4LI3X

Crystal structure of o-acetylserine sulfhydrylase from haemophilus influenzae in complex with high affinity inhibitory peptide from serine acetyl transferase of salmonella typhimurium
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
311
structure length
310
Chain Sequence
MAIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVCRIGANMVWQAEKDGTLTKGKEIVDATSGNTGIALAYVAAARGYKITLTMPETMSLERKRLLCGLGVNLVLTEGAKGMKGAIAKAEEIVASDPSRYVMLKQFENPANPQIHRETTGPEIWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDLSIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSASERYLSTALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Cysteine synthase
publication title Crystal Structure of O-Acetylserine Sulfhydrylase from Haemophilus influenzae in complex with high affinity inhibitory peptide from Serine acetyl transferase of Salmonella typhimurium
rcsb
source organism Haemophilus influenzae
total genus 108
structure length 310
sequence length 311
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2013-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4li3X01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4li3X02
1M54A 2WSYB 3FCAA 1KFEB 3TBHA 1J0BA 3PC2A 3X44A 3SPXA 2BHTA 2CLHB 3R0ZA 1P5JA 1UIMA 1J0DA 1TZ2A 4OFXA 2Q3DA 3AEYA 3X43A 2ECQA 1BKSB 1VE1A 2J9YB 2CLKB 5D84A 1PWHA 5EY5B 2CLMB 5D87A 1A5AB 2DH5A 3RR2A 1KFKB 5I7WA 5I6DA 1A5BB 1TJPB 4D9KA 4JBNA 2Q3CA 1QOPB 4ZQCB 1K7XB 1KL7A 1KFBB 4JBLA 4L27A 5DW0A 4HPJB 2CLFB 4L28A 3IQHX 4HO1X 3T4PA 1QOQB 3IQGX 1TZJA 2JC3A 3IAUA 1TTQB 2RHGB 5CGQB 1TYZA 4ZU1X 4D9CA 5B1IA 1K8XB 3FGPA 3VBEA 4COOA 1RQXA 2EFYA 4QYSA 1Z7WA 4XUGB 1TTPB 4L3VA 1C9DB 1WBJB 3DWGA 2TRSB 3DWIA 4IL5A 5CVCA 5IXJA 4D97A 1D6SA 1O58A 2CLEB 5HBGA 5BW6B 1F2DA 3VSDA 3AEXA 4D9EA 2DH6A 1E5XA 2CLIB 5D86A 4ZU6X 4HN4B 3VSAA 3BM5A 1CW2B 5T6MA 1C8VB 4D8UA 5JISA 2CLLB 3IQIX 3R0XA 5DBEX 4HT3B 1J0CA 1K8ZB 1A5SB 1BEUB 1C29B 1K7FB 1WTCA 1VE5A 5DBHX 4D96A 1WDWB 1J0EA 1V7CA 5IW8A 1KFCB 2BHSA 3VSCA 1UBSB 2RH9B 1Y7LA 4D9NA 1K7EB 3PR2B 4NU8X 4PCUA 5I7HA 5KINB 4HPXB 2J9XB 5D85A 4LMAA 1J0AA 2CLOB 1V71A 2GN1A 1JBQA 5C3UA 3SS9X 2TYSB 1OASA 2RKBA 5B53A 2PQMA 2ZR8A 4D9BA 4LMBA 2ZSJA 5B55A 1PWEA 5DW3A 1WKVA 1K3UB 2ZPUA 4D99A 1V8ZA 3ZEIA 3PC4A 5J5VA 4AECA 1TZMA 1FCJA 4KKXB 2ISQA 4D9MA 4H27A 1CX9B 2C2BA 4I1YA 5I7OA 3CEPB 2O2JA 4AIRA 1UINA 1X1QA 2Q3BA 5B1HA 2D1FA 2TSYB 4WX2B 4F4FA 4D9FA 5B36A 5J43A 3L6CA 4LI3X 3V7NA 4D8TA 4D8WA 2J9ZB 5JJCA 3SS7X 3DKIA 5E0KB 3L6BA 4D9GA 1VB3A 4L0DA 2ECOA 5IWCA 5B3AA 2V03A 4NEGA 1FUYB 1KFJB 4D9IA 5DVZA 1TZKA 5I7AA 4D92A 5I7RA 2GN0A 5KZMB 2GN2A 4Y6GB 2O2EA 3PC3A 2EGUA 4OREX 3VC3A 1A50B 1TDJA 1Z7YA 2C2GA 3HMKA 1K8YB 3L6RA
chains in the Genus database with same CATH superfamily
1YS2X 2A5GA 1UKAA 3F3KA 4TSRA 2PJRA 2WPDA 4WZAB 4C4XA 4HLQB 1TQ4A 1X7GA 1FDWA 4ZAZA 4ZHQB 3PJRA 4DWJA 4R1PA 1O1YA 2R4TA 1SIWA 2CLHB 3LT4A 2R68A 4L72A 4XB1A 5HJ2A 1Y37A 3ZYZA 4DUZB 3T7IA 1CZLA 2VHZA 3OPNA 4NJMB 3U2QA 1Q92A 2QIPA 3B1JA 3CT6A 5CH8A 4DCSA 1TVMA 1LD3A 1DAHA 1NMQA 3ELYA 4B5LA 3B1KA 2QLNA 4HBZA 2QRPA 5JO0A 3U37A 1H1TA 1EUZA 1SQSA 1VCOA 3EVCA 4I19A 5EGSA 5KKCA 3DT9A 3GUVA 1S3SA 1DL5A 2N1MA 2OAEA 4JBNA 2A4KA 4AQDA 1DRUA 3DCNA 1W34A 2W2LD 3KEGA 4MIYA 1YXMA 1EDEA 1IJBA 1G60A 1Z2DA 3ECAA 4OHXA 1ATZA 3CWCA 5IZCA 1MB4A 3TX6A 1AK2A 1ESNA 2Q0HA 4UEJA 4C89A 3RTDA 2XLBA 4C2BA 3HJTA 1AUXA 5JH7B 4QULA 3DQPA 4X8OA 4BBAA 3IRVA 1MB2A 3IUBA 4RSGA 4KN9S 1KJ9A 3GJ6A 4DBZA 2G9QA 1BQEA 1P31A 2V4UA 2J3KA 3IRUA 3KR9A 5EJAA 4B7UA 3EW9A 3PE6A 3LQ4A 1UPFA 3WJ2A 1S0UA 5DPMA 4U2DA 1KK3A 3TE6A 2SHKA 2ANCA 3CLTD 3NP7A 2KBEA 2R8ZA 3O91A 3T5GA 4BQSA 1T5HX 3DM9B 3KD2A 5HF6A 1FW6A 1SWWA 1RWQA 4MJ7A 3ISTA 1KS2A 1B2LA 1GQOA 4N3NA 3H1GA 2HIAA 4FD2A 1SOVA 2ZTUA 2DKOA 3SXUB 2PA3A 4ENTA 3K16A 4D9NA 1GHTA 2ACVA 2D1QA 3DO8A 2HD4A 4IJWA 2RONA 1S1CA 4I4IA 3UA3A 4X0EA 1YAJA 4QHYA 2VK8A 1JV2B 2GPNA 2JFGA 2QP3A 3SJUA 3QV2A 5KTMA 2UZ4A 1CF2O 2C7OA 4K03A 4KXUA 1F51E 5C7OO 3OIVA 1PFYA 4LDPA 3WK5A 2PT6A 1DFGA 1DKUA 3UCFA 4EG6A 1K5DA 3I0MA 1XEAA 2PN1A 3GQBB 4FEAA 4L95C 3SYNA 1NFQA 3LUGA 4G0QA 3FG9A 1XEXA 1VSBA 2R86A 2PGOA 4Q05A 5REQB 3DV0B 3WAGA 4OGGA 3EVFA 5KO2A 2I7CA 2EQAA 3W9UA 1OCEA 1W4RA 4YNBA 1T0HB 4YASA 4G07A 3M82A 1OFUA 3E5MA 2G83A 2WKQA 4NKRA 3UUWA 1XCLA 3BQNB 4BNUA 4V0RA 1E2MA 3S5UA 2DBZA 1XEWY 2G04A 4LZNA 2FN4A 3OQOA 4TVKA 5C7YA 2CW5A 2YNMC 1AKQA 1T8PA 3E1GA 2XOKD 2BKXA 4BMYA 1GZ6A 1KI3A 1TZBA 2AG5A 3HADA 4RHEA 2Q3FA 5FWDA 4YRAA 1K4MA 1P0IA 5JXHA 4XVQA 2UXCB 2AX3A 1BMFD 4OU4A 3R7AA 1XL1A 4AQ7A 1HT1E 4B87A 1WMEA 4R71A 4U0JA 1RLMA 3QLVA 2Q9BA 3OFNA 3KB6A 1ACMA 1P2VA 2GUWA 2WIFA 2R5NA 3OETA 5TX7A 1SJ9A 5F2NA 4L15A 3N0RA 1SG9A 2QRKA 2HMVA 1G8PA 1WJGA 2FZVA 3GLHB 4BUZA 1JI0A 1N0WA 1W0JA 1U0FA 1YO6A 2J9YB 3E2PA 1FS4A 4A26A 4BEBA 2O8DA 1JDBB 1NZDA 1VSTA 3K1YA 1ULAA 2XCLA 4TX1A 2HIHA 2W6NA 1NQUA 5GJVC 1X7ZB 1KE2A 3WYDA 1G66A 4EDHA 2GEVA 4UBJA 3IPRA 4RDCA 4JELA 1NE7A 4MLDA 3I28A 5LB4A 2H7YA 3RFTA 3RJZA 3ZH2A 3UKDA 6CHYA 4ZVUA 1CE8B 2BZSA 2WAXA 3EASA 2WSIA 1ZNXA 1DAEA 2VI5A 3ZCRA 2QLFA 2YHBA 4E46A 3K0BA 5HTKA 2IU3A 5DIZA 3D6MA 1KIAA 3KCNA 4D9CA 3T5DA 1KI9A 