3T8YA

Crystal structure of the response regulator domain of thermotoga maritima cheb
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
134
structure length
134
Chain Sequence
RVIRVLVVDDSAFMRMVLKDIIDSQPDMKVVGFAKDGLEAVEKAIELKPDVITMDIEMPNLNGIEALKLIMKKAPTRVIMVSSLTEEGAAITIEALRNGAVDFITKPHGSISLTFRQVAPELLEKIRQAMNVDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chemotaxis response regulator protein-glutamate methylestera
publication title Structural insight into the low affinity between Thermotoga maritima CheA and CheB compared to their Escherichia coli/Salmonella typhimurium counterparts
pubmed doi rcsb
source organism Thermotoga maritima
total genus 50
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 3.1.1.61: Protein-glutamate methylesterase.
pdb deposition date 2011-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3t8yA00
3C3WA 2WWVD 1ZVVA 2CHEA 5DKFA 1YK0A 1M5TA 1MAVA 1ZESA 1ZITA 4YO7A 4PICA 1RXEA 5IEBA 3QEMA 2QSJA 3KYJB 3I42A 5CHYA 3H75A 4Z4IA 4P1ZA 4RXTA 4JOQA 3MYYA 4LE0A 3H5LA 4Y9TA 3K9CA 2JVIA 3HUTA 2E4UA 3BRQA 3A10A 2GWRA 4MR8B 3HK2A 2L19A 3Q41A 3SM9A 4JB2A 1XHFA 1APBA 4D74A 4IF4A 1QQBA 3DLHA 1PEAA 3QEKA 4MQFB 5IEJA 4RK4A 4EVSA 1WETA 2QU7A 3DZDA 3A3KA 3CHYA 1VRVA 3RVNA 3MA0A 3NHZA 2R48A 4N03A 4G0OA 2HQBA 9ABPA 3D8UA 4RS3A 2PLNA 2HSGA 3S99A 5JNTA 4S04A 4N76A 2ID9A 2P4UA 2FVYA 4IILA 4YCSA 1F4VA 3CZCA 4HNSA 4WWHA 4D6XA 4RY9A 3KKEA 1DBPA 4ZJPA 3N6VA 3B2NA 4NQRA 4UHKA 5IBQA 2M1ZA 3LUDA 4FB4A 3JPWA 3FFXA 3HDGA 3O1IC 5PNTA 3FMVA 3N0RA 3QEMB 1H9CA 3MF4A 4YS6A 3RVRA 2HPHA 4RXUA 4XXHA 1S8NA 3HUUA 3K4HA 3RVPA 4RK6A 2L2QA 3CRNA 4W5TA 1EWVA 3TMYA 3CKMA 1YMUA 5EWLB 3IP9A 5BRJA 1P8AA 3KHTA 4Z0NA 3OQOA 1QQAA 1NXVA 2IPNA 1PNTA 2VUIB 3NNSA 4EUKA 2JCGA 2QZJA 5JNWA 4Q6BA 3RVSA 5HKOA 3ROFA 4H3KB 4ETNA 1EWKA 2FQYA 2P9HA 2L17A 4KQ9A 8ABPA 4HNQA 4N0QA 5JNRA 1ZGGA 2WRZA 5FBHA 4EYGA 1ZY2A 3H5VA 4XLTA 3UUGA 3H5IA 4GNRA 4QPJC 3QLVC 1JLKA 5TE9A 1U2PA 2FMFA 4YV7A 3JS5A 3SG0A 2PUDA 2NUBA 3I45A 1JBEA 3JVIA 3CG4A 2PMCA 4UHJA 2I6FA 4RXMA 1QP0A 2E4ZA 3GBVA 1JX6A 2FLKA 3LUGA 4OLAA 5TPZA 1L5YA 3HEBA 2JBAA 5KQGA 3A0RB 3GV0A 2IPLA 3IP6A 1ISSA 3HDVA 3OO1A 3RVLA 1AB5A 2BGGA 4G0ZA 4MPTA 3RVJA 1LJUA 2NT3A 3KLNA 3QX9A 2PUAA 4RWEA 3LUFA 3OO0A 3N8IA 1U0SY 5GQSA 5C5CA 1DC7A 3R0JA 5BRAA 1GCGA 1MB3A 4NCBA 1CYEA 1TVMA 2RGYA 3BRSA 2AYZA 1RXIA 3KTOA 4ZMRA 4ZYLA 5BR1A 1QP4A 5IULC 4RK7A 1LBIA 2HJ9A 3F73A 4KV7A 5TQ2B 4MR8A 4MRMB 4F3TA 3EJWA 2PUFA 4G97A 1A2OA 1JL3A 1Z18A 3L6UA 4WXEA 4DN6A 2PJUA 3H5OA 7ABPA 1ZAYA 3RQIA 4MQFA 1USGA 1QO0A 3GA5A 3N0WA 4YWHA 1QPZA 4F8JA 2YHBA 4JP1A 4L4UA 1TM2A 1VPWA 1Z15A 2V0NA 3KG2A 5JNUA 1HEYA 1LK0A 3H1EA 1YVUA 3Q7TA 4EVRA 2ZAYA 1VLZA 1USIA 2JBAB 3OLXA 2O20A 3C6QA 3KLOA 2TMYA 3SNKA 3BREA 4TLLB 3OLZA 4ZPJA 3O75A 3CNBA 1SD5A 1ZGZA 1ZH2A 5T7BA 4RK5A 3GWGA 1DBQA 1JDPA 3LKVA 4WXMA 4HYEA 3VNBA 1SXIA 2VUHB 3EULA 5E3JA 3OM0A 3G85A 5B3JA 5IUJC 2A9QA 3LKBA 4G0MA 2PKXA 3JVDA 2QV0A 5EWLA 3W9SA 1U04A 3ROTA 1VKRA 3QLUA 1DCFA 2GI4A 2NZUG 1GUDA 4W5QA 2IOYA 3E3MA 3H5WA 3LOPA 4LDAA 3EQZA 5DLEA 4DQDA 3OQNA 1I3CA 3IP7A 1M2FA 5CNKA 3CU5A 4EY3A 2DRIA 4W5RA 4F11A 6ABPA 5DCLA 3MIZA 2JVJA 1QO0D 2E4WA 2B1JA 4MS3A 2OQRA 3MM4A 3M6MD 2H0AA 4QYMA 2CWDA 4L85A 3A0UA 3N0XA 3D02A 1NXWA 3OLWA 3P9YA 4PZ0A 1JF8A 5CNJA 4YP9A 1ZHHA 5TQJA 2GX6A 3EDCA 1D5WA 5B3JC 3H5TA 3RVKA 2KYRA 5EWJB 1JWLA 5JS1A 1YS6A 2MYNA 1FFGA 5JNSA 4RK0A 4GPAA 4NICA 5T3YA 4ZMSA 4RY8A 4KFCA 1L5ZA 3NNNA 2FN8A 5KI6A 2B4AA 3IPAA 3SQNA 2MSKA 1B00A 1RNLA 2JK1A 3JTEA 4FE7A 4TMYA 4CBVA 5IX8A 3BBLA 3EGCA 3GYBA 2JRLA 3HS3A 4F12A 2NT4A 4RSMA 3O21A 5FWYA 3O1HB 5IC5A 4EYQA 3M9XA 3CTPA 4EYKA 3M9WA 3URMA 5TQ2A 1Z25A 5HQJA 4HNRA 1K66A 4MRMA 5HM6A 1P6UA 2CD7A 2MSWA 4MS3B 1DRJA 3FGZA 4RKRA 1OXKB 1SXGA 2IPAB 1QP7A 1E2BA 4MR9A 2LP4Y 1EAYA 1ZH4A 3ILYA 4MQEA 4N41A 1SXHA 1PUXA 2FKAA 1JHZA 4FE4A 1RZRA 3O2QB 2PUBA 3F7NA 4LX8A 1URPA 3O74A 1ZN2A 2PUCA 4D6YA 4EYOA 3DGFC 2WB4A 3DBIA 2LBPA 2QR3A 3OMXA 3KJXA 3TX6A 2WMYA 1D4ZA 1KRXA 4G0PA 4MAAA 2FMIA 3MMNA 2R47A 2FMHA 4G0QA 1MIHA 4N47A 4RZSA 2QW1A 1DCKA 2RJNA 4NV3A 1AB6A 3RVOA 1D1QA 5BQ3A 4NCAA 1JH9A 4IRXA 4MS4A 1NXXA 3GL9A 3Q15C 3O2SB 1TJYA 1CHNA 1ABEA 1QNLA 2MYTA 4P98A 2FXIA 1KGSA 4PEVA 1A04A 3LUCA 5FWYB 3TD9A 4E7OA 4Z4CA 3FFWA 1NXOA 4RV5A 3OLYA 3HM9A 2VK2A 4QICA 4RKQA 2F8SA 1D2AA 4KZKA 1JFTA 3N53A 1NTRA 3LFTA 3LUHA 3GRCA 2M98A 3DGEC 3IP5A 5JS2A 4MR9B 4ML3A 3H6HA 2PAFA 4KVFA 4MQEB 6CHYA 4MR7B 2ZWMA 2PE5A 4KNYA 4G0XA 3CS3A 5EWMA 2L18A 1GUBA 4YLEA 2PL9A 1DZ3A 1FFWA 3KS9A 4ETMA 1YMVA 2E4YA 3EQ2A 4Z4GA 1Z16A 3KCNA 4IGAA 4G0YA 4QYWA 3VNAA 2FMKA 1M5UA 2FEWB 4YRZA 1YIOA 3CG0A 1K68A 3EAFA 3CFYA 3ILHA 2A9RA 2H3HA 3O1JC 3QELA 2RJOA 4JA2A 4RDCA 1A0OA 3HJFA 5EWJA 3C3MA 2F8TA 4RU1A 4EGSA 3JY6A 1C4WA 2CHFA 4Z4HA 2MSLA 4MS4B 1ISRA 3TB6A 1JYFA 5TQ0A 4MLDA 1QMPA 4JASB 1NY5A 2NZVG 2FEPA 2LPMA 5DTEA 1U8TA 1J56A 2AYXA 2MYPA 3RH0A 1ABFA 4JB0A 4MS1A 1IIBA 1BDHA 4W5OA 3F6CA 2J48A 4KRFA 3QK7A 4S05A 5EWMB 3T8YA 2XDYA 1Z17A 2IYNA 1SRRA 3OMWA 4YR7A 5TPWB 1FFSA 1YTUA 1XHEA 5DGCA 1NATA 3N75A 3SAJA 2OENG 4RY0A 5F64A 2A9OA 1GCAA 2LUOA 2E4VA 