3T8YA

Crystal structure of the response regulator domain of thermotoga maritima cheb
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
134
structure length
134
Chain Sequence
RVIRVLVVDDSAFMRMVLKDIIDSQPDMKVVGFAKDGLEAVEKAIELKPDVITMDIEMPNLNGIEALKLIMKKAPTRVIMVSSLTEEGAAITIEALRNGAVDFITKPHGSISLTFRQVAPELLEKIRQAMNVDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the low affinity between Thermotoga maritima CheA and CheB compared to their Escherichia coli/Salmonella typhimurium counterparts
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Chemotaxis response regulator protein-glutamate methylestera
total genus 50
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 3.1.1.61: Protein-glutamate methylesterase.
pdb deposition date 2011-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3t8yA00
4RZSA 3EQZA 3F6PA 1B00A 3N8IA 2B1JA 2IPMA 4MQFB 3BRSA 4NCBA 1LBHA 3F6CA 5TE9A 2LUOA 2X7XA 3QLVA 4Z99A 3ILYA 3QLUC 3HZHA 1L5ZA 3RVOA 1MIHA 4LE0A 1A04A 5FWYB 1P6UA 4RXTA 3H6HA 1Z16A 4OLBA 4D74A 2AYZA 3EQ2A 1JFSA 4W5NA 3CHYA 4TMYA 4NCAA 1JF8A 1R8JA 4XAQA 5BQ3A 1ZESA 3FFXA 2PL9A 3GYBA 4YP9A 4RU1A 4Z4HA 2HJ9A 1QQAA 1JX6A 4MR9A 3N0WA 5T3YA 1QO0A 4GNRA 4ETMA 3P9YA 4PYRA 4EVQA 1GUDA 4RWEA 4KMRA 4W5TA 4DN6A 1EWVA 4RK0A 2Q5CA 2VUHB 2HPHA 3DLHA 1EHCA 5I4CA 5JNUA 4JASB 1PHRA 3HUTA 1EWKA 3HDGA 2PUCA 3MQ4A 5TPZD 5IBQA 2CWDA 3KLNA 5KC9A 3OQMA 4D6XA 3IP5A 2NT4A 7ABPA 3BILA 4B09A 3LUJA 1ABEA 1VRVA 3H5OA 1Z2DA 3Q7TA 1QKKA 3IP9A 3LUDA 4XLTA 5DLEA 4DADA 2E4UA 1SRRA 3I09A 1NXVA 5FBKA 2E4ZA 5JS2A 5KQPA 4N76A 3HXMA 2JRLA 1KRWA 3DZDA 2LBPA 2L18A 5DCLA 3FDFA 4KK3A 3HCWA 2A9QA 2B4AA 1Z13A 3RVSA 1K68A 3N0RA 1DCMA 3JVDA 2OQRA 4H3KB 4F06A 5JS1A 1JBEA 1DBQA 3QLTA 5JNVA 3OLYA 1NXPA 3H1FA 3M9WA 4WXMA 4W5OA 1EWTA 3C97A 1NY5A 2IPLA 3CKMA 1YMUA 1QP7A 3IP6A 5ABPA 5CNKA 1XHEA 1PEYA 3VNBA 3F73A 4ZJPA 4YO7A 4KFCA 4EVSA 8ABPA 3RVNA 2TMYA 4N03A 3RVPA 1Z2EA 2JB9A 2FMIA 3CFYA 4Q6WA 5DKFA 3W9SA 5IUNC 2PE5A 1LJUA 4KRFA 1NXXA 3KJXA 3GL9A 5KI6A 3HUUA 2JCGA 1HEYA 1S8NA 3D8UA 3OLXA 3TD9A 1USGA 1DZ3A 5TQ0A 3HV2A 2FQYA 1YIOA 2FVYA 1D1QA 1YTUA 4H3HB 3HEBA 2WJWA 3KTOA 5IEBA 6ABPA 3LUKA 3OLZA 3RVKA 5KWSA 4MPTA 3O2QB 3QEMB 4MS3A 1TJYA 3MM4A 4EGSA 2JVIA 3Q9SA 2BGGA 5JNTA 1BVHA 2E4VA 3KYJB 1RXEA 1IIBA 2QZJA 3Q15C 3MMNA 4XASA 5FBHA 1CEYA 1ZITA 2ID7A 3A3KA 1NXSA 1DBPA 5TQ2B 4MQEA 3RVJA 3KHTA 3SG0A 3HVRA 2PL1A 3T38A 1YVUA 2FQWA 4L4UA 4UHKA 5HKOA 3HSYA 4QYWA 2F8SA 4MR7A 4WXEA 1M2FA 1SXGA 2JVKA 3TB6A 3EJWA 5JNRA 3LUGA 3N0XA 3FFWA 2LIVA 3LOPA 4Z0NA 4LX8A 5KQGA 3OQOA 5DGCA 4OG2A 3MA0A 2H3HA 3L6UA 5PNTA 5C5CA 2QW1A 3C3WA 2GBPA 1AB5A 1QP4A 3G85A 3Q7SA 3QEKA 1ZN2A 2WWVD 3NNDA 4MR8A 3O1JC 2PUGA 4NV3A 1YS6A 1T34A 3O1HB 2R25B 3QLVC 4Y9TA 4YCSA 5IEJA 1SD5A 5IX8A 3KSMA 4IF4A 1E6KA 2OENG 4KVFA 4Z9BA 3I5AA 2I6FA 2CHEA 4N47A 4YRZA 5EWMA 3OMXA 1D2AA 5CNJA 5TPWB 4G0YA 1NXWA 2RDMA 5B3JC 4F3TA 2WB4A 1PEAA 3LFTA 2JK1A 4MS1A 4LDZA 3A0RB 1KRXA 4ETNA 3DLBA 4KNYA 3IP7A 1XHFA 3KKEA 3SM9A 2GKGA 1Z18A 2LP4Y 1JLKA 1OXKB 2A9RA 4NQRA 4G0MA 2V0NA 9ABPA 5IULC 2GX6A 3H5LA 2MYPA 3URMA 2PUBA 2QSJA 2VYCA 2FEPA 1BDJA 4QICA 1Z15A 5JNSA 3MF4A 4LE1A 4MGEA 2XDYA 3A0UA 1AB6A 5CNIA 6CHYA 1GCGA 1PUXA 5EWLA 4EVRA 1USKA 3C6QA 4P1ZA 2FSPA 1L5YA 4RY8A 3UK0A 3HS3A 2FMHA 3KG2A 4G0OA 4G86A 4RKRA 3RVLA 3RH0A 2NT3A 3FMVA 3MYYA 2FKAA 2HQOA 3G1WA 1M5TA 4O5AA 4N41A 5F64A 5C5EA 1DCFA 3KLOA 3OLVA 2HQBA 3CZCA 4HNSA 1EAYA 1PNRA 1E6LA 3T95A 3MIZA 4PEVA 3IPAA 3BBLA 4MR8B 1GCAA 3T6KA 3NNNA 5BR1A 2F8TA 2NUBA 3GA5A 4IGAA 2FQXA 3H5TA 4LZLA 1D5WA 3OM0A 1F51E 4UHJA 1FFGA 3Q41A 1JWLA 1CHNA 4KV7A 4YR7A 4MQEB 2IDMA 4JAVC 4MLCA 3TX6A 3O1IC 5BRJA 2PUAA 4MS1B 2L17A 2MYNA 4MR7B 3H5IA 1RZRD 4JB0A 1KMIY 2FMFA 1FFSA 3RVQA 4WUTA 3GV0A 3LKBA 5B3JA 1K66A 3TO5A 5TPZA 5EWLB 4ZMRA 1EFAA 1DC8A 3CU5A 1BDHA 4RDCA 5GQSA 3JTEA 3LTEA 3SY8A 3DBIA 4LDAA 1WETA 3IPCA 1ISSA 1U8TA 1BA2A 3CTPA 2MSKA 3GBPA 3UKJA 5TQ0B 1YS7A 1JHZA 2QVGA 1M2EA 3IDOA 1UDRA 5IUKC 5EWJB 2FTKE 3ILHA 4FB4A 1W25A 4MR9B 1YK1A 3FGZA 1U2PA 3ROTA 4KREA 1ZH4A 4M88A 1TLFA 1USIA 3EODA 5FWXA 4E7PA 4WZZA 2IYNA 2QV0A 4RY0A 2RGYA 4RK5A 2L2QA 2FEKA 4G0QA 2HSGA 3H6GA 1F4VA 1APBA 1MAVA 4RK1A 1Z17A 3R0JA 4RK7A 4ETIA 2O20A 4KZKA 3ROFA 3NHZA 3RVMA 1JYEA 5CNMA 3LMKA 1ZDMA 2MYTA 4MQFA 2IOYA 5CHYA 4DQDA 4HYEA 2E4XA 3O74A 4RV5A 1D1PA 3CLKA 2IKSA 2N9UA 1PNTA 4G97A 1Y1LA 4RKQA 4YWHA 4E7OA 4YGXB 4QPJC 1D4ZA 1GLGA 3QX8A 3QX9A 4Z9AA 1DJMA 4D6YA 3QK7A 5EWJA 1Z25A 5KC8A 1QO0D 2JVJA 4RK6A 3OLWA 4ZPJA 2M98A 3CRNA 3O2JA 4F8JA 1JDPA 1RXIA 4TLLB 4YLEA 1DCKA 1LK0A 1FFWA 2YHAA 5FWXB 3JVIA 1ZY2A 3EAFA 4H60A 2VUIB 5TPWA 3CZ5A 1NTRA 4IMIB 1TVMA 2PJUA 4O1IA 4MS3B 5FWYA 1U2QA 1DBWA 1VPWA 2GWRA 1ZVVA 3LKVA 3CNBA 3H1EA 4TN5A 2A9PA 2AYXA 4EYGA 4G0XA 3O2SB 3E3MA 3L49A 2FLWA 1VKRA 3O75A 4MS4A 2R47A 1C4WA 2R4QA 3I45A 3JS5A 1LJLA 3EDCA 4Q6BA 4LE2A 4RXMA 5ED4A 1ISRA 1P8AA 1Z26A 5D2CA 3F7NA 3K9CA 1YK0A 5TQJA 5JNWA 3LUCA 3N6VA 3A10A 4EYQA 1DRJA 2PKXA 4KQ9A 4RK4A 4XARA 3UUGA 2LPMA 4MAAA 2QXYA 1FQWA 2R48A 2FMKA 3T8YA 5HM6A 3HO1A 1P6QA 3EGCA 2IPNA 1JFTA 1NXOA 3EULA 3OO1A 5EWMB 2DRIA 2WMYA 2JBAA 