1H4QA 3VC1A 3KOMA 3A4YA 4N47A 4F46A 4QYSA 1JT9A 1REQA 3LFTA 1N7IA 3QZUA 2X42A 2D5LA 5L7YA 4M7PA 3TMKA 3BFJA 3AUUA 5LIRA 4XJXA 4KAXA 1ZRNA 2BE7A 3N07A 4LNUB 4TLDA 3AX6A 5AYVA 2EIHA 2OR3A 4BJ6A 4JL6A 4Y3UA 3WKEA 1E5XA 4GI2A 1LQ2A 1WP4A 2BZGA 2ZTHA 4BFXA 4YUXA 2PSSA 2JI6A 2WFMA 4GX0A 4RK1A 1R8SA 3RUHA 3MSXA 3W6UA 2J6BA 2RHTA 4R41A 3RADC 3NVKI 2C92A 4G5FA 1OAAA 4P0QB 2X9GA 3VTZA 4GZ5A 4OB6A 4QEKA 1NDHA 1G17A 2C07A 1ZCZA 3BE5A 1R5BA 3C16C 3CB4A 3L8HA 4V0KA 4UZFA 5HZMA 4YRIA 2CFCA 3SYKA 3TEMA 1YFJA 4MVJH 2B1JA 3PR2B 3CNBA 3O84A 4EKNB 3E2MA 1YA8A 3LLMA 4MRNA 5HWSA 1GTMA 4GC5A 1U0JA 5EKXA 4DG8A 2X7JA 3F49S 4TL8A 5FLKA 1UBOS 2W6ID 5K5EA 4HSEA 5EXSA 4JIMA 4DR5B 1ZAYA 4N39A 2YCLA 5B55A 3RVQA 5C34B 4O0MA 3V8BA 1KMIY 2G4VA 2BF7A 2QGFA 3I32A 3PS9A 4KWEA 3M5PA 4BO4A 1FB5A 1U8TA 3IEUA 1LLUA 4NEQA 4BNLA 5J4HA 4KLAA 1OROA 5AHXA 3PJDA 3V7FA 1JJFA 4N40A 3A3YA 1FFHA 1C1XB 1LBIA 1U2QA 1CD5A 1CRWG 4P3YA 1CY1A 5I9LA 2IY7A 3WIDA 2B9EA 1SU4A 1KH3A 1NKTA 2XYGA 3H1FA 3O3CA 4P9NA 1Q7TA 4QJ4A 1JLSA 2HL6A 4TMVA 5TY0A 1B43A 1ZH6A 4EHAA 1P0FA 5J5AA 1DKQA 1WEKA 2RG1A 4ALMA 3ZDDA 3MG9A 4RHFA 4MLZA 2IHTA 4ARAA 2JK1A 5BSHA 5IX8A 4IMJB 5E8RA 4WT7A 3GDWA 1ZP6A 3QKSB 4R2KA 1A2QA 4OL9A 1RXWA 3VC2A 3IBGA 2BMEA 4BL5A 2R0QC 3TOZA 2G88A 1NW5A 2DWPA 3E23A 2P67A 3DVAB 4MP8A 4W4TA 4YT4A 4MUFA 1RBMA 3K1JA 2XZLA 1XHFA 2XHEA 3IMFA 4QO7A 2Q7OE 3V1TC 2PE5A 2GZDA 4YPFA 2C8JA 2W6JA 4BLQA 5DHPA 4YDHB 4M0FA 4K86A 3TBHA 4DEYA 2FX2A 4EVQA 4O4IF 2HA0A 5A62A 1X1AA 3WGIA 4LF4B 3EW7A 9ABPA 1LUAA 1OW3B 1UMDA 1YB2A 4FNMA 4RZ2A 3G0DA 5HNKA 5DZSA 1MRSA 4E14A 1KSGA 3RSFA 4MYDA 3A9TA 3SIRA 3FLBA 2FUG1 2P7IA 1MV8A 5E2BA 3F6YA 3TCXB 2VZ8A 1JKJB 2BVNA 2I87A 4IMIB 1YL5A 3HY3A 1WHTA 3HS3A 1YU9A 1NQ5A 2C3MA 1IQUA 3E2IA 3Q5GA 4BN0A 4D80A 2E9SA 1AG9A 1MX5A 3L7NA 2WFLB 2AK2A 1QOPB 3C6XA 5F9MA 1MAWA 1Z15A 4PZLA 2PGLA 4L02A 4UVGA 3GUUA 5BORA 5JROA 4XFJA 2P91A 2JKVA 1JHYA 4PAQA 3U3ZA 2XZDA 1U0GA 1ZXLA 1P7CA 2PH5A 1RHKA 2VHTA 3GT3A 1KOLA 2ZTLA 3WGNA 2WKRA 3OU2A 5G4KA 1QGUA 3DDHA 1GDHA 4JXKA 4JP2A 3IL2A 3TG8A 1Q21A 1YQEA 4MARA 4TN1A 2NV0A 4KK3A 3DBLA 4CN8A 3PD1A 3H2IA 1Y1KE 4W9NA 1J2TA 1G19A 1D2GA 3UMSA 3LC7O 2CB0A 2XKJE 3OQPA 4CG2A 2TS1A 2GERA 5FB3A 2QPTA 4C0KA 2AFHE 4Q19A 1NYRA 2E21A 4UNNA 2VEOA 3FSGD 3ETJA 4PXSA 2A9QA 1HH4A 4ZRDA 3HGTA 4DC9A 3GUHA 2E4VA 2XW6A 3VISA 4PNEA 3SHWA 2FEPA 4HNQA 2AXNA 4DJFC 1MPXA 4ER7A 5EHQA 2E1RA 3I2GA 4KEAA 3GPDG 3DCIA 3ZS9A 1EHYA 1VSVA 5I5EA 4NZZA 5FI3A 1RMQA 1WS6A 3GLGB 4DNXA 1USVA 3QUSA 4P36A 2YN4A 4ESVA 3R0VA 4H3HB 4DR1B 4UNRA 2CLOB 2Q3MA 2W6QA 1ZNYA 2HLDD 2ZBVA 2EP8A 4KO4S 4WL0A 4I36A 5TV2A 3GLIB 1K86A 1XZEA 2WT8A 1Z6TA 3TQCA 5BSRA 3WLRA 2ZAYA 4WGFA 4GD3Q 2WTUA 3AP2A 3FDZA 4ZYZA 2CUTA 4AMVA 3C1AA 1F0PA 1UBKS 3P9IA 2G8NA 4FGJA 4YMIA 1XJQA 4Z9AA 2XGJA 3IJRA 2C4UA 3CXRA 3NBAA 3JS5A 3QFRA 1K5GA 1TCVA 3TIFA 4IHAA 5A5FA 1IL0A 4WKGA 4EPXA 2ECPA 1JQLB 3QVJA 3TW0A 4AWXA 3E9RA 5GIOE 3L04A 2RGNA 2D8MA 3AU9A 3OT1A 5EEGA 5BV7A 1V16B 1LDNA 3T3OA 2IEYA 5AW7A 4C0HA 2MSDB 3V1UA 1QRUA 2D5AA 5DRYA 5CB0A 2C57A 2AXQA 2UZ1A 3C3JA 3WGZA 2UV8A 4A0GA 3VYUB 2PCJA 1RXUA 3M5CA 3RLIA 2R62A 3DGEC 3MQ4A 5BNFA 3ZWDA 4IICA 4B3JA 5ICFA 4C7MA 5IC4A 1DDOA 2W0SA 3AHJA 3L82B 4MV9A 3C3BA 3SZOA 5GJBA 1IY8A 4ZIRB 2ZJ7A 4CKYA 4G4SO 2QSZA 4WKCA 1VLLA 4JLWA 1G6Q1 1JVSA 1RS0A 3OKCA 2A8YA 4I99A 4JDPA 4A0QA 2CYAA 3WB9A 4NMLA 5I7FA 2AOVA 3OO0A 4US1R 5U4XA 3TINA 2AOUA 1TF5A 1A9RA 3T5CA 4DL9A 2ZUEA 4YECA 2O2GA 2VATA 4YIKA 1MX3A 4W6ZA 1A27A 2OXTA 1KHTA 3FSEA 3HCNA 5JR3A 3FYTA 3RYFA 1PR2A 3PR3A 3RF7A 4PGAA 2VP2A 4OCZA 1H0KA 5JS1A 1YH3A 3H75A 3GFOA 2B4QA 2JJ1D 2XPCA 2Z6QA 2ZBUA 1QONA 1VE9A 2VOEA 3KEMA 4QARA 3ZNNA 3P8ZA 4N3GA 3FPFA 4OQ4A 5AJXA 5JMWA 3MWDB 4KQ6A 4CXMA 1QGYA 3NUGA 1TB4A 3A3KA 4JR1A 1YOBA 3M4XA 1YASA 1H93A 3DR5A 4EHKA 1OGIA 5A5GA 1ZGZA 1D1TA 3ZCSA 2A1TS 2QAGB 3LVFO 1Q95A 3ZGVA 3P5SA 5CK5A 1LTKA 3MB8A 1UOPA 2BMVA 4I81A 2OFOA 4UW9A 5CM9C 5BV2P 4M0UA 2IZZA 4LQCA 4XWGA 3AIOA 1ABBA 2XB9A 5JDCA 3MRVA 3QBVA 1EXVA 4JA0A 1UWCA 2J08A 2YY5A 4BNVA 3WLQA 1Z47A 4Q47A 3G8DA 4HDCA 2QV7A 3ZCUA 3LRTA 4CKBB 1ECCA 3QE9Y 4FFWA 1IN8A 1CJVC 4TLLB 2PA0A 5JC8A 1JWAB 3HFRA 3DCYA 4HZGA 4IM7A 2JFVA 3NDPA 3OJXA 4JLBA 4DQVA 4BQOA 2B8EA 3MA0A 5IH7A 1XRJA 4NNOA 5JT1A 5MFZA 3F4KA 2A5JA 3DPIA 3D8TA 3GG9A 4HY3A 3A1UA 2O2CA 2P90A 3DL0A 3JD3A 3OUTA 4FI3F 4UNIA 3WDKA 3UJNA 1UCFA 4WV3A 4ND2A 4FDLA 7ABPA 5IVIA 1M2NA 3QVTA 1KSFX 5MN4A 3ROPA 2XQFA 1BS9A 2FSGA 5DGTA 2HO5A 3HSYA 3RS7A 1PNVA 5EE5B 3UTDA 3ZDRA 5F12A 4F4IA 4CIAA 4QQ8A 5A05A 3VX4A 2RGUA 3ASZA 4DJTA 3VPXA 4A23A 2C8VA 1H1DA 5HMLA 2Y0BA 5K0SA 3JZDA 1IIRA 1Z4OA 1Y7HA 1L1FA 2R1TB 5BMVA 4F5EA 1NWHA 2VIIA 4I1RA 4W7SA 1QS0A 2IXEA 1T0PA 1WCXA 2BISA 2COUA 1NLZA 3FA2A 1IAQA 4GLJA 4O4JA 5FI0B 3RWOA 3LTNC 5FQOA 1DC8A 5EWLA 4FUQA 2ATEA 4MQUA 3DTVD 1XA0A 5KDOA 4CG0A 1E5QA 2OXFA 1BXZA 2HTEA 2PV7A 3L0ZA 1NF9A 4IHJB 1Q6ZA 1Y1PA 2VP3A 4RYDA 4E22A 6REQA 2VT7A 4M89A 1E6KA 4FZRA 5C35A 1II0A 3AB3A 2M98A 3TIVA 4DMFA 3H5WA 2C5EA 2REXB 1H2HA 5CA1A 5FLYA 3IVGA 4G5OA 4NLLA 2A9PA 1QHHB 2CZGA 5COQA 3ZWWA 4LE0A 3ORFA 2VPIA 1M6YA 1XQYA 3DULA 1TU4A 3EA0A 3IQFA 2WT9A 3FOCA 4WGGA 4RTLA 1AQUA 2I1QA 