9LDTA

Design and synthesis of new enzymes based on the lactate dehydrogenase framework
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIHNLLKEEHVPHNKITVVGVGAVGMACAISILMKELADEIALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSRLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPNCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWILGEHGDSSVPVWSGVNVAGVSLKNLHPELGTDADKEHWKAVHKEVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKENVFLSVPCILGQNGISDVVKVTLTPEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and synthesis of new enzymes based on the lactate dehydrogenase framework.
pubmed rcsb
source organism Sus scrofa
molecule tags Oxidoreductase(choh(d)-nad+(a))
molecule keywords LACTATE DEHYDROGENASE
total genus 100
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1991-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 9ldtA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 9ldtA02
3NAQA 2VNAA 1CDOA 3JQDA 1M76A 3DMTA 3I6QA 2GF2A 5G4KA 4AICA 4OQZA 1L7EA 5T6BA 1CRWG 5ILGA 1LLCA 2P91A 2DQ4A 2VYNA 1YE3A 1ZCJA 3QA9A 1TI7A 4XQCA 5EQFA 1WMAA 2Q99A 3DBLB 3PFFA 4FD3A 4LISA 3RUEA 3AFNA 3TSCA 2OP1A 4OAQA 1SPXA 4M86A 3JQCA 4JXKA 4BKOA 2JD0A 5F5NA 2J5QA 3BMCB 1KS9A 3OA0A 2JHGA 2ZTVA 1ZIDA 1P3DA 2PZMA 4F46A 5HWSA 1RM0A 1BXGB 4JX8A 5LDGA 2X22A 1GL3A 1ZMOA 3PDUA 2G5CA 2Y99A 4BNMA 4I9UA 5TNXA 4EUFA 2D59A 3KBOA 2GZ3A 4WK6A 1GZ6A 4QO7A 1H93A 3RASA 4JK3A 3TZ6A 1I33A 1U7HA 5B4UA 1SOVA 1GQYA 3I5MA 4JGBA 3L0DA 4ND4A 1LDNA 1NPYA 2ZK7A 5COQA 3NYWA 1NQ5A 4OKIA 4UVDA 4DXHA 3V2GA 2X0JA 3A28A 4M8SA 2Y0EA 4WEQA 4YAJA 4AJ4A 4NHEA 3HG7A 1OAAA 1DHTA 3KB6A 2BFPA 4TMFA 5A9TA 2JFFA 1F8FA 1QV6A 3L4BC 4AJEA 4AJJA 3U4HA 5BSFA 1IB6A 1UXGA 3LDHA 1H9AA 5KNLA 1MXHA 1P77A 3QIVA 4BHTA 2AQ8A 3DOCA 3JQ8A 2ZJ0A 1LXCA 4YQYA 3H9QA 2O3JA 1E6UA 1Q1NA 1C0PA 1CQJA 2VUUA 1C1XB 1GDHA 5T57A 1B2LA 3PGJA 4URFA 3EHEA 4IXWA 3GR6A 4XQEA 1VJTA 3KXDA 3KYBA 4UULA 1KVSA 1BSVA 3LZ6A 3E48A 3OJLA 2W98A 3QWBA 2FZEA 5JS6A 2BD0A 4XYMA 2J3IA 5KVCA 2GN9A 3PLRA 1HRDA 4WPGA 1E3WB 5AOVA 4D3FA 1U3WA 2BFMA 4OXKA 1TT5B 1Y7TA 5AXAA 1H0KA 2OBYA 2Q46A 4XD2A 4GLLA 4YAGA 5FWNA 3RKUA 4UEKA 3T4XA 1B8UA 2ZCUA 3CUKA 1U8XX 1AXGA 4DVJA 3ROQA 3PLNA 3C7AA 3DOJA 3JSAA 2D0IA 2CNBA 4DQVA 3GVXA 2AE2A 4ZRNA 3PXXA 3IJPA 4Z6KA 4KQWA 2X8LA 2BMAA 1Z7EA 3VH2A 5DN9A 1O6ZA 1HDYA 2XXBA 3S2FA 1E1MA 1P31A 3N7UA 4X54A 3T7EA 1LQUA 2NU7A 3EDMA 1I3KA 3DO5A 3OEWA 4QO8A 3HB5X 4B4OA 3FR8A 3N74A 3VDRA 5EN4A 2NQTA 1VJ0A 2ZYGA 4J0FA 2C29D 1X14A 4IGFA 4HFMA 1X0XA 3P7MA 3ZWWA 4DQUA 4BNNA 5JYEA 4J2HA 3X2EA 1HXHA 1P1JA 2QYTA 4PLGA 5DOVA 1P1HA 2BGLA 1LTHR 2G82A 4CMKA 4CUJA 3H3FA 4IDFA 5FI5A 1D1SA 2EF1A 3OHSX 1AHIA 4KOAA 5A9SB 3U5TA 1X7DA 3E5RA 3DHYA 5KIAA 3RU9A 4J4TA 2J3JA 1GFSA 4YB8A 3T7CA 3WGHA 4CMJA 4MP8A 5TQVA 4FSHA 1MC5A 2DVMA 4D79A 2OL4A 1EUZA 4CM1A 1ADBA 1KC1A 4R69A 2VZ9A 2FRDA 3DBRB 2OMEA 1N1GA 4FJ1A 2FMUA 4AJHA 1A7KA 2EJWA 4YJGA 4G2NA 4PVDA 3K5PA 1JN0A 1XWFA 4JNKA 3H7AA 3V2HA 4YEDA 1E6EA 4NIMA 1K6XA 3AU8A 1MG0A 2DFVA 5CDUA 3Q2IA 2B35A 1E7QA 3FWZA 3MWDB 2O7QA 2FPPA 4AJ1A 4CMCA 4PVCA 4XCVA 1KC3A 3G3EA 4FQ8A 4UVIA 2EERA 3A06A 1DDOA 1QRRA 2AW5A 3PTZA 1V35A 2ZB7A 2PD3A 1T4DA 1Z74A 3OJOA 5AXCA 4EJ6A 3KEOA 3GZ4A 2HUNA 3ENKA 3I83A 3GFBA 4RORA 4KQXA 5HA5A 1HDGO 3SXPA 1Y8RB 4E5YA 1KY4A 5BQFA 3ZWMA 4AG3A 3C7CB 1FK8A 4FJ2A 1T2FA 1O5IA 2DLDA 3DFZA 3GF4A 3L77A 4Y6RA 5I8WA 1VSVA 5TRTA 2ZJ1A 3JQ6A 3OSUA 3UH1A 3MCVA 4B3IA 2E48A 5JC1A 1R4MB 1YOVA 3K6JA 3JQFA 4QQRA 3QVWA 2EJVA 3CKYA 3DBVO 1LNQA 3PWSA 3VPGA 3DBHB 4YPOA 3WLFA 4RJTA 1DHRA 1LA2A 4L8VA 3Q9UA 3OBBA 3QWFA 3WX0A 4BNVA 1MLDA 3F47A 1YRLA 2X58A 4BKRA 3DZGA 4ZRMA 1BVUA 4MVJH 4BMSA 5U4QA 3ZHZA 4L0QA 1E7MA 4BB5A 1ZSVA 4TKMA 5EJ2A 4HFNA 1E7SA 5TGDA 4YACA 3GHYA 1RPNA 4CODB 1LLDA 3ZI0A 4YQZA 3AOEA 4EEZA 4YCAA 2UDPA 5FYDA 4I5EA 2DPGA 3C7DB 5DCWA 4WNCA 5JCJD 4ALIA 2V6GA 3LLSA 4XIYA 2OXIA 4R41A 4EBFA 1Y5RA 3D3WA 3DTTA 5IN5A 4GKVA 3TFQA 4ALJA 3BMOA 3KSDO 2NV6A 1EVYA 2R00C 1B3RA 2QHXA 4RF4A 2IRWA 1UR5A 2I99A 2GDZA 4ESOA 4Y9DA 4BNZA 1I30A 4NBRA 4N5MA 3JTMA 5A02A 2VTEA 2VCYA 3BMOB 1Z75A 3V1YA 4ZU3A 4A2CA 4IZHA 3H3JA 3RBVA 3OFSA 3S2EA 3D4OA 5IXYA 4CM3A 3LSYA 1S6YA 3I1JA 4PG6A 4RLHA 2DUWA 3PQFA 4JBGA 1XDWA 4E2WA 3HN2A 3O38A 3B1KA 4WOJA 3VOSA 1P0CA 3LVFO 5DP1A 2FR1A 4YYZA 3AI2A 3JV7A 3C1AA 2O48X 3QRWA 1DIBA 4IQ8A 2WD7B 1C1DA 4AFNA 1CQIA 4QFCA 1TLTA 4OOEA 1U7TA 2R2GA 3JYQA 3JYNA 5A5EA 3K9QO 1N8KA 2Y66A 4PCVA 1NXQA 3EK2A 3EW7A 3OEYA 1DC6A 2YFHA 4PFJA 4P4GA 1GYRA 1GTMA 1LDGA 2IODA 1JTVA 4MOWA 1HSOA 2ZATA 2JD2A 3NTQA 1DB3A 3SJ7A 1V8BA 2QW8A 4CQMB 1WMBA 2B0JA 4L4SA 1NPDA 4QT0A 1BG6A 1W4ZA 4TRNA 3JQ7A 1VL6A 2ZTLA 4YRDA 4ZA2A 2LDXA 5MGBA 1K5HA 4ZQBA 3EZYA 4IZIA 3V8BA 4ND1A 3RC1A 4MIYA 4B8ZA 4L74A 4BGUA 1YWGO 5K6AA 1NWCA 5KCZA 4I9HA 2J5KA 1PQUA 2QRJA 1ZNQO 3H5AA 3MOIA 1C0LA 1YQXA 3O26A 2QG4A 3LT0A 2GRAA 3AUAA 2NU9A 1YL7A 5BT9A 3IIEA 3NV9A 2BI8A 4AJPA 4K1LA 3M6IA 3ZNQA 4CR6A 4B4VA 4CMBA 2O23A 2VTDA 4KWIA 1DAOA 3IJRA 4AJNA 2D1YA 1WDLA 3W1VA 3OQ1A 4NBUA 3SLGA 4PLTA 4A03A 2BI7A 1E3EA 1ULSA 2Q45A 1DIAA 1SEPA 1KVTA 2EXXA 4GX1A 3ZN2A 2DBVO 3LC1O 