9LDTA

Design and synthesis of new enzymes based on the lactate dehydrogenase framework
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIHNLLKEEHVPHNKITVVGVGAVGMACAISILMKELADEIALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSRLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPNCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWILGEHGDSSVPVWSGVNVAGVSLKNLHPELGTDADKEHWKAVHKEVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKENVFLSVPCILGQNGISDVVKVTLTPEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and synthesis of new enzymes based on the lactate dehydrogenase framework.
pubmed rcsb
source organism Sus scrofa
molecule tags Oxidoreductase(choh(d)-nad+(a))
molecule keywords LACTATE DEHYDROGENASE
total genus 100
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1991-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 9ldtA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 9ldtA02
3WGYA 1AHIA 1P31A 3EDMA 3D0OA 2HUNA 4EUHA 5CG2A 4BO9A 1ZJZA 4LN1A 4DLBA 1RKXA 1UP7A 4EGFA 4D41A 4TZTA 3HNPA 4RZIA 4EEZA 4IS2A 4AVYA 4R3WA 2NU9A 2UV8A 3IP3A 4IJUA 1I30A 1NWCA 4K6CA 4PG7A 4WASA 1I2ZA 4YT8A 4GPD1 1NASA 4BMSA 2PZMA 2AQ8A 4MIEA 3ORFA 2EKPA 4DUPA 4B79A 3FD8A 5BSGA 2FMUA 2NM0A 1WPQA 2ZATA 5I7VA 2IDZA 2VHVA 4E2ZA 4UUMA 4KTVE 1T2EA 5JCJA 1GEGA 1DLIA 3BMOA 3UOGA 3HDYA 2Y1FA 1NPYA 4RVUA 3JQ9C 1B26A 1KY4A 1DOHA 4EBFA 1X0VA 5EIOA 1XDWA 3QE3A 3OIGA 3CKYA 4L73A 3PJEA 1PS8A 3D1LA 3O03A 4GI2A 3D3WB 1BG6A 1QYWA 2HK9A 1QV7A 4MP8A 3QP9A 4LCJA 4CQLB 1E7QA 3UCXA 4UVGA 1ADCA 1YVEI 3E9QA 4J0FA 4WCDA 4GMFA 1E3WB 2IXBA 4WEOA 2DKNA 1RM3A 4O0LA 4RPHA 1L1FA 5HRUA 1CYDA 4ZHSA 2B37A 3AI3A 3GPDG 2PGDA 1XYGA 2PWZA 5A02A 1EK5A 4I5EA 3IL2A 3RAJA 2HJRA 1A7KA 4ND1A 4K28A 2C82A 5CDGA 2ZB4A 3JD4A 2B0JA 1M6HA 4XRRA 3ZWWA 5CFZA 1IHYA 2GO1A 3Q11A 4ZICA 3HDHA 3HFGA 1UP4A 3U4HA 5IZCC 3OIFA 1P1JA 5EERA 2RIRA 2YZ7A 3GFBA 4PCVA 3IUPA 3KSUA 1WP4A 4OSOA 1HYGA 3LC7O 4YAGA 1G1AA 3DZFA 4CM1A 2FPPA 1T2FA 2GCGA 1OC2A 3ZWVA 2ZYAA 5JO9A 1O89A 3UCFA 3RJ5A 5BNTA 3G0OA 1SAYA 3QVXA 2PGJA 4DREA 3NGLA 1DC5A 2Q4BA 4CODB 1HSOA 4DLAA 2X0JA 4KP7A 1OAAA 3ICPA 2J5KA 1HETA 2Q50A 4GX5A 1WLYA 3LF1A 3F1KA 3RQSA 2DFDA 3RBXA 4L76A 3KETA 3UW3A 3RFTA 1OBFO 1LQTA 3GZNB 2EP5A 4RVGA 3H9QA 1TT5A 5AXCA 1XU7A 3TFQA 3U49A 4M55A 4EW6A 2VWGA 1RM5A 4DPLA 4A5OA 5K9ZA 4FFPA 4XDZA 2ZB8A 2C5AA 3JQ9A 2ZTVA 4L74A 1VJ1A 3ST7A 3D5TA 5JC8A 1P3DA 3OSUA 4UVIA 1LBEA 1U28A 1ZZEA 3RUHA 4WNIA 3A14A 4XYBA 3V8BA 1B2LA 3RVDA 5A1TA 1PEDA 4HWKA 3JD2A 2BI8A 2C2XA 4RO0A 1XEAA 2YFQA 4TRRA 1U3UA 1H5QA 4CMGA 1NX6A 2WE7A 3QVSA 4M87A 4NPCA 4YTEA 4E5KA 1EVJA 3T7EA 4F45A 4CR7A 4AJOA 4HBGA 2PZKA 4FC6A 1R0SA 3ZNQA 2BELA 4KZPA 3TZQA 4JX8A 4ALNA 4RVHA 1NPTO 1GR0A 4XIYA 2X0NA 1DIGA 5DN9A 3BMQA 2AEFA 3KVOA 4J9UE 4EUEA 3F47A 3HUDA 3GMSA 4RDIA 1B3BA 2WMDA 2IEDA 1LLUA 1EMDA 2I65A 1XLTA 2B69A 4YYZA 4FR5A 4XQCA 5IXSA 4YJFA 1GQQA 4DC0A 3JQBA 2G82A 4W7IA 1JW9B 3AY6A 3K6JA 4U7WA 1U3VA 4GSLA 1TI7A 2JCXA 3EHEA 4JP3A 1QG6A 4ALJA 4L9RA 3D3EA 5TJHA 5A3VA 1A4UA 4YA6A 3VDRA 5CAEA 3G1UA 4CMEC 5JYDA 4NFHA 4IDGA 3CSDA 2VHZA 1YL5A 3PTZA 1JAYA 5LDHA 1E3WA 4ID9A 1C1DA 2VOJA 1LRLA 4UUPA 3M6IA 2FPGA 3LT1A 3KSZO 2WYUA 4D45A 2DM6A 3GA0A 1SB9A 1X7GA 1E1LA 4LCEA 1B8VA 1TB4A 4UUOA 3RU7A 3IJRA 2G17A 2C7GA 2VTDA 2VZ0A 3OQBA 1HTBA 5CHEA 1ENYA 1I3MA 2AG5A 2JHFA 2H5LA 1E3EA 4QECA 1ENPA 1ULUA 3LYLA 1QSGA 2ZK7A 3PPIA 1GPDG 3WQQA 3W6ZA 3NDRA 3ZNPA 5BSEA 1C3VA 3HFSA 3RUCA 4BO2A 2OL4A 3IP1A 3AM3A 4GVLA 5JSFA 5MDHA 3P19A 4JROA 5TSDA 3OETA 1BVRA 2OBNA 1LEHA 4B7XA 1ULSA 1J0XO 5T57A 3U4DA 4UREA 4Z3KA 1O8CA 1UDAA 1LRKA 3D4OA 5JAIA 2P5YA 4GGPA 1WXDA 3O4RA 4O59O 4CV1A 3A4VA 1YQGA 4IGFA 3ZWAA 4WLOA 3DXFA 3PP8A 3U0BA 4FFOA 1HE3A 2UDPA 2X6TA 1UP6A 4ALIA 5IAAA 1ONPA 2AQHA 3TL3A 4EJ0A 3W8EA 3JQGA 4IXTA 1FK8A 2NTNA 3MTJA 1WMAA 4U6SA 3S55A 3NTRA 3U9LA 1G6KA 1TT7A 2NVWA 1T1SA 2BFMA 1LXCA 2R6JA 3CZRA 2D0IA 3RFXA 4E5PA 1H9AA 3F1LA 1Y6JA 3NT2A 4BNNA 1O9BA 3P5SA 4HY3A 3TZHA 3ZI0A 1I36A 4M86A 4H16A 1DB3A 3KLPX 4M1QA 1NFFA 4DLLA 3QWFA 2DVMA 1E0DA 3RIHA 3ZGYA 2HSDA 3HHPA 3PQDA 1SO8A 4XA8A 4BO4A 1KBZA 2VRBA 3R3JA 4YT5A 3W4KA 4DQXA 1DAOA 4YACA 1NWHA 3JQFC 4W9NC 2IEBA 2BKAA 3AY3A 2GPTA 2J6IA 3I5MA 3NX4A 5DOVA 2JD1A 4CMJA 3OA0A 3IMFA 1KS9A 4YRBA 4N7RA 1EQUA 3I9LA 1S7CA 5G0VA 3QIVA 4M89A 1SNYA 2FN7A 2EERA 4BOYA 2YHIA 2P4QA 4MP6A 4PLCA 3PHIA 4Q3NA 4CM6A 1GZ3A 2C07A 4PLZA 3L4SO 4J90A 1MP0A 4DWVA 3DDNA 1EQ2A 3JQEA 5KVSA 1KETA 1UXKA 2YYYA 1UXJA 2AG8A 4YJHA 1GEEA 5T5QA 3MWDB 4BMNA 1CETA 3AU8A 1SMKA 4MKXA 4BNHA 4TVOA 2XXBA 3OP4A 4BNFA 2DPHA 4JBGA 2NTVA 4GGOA 4D0SA 2UVDA 4LRTB 2HJSA 4ZD6A 4QX6A 2J5QA 3PYXA 1LJ8A 5DULA 5A9SA 3VTFA 3VZSA 3FI9A 3WYEA 3VZRA 3LT0A 1MB4A 1V0JA 4F6LA 4AFNA 2VWPA 3U5TA 2GDZA 4YJHB 3ITDA 4CLXA 3IJPA 3JYLA 3RUFA 3AOEC 2D5AA 4CMEA 1IYZA 2V6MA 4ITUA 4QTZA 2PKRA 4W4TA 5THKA 4A0SA 4B7UA 1YBVA 1ZH8A 4EDFA 1UXIA 2PZJA 3KB6A 3TF5A 1IHXA 1AXGA 4NU6A 2RBEA 4BNUA 1MXFA 3I4CA 3RUIA 3I9JA 1I3LA 2EW2A 1XIVA 2VHYA 3ROQA 5I9LA 1F14A 4YCAA 5ENVA 3IQDB 2OOSA 4R5HA 1YB1A 2Y93A 3PXXA 4J1TA 1GQ2A 4UVEA 3JQ7A 1JKIA 5GY7A 4WEQA 3DAPA 