4LI3X

Crystal structure of o-acetylserine sulfhydrylase from haemophilus influenzae in complex with high affinity inhibitory peptide from serine acetyl transferase of salmonella typhimurium
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
311
structure length
310
Chain Sequence
MAIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVCRIGANMVWQAEKDGTLTKGKEIVDATSGNTGIALAYVAAARGYKITLTMPETMSLERKRLLCGLGVNLVLTEGAKGMKGAIAKAEEIVASDPSRYVMLKQFENPANPQIHRETTGPEIWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDLSIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSASERYLSTALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of O-Acetylserine Sulfhydrylase from Haemophilus influenzae in complex with high affinity inhibitory peptide from Serine acetyl transferase of Salmonella typhimurium
rcsb
source organism Haemophilus influenzae
molecule tags Transferase/transferase inhibitor
molecule keywords Cysteine synthase
total genus 108
structure length 310
sequence length 311
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2013-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4li3X01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4li3X02
3V7NA 1WDWB 4PCUA 4D8WA 5HBGA 2GN1A 2CLMB 5DBEX 2D1FA 1P5JA 2CLFB 2TYSB 3DWIA 1CW2B 4HT3B 4D96A 3VC3A 4OREX 1WKVA 4JBLA 2CLEB 5E0KB 4F4FA 1KFJB 2J9XB 1WBJB 4D9IA 2WSYB 3IQIX 3IQGX 3SS9X 3PC2A 1J0DA 2RH9B 5J43A 2J9ZB 3IAUA 4D9EA 4AECA 1VE1A 2ECOA 4WX2B 1PWHA 5D87A 1RQXA 1K7XB 2RKBA 2GN2A 3AEYA 2TRSB 4ZU6X 1K8XB 3DKIA 1TDJA 2RHGB 1K8YB 2CLKB 5I7RA 1KL7A 1J0AA 3PR2B 2GN0A 1JBQA 1UIMA 3R0XA 5DVZA 3BM5A 3L6BA 5B53A 3T4PA 1TZKA 3PC4A 5KZMB 1V7CA 1F2DA 4H27A 3R0ZA 4D9MA 5CGQB 5T6MA 5I7OA 1K7FB 3IQHX 1OASA 1J0CA 3L6RA 1C9DB 3CEPB 5JISA 4HPJB 2ZR8A 2TSYB 1A5AB 1CX9B 2C2BA 3VBEA 4D9KA 4XUGB 4D9NA 1BKSB 2Q3CA 5DW3A 5B3AA 5DW0A 3ZEIA 1Y7LA 4KKXB 1TZMA 2CLHB 3L6CA 5KINB 5B1HA 5D85A 4HPXB 1FCJA 4IL5A 4L28A 2C2GA 3PC3A 3HMKA 1V8ZA 5JJCA 2J9YB 5I7HA 3TBHA 3FCAA 5C3UA 1A50B 1TJPB 2BHTA 4OFXA 5EY5B 1A5SB 4D9BA 1KFEB 1VE5A 2EGUA 3AEXA 1BEUB 2CLIB 3RR2A 1TYZA 1K7EB 1UBSB 1C29B 5I6DA 4L3VA 4HO1X 2ISQA 4D9FA 5B55A 1J0EA 2DH5A 1Z7WA 5D84A 1PWEA 4D9GA 4D8UA 2JC3A 2O2EA 1D6SA 1K3UB 1KFCB 2CLOB 2Q3DA 5B1IA 4D9CA 1TTQB 4AIRA 5J5VA 1TZJA 2V03A 3X44A 3X43A 4NU8X 4Y6GB 4D8TA 1TZ2A 5IWCA 3VSDA 5CVCA 3VSAA 4ZQCB 1WTCA 4LMBA 2ZSJA 1X1QA 1UINA 5IXJA 4LMAA 3SPXA 3VSCA 4JBNA 2O2JA 4L27A 4NEGA 5I7WA 1Z7YA 2ZPUA 1M54A 3FGPA 3SS7X 5IW8A 1C8VB 2Q3BA 1KFKB 1K8ZB 2ECQA 5B36A 1FUYB 3DWGA 1KFBB 5D86A 1E5XA 2CLLB 1TTPB 1VB3A 4HN4B 4QYSA 5DBHX 4L0DA 4I1YA 5BW6B 1J0BA 2PQMA 5I7AA 1A5BB 4D92A 2EFYA 1O58A 2DH6A 1V71A 4ZU1X 4D97A 4LI3X 4COOA 1QOPB 4D99A 1QOQB 2BHSA
chains in the Genus database with same CATH superfamily
1USKA 4F9GA 5BN5A 1CUFA 1KH3A 3NRJA 5H3CA 3KVNA 5T4FA 5CX4A 5JNRA 4LGCA 4ZHSA 4U2GA 2Q9CA 4D5GA 1P0PA 5L53A 1N33B 2FN9A 3FXAA 16PKA 2ZJFA 1JFSA 5FUXA 1WXFA 4F5EA 1AKNA 3K20A 2SKCA 1G1MA 1L5ZA 1K89A 1OBCA 2AT1A 3IEPA 3PFNA 3OLYA 5AKHA 5EZQA 3WYNA 5JS1A 1ZK3A 5F9MA 1TM5E 1RYNA 2IYPA 4HNRA 1U4OA 2O0HA 4JLUA 5LQJA 3PE3A 1DMRA 1JR6A 5CPFA 2C96A 3PRJA 3A26A 4OBEA 1TW3A 3PG5A 4LRXA 2HJVA 5IC5A 3WLTA 1GPAA 2MSNA 3ETJA 1VG9B 2AD1A 2Y0DA 4OMUA 1HXHA 2QXTA 4A26A 1GZ4A 4NS4A 1H8ED 1W1UA 1V3TA 2JHCA 4AF7A 4NXMB 1GPH1 2GEDA 2I4OA 3WQSB 2Z5GA 3FRHA 3LX5A 2FV8A 3PPIA 2CHUA 4Q1AA 4U2FA 5AH0A 2W6OA 1JSXA 1L9KA 1NA5A 2I3GA 2WF6A 2YY7A 5G40A 4ZEWA 3RC3A 5KNLA 1KRWA 1F5NA 4X93A 1S2OA 1ZNQO 4IHJA 1M72A 3HZOA 3D2AA 2FFHA 4WGFA 2RHJA 4UHJA 5FNVA 4YP9A 4FLEA 4ZGWA 4MUNA 2BP7B 3KSAC 4WUTA 4CLOB 1G5QA 3LJKA 4UVEA 4BJ5A 2A57A 5KNBA 4MTCA 4AU1A 1CF2O 1ISSA 2Q2VA 4XUGB 4WBNB 3K5WA 1A9OA 1RABA 2V1XA 5BO5A 3TK1A 4P0PB 5ELLA 1I6MA 2JHFA 4RL4A 4UU8A 1QK3A 5FNVF 2GM4A 1P1IA 2R6DA 1MVNA 4YROA 3AXTA 3NV7A 4J2TA 3W6UA 4CEIA 3GELA 4MV3A 1NR5A 5ILQA 5ALTA 2PS1A 5EP4A 5IANA 3HCFA 3IBCA 4C1NA 1G8HA 3WSVA 4B8ZA 1ZG3A 3QKRA 5IBCA 5COQA 2CE2X 2KW5A 4ZC8A 4Q9LA 3OMWA 4PR0A 2ZB7A 1E89A 1B76A 4I6EA 4LQCA 3VX4A 5C5CA 1DQNA 1ODKA 4FYJA 2FJUA 4MVJG 4C4AA 3HRKA 3OAAA 4K7JA 4A82A 4QDOA 2H5LA 2K4MA 2L0XA 1CNEA 3TOSA 1GAJA 1RRKA 2IJGX 2ZK7A 3FTCA 5FPHA 3EGXA 4Z8XA 3Q8XB 3ZI4A 3MEQA 5LNK1 4B3GA 1BDJA 1NU6A 1FNBA 2WNHA 2ZREA 3QIVA 2P67A 4K3UA 5JWRA 2PKQO 2VPWA 2CZQA 4WOKA 4E2YA 4LZJA 1OBHA 3BN3A 2BFPA 1L5GB 3FVWA 2ZG6A 3S29A 3UMJA 5E1BA 3RREA 1R10A 4M0EA 4WJZA 1NW7A 3P0FA 4BMDA 2FWJA 3N3BC 4Y9SA 3V4SA 1MA0A 1V3UA 3A28A 5EIOA 4OBXA 4PHCA 4KXXA 4HWOA 4J1TA 4M1YA 1DAEA 3EFBA 4QWWA 4IZIA 5FYQA 2NM0A 2V7PA 5E4FA 1C1XB 5KQRA 4H6VA 4BE4A 2GSDA 2W22A 1JTFA 4N48A 3PHLA 1FLVA 1PS9A 1UBHS 3HDGA 4XQ9A 1KYVA 1X1AA 3FROA 4P7JA 5HE9A 4EAAA 4BNKA 2BFBB 3DOIA 3QWBA 4JROA 2B7LA 4TYYA 3RSCA 4MKXA 1E1RD 3A1TA 3KAQA 3L8MA 4ZAVA 3REQB 2G6BA 1SULA 2A1UB 1Z6QA 5DN6A 2FN7A 1RHRA 4C7KA 2J32A 1N75A 2Y1FA 4L4XA 1LU9A 4TS1A 4ZU3A 4UZFA 3T9BA 1FP4A 2FUKA 3VMFA 4AJJA 2JGFA 3C7CB 4IOKA 3KU1A 4Z4HA 2PGXA 2REQB 3D3WA 2ZSDA 4M1SA 1WZ2A 1A27A 4UUMA 4LBYA 4B7UA 1LS6A 1ZYUA 3I3SR 5CEEA 5EUBA 1WY7A 3TLEA 3UH1A 3JQGA 2GWHA 3CU5A 4E4YA 1JKMA 3DEJA 1KVUA 1A4XA 1NJ8A 1SNYA 3R6LA 5JPIA 1GT91 