1ZOSA

Structure of 5'-methylthionadenosine/s-adenosylhomocysteine nucleosidase from s. pneumoniae with a transition-state inhibitor mt-imma
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
230
structure length
230
Chain Sequence
MKIGIIAAMPEELAYLVQHLDNTQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVAILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFESDKTFVAQIQESLSQLDQNWHLGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGAAIAQAAHTLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVLLAFLKALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 5'-methylthioadenosine / S-adenosylhomocysteine nucleosidase
publication title Structure and inhibition of a quorum sensing target from Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae r6
total genus 74
structure length 230
sequence length 230
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.2.16: Methylthioadenosine nucleosidase.
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zosA00
1V41E 4L5YA 5B7PA 3E9ZA 3OPVA 4EB8A 4GLFA 2OXFA 4YO8A 4L5AA 1PBNA 1ULBA 1Y1QA 1Z38A 2P4SA 1V48A 5B7QA 5FAKA 3SCZA 1TGVA 4LKRA 2QPLA 1SJ9A 4WKOA 1I80A 4DA6A 5CYGA 3EUEA 1SD2A 1Z36A 4UC0A 4WKNA 1PK7A 1PR2A 3IEXA 4LDNA 5F73A 3O6VA 1A9QA 4L6IA 1T8YA 1RR6A 4MCIA 1JDZA 1OTYA 1PW7A 4YNBA 5F7JA 1V45E 2GUWA 3DPSA 3UAZA 4H1TA 1T8SA 4RJ2A 2XRFA 5F7XA 3EMVA 1Z5OA 1OUMA 1RFGE 1U1EA 3UAWA 4YMLA 4ECEA 4U2KA 1PF7E 1V2HE 1ODJA 5I3CA 4M1EA 1B8OA 1RSZA 4BN0A 1PR0A 1K27A 3F8WA 1C3XA 1QE5A 3KVVA 3LGSA 3BGSA 4QASA 5F7ZA 1VHWA 4GKAA 1Z5PA 1NC3A 1TGYA 1RXUA 3C74A 4QEZA 2ON6A 4L5CA 4LNHA 1A9TA 4D98A 1YR3A 4L0MA 4NY1A 4MARA 1ZOSA 1VMKA 3DDOA 4IP0A 4F3CA 4DANA 4MCHA 1JE0A 5CXQA 5EFOA 3IOMA 1VHJA 2I4TA 4TS3A 2I8AA 4WKCA 1XE3A 1PR6A 4QARA 2A0XA 2HRDA 4PNPA 5CCDA 3GB9A 4TTJA 1RXSA 4R2XA 1T0UA 2AI3A 3E9RA 1PK9A 5CXSA 3T94A 3PHBE 5F77A 3INYA 2QSUA 1JDUA 4TS9A 3DJFA 3TL6A 2AI1A 3K8OE 4D8XA 2A0WA 1ECPA 4OGKA 4OJTA 3NBQA 1A9SA 1RYZA 4TXMA 1ULAA 4DA8A 4M3NA 1OTXA 1U1CA 3KU4A 1YBFA 5B7NA 5IFKA 4BMYA 3LA8A 5B7GA 4EARA 3NM4A 4G41A 1CG6A 1V3QE 5F78A 3UAYA 3KVRA 3MMSA 1SQ6A 1YRYE 2QDKA 3OF3A 1U1FA 3NM6B 3QPBA 4F2WA 1V4NA 2A0YA 1A69A 2HWUA 2AC7A 5EUBA 4TTAA 1WTAA 3ODGA 3OOEA 1NC1A 2PGAA 3PNSA 3OOHA 4BMZA 3EUFA 1M73E 4OF4A 4YJKA 1OU4A 4KN5A 1ODLA 5KB3A 3D1VA 1TCVA 4DAOA 3PNPA 1OV6A 3ONVA 1VFNA 4G89A 1A9RA 4JWTA 3KUKA 3DP9A 1G2OA 1YQUA 3BSFA 5K1ZA 2AI2A 4F3KA 4TTIA 2ISCA 1Y6RA 1N3IA 3EEIA 5EPUA 3U40A 4GLJA 1PR1A 1YQQA 4DABA 1RXCA 4TXJA 2RJ3A 4X24A 3OZCA 2B94A 2HSWA 1Z34A 4R31A 4FFSA 4OGLA 4LZWA 1RXYA 4DAEA 1JDTA 4DARA 3P0FA 4R2WA 1T8RA 3FNQA 1Z5NA 3O4VA 1K3FA 1TD1A 3MB8A 3FOWA 3ENZA 5F76A 1LV8A 1PKEA 4F1WA 1PR4A 3DF9A 4WKPA 4PR3A 1JPVA 4TYMA 5IU6A 4TXHA 3BL6A 4I2VA 4D8YA 1Z39A 4D8VA 3E0QA 4TXNA 2OECA 4DA0A 4QAQA 1RCTE 4K6OA 1SD1A 2A8YA 4M7WA 4DA7A 1CB0A 1ODKA 1U1DA 3FB1A 1Z37A 4BMXA 3KVYA 1NW4A 5F7OA 2OC9A 1A9PA 3FAZA 4NS1A 1U1GA 3LBAA 3BJEA 4JOSA 1Z35A 1ODIA 1T8WA 4OEHA 1JE1A 2IQ5A 1LX7A 2OC4A 2QTTA 4G8JA 2QTGA 5CYFA 1JDVA 1K9SA 4E1VA 3UAXA 3K8QA 4QFBA 1Y1TA 3PHCA 1JDSA 1TCUA 4TXLA 2Q7OE 3KHSA 3NM5A 5ETJA 1RT9A 3FWPA 1A9OA 3OZEA 5DK6A 1Y6QA 1Y1RA 3OCCA 4LNAA 3OZBA 4QATA 4JP5A 4D9HA 2HN9A 3OZDA 1Y1SA 1LVUA 1PR5A 3P0EA 4NSNA 1Q1GA 5CCEA 1JP7A 1ZL2A 5C80A 4F2PA 2BSXA 4GMHA 4OY3A 2H8GA 3FUCA 3UAVA 3UT6A 4P54A 1B8NA 4WKBA 1FXUA 1Z33A 1OVGA 5JPCA 1PWYE 1JYSA 3GGSA
chains in the Genus database with same CATH superfamily
2M2IA 1UBMS 2C2ZA 4WBNB 2GZAA 2X9NA 1XNHA 4I50F 5F2EA 5HTOA 2CNOA 1U5BB 1UQRA 4DV3B 2PUDA 5JJKA 4B6EA 2RKWA 3PXDA 4ZVQA 3DZKA 3NU1A 4BO7A 2EERA 4RMIA 4WN3A 1XEFA 1K68A 2QV0A 2XWQA 4PLHA 2ZRNA 4BNVA 4D9IA 3NI2A 3X2SA 1IB0A 2VJMA 3EC7A 4FS3A 3NBKA 1LTHR 1ZD8A 4LDZA 5DTRA 5I8PA 3L84A 1U8XX 1BE0A 1DDGA 1J06A 1W9HA 4KXMA 2IYYA 2NXEA 4B17A 3L49A 2R87A 4UXJA 4UEKA 1G5RA 1T1RA 1X3LA 3MWDB 1EA5A 5FNVA 3ZYZA 2Q1SA 2KJQA 5TMPA 5DSTA 4IV5A 4UNNA 4YRDA 4B3MB 1RRKA 3KELA 4EIWA 1G8AA 1PT9A 2W2NA 2M6RA 3MB5A 1YOVB 3DLTA 5J2TF 4PQFA 3PXEA 1M34B 2P9CA 4OYYA 5JRZA 2IYAA 3W0LB 3VGJA 2C0QA 1AN9A 1AUOA 2XYVA 5HQ3B 4Q4JB 2JIMA 1C1XB 2DQSA 3THXB 2P9QA 5C32A 3JZMA 1P9OA 5IM5A 3LCMA 1T91A 4NZYA 3ZCUA 4H1VA 1H9CA 4DRXB 1QE0A 3EVDA 1RKBA 1WZCA 2XOKD 2V1UA 1E2DA 2BL4A 4KE7A 2J30A 2EG9A 3OM0A 1F6BA 4FJ1A 4B7AA 2XTMA 2GJ8A 4R8RA 4YNBA 1USUA 5LMNB 1QH9A 1F0NA 1R0CA 3GDFA 1MG5A 4HWSA 4IFBA 4AQYB 5KYGA 4JSRA 4DKJA 3EGDA 1E69A 2X0IA 2ZIAA 2QRUA 5FAXA 4DG5A 4KAFA 2WY2D 4RD0A 4DIEA 1X7DA 2HMYB 2XRZA 1RJ9A 1T8SA 3OM9A 4YRJA 1PV2A 2R6FA 3KT8A 1K7SN 2P9HA 4OMUA 4PQYA 5KDLA 3DFMA 1QO7A 3EZ2A 4J0FA 2EJWA 4DM7A 5B5SA 1DJMA 3CB4A 5F1KA 3ITNA 5KJCA 2WTEA 1KAMA 1FDRA 3AILA 4URWR 4ZPJA 2REXB 3UA4A 3SS8A 3E9MA 5LMCA 5HIIA 1Y8RB 3RRFA 2GETA 2QT0A 4MVJD 2FFJA 3L46A 3QV1A 3IC5A 2IGBA 1IG3A 2F6RA 3W3AA 4CL0A 3DAOA 2PZGA 3G1WA 2PHZA 4LWZA 5KYXB 1HZZC 4DQXA 2CT8A 4UTRA 4WZBA 4C7XA 4QO8A 1E64A 2PZKA 2H06A 4IUDS 3TE6A 3ORHA 3HNOA 4HN4B 3P9YA 5H3LA 5EJ4A 1JILA 1K3UB 3IP6A 2BN4A 2C9DA 2QJOA 1FDOA 3PUHA 4Q9DA 5K01A 3VU9B 3C7TA 3E9EA 3SF8A 4MLCA 4UUNA 4H0NA 4UCFA 4FC6A 1GQ2A 1NY5A 4R1UA 5L7YA 5TPZD 1V37A 2O52A 