9LDTA

Design and synthesis of new enzymes based on the lactate dehydrogenase framework
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIHNLLKEEHVPHNKITVVGVGAVGMACAISILMKELADEIALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSRLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPNCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWILGEHGDSSVPVWSGVNVAGVSLKNLHPELGTDADKEHWKAVHKEVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKENVFLSVPCILGQNGISDVVKVTLTPEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and synthesis of new enzymes based on the lactate dehydrogenase framework.
pubmed rcsb
source organism Sus scrofa
molecule tags Oxidoreductase(choh(d)-nad+(a))
molecule keywords LACTATE DEHYDROGENASE
total genus 100
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1991-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 9ldtA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 9ldtA02
1WDKA 4DREA 1EQUA 5AYVA 5TNXA 2J3JA 3LK7A 1J49A 4RVSA 3WFIA 4ND1A 3WGHA 4LK3A 1PEDA 4R4JA 2NTJA 3ICCA 4LSWA 5COQA 4ZVVA 1CWUA 4K6CA 1YVEI 5A9SA 1DIAA 1HDCA 4IXTA 3AFMA 1U3VA 4L4XA 4N5LA 1E3SA 2PFGA 3BTVA 2GN8A 1GQQA 2PZMA 2BGKA 2CD9A 1QP8A 1TXGA 2EERA 3NV9A 3I9MA 3OJEA 4GSKA 3GVXA 4DWVA 4DGSA 3NTQA 1I32A 3HNPA 3EGOA 1A9YA 4D79A 5TGDA 4NPCA 3QV1A 2VYND 4BNFA 3TWOA 3WXBA 1M66A 2IZ1A 1LC0A 3KHUA 4KQWA 1HEUA 5JYEA 2ZCVA 3NRCA 1I0ZA 2PD3A 4YWJA 3DDNA 3A1NA 1E7SA 4F6CA 5ILGA 2P9GA 4NIMA 4GH5A 5DNAA 1O94A 1NR1A 1DFHA 3TZ6A 4OMUA 1EK5A 4DYVA 2PLAA 2B4TO 3FN4A 5DN9A 1ZBQA 3RASA 4TSKA 3E18A 1V35A 3GZ4A 2B0JA 1EBFA 4RPKA 3CUKA 2DPGA 1PJ2A 4PG8A 3ASVA 1YGYA 3A28A 5CPFA 3ZV3A 4WCFC 5B4VA 1EQ2A 1F12A 3BHMA 3DL2A 3OQBA 3PGJA 4DLAA 3DOCA 4KOAA 3LC2O 2NTNA 4DC1A 3ZU4A 3ADOA 5IZ4A 3IL2A 3OQ6A 3TF5A 1PS0A 2EGHA 1I2CA 1VL6A 1LNQA 1XIVA 2E6UX 3DONA 1YJQA 3JYLA 3HB5X 4YAEA 4ZQFA 4KQXA 2C5EA 3MJEA 4WLNA 5CDSA 3FR8A 1XWFA 3ABIA 1ZMTA 3PZBA 1QYXA 3OECA 4D45A 1RWBA 4AJOA 2BFPA 1PS8A 1RYEA 3MOIA 5EIOA 4IZHA 2DM6A 1E1MA 4GI2A 4Y9DA 1MV8A 1JA9A 4MP6A 4YAGA 2NNLD 1GY8A 4HV4A 4JX8A 1ADGA 3DHYA 4AJJA 3T4EA 3H7AA 1ZK2A 5JO0A 2FPPA 1N7GA 3VC7A 2HMUA 3T4XA 1H93A 4NK4A 1PTJA 2BGLA 5CDGA 4CPDA 4CLRA 4DQUA 3NDRA 4P4LA 1IUKA 5BQFA 1DHTA 3D5QA 3K6JA 3PXXA 1A71A 1LA2A 1F8FA 4JBHA 4UVGA 2DVMA 4D3SA 2O4CA 4XGNA 4XRGA 1R4MA 3LSYA 1DRWA 2JL1A 1DLJA 3GMSA 3MJ4A 4PVCA 4CM8A 4E5NA 1GV0A 5F21A 1LTHR 3RUDA 3QVWA 4MVJM 2BHLA 3H8VA 1PGJA 4IDDA 1HT0A 4BO7A 5B12A 1P74A 3WQQA 2DPHA 4W7IA 1LDNA 3B20A 4J4HA 2B4RO 3LDHA 3DZFA 3PTZA 1N9GB 2WWRA 3JQ7B 4R69A 4J9UE 4TRJA 4MVJI 3DBLB 4TZKA 1TVEA 2QZZA 1YO6A 1D4FA 3H5AA 4FS3A 5B37A 2FSSA 4GWGA 3FNHA 3ADPA 5ICSA 2FR8A 2GN4A 3QWIA 1I30A 4BO3A 5IZCA 3WTCA 3PLNA 3DFZA 4CODB 4IMPA 1T25A 3C7CB 3ZCXA 1U8XX 4J7UA 1PS9A 2NU7A 3I4CA 1QYWA 5T67A 3L77A 1K6XA 4CQLA 5L9AA 3AFNA 4FFMA 1JKFA 2FY8A 3VTZA 3CPSA 3S55A 3ZWWA 2ZTLA 1K6JA 3UAGA 2JAPA 4BKOA 3C85A 3NTRA 1A7KA 4PG4A 3TL2A 1UAGA 1ISJA 3ETGA 4CM6A 4NBUA 3RUCA 2GUGA 4QTZA 4XZ3A 3VAZA 2OBNA 3FWZA 4PCVA 3QWAA 1NPTO 4YVFA 2AEMA 2IEDA 2OOSA 1ISIA 2VWPA 3PLRA 2E4AA 3GDGA 4HNGA 3K5PA 2AQHA 3K96A 1E1LA 4J43A 1Y81A 1C14A 1UP7A 1N1GA 1X1EA 2PGLA 5H81A 4JJIA 2VHZA 3KZVA 2ZB3A 4PG6A 5DBFA 5JCJD 1C0PA 2JJYA 2GF2A 3GY0A 4RO0A 3RU9A 1SAYA 4NBRA 4E32A 1T2CA 3FPCA 4M1QA 5EJ2A 3DBRB 1B16A 2C54A 4OYRA 1VRWA 3K2BA 3LC1O 4YA6A 2G1UA 5L7YA 3V8BA 4YQYA 1ARZA 2E48A 1Y8QB 3MJCA 1E3WA 3ON5A 4BV9A 2CVZA 3GA0A 2EW2A 3UVEA 3ROMA 2PKRA 5F5NA 4XIJA 3GRKA 3RKRA 3FWNA 1Y9AA 2EHDA 4FDAA 2JCYA 4BB5A 4FB5A 2YDXA 1WLYA 1Q7GA 1ZVMA 4XYBA 2Y1EA 3Q9UA 1GR0A 1N9GA 2UDPA 4JNKA 4TRNA 3GEDA 2ZK7A 1Y8QA 3JQAD 3JD3A 4J91A 4MOWA 1A27A 4QUKA 4CV0A 4IIUA 4WE3A 2HLPA 2DTXA 3UW3A 4MP3A 3BMNA 4KTTE 4CLRB 4XIYA 4Z3DA 2VWGA 1V3UA 5ER9A 3TQHA 3ZWOA 4AG3A 2Y0DA 4WEOA 2X23A 3AU9A 1RKXA 1BHSA 3DWFA 3OJFA 4CLXA 3KBOA 3R3SA 4Y8VA 1GFSA 4YJHA 3MWEB 5B4TA 2AQ8A 2HSDA 1K0UA 1VL0A 5KNLA 3E1KA 2D4AA 3O8QB 1NTOA 4ND5A 1CRWG 2VHWA 3IQDB 2DQ4A 4H3VA 3PHIA 3ZV6A 3EVTA 5JMPA 2BF7A 3RWBA 3RC7A 5FFFA 3KOUA 4GLOA 3JQAA 4L76A 3TL3A 5L7WA 3Q0EA 4R51A 3ZHXA 5FF9A 2VYNA 5ITVA 4DLLA 5BSHA 3QJ5A 3D3WB 1KYQA 3GRPA 3FF4A 4D0RA 1BVUA 1EE2A 1Q0QA 1NWHA 4W7HA 4AJNA 2FR0A 4B7UA 4IDAA 1NPYA 2Q1SA 3L9XA 4J1NA 4RZIA 3P2OA 2NVUB 3HADA 4BNXA 1NQ5A 2EEZA 2Q50A 3W8DA 3WGZA 3WG9A 1PJLA 2Q45A 2IRWA 2RCYA 1H9BA 3KYCB 2AE2A 2P4QA 3CH6A 4QO8A 5HS6A 2VNAA 2D0IA 5JSFA 5JY6A 4CMAA 4WNIA 2ZQZA 3BAZA 4EGFA 2J3HA 1H6CA 3F3SA 1LSSA 3JQBC 1PZHA 5T8KC 1M75A 3PDJA 4YT4A 4II3A 2EJWA 1P9LA 3WIEA 3I6QA 4I5EA 4TMFA 3CIFA 4PFJA 4D46A 4PG7A 2I99A 3UUWA 3ZU3A 2O2YA 1TA4A 1GUFA 1U4SA 2LDBA 1MA0A 4IIVA 2O4UX 1NM5A 2VRCD 3TZKA 3S2IA 4CQMD 4BNZA 5L95A 2ZB4A 4PN3A 1MB4A 1WZIA 1U9JA 3A14A 1BG6A 4Z9XA 1ZSYA 4B4OA 4C7JA 1PJBA 3BIOA 1DC5A 2IODA 4WJZA 2B83A 4KP7A 1NAIA 2E49A 2Z1NA 5A5FA 1KVSA 4TVOA 1GCUA 5T57A 1SOWA 4J1QA 4Y67A 4H16A 2UAGA 3GGOA 2DBZA 3UCEA 1Q2XA 3OF2A 4I9NA 3WOHA 2HMWA 2PK3A 3IKTA 1X0XA 5LCXA 3VVCA 4AJIA 2HK9A 4XB1A 1HZZA 3UFXA 1JKIA 1PGOA 3LZ6A 1H2BA 5IDWA 1ONNA 2Y1GA 5CEEA 4GL4A 2VRCA 4F45A 5IDQA 3ETEA 1JWAB 3B6ZA 4TQGA 3TDKA 5G4KA 3CEAA 