3JQ9A 4II2A 1KVRA 4L75A 4Q3NA 4BMNA 2Y68A 1YH3A 2PGLA 2VWHA 2W8ZA 2PTGA 2BELA 4W99A 5EL0A 3NTRA 5ENDA 3ZU4A 3OF2A 1ZW1A 1O9BA 3HQ4O 2IZZA 4MKRA 5COBA 1JVBA 3STHA 3WGZA 3OA2A 3V2UA 5EPOA 3H9EO 2H9IA 3E9MA 5HTOA 1T4BA 1E3LA 2IEDA 2Q4EA 5T67A 4IIUA 1QP8A 1ZJYA 5DULA 4J0EA 3DHEA 2W2LD 4BNHA 1R16A 5BNIA 4MVJP 4RO0A 5K9ZA 3U4DA 4O6VA 2DM6A 2CDBA 4I1IA 3RAJA 1NAHA 1F8GA 3GY0A 3WBFA 3LQFA 1E1NA 1GU7A 3ASVA 3TZCA 3A1NA 4NFYA 3DAPA 3TNLA 1LJ8A 4DPLA 5EQDA 3BHJA 4Y67A 4UUMA 3GNQA 3I4CA 3QE3A 2E4AA 1AN9A 4M54A 4RDHA 3U0BA 3IUSA 4J9UE 2DC1A 1I2BA 4GBJA 4O5OA 1R66A 3QP9A 4BQPA 4LW8A 2C59A 3KSUA 4HP8A 1F14A 4CMEA 3M2PA 2NADA 2PZKA 4D0SA 1JLLA 2QRLA 1LC3A 2FR0A 1NFFA 3ROKA 3WMWA 3AI1A 4KWHA 5I7FA 3KEQA 3IS3A 3IDSA 4IUYA 1ENOA 3OIGA 2P9EA 4NK5A 4NQZA 4BNUA 2PKQO 4D7AA 1WLYA 2V6BA 1PJQA 3TOXA 3ZWYA 3INTA 2B5VA 2WD7A 3WSVA 1D1TA 3BTVA 3FF4A 4WASA 1H9BA 2C0CA 3I9LA 2WJPA 3PIIA 4HY3A 4BO7A 3F5SA 1JKIA 3G17A 2CDCA 3WBBA 1ZK2A 3VZSA 3W4JA 1PWZA 2IYOA 1JWAB 1EBUA 1PJBA 2ZB8A 2NU8A 4D41A 1ZK1A 2AA3A 4GH5A 3RWBA 4F45A 3JQ8B 2VRCD 3HUDA 4NH4A 4BKPA 1CJCA 1Y8QB 3FN4A 3K31A 2O3QA 1J5PA 1FDVA 3MJ4A 3KVOA 3GNSA 2Z1MA 3ONEA 1PL6A 4ZQGA 4CMHA 5COAA 1UJMA 3KYCB 1E1KA 3CEAA 3UCEA 1K6JA 3WICA 1R4MA 5C5IA 3NT5A 5JCXA 1AXEA 4A5OA 1C0KA 3RUAA 1UZNA 1KEPA 1NASA 1UP7A 5GZ6A 3V1TC 4CMEC 1YO6A 2EIHA 3K73O 1ADCA 4R54A 2EP5A 3Q3CA 2PD4A 4IS2A 4CR8A 5ITWA 1R15A 4RVDA 1P1RA 1WDMA 1T2DA 2FPGA 4J16A 4CM6A 1ZK3A 1XG5A 3GPIA 1U3VA 4DBVO 2O3UA 4DMMA 3I23A 3EC7A 5JAIA 4I9NA 3KYCA 4ZQHA 1SC6A 3CXRA 3I9KA 4LMRA 2Y93A 1IL0A 4R16A 3VDQA 1YB5A 1DRUA 1PQPA 4WOKA 1DRVA 3PHGA 4BO8A 2DFDA 3KLMX 3Q9NA 3M1AA 4E3ZA 1A4UA 3HFGA 3ROPA 4DC0A 5AXDA 4R9SA 1KVQA 2X0IA 4I8XA 3VC7A 1RKXA 1RYDA 1HSZA 3GEDA 4NI5A 4FGWA 1EFLA 2Q50A 4JP3A 3Q11A 3GN1A 3JQ9C 4MINA 2DPHA 3DFUA 3E03A 3AOGA 1BHSA 2BF7A 4WCDA 3TL3A 5JO9A 1HLPA 1I0ZA 3BIOA 1YQDA 5JDIA 5A3JA 1MB4A 3ZW9A 5JFOA 5C7LO 5MDHA 1QORA 3E82A 4Z9FA 1E5LA 1FJHA 2UUPA 4BGVA 1KVUA 5BNFA 3QVTA 2GZ1A 4CUKA 2HJRA 1FXSA 1V9LA 5JE8A 3D4PA 3H9UA 2B4RO 1Q0LA 3L9XA 4OOFA 3JD3A 4GX2A 4CM8B 3ADOA 3IKVA 5DP2A 3SVTA 1B14A 2O2YA 2YW9A 1OOEA 4TVBA 5A5FA 1F17A 4I08A 1X7HA 5F1KA 9LDTA 1M6HA 1XLTA 3WR5A 4GGPA 1MX3A 2A9FA 3D64A 4MKZA 2ZIZA 5L9AA 4MP3A 3D5QA 1QYCA 1H6BA 2ZB4A 3PHIA 1W73A 2AQHA 3O8QA 4KUGA 4PLZA 4F3YA 1T1RA 1GQ2A 2YDXA 2BLLA 4NJOA 1WXDA 3UHAA 4E6PA 1XR3A 3AUUA 1WWKA 2X0NA 5JCJA 4BUCA 1J6UA 1HTBA 1OFGA 2X7HA 1MFZA 1E7WA 2GN8A 2BGMA 5B37A 3ZW8A 5L7YA 2V65A 3ULKA 6LDHA 3UXYA 4DA9A 1ENZA 3FNEA 4ND5A 2NTJA 2J6IA 4TROA 4BV8A 1C0IA 1ZJZA 2PV7A 4CR7A 4DIBA 3VPSA 4U6QA 2JFGA 1E3WA 1SB8A 2Y1DA 1HE2A 5HBRA 2WYVA 3ZHYA 3HB4X 5A04A 4OO3A 2C2XA 1DC3A 4P4LA 1VSUA 2FHSA 4PRLA 2CSUA 1JKJA 4A7PA 1PIWA 3PRJA 4XX0A 1T24A 1YL5A 1RWBA 1LLQA 2GASA 1ML3A 1YBVA 3F6YA 3VKVA 2I67A 2PH3A 1O8CA 3SC4A 2NVWA 2EV9A 2X6TA 2PY6A 2Q49A 2IXBA 4IDCA 4D0RA 3A9WA 2O3SA 1E5QA 1TXGA 3IL2A 4J91A 4U7WA 4XA8A 1EVZA 2AEFA 4NU5A 4L9RA 2NACA 1DFHA 4GAEA 1ENYA 1OZAA 4LSWA 2CVOA 3WGIA 1GUYA 2Q2VA 4K6CA 4B79A 1DSSG 4CQLA 1X15A 5CEFA 3PQEA 2YDYA 4IINA 2HJSA 4Z0HO 3WWZA 3QVXA 4IMPA 4EUHA 1ISHA 3DB2A 3CZRA 3OP4A 4E31A 3I9JA 4N5LA 4TVOA 3QVOA 2GZ2A 3COSA 4CQMD 1ZUD1 2R00A 5KOIA 4M49A 3BHIA 5JPIA 1WPQA 3H6KA 1WVGA 4IPTA 4C7KA 1Q7GA 4FC6A 3GH3A 3ADPA 3K2EA 4MVJG 3C8MA 3QWHA 3SC6A 3U62A 1FMCA 2XPCA 4ALKA 1RYEA 2FP4A 3GPDG 4RQTA 2IEBA 1H2BA 2HK8A 5KWEA 1B26A 1XU7A 1ADFA 2C07A 3GMDA 3QQPA 4HFJA 1YONA 1KIFA 1BVRA 3EY4A 4TWRA 1M66A 3BMCA 2C2YA 3GEMA 4GMFA 4BNFA 4FOSA 3VZQA 4H15A 1GZ3A 1N7HA 1GUZA 2W2KA 2Y1EA 4XWYA 1B15A 4CV3A 3HDHA 4LCEA 1EBFA 1NFQA 4XR9A 1Z82A 1P1KA 4E5MA 4UREA 3DTYA 1B16A 1WAMA 5C7OO 4XEHA 1ZXLA 1GEGA 2Z1NA 1GV0A 3FI9A 3V5NA 1H5QA 3JQFC 4E0BA 1V3UA 2PA3A 1QLJA 3NX4A 1N92A 2FZWA 5EMHA 4BQRA 3AW9A 1PZFA 5HS6A 3WLEA 4FFPA 4NBWA 3GOHA 2EGGA 4QECA 1WZEA 2DUUA 3K8ZA 4YAIA 3L4SO 4OMUA 3FBTA 4KMSA 3KM0A 1LSSA 1PZGA 4Q3CA 1Y8RA 3D3EA 5CG2A 3PHHA 2NM0A 2PNFA 4WLUA 3ZWXA 1CETA 4R5MA 4LVCA 4FR5A 4II3A 1YDEA 3PHJA 4J43A 1JQBA 1IUKA 1NTOA 3U49A 3LU1A 1GEEA 2IZ0A 4RPHA 1MFPA 4CQLB 1SAYA 2YY7A 3PZBA 4AJOA 3PWZA 1YBMA 4CPDA 4U0KA 5JAMA 4WJZA 1GPJA 2RIRA 1ZH8A 4TRJA 4XGKA 5IXSA 5CDGA 4R9RA 5JAZA 1LSOA 4HUJA 5CDSA 3DMTC 3ZV6A 3WTCA 3AM4A 1EUDA 4TZKA 1NWHA 1NHWA 1QKIA 3K2BA 3ZU5A 2B83A 1A27A 3I6IA 2NSDA 2NTVA 1Z7BA 4WGGA 2X5OA 4S3MA 1Q7BA 2PWZA 3PGXA 4K9DA 4HX5A 1P45A 1R0SA 3F5QA 3GN2A 4E2XA 5B12A 4B3HA 4UEOA 1GYQA 3RU7A 1IE3A 5IDWA 5CFZA 3CMMA 3ABIA 1VPDA 3LT1A 4HNGA 3SEFA 4A26A 4DLAA 4P38A 1UDAA 4JJGA 3ZNPA 2WTBA 3HJAA 1D4FA 2NVBA 3C1OA 5THQA 3PYXA 4FFRA 4UVHA 5I9MA 2X23A 5GMOA 3L6EA 2AG5A 3MZ0A 1NVTA 4MVJA 3IUPA 4AJ2A 1MXFA 1QMGA 4RPJA 4XKJA 4M89A 4M55A 1PX0A 2FY8A 3GAFA 3DZKA 4EDFA 1Y6JA 1O0SA 3NDJA 4UUNA 3W8FA 3GA0A 2ZKLA 4DWVA 3VZRA 1AGNA 1QYWA 2FPIA 5JY6A 1ZSYA 1OMOA 1NR7A 2G17A 2YUTA 1LDYA 1IYZA 2JCVA 4YDRA 2RBEA 4IJUA 3HDQA 5BR7A 2Y0DA 4ALLA 4L4XA 1SZJG 1LBEA 1OC4A 4DBZA 1BDBA 1HDRA 1QXSA 2H6EA 1TT5A 3RD5A 3VHRA 5H81A 1JAYA 3KOUA 3RUCA 2OO5A 1T2EA 4A27A 1BDMA 1UXHA 4MDHA 1GADO 4W9NA 1Q2XA 2GUGA 2A94A 3INRA 4BL5A 2O4UX 1TEHA 1TVEA 3BHMA 5L4SA 2FR8A 1ENPA 