1EAMA 5KNBH 2W6JA 3GH3A 1I2BA 2Q1WA 1I33A 3ZPXA 5I8ZA 4BEBA 2AG8A 4DA8A 1G3UA 1SXJD 3WFIA 1US8A 2Q8NA 4TOIA 1FLAA 1KZ9A 1TKAA 1BX3A 3FY4A 1BMQA 2II6A 4R3UC 1Y3IA 4XX0B 2I80A 2NU9A 1W73A 3G1UA 5F5XA 1MEJA 1WXGA 1IY9A 2P6OA 4XWGA 4DIOA 4BQFA 4OF4A 1P1RA 4F12A 1U7HA 4K8RB 3OHPA 4RH0A 1E6UA 3QM1A 2XEXA 1AZLA 5IH3A 1A9XA 2HOQA 1Z35A 1M5UA 2CXSA 2IHBA 3EOAI 1BCRA 1RZRA 4TN1A 4M46A 5AJVB 3PX7A 4G0XA 4OX9Y 3NP7A 4EJ2A 3COPA 3T1TA 1P0CA 1SIBE 1NULA 4RHEA 1A9SA 5B3LA 2FMUA 2X2EA 5BR7A 2PUGA 5FLYA 4KODA 3ZG6A 4LKOA 5AVWA 3TG2A 3ISJA 4LDRA 5HJEA 2VR1A 3C8UA 3RK0A 4TV8A 5BW4A 1EIZA 2HUPA 3IXLA 2ZUEA 1E1DA 3KKPA 5A4KA 1C8KA 1KFEB 2RJNA 3PJFA 5EC8A 3OP1A 1I0ZA 2B1IA 4D9JA 3TLMA 4BNJA 4Q12A 4X90A 4DLVA 3BDVA 3E9ZA 4A8PA 5ALXA 3QNWA 4D74A 3L40A 1NJFA 5LWQA 3EVBA 2YMQA 3D7LA 3TQTA 3F5QA 3SNKA 1NNUA 2QRQA 4GPIB 4TKLA 1D6NA 1PR2A 4QBIA 2JDID 4R8MA 5T6BA 4N41A 1EVLA 2ZYAA 1OSNA 3GJ7A 4C2AA 4KE8A 5CT5A 2EW2A 1OI7A 3WK5A 1CRZA 1FP1D 1GGNA 3MC1A 4LXIA 2PQ0A 4JR2A 3GMIA 1W4ZA 1LC3A 2FPOA 3DL4A 2G76A 3NORA 2PMCA 1QHNA 2IIQA 2ZPUA 3HUFA 3OMXA 1JPJA 1M8KA 1ZQ1A 3AW9A 4ENRA 3HUEA 2HLPA 3BHJA 4I4LA 4MW5A 4NENA 3W8RA 1MW8X 1QRUA 3PJGA 4FHZA 4JVMA 1NVVQ 2A3RA 1Z25A 2QTWB 1CCWA 2JGJA 3HKEB 3UFXB 4BLUA 2PWYA 1XDDA 1D03A 5LA6A 1Q2UA 3SX0A 1XMXA 5T67A 1D4AA 4NPAA 3LXUX 5G0SA 3N8KA 5B6IA 2N0SA 1ETUA 4L5AA 4PZLA 5HFAA 3U7RA 3PXEA 1KWKA 5F2NA 1ZH4A 1XFDA 4ZMBA 5F1OA 1XUOA 4HLUC 2DY0A 2FY8A 2VDUE 1RJ9A 1OFHA 4N6OA 3VNAA 4ZD6A 4JZYA 4CKWA 4UXJA 1NQAO 1R16A 2QS9A 3OEHA 1OXVA 1P91A 4OMFG 4TZTA 2J5XA 4G4SO 4N0DA 2D1YA 3PEUA 1Q7RA 3TUIC 1XMOB 3WQHA 4XCVA 1GUAA 3B1WA 3BORA 3D0OA 3KXKA 1KQOA 2PO5A 3BJMA 3NTUA 4EG8A 1P2TA 2BCEA 3LX6A 3AR9A 1G6KA 1DAHA 4I1VA 1SH7A 3VFDA 3VI4B 4AF8A 3ZNQA 4CM8B 4P82A 3I4LA 3O91A 4G1BA 3D02A 5LIPA 1H93A 4XB2A 3H84A 5AUQA 1GNLA 2Q5CA 5BP7A 1WPRA 3PNYA 3MPOA 1GNPA 5K20A 2PKCA 3AVPA 1GG5A 1WMBA 1VE6A 3KOMA 3GI1A 1THGA 2WU0A 2XQGA 4IDBA 1OI2A 5LC1A 5CYGA 4XWWA 1OA0A 1F14A 1B2LA 3CZ4A 4MAFA 4ER5A 1S3FA 3GFGA 1HQCA 1LI5A 3JWEA 5ALEA 4B4KA 2OUKA 4PONA 1X8LA 4EVQA 1M6EX 1WZEA 2WYHA 1S4MA 5DV9A 2JGKA 4MQLA 1FYFA 1PHPA 1F20A 4PY2A 1RRPA 3UANA 3EE6A 1BWPA 4IP0A 3IRVA 4BZWA 3KQKA 5ESDA 2P9EA 4AKSA 1L1FA 3TECE 3QKIA 1GKYA 3I9JA 5HXAA 3C7AA 3VR4H 1JHZA 2FSGA 2GPNA 4DSOA 3KB8A 1QCZA 2DRIA 2I3AA 4MARA 1SAYA 4W6QA 4AFNA 4QG3A 2E55A 2NZYA 4YRGA 2QRLA 4G5SA 7MDHA 4GC5A 4OFXA 5FL7D 1I6WA 3S2IA 1JLRA 4CIXA 4MA0A 4Q4AA 1ODJA 4NMWA 5H82A 1PP4A 4TZKA 3AHFA 2BGWA 4C6HA 1SN7A 3N58A 1DG3A 3KUXA 4RKRA 4ZVOA 2DG2A 3JD0A 1XWFA 3CRQA 1RLIA 3NDBB 1NN1A 2DHQA 2IUEA 3BL5A 1HSZA 2DR2A 3U4GA 1LTHR 3R7AA 4CLDA 1HFKA 2Q3DA 5IDXA 2Y1OA 2XITA 2UXCB 2Q45A 3NUZA 4YUZA 4QGFA 1I6LA 4RQUA 3KETA 2FWMX 5F78A 3JTMA 1IRIA 4N0MA 2FPPB 1O54A 1BH6A 1NKTA 2GS9A 4KO4S 4HVLA 3EPLA 1THZA 3A1UA 2WR8A 4FVTA 1CYDA 2CLSA 2V1UA 3KE8A 1DKQA 2Q2NA 3KSZO 2AEMA 2W8ZA 3FKQA 3ML1A 1S02A 4RMJA 1YF3A 4JGGA 3QX8A 3WRYA 3AVXA 2PTGA 4B3JA 1FMLA 2H7YA 4QVKA 3UW1A 4G01B 1J9ZA 3B60A 3ECAA 3OZTA 1EESA 2XUZA 1V4VA 3K70C 4EHAA 1XKLA 3SAJA 4KIUA 4ARZA 1KJYA 3P9SA 5IJAA 1P2VA 4XA8A 1G6Q1 4TQ9A 1U65A 5MN5A 1WF6A 1XYGA 1E8NA 2OK7A 3ETNA 3R5JA 1W19A 1Z36A 3GEEA 1JMYA 4AY4A 5JAOA 1RAEA 1E3QA 2F17A 3AM1A 3SLKA 2AI3A 2DJIA 2OPHA 3TR6A 1DE0A 1MOPA 1XYYA 2B37A 3AUTA 3GC6A 2GEKA 1J9EA 4RTKA 4WQMA 4KWTA 1ZJ4A 3EIUA 4B4OA 2HH9A 4LOLA 4LRUA 5M5BA 3V4PB 2O19A 3SEZA 2QN3A 4X1YB 2DQ4A 2VYND 3PL1A 3RAEC 2R84A 3IQGX 2VYVD 1ZWLA 5BUCA 2QTLA 1A8IA 2JAQA 3IQXA 1ZA2A 1DP4A 2WVHA 1IN6A 3WGTA 3KS9A 5DK6A 4ML3A 1PX0A 3EEQA 2ADFA 1O6CA 3GRKA 3LY5A 1NVBA 4B9AA 1WD7A 3U49A 1DIAA 3GEIA 4N7MA 3TRIA 4HFJA 1ZRHA 2ODPA 1ZK1A 5JVDF 1IEWA 4W4TA 4MGYR 4YHBA 2VTEA 1F17A 1UBLS 1XEWY 1G8AA 2NO7A 3FDXA 1ZD1A 3LLMA 1RJGA 2QG9A 5FPYA 5DTMA 1SBYA 1LI4A 3BIXA 4M21A 1MAUA 2QT9A 2RHGB 1QSGA 1Y5IA 4MRAA 5HQTA 1H22A 1LLFA 1RWWA 1NDQA 3WZ2A 2J3MA 2WFLA 4AZ3B 5T4EA 5A9SB 1M0WA 2DFLA 3FMPB 3ESRA 4UEOA 2ZVJA 1T9ZA 5T6MA 1U2QA 4HBGA 1DBSA 1EFTA 4CM9A 1PGOA 3AG5A 2QBYB 1TQ4A 3KJXA 4NYJR 4FFDA 4AJ1A 4FM9A 3VTAA 3S1AB 3ZZMA 4YACA 1BKSB 2JEOA 2P40A 2EU8A 3DP9A 1FUEA 2JGEA 2RH5A 4MYHA 1RPJA 2CJYA 2EDCA 3HKEA 2N1MA 2Y0PA 3EDMA 1NXXA 1P1FA 3ZE8A 2XJ4A 1U9IC 3GJQA 5TMEA 1I1HA 4C7JA 4A03A 5CFRA 2PVSA 4YBZA 2ZZMA 2ZWAA 4F6RB 2ZWMA 1IQ0A 2CYAA 3AINA 1V25A 2QN8A 1DT5A 1ZNYA 5J2TF 4JELA 3OTIA 2ZYUX 2IVZA 4CPDA 1E1QD 1SRQA 2PD6A 4YRSA 4DB4A 2WQZA 1IDN1 1QFJA 2PGLA 3IFSA 3PJDA 4XGRA 3V46A 2PD4A 3OT5A 1S6YA 3BWMA 1ZJYA 3OIYA 3X44A 4OBBA 4CKCB 1QZTA 4LDPA 4KBYA 5DF1A 1XGKA 2VC2B 4YJHA 2FFAA 2FPLA 3BICA 4H2DA 1A8SA 3C4QA 3IIKA 3AY7A 3MWEB 4Z99A 3JYHA 3HO1A 3C87A 4RM2A 3QFCA 2Z09A 3IVRA 4WBNF 1B23P 1RKQA 3A6JA 3WWDA 4FFLA 1SQGA 1L5RA 1QU2A 5BMVF 2R65A 2C20A 2WJHA 1E9CA 2V6MA 1PW5A 4MNTA 2NT3A 3PRYA 2DGDA 1VJ5A 2WYOA 3WAKA 2OZEA 3KYBA 3AHJA 3H1FA 3Q7SA 4TVKA 3TQFA 1QNLA 1KSJA 4DIEA 4ZI2A 4EARA 5CLHA 4IJKA 4C7MA 3G2PA 1CE8B 1GA1A 5B7QA 2WKWA 3WYFA 4KXWA 4C4RA 1VKNA 4YJ2B 2CNNA 3HFJA 3BMCB 4BVAA 2BP7A 3KVRA 1LSOA 3CS3A 3OHSX 4A2WA 1EUCB 1J2EA 3FHOA 2HX1A 1LQTA 3B20A 5IZ4A 2H5IA 1MUUA 4MCIA 1S01A 3IAAA 1EGMB 3OZIA 1CQJB 3BWEA 4MJ3A 3UWPA 5CA0B 4WKGA 5E3JA 2A5DA 2D8AA 2Y1DA 