1PLLA 5EUBA 5AVTA 1L5SA 1O77A 1QZTA 1VIMA 7GPBA 3RIHA 2NUPA 3A58B 3L4JA 1PG0A 1QU3A 1UR5A 2Q4DA 4HNGA 4TL6A 2UYQA 1YF3A 1J1UA 5K3FA 4PG8A 1P3Y1 1SA0B 3LT0A 5IVDA 3OLZA 2Q21A 4FYWA 3F5QA 4OIFA 5BW4A 3ZE0B 5D84A 3U7HB 4KZKA 2DPXA 2WF8A 4D26A 5F5LA 4XR9A 1UKCA 1GR0A 4O6VA 3LBNA 1CR2A 3B8EA 2QVZX 1DO0A 4OLAA 2UUOA 3H17A 2CNKA 2QTAA 1YACA 1R0CA 1JG7A 1ULTA 3FZYA 3NFYA 4XR4A 3WNVA 3R8FA 3TW4A 1XZMA 2B25A 2HCRA 4JEIA 4MWDA 2D8AA 1SCKA 3IALA 2QEQA 5AVYA 2IXGA 1AKRA 4G65A 3HU1A 4CN9A 3ZR4B 3BD8A 4TT8A 5D5HA 4D9JA 3ZLJA 4TZ6A 2YV2A 3DQZA 4P7JA 1G4HA 5B1SA 1K8XB 4QXQA 2HCFA 3TWOA 3ETGA 1EFPA 1XVTA 2AWOA 2WU4A 1S2MA 3G2OA 1JJAA 3FPBA 5BUZA 1RE1A 5BR7A 1TGYA 1XXLA 1EA7A 4QODA 4YXFA 3NLLA 4LS3A 4X8LA 4A7PA 4EB6A 2CDRA 2DQ4A 3O74A 4KUHA 4DR3B 2UU9B 2PJZA 1TA0A 1SXIA 4QEZA 2NZUG 3UB4A 3TNFA 2Q6TA 3IUYA 1J56A 3OLWA 3PLNA 3ST7A 3NTRA 2JEYA 3B12A 5ANRB 4AROA 4JT9A 5C8YB 4IFBA 4KNVA 3W8NA 1C14A 1EXWA 2JCSA 2VYND 3KXDA 1TEZA 3Q5DA 2AUNA 4CL0A 4DIKA 2R11A 4NX2A 2IYFA 1LJUA 2JARA 3FF4A 4UARA 2EFDB 4UREA 5DDIP 2O6HA 3LYLA 2GEKA 4IDGA 4N03A 5GZ3A 3GQBA 2H9AA 3H5AA 3BEOA 3B2EA 4A2WA 1DG9A 4GO1A 4HWRA 1MC8A 3HHEA 3GAZA 3G0HA 2V7QD 3B6KA 3DV0A 2B3DA 2AIRA 4V0NA 4A6DA 1RQNA 1UMCA 4ENQA 1HLPA 4MUYA 2M9MA 5FT9A 4L75A 3WBJA 3HXMA 4IDAA 2SCUA 4CHTA 1Q1EA 1ORIA 1EWKA 1Z39A 2CC2A 3T15A 4IDHA 1K7YA 4TV9A 4B2YA 5HDQA 2ZRGA 8MHTA 1HYHA 4BNHA 2V98A 3T5AA 3GRVA 5JO9A 2VAXA 1NASA 5JCZA 2G7ZA 3A26A 5FWXA 3MILA 3U60B 1QBKC 1T6XA 1OYYA 2GZSA 2E7ZA 3ABSB 3TL6A 2BKUA 4N5MA 2FLWA 3OIUA 1WG8A 4W5HA 2OM2A 3L7JA 2PX6A 4R1QA 5DBIA 1BW9A 4KO1S 1Q0LA 4CMIB 3DXYA 3H0EA 1CG6A 2PX8A 4NYIR 4PLVA 4QJ5A 4ZRMA 1P81A 4Z7NB 4ZOAA 2O2HA 2P3OA 3KS9A 1JFRA 2B1QA 3LWNA 4FFNA 3DOHA 4Q24A 4FW9A 4QPDA 5LBIA 3P0FA 3SNHA 1M8KA 5C31A 2NTEA 1TL7C 3CNOA 2ENUA 1RAAA 4HRAA 1VXRA 2Q5LA 5K4HA 4U7FA 5EPEA 1H5QA 1YJXA 3UMRA 3W06A 4BGEA 1GUZA 1U3GA 5I9NA 4ZVTA 3RU2A 4HDNB 1AUVA 1F4VA 2XB6A 2FG6C 3SM3A 2J87A 1DOZA 2FR1A 2HF8A 2C1ZA 2Y99A 5H3LA 5HKBA 2AOTB 1W0KA 2Q5EA 4NU0A 2J4CA 3G85A 3LOPA 3DLAA 2Q41A 2JG3A 3OEHD 3EGEA 1I0LA 2J3IA 2ET6A 3SQDA 3MJVA 4BN5A 2GD6A 1JSXA 4Z7QB 4TMKA 3TOVA 4J43A 1NMSA 4UDOA 4NXMB 4GSLA 4QYWA 3VH3A 4GI7A 4Q9DA 2Q7DA 4CKXA 4YI3A 1RZRD 1MZPA 1NF3A 3CZRA 4V0LA 4DV3B 3DE3X 2O2SA 3P9NA 2ZB2A 4HFNA 4BNTA 2QRHA 3KWLA 2RKOA 3ZZUA 3K53A 5FULA 1K5PA 4ZCQA 1JQDA 3H8WA 2LBPA 1CRQA 2Q2OA 2XNDD 5HTOA 1KEEB 3O31A 5JBIA 3PUYA 4RENA 1FQOA 3H97A 1FSZA 2OD9A 3N58A 3TGPA 2JGFA 4X91A 2B82A 1T15A 3O9MA 4M0MA 1YULA 4E5DA 4X63A 3JZMA 1TTQB 5DXFA 3HEAA 1ODFA 2L17A 4BNFA 4CUZA 4JS0A 1GRQA 1BVRA 1Q7GA 3BTSA 3LUDA 4J3FA 2EX1A 3DS8A 3L4KA 3FPSA 2R6R1 1IAVA 1MQ8B 1HLFA 2EKPA 3WICA 1D1QA 1MC5A 3DC7A 2REQB 3VUFA 2ZJ6A 3FLMA 3LTEA 1DE0A 2CLIB 4DQLA 2A5LA 4UMFA 4EY8A 2GYWA 2V7XA 3LDHA 2Q4EA 3QE2A 2YWDA 3DP7A 2NP6A 3M49A 1XKQA 3K6JA 5EJ2A 3TL2A 1AQIA 4GVXA 4RY0A 1WVMA 3DJYA 3L01A 2FQYA 1UIRA 4UAVA 1U28A 1KOJA 3WHIA 2HGZA 2B5WA 5THQA 4RX1A 1ICEA 2NYRA 3IA7A 1DB3A 3N1UA 1Y89A 3H5LA 4XQEA 3EUFA 3FPCA 1ZYUA 4MA0A 5DYYA 3WG9A 3ETEA 3E3OA 5T3YA 4EA7A 5LP6A 1Z5UA 3GN2A 4BB5A 5JARA 3P9QA 5F78A 5EP4A 2CL0X 3TOSA 4AX4A 1HDIA 4AURA 3DBHA 4IDFA 2FZCA 2G70A 4FT2A 2HGSA 5F51A 5HIIA 1CEEA 2ZR0A 3CRVA 3BHJA 3QOYA 2ZIWB 1HEIA 2I3DA 3AGQA 4RF2A 2VYQA 2FR8A 3DKVA 3SQMA 4G01B 1U4SA 3K8ZA 4LK2A 2BKAA 3RWMB 1JNXX 1IUNA 3HO6A 4H7PA 4DOMA 2I6XA 3OCUA 1RHJA 1UBMS 2C2BA 3K4HA 1IHYA 3O90A 3DVAA 1ZVQA 1ZU5A 3RYTC 3WGGA 1QHSA 4W1SA 1P72A 1JR3E 2YXNA 3D7MA 4ND4A 2IIPA 4NCNA 4AW9A 5JJCA 1KI4A 1VYVA 3U39A 2WR8A 2HA6A 4FMBB 4X54A 4O4JF 5LZ7A 4IZHA 3OFVA 2DKFA 3IHLA 1OGJA 5HJ7A 4CNBA 5I4CA 4P31A 3W2FA 2VQSA 4MCIA 4YA6A 2VJPA 4YVFA 5AVJA 1CEXA 2ZZNA 3KDSE 3RAEC 3M4YA 4TRRA 2HV8A 2Q2QA 3Q98A 5CA1F 2W2MA 4G0WA 3NDIA 3Q7RA 3KJNA 1CV2A 1XZFA 2X14A 4JX8A 3AUXA 1K1EA 3Q8XB 3HVHA 2BLNA 3E81A 3FN4A 1W59A 4F4UA 3GL9A 3HSSA 4FR5A 2H7CA 4XTCS 5ALIA 5IT4A 3OHMA 2M6LA 3U5ZB 4GXTA 4JDUA 4I4LA 2I03A 3I9V6 2G1AA 4XLTA 5CLGA 5L40A 3BXFA 4MYTA 2JA2A 1DBQA 3PXXA 4OOEA 5EKTA 4LGVA 3R7LA 3EVAA 4LZZA 4DDMA 4BMNA 5LC1A 1GUBA 4MKRA 2CLCX 3UT0A 3HYNA 2JATA 5G3YA 3K5IA 4DHWA 2PYZA 1OC2A 2CMFA 4LKOA 4X7MA 4AO8A 1YOVB 3WNQA 3WX0A 3BMQB 3HJFA 1G3RA 1OYVA 1B6TA 2HWUA 4N0DA 1B8NA 2ZK7A 3LIPA 3DE1X 3OZTA 5NULA 3ZIUA 4G63A 3RSQA 2WWYA 3UK6A 4Q7QA 1OIXA 1Y81A 3HJRA 1QIHA 1V25A 3IIIA 3KR2A 3CYFA 2EVWX 4P5EA 4ZT7A 3V3KA 3J7AC 4JLSA 4DRZA 3OZEA 4LOLA 5BNZA 1GQRA 3QXGA 3L43A 4PFJA 1JIUA 1K4YA 3BE4A 1W5SA 3H7AA 3OCZA 1O6FA 4GR9A 4IJVA 4E2ZA 3BK7A 2GJKA 1VIYA 2PZ8A 1AUQA 3ZD9A 3RRJA 3X1MA 1W4ZA 3LI2A 2C7RA 2OT3B 2BUCA 3AEXA 1E7YA 3KEFA 5FOSA 1DQSA 1NV9A 4JBYA 1JLHA 4YYEA 2J0SA 1J06A 3AYXB 2BEVB 2N1BA 2V65A 2VS1A 4K6FA 2JFQA 4UM8B 2BMFA 5HRUA 5CK4A 2FAXA 1CQZA 4MDEA 3BA1A 4ZRNA 1LCIA 3E3NA 3OEYA 2WM8A 4IJMA 2FRXA 5TVKA 1V8BA 1E60A 2IL1A 4K6MA 4YQZA 1KVQA 5FORA 3JARA 5I7HA 2JJ1A 4Q4CA 3B7PA 4RCVA 1GYRA 3GJ3A 1IPFA 2A14A 4C07A 1KAQA 1U7ZA 1FK8A 5TARA 1OV6A 1HNZB 4RDXA 2ACWA 3JVIA 1XDZA 5EIWA 3HWWA 2Y1OA 5A6VA 4REMA 3UBMA 2EW1A 1YDWA 2DG2A 1L8XA 2NO5A 4BAZA 1C8LA 4YMTA 1S3GA 4ZVKA 3NC4A 2ZYDA 4IDNA 1Z28A 3LCUA 2DP4E 3MMSA 3C4JA 5FBHA 5DLPA 1I9GA 1E4EA 2J48A 3KYCB 1XTRA 