9LDTA

Design and synthesis of new enzymes based on the lactate dehydrogenase framework
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIHNLLKEEHVPHNKITVVGVGAVGMACAISILMKELADEIALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSRLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPNCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWILGEHGDSSVPVWSGVNVAGVSLKNLHPELGTDADKEHWKAVHKEVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKENVFLSVPCILGQNGISDVVKVTLTPEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LACTATE DEHYDROGENASE
publication title Design and synthesis of new enzymes based on the lactate dehydrogenase framework.
pubmed rcsb
source organism Sus scrofa
molecule tags Oxidoreductase(choh(d)-nad+(a))
total genus 100
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1991-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 9ldtA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 9ldtA02
4BNLA 1PR9A 2VT2A 3PZBA 1CYDA 3BMOB 1PZGA 4NZ9A 4W7HA 4CM4B 5U9CA 4BKOA 4L75A 5JCJD 2Y1EA 2X5JO 2NQ8A 3HJAA 4E5PA 3ZZNA 1IHXA 3RCBA 1GPDG 4I5DA 3AI3A 3DHYA 1DIRA 2PZKA 4DQXA 4BO1A 3BZUA 4GSLA 5A06A 1VL0A 4YTEA 5KVCA 4EEZA 5G0VA 1UR5A 4WUVA 3AI2A 3VTZA 1A9ZA 2D59A 3KSZO 4IJVA 1Q1NA 1HZJA 4CMEC 3BTUA 1YXMA 4XQ9A 1IPEA 2PLAA 1CF2O 4IQ0A 4O1MA 5T64A 3S2GA 3GUCA 3L0DA 1CIVA 2VTEA 4Y6PA 1PSDA 1HXHA 4ND5A 2PGJA 3JQAB 3D3EA 2O3RA 1R4NB 2EGHA 2IODA 3ZU5A 3FR7A 1DPGA 2YV2A 3DAPA 1XGKA 3DOOA 5CPFA 3ZNOA 1K6JA 4OAQA 5H83A 4PZEA 3V2HA 5TSDA 4JK3A 5KVSA 3N7UA 4Q3AA 1YJ8A 1LDEA 2EIHA 2JKVA 4Q9NA 1T25A 5FYDA 1CQIA 2CVQA 4ZHSA 1P0FA 3DMTA 5TJHA 2NV6A 3WYEA 2VRBA 5DP1A 1M67A 1C1DA 4MP6A 1IL0A 3CUKA 1MUUA 4L74A 5CDTA 4MDHA 2UAGA 1HDRA 2PKQO 1C0KA 3C3XA 1GYQA 1LBEA 4N54A 3IC5A 2ZTLA 1ZKMA 2RH4A 3O38A 4FPXA 3ETDA 1DOHA 2VNAA 4PLWA 1H6AA 2WE7A 4YJHA 1LU9A 1ZUD1 3OHSX 5F1KA 5BT9A 1F8GA 2OP1A 4AJOA 2A94A 4BNKA 4BV9A 4GMGA 4W9NC 4GMFA 3EHEA 4CV2A 5I8WA 2PZLA 1U3TA 4BNZA 1KIFA 5G0UA 3G1TA 4ZQEA 4CMAA 1IB6A 4CLOB 2C20A 4BKPA 4FS3A 2GGSA 1YGYA 2NTNA 4RF5A 5B1YA 3GEDA 3PHIA 4MVJM 1K3TA 3QVWA 4R9SA 3JQ8B 5AOVA 2Q2QA 5G0TA 2Y93A 4YJFA 2VHYA 3FI9A 4IS2A 5JY6A 4LISA 1R0LA 1EE9A 2VZ9A 2CVOA 2YFQA 2FSVA 4MKRA 4XWYA 2CD9A 1YO6A 1RM5A 2Q4BA 4LSWA 3DAGA 4Q3NA 3C7AA 4QX6A 1LXCA 3PIDA 1P1RA 1KVUA 4A73A 2Q50A 4GVXA 2VHVA 2X6TA 3T7CA 1HE5A 1LQTA 4LN1A 4BNMA 3JQBC 4D42A 4CQLA 3F6YA 1U2GA 2FRDA 1WMAA 3QVSA 1E1LA 1MG5A 1PQPA 2RHRA 1GCUA 1Q0HA 2PKQP 3QWHA 4S1VA 3AOEC 3WWYA 2BI7A 4URFA 5K9ZA 2Q49A 1ZZEA 4D7AA 5JAZA 3L6DA 2JFHA 4M89A 3ZCXA 4TQGA 1E1NA 3K6JA 2AHRA 3PQEA 4II3A 1JU9A 4IY1A 1ZMTA 1KY5A 2F1KA 5KVQA 3RUEA 3T4EA 1C0LA 3E03A 1NAIA 2CY0A 4DIBA 2DAPA 4PLFA 4IUYA 2E48A 3HB4X 3F1KA 2GD1O 3UN1A 3D0OA 4NG5A 4J9UE 3PYLA 5HTOA 5KNLA 1ISJA 1FK8A 1I33A 1SPXA 1U28A 3PJEA 3L4SO 1JKIA 3KUXA 1F12A 2BFAA 1QRRA 3EVTA 1YVEI 1G0OA 3H65A 3KSUA 4PLGA 3JQCA 2BF7A 2NNLD 2YYYA 3HE3A 2B36A 2AMFA 4FJ1A 1OZAA 2HK8A 5JCXA 3DO5A 3DFZA 2YFHA 4NBUA 4RDIA 1GPJA 5FF9A 2NVUA 2CNBA 4PLHA 4N5NA 4HFRA 4JBGA 1A9YA 4U0KA 4E2XA 3W6UA 1YONA 3DEYX 1SAYA 3X2EA 5JDIC 5L7WA 3FWZA 2OO5A 4G81A 4RV9A 5H81A 3ZDFA 3I9JA 1GY8A 4WCFB 1SEVA 4FOSA 4UREA 5IG2A 4P4GA 4YAKA 2FPIA 3ZWBA 3NJ8A 4ESOA 4N5LA 1KOLA 5ITWA 2IYOA 4RPKA 3VDQA 4YCAA 3GDGA 1NVMB 2PWZA 4YPOA 1PWZA 4ND4A 3UGKA 4RVFA 4FN4A 3RC1A 4FFPA 4CLXA 4NBTA 1ZCJA 1PS8A 4CMHA 2Y1OA 5T67A 3FSRA 1ULSA 4XB1A 4B8ZA 3NDIA 4U7WA 3WGZA 2UVDA 4UVDA 2D2IA 1JKFA 4L9RA 1L1FA 2GASA 3INTA 4FGWA 1BRMA 3OJFA 3ST7A 1S6YA 3JYOA 1EVIA 4QQRA 4Q3EA 1RM4A 3FD8A 5IDXA 5AXAA 3M6IA 1DFIA 2HJSA 3HUDA 2VZ8A 1HT0A 2FR0A 3CKYA 4KWHA 4CM9D 3SXPA 2BMAA 1XR3A 3LC2O 3ZWWA 2BGKA 4E5MA 3I9LA 1I24A 2YY7A 4IDBA 2JHGA 3B20A 4JBHA 5B4VA 1J0XO 1ZO8A 3GMSA 3OEWA 4D79A 3JCZA 2YZ7A 3RUIA 3PJGA 4Y6RA 5BQFA 1TT5B 3ZGYA 1R37A 4BO0A 3DBLB 1U3VA 1Y9EA 3TF5A 1LSSA 5IZ4A 5I7FA 3A28A 4DPMA 3GLQA 5ILOA 1DRWA 3BMNB 1FDUA 4OKIA 3D5QA 4L4RA 1CEQA 3O8QB 4LW8A 4QFDA 2B5VA 4WLEA 4CV3A 1N5DA 5CDSA 3WG9A 2YV1A 3EW7A 4MVJH 2FZEA 3AM4A 4XYGA 2HMVA 1IULA 3LT4A 4EGFA 3RFXA 1QYVA 2JCVA 1C1XB 2VYND 1ZXBA 1YB1A 2BD0A 3HFSA 3JQ7A 3GG2A 4GX5A 5L7YA 4BUCA 3GGPA 4KUGA 4CMIB 3AU9A 3VPGA 4BNGA 2NU9A 4R1TA 1Z82A 4BNXA 3G79A 1X13A 2ZCUA 4RCVA 3WYBA 3OBBA 3QP9A 1B14A 1ZFNA 5DOZA 1LDGA 3ZHBA 5K6AA 2PGDA 2CFCA 2IRWA 2X5KO 3A9WA 3M2TA 4ILKA 4PCVA 1P1HA 1ISMA 4J4TA 1M66A 3MJCA 2NLOA 4NJMB 4P4LA 4B4OA 4GX2A 3VDRA 1ARZA 3FR8A 1UP6A 4CJXA 3TNLA 3VPSA 4PLYA 2Y99A 4R9RA 4L73A 2DBQA 4JNKA 1R6DA 1WDKA 3JD2A 1YWGO 2WTBA 1PZHA 4EI2A 4CQMB 1AHHA 1O8CA 1YBMA 3B1JA 1GQ2A 5CFZA 1UZLA 4AJIA 1E5LA 1KEVA 3WS7A 3RSHA 3PP8A 3WIEA 4GI2A 1C3VA 1E1KA 2HCTA 4E0BA 1U4OA 3MTJA 5CPBA 4Q39A 4IMPA 5GZ6A 3G1UA 3B70A 8ADHA 3K96A 5A5FA 3GR6A 3DOCA 4FR5A 3WJ7A 2OP0A 1Y81A 3LLVA 1XCBA 1M76A 3UHAA 1AXGA 5L45A 5L4LA 2RBEA 4D45A 3OQBA 3QVXA 1LDYA 3QVTA 4R69A 5K0ZA 2Q3EA 1YQDA 4PGFA 2PH3A 2AW5A 4BMVA 3VKVA 3EZLA 3MJTA 2Z5LA 4CMCA 4A5OA 1UXGA 4BGIA 3I4FA 2E6UX 2AXQA 3ZHZA 3WGHA 2HSDA 3RKUA 3RASA 1R12A 2YQ4A 2AG8A 2FR1A 2O3UA 3PWSA 4J7CA 4E3ZA 3F1LA 1E6UA 3RC9A 1GZ3A 5THKA 4R68A 1MLDA 2C5AA 1NASA 3PLRA 1GYRA 