5K4GA 4O4LA 2CXTA 4OQXA 3IDSA 4E5UA 2AT1A 1K0FA 4EY7A 3G2IA 1EA7A 1ONNA 1TK2A 4FTWA 4A0RA 4X66B 1ZGZA 1T8PA 2D0PB 1H65A 1U98A 4MPPA 4RACA 3ZQ6A 5DX1A 4PHTA 3NFYA 3R6DA 2O3QA 3DBHB 4L2IB 4RK0A 3UGJA 3TQOA 4RABA 3PC8A 3UXHA 2VWQA 3WLEA 5AW2A 3OQMA 3LPNA 4ROTA 4HB0A 3W4KA 4E09A 5KTOA 1T9AA 2AQIA 2JVIA 2GYYA 2IBSA 3VKUA 2CK3D 4AMGA 3QELA 3V4ZA 4AP6A 4NH4A 3OPMA 4EHHA 4F3CA 1X7HA 3L6CA 4DDMA 1XEWX 2CYAA 4R7GA 1ZIOA 3D3WB 3RC8A 3TDNA 2Q3LA 5E6RA 1N2GA 2PFSA 2XY4A 4C7OB 1ZU5A 3A3NA 3FNRA 3W6OA 3GZ4A 1JFSA 3Q72A 1M1NB 5LQAA 3PNBA 3MINA 1KZ4A 3GLHB 1JXQA 1OT5A 2RK6A 4ZYTA 1E9VA 4S0ZA 1E77A 3R0XA 1JQKA 2I3ZA 3IRVA 5KQGA 3RYHA 4B81A 4HK4A 2FPRA 1YDHA 4WKCA 3RTEA 4M7RA 2RC5A 2PMKA 1C0KA 1YI8A 5B6IA 3VDXA 4CM9A 2XB2A 4TZKA 2VA8A 4J03A 1V5EA 5T4FA 1LW7A 3VR4A 5FWYB 5HKAA 1DBPA 2H1RA 3KPVA 4KFUA 2EC5A 4Q3BA 3DEJA 4ZANA 5JSHA 1FFWA 2W11A 4OXYA 4YP7A 5C31A 2VQDA 3AUUA 1RI5A 3OKPA 4P0TA 3PHBE 3AEXA 3DEAA 4UMVA 5TX7A 2HA0A 3INYA 4F1JA 4MICA 4DBVO 1Z6PA 2WG0A 1AG9A 4W5WA 5K05A 4DXHA 2XQFA 4IIEA 2QMYA 4F8EA 4XM1A 2VWHA 4ZT6A 4D3FA 1RZRD 2VDUE 2XI4A 4XJVA 5F1OA 3LZDA 3TJZA 3GJQA 3JVUA 1ECPA 3PHGA 4C4OA 2EKPA 4DQUA 5IFLA 1XRLA 2FFAA 4TZ6A 3U7GA 5A9RA 1WF3A 4HKTA 4O0LA 5LQRA 2QLMA 3KUCA 5KQRA 1JTFA 1XCMA 1GPYA 1N9GB 1QGDA 2FUNB 2H6EA 4D99A 3BHNA 4J1TA 1P1HA 4RJJA 1N2CA 3EIFA 3KKMA 4KO1S 3GCDA 2PGLA 1P2SA 2O0JA 2Z6AA 3IJRA 3PJDA 3ONFA 4II2A 1EBUA 1Z2PX 4TV8F 4Z86A 3GXOA 1WMSA 5AHOA 3H97A 2WMOB 3E61A 1MOPA 1H2RS 3N3AC 1W36B 1EJ2A 1ZL0A 4CQJA 2Q9BA 4AMYA 4BQFA 3NVAA 4CETA 2BMEA 4TVSA 4DZRA 4A8PA 1U3TA 1HQDA 1EFKA 2ERYA 4FVTA 4R8VA 4R8MA 1ICIA 5DBFA 3SVZA 4A16A 1C30A 4C87A 4HNTA 2H2WA 3DZ8A 2YVAA 4WXMA 4BXOA 1HDGO 1MC5A 1GP2A 1RMQA 1F48A 5EHQA 5AVXA 3CH7A 1GVHA 2QI9C 4XYBA 2R9VA 1OY1A 1IQRA 1YWGO 5B1YA 1QZUA 3OSUA 1YC2A 2Q9CA 1N5MA 2QSYA 2V7XA 5G4KB 4JAVC 4GT1A 3AUSA 4R54A 4CBVA 5KMGA 4G25A 4I1UA 3GT7A 3ZDRA 4W9MC 2OZPA 3BMNB 2NO6A 3QK7A 4P93A 4QNMA 5BW4A 1TIPA 4DPKA 4JV5B 2ATIA 4W82A 4IGEA 1JG1A 4OF4A 4MDFA 2DPGA 3D43A 3SZRA 1MORA 2C96A 2FA9A 2NO9A 3E70C 3OOJA 4K05A 4RH3A 5AKJA 4I4TA 4D79A 2V9ZA 4IF4A 1J1UA 1G0NA 1LSOA 3LKDA 1VJCA 4IYRA 4K2AA 4J8PA 5CVUA 1TMGE 1G55A 3IXQA 4IVQA 4RHCA 4MW2A 4JVNA 5JXIA 1YDWA 4PS1A 1BC5A 1R7RA 3N2NA 3UMCA 1CUGA 1HQYE 4U7DA 4TL9A 1ZN2A 4RPGA 4TKUA 3KEMA 2BLNA 3OY7A 4Q4LA 5TF4A 1N3BA 2CF6A 4A8JB 2PS1A 4ENUA 3GDHA 1IY0A 3RUPA 4BO8A 4AN1A 4OFBA 2C7BA 5EXXA 2C9OA 1QJCA 5J59A 2JAQA 3CWQA 2D0DA 4IG9A 5K8LA 5CGZA 3ZXIA 3RFVA 4JJEA 5SV2A 2VATA 2EKQA 2WSMA 2QL7A 3JARA 3OZXA 2J41A 1VHQA 1LNQA 2P8JA 2D3WA 3H8WA 4JI4B 2ACEA 1ZSVA 4TSFA 1NG1A 3TXXA 1JG6A 2HQ1A 3KKKA 5D6OA 3R7BA 1BGXT 4G5OA 4NG4A 1T9DA 3NOOA 3VH1A 3EXAA 3FMPB 1QDLB 3O2NA 4HT3B 1EFRA 1QYCA 3SHVA 2DFNA 3TZLA 3IAS6 1SFRA 2IZ5A 3WL4A 1RNLA 3ZVLA 5DLPA 4F9EA 1QHHB 3MWGA 4M6WA 5DK4A 5CG2A 2BEVA 2C5GA 1LF5A 4LZJA 3EPHA 1Z2EA 2QE7A 3BWXA 2VP3A 4BQSA 2QHXA 1ZQ9A 5KQPA 1GL7A 1W19A 4HVCA 5FXMA 2DUMA 1H4QA 3OA0A 2PBFA 1KJ8A 3BVPA 1I4WA 4EZEA 3MT9A 3F1KA 1M6WA 4UUAA 2P5TB 2I1VB 4QXPA 1G41A 2FKAA 4B35A 1M7HA 2XWJI 1ZQ1A 3EGWA 1Z2NX 4UUQA 3O21A 5JS6A 2DBRA 1M72A 1CDZA 1DQZA 1UC4B 2IL1A 2Q3CA 3DWFA 3D8SA 3FYCA 3HXPA 5DBEX 3ZS9A 3NDIA 1ENYA 5A4JA 3QEAZ 4XPIB 1Q57A 2D8MA 2P2SA 5EIWA 3TXAA 3UEOA 4OK3A 3TFOA 3L8GA 3DW3X 3EDOA 4M86A 1F2VA 4MAAA 4P7FA 4Z99A 4ZVUA 1JEQB 2DTDA 4OP3A 3AL3A 4IIVA 1J0CA 4FE4A 3MGBA 4IQ8A 2QLBA 5KDOA 2WD7B 3PPWA 2HU2A 2ZWAA 1D07A 1ND5A 2DWQA 3T1TA 1VCNA 1ZIPA 1EUQA 3BZUA 1G8PA 4JJIA 5KNBD 3ENZA 2A57A 2A78A 3E9YA 2P65A 1SCNE 2OCBA 5BYKA 1ETUA 4EAAA 4C0BA 3TECE 2BZGA 2RG1A 4FD2A 3ESQA 5LBIA 2E87A 3UJDA 2PS0A 2UZ3A 4PPGA 4F1WA 3PU6A 4WV3A 4ERXA 5JC8A 1VLHA 3GLFE 1NRWA 1AM4D 4KQJA 5JVDB 3KVNA 1CF4A 4PNZA 2YZKA 2EHDA 1N2JA 3PRKE 5KTTA 1LLCA 1LW6E 3A05A 5JNTA 3D8TA 2ST1A 1F06A 3GLVA 3R44A 3EOZA 3MD9A 3WTCA 1QIJA 5ITWA 2AUTA 4C88A 1TZBA 3AVWA 1NJ1A 2A86A 2CDBA 3KOUA 3QVMA 4I1IA 5ED0A 4RF2A 3V32A 4OYRA 1NONA 1G60A 5CA0A 5C7LO 2VEOA 4CIXA 3E9CA 1WUJS 4U5QA 2J7PD 2XNSA 5HIJA 4PZCA 5A3RA 2JD1A 1V3UA 2CCKA 3MJVA 1BQEA 1TYEB 4H3SA 3IHKA 3K8YA 3RU7A 3U31A 1GUAA 1X6VA 1AUVA 4M7WA 4ARVA 2NTNA 4YT8A 4OQQA 4X3PA 1B2RA 4EQ6B 2W4MA 4JP2A 2V7WA 2Q3JA 4H7FA 5JG7A 1V3TA 4JUFA 1A9PA 3I28A 3H1BA 2XOKA 1T1JA 1VL6A 1TF7A 1C41A 2Q6IA 3DXZA 3LX8A 5JDCA 5GWXA 4B33A 4I9GA 3ETJA 2EHJA 3FIUA 4LJYA 4K9SA 4LAFA 2Y4NA 5B4TA 3QHPA 5EKUA 3QKSB 1U2ZA 2A5YB 4BNUA 3E8MA 5JDCC 1TQ4A 1LQTA 1DIRA 1ONPA 1W73A 3AI2A 5DEOA 4EABA 1BDBA 2MSNA 4XDHA 2W5UA 2NVWA 4G5SA 4AXBA 1PJAA 3X43A 3VNUA 3EDYA 4N49A 1TAHA 2M32A 2Z8ZA 3HCDA 1PV1A 3M3PA 4I08A 3ULKA 3LPCA 3V2HA 2MWMA 1QUFA 1HXHA 4MB0A 3C2QA 5JD4A 3HO6A 4RQBA 1OAAA 4E1VA 4BMVA 1JDJA 5F5XA 4ZIRB 4CV3A 3OQPA 4UMDA 2DBVO 4ZVKA 1UAAA 3KLOA 1G3MA 3IOCA 4RSHA 4QXQA 5GQSA 5HF5A 3DV0B 4MVJA 3U3XA 3HB0A 4UNIA 4R1OA 1RHJA 3GFGA 4TXLA 1TA0A 1NBHA 3UJ6A 4F4DA 3CVXA 1E2LA 1H8ED 4DLUA 1KH1A 2XZPA 5JMPA 1W0KD 2Z95A 2X5JO 3TW0A 3PDWA 3AVXA 1GDHA 1S1CA 4ZODA 1BKDR 1N7GA 3HYCA 3ZKAA 1C0EA 3SDZA 1C7EA 3U4QB 3AEQB 3GNSA 4K9RA 2C7VA 3MRXA 3OZBA 2GJ4A 4X8MA 2ZWMA 2VK8A 1G5TA 1CY8A 2HLHA 4U00A 4CUJA 5ITVA 4K9KA 4D9HA 3PC2A 1YNSA 1W9MA 2O14A 