1M2EA 2LIVA 4WT7A 4OTZA 3QELB 4OBBA 2R25B 1P2FA 1MB0A 4XASA 1XWWA 2PL1A 1NXSA 4Z99A 1FQWA 5CNIA 5D2CA 4PYRA 4LZLA 4O1IA 3T6KA 1U2QA 1LJLA 5HSGA 2FSPA 4Z9BA 3QLUC 4OLBA 4LE1A 2IDMA 5FBKA 5TQ0B 3I5AA 1E6LA 1YK1A 3H6GA 4Z4FA 3SY8A 4W5NA 1FSPA 1JYEA 1PNRA 3OLVA 2FW0A 2JVKA 2RDMA 4E7PA 3HO1A 1YS7A 3F6PA 1D1PA 3HCWA 3GT7A 3IDOA 4M88A 4MS1B 4XARA 1DJMA 3CLKA 3GBPA 2FQXA 1TMYA 1PHRA 4LRQA 3QLVA 3UK0A 3G1WA 4PE5B 5FWXA 2X7XA 4OG2A 3RVMA 5KWSA 2PUGA 5GOTA 5JNVA 3TO5A 5ED4A 3HVRA 1JDNA 1Y1LA 4Z9AA 4O5AA 2FEKA 2GBPA 3QLTA 4KREA 5IUNC 4MR7A 4H3HB 3MQ4A 1JFSA 4EVQA 4TN5A 1UDRA 1Z2EA 4XAQA 4XFKA 3C3KA 4N0PA 1E6MA 1EFAA 4MYRA 1P6QA 2HQOA 1MVOA 2IKSA 3NBMA 4G86A 2FTKE 5KQMA 2QXYA 4F06A 4KK3A 1KRWA 2QVGA 3H1FA 2E4XA 3LTEA 3Q7RA 1DBWA 1PEYA 4H60A 3OQMA 1USKA 1W25A 1DC8A 1TLFA 3T95A 1KMIY 3CZ5A 1DP4A 5KC9A 1RPJA 1Z2DA 2JB9A 4MLCA 1NXTA 2IPMA 3HV2A 5FWXB 4LE2A 2ID7A 4MGEA 2Q5CA 1JFVA 3UKJA 5IUKC 3EODA 1CEYA 4KQCA 1Z26A 1F51E 2WJAA 3I09A 3Q9SA 4O1HA 5KQPA 4ETIA 2GKGA 4TLMB 3Q7SA 4IMIB 1DRKA 1OXBB 3OM1A 1GLGA 3LUAA 4Q7EA 5KC8A 3IPCA 3H1GA 3E61A 1EWTA 5KQLA 3LMKA 1BA2A 3NHMA 4YGXB 5I4CA 3KYIB 1DG9A 4Q6WA 2W42A 4Z4EA 5TPWA 1RZRD 2MYUA 1BDIA 4KK4A 3JPYA 1C0EA 3NNDA 3RVQA 2A9PA 3KSMA 1BAPA 3L49A 1T34A 4OATA 5C5EA 3QX8A 5CNMA 2PUEA 3FDFA 4IMJB 1E6KA 1NXPA 4KPYA 5ABPA 3LUKA 2YHAA 3FFTA 2WY2D 4LDZA 3BILA 4WUTA 1Z12A 3HSYA 4B09A 3HXMA 2FN9A 1BDJA 1W9HA 3C97A 4KMRA 1LBHA 3LUJA 4RK1A 3T38A 2QVCA 2FQWA 4JAVC 2N9UA 3DLBA 2FLWA 2R4QA 3HZHA 5TPZD 2HQRA 3O2JA 1EHCA 4DADA 1QKKA 1BVHA 1DCMA 1R8JA 2WJWA 1ZDMA 1Z13A 4WZZA 2VYCA
chains in the Genus database with same CATH superfamily
2CFSA 3SJZA 3IT3A 1MAVA 4KQKA 5BOVA 5T4FA 5TGDA 4DQKA 4M89A 2GO1A 2QSJA 3KYJB 1XDGA 2OUKA 2GCOB 5FYQA 3RKRA 2OGTA 4Z4IA 4I55B 1TTHA 4H1TA 3SEQA 4ZQEA 1WDKA 4HUTA 2Y2UA 4R0NA 5CA1B 4Q4AB 2F43B 1XZJA 2C2ZA 2LW7A 2XGSA 4TROA 1UJ4A 1IB0A 2AR0A 1JIXA 1NW4A 1PK7A 1XCOA 3JQGB 4W6ZA 1RS0A 3ZEIA 4PCVA 5GINE 1LUAA 2G3YA 2KBEA 1KVTA 2PKWA 2ECFA 3MLAA 3FCOA 1G64A 3MQFA 5JZ9A 1RE1A 5LD2C 3S8EA 2XAAA 3RBVA 1MT3A 1WVMA 1QS0A 1YI8A 3A3KA 1KI9A 3DZDA 4RLQA 3IXLA 4UQPA 2OPHA 2QT9A 3NHZA 3SVZA 5A6VA 2C7OA 2G5GX 4ILKA 2VJNA 1OBFO 5C5IA 1CERA 3H65A 4RAOA 4BFZA 3KQVA 4P3PA 2I4MA 4OMDA 4G9GA 2F64A 1XVTA 1TZBA 4MQUA 3WWYA 1S2MA 4U6SA 3R7BA 4MIYA 4EK9A 4RVUA 5K0JA 4WZ6A 3JASA 4WEOA 3L6EA 1EFLA 1KMMA 3EDOA 4NQRA 1SXJB 5CCXA 2F00A 2JFPA 2YZGA 3FFXA 3AHJA 3JPWA 4DIBA 2HA3A 3Q3GE 1N0HA 5ALRA 1KDOA 3Q8WA 3GD5A 3QJ5A 3RVPA 2L2QA 4MWGA 1AK9A 1W581 3OD1A 4RH0A 3KAQA 4Z86A 5IABA 3LP6A 2WM8A 5BRJA 1CUXA 1JHOA 5THXA 1D07A 4L8YA 3OCUA 1SBIA 3A3OA 4JYCA 5CFQA 3G23A 2I66A 2Z5FA 2IUUA 2NXNA 4RHCA 4D0GA 4IHKA 5FUQA 1E6CA 1MH9A 2FE1A 5AESA 2PANA 4ETNA 1U4OA 2G07A 3G2QA 3RYHA 3TGWA 5ICCA 4Q7LA 2JARA 2BFAA 4B7XA 2L17A 4RVNA 1ZGGA 4H6XA 2QROA 1G16A 4RPCA 5H82A 1YJCA 1YZUA 1Q1NA 2EVWX 2YY7A 3IBFA 1G8HA 4C4SA 4YCCA 8ADHA 5I51A 1A3CA 3G2OA 3PHBE 2VP2A 4B34A 2PUDA 2XX3A 1QYRA 2PX6A 3JVIA 1RCFA 2NV6A 3PGVA 2PMCA 3WXBA 4JLVA 2VPYA 4HDMB 2NU8B 1G8YA 4UFOA 2H4WA 1Y4UA 1V95A 4J07A 3ZJUA 2QSYA 3D6HA 4GC9A 1OWOA 4P3XA 2I3DA 4ALNA 2V74B 3QIAA 1SHZA 1NI3A 4POAA 1HV8A 5DBFA 4TKLA 2ZUEA 4K9MA 4UBIA 3ZWBA 4L5CA 1Y5MA 1CRWG 4J4TA 3FCYA 3F5FA 3BHIA 4RWEA 1TVCA 5IDXA 4XTRA 1U3FA 2RHTA 5AHRA 3EGIA 5BRAA 4EA9A 4DSOA 4OMFG 1AGYA 1GGEA 1OVMA 4YAOA 2B69A 5P8WA 4CKZA 5IKXA 3M34A 1CY4A 1M2OA 1AN9A 2BMVA 4INOA 1G20E 4RE6A 3VPFA 2P5SA 4IIYA 3K2BA 4B1FA 4NXMB 1CUWA 1N8KA 4G5XA 1PVOA 2QRVB 2EL9A 1QO9A 3AKCA 4IG4A 1JPNA 1V11A 5FP0A 3HI6A 1LKZA 3K2EA 4TUYB 4LMAA 3KOXA 3FTFA 1ZW6A 4ZJYA 2ZE8A 4X84A 2ZBPA 3G8DA 4I8DA 1ILWA 3WMRA 5BN5A 1JQJC 3FDZB 4TVKA 4XQEA 5ER9A 3IVRA 3RUEA 4NU0A 4DA4A 5FOQA 3Q7TA 3RAGA 4W63A 1JJFA 3FJOA 3N9IA 3PC8C 2P62A 1BE0A 2ZAYA 4IS3A 1VLZA 4DM3A 1Y4ZA 2JBAB 5HFAA 3TZCA 3MJEA 4O4HA 5FWNA 2R87A 3BREA 3AEUA 1U98A 3E7FA 3LRPA 4HX2A 4U0KA 2NG1A 4O33A 3G5MA 2W4QA 2GK4A 3AUUA 4Z1MD 2QY9A 5IHXA 4CM8A 1VYTA 5DHFA 3M9LA 3OE5A 4NSNA 4B87A 4B3TB 3B13B 4ZO7A 5FA5A 3STWA 1ADBA 5DBIA 2CNNA 1NVBA 3IODA 1SXIA 2ZRCA 3TGLA 1PGNA 4OHVA 2O3JA 4F5YA 3QG1A 3G85A 1E9EA 4M83A 3LSYA 1Q57A 2ZI5A 4GOND 4W8GA 4XOUA 1N7HA 5DGHA 2YQ4A 1HYGA 5L53A 1ZOLA 2WK1A 2WKSA 2HMTA 1UFOA 4KVAA 1CY1A 5HJ2A 1M0TA 2R65A 2AJTA 4F1KA 4B4UA 5EHIA 3QLUA 3SF8B 4E09A 2XVMA 4NDAA 3EVGA 4CV1A 1GGJA 5JCZA 1NNEA 4LDAA 4IXNA 1AKQA 1ODKA 3F46A 5K6AA 1TMKA 4DG8A 2ZJOA 2Q2OA 3QWIA 4CG2A 4ALKA 1VSTA 1KE2A 2X23A 4NATA 3ZDEA 6NULA 1LBQA 2VAWA 4WPGA 1QGUB 2CYAA 3B9BA 2BFEA 4C1BA 3EPKA 3Q0IA 4P81A 3R09A 2NXJA 2FUNB 1EZZA 3A0UA 2V6IA 3EGVA 4BCBA 1R66A 5BP7A 1WZEA 4JKOA 5ARCA 3DUFA 4F4FA 4Y1GA 2ZR0A 3BF8A 4U2KA 1M0SA 1SKQA 4AJ4A 4BCCA 2RCNA 3BE6A 3N74A 4HAUA 5CEEA 1IHUA 3U4HA 1GY8A 5F78A 5JH7F 3Q1LA 4F7DA 2UZ4A 1I3KA 3ICWA 5KOYA 3E81A 1Q3HA 4YTEA 3L7BA 4F93B 3UVEA 4PG5A 2R1TA 3QF4B 4FFBA 4O4IA 4QFDA 3BN3A 3MCWA 5D84A 4PBTA 2Q4DA 1KPIA 2COKA 2Z4RA 4PLHA 1FUIA 2FN8A 1Y42X 3AVPA 1DELA 5KI6A 4IVRA 3KXDA 1BA3A 3JTEA 4FYJA 3VPCA 1ORDA 3LDUA 2WU1A 2W2VA 2FWPA 2I55A 3JQDA 3PL1A 3HS3A 1RPNA 2I4NA 1E32A 3D3QA 4Q19A 4CF5A 1F20A 4LOIA 4EKYA 4G5HA 5FWYA 1BROA 