 1ZI6A 2HNKA 3PRYA 4Z53A 5BWBA 1MNQA 1BC5A 3ICEA 3EMDA 3QKTA 2SCUA 4BFXA 2ZSAA 4PG7A 1EP2B 4QAJA 4JU8A 2BMVA 5FB3A 4W5WA 1FUUA 2QW8A 1DJNA 4EYEA 4HH0A 5HS6A 1A9XA 1YI1A 1U8FO 4RVHA 3HJFA 2AI1A 3A2MA 4JOCA 5HHTA 2JAQA 3Q7QA 5EPEA 1HSOA 1YUNA 1WE2A 2ZYVX 4REOA 3B52X 1MOZA 4XLTA 4YLYA 5A1JA 4ACAA 2JAPA 4TXJA 3ZHVA 3DL4A 4F1WA 5K51A 5GY7A 3UMGA 4C03A 4GHWA 1UZAA 1WU8A 2YJ6A 1P77A 1HRDA 1DFHA 3QE2A 2E89A 1L3CA 3JVIA 2ZAMA 3DHVA 3EGXA 3NHJA 4LVOA 3NC1C 1D7OA 4FGWA 4F45A 5DP1A 3DWIA 2QSYA 3BIFA 4QPPA 2HGZA 4W7HA 4U8GA 3WL5A 2IYXA 3O3CA 4JJZA 4S0XA 1BSVA 1QZXA 3UW3A 3ZE8A 2CCJA 2QDKA 4B79A 5BWOA 1KY5A 3GCXA 4D8XA 4YP7A 2GN4A 1A8HA 1EIZA 2C4TA 5CT9A 3RYHA 3ZQJA 2AMJA 4PSDA 2ZCJA 3GLIA 2Y0DA 4MEAA 1L3BA 4HPWA 3GLIE 2Z4TA 1ONPA 3FYUB 4JJ6A 2FN9A 4POAA 5EE3A 2IF0A 1JQDA 5HF6A 2Z8ZA 1F51E 2V7XA 4QPCA 3PGKA 3ZWVA 4YV2A 3T34A 1E5VA 1TPYA 3KVOA 3NEJA 2Z3VA 2GCGA 1SUAA 3NEAA 3QX3A 3KKKA 2BSXA 5J4VA 1Z7YA 2JATA 4LE2A 1XELA 4OA5A 1KMCA 2PGAA 3BK1A 1U7TA 4NZPA 1C14A 4Q4AB 3IL2A 1UXIA 2QVYX 4DJEC 4KNWA 2ZJ6A 2Q3EA 3T3PB 2CHGA 1DTWA 3LLVA 3K9GA 4WDRA 5J2UF 3WRYC 5EP3A 3LVQE 1H2EA 4UM5A 3L8GA 4LY3A 3R20A 3T9FA 1KK2A 4NS4A 3HM2A 3TSAA 5JYDA 2Z9DA 4HXGA 3V4OA 5IVDA 1FNBA 4AMBA 1G5IA 3C1AA 3RSGA 4LWZA 4DLYA 1QVAA 1GDDA 3IO3A 1MTZA 3IAEA 4NCHA 3GVCA 5H81A 2FE1A 1QV7A 3AK4A 1O57A 4N40A 3OMLA 4JEIA 4WZBE 1WY7A 3QTBA 3UTDA 4UD6A 1UEIA 1ONOA 1WV0A 3QVVA 3TRKA 2OHVA 1FDSA 2C2OA 4KAJA 1NN1A 3RVQA 3EXIB 2LD4A 4IKPA 2X9GA 4X0EA 4KYUA 3QOFA 4K3UA 2G67A 4XD2A 3MT7A 1I2CA 4FBMA 4MVJI 2DGDA 4CCSA 4ZO4A 5F1OA 3TD6A 1F06A 3LRPA 1EMDA 4Q3CA 3DD1A 1Y1TA 3QKWA 1A1VA 3PPYA 2AFHB 4PGAA 4TS3A 5FCDA 4X54A 5DISB 1RXEA 2E9SA 1IBLB 2BFCA 4A4DA 1RMQA 2HWUA 3L43A 4PIMA 5BR8B 5LZ9A 4N48A 5JCJA 1D1PA 3DAPA 3DJYA 3T3GA 4HNTA 3LF1A 4MS4B 4BN0A 1HYQA 1K9SA 1UEXC 1Q14A 2VUIB 3MCAA 3B1XA 3AEYA 4GPTA 3WE7A 3R40A 3U19A 2D3TA 2NN3C 3H6HA 2WSBA 5JQGA 3QXHA 1Q0PA 3KEFA 1KPHA 2NSLA 4B8ZA 4KWEA 1QRUA 2GZHA 1A9RA 3HDYA 4XB2A 3TRFA 1H6CA 1KR5A 4H6WA 1JIKA 3FIJA 5JZOA 1Z7WA 4KQ6A 3D6VA 3I64A 3UJCA 1KJNA 2A5DA 1BNCA 1LJLA 2ZZKA 3N0VA 2ZDQA 3GMSA 1XMXA 3H05A 1WJGA 1XZFA 4JJ8A 2FEAA 3W2FA 2GAOA 1EUDA 5DVZA 1P6UA 4IJVA 1GAWA 1MD9A 1IZYA 3TZHA 4WKOA 1XXHA 1DBQA 2JI7A 3CUKA 3KYJB 1AOXA 3HKEB 4O4LB 2AL7A 3EXHA 3KKOA 5J4YA 4BNWA 1DZ3A 1YDMA 3IPXA 4IIFA 5KYXA 4G63A 3TW8A 1TOAA 4UCXA 1RKUA 4JD5A 4JJIA 1T9AA 1NR7A 1QTRA 1VZ3A 2D5CA 3NIBA 2QP9X 1OSNA 3QFRA 4Y9DA 3WSTA 4CG0A 2VHZA 3DMYA 4NBUA 4U2BA 2CLKB 4R0NA 4KRFA 1T5OA 1UJBA 2XUFA 1JUDA 3Q85A 