2A88A 3DUFA 1S02A 3G6WA 3OUUA 5B58C 2O7VA 3D9QX 4WXEA 3GLFE 4TV9F 1L4EA 3VYWA 4DF3A 3LY5A 3UJ6A 1KYQA 4OFBA 1QZZA 4F2GA 1X1BA 1M34B 5TMDA 3BK1A 5DJ5A 3TTYA 1FL9A 1W4AA 1T26A 2GH1A 2H11A 4RFLA 5EP3A 4EZIA 3WLMA 2AG6A 2AJLI 3DE0X 1DAKA 2EG5A 3G02A 2IZOA 3HG7A 4GPIB 5I4KA 1K6IA 1N6KA 1XTUA 4KPUB 3S6JA 4TUYA 3OT4A 4NBKA 3LF2A 4S04A 4I1PA 1GZ7A 1UKEA 1X8JA 2WB4A 1B16A 1JBEA 3HI4A 1WZ2A 1CNMA 4LCJA 3JVDA 2XHZA 5KEIA 3DEFA 5AK5A 3ZWCA 1JEYB 3IS3A 2CDBA 3MN1A 5KHLB 5KU7A 5C51B 1G3MA 3ZTYA 1KYVA 5AD1A 2G80A 5AUQA 1HNWB 4A8JA 2IZ0A 4BNDB 4RSHA 1T3GA 4AMUA 5B5SA 4RSRA 4MRVA 5CLJA 1H23A 3GWGA 2IUUA 5L6LB 2R6HA 4IOJA 4QATA 3QELB 1SXPA 2YIDA 2C58A 3RK4A 4J94A 4HDMB 1OH8A 5F1YA 2CBXA 3H2ZA 1EZ1A 4PTLA 4Q18A 1XXHE 2ZRBA 1QQ5A 3DTVA 1FEZA 4B35A 1DHRA 1UKZA 1P39A 5G0TA 4DKJA 3DDSA 3PUKA 4KWTA 4DREA 3PSHA 4B44A 2IUYA 2OK8A 3ESXA 3ROTA 4NBLA 3VMFA 3ADOA 1L4FA 2Z09A 5CVDA 5L3RA 2LGJA 3MOGA 1UPBA 1SCIA 4R01A 4FYHA 4NPHA 2PMCA 2F43A 2FOXA 3L5OA 4ZQGA 5JZVA 5DEIA 3SX4A 4OKIA 2DPLA 4F91B 4FFBB 4V0OA 1EFHA 1J09A 3JQAD 1H42A 4KXXA 3FVVA 4GGMX 1NBAA 2ZTVA 5HBGA 4J4HA 1FDIA 1PJAA 3MTEA 2WHXA 2HSWA 5CB4A 3EE6A 4NZNA 2EQBA 2F62A 2H1RA 4DVJA 1DWUA 1BIFA 4D8UA 5AHRA 1CKEA 4PX2A 2M6SA 4XAQA 1M66A 4OXRA 1UPTA 1F5NA 2NPOA 3AEUA 3FWHA 2H7VA 1ORHA 1DSSG 2QD4A 4DIOA 1EVZA 1XAIA 4DZRA 1QDEA 3JRXA 2WRZA 3PNSA 3GLUA 4WE3A 3SC6A 3T7EA 5A1TA 1EXDA 1YZFA 1Z26A 3D7RA 3IB6A 5EIBD 4W7HA 1C8BA 3V1YA 4AJIA 3FH0A 1PR6A 3LFUA 3I92A 3KBBA 3QE0A 4CM3A 5L3QB 3UVEA 4O1HA 5G53C 1CS4C 4WN3A 1LEHA 1IBRA 2YZ2A 2IITA 4M3NA 1ZEJA 2VHJA 4CDGA 1ZMOA 4IIUA 4AVYA 3PYXA 3EXG1 4PV7A 2BE9A 4DMRA 3EZLA 2G0AA 1K08A 2DM6A 4J9VA 3FVRA 2OGZA 4L8YA 4ZV7A 2J5QA 5LP6F 1QKJA 1UODA 1SVLA 1WKCA 2GUGA 3N2ZB 5MDHA 1P2UA 3F8SA 3EF1A 3LOQA 3SSNA 3UMFA 5IF9A 1A5TA 4JC8A 2FEXA 3AL0C 1U1DA 4Y2TA 1OQAA 1XDWA 2WABA 2IUEA 1TAQA 2J0VA 3D0OA 4YV0A 4X60A 4PLFA 4R7ZA 3S1AA 4YFYA 2PKWA 1DC6A 3DF9A 2ZRMA 5M3BA 1V35A 4GXNA 3R7WB 1L5QA 3P32A 1OBCA 1N9GB 2AH5A 7AT1A 3ZKWB 4YBZA 3VNQA 3KQTA 5ALOA 1FNBA 1PHPA 1G20B 1QVAA 2Z98A 2D62A 4V03A 4M9SA 3QF7A 1SOAA 1XZPA 2EJWA 2GSDA 2EGUA 1IVYA 1ZCBA 3K0AB 4URYR 1A50B 4C4RA 3LW7A 1ITZA 2V7QA 2VDPB 1LKZA 1NBEA 1XTTA 3JWGA 2JA1A 4ASUD 2PL9A 3RRYA 3NV9A 3ZQUA 1J21A 3O8NA 4F3TA 4WZ6A 1PSZA 4A15A 1BEZA 2EDCA 4H17A 3ZU3A 3CSUA 1R0BA 2NTYC 1U6JA 2G67A 3B6JA 1NULA 2VZ0A 2ID9A 2LZ0A 4EMBA 2JW5A 3LHIA 4P5PA 1F4LA 1PZHA 2ECQA 2PBLA 4S3MA 5H0IA 1WWKA 4RM2A 4QVIA 2WJPA 3HB5X 1SHJA 5AR1A 3Q10A 4CIDA 4BGVA 1QM5A 3H84A 3LXRA 3ROQA 1OI2A 4ND1A 1PG2A 4JC4A 4S1VA 5D51S 2XQKA 5KJEA 4FHEA 5K6AC 1JMVA 4KLNA 1UADA 2A9JA 4PYQA 1UJBA 4FM9A 2I2WA 3OAAD 4CU2A 2AA3A 4CODB 3L8GA 1EWTA 3GOHA 4FLMA 2IODA 5AQEA 1LI4A 3V8MA 4Z4IA 2UXBB 2ZYUX 1J8QA 5B4TA 3ZDZB 3IAS1 3ZQ4A 1FDVA 4QXAA 2B98A 3KTAB 3T5PA 3KD3A 1EQ2A 1NP7A 5C8YA 3X1YA 1VFPA 1WQ1R 1Y6JA 4H59A 1PL6A 2J3MA 5DYGA 5LLSA 4CKWA 1N0VC 1BO6A 3RUPA 4KR7A 4IFIA 2AE2A 3NBMA 1Y34E 4EOGA 1GFWA 1H8EA 1N8SA 2QHXA 3MMNA 4FSXA 3VHQA 1X9IA 1P6UA 2NXWA 5T57A 1WHSA 1I36A 4A3SA 4EW2A 3ER8A 1DPGA 5IMSA 2GK4A 2A5YB 3DJFA 4W5QA 5K0LA 4XB2A 5HJEA 4JNKA 1ESZA 2ZZKA 2LP4Y 3ENZA 3OZCA 3UB3A 2H3EA 3UMMA 3OJOA 1VDMA 1EG2A 1KZ4A 1RAFA 2RHDA 2WC1A 3Q9UA 3VZQA 1Z2CA 4D96A 1CUBA 5BW8A 3PCRB 1YIOA 3L0PA 4C6TA 5KWSA 1NVTA 1QV9A 2EKZA 2XQIA 4NG4A 5SY4A 2BL4A 4L73A 4EA6A 5A4FS 3EY4A 4DLLA 1WCIB 5BYKA 1G0OA 2II6A 3IE2A 3NAMA 4IRMA 4QM6A 5D85A 1MTZA 1M0WA 3AR5A 3K9WA 4RD2A 2JLBA 4Y1EA 1RRCA 1M6EX 4F93B 1Q0PA 1SKQA 1OVGA 2HMAA 5CHEA 1ZIYA 1F4PA 5HMMA 2UUPA 1ZZEA 5KI6A 1LW6E 4NNPA 4UVIA 2X2EA 3B78A 5BT8A 2P9ZA 4M2LA 3LCMA 3IP3A 3RGWS 3ZHZA 3IR7A 2Z5FA 4E3ZA 1IY1A 1ECFA 3JQ8B 3JX9A 4AECA 5IU6A 4NE9A 1V8OA 2PX0A 8LDHA 4EI9A 1U6KA 1LDYA 3P2OA 4HDRB 5EWMB 1XQXA 2AW3A 3STWA 2WDPA 2NZVG 3QVSA 2DQZA 3GEPA 1R9MA 2Q3BA 4JR0A 2BTQA 2PU5A 3THOA 3ZGNA 4MGEA 2X8AA 3ZD7A 2CD9A 1CUSA 4JB0A 3P9XA 2OB1A 4MCAA 3SS7X 1TUGA 2ODEA 4Y67A 2JBWA 1EFDN 4LZJA 2FPOA 2WIKA 2PZBA 2XYPA 3BZBA 3C7DB 3M9XA 3BWMA 4IINA 5K2MA 4EP1A 3EPJA 4XD7A 1KFJB 3IC5A 4LNAA 1R4MB 1RWXA 3O9ZA 4ZMBA 4QDJA 1IB6A 3AV3A 2OA0A 3FOAA 3HZZA 3ZNOA 2FEWB 1W96A 4LXIA 5FOVA 5K0TA 2D3TA 4QYMA 2BONA 1Q0HA 1HTTA 1RQ7A 2FSVA 2BR3A 5HRCA 1G0NA 2FFQA 4ZHSA 4CM8B 1HOTA 1WUKS 1KMHB 1PSDA 4OMDA 5I9SA 2XZOA 1Z5WA 1BNCA 2QL6A 4H1WA 1XTVA 4Q4AA 2WD7B 3L1JA 1VKHA 2WHPA 4TUYF 3G7SA 2AK3A 3BULA 4QGHA 5E6SA 3IBCA 3JWHA 4GP6A 1QC5B 1NMYA 4JQZA 5KAMA 1KMMA 4Y2PA 4HAYA 1GG8A 1XHEA 1FP2A 3O83A 4RPGA 1X87A 4E15A 1Y5LA 2HPHA 1XI2A 4G0NA 4R1SA 3S2FA 4PZUA 3NKLA 5BOSA 1U1FA 2OVFA 1RI5A 4EBBA 1E7RA 5AI4A 1YDMA 5TJ9A 4MQ6A 1HRDA 3O3NB 1ZUIA 2XT0A 1IM8A 2RAUA 3QIAA 1NPDA 1XT6A 3CLSD 1F8XA 2XXAA 1PL0A 2OD7A 2IGBA 4LTMA 5LM3A 1HYGA 4JFAA 1ECJA 2I9PA 3LBAA 1ISGA 4GLFA 4RACA 4YRSA 2REQA 1Z45A 1SZDA 2GGSA 4NCIA 5CT5A 3LWDA 4TLMB 1F0NA 4G8DA 4J75A 3RABA 4UTNA 5IXYA 5KDLA 3D0QA 1PIWA 3GCWA 1K9VF 1V4BA 4IGAA 4LDZA 5DTIA 1MJFA 1GL6A 1PNTA 2Z6UA 1WXXA 3CX6A 4HXFB 4Z9FA 4YUYA 3C3WA 4BZQA 2PGDA 2D0IA 1VPEA 3DWIA 3M3HA 3COJA 1YK0A 4QD3A 1EUDB 3BAZA 4XVRA 3S5JA 3RAFC 2ONCA 5CCBA 2FPMA 1W9MA 2FG7C 4Q7KA 2XDQA 2CKDA 3O8QA 2CNOA 4FIZA 1U81A 1YA6A 2G6BA 1ZGBA 1EWQA 5AVSA 