9LDTA

Design and synthesis of new enzymes based on the lactate dehydrogenase framework
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIHNLLKEEHVPHNKITVVGVGAVGMACAISILMKELADEIALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSRLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPNCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWILGEHGDSSVPVWSGVNVAGVSLKNLHPELGTDADKEHWKAVHKEVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKENVFLSVPCILGQNGISDVVKVTLTPEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase(choh(d)-nad+(a))
molecule keywords LACTATE DEHYDROGENASE
publication title Design and synthesis of new enzymes based on the lactate dehydrogenase framework.
pubmed rcsb
source organism Sus scrofa
total genus 100
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1991-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 9ldtA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 9ldtA02
5AXCA 4EEXA 2D3TA 4BO2A 3K92A 2EWMA 2XXJA 2CVQA 1TB4A 1Q0HA 1T1RA 1GU7A 2BI7A 2BHLA 3DMYA 4ZQEA 4QT0A 4R5MA 3D64A 3GVCA 4GGPA 1E6UA 1U5CA 4ROSA 1A7KA 4J1TA 2DPHA 2Q1WA 3E5MA 5C7LO 3CUKA 1YBAA 1DIAA 3JTMA 1H6DA 3B70A 4PG6A 4XYLA 3DTYA 1V3UA 5DP2A 1FMCA 3L6OO 1O95A 1X15A 4Q3BA 1X7HA 2DU8A 4A10A 4Q9NA 1L7DA 1KC1A 2PLAA 2OMEA 4U6QA 3BA1A 2B0JA 4BNUA 1XLTA 3TQHA 4PG4A 5DBGA 2V65A 3QY9A 2J8ZA 4J4BA 1J5PA 1YL5A 4J6FA 2YUTA 3EDMA 1EMDA 1X14A 3A4VA 2EGGA 1ZSVA 3Q2IA 2PZLA 3PRJA 3GZNA 3ROMA 4OAQA 3F5SA 4QFCA 3WMXA 4ALNA 3QWHA 3CXRA 4IQ0A 3LYLA 5I9MA 4BO6A 1P1IA 3JQBC 4NJMA 4NIMA 1LDBA 1MX3A 2P68A 2VTEA 4Z9YA 3WQQA 3BMCA 3FPLA 5JAMA 1HL3A 3MJ4A 4IDGA 4E33A 5JNLA 5TLSA 3K96A 3I83A 1L7EA 3GGOA 1V8BA 3BYZA 2Z95A 2YW9A 4JBGA 4PFJA 5AVOA 3VDRA 4AL4A 4BO0A 1SMKA 3K31A 4MIYA 5LDHA 4DLLA 2NTJA 1HDGO 5AQ1A 5KJ1A 5FI5A 4IINA 2GZ1A 1J49A 2NVBA 4TZKA 4CQMA 1GYQA 4FFNA 2E4AA 1E7QA 3WSWA 2UVDA 2C20A 4XGNA 1ISJA 4HWKA 1IOLA 1KEUA 3WYBA 1V3TA 3L6EA 4JXKA 4IJVA 1GR0A 2NNLD 1C0IA 1EUZA 3OM9A 3SJUA 3SVTA 4YAIA 1NX6A 5KJ6A 3KYCA 2DTEA 2CUKA 2ZIZA 4PN3A 1YH3A 4F6CA 5JDCC 2E37A 1P0FA 1WNTA 2FHSA 2GN8A 4ND4A 4DYVA 2OOSA 5BSGA 3EY4A 5L45A 1DIHA 1EUCA 2VTDA 4XKJA 4BO1A 4KZPA 4ALMA 1DOHA 3PK0A 4CL3A 5JYEA 1BG6A 5IAAA 3WNQA 1H0KA 3F6YA 3PJDA 5CHEA 2C29D 3ADPA 1ZK0A 4TWRA 4BKRA 4D42A 1HE4A 3BHIA 4J0FA 4WUVA 5ER9A 2EJWA 5EJ2A 2I76A 3FN4A 3A14A 2CDBA 1ZFNA 2W98A 3PXXA 3CINA 4RPLA 3ZNOA 3PEFA 3QLJA 2VYNA 2G76A 2AMFA 2ZYDA 1EBUA 1MFZA 4NK5A 3AU8A 3GR6A 4TKLA 1I8TA 3F4LA 1YVEI 3JQ8B 4TSKA 1WP4A 4Y98A 4TRMA 4BGIA 3EMKA 3RBXA 1ZJZA 4NBWA 1N1EA 3O38A 4UEJA 5JXWA 4YAJA 5I7FA 5U9CA 1DIGA 3PYLA 2X23A 3RUEA 4II2A 2D1YA 3D3WA 4ZQFA 2VQ3A 4LGVA 1UAGA 3TF5A 2VRCA 2DBZA 1O6ZA 1UDAA 1UZLA 3DBRA 3DHYA 3ZU5A 4W7HA 2ZYAA 3WNVA 3UCFA 3RJ9A 3PTZA 1MB4A 1P1FA 2C0CA 4I5FA 3UHAA 1HDOA 3HWRA 2PD3A 4BOYA 1ENPA 4UUPA 4KTVE 4LMPA 2WMDA 4OSPA 5TRTA 2YJZA 2BF7A 1MFPA 3DBLB 2PZMA 2EHDA 3NX4A 1PZEA 2WM3A 5EN4A 3KSZO 3QHAA 4BQRA 1B2LA 3WICA 1ISMA 1U1IA 1WMAA 2Q99A 4IXTA 2HMWA 2Y1FA 5CDSA 1E7SA 2FR8A 4J2HA 1HLDA 3WMWA 3ZDFA 1FDUA 5AXBA 5TC4A 4CLOB 3RC9A 2PZJA 4BV8A 4FD3A 4UREA 1B3RA 1AE1A 2O48X 4RVDA 1LLQA 2VWPA 4U7WA 5BSFA 1H6BA 4IPTA 4RV9A 1UUFA 2WYUA 2POQX 4IZHA 1HE2A 1M6HA 1ZSNA 3AUTA 5CEFA 2IXAA 3DXFA 4S3MA 2VOJA 4MINA 5CEJA 2J3HA 3CZMA 1W8DA 3HNPA 3SBOA 4QFDA 2P9GA 4W4TA 3ZWAA 3INRA 1NAHA 3MOIA 2OBNA 1E3WA 1WWKA 3BTVA 2W2KA 4UULA 4BNFA 1PJCA 2UV8A 4WLEA 5G0SA 1HZJA 1ISHA 3Q0EA 4GKVA 2VYVA 3C1TA 4BMNA 4JBIA 1R37A 2GLXA 4A27A 4NZ9A 4BGUA 1ONNA 2GO1A 4E2YA 2Y05A 3GQVA 5DBFA 5L7WA 4EGFA 4PZCA 1FK8A 2VT2A 2GSDA 5A06A 1A27A 5A03A 1B8UA 3ZHYA 3OIDA 1VKOA 2JCVA 2BLLA 3HB5X 1ZH8A 3T7CA 1RPNA 3OSUA 4UVDA 4XB2A 4ID9A 3WIEA 1VRWA 3ONEA 3OA0A 3UVEA 3S8MA 1RM0A 4P38A 5JCJD 4GWKA 4I8XA 4PZDA 1ZO8A 4JP3A 4L73A 1GL3A 2ZK7A 1R15A 1HDZA 4II3A 2H5LA 2GZ2A 4WECA 2DUWA 4G65A 5THKA 5AXAA 1E92A 4E2XA 4NK4A 2X9NA 3TNLA 4DXHA 3NYWA 3Q9NA 3KM0A 1UXJA 3LC2O 3DZGA 2Q1TA 1YBMA 3PPIA 4DL9A 3DB2A 2Q46A 4CM9A 4W9NC 1ZVMA 4FQ8A 4FN4A 3TN7A 3JYQA 3DO5A 4JQCA 4BNTA 1UR5A 4QEDA 2IE0A 4Q3AA 4JIGA 2NM0A 2RIRA 5IG2A 3WG9A 1WXDA 4KOAA 3WJ7A 3OQ6A 1N8KA 4L8VA 9LDTA 1OC2A 5LDGA 1N92A 2V6BA 1EVYA 1ML3A 3IP1A 1U3UA 3RVDA 3K30A 4CMGA 2PGJA 4XRGA 2NVUB 1CF2O 1JDJA 4FPXA 1A72A 4GI2A 1QP8A 3E03A 4TZTA 1PJ4A 3I9LA 4BUCA 1IPEA 1WDKA 3D7LA 5TT0A 3T4XA 4EITA 2FY8A 1LU9A 5L7TA 3NDJA 3ZV3A 3CMCO 2HMVA 4LVUA 3DAGA 2C7GA 1HKUA 2GGSA 5A5EA 3D5QA 3X2EA 1DHTA 5L51A 1LC0A 1UAYA 5GZ6A 3G49A 3FSRA 3TFOA 1DC4A 3JQGA 2AQKA 4D46A 1LI4A 3IKVA 1EK6A 3UOGA 3SLKA 4O1MA 1P1JA 4CM4B 1KC3A 4RDHA 4YJGA 3VZRA 4N5MA 1O5IA 4E5KA 1H2BA 2V6FA 5DN9A 1I10A 4DREA 1Q7BA 3C7CB 1T4BA 2GYYA 1PJLA 1JVSA 2D8AA 2YY7A 1ZNQO 3E6AA 5HM8A 4ZA2A 1PJ2A 3WS7A 3GY0A 4MDHA 1DEHA 1JAXA 3FTPA 4D3DA 5ITVA 4J7XA 5IDYA 3ZWOA 1E1LA 1ZUD1 1OBFO 3Q1LA 3FPCA 3QVTA 4KUHA 4LRSB 4MVJE 3MJVA 5JMPA 4IDAA 3T7EA 3LSYA 4OKNA 3SX2A 3OHSX 2NWQA 4R1NA 3RU9A 2IYOA 4NNJA 3EAGA 3U4IA 4CLEA 4ND5A 1I33A 2RHCA 3IQDB 2ZCUA 3TJRA 1KEPA 4CMBA 1S7CA 2B5VA 4IJKA 3CSDA 1LNQA 6ADHA 4NBTA 1I3NA 3E9MA 3HE3A 4CM8B 4BV9A 4UVHA 4BQPA 1NHGA 3GDFA 2EP5A 2FSSA 3B20A 