5F5LA 1H2BA 1ZKDA 5A1JA 4RZHA 1LVUA 5TPZA 5EJ9A 4P4SA 2EU8A 4I9HA 1XZKA 4WZAB 3STYA 1IEWA 4Q3NA 4QU9A 1F5SA 4NXMB 4P4LA 1UM9B 5DBOA 1KF0A 1NFQA 4FFVA 5DLQC 2BSXA 4I3GA 3GRAA 3ZHRA 1IWBB 4X64B 5K8JB 1SBYA 3EWNA 2C29D 1YB4A 5JSFA 2OZLB 5FUWA 1C9DB 4BJ1A 4PO8A 4C0KA 3DMYA 3OQNA 3GLTA 4RKQA 3R5KA 2X2PA 3HJCA 1PLJA 2B1QA 4RXTA 2A84A 3RSGA 2II6A 1POWA 1TM1E 1NW5A 4WKBA 5J4YA 3AHDA 3R9XB 2CV0A 2XMQA 4LYDA 2I76A 2OQ2A 3RH0A 1ZGCA 1GVNB 2ZJ0A 2OM2A 4TYWA 1XRPA 1NV8A 2YINC 4EA9A 3VTKA 5KC9A 3TUJC 4G09A 4JN6B 1JH9A 2JCBA 3GGSA 3S2UA 3ZD6A 2HLDA 3A11A 5DB4A 5EWJB 3RQSA 1U0RA 4B3HA 4N3AA 3ES9A 1KDOA 5CLLA 1U7XA 4LOKA 2WJAA 2UVPB 1STOA 5KVCA 2EBWA 2FZGA 5DNYB 4ATNA 4K46A 3ZBUA 3CKYA 4QD3A 3SAJA 2Q4DA 4DLLA 5TC4A 4BJHB 1O4WA 3AX6A 2BT4A 4M83A 1DAIA 5BP7A 2NTJA 1C7ZA 2Y66A 1SRRA 3PL1A 5LM3A 1TCAA 3GGJA 2NU7A 3LRTA 2HXGA 2QT9A 3OZTA 1ZUIA 5KI6A 2VTBA 2XCUA 1JB9A 2NZVG 3C87A 5HZHA 2NTEA 1DLIA 4PHGA 2IITA 1P1JA 1XCJA 3FSJX 4BKRA 1KAQA 1PDVA 3SXUB 1QMGA 3MQ2A 4PPYA 1C9EA 3WNZA 4WGFA 4YRGA 1B23P 4ISCA 2Y9PB 4X85A 2O1XA 1ZMBA 1YVDA 2B9EA 2WT9A 1KGDA 5G1PA 1SD2A 3EXG1 4ENQA 1FUKA 1YJQA 5ERGB 5KU1A 3P45A 4WKNA 5CPFA 1XRNA 4AJ1A 4NP6A 1LRLA 1MVNA 2O8DA 4EFLA 1E66A 4Q00A 2JEZA 3RUCA 1RZRA 1KIFA 1SB8A 4RGQA 4KMRA 3F3YA 3WQRA 2C98A 3DT8A 1H2XA 4JVMA 1EUDA 4WXRA 2EFYA 2FSVA 3ELYA 4X5OA 1HT0A 5TQ0A 5FV7A 4E1AA 1V8OA 4ECAA 2C2GA 1H93A 2FNAA 2KYRA 2VQ3A 4MKFA 4E0BA 1R8XA 2VJPA 4QFCA 4Q9IA 5F4ZA 2BE9A 4DLZA 1Z7EA 3PFKA 1JDZA 1GZ6A 2F67A 2H1CA 3C15C 3PX3A 3ND8A 2JGAA 2IVFA 1U04A 3VKGA 3R7SA 4EO9A 2FSVC 5H1YA 1PYOA 2DWOA 3U7IA 2OA0A 3UC5A 4FC7A 1GUDA 4LUCA 3UQZA 3FWNA 3M33A 3VR2D 2BMWA 4H1TA 2JG3A 3KDPA 2C3MA 2YFQA 4RJ2A 1G38A 4Q9NA 3VU0A 4IHQA 3SYMA 2A14A 3MIIA 4JITA 4U3JB 2PTGA 1O9HA 1PJ8A 1S2MA 1Q1NA 4HWRA 5BWBA 1YHNA 2IYZA 2F17A 3T9DA 3NEJA 1LKZA 2GK6A 4EZBA 2CD9A 4O2AF 4YAFA 3VNSA 3WDLA 1UZLA 3HMQA 4C03A 3HBLA 4PYNA 1LDMA 5EP3A 3U7QA 3FOFC 3ZDAA 3PHLA 1VBKA 4MQFA 3OX2A 3CCBA 4GXRA 3HZRA 4M1EA 2W43A 2BFDA 2D5AA 1JJFA 2XBMA 1PQUA 1D1TA 4DR6B 3CNNA 2O3SA 3VZPA 3PWKA 1SU7A 3NCHA 4ZI7A 3I34X 2NNWB 1IJFA 1NL3A 4C4YA 3X1XA 3RJZA 2IKSA 3UH0A 4D4MA 4PC6A 4V38A 2IYFA 3G9XA 3GJ6A 2VZ8A 4LXIA 3P2OA 3EGCA 3MTEA 1OPXA 1IXKA 3AHGA 1PJ3A 1ZSYA 4KYTA 2IWRA 3W2HA 3EA0A 3LLCA 4C06A 4X84A 4Y1EA 4GI3A 1TVEA 1K7XB 1B0AA 1DOHA 2DWCA 2WICA 2POCA 3GUHA 3OP1A 1OWLA 2O05A 2NX2A 5CB4B 4AN4A 1QG4A 4O02B 4CLOB 3GYBA 5AVKA 3ILVA 3Q2KA 3F98A 2WILA 4FIDA 4CLXA 2R00A 2Z1DA 1TGYA 2YVUA 1ZD2P 1SXJE 2QY9A 3ICPA 5D1HA 5EKTA 1JFRA 5ULLA 4JR0A 2AYZA 3P9KA 2WWYA 4LMAA 3RS9A 5A9SA 2GCOA 1LF0A 5I7FA 2QGFA 4Q7LA 3B82A 1P2BA 4KXNA 4ZMBA 3JYNA 2R00C 2EJVA 2I2CA 1CUAA 1QV9A 2WF5A 1K5HA 2RHOA 4KVFA 4CI0B 3COVA 1L8OA 1MV5A 1XO1A 2O23A 2YYAA 3WQQA 4DCSA 4ETIA 1AQJA 2QD5A 1TLLA 4H7EA 4MV0A 1B93A 4Q39A 4E7OA 3AR7A 3AL2A 1HORA 3GCXA 1AK9A 3ZK9A 2ZI9A 4L75A 5DYGA 2H4JA 4Q3CA 3UG7A 4DANA 3OEHA 4JLWA 1VA5A 3QHAA 1KO8A 1N7HA 5F1YA 2B6HA 3LP5A 4KSYA 3LYUA 4D80A 2HMWA 2VK1A 4QWMA 4ZDIA 2G83A 4CFYA 5MN6A 3M6IA 2WHYA 5MFZA 1QE3A 4ENPA 4HDRA 4US0R 2BFFA 2ZRHA 1D2CA 1W6RA 3HA3A 3B51X 1GDDA 2HR1A 3NTRA 3PBKA 3CEMA 4BNTA 1M1YA 1G1MA 4J1SA 5HG0A 1SU6A 2RAPA 3CW8X 3NVDA 5AI9A 4POAA 4LTNA 3SFZA 3IBCA 3O26A 5M34A 5CT4A 3LY7A 1SZCA 4NU6A 2MSWA 4PNPA 1RCFA 1DGQA 2C1EA 2XITA 5IYZA 2OTCA 2YIMA 5B12A 1UZUA 2OK8A 4ES6A 4MLZA 4P22A 3LX4A 2RCYA 1F1JA 5JJCA 1CY2A 3RREA 4ESOA 1ZESA 1C9YA 2PA3A 1SBHA 2PVSA 3DZGA 3EARA 3SC6A 4CIAA 2PV0A 3EXHA 2GWHA 2D4AA 2P11A 2X5OA 1E89A 1MP0A 3QVWA 4L85A 1K88A 4MV7A 4J29A 2GS9A 3WICA 3EHDA 3JAWA 4OUDB 2WYIA 2GYWA 3DLBA 1Y3CE 2A6PA 3MMPA 3ITDA 2DT8A 2J3DA 4GOMD 1HR0B 1P62B 3BTVA 1T8TA 3H11B 1E32A 1CX9B 3H9UA 3B89A 4LXXA 2YXNA 4B76A 3P9RA 4IO1A 5BV8A 5AUOB 2C3PA 2RHDA 4MB2A 4R1SA 4KPGA 4RIIA 3T5GA 3DMFA 1HMPA 1FS6A 4MQEB 4WNIA 2R8YA 1SK8A 4GC5A 5HCNA 1ZM3A 5EL0A 1YQEA 2BEWA 3JYQA 4WFJA 2FG7C 2DVMA 1HE3A 3JD0A 1A5SB 4JJ7A 5U1PA 4CN8A 4GMXA 1WEHA 2W0SA 3LDAA 4XR9A 1UJ4A 3RVRA 2HHLA 1X2BA 1JHXA 4BMOB 4BVKA 3HXOA 1Q74A 3V4SA 1BZYA 4PZEA 2OEPA 2PN1A 2J7PA 2OBFA 5E7JA 2AUMA 2VFAA 4Y98A 1I2BA 2IKQA 3NHKA 4MAMA 5SY6A 1SC3A 3R5JA 3S1LA 4RA6A 4QXAA 1GTZA 2VZ9A 4WNAA 4WBSA 2GXQA 2IBTA 1Y5LA 4K1XA 4NABA 3WMRA 1K5DA 3DKPA 2BKUA 1UKBA 4DLYA 4H1HA 3CF0A 4LHWA 5BMVF 4JOCA 1TKCA 2QTMA 1YRLA 2FEOA 2RJOA 2BKAA 3EODA 4KSBA 4TLMB 2X77A 4R9UC 3AO0B 2BGWA 5BR4A 2ZRQA 1DB3A 1YR2A 2J85A 4UDOA 2XDYA 3RRJA 3O1JC 2JI4A 1NC1A 1XMJA 4RL6A 3BG5A 4JT2A 5BWNA 4ZQIA 4OAQA 3SXJA 2QM8A 3U6BA 1ZICA 4YJKA 2QD3A 4P4NA 4LZZA 2H9AA 2PBLA 4GUAA 1OKKA 1MHTA 2D5IA 2FRDA 4M0CA 1V16A 3CZQA 4LYAA 1XU4A 3T7KA 2ZZKA 1UL1X 3FPGA 4LRYA 4MUAA 1FMFA 2GJAA 1L7PA 1EWKA 1WKVA 3IALA 4RIEA 4XYLA 1NUUA 4MEBA 1TQ2A 2ZRBA 4LHEA 3TQIA 3V4RA 3ZQ4A 2D5BA 1VP3A 2M1ZA 3GFOA 4P2BA 1E92A 4HGZA 2W6IA 4N18A 2G72A 4YUZA 5IARA 3MHTA 4ABTA 1DKOA 5CLQA 2IV7A 3HGMA 3ZLVA 1FW6A 2VSNA 1AQIA 1H8EA 1LTQA 1SOVA 3GGPA 1EBFA 4PYKA 1T6YA 1W52X 4QBTA 1F3OA 1W0KA 1QM5A 3N2KA 3UMBA 4ARAA 1AZWA 1PD1A 1L7RA 3FI0A 5K0SA 3ER8A 1AK2A 4CL2A 1AA6A 1ZCJA 1CRZA 3BSFA 2ZWPA 5SZJA 2Z5GA 3UBMA 5LZ2A 5LZ9A 4OMFG 3FBGA 4RM3A 4AJOA 1P77A 4PLWA 3ZXXA 4IVNA 