3INTA 2X5OA 1WW8A 3RCBA 3GVCA 4MVJG 3VKUA 1NVMB 2WYWA 1XEAA 3P5SA 3UN1A 1IPEA 3JQGA 1E0DA 4NNJA 5HM8A 4XQCA 2JHGA 3JQCA 1VM6A 2FPGA 3E9QA 3GHYA 4KUEA 2UUOA 4BO9A 1OBFO 1J4AA 1XU9A 1OI7A 2DTEA 5CG1A 3AOEA 1EE9A 4Z0TA 3E9MA 3D64A 5I7EA 3NEPX 3OJOA 1IY8A 3TFQA 3AJRA 3OBBA 3NDJA 4A27A 1AUPA 1JKJA 2C5AA 5CG2A 3V5NA 4AL4A 5HS4A 5F3RA 2O7QA 3PZRA 4DUPA 1C1DA 3TFOA 1XQ6A 4IXWA 3U62A 4JQCA 4ZU3A 4CQLB 1YOVB 5JXWA 5JDCC 2X58A 4FC6A 4MVJP 2Q2VA 3WMWA 1HRDA 4RPHA 2UUPA 3CXRA 3DQPA 4E5MA 3AWDA 5JFOA 2OBYA 2FMUA 4FPXA 1NHGA 3L4SO 4NR0A 6ADHA 1QLJA 3GGGA 3KB6A 1I2BA 5TC4A 3ROKA 3W4JA 3C8MA 5GZ3A 2OUIA 1CERA 2WE7A 3VPXA 4BS9A 2UV8A 1R0LA 2G5CA 2I67A 4MIOA 4UVEA 3LT4A 1T4BA 3WIDA 3L4BC 2YHUA 2JD2A 5ADHA 3U4HA 2C29D 3PK0A 2B37A 3BHJA 1I36A 1KEPA 1L7DA 2EXXA 1DHRA 1C3VA 2J5QA 2XOXA 4RQUA 3ZHZA 1G0NA 4CM8B 4NDNE 3FHLA 1CIVA 3OIDA 3W6ZA 2NV6A 3P2YA 4TWRA 4ALJA 2YQ4A 4EDFA 1DC3A 5A9SB 2WYVA 3B70A 5JAMA 5EPOA 4OH1A 3PHLA 2PZLA 4J4TA 3KETA 2P91A 4BMVA 4I9UA 3GEMA 2NTVA 3DOJA 1Z75A 4IDGA 3DR3A 2ZIZA 2R00A 3PEFA 4UREA 4NHEA 1JVBA 3M1AA 3VZPA 2QYTA 4DBZA 3KEOA 1HE5A 5AQ1A 3UCFA 3EMKA 1GD1O 1EUDA 1F0YA 1I33A 3H2SA 3PQEA 1U5AA 2A35A 4YACA 2WSBA 1X0VA 2O3JA 4IDEA 4XGIA 4B7CA 3GMDA 1LQTA 1BW9B 2DBVO 3RBZA 2BKAA 4N7RA 4CM4B 1CDOA 3DO5A 5CDUA 1UJMA 1PWXA 4KTVE 5COBA 1IOLA 3GNTA 1R12A 4IJUA 4B8WA 1YH3A 1A4UA 1E6WA 4GPD1 1ISHA 3FI9A 3BTOA 1FK8A 1LEHA 5GZ6A 5F1PA 3ROQA 1QR6A 2WJPA 3H9UA 2BH9A 5ER6A 4A5OA 4K28A 3TNLA 1HWYA 1Y1PA 1MGOA 2DT5A 1HXHA 3F9IA 3KM0A 1T1RA 1K89A 1WDMA 5IN4A 5ICMA 3U5TA 1AXEA 4UAGA 2PD4A 1ULUA 4EEZA 2YV1A 1UR5A 1IE3A 4WEQA 2WDZA 1LDEA 3OHSX 2F00A 1W8DA 4ZA2A 5THQA 4J1TA 4GKBA 2XF8A 5TJ9A 2HK7A 5DZSA 2CDAA 2Y99A 5JMWA 4BMSA 7MDHA 4MVJA 5A9TA 3GNSA 1NFFA 4JXKA 1FDTA 3PQDA 1H5QA 1HDOA 2D3TA 4HWKA 2O48X 4ZRMA 4RF4A 1OC4A 1SB8A 2GZ1A 3RUAA 5G4LA 3TSCA 2ZTMA 3LT0A 2NUAA 4RF2A 1G1AA 4A10A 2RHRA 2GASA 3AOGA 1M76A 4M89A 1I5RA 3I9JA 3H6KA 3BTSA 2DLDA 4HNHA 2NQTA 3W8EA 3WLFA 3VDRA 1PGQA 2X6TA 4EITA 3LU1A 4YT2A 1B8PA 2V6BA 4KMSA 2JD1A 3M6IA 4J16A 4MIYA 5T5QA 1NR7A 4Q3NA 1EK6A 3GAFA 3V1TC 3HDYA 4B4UA 2X9GA 2TMDA 3OJ0A 2G76A 2V65A 2Q1UA 3EAGA 4DMMA 3ULKA 3M2PA 4XYEA 4X54A 2YDYA 2RBEA 4QEDA 4QX6A 4I9HA 4ND3A 4DMLA 1B14A 3PJDA 2PD6A 2HMTA 4XD2A 5TF4A 3V2GA 4TKMA 4BO4A 3OICA 1E1KA 4INAA 1XQ1A 3GH3A 4XQEA 4J4BA 5G2OA 4ESOA 3D0OA 3DHEA 3TN7A 4BL5A 9LDBA 1RM0A 5L4SA 4P22A 5EQFA 2CF5A 4CR6A 3BMQA 1X7GA 1C1XA 1UXIA 1GZ3A 1P31A 4L73A 8ADHA 1GPDG 2CDCA 2DUUA 3S2FA 3D3EA 1XSEA 4ID9A 3EYWA 3NGXA 2GZ3A 4BNJA 3JYPA 4PLGA 1Q1NA 3X2EA 1UUFA 3SBOA 3GG2A 1QYDA 4BNHA 1MC5A 2O3UA 1IB6A 4BO5A 2YV3A 3TOXA 5KKAA 2IXBA 1B8VA 1IULA 3IOYA 4ALMA 3ZWPA 4KDFA 5DT9A 3PPIA 5G4KB 4U0JA 1Z45A 5I7SA 1M2WA 2X5JO 4S3MA 3GG9A 2C82A 3RROA 3GAZA 4HY3A 1OOEA 4IUYA 3K30A 3S2GA 4YDRA 4F3YA 2E82A 1P1IA 3RKUA 3C24A 1ZK4A 2RH8A 3VZRA 4A2CA 4BNKA 4BNWA 1YQDA 4YQZA 5TT0A 2W2KB 3WS7A 3E9NA 5JBIA 2EWMA 1OAAA 4MIEA 4AJKA 2Q1TA 3JYQA 2CMDA 3ZV4A 4BO1A 3HDJA 4RVHA 1E7QA 2EIHA 3IP3A 3WGQA 3AK4A 1QKIA 4BNYA 1QYVA 4LMPA 3TJRA 3GFGA 3W4IA 2PH3A 3OP4A 3F4LA 1ZEMA 3WSWA 8LDHA 4JN6B 2NQ8A 4ROSA 3JD2A 3PYMA 4G5HA 3EZLA 4RORA 4GX2A 2PY6A 3DOOA 2Y1CA 2ZB8A 4UVHA 1K3TA 4WLFA 3LVFO 3OEWA 3C1AA 3ST7A 4PVDA 1BXGB 1W0CA 2VWHA 1UZLA 5JAIA 2X7HA 2HAEA 4ALIA 4Z6KA 2EV9A 2GSDA 5LDHA 4RPGA 5KJFA 3A06A 4P8RA 3KVOA 4E0BA 1YDWA 3AY6A 1KEUA 3L6EA 2VZ9A 3F1LA 3VHRA 2QZ9A 3O26A 1N1EA 4DL9A 1HETA 5EL0A 1E3IA 4RLHA 1EUCA 4OXNA 2IYPA 3C7DB 5TT1A 2HRZA 3QY9A 2G0TA 4OXYA 5G0VA 1QMGA 4TVBA 1JW9B 3DBLA 4FCCA 3I9OA 4PRKA 2FP4A 4Y6RA 1X14A 2X0NA 3I1JA 3QRWA 5ILOA 5KJ1A 2W4QA 4PGFA 3PJGA 1VLLA 2GO1A 3DTTA 1BXZA 5A9RA 3BMCB 3Q2KA 2A9FA 5GZ1A 1IZ9A 1Z73A 4N54A 2AQIA 1E7RA 3LYLA 1LI4A 3I23A 3K8ZA 4Y6PA 1PWZA 4DPLA 2RIRA 3TPCA 4PLZA 3OEYA 3WICA 3WGTA 1ENZA 4B3JA 2HMSA 1GU7A 4C7KA 3P19A 3SX2A 5IZCC 2V6MA 1SPXA 3OMLA 4M49A 2W2KA 5IN5A 4CLEA 3Q2IA 3AM3A 4XX0A 4RVFA 3AUTA 3GVPA 1SO8A 3VH1A 4IBOA 2GERA 4NFHA 3KLMX 3DZGA 3Q6IA 3NT2A 3OA0A 4A7PA 4E33A 2QYSA 3OIFA 4E12A 4IGFA 1DIBA 1LDBA 1WMAA 4WLVA 2C2XA 1U8FO 4BNNA 1P33A 2XPCA 4R3WA 1S7CA 5CDYA 2IXAA 1NX6A 5L51A 4TZTA 1RM3A 5GMOA 3ETDA 1DBVO 3F4BA 4XYMA 4GMFA 1QYCA 3JQFA 3SC4A 4BNVA 1NPDA 2OO5A 5FWNA 5TSDA 1GQYA 4HBGA 4CV1A 1V9LA 4FJ2A 1SC6A 4N5NA 5AXDA 3QWBA 4R9RA 4RLSA 3TZHA 3KV3O 1Q7BA 4IQ0A 1TLTA 5C5IA 4BNGA 3SLKA 5FI3A 2H9IA 1NQOA 3LT1A 4OO3A 1O8CA 1BDMA 3DBRA 1I3KA 3T7EA 2YY7A 4NJOA 1XKQA 1LUAA 2YQ5A 1Y9EA 4Q3DA 1JLLA 1SCUA 3EUWA 5JYDA 3CSDA 1AHHA 3D1LA 4CUJA 5JY1A 4PIVA 1EDZA 3I9LA 3RAJA 5L40A 4FJ1A 1ZUD1 2Y1OA 3DBHB 4J2HA 4MVJH 1KC1A 1JU9A 2JAHA 5MDHA 2FR1A 1DSSG 3M2TA 3PP8A 4WOKA 4LRTB 1MXHA 4FOOA 1PR9A 3F47A 3UF0A 4CMIA 4BKUA 4IPTA 1Q0LA 1WAMA 3ZW8A 2G17A 4FFOA 2NVWA 4OSOA 1BVRA 3I83A 1P1HA 1FDWA 1T2AA 1YWGO 1PIWA 2B4QA 3AM5A 5F1OA 2GD1O 4IINA 1WDLA 2FZWA 4YTEA 4PLWA 4J7XA 1JAXA 3LF1A 5FI5A 1LRKA 3PIIA 4KWIA 2PNFA 1R6DA 1NVGA 4O5OA 4LMRA 3RD5A 2VOJA 2I9PA 2IE0A 2Y1DA 3QVOA 2EGGA 4FC7A 4GBJA 1N5DA 2O7SA 3WX0A 1MG0A 4QSMA 5CEFA 3BMQB 5K0ZA 3AOEC 3I9KA 4MVJE 4U6QA 4DIBA 2FZEA 3DFUA 1E3EA 3OA2A 4B4VA 4AJPA 2DC1A 2H1SA 3CKYA 4ALLA 2WTBA 