4O1IA 3IQIX 4JJGA 1DCFA 4CCAA 4CDNA 2YJTD 5E0OA 4BZPA 2Q9UA 5TMDA 2F8LA 2GYYA 4CUZA 3N1UA 5AM3A 1X87A 1YBFA 1HFWA 1KK1A 2C00A 3L05A 1X1RA 3CONA 4OP1A 2HU8A 3LPLA 4GQAA 3JQGB 4ZICA 1C2YA 1XZCA 1L4BA 2J85A 4RJJA 1N3YA 1EX7A 5EQJB 4G1UC 1PV1A 3FJ1A 2EW8A 4XVQA 5GVRA 1PIWA 4E33A 3NWOA 5K4AA 1RKXA 3FNQA 3RV3A 2J0SA 3DFIA 3B2EA 1F8XA 1RLTA 4ENSA 5IJWA 5HIAA 4MWEA 4ZOLA 4DJ5X 4C2UA 5DVZA 2AKYA 2I1QA 1GA6A 3BDAA 3A9SA 1L5MA 1QHHB 3PWKA 4WERA 4BLRA 2ZXUA 4IHQA 4P1ZA 4M0CA 2OV1A 5G3ZA 2EERA 5IT5A 4F1KA 2PTHA 1M2KA 1OWNA 2IXFA 4WLOA 3RYFB 1N57A 1WY5A 4B34A 2I9KA 1VL6A 1Y6JA 5FF9A 4UBIA 4OQLA 5C0OE 2CB0A 3E7DA 3UJAA 5BY2A 4LDNA 2PVCA 3PEVA 3HY4A 3NYRA 2WD7B 4JGIA 5EMHA 1YGPA 4UPEA 3BE4A 2PAFA 4ZYUA 2GCNA 3WO1A 2X3YA 3WADA 3W5JA 4ZREA 1AHHA 2OGZA 4MEAA 4OHWA 3OA0A 4QX6A 3EXEA 3OCJA 4HDRB 1MNAA 3CGGA 5FOQA 3AJEA 3O4HA 3Q9SA 3CURA 1JPNA 2VP6A 4MRNA 1SBHA 5KYYA 4LPKA 1RE0A 4RSRA 4YX9A 3HNOA 2ZIVB 1MQSA 1PWEA 2H8GA 2QE6A 1KY3A 2IEIA 3SHOA 4U00A 1O9BA 3GLHE 3IO5A 1TYAE 3QWHA 4KQEA 2Y6UA 3TBKA 1EVKA 3VV3A 3PNKA 1R4NA 1QYRA 3J7AC 1T6XA 1X7HA 1E64A 2NQTA 3QPWA 2G70A 3GMTA 3GRFA 3NKLA 3QVVA 3ZU2A 3ZVLA 3DM9B 3ROXA 4CIWA 3DMTC 3PXAA 1J22A 5EKUA 3K0FB 1U2SA 4ZEOA 5DHPA 5J5AA 1W34A 1Z6XA 4X85A 3FTQA 3NUQA 1K3FA 1SIWA 2X4LA 4ZQEA 3MINB 4O1MA 3BWXA 2NVWA 1RS0A 3WV5A 2WWHA 5FTMA 3S8YA 1FY2A 3EZ6A 5KNCD 3Q7TA 2EWWA 2JFFA 2D5CA 2B2XA 2I7VA 3ESYA 2ES4A 3FRIA 3G9ZA 1P8AA 2OV6A 1F6DA 2ZT8A 4I1YA 4EB3A 3OOJA 3QEMB 3K2BA 4KQMA 1WKBA 4R68A 4B84A 2QY9A 3JR7A 4Z0HO 2OVBA 5L7TA 4LI3X 3SKXA 4MCAA 1DCKA 2Q3EA 4D2IA 1JJIA 1XQXA 3ZHZA 4ENVA 1AN9A 1R5NA 2QW8A 2WJ4A 1MB0A 2W6ID 1YONA 1KO1A 3IUPA 3NGXA 1WO8A 2HRDA 4J0CA 4BN4A 2GR9A 4QT4A 5CCEA 5MF6A 4JI5B 3QMWA 3SHTA 4X00A 5EJ7A 4IQ8A 1OFGA 1A2QA 2HU7A 2P27A 1KU6A 621PA 4LVOA 1CUWA 1RHKA 1XMJA 1TM3E 3AI3A 3BRQA 4GQBA 2XZOA 2AQIA 1DQRA 2BFNA 4F4FA 3K72B 1Y6GA 4HS9A 4WKCA 2WAAA 1XEAA 3EBLA 3QPCA 5EZ5A 4JOBA 3RTDA 2ORVA 3AESA 4YQYA 1N1GA 2R8BA 2CC2A 3Q2OA 4JJ8A 3S27A 4BRSA 3BWDD 3COJA 3D5TA 4DADA 4MVJD 3KKEA 1RIFA 2Y77A 5KYUA 4G0PA 3MTDA 4EUFA 2VVTA 4WX2B 2OQ2A 1ZFNA 3VR2D 4DMMA 1X7WA 1Z8HA 3PF9A 2QAIA 3UZUA 1NN3A 2J07A 3LRTA 2VDNB 2Z6VA 3ZVKA 1K8XB 1U8TA 4R6XA 5JDIC 5ER9A 4NV1A 3C3EA 1P1HA 4IH1A 3EXHC 3U3JA 2ZVPX 5BSKA 4JYZA 2CV1A 3I39X 4H77A 3QI7A 2NXWA 4PQFA 3UN1A 4R83A 1FZTA 4N5IX 1FL9A 4OUKX 1MAVA 1UMBB 1BMFA 2ZJOA 4GXRA 3D7RA 3GP5A 3FTNA 4JV5B 3LLSA 1G5TA 2YXEA 3OJEA 3QZUA 3X1WA 4D9NA 1AKQA 3F6YA 5KDDA 5DW0A 3TIXB 1DPGA 4RK4A 1FJHA 3TSOA 4O4IB 3O3CA 4PV7A 4UHFA 4N65A 1Z6TA 4YS6A 5G4KB 1MFZA 2M1XA 1Q3HA 3RAJA 3FCAA 3ZLVA 1SUEA 3IAM6 4J9UE 1JHPA 1BFKA 5IYZF 4ZJZA 3RBZA 3DBHA 3H9JA 2JGAA 1E1CB 4RXMA 1G3MA 4Q9JA 2AW5A 1KJNA 1L4GA 4QOIA 4ANFA 3ND5A 1MLDA 3ONDA 4HZUA 4NULA 1MC5A 3DXFA 2J5KA 4DR2B 1L2TA 2GRUA 2FSSA 4JP5A 2ZRAA 4MUMA 4D5EA 4Y98A 2WFZA 3A9TA 3V2HA 5CEJA 2P8SA 2JGNA 5ULLA 5TPWB 3ICQB 4I9UA 2A0UA 2B6NA 4OK3A 3GNSA 2C7OA 3RJTA 3RQSA 1ONSA 4G0UA 1AGYA 4BFSA 5CVCA 3PENA 3N07A 3A2NA 4IV8A 3MUFA 2AFIB 4YRRA 3OIFA 3ACCA 3VNQA 2IYEA 5J59A 1HK7A 4EA7A 2W6NA 2B9EA 1UWVA 1ZWKA 4KW7A 2J30A 2PG3A 4EAQA 1IUKA 3MJDA 4KB5A 4LZNA 4LYGA 4EL5A 1A9TA 5A7FA 1IBKB 4X63A 4WZAE 5LZ8A 2AJCA 3EYAA 5L3QB 1YS9A 1EP2B 3D9QX 3DWGA 3ROTA 1OTXA 3AF2A 3LPAA 1PW7A 1Z0IA 2J3IA 4FQ5A 3U3DA 1K98A 9LDBA 2CW5A 5DGTA 2R48A 1Y4UA 2VI5A 5KS2A 5A5EA 2WRZA 4FCVA 3D2BA 4EG7A 5BORA 3S2FA 4O0MA 3DH0A 5B3JA 3FETA 3UK2A 4DLKA 5FPQA 1PR5A 3U62A 2BCGY 2G9RA 5CXXA 3ZIAA 2A5YB 2WE7A 5JS6A 2GN1A 3LCCA 4EYGA 2P62A 4BP3A 4S3MA 1M76A 1V2HE 5DM70 1CBUA 3N7UA 2LD4A 3JYPA 1QS0B 2UUPA 3DD1A 1E4EA 3HJRA 3LHDA 3F6SA 2FSPA 3KG2A 3GVPA 4XUDA 5LKAA 4PSCA 4EK9A 3U09A 2ETXA 4IVPA 4ITVA 5EUQB 4MUXA 3RC1A 2WQ6A 5EJ4A 3DAHA 1OVGA 4NZZA 1EK6A 5L4LA 4FHEA 2O8FA 5CCBA 1U9ZA 4DJFC 1P8JA 3GFQA 5K3BA 5IXSA 1GSOA 3OQVA 2CNBA 1RU3A 2JVJA 4C76A 2ODNA 1II8A 4H18A 2F8MA 3OX2A 3KZCA 1V5FA 3R7LA 2A7XA 4X0EA 2F67A 3VPXA 1YZLA 2EATA 2GFIA 2W6JD 1SXGA 4QRIA 4WZBE 2OMEA 3R09A 3ADBA 4MWBA 3SC6A 2J5RA 2GEBA 3N2LA 1T2AA 4D9HA 4CU5A 1U3VA 2IH4A 3TQOA 3TSAA 5ICGA 1G5RA 3NHUA 4MQEA 2QRZA 2VBGA 1XVUA 1NTRA 1STOA 1Z82A 4MR9A 3BSYA 3KUDA 2BH2A 3FCYA 1KOLA 2VSNA 1K7FB 1W8IA 3KVVA 1Z5ZA 2OMKA 4BKPA 2ZUUA 2Z5LA 3INTA 5H70A 1MTZA 4IPTA 1ND6A 2R7LA 1KO7A 1CP3A 3O31A 3H04A 1YZUA 1C0EA 4BRUA 1WW8A 1MNQA 4DCGA 1XVTA 2K7ZA 1RZRD 1BSVA 4XR4A 5GZ6A 4HUQB 2WJGA 3NGLA 1PUJA 1IWPB 1CXZA 1NP3A 4RZQA 2ORYA 3MS4A 3N05A 4PR3A 4EG5A 1K7YA 2O6LA 1XK6A 1EBUA 2H1RA 3FNRA 3LUBA 3GL9A 1LBHA 1ONOA 2ZJAA 2HMAA 1W49A 4M60A 4G8BA 2JATA 3K30A 1D07A 1DIGA 1TQ2A 2X1HA 4GOLD 4GRAA 1ANKA 4TLMB 2BJVA 3SYMA 3T5GA 3AX6A 2XA9A 4HUJA 2C9BA 2XIQA 4L16A 4TWJA 1H2FA 3D7NA 3VOTA 4RK7A 2AZXA 2L42A 1ZZEA 4XWAA 4CGYA 4RLHA 1ZXXA 2OGSA 2YYZA 1CY2A 3MD0A 1W35A 5BR4A 2EKPA 2KB0A 1SG0A 2VHTA 2YWJA 2XMQA 4ZTUB 4KLRA 4AK9A 1P0FA 1V5GA 5LBUA 1DINA 1W0KD 2DPLA 1ORWA 3EA4A 3N0XA 3R41A 3WHPA 721PA 4ZQIA 1PNOA 1J21A 4KEAA 4OLAA 4EQ6A 2AF3C 3MWLA 4OJMX 4HWKA 4GBJA 4G8JA 3SM9A 2ZAIA 1P62B 2A9VA 2AN4A 1M54A 2EZUA 2VAWA 2A0XA 4GW3A 3HSSA 2YQZA 3S40A 1Z7EA 3ILYA 2GZDA 2HNAA 4QOSA 1TM4E 4XGKA 1XNQB 1BU5A 3H8VA 2IDZA 1CYEA 1COWA 3KT3A 5E38A 2XNSA 