3GRPA 2V7PA 3FCOA 1W73A 3VTZA 5AXAA 5I8ZA 3NUGA 4QT0A 2IRWA 1I8TA 4CQMD 4E3ZA 1LTHR 3L6OO 1WW8A 2ZIZA 4JGBA 5THQA 3TZCA 1I3NA 4FOSA 4J1NA 1B0AA 1ZK3A 1ZCJA 3GNSA 3A06A 1BDBA 2EIHA 3FPLA 3L9WA 4WLVA 3UVEA 3NTQA 1O95A 1X7DA 4B4VA 4JBIA 3WWZA 1PJBA 4HUJA 3GH3A 1ADGA 4XYMA 1PS0A 3ADOA 1TEHA 3H9UA 2JD0A 3NYWA 7ADHA 5IG2A 3OF2A 4MPDA 4B3HA 1LNQA 2BFOA 3BMCB 3MEQA 5KJ6A 2G1UA 5ER6A 4AJHA 5JDCC 3BXXA 2OORA 1I33A 1ZO8A 3EMKA 4XZ3A 1SOVA 1ZSVA 4IIUA 1IPFA 9LDBA 4NBVA 3GAFA 5F3RA 2WWRA 3UFXA 2X0IA 2V6BA 1Z7BA 1XQ6A 1R6DA 4CL8A 5COAA 5G4KB 4KUGA 4UEJA 3E5RA 3I9OA 4IJWA 2A9FA 3ETEA 2HMWA 5IFLA 3AU9A 1GAEO 3MOIA 5COQA 4N5LA 3ENKA 1P77A 1ZSYA 3LVFO 1Y5RA 5I9NA 4G81A 5LCXA 1PTJA 2DQ4A 3M2PA 2NADA 2YQ4A 3BAZA 4PRLA 1ARZA 3I9NA 3QWBA 3E82A 4Y9DA 3LU1A 1GV0A 3ONEA 2DBQA 3ZH2A 1NFRA 2DT5A 4NBTA 4E0BA 1ZKMA 1X15A 3Q3CA 3AM5A 1Y8RA 3LLVA 4JJIA 4IZHA 3SBOA 4J16A 5GZ1A 1DBVO 1JA9A 3PK0A 3GVXA 2V6FA 1J4AA 4IDAA 1M67A 1R4MA 4FBGA 2C59A 2EKQA 1YJ8A 1E7MA 1LSJA 3COSA 3HB5X 1DFGA 1NTOA 4HFNA 3GC6A 1X1TA 1AUPA 4FPXA 4TMFA 1P1HA 4QUKA 1MG0A 1Y5MA 4Q3EA 3VKVA 4YPOA 3DMYA 3OMLA 3SJ7A 3B20A 2BHLA 2NU8A 1GD1O 4YAIA 4OM8A 4U0KA 4YT2A 1DLJA 1NVMB 3PJGA 4CMAA 4BKRA 4CR8A 2ZB3A 3ZHYA 4YAEA 1Q1NA 3CZMA 5TGDA 1GADO 3S1LA 5JLAA 5B12A 1V6AA 4CQMA 5A03A 1V35A 1A9ZA 3DZGA 4AJ4A 3VVBA 3DMTA 3WXBA 4JK3A 4RL6A 2AE1A 1D1TA 4GMGA 2HDHA 3ABIA 4MVJA 5ES3A 4B3IA 3UCEA 1FJHA 1E3IA 2CSUA 4HKTA 8LDHA 5H81A 2PA3A 3T4XA 1HRDA 1AE1A 1J5PA 4B4UA 1EUDA 2PKQO 2Y67A 3SJUA 1RWBA 3H3FA 4FDAA 5U1PA 2B4TO 1GPJA 3L6EA 1BXKA 2WD8A 4Z9XA 1KVRA 4U5QA 4GX0A 3MJCA 3JCZA 4GWKA 2PK3A 3FWZA 3RROA 4BNLA 3L9XA 3EY4A 4WK6A 4OOEA 5L95A 3AOGA 3G17A 3AFMA 4K26A 4NG5A 4QFDA 1KOLA 2ZB7A 2F00A 3RBVA 1DIRA 1GCOA 3DTYA 3VVCA 4CV3A 4CM8A 2O3UA 2GR9A 1DC4A 3RUDA 3ZW9A 1ENOA 2X22A 4PG4A 2YQ5A 3ZV4A 2O4CA 4B4WA 1VE9A 4AJNA 1V3UA 2QHXA 5IDWA 1ZNQO 3OECA 5DOZA 5G0UA 1JVBA 1Q0QA 2OZPA 2HCTA 3QY9A 1DEHA 1YKFA 2FWMX 2GASA 1BXGB 2V6GA 2BFPA 4WE3A 4Y67A 2JFGA 4NMHA 2GZ2A 1GQYA 3OQ1A 3ZCXA 3N74A 1K3TA 4B8ZA 2WYWA 3WMWA 1DC3A 4CMCA 1N1GA 1SBYA 5A06A 5TLSA 1PJLA 1GUZA 4B3JA 3E8XA 4OSPA 3WTCA 4F46A 4KOAA 4LK3A 4C4OA 3GY0A 3B6ZA 1E7WA 4FFNA 4E5MA 3EAGA 2AA3A 5ENDA 3HE3A 4BUCA 2PD3A 5HA5A 4RVDA 5AYVA 2OXIA 1UH5A 4ZU3A 4A73A 3N58A 1KEPA 1U9JA 2Y1EA 3WGOA 1TT5B 3EVTA 4BNKA 5C37A 4WLNA 4MDHA 1YL7A 2JCYA 2VYNA 4R51A 2CDAA 3HWRA 1Q0HA 2YV1A 5CDTA 4J4HA 3K8ZA 3ZU3A 1U5CA 3JQCA 4RPLA 1DJNA 3HDQA 3KHUA 5ADHA 3WDSA 4BNJA 4L4RA 4LRSB 3EZYA 3ZV3A 4IJVA 4D0RA 2ET6A 1JQBA 4JNKA 1BXZA 1JVSA 2BI7A 5A9TA 3ONDA 4RPGA 4RORA 3SC4A 6ADHA 1DAPA 5JS6A 5DBFA 3DR3A 3JQAA 5A04A 3FSRA 5EL0A 1KVTA 2CVZA 4J4BA 3IIEA 1RM0A 4P38A 1LA2A 3ZHXA 4CUZA 1NR1A 1WMBA 2ZKLA 3WMXA 3PIDA 4LSWA 4F3YA 4Z0TA 9LDTA 3OEWA 3L77A 2EHDA 3C8MA 3PFFA 2QQ5A 4TRJA 4XGKA 5DNAA 3CMMA 4MVJG 2PZLA 5G0SA 5JFOA 1K6IA 1KC3A 4TROA 3PRJA 2NACA 5A9SB 3PWZA 5TF4A 4JLWA 1GL3A 4NU5A 2OBYA 1X1EA 1WZEA 2BGLA 1MUUA 1AXEA 2QYSA 4J7CA 5AOVA 4WCFC 4P22A 1P0FA 2NV6A 5EJ2A 4ALMA 1OZAA 3LC2O 2Q2QA 2J3JA 2PD6A 4J3FA 2EV9A 4MVJH 1ISIA 3G49A 4WPGA 4BNGA 1N7HA 4MVJI 5BSFA 1PJCA 2EXXA 4HADA 3ASUA 4IINA 3AUSA 3LK7A 4Y6PA 2IE0A 3HB4X 1JWBB 4CMHA 1OOEA 2PD4A 1RYEA 2OO5A 5BNIA 4HNGA 4GX2A 2WDZA 3V5NA 3AUAA 4YQYA 1G0NA 3MWEB 5BR7A 2EW8A 3L0DA 1E5LA 3F6YA 1TXGA 1NQAO 3AOEA 3QHAA 4CLDA 3ASVA 3GEDA 3KTDA 4QO7A 4GKVA 3WIEA 1QP8A 4C7KA 1JKJA 1EUCA 5EQFA 1QYDA 4CPDA 1DIAA 1ID1A 3AWDA 3D5QA 3JQ7B 1C14A 1VJTA 1VL6A 1PJSA 3OIDA 1NXQA 5C7OO 4LW8A 4RV9A 4LVUA 4Y6SA 3JQDA 3O8QA 3F3SA 1HF3A 4E4YA 3DONA 4YRAA 1LDEA 5L53A 1H94A 2HU2A 1PU2A 3VDQA 4OQYA 1LSUA 4RLHA 1PSDA 3H9JA 3H4VA 2OHXA 1KVQA 3K30A 1NVTA 1R37A 4RVFA 2O3QA 3QW2A 4ESOA 2VNAA 2VYVA 5JY6A 1KEVA 5GMOA 3S2FA 1BHSA 3PHHA 3G79A 3SLKA 3V2HA 1Y8RB 4J9VA 4AJPA 5EINA 3B1KA 1XWFA 5F1PA 1XHLA 3KYCB 1QLHA 5DZSA 3RKRA 2BFAA 1K2WA 2G76A 1BGVA 1Z74A 3ITKA 3TSCA 4A03A 5FFFA 4AG3A 4ALLA 4DPMA 2OP0A 2PLAA 3STHA 1DXYA 1Y8QA 4OH1A 2B83A 1XA0A 4J2HA 4MKZA 4ND4A 3PZRA 3ULKA 1JU9A 1V9LA 4PVDA 4BO5A 4P4LA 2CF6A 1CIVA 1HDZA 5KVVA 5CEJA 3K2EA 5DCWA 4WLFA 2DAPA 1TLTA 1QYXA 4OXKA 4YJGB 3HADA 3W4IA 3DQPA 5IF3A 3ZV6A 4DXHA 2W2LA 3DZKA 4BO1A 3D7LA 4CMIA 2CZCA 3FRJA 5IDYA 2C2YA 3QSGA 1NNUA 2DC1A 3TNLA 1Q2XA 3UKOA 1C0PA 3M1LA 4WJZA 3PJDA 3PWSA 2E4AA 4ALKA 3R1IA 3M1AA 2CMDA 3CINA 2X5KO 3U4CA 2YV2A 3RI3A 5H83A 3NJ8A 3WYBA 4FSHA 4DC1A 4EJMA 1B3RA 2NU6A 3WGHA 1H6DA 3K92A 5L40A 1N8KA 3CIFA 3F9IA 3MTGA 4KTTE 4Q39A 4D42A 1Q7CA 2LDXA 5DT9A 2EGHA 3UF0A 3WX0A 1DDOA 1H6CA 1SEPA 4BNIA 1HE2A 1XGKA 2QRJA 1ML3A 5BSHA 1GTMA 1FDUA 4OKNA 4TVBA 2E82A 4IJKA 5F5NA 1SB8A 4FJ2A 5CG1A 3H6KA 1ISFA 1PQPA 3A28A 3FWNA 3JQGB 1WDMA 2GGSA 2W4QA 5T67A 3NAQA 3DMTC 3PJFA 4A26A 1BTOA 2GLXA 2ZJ0A 5DCUA 2B4QA 4FD3A 3WNQA 5TT1A 4YJGA 1ZMTA 3H5RA 3ONFA 2D2IA 1E1KA 2JD2A 1XU9A 4Z9FA 5IN5A 1ZUD1 3S2IA 3TJRA 4AICA 3VH2A 4GLOA 4A7PA 2Z1MA 3HZZA 4J91A 3OQ6A 5HM8A 3OFSA 3Q0EA 4AJJA 4R1UA 4ZQBA 4CM4B 1PWXA 1A5ZA 1U2GA 1A7AA 8ADHA 2Y0EA 1YQXA 1ZMOA 3RU9A 5JXWA 1PJ2A 4CM7A 3H8VA 2Q1SA 4XEHA 2H63A 3CMCO 3KYCA 2CF5A 3TZ6A 2VUSA 3GN1A 3ZNOA 2VZ8A 4BB6A 4J7XA 1IUKA 2H1SA 2VN8A 3V1YA 3RFVA 