3KSDO 1PJQA 3G49A 4K26A 4NQZA 4P38A 3GHHA 4BO8A 4CL3A 3PYLA 2CY0A 2DFDA 2Z95A 2CVQA 4AJ1A 3DAFA 3UCXA 1IZ0A 2Y05A 3KTDA 4XR9A 2ZTVA 3JTMA 1KY4A 3JV7A 4DYDA 3O8QA 4W99A 5U4QA 1HE2A 4PLPA 2AW5A 2Q99A 2DBRA 3N7UA 3H9EO 2BI7A 4GVLA 2C2YA 5IDYA 2EW8A 3RC1A 5DP2A 5BNFA 5ENVA 2WEKA 3G17A 3GK3A 1YQGA 1V6AA 4EEXA 4DVJA 2VHYA 3ZNQA 1IPFA 4NH4A 3Q11A 4E4YA 4F6LA 2X9NA 4E2YA 1LRJA 1YRLA 4A26A 3GVIA 2YYYA 3U0BA 5JDCA 3M1LA 4R1NA 4R1UA 4W9NC 3VPHA 4UVIA 3WR5A 5G0SA 4TROA 2FSVA 1U5CA 1YB4A 1H9AA 1XLTA 2EF1A 5F1KA 1KOLA 4CR8A 1DAPA 3H9GA 3MTJA 5HTOA 2HQ1A 5DOVA 3QVSA 2IZZA 1R4NB 1DDOA 4LN1A 4Q9NA 4H15A 5I8WA 3K31A 1VE9A 1UDCA 4BOYA 2P9EA 4DQXA 4TRRA 5HBRA 1YJ8A 3O38A 1DC6A 2Q1WA 3PI7A 3IUPA 4YRBA 3AI1A 1N92A 4FQ8A 4RPLA 3IJRA 3MJVA 4FFNA 4IS3A 3FPLA 1J5PA 1VKOA 1ZZEA 4JJFA 1FDVA 3TZQA 2HMVA 1ZEJA 1UZNA 4OQYA 4CM5A 1LQUA 3UICA 4R01A 2CSUA 4Q39A 5CP8A 2BMAA 4G81A 3VH3A 4BQRA 4E2WA 4CQMB 5B1YA 2Q2WA 1WXDA 5JNLA 5THKA 3GPIA 1UXHA 3DB2A 3NKLA 3AU8A 3ZI0A 4QXMA 5JCXA 4FFRA 3JCZA 4JK3A 4R5HA 5A3JA 4O6VA 2HK8A 3RUHA 4Y6SA 5EQDA 2Y1FA 2OXIA 4CM9D 1T4DA 2HUNA 1ZW1A 2B5WA 3I3OA 5BSEA 3E03A 3U3XA 4OKIA 1HSOA 1FMCA 1WZEA 2NWQA 3D7LA 5A06A 3S8MA 3NT4A 1PGNA 2OFPA 5EINA 2NU6A 3QLJA 1P0FA 4H7PA 4GWKA 3ZW9A 1P45A 1R0SA 1MXFA 1ZO8A 1N2SA 5CAEA 4G2NA 2VOEA 3I52A 5JS6A 4W4TA 5BR7A 1Z74A 5GY7A 2W2LD 4DIFA 2OMEA 3WB9A 4ND2A 2F1KA 1EZ4A 3F46A 4WLEA 3KEQA 2Q46A 5EMHA 2PA3A 3ZNPA 1NYTA 4BMNA 5IJZA 1UP6A 4JLWA 2RHCA 3LF2A 5AXAA 3VDQA 4NFYA 4K6FA 4J3FA 1XG5A 1O6ZA 3H2ZA 3ZWVA 4BNIA 1ZH8A 4WCFB 1NVTA 4L9RA 3FRJA 4M55A 2X4GA 1IHXA 2PGDA 4KUGA 3L4BA 4CL8A 4CUKA 4RF3A 1H94A 4CLDA 1PQPA 3DEYX 3EC7A 4PLVA 3IAHA 3KO8A 1YOVA 2X5KO 1D1SA 3RUFA 4BVAA 3G79A 1FXSA 5TRTA 1MFPA 3HN7A 4AJ2A 4U5QA 4CLOB 4OM8A 1HLDA 1U3WA 3DZHA 2H63A 1ENOA 4NBTA 5AXCA 1D7OA 2WD7A 2W2LA 4HP8A 3COSA 2YJZA 1WPQA 4AJ4A 1L1FA 1EVIA 1E3LA 5A05A 4IDCA 2X9VA 3H4VA 3WJAA 4E6PA 2FHSA 3Q3CA 5KOIA 1EUZA 1O9BA 3W6UA 1T1SA 5KCZA 1D3AA 3SLGA 1LLQA 3TRIA 1O0SA 2PKQP 3RJ9A 3JQ8A 1SEPA 1ZK3A 3ZNOA 2X22A 4MINA 3PJFA 4B79A 4ZGWA 2JD0A 3NTOA 1ONOA 2CZCA 1WWKA 1ADFA 2H5LA 3BMCA 3UH1A 1DC4A 3GLQA 1P1JA 4RPJA 4OGWA 3RC2A 4Z9YA 4D7AA 5BNIA 3PHHA 5U1PA 3IDSA 1RJWA 1FF9A 1GEGA 1JWBB 4WUVA 1ZK0A 2FOIA 2HU2A 2GN6A 3DXFA 3UHAA 2HO5A 1E77A 3H5RA 2DUWA 1PJSA 2QHXA 2JFHA 3E5RA 4Z0HO 4W6ZA 3RFXA 1BWSA 4QQRA 3WTBA 1I3NA 4UEOA 6LDHA 5IXYA 2X0RA 3H65A 1B2LA 5TQVA 1LC3A 5DBIA 2AG5A 1VSVA 5I9NA 2P5UA 2B5VA 3WGIA 3JQDA 2ZATA 2NLOA 1P1RA 2FPIA 1TEHA 1XYGA 3JQ9A 3ZWXA 4PRLA 2H6EA 4OIMA 4R41A 3VZSA 2EJVA 5L3ZA 1U2GA 5HRUA 1BXKA 2Q4BA 3QE3A 1X1TA 1KEVA 1HDZA 5C7IO 1SZJG 3RVDA 4OJNA 4MKZA 4N5MA 1I3LA 2DU8A 4JGBA 1NQTA 1EVZA 2NSDA 4RDHA 3NX4A 3GDFA 1P1KA 3WGOA 1NBOA 1I01A 4J9VA 4JP3A 4DLBA 3QSGA 2PZJA 4WK6A 1NHWA 2I3AA 5A03A 1EFLA 5F5LA 4D3FA 2ZJ0A 1UZMA 1AE1A 2ZKLA 5DBGA 2LDXA 3FBTA 1WNTA 1GEEA 2J8ZA 1P77A 1N7HA 4J0EA 4IQGA 3KSZO 3Q9NA 4BNMA 4C4OA 1ZJZA 1Z6ZA 4O0LA 4FFPA 2Y93A 1NASA 2ZTUA 4UUNA 1LSOA 1B3BA 3ZWCA 2D5CA 3QP9A 1V3TA 1ZK1A 1U2DA 3UGKA 2W8ZA 3D3WA 2GNAA 3DZBA 2NU8A 2ZQYA 3D5TA 4YPOA 2YW9A 4DRYA 1DIRA 2VTDA 5AXBA 3VZQA 3OETA 3SJUA 4EUFA 4D41A 1B26A 2BLLA 5JO9A 2EG9A 1U3UA 4E5YA 1DOHA 5H82A 3H3JA 2Q49A 1IL0A 3FD8A 2VYVD 2GDZA 1VI2A 2WD8A 2O50A 3GOHA 3PWSA 4XQGA 1K5HA 1AHIA 3VOSA 3C1OA 3JQ9C 2O3TA 5CPBA 4RGBA 3G1UA 3H9QA 1MX3A 3ZH2A 1OZAA 3KUXA 3GN2A 1KEWA 2O3SA 2WYUA 4FW8A 4MJLA 4L0QA 4MO2A 3MOGA 3GR6A 1UXGA 2B35A 2GLXA 5AVOA 5L4NA 1F06A 3FSRA 3AUUA 4FN4A 2ZYAA 5AOVA 3ZWBA 2V7PA 3NAQA 2I6TA 4L4RA 5A02A 5KVQA 1GYPA 1LDYA 4K9DA 1NFQA 4NMHA 3X2FA 3JD0A 4MKRA 2D2IA 3ROPA 3QVXA 4Z3KA 1DIHA 3DAGA 3HSKA 4XCVA 3MZ0A 1W6UA 4J49A 3DMTC 1RM4A 2UVDA 3AI2A 1ONPA 5DF1A 3BMOA 4GLLA 3E5MA 3DZJA 3R0IA 1HE4A 2AXQA 2XXBA 1KIFA 4DXHA 5J23A 3NT5A 3JQGB 4LRSB 4JJGA 3B1JA 3RFVA 4EUEA 4BO2A 4KWHA 3VPSA 4CM9A 5ES3A 5A04A 5IAAA 4LVCA 1E6EA 3WFJA 3WGGA 2W90A 1P3DA 3ONDA 4OQZA 2Z5LA 3H9JA 1T2DA 3JQFC 4J90A 1ZMOA 2QRLA 1UH5A 2OP0A 1E3JA 3L6OO 3ICPA 2CNBA 3LLSA 2VHVA 1M67A 4XB2A 1Y5RA 2ZB7A 1G0OA 2C7VA 5BT9A 2HRBA 3PYXA 4IJKA 2FWMX 1B15A 1HZJA 4EZBA 1F14A 1YDEA 3PWKA 1E92A 2YV2A 4BKQA 2XAAA 1ENPA 4CMGA 3B1KA 3MJTA 3IP1A 4AJEA 5EESA 3FBGA 1U28A 4DQVA 5G0WA 4YJFA 1QRRA 3GEGA 1I3MA 3KYDA 4TKLA 1ZSNA 3H5NA 3JD1A 1ZJYA 2AA3A 2BRUA 2GGSA 3E6AA 1FDUA 2OZPA 4ZICA 2FRDA 3UKOA 2A94A 4R1TA 1H6DA 1ZNQO 4D0SA 4PLYA 3ANLA 3HZZA 1PJ3A 4FFLA 1Y6JA 1GZ6A 1KVRA 1CEQA 3UXYA 3NDIA 5A3VA 1Y5MA 2NACA 4JROA 3ITDA 1D1TA 1A72A 1U4OA 2J5RA 3E48A 4BHTA 4YT8A 4J1SA 1HKUA 4P4GA 4F46A 5TLSA 1CETA 5DDIP 2ZYGA 4EJ0A 2P5YA 3DHNA 4ZQHA 2B69A 4CQMA 1RM5A 1Z82A 2DAPA 1TI7A 4AICA 4R3NA 4L74A 3K2EA 3HFSA 4N18A 1LLDA 2PV7A 2ZYDA 2RAFA 3HUDA 3LQFA 4GAEA 1Q0HA 2EKQA 3OSUA 1T24A 3HN2A 4DPKA 1ZCJA 4Y98A 1MUUA 3VH4A 4PG5A 3MWDB 1QSGA 4WECA 2OP1A 1Y7TA 5KVSA 1PU2A 1VJ1A 1ZXBA 1PQWA 2D8AA 4CV3A 4YJGA 3DZIA 4BUCA 3A4VA 4EUHA 1RYDA 2RH4A 4O1MA 2VWQA 1PL7A 1L7EA 4IQ8A 4R68A 3AY3A 3QA9A 4OOFA 5T6BA 3WNQA 7ADHA 3EY4A 1H6BA 2O3RA 3V2HA 2I76A 3HB4X 3V1YA 1BGVA 5KIAA 3EDMA 4E2ZA 2VUSA 3WBFA 9LDTA 1T2FA 4EJ6A 4CMIB 3KLPX 4BKRA 2BFOA 2VHXA 3PVZA 1CYDA 4BNTA 2Y67A 