4AMUA 4RPIA 1NW3A 2ISCA 3NIWA 1K8YB 4O4JB 1KGSA 4YJHB 1NVMB 3PKIA 2XUKA 3DAGA 5KNCD 1U0HC 2R7LA 4KQWA 3VPXA 3ZVNA 2HYIC 3LVRE 2V0NA 3OEYA 2AOWA 3GJZA 5IS2A 3ET5A 2N9UA 4PIMA 1LZKA 2XT0A 2FZKA 5EC8A 1L5MA 1W5BA 3IQEA 1EX6A 2JD0A 5E9WA 2FPGB 1QFXA 1KE2A 2C77A 3AIIA 3OE1A 4ZTBA 3ZY3A 3D6NB 3HA7A 3GK3A 2JLSA 1B7GO 3EIHA 2WP8J 3OKAA 4RKRA 5H81A 4YLYA 1FJ2A 2OSVA 2ZSIA 4CW7A 2CLSA 1ANKA 3F5FA 2N42A 4Z4HA 4X95A 2GTIA 4R3WA 3H0KA 5ESXA 1H05A 2ZVQX 4R9VA 5DHRA 4PBRA 3DOIA 3ZDYB 1K8XB 4BLPA 4P34A 4D9MA 2YJZA 4LGCA 3JQ8A 3JAKB 4AL4A 2DEUA 3QE4A 2FP3A 3RVDA 3UHOA 1IQ0A 2NXNA 1HH4A 3LBFA 2QR2A 3R0JA 3B3GA 5T4BA 2ZYVX 2W2QA 3SZ3A 3ZHZA 2WB2A 3AQIA 2GZ1A 3IUYA 4G1MB 1RP7A 2H08A 4TRMA 3PIDA 4UVHA 2PZBA 4AZSA 2RK4A 2QUBA 2AMLA 1KVRA 2WFZA 1RHUA 4I8XA 2BW0A 1WP4A 2P68A 3NIBA 3LX5A 3HBAA 5G02A 1SVMA 1NVEA 2RONA 4L8YA 2FMFA 3DW1X 4NAUA 2W2TA 4HL6A 4RY9A 4EA7A 4F1KA 1A27A 4TLBA 4RKWA 1URPA 1QQAA 1Y0BA 3F4LA 1FC0A 3MN1A 1M2OA 5GM1A 1P0PA 1WV1A 2DCMA 3R5FA 2BZ0A 1F8UA 3WY9A 1NLYA 4I5EA 3DF9A 3S3TA 1L5QA 4UEOA 5DCYA 2PDAA 4QG3A 3B8EA 3V7NA 2JFYA 4I2VA 3L7MA 3WLIA 1NWCA 3DAYA 2H4FA 3A9TA 1R5OA 3HI4A 1VSTA 1P4HA 2IHJA 1ML4A 1YCFA 3EW7A 3T3HA 5KTRA 3EPKA 1GU7A 4NTZA 4LZPA 3V3KA 1XQXA 2WJZB 1SEPA 4C0WA 3UFXB 2REQB 2E7ZA 3CVVA 3TI9A 3HDTA 4FEAA 1F12A 1XPOA 1H6AA 3FMIA 4JKIA 5FYDA 5G0TA 3WGNA 3BRWA 5F9FA 1AKYA 2VT7A 2WU0A 3BXXA 3CUUA 2NUTA 4K6OA 1SD1A 4QTYA 3IDQA 4K86A 4ZKDA 2JGFA 3INRA 1D03A 1OH8A 2CNNA 2LGJA 2JRCA 1PW5A 3ANTA 2A94A 2NU6B 3HLKA 4PBTA 3ZBPA 1Z2OX 3JU3A 4BUZA 5E3HA 3HVHA 4DWOA 2CMFA 5L6MB 5CM8B 4ZO8A 3ZHQA 3TQTA 2FRXA 1UXHA 3FZQA 5F7OA 3A6HA 4RD6A 1UZMA 2Y0EA 4TT3D 1U11A 4BDTA 1QTQA 2B7CA 2IIVA 4X1IA 3AR6A 1Y34E 5EZQA 1KAEA 3PNOA 2B8NA 3MC1A 1R6UA 5B1SA 4DV4B 3L3BA 1DKQA 3FNFA 4CPDA 4CDNA 3NS7A 4HJXA 4UUPA 1EK0A 1Q1BA 4CEIA 1W34A 1QIEA 2HA5A 1EXWA 3G85A 2YJ6A 2IS2A 4IDQA 5IM4F 4M8LA 1EM6A 1P6QA 3M70A 3N0TA 4FUTA 1VG9B 2BBOA 1XU7A 5E7IA 4CR6A 4FQ8A 1V1RA 1G21A 1USKA 3C97A 3DG9A 4HAVA 1EQ2A 4MV3A 4DMUB 5C1BA 1PFWA 3IEMA 5JY1A 2IP1A 1KJQA 2NM0A 3H05A 4KE8A 3T3GA 2IH5A 5BW5A 1S9HA 3Q2OA 3TLBA 2WU4A 3ELUA 1QHIA 3EBOA 5DM1A 3ELDA 1B6RA 3BQ9A 3G2QA 1PK8A 1TCUA 2JS7A 3O95A 4RDXA 1WUYA 2NZXA 4NLLA 3TNFA 3DVLA 1E8DA 1LK7A 3GP5A 4R2IA 5DJ5A 3G0CA 3MS7A 1VL2A 4ZZ2A 4E5SA 5K6AC 2ZSFA 5TT1A 1RKVA 2XEDA 3Q3JB 1NXWA 5ALHA 1O6GA 4GE3A 2EOAA 1BMDA 3CLSD 4FHDA 4LNAA 2ZLBA 3HU2A 3INGA 3R76A 4G24A 4XDGA 4BN5A 3T7CA 3QXHA 3L06A 3KTFA 3U3JA 1OTHA 1UEIA 2R7MA 5DMXA 3WTBA 3F5MA 1EB8A 1ZWLA 1W29A 3BHIA 2PUHA 3TLZA 3K5HA 2ZYRA 3CJRA 4E2XA 3K3PA 4Q03A 5J4HA 3L1IA 3B6IA 5CU7A 3K1ZA 3GLQA 4RQUA 3W05A 3WMWA 4Y2GA 2O6LA 4Q9JA 2UVQA 1ZIYA 1UBKS 1ZD5A 3TIIA 1QZTA 5KO2A 2XUAA 5ABPA 1M33A 2ODTX 5KYYB 1RYDA 2F1KA 3K2BA 4PSCA 1ZW6A 3OOSA 2BFMA 3X1ZA 5T3UA 3UHPA 4B3RB 4MQUA 1M1ZA 2ZAIA 2WZCA 2FXIA 4KQ9A 4XX1A 3C1UA 3WI7A 2OG1A 4R40A 4Z3OA 1R0ZA 3BKWA 4Q02A 4E5NA 5A4AA 3A4MA 4TTVA 3RJTA 2PK3A 4LF4B 1KMMA 3DTVA 3H9GA 5ILQA 2JBWA 3O0DA 1P81A 3NXKA 2ZIFA 3C3JA 4DGSA 2OM6A 3EXFA 2IC5A 1BDIA 2ZIWB 4RK7A 3GT0A 3U9SA 4HUQA 3KOZA 4IZ6A 3ZWMA 4Q4HA 1FS5A 3AERB 1VDZA 1SC6A 3IQXA 2Q6TA 1QRAA 4K1LA 1DXOA 3ZWNA 4OLJA 5AJVB 5BXYA 4GS5A 4MDEA 2IS4A 2VUSA 3M5WA 4EYOA 3OLCX 4ARCA 4H7JA 3OIGA 4EPXA 3I3SR 3QM1A 4V1CI 2V7EA 3CF2A 1YZVA 1J0AA 4FFLA 4J4TA 1UT8A 4G0NA 1KK3A 2D1YA 2GBIA 2D7DA 3E22A 2B5WA 3KAKA 4PG4A 5K03A 1XPUA 1EVLA 5IXSA 1I80A 2G6BA 2FZWA 1FTNA 2FE1A 2RGUA 4IH4A 4HJRA 4RHUA 1I24A 1R0SA 4RW0A 4U02A 5JEEA 1AX9A 3AVUA 4JBIA 3QNWA 5FKJA 5E6UA 2KQUA 4DBLC 1SHJA 5K45A 1T6ZA 2Z3VA 4CUKA 1Z36A 2QV7A 1C4XA 3OMLA 3QVVA 5AKGA 3RBVA 3WFZA 1E2UA 4ZV9A 4HOYA 3VJLA 5JAOA 2CSXA 2I7CA 2J07A 1OFGA 3W1EA 1Z8HA 2VPWA 2BHLA 3H19A 3RR2A 5YASA 5ITZB 4CEJA 2X3UA 2WPNA 1GQQA 2E49A 2C3UA 4A82A 1W4ZA 1I6MA 2DWPA 1RR6A 3PDJA 4AY3A 1Q6YA 2P91A 3FPEA 1AGPA 3QPVA 4IMJB 4TVBA 3RAPR 2NUPB 3PQ5A 3GI1A 3A7EA 3FOEC 3VHQA 3JQCA 1X7XA 1PDOA 1B0PA 3CLTC 3N39C 4X63A 1NNEA 3R1IA 2B99A 4CV0A 1XG5A 1SG0A 2BMVA 4DMHA 5C53B 2AFRA 4NNJA 1VC2A 5BV1A 4QRHA 1KYQA 2OGZA 5E9JA 3HACA 4G37A 3DWIA 1ZMTA 4NCKA 4X1YB 4DCMA 5L53A 4TSRA 1IBLB 1X7GA 4NATA 1TMYA 1XD2A 2A92A 1HE2A 3AKDA 4KMMA 4OBEA 4RD3A 2HC9A 3E1GA 4CLRB 5T8KC 1UKCA 2I3BA 2PKRA 2VHXA 5A3QA 1BVHA 4Z9XA 1SXGA 2G82A 2IYWA 5F12A 3WRXC 2Z9CA 3DQQA 1Q0SA 2QKYA 4LSMA 1QJ4A 4UXHA 1HYGA 1X1BA 4OMCA 2Y0CA 4FNOA 5AW6A 1E2IA 4HZUB 3FROA 1YA6A 2C4UA 3HBFA 4Q82A 4MO2A 1KQNA 3TFQA 5A2QA 4W1QA 2Q2WA 2QX9A 1T3HA 1V2HE 1OAKA 4W9NA 4ABYA 3MG9A 3MFQA 3I76A 5ALGA 1OB5A 4HUJA 3PD7A 2VTDA 1SUCA 1A5AB 1RAAA 2XMGA 4BVBA 3HABA 4IXNA 1XD9A 3EWSA 1LNSA 1D1PA 5A6SA 3AJRA 3EXIB 1XA3A 3GAAA 1XZDA 4G4SP 3JV7A 1J5PA 1VBMA 4FGSA 3AR4A 1G7RA 4JYMA 1E6MA 4KX3A 4OJMX 2BHRA 1GWNA 4W9NC 3IA2A 4Y6RA 1UQTA 3UFBA 5C4IA 2JGRA 3EY9A 3LDUA 5K8CA 3JAMA 2I0FA 1QE5A 3MGAA 5BOSA 3RSOA 3V00A 5KVVA 1DV2A 4YYZA 2C20A 3BS4A 5NLLA 3TIVA 3KJZA 3IAFA 4Q15A 3FTPA 5GZ3A 3IO5A 4YVFA 3EJWA 3VR6H 4F3NA 1N33B 1YF3A 4N3GA 1UIMA 2QTNA 3H2BA 2VZLA 5FEUA 1AHNA 4YECA 3ZWWA 2HCBA 3X1YA 1I4LD 1R00A 1U3VA 5E2BA 3TUIC 2R4TA 2ODBA 1KVUA 4CI9A 2FMIA 4OJQA 1RQ7A 4DLVA 4FW9A 1CE8A 1JVNA 2JH9A 4WH0A 