4Y2QA 4DSUA 3HADA 3OC6A 1K7YA 1TVKB 4I2VA 5A0FA 4C43A 3TM4A 2JJ8A 1TJ3A 1D3AA 4WMLA 4KQMA 4BY9E 4DARA 2JFNA 2E3JA 1PR5A 2PRKA 3DEAA 3HJGA 5D85A 1NOIA 2CNWA 3JRNA 1KA9H 2VDRB 3VR0A 2GBFA 4GRIA 3EZ2A 2CNDA 5BR8B 3C98A 1VFNA 3ENVA 1PUXA 4GGPA 4ESOA 4MKZA 2PS9A 2IKQA 4R3WA 3TVTA 3HYLA 3VNUA 4LFBB 4BTEA 3BWXA 4E12A 4QUDA 3W05A 2ODNA 4R6WA 4BXOA 1BMFA 3CNEA 3HR8A 4YPOA 2QTHA 4KFSA 1X8LA 4QQNA 1T3GA 3K73O 3OMXA 1BFKA 1FFCA 1T15A 4KN8A 4CT0A 3N8GA 4FYYA 4KTTE 2P2CA 1DAKA 2Q8QA 3MMNA 3ZQJA 4MLPA 2R47A 3VR4H 5AI0A 1ZL0A 2J32A 4HMPA 4HBGA 3OE1A 5F2NA 2RJNA 3N86A 2ZI6A 1IFXA 2PH5A 2P79A 3DZFA 4FDAA 2AYYA 3C5HA 4KMOA 5TDHA 1RXUA 3TFWA 2A86A 2MIIA 1ADJA 3R7FA 5C7IO 4GX0A 5EQTA 2FKNA 3C7CB 1KSFX 1P80A 1ZCBA 2H2GA 1RPTA 4PNPA 2OQIA 3ZCPA 3L4KA 5CB0A 1FBTA 1I9CA 4WN9A 4QJBA 1P31A 4MZDA 3LL7A 3JD0A 4PPFA 2OAGA 4LZWA 2ZBEA 1T9GS 2K87A 4BB9A 2I4LA 2IHZA 4YIHA 2XRZA 4XD7A 2RC5A 5JS2A 4ND2A 5EEHA 4F2WA 2XSZD 2PAFA 1Z6YA 2XHEA 4KVFA 2RI1A 3ISTA 3L0CA 1YZNA 3UMJA 2OFOA 4RIFA 2L18A 1PAUA 3DXXA 3TJRA 1KDZA 4C2TA 5CYFA 2GPJA 3TG8A 3MNFA 1YMVA 2E4YA 3DFZA 1SQSA 2IITA 3EQ2A 3M1IA 4WKBA 2P2SA 1DAOA 2VHCA 4BECA 4GLOA 4FQ7A 4DB4A 2OYSA 2H5JA 4LGMA 2GA8A 4KOEC 4O2AF 4C9BA 1G55A 3HCAA 3VYSB 2WC1A 5BWBA 5BPFA 1PFUA 1Z4JA 3ESZA 3ILHA 3QELA 4R1SA 4U02A 2HMVA 1P29A 5J4YA 4H18A 4JEMA 3BL5A 3RR2A 1N2CB 4C7KA 2I2DA 4HH1A 1O96B 5SYAA 1WB9A 4NECA 4BCDA 4JKYA 1PZEA 3FGPA 3JY6A 4NZNA 4OPMA 4S3MA 4QNMA 4ZAZA 2X58A 5ULLA 3DXYA 1HGXA 5C4MA 4Q1EA 3UXEA 4QARA 2VBGA 3TCNA 4K9QA 2CEAA 4PX5A 3T0GA 4WJZA 3U3RA 3AWIA 4EHDA 3RIGA 2AOTB 1KYYA 2A9KA 1IBRA 1RI1A 5DW0A 4X6LA 4M0MA 4WLNA 4IIHA 3RWOA 1N77A 2E82A 2ZTVA 3I62A 1X0XA 1R88A 1ECLA 2WNSA 3TIVA 1TT5B 1HA3A 3R76A 3TLEA 4Y2RA 2ODEA 4DGSA 4DUGA 1NT4A 3EFEA 1SC6A 3IA7A 1GPUA 4GPTA 5EWMB 4HKTA 2AX4A 1TW3A 3EA0A 4K86A 1U3CA 1L4YA 5E6SB 3CISA 3QMWA 2ODPA 3OZAA 4R2WA 1Z83A 1K8ZB 4HEHA 3O95A 4WFKA 4ZEXA 5J58A 1A8IA 1DO0A 4I6JA 1JHVA 3IFSA 3EXHB 4W5HA 1XO1A 3FF4A 3JCZA 4WKPA 4B33A 4CVNA 1OFTA 2YCLA 3DLPX 3PV0A 3WYAA 4AJIA 3C6XA 3L4SO 3A1UA 2REBA 3V00A 2PWAA 1VXOA 1V4VA 1ZUNB 2OBXA 5K0BA 5DBOA 3OZXA 2Z57A 2UZ3A 2JNWA 2D2XA 4B4KA 3BL8A 3Q9UA 5AKHA 2FSPA 4DPMA 2B4YA 2G9UA 4ESVA 2OMKA 1E6LA 4QNNA 1FSPA 2PK3A 1OT3A 1ZFNA 4KU4A 1ZK1A 4MUHA 2QLLA 4JP5A 3F7OA 4TQAA 3HO1A 1KAHA 3CEMA 1KYQA 3O6VA 4MYCA 1J42A 4NS4A 1ZI9A 2GJ4A 1EXVA 2GM4A 2R6AA 4ITRC 1W36D 1XTJA 3KOMA 4KXMA 4R2MA 2YNMC 3TE7A 3JWIA 4RZXA 4RPKA 1S3FA 1V1JA 2OD9A 3RODA 5KWSA 1EUDA 4JZYA 4PR3A 1WCYA 4EHNA 2PUGA 4TS4A 1R10A 1NJFA 3Q10A 4MCHA 4CM4A 1DU4A 3EGOA 3K8YA 1WV1A 5GONB 5HF8A 1GA1A 3Q40A 3K9LA 1NNSA 2GBPA 3GH1A 4OU5A 4Q47A 1ECPA 3LK7A 4QPNA 4KPFC 4BP1A 3A70A 2J5QA 2M1XA 5CM9C 1UJ2A 4WKNA 1D9ZA 1E3JA 4IF6A 4B8WA 2BELA 3IRUA 5TEVA 3LCUA 4JD5A 1LX6A 5C8XA 4H35A 3GMSA 4U7FA 1E3DA 1SCUA 3FDJA 4LHEA 5KSOA 4R2JA 4Q9IA 4QDJA 4H3VA 2P3SA 4IV5A 4TVSA 1FU7A 5C1IA 3D5TA 4LSGA 4GLBA 1NW3A 2BEJA 2JIOA 5G53C 1HYQA 3ZY6A 4X24A 1YQXA 4EB8A 2WWWA 5FT9A 1R0RE 4FYKA 2YJ6A 3X2FA 1ST2A 1YWGO 4LSZA 3VVBA 1NURA 1QFJA 1F3LA 1YDHA 4KV9A 5G40A 1HY3A 5K4AA 4DNXA 5DCYA 2PD3A 4L9WA 2VDPB 4UAVA 3HVJA 3KQTA 3MWLA 4D45A 4KRGA 2Z2ZA 1Y9AA 3MINB 5KQRA 2ALJA 5AUOB 4RTNA 3W3ZB 3ET5A 1JN0A 2EJBA 3BIJA 4UFPA 1JFVA 2AG6A 4J16C 3AERA 1NJGA 4X8MA 3AGPA 3NS7A 1YVPA 5CG1A 2I91A 3AJRA 3CNQS 4IHAA 1XAGA 2QAGA 1CB7A 3AZOA 5COQA 1GDTA 2R00C 2SBTA 4UPDA 3DLCA 3C8DA 4X7MA 5EZYA 1UBCA 1USVA 1DHTA 2VKQA 821PA 2ZREA 5HCUA 3GUUA 2PO7A 1K4KA 3NHMA 2WJZB 2VQSA 2ZYGA 2PTHA 3CF2A 3OESA 4NEHB 1HE2A 3O84A 2H06A 2J3JA 4PO1A 3ZUGA 3VKGA 2EX1A 3RVQA 1KFKB 1XXHB 2B4TO 2JASA 2A9PA 3SPXA 3RYHB 3HJBA 1T2UA 1XYVA 4MEBA 3PXAA 2DLCX 4BN0A 2WIGA 1K6IA 3QX8A 1V5IA 3L7NA 2EDAA 3NHFA 4IIJA 4Q9NA 3IKLA 3SZGA 3IESA 3MGKA 4QU8A 1UC4B 3QFCA 5EHGA 4EHBA 4C05A 2VQFB 4M1QA 4ARVA 5EZQA 3I2JA 2VTVA 2JD1A 3PIIA 2IZ5A 4HPWA 4ZAYA 1DXHA 5EJFA 5BORA 2I8CA 5FXMA 1KZ7B 3WYEA 4B09A 1QG4A 3IIMA 2FN9A 4RK1A 1G1MA 3KZ1E 1A2QA 1GXSA 2R4QA 3D6NB 1CUAA 4L4SA 5AM4A 3EDMA 4N01A 3LT2A 3M70A 4OQFA 1XLTC 2FRDA 1WZ2A 1DZIA 3CT4A 2ZRMA 4ZRDA 3W8DA 2PMFA 1H42A 3IS3A 2IUTA 3OCWA 3FNGA 3OX1A 5E4YA 3V4RA 2RHOA 3OQIB 4K3UA 4BTVA 2ZBRA 5K0TA 5HQ3A 4LCBA 1YK0A 4LI3X 4MVXA 3IDQA 5EJGA 3SE7A 2F90A 4JFAA 1S2IA 4OAPA 1UBUS 1ZICA 2IWRA 4DAEA 1CIPA 1NMSA 4OF4A 1UBRS 4ZZ2A 4NC9A 1JLSA 1M2OB 1XT6A 3EHEA 5A3RA 2C5FA 3UB2A 2P69A 4AP6A 1WLYA 3G0IA 2C04A 4WZBE 1HZZC 1G5TA 3U4GA 3H2IA 5IZCC 2VZLA 2BUAA 4AYXA 3KWMA 3LBHA 1ZR2A 2KI5A 4MA4A 2Z43A 1KTVA 4NZ9A 4JJ8A 2GN0A 5TVKA 3VO8A 4AMZA 1PEAA 1TZMA 1MD9A 1SPBS 4RZ3A 4F5DA 3E9CA 2FF7A 1BN6A 3U1BA 1HXHA 1N2JA 1F3OA 4DVJA 4Z3DA 1RLMA 1K7EB 4Y6PA 4BX8A 1ACMA 1JHMA 2VF2A 3IVCA 4OQNA 1TK3A 4KXXA 1QHNA 2P1ZA 3UV7A 1M8KA 2AKYA 3EOZA 3WJ2A 1LCIA 2WU4A 2XYVA 2DTEA 4AJ1A 5KKAA 1G3MA 2XD9A 3W5HA 4C7OB 2J4DA 3AEUB 3AJ8A 4H3SA 1H4QA 2CUZA 2WIKA 3DZKA 3T7DA 3RV3A 5JAMA 1THTA 1VPVA 1VG9B 1ORHA 3VDNB 4CU2A 4NK5A 3ZW8A 2NO4A 3G0OA 4C3ZA 4CLDA 3THWA 2VXCA 4Y2SA 3A6DA 3NV9A 1UK6A 2HDNB 3TQRA 1AA6A 5F3WB 1W5BA 2X8AA 3IALA 1VIDA 3RBZA 1XBTA 1YB6A 3PIDA 1I32A 2HPHA 1O9HA 2WT4A 4HQLA 1UJMA 4BO6A 2F8LA 4EHKA 4EJSB 