2I9PA 1P74A 2WM3A 1QXSA 3ZWCA 3H2SA 4WUVA 4F6CA 1I32A 3BMNB 3DZJA 5T6BA 1P9LA 4YB8A 3WFJA 1HL3A 3JD0A 3BHJA 3OJFA 2Q1UA 3U62A 3QV1A 4D3DA 1VSUA 4NZ9A 5C7LO 4R1SA 5FWNA 2VYND 3JQAB 1JLLA 4FJ1A 2JFFA 3BA1A 1ZW1A 5FF9A 1U1IA 2J3IA 1YE3A 1BW9A 1P33A 2ZQZA 4CV0A 2IZ1A 3KV3O 3GPIA 5JMWA 3WSWA 3VPHA 2RHCA 4H7PA 5JDIC 1I2CA 3GN2A 4NBWA 1HKUA 5L51A 1CERA 3BMQB 4NJMB 4ZN6A 4CLOA 3F5QA 1GY8A 5AXBA 1OC4A 4UVDA 3RWBA 5IZ4A 3VOSA 1FXSA 1L7EA 2W2LD 5JO0A 4KQXA 2UYYA 4BO7A 2O4UX 2NLOA 2ZTLA 1O5IA 5JYEA 4OJNA 4TSKA 1CWUA 3DOCA 4KDEA 3G1TA 3AW9A 1LX6A 3I23A 5T64A 4XKJA 4CLHA 3GG9A 1Z75A 4IXWA 2O50A 4WKGA 4RZHA 1CJCA 3C7AA 3NDJA 4PLVA 1E7RA 5G0WA 1GV1A 4X54A 2WSBA 1U3WA 4IQ0A 1U8FO 3JYNA 2Q49A 3C3XA 1O0SA 5F21A 2Q4EA 3I6QA 3H9EO 4MIOA 1IL0A 2Q2VA 1ADFA 1O6ZA 1VKOA 2EF1A 1LDMA 4YVFA 5TT0A 5F1KA 2VCYA 3HQ4O 3OM9A 3GGOA 1KIFA 2YV3A 2RHRA 4PZDA 4WNCA 3R3SA 4BNZA 3D4NA 2Q2WA 3LSYA 1PL8A 2PR2A 2BH9A 2R00C 1BWSA 2C20A 4UAGA 5AQ1A 4RF2A 2GRAA 4DRYA 1U5AA 1Z73A 1LDYA 1DIBA 2NWQA 5KJFA 4NFSA 4GSKA 1LSSA 5FYDA 2HMVA 1T1RA 3OH8A 3PEFA 4KDFA 3V1TC 1LQUA 5JCJD 5K6AA 2Y1GA 4IBOA 3K73O 2X9VA 4DQUA 4FN4A 4WLUA 3I9KA 1KERA 1PZEA 3TPCA 4ZRMA 5F5LA 5IZCA 4CM9D 2VUTA 1BXGA 5A4DA 4L8VA 1T2CA 2NQ8A 5HS4A 3Q2KA 1NM5A 4E2WA 3GVCA 2WEKA 3RUEA 3BMNA 2E37A 1H93A 3NGXA 5JDCA 3PHJA 3B1JA 1V3VA 4J1QA 3GGPA 2Q1TA 4W7HA 3PLRA 2VOEA 4L4XA 3L4BC 4ZJUA 1I0ZA 4I8XA 1YRLA 2CDCA 2QZ9A 1U7TA 1LLDA 1ZSNA 3VPFA 3AJRA 2X0RA 2O7SA 4CLOB 4R3NA 2B4RO 1CEQA 4XB2A 4RLSA 3GRKA 1PL6A 2R00A 4YAKA 3PZBA 2NVUA 2WJPA 3PGJA 4O1MA 3O38A 3GT0A 5L7WA 4FJ0A 3CE6A 3GZ4A 4E31A 1K6JA 2QG4A 1EBFA 4MVJM 4BNTA 4XWYA 3NEPX 1F17A 1KEUA 3D64A 5IJZA 1PZFA 5I7FA 1C1XB 1D1SA 3ZWMA 4XYGA 4HV4A 4BKPA 4BB5A 4RF5A 3UN1A 2HKIA 4PIVA 4CJXA 3GG2A 1HE5A 3NKLA 4J49A 3T4EA 4BGIA 3VAZA 1NR7A 4D44A 2Z95A 4CUKA 2FRDA 5C5IA 2GZ3A 3RC2A 4Z9YA 4WGGA 4CQLA 1E6WA 2X5JO 4OGWA 1PWZA 3ANMA 2AHRA 3FR8A 3RC1A 1PL7A 2DUWA 4ZVVA 3L6DA 1LC3A 3SEFA 1N2SA 1GDHA 1IPEA 3AUTA 2VRCA 3JQ6A 2O7QA 2YDXA 3WS7A 4Q3CA 3ZWYA 4DIBA 2DTDA 4BIIA 4I08A 2NTJA 2HRBA 3F46A 4KWIA 2YHIB 1Y9AA 3GAZA 3V1UA 5JPIA 4Q3AA 4CMBA 3NT4A 2YJZA 3SLGA 4CLRA 4XYEA 4J6FA 3EYWA 5JCXA 4HFMA 3FNFA 3GGGA 4XCVA 2GN9A 2FSVA 2J5RA 2TMDA 5JE8A 4BV8A 4FCCA 3LZ6A 1U3TA 3DBLA 3AY7A 1UXGA 4NFYA 4R41A 5FI3A 2D3TA 1E7YA 4NNJA 1VL8A 1NQOA 1NBOA 2FP4A 4MVJD 3I1JA 5U9CA 2HK8A 3W8FA 4BGEA 2QRKA 3P7MA 1E3SA 3LF2A 3ZWBA 3BTOA 3FR7A 3P2YA 3F4LA 4R16A 3PYLA 5TX7A 2RAFA 4I5DA 4D3SA 1R4MB 2D5CA 1ISMA 4N54A 2CUKA 4MP3A 1KVSA 2AE2A 2ZYGA 1QORA 1MA0A 3AI2A 2E49A 3SXPA 3R0IA 5CPFA 1M66A 4NK5A 2FR1A 4R54A 1ZIDA 4MJLA 4INAA 4PRKA 4PLPA 5ITWA 4KUEA 5L7YA 3BIOA 3WLEA 1GYRA 1ISJA 2ZTUA 1D7OA 4CM5A 1H6AA 1P0CA 3PIIA 1DO8A 4LMRA 2I3GA 4RVSA 3LDHA 4ZQEA 4II2A 1AHHA 1ONOA 5EN4A 3C1TA 3B70A 4BKOA 4IQGA 4Y8VA 5FEUA 5KVQA 2GSDA 4IDBA 4NJMA 3G3EA 3DZHA 4PN3A 2BMAA 3IS3A 2DTEA 3WB9A 5B1YA 1FDVA 3QJ5A 1WNTA 2EJVA 3KBOA 4P8RA 5L45A 4PLTA 3LC1O 3DWFA 1X0XA 1HZZA 1GUFA 4ND3A 2BLLA 2WE8A 1GFSA 1HDXA 1NVGA 5A5FA 3CXRA 1QYCA 2GYYA 4AJ1A 3MOGA 2HMUA 2C5EA 5JDIA 3T7CA 3W8DA 5CEEA 1PZGA 1B15A 4R1NA 3WSVA 3KYBA 3OBBA 4XR9A 3V2UA 3WGQA 4Q9NA 1LU9A 2FR0A 3BMOB 3V2GA 3DHNA 3WQSB 5I8WA 3BZUA 4R4JA 1MGOA 1W0CA 2O48X 3TRIA 4BS9A 1PJ4A 5CDYA 2E48A 4CR6A 3F5SA 4AJEA 3QVTA 4ZQGA 3INTA 2GF2A 2VWQA 4IS3A 2X4GA 4AJ2A 1P1KA 1NQ5A 3GNTA 4RDHA 3QVOA 5L4LA 1EVZA 4C7JA 5DBGA 4JBHA 5ICMA 1EUZA 1XKQA 2EGGA 3RC7A 4AL4A 3TQHA 4XGNA 1BRMA 5JAZA 4QEDA 2ZQYA 1CRWG 4BHTA 4LVCA 3RC9A 3IKTA 4KUHA 4S3MA 4BL5A 3CPSA 3WLFA 3FF4A 1QLJA 1B8PA 3L07A 3DZBA 1M75A 2P9EA 2UUPA 1EDOA 4L0QA 5G4LA 3VZPA 3AFNA 4TZKA 1J49A 3QRWA 4GQAA 4PZEA 3RD5A 4EI2A 1SPXA 2NVUB 3KXDA 2JFHA 1ISHA 1U7HA 2GD1O 3DAFA 4IDEA 3GNQA 3JQ8B 3MJEA 1RJWA 3S8MA 3VH4A 2JL1A 3GDOA 4XX0A 5I7SA 4EEXA 4O63O 3WTBA 4XJTA 2CY0A 3TOXA 2X9NA 4CLEA 2PGLA 3PI7A 6LDHA 4YQZA 1WAMA 2Q46A 5TJ9A 2Z5LA 2XF8A 3IC5A 3PGXA 1U4OA 2AEJA 4R68A 1DIHA 1YOVB 2A35A 3GDGA 3INGA 3KEQA 1DHRA 3KSDO 3PLNA 4WECA 5DDIP 3MJ4A 1P1RA 5BQFA 3WICA 1YL6A 3TDKA 2XOXA 4WCFB 1XCBA 2IZZA 4N18A 5GZ3A 1NHGA 2IZ0A 2ILTA 4K9DA 4OO3A 4CMIB 4AJKA 4NBRA 1HDOA 1N1EA 1WZIA 3Q1LA 2FSSA 5A3JA 1DC6A 1KEWA 3OA2A 3EW7A 1FF9A 3CH6A 2C29D 1MC5A 1XQ1A 2DU8A 2X58A 4FW8A 4IMRA 1LDNA 1MXHA 2VZ9A 4URFA 4TQGA 4XGIA 3U09A 2DBVO 2J3HA 4BO6A 3UXYA 2PFGA 4QO8A 1FDWA 1DSSG 1DRVA 5I7EA 5TRTA 4IDFA 2O23A 5CEFA 2OMEA 1KY5A 1EK6A 1ZXBA 5JNLA 3WQRA 1UZMA 5KKAA 3X2FA 1V3TA 1NYTA 3WYCA 3X2EA 1UJMA 2YDYA 3IDSA 1DRUA 1VJ0A 1MFZA 1M2WA 4PG8A 1VM6A 5DF1A 4I5GA 2JAHA 3HG7A 1LLCA 3ZDFA 1JKFA 3E18A 3HJAA 4BNYA 5G2OA 3DTTA 2J8ZA 4IMPA 4Q3DA 4YAJA 3OJEA 4OHUA 1Q0LA 1KC1A 3EC7A 1YDEA 4D46A 4Z6KA 3H9GA 1L7DA 2B5VA 1OI7A 4BKUA 4NR0A 4DQVA 1R4NB 3GQVA 4BNMA 3KOUA 1MV8A 1C1DB 4GBJA 1MLDA 4Q3BA 4JCOA 4JN6B 4BQRA 1E1MA 4U6QA 1SEVA 1Z82A 4B7CA 3U4IA 4J2OA 4Y98A 3PHLA 1W8DA 3LQFA 3DFZA 1UAGA 1T4BA 4RCVA 1PGNA 1ZEJA 1Q7GA 4EZBA 4DVJA 5L4SA 2AW5A 4UULA 3S2GA 1E6UA 1PR9A 3NT5A 3VZQA 4XQEA 1MFPA 2CVOA 5B4VA 1EFKA 1I01A 2A4KA 4IPTA 4TRMA 4ZQFA 3PQEA 1XELA 4UUNA 5F1OA 4PGFA 2DPGA 2HMTA 2EP7A 3VPXA 3VPGA 3IOYA 3FTNA 3MJVA 1VKNA 2VNSA 4G2NA 