4KFCA 2B82A 1T24A 1QQ6A 1U9JA 5CM2Z 3TQIA 3NWBA 3U44B 1NQXA 1ZW1A 2EW8A 5EKSA 4A91A 1U3UA 1X1BA 2Q7OE 1EEHA 5ITVA 2ZJ4A 1E79D 1I80A 5BSWA 3AHHA 3CZ4A 2O7VA 3GLKA 5HUJA 4XSHA 2P40A 3PXUA 1WX1A 4HQRA 2A78A 4PHCA 1FP4A 3EFEA 1O6BA 2RSLA 2FPMA 5ALVA 2VPIA 4I50B 1MJGM 1F1JA 1HPLA 2R7MA 3E84A 3TUJC 1HE3A 3ZHZA 5DM70 5IVKA 4J1SA 4QUDA 3OY2A 4MV6A 3KCNA 1XV5A 4MKZA 5I47A 3SPXA 3Q72A 2K2WA 3QG5A 1QJ4A 5L3ZA 3VKGA 2J0QA 3UCEA 1ZU5A 4Q3AA 3SAJA 3SE7A 1ZISA 3P45A 3ZNOA 2NSDA 4BX9A 1VL0A 1R3UA 5FR2A 4MUBA 2XXAB 3GGGA 3O1JC 2PFSA 1WDMA 1ZNXA 2Y1FA 1T2FA 4YRRA 4N4AA 2YCLA 2TECE 4LOHA 2HDHA 3RUFA 1CRZA 4MR9B 1HSZA 1PX2A 5TPWA 1FB5A 2ZBRA 1FUKA 2JGDB 3NALA 3V1NA 5DIFA 1VCHA 2EWVA 3RRNA 2F8LA 5HE9A 5C32A 1HNZB 3QXCA 5EYPA 1SRQA 2Y4NA 3I45A 3LZ6A 3CRQA 3D2BA 4DG9A 4M0CA 4ZJUA 1LDGA 2G17A 1I0IA 2Y93A 2ZETA 2GEUA 3CB4A 1USIA 4PAMA 3BHJA 1KE1A 3WFZA 1WB4A 3OHPA 3LPNA 1M0EA 4G4JA 5SYMA 3UXMA 4LDNA 2J0EA 3EUAA 5DBHX 4ZJPA 3G13A 1OWLA 4NPAA 4RSRA 5IM4A 1M1YA 2R751 3H8VA 5BSGA 1J5EB 4OVKA 1NLFA 1KQOA 1C3JA 4WDQA 1R66A 4KDFA 4RU1A 4PC2A 1C1XB 1RAFA 4CT0A 1WF3A 5THQA 3VYUB 4BNIA 4YJHA 4FZ5A 1DXYA 5B6IA 2F55A 4MTLA 1RM3A 2FEPA 1HT0A 2YMPA 3P0JA 3WADA 4Z9FA 4L8LA 3SWWA 4OX9B 5JJKA 2PRSA 2JLWA 2BDTA 2VZEA 2Z5GA 3DE1X 1B76A 2CLOB 2VH5R 1JR4A 4J4TA 2CKDA 2HSZA 1N7JA 2H8GA 1ZJ6A 4R5MA 2ZQZA 5FHRA 2WJWA 2OGZA 3O21A 4PXSA 2ZCVA 1JECA 4MAMA 3HJGA 1T0JB 3UH1A 4P08A 4A0GA 1EFAA 2R8EA 2BGIA 2OESA 2QJOA 4LVCA 1PJQA 2PR7A 4G01B 3CYFA 4PC6A 1V8BA 1X39A 2RHDA 3ENNA 4EPWA 5HGXA 4ALMA 5LZ5A 1Y5NA 1KRXA 2IUUA 5LWQA 1OPXA 2XW6A 1RP1A 4F12A 1FFHA 1WXDA 4QOSA 2VBFA 3GP3A 1HYEA 4RDHA 3EWIA 3Q87B 1LF0A 3PKZA 4TLBA 5AHXA 1WCYA 5EKTA 3EXIA 2EZ9A 3R5KA 1DEHA 2P9HA 1VMDA 3BFVA 3GGOA 4YRFA 5H4GA 1CR6A 1WVMA 1BQ4A 2QD4A 2BV3A 3IEPA 1NUAA 4H15A 3EOAI 1XTKA 2BBSA 1M34B 2A5JA 2XTMA 3MUFA 4R3NA 1C5KA 1A9YA 3C5CA 4MUGA 3BDAA 3LBHA 4ALNA 5DM2A 3PA8A 1SKQA 3N75A 2NU6B 3PEFA 1DIAA 3P9IA 1WUHS 2AC2A 3JWGA 4QDKA 1M8KA 2P3OA 2LV8A 5CVJA 1XHLA 1D8TA 3KG2A 1OAOC 4ZYZA 4PQGA 5C51B 3WHPA 1NDUA 1Z0UA 2JCGA 3DQPA 3FFBA 4O8CA 5DGDA 2Z1DA 3KQSA 1ML3A 5IKXA 3JQFA 3IPRA 2G36A 1XRLA 4MKFA 1P0FA 3MRSA 5I3CA 3GC6A 3N0TA 5B12A 3TTYA 4B71A 3IJ5A 5KAMA 3GAMA 3ZNPA 2LNDA 1XQWA 2YMQA 1F6DA 2I99A 3ROXA 5IT5A 1SN7A 1XGKA 2Q45A 3P9SA 5EZ6B 4AAYA 3E9RA 3L93A 4DMGA 3OPYA 1G8FA 2WIGA 2X4IA 3FVQA 3O95A 1LSUA 4QFBA 3R7BA 2ES4A 3KK0A 3UGQA 4A15A 1E7QA 4N5HX 4TMXA 5HGJA 2W5UA 2VYND 2GS9A 1RAIA 4K6GA 5ABPA 3EZ7A 3KOOA 2P3LA 3K15A 2YWJA 1D0SA 3EMKA 2ZG6A 1XRNA 