1V3TA 1MV8A 5IAAA 1T1SA 3KHUA 3JYLA 4C7JA 4B4WA 3PYLA 4MIEA 4K28A 4Z3DA 2I9PA 5U9CA 1IZ9A 1IPFA 4OXYA 2OOSA 3B1FA 3NRCA 2NU6A 2A4KA 4A73A 3GDGA 2VOJA 2BFOA 3ONDA 1LRKA 1N7GA 2Y1GA 4E32A 5F5LA 4Z3KA 3D3WB 3BMNA 4PZDA 1SBYA 4N54A 5A9SA 4BNLA 5IDQA 3RROA 3K96A 4RDIA 4BB6A 3MJSA 2X0RA 3BXXA 1EMDA 1DFGA 1ZXBA 4PLCA 3RUDA 1PS0A 4CQMA 1A7AA 4J49A 1CF2O 4ZQEA 2B36A 5CDYA 3AJRA 3VTZA 5EIOA 3WQRA 5CG1A 1ZEMA 3WOHA 2Y0CA 3AY3A 4AL4A 4NBTA 1E92A 1YL6A 5I9NA 3IQDB 3B6ZA 3LC2O 3IOYA 3ANNA 1PGPA 1T25A 3QWAA 3KV3O 2P2SA 2X5KO 1U2GA 3MOGA 2IE0A 4RVHA 2DBQA 4HXYA 4JQCA 1H94A 2B69A 2OZPA 3E18A 4JP2A 3EVNA 4FJ0A 4R1NA 3BTOA 3O8QB 4F6CA 4WKGA 1BRMA 3F9IA 4J4HA 4ZGWA 1AE1A 1FDUA 3TPCA 2UVDA 1NQOA 5FEUA 3C85A 2G76A 4UUPA 1ZFNA 3QW2A 1I01A 4AJLA 3SLKA 4IDBA 3I9MA 4DPKA 2JAHA 1P1FA 3CPSA 3DZHA 1UP6A 2CF6A 1I36A 3GT0A 5AXBA 5C7IO 4WLOA 1G6KA 3DZFA 2P5YA 2VQ3A 4GSKA 4L4RA 4BO5A 1XYGA 3G1UA 1GD1O 4RPGA 5B4TA 1K2WA 2Y67A 3FNFA 5TC4A 4CM9D 5TF4A 3R0IA 3MJTA 3TOZA 3WGYA 4P4NA 5BNTA 4O59O 1HL3A 4L73A 1BTOA 4Z9YA 2WE7A 1F12A 4NMHA 4OGWA 4TZTA 1KBZA 2AMFA 4FOOA 1EUCA 1S7CA 3OJ0A 4G5HA 5C3MA 3G1TA 3DBRA 5DDIP 2UAGA 4PLHA 4W6ZA 4AVYA 1DO8A 2VWQA 1L7DA 1O89A 1X0VA 2VWGA 1UXKA 4BNIA 3EYWA 4J7XA 1YXMA 2D4AA 3JQAB 3QHAA 4U5QA 4E5PA 4ZN6A 4QUKA 2HMVA 3A14A 4JJFA 1H6AA 2WM3A 5KKAA 4B4UA 1HETA 1MC4A 1QSGA 1Y9EA 4YAKA 2FN7A 5I8ZA 2X5JO 4E4YA 4IMRA 5AQ1A 3BYZA 2IYPA 1BXGA 3WG9A 5H83A 5G0VA 1A71A 3FCOA 3WDSA 3OH8A 4EW6A 4CM8A 4F6LA 3H9GA 3DXFA 1SEVA 2WWRA 3ZWVA 4E2ZA 1K3TA 3HWRA 6ADHA 3ZZNA 3GVPA 1ONPA 5TIIA 5AYVA 3VVCA 3RC7A 3OQ6A 2H1SA 3BA1A 4YT5A 4Q3EA 5CP8A 3ZU2A 1ID1A 3E6AA 5A06A 5A03A 2SCUA 4CM5A 4A0SA 5JDIC 2WE8A 1EQUA 2YHIB 1KEWA 5TJHA 2DBRA 4LVUA 2ZTMA 4K6FA 4NJMA 3GG9A 4CV1A 1H6CA 1ORRA 3S1LA 2OORA 3OECA 3JYPA 2NVUA 2JCYA 5LDHA 3F4LA 1SO8A 3NJ8A 2Y05A 3I52A 4XRRA 3AM5A 4D44A 3IP1A 4DTIA 4J7UA 4CUZA 3PQDA 2VRBA 1NVMB 3F3SA 3DAGA 4J7CA 4WLEA 4HFRA 1Q7CA 2VHYA 4E33A 2YHUA 3HNPA 4W7HA 7MDHA 4CLRA 1PU2A 2WYUA 2JAPA 3RKRA 4ALMA 4D43A 2QIOA 3GFGA 4MKXA 3ICPA 1VI2A 3LLVA 3MJEA 4IDAA 5ENVA 3ZH2A 2ZYAA 2D5AA 3DBHA 4IGEA 2P4QA 1YGYA 3Q0EA 2OBNA 1I5RA 3OETA 3RIHA 2UV8A 4UEJA 1QLHA 4MP6A 4KUHA 5TT1A 4WEOA 1GCUA 1HE4A 5KTKA 1I3MA 3W4KA 3JQAA 3NDIA 3JD2A 4Q3AA 3WYCA 2BH9A 4L76A 5JBIA 2CZCA 1TT7A 3JQGB 1M67A 3RUHA 4MVJF 1D8AA 2GN6A 1NHGA 4W4TA 5JSFA 2EEZA 4PG8A 3UN1A 5T8KC 5ICMA 3RUFA 3CZMA 2HAEA 1PJLA 3CH6A 2E82A 3FSRA 3DL2A 4M87A 3WIDA 1ULUA 2EWMA 3GVHA 1LI4A 2RCYA 3C1TA 4IJWA 3ZHXA 3EZLA 1V6AA 4OHUA 1Y1PA 5L7TA 2HMWA 1QR6A 5IN4A 4NDNE 1DRWA 3Q1LA 3F1KA 3LK7A 5G2OA 1M2WA 4Q9NA 4OL9A 4XYBA 3H8VA 4FB5A 3WGGA 1VL8A 1DBVO 3RSHA 2FOIA 1B7GO 2HCTA 4OSOA 2YFQA 5KJEA 2C20A 3VAZA 3WFJA 1E3SA 4RF2A 3HZZA 2AQIA 2X1HA 4O1MA 1UUFA 1R12A 3PDJA 3VPHA 3VH1A 4DRYA 1NQTA 2Y1OA 1YJQA 4MPDA 3B1JA 5L45A 4BO6A 5L4NA 2H63A 4B8WA 4PLVA 1WP4A 2J5RA 5CAEA 3QJ5A 1NVGA 3VH3A 1MGOA 3S2IA 1MA0A 2TMDA 4RPLA 2V6MA 1X7GA 3GQVA 3SBOA 2PFGA 1VLLA 1U8FO 2ZYDA 1P1IA 4KTTE 2RAFA 4Q3DA 3RBXA 1UP4A 4FGSA 5CPBA 1ZSNA 3PEFA 2BRUA 3RI3A 4AJKA 2GN4A 4CLOA 1BXZA 3HSKA 1DLJA 4IS3A 2QYSA 1UAGA 4GPD1 4NNJA 3ST7A 1JWBB 4XB1A 3D7LA 3JD4A 5I9LA 3D4NA 1MP0A 2OP0A 1OC2A 3FHLA 3O9ZA 5CDTA 4WE3A 3F46A 3ANLA 4CL8A 5G0WA 3QY9A 1H6DA 3UGKA 4GSLA 1ZEJA 1ZKMA 3QWIA 3RC9A 4U6SA 1EVIA 4D3SA 3IMFA 5U1PA 1DIRA 4YJHA 5G4LA 4ID9A 3ZWOA 4D45A 5TS3A 3TZHA 4YT8A 8LDHA 1RM3A 2VYVA 1G0OA 3ROMA 1CIVA 3TL2A 1HF3A 3GGPA 4NU6A 4N5NA 1YQGA 3VVBA 4DMLA 4YRAA 5IZ4A 4YT4A 5L53A 3HN7A 4O63O 5IZCA 1PWXA 1PJ2A 3AY6A 4OYRA 4JROA 4HADA 4EJMA 1ZK4A 4J3FA 1HEUA 1XIVA 1ONOA 3FTNA 2WYWA 3WB9A 1DJQA 1JDJA 4FIZA 1DIGA 2G0TA 2ZTUA 4BIIA 4JBIA 2QRKA 2FSSA 5HM8A 4PN3A 1R37A 1PR3A 1U9JA 4BNKA 2QZZA 3UAGA 2VUSA 3DWFA 5ADHA 2ET6A 3BTUA 3KSZO 3T4EA 5TSDA 4CV0A 4GWGA 4CM7A 1QV7A 3VTFA 1R4NB 2WDZA 4BO0A 3JCZA 2X9NA 3NGLA 4JCOA 2VHZA 3EMKA 4RVFA 1BW9B 4LSMA 4ZHSA 4IBOA 2C54A 2QQ5A 1LUAA 5ER9A 3TWOA 4G65A 4YRBA 3GUCA 2DT5A 2PR2A 3GK3A 4LK3A 4QEDA 4XJTA 2D5CA 4UAGA 2HKIA 2PH5A 4A10A 2R6JA 1SB9A 1GQQA 2ILTA 5L51A 2GR9A 1DPGA 1U3UA 2IZ1A 1JKFA 3IAHA 4ND3A 5BSEA 4OJNA 1IOLA 1HE3A 3ZNOA 1G0NA 4NG5A 4RL6A 4BNTA 2OHXA 2Q3EA 1RJWA 1ISMA 3KYDA 3B20A 1IULA 3HADA 3PWKA 2NUAA 5ES3A 1GYPA 1VJ1A 4BNXA 1PJ3A 4R51A 3TDKA 3K30A 5KVSA 3U4IA 4I5DA 4TSKA 4XIJA 3UICA 3BAZA 5TLSA 3I3OA 3FNGA 3CMCO 4DUPA 4R1TA 3JQ7B 1Y81A 3WSWA 2EW2A 1PL8A 1EDOA 1XHLA 3E8XA 2P68A 2D8AA 4OKNA 1FDTA 3UCFA 5I7EA 1O95A 2RHCA 3RC2A 4YVFA 5A4DA 2XXJA 4R3WA 1A9ZA 1KEVA 3LYLA 1LDBA 2X4GA 3P19A 3TF5A 1KEUA 1KYQA 4FS3A 2DU8A 1D3AA 7ADHA 1NR1A 5ILOA 3ETGA 4YWJA 3RBZA 2X9GA 4XYEA 4EITA 3C3XA 4PG4A 4TRMA 1XU9A 2GPTA 1JAXA 4ND2A 1YDWA 3P2YA 3ZU3A 2YV3A 4BV9A 1UAYA 5I7SA 5HRUA 1WDKA 1PR9A 5G0UA 4UVGA 2YV1A 3U4CA 3IP3A 3VPFA 5TX7A 1E3IA 2AEJA 2EKLA 4FDAA 3DQPA 4CM9A 3NUGA 2O3RA 2PZJA 2Z5LA 2XF8A 1W8DA 2E6UX 1V3VA 3WWYA 3DZJA 2WD8A 1HE5A 1K6IA 4OH1A 3VKUA 4WCFB 4IXTA 1N5DA 3FPCA 4YA6A 4GL4A 3UKOA 4Z0PA 3ZV3A 4DPMA 2B4TO 3QSGA 3GEGA 4RLSA 3LF1A 2P5UA 2CDAA 4IQGA 1Q0HA 1NNUA 3G79A 3GLQA 4DYVA 3HFSA 3Q2KA 4P8RA 4IM7A 4CLEA 1F06A 1XGKA 2X86A 2Q4BA 1VL0A 4DQXA 3RCBA 4EZBA 5KJ1A 