3V8EA 1N75A 3HBFA 1XJWA 2V9CA 1TM4E 3OBIA 4P33A 2WUGA 1LF0A 1QIMA 2EX4A 2XMZA 4REOA 4C1NA 2G0TA 4EGFA 2D8AA 4EG5A 5CLJA 2W11A 4FBGA 4QXPA 3QLEA 1NXVA 5CLHA 5EGNA 1E69A 1PNTA 2FMTA 1T9GR 1HT1E 5JAHA 1JEAA 2VA8A 5F9MA 4DIMA 3FG9A 13PKA 1FVFA 4HH0A 1UCFA 2Y6UA 4GMHA 2A4MA 5ALPA 4DEXA 2ZIVB 3WG9A 4OSEA 3GFQA 1F2UB 5LUAA 6REQA 1T0UA 3ITKA 1SVLA 2WF7A 3LYAA 1ZR4A 1FDIA 2C5HA 2OHHA 2ZT6A 1PHPA 3H3JA 3H5IA 5KQSA 4DMKA 3ND7A 5M3BA 1P2GA 3E7PA 4DCUA 1C7IA 3U62A 4KYVA 3SD7A 1V4BA 2GOYA 3BQNB 3AR8A 2IGTA 2ZGVA 3QY9A 3SG0A 1NMEA 5ADUS 3EY9A 3VYTB 4QBIA 3WOHA 3LD9A 1NP6A 3ENKA 5DHRA 3ZPXA 1UBMS 4DRXB 2AEJA 5I3CA 2O1EA 4XZ3A 1JNXX 4RTJA 2R3SA 2ZPTX 3GQBB 3T1QA 1B0PA 3QMVA 1Z63A 2Q3CA 4LMPA 4U3JA 2KX7A 2BGGA 4WK6A 2FGJA 4FT4A 1XD2A 5D5HA 4G0ZA 2VK1A 2C4UA 4LXXA 4AQYB 2B8JA 4CIYA 4MWDA 4QQRA 4HDOB 2GPYA 2VTKA 1GCGA 2HBYA 2QSUA 3UNXA 1JMVA 2Z1DA 3VR2A 4C4RA 4D4JA 1GAEO 2GTPA 3PK0A 3BULA 2GPNA 1QP4A 3ABZA 3OHPA 3K3PA 4JBGA 4P7GA 1CQWA 4ZT6A 5G41A 1ZPDA 3GK3A 1AS2A 1JR4A 1U7OA 1IE3A 3IJPA 4DA8A 3IEXA 4DN6A 1PT5A 1GD1O 5ERYA 7ABPA 3U4QB 4LJKA 4DKJA 1OKKA 2ZQZA 5CFRA 2YWXA 1J99A 2DSTA 3OF3A 4GG1A 3PWTA 2NGRA 1Z39A 4WHMA 3CX8A 4NBKA 4Y0AA 3V8MA 1OC2A 2XQJA 4U7TB 1XMVA 4L5YA 1THZA 1S8AA 1QDUA 3GNLA 4FP9A 4JLSA 3EUEA 4J43A 4KI7A 2Y05A 4YV1A 4YECA 1YBHA 4IQ8A 1WA5A 2ZM6B 3Q3EA 1ZGZA 3A1TA 4PCAA 5LU9A 4CF3A 4NPCA 3M6UA 4RK5A 5HCNA 4B48A 4QYTA 4C01A 3QU4A 4LRXA 3VNBA 3ESYA 4CL2A 2QNBA 5U4XA 4B6OA 3BTOA 1PS9A 1WPXA 4M1TA 1CZLA 1R74A 2H4HA 4BFXA 4BNKA 3ZCRA 3RS5A 2Y77A 1MW8X 4DBZA 2PZBA 2XBUA 4WBNF 4WN9B 3NOXA 4NNJA 2BHRA 3AHEA 5I4BA 3WYGA 2GI4A 1Y89A 3FTDA 1N78A 2C07A 4URZR 3ROMA 4D3YA 3EGEA 1I30A 4I7EA 2UV8A 2LWIA 2QV7A 2OSVA 1KMHB 1YZQA 1N5KA 1DJLA 1C3OA 2VNKA 4GEKA 1TO2E 3FLMA 2XQGA 2VJLA 2PHZA 2ECPA 3NCTA 3VKFA 2RI0A 1J1IA 3DJFA 3QKTA 4MCIA 5T64A 2YDYA 4I9UA 2QUHA 2PRIA 4C07A 2B1JA 2B37A 2EZ8A 4PGHA 3ZEAA 1JLMA 5DNDA 4B8ZA 2IV3A 2TSYB 3KUUA 1E60A 2EOAA 2OLEA 4HNHA 4GFDA 3U80A 4DXDA 1EGQA 3EOBI 3QUAA 5ES3A 3VAZA 5CNJA 3M4JA 3FPEA 4NYJR 3GNTA 4PIMA 5TQJA 1KZHA 1V5GA 3F1LA 1X15A 2OCIA 3FOZA 2Q3LA 2JJYA 4A8JA 2D2FA 3UMCA 2IYEA 4BZWA 5B2EA 3VYVA 3QTTA 3VHLB 5AFSA 4CKEB 4RPHA 5IT9A 2IH2A 3H05A 3RSQA 3M6XA 1LDMA 3TKAA 5DBHX 1S8OA 1T5HX 2O1XA 1L4HA 1JG3A 4HRYA 4RY8A 2W6ZA 4HWSA 1DAEA 4XUGB 1L1EA 1B00A 2V7QD 2Y68A 1HM5A 1XIVA 1ZZGA 2HO4A 3TXAA 4DWVA 4EA7A 5KHOC 5LPNA 1QTRA 3ELWA 1K06A 1GRCA 4GMDA 1C0KA 1OFIA 1XWIA 1ZISA 1EZ4A 1ODCA 4O59O 4DBLE 3QVXA 1WPRA 3PKJA 3RS7A 1ICEA 1P4HA 2FWRA 3IAHA 4PZPA 4X41A 3W9UA 5JBNA 2ZI3A 4AY5A 2ZE6A 3RGWS 2G06A 3HWSA 2RH8A 3P2JA 1JHQA 3BZBA 4MS3B 4W7IA 3RHFA 4CETA 1DRJA 2I76A 5I4IA 2ZT8A 2E4AA 3UWPA 1Y7TA 1EG7A 2WR8A 5DI3B 2HBRA 2Z04A 1WXGA 2PLFA 3O2QB 1W0JA 1WNTA 3KLPX 4NAHA 1T29A 721PA 4RULA 1K6EA 2OM2A 2DR2A 1NJ8A 3LXRA 4HJXA 4BNYA 3LH5A 2XVZA 1Y1KE 3V6LA 5KBYA 3NC0C 1CIVA 4EF5A 4FN5A 4GOXA 1F1BA 4UEWA 1J5XA 1KIAA 1BW9B 1T6BY 3G9TA 1EXNA 2PMWB 3O3CA 4PYOA 5ALXA 2ZSUA 1ELOA 4E3ZA 1RWWA 1DKRA 4ZU6X 1MIHA 3DMTA 1AGXA 3QW2A 2HK9A 5JD5A 1L7MA 2DPYA 2P41A 2F3PA 3ON5A 2X2OA 3WLNA 2YH2A 2OE2A 2NSHA 5JFGA 3BA6A 3CO5A 4OKNA 3T1OA 4IIUA 4MGHA 1NXXA 2ISCA 2WWIA 4JQZA 1KYWA 3IAUA 3O2SB 1FP2A 1QK5A 1L4GA 3LYLA 7AT1A 1HDXA 1QH8A 3V97A 3A36A 2ODTX 1UBOS 4JDPA 5ECDA 1TCVA 4PYJA 2XUJA 4GQAA 2G1JA 2J3HA 1VYVA 3IAM6 1I4OA 4TTVA 5K8LA 2CXSA 4GL4A 3WTCA 5A3JA 1PRYA 3O8OA 4HEA6 3GRZA 1D2AA 3I72A 1LS6A 3D5EA 3DFFA 5DSTA 5BSEA 2M98A 3IP5A 4S2UA 2A7XA 1EP9A 5KWJA 1JKFA 1XCBA 4OQ4A 1OV6A 4D1YA 3T1YB 2N3ZA 4E1AA 4IHJA 4YLEA 1Z5UA 3H13A 3BCUA 4IZIA 3KQPA 4DMHA 3CVVA 1UFQA 3NTRA 3K0KA 5FWAA 2ZE7A 1H5QA 4IGAA 1M0EA 1SKAA 4IJKA 3AR2A 4G0WA 3F3MA 2OO7A 3VNAA 1U6KA 4KL8S 1UIMA 1NBWB 3PFBA 2OKCA 3CUVA 3E2IA 3KHUA 4EJ2A 5K45A 3HJUA 1T4DA 3RSLA 2DE0X 1ZOIA 1GAWA 5FLYA 3NWPA 4FPXA 4DEVA 4I1YA 1PJAA 3QEAZ 4R5MA 3TBHA 4NYIQ 4A2WA 4GBED 3VR6D 1AZLA 3D6AA 3DEFA 3ONEA 2AMVA 5KNCH 1E4YA 4K5QA 4LNUB 2QJRA 5A4IS 1YOVA 5BMVF 1HDRA 3L7JA 1V5FA 4KQ2A 1BEUB 4RORA 5BQPA 3U48A 3PQ8A 3DZ8A 2LPMA 121PA 5E7JA 1U8TA 5AK5A 3VVMA 2X0KA 2AYXA 3DMGA 4ER3A 3GZ4A 3UHOA 1DI0A 1TI7A 2ZDGA 2V8OA 1DQRA 1Z6TA 2VKTA 3IJ5A 3JAKA 1I9GA 3TTTA 4D41A 3EVTA 2W58A 1SG6A 3QK7A 3KDPA 2D62A 2X9GA 4UZFA 4BHTA 4PG8A 1IHYA 4LYHA 4I1IA 2H5EA 2XY4A 4CEIA 2DHQA 3FNIA 3DMDA 4JR0A 1CNMA 3SHOA 1JFFA 2A9JA 1JKMA 4K26A 1TUBB 4CCSA 4KR6A 1OI2A 1NATA 4RPLA 2BFCA 1J8FA 3HVKA 4NZMA 1U0JA 2XRFA 3EMVA 3B8HA 2A9OA 5ALQA 5JIBA 2BMEA 2E4VA 2QQEA 5F5XA 4BLVA 5T3UA 5KTNA 5KJ1A 1SKYE 3B9QA 1X1CA 1IVYA 1NBIA 1XLVA 2AN1A 2Q4BA 3KSRA 4IIJB 1CQXA 4BLPA 4XPIB 3TNLA 1PR4A 3B6IA 3H3XA 3I1IA 4IDEA 4KSCA 1CP2A 2XZDA 3KPUA 4RENA 1L5LA 3U6KA 3Q8LA 1RJ9B 4IBOA 3SYNA 2FZEA 4PPQA 5ENVA 4RUKA 3SEAA 2ZAOA 2QG4A 3LBNA 4IJVA 4QRHA 5IBRA 4DM4A 5F4ZA 2P0AA 1DEHA 4JHXA 3WWDA 1GXSB 5C3UA 5IJ0B 4Z5XA 1K92A 2P27A 3SX0A 2VPIA 1XPJA 2DSNA 1Y3CE 3TZKA 2XB9A 3VDRA 1O08A 2YMMA 4HLDA 4DCMA 1ZLXA 2V55B 3VSDA 5E3IA 1A9YA 1IXKA 1D6NA 1JU4A 3N6XA 5KTTA 5KYXB 2XGJA 1NKSA 4HUQA 3FHJA 5FWXA 2CCKA 4QGSA 5HQ3B 1C0IA 1CD5A 2V6BA 5ED4A 4ZANA 3CH7A 2QBYA 2QMUA 5ITSA 2P77A 2GYVA 2YXDA 4OI2A 3U26A 1IM8A 3FD8A 