3H9GA 3VZPA 3E48A 3CE6A 2EW2A 5G0WA 4YCAA 1D8AA 1PEDA 2VYND 3CIFA 4XEHA 4BNVA 3Q6IA 3RFXA 3V2GA 2BGMA 4E31A 4IZIA 4X54A 1R0KA 3VPFA 1KY5A 4K6CA 3VVBA 3F46A 4LSWA 2FP4A 4OL9A 3WTBA 1GV1A 4UVIA 1DAPA 5TJ9A 4BHTA 2ZB4A 2VRCD 3ZV4A 3S2GA 1Z74A 3FWZA 2PV7A 3G0OA 3E5RA 2AEJA 3DOJA 4HXYA 3ABIA 1KYQA 3D0OA 3WYEA 4JLWA 2HO5A 4IJUA 1BXGA 3GZNB 2RH4A 3KO8A 4RO0A 2D0IA 4RDIA 3M1AA 3DDNA 5L40A 1X1TA 4J1QA 1W6UA 1TLTA 4M87A 5EL0A 1B7GO 1E3EA 5DOZA 3BMCB 2DAPA 3QWFA 4FFRA 4I1IA 5B4VA 4XR4A 1FF9A 2VUTA 1TXGA 4HKTA 1SBYA 4DRYA 1PQWA 4JK3A 2B83A 3TZHA 3LZ6A 1IHXA 2Y1DA 1GTMA 2QRJA 5JAIA 3DOCA 3VPGA 1GZ6A 3PFFA 2HLPA 5JDIC 3G3EA 3ZWMA 4CV2A 3C7AA 2X0IA 3C3XA 1QYVA 5T64A 1LRLA 2VHVA 3WGGA 4CR8A 5DULA 3TDKA 1JLLA 3LC7O 1QYXA 3QSGA 3C7DB 3G17A 1XQ1A 2GF2A 1GAEO 1DC3A 1PX0A 1E6WA 5ILGA 3UW3A 1SEPA 4ESOA 1LC3A 1BMDA 3IIEA 1DLJA 3ZNQA 3KYCB 4WLUA 3UCXA 5KJEA 2VOEA 3LDHA 1K6XA 4I9NA 4AJHA 3CZRA 1ENYA 4ZRNA 3GFBA 1C1DA 4MVJA 2WYWA 2QHXA 2E49A 3WR5A 1U3TA 5C3MA 5C7OO 4AJOA 1EVZA 1M67A 5K0ZA 1BDBA 2PA3A 4W6ZA 3W8EA 4IS2A 3PHHA 3U0BA 1M66A 4KUGA 3Q9UA 4O59O 2DFDA 2B35A 3JD0A 3QWIA 2A9FA 1MGOA 2DKNA 1E1KA 2GERA 1ZZEA 3D4OA 4IIUA 1GDHA 3GRPA 4IGFA 4A03A 2CF6A 4YAKA 3JD3A 5IN4A 3FD8A 3W6ZA 3RUHA 3JQEA 2EIHA 4YDRA 4YTEA 4PRLA 1JKIA 1NAIA 3V1UA 1ZCJA 3LK7A 4GSLA 3KOUA 4GBJA 4GL4A 3ZH2A 4JJFA 5KJFA 3AOEA 3D3WB 4Y67A 4PGFA 3H2ZA 1FDVA 4B4VA 1TT7A 4BO9A 4GKBA 4PRKA 3E1KA 3NEPX 3PI7A 4J2OA 5B37A 3HUDA 2WDZA 3K2BA 3DBRB 2NU7A 4ILKA 4YRDA 5IDWA 1O89A 4P4GA 1UXIA 1WLYA 1HSOA 2CF5A 1LRJA 2BFAA 4D3SA 4E13A 3TSCA 3VZSA 4ZJUA 1MA0A 2X5JO 4CUJA 5CAEA 4CM9D 2Y93A 2ZB8A 3MJCA 1NFQA 3VH3A 3I9MA 3I9KA 3W1VA 2J3KA 4OMUA 4CUKA 5JC8A 1M6WA 3FNEA 4CV3A 3GMSA 4R3WA 1GPDG 1NVTA 2RAFA 2ZTUA 4Y8VA 4AJIA 1FXSA 2ET6A 1E7MA 4P4LA 1Q7CA 2X9GA 2VHXA 5ICMA 2Q3EA 4R1TA 1I24A 2D4AA 2A4KA 3K73O 3WWYA 2W90A 3H2SA 4RJTA 1I32A 1O0SA 2PGDA 3M6IA 5KJCA 4Q3EA 2ZTMA 1T2FA 2I67A 3AM4A 4YACA 2AG8A 5JY6A 3KB6A 3WGOA 1QKIA 2O7QA 4ND1A 5L95A 1LDYA 4M55A 5KIAA 1U3VA 2C59A 1DIBA 1E3WB 4ND2A 1I5RA 2W2KB 7MDHA 2CVZA 3OH8A 4IDCA 3E9QA 4ZD6A 3PWKA 4G5HA 3ONFA 4R68A 3VKUA 2BD0A 4CM3A 4E4YA 1VE9A 2X1HA 5C5IA 5JW6A 3GGGA 4UUMA 2RHRA 2OO5A 4GMGA 2BFPA 5T8KC 5DNAA 1E3LA 4OO3A 1EVJA 1R16A 4FB5A 2FSVA 4H7PA 4XJSA 1GV0A 4B4UA 2PKRA 1A9YA 3NRCA 4RQTA 2G82A 3GZ4A 1T2DA 2GDZA 5ENDA 1UP7A 1G0NA 1TT5A 3DAPA 5AOVA 1P1RA 3I1JA 1PJQA 1HXHA 1LDNA 2X0RA 3RBZA 2DFVA 2Y66A 4NH4A 4XRRA 3HSKA 4JX8A 1HLPA 5ES3A 5C7IO 5T5QA 1NYTA 4B7XA 2D5CA 4B7UA 2OP1A 2NV6A 2Y99A 3DBHA 4OH1A 4J4HA 2LDXA 1K6JA 5J23A 1VI2A 2P9CA 2NADA 4QECA 3OA2A 3JQFC 4JCOA 1F14A 3PYMA 3C1OA 3I9JA 3IS3A 3VH2A 5JE8A 2NQ8A 3SLGA 5JCJA 1LLUA 5F3RA 3IAHA 1PL6A 2AQHA 1T2CA 4IJWA 1PGJA 5JY1A 3KV3O 1N7GA 3C85A 3HDJA 3JYNA 4R41A 3VPHA 3DTTA 1IB6A 4CM8A 2TMDA 1WAMA 3F4BA 3VDQA 3DZHA 4RORA 3D3EA 1ZEJA 4TRJA 4Z9FA 4J1SA 1A7AA 3L6DA 4A5OA 2RH8A 3L9XA 3H5RA 3W6UA 4PLTA 1DC6A 3RBVA 1MP0A 3GVIA 3HHPA 2FRDA 1NXQA 3B6ZA 2O7SA 1LXCA 2OL4A 2EJVA 4PLGA 2D2IA 2A94A 1T4DA 3HADA 1XEAA 4Z0HO 2YV3A 3JQAD 2P5UA 3A1NA 4HP8A 2VWHA 4FFLA 4I5DA 2I6TA 3NV9A 2YQ4A 3R1IA 3WSVA 2P2SA 2Q2VA 1AN9A 5FFFA 4OQZA 1Q7GA 2CY0A 2C82A 3AFMA 1KBZA 1QYDA 2OBYA 1SPXA 3HDHA 3ZCXA 3P2YA 3QJ5A 1T25A 3GOHA 3VKVA 3JYLA 2GZ3A 3JQGB 1XGKA 3CPSA 4YEDA 1WZEA 1H9AA 5HWSA 4IY1A 2VRBA 2BGKA 2UAGA 1SNYA 4LCEA 4YJGB 4BGEA 4RVUA 3PVZA 5JSFA 1PIWA 2V7PA 3AI1A 1DB3A 2UUOA 4Z6KA 3BMOA 1EFLA 4WLNA 5A9TA 3ZW8A 1L1FA 1A71A 1E3SA 3I9NA 4N54A 3RC2A 3SXPA 3V5NA 4BKQA 3IMFA 5B12A 4HUJA 2OFPA 3OIFA 3FF4A 4WCFA 2EERA 4U0KA 1ZW1A 5BNFA 4EZBA 5HBRA 1P9LA 1T24A 3MWEB 3RD5A 3LVFO 3DZFA 3SEFA 4L76A 4B79A 4DC0A 4XQCA 1YJ8A 1ENOA 3GNQA 3LT4A 2B4RO 3QP9A 4TRRA 5EIOA 1SO8A 2QRKA 3RIHA 5DCWA 4ZN6A 4MVJD 4R1UA 1B8PA 2O4CA 5JO0A 4FJ1A 5L4NA 1F8GA 2DM6A 4D79A 4RZHA 5AXDA 2SCUA 5L7YA 3W4IA 2HJSA 4WNIA 4G81A 4YJDA 1W0CA 1EE9A 4GWGA 3H4VA 1O9BA 4KP7A 5EERA 4CR7A 2PD4A 4UEOA 3UGKA 2AW5A 5I7VA 3OJFA 1EQ2A 4NMHA 4Y9DA 4B3HA 3WFJA 1GUZA 5CDYA 1RWBA 3QVWA 4J7CA 3ONDA 1BSVA 3RFVA 2F1KA 2X5OA 5DP1A 2HMSA 2GN9A 4DPLA 1PJSA 1R4NA 3H3JA 3HQ4O 3JYPA 3V1TC 1Y8RB 4CLHA 2DUUA 3LQFA 4FW8A 4O0LA 4FJ0A 3EZYA 3ON5A 2G0TA 3F5QA 3KYDA 1NVGA 4HFJA 5DDIP 4DTIA 3GPDG 4M86A 1PL8A 2Q4EA 1QMGA 3I9OA 1ULUA 2I99A 2Y67A 2VNSA 4YB8A 3EGOA 2Q45A 1DHRA 4WLOA 1ZMOA 3ZHXA 4B4WA 3JQ9A 1Z73A 4CJXA 5L9AA 3HN2A 3MCVA 3WXBA 1NP3A 1LQUA 2YHIA 1BXGB 2DLDA 1GEGA 2HRZA 3PQDA 4GH5A 4I5GA 1QSGA 4XQ9A 5FYDA 8LDHA 1M75A 3DMTA 1P1HA 3AK4A 3ICPA 3LLSA 3AFNA 2XF8A 3V2UA 4PLPA 2IODA 3V8BA 3QWBA 4DBZA 1X7GA 4LVCA 2R2GA 3WGZA 1VKNA 2AA3A 1LSOA 2FR0A 3DONA 4C7KA 4JBHA 3H9UA 4YJFA 1NVMB 3O9ZA 2IEDA 5COAA 1CIVA 2I3AA 2R00A 4NBRA 3ZWYA 4NI5A 1V3VA 4MVJF 3LLVA 3MTJA 2Z5LA 3DFUA 1E3JA 2ZTLA 4FS3A 1YQXA 2HDHA 2QW8A 1V35A 4PZEA 3PJFA 1U2DA 4F45A 2JHFA 1WDMA 3EUWA 2Q2WA 1AXGA 1PJ3A 5HS4A 1KEVA 3NGLA 5CDTA 4L4SA 2PH3A 2ZYGA 1RM5A 4QX6A 1NQTA 3I4CA 1DIRA 3GDGA 2A92A 2HSDA 2Q50A 2HK8A 5BNTA 4XIYA 1C1DB 3JQ9C 2YYYA 1DXYA 2PTGA 5FEUA 3H8VA 2FZEA 3ITKA 1H94A 4OOFA 4ONEA 5F1PA 1VJ0A 5KVSA 3VH4A 5CFZA 1SAYA 3QW2A 3DMTC 3WTCA 5A02A 3AJRA 4RPGA 4CMIA 5EINA 4CMCA 1CERA 