9LDTA

Design and synthesis of new enzymes based on the lactate dehydrogenase framework
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIHNLLKEEHVPHNKITVVGVGAVGMACAISILMKELADEIALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSRLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPNCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWILGEHGDSSVPVWSGVNVAGVSLKNLHPELGTDADKEHWKAVHKEVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKENVFLSVPCILGQNGISDVVKVTLTPEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LACTATE DEHYDROGENASE
publication title Design and synthesis of new enzymes based on the lactate dehydrogenase framework.
pubmed rcsb
source organism Sus scrofa
molecule tags Oxidoreductase(choh(d)-nad+(a))
total genus 100
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1991-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 9ldtA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 9ldtA02
1I24A 2D1YA 2YJZA 1IYZA 1M67A 1T2FA 2W2KB 3GC6A 4Z9XA 2A92A 3ZCXA 1SEPA 4BV8A 3D3WB 3RBZA 4NFYA 3KM0A 3ONDA 4PLWA 4EJ6A 4MP8A 1U9JA 5KJFA 5I7VA 3PYLA 1LC0A 2LDBA 3ZWVA 2QZZA 2FRDA 3U9LA 1WLYA 1A9ZA 4E6PA 2AEJA 3ONFA 4ALLA 3WSWA 4OXNA 1C3VA 1GQ2A 3GA0A 4BNMA 3KRTA 4KOAA 2ZJ1A 2YYYA 5JAQA 3WWZA 4E0BA 4P4LA 3EAGA 2VYNA 4E33A 5EPOA 5JLAA 1UDBA 5L45A 4F45A 1ISIA 1LDGA 3L6DA 3WBFA 4L8VA 2VHXA 3DAPA 3D64A 3AJRA 1SPXA 2C0CA 3ZV3A 4E13A 3S8MA 3H5RA 2PFGA 5K0ZA 2CDAA 3CKYA 4Q3DA 5ITWA 5IZCA 1YO6A 1YXMA 4FJ2A 4MKRA 3LK7A 2O3JA 2PY6A 1P1FA 4EUHA 3O38A 2RIRA 2VHYA 3QWFA 4WLFA 3KOUA 4J2HA 2CMDA 1LLQA 4OGWA 1GUZA 3ANMA 3MEQA 1VJTA 3B70A 5ILOA 4JJGA 1Y81A 3RFVA 2BFAA 5CAEA 5JBIA 4NG5A 3PRJA 3LT2A 5ITVA 3X2EA 1WP4A 2C07A 3FD8A 1LDBA 3E9NA 4RDIA 4RPGA 1NYTA 4XDYA 5JE8A 4LSWA 1HSZA 4W7HA 4AJKA 4C7JA 3L0DA 1P9LA 4M1QA 2FPIA 5DOZA 2HO5A 2OMEA 2WE7A 3HSKA 3GK3A 1Q2XA 5L95A 3K30A 5BNTA 4YJHA 1LTHR 3AOEA 5TJHA 3CMCO 3C1TA 4YAGA 3DDNA 2I3AA 3RC9A 2EP7A 2BGKA 5AQ1A 2NNLD 1UAGA 3ROKA 3JQAA 4FPXA 4M8SA 3BTSA 1GU7A 3R6DA 4IMRA 3RC2A 3K96A 1BGVA 3ADOA 1EQ2A 2EW8A 1RM3A 1JA9A 2CDBA 3MWEB 3HDYA 1BXGB 2FOIA 5I9LA 2EIHA 4HNGA 1E1KA 3OEYA 1HE2A 2IE0A 4GKVA 4EUEA 1QR6A 3L4SO 4U8GA 3OIFA 4BVAA 4IS3A 1HKUA 5IN5A 4WCDA 1ZSNA 4JQCA 2FSVA 1B2LA 2EV9A 2WD7B 3RC7A 1IUKA 3WGHA 4DC0A 3RUFA 1N1EA 4ROSA 1ADCA 3QV1A 4UVHA 3PP8A 3EYWA 1BWSA 1GQYA 1QSGA 3MOGA 1Q7CA 2IEBA 3IS3A 3SC4A 3IQDB 3TDKA 2ZYDA 4TVBA 3FR7A 4O63O 4IDFA 4O0LA 1E3SA 1PS9A 1Q7GA 3H9UA 2EWMA 4YXFA 3WYBA 1WPQA 3BMNB 4MINA 1EFKA 1O95A 2GUGA 4L4SA 1V35A 1CJCA 2G76A 1ZEJA 5H82A 5BR7A 3PIDA 4K28A 3WGIA 2RHRA 2PR2A 2YW9A 3INRA 3AW9A 4FFNA 3RUIA 3WBBA 4TZTA 2VT2A 2QG4A 3RD5A 3NJ4A 4JX8A 1T2DA 3WXBA 3V8BA 5A3VA 1KEPA 4IXWA 3K2EA 3UVEA 1O89A 1KC1A 4OXYA 2X0NA 4E32A 5J23A 2DU8A 1PQPA 1KEUA 2PKRA 3K6JA 5F5LA 2P5UA 3BYZA 1GV1A 2WYWA 3PXXA 1ZK3A 5EQFA 4GI2A 3H9QA 3D7LA 2P9GA 3QVTA 5A4DA 2RHCA 3IP3A 4XQGA 5C3MA 1VL0A 1I2ZA 2VZ9A 4QT0A 3EZLA 4XQCA 2O7QA 1T25A 5THKA 3JQGA 2NU8A 1MA0A 4IINA 4RGBA 1TXGA 2HUNA 1AHHA 4OSPA 2PD4A 1QYXA 2CFCA 3K92A 4LW8A 3PGXA 4I08A 4IDBA 5COQA 3TZKA 4TSKA 3C7CB 1DSSG 1N92A 4ND5A 4QO8A 5JAIA 3WGYA 3FNHA 5EERA 3O26A 4O1MA 3ZWOA 4GGPA 1D7OA 2AE1A 4D3FA 5TJ9A 1QKIA 5IDXA 4LCEA 3VC7A 2ZB7A 1XG5A 3FR8A 1M66A 1Y5RA 1HDCA 3RBXA 3BHJA 3FNFA 2C29D 2RBEA 2CVQA 4UVIA 3JD3A 5ER6A 3OMLA 3LT4A 4UEOA 5DZSA 1EK5A 2O3QA 4IJVA 3A1NA 4PLHA 3D4PA 2EW2A 4LK3A 4XA8A 4CM9D 3JQ7A 5A02A 1PEDA 3IJPA 2YQ5A 2VRCD 1B8PA 3BA1A 3PFWO 4I9NA 2VNAA 3G1TA 2O50A 4JCOA 3BTVA 4RCVA 4XZ3A 1GCUA 2I5PO 3I23A 6ADHA 3TFOA 4I5DA 1F8FA 4W9NA 4YAIA 1M75A 2WMDA 4M54A 2O3SA 1E3EA 1D1TA 1UZLA 2F1KA 3ZWPA 3PYMA 4YAEA 4BNYA 3WTBA 1B14A 1AXEA 4Y6SA 1EUDA 2YQ4A 1YBMA 1K6XA 1PZHA 3GZNA 2V6FA 1J49A 1ONPA 4E4YA 4BUCA 1AN9A 5KVQA 5K6AA 1IE3A 3JQEA 1S6YA 1SBYA 1FDWA 3E9MA 5THQA 4OXKA 1NVTA 4B8WA 3MTGA 2RH4A 5JY6A 2NUAA 2GDZA 4XGKA 5G0UA 4AJ4A 1X0XA 2Q1SA 3IDSA 1EUZA 3VPFA 4YWJA 3EUWA 3I9MA 3ZHYA 4DIOA 5C5IA 2PH3A 3AUTA 3NTRA 4FCCA 5H83A 4I5GA 1DFGA 4C7KA 5A9SA 2IZZA 4GKBA 1V3VA 4I5EA 4PLGA 1MC4A 3PQEA 2FHSA 4CLRA 4OSOA 4YAJA 1ZEMA 1Q1NA 1WZEA 4KDEA 3WMXA 5K9ZA 3O8QA 3SXPA 3S1LA 1NAIA 1E1MA 1R0LA 1LSSA 3Q3CA 4CM8A 3AY3A 3RUHA 1CIVA 3PEFA 3GPDG 4II2A 3ASUA 3DFZA 1XEAA 1NHWA 4YJHB 1R66A 3KSUA 1DRVA 3E48A 1IZ0A 2HMUA 1GZ6A 4IMPA 1NTOA 3AM5A 4Z0TA 3DAGA 3WQRA 4CQMD 4JP2A 3C7DB 1PJBA 4NFSA 3D5QA 4ALNA 1O5IA 4M87A 2DC1A 3JQAB 4R1TA 2Q2WA 4BV9A 2FR1A 5G4LA 1EUCA 3GT0A 3ZNQA 2GZ3A 2VRBA 4J49A 4Z3KA 4ND4A 4R5HA 1T26A 4J0FA 5BNFA 1IOLA 2HKIA 5T64A 1Z7EA 2Q2QA 4BGVA 4FOSA 4EGFA 4IJKA 2J8ZA 4RPHA 1EFLA 4E5MA 4JROA 3LT0A 1JTVA 2DBQA 1TA4A 4MVJI 3VH3A 5KIAA 2GNAA 4PLFA 3L6OO 2Q4BA 4CL3A 3FBTA 2WJPA 3G0OA 4UUOA 2QIOA 1V9LA 3OFSA 3HB5X 5JDIA 3OP4A 4GX2A 1U3TA 4U0KA 4FFOA 1O9BA 5A06A 4HADA 3RFTA 1BXZA 1KEWA 4KUHA 2VRCA 4NR0A 1T4DA 4BNUA 4Q3CA 3DHNA 2GYYA 2Y1FA 1PJ4A 4WCFA 5L9AA 4CLHA 5JPIA 2G1UA 5DCWA 3CSDA 4MJLA 4XGNA 4BNWA 1IZ9A 3GMSA 3MTJA 3GUYA 2SCUA 1U8XX 2CZCA 3BTOA 3DHEA 3HDQA 1MXHA 3DZIA 3KLPX 3VDRA 4RDHA 1XSEA 1Z74A 5L7WA 4P22A 1MFPA 1Z82A 2X5JO 4DMLA 1DAOA 3KTDA 1OC2A 3PDJA 4L4RA 4B3IA 1DRWA 