1A5ZA 1AGNA 1SBYA 2O2SA 1YB1A 3VH2A 3JQ6A 1O5IA 3GF4A 3SC6A 4ZHSA 1TT5A 4UEJA 1EVJA 5DCYA 5BNTA 4A0SA 3OIGA 5HWSA 5K6AC 2BFAA 4P4NA 1LX6A 3DBHA 2EP7A 1NXQA 2R2GA 4IDBA 3IIEA 4M87A 3CMMA 1HDXA 3K9QO 4AVYA 1B7GO 3GUCA 3EZYA 3NGLA 2JHFA 5JDIA 2C20A 5C3MA 3GQVA 4L4SA 1ISGA 4O63O 5JC8A 1J6UA 3WYBA 2PWZA 4IJVA 3ONEA 4GMGA 4FSHA 4D43A 1GTMA 3ZU5A 3ZWAA 3ANNA 1DB3A 1MFZA 3OJLA 2GR9A 2OHXA 5DP1A 1EEHA 3JQ8B 4RJTA 3GPDG 1DEHA 1DRUA 2C07A 4WKGA 4YAKA 1HLPA 5LC1A 3SXPA 4I5DA 4EYEA 4I1IA 4B3IA 3PWZA 1QV6A 1PX0A 1R15A 3AY7A 3HE3A 1BRMA 4RQTA 1C1XB 2CDBA 3DZKA 4O59O 4YJDA 1U3TA 3G3EA 3WYEA 1GPJA 4FGWA 4CMKA 1EFKA 1RPNA 4BGEA 4BO0A 2D59A 4I8XA 3MEQA 3QVTA 4B4WA 1BTOA 3U9LA 3WDSA 5BSGA 2AHRA 4IM7A 3PHGA 5EERA 4YJFB 2VYVA 4K1LA 3CZRA 3RJ5A 4IMRA 1YL7A 3B1FA 3E82A 3I4FA 1DO8A 3O9ZA 4D3DA 1XCBA 4G65A 1UAYA 4AJLA 4WCFA 4BGVA 2YHIA 3ANMA 1XA0A 4WASA 5LDGA 3RBVA 3EVNA 1I24A 2I66A 3N74A 1CQJA 5COAA 3RI3A 1IYZA 2Z1MA 3O4RA 4IDFA 1H6AA 4HFNA 4XDZA 2Q3EA 4ALKA 4BQPA 1IHYA 4NI5A 2Y66A 3U4IA 3RBXA 2CF6A 3ZV5A 4HKTA 3PJEA 2AE1A 3I5MA 2AMFA 2WE8A 1R4NA 3FNFA 3W1VA 1SNYA 4U8GA 2DBQA 1A4IA 1DPGA 1BMDA 5MGBA 5IFLA 1F8GA 4ONEA 4BB6A 3WMXA 1DFIA 5C37A 4QO7A 3WLEA 4ZN6A 3LT2A 2PH5A 4IGEA 3ZWYA 1A9ZA 3K73O 3FTNA 4OHUA 1I10A 3EHEA 4GKVA 2BFMA 5L7TA 2POQX 4BGUA 2CVOA 4PLHA 1YBMA 1GYRA 3ZN2A 1P0CA 4ZRNA 4ZD6A 1R4MB 3ZWMA 1HDYA 4PZCA 5I7FA 5JDIC 1LBEA 1NP3A 5L4LA 1DIGA 1EBUA 4CUZA 5KJCA 5JLAA 1XELA 5HA5A 1HL3A 5L53A 4E5KA 4IS2A 4LVUA 2Q4EA 3RFTA 2D1YA 3N58A 4RVDA 1LJ8A 3CTMA 3ZWNA 1XR3A 3GDOA 1E5QA 4MVJD 5IF3A 1KVQA 2GN9A 4E30A 1DAOA 1X7DA 3ONFA 1E7YA 4GSLA 4RV9A 1W73A 3IMFA 3NJ8A 5TS3A 4D44A 1WMBA 4XJSA 5A4DA 1GCOA 2PKQO 3R6DA 4JIGA 1R0KA 3IKVA 4GX5A 4UUPA 4JBGA 1P1FA 3HQ4O 3I6IA 1P44A 4MKXA 1GYQA 1NAHA 4E21A 4BNLA 3C3XA 4B3HA 2ET6A 4CM7A 1B3RA 3BYZA 1HDGO 1SMKA 1EVYA 2X1HA 3ZU2A 5L45A 3INRA 3AUAA 4EI2A 1UXKA 4QECA 4NJMB 1HE3A 3SVTA 3WSVA 1Y8RB 3U4DA 3BXXA 1HSZA 1E7MA 3JQEA 2OGUA 3ENNA 1HTBA 1HYGA 5KKCA 2BD0A 4NFSA 1WP4A 3RUIA 1ULSA 1K2WA 2R00C 2X86A 2VUTA 2QW8A 4E5PA 3WYCA 3TZCA 1X13A 4NU5A 3OQ1A 5KJ6A 2DFVA 2IDZA 3INGA 4TRMA 5C7OO 1PR3A 4Q3EA 3MTGA 4Z9FA 1PZFA 2C0CA 4J2OA 5KVCA 1MC4A 3KXDA 1YQXA 1B8UA 1E5LA 2BELA 4L8VA 4UULA 3V1UA 1HDRA 1ID1A 1DFGA 5DOZA 4R5MA 4ALNA 4OSPA 3HG7A 2B36A 2DKNA 3ITKA 1J0XO 2GCGA 2VCYA 2P9CA 4ND4A 3PIDA 4Q3BA 2PTGA 3KRTA 3STHA 3BMNB 1KERA 3ENKA 2VT3A 4GVXA 1UXJA 5CHEA 5IDXA 2X8LA 3IUSA 4XGKA 4CLOA 4YCAA 1K6IA 1JTVA 4OOEA 4JCOA 4E13A 1KETA 4J0FA 4CLHA 4I5FA 1AN9A 1YONA 3GNQA 4DA9A 2HCTA 3T7CA 4YEDA 3GC6A 2PR2A 4S1VA 3V2UA 3ZZNA 1UDAA 4OXKA 4CMCA 4GX1A 4GGOA 3IC5A 4KZPA 1VL8A 3PFWO 3DC2A 3PRJA 4YXFA 3C7AA 1MP0A 2P2SA 1O89A 4KUHA 2X0IA 4NZ9A 4NG5A 3CE6A 2R6JA 4XA8A 4FR5A 3E8XA 1Z7BA 4YB8A 1FJHA 1SOVA 1KC3A 3DTYA 1PGPA 4QT0A 1B0AA 4I5GA 2VZ8A 1PJTA 4J6FA 1YB5A 2J3IA 3RSHA 1V0JA 3AM4A 3BMOB 4YT5A 4DPMA 4OAQA 1VJ0A 3BTUA 4BV8A 1W4ZA 3FR7A 3DMTA 4CM4A 1YL6A 2JFGA 2QRKA 3HHPA 3RIHA 4ILKA 2JCVA 2VTEA 2QX7A 4ZJUA 4WLOA 4FJ0A 1UP4A 4YJHB 4EJMA 1ZKMA 2AEJA 4HX5A 1GUZA 1VSUA 1YS4A 1NNUA 3F5QA 4LCEA 4YJGB 2AG8A 2NM0A 1ADBA 3GT0A 1PL6A 3FCOA 1SEVA 2J6IA 4CMEC 2EP5A 2VN8A 4MPDA 2WD7B 1QORA 2XXJA 3GZNA 3AI3A 1KY5A 4RVUA 1BW9A 1O95A 2JKVA 2IYOA 2PZKA 5I9MA 4XR4A 1ZXLA 1VJTA 3U09A 4BNUA 4AFNA 2QG4A 2I3GA 2WMDA 2OORA 3W8FA 2AEFA 4CMEA 4J7CA 3FNEA 3GGPA 1CJCA 3NJ4A 3VKVA 2NVUA 3L07A 2Q2QA 3ZHBA 3EK2A 3I9NA 4B8ZA 4LISA 3R3JA 1V8BA 1GADO 3QW2A 1KVUA 4M86A 1Y8RA 4YBZA 3JQ7A 3HJAA 3KYCA 2O3QA 3CINA 3WNVA 1HYHA 5TJHA 2Y0CA 1LDMA 5G0UA 1I8TA 4PZEA 4HADA 3NYWA 1TB4A 2YHIB 5DULA 3VVBA 4RVGA 2Y68A 3WGYA 3DAPA 4UUMA 4XEHA 1CQIA 2DTDA 4R1SA 1Z7EA 3FNGA 1QLHA 3O03A 1VPDA 3JSAA 1F17A 3P7MA 5ITWA 2IZ0A 2VNSA 2E37A 1KBZA 1OMOA 3JYOA 1VKNA 4E3ZA 3VTFA 4UEKA 4HUJA 1G6KA 3OH8A 3KYBA 4XDYA 5JAZA 2PGJA 1NWCA 1U1IA 3DBVO 1GUYA 3MCVA 4RDIA 1I2ZA 1JN0A 3BHIA 2NADA 3TOZA 1PSDA 2D5AA 2YFHA 1BDBA 3S1LA 4LW8A 3SEFA 5K6AA 4GGPA 3ZDFA 2C7GA 1GQ2A 3ZGYA 3K92A 3F5SA 1ENYA 4R16A 1XDWA 4MP8A 3G1TA 1ISFA 4XYGA 3L0DA 2YFQA 4IJWA 5G0TA 1H2HA 5I8ZA 4PLCA 1R66A 1GAEO 1LSJA 1PL8A 4QFDA 5I7VA 3UOGA 1DLIA 1V3VA 4WLUA 3PGXA 3WJ7A 4UVDA 1GL3A 1D8AA 1S6YA 4XKJA 5I9LA 1SB9A 4URFA 4R9SA 1GZ4A 2QQ5A 1ZIDA 2G82A 4BIIA 3IS3A 1LRLA 1LSUA 2SCUA 4XRRA 4XWYA 5K9ZA 4GQAA 4NBVA 3QHAA 1VC2A 3D4OA 2IEBA 4GX0A 1KS9A 4A03A 3H3FA 4DTIA 4M8SA 4YRAA 5KTKA 1T26A 5T64A 4BGIA 3WQRA 2J3KA 5CFZA 5JAQA 4EBFA 1H0KA 1HYEA 3AUSA 3CZMA 1OFGA 3JQBA 4XJTA 1BXGA 4E31A 3W4KA 1KVTA 4PLFA 3QQPA 4RL6A 4BKPA 3L9WA 3D4PA 3G0OA 3EW7A 3JD4A 4E2XA 1TT5B 4LSMA 4ZQEA 3DMYA 3ASUA 1EMDA 1U7HA 5DCUA 4ZQGA 4RZHA 4YYZA 2TMGA 5ENDA 3L6DA 1YL5A 3F1KA 4NBWA 4NU6A 4CMHA 4PLTA 3LLVA 4WOJA 2C59A 1FDSA 5JPIA 4Q3CA 3PFFA 3QWHA 3JYNA 1PJCA 3AW9A 3BZUA 2W98A 5IG2A 1YXMA 5JW6A 3C1TA 1LXCA 1LDGA 4FBGA 4UUOA 1ADCA 4YAJA 4CMBA 3RUEA 2HDHA 3GFBA 3WWZA 1ORRA 2VT2A 4EW6A 4RF5A 2GZ2A 3U49A 5CEJA 2GYYA 1R16A 2A4KA 3RU7A 2NU9A 4DBVO 1LLUA 4ITUA 4XQ9A 2I5PO 2ZJ1A 4U7WA 1R37A 1XGKA 4FGSA 5JC1A 2AQKA 2X0JA 3GN1A 2V6GA 3A9WA 3WQSB 3WWYA 4JP2A 5KJEA 4M54A 4NK5A 1ZFNA 4YRDA 5CDTA 1YE3A 2JCXA 3KSUA 3S2EA 4II2A 4WPGA 