1UDBA

Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4-fluoro-alpha-d-glucose
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords UDP-GALACTOSE-4-EPIMERASE
publication title Structural analysis of UDP-sugar binding to UDP-galactose 4-epimerase from Escherichia coli.
pubmed doi rcsb
total genus 128
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1997-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1udbA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1udbA01
3U9LA 1FDVA 1T2CA 5TGDA 4M89A 1HZJA 2GO1A 4E5MA 2I3GA 3D3WA 4R1TA 2YHIA 5AXDA 3RKRA 2IZ0A 4BNFA 1DC3A 1YH3A 2BI7A 1DRUA 4I8XA 1EQ2A 2NU6A 1WDKA 4ZQEA 1EEHA 2NVUB 4ZICA 3H8VA 1O8CA 4JBIA 4TROA 4BNUA 3B6ZA 5EN4A 3JQGB 4W6ZA 4NDNE 3ETGA 1B3RA 4FC7A 4PCVA 1LUAA 6LDHA 1KVTA 1H2BA 4CPDA 3FCOA 2VHVA 2D4AA 1LEHA 2PZJA 2XAAA 3RBVA 2JFFA 4UUMA 1UXIA 2NVWA 1VL8A 4ILKA 1OBFO 1BDBA 1JTVA 2VWQA 5C5IA 1CERA 1CETA 3H65A 2JCXA 3KYDA 2GRAA 4W7HA 3OEWA 3WSWA 3ZV3A 4AJ2A 1PJ3A 4QEDA 1MX3A 4I5DA 5DCWA 3S1LA 1E3EA 3WWYA 4U6SA 4MIYA 4RVUA 4XKJA 3TFOA 3JYOA 4PZEA 4WEOA 2EERA 2WJPA 5L4LA 5BNFA 3JQAB 3L6EA 1EFLA 5U9CA 3I9KA 2F00A 2VYND 3IUPA 4D79A 4DIBA 5IFLA 3FI9A 3DBLB 3QJ5A 5AYVA 3GGOA 5C37A 4WNCA 4H16A 5CDYA 3RASA 4MJLA 4RQTA 2O7QA 2I66A 4WGGA 2CUKA 4PFJA 3RI3A 1DO8A 1U4OA 3RWBA 1UH5A 4QSMA 4YR9A 2BFAA 2IRWA 4B7XA 1QSGA 1JWBB 1B7GO 2DFVA 3KRTA 1F12A 3R1IA 2B35A 5F21A 5H82A 1MGOA 3ZWWA 2YY7A 1Q1NA 3ICPA 2O50A 4A2CA 2VHXA 8ADHA 3E5RA 1ISHA 2PLAA 1LLQA 3I9MA 1ENYA 3TFQA 2NV6A 3CZRA 3WXBA 4TZKA 3TN7A 2C5AA 1V3TA 3FWZA 5IDWA 1QLJA 5JC8A 1YJQA 1MFPA 4ALNA 1A27A 4YEDA 1LSUA 4XJTA 3ZU4A 4BIIA 2TMDA 5DBFA 4MVJH 4TKLA 1M66A 3P5SA 3ZWBA 1Y5MA 1CRWG 4IDCA 4J4TA 5JC1A 2AQIA 3BHIA 1H93A 5IDXA 4YRBA 4J90A 4YXFA 3KEOA 2B69A 4OQYA 1PL8A 1AN9A 3VPFA 3V2GA 3K2BA 3I9LA 1P44A 1N8KA 4AJOA 4YAKA 4HXYA 5DN9A 4BO8A 3HNPA 2YFQA 1N9GB 4XGKA 3OIFA 4AJPA 3K2EA 4P8RA 2OOSA 4WLEA 1LDYA 4FIZA 3C8MA 2Q2WA 4Y67A 3BXXA 3RUEA 4XQEA 4KP7A 5ER9A 2YHUA 1SPXA 2GYYA 4I5GA 3RFVA 4IS3A 3ZNNA 3UICA 4HY3A 1I3NA 2P5UA 3TZCA 4J91A 5JYEA 4MKXA 3MJEA 3H3FA 4BNNA 5FWNA 3A06A 2JD2A 4U0KA 3GY0A 1A9ZA 1LRJA 4UREA 2W4QA 5I7FA 4PLGA 3AUUA 4LVUA 4CM8A 2X0IA 2EP7A 3UKOA 2O3QA 3ETEA 1H2HA 5LC1A 1T2DA 1ADBA 5DBIA 1W8DA 1PGNA 4WCFB 2O3JA 3NTOA 1KETA 4PG8A 4BNIA 3LSYA 1N7HA 2AA3A 2YQ4A 1HYGA 5L53A 2BF7A 2HMTA 3WNQA 3B20A 1E6WA 3PRJA 2Z95A 3ZNQA 2FP4A 4B4UA 4W99A 1EK6A 1UP7A 4XB1A 1Y5RA 3HN2A 4BVAA 4CV1A 4BMNA 4EBFA 3PHGA 1Q7GA 3F46A 3GF4A 3R3SA 5K6AA 1PR3A 2DT5A 3GUYA 1YKFA 1U3VA 3QWIA 4ALKA 1IHXA 1VPDA 3PVZA 2C54A 2X23A 4IMPA 2IZZA 2IODA 4WPGA 2HLPA 4E5NA 5DOZA 3KEQA 1IPEA 1R66A 1DHRA 1WZEA 4GBJA 6ADHA 5A9SB 3RUFA 3VPHA 3WGTA 4YRAA 4AJ4A 2AQHA 1R15A 3N74A 4HADA 5CEEA 1OZAA 3U4HA 1GY8A 4BKPA 3Q1LA 1I3KA 5JAQA 4NBTA 4YTEA 2E48A 3UVEA 3JQAD 4PG5A 3AY7A 3HFSA 1HE3A 4XB2A 4QFDA 3I4FA 3D7LA 4R1NA 4PLHA 3KXDA 5K0ZA 1E7WA 4K1LA 3ITDA 1Q7CA 2CF5A 1DJNA 1E6UA 3JQDA 4RDIA 1RPNA 5TQVA 3VOSA 4DQXA 4G5HA 3HADA 3ORFA 3MOGA 3DZJA 5JNLA 1IPFA 1D3AA 5A5FA 2FR1A 4NHEA 1TXGA 3RFXA 4E32A 3FNHA 2HK8A 3WNVA 