4LRQA 2GI4A 3BRQA 5DTEA 1ZGGA 1FSPA 3C3MA 2WJAA 3QEMA 3HK2A 1DRKA 4WT7A 4EUKA 4GPAA 3CG4A 4ML3A 4KPYA 4RXUA 3LUFA 4EY3A 3SAJA 4N0PA 2YHBA 1QMPA 2FN8A 1ZH2A 3H5WA 1BAPA 3JPWA 3OO0A 4IILA 4OBBA 3H1GA 2WY2D 4Z4EA 2M1ZA 3OQNA 3N75A 4YS6A 5IC5A 5TQ2A 1SXHA 2RJNA 5HQJA 2W42A 1J56A 4FE7A 4ZMSA 4EYOA 2E4YA 4F11A 3HJFA 3C3KA 3RQIA 2ZWMA 1TMYA 3GBVA 3H5VA 3B2NA 3LUHA 4W5QA 1P2FA 3VNAA 2P9HA 4KQCA 4EYKA 2FN9A 1YMVA 1TM2A 1URPA 1JH9A 1M5UA 2HQRA 2RJOA 2WRZA 3RVRA 1MB3A 4TLMB 3M9XA 2KYRA 3FFTA 1Z12A 3KS9A 4MYRA 1MB0A 1KGSA 2PLNA 5GOTA 3GT7A 4Z4FA 3SNKA 5BRAA 4MLDA 4PICA 1DC7A 1E2BA 2IPAB 2PUFA 3SQNA 4S04A 4WWHA 2ZAYA 4N0QA 2MSWA 3QELA 2H0AA 2NZUG 4O1HA 3NNSA 4OATA 1JFVA 3N53A 2CHFA 3QELB 2P4UA 3KYIB 3JPYA 3K4HA 4L85A 1DG9A 1QPZA 3KCNA 1ZAYA 3TMYA 5T7BA 1MVOA 1JYFA 5KQMA 2E4WA 2QVCA 1DP4A 2QU7A 1RPJA 2L19A 1RZRA 3I42A 2PAFA 1OXBB 1A0OA 1QQBA 2NZVG 3CG0A 3QLUA 4Z4GA 2PUDA 1I3CA 4Q7EA 4FE4A 4RSMA 1VLZA 4KK4A 4XXHA 1BDIA 3Q7RA 1QNLA 3CS3A 4F12A 1JL3A 1H9CA 4IMJB 2CD7A 3GRCA 1ABFA 3NBMA 1RNLA 1U04A 2PUEA 1LBIA 4HNRA 3H75A 4JB2A 2FXIA 4Z4CA 4G0ZA 3HM9A 4JP1A 3DGEC 2A9OA 2MYUA 3D02A 4S05A 2JBAB 5IUJC 4ZYLA 1SXIA 4MRMB 1C0EA 3OMWA 1XWWA 3E61A 5KQLA 1QP0A 3LUAA 2FLKA 1JDNA 4YV7A 2PMCA 3BREA 1ZGZA 4IRXA 4OLAA 4W5RA 4RY9A 1U0SY 4QYMA 3S99A 2FEWB 2MSLA 4XFKA 2QR3A 3OM1A 4MRMA 4PE5B 1NXTA 4G0PA 1E6MA 2J48A 3DGFC 2ID9A 2VK2A 4Z4IA 1GUBA 3O21A 4HNQA 5HSGA 4RS3A 3GWGA 4OTZA 1CYEA 4MS4B 3M6MD 3JY6A 4P98A 4PZ0A 1ZHHA 4JOQA 5E3JA 4NICA 4JA2A 1A2OA 3NHMA 4CBVA 2FW0A 1W9HA 3HDVA 1NATA
chains in the Genus database with same CATH superfamily
1SHUX 4D9FA 4F6RB 1F7VA 4P58A 1FNNA 1GLVA 1HE4A 2YHUA 3NYQA 1U2GC 2D2VA 2NZ2A 2VZLA 3N8IA 4WCDA 3Q8MA 3ZCTA 1JB1A 2VJPA 3HU2A 1UJ4A 1UJ5A 5CXUA 5TE9A 2LUOA 1NW9B 1P2SA 2NIPA 4DGSA 4JSYA 4NYIQ 1M2VA 1NNI1 2CZQA 1K2VN 4IIBA 2XGOA 1GY8A 5B37A 4BIMA 5E7MA 5C0OE 1B26A 2MT9A 4GL4A 4HRYA 4P0PB 3DXZA 4E15A 4F7WA 5DSTA 5GTDA 5IHXA 3D4PA 2RI1A 3C7KA 2QLFA 4XSVA 1GYRA 2C2ZA 4U2BA 3AH8A 1CE8A 3IESA 5M2QA 1H69A 3AR6A 3U61B 1E2MA 2VJOA 5C5IA 2B1RA 3BG5A 1LNZA 4MV3A 5DLPA 2JBWA 1JR3A 1K75A 1W49A 2LNDA 3HG7A 1P60A 4HFJA 2PPVA 4M9XA 2VRCA 1TMKA 2GCNA 3OKAA 3NBQA 4M9QA 4QSHA 1SC4A 3WGQA 3S2YA 3NDBB 3KKKA 4FBMA 3ZZ1A 4HAWA 5EZ6B 2XGGA 4B75A 3TFQA 2Q62A 2V55B 4ER6A 2H48A 3VBCA 4ES6A 2FYTA 1PHRA 1E0KA 5ARDA 5IKEA 5AM2A 3R3HA 5JCOC 3QA3E 2CDAA 3NC4A 1Y4ZA 3VDQA 3FW1A 1ZM7A 1W9MA 1V9SA 3SSMA 3IP5A 1II8A 1P75A 3BILA 7ABPA 1E1RD 1GIAA 3FPCA 4LZAA 3ZE1B 3TL6A 2O2EA 4I46A 1OI3A 1VRVA 3CRMA 2QXUA 2ZAMA 1QKKA 2NZ8A 2BAGA 3NBUA 2VBFA 4QKQA 2FOIA 1EQUA 5DXAA 3WE7A 3A9CA 2Y77A 3PDIA 3EIUA 4GPTA 1AH2A 5FBKA 3HACA 3TZQA 3CB2A 3OM8A 1MG5A 1AKUA 1KYYA 1D2MA 4WE3A 3TUZC 2ZYIA 2GN6A 3BX1A 1N6IA 3GMTA 2OC9A 4XIJA 3KQUA 4OHUA 4EZBA 5JDCC 2BHLA 3SF8B 2DLCX 4BUCA 1DT3A 2W2OA 2HD4A 5DPMA 1GQSA 3TIGA 2Q7OE 1NY5A 3L8FA 5HFJA 2IPLA 2B69A 4BO9A 3FVTA 3GRVA 3RSHA 4EGFA 1K8YB 3OU2A 1XXHA 3FJ1A 3EZFA 5K20A 1XQXA 1Z4LA 4XX0B 1QLWA 1LEHA 1P1KA 1S7CA 3T5DA 2Q3JA 3EMKA 4I4NA 5I51A 1O89A 1COWD 2EG5A 3I1YA 4GFDA 1VHLA 2J5XA 2YXPX 4UUOA 3GN2A 4XSHA 1PFVA 3ZHZA 4EABA 1JJFA 2QVYX 1WRBA 2ZYHA 3QKSA 2GETA 1BQ4A 3MTIA 3MUEA 2P7IA 4HPJB 4IJKA 3B85A 4PVCA 2DJ5A 1Z9BA 3RB8A 4QUBA 4Z54A 5DYGA 4U6QA 2G76A 3H1AA 3M5DA 3ORFA 1YIOA 5BURA 2ZRCA 1UJ6A 5LCXA 1MLDA 3SQLA 2W6IA 2VWGA 3QBDA 2O8FB 2FW9A 2WJWA 3JQQA 4XR4A 3L6EA 4IV0A 1GSAA 4LRUA 2F62A 1V35A 2EKDA 4Q7LA 1SEVA 1ZAKA 1L4EA 3QU2A 5DYIA 2Q3CA 2VPWA 3QY0A 5DBGA 4RMJA 5E4YA 3NWJA 5HTKA 2I1VB 1TZJA 3E4CA 1F2UB 3OPMA 4PYJA 2X4IA 2ST1A 1RXEA 2FK7A 5F9MA 4AG3A 4DMRA 3UW1A 2P2CA 1NVFA 3MD0A 3ACBA 4EUEA 4LJ9A 4WKGA 3KYDB 4WY8A 1R10A 4BFLA 2HA4A 3CXUA 1QQ7A 3LO5A 4ZAGA 5IASA 1U1IA 3WLRA 4DMHA 1LI4A 4QYWA 4D9MA 1E7SA 3UENA 4JXXA 3A6LA 1IVYA 1MJGA 1QIJA 1YQDA 2V5AA 2WFAA 4OYRA 4RCYA 3RTEA 4DIMA 1I3NA 3BMXA 4HVAA 4CM8A 5CLQA 3HXQA 4JLSA 1R8YA 4P92A 3E70C 4YRAA 2QRKA 1YZKA 1Q1BA 1D6JA 1LFDB 1NZFA 3ZCRA 4JJKA 2QQFA 2W0SA 3MOIA 3OA2A 1QP4A 1NYLA 2ZIXA 4PHFA 3IGFA 5AOVA 4WOBA 4IIEA 2PX0A 3DE0X 3FMIA 2QTAA 3KSMA 3N74A 5AKIA 3CX6A 4N47A 1GTMA 2G09A 4ND8A 3VTAA 4EUHA 2IBTA 2YIVX 1RI3A 5CNJA 1NXWA 1WQ3A 4AC9A 5LMNB 1Z06A 5F33A 5CK4A 4O33A 1ZEJA 2WHRA 1WLYA 3PQ4A 3ICVA 4IHAA 4LDZA 3QKRA 4XM1A 4YUAA 3DLBA 3IAM1 2YC4C 3SE0A 3WWPA 5KVQA 3K5PA 3KKEA 1QORA 1MRSA 5FUXA 4HEJA 5HKAA 3V1YA 1UAAA 5K3SA 3E9RA 1EP9A 4G0MA 2JD0A 4OXYA 1ORRA 3I53A 4RPLA 2PUBA 1RRKA 1OR8A 2WA2A 3D81A 1A95A 1EX6A 4R5HA 1JFLA 2HA3A 3GQBB 4LXGA 2R1UA 3GGOA 1SVMA 3N8KA 1XCMA 4FP9A 3JD4A 4JENA 3ACDA 1AHPA 1EJBA 2XCSB 1Q7EA 4O2BF 1O87A 2PZEA 5EIBC 3AP1A 3OQ6A 1H0SA 3NHLA 1PZEA 3HCNA 4QUAA 1E7WA 4QULA 4LFBB 1WWKA 4EMSA 3KHUA 2J6BA 3SHFA 1TM7E 3ABZA 3PUIA 4HZGA 5F77A 5J2UF 3G1WA 1L5SA 2ZJZA 1QRRA 2ZREA 1DX6A 4JP2A 4IOJA 1LPNA 1G38A 4TWIA 1JAYA 1VKHA 4X7RA 5DIZA 4ZGGA 1CP2A 1N6PA 1TYAE 3R3VA 4CFZA 3AGQA 1K7FB 4D02A 4I1OA 1LFAA 2VQSA 2VK8A 3CLHA 4DAOA 5KOHB 1L7OA 3RS3A 1VM6A 2DH5A 5L6LB 3ZGXA 1XRSB 2E2WA 5DN9A 1UOOA 4HR7A 2JL1A 2Q5IA 2NTVA 2DU8A 2RGDA 3DJFA 5KYYA 1G3UA 1NOJA 4WLOA 1E0SA 1E98A 3T5TA 2BMWA 3NAGA 3EVZA 4M8LA 3A8TA 2NTNA 