4RTRA 1CUWA 1I32A 4G5HA 5B55A 2ZRLA 3KCQA 5B36A 2J9FA 4LV6A 3PXAA 1PEAA 2ZE8A 5ERXA 2JJ8A 2WDZA 1QUEA 1T9HA 3MD0A 3U5ZB 1UMCA 1YRQA 2PGJA 3HGTA 3UOAB 2I65A 4K7JA 1OBHA 2UUAB 4BPBA 3ZX4A 2Y6VA 1DDOA 3D0QA 4BGUA 4DZZA 1TM7E 1ATIA 2QVCA 2W93A 3LAWA 3OEED 5LXTB 1KTIA 3L1HA 1BXGB 4DLPA 1ZCAA 5KNCA 3GC6A 1KU6A 3QKIA 1VXRA 3IKLA 2R7KA 5LD2B 1TZMA 1J2TA 2EF0A 1JFFB 4GI1A 3WYNA 2O7RA 3FW1A 3L6DA 4MYDA 3Q8LA 4QOGA 4Y18A 3JRNA 2YWGA 3EF3A 4IDNA 3IAHA 2WLTA 2XMBA 2ZE7A 3ASUA 1N1EA 4RPHA 5DNVA 3UNXA 2H5IA 2YWJA 1Q0QA 3CT4A 4FGKA 2AFHE 4CV1A 2X1MA 4XA8A 3EOAI 2O8BA 4MUBA 4RMGA 4W6ZA 3BRCA 4AMZA 4YXFA 2V7UA 4L4SA 4L4ZA 1XMQB 4KXUA 3AOEA 2P9JA 3ROFA 4LRXA 4XXHA 1EM8A 5FUXA 1A2BA 3E7WA 4FLFA 3K1AA 3R40A 1O77A 4Q4AA 1RXSA 3L6OO 2Y1WA 1EFPB 3CKMA 4E30A 1ITZA 2Q5EA 1GZ5A 3N86A 1BVRA 4CNQA 4DGQA 4NFSA 4EZIA 3CCFA 4N0DA 1TK9A 2IHVA 4L8GA 2W9XA 2WTBA 4PZZA 3L4BA 1K7EB 5DVZA 3WYEA 5KTMA 2CKDA 2RHHA 3FJYA 4PAQA 4NI5A 3MT8A 5EMKA 3WLAA 3N6RA 4PLPA 2EKBA 2JA1A 4HB2A 5G0UA 2WINI 1JDUA 1TA9A 3B1YA 5LP6C 4OCZA 3P0RA 3P4UA 4E2WA 1M8PA 3K2EA 4RV5A 1WUIS 1WCYA 5JDIA 3L4BC 1CERA 1ZITA 3OLQA 5BUZA 4JYBA 4Q3KA 2IOFA 3T7EA 3TW8B 4PIPA 3H5RA 4NMMA 4FGJA 5E3JA 5G41A 3H1PA 4GKJB 5LJIA 4R81A 2F90A 4JR2A 5F52A 1NVDA 3L0ZA 3P8ZA 4IO0A 4GGMX 2FHPA 4GBJA 3A31A 5DCLA 4DS3A 5JDIC 4NEHB 2IF0A 2IT1A 2QRPA 2DHQA 1FNDA 3K71B 1TA4A 5IFKA 4YRAA 4WQMA 4PICA 3PXGA 3TB6A 3BQMB 3K9BA 5HP4A 1XTKA 3KKZA 3U16A 5D3KA 1US8A 1EFVB 1EH5A 1KI6A 1NATA 1EFLA 2HCRA 2ZB3A 2ZYHA 3IMFA 2NV2B 3E05A 4IIGA 4QUGA 2Q0SA 1GTMA 1FSSA 3TG8A 1WHTB 3OT4A 4KQGA 4BEJA 3GA0A 4NK5A 4BRUA 1YZLA 2B7BA 5SYAA 2VTVA 3E18A 4JI1B 4FD3A 3SX4A 5L7TA 1GQFA 3T3IA 4IJUA 4RXMA 1TMOA 5CGQB 4J3FA 3TQFA 1VJDA 3A8TA 2AL7A 5FJJA 1S1MA 1X1SA 4JVSB 3B1WA 1ZOIA 1F8GA 4NH0A 2IPNA 2CFCA 1MC1A 2A0YA 2AMYA 2FQQA 2R85A 4CTKA 4JVOA 5LQKA 1UBEA 2HIHA 5A71A 2RARA 4TT3A 1QOZA 4BB0A 1MEJA 3LLUA 3T1YB 1W2HA 1UINA 1Y6JA 2W6OA 2V6JA 2WMDA 2EJCA 4KPFC 4WI1A 1HNWB 1T1GA 1VIVA 4KIGA 2O7NA 3MPOA 3WNVA 1ZLYA 4QJIA 3BXPA 3E03A 3KQMA 1YCHA 4GXTA 5A3VA 3RIHA 3IT2A 3DMPA 5AW7A 2P9FA 3RTGA 3VDRA 4C0LA 2RAVA 1N7IA 3I05A 4W5JA 3M1IA 3ORYA 1NPYA 4MI3A 2QBYA 1B2LA 3CEAA 3EFHA 2BE7A 2HCJB 4UFNA 2CLHB 4EY4A 4KLZA 3G23A 1V8PA 2TSYB 4UQPA 2VJQA 3I5XA 3PQEA 3ACCA 1S2LA 4DNXA 4LE1A 1SUBA 3VR0A 4E13A 4RTQA 1K8ZB 1T5LA 3PQ6A 3P52A 2PQ2A 4XWGA 2HY7A 4EJ0A 2G63A 3CJTA 4EPYA 2E55A 1TUBB 3JTEA 4D41A 2HMSA 4H35A 3PUWA 2OZKA 2Q3DA 4PYQA 4UJ5A 1M10A 1X80B 2XE7A 3M0EA 1SHLA 4EEXA 2OB2A 4K0KB 3RDPA 2W58A 5HF9A 1CUVA 4BKPA 3KUKA 4CQMA 3AVPA 3F74A 1E1LA 1USIA 2D1FA 2MINA 3ZHYA 3VOAA 3M4JA 4IMIB 3W5UA 1CVLA 1LJLA 1XDUA 2EWWA 5JMWA 2JIQA 4HGPA 1SKYE 1MD9A 5K1ZA 1BWQA 2CVZA 3T5CA 4KOAA 4HWKA 1C8KA 4BWVA 4DWVA 1ZI8A 3RSHA 3D0RA 1X70A 3ILXA 2QL6A 3JQAA 4HGNA 3ZUGA 2WWGA 3SR4A 1F60A 4TN1A 1E4YA 3M6FA 5AWFC 2R48A 1ZAYA 1QZZA 4AJKA 3U9LA 1A8QA 5KOJA 1DIGA 5DM0A 5HJ7A 1BQ4A 1K6JA 4HAYA 3MT7A 2GBGA 1P45A 1XLUA 1E7YA 1ZRMA 2GNPA 1R6DA 2D1RA 2BP7A 2IK8A 4DABA 4Q1CA 1YSCA 2J4DA 2AW5A 2CFRA 1KERA 2AXPA 4GPEA 2CV1A 2IIQA 3L6EA 4XVCA 5EJIA 1VHDA 2VP9A 2G8LA 3DCNA 3TVDA 4YACA 3EPJA 4KIJA 2XXBA 4ZHQF 1OX4A 1WW2A 4YQYA 3IOEA 3MMZA 3ST7A 5HIKA 1KI2A 2HDOA 1W581 2VAXA 1NLFA 1SURA 5L40A 3QVUA 3I2YX 2ZS9A 3IB6A 3FNHA 4GKVA 4D6XA 4PRYA 4ED9A 1KRHA 4TYYA 1HG0A 3A1WA 3CMMA 2P5YA 2FQWA 4XM0A 3WYGA 2B36A 2F48A 4GH5A 5C2JB 1Z4IA 2H4YA 3O4VA 1H2ZA 1QVRA 1E99A 5IJZA 1ETHA 1TD1A 3BXHA 5AESA 5KIAA 2VYVD 2DY0A 3QITA 5BNTA 5K0JA 2AEMA 1O96A 1T3LA 4Y1FA 2O54A 3SJBA 2I4IA 1B8VA 1Z6AA 2VXBA 1ZMRA 1UJ5A 1O0BA 5DIFA 4D4JA 4O2BB 1OZAA 2P9EA 2FUEA 1RLUA 2BMAA 5JQGF 4FGWA 4WKPA 3ZOKA 2IY7A 5A03A 4B6OA 3PENA 3ETEA 2PYZA 1EK6A 2UZ1A 2HLPA 3DBRB 3DR3A 3HSSA 5HS6A 3QE0A 1KDVA 3R7FA 1ECCA 1K66A 2IUEA 1CZKA 3RC2A 3WXBA 1KSHA 3DL4A 5CP8A 3O2JA 1MB9A 5REQB 3NHAA 1RWBA 1W5FA 2I34A 5I7HA 3ORQA 5AJZA 2NO7A 4OHXA 4PPFA 3TPCA 3RUEA 4MR9B 4DOMA 4Y6LA 2N0SA 5ENVA 4B0OA 1QAQA 3JYPA 3QA9A 4GQIA 4Z4QA 3MJFA 1MXHA 1LRJA 1SZDA 2FB9A 5C7OO 1J23A 5B1EA 3VUEA 3DXFA 1RAIA 1LLQA 5IT9A 4PX5A 2IXTA 4RULA 4PC1A 4A6PA 3PI6A 4L22A 3FZGA 2QX7A 1JZTA 4Q1DA 4JLKA 4URHA 2AG5A 1JS1X 1GSIA 3WB0A 1HT2E 1SXJD 2C1XA 4ZCPA 3WE7A 3AP2A 3DAHA 5LLSA 2Q6VA 4S1OA 3OJXA 2JIBA 4KK4A 3WGLA 4N5NA 1YZGA 4NBRA 2VBFA 1IVNA 1GILA 4MRVA 2G9UA 1TVCA 3IDFA 1T8WA 4J2OA 4J43A 3VKVA 4EHAA 1K86A 4UUMA 2A5GA 3SJUA 1AQNA 4HEHA 3LCVB 2ZB2A 2AJCA 3MWEB 3I5YA 2ZIXA 4HXYA 2DGDA 3HEMA 5IBRA 4B3BA 3A1DA 1CLEA 2UYYA 1BCSA 4P35A 2GPNA 5EE0A 5G53C 3U4HA 1WR8A 1XRSB 2IA5A 2AH5A 2ERXA 3I6BA 4ZOLF 1FP4B 5HCUA 1UDCA 3L8CA 5A7HA 4E12A 2WWTA 1AO0A 1B74A 4Q9HA 2CLOB 3TKYA 2B8JA 5CXUA 1JEAA 1JLLB 4PHHA 4L4YA 1EUZA 3EMDA 3KZCA 4P3KA 4QFBA 1Y1TA 2A30A 4X41A 4QHTA 1N5LA 3GJ3A 4ZV7A 3WO0A 3IQIX 5ES4B 3RFFA 1YVUA 2EGHA 5K7SA 3QUCA 1WBJB 4ILEA 5CTAA 4DIOA 5BSHA 2QMOA 2D00A 1RPNA 5T6BA 2O1EA 2PX5A 5FWNA 4H15A 2ZWOA 3D6MA 4NDNE 1MAUA 2CZCA 3U13A 1A9OA 3CLKA 3K6KA 4I7EA 2NUAB 1RJFA 3UJNA 4JUDX 2HUPA 2VDQB 1IJKA 1EFHA 3WOVA 2I4OA 1DJOA 1CR0A 3CWCA 3HP1A 2D1QA 5B2EA 5JD6A 1PWHA 5JSZB 2HA6A 3OX3A 4ZU6X 2VJYA 3LT4A 1QXSA 2Q6LA 3SC3A 4YGYA 1CDDA 2BV3A 1DT3A 3IBSA 