4QXOA 5DXJA 1NUUA 4YGYA 1QHNA 5CMLA 1X3LA 2GPTA 1ADGA 4I7EA 1XXHB 2E0IA 2IX9A 4LDPA 4MCAA 1FX0A 3EXHB 4HWOA 2NTNA 3C24A 3N8KA 3D31A 2V65A 4DC1A 3Q2KA 3FSEA 4RHUA 4UZEA 3GUYA 1F9EA 2PGLA 3ADPA 2KSQA 1EGHA 1DO2A 2C8KA 1ST2A 3FA2A 4XD7A 4ZT3A 2CE7A 3ET4A 4FZ3A 1BGXT 4MRNA 3R5TA 4YDHB 5J4KA 1ZGGA 4OPMA 1M73E 5EJ9A 4KL8S 1JEYA 1VMEA 1J0DA 1RFGE 2AOUA 4GI1A 2ZB2A 4X8HA 3R76A 4CKEB 4DBLE 4NENA 3T12A 3DKVA 1UH5A 2Z6QA 2QVCA 2WJPA 4RD4A 3SGLA 2MYTA 4DMMA 4ACBA 5BR1A 3BFJA 2JK1A 3WIBA 1G2PA 3DFKA 2FPSA 3AFMA 3GLSA 4X24A 5BW5A 1RZRA 1KJQA 2OHFA 2R0QC 2BIFA 3I5XA 3PWKA 2AXNA 2OO3A 3CUEF 3HUUA 3Q6IA 3G9QA 5GONB 1NX6A 3RS3A 3WKBA 3AF0A 5KZMB 4Q1VA 1PT5A 1JA1A 1SUSA 4I50A 5H3CA 1QCYA 5A3RA 5JNWA 4LDQA 4C5CA 1UBCA 1H93A 2QMEA 1XKQA 4G0XA 2Q29A 5C8YA 1XD9A 3CGGA 3QKUA 1C0LA 2JJ2A 2ODNA 3L1JA 4JIMA 4HDAA 4NRDA 3UMCA 4KH0A 3UG6A 1LWNA 1SCNE 1UIMA 1JEQA 4P6VF 5CK5A 1PNQA 8ATCA 2VWHA 1P17A 1T2CA 1YZYA 2WP8J 5G02A 1E1KA 1BQEA 1W25A 4U6SA 3DZFA 2OBLA 3R5SA 4EG0A 2J48A 3AHDA 3FSJX 4P7BA 4B75A 3LX8A 3N86A 4MITA 4YRAA 5C1IA 1N5RA 2WSLA 4ESEA 1FUIA 2FW0A 3UAWA 1LJUA 3RYHB 3T7AA 4B87A 1MRZA 1RHQA 1JAIA 1QGAA 1W4LA 1TW3A 3OQMA 1C7JA 2C95A 3GUHA 2WSIA 3C45A 1QZ3A 2A0KA 1IHUA 1QJCA 1A3CA 2RI0A 3RVDA 1SIOA 2B2CA 4JQZA 4B7UA 1Z2AA 2Z6VA 1HX7A 2VNIA 2Z8YM 3V8EA 2IS2A 3P0HA 5EPOA 1IULA 1M1YB 2V5VA 3BXEA 3RK0A 3SSOA 2H2AA 3F9IA 4FDVA 1G6Q1 3WK5A 2FETA 5EWLB 1II8A 3EEFA 2SBTA 1PFKA 1REQB 1DAGA 1XKXA 1ECCA 4P84A 4MKRA 4GXRA 3T3DA 2AKAB 2B4QA 4C78A 3W9UA 3DA8A 1ZHOA 5LNK6 2ZJ5A 1NONA 4GMFA 2CVZA 2V7QA 3O90A 4D4KA 3NHUA 1P33A 5LQDA 1JU3A 1OH5A 3PQFA 4OXXA 4XCQA 1AQLA 1IDOA 3FMPB 3NBZC 3VPCA 1XZHA 4KTVE 3RYFB 4NYMR 1O5TA 4OLFA 3CLRC 4HWKA 4Z3OA 1VIVA 1UC9A 1X7XA 2SHKA 3UUWA 1H0SA 2H1LA 2VSXA 1QHEA 4BAGA 1TKCA 1Y7LA 2WHPA 1N6IA 2V7TA 1L5QA 3PCRB 4LXQA 4R68A 2MHCA 4WECA 4IAOA 4Q4AA 1ZXBA 5BVGA 1YQ9A 2B6NA 4Z2YA 3PB3A 2YASA 2B92A 2QTZA 4YLEA 1GQ2A 4P4SA 4YO8A 1VQ1A 5I5GA 3W8RA 2CLDX 5FWYA 2YL2A 4K9OA 4BVLA 4MB6A 3D7NA 1NBMD 1NI5A 3I2KA 2EFJA 4G1EB 3PT5A 4IH1A 4EO9A 4G09A 2ZKLA 4GPIB 4G5OA 4Q37A 3HN7A 3UOWA 1N2HA 3FKSA 4QZVA 1CZLA 1O5OA 2AXQA 4FGKA 4Z4IA 1VGVA 3GJ3A 1TJ4A 1K2VN 1T6XA 2GYVA 10MHA 4YAGA 1XZBA 1HGXA 2CJYA 4YVFA 1F1BA 4B46A 5DM4A 5B30A 1XHEA 1ZG3A 4L78A 3U81A 4MWEA 3K9WA 3ZGVA 2PS3A 3BE8A 3PYMA 5DGXA 3U62A 4PYMA 2RAPA 1Y6JA 3Q1KA 1LB1B 4CFZA 3RH0A 1TNDA 2QOEA 2Y27A 1IXZA 2ZBFA 4PPQA 2UKDA 3TQTA 2HUNA 4UU8A 2FRVA 4FJ0A 2BTQA 1LDYA 2V3WA 1R12A 4RF4A 3SYNA 4N01A 3ZGOA 3KCQA 3R3WA 4PGMA 5K3FB 3AI7A 4R2KA 