1I7SB 2IYYA 5LD2C 3T7SA 1IUPA 4PQFA 4BFWA 2ET6A 3GV0A 4X8HA 2FG5A 1QZ3A 1RLOA 2YICA 4QOSA 3D3WB 5UKDA 2BMEA 3M5WA 5JCJD 2IITA 2BLLA 1IG3A 2FKNA 5KJ6A 4RTJA 2WM8A 3A37A 4YJDA 4CHGA 1GL7A 5F2EA 4S1PA 1IMJA 2VTBA 3NIDB 6REQA 5F9HA 1RAFA 2ZM6B 1DC4A 2O1SA 4FMPA 2PX2A 1YS7A 4D3DA 3CO0S 1CJSA 1TCVA 5FI0B 2NADA 3QYPA 1HDRA 2C42A 2PL3A 2Q9AA 4LWOA 1O96A 1R66A 4Y6QA 1W88B 2XTMA 2ZDQA 4C6TB 1W25A 1KC1A 4DCSA 2X0KA 3K32A 1ZYUA 3MCVA 1GKYA 5HDQA 3WADA 2PGIA 3ICPA 1HNWB 1KVTA 2C2GA 4BQPA 3G0GA 5AKGA 3OQVA 1IH8A 1YO6A 3CB4A 1YQGA 2Z2KA 3LP5A 5CAEA 2XKAA 3WO0A 2Q1SA 4K86A 2RGYA 2VAXA 2ORWA 2KQUA 3MWGA 3EWIA 1F3OA 1PZFA 4TVOA 1B41A 3K35A 1XP8A 2D59A 1G4HA 2HXSA 3QTBA 1RM5A 3VZQA 2A1UA 4IJVA 3TOXA 4K9RA 2HC9A 2AG1A 3MRSA 2BZ0A 5FKJA 3EXHB 1PDWA 4A0FA 4AF7A 2WD9A 3RIYA 1EXWA 2AK3A 1ZO8A 4GLJA 5ICCA 4G9BA 2QGNA 4F84A 1T9AA 4U9UA 4FONA 3AF1A 1E6WA 1EX7A 3GAFA 2WIBA 4MKZA 2IKSA 2JFQA 2AEJA 2CUKA 1Y1LA 2D3TA 2IPOA 2PKQP 1RP7A 1CNEA 2BVNA 3DLPX 2A59A 4IWYA 4RKQA 2PLAA 3DR5A 3RAJA 3TCNA 4CTKA 3RAFC 1QTRA 5B55A 3RU7A 1XXLA 1TX4B 3F2IA 4U00A 4ZPJA 1UZMA 3AYZB 3JQ7B 3GIWA 5EERA 1ZJ5A 3H5AA 4TLAA 2I2BA 1LB1B 3KTAB 1SCDA 1LPSA 2OXIA 2X13A 5KTMA 2ODEA 4XPIA 2NV0A 2WWFA 3REGA 1U0RA 2VUIB 3TTVA 1R2QA 3KTAA 3N0TA 2JEYA 1FTSA 1BU5A 4M0CA 1GQQA 1IY1A 1R0CA 3JQ7A 3FPBA 1IBSA 2H59A 3DNMA 3LC2O 3Q8XB 4FUQA 4R1MA 4Y67A 4ZVSA 3W7BA 1I6LA 3VRHA 4TN5A 4RPCA 4EI9A 2AYXA 4HDNB 3L41A 1EX9A 4GT1A 3WBBA 3R75A 2ACVA 4XPIB 4MRVA 3WWCA 2UVDA 3PLNA 5HTOA 1FPQA 1FXSA 4I50F 3UGKA 3UOGA 4DLPA 2V0GA 4F3YA 2IEDA 4AP6A 3VZPA 2WWGA 1N6LA 3O3MB 5AMXA 3VPXA 2O50A 2OGZA 2ZIWB 2UYQA 3A6DA 2Q0HA 2QBYA 3JQGB 5H1YA 2XDQB 4HDNA 3R3WA 3VNUA 2IHKA 1Y7TA 3D4BA 4KV9A 1CJKC 3HXPA 4O4IF 2RAFA 1P8AA 2G25A 3FNFA 3L7KA 5IT0A 2CF6A 1GZUA 3CUKA 1QGAA 2PGOA 5ADHA 1DRJA 4P53A 4QLBA 3P71T 3JR7A 1B23P 1NI4A 2A58A 1Z6GA 4UU7A 1NJ5A 1MX9A 1JR3E 1Z0IA 4IQ4A 1P6QA 3W5DA 2D54A 3EULA 4B3CA 4ZZ3A 3EZ7A 4CLRA 5CJ2A 2FQQA 1DUSA 3PQ3A 4FZJA 4KDRA 3T4EA 3ZHYA 2C2XA 2HA6A 2JJ1A 1TECE 4XR9A 5I9SA 5HM8A 1QX3A 1Y6FA 2BSAA 1ZBQA 1C3OA 1VKZA 4DVJA 3DF7A 3U1BA 5AK0A 3VO2A 2GEVA 5GINE 3UMCA 3IELA 4OJTA 3GLGA 1EDDA 3IXLA 3PR1A 3G23A 4B47A 2HNBA 4GH5A 4FC6A 1EUCA 4Q66C 3RQIA 3E5RA 3UAZA 1N3YA 5HG0A 3WTBA 3DEFA 5ERYA 1T2DA 4C06A 4W7IA 4IVPA 3KQTA 4EYKA 3B1XA 2AH5A 2IU6A 2GRUA 2YVUA 1FP6A 4G01B 1WV1A 4LPSA 3X44A 4XUEA 3ZZNA 1T5DX 2NYAA 4GC9A 2ZRBA 1C9DB 1KDOA 3KQYA 3L7OA 1AN9A 2V45A 4UU0A 3ROZA 4HDKB 4HX2A 1UXIA 1JA0A 4LXHA 4LGCA 1U3VA 4M37A 3PPYA 4C4YA 3UUFA 3GLUA 1XMPA 3DTVD 2JCXA 4FKMA 3SBXA 5BRAA 1TTHA 2BMFA 1GSHA 3VPCA 4QFBA 4TTJA 4X6YA 1QQ5A 2J6IA 4XZ3A 4XD2A 3IP1A 2YWBA 1DEAA 2I54A 4BUJA 4MHOA 2BFFB 3RVBA 1QBGA 3TQTA 4EHDA 3ZK7A 4MEBA 4UOZA 2ZKLA 5FFFA 1Q0LA 3QIVA 4L08A 4DS3A 3EDYA 3THXB 3C8ZA 2CMFA 4IDFA 2ODQA 5JROA 2Z3ZA 4XM0A 3RUHA 1V6AA 2VKTA 5TF4A 2NQTA 1W47A 1XJCA 3SJBA 4LNUB 4FHDA 2OY0A 4MVJE 4KQXA 1JSLA 4ZOQI 1LTKA 1GILA 1CZRA 1IHYA 3B12A 1LF5A 3D0KA 4PQYA 4QLAA 3RGWS 3O7WA 3IQGX 2PUDA 2B82A 1ZM3A 3Q10A 4CRWB 4HAXA 5L8VA 4DC1A 3TIXB 1CY2A 3ZD6A 3WIOA 1MH9A 3FOAA 1JL3A 3IA2A 2FWBA 1A97A 4YHBA 3QHAA 4K9NA 1VFPA 3BSSA 1S1CA 2V7GA 2W6NA 4NE2A 4OBEA 5TS2A 1EVIA 3AU9A 2FXIA 4FQ5A 3W5IA 3WNVA 5IVKA 3GLIA 1GN9A 2FOXA 3T0FA 5JSZA 2XRYA 2ATIA 2YH2A 4YN3A 4IDHA 3SK0A 2FI1A 2ACKA 4CFSA 1Z63A 3RANA 1PJCA 4BNZA 5LP6A 1TYDE 1F8UA 1QGUA 3KOZA 4LZWA 5KNBD 3EEYA 3ISJA 1MOZA 1US8B 3IURA 3SHQA 4R8VA 2HK7A 1I14A 1BFDA 5F3RA 3OE5A 3R40A 4QC2A 5AW7A 2VP4A 5DX8A 5BW6B 2NLOA 3NT4A 3WHLA 3FBGA 2IHNA 2VATA 5BMVB 2GKSA 3E35A 1W36D 2V9CA 4H1WA 4U6SA 1NXTA 1P4AA 3GXOA 2QOEA 1KI9A 1XL1A 4E08A 1QUEA 4Z4IA 2FWJA 4D4GA 1Z47A 1CZKA 1JLLB 1T4CA 3W06A 2O4UX 2ZUUA 5AOAA 2ZSHA 4OTZA 4MS4B 3M6MD 2X42A 1N36B 4R8KA 1C8LA 5KX5F 3IP3A 5JHGB 4NICA 2VWPA 1ONSA 2XMGA 1G1MA 1YBAA 1E20A 1VDZA 4UDNA 1XNHA 3OZEA 4IDOA 1B00A 2Y6VA 1E2IA 1PZMA 3RIGA 3TPFA 3U7QB 3M7IA 3BCUA 2OLKA 3ED5A 3L1IA 1OJLA 3TZHA 1FDIA 3QLVA 3I5UA 4NE9A 4UM8B 1W36C 5F9FA 1R8SA 3AF5A 5EJIA 2X5NA 3UCFA 1NJ8A 1X7HA 3AIKA 2JDID 3MS2A 3LT4A 4GKBA 3OKPA 2L82A 2PFGA 2IZ7A 2A92A 2HIHA 3GT4A 1SURA 3DNFA 5KU7A 1FFAA 1E89A 3I2IA 3M5CA 3OTWA 1NX6A 3DUFA 3ILVA 5IDYA 2OO5A 3LYHA 1GXSA 2P9YA 3TLGB 4UQOA 3U4IA 3AWIA 2I5PO 4BNJA 3IIKA 5KOIA 2YZGA 3O3OB 1KU0A 4LDPA 5D51S 4A8JC 3GNSA 4KRGA 2QTCA 3W6OA 4UJ5A 4BMOB 3I6YA 4BCCA 1TEHA 2ONYA 4NBRA 4ILEA 3RCBA 3NC0C 3EUFA 3EGWA 3TVDA 4B82A 3IUPA 3LOQA 2FQ1A 1U8YA 2DC1A 2IHTA 3TOVA 3M4XA 2H0RA 2I66A 1J9EA 4KLNA 3D3KA 1RYDA 2PMBA 4XPZA 4BKOA 3U5TA 2Y1WA 2HLHA 4M9ZA 1LF0A 1YASA 2R751 4M1YA 1BW9B 3PXCX 1F1JA 1P5FA 4Z1OA 1U28A 3K8YA 4HAOA 3IP9A 1YZLA 3GMDA 2QG4A 3T99A 1T8YA 3HXOA 3SBOA 1X9GA 3MD9A 1VC2A 4G5GA 3G2OA 2H63A 4RVGA 1SA0B 2AJBA 3LXMA 2LBPA 3K4QA 5AYVA 3T9DA 4KK3A 1A5TA 4B32A 5U1PA 1Z13A 3JQAB 3NJ4A 2OYRA 1P9NA 2I55A 3DBHA 3MILA 1Q19A 7REQB 4F06A 5K6AC 2JLVA 3QLTA 3H1FA 2P0AA 3HB7A 1Y1PA 4U7DA 2NX2A 3N2IA 1YZTA 3E3LA 3B6JA 3UTCA 3S1SA 4GQAA 5KYTA 4JYZA 3TXYA 5BW8A 4QZVA 4LXYA 1U7DA 1L7AA 3B3FA 5JBNA 1Y6QA 4ZEWA 3WLKX 2PX6A 3ZLUA 8ABPA 1W6UA 3KEQA 4N03A 3HVJA 4PLPA 2XQIA 2VZ9A 2ACEA 5AJUA 3L5KA 4IJ5A 