2I80A 3JD1A 1Y1SA 3CR3C 2PWZA 2Q3MA 1OILA 3VX4A 2BDTA 1E1RD 3L7OA 3WLSA 3B6EA 3TWOA 2YYZA 2VK2A 3IA7A 4LK2A 1SRQA 3SK0A 1EAYA 3RVBA 3E7XA 2PRJA 1JA9A 1MV8A 4AFNA 3I37X 1HF3A 1W4AA 3IAXA 4EDHA 1B14A 5B3LA 1NJ5A 1UOOA 4IH1A 3JALA 2OPBA 2WUGA 3TOZA 1G8FA 3KSMA 4QFMA 1JHOA 1TW3A 2FMUA 2WABA 4BUJA 1ECJA 2ECPA 5AXCA 3LY8A 3K4HA 3DE4X 1L8QA 4TYPA 1Q83A 4LWPA 4GHWA 1M2NA 2PGIA 1QHXA 4NZ9A 4E1BA 1GUYA 1OXMA 1PQWA 3AH8A 2OGUA 1NJFA 1Z33A 4KQMA 4XWAA 3GPCA 1R8YA 3OEEA 4PTYA 2PZFA 3PHJA 5JPCA 1U63A 1JJVA 2H3EA 1YBMA 2HBYA 1JAYA 4JYCA 4QGAA 1BMFD 1Y33E 4ZDWA 5CMLA 2Z8YM 1XB2A 5K3FB 5HX7A 4U6NA 3EVFA 1E3JA 1DTWA 3IPXA 4XUDA 3IQFA 1F2TB 4L8WB 3OD1A 1NVUQ 4AYXA 3UXMA 2GZMA 4ACAA 4OI2A 4O5OA 2DJIA 3IILA 4B74A 4U4AA 1W4RA 1CY6A 2PMFA 4LXGA 2W71A 4CF4A 3QV2A 5KBYA 1V48A 1GPBA 5FAKA 2E5LB 5KPJA 2RGGA 4NFLA 3IP8A 4PZPA 4QSHA 5JAIA 4P81A 1N77A 3JPWA 4E5DA 1O5TA 1OLXA 1QH1A 4LC9A 4WKOA 2RH4A 1XN1A 3INTA 1JI0A 5CYGA 2P6MA 1EP9A 4X61A 5BN5A 3W8RA 1HM5A 1E62A 2KM1A 4B83A 2OZEA 5FUVA 1Z6QA 5KX5B 3DKVA 3FTDA 4YMSA 4FGUA 4M99A 4PWZA 2R97A 5ARCA 3ZWQA 1GFIA 3IEXA 4LDNA 4L78A 3O6VA 2VN8A 5HVNA 2HCFA 1MOQA 3EFOA 4L6IA 1CDEA 1DEHA 4JDUA 5AJYA 3L92A 1P7PA 2AG1A 5EZSA 4EKDA 1IY8A 1X1RA 1TD9A 3SZOA 4Z1MD 1DOZA 1N9ZA 3Q9LA 3RIEA 5DPMA 1QGUA 1Y9DA 1JKXA 4JC4A 4TX1A 4XQEA 1QH8B 4GGPA 4CCSA 3T9CA 1U28C 4B47A 1DKPA 2OCYC 1T36B 2W6MA 2YV4A 3EN0A 1YUMA 1CYDA 4P7BA 3H13A 5GONB 1NF3A 2AE1A 5D3QA 4AWAA 1TO2E 5BUQA 1UPXA 4HADA 5HJ2A 1V8DA 2GX6A 3SX2A 4H1UA 4UTVA 1U8YA 4WINA 3AGQA 3FHTA 3QWFA 4YDSA 3H42B 4XI9A 4B4OA 4IDAA 1VKNA 2XRFA 5F7XA 1FFCA 1NBAA 4YAIA 4UKDA 4L0DA 1Y3FE 4RCYA 1P2FA 3CPSA 3B20A 4MMZB 3K70D 3EGIA 3F4BA 1CTQA 3IJ5A 3LQQA 3DFFA 3UMFA 1X7ZB 3SZUA 1UFRA 5CBPA 4URUR 1FK8A 4R6WA 1KQ3A 1G64A 3DHVA 3DWGA 3QU5A 3O8NA 4LPKA 4OJNA 1O0SA 4RTJA 1GTJ1 2CLFB 2FF7A 2HM7A 1J20A 1QZ3A 4J90A 5IVIA 4MKIA 1ZVVA 3TR0A 2GAIA 2X0DA 1R6XA 3BF7A 2B2XA 3NO4A 4Z7QB 3WP0A 1KK0A 4C4RA 2J0SA 2WD8A 3SX0A 5IJ9A 1U99A 2RGEA 2VHYA 2YWBA 1PR0A 2RHMA 4OXKA 4WNCA 2PS3A 4YO7A 2VBCA 4EW1A 3W7VA 1BS9A 1C3XA 1LPPA 2WYWA 4QSMA 3S5JA 3RF7A 1TU3A 5ALZA 1O89A 1H2HA 3E1KA 4FYYA 3T3NA 3WQSB 4B6FA 4IIDA 3CSSA 3X2EA 4AY4A 2O6HA 3KOYA 2XH8A 1L5VA 4TKVB 4BO6A 5FF9A 2RHGB 2XUZA 2YZ7A 5IMSA 1YS2X 4GWLA 4JLBA 4A1OA 5LUAA 4LF8B 4XPZA 1P80A 1GXSA 2HFJA 3FNIA 5LJLA 2IYRA 2PH3A 2NT4A 1A82A 2ONZA 4QEZA 2J31A 5I7WA 5EE1A 1BFDA 5AW4A 1U3GA 1EGMB 4AJJA 1P7WA 4C89A 2OBNA 4FMBB 3PFHA 3R9WA 4Y0AA 3PXCX 1MPXA 1QWSA 1E9CA 1E1QD 2COEA 2WM9B 3CPJB 3NDRA 4L0MA 3LHIA 4L16A 2NN3C 4O4IB 3UMSA 4F9FA 1NMYA 3QW2A 3FPKA 4DJ5X 1T6NA 2B7LA 3E84A 4YBZA 2BHSA 5B1DA 1FFBA 3TBHA 3DDOA 2BAGA 3LNTA 3RSCA 4RHTA 4WOCA 2BLLA 2OXRA 4OREX 5JHGB 1OFUA 16PKA 2JKYA 2OO5A 3FCOA 4E3WA 3KALA 4XFDA 4QM6A 4QVKA 1W36C 4WLNA 2WSSD 4X7PA 1PJTA 2MSEB 2GQ0A 3HKDA 4KH0A 4EY5A 3LOPA 3MTIA 3UV6A 2O5CA 3CUVA 1SOUA 2CUZA 2FUKA 2QUIA 1JZQA 1GT91 3N8NA 1P74A 2EQBA 1UOPA 2EX1A 2VP6A 2WC1A 1GLNA 1Z4KA 3DDWA 3IEUA 1SBCA 1SY7A 2ENUA 2GPYA 4FZ5A 3JATB 4JUBA 2XTAA 3S27A 2H92A 3ND5A 4YGXB 2B6NA 2W0MA 3DAPA 2QS9A 3JQGA 3MA0A 3R5TA 5LQUA 4LX8A 2FPOA 1XZFA 2DHRA 2QLNA 4G84A 4KGZA 1UPCA 3DDNA 4EG4A 4ND8B 1DFIA 4JODA 3ZD8A 4LCBA 3DEZA 1MXFA 5FI0B 3KLMX 4LRSB 2LDXA 1UC8A 2DF8A 2DSNA 2HXYA 1JAHA 3D02A 3I5MA 3KUXA 2HV9A 4Q48A 2MR5A 2ZYGA 1R27A 4RE5A 3SKVA 4DLXA 1ID8A 1KBQA 4NOKA 2H85A 2PT6A 1RVDA 1UKAA 1UT5A 2XGMA 3BHJA 3LSYA 1AY0A 3IXLA 4G4JA 4GR5A 3TB4A 5HWSA 4MKRA 3P2EA 5H4HA 2HNKA 5JASA 1WHSA 1JU9A 3IEKA 5BSEA 4L8VA 3RVSA 1O95C 2F9LA 3ZWYA 5EXSA 5CYPA 4II7A 4KXXA 4ZRMA 3VNRA 3AF6A 5CVJA 4NDAA 2FMHA 1GQOA 2H5JA 4I5GA 4NJMB 4A8JC 1CQIB 5AI5A 2OR3A 1Y7TA 4M3NA 4KOEC 3V9AA 3V7YA 1XXHB 1OZ0A 2D06A 4FNGA 1O94D 4BMDA 3GF4A 1OROA 1Q2XA 2BTQA 2GBPA 4OPMA 2H2IA 5B7NA 4UNQA 4RZIA 3SC4A 2CZQA 2AZXA 2MIIA 3OTHA 3L0YA 2HPVA 4JQSA 3HYSA 3NM4A 4GC9A 1AGRA 4LHYA 1CZUA 3N7TA 2BISA 2PD3A 1VYVA 1MR3F 3LUAA 5CITA 1P1FA 3PQCA 3VNQA 5AM2A 3HKEB 1ZRSA 3OM1A 4GMKA 3UAGA 2X7HA 1EWYA 1N2XA 2X23A 3OECA 4EJMA 4RL4A 1O5OA 2ZXFA 3FWYA 3Q7IA 4KN8A 1KPHA 3U4DA 3MQFA 4AC9A 4CKBA 2GBFA 4ZKEA 4JT9A 3RW9A 1MHPA 2R79A 2FLKA 3UWOA 4BGVA 5FBVB 3PL5A 2DHEA 3I62A 1YZ3A 3WX0A 4F72A 2DPXA 5E3IA 2CXPA 4N5IX 3KXPA 3O03A 3UTCA 4DUYB 1U2SA 5ECWA 1Q20A 2E4VA 4E15A 2ICAA 1X9HA 4L76A 3NV7A 2BF7A 3IIEA 3T52A 5BSMA 2ODQA 3FN4A 1A1SA 3ODGA 3DQZA 3P9ZA 3QUAA 4GRDA 4NARA 2I8LA 3GR6A 5KWEA 4DB2A 3AONB 3TMYA 4M4SA 1YNOA 2Q99A 1V5FA 2WFAA 3BA6A 4WVLA 1CUSA 1VL8A 2C61A 5KYUA 1AU9A 2XMSA 4B6RA 4C3ZA 1G4HA 3K9QO 4BMZA 1WCXA 4HB3A 5FO0A 1SUEA 1PKXA 3K9LA 3MUNA 2XLCA 4LJ7A 2V3VA 3E9QA 4HV4A 2CDCA 2SECE 1NLUA 4F5ZA 1WETA 2WKQA 2VA9A 3GLHE 4P32A 5A06A 1EUCA 3TNJA 1MJGM 1SA0B 3ZE2B 1YIDA 3TTYA 2GMWA 3R8XA 3N5CA 1P33A 3AR3A 5EHNA 4FMPA 1W5TA 1Y5RA 4DDKA 2IJGX 3N8IA 2HA4A 1Z0FA 2Z2YA 4RA9A 1YCDA 2JFWA 4R2LA 5FOXA 3ZD7A 3IB3A 3RSSA 2IHTA 2YASA 2XXAA 3KC2A 5JYDA 2QAGA 3HKCA 4YALA 4RVFA 1BWPA 1PT7A 4D7AA 1FDUA 1KZ7B 3BD8A 2YICA 5TJHA 3ZWXA 2OCDA 4YT2A 5HOEA 2VJAA 3TH5A 1NQTA 4XARA 5D3ZA 1SUSA 1W47A 1ZRNA 1B15A 4FK8A 4YWJA 2XMRA 2R86A 3QOFA 1CETA 1LEHA 2MYPA 4Q66C 2N46A 2EGUA 3UENA 4YV0A 2VPQA 3OQVA 