1RJWA 3MOGA 3PWSA 4LSMA 1JU9A 5L4LA 1MV8A 4XJTA 1WMBA 3MWDB 3B1JA 2EG9A 1GFSA 1KVQA 2EEZA 1GY8A 3U5TA 4DPMA 1N1GA 4BGVA 4JNKA 3BTUA 3F1LA 4WOKA 2G5CA 4I5EA 1RKXA 2R00C 1JTVA 3BZUA 5IZ4A 1NR7A 5KVVA 1E7WA 3JD2A 5LCXA 2PKQP 4RLSA 3DBVO 3CKYA 5IDQA 5IXSA 2BFOA 3H3FA 1SEVA 3PHJA 3ZWWA 3BMNA 5EMHA 3HN7A 5CPFA 2QG4A 4DQUA 3KHUA 1B14A 1IYZA 1LEHA 2B36A 1B16A 4R51A 3B1FA 2EKPA 1DJQA 4JN6B 4D0SA 4RVGA 3FRJA 4FOSA 4AJ1A 4D43A 1GPJA 1U7TA 4IQGA 4RLHA 3L07A 3RFTA 3DZBA 3RUAA 1Q2XA 3WGYA 3ITDA 4XGIA 2C5AA 2O2SA 1E0DA 5JPIA 1PU2A 4OXKA 3RSHA 2HJRA 5AYVA 3WIDA 2WE8A 5TSDA 2DBQA 1U4SA 3ASVA 4YR9A 1HTBA 2QQ5A 4D41A 2DBRA 5CG1A 4FC7A 3FNHA 2JCXA 3U3XA 4TVOA 5JCXA 3KEQA 1F12A 4ALLA 4BNWA 1PWXA 4JGBA 5G4KA 1A4UA 4RQUA 1HDCA 3E8XA 3L77A 5U1PA 3K5PA 3LT0A 5L53A 1PGNA 3M2TA 1GCOA 3V1YA 4EEZA 4OKIA 4JJGA 3M1LA 4CMJA 4Q3NA 4L4XA 3ZHBA 3RWBA 4J4TA 3UH1A 3VVCA 3OF2A 3PFWO 4R9RA 2FN7A 4J49A 4BNHA 2Y1EA 1FDWA 1UZNA 2CMDA 3KVOA 4BNKA 1KVRA 2AQIA 2CNBA 3PLNA 1GUYA 3K6JA 3PGXA 2FPPA 3EVTA 3DQPA 2A35A 3WJAA 1DC5A 2IXBA 3QIVA 3VZQA 2FMUA 1UH5A 1JWBB 1CDOA 1LBEA 5A05A 5A9SA 4HFNA 3NDIA 1HDYA 4MVJM 1GYRA 5CDGA 3F3SA 4YT2A 2VZ8A 4ZHSA 4GVLA 4YJHA 1R6DA 4G2NA 3NAQA 1UJMA 1MLDA 3PZRA 3R6DA 4BKOA 4J43A 1PS0A 2E82A 3RJ5A 4ITUA 2JAHA 3ANNA 4RPHA 5KVQA 4CLRA 2HKIA 3D4PA 3FWNA 1TT5B 1KEWA 2DPGA 4HNGA 2GR9A 4KQWA 1LDGA 5COQA 5I9NA 5B1YA 1QV7A 4IS3A 4F3YA 3DBHB 2H6EA 4BL5A 2NTVA 1ZK2A 4DVJA 1PS9A 4BNMA 1OAAA 1R12A 1E7YA 2OUIA 3AM3A 2O50A 2HUNA 2OP0A 2VWQA 4PIVA 3WLFA 4R54A 2B69A 3QVOA 1DFIA 1I3KA 3I6QA 2EW8A 4GLLA 3U62A 4DIBA 3IUPA 4KUEA 4TKMA 1K2WA 1SOVA 2J5QA 5IDXA 1X0VA 2I65A 4YQZA 5KKCA 1YJQA 3WLEA 2Q49A 3RCBA 2X6TA 3X2FA 1Z7EA 3GT0A 3ZI0A 4B3IA 1H9BA 2J3IA 4N18A 4A26A 1DRVA 4PLHA 3P19A 3KSUA 1E1MA 1BHSA 4LCJA 1Y8RA 3WGTA 4FIZA 1YQGA 1UDCA 3EZLA 1I0ZA 5KKAA 4CUZA 4BO7A 3JQCA 5B4TA 2WD7A 4QSMA 2JD1A 1VL0A 3JD4A 3PZBA 1KY4A 3KSDO 3ZWNA 3MJSA 5IF3A 3GG9A 5I8WA 4FGSA 4NPCA 1DO8A 1HETA 4EUEA 3ZU4A 3JQAA 1X0XA 1PWZA 3FNGA 3KUXA 4M54A 4DQVA 1N7HA 3KLMX 5BQFA 5I7EA 5TX7A 1C14A 3N74A 4URFA 5MGBA 1LQTA 2B4QA 3LC1O 4TMFA 5EPOA 3UKOA 5IJZA 1BXKA 3M2PA 2GASA 3AI2A 4P8RA 3GAFA 5JO9A 4YAGA 5F21A 2Y68A 1P77A 4KQXA 3ZWVA 2IDZA 2OHXA 1PL7A 1O8CA 4I9UA 4DLAA 3MZ0A 3BMOB 3VHRA 4YVFA 3ZZNA 3AUSA 4OXNA 3RUFA 3ORFA 2NU6A 3I4FA 1HE3A 2H63A 2Q4BA 1I3LA 2WEKA 4WCFB 4CV1A 3T4EA 4KWIA 4CODB 4MKZA 4E3ZA 4CMEA 5IXYA 4E21A 1HDRA 2WE7A 3AU9A 4E2WA 2AQ8A 1C0PA 3UXYA 3IL2A 2TMGA 1ZJYA 4GMFA 4JJIA 3VOSA 4E32A 4YT4A 3NTQA 1PSDA 4XCVA 2WJPA 3NTOA 2D59A 4WLFA 1DFGA 4FOOA 3RQSA 4E5MA 2Y1OA 4RGBA 3P7MA 2IZ0A 4R01A 4Z3KA 1GZ4A 1U4OA 4UUOA 3KTDA 4M8SA 5F1KA 1LTHR 1XR3A 1RYDA 3OQBA 1C0KA 1MXHA 4BB5A 1IPFA 3VPXA 4XYMA 1BW9A 2GUGA 1YL7A 3FNFA 1NFFA 4MVJH 5DT9A 5HRUA 1F06A 3INGA 4WASA 1ENZA 2X8LA 3OFSA 1ADCA 3ANMA 1M76A 1DJNA 3GLQA 1KETA 1R4NB 4HFRA 3IKTA 1CYDA 3SC6A 4PLYA 2O23A 2BH9A 5BSHA 3GNSA 4CL8A 2UYYA 4WLVA 3TOZA 1IHYA 1U5AA 4UVGA 1K5HA 4WK6A 3DEYX 4B4OA 3ZV6A 3DAFA 4FCCA 2HK9A 4PLVA 3FBTA 3KYDB 3NDRA 4XWYA 3AOGA 6LDHA 1XQ6A 1H2HA 2ZCVA 5GZ3A 3GMDA 1IULA 4J9VA 1UP6A 5K6AA 3O03A 5TNXA 3HJAA 3JCZA 3LT1A 4QQRA 2QZ9A 2AG5A 3GVXA 4BNGA 1ZBQA 4RZIA 3HFGA 4ZQHA 5HTOA 2WYVA 4A7PA 2CDCA 2YHIB 2YDYA 3RC7A 3OJLA 1GYPA 2AE2A 3S2EA 3WGIA 2NU9A 5TJHA 2ZQZA 4A2CA 3L4BA 4WGGA 3OJ0A 4DBVO 1Y8QA 1P3DA 4WJZA 3U4HA 1MUUA 3KXDA 4YA6A 3W4JA 3GVHA 4PG5A 3O26A 4HY3A 5A3VA 2X58A 1SB8A 1NQOA 1LLCA 2Y0CA 1UXKA 3DOOA 4BNLA 5G0TA 3I3OA 1VPDA 4R1SA 4W99A 4MP6A 4MJLA 1XKQA 4YJFB 5F5LA 1EVIA 3OP4A 2Q1SA 2Y1CA 1TEHA 5JMWA 2UUPA 3K8ZA 3C24A 2E6UX 2X9VA 4C7JA 4ZU3A 3QQPA 3BAZA 4BO8A 4E30A 4IGEA 5KVCA 2FR1A 2DQ4A 3HDQA 2ILTA 4PG8A 2B5WA 1VSVA 3R3JA 2I5PO 4P22A 3ZWXA 1JQBA 2JKVA 3S2FA 2X0JA 2PH5A 3GVPA 3TZCA 4DQXA 4XYGA 3C8MA 1U8FO 2AEMA 4NG5A 5H83A 1UDBA 3AW9A 1I2ZA 1C0LA 3AOEC 5IN5A 5FI3A 1WW8A 3WOHA 4P4NA 3AI3A 1X1EA 3GEGA 2JD2A 3R0IA 4AJPA 3VAZA 2W4QA 4AJKA 3L4BC 4WE3A 3H9QA 4CMIB 3AUAA 1BTOA 1J4AA 1ARZA 1R66A 4D7AA 3NGXA 1PS8A 2O3RA 1U8XX 1ZKMA 3U09A 4EJMA 1HDXA 3Q3CA 5JAZA 1IZ9A 4M1QA 2P91A 2D5AA 3NJ4A 3RKRA 1YB4A 3H9JA 4I9HA 1GCUA 1B0AA 1K6IA 1DSSG 1P1KA 1VJTA 3JQ7B 3WDSA 3RUIA 1KERA 3ETEA 1AGNA 4HX5A 4NHEA 4PLCA 3VTFA 2NQTA 2YV1A 3BMNB 3ZU2A 4OIMA 3RASA 2BRUA 4H16A 1MG5A 4YXFA 3JQDA 2OZPA 2BI8A 4H3VA 3ZV5A 3EW7A 1Z6ZA 4GGOA 4BNZA 5A4DA 4U6SA 3ZU3A 3NT5A 3ZHZA 4XB1A 2QIOA 2O3QA 5G0UA 3VC7A 5DOVA 1T26A 1I2CA 1NBOA 4BIIA 1K89A 1OC4A 1Y9AA 3LF1A 4HBGA 1W4ZA 5KCZA 1XU9A 1P74A 1KS9A 4FFOA 4E5YA 3PDUA 5A5FA 4IDEA 1WZIA 5DBIA 1ZXBA 4Z0PA 4QO8A 2NTNA 4XX0A 5T67A 1HE5A 3RROA 1VC2A 4MPDA 3SJ7A 1HEUA 4BO4A 1R4MA 3GFGA 1YB1A 1NM5A 3F47A 1CWUA 1OMOA 4YT8A 3UICA 1PZGA 1LDMA 2HU2A 2BKAA 5G4KB 3NKLA 4M89A 1B3BA 4NBVA 4YBZA 1HT0A 3S2IA 4GQAA 1CQIA 1YONA 3TPCA 1FJHA 4AJJA 4Q3DA 4E6PA 5JLAA 4UVEA 3DZJA 4BMVA 3AY3A 4RF3A 4TROA 3WBFA 2B37A 5JAQA 1PGOA 4ZGWA 4AFNA 1LSUA 1WPQA 1AXEA 1YOVB 4NFSA 1JA9A 4YAEA 4RPJA 3CH6A 3HDYA 4GX0A 4LRTB 2ZB7A 4L0QA 4CV0A 2CFCA 2VNAA 4DIOA 3OECA 3QVSA 1KIFA 2H9IA 2C2YA 2XAAA 4H15A 1IE3A 4NBUA 3OBBA 4FFPA 1ZK1A 2V6MA 5A9SB 1EEHA 5JDCA 4PVDA 3L4SO 1UZMA 1V9LA 3OQ1A 3GGPA 