3WIEA 4RGBA 3AOEC 1PQWA 2VWPA 1PSDA 4ZJUA 1VE9A 2GO1A 4J9VA 1E77A 1CEQA 4LRTB 4HWKA 4UVEA 2OFPA 1W0CA 5DZSA 3ORFA 2GYYA 1CYDA 2HU2A 5FFFA 5CEJA 1U4OA 1ZMTA 1HWYA 1E7RA 4DL9A 4CLRB 3E9QA 1ZBQA 3ITDA 5DBGA 2NWQA 4CL3A 3FNHA 4XQ9A 5JYDA 1PS8A 3DZBA 4CMIA 3GAZA 2UYYA 2GGSA 3E9NA 4RF5A 3RFXA 3WGOA 1B8PA 2ZQZA 1VKOA 2P4HX 3ITKA 1G1AA 2TMGA 2Y1FA 1BXKA 1PJCA 2JFHA 3NKLA 5A3VA 1JVSA 4LGVA 3LT2A 4IQ0A 3DR3A 1N2SA 3W8DA 1U5CA 1DFIA 4E2YA 4NJMB 1LLUA 2NQ8A 1C3VA 5IFLA 4LMPA 1BMDA 2EGHA 3AWDA 1U2DA 1FDSA 3UUWA 1Z6ZA 3NTOA 1R6DA 2VOEA 4R1UA 4RZIA 5DOZA 1PZHA 2B37A 3ZWBA 3OM9A 1YS4A 4Y98A 4PZEA 1C14A 3LF2A 3KYDB 1MUUA 2YJZA 3I4FA 4XJSA 3R6DA 1IHXA 1CERA 1HDOA 1B8VA 5C37A 3C24A 4R1SA 4XYGA 2RH8A 5CHEA 2D2IA 3JYOA 1YVEI 2HMTA 3PJDA 4JN6B 5DCYA 5B1YA 4TRRA 1R0KA 3ZV4A 4HKTA 5JC8A 3KRTA 1NBOA 4IJKA 4YBZA 2NLOA 3MJCA 1DEHA 2HK7A 3AFMA 2DTXA 4NFHA 4CM4B 5JY1A 1Y5MA 5F21A 2GD1O 2YYYA 1EE2A 3DMYA 5K6AC 4RPKA 4I5FA 3L6OO 5BSHA 4NFSA 1PL7A 3DHNA 5JMPA 1Q0QA 3RJ5A 1L1FA 2O4CA 4N7RA 5JDCA 1HKUA 3CTMA 3Q6IA 4BVAA 1UXIA 2HSDA 1I10A 2I66A 1I3LA 4S1VA 4RQUA 1MG5A 4D3DA 4KP7A 1YB4A 1T2AA 2W4QA 1GZ4A 2E49A 3KTDA 3WJ7A 4BO9A 1ZK0A 3QLJA 1DC4A 3PJGA 1UH5A 2B4QA 3FTPA 4BO3A 4CM4A 4CLOB 4DIFA 2GNAA 3HHPA 3TZKA 2YZ7A 3GVIA 3ZWPA 2YHIA 1K89A 4YJDA 4BNJA 3FD8A 2AEMA 3AM3A 4DLBA 2PGDA 3ETDA 3RUIA 1EZ4A 4YTEA 3G49A 5I7VA 4BNYA 1EQ2A 2Q1WA 5JDCC 2FWMX 4XR4A 4BO2A 3ONFA 3GZNB 1FF9A 4H7PA 1QYDA 2HRZA 2GSDA 4QSMA 5JNLA 4FFOA 1B0AA 3AI3A 3D0OA 4XGIA 2VUTA 1HLDA 3KLPX 4WLNA 2VZ0A 3GMSA 3LC7O 2YQ5A 2J3HA 1HDXA 2PK3A 2E37A 4C4OA 2QZ9A 2JHFA 1ISGA 2C7GA 3DAFA 3U3XA 4WNIA 1DJNA 4NBVA 4HV4A 5DT9A 3PJEA 3SX2A 4XRGA 3D5TA 3PP8A 4YJFB 1Z45A 2O3TA 3ZWNA 5JAQA 5IF3A 1LX6A 5EINA 4BNWA 2AXQA 3GNTA 4J90A 5DBIA 5L7WA 1BGVA 2Q1SA 1AHHA 2CY0A 1K0UA 4GX0A 1P44A 1ZVMA 4EEXA 3ZGYA 2JKVA 2O50A 3PIDA 3LT4A 2P9GA 3PVZA 2LDBA 4IIVA 4PLYA 3TQHA 4U0JA 1PEDA 4PG7A 4DLLA 1FDWA 3O03A 1C1DB 1VRWA 4FN4A 1T2CA 1IHYA 1U4SA 3JQGA 1M75A 3RJ9A 4TKLA 2HDHA 4NR0A 1F0YA 1Y8QA 2IXAA 1V0JA 5KJFA 3DBLA 1LSUA 1GPDG 4LRSB 1VC2A 2CD9A 4J1NA 4YAEA 3U9LA 5KJ6A 4CJXA 4CMGA 1A72A 3NEPX 4N18A 2HRBA 4IJVA 1I32A 3WFIA 4KTVE 3WQQA 2J8ZA 1E7YA 1PGQA 3WXBA 3ZWAA 4PLFA 4GVXA 4FBGA 1PJ4A 2C82A 1E3JA 3FR7A 4XDZA 1LC0A 3HE3A 3R3SA 3DOOA 3PI7A 3PK0A 4Q39A 2EHDA 3GG2A 3UOGA 2RHRA 3VPXA 4E13A 2CUKA 2PLAA 4XGNA 1XCBA 3TRIA 3L07A 3M1LA 5ER6A 3L6DA 2BKAA 2POQX 5F3RA 3AUTA 3P5SA 1KERA 1ZO8A 3ZCXA 2NVUB 3QV1A 3H65A 3RQSA 2Q1TA 5TT0A 1RM4A 2HMUA 1LSJA 3DC2A 1LRJA 3JD1A 1OI7A 3W8EA 2VRCA 1HDZA 4DGSA 1NX6A 2XAAA 5IDXA 2D3TA 3RFVA 3UCXA 2PKQP 2I3AA 3AUSA 4P22A 5JO0A 1U5AA 1PGOA 2G1UA 4W82A 5L4LA 5DF1A 5TJ9A 1RM5A 4K26A 3TZQA 4LN1A 2VN8A 1EE9A 4IDGA 4MVJI 3NGXA 1CWUA 4BO4A 2BHLA 3EUWA 1HYHA 2UUOA 2OUIA 1XSEA 3HDJA 2HK9A 3F1LA 3PJFA 1HYGA 1ISJA 2WSBA 3WNVA 1A4IA 1EVJA 3MWEB 4MVJM 2WEKA 1TB4A 1J49A 1N9GA 1ZZEA 2VYND 3H9JA 4Z9XA 3I9NA 5IJZA 4IDEA 3IC5A 1PJSA 4ILKA 4BNGA 3P2OA 1OBFO 4OSPA 3W4IA 3WNQA 4MO2A 3MTJA 4PGFA 3OQBA 3R1IA 1DC5A 1WZIA 2PKRA 2GLXA 5T8KA 4YR9A 3RFTA 1E1LA 1UDCA 2CF5A 2ZB3A 4JIGA 5KKCA 4BKQA 1M6WA 2NTNA 5T64A 3JD0A 1PJTA 4Y6PA 3GDOA 4J1TA 1IPEA 1GUFA 1UDBA 4B7CA 4BGIA 5BSGA 1BW9A 2I5PO 1TA4A 2VZ8A 2C5AA 3N58A 4RVGA 3SJUA 3OIDA 5JXWA 1NQAO 1ISIA 1WW8A 2Q1UA 2Z95A 2H5LA 3BMQB 3KETA 2VNSA 3OJEA 3GC6A 2X9VA 4E12A 4RV9A 5EESA 4RZHA 5FF9A 3ZHBA 1H2HA 1P33A 3GRPA 2BFAA 1E0DA 2PD6A 3ICCA 4JBHA 4EGFA 5T5QA 3QVSA 2W2KB 4UUOA 3ZWCA 2EKPA 3GGGA 4OM8A 3ASUA 3FWNA 4NPCA 4ZD6A 2F1KA 4OXNA 3OIFA 3NT2A 2VHXA 3H2SA 3R3JA 4OIMA 1VKNA 4BKUA 3PPIA 4ITUA 4ROSA 3GRKA 2O7SA 5F1PA 4ZVVA 3ZV5A 3UW3A 1NP3A 1UZLA 2DTDA 4I5GA 3PYMA 1AUPA 1PTJA 4QXMA 4R3NA 5A05A 3DEYX 1DXYA 3ANMA 4OQYA 1XQ6A 3ZNNA 1PS9A 4HBGA 2J3KA 3H4VA 4DREA 4KDEA 3G0OA 3U09A 3WJAA 4J2OA 4D42A 2GCGA 3W6ZA 1HZZA 1JW9B 2AHRA 2C7VA 4R01A 5EERA 1HZJA 1NAIA 4ALNA 2WMDA 5H82A 3L9WA 1I8TA 3CE6A 4XB2A 5IZCC 5DNAA 3E1KA 4EI2A 1VM6A 2VYVD 4QTZA 3KZVA 4FFLA 1A9YA 1C1XA 5K0ZA 1P0FA 4PLWA 1PGNA 4FFMA 2CVZA 3H5RA 3GVCA 3X2FA 5G4KB 1Z73A 1XKQA 4GLOA 1I3NA 3WGTA 4CLHA 2Q2WA 2ZCVA 1LDEA 4Y6SA 4B3JA 3ENNA 1W6UA 2JD1A 3O4RA 4H16A 4XYLA 1DLIA 2V6FA 4QX6A 3ON5A 1A5ZA 3CSDA 3NDRA 3BZUA 3WMXA 4YJHB 3UF0A 1NYTA 4FPXA 5A1TA 5AVOA 1KY5A 3GZNA 2V7PA 4CV2A 3L4BA 2IDZA 1GAEO 1SCUA 2F00A 2JL1A 5L3ZA 2CFCA 3S8MA 4EYEA 2PZLA 2DKNA 2I6TA 1J4AA 1E6WA 1PZEA 5DBFA 4D46A 4GQAA 3VH4A 4INAA 1JU9A 2AQKA 4FW8A 4CLXA 1X13A 2XOXA 1U1IA 1B3BA 2JCXA 4KZPA 4GX5A 3H2ZA 1ARZA 1N1EA 4PIVA 4GKBA 3NJ4A 5B4VA 2CMDA 1NM5A 2A92A 3WQSB 3OICA 4IY1A 5JMWA 2DBZA 4GVLA 3VZPA 4BMVA 3JQAD 3CIFA 3DDNA 4WCFA 3EAGA 1KETA 4ZQFA 3TFOA 3WGQA 1EK6A 5FI3A 5KJCA 4EJ0A 4KDFA 3OMLA 5L40A 4B7UA 1I2ZA 1NPTO 1JA9A 1SNYA 2B5WA 3MEQA 3H5NA 1IY8A 1J0XO 4WLFA 4B7XA 2C5EA 5CPFA 1QG6A 1N9GB 1YB1A 4H3VA 4XZ3A 4FCCA 4J1SA 1QYXA 3WTBA 3PHLA 2P9CA 1YBAA 4R4JA 1ADGA 1R4NA 4GGOA 3KUXA 4BS9A 2AG8A 4WCFC 4MIOA 3AU9A 5THKA 3IKTA 4RCVA 2VT2A 3WS7A 1QYVA 4AJIA 4J6FA 4WLVA 1T26A 2DAPA 2OGUA 5L95A 3K92A 4U8GA 4E5NA 1GCOA 3DONA 3GDFA 4ONEA 1ONNA 2Y1CA 3TN7A 3W6UA 4PRKA 4J1QA 2VHVA 5DCUA 3V1UA 2I3GA 2A35A 4XQGA 4WECA 1GV1A 