4GPD1 4GGPA 4ESOA 4MKZA 3ZGYA 4R3WA 1C0LA 3BTSA 1FDWA 2CSUA 4E12A 1N1GA 4N54A 4YPOA 2X0JA 1NQOA 1UR5A 4INAA 3K73O 1GCOA 3AFNA 1DFHA 3INTA 3IOYA 2DBRA 3QHAA 4KTTE 2YUTA 2A9FA 3HB5X 5AXCA 4Y8VA 3GFBA 3ASUA 5ICMA 3S2EA 3DMYA 4HBGA 4BUCA 4DLBA 1ZSYA 4JJFA 2FY8A 2PH5A 4EJ0A 3DZFA 4FDAA 4R3NA 3SVTA 1V3UA 5KKCA 2VT2A 5C7IO 4GX0A 1BHSA 5JO9A 3DBVO 3C7CB 1E7MA 2GN6A 4E2YA 4CQMA 2XOXA 4FSHA 4HX5A 3DTYA 1ISMA 1I3MA 1P31A 3VZQA 3JD0A 4MVJE 1J0XO 3AOEC 1A4UA 3H2ZA 1ZUD1 3IQDB 1WPQA 4FN4A 3MWEB 4JLWA 3EUWA 1YDWA 4ND2A 2C2YA 4ZRMA 1KVSA 3MJSA 4I5EA 1WZIA 3T7EA 3TJRA 2BH9A 3HG7A 1E7SA 2VYVD 3K96A 5F1OA 3DFZA 1YQDA 5EINA 1YL5A 3S2FA 2P2SA 1DAOA 3F6YA 4GLOA 3CKYA 3PHLA 2B0JA 1RJWA 3GRPA 1E7QA 3GG9A 4R1SA 1OAAA 2HMVA 4NFYA 4DPLA 3W4JA 4M86A 4C7KA 4L0QA 1XDWA 4LISA 4YT8A 3PJGA 1PZEA 4S3MA 1WMAA 2X58A 4GX2A 5THQA 3I3OA 5IN5A 1HDZA 1XSEA 1NX6A 3GT0A 4WJZA 3FTPA 2E37A 3A14A 5G4LA 4L74A 4MIOA 4XWYA 4HV4A 2WYVA 4WLNA 3EY4A 4DLAA 2E82A 2ZTVA 3JQ8B 1NQTA 3JTMA 1X0XA 3RUHA 1W73A 1E7RA 1UXHA 1TT5B 5B1YA 1NP3A 3BMOB 4DGSA 2G82A 4Z3KA 3ZDFA 1SC6A 1VJTA 4TRMA 1XEAA 2QYTA 2TMGA 4HKTA 4CM6A 1EVYA 4UVIA 1LSOA 3HE3A 4W9NA 3S2GA 5FI3A 4OOFA 3WGOA 1U4SA 3KOUA 3R0IA 5DP2A 3KYCB 2ZQYA 3FF4A 3JCZA 4PRKA 3BMCB 3TL2A 3PDJA 4P22A 4U6QA 4AJIA 1HE5A 3L4SO 3ICCA 1ISIA 2PZKA 3U4CA 4R68A 4UVDA 3Q9UA 4DPMA 4OQZA 3P19A 4B7CA 1FXSA 3ZWVA 2PK3A 4L4RA 2Y66A 1ZFNA 1ZK1A 3GQVA 4M87A 1KYQA 3MEQA 4MP8A 1UDAA 4XIJA 4W9NC 3WS7A 3BMQB 4EJMA 4RPKA 1LSSA 2UVDA 3TQHA 1Y9EA 1EUDA 1X7GA 4YACA 3QWAA 1G0OA 1UZLA 4CM4A 5L95A 3EGOA 4PLFA 5COBA 1EE2A 3LK7A 1X14A 3DR3A 3ZHXA 2J5QA 5ITVA 1NFQA 3L9XA 1E3JA 1JLLA 3NX4A 2HKIA 2BELA 3UHAA 4B8WA 1LX6A 3GMSA 3ZWMA 1PS8A 1JVBA 1MG0A 1SCUA 2R00A 4BNZA 4R9SA 3LZ6A 1ONNA 4H3VA 5F5LA 4CLOB 5L4SA 3DBHB 5G4KB 3ZWYA 2VWHA 4TZTA 4CLXA 2RHRA 3D5TA 4E13A 1C1XB 1YQXA 3I83A 4RF2A 3KYDB 1YBVA 5HBRA 1YWGO 5EMHA 3X2FA 1VM6A 2C7VA 3VVBA 3VKVA 5L7WA 4XR9A 1YL7A 4FQ8A 3PDUA 4ND1A 3JQBC 5DCYA 2PD3A 4NJMA 1YDEA 1HTBA 4D45A 1Y9AA 1F14A 1R4NB 3DFUA 1DLJA 2NU7A 1JN0A 3NAQA 5JSFA 3BTUA 1LC0A 2CMDA 2DBZA 3E5MA 5L7YA 5CG1A 3AJRA 5COQA 1NAHA 2O2SA 2R00C 4IPTA 5DNAA 3IDSA 3PXXA 5HWSA 1DHTA 1YL6A 2IYPA 2HMWA 2VHYA 4OOEA 2PD6A 1QP8A 1P1HA 4Q3EA 1Q7BA 1W6UA 5IN4A 1SB9A 2ZYGA 1PGQA 1HE2A 2J3JA 3JSAA 1NR1A 4PLWA 1CQIA 1YQGA 2HQ1A 2EXXA 3D4PA 2B4TO 2QRKA 4ZA2A 2Y1OA 3DOOA 1K6IA 4Q9NA 3AY6A 4M49A 1BVUA 2NWQA 2EV9A 4CMAA 4M1QA 3SC4A 4DQVA 2CFCA 3LVFO 4EITA 2JD1A 3PIIA 2YV2A 4XQ9A 4IY1A 3ST7A 2V6FA 3WYEA 3E6AA 1LBEA 4GX5A 4B3IA 3M2PA 1WMBA 4I9HA 4L4SA 3EDMA 3LT2A 3H9JA 5H83A 2FRDA 1D8AA 3P2OA 3W8DA 4DUPA 3IS3A 5HA5A 5BSGA 4II3A 3FNGA 2HRBA 2DPGA 1DB3A 3CINA 4R41A 4E2WA 3W6ZA 3K6JA 5CDGA 5TC4A 2I3AA 2FSVA 3TZQA 1HETA 2Q2QA 2IXAA 1UUFA 2NADA 1LXCA 3EHEA 5CHEA 5JMWA 4DC1A 1WLYA 5IZCC 4RZIA 1PGPA 1QV6A 4HNGA 4NZ9A 3LC7O 4CR7A 2OUIA 4I9NA 4XR4A 2WTBA 3ABIA 1NQAO 4Q3CA 5KVQA 4UAGA 1HXHA 3UFXA 4DVJA 4Z3DA 2NNLD 4Y6PA 1C1DB 5AOVA 5EERA 4NBVA 1FDUA 3GEGA 3L07A 1IOLA 2FSSA 4AJKA 5KOIA 5A5EA 2DTEA 2X22A 3JD3A 3ONFA 4XJSA 5KKAA 4AJ1A 5KJCA 2VN8A 4L75A 1Z6ZA 2JL1A 