2HD4A 2R5NA 6GPBA 1M76A 4NV1A 3A2NA 3C8ZA 4FHDA 4Q9LA 5HE9A 2ORVA 3SC2B 3WL5A 2GF0A 3WRYC 4B84A 4EVQA 1MTZA 1UQUA 2A7QA 2D1SA 3A2KA 4C4ZA 1J8QA 2IIPA 1OSNA 1GFSA 2GK6A 3B70A 4HPXB 5JYBA 2WYHA 1V8OA 1KARA 3SIRA 4EG1A 2ACWA 5IM4F 4NFHA 2XGMA 4B4OA 2YX1A 2QM8A 3RUIA 2WABA 2WEKA 1KSGA 4OH7A 4NEGA 3UOAB 1KI7A 2P1DA 3IP3A 5DYWA 2GNAA 1HO3A 3K0CC 2ZJ8A 3PX3A 1FP7A 2CUNA 1QCZA 2IDZA 3E84A 3PEVA 3UJAA 4A6EA 3OJFA 5JDIC 1PW7A 5EUQB 1JQKA 2Z5GA 4EGQA 2QRGA 3LLUA 5FF9A 2Q46A 5FFMA 5AIBA 3QHQA 2PMKA 3SOPA 3CH5A 2QLJA 3DWIA 2ZM5A 3USES 1QZUA 3QEBZ 4KQ1A 4GKJB 4JI8B 1MVLA 1E8NA 1UKVY 3HLTA 3FA2A 4FMDF 3W4KA 2A3NA 2FB9A 5JALA 3FTQA 1BXGB 4EL5A 2OV8A 1MNAA 8MHTA 4IEEA 1JHDA 1II9A 1FA9A 2YQZA 3AUAA 1TQ8A 4S1VA 3ZQ4A 1JW9B 3JYHA 2O05A 5EHXA 1H2ZA 3TOSA 3GVCA 5HS6A 1VIMA 4NKRA 3G88A 4UUAA 1ZNYA 1TC2A 4HFMA 4MUIA 1MQ8B 2NTYC 4F96A 1XYYA 3KAKA 2F1KA 4LXUA 1VGRA 4J49A 2EKQA 2I3BA 3KYIB 4Q4LA 4LC0A 4RTQA 3PYLA 2GDZA 3HFRA 1O6BA 1R0BA 5LLDA 5LWHA 2WUDA 4RESA 4ZK6A 1GNTA 3PQ5A 4MUFA 3D6VA 4MH0R 4HR7A 3ICQB 3SFTA 1BTOA 1EUZA 2FQQA 3ND5A 4V0ME 3ZLJA 2C9MA 3DBOB 4DC0A 4F85A 1DNPA 5IXYA 1XFAA 3UV3A 2IQ5A 1NXPA 2RK3A 4AQDA 1XKLA 3E9DA 4PIPA 1IDOA 3RJTA 2BGMA 2FPGB 2JD0A 2SCUB 2WY2D 4PAOA 3SE0A 1PI3A 1E2DA 1Q5PA 3KUCA 1HDGO 4HYYA 4PX9A 2G25A 1V4NA 2W98A 3ZE7A 1XU7A 2I7TA 1YMQA 2OHOA 3IJEB 1OZHA 3NIWA 3NORA 4NPAA 2QX9A 3HZHA 3AINA 4L3OA 1D8TA 2YWHA 3ORRA 3G2LA 3ANNA 5KTSA 1BVHA 5FTNA 3VU9B 1P62B 2EYUA 2J87A 3QVJA 2X0RA 4IDBA 2O3UA 2AFIA 4Y1EA 5IVKA 1NX9A 1R0LA 4CKWA 3CZQA 5IJ9A 4OV6B 1RMYA 2WHXA 3HR7A 3N6RA 3L1UA 2OPBA 3ICVA 1GPWB 3BUSA 3JQAA 4QUKA 4BO0A 5AVRA 1YDFA 2QRQA 4K9SA 1ONPA 4F9FA 2BHLA 3WGVA 4KLCA 4A8HA 2G71A 4WNIA 1CDOA 2QP3A 3NHBA 4ABTA 4J3FA 2AK3A 1KNQA 3ZNPA 5AIAA 3WR5A 4OB8A 2DT8A 3KTAB 4WBXC 3RD5A 4FOLA 5FBRB 3V4OA 4XLZA 3BEDA 1VGVA 1NWCA 3BGIA 4IV8A 1JIKA 2ZU6A 4QOJA 4RA6B 3T99A 4CI9A 5BMVB 3A10A 4G9EA 2L19A 2WM9B 2C03A 5EUCA 2NQ2C 2PU7A 1L3CA 3I39X 3KSUA 1HKHA 4F21A 1Q0QA 3QTLA 1P2DA 2BTQA 2XVXA 2HR1A 1RBQA 2GEBA 1ZA2A 1BXKA 2QIOA 2XF8A 4RK4A 4YJ2F 3L8MA 4BO3A 3GLFA 2GLTA 1YAHA 1R0ZA 4RVDA 5FBQB 4BO5A 1XNQB 1VHJA 5FWDA 2OAEA 1QK4A 4RS3A 1J21A 5DIFA 3EC7A 2IELA 1B8UA 3JV7A 1LTHR 2EG5A 4QTZA 1BYUA 1G4AE 1O5TA 1XL1A 1GAQA 3QF7A 2ZUVA 4URWR 5K8CA 2GT1A 1KDYA 3WXMA 1PDWA 2BFDA 1X9GA 2COUA 2WWHA 3BWMA 1NYLA 3KKEA 3KQYA 4GI5A 3KOZA 4C03A 3LO5A 2M1ZA 5CTJA 5DLQC 4URVR 5KYWA 3O1IC 3FMVA 3KP1A 2YHIB 2EYQA 3ASZA 1DJQA 3E9YA 4A0HA 2I2WA 2JH9A 3TLAA 3BB3A 4W5TA 2ONJA 3W2HA 1KC1A 2NU6B 3IUQA 1VB3A 5BWCA 3EQ7A 1ILEA 3DYVA 3R8CA 1RKUA 2PQ2A 4G41A 4G81A 2B7CA 3ECSA 4K3VA 1TYAE 4XCXA 4EUKA 1FMLA 3OHMA 3I01A 3CZ4A 1J1ZA 3CURA 4OKSA 1ZHOA 2WLSA 1C3OB 1T4CA 3A4VA 4IG9A 5FUBA 1N5MA 2WFZA 4LJYA 4M1EA 3ZIAD 2YV5A 3KB2A 2AVNA 1JEYB 4QVIA 1YR9A 2PZMA 1FFHA 3T1VA 4YC7A 1L4UA 3UWKA 2PS1A 5TS3A 4XIGS 3C1OA 2CK3D 4C5AA 1EWRA 1ZL2A 2P9JA 5JTUA 1U2PA 2HSWA 3BWYA 4EEZA 3IV9A 4OHMA 1PJCA 3PNPA 1DC5A 2FU5C 4RCYA 4KUHA 3SHTA 1POWA 4A8JB 4BFLA 2I6FA 3A1WA 4E4RA 1EXMA 4JWKA 5B4UA 2YXNA 3AB3A 3LT4A 1ATIA 1IUOA 3KHKA 3G13A 2P5TB 2WE7A 1K5PA 5T4BA 3KZKA 1UL1X 1D2HA 5AVWA 1NUUA 2QF7A 4B4WA 1U5CA 3GVHA 3G1TA 3ABSB 3M6AA 3IJRA 3I34X 1T2EA 2AEEA 3K0BA 3QRWA 5ALKA 1P0CA 1BH2A 4MRNA 3HKEB 4B3XA 1U0SY 4KO3S 4NCBA 1KEUA 2O7NA 1KL7A 1N0IA 3ZTWA 4BMZA 4KE7A 4WCFA 1ZBQA 3N70A 4IDGA 1ZD9A 4PZCA 1TT7A 2AYZA 4KSYA 1IBSA 4DWWA 1TIPA 2XT9A 4L76A 2BMJA 5BSKA 3PQ4A 2O19A 1NNI1 1PEKE 2OXTA 3TDNA 4PHCA 4PWZA 2PVSA 3MWDB 4OHUA 3GJXC 3OEHD 3RV4A 3NDJA 5F33A 4B4DA 4H6VA 4EKDA 3QVGB 4Q9DA 1OPXA 1VI2A 4K05A 5GY7A 4AMVA 3EIXA 4HTFA 2XEXA 4PCLA 2O59A 1LV7A 3PENA 1QNFA 3MZ0A 4B3RB 4QTYA 1UODA 4FWIB 4XFDA 1BRMA 1CW2B 2VT3A 5G2OA 2GPWA 1H8HA 1RYYA 4RHXA 5DVZA 2OT3B 2IL1A 3R6TA 1AU9A 2H1SA 4UEQA 2VK8A 3ESBA 5L3ZA 3WQBA 1R8XA 4BEBA 3VC7A 3ZLBA 1IBKB 5A9SA 3OLZA 1F1JA 4FYMA 3A1EA 4HDAA 4QREA 5FA6A 3EIFA 4ZVOA 3TUZC 3OZFA 2QZ4A 3D9QX 4CV0A 5A71A 3DQZA 2DHDA 4Z8XA 1TKCA 2D74A 4NU8X 4KQWA 5DNUA 3B6MA 1WKVA 4W4TA 4LTDA 3VJLA 5E3JA 2PGOA 3DL0A 1SXJE 1FL9A 2CJXA 1AQ6A 3O1LA 4GP7A 1QH8B 4YJ3F 4DCTA 4TX1A 1TMGE 2X5JO 5H9WA 2ZRAA 2O57A 1F17A 3UT5B 2X8WA 5H8WA 2P6MA 3GLIB 3KWFA 2PGAA 4CIXA 1ODLA 2JFHA 3LDAA 3CLTC 4RDHA 5CH5A 4A03A 1WKBA 1OD6A 2FRXA 3M1AA 3M1LA 3R3HA 4MV0A 4S0ZA 4KO8A 4GQIA 3QVKA 3KZCA 1E18A 2CLKB 2Q3BA 4GBMA 4LHVA 5FADA 2D0OB 2AOUB 1P77A 1N6PA 3DZIA 2YC2C 1ZCZA 1W4ZA 4NOLA 5AJWA 5SZKB 3JSXA 2GPBA 3EZLA 3M5WA 4WCDA 4BLUA 4ZDIA 1L9XA 1CUVA 2BBWA 1A7JA 2CWDA 2HRZA 3T5BA 4HB2A 3L7KA 5TGTA 4H59A 3UAXA 4UOEA 2VZ9A 2ZR8A 2F1HA 2HXGA 5MN6A 3N28A 4JGBA 3QG5A 2H4ZA 2A58A 3GNSA 4QEZA 2E18A 3GEDA 4C78A 3RVKA 1W94A 3IMKA 1I7NA 2GZRA 3GVIA 1UC9A 1UIRA 5FYDA 4OMCA 3AUJB 4YMSA 4JODA 3RSCA 1WY5A 1J7KA 3AJDA 2CV1A 3EMKA 4RD4A 4YUXA 2AKAB 2QDKA 4GPAA 4R8SA 3TUIC 3WIBA 5K8IA 4FUQA 3LPCA 1TYZA 2AJBA 2ZROA 3F5DA 1K3TA 2CDNA 3DDZX 3HUDA 2RK4A 4JROA 5F76A 3U3XA 5KVCA 4KFCA 5ITWA 3BBPA 4H7DA 3LECA 3NHWA 4BV3A 3RREA 1Q17A 3N76A 3GLTA 3O8NA 4BQIA 3A9UA 4DLLA 4DCJA 1IZ8A 1X1QA 1N9KA 2OO5C 4P5PA 2NT4A 1VSUA 3ZN2A 4WOKA 1Q95A 3PPWA 3QQPA 3EYWA 4C06A 3OZVA 2GJSA 3ZCTA 3S6JA 