1YKFA 4WNCA 3VPFA 2VQ3A 1CF2O 3R1IA 4YR9A 1PQUA 3F6YA 3NUGA 5B4UA 1QV7A 1JVSA 4CR7A 1X15A 5FYDA 2ZCUA 2HJRA 3BA1A 3FTPA 1HF3A 5FEUA 5KWEA 4LGVA 3MJSA 4BO6A 1NQAO 2CFCA 1PJ4A 4L75A 3ORFA 4A73A 3QWFA 4IZIA 4W9NA 5A5EA 4JBIA 2ILTA 4FIZA 5T8KA 1GV1A 4FOSA 3WBBA 1PZGA 3IJPA 2P4HX 1YBAA 1JQBA 5H83A 4HFMA 2VRBA 4U0KA 2P68A 4NJMA 1DJNA 4WCDA 2QIOA 4CM1A 5EN4A 3KYDB 4OL9A 2JFFA 5TIIA 3QIVA 1LU9A 1AXGA 1X7HA 4DIOA 4KDEA 1YBVA 1E6UA 1M6HA 4MDHA 1TT7A 1OC2A 2I65A 2BI8A 2A92A 1C0LA 2UYYA 3OM9A 2YZ7A 3ZNNA 2QRJA 3HFGA 4CM3A 4CMJA 3HDQA 3OFSA 4RCVA 1EDOA 3GUYA 3U4CA 1DJQA 3PHJA 2FN7A 2NVBA 2VUUA 3HDHA 5DCWA 5TX7A 4LCJA 1ML3A 1C0IA 3RQSA 3CMCO 3GZNB 3JQAB 4QFCA 3SJ7A 1T2EA 5JCJA 1C0KA 5BSFA 4HXYA 5JE8A 1MLDA 1QG6A 1E7WA 1E3WB 2O23A 1LLCA 4U6SA 4HFJA 4Q3AA 2HJSA 2BGMA 5KVVA 1C1DB 2CUKA 3PQFA 4D42A 1XU7A 4MVJF 1DRVA 2EKPA 1UDBA 1ISMA 3VPGA 2YUTA 1Q7CA 2GRAA 4FD3A 3D4NA 2J5KA 4YAIA 2OL4A 4XYLA 4CJXA 1ZSVA 5IXSA 2VZ0A 5U9CA 4I08A 1XHLA 5A1TA 3PDUA 4R54A 4AJHA 1E1NA 4WGGA 1PZEA 4Z0PA 1WVGA 1M6WA 3GVHA 1MG5A 4DC0A 3ZHYA 3LC7O 1GDHA 1JAYA 2GPTA 4B7XA 4W82A 4IY1A 1U7TA 5C7LO 1QXSA 3HWRA 1N8KA 1NFRA 2WM3A 4HFRA 2V6FA 1DXYA 2HKIA 1A7AA 1BSVA 1JDJA 4CV2A 3Q1LA 4OKNA 2EKLA 4PZDA 2Y0EA 4ZQBA 3RC9A
chains in the Genus database with same CATH superfamily
1Z4OA 4XD7D 3LK7A 2MSKA 3LTEA 4ND1A 1HK7A 1L5YA 3D4IA 4G25A 1FOEB 1E4VA 1PFKA 1JDNA 4LK3A 2YOGA 5BWLA 1HI9A 1TJPB 1Q74A 1DRJA 1HGXA 1SY7A 4KI7A 2NTJA 4KH1A 1UBCA 1QO0D 4DNPA 2FPRA 4K6CA 4UHDA 3RGGA 1T3LA 1JDZA 4LZZA 1U3VA 3W5IA 2ZRMA 2FCRA 4K6MA 3CU5A 4QYSA 1E3SA 4ZRDA 1KSJA 4JLNA 4FI3F 4DV7B 1Y3FE 4B3DA 4TUYA 1W48A 2AVNA 1UMDB 2CD9A 3B6EA 3PR2B 3QJYA 5HKAA 1TXGA 3T3GA 3NV9A 1US8A 2P1DA 1JS1X 3I9MA 3IJ5A 5CIQA 3AHDA 4C4PA 3EEBA 4OB8A 2DWOA 5J4HA 3RIYA 3GVXA 4XWAA 1PFVA 3NTQA 4YMIA 3O8OB 3EGOA 3PPWA 4DGSA 1KH3A 3D6HA 3GDWA 5TGDA 1XYYA 5LQSA 3QV1A 1YI8A 2NUTB 4UE3S 5A6VA 4JI0B 2QLTA 2AXEA 4D3YA 1C8VB 1QVVA 3D8HA 1M66A 3WXBA 1BFKA 4G0WA 1BZYA 1A8QA 3TXYA 3KHUA 3KLOA 1MJ5A 1GL6A 2XYQA 2ZT5A 5K8TA 1BH2A 4Y1RA 2QUIA 5JYEA 3NHBA 4PO9A 2ZCVA 4HEA6 4PWZA 3NRCA 4YONB 5KYVA 3WKDA 1I0ZA 1T5OA 3PX3A 4TTPA 3OWOA 4EQ6A 1OA0A 1ZDMA 1ZJWA 5UKDA 2WF8A 4EPWA 3A1NA 4C4TA 3G13A 5ILGA 2P9GA 4D9GA 1Q44A 1GRQA 5JI3E 1RJ9B 4FHGA 821PA 1NF9A 2PT9A 4KPFC 4OHZA 1K8QA 1NR1A 2UYOA 3A0RB 3LV8A 3TZ6A 5DM60 1VGRA 1LW6E 1EXMA 1JHRA 1R4ZA 1VKZA 1E9BA 2AOTA 3CLKA 3PL1A 4KL8S 4LGMA 3FN4A 5IHPA 3F6SA 1NF2A 1KR5A 2PRZA 3NBAA 4TSKA 3A10A 1OWMA 1T9AA 3GZ4A 5JH7A 1P4AA 4RPKA 4C87A 3ONWA 2R8PA 4OATA 3OZIA 1PJ2A 1OB2A 1YGYA 3A28A 3ZV3A 1P4GA 5DX0A 2ATXA 5BSWA 1IG3A 1XJ0A 2GPSA 4FUTA 4I14A 4KQKA 4ZOEA 2E21A 3DXZA 1WMDA 3TTUA 1F12A 2OO7A 2VDNB 3DL2A 3P4YA 3PGJA 4GOMD 2IXGA 3AESB 4D8TA 3GMTA 4EYKA 3GLFE 3OD1A 4KOAA 4DJFC 4MDEA 1YE5A 5FX2A 4MGKR 1BFDA 3ZZMA 3VYUB 1PS0A 2F3TA 2DH5A 2EGHA 1JBQA 3ESQA 5TJHA 3VBCA 5GADl 3FR8A 1UM9A 4M0CA 3ABIA 1ZMTA 4DUGD 3JS5A 5A3SA 1VBNA 4AXBA 5E7MA 3DT8A 5K1ZA 4KWEA 2QAGC 3N8GA 1U7UA 1EAYA 2VUIB 4BAGA 2DZDA 2K7ZA 4GI2A 4Y9DA 4TS1A 2CNLA 3UT6A 2JAOA 1JA9A 5DK6A 5KU7A 4MP6A 4HWSA 3A26A 1GN9A 1W2GA 3GJ6A 4N01A 5FBVB 1P62B 5FHQA 1A69A 1IN1A 3RYIB 5D7BA 4AJJA 1MORA 3A31A 3OZSA 4EL5A 3ACDA 4ENWA 1G8AA 3PNQA 1R9MA 1NT2A 1JHPA 4HMQA 4LHXA 3ENZA 2J7PA 3T4XA 4ZXPA 4G0YA 3QV2A 1SUSA 1DU4A 4OB6A 4CPDA 5IMBA 4XWOA 3HM9A 5A4JA 4DQUA 3EH2A 3DTVD 5GVSA 1W5EA 2XODA 3NBQA 4P4LA 2IWHA 3F5FA 5BQFA 1JR3A 1LNZA 3D5QA 4PO3X 5DB4A 1HH4A 1F8FA 4JBHA 4OK6A 5KDOA 2IHNA 2PUDA 4HN4B 5CYPA 3HWWA 2O1XA 1P1CA 1NVEA 2O4CA 5GWXA 1O77A 1UJ2A 4Q9IA 5EJAA 3LSYA 1YS1X 1IZYA 3ROTA 3GMSA 3U17A 1DKRA 2P2GA 4E5NA 1GV0A 1DKNA 3LCMA 2QTTA 1R9JA 5A4MS 4DIKA 4I1SA 4MVJM 1RQRA 3QIAA 2HPHA 5B12A 3BCHA 4L95C 4QC2A 5I7UA 5BURA 2J3DA 4D9CA 2QSJA 3DZFA 3INNA 5BSMA 4LXGA 5KX5F 1HQKA 1N9GB 2WWRA 1E2EA 4TRJA 4TZKA 1MENA 1VCNA 4MVJI 2C9DA 4BQNA 2QZZA 3A3YA 3O83A 4DMRA 1IJKA 1Y1LA 3H5AA 4CGYA 1Y1TA 3GP3A 2YBEA 2I4MA 3U7QB 4F4JA 4ZC8A 4FS3A 1S2OA 4GR4A 2WAMA 1JYFA 1H2RS 4O02B 5B37A 4BY9E 2PPVA 4IRUB 1ZWKA 1VFPA 2GN4A 1XEXB 1I30A 4BO3A 4DLRA 3OZRA 1FLNA 3O92A 4IMPA 1RJFA 5D2CA 2YNMD 4YUZA 3S29A 1Q57A 1U8XX 2HZBA 1PS9A 4UM7A 3I4CA 1QYWA 5T67A 1LTKA 4JNCA 1K6XA 2HIAA 3K1YA 2VXBA 3SXUA 1V6CA 4G23A 1CR1A 3O3OB 1O58A 1UKZA 4FFMA 5L9AA 4JI2B 1E5DA 5CVDA 3UAGA 4QDXA 3C6YA 3RK4A 5HMLA 3NTRA 1A7KA 4WDRA 3K0AB 3TL2A 3H9CA 4IDOA 1UAGA 2CYAA 3CLTC 3EVGA 1ISJA 3DCIA 3ETGA 1HURA 4BLSA 3RUCA 4CM6A 4QTZA 5KHAA 1GVHA 1FVHA 1XF9A 2E85A 3UWDA 4L8FA 3CUEF 3IO3A 2VTBB 3SSMA 1Z07A 3G82C 2C61A 4HNGA 1SQSA 2WDPA 3K5PA 2PRYA 1RJEA 1R88A 3Q3GE 1U8EA 4J43A 1Y81A 4BBZA 1X1EA 4E14A 1QGUA 2PKCA 3WWCA 3L1JA 4X41A 3SVLA 4MW2A 1G59A 1SAYA 2W58A 2WIBA 4NBRA 1ZD1A 2FN3A 3IESA 4E32A 1XMQB 1DEXA 2FSFA 5HF6A 3PE4A 4M1QA 4A0HA 3OLVA 3GGCA 4JASB 3IGFA 2JIZA 4OYRA 3MSXA 4TUYF 4YA6A 5AT1A 2PX5A 5JPDA 4BXOA 1TYZA 2G1UA 3TO5A 1GNQA 2G9UA 3V8BA 2XITA 3G0DA 4LV8B 5ICEA 1Q84A 2E48A 1GCIA 3KFVA 3MBOA 4LDQA 3TAXA 3UAZA 4I19A 4EFMA 4PYJA 1RW4A 5BP7A 4H6VA 4DQKA 4OHVA 3ON5A 3TQSA 1C7EA 2OV8A 3FLBA 4QYMA 4EKGA 4ARIA 1T0PA 1FFCA 1BNCA 2CVZA 2EW2A 3G0GA 4YRIA 1SWWA 3D43A 