4MO2A 5TF4A 2VTEA 1P33A 3DC2A 3DZKA 4QECA 5JAMA 1JWAB 2DUWA 2X4GA 3WSVA 4AJHA 4NK5A 3ZW8A 4J7UA 3G0OA 5EIOA 4CLDA 4CMIA 1Y8QA 4F3YA 2X5KO 3PHHA 1HF3A 1F06A 3NV9A 2VRCA 1AHHA 3RBZA 4Q3DA 5DZSA 4IZHA 3PIDA 1I32A 1F8GA 1UJMA 4Z9FA 1R12A 1O9BA 3JD4A 4EGFA 2I67A 2G0TA 2D8AA 1KEVA 2LDBA 4FBGA 5DT9A 3LLVA 2PFGA 5JAIA 3PJEA 2DTXA 5L9AA 4TVOA 1ZMTA 3W6UA 3FSRA 2FZWA 2NU9A 1XHLA 4JNKA 4NBWA 2Q50A 3OECA 3WG9A 1MC4A 4RJTA 3ITKA 4LRTB 3H3JA 2VUSA 3RAJA 4ID9A 4KMSA 3U62A 1JAXA 1ZK3A 3QY9A 2QRJA 1QYDA 4NU6A 2GGSA 5I9LA 3WOHA 5ILOA 3ENKA 3EW7A 4X54A 3DWFA 3MOIA 2AEJA 4XZ3A 1YB1A 2CY0A 1ENZA 1ADGA 4LMPA 2O3SA 1KEWA 4E2XA 1S7CA 4PG6A 2AQ8A 4WK6A 3DQPA 3TOXA 1I3LA 4JJIA 1WP4A 5EL0A 4D0RA 4J2HA 4QQRA 3NGLA 4ZQFA 1U28A 1GAEO 3HDYA 4R1UA 3PK0A 2IE0A 3AU9A 1HWYA 1XA0A 1NBOA 1GTMA 1CEQA 3WFJA 1X7DA 4JBGA 4Q39A 3QVOA 4CLEA 3GK3A 4CM3A 1IE3A 3IJPA 2R2GA 1XQ1A 4AFNA 3HN7A 4GWGA 1PJSA 3RU9A 1GD1O 1Y1PA 2ZQZA 4Z0PA 3WGGA 3ZU5A 4CLRB 3SXPA 4BO6A 4YWJA 2JHFA 5C3MA 3GUCA 1OC2A 3WGIA 3G17A 3PFFA 5IZ4A 1WDLA 4GX1A 2EJVA 1J49A 4KUEA 4NQZA 4D3DA 4J43A 1NQ5A 2Y05A 2PY6A 1GEGA 4MOWA 4IQ8A 2Q4EA 2VZ8A 2NACA 2YYYA 4NPCA 3QV1A 1QORA 3C85A 1KIFA 4Q3NA 4UULA 3BTOA 1YBAA 1PS9A 2X8LA 2EKLA 1IY8A 4MIEA 3A1NA 4BNKA 2ET6A 1X0VA 4DBZA 4ALMA 4R54A 4NNJA 1PL6A 4K9DA 3KTDA 1L1FA 3VH4A 2OORA 1NNUA 2C07A 3MTGA 1PSDA 2JFGA 3ROMA 4LVCA 1I30A 3GEMA 4BO7A 1Z74A 2UV8A 3AI3A 8LDHA 1MXHA 4OYRA 1G6KA 2Z1NA 1N92A 4B4VA 1E1KA 1R0KA 2A4KA 3HDHA 5FI5A 3VH2A 5T64A 1B15A 3Q3CA 2YDYA 4I9UA 3QE3A 2B37A 3PHIA 4B8ZA 2CF6A 4YAGA 3DZBA 2HMSA 4HNHA 5BT9A 2VNSA 1K2WA 5ES3A 3VAZA 4ZRNA 1BDMA 3GNTA 3V1UA 4CM9A 2HSDA 1X15A 3F1LA 4CMEA 5I7EA 2JJYA 1N2SA 4NH4A 3DXFA 2EW8A 3ZCXA 1AE1A 4RPHA 4XDZA 1LDMA 4BKRA 1GCUA 4J1SA 2Y1EA 1ZCJA 2UYYA 2Y68A 1XIVA 5A3VA 2W2KA 4DWVA 4WECA 2WE8A 1H6CA 4UUNA 4O59O 1C0KA 5T5QA 3V8BA 1EZ4A 2G5CA 3QLJA 3QVXA 4H7PA 4CV3A 1OFGA 4EJ6A 3IAHA 3ZWOA 4QO7A 1ZK4A 3D64A 4FB5A 4AJJA 2RH8A 4W7IA 4M8SA 3OQ1A 4CMEC 4D3FA 1NYTA 2I76A 4J0EA 4PIVA 2E4AA 2PZLA 1ZSNA 1GQYA 1Y7TA 4R69A 2WD7A 3RC9A 3I4CA 1ORRA 1KOLA 1WNTA 3KLPX 5KNLA 4NBRA 2D3TA 4TQGA 4BNYA 4LGVA 1GZ6A 4KWHA 1ZSVA 1CIVA 1DSSG 4D42A 1BW9B 2VWGA 3PQFA 1M6WA 4E3ZA 2Y0CA 3RVDA 2IEBA 1EDOA 3DMTA 1I2BA 3QW2A 2HK9A 2O4CA 1PTJA 4K28A 3ON5A 2ZCUA 1ZKMA 3NGXA 4OKNA 3PYMA 4IIUA 3DB2A 4XQGA 5TNXA 4NIMA 3GN2A 3LYLA 3PP8A 2FWMX 1HDXA 2P91A 2J5RA 3ONDA 4MVJA 4OH1A 4DIOA 3O9ZA 3WX0A 4E33A 5JCJD 1YB4A 1HKUA 4GQAA 3LU1A 3VTFA 2J3HA 1U8XX 4R51A 5A3JA 4GL4A 3WTCA 2VWPA 3UCEA 3PLNA 5EQDA 1DIHA 1EE9A 1GV1A 5BSEA 1VE9A 3CXRA 3GZNA 4FFRA 1PGOA 2X6TA 1JKFA 1XCBA 2PNFA 2HU2A 4IGEA 5CG2A 2V6GA 1C14A 4FW8A 4EUHA 4IZIA 2W2LA 1GUYA 3NTRA 3O8QA 1H5QA 3E9MA 4XCVA 4IJKA 3GVXA 1P1JA 3KHUA 3ZU2A 1LRLA 3D4OA 1DRVA 1EBUA 3O4RA 1T4DA 1GZ4A 5I8ZA 2OBYA 1UAGA 2GSDA 4IMRA 3WMXA 4FPXA 4A73A 1P3DA 3WQSB 1PU2A 1MLDA 3PZBA 3N58A 4R5MA 1ZK0A 4A27A 3JYQA 3ONEA 2I6TA 1B8PA 4NJMB 1YBMA 1YOVA 2J3IA 1HDRA 4DBVO 4RORA 1B16A 4TWRA 4YA6A 3GZ4A 3L4BA 1TI7A 4D41A 3F4LA 3GAZA 2CVZA 5JO0A 2A35A 1ZJZA 3D3EA 3EVTA 2DQ4A 2X9GA 4BHTA 2C5EA 1IHYA 4I1IA 