2VYVD 4P3NA 4BX3A 1M54A 2FAXA 5LB4A 5HP4A 4CKWB 3T7IA 1V45E 3D7RA 1TU0A 3UMMA 3UMYA 1ZC3A 4HEA6 3BPSA 3V2UA 4PAQA 3SJAA 3PIIA 1XCGB 1WP9A 4J8PA 5TGZA 5AQ1A 2WMDA 5BSEA 2GB4A 5HEKA 4FYKA 3R0ZA 1Y34E 2D0PB 2BHTA 1YTUA 1O9GA 2XVMA 2P69A 3UWOA 3SVLA 4PNEA 3KR0A 1MFPA 1J21A 3RVKA 1AF7A 1IOWA 2F3SA 4L3VA 3WICA 4JV5B 3E9MA 2FB9A 2AVDA 1AKMA 5AVZA 4CM3A 3W2GA 2UXCB 4BQNA 2IY9A 2F8MA 2UU9B 3U81A 1B74A 3UFXA 3T9BA 1VE6A 3T1YB 3SXJA 4PYLA 2NVUA 1JNYA 1BGWA 1NW6A 1PJLA 2DQZA 2ZT6A 4OYYA 4QODA 1WV0A 1H8EA 4P3YA 5CH3A 1ZN8A 2F43B 4BZZA 5DHTA 1EK6A 1GITA 1TU4A 4G4SO 1DTSA 1N34B 2JLQA 1N0WA 1IM5A 3W90A 2O8EA 4CU5A 2GFIA 1CJUC 3DCIA 1E1LA 3PHHA 5I7EA 4PRKA 3FLMA 1E3TA 3N2GA 2ZS8A 1RIFA 1XCLA 1C30B 1ODJA 1X7YA 1XDWA 5I3ZA 5HFAA 1SVKA 2H3HA 4LJAA 2O5CA 4L5JA 1QYRA 5T8KA 2C5FA 2Q5OA 4EGCB 1IQRA 1JA1A 3Q7SA 3ZV7A 1E7YA 3WNBA 3PX3A 4Y9TA 1HEUA 1CZUA 4U7WA 1NAHA 1PLKA 2FN4A 3D2BA 1KYQA 1Y7HA 4H9GA 4HZUB 3CPJB 4YAEA 4DCPA 3FNGA 4Z3KA 1PV4A 1JIXA 3AFNA 5CT4A 5CDFA 1CF4A 4ECEA 1WR8A 3G59A 5B3KA 2C8JA 4G0YA 2QU8A 1EX1A 3DFIA 3Q12A 1E61A 1PEAA 1XFDA 3UAOA 3BS4A 2QRJA 4OV6B 5I7AA 6YASA 5TIIA 5T4EA 1I1NA 3KV3O 1ZRNA 4LBYA 5TB5A 3RROA 3TSYA 4E46A 1QTQA 2J8ZA 1N9GA 1P2VA 3EWAA 1BMFA 4N3CA 2VPZA 1II9A 3DVLA 2V6BA 4G0VA 3T12A 1H22A 2P0YA 1X7GA 2OUIA 3CLTD 2V4MA 4V0NA 5CD9A 3U0VA 3V5NA 5IS2A 2H7CA 3JQAD 3P97A 2ORIA 3LYAA 3A0UA 1AB6A 2IEZA 4FSXA 5IDVA 4M6WB 4PFKA 5HBRA 3VSAA 1JBKA 2J08A 3HJAA 2PMKA 3FPLA 2YXEA 4EITA 1NQOA 2X1VA 3NP9A 4RY8A 4ZO8A 1UAGA 3PJRA 4YRRA 2NU9B 3OP1A 1SWWA 2J5BA 2WM3A 4TS4A 2GFHA 3L6CA 2FR8A 1LTHR 3C6YA 4UCQA 2FKAA 4O5OA 2HQOA 4JBWA 4J29A 2VP3A 1NOKA 1IN7A 3G2KA 4QDUA 1X86B 2QQ5A 3MMXA 1TT5A 1DUIA 1OLSA 1TJ5A 3FNIA 3Q7PA 1RBMA 3GLSA 4R9NA 2QJTA 5FOWA 4MR8B 1S5PA 4LYEA 3LBHA 1JDZA 4Y2UA 5BWNA 3SQXA 2AIRA 1D1SA 1N6KA 1OI7A 2NO0A 4ZVLA 5LQDA 4MRAA 3RV3A 2O7QA 1DIOB 2RHTA 1DAHA 4G5HA 5FAXA 2OPHA 3ZLBA 1JMYA 2J9RA 2QMUA 3OP4A 5CB8A 3EFOA 1BGXT 3B53X 3NHYA 4M1EA 1KI4A 1NJ1A 1H6BA 4UFPA 3QUQA 3G8CA 3ZVNA 2EQBA 3CGWA 5AXDA 1F6BA 4PO1A 1UZLA 4N7BA 2JKYA 5DNAA 1YQQA 4DEVA 1KMMA 3W34A 1GYPA 1X1CA 3OJEA 3T7JA 3G2MA 1I1HA 4JYMA 4BYMA 4QEKA 1R0WA 1TZBA 4WINA 2YZNA 3EVNA 1AKVA 2D4AA 2TMKA 4YP5A 4LVOA 2GK7A 2ZS7A 4MI3A 4UTZA 5ELMA 2BFWA 2Z2IA 2ZIUB 2VO1A 5HYVA 3JWHA 4URVR 2X0FA 1DRVA 5IVPA 1EP3B 4KYTA 4OM7A 4BV8A 1VMEA 3TBKA 4O2LA 3H2KA 2I2AA 5U9CA 2L42A 1T1IA 2WT9A 3KJHA 3PKZA 4NLLA 1YA4A 3ESDA 2BH2A 3H11A 4V0OA 3REOA 4YMGA 1OZFA 4Z7NB 1J39A 1R4NB 1E7QA 4XE5A 1P5RA 2C2YA 4FKBA 1GT91 1ZH4A 3TGPA 1UQUA 3WGZA 2BR5A 5L7WA 3R5SA 3LC0A 4AZTA 1M1UA 5F1OA 5HK8A 3LGSA 2X0IA 2HWUA 5KEIA 3QVJA 1Y6ZA 3DFZA 3FGNA 3UBMA 4FW9A 1B6SA 1V0JA 3PEWA 4ESHA 1KH3A 2VG8A 3D8RA 1AHIA 1YC5A 1NC1A 1F4VA 3ABOB 1OYYA 2HCTA 3QMPA 2NO6A 4M8IA 3A2MA 5EXTA 4Q12A 3VR2A 3W4KA 2GZ2A 2RSLA 3QX3A 5EP2A 3JQEA 4M1WA 1K7YA 3LOUA 1JYEA 1LRJA 4KW7A 3KKMA 2PCJA 4LAFA 3JQFA 2QZ9A 4GR5A 2WIDA 4Y6OA 3SBDA 2G4VA 4NBVA 3F90A 4MWDA 4QUKA 4CDMA 2DKNA 5ALYA 1GP2A 1NIJA 4YPOA 2N9UA 4DUGD 3JAWB 1SIUA 2ZBGA 1IHDA 1R8QA 3J81A 3HCFA 3QX9A 2F90A 2W83A 4P22A 3F5FA 3Q85A 3OLWA 4L6IA 2QX9A 3A4VA 5HWSA 5AVUA 1U02A 2XE8A 2XUFA 4FEAA 3SLGA 2FW1A 4F5DA 2J7PD 1V41E 1FFHA 2WUGA 3NZEA 1NURA 3QG5A 3TOCA 1AGNA 4E6PA 4LI3X 1SOAA 1TF2A 1W94A 2V7QD 3FIUA 1NTRA 2VDWA 1DKUA 4JOSA 4KQ2A 3GLFE 1IRXA 3RIMA 4YEDA 1OX6A 1QIMA 3DAPA 3BF7A 3UVEA 4QGHA 1XEFA 5JNLA 3BORA 2W00A 3UB4A 1KVRA 3HGQA 2C92A 5KYYB 2DE0X 2OSVA 2OGTA 1LX6A 3P9XA 3UHAA 5DW0A 3N9IA 3NHPA 4KQMA 3I9LA 1L7DA 1WXHA 2OWDA 2M6KA 2CFOA 3W5HA 4BJ6A 2ORED 4MIEA 4DWOA 4ERNA 5L3QB 2B1IA 2REXB 3PQ7A 3ENVA 4HS4A 4K26A 2OE2A 4OJMX 4ESEA 2ZFUA 3K1AA 3KE8A 4HC4A 1ZH8A 3GFPA 3ZI0A 5K2MA 2ZUEA 5ED4A 5BV7A 5D2CA 2CUTA 2HQ1A 5DYYA 1HQYE 1QH9A 3SEZA 4KI7A 3P9PA 3UJ9A 1I4WA 3DC2A 3HYRA 3PK0A 4DMKA 4EFNA 1LSJA 3LBFA 2HO4A 4IKPA 5AVYA 3FMFA 4PFJA 2I4IA 2UDPA 2BLNA 4DR3B 4DJEC 3UWSA 1YZ3A 4YAWA 2FK8A 1JAHA 4FE3A 2A7QA 2Q2OA 3A7EA 4KH1A 4OSPA 4UZFA 5E4FA 5E6SA 2Y0BA 4XI9A 4A2PA 3ZHSA 4YMHA 4RTLA 2IS2A 1P19A 5I9BA 3V7FA 1MOPA 2O8DB 1N2HA 1NDQA 2QRVA 1FSPA 2O06A 2AR9A 2MIIA 4CIXA 4PQRA 4CLDA 2VHEA 1PJZA 2R6ZA 3GJ8A 4XQEA 4EJFA 1T5HX 3PEFA 4ZYVA 3R7DA 4A5SA 4DHEA 2VN8A 5EKSA 4IILA 4Q1AA 4TV8F 3SZLA 3N75A 3GDFA 1T5IA 4P9NA 3WWZA 3EY4A 2XZTA 3SYKA 4FE7A 5KPDA 1QM5A 2OB1A 2P5YA 1VP3A 2P6UA 4U2CA 4EA6A 4GLBA 4EYOA 2ZWMA 1YFJA 3HJFA 2SNIE 1PTKA 4PLGA 1X7XA 5K7SA 3KKQA 4RH0A 4XB6B 4IXWA 3HDHA 1QGOA 1SCBA 3MAGA 5CFOA 4YJFA 1T2UA 1E60A 2OB2A 2W2QA 2BTQA 4DF3A 3E2MA 3O4FA 2DLNA 2OT3B 3TLBA 2H2WA 1OWPA 4EIWA 3EXEA 1EWQA 4E33A 3JALA 1DO0A 1CQIB 2W22A 1P8JA 4PRYA 1QFYA 4F4JA 1XMQB 5LMUB 5JQGB 2HMTA 2X4DA 4DG5A 1KKMA 4AM8A 4BFVA 3RSSA 3AVUA 2BFMA 3KOXA 4HP8A 5F7ZA 5FOVA 2QAGB 4GP9A 3SQNA 4YRNA 1ULSA 3K70D 1KJ8A 1Y1QA 1PJAA 1N5MA 1QFSA 5EJ5A 1KH1A 4N0QA 4GM4A 2QAGA 2O8FA 3V1NA 4AKGA 2NZUG 4QBHA 4XQGA 3WNCA 4GAEA 1ES9A 1T8RA 1AO0A 1BYIA 4ARCA 5AKYA 3GUZA 3I6ZA 1PT6A 4P4LA 1ZSYA 1ZIYA 2W90A 3LFHA 4L85A 1KAHA 5K0ZA 1GGVA 3LKDA 5B36A 2Z2XA 4KX5A 1JKXA 2HL6A 3GO4A 3II6X 4PZYA 4RF3A 4DANA 5DOZA 4UHFA 4EHFA 3PFKA 3LE8A 1AMNA 4BAZA 1U4SA 4R1OA 