1FNMA 2DY0A 2GT1A 2Q62A 3NM6B 4BNWA 1FSGA 1XZNA 2H2FA 3EEQA 1QNFA 3H1BA 4GBED 1R6XA 3EWNA 3LG2A 5LUBA 1EP1B 5IASA 3ODGA 1BTOA 2O7QA 1RYFA 4AKTA 1FLDA 1QVWA 1OWMA 3AQ4A 5CB4F 3I4CA 5J4KA 2P9CA 5B3JA 3CVWA 1J8YF 4B46A 2I76A 3G8CA 1PZMA 5H3HA 2F8SA 1Q3KA 4OXKA 1NY6A 3DBVO 1QCCA 3BE6A 3BG5A 3HEBA 4KOAA 5FF9A 5LCXA 3VAZA 3VDNB 1EK5A 5BYBA 2I66A 3SBOA 3AR3A 2Q3JA 3QPCA 3DFKA 3WOHA 5KQPA 5H59A 3STVA 3E22B 3JQDA 3HFSA 4QWWA 3NBUA 2BTEA 5DI3B 1SQ0A 4BQIA 3HWRA 1CWUA 1XZGA 2F3SA 3VYRB 2ZIXA 3UCEA 4C4OA 4FHFA 4IS2A 1T29A 4MV6A 1IZZA 1XNHA 2HA2A 2OILA 4GX5A 3OG9A 4WSOA 5JEDA 2OV2A 3PE3A 2IIQA 1E5VA 2VDLB 3IMKA 1Y1QA 3FYSA 2VWQA 3BEDA 1EX6A 3BKWA 3L6OO 3L77A 3G1UA 3KM0A 4QAJA 4TS1A 2AR0A 1H1LA 3DBOB 3VJRA 4F85A 5ESDA 1NTOA 5IJXA 3DAPA 4XRGA 4NU6A 3UK7A 4HGRA 4OKSA 3EOBI 4ZKDA 2JI9A 1U8FO 2Y67A 5B36A 4H3VA 1KTVA 4H0CA 2XWJI 2ON6A 3PXGA 4TWIA 4YJ3B 4V2UA 1GGJA 3VNBA 4M53A 4RV4A 3HV0A 5HW0A 3WE7A 3E9ZA 4KVZA 1N7GA 1YIDA 1RWVA 4CUKA 2ZRLA 3I9MA 2FE1A 5JXIA 3W79A 1JFFA 2F55A 2VJKA 3QU5A 3HCFA 5DTJA 1VZ2A 2P9HA 3BREA 1GXSB 3PDUA 4M9ZA 1HQCA 2ZIFA 3NCTA 2HLHA 2EOAA 2KQUA 2ZRAA 5EKUA 3TVYA 1RABA 3QKIA 1PJ3A 4DM3A 5BSTA 1JTFA 1ZN7A 4WMLA 5BV8A 4XDZA 5F98A 1DEXA 4XJTA 1OXTA 4NIMA 3IPXA 1E2HA 3E9QA 4IEFB 4HXEB 1UXGA 3M4JA 3VDRA 2YBDA 4HNAB 4WXPA 3ZHOA 1BDMA 4IWNA 3BMQA 3K5PA 4X1YA 4P38A 1I0ZA 2GR9A 4K8OA 4WN9B 1U0OC 3DFFA 2H7XA 4XH9B 2IP2A 2JH9A 4EUHA 3QUBA 3S55A 2PKXA 1YKGA 3T41A 5KQMA 1WDKA 4MI6A 3TNYA 2HQSA 5AVQA 5KS2A 3SFTA 4QOJA 3JD1A 2H1LA 2PKCA 2R65A 5J23A 4KDRA 1R8QA 1WRBA 3VU9B 1JQAA 5HZHA 2ZJ5A 4EYQA 4QRIA 3DEKA 1FXSA 3VPAA 2BHRA 1Q19A 4CLOB 1P0QA 4YONB 2PT5A 2CDCA 2FB9A 4EAQA 2Y2VA 4FC6A 1Y5IA 4RNCA 2CNBA 1P1BA 2CMDA 3EFEA 4X3OA 1XZIA 1F9AA 2Y0EA 4IO0A 3MINA 1PGJA 2DSTA 1JFLA 2GBFA 3CUUA 3N0TA 5FIUA 2O2YA 4HUQB 4UU0A 3ZS8A 5SZKB 5KJ1A 1O3YA 1KQPA 3F78A 1RI1A 3R9IA 4ZYVA 5IZCC 1PNRA 5BUSA 3H0CA 1A9SA 2Y68A 5C8YF 1V6SA 3QU4A 3AKYA 4H2DA 5GP1A 4ZYWA 2WINI 2Q9CA 4ARCA 3U44A 1ENOA 1OBHA 3EG5A 4G4IA 1ZLXA 1YT5A 4RE5A 3R0XA 3THWA 1XRRA 3KDPA 4A1FA 2BJHA 2VH1A 3Q2IA 2PGIA 1KJIA 4H1UA 1V4VA 3N5KA 1W47A 4RELA 2XRFA 2ODTX 3ROFA 1C7FA 3NBZC 4RS4A 2P9TA 1YCFA 2EFGA 4DJ5X 4ZYLA 5E7MA 4EMUA 3G23A 5LQDA 3OBIA 4FCCA 3NYIA 3HN6A 3X2SA 4B4OA 3BH0A 2CZCA 4LHEA 2QY6A 2W2KB 4ESHA 2DF8A 4ETWA 5ITVA 4V0QA 2YY7A 4HJXA 4NFYA 3FCEA 3G5MA 4HNUA 2NSJA 2P3LA 2VJBA 3LDGA 5GM1A 5B3KA 1TQHA 1PBNA 2I2BA 4FUTA 1KJWA 2YHIB 4CHGA 4J4TA 4W8OA 1SBHA 1XMQB 3BA6A 1TUBB 4WZAE 1STOA 3W8DA 3H2BA 2D2IA 4QFBA 4FWIB 4UZSA 8ADHA 1L5RA 2FPGA 3JALB 4KKXB 4Z7JA 5EJGA 1RJ9B 3U3JA 1GY8A 1EVYA 4AF8A 4D5EA 1N9KA 1TECE 1XKTA 2G1JA 3PHIA 3LK7A 4MYUA 1PYOA 4KBYA 1R4AA 1MJNA 4KPUA 1WSDA 2NU6B 3MIIA 5HQ3A 3R3ZA 4GE0A 4AY2A 2BEWA 4OBXA 1K0UA 5JZ9A 3OJFA 3W4JA 2ZR9A 3RREA 1Q74A 5MFPA 3A2KA 3VR6D 3ZBPA 1HL7A 2ZULA 3PXUA 1RLTA 5AFSA 1I2BA 4HV4A 2GXQA 1B23P 3FHLA 1CR0A 3U4DA 2HSZA 3FD8A 5SYNA 3PX7A 4TKUA 1X1EA 2VNHA 2IT1A 3AVQA 3QUQA 2VEDA 3R9KA 5B2ZA 5DF1A 2R4UA 4HB0A 4F5WA 5CW2A 4KE9A 1ZVKA 1R5NA 3HACA 3DLBA 1RHUA 2MJLA 3KPWA 1O5OA 4G0VA 3SNKA 1II8A 3DNMA 4C05A 4EVRA 1IY2A 1H94A 1YKFA 1OLOA 1XKLA 5G1OA 4JI4B 1X1CA 4U5QA 1X14A 2BWJA 4P3OA 4A8HA 3BGSA 4ETNA 3V6MA 2NXJA 1T0UA 3O21A 2O8BB 2Q3DA 1QQ6A 3H2KA 3IP6A 1TF7A 4WINA 2GK3A 4CCSA 2CFRA 1FW8A 1KEZA 1JZTA 4CM9D 1V3TA 3HGMA 3DAOA 3KPVA 1X1SA 1QOZA 3QEKA 3QLVC 4N82A 4DTCA 1IZ7A 1JU9A 2H06A 5DLQC 3HB4X 3FGOA 1E66A 1HXHA 1KQ3A 1QH8B 4IQFA 3UGKA 4E94A 3FHTA 4B5KA 3KPUA 2AZTA 3ORQA 4LJYA 1I13A 3R2JA 3RV3A 4R69A 2IIBA 1Z29A 2VSFA 4J2HA 4PSAA 2IWRA 1OUMA 2H4XA 5CXUA 5AVZA 3KJZA 5F77A 3IV6A 2R2AA 3TIGA 3WGLA 4PAGA 5TPZD 5IMBA 5GZ6A 4QU9A 2NNWB 3FDJA 4COOA 3QXJA 4FB5A 1F0YA 4QQNA 1OX4A 3AB7A 3LBIA 2X1MA 2X0EA 4WH0A 2X86A 2O3QA 4FJ1A 3DYIA 4MKZA 4I9NA 3B82A 5EJ8A 3BTUA 3RYHA 4GP7A 4M87A 4NH0A 1BKYA 2FNAA 3REQA 3SS8A 2B7LA 2ZJ0A 4GDMA 1NATA 1O95A 1DOHA 4WOKA 2ATVA 2HMWA 2OV8A 2A5FA 1Z75A 2DPYA 3BICA 3K8OE 4W8HA 3QVMA 2WYOA 4JH0A 4DCUA 1GT91 4R16A 4HS4A 2B6HA 2J7PA 3GPCA 2CXTA 5IC5A 4LJKA 1EBFA 4M55A 2CCKA 2QJRA 4IDOA 1V1JA 4DSZA 4QVGA 3C6QA 3EC7A 3GPIA 1P74A 2Y93A 4DNPA 4TZKA 1X39A 4B6RA 1BEUB 2NV6A 4U7DA 1K6EA 3PDWA 1E7SA 4UUQA 5F5XA 3SE0A 3U3XA 3WRXA 4EY6A 2PBFA 3A9RA 1ZMXA 3GVCA 2JFXA 5L3SA 1JDPA 3UJPA 4NCXA 3S1LA 4UBKA 4HAIA 2VYFA 2FEAA 3TS1A 4B3GA 2A3RA 1JE1A 2XI4A 3OAAA 1A8QA 2LR0A 1I5EA 1O54A 3GGDA 3JATA 2OBYA 2WAMA 4ZI7B 3QYPA 2CJYA 4Y7CA 1H66A 1R0ZA 3N6XA 5FOUA 3CNQS 1QB8A 3NATA 2NMVA 3A25A 2ZCUA 4JXJA 4WEQA 1IHDA 1KH1A 2DHQA 4GF5A 4TVBA 3TUIC 4BLUA 2YZ7A 4N4AA 2FJUA 4I1VA 4YJHA 4P3NA 5SV2A 3KPYA 1QCZA 1LV7A 1EZZA 5E6UA 5H1YA 1X38A 1S6YA 2F2TA 2IHVA 2XE6A 1V8FA 4JI8B 1WQ3A 3ICVA 5K0NA 1M0EA 1YKSA 2QZSA 2H07A 3Q3HA 1GAQA 3GLHE 5DM1A 3BXHA 2D5CA 3KLPX 5THXA 3TLBA 3ZU4A 1Y9EA 4BTLA 4F4FA 3PXBA 4D9FA 4PANA 1NJ6A 3L7KA 2E4YA 2CXHA 2JLZA 1GPWB 2I67A 1U2DA 2RK6A 5JJBA 3BMNB 4IKPA 2FF7A 3ANSA 5AESA 5JSUA 1R1DA 4L0MA 4UDYX 1Y9JA 5HE9A 5J63A 4XVCA 5CBPA 2VXBA 1I6WA 4D9IA 5EJEA 1TPYA 3CX8A 3DMYA 1MIOB 1SBTA 4DR7B 1KJ8A 1MAHA 1ODIA 3OOJA 4AZ0A 1D6NA 2CF5A 2HPAA 3AVXA 4H16A 4YH1A 3AW8A 4HNTA 4Z4CA 1RJGA 5CLHA 4FOPA 1HFKA 1O9BA 3L7OA 2ZSEA 