4KTTE 3JQ6A 4YJHB 3WYCA 3AWDA 2PGLA 3FCOA 3GPIA 3FR7A 2O4UX 3IDSA 5JYDA 2HRBA 2JAPA 4CLRB 1U2GA 5IZCA 4Z3DA 4R16A 1NPYA 1ZMTA 2HMTA 2AEFA 1KVTA 2OORA 3ASUA 1NR1A 2JL1A 3QWAA 4CPDA 1JW9B 4BNYA 4RVFA 4BVAA 2PZKA 1XG5A 1NWCA 2QYSA 1PGPA 2RCYA 4FJ2A 1O94A 4K1LA 4UEKA 3BXXA 3PDJA 4DGSA 1ADGA 1LSJA 3EHEA 4PVCA 3TWOA 3I5MA 4ZVVA 2OXIA 3GDOA 4RF5A 4FGWA 3P2OA 4YWJA 3TZ6A 4O5OA 5ITWA 3BIOA 1QYWA 2XPCA 4CR6A 1GQ2A 2NU8A 1YE3A 2NACA 4XDZA 2JFHA 3GUCA 3CTMA 1IY8A 1JAYA 3BMQB 3K9QO 1QXSA 2NUAA 3PJGA 3PJEA 3IP3A 3WQRA 4CMKA 4Q3CA 4IDDA 2P5YA 5GY7A 3A28A 3WB9A 2FPGA 3CEAA 5TS3A 5U4QA 4XGKA 5KOIA 4K26A 1QV6A 1EDOA 4D0RA 5T6BA 1K0UA 4HNHA 1U3WA 4Q39A 3VH1A 3VTZA 5I8ZA 1GADO 1P31A 1WDLA 3GG2A 3GEMA 4QUKA 4CQLA 1YQDA 1GD1O 2WD7B 3UN1A 3ANLA 1QORA 2CD9A 4HV4A 5IZCC 2XOXA 2Q1UA 4CM5A 4WCFC 5ENVA 1I36A 3GH3A 4BMSA 1QR6A 1EQUA 3JQAB 3S1LA 3JD1A 2HMUA 3DR3A 2QRLA 1LDEA 2BELA 4DC1A 3ZWPA 5ADHA 4GPD1 2FWMX 4U5QA 2CDAA 2JCYA 4F46A 4IM7A 3OEYA 4ZICA 1H93A 1BWSA 3NUGA 1NFRA 1YDWA 3H9EO 3TZKA 3N7UA 4WEQA 5A9RA 4J91A 4PLZA 1TA4A 1QYCA 2X4GA 2VCYA 2ZB3A 3ZNPA 3PQEA 3NTRA 1B8VA 2VHWA 4GLOA 1Q1NA 2YV2A 3DL2A 3TFQA 4CMHA 3JYOA 4I08A 3RAJA 1UXHA 4O63O 3FBGA 1J0XO 3DC2A 3OETA 1MC5A 1EDZA 4R69A 1CEQA 3IOYA 4HADA 4OXYA 3W8FA 1LSSA 1J6UA 1JKJA 1GZ3A 2B4TO 3L9WA 5CDUA 1LRKA 1LJ8A 1BXZA 1QG6A 4YRBA 5JC1A 2O3SA 3O4RA 5T57A 1JWAB 4CLXA 2VHZA 1E5LA 3PIDA 4IQ8A 3UCEA 3D5TA 4LISA 4QTZA 1C1XA 1HF3A 4K9DA 1PJBA 1XYGA 2PKQO 4AICA 3UAGA 3GHHA 3ROQA 2G17A 4AG3A 4DA9A 3ULKA 5EQFA 4B8ZA 1DDOA 4Y6PA 1E6EA 3INTA 1I2BA 1DPGA 1VM6A 2FZWA 3DFZA 3DWFA 3R3SA 4J90A 3ZW9A 5BNIA 4JP2A 1XA0A 4BNNA 2VUUA 2C2XA 4R5HA 2IEBA 1BW9B 4CMAA 1P33A 1K3TA 3MJTA 4OYRA 5I7SA 4D3FA 3GNTA 4KWHA 2Y0EA 1G0OA 1YB5A 3E82A 4BO5A 4RVSA 4EUHA 1D7OA 1I01A 1AHHA 4F6LA 4UAGA 3OMLA 1H6CA 4MVJI 3H5NA 4FC6A 3F9IA 1LX6A 5CP8A 4YPOA 4XQGA 3PP8A 3JQ7A 4W9NA 2C07A 2W2LA 1X7DA 3C1AA 3QV1A 1W73A 4AJEA 3GRKA 4NU5A 2YFHA 3RUCA 3WFIA 4L4RA 1XDWA 4E5PA 1GQYA 1SOWA 2ZJ1A 2EKQA 1ID1A 1RYEA 1DBVO 1NWHA 3KETA 3G1TA 2IRWA 3D1LA 1XSEA 3OJEA 2DC1A 3FHLA 2EXXA 1LUAA 1Y8QB 2YFQA 2DTXA 1N9GA 2RBEA 4FDAA 2CSUA 2VN8A 1FDTA 3GK3A 1YO6A 3PYXA 3K2EA 4YRAA 1VL8A 5THQA 4D44A 3E18A 1PR9A 1PZFA 3WX0A 4CLDA 4EJ6A 1ZSYA 3H5AA 3I23A 1YL6A 2BFMA 5COBA 4KDEA 2YHUA 5B4UA 3NT2A 4Z0TA 5CG2A 3D4NA 4MIEA 4N7RA 1XU7A 1EUDA 3LU1A 1WVGA 3PHLA 4DPKA 5DCYA 2HCTA 2I66A 2NVWA 1F8FA 4KDFA 4EUFA 1ISIA 4RF2A 4EYEA 5TQVA 5DZSA 4WNCA 5L3ZA 4MO2A 4GSKA 1Y9EA 5F5NA 1OOEA 4GAEA 1YS4A 3H6KA 3U4DA 1ZIDA 4A73A 3QA9A 1YOVA 2YDXA 4LN1A 1MXFA 4IDBA 4NJOA 4BNXA 2HK7A 3F1KA 4GX2A 8ADHA 4CM6A 1U7HA 4DUPA 2DTDA 1NASA 1QLJA 4OM8A 3TL3A 4PLFA 4FR5A 2PY6A 4MP8A 2ZKLA 3A9WA 2F00A 2J5RA 1KVUA 1PQPA 2JFFA 3IJPA 4B8WA 2PD6A 5TIIA 3MJEA 2R6JA 5JFOA 4YT5A 4WKGA 2G1UA 5H82A 4TRNA 2GN6A 1E7RA 2HAEA 3ETGA 5CEEA 2WWRA 2X5KO 3PWZA 3ADOA 4MVJG 4NDNE 3ENNA 4RCVA 1CJCA 1U9JA 4BKUA 3HZZA 4DWVA 1XHLA 1EBFA 2JFGA 1RM3A 4DIFA 4XDYA 3PGJA 1JKFA 2ZATA 3IUSA 4QO7A 3W4KA 5H81A 4RPKA 2HQ1A 1TI7A 3O8QB 4L74A 3RI3A 3U9LA 3QVXA 5I9LA 2WTBA 4N5NA 1ORRA 1U28A 3E9NA 4MVJP 4CQMD 4WCDA 3JV7A 1VJ1A 3BHJA 1OZAA 4AJ4A 4W7IA 4AJ2A 4IUYA 1BVRA 2DVMA 1Q0QA 4E2ZA 1ONPA 2VHYA 2OGUA 1I30A 3WGQA 3KYBA 1DLIA 2O2YA 4UUNA 3BMQA 5IFLA 5FF9A 3UF0A 3N58A 2GD1O 2WD8A 3EK2A 1Z7BA 4IBOA 4NU6A 2X7HA 5CPBA 5ICSA 1H5QA 1E77A 3EVNA 4ZRMA 4EW6A 5MDHA 2GNAA 4PCVA 4XR9A 3NJ8A 3RKUA 2ZQYA 3GA0A 1R4MB 2Y0DA 1SB9A 1E1NA 2I3GA 3ZWBA 3UFXA 4RVHA 1XELA 3RUDA 3TL2A 4E5NA 4L75A 1VL6A 3WGHA 4J0EA 1UXGA 1HZZA 2FPIA 1P0CA 3GHYA 2NLOA 5KWEA 4XD2A 3P5SA 5F1OA 1Y5RA 4OQYA 5ER6A 3ZNNA 2EKLA 5DF1A 4NQZA 4WPGA 1RM4A 3HG7A 3KBOA 5JDIA 4K6FA 1Y1PA 4BNJA 4B7CA 3PHGA 4K28A 2P9EA 4RF4A 1N5DA 1DFHA 1QLHA 5EQDA 1ISFA 4INAA 3PIIA 4NR0A 3ROKA 2J3JA 1D4FA 3WBBA 4A0SA 4GVXA 5EESA 1MC4A 3PQFA 3JQ8A 1Z45A 2GCGA 2QX7A 4DYDA 4EBFA 4ND3A 1I3MA 2JD0A 4Y6SA 1A5ZA 1FDSA 1NHWA 4M49A 1IL0A 1TVEA 4OSOA 5GMOA 3FR8A 5TF4A 2IZZA 1ISGA 4N5LA 1X13A 4HFMA 5BR7A 1IUKA 1Z82A 4XIJA 2X0NA 4E0BA 4YYZA 4J3FA 5BSEA 3KEOA 2X86A 3NT4A 1VLLA 3H7AA 1B26A 4J9UE 4B3JA 2VZ0A 1YGYA 4U0JA 2BGLA 3EYWA 5JBIA 1Y81A 5LC1A 2VUSA 4YQYA 4NJMB 3VPSA 3SC4A 3B1KA 5FWNA 1HRDA 2PK3A 2QYTA 4IMPA 3GUYA 1R0LA 4XZ3A 4IDFA 1XWFA 1QRRA 3QE3A 3A06A 4KMSA 2Z1NA 3DBLA 2O3TA 5L4SA 4WOJA 4BKPA 2BMAA 2WSBA 4GX5A 4D45A 2V6GA 4IIVA 5TT1A 3L0DA 4CQMB 4W82A 1MG0A 4MKXA 1D1SA 1YWGO 1AHIA 1EK5A 1NPTO 2ZJ0A 4CLOA 2XXBA 1XCBA 2EP7A 4RL6A 1E5QA 1NQAO 2Q2QA 5KTKA 5A1TA 4FFMA 2VWGA 2IYPA 3PLRA 4DMMA 1NTOA 1Y6JA 1YRLA 4O6VA 4ALKA 4J16A 1PZHA 2LDBA 4TVBA 5HS6A 3S55A 4FSHA 1GUFA 3Q11A 3IC5A 1G6KA 2W2LD 1PGQA 4CQLB 1ZXLA 3I6IA 4XQEA 1G1AA 1BVUA 1PR3A 2O3JA 4QXMA 1HYEA 2AE1A 4PG7A 1BDMA 3H65A 2VYVD 4Y6RA 1SC6A 1ULSA 2H1SA 1AUPA 3LF2A 1HYGA 5A3JA 1Y7TA 1IZ0A 4XYEA 1HSZA 2DBVO 4CMEC 4CM7A 3LT2A 1M2WA 1ZK3A 2E48A 4ZQBA 4R4JA 3AUUA 5G4LA 3U4CA 2QZZA 4LK3A 3FI9A 1CQJA 3GAZA 3GN1A 5JS6A 4BNIA 1ONOA 3ST7A 4BB6A 1HYHA 2C5EA 3HFSA 3DHNA 1OFGA 3ENKA 1H6AA 3DZKA 3MEQA 3ROPA 1D3AA 3GF4A 4C4OA 2PFGA 1Z75A 3CMMA 2GPTA 3TOXA 3STHA 1E3IA 2J6IA 3ETDA 4AVYA 5HA5A 4ALJA 3GN2A 1C3VA 1KOLA 4NFHA 2W8ZA 