4TXJA 1CJVC 3PGA1 3PQ8A 4R1UA 3KAPA 3IE2A 1HTBA 2P5TB 4FXPA 5F51A 3AVVA 2CLCX 1HBJA 4HNTA 2VAPA 2ZE6A 3GFTA 3FTFA 2VH1A 1WF6A 2ZANA 5SY6A 3EDRA 2Q2VA 5HMMA 5JCJA 3GGSA 4IMJB 4PS1A 3M4NA 4Y1RA 2Z9BA 1EIWA 2J0UA 1R4MA 1SUEA 3GT0A 1VL1A 1EGMB 2ES4A 3FX2A 4OQMA 3AP3A 1UKZA 2DCUA 2WA1A 4HNRA 4LTMA 3SKYA 3TK1A 2GN0A 1GZ6A 1HKHA 1NM5C 1Y1SA 3GEDA 3MFQA 5ESXA 7AT1A 1DAIA 2AC4A 2XA9A 4JJ7A 4WCFB 1PYOA 2WAXA 4JLAA 5K6RA 2C8LA 3ZTYA 4REQA 1HK7A 2OECA 4NMMA 3ZNQA 1THGA 3VKGA 4O2RA 1E9AA 3ONEA 1YQ9A 4QVIA 3O8QA 3FM9A 2Y2UA 3HVIA 3JQ9A 4ZYLA 1D2HA 1C0EA 4J2HA 3MLAA 2QX4A 3MTDA 4MWZA 1JDTA 2HDHA 2G9VA 2F7SA 3ZCVA 5BYKA 1GN8A 4O4HB 3TGWA 5EFOA 4EAAA 1BMDA 4YV7A 1WVIA 3SMQA 3DS8A 5DTIA 4G56A 4K8OA 5F4BA 4EFDA 3C1AA 3CUEF 4QDJA 4BO5A 4BZQA 3PNSA 5A5EA 4YRQA 1P6XA 2OV1A 1P1RA 4RY9A 2XOKD 3M1LA 4KUGA 3DMRA 2YIJA 3VJRA 3W8EA 3MC1A 4RD1A 1H93A 2Q5FA 1ENOA 2I3BA 2VI5A 2BBSA 3O0TA 3A7DA 4JGIA 4NJOA 3OCXA 4BCDA 1N1GA 3A9VA 2AXQA 2IYTA 2XI4A 3AEXA 3S81A 2QG6A 2QX7A 3PRKE 5C31A 4JSTA 4ZALA 3WX0A 1LVHA 2GQ0A 3DV0A 2Z2ZA 3CZAA 3KB8A 1VJ0A 4KQJA 5GONA 1KOLA 1Z29A 1THZA 2XMCA 1Q92A 3GYBA 3QPCA 4XGQA 2YY6A 4DPLA 1ZSVA 2ILVA 1XZJA 4TT3D 1X14A 1XTKA 3UMVA 2EFEB 4B7CA 5JHHB 3DHNA 2ZM5A 2VDWB 3NOVA 2AX3A 4JUIA 3GVHA 1A7JA 1BS9A 1MP0A 4S2EA 5TSDA 3OIGA 3V4OA 2HMYB 4CV3A 1KK1A 2LCFA 3AUYA 5LMCA 1TM5E 1ADYA 1FVOA 2IXDA 2RGCA 2O8CB 1YFLA 2YMLA 3PA6A 1H2WA 1HDYA 3CHYA 4YQEA 1D2RA 1VG1A 3ENKA 5BOVA 3A4IA 5COAA 4AMYA 4CFYA 1V8BA 5JH7F 5JH7A 2AMYA 1H3FA 2AE2A 4H77A 2Y0DA 2AFIE 3D2AA 1PU2A 3ABIA 4B4DA 1ENZA 4CI0B 5AUNB 1P2TA 4YP9A 5L3ZA 4C87A 3NV7A 1P0CA 2HJ9A 2O4CA 3P2KA 2XBMA 1AKWA 2AUTA 2OFFA 4DBVO 2YWJA 2F3QA 2BGJA 4J49A 1ISJA 4RFSA 4OHRA 1ZW6A 4GNRA 5E95A 4YXWA 1MNAA 1VCMA 4EJSA 2JBHA 4BBJA 1BCSB 3PFCA 5F78A 3X2FA 4DN6A 1TLTA 4O4LF 4RK0A 2ZAOA 3QNMA 3LJKA 3OLQA 4TV8B 4Y2QA 3N2YA 2C9OA 2C4WA 3PUWA 3MQ4A 5DHAA 2VTVA 2PUCA 3NOXA 3QUBA 1A2QA 4R31A 2EWMA 5E4TA 1VIAA 2C84A 2HYDA 3GJ3A 1A27A 3EF3A 3L3BA 4NHOA 4BX2A 3SFTA 3ZTTA 3ABSB 3H9BA 3NALA 4J91A 3X2SA 4ZODA 2KWIA 1SHTX 3LUDA 5H82A 4UU8A 1ZD3A 3HCPA 3TOZA 1PFWA 1NJ6A 2NGRA 4CMIB 4EL5A 4KPGA 3W2IA 4ZI2A 5CA1B 1O1YA 2QTVB 2IT1A 4M0UA 3CZQA 4R3UC 4L5AA 3TNFA 1AT1A 2ZOSA 3AEUA 4OI0A 4ZCPA 3HCWA 2B4AA 4TUYA 1WXGA 3LWDA 3N0RA 2EIXA 4MA5A 1FS5A 5FOTA 3SOPA 5FPQA 3K8ZA 4GGMX 1H1TA 5FUBA 1NXPA 3W2TA 2XUJA 4H3SA 4Z86A 4DMGA 1DI0A 3IFSA 3V7YA 3G68A 1SBQA 1NF3A 4A7PA 4DDMA 4GC5A 1OE0A 3ZV4A 4DLAA 3DW1X 4DY6A 3TR5A 1SNYA 4X91A 4YO7A 3LGXA 3GFRA 3O26A 3RYHA 1YU6A 4N5IX 4HUQB 3HSKA 4QUGA 2QA5A 4AMZA 4MAMA 3DCNA 1PR0A 2CJFA 2I4MA 4JZKA 2ATVA 2J33A 2REQB 3ZJYA 2Z8XA 3OJFA 4EY7A 5DBFA 1HYHA 4QUEA 4YCJA 5T57A 1JIUA 1YSCA 4I55F 1U3UA 1WL8A 1J8YF 3T9CA 5KI6A 2YRXA 3FYHA 1HEYA 1M1YB 4FT4A 3OLXA 1YJCA 2OQ2A 1F6WA 4R7ZA 3I9NA 5EE9A 5C7LO 4UU1A 3N6XA 4ZC8A 4QJ5A 2O3JA 3HI4A 2DT8A 5HKLA 2JIRA 1W85A 1WMDA 1L5VA 1V6CA 3R5TA 2VLIA 1UUFA 1YDGA 3KTOA 1B0ZA 3F5MA 2FCAA 2O2DA 3QV2A 1P1JA 3GGCA 2O48X 1A76A 2JGKA 2BBOA 2Q3HA 2WTNA 5IM5A 1BHO1 3DAOA 4CDRA 3MWEA 1HQCA 4DZZA 3DKRA 4CL3A 4PTYA 3OFND 2JVIA 4Q3KA 1W96A 2ZJFA 3G5MA 2TYSB 2HWYA 5ALVA 4OXXA 5CJJA 3ZWBA 3A05A 3ER9A 2FHPA 121PA 2W4MA 4WZBE 4BTVA 1WXQA 1V7QA 3KSDO 3E8XA 3O03A 3OI7A 4R54A 5DV9A 1N32B 3GA0A 1XF1A 1U28C 2FPRA 3GJQA 5FORA 1G2OA 4D9JA 2BI7A 1SUSA 4UHCA 4YDRA 5I9MA 1RAIA 5BP7A 3LS2A 4JEMA 1T36A 4N7RA 4WDRA 3QHQA 2C03A 3QSGA 2QVLA 1NAIA 2W11A 2IX9A 4JR1A 4CCSA 3EPPA 3ZNOA 3IHWA 4KYVA 1Y3IA 3FUCA 3HXLA 4JJAA 5DXJA 4N5MA 1RWOA 1Z34A 2JCVA 2HM7A 4KH0A 3U4DA 1N2SA 2PSEA 3KXLA 1JIIA 3IQWA 1S8FA 4QNMA 1E32A 2J9FA 3ZZ0A 1E6KA 4R71A 4CE6A 1DIRA 2SBTA 3I2HA 2FFRA 1CQXA 3PKJA 4DVGA 5BVHB 4MAFA 4RVHA 5JWHA 4M87A 2DBRA 2G9UA 3SC4A 2IV2X 4ZHQF 1XVVA 1ZMOA 1TC2A 2MINA 1I4DD 3C98A 4K9MA 5IW8A 5KHOC 4CGZA 4AAYA 1XHFA 1KPHA 1Z18A 2DP4E 3PHBE 3C8HA 1XALA 4YAFA 3WJ7A 3IXQA 3VU1A 4KAAA 3DTYA 1OV4A 2D06A 3R9XA 4EKDA 1T9HA 1XKXA 2HEIA 2RB4A 2IOQA 4K6MA 2HIAA 2OQIA 4NATA 2EW1A 1Y6GA 4FHGA 2FWMX 1XD2A 4L0MA 3C6QA 3JRWA 1Y0BA 5DB4A 3VH2A 2HJWA 3VX3A 4CIBA 2Y93A 3KETA 2W6QA 1PR6A 3JSAA 1NI3A 3KKZA 3KG2A 5DTMA 3VFDA 5BSMA 2J9FB 2Q49A 3G89A 1A1VA 4QQNA 4I7EA 1N3IA 3FR7A 3HV0A 2IUTA 2W70A 3W0LB 4CR8A 4D9KA 2FMXA 1NF2A 5HJ7A 3OEHA 5ITZA 3IUQA 3PGKA 4WKCA 1GGKA 1H4TA 1NP6A 3DHVA 3JQ6A 5DI3A 4DCOA 3T95A 4MMZB 3T6KA 4EKYA 4TZKA 3MGGA 4BVFA 1E4EB 4K87A 4KIWA 1SA0A 1VJ5A 2DWOA 1J33A 2PA3A 3UZUA 1MNQA 2R7KA 2ZUTA 3NU1A 4PZ9A 5BMVF 1IAVA 3PXAA 1P1FA 4TMTA 4NCHA 5L3SB 1MVLA 1OSNA 4HOYA 1JR3D 3Q7IA 3MJ4A 3DMTC 1G21B 4D4JA 3KJEA 3OCJA 4BAGA 1Q77A 4FEEA 1C1DB 2PYDA 3EEFA 1EK0A 2MYNA 4NRDA 4Q37A 2QRHA 1O0BA 1G5PA 4JNCA 4NCXA 3HCDA 3QM1A 4XIFA 1WCIB 2OHJA 2E6KA 4BNFA 4WUTA 1PJ3A 3CLUD 1E4YA 1HQKA 2D1RA 3U3ZA 4ZCMA 4W8OA 1BXGB 1A71A 1FQOA 3A1VA 1GDDA 1ZXXA 3B82A 3NBAA 4TYWA 1PQPA 2ANBA 4JC4A 2H2GA 3GU3A 1FSSA 1QOZA 1W1WA 5LM3A 2W2MA 3F8SA 1IB0A 3BRWA 3HN7A 1YACA 1DCTA 5IFKA 4ZT4A 4BC0A 2GYUA 1KNQA 1FUKA 1M1ZA 1QIIA 2PGNA 4DRYA 1J25A 4YDHB 3V8VA 3AONB 3CKKA 2JGAA 3OM9A 3MT8A 3UT5A 4ONEA 1P0MA 3LX8A 1Y4AE 4IJUA 5F3WB 3R6DA 3WQRA 1Z38A 1XEWY 3D0QA 5LOVA 4L0CA 3CZRA 