2HXSA 1EFRD 4CQMD 5L51A 2QYHA 4XOUA 5I7AA 4CG3A 4J0KA 6PFKA 5HK8A 1Q3KA 2IZ1A 2KBEA 4Q4AB 4DCVA 1YCHA 4GOOD 4H1HA 4BNXA 1SK9A 1T13A 2AUMA 3NC4A 4Y0AA 3RSOA 4ZOCA 4QUHA 1UADA 3KRTA 1E9EA 3HGMA 4N18A 5DJ5A 3PT5A 1M2EA 3FDJA 2BDUA 4B8WA 2EJVA 1VXRA 2G4CA 4FWTA 1PN3A 4K1XA 2VSFA 1N2EA 4XB6B 2WHYA 4N5MA 4UM8B 1B6GA 3RU2A 2V97A 4ER6A 3PIIA 2EZTA 4IRUB 3FHLA 3OT1B 5CK4A 2H3EA 4V2IA 5A9SA 4Z54A 1L7OA 3ONWA 4NPHA 1B15A 4KUEA 1I5OA 4REQA 1NHWA 2TS1A 3INRA 4B2IA 4QM6A 1KKLA 2XW6A 1R5JA 3EVNA 1PJQA 3F9IA 4FOOA 3KYDB 4WK2B 4DABA 2VPTA 4UTRA 3H11B 3M4JA 3W6NA 1PRYA 2QTFA 3KQQA 4R9UC 3UPDA 4H1WA 1W76A 5JAQA 3NBZC 4O08A 1YVEI 2QT0A 5TPWA 3HJCA 4UBMA 4JLJA 1JEQA 1DCMA 4URZR 2EKLA 2CZGA 1H69A 5CHEA 4L9SA 2OZLB 1GNSA 1T25A 1F2TA 3AFGA 5HIKA 2E1PA 2AN9A 2P68A 1WPQA 3QYFA 4KVZA 4Z1MD 4MVWA 2PT5A 2QTMA 3KB1A 3SJCA 5I8WA 2XSZD 1RWQA 4UUBA 4BGVA 1KIAA 3OUZA 1F0YA 4M4SA 4C07A 3VJKA 3E05A 3IEMA 4NDAA 3JQBA 2AEJA 2AFIE 3ASZA 2PYIA 4N1AA 1J5PA 2H08A 1K9VF 1Z0FA 3BHIA 1FRQA 5CG2A 4BCDA 5JRJA 3M9XA 4JBWA 5JZVA 4H7PA 2RHMA 4FSXA 1OZHA 3OWOA 1ZOSA 3VGPA 2QRMA 1BVUA 3JVVA 3BHNA 5IP5A 3P9NA 4B9EA 1A82A 2ZAMA 3ITEA 4D43A 1RYEA 1E61A 2ISCA 2PWZA 5TVKA 1N2ZA 3W1VA 3A6DA 1XL1A 3A25A 3F3SA 2QT1A 1QKIA 1XVLA 3A14A 4CNQA 3MBKA 5AD1A 1ZK0A 1YJQA 4GIBA 4DMFA 1MC1A 3E1KA 3VO9A 4EQ6B 3RAFC 1UKCA 2BRUA 1DX4A 2REQA 3CUYA 3D3WB 3M2TA 4TV9F 3KB2A 1UP6A 4Y2VA 3KD2A 2FXIA 1Y1KE 2C94A 2OORC 3VVCA 1F12A 1DLJA 2Z1MA 2QL7A 4QDTA 2VEOA 3DT9A 5GONF 1R37A 4YMIA 4FQ8A 2P77A 1YUBA 2UYOA 1AT1A 1P2FA 3AU8A 2A9KA 3GV0A 4JFRA 4EENA 4ENTA 2OCLA 1Y8QA 2DFDA 3BMCA 3HMQA 3T9FA 2C7VA 2GHRA 2NSDA 4GMFA 4UM9B 2XTZA 5KX5A 3N2ZB 3STYA 3AR5A 4K1LA 1PYGA 3OCWA 4QDJA 3BZBA 4NP6A 1HC7A 1PNVA 2D5AA 4U7GA 4ZANA 5AI6A 5CDFA 4DLUA 1MBZA 4YRAA 1JAHA 4NCNA 5F7JA 2ZSIA 5NLLA 1QIMA 2HIHA 2I03A 4CETA 3OIDA 2XOXA 2CT8A 2C7GA 5ITSA 4HBZA 4LI0A 1N2GA 4LJ9A 4K05A 3PXCX 3HK2A 1ZSYA 2MMCA 1A5BB 1FXWF 1QFSA 2H4HA 1D2GA 3JRWA 2ZJYA 5B58C 4W5HA 3D8RA 3DBLB 5A0FA 1QV7A 4XM1A 4HK4A 3N8DA 3VM6A 2EFJA 4PZDA 4BFUA 2CUTA 4LHWA 4YJ3A 1G9XA 2LPMA 1NNSA 1L5HB 4AC9A 1JWLA 3UKJA 3M3HA 4MP6A 3WGJA 4MQ5A 1JB9A 1YIDA 4UNIA 1OU0A 3RRYA 4JP2A 3WK6A 3INGA 4XVRA 4DE5A 2VBIA 2J9FB 4GC9A 4YWHA 4HGPA 3C3JA 5EXTA 5EWMA 1KY4A 3ADKA 3EVGA 1JPVA 2NO4A 4QPZA 4B79A 3KTOA 1T0UA 3R40A 2ZUVA 4YCAA 3EQ9A 4C6TA 4HAVA 4CQMB 2CNKA 3TQSA 4QSMA 1PJCA 4QG7A 2Z3WA 1SB9A 2R0QC 5CXQA 3F3MA 3A1SA 2XECA 1NBWB 2PH5A 3AEYA 3G2HA 3IIIA 4MUIA 2OAQ1 2HYDA 1MO4A 1JSCA 2R8PA 4A8HA 4JUFA 3UC5A 4HFNA 3PHCA 4WCFB 1E4OA 2OFOA 2VT3A 3FX2A 4L0MA 1VL2A 4QIHA 4UXIA 1EKXA 5K3FA 2ZBQA 4JJ6A 1OH8A 1DUVG 3GLRA 2YHIA 2V98A 4NDZA 4NCHA 1LWNA 3PU6A 1JIVA 1TLLA 4KNWA 4XVUA 2J7PD 1KBOA 3WMRA 4OHPA 2TMKA 2CSUA 1NBHA 3L8ZA 4RSGA 5EIWA 3JU3A 5C8XA 4IDNA 4YDRA 2XTAA 3PYXA 2E4UA 3GJSA 3IE2A 3VV2A 2C5GA 1QVVA 1K0FA 4O4IA 1ZQ9A 3MJCA 3T8YA 1MABB 2HDWA 5HTOA 1PDVA 4MVJP 4BJ1A 3PEWA 4JUDX 3EQ6A 2D59A 3FB4A 2G9QA 1CIJA 1FNSA 5ALUA 3FPBA 5EHZA 2QX4A 3HGTA 4A36A 3QLVA 1QZZA 2ZT5A 3CRNA 5A05A 1QIJA 2WJPA 1ECJA 4W5WA 4MUKA 1JQDA 1VYTA 3R8FA 4DJTA 1X92A 2GH1A 2SCUA 3C3KA 5DNEA 1JKIA 1E9DA 5DH9A 4N40A 1ZDMA 4FU0A 1IONA 4G5RA 1ATIA 1RYZA 5KSZA 1G0OA 3C8DA 4C7BA 1EFKA 4LE0A 2X0FA 3PVCA 3SF0A 3ZWDA 1TZ2A 1FB5A 2ZETA 4X97A 3TOVA 1XJ0A 3QYPA 4P36A 4LGVA 1QJCA 4PG6A 2E4WA 3G2LA 5DIZA 1MP0A 1TIPA 2C2WA 4X94A 4DA4A 1K6JA 2C9DA 2GZ1A 4U7FA 1AS2A 3J81A 2C57A 3SN6A 2ODWA 5G53C 1EEHA 1ORDA 2BKEA 2ZWIA 4JL8A 3S1AA 4XLZA 4I9NA 4R16A 4FCCA 4DAEA 2DSTA 1XRJA 4Z7JA 4TTPA 2FR8A 1RM3A 2H0QA 4XX0A 2G06A 4JP1A 4ZCQA 4BGEA 1XTUA 4D99A 1Q84A 2FR8C 3Q0EA 4QUEA 3V1MA 3KEOA 3W0LB 3KE9A 1DWPA 5BSEA 1R4MA 4GKBA 1CJMA 3EQ2A 3LF1A 5DBFA 3W9YA 1XMIA 1HZZC 1PL0A 5CP8A 2EL9A 2HGZA 5LU8A 2OV3A 5BWMA 1P5ZB 1XMSA 3ZGOA 4DA7A 3IP3A 3WL6A 2R47A 4CGZA 3Q8KA 1DO0A 3A1DA 4A0HA 4XH9B 2NU7B 1U7TA 3MTEA 1C7QA 2JGMA 4HDQB 4WCFA 3PC2A 1QGZA 1NW9B 1J0DA 3NYWA 1CJKC 5K3FB 1MW9X 3TNJA 1DKRA 4EHFA 5KQMA 5MHTA 1GITA 2VOJA 2EKDA 2J4FA 3OIUA 5HMLA 3RADC 1Z7BA 3WLSA 3DE2X 5D7NA 3UYLA 3ZGYA 4QJ3A 2OD2A 3LI2A 3OOEA 1COWD 3EFOA 1BXKA 1T3TA 1XEFA 3QX7A 2Q5LA 1KPGA 5DFAA 1C30B 1H3EA 4EUNA 2GXSA 2IKSA 2JDIA 4MCHA 4ZMRA 4MICA 1QB7A 2ZRNA 3EW9A 5F3RA 3TRJA 4NFYA 3UJPA 2FG6C 1Q7EA 3NYIA 4DC0A 4RGYA 3WYEA 1UDXA 3E1SA 3GG9A 3L01A 1FE8A 3X1XA 3RV4A 1GSAA 1MMFB 2ROQA 4BLWA 2ZRCA 2EC5A 3TUZC 1ZL2A 4FEGA 1NG1A 1KS9A 2AHRA 4P98A 1UJCA 2JPDA 4HXYA 1ESZA 5KTMA 1OFIA 4N01A 3N3AC 3DOHA 3CRRA 5GV7A 4P4LA 3RHSA 1OFUX 3E5MA 4FYPA 1OFTA 2PYDA 4Z4GA 2FZCA 2ZIFA 3ND9A 4JI7B 2SBTA 5C35A 3NRCA 2DKFA 4UC0A 1GNRA 1CR4A 1DWQA 3I3OA 2NZ8A 4NENB 4IL5A 3UOGA 4V38A 4B6GA 5F2EA 4NMHA 1H1DA 1T2VA 1WW3A 4C29A 2ODEA 4M0MA 4U7WA 4PLWA 5SZIA 1SXJE 1UQRA 3PC8A 5CJJA 1VA4A 2JHAA 3GDGA 3K0AB 4YRQA 5BPHA 1BA2A 2J1LA 5B1DA 4WIAA 5IJXA 3F2VA 4N5LA 4P4GA 3QLJA 4UZEA 3C48A 4AMYA 4Z2YA 3RM3A 1E1MA 2VRCD 3ZHCA 4BYGA 3WDMA 2BEVB 1YKGA 4MR7B 5AW6A 1TU4A 2HXYA 4YRCA 4CTKA 1TL7C 1U0NA 1ZCAA 2FQWA 3H97A 2VHJA 1TGVA 3H4IA 4LGYA 5K8CA 5FTLA 1EDOA 1X7ZB 5TDHA 2WUGA 3RTCA 2D2EA 1I2ZA 1EE2A 1I7PA 1XROA 2CBXA 1MORA 3O1LA 4PHFA 4ZODA 3C6ZA 1ISHA 3V2IA 1B7GO 1BYUA 3KQNA 3NCTA 1TMGE 2NYVA 