5J23A 3FRJA 1D7OA 1YKFA 4FFNA 4EUEA 1DIHA 3INGA 1LDMA 5GZ3A 3F4BA 3TJRA 1X1EA 4GI2A 2DTEA 1EEHA 1LQTA 3DZIA 3MJVA 3B70A 3FPLA 5IDYA 3MTGA 1HYEA 1UXJA 4NZ9A 3GUYA 1IZ0A 5KVVA 1NFRA 2YQ4A 1P9LA 2W2LA 1ISFA 2ZQYA 3AY7A 1X1TA 4YT2A 5IG2A 1YJ8A 4ZICA 1HT0A 5LCXA 2O2SA 3BMQA 4R68A 4BGEA 1EDZA 2QX7A 2YV2A 4QFDA 4WUVA 1EK5A 4W7IA 3ETEA 1HDCA 3I9OA 4RVSA 2W90A 1O94A 3BMNB 4YJGB 3JQBC 2EKQA 1XEAA 3A4VA 2EW8A 3M2TA 4BO1A 5LC1A 3PZRA 4RF3A 4RVUA 4E5KA 2AE1A 2EP7A 1GR0A 1YOVB 4TQGA 4Z0TA 2PGJA 3NT4A 5JLAA 4E21A 3EVTA 4O0LA 2I76A 5ICSA 4GWKA 3HDYA 5G0TA 4NK4A 1I2CA 1Y9AA 1U3TA 1XA0A 3AK4A 4JLWA 2VHWA 5HS4A 5G0SA 2HMSA 3KO8A 1GY8A 2Q2QA 1KOLA 4E30A 3GGOA 3JQEA 3UVEA 3EGOA 4W9NC 4Y8VA 4CMIB 5A9RA 3CINA 1U28A 5CEEA 1WNTA 4Q3BA 1XELA 2FSVA 3PFWO 2GERA 4PZCA 5GZ1A 1SOWA 3E5MA 4CMAA 2HO5A 2HQ1A 1PGJA 3WYEA 3JQBA 4MVJE 4LCJA 1DAPA 1DOHA 4BOYA 1R0LA 4YJFA 3OJFA 4CLDA 4XDYA 1LEHA 4KUEA 5GY7A 4M1QA 4MVJD 3D1LA 4YXFA 1BWSA 2CVQA 3BTSA 1UZMA 2VT3A 4JJIA 3GHHA 4GMGA 5ITVA 9LDBA 2JJYA 4R5HA 2EG9A 1I24A 2NNLD 2RH4A 3UFXA 3S55A 1XQ1A 4DIOA 4IDDA 4J4BA 4FC7A 5JW6A 1EFKA 3FBGA 8ADHA 4G81A 3S2GA 3WYBA 4PLPA 5F1OA 4HNHA 1LRLA 1P74A 4DYDA 4MJLA 1SMKA 4PG5A 3ZDFA 3RVDA 4DC1A 2I65A 1LU9A 2HLPA 2BGKA 5KVQA
chains in the Genus database with same CATH superfamily
2Q7DA 5FBWB 1MCZA 2PZBA 1D2RA 2NT3A 2DYKA 2QPAA 3G7NA 1ZA2A 1T15A 5AJZA 5DPMA 2GF2A 2WSIA 2HPHA 2PUVA 1CX9B 3HUEA 5G4KA 5D3QA 4AICA 1L7EA 4YLGA 4PN7A 1CRWG 1GG5A 5ILGA 3IDFA 3TUIC 3ELBA 3HLTA 1LLCA 1OWOA 1LNSA 1EJBA 2H18A 1YE3A 1ZCJA 2P91A 1TI7A 1ESCA 1DG9A 3QA9A 1WMAA 3PFFA 4LRWA 4NZPA 3TLKA 8OHMA 4FD3A 4CL2A 3FVWA 4BZZA 4EY6A 1S3SA 2VK8A 5DHFA 1DQNA 3Q1KA 3TSCA 4FI3C 2C5FA 1TZKA 4JXKA 3KCNA 4MS1A 2DQZA 4PYOA 5F5NA 2ECQA 1FX1A 2J5QA 3B82A 1UXOA 3BMCB 1DARA 2P6UA 4OJTA 1KS9A 4DEVA 4DY4A 5JRJA 2WV9A 1ZIDA 3ELDA 2PZMA 1VHLA 3U80A 3UMBA 4DCMA 1BXGB 1SHKA 3Q7SA 1TF2A 5IS2A 3THWB 5BT8A 2O2CA 1TVKA 2RGRA 1MZVA 4AZ0A 3HEBA 2W6CX 4O2RA 5EJ4A 1ZL2A 4TMXA 2ZRNA 2CYCA 3LUKA 2D59A 3OCJA 1YVPA 1GZ6A 1NSFA 5HQ3B 1H93A 3EG5A 4O2BA 2W6NA 3D7MA 4I8DA 1GQYA 1WABA 3FCSB 3K0HA 4JUAA 4BFYA 1F8YA 1JQ5A 5EKXA 2ZK7A 3NYWA 5KNCA 1PP4A 3A4IA 1JUDA 2P9ZA 2PR7A 4MROA 4WEQA 4AJ4A 4NHEA 1P1CA 1E60A 1VMIA 3QK7A 1EFUA 3KB6A 3THXB 2O06A 3ZJTA 4TMFA 1IBCA 3ZCPA 3L4BC 3QUCA 2ADOA 3FMVA 3GL9A 3IQWA 3WRYC 4BX9A 4NCXA 1GTL1 1UXGA 4IRMA 4JQSA 4L85A 4ZRDA 4QREA 1RHQA 2H9YA 4EPTA 5KNLA 1P77A 2EQBA 1ECLA 3VUFA 4EO7A 1CR6A 1CW2B 3KJXA 3M7IA 2AQ8A 2BBSA 2BMJA 5IBPA 1D2CA 1NBHA 2V1UA 1BOFA 1DQSA 1YZQA 2PJZA 2ZR0A 1LXCA 3R5HA 3NBUA 5A2QA 1Q1NA 2X40A 4A82A 2HHAA 2PRJA 3NI2A 1EFPB 2RGCA 2VUUA 1Q21A 1NP7A 4TTVA 4JQOA 4B45A 1JG2A 3NXKA 2J32A 3EHEA 4GZ5A 1V4VA 3CG4A 3IT1A 2WUWE 3LUHA 4IXWA 5FADA 1YSCA 2GARA 1RDFA 1VJTA 4B35A 3KYBA 3R8CA 1Q0TA 2BM8A 1ZQ1A 2QNBA 4Q03A 5J4LA 1M2VA 3I5AA 5JALA 3E48A 1P8AA 4F2DA 2Q07A 5KSPA 1W6RA 2P6MA 4IOLA 4MYUA 2GK4A 5LU8A 4XYMA 1RYMA 4NU0A 5HM6A 4QHTA 2ZSDA 3ZY6A 3PLRA 1EGHA 2FZ4A 2NAPA 3AP3A 3D6UA 1E3WB 1W4LA 2IZ7A 2WWHA 3N28A 4M7OA 1TT5B 5AXAA 3RVRA 4F5ZA 1XE3A 2R87A 1B73A 4ZYLA 4AKTA 4MQFB 3I73A 4YCMA 2BJVA 1GNRA 2HRCA 3CUKA 4ZCPA 3RSLA 4WBNB 2FR8C 3EUEA 1AXGA 3HO6A 3O1LA 1JECA 1TO6A 2H8GA 2ONYA 4J0QA 3NBMA 2JEZA 3CEMA 3F6RA 4Q9LA 3ZCUA 3GGCA 1FTGA 3NAZA 1NMEA 3PXXA 4M2LA 1GRVA 2W37A 2X8LA 4NNPA 1FNSA 4PPFA 1Z7EA 4OU5A 1P31A 4PINA 3RRFA 3TI7A 2FJPA 3FKSD 1LQUA 2YWCA 1K8XB 1NNI1 3L7YA 4M0MA 4PSUA 3FFTA 3EDMA 4FONA 3WADA 4HNTA 5CCBA 2V8OA 4QO8A 1NYLA 3RVJA 2J9XB 3F6PA 3CZ5A 2PSDA 3G5MA 2LR0A 4XSGA 3FR8A 5BUCA 2O8CB 4HGNA 3DUFB 3RRBA 1ORWA 4RIEA 1MX1A 2A5YB 2MINA 2W9XA 3K8QA 1VJ0A 4E12A 4IGFA 2P77A 4HFMA 5A0VA 3PENA 1F9AA 4YALA 4DQUA 1GAXA 1V43A 4J2HA 1HXHA 5KNDH 4FMCF 4XPIB 3LECA 2VFAA 4WXHA 2QKYA 3H6GA 4I4TA 4YHHB 1DKNA 5KC8A 5DOVA 4ZOQI 1P1HA 1IN5A 1LTHR 3R7NA 4IXMA 1QNFA 5FI5A 1D1SA 1AHIA 1A4RA 3PQ6A 2GJSA 5ALQA 5KDOA 1SCJA 5GV7A 1W9HA 2ZBFA 3IQEA 4ACBA 4J4TA 1JHQA 3TH5A 3T7CA 3WGHA 1P80A 4MP8A 1BE8A 3DMRA 1XRJA 1BJTA 3HJTA 2VDNB 3HEAA 3Q5EA 4KOEC 4D79A 1W44A 1Z83A 2G5GX 2R6AA 2L69A 4CM1A 2OYSA 4GS5A 3AIIA 3P9CA 2BHSA 1NUHA 5FXMA 2F3RA 3U7QB 2XT6A 2OMEA 4H1UA 1WBJB 2FG6C 4C7VA 1J99A 4DOMA 2XF2A 4AJHA 3O1HB 2VNKA 4OJYA 2PRKA 2O6HA 1EWKA 3LGSA 5M2QA 2O0KA 2C7RA 2YR0A 2Q8NA 3R4VA 5E2AA 5ECYA 2XVYA 1TGYA 4G2NA 3RVQA 3K5PA 3NHFA 4PYJA 5BURA 1Q57A 2R6FA 2YZNA 3I76A 4ZVPA 2WA1A 3H7AA 4H18A 3ZHUA 4JSTA 2XWSA 3VVLA 1XLTC 3Q2IA 3ZTWA 2BFNA 4D9EA 2A2ZA 3MWDB 4X93A 2D54A 4FZ3A 2X2EA 4LOLA 2GAAA 3L18A 3VFDA 5DNCA 1TYBE 3IVCA 3TR0A 3W8RA 4YYEA 4MV9A 1GPNA 5KUTA 3I28A 1TW3A 3I58A 1W5EA 3CNBA 4UVIA 5BSTA 4ES6A 4EFNA 5CYGA 2YINC 1NUUA 2AW5A 1V35A 3Q87B 4E5DA 4YP9A 1XTTA 1HLGA 4B3DA 1T4DA 2IWHA 5KSWB 4EO4A 1N78A 3ISVA 2EFDB 4M7WA 1DXOA 3B5JA 3EXEB 3OJOA 4OHVA 4BVKA 4EJ6A 4JHLA 3A1VA 4AN4A 3GZ4A 1M1NB 1DU4A 2P79A 3ENKA 3I83A 4OU4A 4QU0A 2Z8ZA 1ST2A 2GXUA 3BJEA 2PKYX 4FU0A 1NJGA 3I37X 5HCUA 1L7OA 3SXPA 5H4GA 1QJ4A 1BYIA 3GAAA 3IALA 4MKGA 3MQFA 1XEXA 1IOWA 4AG3A 1I1QB 3A1UA 1PFWA 4IG4A 5JSYA 1T1EA 2DLDA 3QHQA 1FJ2A 2HPZA 5FBHA 2J6BA 3DFZA 1LPOA 3GF4A 1XZQA 3H2KA 3ICWA 3L77A 4Y6RA 