2PR2A 3FTNA 1B15A 4CM1A 1EE2A 3OJOA 3GEDA 2YZ7A 4OOEA 3W8DA 5GZ1A 1BGVA 3ZWCA 1R0SA 1ADBA 1V0JA 4R3NA 2EF1A 2I9PA 3WWZA 3JSAA 1DRWA 3RC1A 4GX1A 3ZGYA 2EGHA 1UP4A 4J1NA 3U49A 4DMLA 1CRWG 4ZQGA 1EZ4A 3GC6A 3IJRA 5T8KA 4Z9XA 4E12A 3OICA 2PNFA 4EDFA 1VSUA 4MOWA 5G2OA 3UUWA 4EI2A 3WQSB 1C1XB 1A4IA 3HB4X 2Z1MA 4XA8A 4AJNA 3BHMA 4MP3A 5K6AC 4JROA 1P44A 1NNUA 2AXQA 5G0VA 4PLWA 2C54A 1LA2A 1ZEMA 3OEWA 4XYBA 1N2SA 2IZ1A 1SZJG 2PWZA 5A04A 7ADHA 2P4HX 3V2HA 1S6YA 2NVUA 1YBVA 2GN4A 4DLBA 3JQFA 2VZ9A 1NQ5A 5DCUA 3RU7A 3ICCA 2EV9A 1KVSA 1LLDA 2FOIA 1F17A 5C37A 3I52A 4IXWA 3Q2KA 2JJYA 1Y5MA 4OHUA 1NPDA 2C7VA 2JHGA 4MKRA 1JN0A 5ILOA 5K9ZA 2P4QA 4EJ0A 2J5KA 3AY6A 3KLPX 1YXMA 2NSDA 1D1TA 3QRWA 3KRTA 1HWYA 1JVBA 2VT3A 4FBGA 3O8QA 5TGDA 1Q0LA 4BS9A 3TZQA 4ALIA 4CM4A 4R9SA 3ZN2A 1EFKA 1PTJA 1YKFA 5KNLA 2ZTVA 3COSA 1T2EA 2AHRA 2GRAA 2YQ5A 2CVOA 4S1VA 2UDPA 1OI7A 2Y1GA 5BT9A 2DT5A 4U8GA 4AJLA 1DRUA 4MIOA 9LDBA 2X22A 1XIVA 1V6AA 1F0YA 4OGWA 1PJTA 4BO3A 4IMRA 1ADFA 3G1UA 2O3UA 1N9GB 3DHEA 4TQGA 4LMRA 3BTSA 3AM5A 3PHIA 4LW8A 4WEOA 1ZK4A 4NFYA 3KZVA 1A9ZA 1PQUA 3G79A 3AY7A 3EC7A 2CZCA 3TRIA 3DZIA 1YDEA 4J7UA 1CETA 1T2AA 3MTGA 1P45A 3JQBA 1BRMA 3OIGA 1T1SA 4L9RA 1GQQA 1GEEA 4OJNA 1SCUA 1DAOA 3BTOA
chains in the Genus database with same CATH superfamily
5AXCA 4EEXA 4GDMA 2IW1A 2PJUA 1ZNZA 4N39A 2D3TA 2QJWA 2R7LA 3DE4X 3RREA 4BO2A 3K92A 1W8IA 1H2YA 3UT0A 2BBSA 4EHIA 2JLUA 1GU7A 2BI7A 1YMVA 4Y9UA 4MUHA 1VL2A 5IJ9A 4P5DA 5GIOE 1U5CA 1YJBA 3GRVA 3OUTA 4UOZA 1C7FA 3WAGA 2WBLC 1PYDA 3V42A 2IU4A 4HT3B 1TA0A 3KLNA 4V2IA 2NMVA 3DEFA 1PG2A 3G7UA 1UJ5A 4HOYA 3WI7A 4MW1A 3Q9LA 3SBEA 3TTTA 2LCFA 3LQ4A 3WLOA 1V1JA 5E7IA 5IAGA 3H0KA 3P0RA 2EJBA 4RENA 2O52A 3SFTA 1QZ3A 2WVAA 3SFZA 1EWYA 1G21A 4R98A 1VSBA 4RELA 5HP4A 1J1IA 3A6FA 1SOAA 1JG3A 2NAPA 4D9KA 1GJRA 3B9BA 4U6QA 4DCSA 3BFJA 4OLHA 3DW3X 4QGGA 4BNUA 1QV9A 1Z29A 4RIFA 1GKYA 5GVRA 2ZZNA 1E1YA 4J4BA 4GDFA 4J6FA 3GJYA 1XWWA 3TCXB 1K8RA 4FGKA 1V7CA 3B6KA 1X14A 1TGVA 2ARKA 2PZLA 4MITA 3DD1A 4Z4GA 1PAUA 3PHCA 4KN8A 3TLBA 5FJJA 4BO6A 4FZ5A 4E5VA 4ZVQA 5I9MA 5JH7F 1RJ9B 2BFBA 4KRXA 3R3YA 3FGPA 3CZQA 1GGFA 4NJMA 4NIMA 3ZLBA 3KSMA 4INZA 4D8UA 3WQQA 4URVR 1U0HC 1RHMA 3I76A 3LWDA 3MJ4A 3OIUA 2R44A 5DTQA 3TW0A 3GRZA 5JNLA 1PFUA 5TLSA 2FK8A 1L7EA 2P1RA 3K1AA 1XL0A 2A1TR 1V8BA 3L1KA 3NONA 2YCLA 2YW9A 4PFJA 4LOHA 4Y9TA 3VDRA 2CYCA 4BO0A 3L79A 2Z43A 4RZ2A 3SF8B 4D9FA 1P81A 2GO7A 5KHAA 1IVNA 1XKLA 3PQ3A 4QVKA 3T3EA 4BZXA 4CQMA 2GZ1A 2D3WA 1SBIA 1M1NA 5KJ1A 3K0AB 4RY0A 1GYQA 1N2ZA 4LHSA 2NVOA 2YRFA 3HYNA 3KJFA 1ZUWA 3C87A 4QRDA 5D5QA 1J06A 1WKVA 3IP7A 2DRIA 4QJIA 4A92A 5M7EA 4ME6A 4XGNA 3RFUA 5KNCA 2O8VA 1OY1A 2GF0A 3WNVA 1KEUA 1RJGA 1L5RA 2XB9A 4FOLA 2BFDB 4NOLA 2ISCA 1E1RD 1GR0A 4UDNA 3MGAA 4Y7DA 4ZT6A 1C0IA 2C4KA 5LQNA 5EHQA 1JV2B 5J4VA 1UMKA 2F1HA 3QE2A 4YIKA 4KPYA 5KJ6A 5HQJA 4F4HA 1GGKA 1IY9A 4WXYB 2Q0XA 1GZ5A 3LJKA 4PN3A 5CTAA 1YJ5A 2R5NA 3EFHA 1P0FA 3ZD6A 5FBVB 1AVTA 4KL8S 3GARA 1ZITA 3INYA 4BVJA 5BSGA 1I94B 2BONA 1N1DA 3R7BA 3A9SA 4DLUA 2PLNA 1BH2A 1Q0ZA 3DEHA 3HP7A 4KZPA 4NKRA 3KU4A 5EHGA 4F12A 5JYEA 3QX3A 3WNQA 4OL0A 1H0KA 1YR8A 2EZUA 2YJ5A 3OT1A 4DQ0A 3WGLA 3F7NA 2C29D 3RVOA 1ZK0A 2OORC 1FUIA 2NIPA 2AZ4A 2CVHA 2NZJA 4J0FA 1TAUA 1A69A 3PVSA 4WUVA 3FN4A 3ABQB 3VQTA 2CDBA 4D8WA 1QFSA 4ZYYA 2OR3A 5ICEA 4HRVA 2G76A 3PFGA 2HA2A 3BORA 2BZGA 1MFZA 4NK5A 3G1WA 3F4LA 3JQ8B 1KTIA 1QGUB 3OFNA 1WP4A 4GYJA 4KBYA 4UEQA 4ZV7A 4F46A 2KBEA 1FP2A 1UC8A 3ZHVA 3SYNA 4C1BA 3GXBA 4CEHB 4X6UA 3TD2A 2BKUA 4UEJA 5DO9A 5I7FA 1Q1ZA 4PQRA 2PMFA 3LTNC 1DIGA 3PYLA 2X23A 3RUEA 2D1YA 5EXDA 2IEZA 1KF0A 3KQSA 4BLOA 1U9ZA 3KHTA 3TF5A 2C94A 5EXSA 2ONJA 3PNLA 4V0SA 2VPZA 1UQUA 1V1MB 2VJCA 3ZXSA 1TC1A 1ZXXA 1P5RA 3ZE0B 1YRAA 3F9CA 2ZYAA 4IYRA 2UYHA 2COUA 2VJKA 3G2HA 2O5RA 3D6NB 1OF1A 2HX1A 4MR7B 1VLJA 3TLXA 1CG6A 1U7OA 2P40A 2PQ6A 2C0CA 3FKSD 1TC2A 1HDOA 3HWRA 2PD3A 4GEGA 1ENPA 1KFCB 1SCNE 1Z0ZA 3FLEA 4KTVE 4UUPA 5AW2A 3JAMA 1G6OA 2EJUA 3COJA 2IPMA 4LBZA 2BF7A 3TRJA 5JSKA 1UK9A 4AAYA 4M38A 3TSWA 2WSSD 1N8TA 3NX4A 2IOFA 3ENVA 1PZEA 4J3JA 5ALXA 4LZZA 2P2NA 3W04A 4LFAB 4NCNA 1U1DA 2PRKA 2BOVA 1ISMA 1U1IA 1SKBA 2IYTA 4IXTA 2Y1FA 2AN9A 3ZUGA 3FVRA 3RSZA 5K20A 3WMWA 1SVLA 2PUCA 1RWWA 2FPUA 2QMZA 4UREA 1D9XA 4WZAE 4DV6B 2QN6A 2EQAA 2O48X 2YW2A 3LQ2A 5AK3A 5AO9A 2OGZA 4JJEA 4KLZA 4U7WA 3KTAB 5K3BA 2PG3A 2IT1A 4KR9A 1EH5A 2WT8A 4C78A 3PE4A 4OHMA 3VO8A 1YS2X 4LWPA 1HNWB 4TKUA 1RLIA 1X1BA 2GCOA 2EATA 1EXVA 4ARSA 3ZY5A 5CEFA 2YIMA 1YDFA 3RYTC 1F4PA 2IXAA 3DDCA 3DXFA 2B82A 4L6AA 4S3MA 1VYVA 5I45A 1YZGA 3VOBA 1OFUX 5BN5A 2YX1A 2H4XA 1W8DA 1E1CB 2GARA 3FYDA 4ZDIA 3G8AA 1JB1A 3EQ6A 3INRA 4BBJA 3MOIA 5HR5A 1E3WA 5EJEA 2AYXA 3GJ0A 1PJCA 4X7BA 2UV8A 3Q72A 4WH0A 2WLTA 1YACA 5K7SA 4Z4HA 3NHUA 3Q0EA 4YY3B 1OCEA 1DTWB 3VJMA 1T5OA 3WK6A 2GLXA 1T29A 2P5TB 1G7TA 1JHMA 1TJ4A 1FP7A 5I9SA 4W8HA 4A27A 3Q10A 2CN1A 4FE3A 5EHZA 3LO8A 1E2UA 1RP1A 3HO8A 3VDNB 1FK8A 2VT2A 4EGFA 3URKA 4S1NA 5A06A 5BVHA 2X76A 3FY4A 4CFZA 3CF0A 1T8TA 1IHUA 1CUHA 1SH7A 2C77A 1L7VC 2ZSIA 1VKOA 3CLHA 3R2JA 1DO2A 4ARBA 1HOXA 2F1IA 2GCEA 2K7FA 3Q8WA 1EXWA 4G0NA 