1YL7A 3FSRA 3TQHA 4YT8A 4BNTA 1J4AA 4E5YA 1PJCA 4PZEA 3HB4X 2JJYA 2Y0EA 3STHA 4CMBA 3WYEA 1C14A 2JFFA 3DMTA 1DIRA 3PWSA 3A4VA 1I3KA 5DBFA 3JV7A 5FFFA 5LC1A 3OQBA 5JFOA 3W8FA 4KTVE 4M49A 4FB5A 1QRRA 4D79A 4D3SA 2AG8A 1KEVA 3ANLA 4UUMA 4CMCA 4MP6A 4OQYA 4OYRA 4Y6RA 4GVXA 2DM6A 5A05A 1RPNA 2Y67A 3GVCA 2W8ZA 4QSMA 2IZ0A 3JQGB 3QY9A 1MUUA 4M55A 4BMVA 2IEDA 1I0ZA 2Y1OA 3MWDB 4KWHA 4N5MA 4AG3A 3KSDO 3H9EO 7MDHA 1GY8A 1IHYA 4BKOA 1DIBA 4OOEA 2XPCA 4N5NA 3NX4A 4NJOA 4FFPA 3TWOA 2VTEA 1NPYA 3FI9A 4RPLA 5KOIA 2WYUA 3DOCA 3C1AA 3E8XA 3N7UA 4YJDA 4HY3A 1NX6A 1P3DA 1VLLA 4OOFA 5CDUA 3ETDA 3UXYA 4FOOA 1JU9A 4URFA 3E5MA 3ZV6A 4OL9A 4AJHA 1I3LA 1GTMA 3WFIA 1E92A 1GFSA 1SO8A 3DMYA 3GRPA 1OAAA 2O4UX 3VOSA 3DQPA 5TQVA 4BNJA 1E3IA 4BGUA 4FGWA 4PLTA 4OJNA 2UVDA 2YDYA 3DXFA 3F3SA 4HNHA 3ZU5A 2NTVA 4D46A 4OO3A 2PKQO 4YT2A 3UAGA 2NSDA 3ASVA 3JQ7B 3WWYA 1LQTA 4YRAA 2C7GA 2F00A 1B3BA 4H15A 3PJGA 2V6GA 2B4RO 3RASA 2C5EA 3FTPA 5GY7A 5FEUA 4R1UA 4WEQA 3GGGA 3OQ1A 4DLLA 4OH1A 2CNBA 4YBZA 3TSCA 4FBGA 4NK5A 1SB9A 5B4VA 3DL2A 2AQHA 3BXXA 3W1VA 4WOKA 4O6VA 3AU9A 2YUTA 1V6AA 1HLPA 5DULA 1YB1A 3GVHA 1ZJYA 4D0SA 3CXRA 3OH8A 4EUFA 3ADPA 1JVSA 1JN0A 3RBVA 2FPPA 4TVOA 3R3SA 1NPTO 2IYPA 3SLGA 5DN9A 4CUKA 4MKXA 4LMPA 4K6FA 3VPGA 1OFGA 2O3TA 1YH3A 3ZHZA 1ZH8A 1P0FA 4IQ8A 1QLHA 1Z75A 1ID1A 1Y9EA 1GR0A 4QXMA 2D0IA 1JAXA 2BD0A 4D43A 1A7AA 5A9SB 2IXAA 1XLTA 4R9SA 2YDXA 3KZVA 3HQ4O 2GN4A 1UJMA 1HDOA 1HE5A 4EITA 1C0IA 1X15A 3QW2A 4YTEA 4DA9A 2GZ2A 4Q9NA 4ZQBA 4UUNA 4DIBA 4BKUA 1R0SA 4J9UE 3EW7A 3ZWCA 4IXTA 4BOYA 2Y68A 1C1DB 4CM8B 2Y1DA 3OICA 4H16A 4CM1A 1HEUA 4DLBA 1BXGA 1QORA 1DFHA 1ADBA 1U3UA 1CETA 3ZNNA 1RM0A 2JFGA 2EP5A 3A28A 4HXYA 4IZIA 1H6DA 4RPJA 4FJ0A 5IDYA 1NR1A 5G0SA 4PFJA 3DEYX 3LYLA 3PQFA 4R69A 2QRKA 4BNFA 3DBHA 2P68A 2C7VA 2W2LA 3TZ6A 3WGTA 4UVDA 1YE3A 4W7IA 1H2BA 3GEDA 2I6TA 4L9RA 5DT9A 3W4IA 3WX0A 3IUSA 3E1KA 2BMAA 2ET6A 1PWXA 3QWAA 1JW9B 3BIOA 4FN4A 4N54A 4BO0A 3NT2A 2DVMA 4RVGA 2VYVA 4PLYA 3TL2A 2GPTA 4B4OA 2PTGA 3ZNOA 3IKVA 4CQLA 3RKRA 1K6JA 1B8VA 5B4TA 4YQZA 4E30A 4WLUA 5BSEA 3JQ6A 3TOXA 5EIOA 3TPCA 1HYEA 4RVFA 4CM3A 1NQAO 3HN2A 2RH8A 3I6QA 2RCYA 4RVHA 4LN1A 1DRUA 1E1NA 3ICPA 4YJFB 1LRJA 2FMUA 3T7CA 3ZZNA 1YONA 2OZPA 3UH1A 4UULA 4WCFB 5I8ZA 3DOJA 1TB4A 1IB6A 2X5KO 1UR5A 2HMTA 2EJWA 2PK3A 1QYCA 3HDJA 3M6IA 2OUIA 1E6EA 2JD0A 1GYPA 1SEVA 3VZRA 3OA2A 5C7LO 3RUEA 3F1LA 1E77A 3DAFA 1Q0QA 4LVCA 1Q7BA 5TGDA 1P45A 4DMMA 2Q1TA 1MB4A 3SEFA 1I30A 4BMSA 4EYEA 3DC2A 1D1SA 2HU2A 1JDJA 4AFNA 1DIGA 2JCVA 4KP7A 3E9QA 1UP6A 2PV7A 4EEXA 2EXXA 4A5OA 1E0DA 1JWBB 2DT5A 2WEKA 2B83A 2XOXA 2AG5A 2WSBA 1G0OA 5EN4A 3ZN2A 3TRIA 2G5CA 4Y67A 5DNAA 1N8KA 1CF2O 3FF4A 3ITDA 5CG2A 3NTQA 1B15A 3LQFA 3JQFC 1ONOA 2PH5A 1KS9A 4WLOA 3I6IA 3H65A 3ON5A 4F46A 3ETGA 4CLDA 2HK8A 2X22A 4BNIA 4QECA 5T5QA 3ORFA 2VWGA 4NK4A 5G0VA 3JQBA 1SNYA 1A5ZA 2FP4A 4CMEA 1IHXA 2LDXA 2ZB8A 3RVDA 5L4LA 3UCEA 1DXYA 1GZ4A 1RKXA 2OBYA 4ALIA 2IZ1A 3UCFA 4U7WA 2Y0CA 2A35A 3VVBA 1YRLA 5F3RA 3L07A 2VZ8A 2YY7A 1F0YA 1H9AA 4EJ0A 5KKCA 3IL2A 1N2SA 3F47A 5CDYA 3QIVA 4R3WA 4J9VA 5CEFA 1U2GA 4CQMB 4MIOA 4RLHA 3H3JA 3JCZA 3ICCA 1NFQA 3WOHA 1GD1O 3FWNA 1GCOA 4NBVA 4BO9A 1B26A 1GPJA 5TT0A 5B4UA 4J7UA 1NASA 1LEHA 4ZQGA 4ZRMA 4U6SA 4RORA 3ZHBA 2PWZA 4TRMA 4CV2A 4K6CA 5JYDA 4BB6A 2C2YA 3DBRB 3QJ5A 4AJLA 2X7HA 1RWBA 1OI7A 3K31A 2QX7A 2WWRA 2YHIA 3HJAA 1BMDA 5BT9A 1FF9A 2AQKA 5HRUA 1QG6A 4FFMA 4LVUA 5IXYA 4F6LA 2AHRA 1T4BA 4R68A 4DQVA 4A03A 3FBGA 1XWFA 2D5CA 2VOJA 1YL6A 4W6ZA 1TT7A 3W8DA 1XCBA 4O59O 4Q3AA 4DLAA 4IDDA 1GYQA 3KYCA 4DPLA 1ZNQO 1U4SA 3OJ0A 3ENKA 1RYDA 4JJFA 3B1FA 5LDGA 1RYEA 1C0KA 2OBNA 1DC5A 1ZK4A 1NP3A 4Y8VA 1KBZA 3AUSA 4CV0A 3JYNA 3PIIA 4CM4A 4ZJUA 2A4KA 2AXQA 4J90A 3BTUA 2VUSA 2JL1A 3AU8A 2PZKA 3WJ7A 4NBUA 3PQDA 2IRWA 2GN9A 1YBVA 1PQUA 2ZYAA 4R41A 3U09A 2HDHA 1E6UA 2Y66A 2B37A 5ENVA 4MVJP 3CUKA 2ZKLA 3RI3A 1BTOA 4E2ZA 3GPIA 4CODB 2D59A 1UUFA 3WIEA 4KQWA 2D2IA 2C59A 2J3KA 4QO7A 1D8AA 4HWKA 2BFOA 2ZK7A 2E6UX 2XF8A 4WJZA 4XYGA 2JKVA 3PJDA 3H9GA 1DBVO 1V8BA 3HZZA 2DQ4A 2DFVA 2X0IA 3GHHA 2Q3EA 2FSSA 3F6YA 4D0RA 4FC7A 1ONNA 4CR7A 1HYGA 1GL3A 9LDTA 4K26A 4I1IA 3KSZO 1DB3A 4YA6A 2Y99A 1Q0HA 1ZK1A 3NDRA 4IDCA 1H93A 4KZPA 3W8EA 1WWKA 2EGGA 1H9BA 2OOSA 4QQRA 3JYOA 2NLOA 4CLOA 2P9EA 3JD4A 3L4BA 5IAAA 4BNKA 4J4HA 3L77A 3V2GA 3G49A 4P4NA 3DBHB 1KYQA 1KERA 2GRAA 2UV8A 4UVEA 5DDIP 1K0UA 1PU2A 1ULUA 3WG9A 1ISHA 2DLDA 2UUPA 3BMQB 3H7AA 5EESA 4BGIA 4EJMA 3RWBA 3OEWA 1IULA 4P8RA 3GF4A 1HL3A 1P1HA 3C24A 4GMFA 1X7HA 3ULKA 4FR5A 4DVJA 4CQLB 3VZPA 4J43A 4X54A 3ZDFA 4IGFA 5T8KC 3F9IA 3MJ4A 4XRGA 5CDSA 1K3TA 4XB1A 2VZ0A 4CL8A 1C1XA 2X1HA 2OP1A 2ZATA 1VSVA 3PJFA 4XCVA 2FN7A 1ORRA 4NH4A 2DTXA 1T1SA 1NQTA 1UAYA 3WR5A 1HDXA 3CE6A 3UKOA 1ENOA 5JCJD 1ZVMA 4J0EA 4ALJA 3DZBA 3RKUA 4FGSA 4NJMA 3IKTA 2O3RA 1TLTA 4Q3BA 4IUYA 3KVOA 4J3FA 1ZXBA 2Z1NA 3FWZA 4NBWA 3GNSA 3Q1LA 2WM3A 1P31A 4HP8A 1YGYA 3GRKA 2DUUA 1I5RA 3W4JA 4QFDA 4OHUA 4WPGA 4DUPA 3U4IA 3TZHA 5TIIA 3IJRA 1R4NA 2QRLA 4MDHA 2C2XA 3L9WA 3H2SA 1N1GA 3RROA 2OGUA 4R4JA 4DIFA 2R00C 4N7RA 1P44A 5DCUA 4YB8A 4GX1A 5JAZA 1SCUA 1U4OA 1P1RA 2BHLA 2B36A 