4BV8A 4OJNA 1K6JA 3UF0A 3E48A 4K26A 4DRYA 3LF1A 3QVTA 4RPLA 4URFA 2OGUA 1GQQA 2X5OA 4YQZA 3HB4X 4CV2A 2D59A 4N7RA 3H9EO 5KJ1A 4FS3A 4UEOA 3QSGA 3UUWA 2Q4BA 1EMDA 1M75A 3TNLA 3AU8A 4IDEA 1C3VA 2GLXA 1AXGA 3WMWA 3QVWA 3CEAA 3G49A 1MA0A 1LA2A 4IBOA 4O63O 2FZEA 5ENVA 2QG4A 4IJVA 1FF9A 3UN1A 2ZB7A 3LQFA 3U0BA 1DEHA 4A7PA 2Y1FA 2ZTMA 3GDOA 5K6AC 1BMDA 5EQFA 4E5KA 1EFKA 3TZKA 3VDRA 4BB5A 2GR9A 4Z6KA 3I6QA 2HCTA 1A9YA 5JDIA 5JYDA 1CF2O 4Y6SA 1C0IA 2D5CA 2RHCA 2V6BA 1JDJA 2E49A 1E3WA 3MTJA 4R5HA 3FD8A 1EK5A 3RQSA 1KVQA 4DMLA 1M76A 1SEPA 4EEXA 2X9VA 4D7AA 4ONEA 5B4VA 4E31A 1GFSA 1YXMA 3B70A 4YJFB 1T2FA 1O89A 4LRSB 4NFHA 3OJOA 1TLTA 4QXMA 4B4OA 5G0SA 3RUIA 2WEKA 1MFZA 1DFGA 1O6ZA 3IP3A 2YW9A 5G0UA 2GNAA 3GLQA 2Y0DA 2G1UA 3ZV4A 5JDIC 2IDZA 1ML3A 3BZUA 3OJFA 2VQ3A 1QR6A 4PZDA 4RVFA 4HUJA 5FF9A 2Q46A 3FR7A 4GKBA 2P9CA 2Q2VA 4QFCA 1R4MA 1Y8QB 4BO9A 1LLUA 1LC3A 3W4KA 3W8EA 4OKIA 3M2TA 1BXGB 1FK8A 2C0CA 1PS0A 2YQ5A 3FTNA 2EKPA 4XYMA 3AUAA 4S1VA 3WYBA 3DBRB 1JW9B 5U4QA 3GVCA 1PL7A 5HS6A 4MVJM 5JDCA 2DU8A 5EPOA 2WMDA 4HFMA 4GSKA 3EVNA 4PLZA 2F1KA 2WSBA 4J49A 4PVCA 2EKQA 1U5AA 1TB4A 3OQBA 1RKXA 2GDZA 3PYLA 3TOZA 3ZHBA 4YVFA 3K92A 2NVUA 4RPJA 3JYNA 1BTOA 1EUZA 3LT0A 4L73A 3JQGA 5CPFA 3STHA 4DC0A 5IXYA 1XELA 3PWSA 3S55A 5AVOA 5TJ9A 2UUPA 1QYWA 2DC1A 2BGMA 1KS9A 2JD0A 2Z1MA 2BKAA 1M67A 1E3IA 5THKA 1HDGO 2W98A 3TPCA 1XU7A 3OQ6A 4J0FA 4IXTA 3JQ7A 1LU9A 4PG7A 1WAMA 5JDCC 3SEFA 2WYUA 5DP1A 3U49A 4BO1A 3ZI0A 3ANNA 1PQWA 1NWHA 2PKQO 1Y6JA 4Z9YA 2X0RA 3HDJA 2O3UA 4IDBA 3RC2A 5B12A 2YFHA 1R0LA 3Q9NA 2RIRA 1WXDA 4TVBA 4QUKA 3JQAA 3C3XA 4BO0A 4PLTA 4FR5A 4NI5A 4UUPA 1ONPA 2OL4A 2BHLA 1DIAA 2OHXA 3V2HA 4WNIA 1CDOA 4J3FA 3ZNPA 1T2AA 3WR5A 3RD5A 4U0JA 1P9LA 1NWCA 3TZ6A 5BR7A 3NDRA 4HFNA 1CJCA 3M6IA 4IIVA 3UW3A 2O48X 4CL8A 4IDAA 3KSUA 4TSKA 4A5OA 1Q0QA 5JY6A 1DDOA 3OEYA 4OXNA 5GMOA 1ARZA 2QIOA 2NLOA 4OM8A 1BXKA 2XF8A 2JKVA 4R4JA 4BO3A 4RQUA 4NJOA 1U2GA 4J1TA 1YONA 4RVDA 1EVZA 4BO5A 1BWSA 4G65A 4ZJUA 3EC7A 2DTDA 1B8UA 3JV7A 1LTHR 1VKNA 4QTZA 3BA1A 3GGGA 1MP0A 3W8FA 4CL3A 3VH3A 1LDGA 9LDTA 2JCYA 2CNBA 3DHNA 4R01A 1HE4A 1YRLA 4RL6A 4D43A 3VH1A 5A9RA 5L45A 3RIHA 3D3WB 2YHIB 1DJQA 2J5KA 5TJHA 4P4GA 1VC2A 3U4IA 1KC1A 2X86A 1UXGA 1E6EA 4II2A 4G81A 1HDOA 3OBBA 3G3EA 1B8VA 2H5LA 3HZZA 4D46A 1E5LA 3WIDA 3A4VA 5TT0A 3AM5A 4TMFA 3WJ7A 1VJ0A 1DLIA 3UCXA 2PZMA 2Y93A 4XIYA 5KJFA 1N9GA 1OMOA 5TS3A 3C1OA 1HSOA 5KTKA 4EEZA 3H5RA 4ROSA 4XYLA 4P38A 1PJCA 1ONOA 3AW9A 1DC5A 9LDBA 4OGWA 3A9WA 3DDNA 3FR8A 4KUHA 2YJZA 3E82A 4EUEA 4JN6B 3UXYA 7MDHA 1LDEA 2D0IA 4BGVA 3I1JA 5B4UA 2VZ0A 3ZW9A 3U09A 3LT4A 2EEZA 1DBVO 2BD0A 3U5TA 2VRCD 2WE7A 1B0AA 1J4AA 1YGYA 3V5NA 3PJDA 4JK3A 4B4WA 1U5CA 3GVHA 3G1TA 2GZ3A 3IJRA 3QRWA 1T2EA 4BNVA 1P0CA 4YJHA 4U7WA 1K89A 1KEUA 3AI1A 4WCFA 1HLPA 1ZBQA 5HS4A 4IDGA 4PZCA 1TT7A 5EJ2A 1JVSA 3E18A 4L76A 2WDZA 1F8FA 3CMCO 5KIAA 3WYCA 3F5SA 3MWDB 4OHUA 3RJ5A 2VTDA 3NDJA 1VI2A 4KWIA 5GY7A 2I99A 4UVHA 3MZ0A 3WLFA 3O03A 1P1IA 3GMDA 1BRMA 2VT3A 3R6DA 5G2OA 3INGA 4HFJA 2FHSA 1DIRA 4O1MA 2H1SA 2VUUA 3GHHA 5L3ZA 5A4DA 3VC7A 5A9SA 2EHDA 