3EIOA 1W8IA 1YSCA 2J0VA 1Y7HA 2QU8A 2OQ2A 4YNBA 5B36A 3RSGA 4H1VA 4NCIA 3KAJA 4E6PA 1CG6A 4FI3F 3FZEA 2LP4Y 1YC2A 1YE3A 2I22A 4TXLA 5JZBA 3CLUD 2VHJA 2BDTA 3IIJA 2FKAA 3IIKA 4M0LA 1UPAA 4IP0A 3TIFA 1DO2A 5BURA 4CM9D 3TDMA 3B52X 3DGFC 1UJ5A 2FK7A 3U56A 3LC2O 4MUAA 1P7CA 4ER0A 4P36A 2YZ2A 4HGQA 1G17A 3SBXA 3TAUA 1Q0HA 5AUNB 2C8VA 2JGAA 4FEAA 1A2BA 3WK9A 3WSTA 3GPIA 2DFTA 5EIBC 4G0QA 2XYGA 3X1DA 1T8SA 1E9SA 3KL2A 3ABRB 5LDHA 3N7UA 4ARSA 3X0DA 1TECE 1OLUA 1XQXA 1RDFA 2BBSA 4PNEA 4N9WA 4NCAA 3T7RA 3AZQA 2FUEA 1CF4A 2QYOA 4I14A 3CVXA 3EQ6A 1RQLA 1CK4A 5AO9A 1Z2AA 3TD9A 1PG0A 1KGSA 2FXIA 4O4LA 5DM1A 1JECA 3TZEA 1W85B 3OJ0A 2ZJ4A 1IZ0A 1PJLA 3JQ8A 4L9SA 4GVXA 3MG9A 3X1WA 3LFTA 1XB2A 1UMKA 4EUFA 3V4FA 4QVKA 2QW8A 3HSKA 2V7XA 2ZWMA 1GUZA 2JHCA 1VCHA 3BXZA 3EPJA 1ZCFA 3OSUA 1DZ3A 2FFQA 4C6HA 1CUJA 1DBRA 1NM5A 4OUDA 3UBMA 1ZOPA 5J4VA 1PJ2A 1NVGA 2RHBA 4ND7A 4UTNA 4YV0A 1KVRA 1W4RA 3VSCA 3IVMA 4E2ZA 1PNVA 1F7VA 3KYCA 4DNOA 4N3GA 4Y1RB 4QPPA 1MOZA 3GLKA 3ZZ1A 2BMAA 1U28C 2D4HA 1N25A 4XTCS 4RHEA 4RGBA 3V7UA 4EW1A 4EUSA 3PXDA 4YUZA 5EWJA 3CUSA 3NM5A 4KXLA 4Q7QA 1FXWA 1K7SN 1VDZA 1AGNA 4EGSA 1UXJA 4OBXA 3ZCVA 1LK5A 3MPUA 1E2QA 1LLFA 2XQKA 3PE3A 4EYQA 2A67A 4CQMB 3KM0A 2B8TA 3KNZA 4NARA 3S40A 5CBPB 3A9VA 1DC6A 5H59A 5BNIA 5JXIA 4HMOA 4YAEA 3VI3B 1XEXB 1KBOA 2IEDA 3E03A 3DTVD 3FUCA 4V3CA 1PR2A 3AGQA 1M1NB 2GN4A 2IQIA 2SKDA 1VXRA 3ELUA 5L40A 1IIBA 2JFWA 1I10A 4HYQA 3MTDA 3BMQA 4F1JA 2GUGA 4H0FA 3ZE8A 4TV9A 1A4RA 1C30A 4B2IA 3DEZA 2WF6A 5FX2A 1CUSA 5A0VA 2Q3HA 1K1EA 1T25A 2GBGA 2ZYWX 1O57A 3IAEA 5FUXA 4DLKA 1UZAA 2OVFA 4XQCA 2WTMA 2WIFA 2WHQA 3KXPA 2WKRA 1VKZA 3ITEA 3RBXA 3HA5A 4BQPA 2D06A 1RT9A 3AIIA 1KO5A 2W2LD 3EIHA 3FOWA 3MT9A 2VH2A 4IWNA 3BC1A 3EW9A 3IMFA 3EUAA 4M9UA 5F64A 3TKLA 4YJ3B 4MITA 1X3LA 3FW1A 2YWBA 2FUG1 4BJHB 1TCUA 5CEJA 3KEMA 2ONYA 1RHKA 2KQUA 3AEKA 3AZPA 1P4GA 3K09A 3BDAA 4DWJA 2Q0SA 2IU6A 3PNKA 5E9QA 4BKQA 3AF1A 2QNIA 5L4NA 3CZMA 3DYBA 5G4KA 4PS1A 1RC0A 4RLHA 1M6YA 1U2QA 3O83A 4OBWA 4H6WA 3ULKA 3JQFA 2Q1XA 2Z2KA 1EJ6A 1Y81A 2H9AA 3MB5A 4B2PA 2ZDQA 1M2WA 5TQ0B 4LY0A 1EUYA 5AQEA 2HJSA 1R8QA 4BJ1A 2VTBA 3AQ4A 3S2YA 3UAGA 2UU9B 1OYOA 1RWMA 1D0IA 4F45A 4AN1A 1U94A 1GPDG 3B53X 5BSFA 1P5ZB 1P91A 3F67A 3OM9A 5CD1A 3GT7A 1NPDA 1A9RA 4G84A 1KJWA 4M88A 1NKTA 4XUCA 2ZFUA 1M2GA 1B2LA 2Z3WA 3P52A 4QRIA 4CKWB 1NJ5A 5IJ9B 1R6BX 3DMHA 2C82A 5TF0A 4XSGA 1G4HA 3OOSA 5ALOA 3FPAA 4RMHA 4A10A 4TYNA 3TO5A 4RNDB 5M2QA 1B3BA 3UPDA 3H4MA 1Y1LA 1M7GA 2Q1SA 1DE0A 4JI0B 5F7XA 1DQSA 4D9HA 2C7GA 4OEHA 1HI9A 1KK1A 1YR8A 1QFYA 2H7XA 2VCYA 3OC0A 4F4DA 1NUQA 2JIMA 3DEJA 2NSJA 3GAAA 1M3SA 3H99A 3ZK8A 2BP7B 1ZU5A 2Y2VA 3TIXB 3PDCA 1SUPA 1JG6A 4IQ4A 3ROXA 3P26A 3SYMA 3NBMA 5JSZB 3QE2A 3GLFB 1D2NA 4WZAA 2V7PA 5LOVF 2FFJA 3AF3A 2ZI9A 4LECA 4V0QA 4Y98A 3TEFA 1R6VA 2NUAA 4ENQA 1H2EA 1XROA 1NLMA 3H1FA 2BFMA 3LWNA 4NMMA 1JSRA 5IYZB 1AH2A 1JHUA 4NX2A 5FR2A 2WA1A 5AKXA 1USKA 2A57A 2VHEA 4X44A 5ESXA 2CXXA 4DDHA 3R7WB 4LCEA 4B81A 1KMIY 2V97A 5BVGB 2BFDB 4LHYA 1RPJA 5JRJA 1KZ6A 1YE5A 2YS6A 1QQ6A 4B85A 1NXTA 2XYHA 2XRMA 2Z08A 3DF7A 1A1VA 1H4VB 2I29A 3S2ZA 4ARIA 1TPZA 1H2RS 4ECEA 1L7XA 4DIUA 2ZR9A 3OZRA 4L1KA 2QJTA 4C0LA 3MHTA 1ZRHA 4NFSA 3OZEA 3T7KA 1GLGA 3QFFA 4PV7A 4U1RA 2A0KA 2G80A 1A95A 3E61A 3HU2A 3EDRA 2P9YA 1FC0A 4MW4A 4NZYA 4PC1A 4W7SA 4LF4B 3IE0A 1KSJA 4CF7A 5K0CA 3BAZA 4ZP1A 1LDNA 5DWDA 3VGPA 1ZA1A 1T1EA 2PGLA 1SUIA 3INRA 3NDPA 1NZFA 1PTJC 4WXRA 1BMFD 4AJLA 4EARA 3K9FC 4YDHB 2J08A 5CFNA 3RLFA 4F6CA 2PR7A 3HNRA 5CNMA 3A6HA 2OY0A 1IB6A 5AKEA 1SEVA 1HORA 1ZZEA 1K8YB 4R40A 4DQUA 3P7MA 3FDIA 1O97C 1AQNA 1P2UA 3EBPA 3IUSA 4YRPA 2FZ4A 2WF5A 3AQIA 3UW1A 4DLUA 2C9YA 2HA4A 3UGKA 4AKSA 4EM6A 2H65A 3KD3A 4HH4A 4UTRA 4D81A 1HMPA 3EPHA 5JAUA 2P8SA 3OIYA 4B2YA 2NU7B 1V9LA 4YGYA 7YASA 2QRLA 3TIGA 1ISJA 2XGOA 2QLFA 3BHMA 4DADA 3IEVA 2OM6A 5IJZA 1E1NA 4ZYYA 5KNCA 1F38A 4AUNA 1SKUA 2WMNB 3AG5A 2VYNA 5KCMA 5K3DA 3WJAA 4NULA 4UDOA 2H92A 5LP1A 4XD7D 3PFKA 1R6TA 3MMSA 4XJXA 3QEMA 1DV2A 2IYLD 4BMOB 4MW5A 1AUXA 3F1KA 3DAYA 2A5YB 4AS2A 3L9WA 3FHCB 3DAGA 3GFGA 3MYYA 4YMUA 4BNDA 3QA9A 5AI6A 3KR2A 4TTSA 5CFOA 4F46A 1A9XB 2IS6A 2V45A 4NU5A 1RWBA 3HKDB 4U63A 3OA0A 3ZXYA 5E4JA 1VLQA 2H52A 2D1YA 3C3JA 3PQ3A 3HCFA 4NP6A 4IJUA 4W82A 5BY2A 1UKCA 2XWBF 2IW3A 1A69A 2CLSA 5AUQA 2GXQA 1UBKS 4QTXA 2CZCA 1GRQA 2RGWA 5DBEX 4LYEA 1Q7TA 2SICE 3GJQA 1VBMA 1VLHA 4HGYA 4GUAA 3L4BC 4UKDA 3EVCA 1LBTA 1W35A 5CD9A 2Q3EA 1PZFA 2PH1A 3HACA 3BJIC 3O31A 1KC3A 4UE2A 3P9NA 4KAFA 5JZSA 2D2IA 2ID9A 3LDFA 4PPYA 3BXGA 1WO8A 4YIKA 2B2NA 3HXTA 1YVRA 1XKXA 4UM9D 2QX6A 3K8ZA 4CCYA 2UZ1A 1P4RA 5EMJA 3QJGA 2JZCA 4LYDA 4ZJPA 1DS6A 1CKEA 1I36A 3A6KA 4Z51A 3WKBA 5IG2A 3BYZA 3JQPA 3LQYA 4AJEA 1QGYA 1EWYA 4YS6A 1JQBA 2ZDHA 1EE1A 2CKDA 3R5KA 1PR1A 4LN1A 4YBZA 2BFFB 9ATCA 3I2FA 4FSXA 3PXGA 3TMYA 1AQJA 3T94A 3IP9A 4BGEA 2G63A 2ZUUA 4B5KA 3ADBA 2FPLA 1OX4A 3LK6A 3FMIA 1WXEA 1ZNWA 4HAZA 2HLNA 4BB6A 1SIUA 3CX7A 4FGUA 4KH0A 4QUHA 5F77A 1VPTA 3RUCA 1CRPA 4X7RA 3CVOA 3RG2A 2K2WA 3ERCA 4ZEWA 2BKXA 1HNNA 1KFBB 1ZM4A 1MENA 3AR5A 3PFGA 3F0TA 3UFXB 2XQFA 4A3SA 4EKIA 3CB4A 2FE4A 2O8EA 2WQ6A 