1S02A 4X6LA 3VC2A 2PBZA 4Z8XA 1NDUA 1U94A 2DPGA 2DH6A 2XMPA 4OKNA 1JT2A 1K5PA 4EY6A 3C8UA 4ZI3A 4W1PA 2C0CA 2VSYA 1SZCA 4IEEA 5CB4F 1HNZB 1X3LA 1AOXA 2B9EA 3AUXA 2EFHB 3V55A 3OLCX 4L5YA 5EP4A 3C15C 1TOAA 1O0SA 3HP4A 4MIOA 2BZ1A 3C8MA 3ETEA 4AY3A 4M9SA 4N3AA 3R0JA 5EHQA 4KWCA 3T1TA 4YT2A 3TEMA 3CN7A 5B64A 5EIFA 5JBQA 2XE6A 4B3FX 3E9DA 2Q3EA 5DU2A 2MYTA 1GNLA 1KJYA 2VPPA 1KEUA 4HYEA 4DLWA 5JSZB 1IN1A 1P7VA 2VCHA 3NVDA 4N3NA 2O2HA 1YI1A 3NDRA 1S2MA 2IW1A 2NXWA 2PSSA 2DBVO 2M6RA 2X6QA 3RBVA 5DNCA 9LDTA 1ZD9A 4YGXB 2PSJA 3C87A 3DDZX 1OT3A 3H2ZA 1HWYA 3AY0A 4MEJA 4NR0A 4AW9A 4BJ3A 3ZN2A 3KT0A 3EOBI 4KR7A 5ALTA 3JASB 3WHPA 3T9EA 1NLFA 4ND6A 3WAGA 1WSDA 4HAUA 1JEYB 4QG3A 5DH9A 3AKCA 3WB0A 3DD1A 3PD7A 4LNHA 1JQAA 1DBIA 1SQ5A 3L0YA 1H9BA 1CF2O 3UB2A 1RM3A 5C53B 2QTMA 4NNJA 1ZIOA 1E6UA 1MIOA 2IF0A 2ZVPX 1IEWA 2R5FA 3Q9LA 5G1OA 3ZY5A 5I6DA 3CKLA 4I3FA 3P20A 2R0QC 4IH9A 2YWEA 2HLDD 1AUVA 4I1SA 3NXKA 4A8TA 2CMDA 5B3LA 3TUJC 3ZE7A 2ZWPA 3H1EA 2CYAA 4KWHA 3RKUA 1RHKA 1IG0A 2XNHA 3F96A 4CG3A 4DDVA 1U1CA 3WWDA 3HUFA 1F7UA 4BLQA 3SJZA 1I4EB 2D62A 3V1MA 1EGHA 4I1YA 3RUEA 1VTKA 3ORYA 2PX4A 2FPIA 4KXNA 4EYSA 4B4KA 3AUFA 4JR0A 4KLAA 2B0JA 1IM2A 2RBEA 1U2DC 3KLBA 2HW8A 2FGKA 2H08A 5IN5A 1TIKA 1Z74A 2RJ3A 5TY0A 2XXBA 5KUTA 1NX9A 1H8HA 2C3PA 4QBGB 1E0DA 3P4XA 3T8YA 1EWRA 3LCRA 2NO7A 5KVAA 4AG5A 4NE7A 4PZDA 3TF5A 2FEXA 2OC4A 4PIVA 1QFMA 2AMFA 5CVVA 5TQVA 4LRQA 1V2HE 4L78A 1V8DA 4JR2A 1V1JA 1NT2A 1RQXA 3NDIA 3OHSX 4J3FA 1SKYE 1XZBA 3FDXA 1EVKA 2W6JD 4KHZA 4TLCA 2J9GA 3RIXA 4BU0A 4BJ1A 4CQMA 5CLJA 1UIRA 3I2JA 1FTQA 3T3IA 5G3YA 5JFTA 2ZWOA 2QRLA 3TR6A 4K9PA 2HJGA 4FOSA 4C0JA 4WERA 1IXYA 1GNSA 1QUFA 1RPTA 1V48A 3N7TA 5BMVA 2WE8A 3FOEC 4O59O 1GPJA 3ZGYA 3AR5A 4JI2B 3RHZA 3U13A 4EJSC 3BT7A 3W79A 2WWRA 4ZP1A 2C88A 3CLRD 1SUBA 3GH1A 4WOPA 3LCJA 4WMLA 1G3MA 4XLLA 2D5LA 1UEIA 4LZZA 4MW1A 1S7GA 4HH1A 2QGZA 5J43A 1QG2A 2VDKB 1PN3A 2CCKA 1MABB 3NEPX 1LPAB 3DEKA 1XTZA 5DLDA 1VYVA 3IBGA 4IOLA 4BYGA 3ZXSA 1GOTA 3D43A 1OTYA 1KGSA 2RK6A 3MCWA 4KBYA 4Q3DA 3BHMA 4RANA 5F23A 2VT6A 4EG5A 1S3GA 2JJ2D 4DYVA 4G8DA 4OI4A 3NPAA 1G18A 4J1QA 1O77A 4OATA 1JFVA 4J1NA 4RKWA 1TJ4A 1KEEB 2PLWA 1QLHA 1UOQA 2CFCA 3QELB 3NIBA 4NBUA 3WY9A 5I7RA 1U8CB 3LVQE 1ZAYA 2VVTA 1AMOA 4B17A 1TAHA 3ZWYA 1RT9A 1ZGHA 1SXPA 1JYFA 1NIPA 1UBCA 1X94A 4PRZA 3KT3A 4XGRA 3VR3D 4DBZA 4DT1B 1RZRA 4EW2A 2AN9A 2YZ2A 2NZVG 2WPNA 3QLUA 3I2KA 4RHXA 3BIXA 5AXAA 1OVGA 1TKCA 1ZI8A 3W6UA 2CVFA 3HCAA 3RWMB 2B6HA 2Q1XA 1K3UB 1BDIA 3ABRB 3IAXA 2C5LA 3CS3A 1HURA 1YTLA 3G79A 4UXHA 2UUAB 1WIWA 4PGMA 1E3SA 3DW3X 3EFEA 3RD5A 5H4HA 1FRZA 3DOHA 3KLPX 5B4UA 5KVSA 1SHZA 1U04A 1THMA 2ISSD 3ICCA 5EYPB 1O5OA 4EO7A 2FUNB 2GM5A 2OCIA 4KQHA 4U2KA 4PANA 1LZKA 1GARA 5EHZA 2W6CX 3TI9A 1U7UA 2A0XA 1AE1A 4H0NA 1ZHOA 4TL7A 3RDPA 4QPCA 4G23A 4PQEA 4S05A 2QPTA 1TUEA 2VSNA 2RCNA 1U4OA 4K6OA 1IXZA 2ZITA 1UP4A 3U7IA 4LX0A 3COPA 4HMPA 3I76A 4TV9A 1U3DA 3HL4A 2AJCA 3BMCA 4QRIA 3UJ7A 4M99A 5I7OA 5KX5A 3RPEA 3WFIA 3NHRA 3SQOA 1FPMA 4J75A 1J20A 1HORA 2XT6A 3HWRA 3MLBA 4R84A 1EUCB 1XZ8A 2OBMA 2ZBUA 4BLUA 4E88A 4I4TA 1GTJ1 3FUXA 2NU8B 4PRLA 3IQXA 3ERCA 1GPUA 1FMLA 1WQ1R 5FXMA 2J7KA 1W2HA 2ASEA 3PUZA 3CZPA 3WKDA 5IP5A 1LC0A 3EFOB 3GWGA 3PWZA 1Y8CA 5EEGA 5F35A 1ZVQA 3M6IA 3QKUA 1N77A 3NC1C 4JOQA 5CYPA 4QDKA 1VPDA 5FULA 5BR8B 4NXMB 2OG2A 4D4MA 2YNMC 3ZHXA 3GOHA 2Q46A 3P2MA 2H4HA 1CNFA 1D9XA 2PYZA 3IAHA 3F6PA 3P2JA 3VR4A 4BLWA 1JTVA 1A96A 3KUCA 4U39A 5DBOA 2BKVA 1WB4A 2BFBA 3QKTA 4FXOA 4O2AF 4IUYA 3UC5A 5M7EA 4N9WA 2W8BA 1Q6ZA 1NR5A 1Z0JA 4NAVA 4TTRA 2XWQA 3H2HA 4KNWA 2VP2A 3TDNA 3K4PA 1QHHA 4UEKA 4LNAA 4KBGA 3RWOA 3VU9B 4ENQA 1X1EA 2BFBB 3UK1A 4EG7A 1J8QA 2AXNA 1M6YA 4TMYA 3VDMA 3SPXA 1YB2A 3ZQUA 1WZUA 2OBLA 3BWVA 2VDPB 4KQWA 3H1BA 3IV9A 1NG9A 5K03A 3L92A 4LJKA 4OI1A 1Q1ZA 1QIEA 2DTEA 2A57A 2IA5A 4FYMA 2PKCA 4MW5A 4OJQA 2I7CA 4IDAA 5K4HA 4JFRA 2BT4A 1F38A 1Q20A 4MVJG 1DGQA 1DVRA 5JYDA 1KJJA 3CUVA 2NN3C 4WKNA 1QZZA 5THKA 4IBOA 3ST7A 1GUDA 3LQFA 4RWEA 3C8DA 3V8QA 2X19A 4BVJA 3I01M 3RFXA 2OG1A 2ZYAA 2G1AA 4UM5A 3VOAA 4BO3A 3ZHBA 1PYDA 1PWYE 2GYVA 3AQ4A 2CV1A 3I9FA 1WCV1 4MCIA 1IJKA 1I8TA 3CINA 1P72A 2WBLC 3OPYA 4MH0R 1NLMA 1PTJA 3H18A 3LF2A 3ND7A 4WFIA 5IBQA 2R6R1 5BN4A 1MXHA 2VDQB 3EXEB 1I2CA 3NV9A 2CXNA 2NTYC 3KQNA 2UYHA 3I01A 4AO6A 2J41A 2IODA 4OHMA 4BL5A 4OX9Y 5CFZA 3Q7TA 5HZHA 3UJNA 3IKTA 4G2NA 3G9XA 4B3SB 3PNPA 3L0DA 1V11B 1FVFA 4L8GA 1DU4A 4F2DA 3GPLA 1VSBA 4XJSA 1Y80A 2BFCA 4R40A 2ZRAA 5TVKA 4C6HA 2D7DA 1WX1A 1SUWA 3M1AA 4D9IA 5B1HA 2OAGA 3V8NA 2DMRA 3JVDA 5DF1A 1BKDR 2Q1UA 5L6MB 4OOFA 1Q7TA 1CQJA 1QRTA 4K0KB 4DCVA 1DC6A 5IZCC 4OPMA 5ABPA 5K3FB 3VNBA 1PEYA 4HGOA 3B7GA 3DL0A 3KL2A 5DGDA 5JAQA 4FQ8A 5LA6B 3N70A 3V1LA 2GDZA 1BFKA 1KHTA 2FWRA 4OF4A 2WHXA 3FNQA 1TAGA 2YJ3A 3C6KA 2Q5EA 2Z6AA 4ZAFA 4IVRA 2C7BA 2NNWB 4R68A 5HR5A 4ZCQA 1GKUB 1BNCA 1UKVY 4M22A 2VPTA 2VPIA 3TZCA 5K01A 3ZYZA 1R3DA 1LW7A 4MUNA 1CS4C 4A6EA 3EVBA 3HY3A 2EEZA 4EHIA 3CSUA 4RH1A 1WHTB 1D1QA 4N7JA 1I4TD 2ZATA 3DLCA 5A4JA 1CRWG 3KJFA 4KR9A 2ZAGA 1E2QA 5CFLA 3DWGA 3C4JA 5K3EA 5KKCA 4AZWA 3EX7C 1R6TA 2QAIA 1ZISA 1XDBA 1S2IA 