5BQFA 4N18A 3ASVA 1NHWA 2GERA 3L6OO 4BQRA 4FJ0A 4MP3A 3ZWXA 1Y8RA 4CV0A 1GDHA 3CPSA 4KQWA 3VPSA 3E8XA 4GGOA 4W4TA 2P5YA 3BMNA 2Q45A 2X5JO 5GZ6A 1F17A 2X7HA 1GL3A 3FNFA 3SLGA 1YJ8A 3I9NA 3C1TA 5KVVA 2JFHA 1KEPA 5TT1A 1DFIA 1H9BA 2EWMA 4J1QA 4RDHA 4A03A 3M1AA 3M1LA 4GVLA 1UZMA 5JXWA 1SMKA 1KBZA 5CDTA 3IIEA 5IDYA 1SBYA 1P77A 1PEDA 3DZIA 2OO5A 4BNTA 1W4ZA 1HSZA 2ZB3A 3EZLA 4WCDA 1GQ2A 3COSA 4RO0A 4WASA 2P68A 5COAA 2B36A 2HRZA 2Y0EA 3ROKA 1E1LA 5DOVA 2VZ9A 3PHJA 2EJWA 5FFFA 4JGBA 4IJWA 3GNSA 4DIFA 4CM8B 3GEDA 3NTQA 5DCUA 4CMHA 2RAFA 3GVIA 5FYDA 1E3SA 2AE2A 2RBEA 5F1KA 3EMKA 3PWKA 5I8WA 3HUDA 3FBGA 1K3TA 4JROA 4PLYA 3U3XA 5KVCA 3H7AA 5ITWA 4CMCA 4MINA 1E3LA 2G76A 3GN1A 3O26A 4CM1A 1YB5A 1SNYA 1ZJYA 4DLLA 3PQDA 3DZGA 3ZN2A 2J3KA 1PQUA 1U3WA 1VSUA 3C24A 2GN9A 4J7XA 3QQPA 3EYWA 4WOKA 3LC1O 4YYZA 4BGIA 4DPKA 5FEUA 4OXYA 3H6KA 5I9NA 1NAIA 3Q11A 4FOSA 4JIGA 5A04A 4TKMA 4WLFA 1ZXBA 1LSJA 1U3TA 1DIBA 1BGVA 1IL0A 1ZW1A 1U7TA 4E6PA 3RKUA 3AK4A 5MDHA 1YE3A 4WUVA 5CP8A 1I2ZA 3Q2KA 1ISGA 3GHYA 4CM9D 4BMVA 5ADHA 5A02A 4GKVA 4JJGA 3ZV6A 3LC2O 3X2EA 4B7UA 1Q0HA 4IQ0A 3GC6A 4IINA 4XYGA 1K0UA 1D1TA 3RUAA 1QYXA 1SZJG 3GPIA 1WWKA 4TRNA 4M55A 1VSVA 1I24A 2UAGA 3VZSA 5LDHA 3N7UA 4BV9A 3DTTA 4UVEA 3T4EA 5T6BA 5J23A 2D5AA 2A94A 5L51A 2UDPA 3OJ0A 1IZ0A 3GAFA 1PJLA 3OIGA 3JQ8A 4FD3A 1E3WB 4DYVA 4GVXA 2DPHA 3QWHA 2V6MA 1TT5A 3BMOA 4AVYA 4N5LA 2A92A 2PA3A 4KZPA 5T8KA 4EUFA 2QW8A 3HSKA 1GUZA 1GV0A 3JQ9A 5JBIA 3OSUA 4Y9DA 1YVEI 1X13A 4DYDA 1NM5A 3PI7A 2PH3A 1PJ2A 1NVGA 3MCVA 2IZ1A 1HDYA 1KVRA 2XPCA 1Q2XA 4E2ZA 3KYCA 1ULSA 2XXBA 3BMCA 1TEHA 2BMAA 3HHPA 3JQCA 4RGBA 3WIEA 4JXKA 4ZU3A 3GOHA 1AGNA 1VL0A 1UXJA 1BXZA 1UDCA 5F3RA 3VZRA 1UAYA 3GDGA 2YDXA 3UOGA 4CQMB 4CUZA 3KM0A 3R3JA 3ZNOA 5BSHA 1DC6A 5T8KC 5BNIA 4MVJD 4NBUA 4P4LA 4YAEA 4BGUA 3E03A 2IEDA 3AWDA 3JQ9C 5L40A 2GN4A 1T24A 1T26A 4Q3AA 1I10A 1EVJA 3BMQA 1PX0A 1PZHA 2GUGA 5MGBA 4LW8A 2GZ1A 1T25A 1LQUA 1UXKA 4XQCA 4C4OA 1V3VA 4BNJA 5JS6A 1SB8A 1NVMB 3RBXA 2ZCVA 4DA9A 4BQPA 4GSLA 1KY5A 2W2LD 3IMFA 1NVTA 1HEUA 1U8FO 2Y99A 3JD1A 4J4BA 1B14A 4QT0A 3NT2A 1YS4A 5CEJA 1GZ3A 3B1KA 4LSMA 4L8VA 4TRRA 2H63A 3SX2A 4BKQA 1H9AA 4CLOA 1AHIA 2CDAA 3DBHA 5C7OO 5L4NA 3CZMA 5G4KA 4RLHA 4YAJA 4ND3A 3ULKA 3JQFA 5H81A 1I2CA 1C1XA 1Y81A 2DKNA 3VZPA 5G0WA 1M2WA 4AG3A 4YRDA 4FJ1A 4IDDA 4BNGA 1I8TA 2HJSA 3JQ7B 3UAGA 3QWFA 2HAEA 3HJAA 4F45A 4IXWA 1GPDG 1QRRA 3RC1A 5BSFA 3OM9A 1NPDA 4FOOA 2R6JA 4IGFA 4PG4A 1B2LA 3CUKA 4YDRA 2AEFA 1R4NA 2C82A 4G2NA 4MKRA 2AW5A 3CSDA 3ROPA 4A10A 1FDSA 4J9UE 4HP8A 4MPDA 5CDSA 1B3BA 3WB9A 2DAPA 1G1AA 2O23A 2Q1SA 2GD1O 3FPCA 3OJEA 4BS9A 3K30A 4YT4A 2C7GA 4E0BA 3DOCA 4FFNA 3PTZA 2VCYA 5C7LO 1NPYA 3JQFC 2W8ZA 3NYWA 1R16A 3BIOA 1EUCA 1DIGA 4XA8A 4YJGA 4CQLA 4B79A 2E6UX 2V7PA 4XGNA 3C7AA 1LQTA 4GWKA 4Y98A 4P4NA 2NUAA 1OOEA 1ZEMA 2BFMA 1GU7A 3AFMA 2VHZA 2IXBA 1EDZA 4DTIA 4LCEA 4OO3A 4LK3A 4NR0A 2Y1CA 3UCFA 3AUSA 4EYEA 3IKVA 1RM5A 4CM4B 2I9PA 1RYEA 2BGKA 5ER6A 4LMRA 3OHSX 4FFLA 4ND4A 2OP1A 3DOJA 3L0DA 2W90A 4NFSA 3KETA 1IYZA 1WVGA 2CD9A 2BI8A 2UUOA 4E21A 1ENOA 4R16A 2WM3A 1UDBA 