3RRYA 2B8JA 1BS9A 3LUGA 3PA8A 2YJ4A 2PBRA 3AR8A 3FIJA 4H3SA 5TRTA 3KR2A 3BEDA 2ZJ1A 2JZOA 3JQ6A 3OSUA 3VX4A 1MOSA 2BYTA 1K0FA 5SYAA 1USIA 1A88A 1CUUA 1GSIA 4C04A 1R4MB 4QQRA 4EJ2A 3EZGA 2C03A 3PWSA 1NY6A 2WSLA 2PO5A 5KDDA 2GFHA 3GOQA 3WQHA 3DBHB 1G63A 4YPOA 3WLFA 1Z0KA 4KO8A 1DHRA 1TRHA 3WX0A 1FXWA 2ORED 4RE5A 1E1DA 3UC9A 4J03A 2FEWB 2ZWAA 1E4EA 1JTFA 3B38A 4MVJH 2JIRA 4CL0A 4L0QA 4BB5A 1A5SB 3IQZA 3KU4A 3M6VA 3QFCA 4MEJA 2MYPA 4R98A 1A4XA 3H6HA 5EJ2A 4F2HA 4RXUA 4F4FA 3QLVA 4CODB 1LLDA 3ZI0A 4EEZA 5G41A 4YRTA 3UPTA 2X8BA 5FYDA 4I5EA 3C7DB 2HJHA 3FNRA 3OHMA 4K3UA 4P92A 1ZA1A 4CQJA 1JEOA 3CEJA 2IYFA 5TF0A 4XIYA 4BJ5A 2GM9A 3JWPA 5KQSA 3WXMA 4EBFA 2CXXA 1IZ7A 1UC5B 3O3OB 3CX6A 4RULA 2HGSA 1PG2A 2XMDA 3DTTA 2RGNC 2QI9F 3ND9A 5IN5A 1SG6A 2UVPB 4BLRA 1DIOB 3VHXB 1PSZA 4RDCA 1VRVA 6REQB 1B3RA 2NYVA 2R5FA 2HEIA 3D5EA 3BFPA 1Z5OA 5DEIA 1MHTA 1R2QA 3SJZA 1U0OC 3IA7A 3HR7A 4R84A 4UM5A 4Y9DA 3AJEA 2OQ2A 4FR0A 3KAPA 2JLWA 4G1FA 2HF8A 3K0AA 2FQXA 3V1YA 3DLIA 3R8XA 1QH8B 4UAUA 1C7QA 2FFJA 1JPUA 4DE5A 3FXAA 3RBVA 1U6KA 3OFSA 5HGJA 4RUKA 2P9FA 3LBNA 3D2LA 1WU8A 3GMIA 2EVWX 3TIVA 4BVJA 4QEZA 3K0CC 4ESHA 1T5DX 4F5YA 2J0QA 2PH1A 2I8AA 2PAFA 3LSYA 2XCSB 4DV0B 2ZBUA 3I1JA 2I4LA 4NPAA 3KUDA 5KTRA 3VPDA 4FYWA 2AYZA 3HN2A 4A4DA 4X8HA 4EY7A 1TYZA 1VKRA 4KYTA 1X7WB 1RYNA 3B1KA 3HBJA 3VOSA 4AY2A 4MDEA 1I2DA 2WP0A 1V2GA 2XZTA 4JSYA 4HXFB 1E63A 1DIBA 4IQ8A 3SHOA 1C1DA 1UEIA 3CLHA 3IAFA 4JOCA 5PGMA 4AFNA 1TLTA 4HO1X 3PR3A 1RJ9A 1ZJ6A 3JYNA 3C16C 4GC5A 5H9WA 4D0LB 2PCJA 4Z7NB 4PCVA 1EFHA 1NXQA 3EK2A 4R9UC 1RRVA 1J07A 1DC6A 2PFSA 3O73A 4P4GA 5FNVA 1GYRA 5CB0A 4F92B 1XTUA 1EJ0A 1YA8A 2IODA 3FDJA 3NTQA 2PUAA 1T10A 3CX3A 1DB3A 3D02A 1HR0B 2PWBA 4I4NA 4DMKA 1V8BA 3L7BA 2QW8A 4JR1A 5LQJA 3C3AA 4LVNA 1WMBA 2OQRA 3ORSA 2GYUA 4L4SA 4HQFA 3USZA 5HYVA 2B8EA 4BFUA 1ATZA 3U13A 2UYCA 9ATCA 4O33A 4JJ8A 4ZI7A 1VL6A 2YYZA 1E2IA 3TAXA 2XH8A 5MN4A 5JBNA 2JI6A 2ZTLA 5BN4A 3GH1A 4ZHQA 1KFJB 4HDOB 5DU2A 1K08A 3OZAA 4JT2A 4YMWA 3IVGA 2AWNA 3EZYA 1T34A 2BSAA 2ZZMA 3NANA 2XECA 4DWJA 5G1NA 3RC1A 4Q9HA 4B8ZA 4KFCA 1BE6A 2WHEA 3BFJA 4ZTBA 1JFFB 1NWCA 2ZUSA 3GLRA 3QEMB 4I9HA 2XNHA 2J5KA 3C41J 1ZNQO 3IKLA 1GLNA 3H5AA 5DI3A 3O26A 5D3MB 5BT9A 3LT0A 3MIIA 2NU9A 1YL7A 3VU9A 5GONA 2R8PA 3TLGB 3FY4A 2H65A 4AD8A 4AJPA 4X65B 1P7YA 2QQFA 2QYOA 4DUGD 4QOEA 1OWMA 3FMIA 4XVHA 1IHUA 3NC1C 4P7GA 4F8EA 3IJRA 2XW6A 2QA5A 1WDLA 4HGRA 5A0FA 4A8TA 1GFWA 4JLOA 3NOVA 1EU1A 2FGKA 2I7VA 4YV1A 2CBGA 1BX0A 1KXJA 2VP3A 1SUDA 3RWOA 2O54A 1NONA 2TRSB 3CF4A 2V0NA 3CRVA 3TW8A 1NDQA 1U2DC 3R0ZA 2XT0A 3VR2D 2CJWA 5AVSA 4H7EA 5EXEA 5KX5A 2HFKA 1ULSA 3ADCA 1MOZA 2Q45A 4ZEXA 2ZAIA 3TQIA 1DIAA 1YZGA 5LWHA 3MSXA 1TO2E 1VLZA 1DCKA 5J2TF 5BVHB 2DBVO 2VAVA 1SHUX 3P2KA 4P1ZA 4L75A 1WXWA 1R27A 5FWYB 2QGNA 4PX3A 3I5XA 2ARKA 5E8JA 2J9GA 4YAFA 1MH9A 4P9NA 1TU3A 1RJEA 1ZY2A 4BRSA 3PRKE 4YCBA 1S8NA 3OF2A 1O9BA 2GTHA 1F1JA 4JD5A 3D6VA 5COBA 5D5PA 1JFLA 3V2UA 2HXYA 2HNKA 5EPOA 4E14A 2LCFA 4OGLA 2AMYA 2H9IA 3K7EA 5T67A 2BSQA 2VPQA 3OT1A 5LP6F 4BYGA 2IUSA 1BQ4A 1R16A 1GPUA 5IASA 4O6VA 5DGDA 3RAJA 1SG0A 2VL7A 3GY0A 3G9ZA 3WBFA 1KZ1A 1RQNA 2ID4A 1E1NA 4QUHA 3Q3VA 4KXFB 3TNLA 4DPLA 1ZD9A 1F9EA 4D6XA 3BHJA 3NFYA 3WQBA 4YUYA 1L9KA 1QPGA 3UMRA 2RHWA 2XWQA 5IUKC 1DINA 4RGVA 4KR6A 1MRZA 3E7XA 1UBEA 4ETNA 5ARBA 3QE3A 2E4AA 5J2TA 2Q8PA 2HY7A 4O5OA 2WINI 5GV8A 1R66A 4L0CA 4BP9A 2C59A 3KSUA 4MX8A 3ZGXA 3OLXA 3M2PA 2Y2UA 2VQSA 3KQLA 5KX5B 2YTZA 3EOBI 3WMWA 1Q7RA 2FR0A 1NFFA 4HSGA 3ROKA 1H2FA 3LYUA 4MQMA 4YRIA 5DJ5A 3IS3A 1E4VA 1ENOA 3GA7A 3OIGA 2P9EA 4NQZA 4BNUA 1CTQA 1KDPA 3AF3A 1NJ6A 3DMGA 2OCGA 2V6BA 2WJYA 4QRHA 1N75A 1NN5A 4TLMB 1A8PA 1XA4A 3AYXB 4O4HA 4JVMA 1CUYA 4TKUB 1R6AA 1QK4A 3BTVA 4Y2JA 2H2GA 1H9BA 1N2CE 1WMEA 2C0CA 2VT6A 2QN6A 4AS3A 3PIIA 3G17A 3AEUA 2CDCA 2OFXA 4PSAA 5HIJA 1QH9A 3QBJA 4UD6A 3V8MA 4YUAA 2IA5A 1W34A 3VZSA 3C7TA 1C81A 4IILA 1JAZA 3T7TA 4ADSG 3BGWA 3TW6A 2HDWA 2JVIA 5L8VA 3ZX5A 1NVDA 2OO7A 4CFSA 4MVYA 1E1QA 2WTNA 4LNHA 3X1KA 2DZDA 3CGGA 3P52A 2AFHB 1Z0AA 1IY2A 4K8OA 5CJJA 4NP6A 4ZAZA 3KR9A 3MJ4A 1FDVA 3KVOA 3T61A 2RDMA 5IK2D 2MSEB 4KGZA 5TMEA 1KFCB 3HB7A 3OU7A 1FDIA 3ONNA 4EJSC 2FPRA 1Y33E 4O1HA 1V8ZA 2RBKA 4N7MA 2W6QA 2QT1A 2HBYA 4OMDA 1NL3A 5HF8A 5ULLA 1ADJA 4YV0A 5C5IA 3CW8X 3E1GA 2X1VA 4DDUA 2HV8A 5F9HA 1EI9A 3CF6R 3VI4B 3L8DA 4TZ0A 2IV3A 4RKEA 1P2DA 3V1TC 3VPCA 3ZI7A 4L7QA 2JI4A 3CLTC 4CMEC 3VSCA 2QTLA 2A9OA 3F6EX 4QE3A 3SYTA 2EIHA 2RG1A 2WF9A 4FSDA 1ADCA 3WDKA 4EB3A 5AVVA 2EP5A 3NIFB 5CXQA 1XXLA 2XCLA 2OENG 4RVDA 4XOUA 1P1RA 3LDAA 4IH1A 5TPWA 4ESVA 1WDMA 1T2DA 3ROFA 2CMGA 4HYTA 1P7WA 3GPIA 2HWXA 4GRAA 1U3VA 1Z6AA 3ZEIA 2ORVA 4GO1A 1XMXA 2C00A 2O3UA 5F2NA 1OV6A 1WEKA 3I23A 4KG7A 4LJ4A 4OL0A 3H1BA 1OVGA 1Z5GA 4C07A 2C8LA 4XPIA 4HI0E 2ZREA 4JJKA 4E07A 1FNMA 1N2JA 4DB2A 5LXTF 4ZQHA 4XFJA 1SC6A 3CXRA 3GXBA 4JVSB 3RS0A 2QBYB 3F73A 2AI3A 4PTLA 3O8LA 4MV4A 4IVRA 3PHGA 4JMLA 3X0DA 2XYQA 2CXNA 2C88A 2O7RA 1P91A 1MQ9A 5AO9A 3VNQA 4PBRA 2VC2B 1QZZA 2ECFA 4RTJA 4EPRA 1YV9A 5GQSA 3RABA 5AXDA 1CY4A 4I55F 1WCYA 1KVQA 1MBZA 2ATCA 1NKVA 1TQ2A 2ZJZA 1EAYA 3RREA 3ZIDA 3VC7A 2CSXA 