3B6ZA 4FBGA 2YQ5A 5EINA 4IDGA 3ANNA 4CLEA 4CMKA 2V6FA 3K9QO 5I7SA 3U5TA 3M1LA 5HS4A 2YW9A 5HBRA 3GFGA 3NV9A 1DIGA 1X14A 5ICMA 1ADBA 4CLRA 3TL2A 2Z95A 3FNFA 3BMQB 3E9MA 2DTXA 3UKOA 1X7DA 1R4MB 1BVRA 3OFSA 1E92A 4P8RA 3W6ZA 5KJEA 4O5OA 3A1NA 1DJNA 5K6AC 2B4TO 4Q3BA 3UH1A 4PLTA 3H7AA 1JTVA 3NYWA 4B7CA 1ZIDA 5JY1A 4DL9A 1K6XA 1N7GA 2ZJ1A 1V3VA 2IDZA 3WIDA 4J1TA 3LF2A 4KP7A 5A05A 3WGOA 3F3SA 3U09A 1EQ2A 2E49A 3CMCO 3PTZA 2HMUA 2NACA 2WYVA 5L3ZA 3CPSA 3E8XA 2AQ8A 4NDNE 2SCUA 2DKNA 3FTPA 5HRUA 3HN2A 1XSEA 3ZWYA 4HADA 4YAJA 1M75A 5T57A 1DEHA 3M1AA 5BSHA 3EC7A 3OH8A 5IN4A 2BELA 3CINA 1F06A 3C85A 3H5NA 3WQSB 1LC0A 3PI7A 5IZCA 5JYEA 4MVJA 2H9IA 4AJNA 4DVJA 1NQAO 5J23A 1NQTA 1HE2A 3PGXA 4PLPA 1Z73A 2ZYGA 2X7HA 4DMMA 2AEJA 4BNYA 1Q7CA 2Y68A 3QSGA 4M49A 4BQPA 3JSAA 3OECA 1EVJA 3OP4A 2DT5A 4CL8A 1ZMOA 1J49A 4W6ZA 1YDWA 3PHGA 3Q9NA 4FJ2A 1CJCA 4NK5A 4E2ZA 3Q2KA 3KETA 1RJWA 3ZV3A 3KHUA 1XELA 3E1KA 1H2HA 1HSZA 2AE2A 4OXYA 5A5EA 4MKZA 3U4IA 4FD3A 3JQDA 4PZDA 3JV7A 4UULA 4GPD1 3DQPA 4WCDA 4KMSA 2FOIA 2C54A 2P68A 4UEJA 3H9JA 4TRNA 4WLFA 5JCJA 3CIFA 4IPTA 2UDPA 1W4ZA 4Y8VA 1XG5A 3WFIA 3I6QA 1A4UA 4BO5A 1RYEA 5DBGA 1B16A 2VYVD 1EQUA 5G0WA 1UDBA 4PZCA 2I3GA 2NVBA 3CZMA 3HQ4O 4BS9A 4YT2A 3TN7A 1U8XX 3E9NA 4BV8A 4XYLA 4WASA 1PJCA 2JD2A 4XQEA 4HX5A 3SBOA 5ER9A 2P5UA 3RQSA 8LDHA 5ER6A 4NJOA 1O89A 1P31A 1YQGA 1SBYA 3OIFA 5COBA 2H6EA 1B3BA 4R51A 5JC1A 3QJ5A 2IEBA 4ND3A 1HTBA 3VKUA 2O3QA 3AUSA 1ZBQA 1QYCA 3BTSA 5TT0A 3VC7A 5A04A 4CV0A 1YS4A 4RL6A 4EEXA 4Z6KA 1LRLA 3NTOA 5B12A 4O6VA 3I3OA 1K5HA 1EFKA 4PFJA 5TRTA 2QYSA 3LT2A 1YDEA 3RUDA 4AJ1A 1ZSVA 2HRBA 2POQX 4QUKA 1HSOA 3D7LA 4RPGA 4XQCA 2YHUA 2ZKLA 5ENVA 3OA2A 2A9FA 3GEMA 5KJCA 4AFNA 2QG4A 1NM5A 3EY4A 3HDYA 1N9GA 3DBHB 2X1HA 1J4AA 4IDFA 2G17A 4ID9A 2G76A 5T8KC 3VH4A 1B15A 5TQVA 3KYCB 3ON5A 3GPDG 4J4HA 1ORRA 4DLAA 4EYEA 2TMGA 4AJ4A 1TLTA 2WEKA 2XXJA 4IDDA 2CDBA 1A5ZA 1U1IA 4YJGB 3VZRA 1GEEA 5I9NA 4WEQA 2X22A 2Y1DA 1XKQA 4KTTE 5DCUA 3JD4A 2X0JA 4HV4A 2FHSA 1ZNQO 4O59O 4D46A 2B5WA 4FC6A 4R01A 2H5LA 3ROMA 1O94A 3QY9A 1XA0A 1GFSA 1JWAB 3E48A 4L8VA 3ROQA 4NH4A 4Z3KA 1ZJZA 3VTFA 3GZNA 4GAEA 1MC5A 4CMJA 4BB6A 3L4BC 5HA5A 1LDMA 3DZBA 1NBOA 3MOIA 4CL3A 4DQVA 4LVCA 2O50A 4FGSA 2R00C 3IS3A 2OBNA 5EL0A 2FPPA 1L7DA 3ZWOA 2VOEA 5FI3A 4JCOA 4DPLA 4B4UA 3FBTA 4NU6A 2B37A 2GR9A 1LSJA 1DAPA 2NU8A 3PPIA 4WGGA 2DVMA 4RO0A 1KEUA 1X0VA 3ZV4A 4L4SA 4P38A 4ALNA 3DHNA 4YVFA 5TGDA 2ZB8A 2EHDA 3JYQA 5C7OO 1SOWA 1LUAA 1P33A 2GRAA 4FOOA 3PFFA 4PG4A 5CHEA 2NQTA 4IJUA 1DSSG 4R3WA 1GUYA 1XDWA 4LCEA 3Q11A 3W8DA 4CMBA 3WGIA 2W2KA 3LQFA 3V1UA 1B3RA 3PFWO 3SEFA 2EW8A 1WXDA 4TZKA 5G4KB 2D8AA 4D44A 2GZ3A 4JLWA 4BNFA 2RAFA 3AY7A 1B8UA 4CM8A 1CERA 2ZQZA 1ZJYA 3ENNA 4E13A 3IOYA 3MCVA 4CM1A 2NWQA 1T2FA 4YAGA 4Z9FA 1R0KA 1U4SA 1ULUA 3D64A 1HYEA 3R0IA 2RCYA 1PJLA 4EJMA 2O3TA 4RF3A 2W2LD 4XRGA 5IF3A 1NQOA 5JDCC 1YOVB 4BNTA 3L6EA 3K92A 3COSA 1E7SA 2I65A 4DTIA 4JROA 1A7AA 3KB6A 4M87A 1NPYA 2DBRA 5TNXA 1FDWA 2JAHA 1PGNA 3NTQA 3GVXA 4I8XA 4Z9YA 2H1SA 3W4IA 4ZICA 1JN0A 5KCZA 3GVIA 4XIJA 1IE3A 5DZSA 2CF6A 5TJ9A 1KYQA 3D4OA 4WOKA 4RPHA 3NX4A 4F3YA 1QXSA 1T1RA 2DBVO 2FZWA 2UUPA 4D3FA 4YRAA 4IINA 4W82A 3ONDA 1B26A 1ZEJA 3MJ4A 3K73O 2EF1A 2Q2WA 3DZHA 4OM8A 5COAA 2OOSA 4J7XA 2PD4A 4ONEA 1ZK0A 3RWBA 4DYVA 2Y67A 4PG8A 3AWDA 1H2BA 1LRJA 3RJ5A 1LLDA 3BHIA 4QXMA 4XKJA 5A4DA 1ENOA 1EVYA 2Y0DA 4TVBA 4K6CA 4J49A 2VWGA 3RKRA 2B83A 1BDBA 3BA1A 1NPDA 3GNSA 3JQEA 1DHTA 4R4JA 3VPHA 5FI5A 4CUKA 4DBZA 3P19A 3F5QA 3V8BA 2GN6A 3PDJA 1EFLA 4GQAA 3LC7O 4CM9A 3UVEA 2NU6A 4AJLA 4OQZA 1SCUA 5EQFA 2EEZA 1H6CA 4YT8A 5IXYA 3D3WA 1P3DA 2HLPA 3WTBA 3TZKA 1PJQA 3PWKA 2D5CA 1SO8A 5B4UA 4TZTA 4DBVO 3ZW9A 2Y1CA 1FJHA 4DUPA 2X5OA 1U5CA 5F3RA 4OH1A 5JAQA 4OYRA 1NX6A 5KIAA 1PL7A 2P9CA 2JFFA 4XYMA 3SC4A 5HWSA 1QR6A 5F5NA 3RFTA 1P77A 1P44A 3DL2A 1JW9B 3GVHA 3DZKA 4J2HA 4YJGA 1P0CA 3AFMA 4IS3A 5H82A 1MXFA 1H9BA 3INGA 3V2GA 2A35A 2VYNA 5CEEA 2O23A 4J1NA 3FF4A 4KTVE 2IZ1A 4JP3A 2NSDA 3IUSA 3O9ZA 1T4DA 1QSGA 3ABIA 3QE3A 4FFOA 4ND2A 1HDOA 4B3IA 4WE3A 4H3VA 1PJ4A 3R1IA 2ZQYA 1PWXA 4AJPA 1PZFA 1M6HA 3TOZA 3IL2A 3RUFA 4EJ6A 1DHRA 3E5RA 4FW8A 5I9MA 1BXZA 1ENZA 4XYEA 3WWZA 1QV6A 4M8SA 2O48X 3KXDA 1I8TA 1YKFA 2W4QA 1MFPA 1PGOA 5BR7A 3A4VA 4JP2A 2O7QA 3JD0A 3ZNQA 2EG9A 2D4AA 3R3SA 1ID1A 3WYCA 3ANLA 4GL4A 2VHWA 4I5GA 4LMPA 1MV8A 4CR7A 5DP2A 5C37A 3GHYA 5A3JA 3GY0A 4FJ0A 1BW9A 1ZH8A 3FNEA 3GK3A 3H6KA 3GDFA 4D43A 2AE1A 3DZGA 3HDJA 3ZNPA 3NDRA 1BTOA 2C07A 1NWHA 4PLZA 1T2EA 2D1YA 1R66A 3Q3CA 3QVOA 1LI4A 1T24A 2QIOA 1I30A 3IP1A 3ROPA 1LLCA 3DMTC 2FMUA 2I5PO 2I6TA 1T4BA 5CEJA 3K2BA 1NFQA 1B2LA 3ZWCA 4XX0A 3GDOA 4OSOA 3ZWVA 4Q3DA 3GGOA 3RVDA 1Y5MA 2PFGA 2QZZA 1R0SA 4G5HA 2J3KA 3VPXA 5G2OA 1VJTA 3JYPA 4II2A 3I1JA 4NHEA 4JBIA 4YAIA 3NT4A 4IZHA 4JN6B 3ZU4A 5JMPA 2ILTA 5JBIA 3NGXA 5JFOA 1U2DA 4LSMA 2OORA 4GVLA 3FPCA 4YT4A 2WD7B 1YE3A 1GV1A 4MVJP 2DFVA 4XR4A 2OUIA 1CRWG 4ZQHA 5BSFA 3BMOA 1VKOA 4CM4A 2VZ0A 4DGSA 1JQBA 2VCYA 2NUAA 4IGEA 3H9GA 1TA4A 1MC4A 4K28A 1XHLA 4EBFA 4KUEA 1W8DA 3UXYA 2VWPA 3PYXA 4BKUA 1LJ8A 2R2GA 3P2OA 4ITUA 2HK7A 3F9IA 1A4IA 3RIHA 3DHEA 3Q9UA 