1LDNA 4RVUA 3PTZA 4HFMA 2BFPA 4KUGA 2EHDA 5JO9A 3G3EA 4YT5A 1LLDA 2WTBA 5JW6A 2VHZA 2X0RA 4GPD1 3NYWA 4E21A 1PL7A 4I8XA 1M6HA 2Q1UA 4U6QA 3QVXA 3ANNA 1QV6A 2P9CA 2BH9A 3ZHXA 1IL0A 3AY7A 3EVNA 1NBOA 1P77A 4EEZA 3QE3A 3FNGA 4K1LA 4GBJA 3VAZA 5BQFA 1LQUA 4R9RA 3E5RA 5GMOA 3VKVA 2BI7A 3F1KA 3ETEA 1QYVA 3PGJA 1H6AA 1F14A 1WMBA 3OM9A 2JFHA 4CUZA 1EZ4A 4L0QA 3L9XA 4XR9A 2CVOA 4YCAA 3HG7A 1NWCA 2DBRA 2EG9A 1XQ1A 1R0KA 2X8LA 5JDCA 2H6EA 3KYBA 1NNUA 5KNLA 4W82A 2HJSA 3OECA 1OOEA 2W90A 5LCXA 2FZWA 1KY4A 1E7QA 1WNTA 3E03A 1GQQA 5EMHA 4I9HA 1XDWA 2WE8A 1OBFO 5EINA 3NT4A 3W6UA 3WTCA 3ZWAA 3CIFA 1LSJA 4AJ1A 4L76A 4BO8A 1K2WA 1XKQA 4GQAA 4PLPA 4UUPA 4HBGA 2VNSA 4DRYA 2QRJA 1T1RA 1A7KA 3K9QO 2PGDA 2YHIB 5T67A 1U3WA 3IIEA 4B7UA 2H5LA 3GDGA 3ZWWA 1UZMA 1KETA 5F1OA 2I66A 2TMGA 3HFGA 3EZYA 1LX6A 3AI2A 3GR6A 3QHAA 4HFRA 4WASA 3AM4A 2EKPA 1LDMA 5JSFA 2DPGA 4XEHA 1HZJA 4IIUA 4ZN6A 4CMKA 1A4UA 3KYCB 4L4XA 1W4ZA 1ZJZA 2VT3A 3RU9A 3HNPA 1GUFA 2HQ1A 4R5MA 4PG7A 5G2OA 1DHRA 1C1DA 3KYDA 5C7OO 1HDRA 4KDFA 4CM4B 3PHIA 4XYMA 1PIWA 1LI4A 1LJ8A 4BS9A 4RPKA 2CF6A 1AGNA 4J4BA 4IDEA 1EQUA 1JVBA 4A27A 3EC7A 1K5HA 3DFUA 3VPSA 1U7TA 4IGEA 4PVDA 2PGJA 2HCTA 3PI7A 1KOLA 1YVEI 4N18A 3VPXA 3JYPA 4BNZA 2C82A 2GLXA 3HE3A 5KWEA 3DOOA 1AXGA 3GY0A 4OKNA 4GVLA 2X9NA 4A10A 2BKAA 2H9IA 3KB6A 1EMDA 3OJFA 4JJIA 3EY4A 1LRLA 1DC4A 3W4KA 5KJCA 2YV2A 1T2CA 5BNIA 2X0JA 3I9LA 2D3TA 3LZ6A 4GWGA 5EQDA 4EBFA 5DBIA 4D41A 4GLOA 4S1VA 4CLOB 3DZJA 4ZU3A 4FIZA 3OSUA 4CM9A 4NI5A 5CP8A 4TQGA 4JIGA 3O03A 5TNXA 1XYGA 1HF3A 5TS3A 4YJFA 3GDFA 2BGMA 1SC6A 1YB5A 1Y8QB 3C8MA 4XRRA 1YDWA 4J1SA 1XU7A 1K89A 2DFDA 5G4KA 1ZBQA 4FC6A 4AJNA 1LRKA 5B1YA 5I9MA 5I7EA 2YFQA 4TWRA 5JMWA 2NWQA 3LC1O 3K2BA 2O23A 4J2OA 1C1XB 4RQUA 1PQWA 2HMVA 2X86A 3CZRA 2O3UA 3MCVA 1E7SA 1PS8A 3HADA 3KBOA 2AMFA 3WSVA 4GAEA 2AQIA 3NGXA 5KCZA 5C7IO 4WEOA 3OF2A 1TEHA 2BRUA 3AK4A 3DZGA 4NJMB 2EF1A 3V2UA 4JGBA 5BSGA 4WLVA 2GD1O 2Y0DA 4GSKA 5B12A 5CEEA 3B1JA 1YL5A 4EI2A 1SMKA 1P0CA 1NAHA 1QYDA 1OC4A 1B7GO 4JP3A 4MVJM 3H5NA 5DP1A 3DWFA 1XU9A 3SC6A 5CDGA 4NBTA 3R3JA 5F1PA 2YV1A 1KVQA 5FI3A 1DLIA 3I9KA 3JYQA 3UFXA 1R4NB 4RV9A 3WJAA 4BO1A 4CM5A 2O48X 3TZCA 1PX0A 2E4AA 5JNLA 5AXCA 2FWMX 1YBAA 2PA3A 4RVDA 3RAJA 4OAQA 4BO6A 1DEHA 3LC2O 4CLXA 4XYLA 1UDCA 3DHYA 3VDQA 3PYXA 3H3FA 3K73O 3VTZA 4ONEA 2ILTA 2EJVA 1FDVA 2XAAA 4MIYA 1I3MA 4YRBA 3DZKA 2I65A 1NFRA 1ARZA 2JHFA 1HZZA 3AFMA 4CQMA 1WDKA 4R3NA 4NQZA 5I9NA 1H2HA 3GAZA 4ILKA 3RQSA 2G82A 1XQ6A 1YQXA 1Z73A 3ZWYA 4E2YA 2NVUA 1LC3A 3OJEA 5A9RA 4O5OA 2W98A 4KWIA 4PRLA 4D42A 5HM8A 1Z6ZA 3VH2A 4CMHA 1X0VA 4LCJA 4EW6A 3HUDA 3JYLA 1PZEA 4BNLA 3DBRA 1BXKA 5FYDA 5A3JA 3ROMA 2X23A 3W6ZA 3LSYA 1M6WA 3GN2A 3HFSA 5ER9A 4MP3A 3UW3A 1ZMTA 1JLLA 1V3TA 4PGFA 2ZYGA 3UGKA 3ZW9A 1KIFA 1HWYA 2Q46A 3PHGA 1AHIA 1BHSA 2P2SA 2GR9A 4DYVA 5TLSA 2B69A 4B3HA 1PJSA 1LLUA 1KVRA 5CG1A 3D4NA 1GADO 3QWIA 1HT0A 2VUUA 2Q50A 5IDQA 4S3MA 3B20A 1DJNA 3QQPA 4MVJH 1BDMA 4JBHA 1VL6A 4MO2A 3KEQA 4GSLA 3ROPA 4A0SA 3QSGA 2GSDA 3WFJA 3LDHA 5A04A 3D5TA 3H8VA 1VKOA 2Z1MA 1ISMA 5EL0A 3M1LA 4AJJA 2FR8A 3AOGA 4XD2A 4YJGA 5HBRA 4RF5A 4W4TA 4QTZA 1O0SA 5KTKA 2P4HX 3GFBA 4B4WA 4QUKA 1I3NA 3KHUA 1U3VA 1DO8A 3ZU2A 1YB4A 1E1LA 1LDYA 1UXGA 4QFCA 5B37A 1BW9A 3IMFA 4E12A 2VHWA 1ZSVA 3PK0A 2V6MA 3KYDB 4TRRA 2J5QA 4ND3A 2CD9A 1L7EA 3NRCA 4MVJG 5L53A 3MZ0A 3PHJA 4UAGA 2VHVA 2PKQP 4II3A 7ADHA 3RU7A 3P7MA 3DB2A 2E49A 3WQSB 1E5QA 4CLEA 1X13A 4KMSA 4LISA 4BL5A 3BHMA 3MOIA 4AJOA 4J1QA 4YT4A 2NU9A 2CY0A 2OFPA 4BNNA 2HMSA 2Q2VA 3A06A 1PGNA 2R6JA 5A9TA 2QYTA 3IUPA 2NQTA 4PRKA 5DF1A 1O8CA 4MPDA 2GGSA 3PZRA 2J3IA 4TKLA 4YACA 4FFRA 3BMQA 4YDRA 4MVJD 1B16A 1JQBA 5BSFA 2AE2A 5JC1A 3H6KA 3TF5A 2PD6A 2VYND 2A9FA 3LF2A 4NU5A 1R15A 2IXBA 4PLCA 1HYHA 1PJQA 3Q0EA 2H63A 3JQ9C 4GL4A 3DZHA 2CDCA 3SBOA 2FY8A 1JKFA 3B1KA 2HK7A 5ES3A 1WXDA 4A2CA 4AJPA 2J5RA 3F5QA 1G0NA 3PLNA 3GNQA 3Q6IA 1LSOA 1G1AA 2DKNA 4WK6A 3BMOA 3MJTA 1EVIA 3HHPA 1ZW1A 4LMRA 4Q3NA 2I3GA 3NEPX 3ROQA 3WLEA 4R54A 3GLQA 1MXFA 3ZU3A 2UAGA 1UP7A 3WGQA 2W4QA 2DPHA 3GGPA 5G4KB 3ZWBA 4BO3A 4FQ8A 1P1JA 2X5OA 3FNEA 2UYYA 4A73A 5FF9A 3Q9NA 1R4MA 3GG9A 3QVOA 2OHXA 4E5NA 4YQYA 1G6KA 1Y6JA 4DC1A 4TMFA 4IM7A 4CV3A 4RO0A 5A1TA 3VZSA 1LU9A 4J16A 5AXDA 4Z9FA 3WDSA 3KXDA 4D7AA 4IDGA 1L7DA 1P33A 4WOJA 1TVEA 4HKTA 4L73A 5CHEA 3RUCA 3NDIA 1DOHA 3EVTA 1W8DA 3NKLA 4RQTA 3F5SA 1XHLA 1X1EA 1R6DA 2YZ7A 3O4RA 5F1KA 1NVMB 4INAA 4A26A 2AA3A 4KTTE 2TMDA 3L6EA 5CDTA 3JQAD 2NTNA 5U1PA 4F3YA 2OORA 3GNTA 3T4XA 4NU6A 3WLFA 4G2NA 4IJUA 4R51A 2C5AA 1PL8A 5IZCC 2VWQA 5G0TA 3C85A 5CEJA 4JBIA 3RIHA 4PG8A 1NPDA 4K9DA 3P19A 2PGLA 1HE3A 3U62A 3ZV4A 1PTJA 2I99A 2O2YA 4PG4A 4B8ZA 3LT1A 4GMGA 1J6UA 4D45A 1AE1A 4BIIA 1KVTA 2VQ3A 4DBVO 1SOVA 5L51A 2HSDA 3EMKA 3JSAA 2V65A 5IN4A 1DC3A 3UF0A 1WAMA 1XA0A 3JTMA 1KVSA 2JCXA 5ILGA 4TRJA 1NQ5A 1GUYA 4LGVA 4IBOA 2NVUB 5L40A 1NM5A 5JS6A 4PN3A 4LRSB 1NHGA 5HTOA 1ZZEA 3I1JA 1PJTA 5HS4A 5AYVA 4BB5A 1QP8A 4MVJA 4BGEA 4XIYA 1C0PA 1F12A 4NDNE 4BQPA 2PZLA 3E82A 1PJLA 3JQFA 4DGSA 1U7HA 1X7GA 3U0BA 5CPBA 4DPKA 1KC3A 3PJEA 1ADFA 3IAHA 3BMCA 1I10A 3AOEC 3WQQA 4FS3A 4OKIA 3CTMA 