4GGPA 5DCUA 5EGSA 1CR4A 1UMDB 1MO5A 2WM2A 4BGDA 2IWHA 3KPWA 2Z9CA 2I78A 3HJUA 2QZZA 2DPHA 3S7TA 4BPBA 2DUMA 4TTQA 2FRDA 4MHSA 1JJ7A 1P2GA 2R5NA 2VDMB 3L7LA 2BGGA 4TRMA 2LW7A 3P9RA 1ISHA 1J23A 1D0VA 4CKEB 3LL4A 4Z3OA 3TTTA 4EI7A 1N5OX 4BQEA 2ID7A 3NB0A 4NJMB 5BY2A 5C1DA 3EQ6A 1YNOA 3P9KA 4MQEA 2LWIA 4NZZA 1X1QA 5K2OA 4YXWD 5CH8A 2VQDA 5B1IA 4B5KA 2BJHA 4DG9A 3C3PA 1O5IA 3V42A 4Y6SA 3AJEA 3UFBA 3FR8A 5I45A 1XFAA 4LX8A 1MZPA 1OFUA 3EEIA 1HZJA 2JLSA 3ZJUA 5IMSA 3A4LA 721PA 3CJRA 1U6JA 1X8JA 3JWGA 4DNQA 1OILA 1UAYA 4NSNA 2YV5A 3PFIA 1H2RS 4IMPA 4JLOA 1XKLA 4O4LA 5FPPA 2WWVD 2O6HA 3NNDA 3EOZA 1JDJA 2EJBA 4BWFB 4R2KA 5AOBA 4A91A 1N8NA 3OSZA 1A4XA 5DTQA 3DPUA 3UAGA 4GMGA 4LVNA 1W4BA 3IEXA 1GEGA 1U0NA 2HRRA 3AI7A 5EXPA 3IMKA 1Q21A 3R3ZA 2ZUSA 2ZIXB 1R74A 3CCCA 4PGFA 4L07A 4PGAA 2YDXA 5E0KB 5G4LA 3LVRE 2ODTX 4OAPA 1NYQA 4DWVA 5CM9C 1E9RA 1F2UA 1T6ZA 1QK3A 1L4KA 3A6KA 1NKVA 3OCZA 2A9RA 3QXGA 1X8KA 2JFZA 5FD8A 1FP2A 2JH9A 2PQ2A 2ZULA 5J59A 2ZETA 3G5AA 1QYDA 3T5MA 1QU2A 1T3TA 4QTUB 1I5RA 3SJUA 2Y27A 2GPYA 4Q24A 4R2WA 1B8OA 4MUAA 4B6FA 5J58A 2AEEA 6LDHA 3M6VA 2HF9A 2QN3A 1AN0A 4O3FA 2XEDA 1HRDA 3ELYA 2PUWA 1VGRA 4PPQA 1ESDA 4Y1RB 5FI1B 5HJ2A 1Z7BA 5K8CA 1IHXA 1U8UA 4YQFA 1NQXA 3KKPA 3HJTA 3VR6D 4AUEA 2PL5A 1ZNXA 3E03A 3EAGA 4G5OA 4NU0A 3VPHA 3VMFA 4EVRA 5C18A 2W37A 1ZUNB 2GZHA 4A6XA 3HCRA 4QM6A 1NVEA 3HS3A 4D0NA 5D01A 2B5VA 3ZLJA 2WWTA 4WW0A 3WQHA 1B15A 3GNTA 3RH0A 1U0GA 3DYIA 2FPOA 4NS4A 5MDHA 4O5AA 4L8VA 2H7YA 2AN4A 1MZVA 5BW4A 4HAVA 1ORVA 4D9EA 2QLBA 3D9QX 3M6UA 4JBNA 2H11A 3CZCA 2C31A 4HNSA 3R09A 2G9NA 1F9AA 3HB4X 5LQKA 2DFNA 3F1KA 3MIZA 3ZV3A 1UXOA 3NGLA 2V03A 3NNNA 1T6BY 3T5CA 3Q8KA 1C7QA 3GA5A 4Q0MA 1W46A 1P2BA 3GLFA 3LX5A 3JR3A 4DBLC 5HX7A 5K6AA 4ZOAA 2GCOB 4AJ9A 3CUTA 3N2EA 1FX1A 2C2WA 3WYCA 4PCUA 3TG2A 1EK1A 2X1HA 3G2JA 1V4NA 1OHHA 2C3OA 4I5IA 3IBCA 2P6PA 2YFQA 1IM8A 3EGVA 5CGQB 4ERXA 3H5IA 1RZRD 4JB0A 4D0LB 1H05A 5A3JA 1PSDA 1HX7A 4Z9FA 2PXCA 2YBEA 1T13A 4ZVNA 1SCAA 3ZLVA 3KEOA 1XG5A 3PG5A 1X1SA 4J9VA 1VQ1A 1K8QA 2R6JA 3PT5A 4RGBA 1C14A 1QV7A 3NCHA 2ZBRA 4L28A 1JTFA 4YDQA 3AVTA 1CV2A 2BF7A 3M3DA 1VP9A 1T5TA 2B7CA 4W1SA 5HCUA 1V6SA 2PO7A 2BJVA 4QREA 5AM0A 4BZXA 1XVAA 4RX1A 4LQCA 2OZLA 2BKAA 3HPRA 1X9HA 2W2KB 1A9PA 1QHGA 4HLQB 2MSKA 2P9GA 5CFQA 5ETJA 1G5QA 4GOKA 3DKVA 4WBNF 1VPLA 3CONA 2HSDA 1Y3HA 3P26A 4M7RA 2QVGA 3HVHA 4KIUA 1OZ0A 1FMJA 3BMOB 3PL5A 5ESWA 5EWJB 5ALEA 3ILHA 1N8KA 4TPKA 1YZVA 4B6JA 4FB4A 3BIOA 2HDWA 5IHPA 3R8XA 3UWDA 2Z8ZA 2QWXA 2NXEA 1G21E 2X2PA 4GBED 4NMXB 3DFMA 1YIAA 2V6GA 3F49S 3WBKA 1EM6A 2VJKA 1ULBA 3WK4A 2Y05A 2JFYA 3HGTA 4MLPA 4QOGA 1QIDA 1F17A 1LRLA 1G20B 4UVDA 3B9PA 4E5KA 3UANA 1WXIA 5AW9A 1KRHA 1H5QA 4GMDA 4MSUA 5EL0A 1ZC4A 2W43A 1EFDN 1IHPA 1T8UA 3QEOA 5EOVA 3UF0A 5JSFA 1IZ8A 2UYGA 1YBMA 1FJXA 4LBZA 5EE3A 2FG6C 3BULA 4FIZA 1E3WA 4GKVA 2BKUA 1M8GA 3OOYA 4MQFA 3FF1A 2QJFA 4IEIA 3LAWA 4TOIA 2OLJA 3UCEA 3VKVA 2IHJA 3A1SA 2ADOA 1U65A 4FFSA 4FYIA 1C7FA 4BPRA 3FNHA 2WTXA 1UBTS 1ZU5A 5A0FA 2BR4A 2FEAA 4B40A 3G5TA 5SZJA 5JJKA 3UQZA 1FA9A 2JIBA 3C45A 5B7NA 4KBFA 2F67A 2H85A 4ZN6A 3M81A 3DYVA 1OGJA 4NYJQ 3KZNA 3DB1A 4XD7D 3BE4A 3L06A 4TLLB 2JLZA 2O2SA 1K92A 1B0AA 2PAAA 4I50A 3GNQA 2V4UA 3GJ6A 1G20A 4I5DA 4XUGB 3VV3A 4HBGA 1PNQA 3X1ZA 4A36A 4CKYA 3EPJA 1U2QA 2OWEA 1B16A 5WRFA 3ETGA 2JFBA 1C4OA 4RSGA 2EL7A 2QQEA 2VA8A 2W2VA 3CNBA 3K96A 5IT5A 1H65A 4BVLA 4DSNA 1LQUA 4M0MA 1VCOA 1LLQA 1YD7A 4L4SA 2XJ9A 3V4ZA 2JHFA 2RHOA 3IOEA 3S1AA 2B78A 3FB4A 3NGXA 4JBHA 2QRNA 4ME6A 3N8GA 1P7ZA 4C3VA 1M75A 3W6ZA 1EVZA 3OZCA 3QE2A 1JAXA 4ESVA 1OLUB 3F6YA 3V80A 4MWEA 3ZOZA 2AZTA 3G7NA 3P2EA 4LHWA 1R7RA 4JJ8A 4TLEA 4WCFA 4IGEA 4LN1A 2VP6A 1XNJA 2JLYA 2RHLA 3GOQA 3OJWA 5JNWA 3FUVA 3I04M 3L6DA 1WU7A 5D7BA 2CV2A 1G3RA 2Z6UA 4C0BA 4MAAA 1L5MA 3PC3A 4A2WA 3DV2A 3NCTA 1H8ED 4Q3AA 3IYLW 3A6PC 1FU7A 1DBSA 3LUBA 3U7QA 2FSVC 4FU0A 2HR1A 3HRKA 3FHOA 1KIMA 3BHIA 1HF3A 1VLMA 2WZCA 4CTJA 1WXFA 2B35A 3KUXA 4PXSA 4QUDA 5AW0A 5JD5A 3C3MA 5SZKB 3WQSB 1OI2A 5TMEA 3QTLA 4ZJYA 3KAQA 4GPAA 1IK6A 1XBTA 2J5RA 1T2CA 3SAJA 2VHTA 4BGUA 1U7WA 5CM2Z 3UK6A 4F3NA 4AY4A 2YX1A 4YV2A 1E9FA 1JP7A 3B1YA 3B7WA 2ZR8A 2DFKB 4IUBS 2YR0A 4ZMSA 1GL6A 2A2ZA 1YJ8A 2P6MA 3K30A 3HB9A 2R8EA 2R66A 3C14C 2PM8A 1T36B 5FQNA 3WO1A 4A26A 5A9RA 4W5QA 3FNRA 4D57A 4M9RA 3SZMA 1ZJWA 2FN9A 5JYBA 3G0BA 1TM2A 3WKAA 3F67A 1ZNZA 1VI6A 3IAM6 5I8WA 4K46A 4ER3A 2GVZC 2OAEA 4KFUA 2WWIA 1YB6A 1AUXA 3UKDA 1DG3A 2YYZA 1KK0A 2AJLI 5CW1A 1TK3A 2EZ9A 3KS9A 4RS4A 3L9WA 1MB0A 3UAWA 4AKHA 2RGWA 1P9OA 2VAMA 4P2GA 3DZBA 3GLKA 1PHPA 4MI1A 4AJKA 2ZTHA 2H2HA 1GSOA 2VP5A 4MVJA 3V32A 1CD5A 4C0WA 5ISMA 5EA2A 4O4IB 3ICQB 1TM4E 2CCGA 2FX2A 3O8QB 1W85B 4KO8A 3WDSA 3W3AD 1GDTA 3N1UA 4UM9D 3UTDA 3LG2A 2P35A 4CTNA 2HHHB 4RO0A 5LYYA 1IPHA 5ARBA 1TFRA 3NNSA 4KOAA 2QPAA 5J2TA 4MUEA 1TL7C 1KOFA 2VUUA 2QQGA 3DKPA 2JZCA 1H23A 3QHPA 4MVJP 3WMXA 3R6TA 4A0SA 1MVOA 3CA8A 3PXBA 4YJ2B 5IAOA 5IZCA 3KWJA 1H0RA 2DHDA 3O3CA 4FHZA 2QU7A 4B2LA 3EG9A 3Q2KA 3EGEA 1WSBA 1R0SA 1W34A 4Z7OB 1ZQ1A 5A6VA 5M3BA 4K9SA 1CDEA 1ESCA 2ZCUA 1ZUHA 2Q2QA 4XJTA 2VJCA 3BQ9A 1U0FA 4Q7JB 5FIUA 1CFZA 