1SR8A 4LY9A 1OHHA 1RI4A 3BWMA 4INZA 3NYIA 3R0QA 2PKWA 4DCPA 1FRNA 4XUGB 3EGVA 3ICWA 2D13A 3K72B 4FKZA 4NABA 4PVCA 3U26A 3FZQA 3SHVA 4BNNA 3VHLB 4RLQA 5IDQA 2GTPA 3Q0IA 2BGWA 1M1ZA 1V6AA 3C14C 3M8KA 4I6EA 4CTMA 4II7A 3RRMA 2J85A 3R7DA 3H86A 5KYXB 4GMXA 2OENG 1SOMA 1PJCA 1EX6A 2X8LA 4Z49A 2AF4C 2NO0A 4X65B 3PPVA 1TM1E 1YRBA 2ZW9A 4UPDA 2BT4A 2YVQA 4LJAA 3VSBA 3OJFA 4JR0A 5A9SB 1PHPA 4L5CA 1DJOA 4OFBA 4G5RA 3MJEA 2ZPUA 4IOJA 2EU8A 4X1YA 2VATA 5SZKB 3SOPA 2QEQA 3GZ4A 3L7KA 3EBPA 1C0EA 5ALGA 1OI7A 1OXSC 1UAYA 2IOFA 2X0NA 3IFSA 4O4LA 4ODIA 5EKDA 4YPFA 3V7UA 1EG7A 2OXFA 2Q3LA 5EERA 1HKUA 1W2GA 1WULS 4CKBA 3U9LA 5L3QB 3IUMA 5M34A 1WHSA 4BFSA 4S05A 3GLRA 3PIRA 5E7MA 4GMKA 4HLNA 1WV1A 1HH4A 2WUFA 2FHSA 4HQLA 4TXNA 4Y7CA 3QW2A 2MCFA 4DT1B 3AVYA 3IOEA 4JBLA 1QP0A 4MYDA 3FR7A 3GO4A 4OI4A 3JWJA 2JJ1D 4F4HA 4PM4A 4MW1A 2NO5A 3V4SA 1V47A 1CP2A 4AC9A 3I28A 3LA8A 3LS2A 5IHPA 2NU9B 1B8NA 2B94A 5EN4A 1X1DA 2RGUA 5IJ0B 2R85A 3MHPA 1O0SA 3IMFA 3ESDA 2CJWB 2JD2A 1NNEA 4KREA 2NPFA 2OCLA 3HRHA 3IR6A 4LYJA 1Q1EA 2Q46A 3AGQA 4ZPXA 3U0BA 3AI2A 3ZUGA 1JPNA 1ZXXA 1A9SA 1JYFA 3LRXA 3WL6A 3K96A 2H0QA 4MUXA 4N5MA 5AXBA 3PEYA 3CXUA 1Z39A 4JC8A 3G5LA 1SQ6A 4R2MA 5AUOB 2H2IA 3THSA 5JJBA 4BO8A 2YJ5A 3WV5A 4KE9A 4GOND 3N74A 1BKSB 3DYVA 1FTNA 1VLHA 2NUAA 2NGRA 3EXEB 3FKSD 3M81A 3LD9A 4JLDA 1H4QA 1SKMA 1K5DA 1F17A 3NBKA 2BUCA 1VA4A 2HJVA 2HMWA 2DPGA 2B0CA 2FKNA 2E4ZA 1A8UA 2QLMA 3UQZA 5I9MA 2CMGA 3OSZA 4A2QA 2JGDA 4EB0A 3SCZA 1NR1A 1UDBA 2J3DA 1T26A 3L6DA 1YJ8A 3B1WA 1ABBA 3KQLA 4YRBA 2PKYX 4HATA 4L6AA 1YB7A 5IK2D 2XMSA 4WY2A 4OSOA 1TTPB 1R5NA 3AIIA 1EE1A 1NU6A 2WKWA 2CUKA 2JFQA 2PT7A 4NE7A 5JNLA 3AJ9A 3UK6A 2F3QA 3SJBA 3BCSA 1KBOA 3PGMA 4OH7A 4ZVTA 4B4UA 3IQFA 4Z6KA 2W83A 4Q3LA 1TKBA 4FOTA 3KKPA 2Y0EA 4EX6A 1CJCA 2XKAA 4PBSA 5AVTA 4QBIA 7ADHA 5IVHA 4G4SP 1TEHA 2GPAA 3GP8A 4A0RA 2P30A 1CUXA 3QWHA 4RGYA 1GR1A 4EPVA 4X94A 1RHMA 4YCJA 3BTUA 2FR8C 1TMGE 3DEZA 4JYAB 1G8MA 1NOIA 3KXLA 4DJFC 1JKJA 4F60A 1WZ2A 1U1DA 5JNRA 2DQKA 4OJQA 4MQEA 2B8NA 3LX4A 1NJ2A 3AU9A 4UE2A 1U2SA 1MEOA 2XAAA 5HKBA 5A3QA 3ECCA 4PEVA 3BORA 3QUSA 1K7XB 2AX3A 2WK1A 2Q9UA 2QRZA 4PR3A 5CPBA 2YJNA 5BRNA 1D2EA 1Z35A 2IDKA 3JWHA 4YTEA 5ADVA 4CEHB 2ZZMA 1Q2XA 5TQ0B 3EMVA 3TRIA 4ZVRA 1FTWA 3O7WA 5ED0A 1VHQA 5FT9A 1E3JA 3PZBA 3ZHTA 3C3WA 4ENRA 3DV9A 4XTCS 3DAOA 1P4GA 3IBGA 3FDXA 1RWVA 4YUZA 2FCRA 4GRDA 4R54A 4DREA 4QUJA 4J0KA 4JH0A 4ARIA 1YZHA 4P83A 1XDDA 3WFIA 2D2EA 1SC1A 1BFDA 4HF7A 1I4LD 1KQPA 3OA2A 3OOEA 4LYHA 1L7MA 3SHFA 1M33A 3GFGA 1JU4A 