4TQ9A 3GP3A 5CX1B 2Z6VA 1PVVA 2H2FA 1NBMA 4LXUA 4NQZA 2QE6A 3LF1A 4GLJA 4QQNA 2PSJA 3FTEA 1I0IA 1TQHA 4V0ME 1Y37A 3IIIA 5AJWA 4ZD6A 2YWFA 3BZWA 4D57A 4OHYA 3ILYA 3E2IA 3DHEA 4QUDA 3WJ7A 1G98A 4L73A 1PS8A 1WP9A 3BFXA 1XZIA 3H5TA 2ZI4A 3ROGA 5GIOE 1N5DA 2RJ3A 1I4EB 2J09A 1RQRA 4ZXPA 4BN4A 2IRWA 1CUXA 1Z34A 4DCJA 5C18A 4AS2A 4ZCLA 3RTAA 4P86A 3C3AA 4YMUA 1A76A 2ADMA 3KSBC 1F4VA 1PQYA 2PZLA 4BB9A 4D42A 5DULA 2R3SA 3FDZB 1N8TA 4DAEA 1GRVA 5E4JA 4HRVA 1AGYA 1P61B 3TSYA 4YT4A 3AM3A 2V8OA 3CX3A 3FFWA 1ZH0A 3O2SB 3C24A 4BIIA 3EHEA 4CU2A 2ZQ5A 2VJKA 2I99A 1TJNA 2J9YB 4HDSA 3PFFA 1T8RA 2DBZA 1BMFA 1Y3BE 2OOKA 3DUFB 4X6YA 5ADVA 4J6EA 1HWYA 2XJ4A 3LF2A 4AKIA 1GARA 1IHOA 1MC8A 1E0JA 2QLLA 2WHXA 1EX7A 4FDVA 1U9CA 4WLFA 5I9TA 3K09C 4CMIB 5JH7A 1BDJA 1UKYA 1FMTA 1XMIA 3MZ0A 3HFSA 4FYJA 2AN3A 2IUUA 3ETHA 1RWOA 2LPMA 3FYTA 4CF5A 2FSGA 2P6PA 2WTAA 5DE3A 3VR5H 3LVQE 3ZTWA 1ST2A 1AUPA 1ABBA 1HLGA 4WFIA 1FRFS 3PPYA 4DSAA 5AI0A 4GSLA 1HX7A 4PR3A 3FA2A 4Q3EA 4JLSA 4NENB 5SY4A 4C4ZA 3I42A 5JZOA 1XROA 4G4IA 1N3YA 4KYIB 1QLJA 5ECYA 4B8ZA 4DY6A 1KO7A 3U1TA 1TTQB 4O3FA 1HDRA 2ETVA 2OECA 2AWOA 1FUIA 5J4KA 5KCMA 2RBEA 2VSQA 5BR7A 3L0BA 1QS0A 4JP1A 3BE8A 1L7MA 4PVCA 3FLAA 3S8MA 4F85A 2SCUA 2JANA 4WOBA 5K3SA 1N6KA 3HEBA 4JOQA 4OK5A 2VH2A 3DE6X 3NEAA 1QFSA 2WWRA 2C99A 4M9UA 4O2AA 3TD6A 3V1TC 4C0XA 1HTTA 1XZMA 4LJRA 1LZLA 4ENTA 1NNI1 2VOEA 1R9NA 5IAKA 1BHQ1 5F4BA 4PSKA 1AGNA 4CTJA 5LDDC 1G66A 4NS1A 4QECA 3AJ8A 5JMTA 2ZM6B 4PCUA 1E3QA 1NI3A 5E95A 3AP1A 2BRUA 4WOKA 4DLRA 1KMIY 1RE1A 3ABOB 1GDTA 1U90A 3K0FA 1Z0AA 5H9VA 3SYKA 2JASA 1RYMA 3QZUA 4HAOA 4D02A 3KQYA 3IQDB 1KK2A 2IUYA 1B1CA 1GZSA 1L9KA 1JE1A 1UODA 3D7LA 5JIBA 1AN0A 2BRUC 1GFSA 4ACBA 1KJZA 5EWLB 1NASA 1BKSB 1TX4B 1BCRB 1SKUA 3QSGA 1BA3A 3OBIA 4OSEA 1KY5A 3AFHA 2QX6A 4PGGA 1DWQA 3U0BA 4O3MA 4K8OA 4IIJB 3RHZA 1M76A 1ZISA 1SHKA 3QG1A 4AO6A 4JUIA 2QMQA 3RFTA 3ZX5A 4U0JA 3W5BA 4Q12A 4LFCB 4PSDA 5D8DA 4LFBB 4B9EA 1HYEA 2CXSA 3TRHA 2O2GA 2WP0A 1CU1A 1LPMA 2XB4A 1E6UA 5DWVA 1YACA 3BICA 1H0RA 1MMFB 3NPMA 3K0CC 3PHCA 3PLRA 4A0GA 4CKCA 1JBEA 3V5NA 2H48A 4RFVA 3GUCA 2V54A 1QG2A 2BGKA 2WJJA 1KJNA 2GSWA 2X14A 3CEHA 3QKRA 2ZZMA 1JQ5A 4ZDJA 4XYMA 5KYNA 3B52X 3ZKWA 1PL6A 5LCXA 2CFOA 2DFLA 2VJMB 4X62B 1DKNA 1J0EA 3H4VA 5AO9A 5DN6D 2AZ4A 4GP9A 3NTUA 3ZE1B 1U2PA 3V1NA 2MTBA 1PWZA 2XOXA 3ZEIA 4H4EA 5I9BA 2QG9A 4YUAA 1CRPA 3CZMA 1Z26A 4ZEWA 1VRVA 5E6SA 3CVYA 5FNVB 1S8AA 4RFLA 2EARA 3CUEF 1M0TA 2PU5A 4XJSA 3WWOA 1NVFA 3EQ7A 4PXSA 1JP7A 1YONA 2VKTA 3I4CA 1T3TA 1CUDA 1VPLA 1IE3A 2WI8A 3G8BA 4FZRA 3ORSA 1SCKA 4Q34A 3ZOZA 2BEJA 2FR8C 2GPWA 4HCJA 4MJXA 1VCIA 3FGOA 1B0UA 1I7PA 4ZRNA 5BYJA 3ZXYA 2SKCA 3LXMA 2E82A 2QNIA 4NZNA 4D82A 3GJ5A 3SJZA 2RGYA 4GOOD 5I45A 3BYZA 1E9BA 1NMSA 4MULA 3P71T 1PJLA 2Q4BA 4P54A 5AM1A 5H0IA 3PEYA 2F7SA 1E1QA 1JEDA 2RE8A 2QW1A 3AEKA 4Z49A 5FUQA 1XK6A 1HEYA 1P2GA 1S0UA 3M6XA 3VISA 1FJGB 4X91A 2JBAA 4BOYA 2IDZA 2LNDA 3K0EA 4X93A 5M5BA 2PGOA 1CZLA 4L7QA 4S24A 5CEFA 2C5EA 2R7AA 2IIPA 4ALJA 3LUPA 5D3MA 1PWYE 3EGDB 2XNDD 1JYSA 3KWFA 1HDXA 2JLYA 2H2GA 3S2EA 2HOQA 1V1MA 3VZRA 5E2AA 5JO9A 2ZT7A 4G0MA 1X77A 2WSSA 3D9QX 3EE6A 4K9MA 4L5YA 4NULA 4BNHA 4HVLA 2PO5A 3NHPA 4HNQA 1W59A 2ZT6A 4MKZA 2OYRA 1IUNA 3VO8A 3IPYA 5IBCA 3DBVO 4K6HA 3REFA 4OHBA 1KKMA 4Y2TA 1NP3A 1RAEA 4GLFA 1DBQA 1I36A 4FGLA 4F91B 5K3DA 2CD7A 2P4SA 2W90A 1F2UA 3DLIA 3ELBA 5IHPA 3R3ZA 1PGNA 4LKRA 2IHBA 4UDNA 3WLJA 1F20A 1CWUA 1RM4A 2CSUA 2C9MA 2GF2A 1PG2A 2R8EA 1Z83A 3W5SA 4AICA 1U2DC 1N6RA 2JJMA 4Z9FA 2P8SA 5EYPA 1GLGA 5FWXA 5C3MA 4KO2S 3OUTA 4DL9A 3CRZA 5ERYA 5FTNA 1ACJA 4AO7A 2G5CA 2PUEA 3U2QA 3A2KA 4L7VA 4WZBB 1QG6A 3OPYA 3KYJB 5CB4F 4RELA 4BP1A 3BCUA 2VWPA 3SJ7A 3AEUA 3OTIA 4BTEA 2BKEA 3G6KA 2HDHA 2ZQZA 1WXDA 5HKLA 3DR5A 3Q12A 3SF8B 4AKTA 1PP4A 3NHLA 2QZ9A 4RGVA 4F7WA 5CDFE 1PNOA 5I9IA 3HYTA 4Q9KA 5EXPA 4O4LB 5BMVA 2C94A 4A2PA 2PWAA 5JANA 4BP8A 4ZMRA 1O94A 2X41A 4IQGA 4QBIA 2PUCA 3K0AB 4G5RA 1MGOA 2YUIA 2I2WA 3L1VA 4DREA 1BU5A 2ZSKA 1RI4A 3A25A 1QIKA 3RIGA 1O6ZA 3PITA 5LWQA 2XQVA 2EEPA 4PSAA 2ADFA 1DHRA 1L1QA 1VP9A 2HJRA 3D3NA 4MRAA 1XKXA 3EZLA 2H1SA 1XRMA 2AQ8A 1PWEA 1JNXX 3DKKA 5CDTA 2QVBA 5EJEA 3I6MA 3PPXA 3STWA 2NADA 2XCTB 2DY1A 1VXOA 1PTKA 1BD3A 4MIOA 1Y7LA 3L8DA 4NS4A 1H1DA 4PN3A 1TTTA 2NVUA 3PQ2A 5E6RB 1DEXA 1E9AA 4QX6A 1KEPA 5L9AA 3PQ3A 2NZWA 1QOQB 5AJHA 4D46A 2N75A 1SHZA 2FWIA 1ODJA 2K4MA 3MINB 3REQA 2QVXX 3E58A 2GZSA 3ESDA 1HNXB 4OKIA 1AKEA 1U7UA 4DB4A 1QCDA 4XAQA 3EISA 2GN0A 3CTPA 5C51B 1B43A 2RSLA 3RYHB 2IE0A 4E32A 4P31A 2G1PA 1QB7A 1U7PA 3GVXA 2ZRFA 1FFXB 1X13A 2ACKA 4KRYA 1THZA 3DQPA 3F6EX 2IY9A 1MJNA 1DKLA 3A14A 2RDMA 1WVGA 2PM8A 2VIIA 1VOTA 2XDWA 3EXEA 1JHVA 3WO1A 2D2VA 4MUKA 4RSGA 3TZHA 3C6QA 1RXWA 3TR6A 1VMEA 3LXRA 4YP1A 2OYCA 2DLDA 3PC3A 1USWA 3U44B 1U2GA 8AT1A 3CO0S 1Z08A 5KNDH 3MAJA 1IEQA 3U4AA 5TQ2A 1ML3A 1TI7A 4AIRA 1Y89A 3B1JA 2GO7A 3AG5A 3PDUA 5I4CA 3VI4B 2W2OA 4IIXA 4CEHA 4OXQA 3UGTA 1D4AA 1N6OA 721PA 4BRSA 1Q7CA 4XRRA 2O48X 2G04A 2VO1A 3TX2A 1T2VA 3UXYA 4EITA 2J3IA 4ZK6A 3AR5A 2HV8A 3NWPA 1WXQA 4CIYA 1RYHA 2Z8YA 3PDIA 3HJNA 3CSUA 4HH4A 4GVXA 1IWOA 5T5QA 1SIUA 2R1UA 2GHTA 