1YNSA 3ER8A 3L2OB 1Y42X 2XMPA 4F12A 2J9RA 3D7NA 2EHDA 2VH5R 1HNZB 1KOGA 5TDHA 3NC0C 2XE7A 4AY4A 2EQBA 3FI0A 1Q7GA 4BPRA 3I01M 3Q9UA 3R8CA 2UDPA 2XADA 3A2MA 3L1VA 4JNKA 3DAOA 5LZ9A 4H4CA 4J91A 4TS4A 4AZWA 2BMFA 3F5DA 1CNFA 3GGDA 3JD3A 1G60A 1A27A 1YVRA 4JEUA 4JVLA 4NTZA 1U0OC 1M0SA 2OHGA 2DTXA 2QDXA 1QQ6A 4HF7A 5CDHA 4ZWNA 3ADDA 2V6JA 1P2SA 1WBDA 4UBKA 4IWNA 5ER9A 1LTQA 3ZWOA 2V58A 1QRUA 4WEOA 2X23A 2WHQA 2PUTA 3AU9A 1RKXA 1BHSA 4R40A 2YWEA 4U9HS 2PT5A 2GZHA 2BGJA 2EC5A 4MUGA 1KHTA 2XHEA 2GXSA 1TLLA 4Y8VA 1DKQA 3FB4A 5CNJA 3MWEB 4G0QA 4PHGA 1JAZA 1NBEA 2FSHA 5DNCA 4TXJA 3BWMA 4A23A 2BMWA 3HV0A 1AKQA 1TX4B 3TD6A 2YIVX 2ONZA 1AU9A 1VRCA 4W63A 1J0AA 1CRWG 3ZV6A 4C08A 4DR1B 3HPQA 3EVTA 1U2TA 5JMPA 2X8JB 2OK8A 3P71T 1YCFA 3ND6A 5LOVA 4GLOA 4L76A 3JQAA 4XX1A 4JI8B 3AHIA 4MWEA 3NDBB 2GK4A 2PX4A 5FF9A 1I5EA 1HQDA 1Z25A 3MCZA 3IVXA 3GRPA 2ZRKA 3GRAA 1EE2A 1JG3A 4RQBA 2QG6A 5JU6A 4MVCA 4J0DA 1GTVA 4FLFA 4G37A 1NI4A 1IWOA 5F3RA 2FKAA 3I34X 2A59A 2A5GA 4JT4A 4PC6A 3BXZA 3O90A 2IIPA 2V8OA 3UMSA 4B7UA 2BGNA 5DGHA 2ZCJA 4M83A 1AJEA 3USZA 4UFNA 4NICA 4J1NA 2G71A 2R8BA 2VP0A 4GRIA 4RZIA 4V24A 5F2NA 2E87A 1UBRS 5DN6A 1VSTA 2X1LA 3GOQA 2HU5A 2D54A 3VNRA 3WHLA 5M7EA 1LBTA 4YMHA 4LYJA 4MWGA 3JWJA 2IRWA 2ZRQA 5DV9A 2R1ZA 1X39A 4KRFA 1E9AA 1GG2A 1M8KA 5HS6A 2IYUA 3H99A 3ANYB 5JY6A 2CEAA 4EGFA 1Z0AA 3F3SA 1LSSA 3JQBC 1NNLA 1IHUA 1OLXB 2NNWB 1E8MA 2V7EA 1UFRA 3FCXA 4FNMA 1FSZA 1P9LA 2JS7A 4II3A 5L3RA 3WIEA 4ZMBA 2BP7A 3GEHA 3ZY2A 3C8UA 4MI6A 4Y9UA 5F35A 2Y2UA 2ZM6B 1PW7A 3QMPA 4PG7A 4B6GA 1IK6A 3CZ5A 3PUWA 3QTBA 2O2YA 1TA4A 2Y1KA 1GUFA 3QVLA 3UT5A 4OTZA 1W36D 1V26A 2Z4RA 4TM8A 1IBMB 3H9BA 1SURA 4PM4A 1R7RA 5EJMA 3AEYA 3S2IA 2VAMA 4CQMD 4F11A 1UEXC 3QM1A 5C5EA 5HM6A 3GJ7A 3HJTA 3OQHA 1VYTA 2Q4RA 3E9ZA 3A14A 5F64A 1BG6A 1MJNA 3QU7A 1I2DA 1J2RA 1PJBA 1N0IA 2XE8A 1DC5A 3M1YA 4WINA 3TKLA 1A8IA 2B83A 3RUPA 2Z1NA 3VZCA 5A5FA 2EFGA 3KPWA 4J1QA 1CEYA 1Z3IX 3ICOA 3GGOA 4G0VA 1Q2XA 1QGZA 4MX8A 4EFKA 2EZ4A 2HMWA 2O20A 3L46A 2PK3A 1WULS 4PC2A 4D4GA 5CT6A 4ZVUA 5LCXA 1KU6A 4AJIA 4XB1A 1Y9JA 1V11A 5D3KA 4LWPA 1TUBA 1QP4A 1JKIA 4FX5A 2NO0A 5J47A 1JJ7A 2QN6A 5AVZA 1RQ2A 1TVCA 3VR6H 5IDWA 1RQ7A 5ESRA 4RMJA 3B6JA 4GL4A 3C6ZA 2VRCA 4CQNA 1JPVA 1OX6A 4EFNA 5C0OE 3TLZA 4A2PA 2X6QA 3B6ZA 1TQ2A 4LNUB 3N2KA 3P9PA 3TDKA 3S7ZA 1YA4A 3DC7A 1EG7A 1OXBB 2F67A 2G36A 3ROFA 2CJFA 4DANA 2AV6A 3B53X 4PGGA 3GRRA 4CG3A 1QHYA 3BBLA 1LZLA 2GKGA 1XEAA 1Y3DE 2WYWA 3CIOA 3DL0A 3KQPA 1IPEA 3JQGA 4KQHA 4YYEA 1E0DA 3CF4A 2NSJA 3ETCA 4QFMA 2FRVA 4XQCA 5HM8A 3JQCA 1NRXA 1VM6A 3E9QA 1DX9A 1WZUA 4FT2A 4KUEA 5C8XA 1QFJA 2FMTA 3N2EA 1OBFO 2JI8A 2GB4A 5B64A 3HI4A 1J2JA 1XU9A 1OI7A 1ZVJA 3DCYA 4K3UA 4KACA 3AOEA 1KMCA 5JROA 1F60A 1V4VA 3M89A 4FW9A 2Z2KA 4I55B 2ZROA 5C8YB 2DSTA 5H4GA 2I9KA 5ADUS 1T2NA 1C9NA 1H05A 1IY8A 2CMHA 2LIVA 3STYA 2R8RA 3WGLA 4B75A 6REQB 2PFKA 3AJRA 4A27A 4ZIRA 5HS4A 1XEWY 2CKMA 1N75A 4O2RA 4TKZA 3PZRA 4Q9JA 4DA8A 5FLXA 3K32A 3CUVA 2FLVA 4AKSA 1GTL1 4MUNA 1EVKA 5JDCC 5KAMA 2H85A 4MVJP 3VMFA 4COKA 1RPZA 3WMWA 4RPHA 4ENSA 5LMCA 3TCNA 4E5MA 1NVVQ 1A5TA 3DO8A 4MR9A 3EGIA 3H75A 1IBKB 1NHGA 2NW6A 2QD5A 1RLJA 2WU1A 3L4SO 3E2IA 4NR0A 1QLJA 3KB6A 4WN9B 1CULC 2O9JA 2IZ5A 1L5LA 1FTQA 5HK8A 2NZVG 2VAPA 6GPBA 5KYUB 5EJ7A 4OHPA 4BS9A 2Q5FA 2UV8A 3SQLA 4D4HA 2ACWA 4P3KA 9MHTA 1D4OA 2J9ZB 3OPVA 5D6OA 4FSXA 3WIDA 2ZJ3A 3QFTA 4EPYA 1VZ2A 2A1UB 1LQ2A 2YHUA 2YWGA 3DHVA 1ZGJA 2HBYA 3L4EA 4O4LA 2QORA 3PK0A 4KLZA 5DXFA 3U1VA 3ILVA 1I36A 1KEPA 1N8TA 2LV8A 1C3VA 5AR1A 3LX8A 1DTEA 3PSHA 2HWXA 3UA3A 1G0NA 2IZ6A 3NIBA 3E9RA 3FHLA 4PNHA 1NVBA 2QD2A 1CIVA 1P5HA 1X87A 3OIDA 4U2BA 1S2DA 4TWRA 4ALJA 4EDFA 1V41E 2WPDA 1LK0A 2ZSHA 2WYVA 3TLMA 1HG0A 5EUQB 5EPOA 4LBZA 4GKKB 3HVHA 2V7QA 5B58T 4F4FA 5C4IA 4TZ6A 1YDFA 1M8GA 4J4TA 2P91A 3KETA 3DVLA 4ZVSA 3EASA 3W05A 2BFBB 2GVDC 1SCBA 4BVJA 4OQLA 4M1YA 2WT4A 3DR3A 1EWTA 2ZIZA 2VNKA 2B1GA 3H5OA 3O1HB 3PEFA 3UAWA 1Q0UA 1I4DD 2QM8A 1QCDA 1N8SA 1YZHA 3G8AA 1JVBA 3AHEA 4NHEA 4DC9A 1TMGE 2QYTA 4GI7A 3KR2A 2QENA 4N3BA 5KNCA 1E32A 3EMKA 1T43A 4IILA 2MIIA 3H0EA 1V95A 2A57A 1G8HA 3SZ3A 2I29A 1ORWA 1U5AA 2GLTA 3T5TA 1RC8A 5B2EA 4IHJF 1W96A 1JB1A 1X0VA 2QU7A 4JJZA 5G1NA 3GMDA 1M6VA 5EHZA 4HGRA 2YMLA 3OZEA 1F0NA 1AMUA 1OYVA 4N7RA 4CM4B 1CDOA 1JAHA 4MI9A 2PLWA 4MV3A 4KTVE 5EY5B 3CTPA 4EY6A 3PXDA 4NYMQ 3RRJA 2HHLA 3LECA 1TW2A 3MTQA 2ZJYA 3F71A 2ORWA 4BMDA 4HDMB 5CUQA 1E6WA 4F96A 1QO9A 3GFFA 3VHLB 1ST3A 2PSJA 3P45A 4QU8A 3UWMA 5B36A 4KWTA 2AI3A 3IXLA 1TD1A 1ODKA 5AVJA 3BFKA 1UFVA 2VRNA 2X15A 2LCQA 2H1CA 5TQ2B 4MYDA 4K28A 4DCJA 2DUMA 4H6PA 2CLHB 1UT5A 4KXWA 3U5TA 4UAGA 3T9FA 2PD4A 3MINB 1HQCA 2B8WA 1I9GA 3DFIA 2XCOA 1LDEA 4JT9A 2F00A 4WEQA 2ONCA 5THQA 5A4KA 3HCRA 1CYEA 4GKBA 4LZOA 5CFLA 1ORTA 2AFHE 2CLKB 2HN9A 5TJ9A 2YIMA 2CDAA 3EVEA 5BMVF 4BQPA 2W4IA 3JZMA 4JXKA 3TEMA 2F3SA 2WVJA 1KEEB 1QDEA 2J07A 1HDOA 1RLUA 3P9NA 1KZYC 1W4CA 2MYTA 3KE8A 1NXVA 1TZMA 2RKBA 3DE4X 2O5VA 4ZRMA 1JDUA 2WJVA 1I4EB 1AK9A 2ZBFA 3PFGA 3RUAA 3I62A 1KJIA 3IUYA 2NUAA 2CDRA 4YLGA 4ISBA 2ZUTA 3LUAA 4Y2TA 2Z5FA 1D0IA 2GASA 3EXEB 3AOGA 1M76A 1I5RA 2GVNA 3D8UA 2IL1A 