4M54A 5B4UA 2H6EA 3FNEA 2P68A 1YB4A 1V8BA 4DIOA 3BTVA 3TL2A 5L4NA 2Z1NA 2DFVA 3KZVA 3ON5A 4W9NA 4DBVO 1GCUA 3FHLA 5TQVA 1SZJG 4DA9A 4R5MA 4CUJA 4A2CA 3RJ9A 4JXKA 1U4SA 4PLGA 1ADBA 3JQBC 5IDQA 1PJQA 1B7GO 1A72A 5KVCA 2PNFA 2IODA 3TZKA 1LLQA 1EVYA 4M49A 4MVJE 2WD7B 2WTBA 4O5OA 2VT3A 5EESA 3K96A 2GERA 3VPSA 1UR5A 3WWYA 2PY6A 4FFRA 4ZRNA 3DL2A 3KYDA 4DYDA 1B14A 1YGYA 4R01A 1AN9A 2YW9A 4YWJA 5EQDA 4CM4A 3JTMA 1R66A 4FB5A 1PS9A 2WYVA 3I83A 4QQRA 1R4NA 5T8KA 1MC4A 1I24A 4Z0HO 1P1FA 2EJWA 1XSEA 2O2YA 3UICA 5L9AA 5COBA 1HYHA 3C1OA 4ND5A 1IZ0A 1PR3A 5ER9A 3KUXA 5MGBA 4MKRA 2CDBA 2A92A 1HYEA 4YEDA 1D4FA 3VH1A 2VQ3A 5HBRA 1X7HA 3RCBA 2PH3A 1VC2A 2I3AA 1K6XA 3JQAD 1R15A 1B8UA 3EK2A 4KWHA 4YRDA 1NHWA 4W6ZA 3PDJA 2I5PO 1MX3A 3I52A 5KJ1A 4ROSA 1F12A 1HDGO 1WVGA 4JJGA 3E48A 1R16A 3GVPA 5TS3A 1HT0A 3ZNNA 5JC1A 3ZWOA 1YOVA 5U4QA 4GKBA 2NU7A 3MJTA 3OICA 3DBRB 2OP1A 4PG6A 2P4HX 4NI5A 3ZW8A 2NUAA 3EUWA 1VSVA 3WNVA 5JBIA 4PVCA 1SOWA 1YJQA 4NHEA 5JAMA 2HLPA 4GAEA 4Z0PA 2GZ1A 3SX2A 1Y81A 4MOWA 5TC4A 2AXQA 1ZXLA 3UUWA 1F0YA 1CQJA 3K5PA 2O3SA 5EPOA 2FPIA 3GVIA 3ETDA 5J23A 3WR5A 4E2YA 1H6BA 3A9WA 5A5EA 1PZHA 3U3XA 3DBHA 2P9CA 1YO6A 2R2GA 4PZCA 4WOJA 2D1YA 1RYDA 4WCFA 3WOHA 3GEMA 4FFLA 3ZU4A 2V65A 2VRCD 5CDUA 3MZ0A 3GHYA 4FFMA 4GL4A 4HFRA 4E21A 4ZGWA 3ZZNA 2Y1DA 4XRGA 1DFHA 2YY7A 1KVUA 3H5NA 5IXYA 2JAPA 2QRLA 3GUCA 4IM7A 4JQCA 3GR6A 1IZ9A 1H0KA 1TA4A 2RH4A 5EMHA 1IE3A 4GX1A 4MO2A 5T8KC 5KKCA 2GN6A 3Q2IA 4HNHA 5JMPA 2FY8A 3PDUA 2P2SA 1K5HA 1M76A 2AEMA 4K1LA 4JJFA 5KIAA 2AQKA 1BSVA 2HAEA 1H9BA 1EDZA 3DEYX 2FZWA 3WGGA 2Q99A 4XYLA 4CMKA 5CDSA 2PTGA 1ENZA 1SCUA 2DUUA 1E5QA 2C0CA 2QX7A 4HX5A 4Z3DA 3GEGA 1D8AA 1WWKA 4EYEA 4D79A 4LGVA 2XPCA 4CQMB 4PFJA 3RUAA 5AXDA 2AMFA 1LC0A 2W8ZA 5KWEA 4IDDA 1LRJA 3N7UA 1LUAA 3DOOA 5B37A 3NDIA 3D4PA 1P1IA 3FBTA 2Y0CA 3DFUA 4OMUA 1N9GB 4OIMA 3QWIA 4NDNE 1ZBQA 1UZLA 4BO3A 2DLDA 2HMSA 4I9NA 5IDXA 1E3LA 2X8LA 4FC7A 4TKLA 2O3RA 1R12A 3ANNA 1PGOA 3IAHA 1ZK1A 3DBRA 3M2TA 5AVOA 1EEHA 4DPKA 3WGZA 4XQ9A 4YJDA 4II3A 1CQIA 2BGKA 4I9UA 4IQ8A 1F8FA 4LMPA 4YT4A 4YXFA 1A71A 2H9IA 5FI5A 1T4DA 5ILGA 4HFJA 3W6UA 2YFHA 3TFOA 4DYVA 3ZN2A 3PYMA 2BF7A 3ROMA 5L7TA 5BT9A 2ZJ1A 3DBHB 1T2DA 1O94A 3AUUA 3IKVA 2C7VA 1YBMA 4GVXA 1AGNA 4JP2A 4HP8A 4EITA 4J1SA 3BTUA 1I2BA 2NNLD 4RJTA 3DHEA 1PQUA 4E12A 4E13A 3EVNA 3F4BA 2O2SA 4PLWA 3H7AA 3VH3A 3GFGA 4TWRA 1FDSA 2VHWA 1H2BA 2X23A 1LDBA 2X7HA 3DBLB 1LSOA 4XIJA 1HE4A 1HDYA 4RQTA 5G4KA 4MVJP 3KO8A 1ZK4A 4KMSA 4AJLA 3SC6A 4CV2A 2EEZA 1U2DA 2WD7A 1JTVA 1XR3A 1JDJA 1M6WA 1UZNA 4YR9A 1FDTA 2X86A 1DPGA 3WGIA 5DCYA 3FNHA 4FGSA 3UHAA 4UVHA 2VUUA 3BMCA 5IN4A 3C24A 1HWYA 3FN4A 3JD3A 3GK3A 3JD1A 4I5FA 4M8SA 2F1KA 4DBZA 5CP8A 4BGVA 1N5DA 4R9RA 2X1HA 3GDFA 4RPKA 3O8QB 4NK4A 3ZU5A 1SC6A 4OL9A 1D3AA 1ZFNA 1QMGA 3I4FA 4DIFA 1XG5A 1VRWA 3K31A 1PQWA 4D7AA 4PLYA 2CVQA 2EWMA 1Q7BA 2P91A 4IDCA 4W82A 1PGPA 5DP2A 5CPBA 4E5NA 1UAYA 3GUYA 1ZK0A 3ZV5A 1IY8A 5HTOA 3RASA 4WOKA 1A4IA 5L3ZA 4E2XA 1DHTA 2QYTA 5LC1A 1NAHA 3DHYA 3QWAA 4E6PA 2TMGA 3FTPA 3C7DB 4BV9A 4FOOA 1RM4A 1IULA 1Z6ZA 3E6AA 3ADPA 3E5MA 3QLJA 1HLPA 1Z7EA 4YDRA 2IXAA 3DBVO 4QXMA 1GZ4A 3NRCA 3HSKA 1PJ3A 1UDBA 2VHXA 3NJ4A 2ZYDA 4S1VA 4DTIA 2I99A 3OJLA 4J43A 2Y1OA 2E6UX 2GN8A 5I9MA 3INRA 3WGTA 1PGQA 1E1NA 4U0JA 1UUFA 4DMLA 1VI2A 3KYDB 5GZ6A 4XDYA 4B4OA 2NQTA 5G0TA 1YBAA 2AQIA 4NQZA 3WBBA 1X14A 2B35A 2NVBA 1OFGA 2X9GA 4MVJF 2JHGA 5A05A 3H3JA 5LDGA 5KNLA 4NH4A 4UEOA 4P4GA 1EZ4A 1JWAB 3K2BA 4R9SA 4W99A 3OJ0A 3E1KA 3ROPA 3ZWNA 3ENNA 5C7IO 3WJ7A 4TRNA 1IB6A 1LDGA 3SVTA 3ZWPA 2QW8A 2Y0DA 2I67A 2FHSA 1I3KA 2Q3EA 3LLSA 1N92A 4P4NA 5KJCA 4KQWA 4XB1A 3WG9A 2FOIA 4ZQHA 2C54A 4XQGA 2YUTA 3JQFA 4TKMA 2P9GA 3AK4A 7MDHA 3OEYA 1UDCA 3Q9UA 1HDCA 2B36A 1NAIA 4RF4A 2I66A 4CM3A 2SCUA 4FIZA 5KTKA 3UH1A 3B1FA 1HXHA 3ETGA 2PV7A 5KCZA 4U8GA 2HK7A 1I10A 2ZCUA 3BHIA 3GLQA 3PQFA 4K6FA 5B4TA 5JY1A 1BDMA 4ILKA 3PVZA 3E03A 4IZIA 3Q9NA 3PFWO 2O3TA 4E5YA 3GOHA 4OXNA 3E9MA 3DOJA 4CL3A 2UUOA 5A9RA 2Y05A 3O9ZA 3WFIA 4BQPA 2VT2A 3TWOA 3DZIA 2Y66A 4IUYA 3C85A 1HZJA 1F06A 4IY1A 3HN7A 1E6EA 1LI4A 3VC7A 3ANLA 5HS6A 3PWKA 1P44A 2JJYA 4WLEA 2LDBA 1R0KA 1YS4A 1VLLA 4DMMA 3JQ8A 5JAQA 3OJOA 2HQ1A 4OYRA 4RF3A 3JV7A 1JAXA 4R69A 2PH5A 1GU7A 3HDJA 2G5CA 3DC2A 3MJSA 2J3KA 2O3JA 2CNBA 4NIMA 5HWSA 1GZ6A 3FNGA 4DGSA 1EE9A 3H65A 4RPJA 4BNXA 3UAGA 3KLMX 4CM8B 5DP1A 1J6UA 1GUYA 2DBRA 4AJIA 1Y8QB 4OXYA 1WDLA 2QIOA 4A27A 5ITVA 1UXHA 4RQUA 3AI1A 1RPNA 1YWGO 1EE2A 3K9QO 2BGMA 3UGKA 2IYPA 4LSMA 1GYQA 1PGJA 1E92A 3BHMA 4J4TA 3RBZA 1BW9B 3CEAA 3I3OA 1JN0A 2A94A 1CDOA 2D4AA 3D3WA 2DTXA 3ICCA 4QFCA 4B8WA 2QZZA 2FZEA 4IGEA 2DBZA 3LT4A 1K0UA 4BKQA 3H2ZA 3WBFA 1Y7TA 3R6DA 1BVUA 4H3VA 2G0TA 5H82A 4OAQA 1C0KA 4D43A 3JYPA 1W4ZA 1Y1PA 2EG9A 4GWGA 1DFIA 4FGWA 4R1TA 5TIIA 1EFLA 1IOLA 3JSAA 3RSHA 4Y6RA 1N9GA 1Z45A 4NJOA 3P2OA 1U8XX 2CFCA 1FMCA 4QSMA 2OFPA 3C1AA 3Q6IA 1T25A 5ILOA 1QYVA 4BMVA 2RH8A 4N5MA 4HXYA 3FPCA 2VYVD 1QR6A 4RGBA 4NBUA 4BVAA 4DL9A 1BMDA 1E77A 4G5HA 3I6IA 3GHHA 2OGUA 1GYPA 4UEKA 4YJFB 1K89A 3KEOA 3ZHZA 5K6AC 1NFQA 1ONNA 2BRUA 4D3FA 3ZU2A 1ZVMA 1YB5A 2Q45A 3ZWXA 2GNAA 3CTMA 4BNVA 