2V6GA 4GRIA 1NONA 2PZLA 1NM5C 1R6VA 4ZO4A 2CEAA 5IVDA 3WYGA 5C1OA 2V4MA 4OGFA 1BAPA 2IYVA 5FQNA 2I5PO 5CURA 1FYEA 3FFAA 1Y1TA 2ZULA 3T9AA 3U16A 1W94A 2I91A 2OBBA 4CMIA 1ODSA 4WLVA 4DLLA 2PN1A 1U63A 3B82A 3DB1A 2P1RA 1LFDB 3FBWA 4U2EA 5F7ZA 5G4KA 3QLUA 2JLRA 3I1IA 1II9A 2CJWA 4DIUA 1YZFA 4FDVA 4GVXA 4MVJE 1TYEB 4BEWA 3DLCA 3M1YA 2FW9A 3GF4A 1YQDA 4JI0B 4ZU1X 4D80A 1OTHA 1C0KA 2ZIZA 1U0SY 3DEFA 2A1TR 3C1TA 1Z0ZA 4M8IA 4L0CA 1X7XA 4Q3AA 4TWBA 4B4DA 2CF6A 5CDSA 2E9SA 4CJXA 1ZBQA 3KVOA 2P6MA 3MS2A 4IMIB 4QEDA 1TRKA 4LUCA 1U9IA 2C3UA 1FPMA 4WDQA 2EXXA 2QPTA 2WT4A 4NR0A 5HWSA 4IFEA 3PLAE 4Q4CA 1JEOA 3NHSA 4H1TA 5KQLA 3EFEA 1XAHA 1ZXBA 5EJ6A 2I4RA 3CF0A 2C92A 3A1VA 1RJFA 4OJNA 5H3LA 2WJJA 2VP3A 2O59A 3NG1A 1USIA 1UFVA 2VNHA 2F1KA 5D3QA 4NZOA 3TINA 5EXXA 1KSGA 3GGCA 2I66A 3GB9A 2ACKA 4CV2A 3OE7D 1FP7A 3OMLA 3L5OA 4FHCA 2Q3JA 4N3BA 4R1TA 2O57A 1I4WA 3BA6A 3ORFA 5K6RA 1Z08A 5A5VA 1TQDA 4XLTA 4CBVA 3KPWA 2O2HA 1MB3A 3LH5A 4NG5A 1S9DA 2JCBA 4UU1A 2SCUB 1I5RA 5U1PA 2H2AA 2VP0A 2R62A 4JQYA 5BRJA 1WB6A 1HNZB 2PZGA 5CJPA 4RXUA 1V95A 4F56A 3LX4A 1DBIA 4LTMA 4Q16A 2W6ZA 1YRQA 3JR3A 4B3CA 4BFVA 5LB4A 1P0MA 2W2PA 1H5UA 1X13A 3I6YA 3SEQA 3B9BA 1PZGA 1O57A 1SVNA 4B2YA 5ED4A 4BMXA 2CF5A 2H9AA 4TWZA 3LQ1A 5CM8B 3FNFA 1KK0A 2JL1A 1HQKA 3GUCA 4HAUA 5KYNA 1XRNA 2GBPA 4QPPA 2W42A 3ENVA 3DUFB 3TKAA 1GNTA 1JQKA 1UP4A 4WXMA 2AG5A 5ALGA 3VNRA 5FR1A 3IAXA 3NNSA 2VPXA 3OE5A 4K88A 5LP1A 4R2XA 5IK2A 1Z4MA 1N5DA 1S89A 1V8ZA 4LK3A 3SX2A 1I2AA 3ZHQA 1K92A 1QRAA 1S2LA 3CVJA 2FEWB 3RRBA 1H8EA 2R8OA 1KYQA 2HRRA 2AF4C 3HCCA 3SOPA 2DKOA 2Q0HA 4F38A 2PX2A 3GCWA 4O2AF 2YZGA 3JZDA 1E3TA 1RKBA 3KWLA 4PPGA 1QV6A 4BVHA 4BOYA 2HPVA 5JCPA 4XLLA 2HMUA 1XNHA 1FQKA 2EFDB 1DG9A 2H7XA 2IHYA 2XUIA 3EUWA 1DEKA 1KOJA 2P2LA 4ZJYA 5JNWA 3BE6A 3NWBA 5F1YA 1CB0A 1ZUNB 4Z9XA 2WEKA 1OXUA 3LT5A 3RNLA 5ESWA 4FKMA 1QO0D 3QTTA 1NGSA 4LOKA 1NPDA 1P5FA 3DZ8A 1ESMA 3P4YA 2OHHA 4YP1A 1H9CA 1AMNA 2XF2A 1VG8A 2BE9A 4RTJA 4QICA 2JZCA 1F06A 2JANA 4S1TA 5E6SA 3TOZA 2ZYVX 2I3DA 4W1QA 1KEZA 1GV1A 4DM4A 3NM6B 4X61A 1GCUA 3LC7O 4BMVA 1FDUA 4J7CA 4R3NA 5JZSA 2DB3A 4D6PA 1FX0B 1Z12A 1DARA 3W2FA 2FOIA 1Z6YA 4QNMA 1YR6A 5ITVA 2VYNA 2SECE 1O58A 1YJ5A 3BJZA 1JZQA 1VCHA 2QZSA 2WT9A 4FBLA 3D2LA 4OMCA 2BE7A 3TXXA 2FPKA 1L4UA 1M66A 1OFVA 1AHPA 4N7RA 3VZCA 4RFLA 4BP8A 4H0FA 3RTEA 1FSZA 4S24A 13PKA 2E3JA 4H15A 4ZVQA 2XNHA 1HLPA 4UNPA 5E9QA 3R7WA 1FFYA 1L5WA 2WABA 1M2GA 1UKZA 3AU9A 3CR7A 1D5WA 1NVXQ 2BUAA 1R74A 2OUIA 1V4BA 3H9BA 5E6UB 1E6MA 2UVDA 4GX1A 4KZKA 2XDAA 3SDBA 1A88A 2XUJA 3KQMA 4K6GA 4MWZA 1UC5B 3CYFA 4OHFA 5ARBA 2NXEA 3RS7A 4ZT4A 5H16A 1DXQA 2BF7A 1EPUA 1WABA 2JA2A 2QR3A 1J8YF 1IM5A 3KKZA 1HETA 1NNI1 3IRUA 2NWQA 3E22A 3F4BA 3GJ6A 2ONJA 4AXXA 1L8QA 2PO7A 2VL7A 5LXTB 1UBEA 4Q6BA 4RA9B 4AG3A 4DLXA 3CW9A 1NOKA 1PHRA 1N2CB 3EB9A 4Y6LA 2F2TA 3K6JA 4LYJA 1SPXA 4DY6A 4FFWA 2X1VA 3JQ7B 2G67A 3DZDA 4QTTB 4BNTA 1SKYE 4F0JA 2DECA 5CNIA 1P80A 1HDOA 3KSMA 4E03A 1NFRA 2C8LA 3ZD6A 2GJAA 1V9SA 1SXQA 3KO8A 2IUUA 4TTQA 4D44A 2ZRDA 1CZHA 1JTVA 2PUDA 4LK2A 3H19A 1SCQA 1VM6A 3LYAA 1IXKA 3KAKA 5AXBA 4ZDWA 3V4FA 5I7EA 2AKEA 1R0WA 1Z3CA 3RYTC 1G7SA 2JJQA 1XN1A 1U8XX 3COZA 1TTTA 3OZUA 1LNSA 3HVUA 2RSLA 2PT7A 3ZY6A 1MO5A 4JITA 4H6XA 1KI2A 2FUG6 2ANCA 2QP9X 1P44A 3A6EA 3Q15C 1L4FA 4PSAA 4DOMA 3AH8A 4OM7A 3TRHA 4AS3A 1N2HA 3AKDA 3LY7A 1HBJA 1YASA 4DJDC 4L5JA 3HJGA 4E5VA 5K6AA 4O2LA 3GVHA 4WZBB 5TQJA 2XSZA 1IHPA 1SO8A 3EQ7A 4L57A 2X7XA 4DBLE 1OLXB 2I3ZA 4LNUB 4ZTZB 1M8FA 1REQA 3LTEA 3B6EA 3V1TC 2DLCX 2XUOA 3A6PC 1FMJA 1N8SA 3OQJA 2A5JA 2JGDA 3L4SO 4GXTA 4M8LA 3DAGA 4ND7A 4RJKA 5FBRB 2V0CA 3TGPA 3CN9A 1JYFA 3QBDA 2JBAB 4C5BA 5U4QA 5HE8A 3GD7A 4JYBA 1U94A 3TD9A 3ZV6A 1MF7A 2O7RA 4LMRA 5FPSA 5J4LA 4N3GA 4TYNA 4IBOA 4KVGA 5AR1A 4Y2PA 4F60A 1MAAA 4YWJA 1AGPA 4Z4EA 2N9UA 2ZJ5A 3QP9A 3TM4A 4KU4A 1Z75A 3VR1A 3PQCA 1GTSA 2PV7A 4AWXA 3FFBA 3NBAA 3GAMA 4LX8A 4DYHA 2R00A 2EQ5A 5F3DA 2UYHA 1A7AA 4HZUB 1BFUA 2A9OA 4LWOA 3AIIA 2P41A 3HGQA 1KAHA 1RYFA 3K3PA 3I64A 3R5TA 2O0KA 3HR8A 2JCGA 3B8HA 5DRTA 2CL5A 2H00A 3EGXB 3P9RA 1Z73A 3TW6A 3S1SA 5CBPA 2Z58A 4D45A 2PUAA 4NOJA 3ZE9A 1Q17A 5BNIA 5EOVA 5I9NA 1RVV1 3CMMA 2C29D 1FS5A 1Q57A 4L76A 5ALJA 5THKA 2WZQA 5JARA 4MROA 4F3RA 3LRPA 2Z2ZA 2KS6A 2IZ6A 2VHZA 1VPEA 4MS1A 4IJUA 9ABPA 1TM7E 4M1WA 1HZZA 5FWAA 5BQ3A 3RKSA 2ODTX 1N3LA 2QLFA 5H0IA 4J49A 4E2XA 5TF0A 1DBPA 1W8DA 2BEUB 4QU5A 2G9UA 4C04A 1JHUA 1N0HA 1HNXB 2VLIA 5CB6A 5K99A 4JBIA 2GXQA 3DQQA 3E5HA 1KEEA 1RI4A 1LZKA 2CMFA 1TF7A 2GM3A 3IT3A 3I04A 1QHFA 2F7SA 4NZPA 3UJ6A 3O3MB 4RAQA 4EFNA 3EXIA 1KI3A 1ZUHA 2OWEA 4OGKA 5B64A 1FF9A 2HSWA 3GEDA 1DV1A 2C9CA 4XJXA 1M0EA 1WCWA 1VCMA 1GFIA 1FU8A 4D3ZA 2QRKA 1KARA 3QOWA 4G09A 3VHRA 2HYIC 3QY0A 2Y99A 3U7QB 3EVTA 1PBNA 1EUCA 2VTBB 4IEIA 1HDGO 2HWKA 5D6OA 4YV2A 5KYYB 3TOCA 3GY0A 3HCAA 2CHFA 3OIWA 3C4JA 3ZD9A 1USVA 1KRHA 4C0JA 4AQDA 5H81A 2ZRHA 4HF7A 4N54A 2CE7A 2IZZA 4DWVA 1NW5A 1IEQA 2XMDA 4PS0A 1MO2A 1E6LA 3HO6A 4KDFA 3S55A 1JIUA 3GN1A 3RBVA 1R8SA 4TSFD 3ZDQA 1HDZA 2CL0X 3PDWA 5LNK6 2V0GA 3AVWA 4WI1A 3HEBA 1SPBS 2RIRA 5DYGA 5EAIA 3RDPA 3GRYA 4AZ0B 5LP6F 3QJ5A 4X41A 2ZB3A 1UPUA 5LYJA 3SMVA 2BBWA 2ISSD 