1WVGA 1MA0A 3JQ9A 4U8GA 1NVTA 5MDHA 3MZ0A 1R16A 1JAYA 3P5SA 4PRLA 4BO7A 4GX1A 4BB5A 3GVCA 1DFGA 4OMUA 3E5MA 3VOSA 2G0TA 4IXTA 1NFFA 3IJPA 1JVBA 3JQAA 4NU5A 1KBZA 4A0SA 3ZN2A 1SOVA 5A02A 1R4NA 3E18A 4J91A 4LCJA 4RZHA 4PG7A 1V8BA 4RPJA 3H8VA 1XU7A 3C7CB 1ADFA 3FBGA 4CPDA 3AFNA 4J90A 2ET6A 1BXGB 3O26A 5HS6A 4M54A 3UUWA 1YBAA 1J6UA 1VI2A 3M2PA 1E3WB 1BG6A 1DLIA 1EDOA 3NT5A 4OQYA 5JSFA 4N5MA 3I23A 4ZQFA 3U4HA 3VHRA 1A72A 4IIVA 4ROSA 3WB9A 3TZQA 4YRBA 1JAXA 2GNAA 3EZYA 1NP3A 2QRJA 5BNTA 1NNUA 1J5PA 2GSDA 5HM8A 3K31A 3S2FA 5DF1A 3X2FA 1E3JA 4MKXA 3VZQA 3D4PA 1X7GA 3LK7A 3CMMA 2GCGA 3EDMA 1OBFO 4HFMA 1OMOA 3ASUA 4MINA 2EJVA 4R1UA 4A26A 1NQ5A 4LK3A 2AQKA 3I9OA 4CUJA 1X15A 2HQ1A 3N74A 1D1SA 1E7YA 3K2EA 1PIWA 5B4TA 1Y8QB 4FFMA 3ZU2A 4JIGA 1XU9A 1VSVA 4GBJA 3TFQA 5TT1A 3JQGB 2Q1TA 4DIFA 1VJ0A 1I2BA 1E3LA 3HDHA 4DLLA 1HZZA 3AUTA 1UH5A 5TC4A 1JKJA 3U49A 2DU8A 1DFHA 1UXIA 4CLOA 4U6QA 2JHFA 3OETA 3D4NA 1SEPA 3CTMA 3EVNA 2E4AA 4QT0A 4Y98A 5BNIA 3JQ8A 1G1AA 3FWNA 4DA9A 3IKTA 4YEDA 4OIMA 5JMWA 2VYVA 3KYDB 1W6UA 2JD1A 2JCYA 1GADO 3DBRB 3OA0A 3WBBA 1JWBB 3H3JA 1DRUA 4Z0TA 1QYWA 2UUOA 5AYVA 3WSWA 3HSKA 1O95A 2IZ0A 1FXSA 3STHA 4YBZA 1DIHA 4G65A 2JCXA 3UCEA 3EMKA 4ZJUA 4K1LA 1V35A 1UJMA 1VKNA 4BO2A 4R16A 2J8ZA 2PNFA 3GMDA 2VQ3A 1Q0QA 3PIIA 3ZWNA 4UEKA 3H3FA 3LSYA 1P1IA 5C3MA 2H63A 3O4RA 4CR8A 3L6OO 4OXKA 4XJTA 5A9RA 1PS9A 1SNYA 1HDYA 3ANMA 3A14A 2X58A 3BXXA 1ONNA 3PVZA 4XGKA 4BGUA 2I67A 4IM7A 5U4QA 3VZPA 3OJEA 4UVGA 2Y1GA 1PGQA 3AUUA 1CETA 4ZN6A 1KS9A 3E6AA 1PL6A 3PJFA 4RQUA 1E7WA 1GQYA 3KLMX 4YDRA 3HFGA 1T1SA 2O3SA 3EK2A 1RM0A 3NUGA 2G1UA 4BNVA 4UVIA 4EUEA 2PGLA 2O4CA 3OQ6A 5GZ3A 1GYPA 4XDYA 4RVDA 3TSCA 3D5TA 3ZHXA 3I9MA 3MEQA 2G5CA 2VHXA 1QLHA 2A4KA 3HN7A 3ICCA 1GTMA 1I32A 5AQ1A 2C59A 1Y1PA 4OOFA 3MJEA 5GMOA 1RKXA 1U7HA 3FNGA 1UXKA 1FMCA 1KVSA 1YH3A 2BGLA 1LSOA 4IJWA 4L76A 1ZXLA 4MIYA 4RLSA 5JS6A 4WCFA 1HE4A 3DC2A 4N18A 1UAGA 5F1OA 3ZU3A 3KTDA 1Y7TA 5G0SA 5CDUA 1S7CA 2B69A 3GFBA 3FN4A 2OMEA 4YYZA 1Y8RB 1MFZA 1Y6JA 3PHJA 4YR9A 4KQWA 5IJZA 2WE8A 2YHIB 3JQAD 2J3HA 1A27A 3HDQA 1EZ4A 4DIOA 2V6MA 5JW6A 3GN2A 3L9WA 2FSSA 4MIOA 4IQGA 3PDUA 4J6FA 5CG2A 3KSDO 4EDFA 2GN9A 1K0UA 5EPOA 3KOUA 5A9SB 3MTGA 4XJSA 1WZEA 4OGWA 3ASVA 5L7TA 1DBVO 1TT7A 3KBOA 3PLNA 2ZK7A 4E32A 2IXAA 3LT0A 1RM3A 4LRSB 3BHMA 3OF2A 4M1QA 2DUUA 4UUOA 1JVSA 2DUWA 4TKMA 2EP5A 4B3JA 3ONFA 4XEHA 2ZCVA 2Y1FA 1H93A 1TT5A 2Q99A 1QV7A 3BMCB 1KVTA 3PWZA 4RVSA 4E4YA 3HNPA 3U3XA 5L4NA 5U1PA 3DBLA 1HDCA 1ONOA 3MJVA 3TQHA 3PRJA 2C0CA 3NKLA 1GUZA 1WWKA 2IXBA 3BMNA 1NPTO 1DO8A 2X0NA 5IDWA 3O8QA 1GD1O 1E3SA 2J5RA 2W2LA 2YV3A 3DMYA 3Q0EA 4R1NA 4DXHA 2PA3A 2RH8A 5TLSA 2QX7A 1AN9A 2C2YA 1K6IA 2AEFA 4F6CA 1O9BA 3GG9A 3GH3A 1Y9AA 4PLCA 1EUZA 1C1XA 4CUZA 3U4CA 4B4VA 1HETA 4JJIA 3E9QA 4PVDA 4NNJA 4H7PA 2PH5A 2Y66A 4HY3A 4OKNA 1EBUA 4CMIA 4NMHA 3RROA 1QYDA 3PK0A 4CM6A 4I9HA 4AJKA 4KDEA 4HFNA 4PG6A 3EUWA 3PHLA 1X7HA 2VWHA 2NTJA 2X9GA 3ZWXA 5A03A 2OL4A 4WNCA 2DPHA 3KZVA 1I2ZA 2BFMA 4RLHA 4NQZA 5T5QA 2P4HX 1D8AA 1LX6A 5GY7A 5FFFA 4C4OA 4PN3A 4PG5A 4NJMA 1E0DA 4ZVVA 2GDZA 3JQFA 1D3AA 1EE2A 5EJ2A 1MX3A 1ZK2A 4BMSA 2NU7A 2FP4A 3AK4A 1NYTA 1GU7A 1GZ6A 3KLPX 3JTMA 1F14A 2ZB3A 3ONEA 3SLKA 3W4KA 4BKQA 2HRZA 4CQMA 5L9AA 1PX0A 1U3WA 2Q45A 7MDHA 5DDIP 1TB4A 3BTVA 2OXIA 4CR6A 4E6PA 2XF8A 2RIRA 4OL9A 1PZEA 5IZCC 2G82A 1WLYA 1BMDA 1YB5A 3H9QA 1EUDA 2WYWA 2O2SA 5C7IO 4RORA 1P9LA 1PJ3A 1X1EA 3H2ZA 2R6JA 1I3NA 1K2WA 4R54A 5LCXA 3BAZA 4N7RA 2QRLA 1FDTA 3PGJA 5L95A 4R41A 3VPFA 3CE6A 1I5RA 3MWEB 4KZPA 1KY4A 5ICSA 1P74A 4BNJA 3F4LA 2Q1WA 2V6BA 5IDYA 2ZYDA 3H5RA 3GNQA 3S2IA 4F6LA 2PR2A 4MO2A 1C1DB 4XA8A 1BWSA 3RJ9A 2NTVA 4MIEA 1LTHR 2IEDA 3RI3A 1KC3A 4L4XA 3W8FA 3LDHA 1JA9A 3EGOA 2GLXA 4ZRNA 5CG1A 5DCYA 3P7MA 1I2CA 2GN4A 1IOLA 4NFYA 4EITA 3H5AA 3A06A 4HNHA 4NBRA 3UF0A 3V1YA 4GKBA 3AOGA 3MJSA 4Y6SA 1HEUA 4CV1A 3HG7A 3N58A 4YJHB 4J0EA 1R15A 3L07A 3R6DA 5CDGA 5THQA 4BNUA 2GYYA 1KVQA 3BMQA 4J3FA 1SB9A 4XQGA 1R4MA 2CDCA 1O6ZA 4GKVA 1YBVA 3DWFA 3KVOA 1IHYA 3ORFA 2VRCA 3RFVA 5GZ1A 2BFPA 3AI1A 2C2XA 3GN1A 2TMDA 1LSUA 3C8MA 4E33A 1YJQA 1SMKA 3GF4A 4A7PA 2Z1MA 3QWIA 1ZEMA 1NXQA 4YB8A 3W4JA 3WGQA 3OQ1A 1DDOA 2CDAA 4TRMA 1NWCA 2X4GA 4YJFB 3BHJA 3MWDB 4J2OA 4NIMA 4GX0A 3Q6IA 3U4DA 5KJ1A 1H0KA 4CMEA 1BHSA 2BKAA 3UAGA 2CZCA 4BO6A 3WMWA 4OXNA 2EJWA 4ZD6A 1TVEA 2EERA 2JL1A 4CQLB 2XXBA 2QZ9A 4PRKA 4BNHA 3TZ6A 4BHTA 6ADHA 1B0AA 2OZPA 2DLDA 3RC7A 3DTTA 1UDAA 1PGJA 4UVEA 1KC1A 3QA9A 3ZWAA 5LC1A 4Z3DA 4CMGA 2ZYAA 3EYWA 3AY3A 2WYUA 3RBZA 2P9GA 1DIAA 1XLTA 2HK9A 5JO0A 2HKIA 4B8WA 1C0IA 2ZTUA 7ADHA 1YL7A 4J9VA 3DXFA 3ROKA 4RF4A 4LVUA 4WPGA 3UFXA 1YL5A 5EMHA 4TROA 3TPCA 3SVTA 3IP3A 3QWFA 4WECA 5AXDA 1UZNA 5TS3A 2VUSA 5IDQA 4JXKA 4QEDA 1VC2A 4E2YA 4ZQBA 3PYMA 1ISGA 4U0JA 1WNTA 1U5AA 5KWEA 2DFDA 2P4QA 3TZHA 4ALKA 3ZNNA 1BSVA 4I9UA 3LZ6A 4TMFA 3GUYA 3L9XA 5I9LA 1NAHA 1P1JA 1EVZA 1MB4A 3PQDA 1LRKA 2AG5A 1GCOA 3OMLA 4NBWA 2EW2A 4KOAA 2NVUB 3F46A 1GUFA 4W99A 4IZIA 3H4VA 3VVBA 1XEAA 3WLFA 3DZJA 4IDEA 3G3EA 3IJRA 1JLLA 1MG0A 2O3JA 3IMFA 4JX8A 4PVCA 5DBFA 2WSBA 5ENDA 4CQMD 4D3DA 3U0BA 4BMNA 5I7VA 5L51A 1HE3A 2GPTA 