3A1NA 2X5OA 1YONA 3EGOA 4XJSA 3WJAA 4EJ6A 1HEUA 2P5UA 2B5WA 3EZLA 3W1VA 3CUKA 3RKUA 4I9HA 4XD2A 1EVIA 1NP3A 1TVEA 2W2KA 3WIDA 1C0LA 2EKLA 4E32A 2GN4A 4GH5A 1YQDA 5JW6A 1X13A 2I76A 2IYOA 4IIVA 4J7UA 4J0EA 4MIYA 4BO0A 2RCYA 3NTOA 3VHRA 2Y1CA 1OMOA 1H2HA 4OQZA 1G0OA 2VTEA 3DAGA 1ISGA 3GF4A 2CD9A 1YDWA 1N7GA 3MCVA 4I1IA 1KYQA 2HO5A 5KOIA 2BD0A 4ONEA 3L4BA 1W6UA 2D59A 4ZA2A 1CF2O 4YBZA 1DRWA 3DO5A 4H15A 4BNWA 1YH3A 1YXMA 1QRRA 2NSDA 2ZCVA 2ZTMA 1E7SA 3JYOA 4JIGA 4N5NA 1T24A 4PG5A 4E33A 3JYQA 3DB2A 1I5RA 3ROKA 5TNXA 1DJQA 4LISA 4MINA 1F8GA 4EUFA 1C0IA 1WDKA 3S2EA 2POQX 4FQ8A 1QV6A 5DBIA 1A9YA 1T2AA 1VL0A 2W98A 4GLLA 1R0LA 1B16A 3QA9A 3E9NA 2OUIA 1ORRA 2Y99A 4L75A 1E3JA 2YHUA 1ZJYA 3KM0A 3H5AA 5BNFA 3GZNA 3QVWA 4OOFA 3TOZA 4CM9A 1PX0A 4O6VA 4PLFA 3VKUA 3BTSA 2VWHA 1VPDA 1EBUA 3KRTA 2W90A 1A27A 4OKIA 2Q1WA 2JCVA 4G65A 1HDRA 2XAAA 3LT2A 3TN7A 3OHSX 3BYZA 1PIWA 2I6TA 1HSZA 3NV9A 5K0ZA 1NPDA 3O26A 4FS3A 1MG5A 2FR8A 1HLDA 3HN2A 3IUSA 2W2KB 3GVHA 1Y9EA 1ZEMA 1P45A 4E30A 1PJTA 3GMDA 4A10A 5C3MA 2D8AA 4ND2A 1C1XA 1NQTA 3AM4A 3FBGA 4PLHA 4CLRB 4BGUA 3PHGA 4L4SA 2HRZA 1ZK2A 2XXJA 2Y68A 3C7CB 1T26A 3QQPA 5ICSA 4BO8A 2GUGA 3W4JA 3QWHA 2UAGA 1S6YA 2JKVA 5KJEA 1QKIA 3ZHBA 3I9MA 4XR4A 2PKQP
chains in the Genus database with same CATH superfamily
4AMBA 3WGYA 2E1RA 1P31A 3D3KA 1E2FA 3EDMA 3HO1A 1XKLA 3DE3X 3QGMA 1HPLA 3CPEA 3H2KA 3UV7A 1DKQA 4N3CA 1UP7A 4EGFA 1QVWA 4C4XA 3UG6A 4GE0A 4W6QA 4EJSB 2HWWA 4QLAA 4ZVPA 1WHSB 1OWLA 1NP6A 4P34A 3FXAA 2JBHA 1QUFA 2J3QA 2C2BA 4IS2A 4Y9UA 1GGVA 2QPLA 2NU9A 1BKSB 2X3UA 3IP3A 2XA1A 1WW3A 4LYJA 1JFSA 1I30A 1WSDA 4YT8A 1DBSA 1I2ZA 4GPD1 1SVNA 3M7IA 2PZMA 4MDYA 1BKDR 2JIZA 2EKPA 1C80A 2QTZA 3JVDA 2QTRA 3U81A 4B79A 3WZ2A 4K8RB 5D3QA 5L3VA 4RW0A 2NM0A 4GECA 5E4JA 1OTXA 1R0WA 2GZDA 2NUTB 3OEHA 1H2XA 2KW5A 2YY6A 3DOUA 4UUMA 5A6VA 3L0CA 3SM3A 4TKVB 1M2EA 1SA0A 2NO7A 3QU7A 1DLIA 1LTKA 1XAJA 3P9IA 1IY9A 4KOEC 4RJ2A 1B42A 3HDYA 4BPBA 5LBUA 3WFZA 1DOHA 5HHTA 1X0VA 5JPDA 2CLEB 3Q10A 4LYEA 2ZB2A 1XDWA 1K92A 1YI1A 4HZUA 3DGFC 4MW2A 3QE3A 1KARA 3OIGA 3CURA 3KQNA 1SPBS 2NGRA 2CNOA 3DZ8A 2P77A 5G53C 3M83A 3O8OB 5GJCA 3D3WB 1XAIA 4OHYA 1ZGZA 4MW1A 4D2IA 2A7XA 1UMCB 4UVGA 3BWXA 1TM1E 2BKLA 1D2MA 2O1XA 4QDJA 1E3WB 2XMZA 3Q3VA 2BDUA 5A0FA 3I9FA 2H4ZA 2QJWA 1L1FA 5HRUA 1JZSA 1J2TA 4ZHSA 5IYZA 1LY1A 1OHHA 2FPMA 4YUXA 4E46A 2PGDA 4DY4A 5JJBA 1KRWA 3UNXA 2PWZA 1OZFA 5AKLA 2ALJA 3RC8A 3IL2A 2WB2A 2C82A 4GNKA 3GRRA 1VI6A 3RTDA 2Y1LA 3Q11A 1WIWA 4BWFB 2XD9A 4ZICA 3HFGA 4DR4B 3H9BA 5AJYA 1IBSA 2RFLA 3K09A 3IPAA 1P1JA 1FU4A 2N42A 1L5HB 1WOMA 3OQPA 1HYGA 2IEZA 3LC7O 2MOKA 5DWVA 4YAGA 2F3UA 4K81B 4HGZA 3TMAA 3DZFA 5DXAA 2VJOA 4CM1A 1JLMA 3T7TA 4RKFA 5CU7A 1EM8A 5JO9A 1CDDA 5BNTA 4AF6A 3G0OA 1VDZA 1FXUA 2YWFA 4RWEA 3DAYA 5INTA 2PGJA 4B3DA 4DREA 3K9FC 4FWTA 1DC5A 4HXFB 2Q4BA 2Q9UA 3FYCA 4AKTA 4BFUA 1BS2A 4QUAA 3RRFA 2JFUA 3IURA 1EFRD 4QM6A 4EY5A 1XZKA 2Q50A 4GX5A 1X39A 2WJGA 5EGSA 4ACBA 3R5XA 4HDSA 4LK2A 3RBXA 1Y7IA 1PT7A 3RFTA 3BH6A 3G2QA 5H0IA 4A2QA 1M1YA 2FW1A 3LQKA 1T35A 3HKBB 1XU7A 1Z12A 3L7IA 3RT9A 3E1SA 5CA0F 1D2AA 1EDEA 1MW9X 1RM5A 2VWGA 4XH9B 4DPLA 3ET4A 3CIOA 4P5PA 1TO1E 4LY0A 1I1HA 4KR9A 3OC6A 3SC2A 4A5OA 3D6TB 4FFPA 3MTBA 4NH0A 3I04A 3DHVA 3TQTA 3I42A 4OHZA 2JIOA 2IE8A 1OI3A 2PGXA 1RD4A 1GZ7A 1LBEA 5J40A 5C0OE 3LCUA 4AN4A 2B25A 4RZUA 2W71A 4FIDA 3I2JA 4H35A 4MUMA 2Y3IA 4RIGA 3RUHA 1B2LA 3U7GA 1U2TA 3F6CA 2CMHA 5K0EA 2Z2ZA 1CUGA 4HDMA 3DVAB 4HWKA 4L6CA 4OXXA 3DM9B 4TQ9A 1RWMA 4WBNF 3DYIA 5L3SB 2ZM5A 2C2XA 3FTDA 1MPXA 1ILWA 4GPZA 4TUYA 3DP9A 3KTOA 2ZSFA 3UC9A 1TE2A 1S3FA 5CVTA 3FOFC 1W1IA 2FG7C 2NXNA 4CKWA 1U3UA 2J7KA 4MQ4A 4W1QA 1SUSA 4F06A 2R3SA 1MEOA 1YQWA 3N59A 4M87A 1N5KA 2ECOA 4TS1A 2RGYA 1UIRA 4G0XA 5TE9A 1NJ8A 3V3KA 1UBCA 3EG9A 4FE3A 1CTQA 4HBGA 4C0XA 1MB3A 3HBNA 3MTAA 3ZD6A 2AG1A 3AHHA 2VCEA 3TZQA 1C81A 3U9TA 1R88A 621PA 5EUMA 1BS9A 4IXNA 2W70A 3RK1A 1T0JB 5DN9A 2GAOA 5LNK6 3BMQA 2AEFA 4OJYA 2OXEA 5K09A 4J9UE 2MTBA 2QL6A 2RJ3A 4PAOA 4QVKA 2J33A 4B2YA 5J43A 3F47A 4B5LA 3C5VA 1B3BA 3B2QA 5LWQA 1D6SA 1WBBA 2IUUA 3PRHA 4G1MB 3NVDA 2PH1A 2BE7A 3N6VA 4JIMA 4OU5A 3NVAA 4WZBA 1P0PA 3UBTA 4DHEA 1RYNA 1DKOA 2A30A 2WU0A 4A0RA 1OIWA 4DC0A 4W7IA 3RYHA 1V11A 4GSLA 1TI7A 2P0AA 1ZRHA 2XNKA 2E89A 2AN3A 1JPVA 1LV7A 1VHQA 5JQWA 1W5EA 4DMGA 4UDOA 1Z5WA 5ESRA 3IP6A 5A3VA 1A4UA 3IIIA 4Q1EA 3VDRA 2NZJA 5DU2A 5CAEA 1QRTA 1YIOA 5AI4A 3NIWA 3QKSB 3ELDA 4NFHA 3R7WA 4IDGA 2DHDA 3CSDA 1SVLA 3TTVA 3V46A 1KO1A 1JAYA 2C9DA 4B87A 4F2PA 4ID9A 2AD1A 4ZOQI 4ZO9A 5HM6A 1EGAA 2NXEA 2B7BA 2JGKA 2Q5QA 1AGRA 4FT2A 3L0ZA 1VG9B 5CIQA 4US2R 3M5CA 3KSZO 5GPBA 3U3KA 1DWPA 2O59A 4A82A 1WPRA 4X60A 3GA0A 4DILA 1Q0UA 3HCOA 4X6XA 3T5GA 3TNYA 1TB4A 3JR7A 4UCQA 5FBRB 3W04A 4EJFA 2IYXA 3L7KA 3QVJA 1HTTA 1YB2A 1HT2E 5IAJA 1ADJA 2VTDA 3ZJVA 2D1QA 4ARZA 3SS7X 3BK1A 3OESA 4RY0A 5C34B 1ENPA 3IVGA 2YXNA 3H6GA 5EHZA 1W59A 4GVPA 1GPDG 1A9PA 3W6ZA 1J5XA 1MO6A 4N39A 2CNWD 1AA9A 2PLFA 3QYJA 5AHWA 2GUWA 3K9NA 3MERA 1TJ4A 3MILA 4I5IA 4EL0A 1N36B 2OL4A 4ZMSA 5CCXA 5JSFA 2WNHA 4AS1A 3UV6A 4R0MA 5MDHA 4BBJA 1ZIXA 5LMNB 2E6KA 4N8DA 3KUUA 