3U4HA 2VRBA 4PG7A 1K5HA 4JJZA 4KXQA 1ZRMA 2E5WA 4OI2A 1XTJA 3F5SA 1P7WA 3CA8A 4EKNB 5KTNA 4P3NA 3TZHA 1KYZA 1X1TA 3KQOA 2YMPA 3HBLA 4OQDA 4OQXA 4L28A 1ORHA 1OWMA 1DEOA 2W9XA 4FW9A 1YULA 1VHLA 5G1NA 3PT9A 3PQ4A 4YRKA 3OSUA 4M9QA 2A33A 4MW0A 3FSGD 5JD3A 3DT6A 3N59A 3L1KA 3ILHA 5BQOA 4B33A 3H65A 4IHAA 4GYKA 2C78A 3GN2A 4TWIA 2YIVX 4RVNA 4LEIA 5FWXB 3EXHA 1MDBA 2ZJ7A 3G89A 4FQ7A 5CLLA 2V8BA 3CT4A 1UDAA 3BCHA 3TH5A 2J9RA 3TMAA 3WLEA 4QELA 4FJ2A 4PC1A 2FQ1A 3H11A 1ZZGA 1HURA 1CDZA 2PQ2A 3NOQA 4MDEA 2HRCA 4PQRA 3HB9A 3G1WA 3KXDA 4PC7A 4CT5A 2VDKB 3S3TA 1DZ3A 1JDUA 3QA3E 3L0YA 1S8AA 1FLDA 1KDRA 2Y4NA 3K96A 3LHFA 5GQSA 3PQ2A 5KYGA 2A94A 1NP6A 3AFIA 2B2CA 4KFSA 1K5GA 3X1MA 2IA5A 4M6WA 3R0IA 4AB1A 1EWQA 5CR9A 2ZI4A 4ZYTA 1NLFA 2XUQA 4OPMA 3OAAD 5BOSA 4KL8S 3DYIA 2I0FA 4WH0A 4D46A 5JSHA 4YQZA 2WMDA 3EAFA 3SE7A 4ISCA 3PCTA 3LO8A 3COYA 4MEBA 3DZGA 3HJHA 1TTPB 2ATIA 3HDJA 3GDWA 3W8EA 1WXDA 3BD8A 2I6XA 1R9JA 2CVZA 1C9JA 1TMOA 2I2BA 1L5FA 4G0YA 4JNCA 1ZUD1 3L0OA 1IRXA 1CJVC 3MSXA 1KDZA 4LF6B 1WCXA 4KQWA 3V5NA 2ZSFA 3ZBTA 2HEGA 1LSSA 1T29A 2PSJA 4KN6A 1CZRA 1ECLA 3VPFA 1JTEA 7GPBA 1XMQB 2HCTA 1I9CA 4FC6A 3VPHA 3H0EA 4TMZA 4MV7A 5K8JB 2P79A 3EGWA 1G9TA 1UANA 2Y1XA 1LI7A 3U7QA 2VTBA 3QMPA 4LJRA 1VHQA 4YJGA 3B8EA 3Q5EA 6AT1A 3TLAA 1G6HA 4OFBA 3VI3B 3L0BA 3ZZTA 1LDEA 3MLEA 1ZCJA 2UXDB 1BRTA 5EL0A 4MB6A 2YL2A 3W4KA 2CVFA 3C8HA 4IFTA 1Z38A 5K0FA 3DOJA 3NRBA 4KGXA 1UJBA 3R3UA 1P9NA 3R2JA 4D79A 3AUJB 2E7ZA 5HS6A 3CPHA 1ICIA 3ZY5A 3MYRA 4KR6A 3T9DA 3W9BA 1QF9A 1XZQA 4PG5A 5K0CA 1OIXA 3CSSA 2ZBGA 2H59A 5DEIA 2RCYA 4FR5A 4CUJA 1YDHA 3S2SA 3W7VA 4OOEA 1FDIA 3QHAA 3W3AA 3L4BC 1SZCA 4XVCA 1CRPA 2WTUA 4H7DA 2DPYA 3C3AA 4LXHA 3DSRA 2A58A 4ZCPA 2AQKA 4D9MA 4C78A 1E66A 4P58A 3AMVA 3NHZA 4DLAA 1QCCA 4NONA 2O20A 2C2MA 3I0ZA 2RHLA 2P4SA 4M87A 4JP3A 4TT8A 3I8XA 4FW8A 4GWLA 3MRXA 1QV9A 2M6LA 3DAPA 2AOTB 3O74A 4IGKA 5KTRA 1T9BA 1TZMA 3H83A 2HJHA 1OZGA 1XJQA 4IDFA 3U3XA 2P9GA 5CXUA 1INLA 2CJWB 1F8FA 2QROA 3MRVA 1T3HA 3IODA 3ASVA 5DZSA 4TQAA 1ISFA 2WSMA 3H5NA 4OYHA 1F0KA 3WDLA 4TM7A 1FVFA 3C5VA 1LSJA 2XKAA 3IT0A 2YUTA 1YS6A 4NE9A 5IM4A 4D9FA 3U56A 2C59A 1JG6A 3T3EA 5U9CA 3NHFA 3T1YB 2YC2C 4JU8A 3IUMA 5LM3A 2CUNA 1NVEA 1QKJA 2JH8A 4MS4A 4ZALA 3EG9A 3WMFA 4L8WB 4G63A 4H7HA 4EW3A 1RCTE 3D43A 1FNCA 1XWWA 4IAOA 4XIJA 4H1VA 2PNJA 2FB9A 4CN9A 4PZEA 1NQXA 3GUYA 3FUVA 5AM1A 5LCXA 1NV9A 2WSBA 4MKZA 1XRRA 4K28A 4LY6A 3UGKA 1YA4A 1BGWA 3TQHA 3OWHA 1T1SA 4FZ5A 2H11A 4ENUA 4HYEA 4GOND 5TNXA 4KVAA 1G18A 3N0VA 3K9CA 1DFHA 3DE3X 1NSYA 4QDUA 3WLRA 1JKJA 1K8ZB 4MRPA 4UHBA 1WXHA 2WA2A 1Q0RA 2YY5A 1NBME 1CQIA 1ZX1A 1Q1BA 1MXFA 2O1EA 3C7KA 5IKOA 1FP4B 1WUIS 1QK5A 4JVSB 5BW6B 3CH6A 4EB8A 4V0OA 1P77A 4Z7OB 2CV2A 1K8RA 2XOEA 3IQDB 5IYZB 3UKOA 1SXJC 2QYTA 3EY4A 4JT9A 2EGHA 2OBLA 3SI7A 4V24A 4BAGA 4X5OA 4XR9A 3WYAA 3ZS8A 2AZ4A 2NZUG 3N76A 3QWIA 3QYJA 5LYJB 1DEHA 3JZMA 5FPTA 1H3FA 1YVRA 1BROA 3PCXA 4KIWA 4MP3A 5AUPB 4BNMA 4OJYA 1GGKA 4P54A 2XZTA 4CTNA 2IEAA 4F4IA 5A3JA 3F6EX 2W2XA 2Q5FA 3RUFA 4HJRA 1BKYA 2HK8A 4REMA 4PRLA 1M2FA 1W5FA 2RI1A 3BD9A 4C4XA 4D9IA 3ESXA 3TW8B 4J76A 5BNFA 3JYLA 4HD8A 3V4OA 2QZZA 1T2DA 2GUWA 4G5HA 5KYWB 1IOZA 4M0PA 2QW0X 3OOYA 4HLQB 4J0HA 2MYPA 5ILGA 3R7SA 3EYWA 3G0GA 3T7JA 2IIVA 1BCSA 3B6ZA 3BIOA 3WQRA 1BRMA 2NO1A 1YE5A 3EXHB 1Q2XA 4FYVA 1C9KA 3O9VA 4NAUA 2JS7A 3LDFA 1WSBA 3GVXA 1GTZA 2FE4A 1SC3A 4ABTA 3P9IA 5JVDA 1H9AA 2CNLA 1TCCA 1O9GA 1RKUA 3G9UA 3JQFA 2B7CA 1EE1A 3ODGA 3I5YA 1X42A 5BNTA 3ZW8A 4BNHA 5AM4A 4D56A 2MR6A 5JO0A 1QH8B 2BDTA 4LWZA 4RD4A 2EIXA 4LHVA 4EJSC 4ZVKA 1U31A 3M5PA 1O95C 2NYUA 2O3TA 1YQGA 4C30A 2AFHA 3PXDA 1P74A 2Z4TA 4GZ5A 1RHUA 1GTJ1 3C6YA 4ND6A 4NQZA 1PD1A 4S1OA 3GJYA 3R5KA 1ACMA 4HZIA 4R40A 3JVUA 1JHDA 5AQEA 3WLKX 4BAZA 7ADHA 5FP0A 4OM8A 1PGQA 1SC6A 1UKEA 1JXAA 1AJEA 4DLZA 1QH1A 1J1UA 1G21E 1J24A 3IOYA 2MCFA 4B6PA 2PZFA 2L18A 1QPZA 4M8KA 4QXPA 2OPBA 4ZV7A 5JMPA 4B80A 4ER7A 2ZU6A 1W4BA 1EJ6A 3KU4A 2YXLA 3MSCA 3CKYA 5A2GA 1A50B 1BA3A 1NLMA 2OQRA 4CODB 1A5SB 4JGBA 4YNBA 3KLBA 1E3IA 1I32A 2FX3A 2QAGC 3JQ9A 4W8OA 4C6SA 4HPWA 3VVLA 1P18A 1X9IA 1Z34A 4KQ2A 5E1OA 2FNAA 3HCPA 2MSCB 4EGSA 4UQOA 2A9FA 1M3SA 2I7DA 4LFBB 3OLWA 3HJFA 3FCCA 1LBSA 4LOHA 4CCYA 4A2PA 4EEKA 4RQTA 1C9NA 1X8JA 2B9VA 3HDYA 1RYHA 4G1CA 3SLGA 1G8MA 4RLFA 4XEHA 4XFDA 2R1UA 3PUKA 3BE8A 3N2NA 5EZSA 2JFXA 1OX4B 4U63A 5D2CA 3BAFA 1BGXT 4RHXA 2HN9A 4EELA 1TD9A 2ZBEA 5FKJA 1KC3A 4J2HA 4G65A 3PYMA 3DPIA 4D0NA 2O6HA 3V8EA 2IBMA 3T0GA 3QVXA 3CWCA 3T35A 3ZTTA 3NQ41 5AVYA 4QU0A 3LA6A 3JWPA 4HDCA 5ITWA 1KK2A 4HUQA 5DSTA 1EYZA 5DK4A 4QFBA 3H3FA 3RASA 3T3MB 3WIDA 2ZE6A 1E3JA 2WVAA 2HADA 2Z57A 3CEHA 5T3YA 1YR1A 1OXSC 3AERA 4TTTS 3DOEA 5IJ9B 2DCMA 1J0CA 1ADGA 1ILWA 2V54A 3JVIA 1MV8A 2EG5A 1F1JA 3OQ6A 3TLJA 2PZKA 3KQVA 4BGUA 5CH5A 3PUXA 5LQMA 1JH9A 4Y3UA 2X9GA 4QZVA 2ZRQA 1X8KA 3I8SA 4BWFB 2BI8A 5AJWA 4OB6A 821PA 1LF5A 1ONPA 2MSDB 2ZI5A 3L7KA 5FO1A 3NHWA 3SYTA 2PUFA 2GBFA 1QGDA 1QORA 2HTEA 2JLVA 1YRAA 1JHXA 4FS8A 1U2GA 3N8GA 3OFKA 4Q3EA 5CVDA 1R64A 1I30A 5ADUS 1DO8A 4DJAA 2RKOA 3R0JA 2HUNA 1L8OA 2YKGA 1XDWA 3O75A 2ZEJA 1P39A 3OCCA 4G2TA 5ILOA 2QD1A 3HYTA 4ROSA 4GMHA 4AM8A 1AD2A 1Q1AA 