2HBZA 1L5HB 3BJEA 4RIEA 3NTQA 4KPUA 1CXZA 4DLLA 4HX5A 4JY7A 4C3ZA 5ALGA 1R4ZA 1D09A 5IWAB 2CVHA 1ZH6A 3K0FB 2W0MA 2GASA 3DEAA 2KLBA 2I2XB 3WK5A 2O3TA 2PGJA 1F8FA 3SKVA 1Z88A 4CG1A 1FFXA 2H1FA 4RHTA 3KVRA 3D1LA 4DXDA 3CUYA 2GA9A 3AINA 4DHWA 3AEUB 3R7LA 4JI3B 1AXEA 1I6WA 3HWWA 4OHKA 3HABA 1SUCA 1ZICA 1Z8HA 2W6OA 1N6NA 3TVTA 1E79D 2XWBF 1E1CB 3DKIA 1JPVA 2MR6A 1XEAA 3CXRA 4NQZA 3B2QA 2EF1A 2DUNA 4KFSA 4I9HA 3JARB 1LI7A 3ZV5A 4DQXA 3M3PA 2FXVA 4JYBA 4ZCIA 4ABTA 1CBUA 2O54A 1SVIA 3T61A 5IVHA 4E51A 2YVQA 2C3YA 4R69A 1GU1A 1C1DA 3WRXC 4AQDA 3AUAA 1UKBA 4JP5A 1JQDA 5IJXA 1QGUB 2CL0X 3BD8A 3WISA 3RC2A 4C04A 1US8A 3ZIAD 3DGFC 4ARVA 4KLCA 5E9JA 2J0EA 5JIBA 2DF8A 2JGMA 3EPLA 5EZYB 4HWSA 4ARAA 1PD1A 4YIKA 1COWA 4KGVA 4L6AA 3KSZO 3T3NA 1JW9B 1KMHA 4DMUB 4M89A 5D5QA 2ZI5A 3NHMA 1MG0A 1VG9B 4LYYA 2ZB4A 4HGPA 2GHTA 2WT8A 3EQZA 1G19A 3LDHA 4GOXA 4KLRA 2GXQA 3RRXA 3THOA 1HG0A 1T8TA 2B1JA 1I51A 3S44A 1EK5A 3ZW9A 5LQMA 4NCBA 3IRUA 1JEJA 3RIEA 4Z99A 2AC2A 2PT5A 4DQVA 1QB8A 3AUKA 3H7IA 4Y9RA 4X6UA 1J8DA 2WAYA 2ATXA 2HZ7A 4FILA 2X8LA 3L8DA 3L8EA 3IV7A 4KTVE 4RTQA 1GTL1 4GEKA 2VHQA 1JVSA 2GOYA 2VYQA 2VPYA 4EF6A 2YVLA 1JFSA 5CVUA 1YR1A 4W5NA 4N5NA 1Z4IA 4HHEA 1B43A 1RADA 1IU9A 4G0UA 3OWOA 2HLDA 4AXXA 4Q7QA 1EQAA 4E32A 3KJGA 3BFXA 1TO2E 2ZRHA 5IH3A 1FBNA 1KY5A 4C0HA 1CUFA 5BQOA 1J97A 4KGDA 3VUFA 3LDGA 4RTKA 2Y1CA 5K0SA 2A0WA 5SZIA 4KQFA 2HWXA 2OL4A 4FFNA 4LQ4A 4CJXA 2AL7A 2A35A 3JWPA 4RD0A 1BWQA 4WA8A 4FZ3A 5HZGA 4FGUA 4V1CA 4OHWA 3OPVA 1KQNA 4OQFA 2J0UB 3OIVA 5F4ZA 5EXDA 1UADA 1DEXA 3L93A 3GGGA 3HUTA 1ADGA 2CSUA 3ZQ6A 3H1TA 1J8VA 1MF7A 1P31A 2PSDA 4MO9A 4RHCA 2VDUE 1RWNA 3A3PA 3KLNA 3FWZA 5KC9A 1XU7A 5HQTA 3PDJA 1DAMA 2GCIA 5ALOA 3ZG6A 4P4TA 1ATIA 4EFKA 2YHIB 3GDGA 4JBXA 1O4WA 3IULA 4M8NE 1J99A 4CQLB 4G5RA 1Q74A 1ADBA 4INZA 1KSFX 2H51A 5EC8A 3QXSA 3FOWA 3K9QO 1A8QA 1Z0FA 4E4RA 4JLPA 5T6BA 1DLJA 4Z5XA 4RA6A 1FEZA 2A9QA 1DX4A 1G291 2HF7A 5A5FA 3WDMA 4BVKA 1KVQA 1P5ZB 1SG6A 3E22A 4IKEA 1M74A 3ZNPA 3I2FA 2C5BA 4OKIA 1OAOA 2D5AA 4YRTA 1BE6A 3DZJA 4XQCA 1EFLA 4GUDA 4FFBA 1VSVA 3E9YA 1XHEA 4U4AA 4HSGA 5BOSB 1Q0HA 2IYOA 4IO0A 2GJ9A 2UZ0A 2GXUA 3JATB 4BE7B 5H83A 4WK6A 3RE1A 1NI4B 4TKUA 5ADVA 4AMGA 1NVXQ 4P33A 4OYLA 1LJUA 1ZI9A 4Y2JA 4L50A 2AQ8A 3FOCA 3G7SA 3GUVA 3R7AA 3ROXA 4PPFA 3GL9A 4FR5A 4C7KA 4O2BA 1H3EA 3QPUA 5H5JA 3ND8A 1NPYA 4WH0A 1CTQA 4NDNE 1KI8A 4XH9B 1TADA 3MJDA 4WNAB 5F7XA 1NJSA 3ANYB 4LMRA 4DLNA 1GR0A 1G64A 1RRVA 2PUJA 5ALRA 3MPOA 2B92A 5IWCA 3FOFC 4IUCS 1ISIA 4RJKA 3HZRA 4NNPA 3ZI4A 4Z7JA 2DY0A 4BO4A 4QJ3A 2X0EA 2ZSAA 3U7HB 5HA5A 4GLOA 4V3BA 1MENA 2F1KA 5LWQA 2B21A 2I6TA 4HATA 1M7HA 3EZXA 2P68A 4IG4A 4TQGA 4MS3A 3RYIB 3RI3A 3IPLA 1Y89A 5BOSA 3M2TA 1A1SA 2X0RA 2BHSA 1H6AA 3E27A 4QUIA 2V9ZA 1D6NA 1RHRA 3IO5A 2VF5X 3MMNA 2NVOA 3RODA 2EKPA 5TXGA 3G02A 4B5LA 1EFPB 2WIKA 4TKUB 3WB2A 1L6IA 1BMTA 3L84A 4C76A 4WOCA 1EIZA 1HH4A 1VZ3A 4FYPA 3H97A 3LPLA 3HVRA 1SVOA 1VMDA 2QTWB 4UHKA 5HKOA 1FDOA 1GVNB 1ZCBA 2O3UA 4WXEA 4BCBA 2B4KA 3MG9A 1M2FA 2YWHA 3QX7A 1GAWA 5HIKA 3JQFC 4Z0NA 3K94A 1D0IA 3CZ4A 4Y2GA 3OQOA 4Y2RA 4BKQA 1J0XO 2IE0A 3TDKA 1MC1A 1Q11A 4FKZA 5DEOA 1D2NA 3NMUF 4LXIA 1H2XA 3C3WA 3E7FA 3UK2A 5AHOA 2Q4BA 1QS0B 3RNOA 2OM6A 4EJ0A 4HH4A 2H1HA 2C78A 3L7AA 5THQA 2R4UA 4K0RA 2HRDA 2HMAA 3N2GB 1ZRMA 1XZQA 4YFVA 5DWDA 4BNHA 4EYGA 4YCSA 3HK2A 3NT2A 1P81A 4OXQA 1R9GA 2CHEA 4QQFA 2C1EA 4LQLA 1SRQA 2C20A 4IYJA 3E5HA 2VOEA 2ISCA 3SXPA 2NV2B 4CV0A 2GEBA 1UDAA 3NO4A 1XJ0A 3PR2B 4YECA 3NYRA 1T5LA 3PNVA 3V8MA 2MJLA 3RRZA 3K6KA 4WXRA 4F71A 1EDOA 2AKAB 2P3LA 3ZZMA 4QNRA 2Z9DA 3ANSA 3HY6A 4WESB 9ABPA 2GX6A 4YRLA 2Z4RA 5KWEA 4RQBA 3UWPA 3KT8A 4WADA 1FYDA 5DNUA 5J4VA 4CKZA 3GFQA 4LE1A 2DPXA 1KYTA 2QN9A 2OCAA 5IJWA 5KNLA 4DZRA 3WAKA 1XOIA 5IKMA 3DPSA 1I30A 1N1EA 2W98A 3GJ0A 3QYAA 2JGLA 1AQJA 2HLNA 1C2YA 2UZ1A 3EASA 4UUNA 1QJ4A 3HHPA 3DEHA 1QWOA 1DKOA 3ECAA 4BN0A 2AV6A 3S70A 1QVVA 4MCJA 2QKYA 4RYLA 1V3TA 2KI5A 3H16A 4ZO6A 2X0JA 3GGPA 2QE6A 3LLVA 3DO6A 3QLJA 4I6JA 1E1QA 4RJIA 3ZDYB 4HVLA 5BR4A 1PG5A 1JJIA 4LXTA 1WABA 1USWA 1ZD8A 4IHJF 4HZUA 3SVTA 2HQBA 3K9BA 4H7EA 1QH0A 1A9OA 1ADCA 3LQYA 2CE7A 4NZMA 1OBHA 1SG0A 3EJ6A 3G8BA 3I72A 4G5YA 3H5TA 3R7BA 1D5WA 2FCRA 1EEXB 1NVAA 3QWAA 1QLJA 1XXHE 4QHSA 3DVAB 4TLDA 2FVXA 2AB0A 2GESA 5KNDH 5FJJA 2AXPA 2PUAA 3GVPA 4R8RA 1RLTA 5EKUA 4H7PA 2JAWA 2QTRA 3OC0A 4MR7B 2RAVA 3HDJA 1GNQA 1TQ6A 3BN3A 1QE5A 3FVVA 3O4RA 4K1XA 4TSRA 4TKVB 3D3QA 3QVUA 4NNOA 4UJ3A 4Z2YA 2WSYB 4YPFA 4GPIB 3RVQA 5A4KA 1PS0A 1UBKS 2FUEA 5AKZA 3KB1A 5KPJA 1DINA 1OX4A 1BW9A 2RFLA 3KOWA 5EJFA 3V1UA 2I7DA 3K9GA 4JROA 1QO9A 3G8YA 1MRZA 3JTEA 2HX1A 3DBIA 1TCCA 3REQA 3UO8B 4BP9A 1OW3B 2NO5A 3OBBA 4URYR 2WKWA 3WK9A 1UDBA 2X5XA 3VVLA 2PZBA 2JHAA 4Q4HA 1KDPA 1Y3CE 1LQTA 2ANCA 1OFTA 1T3GA 2YOFA 4KSYA 1KSHA 2PT9A 4MV0A 2BEKA 2AOVA 4WGFA 2WZQA 2GTHA 3V46A 2XRZA 3L7JA 1F1BA 1ONNA 2PFKA 1BS2A 3QENA 5I4BA 5IN4A 1OU0A 1W1IA 3CISA 4PO3X 1OREA 3TTYA 1GR1A 2PZKA 2Z57A 4W9RA 2VA9A 3T94A 4MUXA 4D9GA 1LSOA 1XYGA 4RZ2A 5A6SA 2J30A 4DCNA 5AVOA 1L3CA 1TT5B 3NAZA 2CK3A 4OH7A 3JATA 1JHMA 1OB2A 2GN9A 1XLTC 1FYWA 2X15A 2C1ZA 1Q0UA