5F3WB 2QT1A 3F78A 4B3TB 1Y3HA 3OSUA 4XB2A 2YWFA 4JL5A 5L3RA 1WS6A 3D4LA 3WIEA 3DLAA 3ONEA 3PQ4A 4G1BA 3OA0A 3SIRA 3P26A 3SMQA 1WEHA 1UFRA 3V32A 4ECAA 1L5KA 1U0GA 3K8YA 4BBZA 3ML1A 2ZUDA 1QONA 2ZK7A 1R15A 2Z83A 5HMMA 4Q37A 1G18A 3BCUA 4KPGA 1BDHA 2GZ2A 4PS0A 1BQ3A 3WL7A 4E2XA 3IP6A 2JAOA 5EVCA 3LYUA 5HS4A 3TNLA 4A4DA 5E0KB 3Q7IA 1XZKA 1K9VF 3D02A 3MT0A 5CGZA 3GJ3A 3KM0A 1UXJA 3LC2O 5BVGA 3SF0A 1BS9A 1YBMA 4NU8X 1G2QA 4YYEA 3E2MA 4FYKA 2VHUA 1T6YA 3LUGA 4L8FA 1ZVMA 4URHA 4W9NC 5CFNA 3L0IB 4C7OA 2PSFA 5ALKA 5EP3A 3TN7A 2P8JA 4MWCA 4RJLA 4UTNA 4N0MA 3K9BA 1HNZB 5JEEA 2ZPAA 4RL4A 4QEDA 1P39A 2IE0A 2XD4A 1MO6A 2A3NA 2W83A 3B9PA 4O5AA 2XCLA 5BURA 4JUDX 3WG9A 1RRCA 4BRUA 5EWMA 1RRPA 3OQ6A 3QMWA 3S1AB 4GR4A 3IP1A 4MRAA 1U3UA 4YRMA 3K30A 3EUEA 2ACVA 1SHLA 2EZ8A 2FWIA 2PZAA 2J85A 2NVUB 1CF2O 2XBMA 4XE5A 5HUHA 3AWIA 3K05A 1XMOB 2GA8A 4K0RA 1XMVA 3I01A 4BUCA 2ZYWX 5KTTA 1WDKA 1NI4B 4O1HA 3GPBA 1LU9A 2J3EA 4AF8A 2ZDHA 5HKBA 4MHSA 5ALGA 4RTOA 3SVZA 3V7YA 2AN1A 3TE6A 1D6SA 4HDRB 2QLBA 1F2VA 2XMCA 3D5QA 2QTCA 4P3PA 4PYLA 2XX3A 4RS3A 1VP3A 2EJCA 2O57A 4NAHA 1DHTA 3K0FB 2HQSA 5L51A 3EGIA 4BECA 3G49A 4XDHA 3RK4A 4HLUC 5HDBB 3T5TA 4C0LA 3HSSA 5EJIA 2GXAA 2E87A 2IOYA 4Y2UA 1DWPA 1DX9A 1PV2A 2L82A 2ZBUA 1A98A 3CB4A 3UMYA 4B9AA 2TMKA 3EAQA 4CM4B 3WBKA 5BNWA 3UG7A 4YJGA 3GGCA 1QHSA 3LHDA 4JFAA 1SRQA 3ND7A 4O4IF 1DV2A 2V6FA 4KQGA 3W1EA 4I1PA 4UHHA 4DSAA 3F6RA 3CURA 3A05A 4K03A 5E2BA 1BA2A 3DM5A 3KZNA 1NBMD 3E6AA 1ZM9A 4KFTA 5GJWC 5GGXA 3GY0A 1YB6A 1JAXA 4MDHA 1VMKA 4NE2A 5BN4A 2Q5OA 1U1GA 4D97A 1P91A 2A5YB 3DFIA 4X20B 4BE4A 4RZSA 4LRSB 4ZAGA 4MVJE 4AP5A 1NONA 1OT5A 3I8OA 5C1BA 3PTAA 2PT5A 3KVRA 2E4YA 3R09A 4BRWA 2WHXA 3LSYA 3QU2A 1N6IA 2JCSA 1JR4A 1LV8A 2C4NA 4UD2A 3DAYA 3JAWA 4J2TA 5JCZA 3IUMA 1I6LA 1BC5A 2ZJ6A 3EAGA 5LZ5A 5F2NA 4P7KA 2PAFA 1YNOA 5FOTA 5ARBA 2KLBA 3T5MA 2OHIA 3TM4A 2W93A 1R0BA 2JFXA 3TJRA 4B09A 4CMBA 1XF1A 4YMTA 4M0EA 1KJJA 1FP1D 4C7BA 3REFA 1DUSA 4TKVA 1C7IA 4IIYA 4UATA 5DSTA 2PL3A 1MT3A 1ODCA 1I3NA 2IHNA 3E9MA 4CTMA 2YBDA 5DGXA 2D0OB 2QAJA 3E7XA 3K0KA 4KSYA 2HF7A 4UVHA 5CFMA 5IJ9B 3NHZA 3DZ8A 4A1FA 4AN1A 4BQPA 5AI6A 1QOQB 3H9GA 2EW2A 2J0QA 2Q9CA 3M4NA 3G89A 1S96A 3MJHA 1PEDA 2VYND 2PX2A 4MCHA 1IDN1 1IEVA 2H7VA 3CIFA 3K4PA 1ZA1A 2RJ3A 1RCUA 3OPYI 4BNVA 4I9GA 3V2GA 1J1ZA 3TINA 4Q01A 2BGMA 2EGUA 2A5LA 2PXXA 8ATCA 4E31A 1JHUA 1G21B 3C0KA 2ESRA 2HBRA 4YP7A 1DP4A 3NANA 3WGMA 2FW8A 1L4UA 3MYYA 1KY5A 1SXPA 3K70D 3Q3IA 4TQAA 4L6CA 5HRAA 4HSEA 1XE3A 3KE8A 4LSWA 5F4BA 4OL9A 1EAYA 4JQSA 3WTBA 2ZSDA 2X2FA 2P2CA 1C9MA 1WOYA 2E4WA 2ZB4A 1U3DA 3ANSA 2VRCD 3LA8A 3GCWA 2PV7A 5IASA 3AETA 3NYIA 2XWJI 3ZXUB 4D8VA 5I01A 4HXYA 1VKZA 5HOEA 3D0OA 2PV0A 4EB6A 4D8TA 1BXGA 5DHAA 5MFPA 3BWEA 4TV9F 1TEVA 1WUJS 2W2OA 4OQQA 3DDNA 2WTUA 2FEWB 5DU2A 2BFBB 2ZRFA 2ZUUA 5HBGA 4NG4A 1Z3CA 1W6UA 2P27A 3PSHA 5EL0A 5ISMA 1P72A 3EIQA 4I1IA 2LRHA 5B4VA 5BSVA 1EJ2A 1S2DA 3I72A 1NI3A 4HKTA 4B6RA 4MAMA 3Q85A 2AEEA 3K32A 4MEAA 2YWCA 3LZ6A 4EZEA 4YLYA 4M4SA 5JAIA 3N39C 4M9QA 4XVUA 2JGDB 1FDIA 4ROTA 4D9HA 4KAFA 3NP9A 1X2EA 2E21A 2EEPA 2XE7A 5JJCA 1R9NA 1M1NB 3ET5A 4FSDA 3C7AA 5EKDA 1GITA 2G9QA 1IAQA 1AIPA 1W29A 3C3XA 3GW8A 1PKXA 3LHIA 4G8BA 4JLUA 4RH1A 5T64A 2H48A 3A6KA 2OCXA 2H11A 3CUUA 5AW1A 1SC9A 3ELWA 3G17A 1KOFA 2L19A 3CF4A 1UKCA 1DC3A 1E63A 1KBQA 4W9RA 5TXGA 5AW6A 4ZFNA 3D6VA 3HJUA 4R8RA 3EZGA 3QY0A 1WZUA 3QFHA 1CU1A 1BX3A 4H6XA 3UW3A 3ZIAD 4DDKA 3EXG1 3ABZA 3IIEA 3ZNQA 1FRQA 5FOVA 4WLUA 5KTMA 3TCNA 5LU8A 1PNRA 3N0RA 3UCXA 1ZIPA 2ZJ3A 3G2QA 3ONWA 1ISRA 5DM0A 2KS6A 4UUQA 5KBYA 3O74A 3BZBA 3Q0IA 4I55F 3T3HA 4ZRNA 3UZUA 1C1DA 1I0IA 2Z2IA 3O4GA 5HIMA 3ZVMA 4ILEA 4BTEA 5BYKA 2XOKA 4D74A 1TMOA 2J32A 3WA6A 3O3MB 3AR8A 1O57A 5C7OO 2IHJA 2R5WA 4DCPA 1YQQA 3UMMA 3ADKA 3EWAA 5JRJA 4LJRA 4TN5A 3OT1B 1P4GA 3A0UA 1PVDA 2PZBA 4MS4A 2BSQA 3MUEA 4UPVA 1J97A 4CKWA 4W5OA 3LCUA 3JD0A 3QWIA 2A9FA 4TWJA 3RBAA 3QEJA 3MUNA 1TQ2A 1Y89A 4YCCA 3GROA 3MWDA 4IGFA 4R1QA 2ZIEA 2CF6A 4IJ6A 5FOWA 2PUTA 4BCBA 2HZBA 4ZIRA 4E11A 1KMIY 2I4LA 3IUBA 3MTQA 3VR6H 1E9BA 1FMLA 3T1NA 3ECCA 4R2MA 4XVHA 2C99A 3FMPB 3F3MA 2VDVE 3QBEA 1PR5A 4MQ6A 4PM4A 6AT1A 2EIHA 1U9YA 4PRLA 4P3KA 1KAHA 1YE8A 3T54A 1ZH0A 3FCYA 5I7RA 1XCGB 1ZCJA 3A26A 1TMKA 2PUAA 1VSQA 2XZDA 1KAQA 4GL4A 2GQ0A 1SVNA 3CLRD 3MJFA 4OQDA 4AUMA 4P9NA 3AOEA 2Z8ZA 3S5UA 3L0ZA 4PGFA 3BGIA 4B4VA 1TT7A 1QGAA 4RMNA 4RVNA 2AOWA 2KB0A 3CU5A 3E1KA 3N0VA 4CCAA 2J31A 3CZ4A 3VSAA 1M5TA 3OX1A 2VUHB 3OZFA 3NV7A 1O89A 4CF3A 1WLYA 1LI7A 1Y4ZA 2O7VA 4ZJYA 2CF5A 5HSGA 3NOOA 1IY0A 1WBJB 3LOQA 4JUBA 1XROA 2QTBA 3D7NA 4EJSC 4A15A 4OG2A 2Y93A 2ZB8A 3LW7A 1ZLYA 2QSUA 4JLJA 4UNSA 4X8LA 2B1GA 2WUGA 2JRLA 4RZUA 1XXHE 5FBZA 4YUXA 5IRCD 4X90A 1W59A 2VF2A 3CZAA 5BW4A 1SQ5A 5B7QA 5JC8A 1E1QA 1M6WA 1FB5A 2G63A 4NS1A 3AF4A 4TWBA 3SKVA 1AMUA 5HQTA 1NVTA 2ZTUA 3QI7A 2CL5A 2BP7A 4Y8VA 1GSAA 3GIWA 3NWOA 5TB5A 4AJIA 2J7PD 2PSSA 3UK2A 5LMCA 2IYLD 1HUQA 3MFYA 2JEYA 2XMQA 3B1ZA 4RE5A 1ATZA 1T1EA 3LECA 3O91A 4IRMA 5AI8A 2R4QA 2AG6A 5F7OA 4R1TA 2WU3A 3KUUA 3KD3A 1CEEA 5LXTF 2LVBA 3H2SA 1LFDB 4BKQA 3PPXA 3T0FA 4UBMA 1O0SA 3FTFA 5BV0A 2YHBA 1XPJA 