4DABA 3D6VA 1GUAA 4F1WA 3R4VA 3OE7A 2GAIA 1QKKA 5H8WA 2JLXA 1UBGA 3TJZA 3AESA 3OFKA 1VBFA 5CLQA 3NX4A 5EMHA 5K8IA 4XWYA 1BKSB 3ZCPA 4E1AA 3A2NA 2DFPA 1SC4A 2VLBA 4TKZA 3COYA 3ZE7A 3F6SA 2AFIA 3QVWA 4GMXA 3HFJA 5EUCA 3WRYA 5DYNA 5IBQA 3OJWA 2PVPA 2Y6UA 5HP4A 1C0EA 5CYFA 1M0SA 3M34A 4MKFA 1H4TA 1R6AA 1WE2A 4GMGA 5KVCA 4AMBA 5JJIA 2WYUA 3H2JA 2XGOA 5I7SA 3NOVA 4MYHA 4OBBA 3TB4A 1MUUA 2ES4A 1NG9A 4G2NA 3KT0A 1Z0AA 1ZK2A 4KBGA 1MP0A 1WSWA 3BFVA 4WXRA 2N47A 2RGXA 5DBOA 4H0NA 2FUEA 2DFVA 1EGMB 4ZI2A 4F4CA 1YZNA 3HY4A 4KO2S 2UZ0A 2W2PA 5C53B 3REGA 2GJ9A 13PKA 3GLQA 5GONA 1GNTA 4M9XA 4OK6A 5IS2A 1UBEA 3C5HA 1GPBA 1OI7A 3MTIA 2X0DA 5TQ2B 4C4ZA 1NGSA 4QM7A 2G72A 2OC4A 2AYZA 3UG7A 3SJAA 3EGOA 1NLYA 2BFDB 1O6CA 3N59A 1E99A 5H9VA 1E94E 4FHGA 1RDFA 4BHTA 5T6MA 3PFHA 3B60A 5CJJA 3IT0A 3CQ9A 4W9NC 3V1KA 5DBEX 2D4AA 5KYYB 4QGAA 2QXTA 3EVGA 2PZGA 4JSTA 3JQ7B 2W00A 5F35A 3RJ9A 1M2VB 3GEGA 5DM70 1OAOA 3JQEA 4AY4A 1M2HA 1YJQA 3WMFA 1JLMA 4HAVA 1SVIA 4X9XA 3TOXA 3LE8A 5LNK1 2Q1SA 5KINB 1TNDA 1SCJA 1EVLA 2AJTA 4MDFA 3CVOA 4MOWA 1H3NA 3OIDA 3KJHA 1AV7A 1YC2A 1BN7A 1WBBA 4XJVA 2DHRA 3C6BA 5H5JA 4MW5A 5KC8A 2VOJA 2H0AA 1XP8A 5F7ZA 3RSSA 2O0KA 4HDRA 1USWA 3A05A 3HR4A 3MFQA 1U3TA 3DZDA 4IIDA 4UQOA 1JAYA 3WQSB 1FFXA 1OWNA 1ADFA 3N2KA 3LYUA 3H9UA 2BHNA 3TB6A 3LGAA 4E0BA 4M21A 1GGMA 1PFWA 4EG8A 4ETIA 5JD4A 3RYCA 1HR0B 3PYLA 2V7GA 3DUWA 3V1LA 4PAMA 2YJGA 4Z7OB 1KI8A 2P9YA 1EMDA 3N8KA 3QPWA 3FDFA 5IEJA 3MK31 3IELA 3HBMA 3KTDA 1KDVA 1I4EB 4AUKA 4DT1B 1V1MB 1JP7A 3OA2A 1DAIA 1THTA 3EQZA 4AP6A 4ZK2A 1FF9A 4S2EA 3V34A 3BX1A 3I5AA 2GCIA 3FYDA 3NUQA 3WP0A 2IX3A 3FTDA 1ULSA 2RGNC 5JCXA 2WD7A 1SO8A 3GJSA 2HOQA 4MITA 3VDQA 3R23A 3WGUA 3TD6A 3GWZA 4G9EA 4L50A 3T1VA 2R96A 4Q34A 3TNLA 1P2BA 1R10A 2ZGVA 3T7DA 4DCMA 4AZSA 5JY1A 2OHXA 5IT9A 3CURA 3H1AA 1ZN9A 2WSYB 2CL7X 3M89A 4LHYA 2YS7A 3TLJA 2YY6A 3WSWA 1DTWB 1U0NA 1LPBB 1X7DA 4RK4A 3X44A 2BI7A 1O57A 2E4UA 3O8BA 2PL3A 4MNTA 2WA2A 3I8XA 3ZZ1A 4MPRA 2BKEA 2OQIA 4IVRA 1W93A 2HFJA 2XCRB 1JDSA 3CX3A 4JKIA 2VTEA 4UCXA 4EZEA 3X43A 4DSNA 1Z2PX 2VDWB 5DKFA 3EBPA 1UXHA 1L5WA 2HJHA 1XYVA 2AI3A 2VHVA 4H3KB 1A9ZA 1O94C 1FS6A 1TO6A 1P4HA 1ZA2A 4N49A 5FCDA 4PG7A 3HKEB 4IIJA 2E0IA 4IX9A 2AC4A 5LXTB 3KZNA 2QVBA 4EITA 2IEZA 5ALSA 4FFOA 1EX7A 2I7DA 1G7RA 5AI8A 2HBRA 4R83A 1HK7A 1VLVA 1VE6A 4KV9A 3TDMA 1FTNA 1SUAA 2HEGA 3FMIA 1JHMA 1PQUA 1U8UA 3EXIB 3X1WA 4C3OB 3GLGE 1ZHHA 5J2UB 2CXOA 1U7DA 1NURA 2RJ3A 2BR4A 1NOKA 2YX1A 4MZDA 4UATA 1ZUNB 5L7TA 3LZ6A 2P6RA 2EKBA 3ESZA 5AVVA 4FTWA 1T13A 2F1RA 4JXZA 4U5XA 2C7BA 4D97A 1P7VA 1OPXA 3AUYA 3BHNA 3BQMB 2AR9A 4FDAA 3ZDCA 3D5QA 4NSNA 2O20A 4NOJA 1EVKA 5IK2D 3OSUA 3RAJA 1G9TA 3AERB 3LP6A 4FFVA 5HFNA 4DLKA 2WZQA 5ALWA 5CITA 1EGQA 3WLEA 2XY4A 3N7AA 4F86A 1EFRD 1VJCA 3FLAA 4RLFA 1OKKD 4HT3B 1J1ZA 1XBTA 3QU9A 4KJXA 4Z8XA 5JDCC 5IJWA 2WSMA 2Y27A 4EB3A 2NUBA 4YAJA 5F4BA 3CLVA 4BQFA 2HB6A 3P0JA 3HZHA 3EQ6A 3P94A 2OL4A 3NOQA 1E3IA 1GNLA 4GYKA 4C78A 5JAMA 1RPZA 5AVKA 4JUFA 2D2XA 1JQ3A 1RQ2A 4KFSA 4KSYA 1Z0UA 2GD0A 3H0KA 3F0TA 3TW8A 3W77A 4CG3A 2QM8A 2WUEA 1ZCFA 2V6MA 2VPQA 5A9SA 1DUSA 1VG1A 2OWDA 4FYIA 5L7WA 1H2RS 3KQPA 1P7PA 2OECA 1VHLA 2QX7A 1SEPA 4LDJA 3ISVA 4YT2A 1FRQA 4OFWA 1UZAA 3CLUD 5LYJB 3KR1A 3THYB 4NQRA 2HC9A 2ZSJA 1D2AA 1ZICA 1SQFA 5JNWA 1ID1A 2K4MA 1SXGA 5D01A 2HRRA 2YXPX 2ZPUA 3BDVA 1V3QE 3THSA 4F71A 1NUUA 4EPYA 1JQBA 2W4MA 4JEHA 1GGHA 1BE1A 1YCDA 3RROA 1BXGB 1ZGCA 2EXXA 3QOXA 5DX1A 5FRDA 5DB4A 4J3JA 3G2NA 2B5OA 1ILEA 1UP7A 3QLUA 4O4LB 4G0XA 2D1FA 5TB5A 2NTNA 4MCHA 1GXSA 1F20A 2NGRA 4EA8A 1E58A 1PI3A 1VP9A 2G5TA 4MS1B 1RCUA 3GJ5A 3MHPA 3VTFA 2Z2ZA 5HKOA 1U04A 3WO0A 1XDBA 4ZV4A 2JGNA 4PWYA 4X24A 1Y7PA 1AT1A 3TEFA 1Y48E 3ZPXA 5DGHA 4ADSG 4LYGA 1SUWA 1I2MA 4OREX 5LIPA 3O2NA 1VC2A 1L5HB 1VXOA 3CLTC 5LQAA 1NQOA 1YVEI 4HTFB 3EIEA 1DIOB 5G2OA 2WAOA 1ANKA 5C5EA 5K0ZA 2VK2A 3ZIDA 2ZEJA 4F21A 2Q1YA 4E07A 4DQKA 1E6MA 4X41A 3L4BA 2B20A 1YZYA 1B7GO 3HBLA 2PRKA 3DBIA 5DM2A 3MOIA 4F3YA 1FS5A 4AB1A 2RGBA 4WXYB 1Y42X 1D9XA 2IP1A 3T9FA 5HSGA 1GIAA 1SKAA 1ZIXA 1A4XA 4OV6B 3AH8A 4QXPA 3AZPA 4HEA1 4R84A 5FTMA 1GD1O 4NCAA 2Q5HA 4BYGA 3PNVA 2W58A 4FR2A 1SUDA 3LHFA 2XZPA 5CXQA 2JLVA 3NBFA 1D5CA 1HYBA 1SBYA 1XC7A 5E7JA 4IJQA 3VO2A 5BXQC 1XMJA 2WTBA 3WYCA 4RVUA 1UK7A 5TGTA 3VR6A 4DMCA 3K32A 1UXJA 1I14A 2C4WA 4V39A 4EPRA 4GSYA 2BY4A 3QX8A 1KIFA 1IHUA 3I1YA 4O2RA 5G3ZA 3DWGA 2GFIA 3DXZA 4E5VA 4DV4B 4RH1A 4TKMA 3LRPA 3G3EA 1A4UA 5FJJA 1P45A 5D7NA 2YV1A 5D8DA 4ZOLA 3N8GA 1R0YA 4K6OA 4YAFA 2WJHA 3ER6A 1C9YA 4HN4B 1VG9B 1V5WA 5HJ5A 5EHXA 3R9WA 5GONF 3R5FA 4WTOA 4H15A 4TLBA 1J9ZA 2V8BA 2BLLA 4V24A 3IIKA 2NO4A 4I8XA 2O2DA 3TRIA 4CDNA 4IDEA 4MQFA 4BCCA 3EPKA 1RXVA 3WYAA 4ARUA 3C45A 4J16C 2R84A 4Q03A 4QBFA 4ZQIA 3IOMA 2RH9B 1TK9A 3CFYA 3EXFB 2G5PA 4TMZA 1M6NA 1KSJA 1SBNE 2HQRA 2YQ4A 3C7AA 3NPMA 4K9SA 1WKBA 3INTA 2HA7A 4CL3A 3DAGA 4DLSA 4DZTA 2O4CA 1V8PA 3Q8KA 2JFZA 2RDMA 2HF7A 3KP1A 2ZIAA 1PV2A 1RJ9A 3SDBA 1DEKA 4KSBA 4POOA 5B53A 2UAGA 1T1SA 5DU2A 4I4TB 5AM5A 2YBEA 2ZR8A 4R81A 5TPZA 2NU6A 5IJAA 2HRCA 4Q4JA 2V4ZA 4OXNA 4YJGB 1SBQA 4XDGA 2NAPA 2ZBDA 4CWAA 2C99A 2P5UA 1KY2A 1D9ZA 1M5UA 5J47A 4B09A 2AB0A 4BFCA 