5TSDA 4P5EA 4MGIR 5FI1B 4B7XA 1J0XO 2J08A 3U4DA 4EJ2A 2YVKA 4Z3KA 221PA 4URZR 3LSTA 3SEZA 1SC4A 3QVVA 2IP1A 4LE2A 5JAIA 1Q0ZA 1QOZA 1X8XA 2PO5A 3EMDA 3KQQA 1QP0A 1XPRA 2IBTA 4FZ5A 2XT0A 1L3BA 4RV4A 3O4RA 4O59O 2LUOA 1XDDA 3CF4A 3GYGA 1YF3A 4DSUA 4IGFA 4U7TB 4UNNA 1LLFA 3STUA 4IJ6A 5K20A 2REXB 1Y4UA 2WWFA 3KVNA 2NO9A 4WVFA 3U0BA 1TZCA 4MW7A 1W6RA 5IAAA 1ONPA 2AQHA 3DFKA 5LB2A 2ADOA 2HBYA 4RTQA 3JQGA 4IXTA 2WHQA 3BFJA 4BRSA 5A7GA 1FK8A 3O0DA 3MTJA 1VPLA 3S55A 5CNMA 1G6KA 1TT7A 4JD5A 2NVWA 1HR0B 1U5BA 2BFMA 4KV9A 3CZRA 3VR3D 1HNZB 2FQWA 1H9AA 1Y6JA 3NT2A 3IDZA 4HGOA 1LQ2A 1ORIA 2BEWB 1SQ6A 2ETVA 2QYOA 3O4FA 2XB8A 1JQLB 1I36A 3AGPA 3GXOA 3IQZA 1ZW6A 4E5KA 3FOCA 3KLPX 3C5CA 3A4NA 2Y6VA 4ZEMA 1NFFA 2Z3WA 3HS3A 4TUYF 4LMAA 4HQ0A 2ZIXB 1E0DA 4HWSA 4EPRA 3NM6B 4ZANA 2XOKD 2IOHA 1G3IA 2HSDA 2NU6B 4QJBA 3P2EA 4XA8A 4BO4A 2AF3C 4HLNA 5IT9A 3JVVA 1N5IA 5KNBD 2YWGA 4KFRA 1COWD 4G0OA 2VTVA 1RDFA 3JQFC 1RPAA 3TZLA 5GM2A 2GPTA 3GLFE 3OA0A 5F98A 4DWOA 4LZZA 1NJGA 4YRBA 4N7RA 5IWCA 1Z2NX 3UEOA 1TW3A 3GLRA 3I9LA 3NAGA 2BR4A 2H57A 3QIVA 2DULA 1YOBA 5G0VA 4LXUA 5A4AA 1A7UA 4FW9A 1SNYA 4ENQA 2HA6A 3OOJA 4MVWA 1L8QA 3OFND 4H2DA 4OBWA 2DE0X 3OCVA 1KHTA 3PHIA 4CM6A 4RFSB 1JHZA 1X19A 2J67A 1RLOA 4PLZA 4BMZA 1BVHA 1MP0A 2Q5HA 1M7BA 1EQ2A 4GOOD 1AG9A 3KT3A 3GUUA 1KETA 5KVSA 4DXDA 2EWWA 2PKWA 2YYYA 4K6GA 1L7NA 3H05A 1QOQB 5SV2A 5EFOA 3S8EA 3T7JA 1P9WA 1SMKA 3GP5A 4MKXA 1V6SA 3BFPA 3C43A 3OP4A 2DPHA 5CB4B 2BR5A 5IU6A 2NTVA 3SYLA 1TZBA 3HK2A 4LRTB 1AB5A 2P40A 4NXMB 2WMYA 1NQWA 4L1KA 5DULA 4IG4A 2VXBA 4QULA 5JSHA 3VTFA 2Y92A 4E15A 1NZDA 1MB4A 1V0JA 3MT9A 2C1ZA 4FNGA 4F6LA 2HIMA 4AFNA 3P94A 5IUJC 2GDZA 3U5TA 3RB8A 2Q6TA 2LVBA 3ITDA 3W5VA 5JRZA 2IGBA 1QVVA 3AOEC 1K6EA 4Z4IA 4E22A 2PDAA 5K2MA 1IYZA 4A0SA 1Q50A 2CNWA 2PKRA 4ITUA 4EDFA 2PMKA 3SEAA 3LKBA 4L0DA 3GH1A 1UXIA 5H02A 4BP8A 1IHXA 1N9ZA 1K9VF 3BSYA 2VXOA 3OE5A 1X1DA 4FN5A 4H3KB 4NU6A 2ZI9A 4PSAA 4WKNA 3EDQA 2E1PA 1XT6A 2FI1A 3AYXB 1ZIPA 3DD1A 2VHYA 3I9JA 4ZOBA 5FNVA 4BE7B 1F14A 5I9LA 1EPUA 3T1HB 1RR6A 2OOSA 1E3DA 2PH7A 2PV0A 4R5HA 4MUXA 4UVEA 1NXPA 1H2ZA 2AR7A 1KYVA 2G88A 4RACA 1ZESA 2C8JA 3C6QA 3LQ4A 5FFNA 1W73A 2PJDA 3VTZA 1JJBA 1RYZA 3SXUA 2IRWA 1I8TA 2C5BA 3VPBA 4E3ZA 5HPYB 3KSAC 4DV5B 1WW8A 5CGQB 3S81A 4JLJA 4RHEA 5CX4A 5THQA 2RKBA 3ESAA 2L82A 3FYUA 1NVBA 5AVYA 4FOSA 3PC8C 1FRQA 1U3DA 2F1JA 2INGX 2XDYA 4K6HA 3VNBA 3GNSA 1OX5A 1S2OA 3FPLA 4REOA 1B41A 1NUHA 4ROTA 1XCJA 5LYJA 2GPJA 1NVUQ 2ZR0A 3EZFA 3FMOB 2ZRNA 2PIAA 4TMKA 4DMFA 3GLGA 3GH3A 1ADGA 2PCLA 3BXEA 1PS0A 1I4LD 2V7QD 4LRWA 5A6SB 3IQGX 4D9BA 4DV6B 1G20B 2G1JA 4NENA 4G9EA 2BFOA 2Z2IA 3BMCB 3MEQA 2PE5A 4TLLB 1CUBA 5EJIA 4REMA 2PS9A 4AJHA 4BLTA 3A3OA 1UDXA 1M0SA 1EINA 2ES4A 3E05A 3V1MA 1QG2A 3BXXA 3RVPA 3U61B 1ZO8A 3EMKA 4NOKA 1SOVA 1ZSVA 1Q6ZA 1IPFA 1VPVA 4WY8A 2FVXA 1EHCA 3UMYA 5K8UA 4PRZA 3O84A 2BMWA 3OT1A 4RK6A 1UK9A 2WWRA 3TGPA 2X0IA 3UYKA 3I0MA 2V6BA 1E61A 3CNEA 4ECEA 1GZHB 3VKWA 1R6DA 1S2IA 3EJ6A 4CL8A 5COAA 5KTPA 1DUVG 3T1VA 2ZTHA 3LD9A 4MPRA 5AW6A 3GRYA 3THOA 1U94A 2XE4A 3I9OA 1YMQA 4PSUA 2HMWA 3TKYA 5IFLA 3T34A 4XTRA 2VQSA 2BUBA 4MB2A 2O0MA 1P77A 1XF1A 2HYIC 1W85A 4FSDA 1MABB 3TI9A 3NKVA 2PAFA 2YQ4A 8GPBA 3BAZA 4PRLA 5CLGA 2ODBA 1ARZA 3FH0A 3I9NA 3OCWA 1F6DA 4IDQA 4Y9DA 4LDZA 1KYTA 3AONB 3DZCA 2UVQA 3M6MD 1BE8A 3ONEA 2SKEA 3QUQA 5ULLA 2VIIA 2DT5A 3TW6A 4XD7D 1X15A 4C0SA 1UM9B 1UF9A 4WTOA 4J16A 2W2PA 4LOHA 1FNBA 5ARDA 5GZ1A 4KEAA 3R7FA 2YHSA 3GJ5A 2C42A 4E70A 4EHAA 2II6A 4JA2A 4M22A 5I9SA 1R4MA 5FBHA 4MS4A 5THXA 4WV3A 5BWOA 1YJ8A 4HFNA 4OGLA 1PJRA 1I4TD 1X1TA 4FPXA 4W1RA 2OBLA 3L82B 5I48A 3UK1A 2OG1A 4YRNA 2BGIA 4M99A 3LG2A 1A4RA 4BX0A 4D4KA 4V0ME 5LJIA 3LQ2A 3DMYA 3N05A 1G4HA 1UIMA 1OLSB 3JZFA 3SJ7A 2GPBA 1YZVA 3B20A 4HRYA 3W1WA 8ATCA 1J07A 1LPBB 1KH1A 1PI3A 3B1XA 5K4GA 2AZMA 3LGSA 3GRFA 4OM8A 3RVRA 1FXWA 2J59A 2YC2C 4YT2A 3H6HA 2XT6A 4CMAA 5B57C 2ON6A 3QXHA 3WRYC 1FYEA 4FXPA 4JI7B 3QKSA 4JYCA 5CYFA 2JIPA 5LPNA 2RB4A 2D74A 3H86A 4LTMA 5IJAA 3W06A 2QRVB 1J25A 1WVMA 2ZU0C 4CQMA 3ZQJA 3G7UA 5BVGA 4ZDIA 4O02B 3P1JA 4QOSA 3ZTTA 3DMTA 2CHGA 2A33A 3AKDA 2FA9A 3ILVA 3JAWB 1JFFB 3OF5A 5ES3A 4B3IA 3K05A 2WHRA 5KNCA 3COYA 2CSUA 2XXAB 5B3KA 2PA3A 5HRAA 4DB2A 2HT1A 1AE1A 2HWYA 4KR0A 4Z2AA 1CR2A 2WVHA 1UKAA 1GG2A 4B4UA 3AYZB 1EUDA 3ZE2B 1XZDA 2XKAA 1BHJA 1ZRNA 3OPQA 3SJUA 3O75A 5EAIA 4EO9A 2W7TA 4FDAA 2EFEB 1GPJA 2OCLA 2QTBA 3D4BA 3Q7TA 3L7BA 3WB0A 4AX8A 5E1DA 4E7OA 4F4HA 5LP6F 2XWJI 2JEYA 4Z9XA 4O8CA 4AURA 2O20A 3JCZA 2EYUA 2PK3A 1XCGB 3FWZA 2OFXA 3ZDRA 4LXGA 4W8OA 5FT9A 2BFBB 3EY4A 3IEKA 4DLKA 5L95A 1TTPB 3HFRA 1KOLA 4NG5A 1INLA 2G9VA 1BGXT 2F00A 1DIRA 1GCOA 4U2FA 3FMIA 2GK4A 5DSTA 3VU1A 1JBEA 3O9VA 1D5CA 1JFVA 2FOXA 3GLIA 1FYDA 3FVRA 2O3UA 2P69A 3OF3A 1DC4A 1UANA 3O9MA 1U3FA 4CM8A 1ENOA 3QELA 2JZCA 3EXHB 3UK6A 4IHJA 4LHXA 4FGUA 1O4VA 1CB7A 4RAOA 4J0CA 3IKMB 3P0RA 4OEHA 5JS8A 2FWJA 1P0IA 5C2JB 3VYSB 1JR3D 4EMTA 4Z8YA 4K6OA 4UEQA 3DVAA 1YKFA 4ZEOA 1AQNA 2V6GA 4BQIA 4EECA 2BFPA 3U16A 1SGWA 2MWMA 4WE3A 1Q15A 2JFGA 4JYMA 1GCAA 4L51A 4NMHA 1GQYA 3OQ1A 5FLEX 2QSJA 3SJBA 3WSTA 1IDN1 3RG2A 4C43A 1KFKB 