3LX4A 3ZGXA 3GFTA 2O7RA 4NNPA 4TKUB 2D54A 5KJCA 2GAFA 2GCOB 4Q3EA 1NT2A 2ZRAA 3IELA 2ZTMA 1T2FA 4RFVA 4MUBA 4QNNA 4DIUA 2C8JA 5FORA 1KY3A 2JBAB 3GAAA 4M76B 3GUVA 5JZBA 2CV1A 3Q7PA 1S2NA 5BN5B 3T9CA 3UGTA 1QKIA 2RGNA 1LDYA 1D07A 3D4BA 2R8RA 1QX4A 1ZM2A 4IHJF 1I4LD 1JJVA 1N57A 1U3VA 2OPBA 1ZL2A 1VDMA 1TMGE 1E3WB 4XSHA 2HFJA 1I5RA 3IV6A 4ND2A 3KQOA 4LVOA 1G3MA 2CFTA 1ONSA 4N6NA 2GEVA 4LOLA 4G5HA 4R68A 1NN1A 3VKUA 5HZMA 4R7GA 4WWHA 4DA6A 1M6YA 4CM3A 3VYRB 1I80A 2ZEJA 3AP2A 1GTG1 2R2AA 4M1MA 1ZD9A 4AMZA 2BFNA 4EK9A 1E3LA 4K2HA 1R16A 4EPTA 5C7YA 1GV0A 4OQEA 3A4MA 1DINA 4B4UA 2XRZA 1A9YA 5BVHB 3HGQA 1H3NA 2AR0A 1UP7A 3I1JA 1PJQA 1HXHA 3RBZA 4CL2A 2DFVA 2W6PA 1L6IA 4B7XA 1K5DA 2Y71A 3LFTA 3NTXA 5H9WA 2PMEA 4LF4B 1JLMA 5IYZF 3OZTA 4OH1A 4GP7A 3ZG6A 1MAUA 1M1YA 4TTTS 2WVGA 4E4TA 1FSFA 1HA3A 2NADA 1F14A 3PYMA 4ITRC 3SQLA 5KSWB 1QGZA 2XHZA 4G5QA 3RJMA 3VH2A 1GPBA 1CR2A 3COVA 4L8GA 3UJ7A 5IZCA 1VZ2A 3KL4A 2JIDA 5JCJA 5F3RA 2Z6UA 1XA4A 3RJTA 1LV7A 2XBLA 3S29A 5EZ6B 1WXFA 4IJWA 4F2DA 4JI7B 1WUTA 2JHAA 3IKJA 3Q5DA 4RHCA 5JY1A 3JYNA 4YJKA 3JR3A 1FSSA 3QOWA 3DTTA 4WZBA 4O2BF 3RAEC 1KYTA 1WAMA 1WXWA 4G23A 4ZYXA 3TW6A 1MCZA 5BVGB 2I03A 3MAGA 1J70A 4OCZA 5FXMA 3P0EA 1QO9A 3C6QA 4QU9A 3IQHX 2JZOA 4OI2A 4YMSA 5G3YA 4N8EA 4J1SA 3VAAA 2V3CC 2IW3A 5LUBA 2WVJA 4E08A 3RT1A 3H5RA 3C4QA 1ZWKA 3T15A 3C7TA 1H8HA 3B2NA 2W4MA 3C1UA 3GVIA 5EWMB 2ZYRA 2ON6A 3C43A 1T5HX 4Q1CA 4XFDA 1W4AA 4X97A 3T61A 3T7JA 1E4YA 2V0CA 3A3OA 3SM3A 4L51A 1T4DA 2XYGA 1ZBDA 1P4JA 1WXQA 4MKIA 2BT4A 5EKTA 4Z0HO 3UHFA 1CE8A 1NVVQ 2VJAA 5LMZA 2BKVA 1QO0D 3VAYA 4MRNA 3ZGVA 2D5BA 4YLEA 4IO1A 1YAHA 2Q8PA 3E3NA 1D03A 3R1IA 2WHEA 3TDMA 4OI0A 3DDUA 2Q2VA 1UK8A 1KIMA 1E2BA 1AN9A 4OQZA 3T7KA 5KEIA 2FSIA 2R84A 2C82A 2NZUG 2WAYA 1U3FA 2IK8A 1KZ7B 3AFMA 1KBZA 2Z9DA 3AHFA 1SPXA 3GXOA 3OLXA 4MQEA 2QNRA 3P2YA 4PZYA 4Z7QB 5C5DA 4M1EA 4KWCA 3GOHA 1FL9A 4W5WA 2RKWA 1NRXA 2CLKB 2ILVA 1PEKE 4Y1RA 4JQOA 4YEDA 3T9FA 3WKDA 1JXQA 1YC2A 4AUNA 3DEJA 2PUHA 1WB5A 1N5OX 1UZUA 2ZUBA 4PEVA 4PQGA 1SUBA 3LP8A 2UAGA 4TV8A 4YJGB 4DV5B 4BGEA 3H42B 3PVZA 3PNYA 3IDFA 2V7PA 4OLBA 2OV1A 2UUOA 3FNQA 2MHCA 4DLTA 4GM4A 4C20A 3RV3A 3LHKA 5EE5B 4UHEA 5LBUA 2JGIA 4HDSA 1L1FA 2V96A 3UANA 4N54A 1YAJA 2QPAA 3GJXC 3IMFA 4FHDA 1IN7A 5BN4B 4U7JA 2QRPA 2FN4A 5CDFA 5JS1A 3KKEA 1XCLA 4EZBA 5LSAA 1J24A 3RD5A 4ZYZA 1K7CA 2G71A 3FHOA 3Q3VA 2H4HA 1Y6QA 1SK8A 1XDDA 3K9LA 2YN0A 1GZVA 1KJ8A 2FRDC 4L76A 1YRBA 5D5PA 3TIXB 3UOAB 1YJ8A 4NC9A 3JAWB 5KNCH 1Q22A 4ZN6A 4MVJD 5F2EA 4F60A 3W6PA 4IICA 5JO0A 5L4NA 2BLNA 3EBLA 4GXTA 1C0EA 2DM6A 2FEOA 1I7PA 3IBTA 1GG2A 3R6WA 4YS6A 5EMNA 2SCUA 3S2YA 2XUZA 3W4IA 1Z26A 4I6EA 4BQQA 1XNQB 2FOLA 2PJDA 1FBTA 1VIDA 4TKVB 4GWGA 3H4VA 4ZT2A 3S44A 4KIWA 1EIZA 3B53X 2PD4A 1GZSA 4EWLA 2A7QA 3BC1A 2FFRA 7YASA 5I7VA 2EHJA 3FOEC 3OJFA 3K09A 2P0AA 1FNSA 1MVOA 5HF6A 1BMTA 1N2XA 3FGOA 4ZO7A 3T9BA 3V34A 3WFJA 4B3HA 3P4XA 1BSVA 4KE8A 5ALOA 1JPJA 1H3FA 3TK1A 2X5OA 9MHTA 2Q6LA 6Q21A 2WM9B 1P1CA 1NW9B 1SXJE 3MWLA 1U3GA 3FX2A 1UBJS 5EXXA 4UHFA 2LW7A 1R9JA 2O9JA 3H3JA 3PR3A 3U4GA 3QZUA 3UUEA 1D04A 2HU5A 1PV4A 4RKQA 3IQGX 4LKOA 3KYJB 1N25A 3NNDA 3VC2A 5ECGC 3EZYA 4O2RA 3WSTA 2HHHB 3UBTA 1G4UR 3B5IA 3BGVA 2CT8A 2HPAA 1NVGA 2PS9A 3GPDG 1JHZA 4COKA 5AVRA 3PUJA 4Q16A 4KLCA 2VPWA 2W7TA 4ZCPA 1ULUA 3PITA 1NQVA 1KOGA 5A62A 2VQSA 3FFTA 2Y67A 4YB8A 3T94A 3EGOA 5ALHA 4CJXA 3CT4A 3ZI7A 1L4EA 4K2AA 2ONZA 1F3OA 3MCAA 4Y2PA 3WXBA 3H8WA 3RHFA 4EB6B 1BXGB 4OH7A 4WDQA 3RS2A 4XQ9A 2HRZA 3C5EA 3HGTA 3KQVA 4DCUA 2VNIA 1M6EX 3O4FA 3DMTA 1T5IA 2L17A 5HX7A 2KX7A 3AK4A 3ICPA 1OFVA 2XF8A 4Q9LA 3H11A 2J87A 6PFKA 3V8BA 3DTVA 1U2SA 3Q3GE 1U9IC 4Y7CA 4FK8A 4UXHA 1D2RA 1FXWA 4KLNA 3FFXA 2FR0A 3RRYA 4UMDA 2QLFA 4JBHA 1N4AA 2IY7A 3O9ZA 5CNJA 1N8NA 5HJ2A 1CIVA 4LBVA 2MMGA 2C1EA 2XTAA 3V46A 4F38A 3ZWYA 4MVJF 1XVIA 4ZYTA 2JEZA 2ZJYA 4FS3A 1CY7A 1P6UA 1UFOA 2P79A 3NIFB 1I13A 3RVSA 3NG1A 4ZI7A 2X5XA 1WXHA 1TFUA 1U2DA 2O1SA 3KOZA 1WDMA 5LBIA 4KLAA 1AKRA 1E0JA 1A8QA 1KH1A 1ZN2A 4DNPA 3RKSA 2VQEB 2EX1A 1RAIA 2OCLA 5HF5A 4UBJA 3KFLA 4NYMR 2QYHA 1UPUA 2PH3A 2WHYA 3LDUA 5I9TA 2WY2D 2W6ID 2QE7A 3TEMA 1V2HE 3U37A 3ZDXB 1NQTA 1SWVA 1DIRA 4WZ6A 4WKOA 2A92A 3W6NA 3EXEA 1CRZA 4XIYA 1C1DB 3ZQJA 4QELA 2YYYA 5KQRA 1DXYA 3DLPX 1R4ZA 3LYAA 3U7GA 1RYBA 3FCEA 2RMKA 3ITKA 1JH8A 1PR4A 3M6MD 5FLYA 5HFAA 5U4XA 4JDUA 3BL6A 2X8WA 1T1JA 5KVSA 3NBFA 2QR2A 3E84A 4KC0A 5A02A 3WTCA 5AUNB 2H16A 4MS4B 1QIJA 3QYFA 3EGVA 4CMIA 4ETMA 4CKWB 2P6UA 1RNLA 2W42A 1RJWA 3PWSA 4LSMA 1RKUA 4CYMA 3M1YA 4OFBA 3U3KA 2GYWA 1JYSA 1MV8A 4FILA 1MJGA 1B2RA 1J42A 1ODFA 4XUGB 1VXOA 4Q48A 3MWDB 5DLEA 5KDDA 1N9KA 4GIBA 5JQGF 2Y2UA 3IR6A 4ZIRB 3SQMA 1KVQA 4DMFA 3ADCA 4YHHB 3IEUA 3WQBA 3DR5A 3VR3A 2G5CA 3L8CA 1YMQA 3O8OA 4FHGA 2FXIA 3IJEB 5DMHA 1D2CA 4MR8B 3R7WB 2ZIAA 1CZNA 2YJNA 2QRVA 4I5EA 4L3VA 3TOSA 5MF6A 4RDXA 3F7OA 3IAS1 4G9GA 2PKQP 5B2FA 5KX5A 1HYQA 3WAJA 5HNKA 4OXRA 4U5XA 1ST3A 1OBVA 2GOYA 2HK6A 3EA0A 3TCKA 3MT7A 1W52X 1Y3CE 2CC2A 4MUNA 3BMXA 1OXXK 1E2JA 3KOYA 2NQ2C 2Q3MA 2E85A 2QG4A 3JTEA 5JTTA 3OF5A 4H1TA 3H17A 3ZE2B 1JYEA 2VZEA 1IYZA 2PVPA 4Q4DA 2B36A 5LKAA 3T3OA 