1R9NA 1TTTA 4FS3A 3A6DA 4D6XA 3OA0A 3EAGA 2GB4A 2O9JA 1WQ4A 1M34A 3P0EA 3Q2OA 2IZ1A 4O2RA 4Y2JA 3JALB 4B31A 3CBGA 2VRBA 1D1SA 1FC0A 1N8TA 1UKYA 4OBBA 3KHTA 5DTQA 1BVYF 2HF7A 1YBVA 1AS0A 1SIUA 3QFTA 3EISA 1EXVA 4JHXA 2RHLA 2V59A 1UBFA 4JLWA 1YFKA 5HG0A 2FRXA 2FW7A 2I2WA 4CKWB 4EHAA 1XMSA 2QJRA 1XQVA 2WKPA 1RU3A 2WAMA 4I55A 1FFXA 2A0WA 3OQ1A 1Z08A 2UZAA 3H2JA 3IOBA 5BMVA 1YJCA 1PV2A 2C61A 3D0RA 3STVA 2QLLA 1EUCA 3HY3A 4FFBB 4QE3A 2FJPA 5CBPB 5INTA 2UUCB 1GL6A 2ZBEA 3UICA 2V6GA 4TSKA 3KHUA 2AR7A 1U2QA 4EF5A 3VU1A 3HCFA 5A71A 3PWZA 3IEVA 5F5LA 1VG8A 1YAHA 2DHDA 2GXAA 1KXJA 1KS9A 2P9BA 1OXMA 2AYXA 3E05A 3K32A 4I1UA 5GM1A 1XXLA 4OI2A 5DBGA 2XKKA 2HV9A 1E4EB 1NQAO 2C29D 4MGEA 3SHQA 4HYQA 1L5WA 4OREX 4GECA 2ZIWB 3TMAA 2R60A 2WDZA 3HCNA 1EZ4A 1KWGA 4R2WA 3ZDQA 5CYGA 2AEEA 4C6TA 2DKOA 4H1HA 3MXTA 1J0AA 2IVFA 3WGMA 1ZRHA 2QNIA 4MP3A 1W5EA 2F64A 4RTKA 2O3TA 3ASVA 5CM8B 3UB3A 3E1KA 4C0LA 2RGAA 4CVNA 5HZHA 3JQ9C 1MDFA 5A9TA 4UBLA 5SY6A 3WDLA 1U2PA 5BT8A 5JVDA 1O6GA 5C52B 4EFKA 2HQSA 3GOQA 3GNTA 3SEQA 2OFPA 4BDTA 3ZWAA 5JY1A 3NHRA 1ZOLA 3Q11A 1SXHA 3ZKWA 3PR3A 1Q50A 3AR6A 1V7ZA 3F78A 1T1SA 4J43A 4AZ0B 4DJDC 3AFIA 3EGOA 5LP1A 4Q1CA 3NTRA 4LHEA 2EFDB 4C4AA 2IEZA 1FU8A 1DIBA 3E1SA 3LUBA 1THGA 1AKQA 1Z6ZA 2Q50A 2ZVQX 4NZZA 2FPPB 4PRZA 3I1JA 4JOQA 4BLUA 3BH7A 3WK9A 3BB3A 2YNMA 3TJRA 2ZR9A 1V39A 4BC0A 3AX6A 2HA4A 3ACBA 2CKMA 1N9ZA 4HDKB 3MIZA 2GN6A 5K8TA 1WU7A 4RPJA 4MWCA 4NYMQ 4GKJB 4R1SA 2J33A 3PDHA 4U8HA 5HF9A 4J2OA 4MWOA 5GADl 2PWPA 3OX4A 1R5BA 3L0SA 4EAAA 2PJRA 1LD3A 3HVIA 3RARA 4E32A 1YMVA 2QWXA 2YQ4A 4M99A 2V4MA 4REMA 2OV8A 2EXXA 3ZW9A 2XVZA 2LUOA 3MFQA 4L16A 4Q6WA 2X4GA 1HDRA 1I4DD 3CV3A 3F5MA 1XYYA 3FPFA 1JDVA 4Q3KA 4JXKA 4PICA 4K9NA 1QIJA 4JB3A 3ROZA 1MJHA 4Y2PA 4MK4A 3TDMA 3FKJA 1ZH4A 3TKYA 3VKWA 3K0CC 4J0HA 3T5TA 3TNJA 4DXAA 5F3WB 3UIEA 3AC0A 3U6BA 2B3DA 3ABRB 3BE6A 4BMYA 4JJEA 4RY2A 1PR1A 1QS0A 2VAVA 3UF0A 4LCBA 1OMOA 1RE1A 4G1BA 2R1TB 2YN0A 1UM9B 1MPTA 3LGXA 3PWSA 3ORQA 1ZGAA 1ZHHA 1DFGA 4F2GA 1LDMA 4ILEA 4HNRA 2O1WA 1M7BA 4ZCRA 4PX9A 5FWYB 2A7QA 2HK6A 1RQRA 4ZAWA 1U2DA 1UMDA 2R6HA 2OZLA 3GLHA 4R2LA 4ZAVA 1HMPA 3A4VA 4L9SA 1BMTA 1S2IA 5MGBA 4B9EA 7REQA 4NH0A 1K5PA 2VWGA 3TX2A 3WGYA 3UG7A 2K6GA 2D5BA 4MS3B 1O89A 1SBHA 4RORA 3IUQA 3ROEA 4CYMA 1APBA 4JEUA 4M1EA 5FI0B 1OBFO 1Y8QA 2A5FA 3OD5A 4GX0A 2GVNA 4LMPA 3RYFA 1V9LA 4ZMRA 3GGPA 1VFPA 2VTBB 3BXXA 3O4HA 2EW2A 3WGIA 1P91A 3BEOA 2AD5A 1NX9A 1E99A 3H84A 4KPUB 4Y2YA 3UA3A 3WRXA 3DW3X 2F4NA 4ZC1A 4F9TA 5BVGB 2FMUA 4WPGA 5EGSA 