1MXHA 5JE8A 4UEOA 3ZV5A 3G0OA 2DBZA 3NT2A 3UCFA 3WFJA 4NR0A 4LGVA 2EP7A 1DXYA 1VRWA 4J4BA 1ZSYA 4E31A 1P1FA 3JQBA 3LF1A 2X9VA 1IY8A 1QG6A 4OSPA 1AE1A 4BO3A 2ZJ0A 3T7EA 4GWKA 1GZ4A 3DZFA 3W1VA 3AOEA 2A92A 4RF2A 4CM3A 5AVOA 1DLJA 1EBFA 4E21A 1ONPA 2X0IA 4J1SA 3DBHA 3WSVA 1B8PA 2HMSA 2Q2VA 1EEHA 4AICA 4B7UA 5CEFA 5F5LA 5IFLA 5AXBA 3KYCA 1LDNA 1PEDA 1Z7BA 2Y0EA 1BDMA 3ZH2A 4TVOA 3OM9A 4PLVA 5L40A 3IQDB 4YQZA 2VNSA 1D4FA 1HDGO 3DTYA 3TFOA 1XWFA 3RUHA 1VJ1A 3ITDA 2B4RO 4IQ8A 1H6DA 2CMDA 4Z0PA 4JJGA 1ADCA 2NVWA 3AM5A 1F17A 3FNHA 2PV7A 3DZIA 1XYGA 3TWOA 1BXKA 3CXRA 1ADGA 2QHXA 3HHPA 4Z9XA 4BKRA 3U62A 1WZIA 4NPCA 1WMBA 4INAA 4WJZA 1IZ0A 1PTJA 5FEUA 4ZQGA 3OJ0A 2OBYA 3PEFA 3GVPA 4I08A 2VRCD 3GA0A 1LEHA 4GWGA 3KM0A 1LA2A 2CVZA 2VTDA 3WTCA 3WICA 4YXFA 1ZK1A 2OFPA 1PJBA 1P1KA 2VOJA 4I9NA 1U7TA 3JQ7B 4E2WA 2W8ZA 1WP4A 3BIOA 3WJAA 5JDIA 2C7VA 1PS0A 4R5HA 2CUKA 3DBVO 4E12A 3QRWA 2Q1SA 1LLUA 3WQQA 3P2YA 2P5YA 4QECA 3PQFA 3TDKA 2I66A 1KETA 3IUPA 3C24A 4HP8A 3WR5A 2NADA 2Z1NA 1LQUA 2C29D 4E5YA 3H9UA 4YRDA 4W4TA 4GLLA 2EV9A 2VN8A 2HDHA 3PXXA 5EN4A 2WJPA 3S8MA 3ENKA 5TX7A 2GF2A 5CAEA 2ZB4A 5G4KA 1D1TA 2ZB7A 4MVJI 3I83A 4UUNA 4WLNA 4CM7A 1PJTA 3JYNA 3LU1A 1F0YA 3IKVA 4JGBA 5EERA 1E6EA 1E6WA 1HDZA 2QW8A 4ND1A 3SX2A 5JYDA 1OC4A 4BVAA 4C7JA 3K5PA 5AXCA 4AJ2A 2Y0CA 2WMDA 3GQVA 2ZIZA 3FRJA 4AJJA 2J3IA 1YOVA 2E37A 2YJZA 4YAEA 3QW2A 5F21A 1WDLA 1BGVA 3GZ4A 1EK6A 1HF3A 2CF5A 2J6IA 3HZZA 3IDSA 4C7KA 2OGUA 3VH3A 1YRLA 3WQRA 3BYZA 4XIYA 1N7HA 3FTNA 3CEAA 4QFCA 1QLJA 5ILGA 2VUUA 2GO1A 5MGBA 1QKIA 3ZV6A 1DC3A 1YL6A 1RWBA 2C82A 5A1TA 4CLDA 4YT5A 5JPIA 1PQWA 3RUAA 1FF9A 1GL3A 1O0SA 4W7IA 4YA6A 3JQ6A 4M55A 4TKLA 4J7UA 5L4SA 4FFRA 1LDBA 3WNQA 5JO9A 3LC1O 3GNTA 1NHWA 2HMWA 1A71A 5TF4A 3JYLA 4WKGA 3AM3A 1I3LA 1FDSA 2AEMA 3ITKA 2O4UX 2EWMA 4OJNA 1QMGA 4IGFA 2QYTA 4CLRB 1ML3A 4A03A 2O2YA 3I4CA 1ZVMA 3ICPA 3JD1A 3LVFO 1RYDA 4J1QA 3S2EA 4E5NA 4P4NA 4LRTB 1E7MA 3H9EO 3RU9A 2EGGA 3DR3A 1KEPA 2PK3A 1E5QA 5CP8A 1QYXA 4Y9DA 3GGGA 3WNVA 2HMTA 4QSMA 2PZMA 2XOXA 3KYBA 4HBGA 4MVJF 5DULA 1Y5RA 3V1TC 4DRYA 3OICA 5F1PA 1CDOA 2BI8A 4DC1A 3LYLA 1DC6A 2I9PA 2DC1A 4QTZA 5T6BA 1OC2A 4Y67A 3VZSA 1DJQA 3TL3A 3IIEA 4D41A 1Q7BA 2P2SA 4AG3A 2PD3A 4FCCA 4DYDA 2XAAA 4ZGWA 3V5NA 4QO8A 4AJHA 4D3SA 2F00A 4FFNA 4FC7A 1B8VA 5BNFA 4GGOA 2Q4EA 2B0JA 2D3TA 1AXEA 1NFRA 2QRKA 3BTOA 4B4WA 3EAGA 1SC6A 1V9LA 3Q2IA 2DM6A 1EUCA 3GOHA 1UZMA 4FDAA 4WK6A 2B4QA 4WOJA 1E77A 1I36A 1GAEO 4XYBA 4XDZA 2FR8A 2VHZA 1HDXA 2D5AA 4B79A 4EUHA 1Z75A 5LDGA 2JD0A 3B1KA 4HUJA 3DOJA 4WLUA 2IE0A 3G17A 1VL8A 3JQ9C 5DOVA 2V6GA 3B1FA 4BQRA 1H6BA 4YJDA 4L0QA 4J43A 1K89A 3SJUA 4DLBA 5KVVA 3FCOA 5IAAA 5TIIA 3RAJA 1LLQA 4H15A 4MVJG 4AJEA 3RU7A 4IXWA 4S3MA 4ALIA 1F8FA 3NDJA 3GRKA 4MVJE 1TXGA 2D0IA 3KEQA 1DIBA 2P91A 1DAOA 1D7OA 2EKQA 1IUKA 2Q46A 1PGPA 4JJFA 1NR7A 4G2NA 4I5FA 1M2WA 4NFHA 3TRIA 3ULKA 3UCXA 3QV1A 5JLAA 3GRPA 3Q1LA 4IIUA 5JXWA 3CH6A 4KUHA 3CZRA 2OHXA 4IDCA 2YDYA 3DFUA 5EIOA 1I3KA 1HRDA 2BHLA 4HXYA 4EJ0A 4UAGA 3QLJA 1VM6A 2YDXA 1LC3A 2AQHA 3TJRA 3IAHA 1WPQA 2CSUA 3S1LA 1Z74A 4BNIA 2PKRA 3HADA 3AUAA 5ES3A 2Q1UA 1UP7A 5BSEA 4OOEA 4NI5A 4MP8A 3NRCA 4YACA 3WLEA 5JNLA 3RUCA 4KWIA 3OJLA 3WGTA 4RQTA 4GGPA 3MOGA 3GAFA 1V6AA 1E7RA 1SB8A 1HLDA 3I52A 1YQXA 5A3VA 1T2DA 3RC2A 4DQUA 2WD7A 1CQJA 3C1AA 1I0ZA 1L7EA 1N2SA 3KEOA 3NTRA 3QWAA 5EESA 4GH5A 1Z45A 3ZI0A 1JDJA 1E7QA 2DTEA 2BH9A 3K30A 2LDBA 5DN9A 2PD6A 1IZ9A 1N9GB 2HJRA 1PU2A 4F45A 2I3AA 5LDHA 2C7GA 1N92A 3SC6A 1ZW1A 4WLVA 3WGGA 4RPLA 2C5EA 4E30A 9LDBA 4GSKA 3KV3O 1M6WA 4BNNA 1C0PA 3O03A 1ISFA 3T4XA 2ZTVA 4BL5A 3INRA 4DPKA 5B37A 2GUGA 3OSUA 4ZRMA 4MP3A 3GHHA 1VLLA 4K6FA 3C1OA 2JFGA 1XQ1A 1X1TA 2Y05A 1N1GA 1T2AA 4HWKA 3FHLA 4CM5A 1NTOA 4A2CA 4DC0A 2HUNA 3F4BA 3FPLA 3I9KA 4XGNA 3GZNB 4XD2A 1UP4A 4U6SA 4RGBA 2EKLA 4TRRA 3ZWMA 1ZK3A 1BXGA 2BRUA 4FFLA 1ISHA 4HNGA 1E3WA 2WM3A 1QORA 2X23A 1P45A 2VT3A 4EW6A 2BGMA 4NFSA 5KKAA 4EUFA 1X0XA 4P22A 4UVHA 4D0SA 4XB2A 2PY6A 5FWNA 4IJKA 1U8FO 3D1LA 1I10A 4BOYA 1A7KA 1GV0A 2FPGA 1TI7A 1DC5A 1WAMA 2VUTA 1LNQA 1EMDA 2GZ1A 2O7SA 4B7XA 5ADHA 2DPGA 3OIGA 4K9DA 2I99A 3NAQA 3QHAA 4RDHA 3OIDA 4EZBA 3GT0A 2GZ2A 1N8KA 4ZU3A 2HAEA 1MP0A 4NK4A 3K8ZA 4H16A 1SZJG 1ZK4A 4IBOA 1PJ2A 4A27A 5IN5A 1YB4A 1Y8QA 1GR0A 2YUTA 2W2KB 3JQGA 1QP8A 1HL3A 4FQ8A 1UDCA 3PJDA 1ISIA 1PQUA 3SLGA 4AL4A 4CM8B 2J5KA 3WGYA 1BVUA 2LDXA 5T8KA 3PHHA 5KOIA 1OFGA 5KJ6A 4TWRA 3ADOA 3TOXA 2PTGA 3ETEA 3C7DB 4XZ3A 4WCFC 3KYDA 4JQCA 2X0RA 2BFOA 3RBVA 4B3HA 1VPDA 3DBRA 4DWVA 3ETGA 1C14A 3V2UA 3LLSA 3U9LA 5JAIA 3OEYA 4XR9A 2WD8A 3AY6A 4R1SA 5EQDA 4R5MA 2BLLA 4ALLA 4CODB 5JAMA 1ZSNA 4IMRA 3L4BA 1T26A 4BIIA 4MJLA 2GN8A 1TEHA 2R00A 3WX0A 2XPCA 1WW8A 1PR3A 1GDHA 5L53A 1G6KA 3I6IA 3NGLA 1RPNA 4LMRA 1E1MA 4XGIA 5C5IA 3AW9A 1H9AA 1V3UA 4OHUA 3W8EA 1XQ6A 3L77A 1AGNA 4TRJA 3AJRA 3G49A 1PJSA 1Z7EA 3R3JA 4D0RA 1I01A 4O0LA 3WMXA 4GLOA 3RD5A 5DCWA 2RHCA 1VE9A 4J0FA 1NR1A 4Z0HO 1IYZA 1Q0LA 1UAYA 4TSKA 2J3JA 1Q7GA 4XRRA 1ENYA 3D3WB 3E82A 3ADPA 2JJYA 1T2CA 3PZRA 2DTDA 1DB3A 4Q3CA 1GQQA 1N1EA 2WWRA 3UICA 3DB2A 3HB5X 1DC4A 3QWBA 3SJ7A 1DRVA 4HFJA 2WDZA 4BO4A 4CLHA 