3KPVA 3MTAA 4N8DA 2JLVA 2VAXA 4MW9A 4JYBA 2HL6A 2X6TA 4R1QA 1MEJA 3LU1A 3LD9A 2V6BA 4Z4CA 4EP1A 4UBIA 1MX1A 1YZTA 4L4YA 4J16A 3M6IA 1ZG3A 3HDVA 4WOCA 4Q3NA 3DAHA 3H17A 4M7RA 4QOSA 4WN9A 1G38A 2ETXA 1JEEA 2HPAA 4AO6A 2TMDA 3OJ0A 3QYPA 3EWSA 2C2ZA 1LY1A 4DMMA 1CUDA 1ZU5A 3ULKA 1YJBA 3LBFA 3M2PA 3JW8A 4XYEA 2YDYA 2RBEA 1HNXB 3HB9A 3R3XA 3Q6NA 4I9HA 4MICA 4Y2QA 4GD3Q 4TMWA 2PD6A 3OZBA 1U7WA 4QUHA 5TF4A 4EF4A 2B25A 4TKMA 1E1KA 4RETA 5FADA 2WABA 3ZE2B 1UBFA 1PT5A 2QI9F 4UMFA 5ALQA 4RY2A 5BUCA 4XQEA 4J4BA 4BBJA 5JSKA 2K4MA 4YHHB 5G2OA 4Q3KA 5L4SA 4G8CA 4L3VA 4Q18A 3OQIB 5FP0A 2ZSAA 1X7GA 4KGXA 1GZ3A 2D5BA 1VJRA 3E9CA 3W0LB 1MB0A 3S2FA 1PT7A 1ZOIA 4Q66C 2R4QA 3GLGB 3I2YX 4TYPA 4ID9A 3EYWA 3QJGA 1F4LA 5AOCA 3R8FA 1RJDA 4PLGA 1Q1NA 5BRJA 1UC4B 3DKPA 3LPLA 1CR2A 1OR8A 1QYDA 1MC5A 1GZDA 5AI5A 1XPJA 3O2NA 4BO5A 2YV3A 5MHTA 4WNYA 3ZE1B 4LDPA 4K2HA 5DPMA 3RF6A 1W35A 1U9CA 5E2IA 2I33A 3SQNA 2QXTA 5G4KB 1Z45A 1E69A 3UY4A 1M2WA 1Q16A 3BXGA 3ZE8A 3GG9A 2C82A 3QH4A 2E4ZA 5AW0A 1XNQB 1RLMA 4WY5A 5DLQC 1UPFA 4YDRA 1A4RA 4F3YA 4AKIA 2R84A 3MPOA 1FNDA 3BPSA 4A6PA 2W83A 2PSDA 4C4XA 3VZRA 3X1XA 3P5BA 1KFJB 4UQPA 1UWVA 3MMXA 4ICIA 4IHQA 3E9NA 3NH9A 4MWSA 5JBIA 2EWMA 3HNOA 1MZPA 3X3HA 3IDZA 4EHJA 1KEZA 1J1ZA 1MR3F 2FKNA 4UHHA 4KYUA 3RRNA 4EA6A 1E7QA 4XLZA 3IHWA 2BTQB 5KX5A 1J99A 4JB8A 5CT4A 4DSAA 3KSAC 1QKIA 3D4LA 2H51A 2WIJA 1KJ8A 3KAQA 4I0WB 3GFGA 4UASA 3WNZA 3S1AB 2PH3A 1PUXA 3UJBA 3OP4A 3RAEC 4ME6A 3VNUA 3WSWA 3L7CA 1WV0A 4LJLA 8LDHA 2BMJA 3W1WA 4RADA 2HWWA 3OE7A 4EG1A 4PNPA 1LPOA 1J9GA 4G5HA 3RVMA 2FVXA 4NE9A 7REQB 2YJ3A 1N5OX 1JNYA 3F9CA 3T12A 3IRVA 5GONF 3N0WA 2ZB8A 4HRVA 3R0JA 4UVHA 3JR3A 5CU7A 5IW8A 5I4KA 1Y98A 3PKZA 1UAAA 1LPAB 1K5DA 1W0CA 2NTEA 1XUOA 2ZE7A 2X7HA 3GLFA 2EV9A 2GSDA 3KJHA 4RPGA 4Y2VA 5LDHA 4PN7A 4E0BA 2NO1A 4TYWA 3AY6A 1KEUA 1US8B 3L6EA 3RSLA 2ORVA 3F1LA 3N3BC 5FIUA 2E89A 1ZGHA 3QUQA 4TTQA 4XLTA 1D03A 4RC9A 3VR4H 1HETA 3VM6A 5EL0A 2GXAA 1E3IA 3CY6A 1EUCA 3C7DB 4JLBA 5TT1A 2ZXUA 3QY9A 2PX0A 2G0TA 4RKFA 1C9DB 1K88A 4OXYA 5CNMA 3UHPA 4GMDA 2QBYA 1X1CA 4FCCA 2AFRA 1Y1SA 2H4XA 2XE4A 3TM4A 4UM9B 2G80A 5CITA 5CXUA 2M6SA 1A2BA 2X0NA 3I1JA 2W4QA 2VAWA 4DLWA 4PGFA 3L8YA 4C3UA 5KWIA 3PJGA 2GCOA 1G55A 2C84A 4X84A 3ZCUA 3BMCB 3ZDQA 4GP7A 1AVTA 1NN5A 1IZ7A 1TE2A 4IL5A 5AJUA 1U2DC 1GPUA 3RV3A 3VVLA 3U7JA 2G0AA 1K7FB 1LI4A 3KQVA 4DY6A 2ID9A 5EMMA 3PE6A 4JITA 2CXNA 4Y6PA 3AF5A 1M72A 1II8A 4UD6A 3WL6A 3WFZA 1MOZA 4A82A 1UBKS 3OJWA 1P9OA 1SA0A 4X9XA 5IDVA 3TX6A 2FV8A 2QN2A 4WNAA 2I7DA 4UZFA 3TJMA 3S2UA 4HD8A 2JRCA 4KYIB 4D3ZA 2PV0A 3LHKA 3P9KA 4CLEA 2X8JA 4ISCA 5ALMA 1JHMA 4CN9A 3MNFA 2O0MA 1E2JA 5FUBA 4YUAA 4M2LA 4MQBA 5KTTA 1JSCA 3AUTA 3N6VA 3H4IA 2XUZA 5CX1B 5FWXB 3DDSA 1VPWA 4TSRA 4LYDA 2BWJA 4QHSA 3N5CA 3DKVA 2BM8A 2V45A 1N5LA 4YLEA 5F9HA 1C29B 3K0CC 1Q1GA 2ZJBA 3D6FA 2F64A 3A9RA 1DCKA 3KOXA 3QNUA 4A7PA 2QYSA 4GOND 4REMA 1I0LA 4RFVA 5KTSA 2OPBA 1DIBA 5HGJA 5FDFA 6PFKA 3M81A 3CZ4A 3QUAA 1BX0A 1U8FO 5DM1A 5CVVA 3U3JA 4EAQA 4ZO7A 1PYDA 3FCAA 3WNDA 3C45A 2IXAA 4X6LA 4IHKA 2XMDA 3GUVA 4PHCA 5CGQB 4EK9A 3UHFA 1QOPB 3C7KA 3K71B 4N6OA 5DYYA 3FIUA 3JQFA 4ZC1A 1FFWA 1A9PA 2PUFA 1JG2A 3OG9A 3FHJA 2CLOB 4LK2A 3ABRB 5B53A 4DJ5X 4MNTA 1V9LA 4FJ2A 3EPLA 3PJRA 4DAEA 1N6OA 4ZVOA 1QIDA 3KYIB 4RLSA 3L7OA 1TLTA 1KZ1A 3HMKA 5FI3A 3KG2A 2EL7A 5LBIA 3SFVA 2H9IA 1GGFA 1YCGA 2OD2A 4JA0A 1I13A 4DJDC 3OZ7A 1ECJA 5KTMA 2B61A 2YQ5A 1LUAA 4CLDA 2O2JA 3KKOA 4ETNA 4GF5A 4WOPA 5KO2A 1JLLA 3CR7A 4KAFA 2IV2X 3M4ZA 3CSDA 4H08A 3HB0A 3S1AA 3D1LA 4YDHB 4GBGA 4PIVA 3R9IA 3F2IA 5GIOE 1EDZA 4Y0AA 4AQYB 5L40A 1D4ZA 1E1DA 4Z1OA 1ZUD1 2BSXA 3OTIA 1S0UA 4C0JA 5LQJA 4NOLA 4UUQA 3RBAA 3ZLUA 3QUCA 3W7AA 4MVJH 4GXNA 5JOQA 2JAHA 5I48A 1M1YE 2GPJA 1OWOA 2N46A 3RVSA 3MAGA 4LRTB 5JATA 5IT9A 3CZQA 2JGDA 3B1ZA 4B3SB 1PR9A 1XQVA 4G5GA 4JHLA 3LQQA 1AGXA 4BKUA 2DBYA 2P7IA 4Y3UA 5M34A 4UCQA 1Q0LA 4CEIB 1WKBA 2F17A 1LVUA 3N75A 3U60B 3I83A 1THTA 3T7RA 2ONKA 1P1HA 1XTPA 2QT9A 3A27A 4GDMA 2QTMA 3ZHUA 1A2KC 1CK4A 1GAXA 3RS0A 5DNEA 5F1OA 2JLUA 3CSSA 4IINA 5FORA 5EHIA 1CUJA 1RAAA 1RAIA 3B3AA 2A4MA 2QUZA 2ZOSA 3PIIA 2PNFA 3GUZA 3EFEA 3H2YA 2E4XA 4LMRA 5JNWA 3K70D 2I9PA 2VOJA 3KJXA 1P0PA 1E3DA 3WLSA 1OLUA 2AW3A 2F6RA 5K45A 4E08A 8GPBA 1N5DA 2Q3FA 4C1NA 5MFPA 3EC2A 5ERXA 1AB5A 2KW5A 2DC1A 5KTOA 3HL0A 3RIMA 2WTBA 1PJQA 1OE0A 4NQZA 1QG2A 1GFIA 1GZVA 2XQFA 2TECE 1B0PA 3GHHA 2TYSB 3IBYA 4JCCA 4ND8B 3T9BA 1RBYA 1IRXA 3DAFA 3BXHA 2N1BA 2I1VB 1TTHA 2WVGA 4URXR 1IZ0A 2O57A 2ODQA 3OPYI 2ZBQA 1KY4A 2Q9CA 3O8QA 4B82A 3S1SA 1KQNA 2CL6X 5FPKA 2WWYA 1PR0A 2QG9A 1GN8A 2Q99A 1WD7A 3LXRA 2CVFA 4QGAA 5P8WA 3V33A 3NTXA 2JKYA 1PJRA 2ZRHA 1AF7A 5BY2A 4C0KA 3FMFA 5IDYA 2C2WA 5DP2A 4KLNA 1JAIA 5ENVA 5BNFA 3RABA 3WDKA 3DULA 3GK3A 2H07A 3M5WA 5AHXA 5LBTA 1SZDA 2IXTA 2VHYA 3EZXA 4JJAA 3DBOB 4POAA 3QG5A 3B1WA 3SHFA 4BWFB 4UHCA 4E2YA 1LRJA 1VB3A 1OH6A 2H7CA 3GVIA 5FTJA 1KAOA 2ECKA 1Q1EA 3K15A 3U0BA 1JQLB 3C3WA 1N6RA 4R1NA 3W9YA 2GJ8A 1UMBA 1XZQA 1U0HC 3TSZA 3BZWA 3VYRB 1S7GA 1Y6GA 4DR2B 2FSVA 2EGUA 2P2YA 1R9GA 1KOLA 3BS4A 2DFNA 1DAPA 4H6WA 2R8XA 1XJ5A 2A5JA 2HQ1A 5DYGA 3UKJA 2J6HA 