3MJ4A 3BAZA 1LDNA 2QYSA 4CMGA 2PGLA 3DMTC 1P1RA 3INRA 3WBBA 5JY1A 1X1TA 4AJLA 2OP0A 4FFOA 3ANMA 3TZHA 4F6CA 1JU9A 5DULA 1IB6A 4ND5A 1SEVA 1ZZEA 1XQ6A 4DQUA 3P7MA 3WQQA 3IUSA 1P0FA 3GVPA 5DF1A 3UGKA 1HLDA 2CDBA 3I9JA 1U1IA 5A1TA 1C1DA 1N1EA 3K9QO 2O2YA 1QYCA 1LDBA 4ITUA 1F0YA 1V9LA 4CQMD 2QRLA 2GN8A 1ISJA 1VKOA 1BVRA 3BHMA 3CE6A 2Y67A 5EESA 3BTVA 5IJZA 1E1NA 3KO8A 4ALIA 4XEHA 2PGJA 2VYNA 3DZHA 4N5NA 3WJAA 2NVBA 4F6LA 5JLAA 4E5PA 4YJHB 2HUNA 3I5MA 1IULA 1GEEA 4IQGA 3F1KA 1PJBA 2PTGA 3L9WA 3DAGA 3GFGA 3FPLA 3QA9A 4GMGA 4F46A 4NU5A 1RWBA 5KWEA 3JYPA 3OA0A 2NSDA 4JP2A 2D1YA 2OFPA 4W82A 4IJUA 3G1UA 1P1FA 1X1EA 1HRDA 2EG9A 2CZCA 4ZQBA 1QXSA 3OMLA 4XDYA 2O7SA 3HWRA 5F5NA 1U9JA 3L4BC 4DMMA 2Q3EA 1PZFA 2J6IA 1KC3A 3GDFA 2D2IA 4KQXA 4ZVVA 4ZQHA 1ZH8A 2WD8A 1ISFA 4MVJG 4RVGA 3U4DA 4IUYA 3K8ZA 3OF2A 3S8MA 4R9RA 5CEFA 1XG5A 3H9GA 1Y8RB 1I36A 4OIMA 5IG2A 3BYZA 4AJEA 4Z9XA 5IF3A 4YT5A 3DAFA 1JQBA 3ZH2A 4LN1A 4NMHA 4YBZA 5JAZA 1WDMA 3BMNB 3D5QA 3KV3O 4BGEA 1Z75A 4CMBA 4PN3A 4M54A 5I7VA 2ZB4A 4GH5A 5JCJA 1GYQA 4BB6A 5ICSA 3SJUA 3K31A 3RUCA 3BHJA 3TL3A 2PD4A 1U2DA 4CM5A 1D1SA 5KCZA 2EGHA 2IYOA 2FOIA 4CJXA 4CR8A 4Q3BA 3ZV5A 4OAQA 4XRGA 1DXYA 1H0KA 3WQRA 3FBTA 3WDSA 4XGIA 2DM6A 3B1FA 4L9RA 4YQYA 3AOEA 4HWKA 3I6IA 4CLRA 2QZ9A 4Y6RA 1O94A 3D1LA 1A7KA 1ADCA 3GNQA 1I33A 1NTOA 1QG6A 2X1HA 1K5HA 4CMIB 5TIIA 1XYGA 1CQJA 3F4BA 1XGKA 3F47A 1O5IA 1Z7EA 3DL2A 1DOHA 1PWZA 1ZEJA 2BFPA 1SOVA 3ADOA 3NKLA 1U3UA 2Y1GA 4PLVA 4QX6A 3Q0EA 1JKJA 2RCYA 2GASA 7ADHA 5TLSA 1RYDA 3KBOA 4WLOA 4YJDA 4BNHA 2DVMA 3G79A 3T7CA 2POQX 1E0DA 4PRLA 1Z73A 4PGFA 2C59A 4FC6A 2DLDA 2BFOA 4RLSA 1HYEA 1MG5A 3AM4A 4RV9A 4YCAA 1NFRA 2HMUA 4BNMA 2BGLA 3FNEA 4TRJA 5T57A 2JHGA 2HDHA 4U8GA 1H6BA 4ZHSA 4EDFA 2Y1DA 1GYRA 1QYVA 3KYBA 1ZNQO 3MJVA 1TA4A 3PYXA 4MVJF 2C2XA 5KJEA 4A0SA 2BLLA 4UEKA 2B5VA 1O95A 5GZ3A 2AMFA 4UVGA 4ZD6A 4BNXA 4OMUA 3JD2A 4YAIA 3VPXA 1UP6A 3WICA 1X7HA 1ZO8A 4KOAA 4LSWA 4RPGA 1Z7BA 1N7GA 1FJHA 3OP4A 3OETA 1RM0A 1DRWA 3TRIA 4BKUA 3TWOA 5JCXA 1ADFA 4CM7A 2NTNA 1D4FA 3FHLA 2AHRA 4I08A 3DBLA 4XRRA 3I52A 1UP4A 4BO4A 3MJCA 4Z0TA 5KJ6A 1YO6A 1A72A 1A5ZA 3IKTA 4JP3A 2QQ5A 3L77A 4RCVA 4EZBA 1G0NA 1H94A 3GRKA 4EI2A 1CYDA 5JE8A 4E30A 1GR0A 4BO2A 2ZIZA 2ZYAA 1H6AA 4FFMA 1CWUA 1T4BA 2AXQA 2FR0A 2GCGA 3LLSA 4O6VA 1XR3A 3PFWO 3ZHYA 5A03A 5CDUA 5TSDA 2O4UX 4WOJA 4E4YA 4KDFA 1I5RA 1B26A 4N5MA 1EBFA 3AI2A 2ZKLA 1E77A 2ZYDA 2PGDA 5U1PA 4KUGA 3V1YA 3WBFA 3SC6A 3NJ8A 2HO5A 3WGHA 2NQ8A 4GLLA 4CODB 1FMCA 3NJ4A 4WE3A 1K6XA 5HTOA 5CAEA 1FDTA 2NU8A 1NHGA 3ZWCA 4K6FA 1JA9A 1ZMOA 3QWBA 4XYEA 5G0VA 3RJ9A 4B3JA 4FGSA 4FJ2A 4ALJA 5A9TA 5I9MA 1LI4A 3UH1A 1BW9A 2V65A 1M6HA 3ZWNA 4WLVA 2EW2A 2YV3A 3WTBA 2EF1A 3ADPA 2NTJA 2DBVO 1QKIA 2OBNA 3OA2A 3DHYA 3GGPA 3HQ4O 4AJNA 1XKQA 4O5OA 2BRUA 3AOGA 3EK2A 1BSVA 2VOEA 4E5YA 2C29D 3WGYA 3EZYA 1E1MA 3PGJA 3Q2IA 3I9OA 2GPTA 4I5FA 4J2OA 1W0CA 4JQCA 3JQBA 4FFPA 3PPIA 4JX8A 3VTZA 2AG5A 4LCJA 5F1PA 2NM0A 2PKRA 3JQEA 2FPIA 4XX0A 4XYBA 3DAPA 5IXSA 1ENPA 3FRJA 2VYVA 4NG5A 4RVSA 1AXEA 1I01A 4J16A 1VRWA 3QIVA 4RF3A 4YB8A 1SO8A 5ILGA 3RU7A 