1NVGA 4NBVA 2J5QA 1HYGA 2QQ5A 4WLOA 1UUFA 3ZHYA 4U5QA 1AHIA 2I76A 3DONA 4FIZA 4ALMA 4FB5A 4BO8A 5KJFA 4MPDA 3F47A 5JDCA 1OAAA 4YQYA 2W90A 1FDVA 2AA3A 3HWRA 1UXJA 5I8ZA 3WOHA 4KDFA 4F46A 3I9NA 5CDYA 4RJTA 2VWQA 1G0NA 1MGOA 4YWJA 2FWMX 2UV8A 2FY8A 3VAZA 3DAFA 2X9NA 1Y8RA 5ITVA 2EXXA 4RVHA 4J16A 4BO9A 2YHIA 1ENPA 1KERA 1EDZA 4R3NA 3JQFC 1WDMA 1UXHA 4A10A 3GAZA 3NEPX 4I1IA 1V0JA 1HLPA 4IDAA 6LDHA 1IPFA 4PIVA 2HU2A 1KVRA 2GERA 2P9EA 2X86A 1E3EA 1KEWA 1NHGA 4BGEA 3F5SA 5A9SA 5A9TA 3S55A 5I7EA 5IXSA 2X8LA 4UUPA 5DT9A 3H2SA 4I5EA 4O63O 1U9JA 2E82A 2HO5A 2IZZA 1EK5A 4K26A 3I5MA 2AQIA 4DMLA 2DQ4A 2EKPA 4BNWA 1HYHA 5DNAA 5KTKA 3VH1A 3C1TA 4ZA2A 3QQPA 4RVUA 5C7LO 4QO7A 2B35A 5COQA 1W73A 3RBXA 2ZTMA 2V7PA 1H5QA 2NM0A 2W98A 3BMCA 3KO8A 4KQXA 1O5IA 2V65A 4WNIA 9LDTA 5JC8A 3CSDA 1VSUA 1BW9B 3LT1A 1VL6A 2FN7A 4UUMA 4E5KA 4ALJA 4RVGA 5G4LA 3DDNA 3GC6A 4AVYA 4RZIA 3AU8A 4BGVA 3GPIA 3UOGA 4MVJD 3QIVA 1CWUA 4M86A 2JAPA 1OOEA 4X54A 1HWYA 3GEGA 2PZJA 1HKUA 3VVCA 4FSHA 3WXBA 1GEGA 1Q2XA 5BSGA 4MOWA 3VH2A 1AUPA 1B7GO 1PL8A 1H94A 2ZATA 1Z6ZA 1U3UA 3ZWPA 1W0CA 4HKTA 3UW3A 1V3TA 2IYPA 4OO3A 3TZCA 2UYYA 3JD3A 3NJ4A 3WDSA 1OI7A 4XCVA 1I3MA 5KKCA 3WBFA 4DREA 4W9NA 4WEOA 3ZW8A 3OJOA 3KRTA 1E3IA 5DBIA 1XIVA
chains in the Genus database with same CATH superfamily
1XTPA 1ZU4A 2JLXA 4ZCIA 5AO9A 4ZAYA 2ZSEA 1KR2A 3W3AH 1F0KA 4K6HA 1GNQA 3DKRA 3MTEA 1TJ5A 2I91A 3KL4A 2NQ8A 4E5PA 2EZTA 2HT1A 3ZZNA 5FHQA 1LNSA 2BMVA 3QI2A 2QLFA 3S2SA 2HA5A 1IJEA 4UM8B 4EHJA 4EY4A 2O57A 2BEWA 1BQ3A 1KDRA 1SBZA 2PT7A 3AI3A 3VR5A 3PNLA 3Q98A 1J9EA 4DQXA 1S2NA 2PZKA 2O8NA 4BO1A 3BZUA 4O2AF 4PPYA 4F71A 4HXFB 1OPRA 1V6SA 5AJVB 2OZEA 3LX8A 2I2AA 4EHNA 1UR5A 5IK2D 4G4SP 4GT1A 1RQLA 1YFZA 5AW3A 1PHPA 3QE9Y 2D59A 3KSZO 3R5TA 4IJVA 1HZJA 1IJKA 1PI3A 2CUNA 2QN9A 3BTUA 3F6RA 4TQAA 2ZP1A 1IPEA 1GG8A 1TZMA 1CF2O 2WJHA 3A6JA 4G26A 4N0MA 3H1PA 3S2GA 3GUCA 4A6EA 1A8PA 1PJZA 1PUXA 2W2PA 4M37A 4ND5A 4MNTA 4O2AB 4JVNA 1NBEA 5EXSA 3KX2A 2AYXA 2O8BA 2RDMA 2AL7A 3SDBA 4FMDF 3C74A 5HKOA 2I87A 2IODA 3FR7A 3IQWA 2YV2A 1Q1BA 4FBLA 5LR6A 1N4DA 1PR6A 1XGKA 1IEVA 3DAPA 3IAEA 1K6JA 4U9IS 3V80A 4ZMSA 1G4UR 2J4FA 5TSDA 1G8YA 1U0NA 1X7YA 4NYMR 5BMVA 2W00A 3DLIA 1ONSA 4BMZA 1NI3A 3HSSA 1ZD5A 3NTVA 1RNLA 3E81A 1CE8B 3ENQA 1GPYA 4FMDB 5CA1A 4P3OA 1HE8B 1XLTC 1SHUX 3LDAA 4P2GA 1XNJA 4TKVB 4TV8A 4HLCA 4PC6A 4QREA 2HDOA 4EA6A 1Z63A 3PPVA 1CLEA 2PGNA 1IL0A 4MP6A 4B6GA 1FW8A 3L5OA 1W4CA 2ZE7A 1NSYA 1IAVA 5TGTA 1G5QA 5C1BA 1OWLA 1MJFA 4ARVA 3MMXA 5F2EA 2PKQO 1WCV1 3EASA 3C3XA 1GYQA 5JRDS 4NJEB 2ZJ6A 2E4XA 1KDPA 2ZTLA 1ZITA 3CUSA 4ZCLA 2RH4A 2DJIA 4XCQA 4B45A 3UM9A 4N3CA 1F9EA 4PLWA 1R6BX 3UJDA 1H6AA 3I1IA 2H00A 2VFAA 4GGMX 1N6HA 4MEAA 2GHIA 3CH7A 1XMXA 4XARA 3ZHZA 4CCAA 3CM0A 4RS4A 1Y42X 1ZC3A 4CL2A 4JC4A 1MDBA 2CFTA 1XDBA 2YHAA 4WESA 1OILA 5F1KA 1WSDA 5TV2A 1VJGA 4MR8B 2A94A 1PLLA 4UTOA 2A6PA 4GMFA 5F2OA 1DCFA 3DQQA 4DHEA 3A1SA 4Y0AA 1Z0AA 3EZ6A 1U8EA 5DFAA 2NX2A 3ISTA 4BNZA 3G1TA 2XE8A 2YBDA 1NRXA 4I81A 1MEOA 3GPLA 5GVSA 2ODTX 3DYVA 1QZ3A 1YGYA 2NTNA 5FLYA 5B1YA 3Q3JB 2PFKA 3EZ9A 1K3TA 3QVWA 2BJVA 2IJGX 2C2ZA 3KS9A 1ZM4A 3NZEA 4GNRA 4Y0NA 3H1GA 3LOPA 4IIJB 4HOYA 4IS2A 4YJFA 4DM3A 2EZUA 5HR5A 4CNQA 3FFWA 4EB6B 4XWYA 2YFQA 2NAFA 3ESCA 3N6RA 2IV7A 2DE0X 1Y4SA 2Q4BA 5FQOA 3U1TA 4Q3NA 4X1YA 4YDHB 4QX6A 3M70A 5AKEA 3W5BA 5JNRA 1F7VA 3EISA 2UVPB 1I3OA 1NOKA 2WD9A 2XKBA 1RWQA 1K7EB 2QY9A 2CJFA 1JQDA 1LQTA 3NHAA 1Y80A 4GQBA 3JQBC 4D42A 4WUTA 4YP7A 4JMLA 4GXQA 4OBWA 1ZHOA 1EG7A 1GARA 2LD4A 3TKYA 3U0VA 4B82A 1V1JA 4ND7A 5DNVA 1EFRA 4JEUA 3QWHA 4NH0A 1NW6A 1FUEA 4L16A 3T3MB 3WWYA 4URFA 5K9ZA 4YMGA 2Q49A 1LPAB 3DPUA 4N3BA 1KI9A 3ZQ6A 3ERCA 1RFGE 5GV8A 5KINB 1CR2A 1ZD3A 3OZCA 5JAZA 5HCNA 4ZOLF 2QT9A 3K6JA 2AHRA 2QG6A 3PQEA 1M34A 1SKAA 1ZMTA 2QGNA 5TQJA 1W85B 4IRUB 4RLFA 2VK1A 5CITA 3AKEA 2KS6A 4GW3A 4IKPA 1NAIA 4LC9A 1EK0A 6ABPA 2DAPA 4PLFA 4KNVA 1S2DA 2BPOA 5ALVA 2E48A 4H2DA 5CUQA 1L4NA 4RY0A 4QUBA 3T54A 4CKWA 4ZOLB 3E53A 3F1KA 2CL0X 2GD1O 1ZD8A 2I0FA 3FDIA 3UH0A 4W1RA 2O8FB 3D0OA 5JV5A 1ZCFA 2IBMA 4J9UE 4WDQA 1WULS 2PL3A 2UUCB 5DI3A 1PFKA 1M2NA 3MAJA 3NBFA 3PKJA 3GXOA 5JFTA 4MI3A 1FK8A 2H4WA 3K6RA 3GLIE 2SKEA 4QC2A 1ZUWA 3CZCA 3GW8A 2G36A 2PX4A 3MVEA 4X1KA 5DLEA 3FPEA 1QRRA 1ODLA 1XUOA 2OXEA 5EJ9A 2Q41A 3ZCTA 1TC1A 2IS6A 3L40A 2NNLD 1FE8A 1OZAA 2HK8A 2IZ6A 3FTEA 3DFZA 1C1HA 3QFHA 4LQ4A 1N77A 4L51A 1JAIA 3AP1A 4NBUA 1B1AA 2XV1A 2CNBA 2G25A 2ZAYA 3L7LA 4PAWA 1XL0A 3QITA 2XCOA 4N5NA 3VR2A 3W6PA 1A9YA 4U0KA 4KH0A 2CZQA 1YONA 1UFRA 1TK9A 2ORWA 2W6ID 3DAHA 3DLPX 2VL7A 1IHPA 3OIVA 4AMVA 1O9GA 5JDIC 2OO5A 2MYNA 1UZAA 1MHPA 2CGEA 3FWPA 1R5OA 3E2MA 3IKJA 4KQJA 1SEVA 1M6VA 4G1FA 4IHJF 4UREA 4FB4A 3CW8X 2XUKA 4N5LA 4MLPA 1TW3A 2Q4RA 4RPKA 3VDQA 5K03A 4MAMA 2IIBA 3ZHSA 4TTTS 2PWZA 1PWZA 4FNOA 4ND4A 4TYMA 3UGKA 3CUYA 4GZMA 3ZWKA 2AFIA 1ZHHA 2JGRA 3MWKA 4N0QA 1PS8A 2DCMA 3NAZA 4NU0A 1FVHA 3FZGA 4XB1A 4I66A 4B8ZA 3DULA 2E5LB 4YJ2A 2B99A 2D2IA 1JKFA 2RARA 2HCBA 1BHO1 4ZO6A 1L1FA 3UMFA 5LZ9A 1XD9A 4WZAA 3QXGA 4FGWA 1BRMA 3OJFA 4WOCA 2P8JA 2CN1A 4K40A 1EVIA 4QQRA 4EGQA 1FX1A 3FD8A 4OUDB 5KB3A 1O0BA 