1Z2PX 4DQLA 1SKAA 1DC7A 3K1AB 2HSZA 1J5EB 2OBXA 3HM2A 4KBYA 2JGMA 4H15A 1AG9A 5ABPA 1YI0A 4R3UC 2P41A 5IBPA 4IJQA 1RI3A 3TI9A 4TRRA 4DQXA 4D9HA 3H13A 3EGXB 4JLVA 3V4FA 1KJJA 4YX9A 3KSMA 4UNPA 1DC6A 3PI7A 4UHJA 2P2NA 3K9GA 3N70A 3T5MA 1IM5A 1CQJB 5EWJB 3KUKA 4IS3A 1J5PA 2ZANA 2QYHA 3FMPB 1YKSA 5TPWB 3ROXA 4JJFA 1FDVA 4OQYA 2QTGA 4KK4A 5LYYA 3UANA 1T8UA 4LX8A 3J81k 2RAUA 4MV6A 5JQGB 2CSUA 2ID8A 2BJWA 3RYHA 4BQRA 4E2WA 3HEBA 5C8YF 2OQRA 2IS1A 4MRRA 4KRYA 2PUGA 5B1YA 2O2XA 5KOHB 2JKZA 2HLNA 4WT7A 2Q2WA 1WXDA 3RE1A 2KX7A 1COWA 1JPUA 1Z5WA 1RC0A 3GRVA 1USWA 3AU8A 3NXKA 3ZI0A 4EYSA 4H7EA 1AKVA 1C7QA 4JK3A 3V32A 1DMSA 3EQ2A 4H4DA 5BSVA 4O6VA 5LOVB 4Y6SA 3OPYB 4E7PA 3AVYA 5FUVA 1JHQA 2QN1A 3HGMA 2VBFA 5HTKA 2W22A 3ZHTA 4NNOA 5LYJA 4HT3B 1NBIA 2HUNA 1ZW1A 2B5WA 5DHRA 3HKCB 2OFOA 3GB9A 1GM5A 3E03A 4Q1BA 2ZT8A 1IHOA 2ZZNA 4O2BA 5TGTA 5A06A 2P9YA 2AMYA 4NAHA 4LHWA 5KCMA 3S8MA 1B8NA 2Z9DA 3D1VA 3GFRA 3QLJA 1P0FA 3AZQA 3AG5A 5FUMA 3NORA 1EJ0A 1CUSA 5CCDA 5DTQA 5GONA 1ZO8A 2BBTA 3CNQS 4Z1MD 1EFVB 4IO1A 1WLSA 4PCLA 2CHUA 4KNVA 4W4TA 5JS6A 1NLFA 1RBMA 1Z74A 5GY7A 2QNBA 2TMYA 4PTZA 3CVWA 1RRVA 1GRCA 1EZ4A 3O4GA 5SZKB 5JJBA 2FPGB 3PC4A 5JT1A 2VK1A 1KDYA 2PA3A 3C8HA 3QTLA 1UP6A 1C2TA 3MRSA 1IHPA 4JLWA 4FM9A 5DHFA 4RD0A 1C4KA 1NVAA 1Q0ZA 2G5PA 4K6FA 4WX2B 4GICA 4LNAA 4A1OA 1ATIA 2IS6A 5CDFA 4E5DA 3ZWVA 4OQNA 1NVTA 4L9RA 2D6FA 5HG0A 2VK4A 5CAEB 2GNPA 4XCXA 2PGDA 3WE7A 3QELA 4X7PA 3L4BA 4CUKA 5BQ3A 2ZZKA 5IABA 2GWHA 1H94A 4RTPA 3EC7A 3DEYX 2ZREA 3DDUA 3R7FA 4IIHA 2A78A 4TLDA 3QFFA 2IBTA 3FPEA 4S0ZA 3HN7A 3WGJA 2WJ3A 4U5QA 3KFXA 4HAWA 3R7WA 2ZI6A 2H63A 1ENOA 1ZIXA 2PMBA 3LGXA 2HQRA 3NG1A 3PNVA 4I2NA 1N0UA 5JSQA 1EJBA 1KWGA 4Q93A 3P4XA 4KXQA 1ULTA 4EB8A 1V2HE 3H2KA 1KNQA 1ZN7A 4AJ4A 5KJFA 1RVDA 2WWXA 2WSSD 4BMCA 2VEOA 4PYNA 1NBWB 5HKKD 1QE3A 2KBEA 4EYQA 3Q3CA 3ZLJA 4UBOA 1F6DA 1D3AA 1LLQA 3F98A 3I3SR 1GDDA 4J0QA 2W2XA 2PKQP 1T2VA 1E59A 5HIAA 3ELWA 4HUQA 3NANA 1R27A 3H84A 4YCBA 4ZPXA 2O1EA 4DM3A 1CSEE 1XD8A 2HYDA 3I9V1 5EIHA 4B79A 8MHTA 2JD0A 1EE1A 4OK3A 1O96A 1UANA 3EUFA 5HCNA 2VP9A 4ENQA 5LOVF 3NBZC 5DNVA 3BSFA 3D8NA 4MQ6A 4XM0A 5EHNA 3IFSA 3BMCA 3ZY4A 4E22A 4J07A 3LLUA 4F5YA 5CFOA 4MRMB 3HCCA 5BXYA 1P1JA 1UKAA 1QYRA 5JXJA 2HMAA 1H22A 2CN1A 3LLMA 1P73A 1OGJA 1HORA 5BNIA 4LECA 3WDLA 1V25A 4MKGA 4PGMA 2FW7A 1GEGA 1JWBB 2HZ7A 3HNRA 5AUPB 1ZICA 3SICE 4KN6A 1XHEA 3DXFA 3RU2A 3UHAA 3W2GA 2J6BA 2HO5A 1DVRA 2YJGA 4X8OA 4LVOA 3IUEA 4Z0HO 1H1TA 5FEMA 3UWSA 1TJNA 4EMBA 4ZCRA 4UEOA 1QRAA 1CFZA 1TUGA 3M9LA 4QVGA 3BERA 2QLLA 1CZRA 2ISQA 2OBMA 2X0RA 2X2OA 3CYFA 1B2LA 4B74A 1VSVA 3CZCA 3WLQA 5BV2P 5C4GB 3V7NA 3BB1A 3WGIA 4PZPA 3H83A 4RTKA 1W49A 1W76A 1RP7A 2WVAA 2K5UA 2I6QA 3GFSA 2ZATA 3TLEA 2BIFA 3B3JA 2FUCA 2H2GA 1QGAA 2Y1XA 3AZPA 3JVIA 4OIMA 1RFLA 1LV7A 3AQ4A 1VB5A 1XLVA 2DWCA 3DEZA 4AROA 5KMGA 4C76A 4WZBE 2Q4BA 3QE3A 4EVQA 1S2GA 1HDZA 1TAGA 3C7TA 2P3SA 3MCAA 2X19A 4LXQA 4M22A 3ZV7A 1XA4A 3FNIA 4M0KA 1XTSA 4GBMA 5FPYA 3UJ6A 2NSDA 1SKYE 1WZCA 4RDHA 2BHNA 4C20A 4GDFA 1CVRA 2K7FA 3EODA 1I01A 4JP3A 1W93A 1ZP6A 4BAUA 2G5GX 3JALA 4WK6A 1G16A 2Q7DA 4ENRA 1NHWA 3TJZA 5A03A 2CCKA 1X19A 1R64A 4MKXA 2VSFA 1AE1A 4M1SA 4OHKA 3SYKA 2IUEA 1M54A 4DNOA 2XTNA 4UW9A 5BV8A 4NPHA 3FOFC 2FOLA 3F7MA 4L16A 1Q14A 1EUDB 1P77A 1T5SA 3NYIA 4IQGA 4J0EA 1XDBA 2IZ7A 4NV0A 3SS7X 3RAFC 4L6IA 2YCLA 4C21A 4KRXA 2P5SA 2REBA 4CIXA 1MAAA 3LNTA 3ZOZA 1ZXXA 4RZQA 3MERA 4LKRA 3G8BA 4O4IB 4O0LA 1FUKA 2P2LA 2Y93A 3DSRA 2ZTUA 1QVZA 4UUNA 5I9TA 5IARA 2DY0A 3WK9A 2PYIA 4JP8A 3CLSC 1LPPA 1N2XA 3O1JC 1K9VF 3QE4A 1GT6A 2XVXA 4RZSA 1OA1A 1U2DA 3UGKA 3KHKA 4A4DA 3EZ9A 2W8ZA 4I36A 3DZBA 1NMSA 5TPZA 2DPXA 3L5KA 4YPOA 5KQMA 5JNRA 4N41A 2YUIA 4JZYA 2LTAA 4BCCA 3QX3A 4ES6A 5DASA 3SJUA 3VZQA 2R7KA 4D41A 3T3IA 2D1SA 2CHFA 2O1WA 1NV9A 2D00A 2JF0A 4N0EA 5F12A 2WIKA 4GPAA 5HUJA 4RIIA 4E5YA 4CDMA 1DOHA 2J0SA 4OI4A 2ZPUA 4GXTA 5C1OA 1RXWA 1GNSA 2GDZA 1PWEA 1UZAA 4M0FA 1W1WA 5G1OA 3O75A 3PBKA 1P0MA 5AKYA 2IH5A 3H8JA 4M9QA 4ZT6A 1W87A 1M0WA 3A4MA 2GYVA 1T5LA 3DS8A 3H9QA 3NAMA 2YWXA 3KUXA 1BA2A 1ZVQA 3GN2A 2OVFA 2F62A 3IURA 2O3SA 3VQTA 2WYUA 4PEVA 1HY3A 3L8CA 2G63A 4MO2A 3DR5A 1KAHA 5DX1A 3KK0A 5EIBD 3A70A 1F06A 2FPXA 4FEYA 4BC1A 1W1UA 1XTQA 2AOTB 3EDQA 4YRJA 4BB9A 2IP4A 3LHSA 1E18A 1MGPA 2I6TA 4FMCB 4DCGA 4PTLA 1GYPA 2YS7A 4K9DA 5G40A 2HGSA 1HEYA 2Z4TA 4IFEA 4LRUA 4BMOB 3JD0A 4MKRA 3T7IA 2D2IA 1MDFA 4NYJR 1N25A 4MUEA 4OBBA 4QBFA 5J40A 3RFCA 4H1VA 4W9RA 3E05A 2PN1A 4PV7A 2CL0X 3VPDA 4ECEA 3MZ0A 4J49A 3J81A 2XQIA 4JQSA 4U3JA 2C1ZA 1YZGA 3DMTC 1ONPA 2CLSA 4Y1RB 5DF1A 2F3RA 4GLLA 3EVZA 1QUFA 3DKRA 3JSXA 3LCRA 2G25A 3FWPA 3KOOA 3W79A 2I1QA 3TW6A 1LF0A 2NVOA 1HE4A 2AXQA 1QZXA 2GNOA 2MR5A 1KIFA 1ACJA 1S4QA 2OCGA 1L7RA 1JVNA 2QVCA 2VTVA 3I6BA 3DEAA 3PFBA 4RK1A 1NMEA 5H3CA 2G9NA 5HVNA 5A2QA 5C52B 1Y6RA 1UBSB 5EMJA 4RTOA 1N5KA 3Q9SA 2O2GA 2FOXA 2H1LA 3EBOA 4JJGA 1NLYA 1XV5A 3HY3A 4KWHA 4MUIA 4NJEA 3CEMA 1CUXA 5F9MA 2XJ4A 1H2YA 4DWWA 1E2QA 2YJ6A 3ANTA 3RLFA 1XFDA 3CUTA 3BGOS 1P3DA 3DWIA 2PR7A 3ONDA 3W2TA 2Z5LA 1WM1A 3H9JA 4ZZ3A 1L6RA 1E8NA 2P9HA 4J90A 2Z6AA 1ZMOA 4P7KA 3BILA 3UMMA