3D0OA 4YT2A 2JAPA 3VKUA 3NUGA 2FPPA 2VOJA 3GR6A 2J8ZA 2AQKA 4B3HA 2VHWA 1JKIA 3ETDA 2Q1TA 4IM7A 3TF5A 3H2SA 1LRKA 3C7DB 1ZIDA 3PZRA 3E9NA 2Q99A 3GG2A 4ZGWA 3DHEA 1HDCA 1DC4A 1R0SA 1A4IA 3VHRA 5B37A 2FN7A 3F5QA 3WWZA 2PR2A 3WGZA 4K6CA 4H15A 2W2KB 1V8BA 1BG6A 1VLLA 3ZU3A 1ZVMA 1V35A 1A7AA 3H5NA 4J4HA 4J6FA 2H6EA 2G17A 1JAYA 3K5PA 3V2UA 2YZ7A 4UUOA 4J7CA 1GUFA 2VNAA 3KUXA 1C0PA 1IZ9A 1DAPA 2B4RO 3AM3A 3QP9A 2PKQP 2P4HX 5CPBA 3OIDA 5T67A 3D4NA 2OZPA 3RROA 1E7YA 2ZJ0A 3RCBA 2AEMA 2JCVA 2WD7B 1XLTA 2ZB8A 3NT5A 1PZGA 1UZNA 4UEJA 5A06A 1QMGA 2JAHA 1NR7A 3HFGA 3ZZNA 3ENNA 3H9QA 1LLDA 4D0SA 3SJ7A 1TVEA 5LCXA 1Z45A 3DEYX 3WFIA 1DPGA 1I0ZA 1RM3A 1J6UA 4YJGB 4CQLB 4RF5A 2ZK7A 5B4TA 1U7HA 1MB4A 1P45A 3WLEA 4WCFC 2DBQA 1PJTA 1PGJA 2H9IA 3SBOA 1L7EA 1KY4A 1D7OA 1GYPA 4CUKA 3KSDO 2QX7A 4DXHA 3SLKA 4WEQA 1HZZA 1RM4A 2NQTA 3EAGA 3NT4A 1HL3A 5IZCA 2XXJA 2QZZA 4CMJA 2EGGA 3ANLA 1L7DA 1SOWA 2HJRA 3AY3A 4RZHA 1ZXLA 3A28A 5AQ1A 3CTMA 4DL9A 3L6DA 1T1SA 1R37A 3KZVA 5DDIP 1PIWA 3PLRA 3Q6IA 2VRBA 3GZNB 1AUPA 3S2IA 2B5WA 5JW6A 3H9UA 1PQPA 3F3SA 3PWZA 4CR6A 1MXFA 2X9NA 1ULUA 4XD2A 2P9GA 4MVJP 3O8QB 4JBHA 2AG8A 1HYHA 1ID1A 3B1JA 1MUUA 2OXIA 3H5AA 4WKGA 3KB6A 4BNWA 4OL9A 5G0TA 4HFRA 1MV8A 1P1KA 5AXBA 3PJFA 5TX7A 3GPDG 1Z82A 1OC4A 4YJFA 5A05A 3CH6A 3QVSA 2GF2A 1KERA 3O38A 3FN4A 1GPJA 2PV7A 4C7JA 5HM8A 3E9QA 3PEFA 1HT0A 3RC7A 3RUDA 1XWFA 2Q1WA 2Q49A 4J1NA 2EIHA 1YOVB 4CMKA 3LT1A 1T1RA 4EW6A 3PQEA 3VPGA 2VUTA 1LNQA 4GAEA 1N5DA 4D44A 4IDFA 3CMMA 1S6YA 3P2YA 2I65A 3KSZO 2DUUA 3PGXA 4AL4A 5LDGA 5JPIA 1LLCA 1BXGA 3ROQA 4U5QA 1NFFA 1IUKA 2P4QA 3C1AA 3DBRA 4OXKA 4IS2A 1EVIA 5GZ1A 5K9ZA 4OSOA 3KLMX 5BNTA 1VL6A 5TRTA 5JFOA 5L7TA 2EP5A 1H6DA 4D3SA 4CUJA 3KVOA 4OSPA 4RF4A 5CFZA 2RH4A 4JCOA 2DFDA 3NDIA 3HDQA 4BOYA 2CVQA 1V6AA 4WLUA 4BL5A 1LJ8A 3W1VA 5AXAA 3RFTA 1SAYA 4BKOA 4RVHA 2FR8A 1E92A 3OH8A 2OMEA 2AE1A 3GH3A 2FMUA 3W4IA 1A71A 4A26A 2ZTLA 2FPGA 2SCUA 4QO8A 1NASA 1J5PA 1ZK2A 3IC5A 5IAAA 3IL2A 3TSCA 1EQUA 2QHXA 4FGWA 5JMPA 1PWXA 3VDQA 2NTVA 3AUTA 5ENDA 2B4QA 3H4VA 4MP6A 1KVUA 2WWRA 4PLCA 4KDEA 3I23A 3WGQA 5I7SA 4L4XA 2C20A 2CVOA 2Q1UA 5DBGA 4ZQGA 2I5PO 4KTVE 3OICA 2PWZA 1R6DA 1P74A 3DONA 1V0JA 3MJTA 2LDXA 3E1KA 1O0SA 1VJ1A 1NXQA 4DREA 2WYWA 3V1TC 2P9EA 3ZHZA 4BNLA 4ALLA 4CLHA 2O3TA 1PJ4A 3JYLA 4FCCA 4GMFA 1GADO 2ZTUA 2Z5LA 1QV7A 3LDHA 4GI2A 3LF2A 3T4XA 3IP1A 3OJLA 3JQ6A 4Z0HO 1Q0LA 2HK7A 3DO5A 2B83A 1OI7A 4PVDA 5KVSA 5IDQA 4O0LA 3NEPX 3CIFA 3TDKA 4AICA 2ILTA 1MC5A 1E5QA 2X0NA 1NPTO 4BMSA 3FWNA 4J9VA 2ZATA 3ZWPA 1R4MB 2CDCA 1WW8A 5HRUA 2ZJ1A 4MDHA 1XU9A 3GA0A 3VVCA 3F9IA 2YV1A 1PR9A 3RSHA 4PLPA 1PJQA 4ZN6A 1QLHA 4NK4A 2O3RA 4MVJI 3NRCA 3OFSA 2GZ2A 3ZWAA
chains in the Genus database with same CATH superfamily