3WTBA 1FZQA 2OO5C 2OXRA 5JJLA 1ADJA 2RAPA 2C2OA 3ZWKA 2R6GA 1TECE 2XRMA 3NR2A 2OO5A 4Z53A 2EZ4A 4OD0A 4L7QA 5JTTA 1H6DA 4WUVA 1I01A 4NNJA 4DIDA 3L6BA 1K7SN 1Z37A 4LNUA 1DRWA 1LSUA 3LLCA 4QVGA 1FFXA 5SZHB 2EYQA 3UT6A 4P81A 3P9YA 3I6QA 3RHFA 4BZZA 2XTNA 3CNNA 3B52X 3NATA 3NFRA 3P45A 1UK8A 5EESA 3SXPA 4Q0MA 2PL1A 3TNDA 3TUJC 4J07A 4DDHA 3LFHA 1O77A 5I7OA 5JALA 2OY0A 3D8NA 3NJRA 3LBYA 3DTTA 4MIOA 2EJUA 1HRDA 1GADO 2QQ5A 3G5LA 4QXQA 4F1JA 3L4JA 5KMGA 1IOLA 3HWSA 2JAXA 3DC7A 3SVLA 2F3PA 4W8HA 4QRDA 3JARB 3H86A 1FTGA 2PEYA 3D6FA 3GLSA 4YJ2F 3UFXA 4EJMA 3L7BA 1Z17A 5BV1A 1HE8B 5EJ2A 4GL4A 4CIAA 3IV7A 5LA6F 2VPZA 1XZEA 1ZD2P 2XNDD 3L8EA 1YMQA 4E51A 3U44B 1BGVA 2IZ0A 1X15A 3LUKA 3NGMA 3DTVA 1SBIA 4JUCA 1QPBA 1FU4A 1A9RA 4R01A 3CO5A 4MYSA 2PSFA 1ZAKA 1IOVA 2NSJA 3P0EA 4BLQA 2IHNA 1K88A 3GJRA 3PFIA 2NU7A 3FOBA 4IZ6A 3TQRA 5IJ0B 5FJJA 3WLOA 4BTEA 2H5EA 3H8JA 5AI9A 4HYYA 2BFFA 4F9TA 2FFQA 5KTPA 4AS1A 1DO2A 1NZFA 5DO9A 3ZV7A 1RC8A 2BM1A 4R1PA 2OLEA 3PNSA 4BLOA 3IPLA 4F45A 3KPVA 4ZEMA 2ID8A 4W82A 3B7WA 1AHIA 2BR5A 4GM4A 4Q6WA 3PUJA 5D5QA 5EPUA 1ORTA 1UJ2A 1VLQA 3BRWD 1OZFA 5LLTA 4QA9A 1EFLA 1SVMA 2OAP1 7YASA 5IAAA 2DUNA 5F5LA 5C53B 4O4HF 2GAAA 2ON6A 4X3PA 4F3YA 4MGEA 1CUBA 1OHHA 1Z28A 3C15C 4DM3A 4EJSA 5FX2A 5JRZA 1G5PA 2HC9A 4F6CA 3W5VA 4KQHA 5KWVA 2HWXA 4JDPA 1WNFA 3F0TA 4KH0A 4KRYA 1H2ZA 1MA3A 3QSYA 3EGVA 3FCSB 1KP3A 4OLJA 4MVJI 2ASVA 1FRNA 3AG6A 1DDOA 5DHUA 2FDRA 9LDTA 1B3RA 2ZJ3A 3G82C 3T3PB 3WV4A 5KX5B 1VIAA 1DC5A 3NXSA 1DQPA 1YQXA 3P2JA 3LUJA 3MZ0A 1NLZA 3DDOA 3PA6A 4U2KA 1PK9A 5AVRA 2VJAA 4WDRA 3PP8A 1WUHS 2O7NA 1ESEA 1HG0A 3NHMA 2ACEA 4KQFA 2GA8A 4QRHA 4BZQA 3E3NA 4AUNA 1GGMA 2VF7A 4IICA 1B14A 3D0KA 4I55F 1ZK2A 2HMSA 4Q00A 4TVSA 1AA9A 3QEOA 3KT6A 4LF7B 4AZ3A 1JHYA 1QZ3A 3RRZA 3DAFA 4A2CA 4MR7A 4FS3A 1VHJA 1RC1A 3QU9A 1E1YA 1J6UA 3A3PA 1LNZA 1HT3A 2PRSA 1CY1A 3PHJA 5BMVB 1R6TA 2FFRA 2JHGA 2IYLD 3DKIA 4BRZA 5I9BA 2VYFA 4NS1A 4P9NA 4CDGA 1L7AA 4Z4IA 1C4WA 1NT4A 3CXRA 2OBXA 3N2GA 2J3JA 1ZMXA 2ZR9A 4FN5A 1L8LA 4LYAA 1EVEA 5TMBA 5JT1A 5KJ1A 3RUDA 1EZ4A 1EA7A 2YIDA 1PR1A 4JI3B 5JAUA 1SOMA 4M83A 1VE9A 4ATNA 2UVQA 3PK0A 4BO7A 1F2DA 5C51B 3I9V6 1RM0A 1GR0A 1K3TA 2QUIA 2C4WA 3CIOA 3TPCA 5JXJA 3U44A 4ND5A 4N82A 2IOFA 2F1HA 2BFDA 3TXAA 2YIJA 4CKBB 4JI4B 3A2KA 3T0IA 5I5EA 1G4AE 3LWBA 4O6VA 5LUBA 4TYWA 4FR2A 1N5OX 5C81A 1DUSA 1DVRA 3PVZA 1GOTA 1X80B 5DXFA 4CRWB 3ETLA 2O1XA 2IYXA 1FFCA 3AUXA 3CZCA 1SC4A 5BNWA 3R7NA 1J99A 3IKTA 1HLGA 4LXUA 1NE7A 5CA1A 4GSYA 1ZAYA 3EISA 1OIVA 1IXZA 1XP5A 3RC9A 4TKUB 4DYVA 3KQLA 5DM4A 1GSIA 3G5UA 2EP5A 4LRSB 5FBZA 2GWRA 4DCJA 1RVDA 5K2OA 4HO1X 1RSZA 3C3DA 1Q0UA 2HA4A 3M6FA 1EM6A 2O07A 4JEIA 5HTKA 2NVOA 2DAPA 1NJ5A 3KPJA 3FYUB 5INTA 4E88A 3IVGA 4R81A 2C8VA 1Y3CE 1ZVKA 5SY4A 2QMHA 2EZ8A 3ROZA 2Z43A 4E1BA 1X70A 3IPCA 3T5BA 3FMFA 3OSZA 1Q3TA 1VDMA 2C1XA 3MBOA 3MMSA 4R0VA 1TLFA 4JD5A 1ZM3A 5JSYA 4TZ6A 1OH5A 1HKUA 1ZONA 2W70A 5IARA 4ER0A 1M1YA 4C88A 1UR5A 2IXAA 4MXDA 5HNKA 2ZLBA 2BT4A 2PXAA 4Y1RA 1LV7A 1GCGA 2JI9A 1G8KA 1QE3A 3FE2A 2HREA 4A0QA 4X64B 2A4MA 3TLBA 4ZCRA 2G80A 4HAXA 4MPTA 4XDHA 4JNKA 4GP7A 4G86A 2ZWVA 4MRMB 5LMZA 1Z3IX 1RE1A 4FUQA 4IZHA 5BQXA 3WGGA 3LOPA 1EVIA 4RD3A 5MFZA 2QVCA 5K8VA 2ZIUB 1WULS 1M8JA 4BC1A 2Y27A 4L50A 2CLCX 3MGBA 1QUEA 5IFLA 1WX1A 2IPOA 1DSSG 1EFPA 3P9KA 2I55A 3ABZA 4IW3B 3YASA 2CVHA 2QBYA 1V1RA 4BTVA 3MPUA 4RHTA 1SVOA 4DNPA 1AE1A 3FTDA 3C8MA 2N42A 1U0LA 1CUCA 4WINA 4J9VA 3S5JA 4HTFA 5KMGB 1B0UA 2Q27A 5CLJA 4OI0A 4GAEA 1F4PA 4AO6A 1SHZA 4CIYA 3NJ8A 1IUPA 2M32A 4QXRA 3EDCA 4BY9E 1JA1A 5DCLA 5IUKC 5LDGA 2ZXEA 3W6ZA 2FUG1 3EUFA 2CYCA 2EWMA 3KB6A 3TM5A 4DCTA 4IYRA 2PNFA 3SIWA 1IFXA 2BGIA 2I6UA 2P69A 4PLYA 1HYHA 3FLAA 1NW3A 4L4YA 3CTPA 2ECOA 4I4TF 5LP6C 1BCSB 4TRMA 2O2GA 4YI5A 4DKXA 2ZM5A 2XWJI 2KLBA 4MWOA 5AW5A 3TLCA 1ZUNA 3PVSA 2J0UB 1M6VA 2IYWA 2WM9B 5JSFA 2ZTLA 4ACAA 1X9HA 3U61B 4EY5A 2GN0A 4ETNA 1U7DA 1MH1A 2WM8A 2YIMA 3HC7A 2OKGA 2BM9A 3SEAA 1X7ZA 4X54A 1OT3A 4GQIA 3SD7A 1H1TA 1JQEA 3LCMA 2P8JA 1BG6A 2IYFA 3RKRA 3NOOA 3REQA 1U1FA 3GFTA 1GPJA 2AIRA 2ZJ0A 4FDLA 4FE7A 1JDTA 3QV2A 4J1NA 2FFBA 1C1HA 3OF2A 4QPCA 3L6RA 5AJXA 3RO7A 2CXNA 4UUPA 3EXEB 3ZXYA 3AHGA 3WB9A 2C2BA 2I2DA 3B2NA 4IIEA 2GYVA 4EPTA 2X7HA 1TI7A 1EI9A 3SBEA 2GBCA 3DULA 2AC7A 4GSKA 2ATVA 2YC4C 1QH1B 5D85A 4K81B 5A4MS 3NBMA 3NPMA 5KPDA 4LRQA 4ASUD 4C3OB 3ANNA 1NQTA 5ICEA 5DTRA 1RCUA 1FRZA 1S4QA 2HK6A 1NYTA 1UBTS 1ZGBA 3FVRA 3H7IA 4M37A 1IZ8A 2GO1A 3S1LA 3ZZUA 1E7YA 3N5CA 3LHKA 1PEYA 3HP7A 1XTSA 2FP4B 4NBVA 1FVHA 4A2QA 1WR8A 2XCIA 3TWOA 4PX2A 3O8CA 4WFQA 2C9ZA 4L3VA 1M5TA 2ISQA 3IE1A 1OXTA 2QTGA 2NTVA 5EZ6B 1YB2A 3VZBA 1N5KA 5HDBB 2DBZA 3VR0A 3G0HA 2YWRA 2B20A 4IZOA 4BU1A 2VA8A 3ZGXA 2C98A 1EFVA 4YT2A 1PFQA 5H4HA 3PS9A 1ZEJA 2WG2A 4KXYA 4PZCA 5BWNA 1R5BA 1VMKA 3L8YA 1HQYE 1JBEA 4WPGA 4X20B 1YDGA 3LWZA 5DGXA 3DVLA 2DFVA 1EJ0A 3HACA 3IP1A 4ZQCB 1PUIA 4D3XA 3U5TA 3MJEA 1VI2A 1R0BA 3VMMA 3MWYW 2Z8YA 1J23A 1XTKA 2G71A 2CXTA 2Z95A 3RRMA 3RUHA 3S6JA 2X8JA 3AEQB 1W4CA 1JU4A 4BFWA 2LKCA 2ZSHA 1AQUA 1W5AA 1LPNA 3H2IA 4KQJA 2HT1A 2QTTA 4ZK2A 1YZTA 3AUKA 1JALA 3H99A 3IVAA 4PVDA 5DXJA 2Z9DA 3HKDA 3N8NA 3UJ8A 4KDRA 3RRNA 3KT0A 