1IMOA 4FR5A 4XQEA 3FPEA 2G9UA 5DXAA 3MB5A 5CFZA 3E7XA 1FW6A 1PF7E 1JJBA 3TECE 3I83A 4OYLA 1IUOA 1EFRA 3KEMA 4HK4A 3B8EA 1CQJB 1QNFA 2H2FA 1Z12A 3SZMA 3B1ZA 4I1PA 1Z5ZA 4BMCA 5DTEA 3H11A 1LRKA 4GS5A 3FUTA 3ILVA 1BW9B 5C3UA 1WETA 4CKCA 2WAOA 3FPJA 1QBGA 3GVHA 1N0WA 3I0NA 4FMDB 1W85A 2BELA 3T1VA 4BQQA 2YWEA 3CM0A 4DBVO 4TTIA 4DYDA 1GPUA 3JVEA 5AIAA 5DE3A 5DT9A 1SVLA 1ZGBA 4AKEA 3RTAA 4D4MA 4O6VA 1GIAA 1R4NB 4Z7QB 3P19A 4DA0A 1O97D 3DLCA 3Q4GA 4EITA 2ICAA 4R05A 2EWWA 7MDHA 4L4ZA 3ABIA 4F91B 2QE6A 4YXWA 2H29A 3WMRA 3REFA 5BN3B 2O3RA 2ZWOA 2J3HA 4PTZA 3KZXA 3O8OB 2BFNA 3K4PA 2IUTA 4PGHA 1M6VB 4O1MA 2DR0A 1E2UA 3PI6A 4WW0A 4L8VA 2B4RO 1GUDA 3LY9A 4AY5A 4C05A 1FFXB 1Y5MA 4ECEA 2ZRPA 3UW1A 1O54A 3AESA 2KPOA 3NRCA 4ASUD 4US2R 1EVKA 3KQYA 5CFOA 1IK4A 1ZOPA 4B3IA 2XYGA 5LQJA 2AZDA 2F3PA 2HWWA 4R8RA 3S8YA 1KP9A 1YZNA 5HF8A 4DTCA 1LTHR 3RE1A 2GFQA 4CQNA 4KIWA 3GU3A 4FCTA 2BGKA 4HLUA 3RC9A 4BKOA 4R1NA 2VJAA 5ALRA 5IT9A 1NHGA 3EGWA 3H1PA 1EFDN 3IBYA 3QBDA 4DUZB 4MP6A 2G7MC 1PEYA 3TOXA 4DJ5X 2O3QA 3F4KA 2Q5EA 1PUIA 3F9CA 2QTBA 3QQ5A 3AOEC 1G9TA 3HCPA 3QNMA 5EQTA 1F5NA 1FYXA 1PP4A 1MC8A 2QY6A 4JJ4A 5KYTA 4HTFA 4I1IA 3RKSA 3MN1A 2WRZA 3V42A 2YVAA 3HG7A 4E5UA 3PYLA 3BXPA 3ICCA 2IBTA 4CUZA 1QVRA 4BE9A 2ZRGA 5K6AA 1S4QA 5GZ6A 3K5HA 4H6VA 3FOAA 1MJNA 3OAAA 2ANBA 4JQOA 5TGTA 5LMZA 1X7GA 4KCGA 1R16A 1Y9EA 2FRDA 3UT5B 3VO8A 2E4WA 1L4NA 2Q41A 4DR4B 3WNCA 5KNBA 1R0YA 2JI9A 3W1EA 2WKSA 5L3QA 4ND3A 4PBRA 2R1VA 4RAQA 5IWAB 4G1FA 4MHTA 2ORYA 3F8TA 1PR9A 3HDVA 4KI0A 2FVXA 3HJTA 2VK8A 4NV0A 5COAA 1YJAA 2W6JD 2ZUVA 3IMGA 4G4GA 3U56A 2VN8A 2XCUA 3X3HA 3PFKA 4XIJA 4OP3A 3L6EA 2LCIA 2QR2A 3RHSA 3VR6H 5I7RA 3AR3A 3SDZA 1EFTA 3OFND 1L5ZA 1OIXA 3N5KA 1CNEA 1I01A 4WUVA 2PH5A 1G3UA 4D2IA 1JQ5A 3UJHA 2NU9A 2BPOA 2DFNA 1YS6A 1LZLA 1A97A 2DX7A 3IMCA 3G2MA 1EP3B 2PSJA 1IY1A 5IMBA 1N6OA 1DCTA 4KC0A 1YZQA 5HTKA 1JQBA 1KNXA 3EUEA 5F1PA 4TZ6A 1GG5A 5JI2E 2P5TB 2QGNA 3EE6A 2C31A 2HA6A 4KKVA 4B45A 4MLPA 2W37A 3PBKA 4TWIA 5K4GA 4HQOA 3ZIAD 4D3YA 1BS9A 3ENWA 3ILXA 3GUVA 4INPA 4KACA 5T6BA 1CUVA 2OG2A 7MHTA 3R74A 1YQDA 5I7HA 4E15A 1JHDA 3IULA 1KSHA 4KZPA 1D6NA 3GLIB 4E7PA 2JG3A 1B1AA 1NW5A 1SBCA 3D1JA 1XF9A 3M6FA 4OQXA 1U0GA 3M5PA 4LOKA 2G77B 1YRWA 3PPIA 1ZNZA 3SVZA 3A11A 3WHKA 1CT9A 5I7OA 2V6IA 5KVSA 1E92A 2PHZA 2XWBF 4WX2B 3ZNQA 3QNUA 3VPBA 1Z2EA 5TVGA 2W11A 4XPIB 2YWFA 4JXJA 5CIWA 2Z98A 3HV0A 1GPKA 4ZMBA 4BKPA 4LOLA 4TLAA 2AIRA 2P0YA 3AOEA 3FDZB 1LPPA 2I2FA 4YJGA 3AF2A 2EDCA 1EVEA 1IN8A 1XFDA 5IASA 1Z33A 2OYCA 3PRKE 