1OGJA 1C8LA 2QY6A 4HNQA 4JFRA 1GQRA 5FJIA 1MO4A 1JLHA 2N0SA 3SC3A 2JIBA 5BN4A 4Q3BA 3UUGA 1DWOA 3ZV5A 3L5KA 3DT8A 3KPYA 2Q5EA 4GYJA 3G02A 3AOEA 3OOEA 4HWKA 5BW6B 2JIPA 2P8JA 4IWXA 4YP1A 1LPAB 4DGQA 3NHUA 1AQIA 1O94A 1JDTA 1A7KA 2A0WA 3KZOA 5ADVA 4I1SA 3TRHA 3CNLA 4CMIB 3I2YX 5JZMA 1CQJA 3GFRA 1T9CA 3AR6A 3F4BA 2A1UA 1N1DA 5CB8A 2R8ZA 5HZKA 2QZPA 5KQGA 2UXBB 3ER6A 1SOVA 1N2IA 3FKSA 2QR2A 1UOOA 2PX4A 3IBTA 2CMGA 3EVZA 3QOYA 5CLLA 1UWLA 5B1IA 2PIDA 4PLVA 4F8YA 5DM70 3Q0EA 1OASA 1BH6A 3A8TA 1C1YA 1J2YA 2FI1A 4KQJA 1U2DC 1RYDA 3KBOA 1B6TA 1P4AA 3H11A 2DVMA 3V32A 3GUHA 1U1FA 3MWJA 4F5WA 2FPUA 2FZ5A 3R3ZA 1A7UA 2OV3A 4FC6A 1XD9A 2O8CA 1DEAA 4Y2YA 1MG5A 3FNRA 4RV9A 5IULC 4IVPA 1L7RA 4K6HA 1EP3B 3ZGXA 2NU9B 3GLVA 1ZLYA 1X1RA 4TRJA 1E62A 2JHGA 5TEWA 2HDHA 3DWEX 4U8GA 4ZHSA 2W83A 4WK4B 5JAOA 3ABQB 4H4DA 4NJEA 5DYTA 4B6GA 3OCCA 3D7NA 1JR2A 4YWHA 3MJVA 1ZNQO 1TA4A 1Y1SA 2JKYA 1Z6AA 5DM60 1JA1A 2X0EA 4A0SA 5C2JB 1CJBA 3PE4A 1WM1A 1O95A 2EEPA 5A6SB 2AF4C 3HRIA 4BNXA 1PDVA 3WQHA 5B64A 2RGEA 3BRWD 1ZD8A 3AR3A 3FSGA 3N2LA 3OLXA 1BWRA 4FFVA 3E7WA 1ZO8A 4LSWA 4BAGA 1Z7BA 4KN5A 3TYXA 5CFPA 5LP6C 1N7GA 4TWIA 4DLRA 5JISA 2BC9A 5BQOA 2HCRA 4BKUA 1DTSA 1Z38A 4QSHA 1R0YA 2TYSB 3EEQA 3NTUA 4HSGA 3DDHA 1ZH0A 4BLTA 3QE9Y 2TMKA 2VDMB 3KKKA 4D9CA 1ODTC 2DCMA 4I08A 2Q4OA 1K98A 3I52A 3P4UA 3NKFA 4YI5A 3MJCA 4Z0TA 1W44A 1XA3A 4O4HF 5IKEA 5KJ6A 4HAYA 1A5ZA 2BBTA 2PBFA 3ID6C 2YMQA 3L77A 3O47A 4JP3A 2V7WA 4O4LB 4QOSA 2ECQA 4H2DA 4RCVA 4EI2A 4EZBA 1UOQA 1U65A 3UJ9A 1VKRA 4MDFA 4I4TB 4UMVA 4EABA 2NZUG 1CWUA 1T4BA 1G5FA 1ZC3A 3N2NA 3EQZA 4MXDA 1XR3A 2C9BA 3PFWO 1ZU4A 4HVAA 4C76A 4ANFA 1VLJA 1T9AA 3NQ41 3SZRA 4EQ6B 1I3CA 2QL5A 5A03A 1M2FA 1GPBA 1SQ6A 2VDQB 2Z8YM 4E4YA 1P0IA 5CDUA 4KDFA 1CEXA 4N5MA 2KM1A 3QJYA 3PRKE 4GQBA 5GIPE 1EBFA 4OUDB 2JFBA 2ZKLA 3RTCA 1CFJA 1E77A 2PUJA 4YCDA 5IKMA 2CHGA 4WTOA 3M6MD 2HZBA 3IUMA 1CCWA 1T35A 3SC6A 3S7ZA 3NJ8A 2HXSA 2HO5A 1Z3IX 2EKDA 5FNVF 3TS1A 3UYKA 4DLTA 4KR7A 2Y9MB 1YFZA 2QNRA 3EXIA 3NJ4A 3DAHA 3EDCA 1QV9A 4QT4A 2CYBA 4KO1S 5CAEA 5HTOA 1NHGA 1DKPA 3BD8A 4K6FA 3ZWCA 2KYRA 5EWJB 1G8PA 3C3PA 3T3OA 3VSAA 3FYUC 3MWKA 1YS6A 4FJ2A 4KMMA 4QYSA 5A9TA 5I9MA 2ZIFA 2PBZA 3BXFA 3QKUA 1S2DA 1DUIA 5D1NA 3C39A 2AN9A 3BSFA 3CKLA 1XTQA 1M6HA 3DVAB 3JWEA 4HF7A 2J3DA 1OREA 3WKEA 2QOEA 3QPUA 2DBVO 1QFZA 2OBNA 1L5ZA 1W1WA 4J6EA 1M54A 2VJMA 4FQ5A 3OA2A 3DHYA 3GGPA 4LZAA 4TXHA 4YP5A 3T3PB 1RNLA 4TMYA 1XKQA 2GAFA 2M6RA 3BBLA 4WKCA 3AF6A 3H2BA 3GYBA 1GNVA 4KX5A 5JJLA 1BSVA 2VOEA 5GGYA 4E5YA 2C29D 2J30A 4F12A 1E1MA 3O21A 3PGJA 1JSLA 3PUWA 2OR3A 4JBYA 4RSMA 3I9OA 4TV9B 3Q8XB 4EFNA 2JZNA 4O4IF 4J2OA 3KKMA 3M9WA 3B9PA 4JQCA 3THXA 3R3XA 1E79D 3L0YA 1RRFA 2ZUTA 3VU0A 2NM0A 3A1VA 4YN3A 4RKRA 4XYBA 2VSNA 1AJEA 3FDXA 4K88A 3HLKA 4KQGA 1AXEA 4KVGA 5DTJA 4Q02A 4UZSA 5K99A 3AFHA 3PTLA 4EVIA 4YT2A 4CL0A 1OBHA 2VOJA 1Z5VA 1QH1A 2AQKA 2P78A 4F3CA 3F74A 4Q34A 4IIGA 3DSRA 2X14A 2UYGA 1QFSA 5SY4A 3PZRA 1P61B 3DPIA 3LE8A 1L5QA 1RTKA 3ER9A 2OKGA 4FDUA 2Q99A 4LJ4A 1QU3A 1FTNA 1W48A 1S7GA 1HDCA 4IEFB 4PHHA 1DC4A 1LD3A 1A4IA 4R6XA 4RZSA 4S2EA 1XZQA 4Z4CA 1W47A 3F5QA 4B44A 3HCNA 4D4KA 2PYIA 2R96A 3OIVA 3WGZA 3EEFA 2OYCA 2W2KB 3X1MA 1V8BA 3FUUA 1YACA 3N7AA 1BG6A 1A8UA 2IVFA 5KSZA 3NG1A 1ZVMA 4QUIA 3L06A 1AKNA 1QOQB 1BOOA 2XWJI 1O87A 4NBSA 2YZ7A 3V2UA 2CLFB 2QMEA 1U2ZA 3KUXA 1WMFA 5EZ5A 3ROZA 1I4EB 1XJ5A 1NJ2A 1QVWA 4RHFA 1XN4A 1S3GA 4CFZA 3STYA 2Y71A 3UAZA 3E7XA 3S0JA 4UE6A 2JCVA 1K5DA 4HGOA 2JI4A 2EFJA 4AZ3A 2C94A 4G0XA 4JUFA 1PZGA 3TBKA 1QMGA 2JAHA 2HBZA 3R5HA 5LSAA 4EHLA 2Z6VA 2YWRA 4IZOA 3QPWA 4LZZA 4P9NA 3A1FA 1WHTB 2W4MA 1WBJB 3AG6A 1RLTA 1N36B 4Y7CA 1J6UA 2YN2A 2XE7A 2ZVDA 1GSIA 5DXFA 4ZCTA 1MB4A 1P45A 1X77A 2OILA 5J9FA 4TXMA 4QOGA 1PGJA 2WZBA 1OI3A 1R18A 3DVRX 5JD4A 2GM3A 2A0FA 1UWKA 2VP6A 1P9OA 4RD3A 3NT4A 2EHJA 2XXJA 5DXJA 3HBLA 2H1VA 2WHPB 2EGGA 4GMKA 3TEJA 1L7DA 2Y1KA 4JBWA 3AY3A 2HB6A 3VR2D 4C0XA 1ZXLA 2YR0A 4ZHQF 3DTVB 3AONB 4KAAA 5AQ1A 4CIWA 4GYYA 4JVOA 3L8ZA 3PLRA 4P5EA 3Q6IA 3MBOA 1BDHA 4X1YB 4TWAA 4KPEC 4IGIA 5FOUA 6PFKA 3DO6A 3S2IA 2VSQA 1X2BA 4PBSA 1M8GA 4PC6A 5JW6A 3PTAA 2BISA 3L0PA 3GJYA 1ULUA 4KQFA 1RQPA 2UUAB 1XU4A 3U3JA 4KLZA 1JVNA 4MVJP 1TL7C 4RETA 3SK0A 4CEJB 2GM9A 2W71A 3F7TA 1HYHA 3B1JA 2P2YA 2OXIA 3KB6A 4H4EA 1EDBA 2Q7OE 4BNWA 5G0TA 2PXCA 4OYHA 3LTNC 3PXBA 2GHRA 4MV4A 1XI2A 3KQQA 3FWYA 3T15A 1P5HA 2PL5A 1N32B 3E3LA 2C4WA 2D54A 2XNKA 4YJFA 4ZV7A 3CH6A 1NXSA 3IXQA 1MOSA 5IKOA 3KETA 2NW6A 1J0CA 3K70B 1GPJA 1ORIA 2Q6TA 2XKAA 2R1VA 2Y0PA 3AR7A 2HL6A 3I2GA 1XOIA 3KPJA 4ZI3A 3PEFA 5BV0A 5HM8A 2WWYA 4XVRA 3AXSA 4MRAA 2EIHA 2XYRA 2M32A 4NRDA 1U0FA 3JWJA 4W5NA 1DKUA 4O2RA 3LW8A 3SX4A 1T1RA 4XW2A 4BN4A 1Y3DE 2H1FA 2OBMA 3PQEA 2JGJA 4J94A 3EA4A 3F6PA 3FZYA 2ICAA 5LNK1 3WZMA 3U3KA 1LNQA 1R0XA 5IXJA 1MX1A 3U7GA 1IAQA 2FMXA 2VC2B 3CLKA 5FNVB 3U40A 4TZ6A 3AUFA 2FPOA 3G1WA 1EGHA 2J33A 4YMWA 2DUUA 4U9IS 5JR3A 2I0FA 5LDGA 4K6GA 4ROTA 3KD2A 5D5QA 5JPIA 1GPNA 1NFFA 5DV9A 1TKAA 4B9EA 3MWEA 1KYIA 5GZ1A 5K9ZA 2FNAA 2Q3DA 3UHJA 1HOXA 4M22A 5BNTA 3G2NA 3MQ4A 1VL6A 3BKXA 3D54D 3IOBA 1JIQA 2NX2A 1XVUA 3DV0A 4YRNA 