3AEZA 5B64A 1I2DA 2NUTB 5E6RA 3ACBA 5LQJA 4XWTA 1A9OA 1HH4A 2GARA 1KDZA 3FUVA 3LC2O 4HQFA 2BGKA 3ZWWA 3I9LA 3GLGE 2AG0A 1XPRA 2AJDA 2YY7A 4Y2SA 3PGKA 3B20A 3FVQA 3ETLA 2XRZA 2LV8A 4WY5A 1ZO8A 5CB4B 1CZLA 3PQ7A 2YZ7A 4FI3F 3RUIA 4Y6RA 3DFMA 1TT5B 2W93A 4UMEA 2JI7A 2XYRA 3C97A 3QHPA 2D00A 1ABBA 3ZDEA 1JIKA 1U0RA 1RBYA 5F5XA 1Y7IA 1Y9EA 2GVDC 2O7NA 5THXA 4J76A 2PUWA 5E7IA 3WK8A 1T4CA 3A28A 4PC7A 5BYAA 5HK9A 4R3UC 1ODTC 3PNMA 4ZKDA 5DXJA 5E4YA 3D5QA 2YWFA 1RYNA 4L4RA 1ODIA 2H8KA 2XT6A 3CCCA 3HJCA 2IHUA 4BJ3A 1XRSB 1M2OB 4NMXB 1NT4A 3DL7A 4P58A 1FP6A 7REQB 2P2GA 4DV0B 1QH8A 1NKSA 4MVJH 4XYGA 1FSFA 2CYCA 4XLLA 1IZZA 4XD7D 5AESA 1QYVA 2JCVA 2UYQA 2JCBA 3BDAA 3FMOB 1WB9A 3C7TA 2X41A 3O2JA 1XNQB 3K2QA 1ZXBA 1UOPA 4GX5A 3UTDA 3GG2A 4CKBA 3I2FA 4KFSA 2Z2YA 4LPKA 1WKVA 1ZGHA 3GPBA 2UXDB 1MC1A 4U5XA 2V4UA 3RHFA 4KUGA 1IVSA 3GBVA 1QGUA 5J58A 5KX5B 5CX1B 3HR7A 1ILEA 2DPXA 4BNXA 2WF5A 3FNQA 2ZCUA 2GWRA 4U7PB 2QI9F 2G40A 3FLAA 3OBBA 4XFKA 4C0HA 4IH4A 5CB8A 3BB4A 1I4TD 1LDGA 4WZ6A 2HSZA 1PSWA 2PGDA 4L8WB 4NCXA 1C3XA 4ILKA 1CY8A 1GDDA 1XVIA 5B3JC 2QD5A 4JLPA 2Q6IA 3G68A 4RV5A 2Q1YA 3MJCA 4IFEA 5I7WA 3BGDA 3EXEB 4EQZA 4ZIRB 3ZLJA 5C31A 3R74A 2J0SA 2QSJA 1ARZA 3T38A 3QQ5A 3QE4A 4Z1MA 2XX3A 3TSAA 3WGMA 2R5NA 3VPSA 3PNPA 2ZU0C 2PJZA 2FP4B 4PLYA 3IB3A 3LHIA 4WXYB 4RYDA 2H0QA 4L85A 5CH8A 4YECA 1L3CA 1SFRA 3UT5B 2VSFA 3X0DA 4CQMB 1AHHA 1I2MA 1YBMA 2UU9B 3EFEA 1GQ2A 3OD1A 3GT3A 1BOOA 1XZFA 2C5BA 3QKSA 1E5LA 3TTUA 1DIOB 5IJ0A 3I01M 3WIEA 2FZKA 4BWGA 3UK7A 2YW2A 4QULA 3B70A 1Z6YA 1A9SA 1VCIA 4I6JA 1ESZA 4FR5A 2H57A 1AURA 3LLVA 4YCSA 3UHAA 2UXCB 2RBEA 4D45A 3OQBA 4KO4S 2PT9A 3RS2A 4HD8A 1C2YA 3F6SA 1AUXA 3O2NA 1WHTA 4M9CA 2XBMA 3COZA 1MKYA 2Q2NA 4JELA 5AK5A 1AT1A 4KK3A 4RACA 2IS4A 1WU8A 1VXRA 1XF1A 2AXQA 3A9SA 1A5BB 2HSDA 1VGRA 1BHQ1 2PTHA 1R12A 3QUAA 2FR8C 3BF8A 4C6HA 5FNVA 1Z16A 3HYRA 4J7CA 4RDCA 2IHNA 1U0LA 3IPLA 1E6UA 4O3FA 5AKXA 1H8ED 3SZGA 3ZDXB 5CTAA 4F72A 4YJ3F 1OYWA 1O6FA 1W4LA 2D54A 4JX9A 5GJCA 4AU1A 4LMRA 1MLDA 1DAHA 2BGIA 2C5AA 2OHIA 1TO6A 3N2LA 3PLRA 1F3OA 3SOZA 4FBGA 4N1AA 1COWA 4RKFA 1VL2A 2HMYB 5ALGA 5EINA 3JQQA 3UKJA 5FAXA 4GLBA 1K5DA 2GK4A 2OAQ1 3STWA 3A1CA 1H0SA 2HFJA 1UBCA 3ESQA 3EXHC 4TMVA 1D4OA 2EYUA 5CIWA 4DUGD 5JD6A 2R4QA 5L3VA 1EJ2A 3OKPA 4LZLA 3TL2A 2J0VA 1R8XA 3O90A 2BFFB 2V3VA 5KTTA 2L69A 2LCIA 1MO6A 1X7DA 4CEHB 1U7PA 4HDNB 4GDFA 3ND6A 2R62A 4P8RA 4F8JA 3A1NA 1DJNA 2BJWA 5K6AC 4OI0A 1UM9A 3ISVA 3QU7A 5HZMA 1HFWA 3J81A 4PLTA 1JTVA 1P0PA 3NYWA 1TF2A 1A5SB 4OFWA 3CX3A 4V0RA 4LXHA 4WA8A 4JBLA 4TPKA 2WWYA 2AG1A 4O2BA 1Z8FA 3WIDA 4Z4HA 4ZTBA 2EDAA 3IALA 3MWGA 2GX6A 4KP7A 5A05A 2AT1A 2JLZA 3U09A 4GKJB 4HDSB 3CMCO 3T5DA 4J29A 3AERA 4JITA 1RAIA 1TVCA 4NDNE 4B2PA 1H8HD 2DKNA 4EARA 4UM9D 4YAJA 1M75A 1DEHA 1G19A 1QK5A 3RSCA 4M2LA 4G1EB 4L5BA 4MULA 5EKUA 5BSHA 2NZJA 5IN4A 2BELA 2BEUA 3IEIA 2WMOB 3GIWA 3WQSB 1ZH0A 1TU3A 3MBIA 1E2NA 4PCAA 3STTA 4EQ6B 1IQUA 1LBSA 1T1GA 3FUWA 4HL6A 3RVMA 1GPNA 4UZEA 3QTLA 1SCNE 3PGXA 3RS8A 2ZYGA 3AEKB 2HW8A 2AEJA 4QXPA 3BFKA 4M49A 3JSAA 3N6XA 2J3DA 3KPJA 4AMZA 3R5JA 4CL8A 2CXUA 3KWMA 1ZMOA 1J49A 4JI7B 1XZNA 5EZ5A 5DH9A 2IYYA 4E2ZA 4C05A 2D5BA 2DWQA 2JFVA 4JOBA 5C4MA 1MBZA 1RJWA 2QRVB 1C7EA 2AF3C 3CX8A 3ZWQA 4F2PA 3KHUA 1T15A 4G8CA 3K0AB 1HSZA 4OXYA 2VBCA 1GFIA 4MKZA 5A5EA 1OX4B 1TTPB 4HG2A 1KXJA 3JQDA 4PZDA 3UGJA 3DQPA 4BLPA 2Z04A 4EJSC 1GGVA 2VZLA 4EVQA 3BK7A 3MB5A 4TRNA 5JCJA 1IQPA 3O4HA 3Q3HA 4FD2A 4X60A 2UDPA 2EATA 5EJFA 4F85A 1W4ZA 4G0PA 4B35A 2PFSA 3OEHA 4V0SA 3WFIA 1YIOA 1A4UA 1QIGA 1RYEA 1Z17A 2CWWA 2GCPA 3GX1A 1TM3E 4LS3A 4ZZ3A 1EQUA 3E1GA 4G4IA 1XNGA 4MUNA 4PZCA 4S24A 1DAIA 1WB4A 1YZYA 2E2WA 2NVBA 3B3GA 3FZQA 3HQ4O 4L2IB 4YGYA 5DWVA 5HF9A 4EMTA 1J7JA 3N2ZB 1XTBA 2WIAA 3E9NA 3ISJA 3OJXA 4HTFA 4WASA 4Z4IA 1JE0A 1XAHA 4U2GA 2ZSJA 3KU1A 5H7XA 2PO5A 3SBDA 1HX7A 2XUOA 3PIRA 2JJ1A 4HDRA 2DHRA 4YPVA 2APJA 2H6EA 3M6XA 1B3BA 1E79D 4R51A 1G98A 3QJ5A 4WKBA 4EHLA 2ZBVA 1B74A 2XWPA 1P6UA 3ND5A 5MN4A 3T9AA 5EIEA 3LA8A 3TDNA 5LIPA 2O3QA 3AUSA 4RXMA 2CJYA 1ZBQA 5LOVA 3N2IA 1P2BA 3C45A 4Z6KA 5B12A 1N57A 1Z2EA 3JARA 1K4MA 4G86A 6REQB 2BHNA 3AC0A 1TVKA 4Q7EA 3LT2A 1YDEA 3FOFC 4I1OA 2SICE 2VTKA 4M9RA 3URKA 2CNDA 1ZSVA 3C8ZA 4DN6A 4RY2A 3DMRA 2C77A 2ZKLA 2Q9AA 5ENVA 1QB7A 2A9FA 2ODPA 3OA2A 3E7DA 2B4AA 3KKQA 5ESDA 3GQBB 3PA6A 2QG4A 4FE4A 4QUAA 3RS7A 1HI9A 3QUCA 1AHNA 1HM5A 1YQEA 2OENG 1GXSB 3GRZA 3Q7RA 3GRVA 4REOA 4ID9A 2H3HA 4P93A 1B15A 2LBPA 2Q7XA 5TQVA 4M0MA 2YJ4A 4HGQA 4PZPA 6GPBA 4DV5B 1IIBA 1PR0A 2BGNA 2PXXA 10MHA 4AJ4A 3FLEA 2ZYVX 3QV2A 4KR9A 1E2BA 4GU5A 3EGXA 5KYUA 4V38A 4WEQA 1X2BA 5EQTA 1GTRA 3N07A 5EUQB 3VHXB 4UHBA 2QGFA 1J8DA 5DCUA 3PQ3A 3R3ZA 2OHJA 2FHSA 1ZNQO 3HLKA 5AP9A 4BQIA 4YRIA 4PE5B 4D46A 2B5WA 8AT1A 3SIXA 3KQKA 3W2FA 1O94A 1PYDA 3B48A 1GNSA 3DLAA 4RXUA 1XPUA 4NH4A 5AM5A 1VHWA 2QTFA 4KTVE 1KJJA 1TCUA 4PO8A 4UJ3A 4A3SA 4K9QA 3WZLA 3VX3A 1Y8ZA 2Z56A 2O50A 4AG5A 2RB4A 4YV7A 2ZBEA 4K03A 1UFOA 5BORA 4JCOA 2W8BA 5EAIA 4EA8A 1LSJA 2XUIA 3U60B 4WHMA 1D0VA 2G1JA 4HGPA 3PEEA 1NG9A 1YVPA 3QLVA 2RK6A 2QR3A 3NBYC 3U7EB 3HM9A 4UFNA 2BKVA 4AJEA 2XY4A 3ZDBA 4L4SA 