2HJSA 3HEAA 1N1EA 1WBBA 1JDZA 3PQCA 4MS3A 4XUEA 2EARA 3EZFA 3KZVA 1QPBA 1BOFA 5F1KA 5C34B 5LUBA 5J23A 3V2IA 3ELUA 4W9NA 3M6LA 3SDBA 1XVUA 4P35A 4IDEA 5AI6A 3VDMA 4PZYA 4DLAA 4E5PA 1BMDA 3DBRA 4AURA 4GZLA 1FDWA 1I5OA 4GPD1 3RS0A 4LWOA 4C4TA 1E6UA 2I03A 4U7WA 3VNQA 2DETA 3DUFB 1FDVA 1I6KA 1GFWA 3ONNA 2ETVA 1HFWA 2YZGA 4XX1A 5LWHA 2BEUA 2E1RA 4E12A 1YA8A 2NT3A 1D2NA 4XIIA 1NRIA 1UXKA 5AJTA 1UJ6A 3TIVA 3W2GA 4DL9A 2AFHE 2HWKA 3R3JA 4XIGS 3PE6A 3COSA 3DZDA 4MV5A 4D9FA 1KJ8A 3JZAA 3MJSA 3RS9A 3SS7X 2QG6A 4MW5A 5EE9A 2AWNA 4HCJA 4B3JA 4DM3A 3Q8MA 5F98A 4M53A 4IJWA 3O82A 3JQAD 2VSNA 2HOQA 2OECA 4PGFA 5HDBB 1T10A 3CTMA 4BRUA 2R5NA 3PA6A 1A96A 1ESZA 2AEJA 3OWOA 4X85A 3Q2IA 2LVBA 5ADWA 2B2XA 3W9YA 1RC8A 2AJDA 2VKTA 3OT1A 1Y5LA 1FTSA 1H23A 1LI4A 3DZ8A 4IYJA 4M36A 1YL5A 4MJXA 5D3MA 4NXMB 4HDOB 1I7LA 4RNDB 3GGSA 3TW0A 2WUWE 1RYZA 3S7TA 2PZ8A 3ZU4A 1FJGB 5ED4A 1M6VA 2JFXA 4FZRA 3FUUA 3X2SA 1GU0A 5THKA 4E11A 3GXOA 3D6AA 4KFTA 1IZ9A 2CXOA 2ST1A 1MO5A 3B6EA 4RXMA 2VJMA 3U13A 1E2HA 4DDKA 3NVMB 4I81A 4M1SA 2VZ9A 4YDSA 4D3DA 3DPSA 1TEZA 3EZ2A 3R0VA 5KYNA 1NQWA 1YAJA 4ER3A 1UC4B 2AOXA 5M2QA 3ZDAA 3P27A 4QO8A 2V96A 3H8SA 2NVOA 1QIKA 3DCIA 3CX3A 4FTWA 4X61A 1CZKA 1XYGA 2QAGC 3SR4A 1SURA 2WU4A 2I6FA 2OT3B 4EJFA 2N9UA 2XXJA 1M8JA 4WOBA 3SYRA 1MPXA 2IEGA 2N3ZA 3OTIA 4LRTB 1AF4A 3DFUA 3PE3A 5EUMA 1BN7A 1L4YA 3BFKA 3LQQA 1D4OA 4FHZA 3ZTYA 3ZJUA 2VHQA 5B58C 4R9SA 1KJIA 2QTAA 1FVFA 1S89A 2JH9A 3TO5A 2E5WA 3QU7A 2Q8PA 2QVXX 4NBTA 4FLFA 4PQYA 3B1VA 4N7MA 1CF4A 3LUCA 5E6SA 3FVTA 2XA1A 3PUZA 2QZSA 3P97A 2GBPA 1PHRA 1TQ8A 4RPIA 3KSMA 5LUAA 1K86A 3BB1A 1E8MA 1L7OA 4Q5IA 3T7DA 1HBJA 3E7PA 3MAGA 5HM6A 5ENVA 3OSUA 1TJ5A 1TW2A 3F5DA 4IVRA 3FOEC 4YAFA 1Q6ZA 3AL3A 3N07A 1K7EB 2IYSA 4FT4A 3PVCA 3A9RA 2AMVA 5KYWB 1XU7A 2R2AA 2ZPAA 1TGVA 1U1FA 4NLLA 5FFNA 3RUDA 3S2GA 1N2SA 1IFXA 3MINA 4TL6A 5CEFA 4HDKA 2CUNA 1FMFA 4R1PA 3GN1A 4YT8A 3HEBA 2O0LA 4MYRA 5KQLA 3GGCA 3P0RA 4U7HA 2HX1A 2QN9A 2V54A 4GEKA 3K9NA 2QJTA 4A2PA 1CW2B 2FLWA 3EFHA 1C7IA 3O4JA 1U9CA 1U0NA 1VI2A 3SQXA 2CEAA 3MS7A 1HQCA 3L7CA 5LMCA 2DBZA 4JU9A 1O08A 2QG4A 2VUTA 4MUJA 4W5OA 3S44A 2J5KA 4EL5A 5E0KB 2J6HA 3ZDZB 2GQ0A 5HKAA 1V8ZA 1TKAA 2MINB 2FV8A 4HDMA 4J7UA 5IDVA 5IDWA 4YX9A 2WMYA 2WTNA 4P7GA 3LPCA 4JBNA 4ZT7A 2PU7A 2GAJA 3ZBTA 5CT4A 2PZKA 3B89A 3O4VA 3SMVA 4CM4B 2ZT7A 5BN4B 3D2LA 3NI2A 5TDHA 3TLMA 4UREA 5KU7A 5FL7D 2EJWA 3NTUA 1GCGA 2VQSA 1QHSA 4IDQA 1O03A 2J7KA 3PDUA 3PYXA 4JX9A 5LQKA 2PZJA 3PL1A 4TYQA 2IKSA 3P2MA 1C1XA 3HB0A 4TUYB 4B43A 3S6JA 3NATA 