2DU8A 4OX9Y 2FZWA 4GMFA 3R0JA 2P2LA 2Q6IA 1DCMA 3VPBA 2CGEA 2XGGA 3MWFA 4UOEA 5JYBA 3ZXXA 3ZVMA 5AJZA 2D6FA 3HVRA 1HDZA 3C5VA 5D3QA 2NUAA 3KK0A 4KYUA 4UASA 4RMJA 3VR5D 5BRJA 3AJAA 3AWDA 3AETA 3BTVA 1OF1A 5ULLA 2P2ZA 2W6CX 3TIIA 4KPGA 1QIFA 1N57A 4PLTA 4JLOA 1ETHA 3KZOA 2CT8A 2I2XB 4KITB 2JI7A 3T94A 1G5IA 3JSAA 2C03A 5EHNA 2AN3A 3BF8A 1CUUA 2PD6A 1Y6FA 3O9VA 1MO5A 1I2ZA 3V8NA 3AXTA 1J8FA 3QVLA 3ZDYB 1M54A 3IXLA 4O2AB 3CGGA 5J1SB 2EEZA 5LMNB 1F8UA 4NAUA 4YB8A 4B81A 2CSUA 4P53A 3ZHVA 5B4VA 4E03A 4K9DA 1VJ5A 1B0AA 4CMGA 3TD2A 2J5BA 2PD3A 2W22A 3LHKA 1JDUA 4JYCA 4L07A 4LSWA 3VPHA 5JSQA 4JP8A 2O1EA 1XRPA 1QLJA 3V00A 3ZCTA 3NNNA 1PJ2A 2BSAA 1PL7A 1SQ6A 3K0FB 1HFWA 4HRVA 1HEUA 3UEOA 1W94A 1KXJA 2QGZA 1XRLA 2I6SA 4E32A 3WP1B 3U7GA 2IY8A 4R7GA 2EYUA 4G89A 4NVRA 4PNZA 4Q37A 3WOVA 2Z5VA 4WCFB 1KO4A 5TJHA 3PFIA 3IVCA 4A2PA 3BCSA 3WGOA 4L27A 1EVJA 1KKLA 4FGWA 1MTOA 3SKXA 5C9ZA 4C76A 1ML4A 2C2YA 2PH1A 1DXOA 3ADDA 1NJGA 1V5GA 2PVCA 5ALUA 4EZBA 3TN7A 1DEHA 1MKYA 1QIJA 4IIJF 1DCKA 3ZWPA 4AM8A 2Y1LA 1U7TA 2HQBA 2WLTA 3G5AA 1C2TA 3JVVA 5KQLA 4F3KA 1LU9A 4U2EA 4W5TA 1GCGA 3ANTA 2JF0A 4QNMA 5TRTA 4UHJA 1F2DA 2AVDA 4UFNA 4F97A 1BVYF 4U2GA 3NZEA 2K87A 4NATA 1PL8A 3RKSA 2H63A 3KT6A 1ST2A 5JANA 4BMPB 1SVUA 1WB6A 5K0EA 2ZE6A 4UMEA 4J0DA 4XQGA 3WQHA 4V1CB 3VKWA 1EIWA 4FMPA 3SQXA 2A92A 4OMCA 1UT5A 1ELOA 4BP8A 1NBWB 1PX2A 3TZCA 3QVUA 3N7TA 1NP3A 2WQ7A 1RTKA 5JAPA 1S2DA 2YHAA 2VRWA 3MGGA 4MQMA 4NBRA 4XE5A 4JN6B 2W2QA 2Z9CA 3ID6C 2OOSA 4FBGA 3KZKA 1D0SA 4Q9NA 2X8BA 2SNIE 2QMZA 3V8EA 2YN0A 5BMVB 1M1NA 2O7NA 1XQ1A 2I1LA 3HRIA 3WADA 4S35A 2PRIA 3RTEA 4B8ZA 4HB2A 4BMVA 1N3YA 1XCGB 3VPFA 3WL3A 1R5OA 3DZGA 3PQ6A 4PHCA 4KPFC 1X0VA 2AZDA 3G49A 4PZZA 2RFLA 3USCS 4CT0A 1MX1A 3HP1A 3ZEIA 4CGZA 4HAZA 5F3WB 3S2UA 2GMWA 4L4SA 2WIGA 3Q7IA 4JQOA 3KV1A 3EGXA 3C3DA 5D3MA 4C29A 4HZUB 2QNRA 2UUBB 3OWOA 3ZY2A 5EQDA 4B3CA 3SJBA 1RYHA 4EIWA 3RQSA 4BU0A 1KK2A 3AFOA 2FR8C 2BGJA 3DDCA 4M76B 2MDTA 3LZCA 3VOSA 1XNRB 4Z4HA 4MEBA 2HMSA 4Y9SA 3TFQA 3TXYA 4YK7A 3WYBA 5HQTA 1ONBA 1ISFA 4GWKA 3ZOKA 3KHTA 4IYJA 2O9JA 4AY3A 1E2NA 2P2YA 3LUAA 1QO0D 3EXHC 1EP9A 3D3NA 2IYYA 1L9KA 4LIPD 1NHGA 3K96A 4UTOA 4NZMA 3KT3A 4X1KA 3VC3A 4XWKA 1E62A 1X86B 2QTVB 2YHUA 2GHTA 2QD2A 3AWIA 3RSHA 4DXAA 1EDOA 2H2DA 2AEJA 3QITA 3SR4A 1CP2A 3UKOA 2ALJA 4NS4A 5BR4A 3NWEA 3KVOA 4WZBA 1ZI8A 4Z8YA 4RO0A 1C3OB 3SLKA 1Z35A 5K3CA 2BFCA 1RC8A 2CMGA 4NAHA 1P1KA 1P29A 3AJEA 3NEYA 4IOMA 1I6MA 1OU0A 3IP8A 3SU8A 1VJ1A 1FPMA 3OTHA 1XVLA 3U1BA 1RCTE 2PSJA 2VF8A 1QIGA 3DZBA 4GKBA 4I8DA 4KTTE 3S28A 1NXOA 5TMBA 3EDCA 1QX4A 2WKSA 3EK2A 4JU9A 2IQ5A 3K5WA 1AKWA 4KVAA 4PVCA 1DIHA 4NDNE 1LFDB 3HSKA 3A9VA 4JGBA 4J8PA 4DWVA 2H1CA 3OOHA 2ZUCA 3BGWA 4F6LA 1AQYA 3SHVA 3L40A 3F98A 3TZKA 4D4MA 2IEIA 4DMKA 3WI7A 1QU2A 1EZ4A 1KI1A 3ZY5A 5LQCA 3VVLA 1NC3A 2VHYA 4G81A 4WLVA 4RS3A 1RWNA 4QFDA 1F2UA 3ILSA 3LQQA 5AM4A 3SC2B 2EWMA 1BC5A 2RCNA 1VHTA 3UB2A 2CXUA 4QUBA 3S0JA 1QSGA 1SK8A 3F7NA 2BBSA 3QWIA 4Y6PA 3TEJA 2BPOA 1B2RA 1CR6A 2PGNA 2WI8A 4A2CA 1P1CA 1YFKA 2GO1A 3D6TB 3IDQA 3PWKA 2P77A 5IDVA 5TQ0A 4BC0A 1CP3A 1Y4UA 2Y8EA 3H7IA 4WKNA 3T3MB 4PIVA 4FEYA 1ORTA 2JAHA 4FN4A 2QX6A 1FA9A 4JROA 4RA9A 2YWRA 2ZUUA 3GBSA 4S1TA 3U4QB 4X00A 2R1UA 5IJ9B 3P96A 1B0ZA 4JI0B 2JKZA 4UD6A 3G1WA 4BWYA 1ZOLA 3NEPX 1CQPA 5EMKA 1K2VN 4LZPA 3WL6A 1QGED 4ZOLF 4EFKA 4DR2B 4DM4A 4AYTA 1FFSA 3VR2D 1DFHA 3LH5A 3QW4B 4D8VA 4L4RA 5BQ5A 3MLEA 1YVPA 4B3TB 3MYYA 3GYBA 3DPSA 3CPSA 6GPBA 2ZJAA 3UAVA 4M1SA 3S40A 1X6VA 1SURA 3RK0A 4Y2VA 5DNWA 3IJEB 3STXA 3PHLA 3G2PA 3FUTA 1U7PA 2VCEA 3FX2A 4IG9A 2C95A 3DOOA 1ZIPA 3IMEA 4B3FX 4YJFB 3DLHA 3I34X 1G21B 2FPIB 2PIDA 2NUTA 4X6YA 4HP8A 5EC8A 2JNWA 2ZCVA 3SY8A 4WK6A 3FGZA 3RVNA 3WMXA 1NJSA 1R2QA 2VP9A 4HH4A 3F6EX 3KQSA 4RHUA 4RXUA 1BS1A 4C9BA 4M0LA 1V47A 4MS4A 1DELA 3LKDA 3WL8A 4AZWA 5IBCA 2R97A 1DKRA 3K1ZA 3ZJ4A 5IKMA 1BXKA 3OOEA 3PYMA 4MVJI 5CR9A 4LXHA 5FI1B 4UCWA 3D8SA 1T2VA 3K20A 5IK2A 4E70A 5DFAA 2WDZA 1QR6A 5JVDA 3G88A 2XMPA 5LB2A 4Q39A 4ARZB 4KAFA 5BN4A 2XMRA 3BWEA 3KKOA 1EFRA 1K92A 1JBKA 2ZRNA 1P73A 2H2IA 4JXXA 2EU8A 2FGJA 4Y2UA 3ZWXA 4BNNA 4Z9BA 1MAVA 2QE6A 4QUIA 3DO5A 4IUCS 2AVNA 1U3WA 3PDIB 1D2HA 1JB1A 1H05A 1X7HA 1ZD8A 2I4LA 3FE2A 4N0MA 4ND6A 2NVBA 5FD8A 4F9FA 4LEIA 7MDHA 1DKPA 1XUOA 3OC0A 1F0KA 2C84A 2WUGA 2JKYA 2GD1O 1ZSVA 1E2FA 4RVCA 5HE8A 5CH5A 4AJKA 4XWWA 4J0FA 2HHHB 5JPCA 3PUXA 4KH0A 5BVGB 3BB3A 4Z4FA 1FUKA 1G8HA 3KYIB 5IDQA 1YR6A 1TYDE 1JIXA 2VQ6A 4LGMA 4PZ0A 5EP2A 1M6WA 2QPAA 4C7BA 3ZWBA 1YV9A 4JL5A 4BUCA 2GKOA 3KKNA 2JJ2D 5IG2A 2XADA 1L7EA 3R7FA 2H2HA 3U3KA 4DQ0A 3LT5A 3G8BA 2P41A 1FX0B 5L3VA 3V8RA 4A8JC 4LJ8A 5K0BA 2GPYA 1PVVA 1U1CA 1ZUNA 2X22A 4BLSA 2D1SA 5KSZA 4N1AA 4MO2A 2HNBA 4M37A 3TL3A 4BKPA 4DNFA 5BWOA 3N86A 3PFBA 1YZ3A 4WY5A 3IUQA 4BC1A 2NZ8A 4BLTA 1TQDA 4YJ2A 1U9ZA 3HYLA 4MGKR 4TSFA 1C3XA 1Q14A 4FOSA 4OHPA 2GPJA 4WW0A 5F73A 1V43A 2ZFUA 4QYIB 3PKZA 4OQYA 3KKQA 3NHKA 4ZVOA 3BK2A 2VAMA 1T2FA 4LSZA 2QK4A 4FHCA 1JKIA 2GWHA 1KR2A 4M9CA 1FY2A 1UFVA 4K2AA 1GO2A 5LPNA 4CKZA 3BMOB 3LDFA 2PUFA 5CHYA 4B2PA 1I3KA 3QJ5A 1G7SA 1CZRA 2VWPA 2GCEA 3PFNA 3CHYA 4LOJA 4WZZA 4MV3A 4Z6KA 5BN5A 1SUFA 2VTBA 2GF2A 