1N1GA 2ORWA 2W6ID 3REQB 1SBYA 3IBTA 3OIYA 5A06A 2CNLA 5TLSA 1PJLA 3B53X 4P4SA 2VI5A 1JZQA 4OSPA 1OH7A 4C6TB 1S3SA 4LK3A 2JCSA 2OG2A 1E7WA 1G8MA 3EGIA 4KXLA 2AA3A 2VJQA 1NRJB 2W0MA 4GWLA 1MOQA 2FWRA 2ONYA 4OH7A 5FPKA 2WICA 2WJYA 1CEXA 3IULA 1UH5A 3N58A 1KEPA 1U9JA 1F5NA 1KAEA 4BNKA 1HQCA 1WSAA 1IC6A 4WLNA 5DM0A 3QENA 4XW2A 1NVVR 1YL7A 2PGOA 2VUHB 4NEQA 2JCYA 4KQCA 1XMPA 3BL6A 4K46A 3D3JA 1Q0HA 2EKBA 4COOA 4LDAA 1FTWA 2IHZA 2I29A 3KZMA 3ZU3A 3TZBA 2BVNA 3EEOA 2AFIE 3WV4A 3ZEIA 3HDQA 1VIYA 3O83A 4N7JA 5K99A 1FVOA 3WDSA 4BNJA 2XBMA 2HX1A 3URKA 3UK0A 1IWBB 1OYOA 2FWBA 3X1KA 2PKEA 1BXZA 1ES9A 1L4NA 3EF0A 5A9TA 1EA5A 3BAFA 3HUTA 1S2LA 2UYGA 4ITVA 2H1RA 5E2AA 1X7YB 1JRLA 1QB7A 1XAHA 3JQAA 3UAYA 4LTDA 3ZDAA 2HREA 1L5HA 3IIEA 1H9CA 2VP6A 4BZWA 2NYRA 3ETNA 3R4CA 3RIMA 1ND6A 3L6RA 5C5EA 4FHZA 1MBZA 2YWRA 9ATCA 2K87A 3WMXA 4ZZ1A 2IYVA 3LDFA 3ZD7A 3OEWA 5IYZF 3L77A 1ZINA 2EHDA 3PFFA 4TV8B 2HQSA 3BRQA 1P2GA 4XGKA 3UPTA 4ZO8A 4E1AA 4FYVA 3MCWA 4KITB 4MVJG 4BRUA 4FHGA 2PZLA 4H18A 4UC0A 2RIPA 1JMVA 1YS6A 3PC6A 3PL1A 4M9CA 3D9QX 3S8YA 3F98A 2CLHB 5CJPA 3L93A 4EZEA 2YV4A 4DLVA 5IYZB 5H7XA 2Z4RA 3K9WA 3VSBA 5J63A 2VQ6A 5FPPA 4FYMA 3K0AB 4XSGA 3H2HA 4H1HA 2OBYA 3I32A 2R6CA 2XBUA 3E22A 2BGLA 2CMGA 5GWXA 5H9WA 3NEYA 5AOVA 2HW8A 4P22A 1OH8A 5ADVA 1G98A 4N3NA 2WILA 3LC2O 2J3JA 1N2CA 3QXSA 1X7WA 4EOGA 1JLRA 2EV9A 1U7PA 3B3FA 1DVRA 3ESBA 3G49A 3VDNB 4G1FA 4Q1DA 4RJJA 4LJRA 2GJ9A 4CT4B 4MVJI 3CZCA 2BGTA 5L6LB 4LGCA 3TXYA 2QL5A 3AUSA 3EIFA 1JWBB 3CN7A 3TS1A 3QEAZ 2AS0A 2WMNB 5EJ7A 5HNKA 3OQVA 1L6RA 2EC5A 5JYCA 2CVFA 5IM4F 4OAPA 4A8JB 3LWDA 1Y34E 1CEEA 4KMOA 1L9KA 5I7RA 1LD3A 4M1SA 1G0NA 2Z2JA 3IBGA 3O4JA 1Z17A 4XVHA 4YQYA 4YWHA 1L5GB 4F9EA 3MWFA 4Q1AA 1H2RS 1K63A 4I4TA 1NQAO 3AOEA 5K8VA 4H7HA 2FWNA 3ASVA 2X1VA 2DCUA 2YFKA 4PHFA 5UKDA 3WIEA 3K9BA 4C7KA 1Y4DE 1A4XA 1EUCA 1JVNA 2QU7A 3MQ4A 3PPVA 4UMVA 2VLBA 1OB5A 5E1BA 3N2GA 3ABZA 3AWDA 4RJIA 1YJCA 3UY4A 1VJTA 3I5YA 2WWVD 2PQ0A 3OIDA 3RS7A 1NXQA 1D2RA 5C80A 5A4MS 3IUNA 4RV9A 4Y6SA 1JEOA 1TAGA 3F3SA 4Q7JB 3QUCA 2DG2A 2HJ9A 1DBWA 1PRYA 4DJFC 4ER5A 3DM5A 1H94A 3CSUA 3FUWA 1EU1A 2C58A 3JZDA 3FE2A 4D6XA 1ABEA 4ZYXA 1RBZA 2K7ZA 1ODFA 2Q8NA 1S0UA 5BWMA 1KVQA 3K30A 1ZM2A 2IHVA 4NOMA 3QW2A 5JY6A 3EWAA 4RZ3A 4ZO6A 4S1WA 5DW3A 3IAM1 2WSSD 4BZQA 5HX7A 1TKRA 3G79A 3HGTA 3SLKA 3V2HA 1JH8A 2C0PA 3D7MA 2O8FB 4MTCA 1XWFA 1QHNA 4XUGB 2PUFA 1XHLA 5DZSA 1QLHA 3B3JA 2WTUA 2BFAA 3ED5A 2DQYA 1K2WA 4GBMA 1JR3A 2RHHA 1BGVA 1ZM9A 2Q6VA 4TZ0A 4MAMA 3TSCA 1KL7A 1SOMA 2HB6A 3TW8B 2LTAA 3HGQA 3NKFA 4ZI7B 1XKTA 4I6EA 3FWHA 4JUAA 1Q1QA 1JAIA 1XA0A 3EULA 4OUDB 4QNRA 1BIFA 1E1CA 4ND4A 1I9CA 3QMWA 3C3PA 3IAS1 4P4LA 2CF6A 1T6BY 3CLSD 2P9FA 3L43A 5EZQA 5BVHB 5KVVA 1IEQA 2PZGA 2FCAA 1WL8A 3Q8XB 1TLTA 4D8VA 1QYXA 2YUIA 4YJGB 3HADA 1YNSA 3ZX4A 3VZCA 3MYRA 1B43A 4LRXA 4V0MA 3S1AA 4DXHA 5IF3A 2IS6A 1O58A 3I6YA 3HCEA 4MLPA 4CMIA 1Z0SA 4UTVA 4XWOA 3TPFA 2C2YA 3VA7A 4KGXA 4KN6A 1NNUA 1MVLA 3M6UA 2FZVA 5KYUB 3VO8A 3KZOA 4N9WA 3C98A 5HJ7A 1XVAA 1GN8A 4E51A 3M1LA 2V7BA 1IQRA 3ITNA 4GLFA 1AUOA 4UD6A 5D7BA 1ZR2A 4ALKA 2OXCA 3R1IA 3T95A 4EYSA 2CMDA 1GGKA 2OHHA 4RKEA 3LBAA 3P0EA 3U4CA 4X1IB 2YV2A 4FHDA 1QTIA 2JW5A 4JJKA 1O9HA 2HV9A 1PHPA 2P2ZA 2J1LA 3UFBA 5LXTB 1JFTA 2YFYA 4U00A 2OB1A 3QPCA 4M0FA 3WGHA 1YA6A 1H6DA 2GETA 4HQNA 4JR0A 1USGA 4KTTE 3WWEA 4DT1B 1CE8B 2IYTA 2ONKA 2ZFUA 3G2HA 3T3DA 3EXG1 4RADA 1IM2A 2O0LA 2QG9A 2WKRA 3AILA 3G1WA 2ATIA 1FUUA 3NRBA 4J1TC 4BNIA 1QU3A 2QYHA 4BVKA 4RXMA 5EJ4A 5K8TA 1IXKA 3WISA 3QTBA 3DTVB 4IJKA 5F5NA 3ZOZA 1U6JA 4RDCA 3VAYA 2JCBA 3LW8A 4FJ2A 4RS4A 3WQBA 4I4TB 1JJFA 4MCJA 1VJ5A 2BGRA 4AY6A 4Z53A 4D5GA 1W4LA 1DMSA 3KWMA 1L4KA 1PYDA 2ZI7A 2XUQA 4KVGA 3U80A 3PQ6A 1PQPA 4LECA 1PSZA 3A28A 4LKOA 1E2PA 1VBFA 5T67A 4RTNA 3DNMA 3DMTC 2CFIA 3PJFA 3G9ZA 4I9GA 4MQEA 1FLVA 3BWBA 1MD9A 3SX0A 4B48A 4HRXA 4P35A 1TQ6A 2ZJ0A 3DCYA 3ZXXA 4F12A 3AB3A 5IULC 1WO8A 2AGVA 2FLWA 2R65A 2QDXA 3CLTC 5TT1A 1ZMTA 1DAFA 2JD2A 2JARA 4G1BA 3WRYA 1XU9A 1KXZA 1JYEA 2B6NA 4AICA 5DKFA 3E7XA 3VH2A 4N7BA 1MJHA 1U0TA 3GO4A 3JR3A 2Z1MA 5HM8A 3HSYA 3L04A 5AFSA 1MIHA 2PSJA 1KP9A 3BSSA 1Q3KA 4AJJA 1N7IA 2BT4A 2AG0A 4KIUA 2G8LA 1Z8HA 1U2GA 1A7AA 1VYVA 1GTG1 3GOQA 8ADHA 3PDWA 4A6XA 3RU9A 4CM7A 2W2QA 2Q1SA 3P4UA 4PWZA 4WXYB 5KYXB 2AN4A 1WUKS 1QFJA 4XEHA 3T12A 4ER6A 3BGWA 1A8QA 3KYCA 3TZ6A 2IU6A 3GN1A 3ZCPA 2AFHA 2LKCA 5ALTA 4QXPA 2H1SA 1D2EA 5AH0A 1OLXB 2R8XA 1JPNA 1ESEA 2QOEA 4I50A 1YB7A 1M2NA 1Z26A 2Q29A 4DA7A 3H2SA 4B6QA 1AJEA 4ARIA 1DKRA 3WFJA 1HL3A 2VTKA 3JD0A 3VO1A 3LOPA 3QEMB 5AUNB 4BQQA 2HRDA 3U62A 3QV1A 1VSUA 2BCGY 2EFDB 1RJDA 3TMKA 3M4JA 4YO7A 2IJGX 5C7LO 5FWNA 2R6R1 3U44B 2H18A 4XTCS 3JQAB 1W5FA 5AW5A 2D1FA 2AF4C 4BVLA 2A9PA 1HFWA 2J3IA 4NAUA 4I7EA 1B73A 2YH2A 4YIKA 3Q5DA 4CQLB 1QVZA 1PKXA 3LUHA 5TQVA 3VPHA 1II8B 1T6ZA 5JDIC 4DLRA 3GD7A 2FTKE 3QLTA 4V2IA 3PGVA 1HKUA 1B6SA 4B7AA 1CERA 4EY7A 5B1SA 3JWJA 5L51A 4CLOA 4QOFA 3F5QA 5AXBA 3RAEC 4FNOA 2OCPA 5IZ4A 1SKYB 4LYHA 3EZ7A 1GARA 2EDAA 1O87A 1PF7E 2O4UX 2NLOA 2R1UA 4RYDA 1RADA 3RFFA 2WT9A 1WBDA 2HSWA 4NBSA 4OJNA 3RGGA 2C9MA 5HILA 4G9GA 4JBNA 2V1XA 4QYSA 