1UXJA 2VUTA 5IFLA 4ID9A 5KJEA 3GOHA 3G79A 4BNXA 4GX5A 2HLPA 3TFQA 3NAQA 2HMWA 2GZ1A 4HFNA 2BF7A 1S7CA 3GEGA 2NU7A 5G0WA 4CR8A 3LF1A 4YPOA 3PVZA 4N5LA 2GCGA 4CPDA 1WDLA 2JD1A 3ONEA 3WYCA 4YEDA 1CEQA 2VCYA 4FSHA 4OM8A 3WNQA 4I5FA 4OMUA 5U4QA 1ML3A 3JQ8A 1ISFA 2V7PA 1N9GA 5DOVA 4ZGWA 1BRMA 4YJGB 3GGOA 5A5FA 1OZAA 2GN6A 3OIGA 4IQGA 3EDMA 1DJQA 3S2EA 4ZICA 3LVFO 3PHLA 3SX2A 4P4GA 3PPIA 1SZJG 3D0OA 4FDAA 5KJ1A 4BMNA 3L4BC 1W6UA 3M1AA 1VRWA 3Q9UA 3AUAA 4WLEA 2BI8A 1BW9B 3SJ7A 1H6BA 5TT1A 2CSUA 1J0XO 5KVSA 4AJ2A 1A4IA 3U5TA 1X1TA 2O4CA 3OA0A 2NU6A 2AW5A 2IDZA 3OIDA 4IY1A 1N7GA 2JHGA 1B0AA 4WUVA 1CQJA 4BKQA 1A27A 2O7SA 4YYZA 4BNGA 5IF3A 4NFHA 4NHEA 4PZDA 1QXSA 1MGOA 2B5VA 4XX0A 1Y7TA 5L3ZA 2J6IA 2X4GA 2Q1WA 5MDHA 2HRBA 1ADGA 1PSDA 1ISGA 1ZKMA 2NV6A 3O9ZA 2Q99A 4WKGA 1MX3A 1PGQA 1U8FO 1Y5MA 1LDEA 3PZBA 3BZUA 2JCYA 1PR3A 4CR6A 2WDZA 3GAFA 1DAPA 1LUAA 3E18A 1ENPA 3RCBA 1Y8QA 4BO2A 3KEOA 3NT5A 4UVGA 4ALMA 3Q2KA 1A71A 3ENNA 4IQ0A 4BKPA 5H81A 1CRWG 1EDZA 1BDBA 1T2EA 2AQ8A 2ZTMA 4JBGA 1PJ3A 3OJLA 1NWHA 5JMPA 2E37A 3IC5A 2FZEA 2I67A 3PFFA 4G65A 5JC8A 1F17A 2G17A 2NTJA 4WNIA 3BMOB 3DBVO 4BNVA 2DUWA 4J7XA 1FDSA 3UCXA 3MJCA 1PGPA 4IDAA 4TZKA 4E2XA 1QYWA 1I2CA 1LA2A 3U4DA 4Y9DA 1HXHA 3WB9A 2ZQYA 2P91A 2OO5A 3FPLA 4JLWA 3OHSX 2Y1CA 1ZCJA 1EVYA 1WW8A 1NVGA 2Y1EA 5IDWA 1MLDA 1R4MB 4PG6A 4DPMA 8ADHA 1JKJA 1GZ3A 3NDJA 4ESOA 3U4HA 4ALKA 4PLVA 1PL6A 1VM6A 1IPFA 4Z3DA 3ZH2A 1XGKA 4MIEA 3B6ZA 4E3ZA 3H2ZA 3FHLA 5I7FA 1P74A 2GERA 4WLNA 1LBEA 4D44A 1AUPA 1RM5A 4Z0PA 4MVJE 1V0JA 1OMOA 2NACA 1X14A 4XWYA 4RF4A 5ICSA 2JD2A 5JDCC 1Q0LA 5L7TA 1O94A 1UDAA 3LLVA 5T8KA 1QLJA 4PCVA 2D4AA 3RUDA 4W9NC 1XIVA 5TRTA 5ADHA 3N58A 3VKUA 4R1NA 2POQX 5L7YA 2WYVA 1BVRA 4ZRNA 1PR9A 1E3WA 2ZTVA 3F46A 1DLJA 2XXJA 3C3XA 3CH6A 4BO7A 4CMIB 1LXCA 1ENZA 1A72A 3KO8A 2PZJA 3AFNA 1VKNA 1EEHA 1PJ2A 5K6AC 3LLSA 3GN1A 3QWBA 1ZIDA 4LRTB 1D4FA 1E5LA 1VSUA 3CINA 1UXIA 1PS0A 3PHHA 4YRDA 5JO0A 3QRWA 4UEKA 3I4FA 4DXHA 1I32A 4BKRA 3RFXA 1TT5A 3ABIA 4HFJA 1NQOA 3A14A 3R1IA 3E6AA 4C4OA 3GG2A 1WVGA 4GLLA 1GYRA 1QMGA 3EGOA 3ZV5A 5L4SA 4EZBA 5LDHA 3WS7A 1U5CA 1Y9AA 1ENYA 3A9WA 1K6IA 2R00A 2XXBA 4H7PA 5T6BA 5GZ3A 4XJTA 4E31A 5JCXA 4BO4A 2O2SA 1U5AA 4XQEA 4F6CA 3QLJA 5MGBA 5HS6A 3H4VA 1YWGO 3GH3A 3VH1A 2DBVO 3CMMA 5DBGA 5COAA 2I9PA 3CPSA 3GHYA 1Y8RA 2NADA 3I9JA 4BO5A 1FDUA 2EEZA 4RF3A 5IG2A 4B4UA 1EVJA 1HDGO 3UN1A 3AM3A 1RJWA 3BMCB 5ICMA 4U5QA 4CJXA 4MVJF 2X9VA 4DL9A 1HETA 2X58A 4WGGA 3JD2A 3HDHA 4NMHA 4ZQHA 1X7DA 3NTOA 2VTDA 4WE3A 2E82A 3K5PA 2VWHA 3JD1A 3S2IA 1TI7A 1E3JA 3SJUA 3RJ9A 1H6CA 4OIMA 3QP9A 1EVZA 3ITKA 1GV0A 1U28A 1WZIA 1VJ1A 4AJIA 4R16A 5JCJA 1ZXLA 4HV4A 1YOVA 4UEJA 3AWDA 2Q49A 3H9JA 4FJ1A 4MOWA 5CPFA 5TC4A 2P4QA 2PD3A 3ZNPA 4E5KA 1ZUD1 3T7EA 1IPEA 3JQ8B 2BFMA 2P5YA 1N9GB 4GGOA 2CVZA 1LLCA 2Z95A 1MFZA 2BELA 4TKMA 4CV1A 3IP1A 3PWKA 4XQ9A 3DBLA 1PGJA 4IJWA 4R1SA 5DCYA 1BG6A 2QHXA 3WNVA 5JDIC 4ZA2A 1ISJA 1NXQA 4LSMA 3S55A 2EKQA 1UZNA 1CQIA 1M76A 4GWKA 4U0JA 1YQGA 2FR0A 2OP0A 4XYBA 3LU1A 4WCFC 1Y1PA 2B4QA 1PGOA 2DBZA 3GZ4A 4ZQFA 5EJ2A 5COBA 2JAHA 1UXHA 1HSOA 3D3EA 1BSVA 5KJ6A 3ZU4A 3I5MA 2EKLA 3V2HA 2PLAA 2QZ9A 2ZTUA 3ZWNA 3CEAA 1JKIA 1VPDA 3DMTC 3U4CA 1LSUA 1P1KA 5FWNA 2ZB3A 1D3AA 1H0KA 2Z5LA 4M89A 4NBRA 1HLDA 3S2GA 4HX5A 4QEDA 5CFZA 4B3JA 3UOGA 4YVFA 1MG5A 1XELA 4J91A 2IYOA 1GEEA 4ZQEA 4Z6KA 1UH5A 3FRJA 1KY5A 2JAPA 4DYDA 1MC5A 4RVSA 1I01A 1I8TA 3GQVA 1L1FA 3P2YA 3OJOA 3G1UA 3P5SA 1VL8A 4JK3A 3VH4A 4IZHA 4XIJA 1HRDA 1R12A 1YJ8A 3K8ZA 4XYEA 3WGZA 1PZGA 2HAEA 3P2OA 1JAYA 2A94A 1A9YA 2GASA 2OXIA 4AVYA 1C0LA 1N5DA 2VWPA 2Q4EA 6LDHA 4TROA 4NZ9A 2Y93A 4E2WA 1E7RA 3AUUA 3U49A 4GX0A 2FPGA 3I52A 3C1OA 1ZMOA 4XDZA 2GO1A 3COSA 3F4LA 3MJSA 3JQDA 2QQ5A 1FMCA 1CYDA 4Z0HO 5HA5A 3JD0A 3MJVA 4TRNA 1Z45A 3TL3A 1YDEA 3M2TA 3EHEA 3BAZA 1SAYA 4A7PA 4P38A 3TZQA 3UICA 4D3DA 3U3XA 2I76A 4DQUA 4G81A 3KUXA 1DIHA 4JN6B 1VJ0A 4KUEA 3FN4A 5IZ4A 1I2BA 4RF2A 9LDBA 4RL6A 4CMAA 3INGA 4PZCA 3VVCA 1YS4A 4AJEA 5IJZA 2ZTLA 1QV7A 4B7CA 1FXSA 5FI5A 3T4EA 3PDUA 2VN8A 5DP2A 2W2KA 3OQ6A 2X9GA 2EERA 3D3WA 4QX6A 1E3WB 1PWZA 2VOEA 1R16A 1ZFNA 3DO5A 4FFLA 2Q45A 2Y1GA 1T2AA 2W2LD 4AICA 4DTIA 1YQDA 5IXSA 1E7YA 3NUGA 1CERA 5GZ6A 2NVWA 5T57A 5HWSA 3I9NA 2AEMA 3S2FA 4I9UA 5TSDA 1RM4A 4J1NA 3V1TC 1FJHA 3KETA 3FPCA 4M86A 3TJRA 2VYVD 1W0CA 3NJ8A 3C7AA 1SB8A 3RC1A 3F4BA 4J6FA 4L74A 4NPCA 1DDOA 3VTFA 4IS2A 3HWRA 1H94A 3ZW8A 2DTEA 1TT5B 2V6BA 4ND2A 8LDHA 5U9CA 5F5NA 3D4OA 1HTBA 1FDTA 3WMWA 2ZCVA 2UUOA 4Y98A 3WGOA 1ZK2A 4B79A 1B8UA 5AXBA 4BHTA 1DIAA 5JAMA 5A5EA 1ZK0A 3VHRA 1FK8A 3Q2IA 3R0IA 5JYEA 1VC2A 2RAFA 3WGGA 1M2WA 4B7XA 3GMDA 3ZWMA 4WNCA 4PLZA 2ZCUA 3V1UA 5KVCA 1Y8RB 2PZMA 4GH5A 3NGLA 4J1TA 1YKFA 3ST7A 4ZVVA 1BVUA 2ZB4A 4HUJA 4ZD6A 4AL4A 1E6WA 2D8AA 5I8WA 4ITUA 1VI2A 4RZIA 3UUWA 1R37A 2NVBA 2Y05A 1V3UA 4J7CA 4JXKA 3GZNB 1MP0A 4CUJA 2D5AA 3FTNA 4DREA 3UHAA 1I33A 5L4NA 2YHUA 1GAEO 3OETA 4BNHA 5JXWA 1EK6A 4CMGA 3OBBA 5KVVA 2J3HA 4CM6A 4RZHA 4MKZA 1U2DA 1YOVB 1Z7BA 4PIVA 5BSHA 1E3LA 3V1YA 4FD3A 2ZQZA 3BHIA 5AXAA 1UXKA 5AVOA 5AOVA 3GUCA 1F06A 3PWZA 2CF5A 3FCOA 1MV8A 4KQXA 4CM7A 3MJEA 3RUAA 1PZFA 