1ZBDA 1ZOSA 3FDXA 3CCCA 4BMSA 1ECBA 2Y6VA 3EVDA 3CF6R 2QSJA 3GRUA 3GZNA 3MS4A 4FN5A 3UC9A 4KDFA 5KYUB 3TG2A 2YFKA 4R05A 4LCEA 2PH7A 4R3WA 1C2YA 3DNPA 3THYA 4E5KA 2DT8A 4HN2A 3EGCA 16PKA 1Y1RA 1M34E 4HGZA 4LCBA 4HPWA 1QHXA 2F90A 1L7AA 4IY1A 4LXQA 3V9AA 4EABA 1JHQA 3L7CA 1PQ4A 1CUFA 2FR0A 3IR6A 4RWZA 2BTOA 1T8RA 1TMGE 2V5UA 3QOFA 4MR9B 4XSGA 3WGHA 2GTPA 2LXNA 2VJYA 1N2CB 1UMBB 5CMLA 1XAJA 3T9BA 4EG0A 5LJIA 2R751 1JHPA 3KQLA 4M8NE 4GNRA 4RY8A 4QPJC 3F3SA 1Y8RA 2FKAA 1CZHA 2VJCA 4Q1CA 2DKNA 1NAHA 5JMOA 3FPEA 3LQYA 1HE4A 4H7IA 4Z1OA 4V3CA 5U9CA 2FOLA 4E31A 2D7CA 3W1EA 1E8DA 4U9IS 1W49A 3KUDA 4J07A 1Y3IA 2QORA 3NIBA 1UBTS 4R4JA 4C08A 2H2WA 5BSMA 2APJA 1DUIA 4BB9A 1L5HA 7YASA 3BFKA 1Z12A 1IIBA 3K4QA 4HTFA 2AW5A 1N7JA 1QV7A 2IYPA 1SHUX 1I01A 3PSAA 1HC7A 2OFFA 1FP1D 3E9MA 2PLAA 4KSCA 3MD0A 1B3BA 3A32A 2X2OA 3WZMA 2G40A 3KUCA 5LA6A 1TZKA 1MZVA 2DULA 3K73O 3UXEA 7MHTA 1RRGA 5FFMA 4Y6GB 2HK7A 4GL4A 2O2EA 1EAMA 1TM1E 3AR2A 9LDTA 1POXA 4BATA 1XG5A 2FW1A 5UKDA 4MDHA 4L6AA 3O4FA 4RETA 1U5AA 1WAMA 2HWKA 1J23A 2HUPA 1NC1A 4GS5A 3G13A 2IPXA 1QH1B 3MAAC 3PC2A 2VFAA 1TU0A 3JQGA 4FXPA 3ET4A 2WG1A 1NOIA 3W7VA 1KGSA 1U0EA 1LTHR 2H4YA 3DMPA 1QPGA 1MMFB 4EGCB 3DEZA 3HWX1 2LNDA 4ZTZB 2W42A 4NR0A 2BUBA 4DDTA 2ACEA 1A72A 1LQUA 4BB0A 1ODKA 3C3AA 2OCIA 3B9QA 2MSKA 1KBZA 1JNYA 4PNHA 3I04M 1WO8A 2FMTA 1V1RA 2O14A 1P0CA 3F74A 5DCYA 2FE4A 2I4NA 3T3EA 4AO6A 4PPFA 1W75A 1YZQA 5C4MA 3VR5A 3K6RA 1N5OX 2JBAB 3AM3A 4X90A 4JVLA 5ALEA 4RHCA 4BRWA 3S81A 3TK1A 5ICSA 2FY8A 1PEYA 3FRJA 3SQNA 1NUTA 3U7FB 1WXQA 1CFZA 2CD7A 1KKUA 3NWPA 4OLJA 1R4NB 1O87A 4AL4A 3U80A 2ZS9A 1W5EA 1RP7A 4LN1A 1XQ6A 1KDRA 2MCFA 1F8GA 3GJQA 3R7SA 3EDQA 2G1UA 3H18A 4NHEA 1QH9A 1JDJA 2R85A 3ABRB 4RA6B 3PD0A 3ZHRA 5L4LA 5EZ5A 2FU5C 2WMOB 2CLEB 4LVOA 1PT8A 1FNDA 1WPRA 2JCBA 1FJHA 1XZKA 3D6AA 4GMHA 4D9EA 5JEEA 5WRFA 3RRXA 1X3SA 1H8HD 1W35A 3IEIA 4ZCPA 2IP4A 1T9KA 3GFPA 2DUUA 5AO9A 5CCEA 4KQHA 1YR3A 4RHYA 2PX4A 1ECPA 2RBEA 2QM3A 3CNEA 1EGAA 3RC3A 3JQBA 4C0AC 9ATCA 2C4HA 1TUIA 4GVPA 1ZONA 4C0JA 1UANA 2QTZA 1T9BA 3CINA 3BXXA 4HH3C 3ZZNA 3HNOA 2CCGA 3L5KA 4Y6LA 2IKQA 2XUOA 3R1IA 4W99A 3TSCA 4RPKA 3OTQA 2C7GA 1GFIA 1KBQA 2BFEA 4WFJA 3ESQA 5D2CA 2B6NA 3PCTA 3QEOA 3SEQA 3V46A 4L5CA 2C5SA 1NA5A 1XF9A 2FWNA 2XMSA 3FMOB 3FM9A 3P45A 3HVUA 3PUVA 1M67A 4CMCA 3RJ5A 3H04A 2QMHA 5LQMA 2C88A 2V0GA 4QEDA 4QGGA 1G20E 3V8QA 3FTEA 3MGAA 1OASA 5G1NA 2X6QA 1LBQA 5GOZA 3ZD8A 4A1OA 3I5XA 2ZYRA 1N32B 4X6XA 1J2RA 1KVRA 5IJZA 1DJLA 2JB9A 5DHQA 1SC9A 2Z04A 4ES6A 4RHTA 3OCVA 3C48A 2X7XA 4PFKA 4FEGA 4EWLA 1T0JB 3NJRA 2XTNA 1VMIA 4Z5XA 5CYPA 3W8FA 1QIEA 5EJMA 1Q11A 1VKNA 3LJKA 4RZXA 3RBAA 6ADHA 2IS6A 5E6RB 1NVBA 3RSOA 3FF1A 2DB3A 2QRMA 2I4OA 1OBVA 4RKEA 2WK1A 4RKWA 2HIGA 1F8FA 1EDDA 4BFYA 1PJSA 4QICA 2NIPA 2OZLA 3BIOA 4IV0A 4QGFA 5EXDA 1HE2A 1W85A 4PHFA 5JVDF 4OX9B 1I8TA 3QMPA 3JZAA 5CVEA 3AI7A 2OUKA 2DRIA 2WJYA 5EIXA 1DJQA 1JG3A 2F64A 1DIAA 1G3QA 2DHCA 2P1RA 4GMKA 2C9CA 3ITDA 4FHZA 3TFOA 4ABTA 1JQKA 1YVRA 4RFSA 3BFXA 2ERCA 4KE8A 3UFXB 3QE4A 4Y9DA 5JNSA 2BFFA 2A86A 2R4QA 4UTZA 4MWGA 4UULA 2BELA 2VT3A 3UJ7A 2GF9A 4C0XA 1W6UA 4JY7A 2V7PA 3J81A 4MGZR 1ODCA 4G5RA 1H5NA 3DQQA 4S2UA 1Z83A 4X8MA 2BAGA 2ARKA 4YYZA 4QELA 4ZDIA 4D81A 4RANA 1ZVVA 1VHWA 1KEWA 2C00A 4MTCA 3PQ2A 5KOJB 4UE6A 1JU3A 2CBGA 1UKVY 1D2RA 4TRMA 4CI0B 4IIHA 1VG0B 4EGQA 5CDHA 2RI0A 4BGIA 8ABPA 5FH9A 2FSIA 2ZB3A 4UHEA 1ZM3A 2PU7A 4AFNA 4UNSA 3AFHA 4YCJA 1QHEA 2RHGB 4KX5A 4UXHA 4WNYA 4ZCSA 4E08A 4UTVA 3DLPX 5ALVA 4Z9YA 3ZVKA 4EPWA 1IK6A 2ZJOA 2K7ZA 5HKKD 2D13A 5ICMA 1R6DA 2O5CA 2HPZA 1PP4A 4IVPA 3UJ9A 4P33A 2DPMA 4WWHA 4W5OA 4NBSA 1EESA 1YZTA 3IAFA 3AOEA 1GG9A 4QTTB 2M2IA 3IQWA 3OCJA 3B51X 3P71T 1UBHS 2XYVA 4G56A 1FDOA 4N6NA 4YJ2F 5HIMA 1L1RA 3E53A 3KG2A 1TO1E 3VHLB 2GLXA 3IT1A 3C6KA 4I5EA 4LHZA 1YTLA 3PUZA 1CW2B 1TK3A 1ZEMA 1I6LA 1NN5A 2ZYVX 4A5SA 3WA7A 1G8GA 2XBUA 3HABA 4KG7A 4YRKA 1S8AA 4RIEA 5FLEX 1FSPA 3ABQB 1VI6A 4GT1A 3OOWA 3CPEA 3MWLA 4RLQA 3WV5A 3NJ8A 1J90A 3KYDB 3NG1A 2E1PA 3FLEA 1QBGA 1KVTA 3F9RA 3FWPA 4WOCA 3ZHUA 5CP8A 4BFZA 1YMVA 1WW3A 4ECEA 4CV0A 1B6GA 5BW5A 3OLYA 4N3BA 3NXSA 4EG1A 1KJJA 1VRCA 2RARA 1JFSA 4OGLA 1V5EA 4ZJUA 3MJHA 4B80A 1K68A 2E87A 3D6HA 4MWEA 4BTEA 1E3JA 1FE8A 1JPJA 1NR1A 4WDRA 4E51A 3DG9A 2TMDA 3QIVA 4X64B 1JYEA 3CJRA 1H22A 3O03A 2Q45A 2W2OA 3C1TA 3MJSA 1GKIA 2DHDA 3PHCA 4P98A 4ZC1A 3MYRA 4P82A 2W4QA 1Z13A 3FSJX 4WFKA 1BCSB 3QWHA 2J0UA 5AKXA 1IOWA 1OR8A 1ZW1A 3H1EA 4TTSA 5J5VA 2NZJA 3NP9A 1LLCA 1I5OA 4K9KA 2Q50A 5C8ZA 2ONKA 4BBPA 5FUMA 1Q7BA 4DBVO 5AHWA 4OM8A 4J0GA 4QKQA 1SRRA 2XUKA 4MWCA 1XSEA 2OCGA 5EEHA 3ZJVA 3CEPB 1RQPA 2YMLA 3R76A 1C7RA 3WIOA 1JPNA 3ZLUA 5HDBB 1M8GA 4P4SA 1DRJA 1J2EA 1QZXA 1NXXA 2BDTA 1M1YB 4ZVNA 4J6EA 4ZVMA 4BMCA 3EEOA 1P5ZB 1B00A 1LJLA 2F3PA 3S2GA 3M4NA 2IVFA 3HKDB 4KMRA 4MDYA 5T67A 4YCSA 2EFJA 4YX9A 4L5BA 2EJUA 5CFNA 3G68A 2NAFA 1MF7A 3IAM6 4URZR 2JLCA 3FZNA 3C43A 4H9GA 5EJIA 5EFZA 1HBJA 5E2IA 4JC5A 4AJLA 5JTTA 1AMOA 1B14A 2B2NA 4HCJA 2I7XA 3COZA 5KOYA 5LA6F 5IFKA 1TQ8A 1IEQA 3L7YA 3NASA 5KOIA 4RBNA 3EH1A 1O96B 1BVHA 4KHZA 4MQ5A 3HFGA 2F9FA 3PTZA 3QTBA 4Y2RA 1OVMA 3IHKA 3WYEA 3MVEA 3PWTA 4NBTA