1MGPA 1SBQA 5JVDB 4AS1A 2RONA 3FMGA 3F8WA 4OHOA 2XTAA 3NOVA 5CLGA 3FROA 5SYMA 2DKOA 3KALA 4E5UA 1QAMA 2DFDA 4H6PA 3R9IA 2I54A 1TD9A 4L50A 4DBLC 1V6AA 3PDIB 2GEDA 5LP6B 4L9AA 2F1IA 1NJ1A 4YBRA 1YOBA 3VMMA 1POXA 1EKXA 3RM3A 1A71A 1V5WA 2VBFA 1ODIA 4H60A 2XDQA 4TQUS 1NASA 1VI6A 1ZK2A 2PJDA 2JGMA 4KYIB 4TTQA 1ETHA 5EJAA 2CCGA 1EQUA 4FGWA 4IGKA 3TSCA 5JMPA 1Z2NX 3VDQA 2FH5B 2XIJA 1T0HB 3T52A 5JG7A 1FTGA 3KJZA 4KE8A 4MLCA 3P9ZA 3ZGOA 1U9IA 1Q14A 5BQ5A 1XRLA 2ID7A 4MB6A 2WVJA 1N4DA 3OP1A 2CVOA 2O2CA 5DBGA 2OHVA 1QOPB 3VO2A 4D9FA 5K6TA 2I5PO 2Q5IA 1GUAA 3RW9A 3UFBA 4GZMA 3HGQA 4IXMA 1JAHA 2PWZA 3ZS9A 4RKYA 4AI6A 3IKJA 5K3EA 1BO6A 2LDXA 4N5IX 3E1KA 4HNTA 1UM9A 3IPCA 1NDHA 3AKEA 1Z34A 1G20A 4BNLA 5DTMA 4LWZA 5TPWA 4FKMA 1Z0KA 1F0KA 3AYZB 1GADO 4PFQA 5DEOA 4R2IA 1V8PA 1QV7A 3PICA 1UBEA 4O3MA 3LF2A 1KAGA 3T4XA 2O8EB 1JDZA 5EZYF 5C5EA 1LPOA 1U8AA 1E2UA 2OBFA 4G5QA 4ZPXA 4HRVA 3PRHA 4RIIA 3E23A 4LDZA 4O0LA 2YOFA 2X3UA 3CIFA 3TDKA 2VXOA 2ILTA 3K1YA 3HWWA 3QU7A 4REQB 1EBBA 3U5ZB 2BONA 1QUFA 2ON6A 3ND9A 3Q5EA 3P97A 2ZSBA 3NI2A 1IEQA 1QK3A 2WIJA 1WW8A 2YS7A 2ZJ1A 4MDHA 1CQJB 2PO5A 4IOMA 2A1UB 3B9RA 3DVLA 3UGJA 1TZ2A 2YV1A 1PR9A 3F9IA 3P0HA 1GSOA 3EAQA 3CCFA 4FINA 4PLPA 5AKLA 4AP9A 2VF4X 3K1JA 4G1EB 4NK4A 4MVJI 3BFKA 4NV0A 4R84A 3HDGA 2GZ2A 5KTRA 4ZYTA 3EFOA 3U9LA 3VR5D 1FDVA 2WNHA 2CHEA 4KXWA 3NASA 3UC5A 2F9FA 3V46A 1T2CA 2CB9A 5BUQA 1E5VA 3EYAA 1VE3A 4HNAA 5E9AA 1XP5A 5CK5A 2I3GA 3I42A 4CDMA 1TW2A 4EIWA 3W06A 2QPLA 4JUBA 3BJMA 5G1NA 1YH3A 5B2FA 1DRUA 3R3UA 1QU2A 1Q1GA 2KS6A 1KDRA 5CTAA 2NVUB 5HYVA 2SNIE 2O9JA 4KR3A 4W99A 4ZHQB 2GWRA 4EI9A 1O8CA 4R0VA 4OHPA 4Y3UA 1W88B 3MFYA 1N7JA 3B6ZA 3TI9A 5EN4A 2YXEA 4MUMA 5JMTA 4FC7A 4NJEB 1DKQA 1Z06A 1MRSA 2C9CA 4GOKA 1H2BA 3S70A 2QK4A 2XMPA 4DOMA 1G7RA 2PZJA 4WRRA 5C81A 4UUMA 2EJUA 2W6MA 4QFBA 1BDBA 1JTVA 1YZFA 2DJ5A 4G5YA 1CETA 4QRDA 3KYDA 3WSWA 2GRAA 4W7HA 4AJ2A 3ONVA 4M9ZA 1E1CA 4QEDA 4TLEA 1OWLA 3WO0A 2FVYA 3LWBA 4I5DA 4CWAA 4X1IA 1E3EA 5L3SA 3HPRA 2ANCA 5DM4A 3CN7A 4D6XA 2QLBA 2WTNA 1UMDB 2D5LA 2GD6A 3JYOA 2P30A 1T8RA 3CEPB 3U7FB 1CJUC 3I9KA 3C41J 4Z3OA 4D79A 1A8SA 5K1ZA 2QL9A 3F2IA 2NXCA 2Z3VA 4D7AA 3K16A 3ZKWA 2JAQA 3M1YA 1P3Y1 1D09A 5IM5A 3AVOA 3E58A 4RZUA 1M1UA 1REQA 3BDIA 3PLAE 5C37A 3S1AA 1F8YA 4WNCA 2JCGA 2O7QA 5JNWA 2C7BA 4R81A 4WGGA 1IN4A 2CUKA 4PFJA 3KQOA 1JALA 1GKLA 1GGHA 3H9CA 4TMKA 1UH5A 1IHPA 4QXOA 3MD9A 1Y3AA 3ETHA 1JWBB 2R751 1B7GO 1BCSA 5LJLA 2H1WA 4FIDA 4NE9A 3TLCA 5TE9A 1YKSA 5JFTA 3E5RA 3KT8A 1CUYA 1US8B 3KQLA 2PLAA 5C8YA 3G5LA 3EXIB 3I9MA 3LIIA 3GP5A 2HIHA 5EMLA 3TFQA 5INTA 3K94A 5DWVA 3T7IA 1I4LD 2C5AA 2R6CA 4MGYR 4XVUA 2I2FA 4Q24A 5H3HA 5LXTB 5IDWA 3VMFA 4D9EA 1YRBA 3N0TA 1QLJA 1VKJA 2IHKA 5JC8A 1JI0A 1X7XA 1NQVA 1LSUA 3A26A 4XJTA 2C9DA 3UC9A 2TMDA 4MVJH 1HYBA 2XKKA 3RVJA 1W96A 2AQIA 4GW3A 2VHUA 3PBKA 4I1OA 2DPLA 2AI1A 1DC7A 4AYTA 4J90A 3RE1A 1MB3A 5LZ4A 2CL5A 5J5VA 1SCIA 2C4NA 3BJRA 4ZOEA 3W8NA 3QPVA 4IIEA 3BWEA 2XNSA 2LCIA 2ESRA 4PYLA 4NMLA 2ONCA 1LBIA 3V2GA 2VR1A 4DUZB 5AVZA 3G2PA 3QZUA 1XQYA 4G1FA 4E51A 3D8BA 5GVRA 4YAKA 4GD3Q 4HXYA 4TT8A 1ZGBA 2OLKA 4JUDX 5DN9A 2R1ZA 2YFQA 4BO8A 4AKIA 3EZXA 2C9ZA 3L7AA 1KI1A 4Q4HB 1IXSB 1GZVA 2O2DA 3OIFA 2OOSA 3RQIA 3IUJA 4WOPA 1Q0TA 3GA5A 1NF2A 1QO0A 2GH1A 1NV8A 2P2DA 3GCDA 4PX2A 3MRTA 3E9ZA 3QOFA 2WPNA 2OWDA 2V0NA 2YHUA 3I9V6 2BEVB 3LCVB 4ZWNA 1M72A 4I5GA 1K3FA 1WRBA 3L0IB 3EGXB 2P5UA 4JT8A 2PMBA 3QBDA 4MKXA 1UKEA 3DKIA 4FUTA 2FFHA 3PCXA 2JD2A 3GIDA 3GY0A 1A9ZA 4TLLB 4UREA 4MVCA 4DDWA 4LVUA 2EP7A 2C42A 3ETEA 5JYCA 5KX5A 5LC1A 3U7EB 1U8YA 3HCDA 1WZUA 1E66A 5CJPA 4HZGA 1W8DA 1ESEA 1G5IA 2D2VA 3ED1A 3NTOA 3Q12A 3UT6A 1L6IA 2AH5A 2YIMA 2ZS8A 5K3BA 1T0JB 3VX3A 4BVHA 2AA3A 2F3SA 2QTNA 4MW9A 3CW8X 3JVDA 3R3YA 4FMCF 2IEIA 1E6WA 3PRJA 2Q5JA 1AV6A 1GARA 5ILQA 3ROTA 1LX7A 1T8YA 1XVAA 4XB1A 1Y5RA 4QPDA 4FGKA 3ER8A 4POOA 3V1LA 1QHIA 2GESA 3E3MA 4LDNA 4X91A 4KRXA 3AKYA 3ZDYB 3P4YA 3GF4A 4G1CA 4R1QA 1ADYA 3S7TA 4DA7A 5DEIA 1MW9X 4AURA 1YKFA 1Z36A 4I1RA 1IHXA 4PGMA 1FMJA 2NP6A 4MO9A 2YMPA 4IMPA 4RKFA 2BJWA 1M83A 4OYLA 4D9IA 3MS4A 2HLPA 3MM4A 5CVDA 3AJAA 3WK5A 5LQNA 4PFKA 4E5NA 1TTTA 5DOZA 3KEQA 3S3TA 1O2DA 1VHWA 1H22A 4A0RA 5C9ZA 1IPEA 1DHRA 4GBJA 4CTNA 3RUFA 2O5RA 3BK7A 5DFAA 3VR3A 1Y98A 4YRAA 1R15A 4KFUA 3ZX5A 1CR6A 4DJEC 4I5IA 5FQNA 4JV5B 1OIXA 3AUYA 5JS1A 2BYTA 2WFMA 4NVRA 3OKPA 5K20A 3QE4A 4NBTA 2E48A 5LZ2A 2V54A 3JQAD 1B42A 1MAAA 5JCOA 4F9EA 3NM6B 4BLOA 1HE3A 4RK0A 2JFXA 4XB2A 5ALYA 4LNHA 5FORA 3BE4A 3D7LA 1WJGA 3KUKA 1Q1BA 4N5HX 4PM4A 4X8LA 2JHAA 1C7FA 3KFLA 5LBUA 2XA1A 1H3EA 5CX1A 2B4AA 3G0DA 1K7FB 4FDTA 3WRXC 2XTZA 3CM0A 1WG8A 2VHQA 3VR1A 1Q7CA 1E6UA 3PSAA 3LIPA 3M4NA 3WBKA 1AKEA 2ZWPA 3L6RA 1V47A 1SCBA 2I71A 2W6JA 3CV3A 1KI8A 3GZTB 4FE3A 2LIPA 4KI0A 1KU0A 3ORFA 1NG1A 1L4NA 5JNLA 3SHQA 1IPFA 1IPHA 3C4VA 3N8KA 2BKLA 1F6WA 4UM7A 2FR1A 3OEED 2IYTA 4NHEA 4DSNA 1Y34E 3IGFA 2X76A 4E32A 3JZDA 5LVAA 3K6SA 3WNVA 2PZ8A 4GPD1 4RFSA 1JHZA 2CXHA 4FE4A 4QXAA 3ZGYA 5I7OA 4AQ7A 3W1WA 3W6OA 3TQTA 1D2MA 1MEJA 5BUZA 1O0BA 4QDXA 2EU8A 2MR6A 4EYOA 2WAXA 3DBIA 3H0EA 4E5PA 5CBPA 1E0JA 1CS4C 1HLGA 1XCGB <