4QNNA 2ZQ5A 4HAUA 3H2GA 5F64A 1YC2A 4NI5A 2O7NA 3OUUA 2Q50A 4JLVA 2X3UA 3E9YA 1BQEA 5AVQA 2I87A 1BCSB 3QOWA 3EASA 1U63A 3OO0A 4S04A 2L18A 3EF3A 5BVHA 1Z08A 1JA0A 4OUDA 1ZGHA 2CCGA 3EUAA 3KXPA 4WCDA 1EG7A 3IAS1 3F74A 4H77A 1TD1A 3OCWA 5JO9A 3TS1A 1KI9A 1MB4A 3ZW9A 1UJ2A 4NDZA 4XVCA 5LQAA 4LFCB 3E82A 4JXJA 4GGMX 4UNIA 3A2MA 3UUGA 1FOEB 2J46A 4LGYA 3BGVA 2FF7A 3KWFA 2ZEJA 2XA9A 1VCHA 4TN5A 3K0SA 1TZBA 2QVLA 5DTIA 3ILXA 3PRHA 2GZ1A 4BB9A 1FXSA 3HDVA 3D4PA 5JE8A 4V3CA 5LNK1 1O97D 4PQRA 4CU5A 3VO1A 3U7IA 1OYWA 4B2IA 2EFGA 4GX2A 3WYAA 1D1PA 1IONA 3IKVA 4TLEA 2AJTA 3R0QA 1C9MA 1NOJA 1DXHA 3KQPA 5J9FA 5BXYA 2YW9A 1R88A 1T5SA 2ZIVB 1FUEA 3MUNA 4REOA 4I08A 5BPHA 3BT7A 2N1MA 4HDNA 4C6SA 1E6LA 4G8BA 1YU6A 5M04A 1MX3A 3D64A 5JMTA 4EB8A 2ZIZA 2BPOA 3LQYA 3O4JA 3D5QA 5J4YA 1H6BA 2ZB4A 1DZIA 4C03A 1NXPA 1CB7A 4PLZA 5H4HA 3BE5A 1RABA 2WYIA 1BNCA 2PBFA 3Q41A 1MA3A 3C8ZA 3RTDA 5A7GA 5E95A 2IS1A 2FMXA 2FPLA 2QN1A 4G24A 4BUCA 3R5TA 3RK4A 1ZISA 2X8AA 1QP0A 3IPYA 3OWXA 2JFUA 4BXOB 1Q22A 4RFVA 4KR3A 5I47A 4CVNA 2ZPTX 2L42A 2YIJA 3N86A 1C5KA 3A1CA 3AR5A 4C6TA 3Q8KA 1K97A 1GL6A 4BX3A 2Q21A 4FXOA 3ZW8A 1KY2A 2Q27A 3CA8A 1U8UA 2ZP1A 1OYYA 1ZM7A 2ANCA 3FNEA 4HLUA 4ZCTA 4JLPA 2BRUC 2IBMA 4ZVNA 5K3AA 1DDIA 2IUUA 1C0IA 4DIBA 4Z7QB 3VPSA 3Q5GA 1J2UA 4HLNA 2XXAB 1N5OX 5IC6A 2BGNA 3T3EA 1KYIA 3KBBA 1QHGA 5A04A 4OO3A 2QIPA 2VF4X 4FWTA 1TIPA 1FFWA 1DC3A 4CDNA 4AKSA 1VSUA 1P0PA 1IM2A 1JKJA 1WTCA 2FW9A 4A7PA 3B48A 2CLFB 2HQSA 2MR5A 4LYYA 4DB4A 1YL5A 3RU2A 1ZM3A 1AGPA 1M54A 1ML3A 1NT2A 2CXPA 2FPKA 3OKAA 5LQNA 3QFFA 2AFHA 4IJQA 3BRQA 3TKYA 1GHTA 5LDDC 4MW0A 1USVA 5M34A 4IDCA 1JHDA 4Q4AB 2X5XA 2JBWA 4PYRA 2EKBA 2ZJ4A 1ML4A 2X9LA 221PA 4G85A 1FP4B 1XBTA 1Q20A 2QN3A 3H1FA 4JYMA 2GESA 4XXHA 3ZCVA 1T5TA 3KPYA 1FL9A 4R1PA 3STVA 4AN1A 2DR2A 1ZL0A 5LFAA 3QV2A 1OIXA 4DANA 3UG7A 4XWWA 1AKQA 4CQLA 5CEFA 1DSSG 1W0JA 1X15A 1UIMA 4G5XA 4XFKA 5IX8A 2DXIA 2XGJA 1JE0A 2B1JA 2Y77A 4G0OA 2HJSA 1Z62A 2ODNA 5IXJA 3QVXA 2PXXA 3BBPA 2PU5A 4EATA 1SQ6A 3OP4A 1NI4B 3UJ9A 1G8AA 2QTBA 3GFRA 3I9JA 4N5LA 4HWSA 2HR1A 2OBBA 2XGSA 5EJIA 4OHZA 5JU6A 3R7AA 3DOHA 5GOZA 2PS3A 1MABB 4HPWA 3BHIA 2BC9A 3MBIA 1WVGA 2E21A 1GLGA 4MQ5A 1S01A 4LBYA 4NAVA 4C7KA 5JNUA 4FC6A 2G77B 4P7JA 4B47A 1GZSA 1P6QA 4E6EA 5A5DA 3AVQA 1FMCA 3ZXSA 4ALKA 1RYEA 1GIAA 3H17A 4I4TF 2L2QA 4GOLD 1AMNA 1T5IA 3FKJA 5FFMA 5HR5A 4PONA 1H1LB 1V37A 1GAQA 5HKBA 2JGNA 2WUFA 4P31A 4UEWA 1U98A 4D8YA 3TLMA 1AQNA 4MQ6A 5KPJA 1KIFA 3BMCA 3VJRA 2C2YA 3WSTA 5JWOA 3RTGA 1A82A 2BFDA 2B8WA 5EIWA 4O2LA 3BC1A 2VXBA 2M2IA 2JFBA 1FRVA 2Y1EA 4N8SA 2QLJA 3HDHA 4GZMA 3SIWA 4CV3A 1DAGA 5K03A 4RETA 2FX2A 3PD1A 4XR9A 1OA1A 1ISSA 2BV3A 2YVUA 4E5MA 1P1KA 3DZCA 4LTNA 1YVDA 1UANA 4RKWA 4GT1A 1GV0A 4JLSA 4HDNB 2KE5A 3EW9A 2OA0A 4KSCA 4JUCA 1QLJA 3HP1A 4EGSA 1N92A 2DH6A 5HS6A 1XMQB 4BDSA 3K9LA 1YQTA 4GM4A 1Q12A 2JIBA 4NATA 1TPYA 4IGAA 1J0AA 2E4UA 3D6HA 2BKVA 2I7DA 2ZT8A 1I9CA 2YZMA 3IT3A 3VR5A 2OHJA 1AK1A 3L46A 1TMGE 3UM9A 5K3EA 1WZEA 2DUUA 2E4VA 4X1YB 3BCSA 3K8ZA 4OY3A 4RD1A 1NLUA 3L4SO 1O5OA 3FBTA 3B3QA 4EA8A 1B23P 2GEFA 2WW8A 1UT5A 3KM0A 1PZGA 4WNYA 4Q3CA 4AYWA 4AF7A 4EA7A 1FNDA 2BE7A 1KNXA 3WWDA 5FV4A 1EH5A 5CFMA 4F60A 4II3A 1L7MA 1YDEA 4PGGA 3PHJA 1QAMA 2AEEA 1USUA 3CZCA 3UATA 1IUKA 3U49A 3LU1A 1JEQB 3IE2A 3A1SA 1ZOPA 2B8NA 4NCBA 2GPBA 3CURA 2YY7A 2J87A 2IPLA 1R0CA 3OIWA 4CPDA 2WAOA 4U0KA 2AOUA 1Z6GA 3NHSA 1SY7A 4XWAA 1WF3A 4GP9A 4DLNA 2YJ6A 3P0RA 5BW5A 1TCVA 2CT8A 4NQRA 3KDSE 2XMRA 3NP7A 4KXMA 3PUJA 1TC1A 2WJ3A 2QLNA 1N0IA 1PHPA 3HBFA 3WTCA 4KJXA 1X7XA 3K2BA 5E1MA 2B83A 3IURA 4CF4A 2NTVA 3QEMA 2J1LA 3TEFA 3UHPA 3G9TA 3VUEA 4S3MA 3W1EA 1Q7BA 1E0SA 5FRDA 4K9DA 3PRYA 1Y98A 5DN6A 4GLFA 5KNBH 1EE1A 3GN2A 3MGGA 4H6VA 3BRWD 3WKDA 4B4DA 1GYQA 5EUMA 1IE3A 4OA5A 1KARA 4KVGA 3CMMA 1CB0A 2P2NA 4DLAA 1VGQA 3QTLA 1P2TA 1OILA 3QE0A 2E5WA 5EE3A 5EPEA 1QK5A 1UBMS 5I7UA 5K5EA 4W5TA 3MWKA 1D4FA 1JR3A 3KB2A 1Y5NA 2JEYA 3C1OA 4FBMA 3DMPA 4P36A 2WUEA 4LA4A 5F78A 2O0JA 2JIDA 1CVLA 1TMKA 5H80A 3DKRA 5JSZA 4AJ2A 5IVPA 1O6CA 1RHRA 4F85A 5LIPA 4EELA 1BS2A 4RPJA 2BY4A 1JBKA 7REQA 4DCVA 4M55A 2FY8A 2P90A 3L4JA 2DWOA 5LA6F 4EDFA 2IHNA 4ZCRA 3VC2A 1NQVA 1V39A 4DWVA 5B58T 3VZRA 3LUFA 2A3RA 2P2CA 2QVXX 2VO1A 3DW1X 5KDLA 2G17A 4RTOA 1WOMA 1NJ8A 1JQDA 3SS7X 3X3HA 4F84A 4OHKA 1DUIA 4IIXA 1AKMA 1YUMA 1KHTA 4C0XA 2NT4A 1J2RA 2R3SA 1MAAA 5FAXA 4IX9A 5J4KA 1E6KA 1Y48E 4M6WA 3UMYA 3LP8A 2N46A 3UB2A 4RD6A 1QXSA 7YASA 2FKAA 1JHOA 5H81A 2FSVC 4UOEA 1CEXA 2OO5A 2Q2NA 2X15A 4LJYA 1IM8A 1A76A 1UXHA 1MQSA 2HC9A 4C7OB 1CUAA 2P5TB 4MDHA 4KAXA 5MFPA 2IZOA 3DDZX 3BMXA 5JHHB 1Q2XA 2O52A 4OQFA 4AKEA 1K06A 2GUGA 4C3VA 4KLAA 3AX6A 5FL7D 1UEXC 5NLLA 2XCQA 1Y5LA 5JT1A 3BHMA 2OAGA 3F96A 3OWOA 4S1WA 5L4SA 1UAAA 1V3TA 1JIKA 5C52B 1G59A 2IU3A 3BIXA 4O8ZA 2GEBA 1TECE 2AL7A 4B4WA 1JHMA 1EHCA 3PYLA 2LP4Y 4LKOA 1DAEA 1XVVA 2LIVA 4OFWA 4KPFC 2Z2YA 4BC1A 3RC8A 3IOMA 1KORA 5KC9A 4Z3DA 3DMDA 3A6GA 3SIPA 3W5VA 2NZ2A 4OD0A 3DPIA 2F1HA 1A2KC 4WZAB 2PUHA 1XAJA 1FNNA 2Z3VA 3CN9A 3ONDA 1PWHA 1N8NA 3R24A 1LRKA 4LX8A 3U9SA 2Y1GA 1TU4A 2F9LA 4Z3KA 3DP9A 1VBFA 1DQRA 1YF3A 1T2UA 4N54A 