4MEBA 3I23A 1UFQA 2DY1A 1NLYA 2ODAA 2BM0A 3KYJB 4XKJA 1OBCA 2IQ5A 4IIXA 1WY7A 2IIPA 1RRVA 1WUJS 5E4FA 1EXDA 2M32A 4KB5A 3FRIA 4UHJA 2IYQA 4KDRA 3V4FA 3WK8A 4WKGA 1B0UA 3C7AA 4TTVA 1NN1A 3BGDA 1J06A 4IWXA 3WWCA 2NSHA 1DAIA 1SCJA 1YMVA 5BP7A 1KJ8A 3L8DA 1MNQA 2NO1A 1KSHA 2R8BA 1LZLA 3VSCA 2Q49A 4EAAA 3M82A 3WA6A 3GEBA 4DY6A 3V32A 3K6KA 3LNTA 1AQ6A 4MX8A 2WHXA 4MIOA 3W9BA 3GP3A 1Z6PA 1LK7A 3TI7A 1KZHA 4YR7A 5BOSA 3SM9A 3B52X 3WDMA 5AVQA 2QTNA 4BZZA 3H1TA 1E2BA 1U8CB 1Q1GA 1QANA 2L18A 5GV7A 3R3SA 5CBKA 1R6XA 1Y6QA 3PQ5A 4OHCA 4LDQA 1OQAA 2IEGA 4H4EA 2GZRA 4MUHA 1PL8A 2HM7A 2BH9A 1NSTA 1U2ZA 3CEJA 2H5IA 1FQJA 1H2WA 5JJ5A 3FVVA 4EB6A 3GLIB 1BDIA 1U5AA 1ECGA 4PXSA 1LDYA 4O2AA 1PG2A 1XPJA 3IXMA 4Y2VA 1DDIA 5JRDS 1J0DA 1YR2A 4HN4B 4DDKA 5FYDA 3TTWA 1Z5GA 3PEFA 3S3TA 2JF0A 3C3EA 3R5KA 2RJNA 1CY1A 3EIXA 3PNBA 4M3NA 4IBOA 4JQOA 3ZDYB 2WUDA 4OHOA 2X9VA 5ALXA 2VDNB 3ROFA 3UM9A 4DQUA 4WLUA 4EM6A 4HHEA 1CUHA 4CWAA 4DIEA 4ZRMA 3DE5X 4O2BF 1C4WA 2GXUA 5IZCA 1TUGA 1S89A 2O05A 3L7NA 1UL1X 1HT3A 3P9ZA 4M1EA 1XNJA 3A7EA 3LE8A 2FJ0A 4TVKA 1N2ZA 3G5MA 1GSAA 2QNIA 1G5QA 3PQCA 2B3DA 4RZXA 3G6WA 4DCSA 3KAKA 5KTSA 1NM5A 4E2WA 2DHEA 4O2BB 3V6MA 4JYPA 2XXAA 3QJGA 5JDCA 3PHJA 3B1JA 3EQ6A 3R7NA 4J1QA 8ABPA 1I7SB 5KSPA 3RUPA 2COKA 2Q1TA 3SNHA 3PLRA 2D8MA 2DKOA 1RT9A 3DL7A 4L4XA 5FNZA 4ZJUA 4ND8B 5DPMA 5FTJA 2CDCA 3EQ7A 4ZT2A 4DA0A 2QZ9A 4LJ7A 3FFWA 4GUAA 1ZSNA 4HXGA 1EI9A 3AUKA 1RKBA 2BBWA 1I4EB 4JENA 2BMVA 2VSYA 3BIWA 5LP6C 2R97A 1BFUA 2ZXUA 2OZLA 4EDHA 2QTFA 5K8JB 3AEQA 1CEQA 3G5UA 2QMQA 4F5WA 2X2EA 4DLWA 3AVQA 3VU9A 2KHZA 2NAFA 3IP5A 4UHBA 1TK2A 4YV1A 3ZW7A 2V3WA 1FC0A 3DH0A 3PGJA 4O1MA 4LWPA 3HVJA 3GT0A 3O38A 4QXQA 2QB5A 3CE6A 1PJZA 1RQ7A 4E31A 4I1PA 4V0NA 2QRQA 2AKYA 5CLLA 1FFWA 4MRVA 4RIHA 4PGHA 3EGXA 3I6MA 1TM7E 4BNTA 4F84A 4YRMA 3VR2A 1Z4LA 3NBMA 3CH7A 1E4OA 2NXCA 2F9LA 2WU8A 5HQ3B 5I7FA 4NEGA 5CJJA 1D1SA 4NX2A 5JCOA 5IJXA 1FA9A 4HV4A 1FFAA 4H6VA 3OPYB 3V1LA 4JZKA 4NCHA 5I45A 2HKIA 2E3JA 4PIVA 4ZPXA 4J49A 2QJRA 2P5SA 2AN5A 2OECA 3AV0B 5A4FS 4E14A 4IIBA 4DCJA 1QVRA 5DNVA 1NMEA 1JAZA 3LZCA 2FRDA 4WHMA 1YK0A 3IE2A 3SD7A 3VISA 5JZOA 4TT8A 4WGGA 3F3MA 2VK4A 3KJXA 4CQLA 1E6WA 1L4LA 1QPBA 5HMLA 4A1OA 3AEXA 4MYHA 3ANMA 1J8FA 1PL7A 1QDEA 3CF0A 5DHAA 4ZVVA 4TL7A 1TLFA 5M2QA 4RLFA 4OLBA 4ENWA 1GCIA 2VRCA 3JQ6A 2O7QA 2ZJBA 5I5EA 4YRJA 5JZMA 2PVPA 3CLTD 2PS0A 4Q3CA 1ZBDA 2Y4NA 2UYOA 2DTDA 4TMTA 5E2BA 3ZWYA 4BIIA 2FDRA 4AKGA 1T6NA 3F6BX 2NTJA 3F46A 4HYYA 4B81A 1M0WA 1Y9AA 3K0CA 1QHHB 4JOQA 1OVMA 1V1MA 3KSMA 1R8XA 5CK5A 3ZYZA 3NT4A 1XEWY 3ZKWB 2YJZA 7REQB 3Q9SA 3WGNA 1ICIA 2CL5A 3GL9A 3PDIB 2W6IA 4YRGA 2A59A 1ESNA 1OCEA 3FNFA 4HWRA 3PA6A 3Q8LA 2AN1A 2FSVA 1REQB 2TMDA 2QD1A 3D6AA 5ARBA 3GZTB 1SZCA 1V9CA 3LZ6A 4WAUA 4R41A 3D6VA 4QSHA 1FMLA 2D3TA 2WJ6A 3QPBA 4Y6OA 1E1CB 2FQYA 3LHIA 3O2NA 3HJGA 4RD4A 2FP4A 3B9RA 3TL6A 5A2QA 5U9CA 2HBZA 1LWNA 4KQKA 3V33A 1P4GA 3NH6A 4O4HF 1RRKA 3LF2A 1J2RA 1RQPA 4ZCLA 3F4LA 4R16A 1ADYA 3PYLA 3REOA 2WIFA 3W9UA 1BRTA 3T9DA 1OYWA 5D5QA 4F04A 4OHPA 4DLNA 2D5CA 3CLRD 2JDIA 2KSQA 4N12A 5B3LA 1NA5A 3EXFA 1ISMA 5E9QA 1CUJA 3HBMA 4B6FA 3IE1A 2CUKA 2GTIA 2ZT6A 1SR8A 4MP3A 3R9WA 2AE2A 3V8QA 1ZHFA 5EHIA 1QORA 3MLEA 1P1CA 3TSZA 2E49A 3SXPA 4G4JA 5CYGA 1O95C 1FNMA 3L0SA 3UUEA 4NK5A 5AJWA 1SUPA 2Z8ZA 1EDDA 1GA4A 4MUAA 4MJLA 3O2SB 3L7MA 1PEYA 5L7YA 4BBAA 1PO7A 3WNDA 5LKRA 1IXYA 1ISJA 2CZGA 4P32A 3Q88A 5C35A 2C04A 1H6AA 1P0CA 2Q5EA 3QU2A 1CRZA 1I9GA 2WQ7A 2I3GA 4RVSA 3LDHA 2DH5A 1IPHA 2HIHA 4EKDA 3W5CA 1ZNYA 3KHTA 3C1TA 1F8UA 4DBLE 1L4HA 1J8MF 1RJFA 2GSDA 1BEUB 4NJMA 4A8TA 1O8BA 3UJNA 2NXJA 1E94E 1Q17A 2HADA 2JH8A 1EWTA 3PENA 2IXFA 1XOIA 4NABA 2AYXA 2VT7A 2DFLA 4P8RA 2I2WA 4PLTA 3AEUB 1A8HA 5JATA 2BLLA 1C0EA 2IXDA 2EZTA 4Y30A 4M88A 3WLTA 2XKJE 5KYKA 1CUYA 2W6ZA 3PUIA 1W4RA 2MSLA 2HMUA 1ZICA 3JWEA 2FK7A 5KPDA 1KK1A 3ZE1B 1LVUA 3WLKX 5CEEA 4E94A 1PZGA 4R1NA 1FL9A 3OBBA 3VR0A 3OTOB 3RRXA 5TS2A 5JNVA 3WQSB 3DHNA 1JL3A 1AZLA 3GGJA 3MHPA 1JHOA 4GHWA 1MGOA 4O2RA 2CUTA 4OIFA 4R4JA 4RMIA 1PUIA 1QWOA 4BS9A 3HZHA 3NIFB 3ORHA 1M2JA 2AOTB 3HY4A 2E48A 3TCNA 5FOWA 4ZYZA 3ICQB 1W48A 1OJ7A 4FGJA 2XNSA 4X6LA 3B60A 5DM4A 4AJEA 2EP8A 2GF2A 2GAIA 1NJ2A 2DRIA 2DLNA 2ZJOA 5HKKA 2WF9A 2VXCA 2YYZA 1S3IA 3UENA 3KJIA 1K8YB 3W3AA 4YYEA 2GS9A 4GBED 4CFZA 2IUTA 2X4GA 4MR9A 5T4FA 3SYKA 4I46A 1UXOA 1SCKA 3K8YA 2I7XA 4RDHA 3FCEA 2D5IA 1EVZA 4C7JA 1RZ3A 4MYCA 4YFYA 5ICMA 1H8EA 4Q82A 2EGGA 3A1VA 1XE3A 2JNWA 3AIMA 5SZKB 1V2HE 5JAZA 3NVMB 4LVCA 3RC9A 3NANA 3IKTA 1SBHA 2RDMA 4KUHA 3JY6A 3WLFA 2WT8A 4W1SA 3V1KA 1B8PA 3L07A 5A2GA 2P9EA 2DPYA 4X66B 3LFUA 3BIJA 4Y1EA 4RZSA 1Z0AA 3QU9A 3CRVA 3VZPA 3G0HA 1UCFA 121PA 3D4LA 2D1RA 2VA8A 1GKLA 3AFNA 4G0YA 4L8WB 1BN6A 3RD5A 3VBCA 3F49S 1SPXA 3DAFA 2PSHA 2RGAA 1VE1A 3DS8A 1TEXA 3JQ8B 1C30A 3VH4A 2H85A 1G60A 3M34A 5LQDA 4ZDWA 2FPSA 5LU8A 1GKYA 5KQLA 3UG7A 1C5KA 1SCDA 3KR0A 4QQFA 4RZ2A 1ZJ5A 1QE5A 2SECE 1M6EX 3BJZA 4YV2A 4LQDA 2PGLA 2JATA 3EVDA 3N39C 6LDHA 1M2FA 4YQZA 4OG2A 1TIBA 4OXQA 5TVKA 1WAMA 1TPYA 1Q44A 1JB9A 1WXXA 3CEMA 3IERA 1QIEA 1W9HA 3O74A 2A4MA 1J97A 2GAJA 5I4BA 2DF8A 2G5GX 1YOVB 4NEHB