1V7QA 2V65A 3VOSA 1IBRA 2BEKA 4F45A 1N2CB 2Z9BA 1LVGA 1R6AA 2GNOA 3CR7A 2J3LA 3LKVA 4RF3A 1D2AA 1O6BA 5H82A 2PLWA 1JXAA 2YY7A 4HLQB 1QTRA 2B83A 4KW7A 4Q18A 1MRSA 4B79A 2YNMD 4TUYB 3QWAA 5EFOA 4BYGA 1P29A 3RSLA 4RHEA 2NAPA 3AF4A 3GYGA 3VH3A 4Q7EA 3JD4A 5BRAA 1I2ZA 1RAGA 2CUKA 5EIBC 3L5OA 1BW9A 4WLVA 2NYVA 1DAPA 2YVKA 3QVXA 2FPIB 3HA5A 2BGRA 4QBGB 4DDHA 4BXOB 4EJFA 2Z0MA 5CT9A 2IS6A 1SBZA 3PS9A 2WQZA 1W5AA 2DB3A 1X7WA 2VDJA 3G8AA 5ER9A 4JLOA 2JFUA 3UK1A 1XEWY 1BU8A 3K9WA 2NPFA 3BIWA 5KQMA 4LSZA 3QUBA 5FBKA 2OCKA 3OI7A 4AROA 5C7YA 1ESMA 2W6ZA 3OU6A 1SQGA 3LWBA 3E48A 5KMGB 3W77A 2YV3A 2QOEA 3HXLA 4J0KA 3RK4A 3ZWKA 2RBGA 1CJKC 4DTIA 3IAUA 3LWNA 3PR2B 1Z0JA 2BGNA 1DEOA 3KBOA 3HCEA 4LDAA 4TKZA 4BC0A 3NNNA 3WLFA 2NACA 1AH2A 1TYZA 5TR9A 4BNWA 1VFPA 4I4TB 5PGMA 2Q46A 2NAFA 3GW8A 2CNLA 2OCPA 4KBYA 4NBSA 5G1NA 1KEEB 5DBIA 4L8FA 5KUTA 2PZAA 1GNVA 3LDGA 4TL8A 4X1OA 1XZPA 4E4YA 5DBGA 1GTL1 4F0JA 5FNZA 3IKTA 1YC5A 1L8XA 3B3JA 3NR2A 1CULC 3IUPA 1FJXA 2O0HA 5JPDA 4G56A 4KDFA 3I0ZA 5CFPA 3QBVA 2DPHA 2A1TR 1L4KA 3RB8A 1HL7A 5B4UA 2PXCA 1MQSA 4LJKA 3RUDA 2F1OA 3L7JA 3OQBA 1SHUX 3WGUA 2FETA 3ORFA 1UMBA 3PHIA 5ALPA 1XF9A 4Q1VA 3ZE6A 1CG6A 5IM4A 4O4JF 1XHLA 3HDJA 5F78A 4DSTA 3H6HA 2UXDB 3UAYA 2CV2A 3TLGB 1EIWA 3I39X 2MT9A 1N0VC 1T6BY 2EFCB 2RCNA 2VYQA 1CKEA 4PNEA 1G6HA 2QB5A 4AO8A 1NUQA 1PL8A 1SIOA 2ZJ2A 5AOVA 2YOHA 3ROKA 4E11A 1U1FA 1NI4A 1ISSA 1EINA 3QPBA 4G2TA 1KI7A 3R3XA 3BXFA 4ZAYA 3TRKA 2C31A 3L0PA 4M6WB 3RGGA 1GRNA 2BEVB 2CFTA 3FVTA 3QA3E 5CLIA 1XDSA 3SSAA 3SY8A 4OHKA 3JCZA 1WMAA 5CK4A 4TTAA 1ULUA 3G2PA 3RFUA 2PZ8A 4QYMA 3UB3A 5CA1B 3HR8A 4GSKA 3T9EA 1W5EA 2EZ9A 3RLIA 4CMHA 1RYYA 1RJEA 5AK6A 2ZR0A 3QLVA 4MP6A 1VSUA 2O7SA 2VUUA 3H9BA 1NQUA 3LQ2A 3NIDB 4HZIA 4P4UA 4OBXA 5JISA 10MHA 3FZNA 4L15A 5CHYA 1QGZA 2CBGA 1YVEI 1MEOA 4CG0A 1RWPA 3T3OA 3TGPA 1GY8A 1Q0TA 1J8QA 1ODLA 1GUZA 2D13A 4HVAA 5DWDA 2HH9A 5G2OA 1W2GA 1TCVA 2PG3A 1CR6A 4OTZA 3FYUA 2F55A 3A4YA 3PNPA 5AVTA 4OI4A 3PP8A 5EPOA 1XI2A 4FOSA 3TM4A 3QE9Y 2NSDA 2YQ5A 3IJPA 1FX0A 4HFMA 4KFSA 4GR9A 1XKTA 4YJGA 3K7EA 1F38A 1A8SA 2AFHA 3COWA 1OI4A 2PX2A 3RYIA 5JMOA 3OETA 3ONEA 1XWIA 2CFSA 3M1LA 1GPAA 4N3NA 1D2MA 1N92A 3C3BA 4QJ5A 2W8ZA 5BXQC 1YQUA 1K5GA 4DY4A 2H4XA 2YYSA 2I2DA 1IHXA 4ZXFA 1G5QA 2WU1A 4HR7A 4QTZA 4WFQA 3H86A 1E4OA 1MH1A 2DLNA 5CX4A 4IRXA 2K87A 3ILHA 3VVBA 1QFMA 2YUTA 3DZDA 4EAQA 3T7DA 2IHYA 3GRRA 4ZT4A 3HCPA 2Y8EA 4UFOA 4UUBA 5CA0B 2P3LA 3D6HA 1M8JA 1IRIA 3WGGA 1NYRA 3WADA 1NVBA 4IJMA 3GZJA 1MJFA 3G5AA 4NBKA 4BV3A 1TU4A 1M2FA 3NWOA 3UUFA 3PDCA 2I4NA 4TXJA 2VLBA 3CHYA 1TU0A 2R1VA 1J7KA 5G3ZA 3SHTA 5DW0A 1CHNA 3GJRA 2HSWA 3HJGA 1EDDA 3D4PA 4IDPA 4Z4EA 2Q5CA 1T9GR 3HN6A 4YAUA 2WDPA 3LRXA 3SQDA 2R5WA 5K8VA 1P7ZA 1WUHS 2F4NA 5F64A 3VXKA 1GSHA 1WDTA 4NONA 5FBLB 4IDBA 4EGFA 1FFEA 4DARA 4MI6A 1E2KA 3G8CA 5E7MA 2GDZA 3WMGA 4BP3A 2YZNA 4LV8B 1FJHA 2XNDA 2XAAA 5G0VA 1C0LA 2R84A 3PR1A 1WAMA 1Q3HA 4XCVA 2X58A 4Z9AA 2O8FA 2IYOA 1JVSA 3F46A 3CURA 2Z3WA 2JW5A 4C9BA 2FW8A 1RXIA 4URVR 2Q1UA 1P72A 3I64A 1EVKA 5FUBA 2ZUTA 2P0EA 4I4IA 1MKYA 5E38A 3T34A 1XD8A 3Q8KA 3WA7A 1J22A 2Q4RA 4J9VA 4KC0A 2CE7A 2G1JA 4OL9A 3KLNA 4D4LA 3AUAA 1IZYA 5FHQA 1HZJA 1L5WA 2ACWA 4E5KA 3PJRA 5ECDA 3MTAA 1TCCA 3VPGA 1XYGA 1HFEL 5C3UA 1I3NA 2G07A 1MX5A 2R6JA 1OR8A 2RK3A 3HVIA 3W9BA 1YZKA 3EZXA 1AOXA 1S2OA 1X1EA 4NPAA 1PQ4A 2H31A 3DZFA 1TW2A 5JSQA 2J9XB 3SQMA 4MYSA 4BVLA 4YQEA 1TE2A 1WU8A 3CA8A 3Q3IA 1RIIA 1RWKA 1N4AA 4CM1A 3HFJA 4RCVA 1DLJA 2ZVDA 2FHSA 3GMSA 4MZDA 4NYIR 4A26A 4B7UA 2V0GA 4AG5A 1KZHA 1BA2A 3SYLA 1ZDMA 4RLSA 1Y1PA 3UY4A 4RTNA 5IVKA 5A3JA 1SVSA 2ZI7A 4KYUA 4WCFA 5KHOC 2IZOA 1RCTE 1PRYA 4G1EB 5IWCA 2HU7A 1ES9A 1PEYA 2VWGA 2OV6A 2XV1A 1FMLA 2ZBEA 4DHWA 4JR1A 4P4SB 4M60A 1DC3A 4WASA 4EELA 2ATEA 4EB3A 1LPSA 2GFQA 4W7SA 4M49A 4UHEA 1IN7A 1U8CB 3WNCA 1V71A 2JHCA 4N6GA 2JLVA 4A23A 5HK8A 4Y2SA 1K4MA 4G5YA 4JI5B 3NEYA 1KAHA 1MJGA 2O2CA 1SVLA 1T5OA 1XLTC 2CYCA 4QQ8A 1SB9A 1YZUA 3ANXA 1EZ4A 3UJPA 1JLRA 3S7ZA 1UAGA 2VHJA 1OCEA 3DNPA 2VI5A 3O91A 2XQJA 4ZRDA 4CODB 2FCAA 3TN7A 4EYKA 2IQ5A 3EPPA 5DYIA 1J09A 3NOQA 1DE0A 3D8HA 3F2IA 3QPUA 2Z30A 4DG9A 5G0WA 1YMVA 1F4PA 3AW8A 2WJWA 4MUEA 4EUKA 4UTZA 3T0FA 4GO1A 3JQBA 3O47A 4KLRA 3DB1A 3LL4A 5JBIA 1L4EA 4DWJA 3G82C 4YRRA 3I53A 3EGXA 3WWCA 2J5QA 3AU8A 2FN9A 4MVYA 3EQ8A 1OD6A 3R23A 1M8GA 4GPIB 1LBSA 3PE4A 4ND6A 2Q7OE 1L5YA 2FZVA 1XC7A 2KE5A 1MJ5A 1U4OA 2RC6A 3JQDA 3OWHA 4QGGA 3F6RA 3TYXA 1KRWA 1GNQA 1VQ1A 1FTYA 2AR7A 2NU7B 2F9FA 4HYQA 5FFFA 3VZCA 4BPRA 2VTBB 3FR8A 3LGAA 3LRPA 3ZGXA 4WK0B 1J0DA 4J16C 2C2WA 2VHCA 1LDYA 1Z0KA 1YVRA 4PM4A 4O2RA 4OA5A 2JAUA 4YAGA 1P3JA 5DP1A 4X44A 2B0CA 3O8QA 1BYIA 3HXMA 1E9FA 2BWJA 2ZQYA 4RYLA 3RFCA 4MJ3A 3RS5A 1FP2A 4AJNA 2JNWA 3DC7A 3ONWA 2FP4A 2Z4RA 1TO1E 5B2ZA 1PT8A 3TQCA 4MITA 1WXGA 2VG8A 2O8DB 2QSZA 4E94A 4P80A 1X14A 2EW1A 4CKWA 1TQDA 1Z5UA 2XVZA 3BHMA 4NYMQ 5TQJA 1OXVA 3VYWA 3NB0A 5FJIA 1T35A 1YGPA 5BQ3A 4RTKA 5TQ0B 2BY4A 5AM0A 1YR9A 3SLGA 5L3SA 5DRYA 5EKSA 3N5KA 3ICVA 4GIBA 2JCXA 3R5XA 4ZI5A 1M2KA 5IAAA 2QYTA 4K6KA 2NSLA 3AIKA 1MENA 4R8KA 2VCHA 3A70A 3CWZA 1XCOA 4H17A 5ALEA 5FTJA 1PGQA 3F97A 3HA2A 2ONYA