1B3RA 3RJ5A 4CLRB 5TX7A 4FW8A 1SOWA 3DBLB 3RSHA 2G0TA 3H5AA 3KLMX 3O8QB 4DWVA 3I3OA 1J5PA 3M2PA 5C37A 3V5NA 3Q11A 3TN7A 2H1SA 2CUKA 2NM0A 1IY8A 4YR9A 1F8GA 3D1LA 1DPGA 5TF4A 3DZFA 1NR7A 2C20A 5GZ1A 2EGHA 1CWUA 2HK9A 3DTTA 1GDHA 2B5WA 1DFIA 3AY6A 4XKJA 3ZI0A 4Z9YA 4Q39A 2IODA 3IOYA 2DTDA 4H3VA 2X6TA 2WD7A 1CDOA 1LNQA 2HJRA 4PG5A 5A03A 3SVTA 1NFFA 4Y6PA 1HDYA 5F21A 3HN7A 4IPTA 3GFGA 4DBZA 3AI1A 1DHTA 3AI3A 3CZMA 3TNLA 1ULSA 1T24A 2WD8A 5KKAA 3VPHA 1GPDG 4XB2A 1HDZA 3I9OA 4BQRA 2ZJ0A 1VE9A 3BMNA 3GDOA 3LC7O 2C54A 1JWAB 3ZWXA 4NIMA 3DR3A 4R01A 4ND1A 1XR3A 5ENDA 1E7MA 1I36A 1E7WA 2BLLA 3SLKA 4UREA 1W73A 4XGIA 1KVUA 3QVSA 1EBFA 4PVCA 4L75A 2HRZA 4IIVA 3PLRA 1H5QA 4RLSA 3TOZA 3I83A 4W99A 3JQCA 1N7HA 4E5PA 1DC6A 2J3JA 1ZSYA 5JY1A 3JQBC 1U1IA 4WECA 3NV9A 4CMEC 4JNKA 2E48A 4XR4A 1WMAA 3INTA 4G5HA 3X2FA 2PNFA 2B4TO 3WICA 1EBUA 1UP4A 2UDPA 3GVPA 4YAKA 2GN8A 3GVIA 3JQ9A 3VZQA 3DTYA 3N74A 4J4TA 3I4CA 1EDOA 1GEGA 1O6ZA 2B35A 3EK2A 3GEMA 5I7SA 2OL4A 2DAPA 2AEFA 2QYSA 3G17A 2YV3A 1ZO8A 4XJSA 3QVWA 4EDFA 2QW8A 1EE9A 2BGLA 4DQXA 4CMJA 4RJTA 3WIDA 2GF2A 1MG0A 4B4VA 1WDMA 4CMIA 3KV3O 4Q3EA 4ZHSA 1HE4A 3QA9A 1P1IA 2J5KA 2ZIZA 2YFHA 1EE2A 4NNJA 4OQZA 2R2GA 3ZGYA 3GVXA 3QWHA 1YJQA 2B0JA 3DONA 2NQ8A
chains in the Genus database with same CATH superfamily
2H7CA 2QMEA 3HA7A 1IYZA 5KYWA 1P8AA 5FAXA 1UCFA 3GC6A 4CWAA 1JI0A 2A92A 2ECOA 3SBDA 1ESCA 4BV8A 4ABTA 4CTNA 3V48A 3RBZA 1VPVA 3O75A 1Z5VA 3ONDA 4UHBA 1UPCA 4UDXX 5GV7A 1TEVA 3C8DA 2J0EA 3T95A 5KJFA 1UT8A 3QG5A 3A3PA 2WHQA 5I7VA 2QZZA 2FRDA 3KR1A 4U02A 3U3OA 4XAQA 1YFJA 1SU8A 2W8BB 3QZUA 4UNQA 3HGQA 3EZ9A 3ONFA 3T38A 1FY2A 3OHPA 4GMHA 1QGUA 1GQ2A 1F7VA 2NZUG 2YOHA 3KRTA 2ZJ1A 1KI9A 4JVOA 2EDAA 3EAGA 4F6RB 2G09A 2Q62A 5CB4F 1XZGA 2VP0A 4QOSA 3LY5A 2AG0A 3IVXA 2QLMA 1G8GA 1LDGA 3CLTD 1F60A 4JJ8A 1H9CA 3LUKA 3ABOB 4IIYA 1AKNA 2ZPAA 3DAPA 3RVRA 1SPXA 2Q9BA 5KYGA 1F6BA 1Z33A 4WXRA 1XZJA 1RYZA 4S24A 2ZT6A 4X6UA 2PFGA 3RS3A 1XMXA 1C30A 2CDAA 2ZS7A 2QUKA 3WDLA 3CW8X 3D1VA 1W59A 3E81A 3T4PA 3EGDB 1YXMA 3BULA 3LK7A 2O3JA 2PY6A 3R6TA 1H2FA 3C43A 2DFLA 4KQJA 5EE1A 2WHPB 1GG9A 4KRGA 3UMFA 4EUHA 1QRUA 2VHYA 1NNLA 1NOJA 2WT4A 1OHHD 3I2IA 4J2HA 2CMDA 3TQSA 3DNMA 4P1ZA 5ED0A 4F5ZA 1GUZA 1I4LD 3ANMA 2CVPA 1YK0A 1OKKA 2VJDA 1NKSA 3B70A 4DADA 4JJGA 1ZH6A 4XM0A 3U9TA 3OZ7A 2XXAA 1IXRC 2Y1WA 1AMOA 1KRWA 1T6ZA 3PRJA 4LRYA 1CY2A 2VDJA 1T36A 3OOSA 5GADl 1IJBA 2HDWA 3LUDA 1E1QD 2A2ZA 1Y9ZA 1SXPA 2XWQA 5TMBA 1UBSB 2JIZD 4O2BB 2OQIA 3UAYA 5FLEX 4YRKA 2PJUA 1MVOA 3F6BX 4W9RA 1VRVA 1QH1B 3GJ3A 3MTEA 4GBED 1DPFA 1HSZA 3CF0A 5AVKA 4HDQB 1L4YA 3S5JA 4P5PA 2KS6A 3U6KA 2PSSA 2RG7A 4HLUA 2OHIA 3DT9A 2XVYA 3AHGA 1KDYA 1Q50A 2FPIA 5K2OA 2HRQA 4EG3A 4MXDA 2UYOA 2XOKA 4BVFA 4AZ3B 2B8EA 1UEXC 2PHZA 2P1RA 1NBMD 3UUFA 3MM4A 1LTHR 1LNSA 1ZCFA 1BGWA 3CMCO 4PTZA 3TM4A 1IN1A 4J0CA 1Q77A 5ARDA 1E2EA 2ISSD 3DDNA 4YAGA 2FEPA 3AFIA 3THWB 3SG0A 3DE3X 2SKDA 3GJZA 5AQ1A 4I66A 5EFZA 5MFZA 2Z09A 2I2DA 3FDJA 2JLSA 2EL9A 1NURA 1E2PA 4Q02A 3SOPA 3RG8A 1Q0SA 2WTNA 3NEYA 3P20A 5DM4A 1B0UA 3B2NA 3R6DA 2J7PD 4IMRA 1J5EB 4Z4IA 3M6VA 1EQ2A 1OD6A 1EK2A 4N7JA 4ZDJA 1YQEA 1R88A 4C0KA 2QL7A 4BPBA 5H4GA 2WG2A 3SKXA 1VZ3A 2EIHA 4HNGA 3HCFA 2EIXA 3AR9A 1QF6A 1HE2A 3QE4A 4EUEA 2BOVA 3L4SO 4JNCA 4U8GA 2EFDB 3KQYA 3OIFA 4IJQA 3WL7A 4UPEA 2UXBB 4L8LA 4TMWA 2G7ZA 3F8TA 3MTAA 2CLEB 4J0DA 3T7RA 4OV6B 2FSVA 5FNVA 1B2LA 5A4IS 3MINB 2EV9A 5CM9C 3FNQA 3EUFA 5KTTA 1IUKA 1DO2A 1ORTA 3GRAA 5EP3A 4HNUA 4KEAA 3BIWA 3RUFA 2O8EB 1RR6A 3C7KA 4IV8A 4YGXB 1YQWA 3BN3A 4JC5A 5HXAA 5BSKA 2COEA 5I51A 3IELA 4ROSA 2H29A 2XV1A 3PP8A 3HSYA 5T7BA 1KE2A 2YJNA 4WFIA 3MOGA 5H16A 1Q7CA 5DSTA 4D96A 2AL7A 2HJGA 4R1PA 4RJKA 5F1YA 2DKFA 2ZYDA 3TDKA 4YQFA 3FR7A 5JPDA 4O0LA 2VPXA 2H0AA 4F4UA 3KJEA 4KIJA 1K8ZB 4ZIRA 2Q6VA 4YXFA 4UMFA 3IQGX 1ZGZA 2QBYA 1NVVR 3UQYS 3VX3A 4B87A 2GUGA 5HYVA 3C41J 2ERYA 1TCUA 1V35A 4WOBA 1CJCA 4BLTA 2R6HA 5GVRA 3A0RB 3F7MA 4CIXA 4EYKA 2IBSA 1Z6QA 1U2QA 2O52A 3PIDA 2VLIA 4XW2A 1JT9A 1JDBB 1G21E 1GZVA 2OKCA 3CU5A 4K28A 4QRHA 2JI6A 2PR2A 4Q3KA 3AM1A 3IVAA 1J25A 2H1VA 3WBBA 1X92A 4DLRA 1GT6A 2FZ5A 3NBYC 1KKUA 5DYWA 4P31A 4JX8A 3IAS1 3TTYA 4M1MA 4MUXA 4RANA 1TKAA 2DLNA 4KE7A 3ZDCA 5J23A 4Z4QA 1HFJA 1VXRA 1PQPA 3UJ7A 4LFAB 5DHTA 3VSBA 1NF9A 3ISVA 5HTKA 4Q9HA 4DRXA 2P5UA 2JCBA 2EGUA 4LPKA 2XMGA 2ZR8A 3G0CA 2OZLB 2G67A 3WFZA 2XGSA 3D7LA 3LFUA 3FOEC 4P08A 4JSTA 3VR4D 5A4DA 3IP3A 3E05A 5LP1A 2VF5X 1SK8A 1VL0A 3G2IA 2VZ9A 1ULAA 2VA9A 3HYCA 3PG5A 3EZLA 4P5DA 4AXXA 1T25A 3SR3A 4BFSA 2CHQA 4IINA 4WWHA 4NBSA 1J56A 4WZAA 3OE7A 1SC4A 3GLGB 2CMGA 1GRRA 2PD4A 1UT6A 4N3CA 3K92A 3Q40A 4LW8A 4OSPA 2YV4A 2GJSA 1G38A 1YA8A 2HPHA 4ZZ1A 3C7CB 1DSSG 1V9CA 4X8HA 5F7OA 1LVUA 4O1IA 4C1BA 4YR7A 4UU0A 1B23P 2CXTA 1W0KD 3O26A 4C6TA 4BZWA 3FOFC 4CEJA 1OFUX 2IPMA 3A1TA 3HBLA 4D9MA 5HJ5A 3JW8A 2JLAA 4JQYA 4CGYA 4K5QA 2ZEJA 3U6BA 1GKUB 2AR7A 1NLYA 2ZR7A 1MKYA 4RL4A 3E8MA 5JZSA 5IVIA 1V37A 3SCZA 3PQ3A 4MGIR 5HJEA 4QYIB 3C1UA 5INTA 5KYWB 3OWHA 2RBEA 1TD1A 1X8LA 1U0SY 2XYRA 1XTJA 1H8EA 4ENRA 1RW4A 1V4VA 5DZSA 4DIMA 2YXDA 3F67A 1EK5A 4IJVA 1N5MA 3OQIB 2EW2A 5CBKA 2BEUA 