1SBTA 2BEWA 4LGMA 4OY3A 1DJQA 3UMJA 4B4KA 4RVGA 1ECFA 4IKPA 3O0DA 4IQGA 4R0NA 4WESA 3RFTA 3RUAA 2QRQA 4F4UA 1Q2XA 3JQQA 4AMUA 3KKQA 1OW3B 3ITDA 4S24A 4KRYA 3W5HA 4XGIA 3LIPA 3KQQA 2JJ2D 4V0OA 3PC7A 1H2XA 4LGCA 1E0DA 3VPCA 3SKXA 4UZEA 2PCLA 3E35A 3GEEA 3K0EA 4C43A 1T9GR 3WIDA 4L16A 2PT9A 2VYCA 5CVEA 5A2GA 4KVZA 5TSDA 1ZHOA 2UYGA 1U8TA 3ASVA 3MPUA 5K3SA 4YR9A 4B48A 4FZVA 2DBRA 3WO0A 5CG1A 2WFLB 3VR5D 2BP7B 2H18A 3FNHA 2JLXA 1G3RA 1M33A 2B1RA 2H4JA 2HBYA 3CR3C 4KR0A 4TVOA 5EYPA 1WUIS 2GJ9A 3WISA 3S2UA 4JGBA 5D84A 1D4ZA 1A4UA 1PD0A 1RVDA 3E3MA 1R7RA 4M7OA 1YVRA 1QIFA 4OREX 3TSAA 3NBQA 1C50A 1G4AE 3M2TA 1QZUA 2Y6UA 4EEZA 4JJGA 3M1LA 5IT0A 4BV2A 2YWBA 4OB8A 5EVJA 1J7JA 4L4XA 4ZTBA 4DY4A 3TVTA 1S8NA 4P35A 3UH1A 4JJZA 1RWNA 1XMXA 5SYNA 2FN7A 3B2QA 3MB8A 2VP9A 2Y1EA 1JI0A 5C8XA 3KVOA 4HL6A 4YJ2F 1OTXA 1YA8A 4Y3UA 3L6BA 3FZNA 3UWSA 3PLNA 1KU0A 3K6JA 1DOAA 3CM0A 3EVTA 3WFZA 4DR1B 2C7BA 2QENA 3G88A 2X9LA 1RKVA 2P9FA 1RQPA 2O2JA 3L7CA 3KJIA 4DLKA 4EG3A 1AGYA 3AG6A 5EZ5A 5J4YA 1JWBB 3W9SA 2ABWA 4MW6A 5KDOA 4AX4A 2ZXUA 2ONYA 2P9BA 2XADA 1Z4QA 2AKYA 4NABA 3ROTA 2FOXA 4YT2A 3CY6A 5CFLA 4AZ0A 5DYIA 1AKTA 3ABRB 4ND7A 5FBWB 1XHEA 1K98A 1MIHA 2Z5GA 3MIIA 1UJMA 3EF0A 3K5IA 1MLDA 2MU1A 2VDNB 3PZRA 1E3QA 3B8EA 1PS0A 2E82A 3OT4A 4J43A 4LYDA 4ER0A 5JZVA 5KVQA 2JRCA 4DDTA 1PLJA 1GAJA 5K8LA 3G2KA 4BQNA 4BMDA 1H22A 4HNGA 2VYFA 1QDLB 2XW6A 1AHNA 3DTNA 4FINA 5B1YA 3AXSA 2WJYA 2Z9BA 3TNDA 5JXGA 2GTIA 1E2IA 2DULA 4HDCA 4TSFD 2PTHA 5JJIA 3GWGA 4KDCA 2H08A 1M1YB 1PS9A 4DMKA 5BXYA 3IEVA 3BGWA 5IAKA 4RLFA 1MPXA 1F8XA 1H4QA 2HUNA 2VWQA 4PIVA 3QHPA 3WLFA 4ZZ0A 4R54A 1EJ6A 5BWBA 1GDTA 2DH5A 2BM1A 2EFHB 2B69A 1T3LA 4BV3A 4K9NA 3IUEA 3HBAA 1Z63A 3U62A 2QSYA 1SKYE 3M8KA 2AR9A 1L7MA 2YCBA 2RHJA 4LHZA 4KUEA 4ZK2A 1ZGJA 5HZKA 4TKMA 4WZBB 2J5QA 4I1VA 4MWSA 3G68A 3GJRA 4E2FA 2PU5A 2B61A 1T0IA 4N6GA 2Q3BA 1K8QA 2OHHA 2X6TA 4P3XA 3WLEA 3X2FA 7MHTA 2IUFA 4G26A 1X9HA 2AD5A 3LHFA 3H6HA 4IGAA 4PBRA 5TMBA 4B3IA 5BQ3A 3CNOA 4YXWA 4JUCA 1M2KA 3EVAA 1KDZA 1E1MA 4LCJA 1P0IA 1DWUA 4J0DA 1XN4A 2H2IA 4B3GA 2ZJAA 1XJWA 1XRPA 3D43A 3EZLA 5KKAA 3SFVA 4CUZA 1XJ5A 5EHNA 1Q6YA 4BLQA 3HCFA 2ZI5A 4JI4B 1DUIA 3RFCA 3D7MA 4QSHA 3FROA 1CE8B 3C74A 3KSDO 3NIWA 2QG9A 2VF8A 2B21A 2H7YA 3QKUA 4OUKX 4GPTA 1M1XB 1UKEA 2WB4A 3G23A 4HZIA 4EKIA 1JJAA 1WW3A 2A30A 5B3LA 5KZMB 1THGA 2BHSA 1U3CA 3JQAA 1X0XA 3QW4B 1JJBA 1PWZA 3QJGA 2NV0A 2IXEA 4M54A 1N7HA 4JSYA 2FQXA 4JODA 4MQEB 2H1OA 3N74A 4KQ2A 1PI3A 2D1RA 3CSUA 3KAKA 1N7JA 1FTGA 1YDGA 1EA5A 2P2GA 2V6IA 4HVLA 3HP4A 3QFFA 4ZZ1A 4Y1RB 1BXKA 1DKLA 3VX4A 1PBNA 3M2PA 4ND6A 4BJ5A 3ZLTA 5B1EA 2FDXA 3AI2A 3TLJA 5JO9A 1FE8A 2P9YA 2C83A 4MR9A 4AK9A 3PDCA 4TV8B 1GARA 1PCXA 1E9RA 5DEIA 4DIEA 4CQNA 2IDZA 1XCOA 3GLHE 1AKNA 1JTFA 2WIKA 4DLAA 4RTSA 2ACEA 1M8PA 1KZ6A 3FZEA 5DHTA 1E9DA 4YCBA 2B78A 1ZOLA 4TTJA 1MJFA 1RLMA 4YDHB 3ORFA 4AC9A 3I4FA 2RGRA 1G19A 3FJ1A 1VDZA 1EWRA 1TU3A 1Z0FA 2W71A 2V7QA 4KWIA 1USUA 2WWIA 3NGMA 4G85A 4MKZA 4CMEA 5IXYA 1JQEA 3HCDA 1HDRA 2WE7A 3ODPA 3UV7A 4URUR 4DAOA 3FSGD 4PSDA 1C0PA 4QYXA 1EFCA 4WGFA 1V8OA 1W0JD 4LRYA 3ZEAA 2BGTA 4YT4A 5KYKA 5EJ7A 4BJ6A 1RRFA 2BJWA 3M0EA 4KGXA 4I4NA 5CA1F 3DGFC 1J8DA 3KQMA 2Y1OA 5BY2A 3U6BA 3VKHA 4S2EA 5CB6A 2O0LA 4K6HA 3S5JA 3ZHOA 2QVYX 5M04A 4Q00A 4Z3KA 2NP7A 5C5EA 1LNSA 1GZ4A 1U4NA 2SCUB 3U40A 1UCFA 3S4YA 3L05A 1YU6A 4ZOLF 5K3DA 5TMPA 1LTHR 1VFNA 3VV3A 1MXHA 2HPVA 3K0BA 5EZYF 1IPFA 1L7PA 2WG0A 4FMCF 4XYMA 4XI9A 3TPZA 3VPXA 3ZV7A 1JH9A 4XM1A 1NFFA 1W35A 2PSHA 4XDGA 4YCJA 4HF7A 1ENZA 5LZ7A 3N05A 3IEMA 3CPHA 4CIWA 3W9BA 4J0HA 3W34A 3D6TB 4K9KA 4X0EA 1ADCA 3UK7A 2N75A 1INLA 4JBYA 5FL3A 1CYDA 4ZVMA 3SC6A 4HTFA 3WJ2A 1OYVA 3PNPA 3SJBA 1EWTA 4DZTA 5ECDA 2IH4A 4OM7A 2I4NA 4WLVA 3TOZA 4QDJA 3UV3A 2VSOA 2ZIVB 3HBLA 3FM9A 4TM8A 3DBIA 1K5HA 4BWFB 1JFFA 2WMOB 5JOQA 1JAIA 3FBTA 4JUIA 6LDHA 1CXZA 1HTTA 5B57C 3CLTD 4YNBA 4KNWA 4AS3A 1HEIA 1G5QA 4N7JA 3CVUA 2F8MA 2OYRA 4J9VA 4NCHA 2HNKA 4DILA 1EGQA 3HYTA 3T9EA 5LOVF 3B85A 1BDJA 4U7DA 3R6LA 4KSBA 2CXHA 1E2HA 2AG5A 4BNGA 1KDVA 5LWHA 3HFGA 3IEPA 4ZQHA 5HTOA 4DLWA 4KB5A 4ER3A 4FVTA 5BP7A 4KGDA 1PT9A 2YDYA 5DMXA 4EKNB 3OJLA 3WGIA 2R9VA 2JC3A 3OOEA 3D9QX 3U5ZB 1B76A 2VCHA 2ZQZA 3LDAA 4A2CA 2RBGA 4JU8A 1P3DA 4MW0A 1ADYA 3H11B 1SQFA 4BPBA 1G60A 3GVHA 2I2WA 4JC5A 2IE8A 3ZHTA 1ZVKA 3T3NA 1B0UA 5AW5A 3WL8A 3TKYA 4EGSA 1HY3A 3HVJA 3L1IA 2QK4A 3DOOA 3MMZA 4XWAA 4BNLA 4QQFA 4R1SA 2ZRIA 5CXXA 1TYEB 3A2MA 1TKBA 2RAPA 5F5LA 1EVIA 2I4TA 3EIFA 4JNCA 2G6BA 1G9SA 5T4HA 1X7ZA 2NW6A 2ZVJA 3DDHA 3O92A 5AW9A 4BN4A 4FMDF 4OVKA 1JKJB 3HKCA 1S8FA 3T7TA 5JMWA 3VU3A 3RU2A 1VBKA 1VXRA 1A5AB 1KNQA 2AZDA 2JAWA 3ND9A 3QQPA 4ZU3A 3RK1A 3CLSC 1CUSA 1R1DA 2C5LA 3DSRA 1H42A 1DBPA 2XI4A 3FMOB 4ZI5A 1M74A 3UQZA 2DQ4A 5KVCA 3DCNA 3AJDA 5K0GA 2ILTA 4PG8A 4D25A 1FNBA 1JILA 3E3LA 3OQHA 2VSNA 5LZ9A 4P53A 3R3JA 4IKOA 2P7IA 2BF4A 1WPXA 4ID3A 1JQBA 2AW3A 3EOBI 3GV0A 4OUDB 3TL6A 3GVPA 5BQXA 3OE1A 5JEDA 3RTBA 3C8MA 1A4RA 1UDBA 3EXEB 3AOEC 5IN5A 5FI3A 2PUVA 1MOZA 5K6RA 2FQ1A 3BBPA 3F5MA 1L1RA 4IVNA 5A7FA 1V71A 3O0TA 1AV7A 1Z8DA 4BX3A 3L4KA 3QVLA 3BRWD 1Y7IA 4AJPA 3HDTA 4I1RA