2Y1KA 2ZJ7A 1UBRS 1ZG3A 2DE0X 2YN2A 3DE0X 3BXPA 5A9SA 3MLBA 5JZOA 2JC3A 2Z9BA 1MC8A 3W3ZB 3HCEA 2QR2A 1PBNA 2HRRA 4D9GA 5EP4A 3ZJYA 4H3HB 2WAXA 4URXR 1WZ2A 3ISTA 2WTMA 3C15C 1BROA 1IVNA 2XQFA 3O4FA 3TQOA 1M3SA 2QLFA 1UBLS 4DR2B 1A7AA 1JDSA 2CLEB 2IYTA 2Z5FA 3CWQA 2PX4A 2B36A 1V16B 3VTZA 2G40A 1F0KA 1QOQB 3K1YA 3ZXXA 8ABPA 8GPBA 5CG1A 5EJ6A 5C5EA 2B21A 3AY3A 4WZAA 4BWYA 3IO5A 4MICA 1E92A 2QTRA 1JEDA 5DV9A 3E4DA 2H48A 4O2AA 1MKYA 3KFVA 3ANNA 2UU9B 2WC1A 2GI4A 3QWAA 2J0VA 4PYKA 2P2SA 5HCNA 3TJZA 3W9UA 3H0CA 4M8NE 2B9VA 2IE0A 2X7XA 1J2TA 3CRNA 1OY1A 4LJAA 3LBFA 1ZN9A 4JP2A 4E70A 4IVQA 2QRVA 1AQIA 2GBLA 3DULA 3EVNA 2D7JA 5J59A 1V7PC 4IIJF 3HKDA 2O19A 4DMHA 4WKGA 4P2GA 4Q24A 3DWIA 3K2QA 5BN3B 1EDEA 2DPLA 1XALA 3RHSA 1VBNA 3MG9A 2XWJI 2VZLA 1NQOA 5KQGA 1LFDB 2YNMD 3IQHX 2G76A 2QLBA 4KN5A 3UMMA 3CZPA 4UUPA 1RZ3A 3HBNA 2OO5C 1ZFNA 4RU1A 3DEHA 1QWOA 3QW2A 3RU3A 3ZHTA 3HA5A 5JD3A 1AZWA 1K98A 2FG5A 4DPKA 1AURA 3OM0A 3PD7A 2J33A 4D8XA 3CPSA 1P1FA 1JTEA 4RH0A 3N8GA 4UZEA 3QE2A 3GT0A 5KINB 4XWKA 3DZFA 2WJZB 1V41E 2CFIA 4A1OA 2GEKA 3FCYA 4GSKA 4JITA 5DIFA 4Q16A 2AK2A 4BO5A 5ALMA 2H1VA 2FWRA 5T41A 1K2WA 1K8QA 2X14A 4YFYA 3LTEA 3PSHA 5E4TA 2DCUA 5TF4A 3R0IA 2BGGA 1QUEA 2A5LA 3FBWA 1FFYA 3L04A 1JG4A 5BYAA 1CUCA 3PKJA 2IYEA 2WE7A 1F12A 1MW8X 5J5VA 5LQDA 3R9XB 1NLFA 1XF9A 2PYIA 2V7VA 5AJYA 1UFRA 4TTSA 5KNCH 3FRIA 4IQFA 5E6RA 2UYQA 2H8KA 1XAIA 3C3EA 4X6XA 2CE7A 4C7OA 2COUA 1U7ZA 1KRHA 4MWDA 2PU7A 5JMOA 5LLTA 3EQ2A 4WIAA 3EB9A 1TW2A 4L9WA 1ZH0A 4QWMA 1EXWA 1W59A 1ZNZA 1X0VA 2VWGA 2X2FA 4Z4CA 2WFAA 3VO9A 4J7XA 4ZN6A 4U5QA 3QHAA 2X13A 5DTQA 4DJEC 4QJBA 1J1UA 1GOTA 4KGVA 4YO8A 1WXIA 1H6AA 5AK4A 1CLEA 3T7SA 2AZXA 1DX6A 1MC4A 2ISCA 1N5RA 1QSGA 1ZINA 3GFOA 3VNBA 4AROA 13PKA 3BRWA 4YAKA 1MB9A 3CM0A 1GNLA 5CLGA 1RCFA 4E4YA 5C4IA 5I4BA 3HVKA 1AGXA 2IYPA 1MOPA 2MOKA 3WHLA 1IBMB 1BXGA 5H83A 3SDSA 5CNMA 1SQ5A 2PH7A 2BGRA 4NEGA 1C4KA 4KRXA 2XA2A 1L4NA 2E89A 1UINA 1WF6A 3VNRA 1SN7A 2WIDA 4G41A 5CK5A 4ZANA 1G5IA 2WWRA 1OPXA 4G1UC 5IMBA 2XT9A 3SICE 1NURA 3HWRA 2P4EA 5CDHA 5GPBA 4G63A 2A5FA 1Q7TA 4JOBA 5TIIA 5CB8A 1MO4A 5F35A 4Z9AA 5H3HA 3G0IA 3PBKA 1UKZA 4F56A 3H1AA 1RI2A 2EBWA 2P1DA 3G6WA 5CM9C 5T3UA 3DDCA 3D1JA 1TM4E 1PUJA 1YZKA 4L08A 4O4IF 5HOEA 2HLNA 4R1QA 5A03A 3URKA 6REQA 1M8FA 2RCNA 4B40A 5FA5A 1RQPA 2CHFA 4DA6A 5JDIC 1KEWA 2JLYA 5TJHA 2HW8A 2ZZKA 2OGTA 2FWBA 1FFDA 2QD3A 3E8SA 4G0ZA 5LOVF 3GG9A 3MUFA 2W8BA 1H6CA 1ORRA 4KIFA 1PYOA 4YRPA 3QQ5A 1L7VC 4JUBA 1XZMA 3L7NA 3NHAA 3FF1A 4WDRA 2Y05A 1KH2A 1OB5A 3AM5A 1P81A 4YECA 4YIHA 1V8PA 3UA3A 4UM7A 1JMKC 1YB2A 1NSYA 2BKXA 3KXLA 3PKIA 1NVMB 4TWIA 3DAGA 1OH8A 3IO3A 3RH0A 4D80A 3ZZ0A 2ZRMA 5ALXA 1Q7CA 4DFDA 1KP2A 1QO9A 2ZU6A 2OHOA 4WKPA 2KBFA 4KPYA 1HNXB 4W7HA 3WL4A 3OOWA 1KBOA 4UKDA 5JS7A 4ZCIA 5D5QA 1YR2A 3J81k 1GDTA 3GLTA 3NASA 4D43A 5BN1A 4ARVA 4IDAA 1VI2A 3LLVA 5JHGB 1JEYB 5LZ9A 1NF8A 1SUEA 2B1IA 3H4IA 3IUYA 1E2HA 4IGEA 2ADMA 4QLAA 4WESA 5JD5A 1F2VA 2NNWB 3HJGA 3X1XA 3PCXA 1YGYA 3EPPA 2AUNA 3WLAA 1KS2A 521PA 5KWSA 1AM4D 2XB4A 3MGCA 1PZXA 2JASA 3OETA 4KXNA 4Q3LA 4UEJA 3RIHA 4ZT5A 3RS7A 4KUHA 2GXAA 5EKSA 1OH6A 2R97A 3FYTA 1FTYA 1XCPA 5KTKA 2ISQA 1FTQA 1Z06A 3LTNC 1XV5A 4ETWA 4TMZA 2HUPA 3RJZA 5JROA 1CRLA 2BH9A 5JBIA 5LJIA 1MAHA 4J1TC 2CZCA 1FEZA 1S2IA 2BEJA 4U2GA 4US0R 5JD4A 4G0VA 2FEPA 4MA0A 1GTSA 3RUHA 3O8CA 3RV4A 3WOVA 4AYXA 1L8XA 3GEBA 2EEZA 4NDAA 1ABEA 1L4MA 4IH9A 5L3VA 4RACA 2QAJA 2QWXA 3AFGA 2WBLC 3PQ8A 4RX1A 4RLQA 5B1DA 2ONZA 3FWYA 3QPUA 3TVTA 1K63A 2HAEA 2QF7A 1MPXA 3DL2A 3TZEA 5AP9A 1ULUA 1UM9B 4RADA 2RCYA 4TTRA 1Y1QA 3ZHXA 4KIGA 5E3IA 3SZGA 4MLZA 2YWJA 5LP1A 3A1FA 2O8CA 1P9NA 3MWLA 3ZJ4A 3Q1LA 2IBTA 1W36C 3F1KA 1ZUNB 2DLNA 2JPDA 2ZE8A 1WPGA 2A8YA 1M2WA 2BBOA 3BE8A 2O2IA 4UHKA 3WGGA 1XMJA 4JR2A 4M21A 3RSHA 3PUXA 3K9NA 1DBPA 5IP5A 5BSVA 3NAGA 2C0QA 3VAZA 1O9GA 2H92A 2HL6A 2QTVA 1Q0RA 2WKPA 5SY4A 1E3SA 1WBBA 5JS8A 2X1HA 2CNKA 2MCFA 2EBHX 1PVOA 1ZUWA 4YV7A 3AKYA 4FX5A 1PR2A 4TZ6A 2M1ZA 4FFBA 1L5NA 1JPJA 3BS4A 4C4RA 1YR9A 3B1JA 2DLCX 1GSAA 5F3WB 4QODA 2CEKA 5CAEA 4RGYA 3VH3A 2ZSHA 1FNCA 2GD0A 1WB9A 1MA0A 4CDRA 6GPBA 4RPLA 3PA6A 2OPHA 1JPNA 3SBOA 2PFGA 4RFLA 1XTJA 1U8FO 3HKEA 4H7HA 4Q3DA 4P82A 3HXPA 2AFHE 1G291 1ZSNA 4AJKA 2BRUA 2XYRA 1V2HE 2GN4A 1BXZA 1JAHA 4ITVA 1RWVA 2B3TA 4IS3A 4NNJA 4ZOEA 1Z0IA 3ABSB 5F51A 1JQAA 3D7LA 2OFWA 1I4DD 3D4NA 3HY3A 2ZRQA 4R8VA 4YONB 5C2JB 5KAMA 5CB4F 1JFTA 4DR7B 2HJGA 3SC2A 2H7VA 2ETVA 3F46A 5JSUA 3K53A 2I03A 3T9DA 4CL8A 4DR3B 3QY9A 3EGXA 1N2CB 3UFXA 1G5TA 3OU6A 2I2CA 5NULA 2Q3HA 5AKIA 1YRBA 1ZEJA 3FMGA 5EYPB 3TXAA 1TPZA 3WNDA 2CE2X 3E35A 3LKZA 3R7BA 4DVGA 1FP2A 3QBDA 4JOSA 5AFSA 3GU3A 5U1PA 2W6PA 1G8PA 4TLCA 4ID9A 4UZSA 3EH2A 3ZWOA 4ARUA 5JECA 2IH2A 3PQ7A 4KO1S 1QHNA 4DF3A 3A2NA 4RANA 3FAKA 3ZUPA 2ZLBA 3IDQA 1RM3A 2VYVA 3M9XA 4M99A 5JAHA 3IDOA 4X66B 1D6NA 5CX1B 2QTZA 4GPEA 3W5UA 3CU5A 1P19A 3RYIA 3U56A 1J39A 2HFJA 4YT4A 5F3DA 1XTQA 1MEOA 5F2KA 5CA1B 1EP3B 1PWXA 2ZIFA 3A05A 5F2EA 4QXRA 5I5GA 3UANA 5J43A 4E1VA 1ESEA 2I2BA 3LHSA 2OY0A 4JROA 1YFZA 2R79A 4OLAA 4AKIA 2O20A 1RHKA 2XHEA 1WY5A 2EDAA 1K86A 2W6MA 1IDOA 2RE8A 3FVRA