4O4JB 4XOIA 1IXYA 4RY0A 2YQ5A 3FSGA 1NX9A 2OFOA 2W6PA 2VNAA 3P0EA 1X19A 4L5IA 2WSLA 4ENPA 1ZNYA 4HTFA 4G37A 4N82A 2JA1A 4GDMA 3NC1C 4KXXA 4M7RA 1DU4A 4E1VA 6ADHA 2C98A 1IEVA 4O2RA 5LJIA 3TFOA 3MERA 3T5DA 3AXTA 4W9NA 2G5GX 1LNZA 5THXA 1M8PA 1VYVA 2O3SA 2UZ0A 5J3JA 1OIWA 1EVKA 1UZLA 3WYAA 4X93A 4DJ5X 4YAEA 5A4KA 2PAAA 4HH4A 4BNYA 1DUVG 1MQSA 1HL7A 2YQ4A 2QTTA 1JF8A 3LKVA 1YBMA 4RTMA 3H8WA 2GEFA 2XGMA 3QU2A 4LSGA 2V6FA 4RZ2A 1K9VF 5DWVA 5K6AA 2R8ZA 2Z2XA 1M5UA 2LP4Y 2ZI4A 3LHFA 1QRSA 2AYXA 4DMUB 5EMLA 3AJ9A 3IO3A 3KQMA 1D6MA 5THQA 1NVTA 2PTHA 3VZCA 5CMLA 2IQ5A 1WSAA 4DMKA 2MHCA 2AW3A 1XAIA 4BZPA 2Q5JA 1KO5A 2GDZA 1XCMA 2BGIA 3EUEA 2H8KA 3HH8A 1J2RA 1XVAA 3ZQ4A 1FBTA 4DFDA 2BZ1A 1UOQA 5LB2A 1EUZA 1I3OA 3VPFA 3I9MA 4MSUA 2WQ7A 3DTVA 1T36B 2GHRA 3AUTA 2GZAA 1E8MA 5H83A 5K3OA 3HS3A 4I5GA 2XRZA 3QIAA 4AY5A 2R8RA 4FMDF 2FVYA 4QWWA 5A9SA 3F3MA 1EJ6A 2H2IA 1V3VA 2W6MA 4I5EA 3OY7A 2FHSA 4OSOA 1MC1A 1SCNE 5DGXA 1G64A 1XJCA 1Y1RA 4A92A 6Q21A 4S2UA 4D5EA 1J9EA 1FP7A 1U02A 3PKZA 1SHJA 4HB2A 4DR7B 4X7PA 3SDBA 2G80A 2IBMA 4G23A 1ABFA 2ZGVA 1M33A 1MABA 4G5GA 3BDIA 3P2EA 4Z8YA 1CIVA 3GBSA 4REMA 5CA1F 1XMVA 4P35A 4P9NA 4X6XA 4ZDWA 3D8HA 3EA0A 2YVLA 4MHTA 1W4BA 1NQXA 3PU6A 3PUHA 1IY1A 2HMUA 1L7PA 3E15A 4IMPA 4PZLA 2QLTA 3PUIA 3W5AA 2FMXA 4MZDA 4Z0TA 1J09A 1ECPA 3TK1A 3WQRA 1GKIA 1JQLB 2EFJA 2JK1A 2MSCB 3ROEA 1N77A 2IEGA 4ALNA 3E27A 1PWHA 1RHJA 3VISA 5EE9A 1K7FB 4FI3F 1Z29A 2W71A 4U6NA 5IHPA 2CMHA 2FR1A 4RENA 10MHA 2DWPA 4UFPA 4KFCA 1KIAA 1KEKA 1UKBA 1XNRB 5FPPA 3GELA 1L7VC 1NBWB 3FLAA 1OGIA 4Z3KA 4H7JA 3CX6A 5BNFA 3L4KA 4K2HA 1CZHA 1RWQA 3T7AA 4BMXA 5BMVF 4EGFA 1A82A 1M2KA 1GG5A 1Z5PA 1CSEE 4KH0A 2RGYA 2D1TA 2XOEA 1P0IA 1JTVA 1M1YA 1LPPA 1Y1QA 4FDLA 3GLFB 1DKLA 1UJBA 3RVLA 2FSGA 1UBTS 4FBLA 2Q4BA 2WZCA 4CL3A 4S04A 4M8LA 4EG1A 1NDHA 1AT1A 3CJRA 3FBTA 4R1MA 3V3KA 3THYB 3VUFA 2RHTA 3OFSA 1Z6GA 1MQ9A 4J29A 2XJ4A 3OP4A 2OA0A 5TEVA 1T9AA 4BP9A 1P7ZA 3OQJA 3RNLA 3WWDA 1E2MA 3TBHA 2GNOA 4GMKA 1HFWA 3RFTA 1NXSA 1KEWA 2M1XA 3ET4A 3G82C 1NRWA 2VRCA 2W6NA 3HJUA 3O92A 4KUHA 3G2MA 4NR0A 1T4DA 3VR5D 2KX7A 3N2KA 4ZIRB 4DR1B 1FP4A 3EFOA 4UM9D 5EJMA 5HQJA 4XSHA 1NUPA 4CLHA 5L9AA 5IKXA 1PR2A 4WVLA 2D54A 5JPIA 2QBYB 2G1UA 3UXMA 1J1UA 1UBLS 5B3JA 4Q05A 4XGNA 3RU2A 1K08A 5A4FS 4GPTA 1TKBA 2SCUA 1RC1A 1MXHA 1I4TD 2UZ1A 1L5HB 1NQUA 1Z4OA 4HG2A 2B7BA 3AF1A 5DYYA 1Z82A 1DAOA 4B3IA 5HCIA 4KN5A 1GFIA 2PSHA 1F20A 4IHJF 1G8JA 4E5YA 3NP9A 1FUEA 2QORA 3KWMA 4W5JA 2BEVA 2JJYA 4AYXA 4AO8A 5DKFA 1XYYA 4E94A 2NIPA 4UM7A 3IERA 4PPQA 1COWA 3BBLA 4BC0A 2W2VA 3A25A 1D9XA 1W4CA 3PWSA 1RAHA 3QOFA 2P9JA 1R0BA 5FFFA 4M38A 4NEGA 5LC1A 3W0LB 3GJTA 3W8FA 2YXPX 4K8OA 3I5UA 1QRRA 3UYLA 4LE1A 2EARA 1WZCA 2CNKA 4DRXB 2YZNA 4ZALA 1M8JA 2AG8A 3F97A 4LWOA 2Z98A 1P9OA 2XUAA 3RAFC 2XGJA 4INZA 4OYRA 3BGDA 4Y6RA 5LWHA 3N53A 1WOYA 3OD5A 4FZJA 1AX9A 1WXGA 5A05A 3RIEA 5MN4A 2VPQA 3N9IA 1YZNA 2IDMA 4LXHA 3C48A 5F7XA 1FA9A 3GVCA 3NYRA 4QSMA 3QY9A 2HBYA 1MUUA 4BMVA 3UJ6A 3QTBA 2IEDA 5B7GA 4DBLE 4WZAB 1E89A 3FFAA 3A3NA 3FZGA 1Y9JA 3MRTA 4KXYA 4N5MA 3H9EO 3DEHA 2XB9A 1GY8A 1SM4A 5EGNA 5EY5B 2HU5A 4BBPA 2G63A 1MU0A 5FWYA 2YMLA 2AZ4A 3TI9A 1KARA 2PL3A 1X1RA 2QMHA 2VTEA 4FFPA 1B73A 5FLKA 4Z2YA 2AUMA 4LJ4A 1GAWA 4GQIA 2WJYA 2ZBRA 4EG5A 2WYUA 5BUCA 1XA4A 2BE9A 1TNDA 2MYUA 3A4YA 1NBEA 4P98A 3NM5A 4RADA 5A7HA 4OOFA 1QK5A 3B52X 5FR1A 5CDUA 1V2HE 2VNHA 3HB0A 4Z8XA 4FOOA 5EJEA 4KXMA 4NE7A 3MB8A 3KQUA 3HCPA 3PQ2A 3RVQA 3KLNA 3MGCA 1PT9A 3G9XA 1QDUA 2P67A 1E92A 2DMRA 1SO8A 1U9CA 2F3QA 3DMYA 4IGIA 4JDPA 5D5HA 3VOSA 2Q9UA 1DAEA 3DQPA 3QKWA 4R1LA 4PLTA 1DOZA 1BOFA 2YDYA 2ZKIA 3I1FA 3OCCA 2NTVA 2B21A 4UBNA 4ZT6A 3EVZA 3ZU5A 1D6JA 4UASA 3FNRA 4KZKA 2NSDA 2BEUB 3ASVA 2E1RA 4YRAA 2F00A 2J41A 2WTMA 2LWIA 4U7HA 3Q5DA 3RVMA 3ZD6A 1DEXA 3QPWA 3H1TA 3M34A 5IH7A 2C5EA 1NRJB 1NW7A 3H0EA 4R1UA 4AU1A 5J4LA 3AEYA 3U39A 2H85A 2R8YA 4YBZA 2P11A 1T6XA 1M7HA 1ZIYA 5J9FA 3WGMA 1QF9A 4HVAA 4Z1MD 4YP7A 1E20A 4LQLA 4WOKA 5BYBA 1ZW6A 3QMVA 2FPXA 4LNUA 1ODKA 1YTLA 2PZGA 4OL0A 1SQ0A 1ZJYA 1HNXB 4JA0A 3CXRA 1SURA 4Y9TA 1T0UA 4M83A 1T4CA 1JN0A 1XZKA 1R6VA 2DQZA 2GA9A 2I2XB 2WM8A 3C3DA 4C07A 3I5XA 3F2IA 4TVOA 1TGYA 4BN4A 5GIPE 4RZQA 2WSMA 4DNXA 4RTPA 3FYUA 5AM3A 1DCMA 4LC9A 3TTWA 3B9RA 2O3TA 1P5ZB 1ZH8A 5KTNA 1SU4A 3PTLA 2G9RA 2ONKA 2JVIA 3DTVB 2K6GA 2HA2A 1JAXA 1RWXA 1TVMA 3MSXA 1P19A 1P2TA 5T3UA 4D43A 5A9SB 2B20A 4C2TA 3CUUA 3KZVA 3BUSA 3LQ4A 4K87A 2OVFA 4KJXA 1HE5A 4WINA 2ESRA 3H9BA 2IK8A 4HQNA 4XSVA 1XTRA 4ZQBA 4UUNA 4BZZA 1R0SA 4S2EA 3TUIC 3EW7A 2CLOB 4IXTA 2BBOA 3WGNA 1KI2A 3DQQA 4ECAA 4NY1A 3MD9A 1F7UA 3NHUA 4OU5A 5E7JA 1BXGA 3UAOA 3ELYA 2X3YA 4MV6A 2FK8A 4J2TA 1ADBA 2PUTA 1UFKA 2BFNA 2QN1A 3LWZA 1D2EA 1EH5A 1PAUA 3AEUA 3OOHA 3ZNNA 4E09A 4K9MA 1U81A 4HDMA 1KOFA 2D5BA 4IZIA 3H1PA 1H6DA 4E88A 3FSJX 1GQOA 2PCJA 2MINA 3ENQA 3OOWA 4IYRA 1NR1A 4NYIQ 3KAJA 4PFJA 1WP9A 5MGNA 4R69A 3D4IA 3O2SB 3TLGA 2AN4A 4TXLA 1RC8A 4KWEA 1D03A 4J16C 3KTFA 5HKLA 3SHTA 2W2LA 1USUA 4N0MA 3TZ6A 1GPUA 5TNXA 4F38A 2OV6A 3LLUA 3VSEA 1ECCA 5DT9A 5JUWA 2GCPA 3IUSA 3QUBA 4TKZA 2G07A 1ZGGA 5DPMA 2OMKA 1YKSA 3T7IA 4FN4A 4PANA 