2PLAA 4P3OA 5IZCC 1XDZA 5LZ2A 3CF4G 1QOPB 2YZKA 3QW2A 2TMYA 3AKCA 4PC3A 2P11A 3LPCA 3R3VA 2OLJA 3ZCXA 4H3VA 2VTDA 5P21A 4BC0A 5K4HA 3MGGA 1NC3A 2Q29A 4FX2A 3ZGLA 1FTSA 5F7OA 3VU0A 2IGBA 4YRIA 2R751 5SZKB 5BXYA 4P93A 4PG8A 3FTEA 2VSXA 1TADA 4JOCA 3I04M 3BJIC 4JCOA 1OIWA 3MFYA 2WWFA 1KRXA 4JLOA 1V9LA 4DR6B 4UEQA 2NXCA 4QVIA 1ND5A 2M2IA 3G2JA 5DYNA 1PZNA 1YZGA 3TAUA 2XUKA 5B4UA 3DOCA 2W6PA 1IMOA 3PNVA 1NR7A 4PN3A 1KYWA 2O06A 3I8OA 1SVKA 1SB8A 4NTZA 3TTWA 3L8FA 4Y9DA 1ZJ6A 3G6KA 1DOZA 1JG7A 3O1JC 3MGKA 4LZZA 3UA4A 5FUBA 3RC2A 4DLPA 3ZDXB 3EEFA 2EGGA 4KYIB 5T57A 2C0CA 5TJHA 4RO0A 2HHLA 1H9BA 3TCNA 3UT5A 2VCHA 4EYSA 3SNHA 1PYOA 4U8HA 1EMDA 3LAWA 1GN8A 4TN5A 3U7EB 1G5IA 2FUNB 4OUDB 4OLBA 1TOAA 1UBJS 2H31A 2NO9A 4EFLA 1GXSB 1QTQA 4YPVA 5CT6A 2NQ8A 3GLTA 1TC2A 3I6BA 3QEJA 4W1RA 3R75A 3O0DA 1W7AA 1RXIA 4WXPA 5C37A 1UBMS 1VL8A 5F1KA 2H17A 1R4AA 4QREA 1NN5A 1B0AA 3VR6D 1MAWA 4HLCA 1XHLA 4HPJB 3MK31 5IF3A 4GUAA 1UJ5A 3SR3A 1X8XA 3MHPA 1E20A 1CEQA 5FBQB 5E6SB 3HVKA 1ZHFA 4MMZB 3L82B 4C0AC 3BDIA 2FK7A 1QGUA 4PFQA 1E3MA 3VC1A 3D81A 1QGED 3LBAA 5BQFA 3ONFA 2WAYA 2PH7A 1RQGA 1PNQA 4HNSA 4U6QA 1JHAA 4B6FA 5C4IA 5LMUB 3EUEA 2EF1A 3FJOA 2IK8A 2QA5A 1G98A 1JQAA 1Z33A 1FDWA 1Y6RA 1VYUA 4QXMA 5IF9A 1FIUA 1OC4A 4MB2A 5AOAA 4INZA 2PWBA 4RZUA 5FQOA 3PTLA 3R3JA 1XAJA 4ZO7A 1Z2EA 2BONA 3O2SB 2W48A 2UUAB 4JR1A 4ALMA 4FDAA 3RRJA 2VP5A 3NHKA 3D7MA 1BEEA 3FLEA 4XGIA 4FFVA 1VJGA 3JQBC 4PG4A 4ZT7A 2FZ5A 1LPPA 2QKYA 2CFOA 1FPQA 2VXOA 4M99A 5ALKA 4YYZA 4NYIQ 1D2HA 1H2RS 2WW8A 4TYPA 5JS8A 4HWRA 1NUAA 8AT1A 1M33A 5B2ZA 3GGGA 5KPJA 2AJBA 2XVXA 3PJEA 1PJ2A 3O4IA 5KSOA 1NI4A 4MWDA 2OAEA 4B3FX 2WWYA 4Y6SA 2IBTA 1JJ7A 3A8TA 2PRYA 3E22B 3RFTA 1BC5A 1ZMOA 1XTQA 2IUYA 3ITNA 5K6TA 1PJTA 5BQPA 2YN0A 2R3SA 2WWVD 3KFXA 4E1VA 2B69A 5D86A 4YUWA 4GGPA 4Q9AA 1QKKA 1XKQA 3K6SA 1I94B 1WEKA 3CUVA 1V37A 4DYDA 4L95C 4ZO9A 2ZWPA 1KEUA 2IW1A 2ZBPA 3EPRA 2DUUA 2JLAA 5JWHA 1O6FA 1IK4A 4G1MB 4K87A 2I6SA 4UU0A 4US2R 5JSZA 1KI6A 1SKYB 4I8IA 3EQZA 3TD6A 1KI1A 1WL8A 2B3DA 2D1FA 1W2GA 2IU4A 3LRXA 3F8WA 1UCFA 1OXXK 4AN4A 2FKNA 2VXCA 1KY2A 2NZJA 1DRJA 5ALQA 5A3VA 1SEPA 3OF5A 1YV9A 3LKBA 3QUSA 4S0ZA 1GLVA 2YOGA 3DB2A 1IBSA 3IQZA 3MMZA 3WKDA 4JSRA 5I48A 4TLLB 1XT6A 3O8RA 3FR8A 4P5PA 4RX1A 3T06B 3Q98A 4J1QA 1CEYA 3PX3A 1RW4A 2DWPA 1GFWA 5EHIA 4R8RA 1UK7A 1IQPA 4RQAA 4XZ3A 1G16A 1NW4A 1F9AA 5IG2A 3V8RA 1PT8A 1TVKA 2DETA 1WCIA 3C16C 2AUTA 2ATXA 3PD7A 4UXHA 3WMGA 1RAIA 1WZIA 1EK5A 3DGEC 3O38A 2HF9A 2SKDA 1K7XB 4MAMA 5DB4A 3ZV4A 1G5HA 3GT4A 4NAHA 4KO2S 2XCRB 4FK8A 1J5EB 3V1NA 2A67A 3T34A 1K0UA 1SKAA 2HO5A 3M9WA 4WL0A 3W77A 3RYIB 5H4GA 3DMPA 1LQUA 2J4DA 2AK3A 3F7OA 5CTAA 2I4LA 3OX4A 2PUJA 2OZPA 5EKDA 4IDPA 3LVRE 3V55A 3E5RA 2VQFB 4UCFA 5D1NA 4ZOBA 3STVA 3WA6A 3R5XA 4P4SB 4YLYA 1Y7TA 1JDZA 2CWWA 2YVQA 3M49A 3EZ7A 4BXOA 2A0KA 5E7IA 1OV6A 1KNQA 1XQYA 3T6KA 1QIKA 5UKDA 2WIGA 3HV2A 5EVJA 3R7WB 5F51A 5KWIA 4W5RA 1Z6AA 3KQTA 3DUFA 4PS1A 1UBOS 3V9AA 1J7KA 1JEDA 2Q1YA 4HQ0A 4IINA 2OA0A 3WLFA 1QG6A 4DS3A 4YMHA 1L4NA 2O9JA 1J07A 3FUUA 4CR8A 4EY8A 2PBFA 3GLQA 3JQ7A 1LZLA 3SJ7A 3KLNA 5JQGA 4C3UA 3ONVA 1NW8A 4BO1A 3WDSA 4UNSA 3MUNA 4KOAA 1JT9A 1GZ3A 1U99A 4IQGA 4JLNA 4KAXA 4EVIA 2RHRA 3AFOA 5TV2A 1EB8A 9ATCA 4S05A 5LFAA 2XGJA 1XTRA 2BKUA 3G5AA 1F1BA 1XZIA 2JA1A 3MCVA 4QOGA 4OV6B 1JVSA 3FNIA 3T7TA 1Y7HA 1T91A 5FPKA 5FBHA 1J20A 4EB0A 6CHYA 4Z5XA 1KP9A 2D0DA 2I4TA 2JFGA 2F59A 3V4VB 3CE6A 1PJ3A 1VZ3A 4NL4H 4ALKA 1SUAA 4X3OA 5DLQC 4LJLA 4YJDA 1LW6E 3RBXA 4ZOEA 2QMZA 1VMAA 2OV8A 2Z2IA 3T3NA 2O5CA 2Q1XA 4LNAA 3VHLB 4AKHA 4JLAA 3M33A 3AZQA 1EP3B 3GHYA 4L8FA 4CMGA 4A0GA 1B1CA 1GPWB 1W25A 1G63A 2BMJA 4G8DA 4KGZA 4OMDA 4Q82A 4TTIA 1IZZA 1OB2A 2HJWA 2AXEA 4D42A 4OQQA 2XT9A 2GKSA 5CLFA 2OM2A 3HYCA 2YWBA 3KZNA 4OAOA 1B3BA 3OLXA 2Y1KA 3SEFA 1TVEA 1ZC3A 4RHYA 5C46F 1O9HA 2XA1A 4ZZ1A 4MKIA 4X66B 5F3WB 4K46A 1RLJA 1RLOA 4S1NA 3MN1A 1YJXA 1E9SA 1FFEA 2BI7A 4KNVA 2G63A 5FLXA 1TJ3A 4TMFA 1XHFA 3KK0A 1TT5A 2HTFA 1D8TA 3SYNA 1PQWA 5CGZA 3KUUA 3EXFB 3ZOZA 3V7NA 2EAUA 1ZC4A 4ZT5A 1JU9A 1FS4A 4ZJUA 2Y6VA 5K8UA 2UU9B 3Q9NA 4HLDA 2EJTA 3L46A 3WYCA 1RBMA 1WKVA 4I7EA 3AIKA 4XRRA 3EVZA 3TLGB 5JANA 1ZJZA 2QIPA 3PUWA 4FMBB 4R54A 2CXXA 3B53X 3MAJA 4G85A 4G0VA 1DTWA 4QU8A 3I6ZA 3PPWA 1YQ9A 3QIAA 1PKEA 4C7XA 3RHZA 4AX8A 3VH2A 3S2GA 2Q3MA 3N2YA 3H3XA 4FBMA 5L8VA 5C18A 2JFUA 2GFHA 3R3HA 3JSXA 4RK6A 4K9DA 1HTWA 1OZAA 5L4SA 3QOFA 4ON9A 1M1ZA 3W9SA 4OQMA 1EINA 1N6LA 4DUPA 3UYKA 5JAZA 2IYTA 2C95A 3AILA 5ADHA 1U2GC 3I30X 2AG1A 5JJKA 3SYLA 3W34A 3SSMA 5HBRA 2JCVA 1F2UA 2ZYHA 3EC7A 5EJAA 5A03A 4PANA 1G42A 1H6CA 5JNLA 2VNKA 1M1NA 2H3HA 2X9QA 2FSFA 1FSPA 1L4HA 4TKVB 4UM7A 1DGQA 3I9OA 3DDHA 3THWA 1PFVA 3K2QA 1WPXA 1AIPA 1FQOA 1XJWA 2XRZA 4MA4A 3TIVA 4B6SA 5GINE 4R9VA 4WESA 5L6LB 3IP9A 1X1DA 2E0IA 3VSEA 1U90A 2ZR8A 2H1FA 2VDWA 4V0MA 3VRHA 4OHMA 4UAGA 2R25B 1DQSA 3BGOS 2MOKA 3DCJA 5FXMA 4DQ0A 4UDYX 2OB2A 1RQPA 4GVLA 2O4UX 2AOWA 3QELA 5G0WA 2ENWA 2IIBA 3ZLUA 1EFCA 2GF2A 4C1BA 2NADA 3I58A 4PPQA 1SK8A 3E0XA 1G20A 3HJTA 3GNTA 5JR3A 2UUCB 3R1IA 1ZGCA 3G23A 2PX6A 1XQWA 4HP8A 1P3JA 4JYMA 4KPEC 2ZRKA 4M7OA 5FI3A 1TYZA 1FNDA 4RVFA 1ZI9A 2AD5A 3TO5A 4CU2