5IEJA 2XGJA 4HDMA 1S4MA 4P38A 1JIUA 5JBNA 3DHNA 4R84A 1F7UA 2C5LA 3PENA 3W04A 2OM2A 3ETHA 1CJKC 1LUAA 1N8NA 2GRAA 3IDQA 4WT7A 1RC8A 3PFFA 3HXTA 2AF4C 5EJ6A 4HNSA 2G9NA 2QU7A 1M0WA 3LLUA 3MJDA 4MJ3A 3U13A 4HVLA 4Y1RB 3DCYA 2KB0A 4IJUA 3VZBA 2RI0A 1GUYA 5F7OA 4LCEA 3Q11A 3CLUD 1AIPA 2HB6A 5EP4A 5IVHA 2F4VB 4N76A 3LQFA 5K0SA 5KREA 4W5WA 3SEFA 2OA0A 3ZX4A 2EW8A 1WXDA 3C3YA 1OF1A 4I4NA 4NYIR 4TZKA 4BNFA 3AY7A 1FFWA 5KNDD 4CM8A 4F4JA 3BOSA 3AUKA 1YZKA 1ZJYA 3ENNA 4G24A 2P3OA 4YRSA 1IJBA 2NSJA 1QYRA 2XUPA 3IKLA 3MCVA 4HTAA 5CM2Z 1XTSA 2OV4A 1MO4A 4WXEA 3SN6A 1GDTA 1R0KA 1EE1A 2FQYA 3D64A 2QXTA 4I4CA 4QG7A 5T41A 1S0UA 1UJBA 2O3TA 4RF3A 1W93A 5H9VA 1REQA 1XDSA 1C29B 5JROA 5JI3E 1P3Y1 3K92A 3UA3A 3OTOB 1VKZA 3EZ2A 3WXMA 2BI4A 4JL6A 3GAAA 3BJEA 3I04A 1A7AA 3KB6A 1U2ZA 3PD0A 1S3IA 1DJPA 2H18A 4J94A 3G1WA 5TNXA 1ZRMA 2WWIA 1XO1A 1EZZA 1QVZA 1SG0A 2LVBA 4M21A 5AHRA 3RJMA 3GVXA 4I8XA 2H1SA 5BO5A 3F97A 3H6HA 4DG8A 3CNEA 4RD0A 1V25A 1JN0A 1KJNA 2QL7A 5KCZA 4ZYVA 4DY6A 4B73A 2GBIA 5DZSA 1PR4A 3MINA 5IABA 2UUPA 2FZWA 4O4LB 5ICFA 2JAWA 3IH5A 3JR3A 3R7LA 4JH0A 4Z8XA 5TMEA 4OFZA 4CKCB 2XYVA 1ZWKA 4O2LA 1JHZA 2MOKA 5CM8B 1NVVQ 2HL6A 4U2KA 1XAIA 2OOSA 5TQ2A 2P3SA 1U7OA 3L82B 4MV4A 4ONEA 5KDOA 3U7FB 1V43A 3AWDA 5F76A 4MYDA 1OH6A 4MDFA 4BP8A 4LZOA 1LLDA 4YMHA 3KXLA 3BHIA 1CS4C 5DIFA 4MW0A 5A4DA 1EA5A 1NTRA 3TK1A 1EVYA 1W0JD 5EWLA 1FUKA 1UKVY 2VCHA 2Y0DA 5C32A 4J49A 4R2LA 5JZBA 1S5PA 1NUTA 2B83A 4HMOA 1DAFA 4BMXA 1NPDA 5FOUA 5KC8A 2AW3A 2GD0A 2EOAA 3VPHA 1S8FA 2P5SA 5SZJA 1QS0B 3O8RA 3CR8A 4MWOA 1EYZA 2XWJI 2C99A 4JUFA 1E3MA 3SFZA 2QTBA 1R6XA 3ZHOA 2YS6A 3IKMB 4ECEA 4S1WA 2R4UA 5BSRA 5IXYA 2YYAA 1MO2A 4DEXA 3D3WA 2ERYA 3BM5A 3G9QA 4FR0A 3WL6A 3WTBA 1UXOA 2VG8A 3TZKA 4HXEB 3PWKA 5E9JA 1BMQA 2GH1A 1YVUA 3D4BA 3KR2A 2V7XA 4LWQA 3PTLA 2W9XA 4QSHA 3TEFA 3HABA 2Y1CA 5AHWA 3HCCA 3T7DA 3WA7A 1U0JA 2MYPA 4OH1A 4DLTA 2V3WA 4OYRA 4AWXA 2GA8A 2AX4A 4TWIA 5C4IA 3VYSB 2G4CA 4UCXA 2QJTA 2JFFA 4XYMA 3SC4A 1NDHA 2WFZA 5F5NA 3KJFA 4YREA 3KPWA 4BEWA 1P44A 2FP3A 1IN7A 4LJ7A 2FG7C 4LMAA 1Y8CA 3DE4X 4TTPA 2OAGA 1CJMA 3DZKA 4J2HA 4YJGA 3AG5A 3Q2OA 5HF8A 3AFMA 2JVJA 4UEWA 4CCYA 4BU1A 2GEUA 4MKIA 1DEXA 3HSYA 4KFTA 4DIEA 2IP1A 3Q5GA 1JDVA 1KAEA 3N2KA 4D26A 5A71A 1GHTA 2ES4A 1SUEA 4TZ6A 5DBOA 3SI7A 5CEEA 1VPWA 2Q0SA 2R11A 1TGYA 2O23A 4J1NA 1L8OA 1GGHA 1Y1QA 4JUBA 4EKIA 5HZGA 4W5RA 3H9BA 1I51A 1L7BA 4OV6B 2H5EA 1MOZA 2IZ1A 2FZLA 3AXSA 2NSDA 1RWNA 3DBOB 3QUQA 4H18A 4OJKA 2JRLA 3ABIA 1KOGA 1AGYA 1HDOA 1OAKA 2AC4A 4WE3A 4LHXA 4HDCA 2ZQYA 3QHQA 1EWTA 5K99A 2BCJQ 5K3FB 1PZFA 1QO7A 1YK0A 2WA2A 4EJ6A 1BROA 4PNPA 3H5VA 4FWBA 5LP6C 4XYEA 1I7DA 2AIRA 2H2AA 4HZGA 4WN9B 1YKFA 3ORHA 4EKNB 4PX2A 4Q16A 3LTNC 4JP2A 2O7QA 3P9SA 1TAHA 3RSGA 5JRZA 1RI1A 3ZQUA 4KWTA 1EP9A 2FEPA 3WYCA 1W0KA 4NRDA 5F33A 4WQMA 3QPUA 5K0TA 2I80A 1QOPB 4QUGA 4DLKA 5DP2A 1NBMD 2PYDA 3GY0A 2FZGA 3BVPA 2GZRA 1QNLA 1QC5A 4QU5A 3ZU6A 4C1NA 2QN2A 3ES9A 3GDFA 3GK3A 2FA9A 4QDKA 3VR4A 4D43A 1BTOA 1U2EA 4PLZA 4DTCA 1T2EA 2D1YA 3IBTA 1R66A 2FLKA 1FNNA 2HZ7A 3UWMA 1AKNA 2GPWA 2QIOA 1QWSA 4UEQA 3VVMA 2WICA 3ROPA 4JYZA 2I5PO 2Q3JA 5IT9A 1Z56C 2JGKA 6AT1A 5JJLA 3IO3A 1T4BA 5CEJA 2YN2A 4KRGA 4ZVOA 1JHAA 4DLSA 3AF6A 4G1MB 1NFQA 3IUNA 4TWZA 3UT0A 1GZDA 4D5GA 2PS3A 4BFWA 3U6BA 2CNNA 4OD0A 2PFGA 2QZZA 3UMSA 1R0SA 2D0OB 4NCNA 4UU7A 5GGXA 4AY6A 1HYQA 1Q50A 3D43A 3FKSA 3KYIB 4MK4A 2I2BA 4LXIA 2WDPA 2JVIA 3AONB 1XDGA 4BRUA 1AJEA 1XTZA 5JMPA 2R97A 2YH2A 3M0EA 1D1QA 1U2DA 3EDRA 5CXSA 4AZWA 1NU6A 1EFDN 4PPNA 1XZBA 3N5KA 1X1SA 4ZQHA 3TPFA 2QUZA 4K5QA 4WFJA 4HDAA 4GZLA 4CM4A 5BSFA 5JXHA 1LQ2A 2B21A 2VZ0A 3IYLW 4DGSA 1I0IA 1T3ZA 1LB1B 2WZQA 5PNTA 5M29A 4DG5A 4HX9A 2IXTA 4B75A 2AVDA 3H9GA 3O21A 4EBFA 4MRPA 4JR0A 2PL5A 4EH1A 1RD4A 4OI2A 2TRSB 3B6MA 3FNRA 4QU9A 4F5ZA 1W8DA 5JH7A 3ZD7A 2DKFA 1VDZA 3UXYA 4BKUA 1USVA 3T41A 5KNCA 3DXZA 1DRJA 3KVVA 1A4IA 3L7MA 5ARDA 1WVGA 1FY2A 3JQ9A 4I55A 2PKCA 5TXGA 2YXDA 2XB4A 4QYSA 1R0WA 4RK7A 3MZ0A 2IV2X 3SMVA 1JAYA 1JS1X 4PRLA 1B0PA 4NTZA 4NS1A 1OH5A 5LJLA 2HJVA 3CRQA 4OMUA 2AUMA 1T9HA 2XA9A 3IE2A 3ZI7A 2OM6A 1C7QA 3EPKA 3JQAA 4NU5A 4C2BA 1KBZA 2ALJA 5D2CA 2ZETA 3ZX5A 1OBHA 4YRTA 4BNDB 1R4NA 3QPBA 3NHSA 1Z4PX 5DRTA 1A7JA 1K92A 3M5PA 5IKOA 4B6EA 5BW5A 4E46A 3CB2A 3FOAA 2WWFA 4FZVA 2F3SA 1XU7A 4TUYF 1B00A 3LYUA 4CPDA 4DCPA 3AFNA 4UAVA 4AK9A 3FOEC 1SKBA 3OVMA 1ORTA 1JLSA 1ITZA 4M54A 1E5DA 1VI2A 3G85A 4CIYA 1E3WB 4UHCA 1I7SB 1CF9A 4J0JA 4LZZA 1APBA 2GAJA 1KZ7B 3CZ9A 2LW7A 4MRMA 4MGHA 3UXHA 2MR6A 1ESNA 2F67A 3KJIA 3TTVA 3WB9A 4JLSA 1MB0A 3CQ9A 4TUYB 2FLVA 1C5KA 1NP3A 1WMFA 4RK6A 1TM5E 4MJXA 1J5PA 4D74A 1KNXA 2GSDA 4QE3A 5AKZA 2RGWA 3VKFA 5F78A 3DB1A 3X2FA 5DF1A 3GLFB 1E3JA 5EWJA 5HILA 3H19A 2J87A 1LI5A 5ALMA 1FP4A 3JASA 1TLLA 2XEDA 3I2YX 5ECWA 4A36A 2NYRA 1NQ5A 1I4LD 2IW1A 4OKSA 1OXMA 5B3AA 4CUJA 3S6JA 1X15A 1EGHA 3D6HA 2XZDA 2ZFUA 3D3JA 4OYLA 1D1SA 4UHFA 1E7YA 5H3LA 2YR0A 2Q8QA 3NTLA 4FFMA 4NCKA 3K1AA 3BJZA 4B5KA 3JQGB 4I2NA 5A1JA 4AKGA 1DQRA 4NOMA 3QNWA 4QASA 2Y9MB 4DIFA 5CURA 5LQDA 1Z5ZA 4JC5A 3TAUA 3AUTA 3KZKA 4AW9A 1FQWA 2DU8A 3FLBA 1UDWA 1YFKA 4IEIA 1MAUA 1X1RA 