4WNYA 4DJTA 1KNXA 2A0XA 3TUZC 1M1YB 1X1DA 4IXMA 2XT9A 1T9BA 3CKKA 4B4OA 3ZNOA 1X86B 2N75A 5BP7A 1YAJA 1AOXA 3TL6A 1JAIA 2HLDD 5B4TA 1TECE 4DYHA 4AP9A 4E30A 5AM2A 1Y8ZA 3DT6A 1U7DA 1ZWLA 5KSYA 4H7KA 4LJ7A 4MR7A 5E4TA 2NNWB 2DHCA 5EIOA 3H83A 1P73A 3QEMA 4ZOLA 1R8XA 1NQAO 1FU4A 4RVHA 1O57A 4GPBA 3T1HB 1T3GA 3FPBA 4AQDA 4WIAA 2GN2A 3N2KB 5B58T 1JG7A 1FP4B 3ZZNA 3EFOB 4L7QA 1U8TA 1WUJS 4UULA 1TB4A 3FDIA 1H0RA 3IP7A 3BXEA 3USZA 2HMTA 2EJWA 5D6NA 3V33A 1DE0A 2NZXA 1GCAA 1QYCA 2QB5A 3M6IA 3H04A 3QE2A 2OUIA 1GYPA 2VYQA 4MW1A 1SEVA 1OY1A 1JIKA 2UZ1B 2EQ5A 2HA6A 5C7LO 3DAFA 4LVCA 4JSRA 3K0FA 2FPUA 4PXAA 2VRNA 3ODPA 5JJLA 2FXIA 1MB4A 1I30A 4FFWA 4EYEA 4LDZA 4PU0A 1KL7A 4YRIA 2CEAA 2WYOA 1ZAYA 2IHVA 2BEVB 2CKMA 1UBOS 3DFFA 4GPIB 3ZZ1A 4CKYA 3HJRA 3TQOA 1EDBA 2OILA 1DIGA 5KYUB 3E9QA 4CDMA 1Z5NA 1M6EX 2EC5A 2EXXA 3AEQA 1V47A 5D7BA 3W5UA 1Z4QA 1NULA 2A5YB 4OPMA 3K1ZA 1MTOA 1QP7A 4DA6A 4C0WA 1GRVA 1DMRA 3JZMA 1ULBA 4Y67A 2FP3A 3SZMA 2WU1A 3V1MA 2C7PA 3AL3A 2Y0PA 2V58A 3DLBA 3Q7EA 4BBAA 5CG2A 2JIRA 1FRVA 1Z2AA 1B15A 1WW2A 3GJ7A 2NT3A 2O06A 3JQFC 4Q37A 3U56A 3QOWA 2FW7A 4EVQA 1SIUA 4KQEA 1N5OX 5AOCA 3BH0A 4WFQA 4EVRA 1ZJJA 2RGRA 1A9QA 2HK8A 2QUAA 2FZ4A 3GD7A 4LF8B 5T5QA 4OB6A 3ORFA 3OZWA 4GT1A 5G0VA 3MWYW 2FP4A 3ASYA 4CMEA 1CUGA 1XN1A 5FWYB 1IHXA 4JC0A 3W5CA 1YUMA 1GPKA 5FO1A 3O8NA 3THXB 3ZYZA 1QHSA 2OBYA 3DOHA 4NP6A 4G07A 2IZ1A 3WISA 5A0FA 4U7WA 2Y0CA 2QK4A 1YRLA 2F43A 3QXJA 3ESXA 3IP9A 2NO6A 4FE7A 2YY7A 1H9AA 4EJ0A 1EP3B 4RQBA 3L4JA 2J45A 1N2SA 2C4HA 2ZPUA 4RGYA 2CJWA 3QIVA 5IC4A 1X9HA 3EXFA 3RBAA 2ID4A 1UBRS 4MIOA 1N9KA 2C2MA 5E9AA 1YCHA 1YHYA 4U5XA 1WCWA 4BLUA 3ICCA 4IDNA 3KJFA 1FMFA 3L7YA 4UOZA 1ZA1A 1GCOA 2DT8A 1I0IA 4PBRA 5A7FA 4BO9A 2LVBA 1J97A 5IPFA 1GLNA 1BE0A 1NV9A 4BVLA 1U0NA 3LVBA 3U7FB 1LEHA 1GTZA 2QTZA 4ZQGA 4MROA 5IC5A 4TV8B 3ZHBA 5H68A 4BE4A 1FYXA 2PWZA 4CV2A 1NONA 1U0FA 3BZWA 2ZSUA 2H08A 3QJ5A 3DBRB 4K6CA 4QDTA 5EHQA 3RT1A 4AJLA 4EK9A 3ROXA 1BWRA 4DV4B 3AB7A 3FW1A 4LRXA 1JLLB 2Q4TA 1A0OA 3O73A 3L43A 3C70A 5FOXA 4IKEA 4HXFB 1MNAA 1Q1QA 3TX2A 2D7DA 5HRUA 1QG6A 2CXNA 1H1LA 4BBZA 2HFJA 4EB8A 4B82A 2NXCA 3L2OB 5D1HA 4NYMQ 3CM0A 3VR6H 2VDNB 3LGSA 1TM1E 4JI5B 4LNUB 1EZ1A 3FBGA 4N0PA 4FYIA 4LHYA 1NNSA 3TG2A 2VOJA 3DYVA 4W1SA 4ARIA 3AVYA 3AIMA 4RVOA 3L8DA 4UBKA 4W6ZA 4XJVA 5C1PA 3HM9A 5L3QB 2VDLB 4RZXA 4DPLA 5FULA 1C5KA 3OJ0A 3ENKA 1A8UA 1RYDA 2YZGA 3G2PA 3BWEA 1YJAA 1GLGA 1WHSA 2CL7X 5HX7A 3FYUB 4JLSA 1MOSA 4Y8VA 1U11A 1KBZA 1YRWA 1JFTA 3T9DA 4ZJUA 3CLUC 2R86A 1G4HA 3KT0A 5FIUA 1O94D 5BRAA 1P5RA 4YUXA 1FJXA 4GS5A 1C8VB 2GS9A 3N05A 1T6NA 1ZCBA 3QX9A 3ACDA 4NBUA 2OE2A 2GN9A 3O0TA 1FVXA 1LV7A 1UPAA 2ZYAA 1DAHA 4NATA 3V32A 2LNDA 2Y66A 3CG0A 5HSGA 3CUKA 1VDZA 3T35A 2BZ0A 2I4OA 3CRQA 4IVPA 1H4VB 3BXZA 3RI3A 2WU8A 2EAUA 3KOOA 3TQCA 1QFSA 1M0TA 4FFSA 1LS6A 3B9QA 1DTWA 4CDGA 1Y4DE 5AWFC 5JAOA 1D8AA 4HWKA 1O5TA 2QPTA 4R05A 1FYFA 1KEZA 3PJDA 3PENA 3H9GA 1EHCA 3UO8B 1DBVO 4AJ9A 1TUIA 2W2MA 3TLJA 2DQ4A 4K03A 1ECLA 3P9KA 2X0IA 4ZO7A 3LBFA 4V3CA 4YRZA 3K9LA 4P54A 3F6YA 4I8IA 4FX2A 4CR7A 3AEUB 1HYGA 1JLMA 1GL3A 3LUGA 5KHLB 2HRDA 5HIMA 3NHSA 1DB3A 4TMYA 4PZPA 1E3QA 4IDCA 1QAMA 4IIFA 1H93A 4YMSA 4ZOAA 3GA5A 3W8EA 4G9BA 3VJKA 1H9BA 2OOSA 3CJQA 2XRMA 3OIVA 3JYOA 1K63A 4NPAA 1DGQA 2JW5A 3JD4A 2E21A 1QHNA 1GAQA 1QH0A 2HGSA 5CJPA 4XM1A 1YACA 2MMGA 3TLGB 4J8PA 2CLSA 4UNNA 5KMGB 1KERA 4TWZA 1JYFA 5DDIP 3E3AA 2P1DA 3KT8A 1Q0PA 4RHXA 5G1NA 5JSUA 5AO9A 2DLDA 4EKYA 4HH0A 1CULC 3OEWA 1RLOA 4IEFB 1GA6A 4Q9JA 1RRVA 2CE7A 3HB9A 3K3PA 3C24A 5I4BA 2VF2A 4GMFA 1X7HA 4DRZA 1I94B 1QIMA 2QUBA 4YLYA 5B30A 3AINA 4R0NA 1SJ9A 3ZW7A 3C6KA 4X54A 3EVGA 4KK3A 2IV3A 4XRGA 1SC9A 5CDSA 3FH0A 1K3TA 3E3NA 4MR7B 4URYR 1HKHA 2ODWA 2X14A 3QEMB 1CY7A 2W93A 4IF4A 3KZCA 4PZUA 4ZOLB 4E51A 2FN7A 4NDAA 4W7IA 4ZMRA 2DTXA 3T1OA 1Z2PX 1R0ZA 3CVVA 4NCBA 3Q41A 1NQTA 1T5OA 3CE6A 3UKOA 2MCFA 3LO8A 4HAIA 3ZS9A 4DDHA 5JCJD 1ZVMA 3UMGA 4M8IA 4XTRA 4EGAA 1SXJC 3QE9Y 3JWHA 3R8XA 3ZWDA 1SULA 1UMBB 4QOGA 4YAWA 2EP8A 2O3RA 3NYIA 2DQYA 4QPNA 4H6VA 3FWHA 1BU5A 1DINA 3DEFA 2EBHX 2Z1NA 4AKGA 3CNQS 3AHFA 1KO8A 2XBUA 3K0FB 1OFTA 1YGYA 3R5HA 3E7WA 1WXXA 3C14C 4QFDA 5FPYA 1TC2A 5JJIA 4WPGA 4DUPA 3T1VA 5C31A 3U4IA 3VAAA 1Y3IA 1UFVA 3IJRA 5AK6A 1SKYE 2C2XA 1NW6A 4ZEOA 4B3CA 4ZMSA 3AG6A 1N1GA 2GK7A 4N5DA 4GM0A 1DI0A 4LBZA 5BW5A 3AEQB 2DR2A 4R4JA 4L8GA 3DM9B 4ZJPA 1S8NA 1H1TA 4YB8A 2RHGB 3KKPA 4PICA 5EJ5A 2HCFA 2QMQA 1OXTA 3K0SA 2CNWD 2Q1XA 2SKCA 3BICA 4C4XA 3PTZA 4HFMA 4YV1A 2VO1A 1LLDA 2ZWAA 4LZOA 4GDFA 4E21A 2IH4A 1NVXQ 3H05A 3K0EA 4NU0A 3V8QA 4G1UC 1QV6A 8GPBA 4JI8B 5HBGA 4JL5A 2H1CA 4LZNA 2FX5A 1G59A 3U3ZA 3P27A 1P29A 3T12A 3UJPA 3OQNA 2M6KA 1YULA 3DKPA 1N25A 2Y92A 1J1ZA 4QPCA 4EEZA 3VAZA 4P3YA 2HV9A 2QQFA 3ENWA 5BQFA 2FP4B 4Z7NB 2HRRA 5KYXA 4KAXA 4QLAA 3E5RA 3V4PB 4E07A 3VKVA 2BI7A 4FE3A 3NZEA 2ZJAA 3MMZA 4WZ6A 3VKWA 1H6AA 3GI1A 1WMBA 1RPAA 2D5LA 3P94A 4FLMA 4PPNA 1N6HA 2HEIA 4QULA 3NVKI 1M1NA 4L0QA 1G5TA 2QUZA 3LIIA 1CIJA 4E7PA 1NWCA 1N2EA 2F43B 1XNGA 3TLZA 3DBIA 1XQ1A 1Q57A 3O4FA 1EWYA 3KYJB 4P3KA 1AZLA 4F06A 4PINA 3OECA 3KXKA 3AESA 1XTTA 3HA5A 5LCXA 3VR2D 