3DPUA 4KYTA 4ENWA 3SDSA 1LLCA 5KNCH 3PNPA 4EY8A 2I3ZA 1HYBA 4R9VA 1H65A 1U0SY 3K9HA 2XSZA 4UBMA 4F04A 6Q21A 4GSLA 1U81A 4HWPA 3ZY2A 4JVOA 3STWA 2XZOA 1YR6A 2V98A 2XYRA 3G82C 1WMAA 4Q18A 5JTUA 1I1NA 4O59O 2YJ3A 1OLOA 4J8PA 2M98A 1HORA 4UEOA 1JVBA 5JAOA 4MZXA 2ZUEA 2WFMA 1L4LA 3AF3A 1CUDA 3LXXA 4OB6A 3OPYI 2AR0A 1R9MA 2BSAA 1L7BA 3R5JA 4LX0A 4C3VA 3UBMA 2G06A 4V0MA 2HBYA 1AKEA 1DVRA 2B69A 3O2SB 3ORFA 4KXMA 4V24A 1OGIA 4BEWA 4MMYB 3ORRA 5E8RA 1T8YA 4L0CA 5AKIA 4Z4EA 2QR5A 5ALNA 3OP4A 1CQJA 2HT6A 4B6JA 5HP4A 3BDVA 1KAEA 2I6XA 1KDPA 3GLHB 5AKKA 5K3SA 1OUMA 4WFIA 4BV2A 2XIQA 1GRCA 1PTJA 3GFFA 1BW9A 3OZGA 2Z9CA 4FFPA 2F1RA 4Z8YA 2FW8A 2GFHA 2X5JO 3L8EA 1FJXA 3ESXA 2HDWA 2IXDA 4KO4S 4BAUA 1HLPA 2FZGA 3DEJA 1UP6A 5A5GA 1R6BX 2WJIA 2ATCA 2PRJA 3SF0A 1RXYA 3UUEA 3F9RA 1VM6A 2XWSA 1L9XA 4YRNA 4KDCA 3AH8A 3OETA 3KQUA 2ZDGA 4BNXA 4EJSC 2D7DA 5KMGA 3DLHA 4K9DA 2IS4A 1VP3A 1I7DA 4DARA 3G8YA 5F21A 1YQEA 2FUCA 3LFTA 3L7YA 4WZAB 3D4OA 4YJFA 3TAHA 1SCUA 1MW9X 1U65A 1GP2A 1V3VA 2ZYTX 3T35A 3CVYA 3OZWA 3EF3A 4NZOA 1E9VA 4CJXA 1WKBA 3LIPA 2FX2A 1G3MA 1NVTA 1GEGA 4BO1A 2J3LA 3RBVA 1UKCA 2ORWA 1Q74A 3ODGA 1ZM4A 3QWFA 4YRMA 4IWNA 1BYUA 1E0JA 4FGJA 4DS3A 5EIFA 3W6NA 3IBTA 4WNAA 5HJ5A 2FZWA 2P5SA 4BLPA 3UJ7A 1VRWA 3M49A 5KJ1A 5F9FA 4TYYA 3MILA 3K6RA 4X71A 3OJLA 1OB5A 1AB6A 1SELA 3DLPX 2Q4TA 3I2IA 2Q4EA 4WXHA 2GBLC 4RA6A 1MDBA 1K5HA 3AB3A 2VJBA 5JLJA 4OOEA 4IR7A 4O2BF 4CKYA 5ALWA 1GTJ1 1WTAA 4OGKA 2QQGA 1XUOA 3ANNA 4O63O 4KQIA 5DM60 1WNFA 4YUVA 3ZDCA 3ANLA 1NYLA 1U0RA 3S1LA 3DC7A 3O93A 4DIUA 1SG6A 1RQPA 1VCOA 2FSSA 2ZYWX 4QG3A 3P9CA 3Q3IA 4D80A 4RH3A 3VVCA 3TQCA 1MAHA 3CG0A 4H7DA 4CIBA 4EG5A 1Y48E 4E5SA 4X97A 2I3AA 3NOOA 5DASA 1Y1QA 3COVA 4AQ7A 2D3WA 4CCWA 4CKEA 2NAPA 5AK3A 3EVGA 4OI0A 3AVWA 1KO1A 1L4FA 3MS4A 3W8NA 1P2BA 3INRA 3TIXB 2OM2A 2Q9BA 2ZULA 4KMSA 3TQRA 3ZZNA 4D9KA 3GEGA 4AJEA 3G9UA 2CE2X 4MSUA 4O4JF 6NULA 5AQ1A 5D3KA 1J0BA 4RD0A 1A50B 4PLZA 4B1FA 1KTVA 2YN2A 1CHDA 2D8MA 2JW5A 5HCNA 4PLHA 4ENQA 2EKQA 2Q28A 4GH5A 3RT9A 3TRDA 1WOMA 4B3BA 4NJOA 3SXJA 3IP5A 2IITA 2VYQA 4FPXA 3K8QA 4N7BA 2ZJAA 1FF9A 3D3WB 1H85A 3IAAA 2C4KA 4EGCB 5JAHA 2WWWA 5ALLA 2QTVB 1KDZA 5T4HA 2VK1A 1CWUA 5LA6F 1V43A 4RSHA 4OH1A 5AVRA 4Y6GB 5BYKA 2VRCD 1I9GA 2XITA 1QSGA 4H3HB 4IX9A 5WRFA 1K63A 4BMNA 3W5AA 5CDFE 2YHSA 4FMCB 4ITUA 1TYZA 2IY9A 4K7JA 4KXNA 4RCYA 1RM4A 2NQ2C 3LCRA 4OK5A 1FXWF 3CLKA 4BYMA 4YBRA 4EJ6A 3AVUA 1UBEA 3CTPA 2C5FA 1I2MA 1MB0A 4P7FA 4PPFA 2ZJ1A 2W7TA 3UMRA 3LRTA 5B37A 3DW1X 4QLAA 4X1IA 3PTLA 3B38A