4JENA 5LQCA 1QQ5A 2I6GA 3UJ9A 3D4NA 3I2KA 1YZUA 3CTMA 2XSZD 1XMQB 1VBKA 5GJVC 3OCXA 2V98A 4Y98A 3JQ8A 3ZK8A 1MABB 5BNIA 3NHZA 4W5OA 3JALA 4WJLA 3KQNA 2VQDA 1Y3BE 3IEUA 1NRWA 5D5HA 4OIMA 5JMWA 2VYVA 2ZTHA 3M6VA 5B58T 3ZYCA 4D57A 2O1XA 4PO3X 4ZI7A 1YFJA 2XZTA 3DT9A 2WIDA 2JD1A 1Z0DA 3DBRB 5JSYA 5IC5A 3A6PC 4M0DA 5T4FA 1M0TA 5E9AA 2IUUA 3GLIA 3V8VA 1HEIA 5EJ7A 3DCJA 4H1TA 1QYWA 3TD2A 2WF9A 2B82A 1P7YA 2Z83A 3WSWA 1O95A 4PZZA 3ZIAD 4X24A 1Y1SA 1GN9A 2ECPA 2ZAGA 5DK6A 5P8WA 1YKGA 2BKXA 1DEKA 2GT1A 5EA2A 3VPAA 2JCXA 3LY8A 4B17A 5TE9A 1E0AA 4ZOCA 3HBAA 4KQ2A 4ZJUA 2WUVA 1NYRA 4P08A 5JHHB 4K1LA 1OKKD 4BP9A 1MH1A 3O8OA 4R40A 4OQFA 1EKXA 2J8ZA 5SZKB 2H16A 2RB5A 2VQ3A 1Q0QA 2CVFA 4K0KB 1CY0A 3UPUA 4MQFA 3UOWA 1EWYA 3IP5A 5DO9A 1NURA 2YC4C 1P1IA 1FMFA 4U2DA 2SKCA 4OAPA 2PXAA 2H2GA 4XJTA 4M7OA 4CDRA 2X58A 1KQ3A 3LPNA 3ZHVA 5DN6D 1ONNA 4BLVA 1VL5A 1X1CA 1X2EA 4IDQA 4PYNA 4WN3A 5G02A 3A2MA 4IM7A 4BGUA 5FB3A 2RGNC 3AY0A 4UVGA 2QRMA 2Y1GA 1JZSA 3AUUA 1JYFA 4Z4CA 1NDQA 3E6AA 3M6WA 4Q18A 1PL6A 3TQIA 5IANA 3KLMX 2I78A 4YDRA 1XALA 1NDUA 1RHUA 3L0SA 4U2BA 1RM0A 3NUGA 2G1UA 4EGAA 5AVSA 4BNVA 5K6TA 2FPMA 4KBFA 1A82A 1R5NA 2PGLA 3M4XA 3PSAA 4IWYA 1W36C 2Y1XA 4I1YA 1TADA 1R10A 2NO4A 1GYPA 4XDYA 3ZXIA 4RVDA 2G88A 4GP9A 1ZVVA 2VTBB 4OQXA 3TSCA 3CLVA 3F5FA 1XXHB 1RW4A 3BKWA 4IHQA 3NANA 4FGLA 4FLEA 4GP7A 1MU0A 3I9MA 4N65A 1NVDA 5E6UB 2VHXA 3KPVA 1QLHA 2A4KA 3ICCA 2H7CA 1GTMA 5AW9A 2NSLA 4S2EA 3KJZA 4RMHA 4V2IA 4AZSA 4CF3A 1ZIOA 3NBMA 3MELA 2BWJA 3FNGA 4G5GA 1XTUA 3O74A 4HJXA 2WIBA 2XR1A 1XNRB 4RVOA 2IHVA 5E3IA 1E4OA 2BGLA 3V9PA 5IUJC 2F9FA 3AX6A 4L76A 3NRBA 4PHGA 4WBXC 3FDXA 2WUEA 2XXAA 1BD4A 1R1DA 1HE4A 2IY9A 1B0UA 4WFKA 5D84A 2INGX 1M0EA 3HM2A 4KRYA 5D6OA 2B69A 3AYXB 2BN4A 4RX1A 3AP3A 5F7XA 1MFZA 3WKEA 4KIWA 4QXOA 5EUCA 1JEYB 4YR9A 1KI3A 4KQWA 4E5SA 3QSYA 1JLHA 3USES 2JPDA 3UK6A 3N2EA 1TZ2A 4B6QA 5BRAA 2J3HA 1A27A 3CVYA 2H0AA 4RNCA 1EZ4A 1OB5A 4ON9A 5TMDA 5BXQC 3D7SA 2OB1A 2FSSA 2D2EA 2GJAA 4MIOA 5EJMA 5CNIA 3PDUA 3VPDA 4EECA 2P6NA 1L7NA 4J6FA 4R7GA 3TSYA 4EDFA 4JOSA 2JLCA 3KQTA 4JJ7A 3C3EA 3CBGA 3E2IA 3LKDA 5EPOA 4F4FA 3KOUA 3HKDA 3MTGA 2OQVA 1OY1A 2RC5A 4NP6A 1V4NA 2AJBA 4XJSA 5LXTF 4EPTA 1JB1A 5BWCA 4FEYA 4X93A 3KBOA 3VFDA 4E11A 3PLNA 4E32A 1RM3A 4MLCA 4R8KA 2KE5A 3LD9A 5AW5A 4ZAFA 4AF7A 4ENQA 1SPBS 3OF2A 4M1QA 2H1FA 4UUOA 1GNRA 2DUWA 3H4IA 4H1VA 4TKMA 3VJRA 2FWRA 3HYLA 4TSFD 1JLMA 2A5LA 2ZRDA 3DVAA 3VGPA 4NU8X 2ZCVA 3GEBA 4A91A 1TYBE 3PD1A 5G41A 4E4YA 5C8XA 3U3XA 3U6KA 1QONA 4M7PA 2HGZA 4D9FA 2I3ZA 5B1EA 2PG3A 1HDCA 1L3IA 4HB3A 3TQHA 2VH1A 3DNFA 3NKLA 2E4YA 4V3CA 4Y1EA 5CGQB 3THYB 3D7MA 3BMNA 1DO8A 4TN5A 2DMRA 2O2ZA 2GF9A 1RPAA 2JIZD 2PANA 1FNDA 1G55A 1T8SA 3O8QA 3ZR4B 1VCMA 2C8KA 2QA5A 2J5RA 4LDZA 4TQUS 5FRDA 3DMYA 3Q0EA 1TIPA 1XDZA 3SKXA 1P6XA 3H2JA 2CYBA 2O0JA 2PA3A 2RH8A 3OQVA 3V8MA 1E2MA 2QVBA 3NOVA 5TLSA 2FQWA 3DMPA 4G56A 4F6CA 4RHUA 3GH3A 1HFKA 6PFKA 2VXCA 2ZRGA 3ILYA 2JFOA 5HF6A 5DLPA 3U4CA 2Y0BA 3LW8A 2BFEB 5J9FA 1QIJA 1HETA 2YIJA 4JJIA 4PVDA 2Y0PA 1LVGA 3OF5A 4WGFA 3DGFC 2Y66A 3OIYA 1H4QA 1DT5A 1W96A 4CMIA 2I34A 4NMHA 3BJRA 1QYDA 3PK0A 4I9HA 1TFRA 4UMVA 4AJKA 4KDEA 4PG6A 3KELA 3KQSA 5A4JA 4LTDA 3VO1A 1JR3D 3PHLA 3T8YA 4OU5A 4B6SA 2NTJA 4IO1A 5JCOC 2X9GA 3NHFA 2ECFA 2WAOA 3BZWA 2OL4A 1HOXA 1N8TA 2FW8A 3DM5A 3GJSA 5A03A 3KZVA 4LF7B 1I2ZA 3C6YA 3HFJA 1T9GR 3G5AA 5T5QA 4CBVA 5CB0A 1KHTA 1LX6A 1PFQA 4WNAB 3E4CA 4RHXA 4PN3A 5IJWA 4PG5A 4NJMA 4URUR 1BOFA 1E0DA 2YNMD 3VC3A 4E1BA 5LD2C 3JQFA 5EJ2A 4F9TA 4RZXA 2QR5A 3TL6A 3TBHA 4D4MA 4F6RA 4LY0A 4QT4A 2JDIA 4YCLA 4D99A 2IY7A 4J1TC 3T5CA 1NYTA 3WWEA 3LQKA 1XEWX 3JTMA 1XWIA 2I4IA 3EQ8A 4O2RA 3FUTA 3ONEA 4AF6A 2ZJBA 4BKQA 5AW2A 2QTWB 3EXFB 5ALDA 1WLSA 1R7RA 4MMYB 4Q3OA 5L9AA 1H1TA 1YOBA 5MGNA 2X2OA 4MUKA 2GMWA 2O8VA 1Q7EA 4PC2A 2IIPA 1V7QA 3HEMA 3ND8A 5J5AA 5JSZB 2LXNA 2R8EA 3GXBA 2O8EB 2G82A 4GZ3A 3RYCA 1N6KA 2SBTA 1AZWA 4TS9A 5K51A 5KC9A 3NXSA 2XUAA 3KKZA 3D0QA 1PJ3A 2G08A 3KQVA 3VU9A 2R6JA 4A6XA 5HXAA 1WBBA 5LCXA 3RIGA 2GK3A 3G23A 4O25A 1JWLA 4LUCA 3MW8A 3VR0A 3CE6A 2MDTA 3MWEB 2NXNA 1Q77A 2WM2A 4KZPA 4AX8A 5ICSA 4BNJA 1CQIB 2LP4Y 3R3HA 2L2QA 1LV7A 3C39A 1M2VB 1TCVA 5ESXA 1KDYA 4AP5A 1N6PA 2AEEA 5REQB 1WNFA 3H5RA 4V2UA 1NZJA 3BFXA 2W0MA 4IICA 3SYMA 1WUHS 4GUDA 4I9FA 3S2IA 4CIWA 3MCTA 3IEVA 4B0PA 4Q3KA 4WOPA 4LDPA 2PLNA 4MIEA 4ND8B 3F8WA 3T7SA 4LJRA 2HQSA 4H0NA 3WV5A 2EFEB 1P4RA 1PW5A 3W8FA 3LDHA 4A15A 4ZRNA 5CG1A 1G8PA 1Y3IA 4FLFA 3QI7A 1JL3A 2GN4A 1GAXA 2PS0A 1QQAA 3SK0A 3H6GA 3UF0A 4MITA 4MWDA 3V1YA 3MJSA 3UG6A 4E03A 3HG7A 2I4MA 4YJHB 5DEOA 4J0EA 3L07A 3R6DA 5KYNA 1WZNA 2CKDA 3COPA 4GPEA 4PNHA 5THQA 3VPCA 1KVQA 2PWAA 4DIDA 2W6JA 1Z6PA 4XQGA 4EPYA 3V4OA 1O6ZA 3KVOA 1U0EA 1D9XA 1JU3A 2E18A 4LYFA 4MUGA 4RESA 4WOBA 4PXSA 2H06A 4TVSA 3PXBA 2CNOA 4JQSA 3O4IA 3H0KA 3GN1A 3KXPA 4UQLA 1LSUA 4E33A 1DJOA 4GXRA 4F56A 2XCLA 4NZYA 2Z1MA 3EVAA 1ZEMA 1T0UA 1T8RA 4RKEA 2IS1A 5LJIA 2OD2A 4BEJA 1XOIA 2KYRA 5HQ3A 1NMSA 3MWDB 1GO2A 1PKEA 4GX0A 4YBRA 3TB6A 4Z2AA 3U4DA 1JIJA 4MW2A 3SBXA 1A2OA 1MZPA 1STOA 4MYTA 1H0KA 2HADA 3DWEX 5KJ1A 2HREA 2BH2A 2BKAA 1R4AA 1E1YA