2FZWA 4C89A 3RSLA 4MA0A 3KOMA 1VIAA 1U7PA 4M22A 3OG9A 4UTNA 1CR4A 1XDWA 5E6UA 3O7MA 1G5FA 3GYBA 3NT4A 3VR6A 3WTCA 1CY1A 5E4FA 3V00A 2ZJ7A 1W76A 1PD1A 4MYRA 3HL0A 4L76A 1K2WA 1M1UA 1P3JA 2XEDA 1JMKC 4F2GA 2DHRA 1GTG1 1NXOA 2HO4A 4DRYA 3RKSA 3W5BA 5EA2A 2ZAOA 5D84A 4E11A 2P6RA 3HRKA 4BXOA 1TTQB 1GCIA 4YFVA 1LPBB 5GJCA 3R75A 4BVKA 2X0DA 5LVAA 4W5HA 3BCHA 4G4JA 3DA8A 5T67A 3KUUA 2LD4A 4JXXA 4C21A 1P4GA 1YGPA 2R96A 1H1LB 3SSOA 2YWEA 3ZWWA 4QBGB 1DTSA 2H3EA 3QX7A 3HFGA 4B3SB 1J8MF 3BWDD 3GR6A 3RV4A 1P7CA 4HFRA 4JI0B 4DXDA 5SZIA 3OZSA 5FTKA 4O02B 2YMQA 2APJA 3LL7A 3QH4A 3U7JA 5KNDD 4H27A 2DPGA 4XEHA 1DZ3A 1WVMA 3WHKA 3I2JA 2Q3FA 2IY8A 5F78A 5IHXA 1ZHOA 5BW8A 3HSSA 5MF6A 2C7BA 1V11B 3LXMA 1TEXA 1ZJZA 2JH8A 2VT3A 3B6KA 4P3OA 3UENA 4Z2AA 4ZV4A 1QFZA 4HN9A 4H9GA 1LJLA 1E1CA 2HQ1A 4DWJA 5EXTA 3SM3A 4LXQA 3DLIA 1XZHA 1C1DA 3A37A 2PIAA 3A8TA 3HUUA 5M3BA 3ESRA 3VM6A 3M4XA 5CX4A 1FVFA 3TCKA 4UXJA 3MCUA 3WL5A 5F12A 1CUSA 2PMCA 4QUEA 4Y7CA 4IDEA 1JVBA 4A27A 2C5BA 1DADA 1VGQA 1K5HA 4PQGA 3LBHA 5IX8A 3BWMA 1R5OA 4D80A 3DFUA 2FX3A 3VPSA 1FFXA 3A6LA 4PVDA 5DNEA 2LW7A 2ZE5A 2BKLA 3IHLA 2V3WA 4G1BA 4DAEA 2H4JA 4INOA 4HNRA 2XLBA 1DTWB 1GR1A 3MHTA 3HE3A 5KWEA 4TTTS 3V9PA 3IEKA 5IAJA 5K45A 3PQ5A 1NP7A 3DOEA 2X9NA 3IB3A 1IY2A 1EP9A 5EHNA 2Z2IA 4YY3B 1LRLA 2PUDA 3AUYA 3W5IA 1OU4A 1ISRA 2J87A 1F2UA 2JDID 3Q9LA 2GM5A 3UEOA 4RVNA 1T29A 2G1PA 3S68A 5EQDA 3TH5A 3J7TA 1JDZA 5BOSA 2P69A 3A6KA 1FTYA 3ZUGA 2Z04A 1CQXA 1E0JA 1K7YA 3SF8A 3DZJA 2JH9A 3M6LA 3SZGA 2MDTA 2AN9A 4QODA 4E08A 1EK1A 1MB2A 2BKXA 3F6RA 2R85A 3OSUA 4CM9A 5CP8A 1INLA 1CXZA 4G36A 3KR9A 3O03A 3P4UA 1XYGA 1HF3A 4LHZA 4YJFA 3GDFA 1WB4A 2R66A 3H2HA 2GYUA 1ILWA 1BDHA 2K2QB 4WI1A 1N3LA 5FA5A 4AKHA 2VP6A 4J1SA 2QDXA 4Y9SA 3D8UA 4FP9A 1CQPA 4WMLA 3D81A 4FC6A 4O5AA 3H18A 1ULTA 2HHCA 4HYYA 4DW8A 4I3HA 1QPBA 4A3SA 1Q15A 2YFQA 4RFSB 4I14A 5JMWA 2NWQA 1ACLA 5K09A 3I64A 5JTUA 2YWXA 2FMTA 3FPAA 4RQUA 5BV0A 2X86A 2OHVA 2O3UA 3CRZA 3MCVA 2VAPA 4MI1A 3HADA 5CH5A 1S3IA 3DE1X 4OLHA 3IUBA 3TB4A 4S12A 2QMUA 2XZLA 3CTPA 3CVOA 1DT5A 5AUQA 4Q01A 2YNMD 2ZJ8A 4QT4A 2PX4A 2SHKA 2VKTA 3KE8A 4HF7A 5KCZA 5C7IO 2Q5EA 1SVLA 1SPBS 4P58A 4JYBA 3OF2A 3DZGA 1E2DA 1EX6A 3CURA 4LXGA 3CPJB 2PUVA 4JGBA 1ATZA 1GSIA 3CF4G 3C8UA 4AXBA 3BT7A 1DC8A 2GD1O 2Y0DA 3HJFA 2RFLA 3FUTA 1YL5A 3EZ2A 3CEMA 4M88A 4EI2A 4Q66C 3R7WB 1NAHA 1QO0D 1OC4A 4UHHA 3TRDA 3H5NA 5DP1A 4DLWA 2A0UA 1JSRA 1XU9A 1DCKA 4HCJA 5F1PA 2NZ2A 2VAMA 5EUBA 1E6CA 2OD9A 5LMUB 1B41A 3JYQA 4R2WA 1V5IA 1X8JA 2J4DA 3CRVA 3WJAA 2A0KA 4CM5A 1YZHA 3LP6A 4ZOBA 4ZHQB 1U7ZA 3KR2A 3TZCA 2OBMA 1BFUA 5FOQA 5AXCA 2O8CB 2QWXA 5AW5A 4OAQA 1DEHA 1PFWA 4TMXA 3S4YA 5KTMA 1DQPA 4JSYA 5ALKA 1KAHA 3K9WA 1NT2A 4O3MA 2R84A 3NTLA 2NO7A 1T9HA 3DM5A 4GP9A 1ZGCA 4DJEC 1KP3A 3VTZA 5LQJA 3QYPA 1OR8A 1O54A 1GZ7A 2D0DA 2Q2NA 5IARA 2QE7D 2EFCB 4J1TC 3PUWA 3FB4A 4NZNA 4KG7A 1YQUA 1Z4JA 1U6JA 2Z30A 1HZZA 2X77A 1I4WA 2RJOA 1E4YA 4CQMA 5T4FA 4GFDA 4L9WA 5GAJA 3SHVA 5IKMA 4B34A 1Z0UA 3Q10A 5CA0A 1JG6A 3REGA 1Z2OX 1DUIA 1N1DA 1ND6A 1Z73A 1YQXA 2EWWA 1T91A 1A8PA 2ORED 1J23A 1OREA 3D2BA 3KZKA 3QLEA 4JOCA 1A4XA 4O5OA 1PE0A 1ZC4A 3DKRA 3DVAB 3OEHD 2RK4A 2WIFA 1ZISA 1Y7IA 3NBZC 1REQA 1M1NB 1IU9A 1Z6ZA 1V7ZA 2AV6A 1OBCA 1NR5A 2HDOA 2JRLA 2O2XA 4MAFA 1L4HA 1Q44A 4R9VA 4ENVA 4BX8A 2NUBA 3TGLA 1XALA 4OQXA 2ECPA 2TMYA 1VG0B 5A3JA 2X23A 3SSMA 3LSYA 2HJHA 3GN2A 4RKWA 4OKSA 4PGFA 1V3TA 4ARVA 3QXHA 5E7QA 3VSCA 4OUDA 4XUGB 2ZUVA 1AKRA 3SYRA 1TZJA 3AESB 3MAGA 3NKVA 1JR3D 2D3WA 3PHGA 1AHIA 5DTJA 1WOMA 2XR1A 4DYVA 1KJNA 3B60A 2QUHA 4KQ1A 5ALYA 2P78A 1JJAA 1XLTC 3PF9A 5E6UB 4DIEA 4G0WA 2J6HA 2YWRA 1KVRA 2IP1A 3N0RA 3SZ3A 1ZU5A 2E4XA 3DMDA 3Q7PA 5CG1A 2VUUA 4DN6A 3HVRA 4XDGA 5TQ0B 1F0KA 1QZ3A 5IDQA 2IXDA 1F4PA 3VC2A 2AOUA 1BDMA 5LOVF 4MQLA 2OCLA 1TM4E 1MEOA 4KNVA 1C41A 2R11A 4G8BA 4EB3A 2GZSA 3KEQA 1Z07A 5FBWB 5LA6A 4AZ0A 2PT5A 2EHJA 1NVWQ 3SXUB 1SQ5A 3WL8A 3WFJA 3CT6A 4O4HB 4BXOB 4F97A 3RDPA 1KMCA 3EEBA 2QGNA 2R5FA 4B4DA 4KV9A 2XUZA 1U0GA 4LQ4A 5EL0A 2WYHA 2H4YA 4UDNA 3T9BA 3EMVA 1V7CA 3NC0C 4IKOA 4RA9A 2XYHA 4DY4A 5DSXA 4K6GA 6GPBA 5EXPA 3KSMA 1LPSA 2DG2A 1KXZA 3GFBA 1JU3A 4GYKA 4B4WA 5J4VA 1F38A 3E7XA 1DO8A 3PR2B 3L0SA 2FQ1A 1E1LA 3FNIA 3L41A 5JH7F 4IH1A 4MULA 3U7QB 3FJ1A 5DI9A 2XTNA 1ZSVA 5F2EA 1ISSA 1J21A 1E1CB 4YGYA 5JZOA 3H2YA 2ZZMA 1SKUA 2Z9DA 2BZSA 3CUVA 3IQXA 3KZOA 4HL6A 4TRRA 1TIKA 4IDHA 1LBIA 2R6DA 3L0OA 1OH7A 1QDLB 4MVJG 1WXFA 5CNMA 3ELDA 3UTDA 1GGFA 5HMMA 4OFWA 2CNDA 1U0RA 3PHJA 2VHVA 2PKQP 5HJ2A 3RF6A 4QGBA 4C01A 3RU7A 3P7MA 1ND5A 3CZAA 1KGDA 2VK1A 3BGOS 4FMCB 4JXJA 3Q88A 2QVBA 3FE2A 4GW3A 4NZPA 4PR0A 1I2DA 1AQJA 1FFXB 4DUGD 4LISA 1C8BA 3BHMA 3IKLA 3ZD8A 2JB9A 2QS9A 4YT4A 5M7EA 4LC1A 1ZBDA 1XTPA 2Q2VA 2WB2A 1XX6A 2WWVD 4MUIA 5DLYA 5A9TA 5JZVA 2QYTA 3RRZA 4P92A 1NF3A 1S8FA 2YJ3A 4PRKA 5DF1A 1EIWA 2GGSA 3CF6R 5CB6A 1GU0A 2MSWA 2XYGA 2GCIA 2R25B 4MVJD 2B99A 1B16A 1DWPA 1JQBA 1KY2A 2BCGY 1JQKA 2QRNA 2PGOA 3DNFA 3DWIA 2QX6A 3EXAA 3FCYA 3H6KA 4Z9BA 4NU5A 5SZKB 3UG6A 1ACMA 2UYCA 4E5SA 3Q0EA 3JQ9C 3FPJA 4UHCA 2CDCA 2OD2A 2CV0A 4NXNB 1AM4D 2HTFA 1PSZA 3PQCA 5LZ5A 5BOSB 2MU1A