2CFSA 3SJZA 3IT3A 1MAVA 4KQKA 5BOVA 5T4FA 5TGDA 4DQKA 4M89A 2GO1A 2QSJA 3KYJB 1XDGA 2OUKA 2GCOB 5FYQA 3RKRA 2OGTA 4Z4IA 4I55B 1TTHA 4H1TA 3SEQA 4ZQEA 1WDKA 4HUTA 2Y2UA 4R0NA 5CA1B 4Q4AB 2F43B 1XZJA 2C2ZA 2LW7A 2XGSA 4TROA 1UJ4A 1IB0A 2AR0A 1JIXA 1NW4A 1PK7A 1XCOA 3JQGB 4W6ZA 1RS0A 3ZEIA 4PCVA 5GINE 1LUAA 2G3YA 2KBEA 1KVTA 2PKWA 2ECFA 3MLAA 3FCOA 1G64A 3MQFA 5JZ9A 1RE1A 5LD2C 3S8EA 2XAAA 3RBVA 1MT3A 1WVMA 1QS0A 1YI8A 3A3KA 1KI9A 3DZDA 4RLQA 3IXLA 4UQPA 2OPHA 2QT9A 3NHZA 3SVZA 5A6VA 2C7OA 2G5GX 4ILKA 2VJNA 1OBFO 5C5IA 1CERA 3H65A 4RAOA 4BFZA 3KQVA 4P3PA 2I4MA 4OMDA 4G9GA 2F64A 1XVTA 1TZBA 4MQUA 3WWYA 1S2MA 4U6SA 3R7BA 4MIYA 4EK9A 4RVUA 5K0JA 4WZ6A 3JASA 4WEOA 3L6EA 1EFLA 1KMMA 3EDOA 4NQRA 1SXJB 5CCXA 2F00A 2JFPA 2YZGA 3FFXA 3AHJA 3JPWA 4DIBA 2HA3A 3Q3GE 1N0HA 5ALRA 1KDOA 3Q8WA 3GD5A 3QJ5A 3RVPA 2L2QA 4MWGA 1AK9A 1W581 3OD1A 4RH0A 3KAQA 4Z86A 5IABA 3LP6A 2WM8A 5BRJA 1CUXA 1JHOA 5THXA 1D07A 4L8YA 3OCUA 1SBIA 3A3OA 4JYCA 5CFQA 3G23A 2I66A 2Z5FA 2IUUA 2NXNA 4RHCA 4D0GA 4IHKA 5FUQA 1E6CA 1MH9A 2FE1A 5AESA 2PANA 4ETNA 1U4OA 2G07A 3G2QA 3RYHA 3TGWA 5ICCA 4Q7LA 2JARA 2BFAA 4B7XA 2L17A 4RVNA 1ZGGA 4H6XA 2QROA 1G16A 4RPCA 5H82A 1YJCA 1YZUA 1Q1NA 2EVWX 2YY7A 3IBFA 1G8HA 4C4SA 4YCCA 8ADHA 5I51A 1A3CA 3G2OA 3PHBE 2VP2A 4B34A 2PUDA 2XX3A 1QYRA 2PX6A 3JVIA 1RCFA 2NV6A 3PGVA 2PMCA 3WXBA 4JLVA 2VPYA 4HDMB 2NU8B 1G8YA 4UFOA 2H4WA 1Y4UA 1V95A 4J07A 3ZJUA 2QSYA 3D6HA 4GC9A 1OWOA 4P3XA 2I3DA 4ALNA 2V74B 3QIAA 1SHZA 1NI3A 4POAA 1HV8A 5DBFA 4TKLA 2ZUEA 4K9MA 4UBIA 3ZWBA 4L5CA 1Y5MA 1CRWG 4J4TA 3FCYA 3F5FA 3BHIA 4RWEA 1TVCA 5IDXA 4XTRA 1U3FA 2RHTA 5AHRA 3EGIA 5BRAA 4EA9A 4DSOA 4OMFG 1AGYA 1GGEA 1OVMA 4YAOA 2B69A 5P8WA 4CKZA 5IKXA 3M34A 1CY4A 1M2OA 1AN9A 2BMVA 4INOA 1G20E 4RE6A 3VPFA 2P5SA 4IIYA 3K2BA 4B1FA 4NXMB 1CUWA 1N8KA 4G5XA 1PVOA 2QRVB 2EL9A 1QO9A 3AKCA 4IG4A 1JPNA 1V11A 5FP0A 3HI6A 1LKZA 3K2EA 4TUYB 4LMAA 3KOXA 3FTFA 1ZW6A 4ZJYA 2ZE8A 4X84A 2ZBPA 3G8DA 4I8DA 1ILWA 3WMRA 5BN5A 1JQJC 3FDZB 4TVKA 4XQEA 5ER9A 3IVRA 3RUEA 4NU0A 4DA4A 5FOQA 3Q7TA 3RAGA 4W63A 1JJFA 3FJOA 3N9IA 3PC8C 2P62A 1BE0A 2ZAYA 4IS3A 1VLZA 4DM3A 1Y4ZA 2JBAB 5HFAA 3TZCA 3MJEA 4O4HA 5FWNA 2R87A 3BREA 3AEUA 1U98A 3E7FA 3LRPA 4HX2A 4U0KA 2NG1A 4O33A 3G5MA 2W4QA 2GK4A 3AUUA 4Z1MD 2QY9A 5IHXA 4CM8A 1VYTA 5DHFA 3M9LA 3OE5A 4NSNA 4B87A 4B3TB 3B13B 4ZO7A 5FA5A 3STWA 1ADBA 5DBIA 2CNNA 1NVBA 3IODA 1SXIA 2ZRCA 3TGLA 1PGNA 4OHVA 2O3JA 4F5YA 3QG1A 3G85A 1E9EA 4M83A 3LSYA 1Q57A 2ZI5A 4GOND 4W8GA 4XOUA 1N7HA 5DGHA 2YQ4A 1HYGA 5L53A 1ZOLA 2WK1A 2WKSA 2HMTA 1UFOA 4KVAA 1CY1A 5HJ2A 1M0TA 2R65A 2AJTA 4F1KA 4B4UA 5EHIA 3QLUA 3SF8B 4E09A 2XVMA 4NDAA 3EVGA 4CV1A 1GGJA 5JCZA 1NNEA 4LDAA 4IXNA 1AKQA 1ODKA 3F46A 5K6AA 1TMKA 4DG8A 2ZJOA 2Q2OA 3QWIA 4CG2A 4ALKA 1VSTA 1KE2A 2X23A 4NATA 3ZDEA 6NULA 1LBQA 2VAWA 4WPGA 1QGUB 2CYAA 3B9BA 2BFEA 4C1BA 3EPKA 3Q0IA 4P81A 3R09A 2NXJA 2FUNB 1EZZA 3A0UA 2V6IA 3EGVA 4BCBA 1R66A 5BP7A 1WZEA 4JKOA 5ARCA 3DUFA 4F4FA 4Y1GA 2ZR0A 3BF8A 4U2KA 1M0SA 1SKQA 4AJ4A 4BCCA 2RCNA 3BE6A 3N74A 4HAUA 5CEEA 1IHUA 3U4HA 1GY8A 5F78A 5JH7F 3Q1LA 4F7DA 2UZ4A 1I3KA 3ICWA 5KOYA 3E81A 1Q3HA 4YTEA 3L7BA 4F93B 3UVEA 4PG5A 2R1TA 3QF4B 4FFBA 4O4IA 4QFDA 3BN3A 3MCWA 5D84A 4PBTA 2Q4DA 1KPIA 2COKA 2Z4RA 4PLHA 1FUIA 2FN8A 1Y42X 3AVPA 1DELA 5KI6A 4IVRA 3KXDA 1BA3A 3JTEA 4FYJA 3VPCA 1ORDA 3LDUA 2WU1A 2W2VA 2FWPA 2I55A 3JQDA 3PL1A 3HS3A 1RPNA 2I4NA 1E32A 3D3QA 4Q19A 4CF5A 1F20A 4LOIA 4EKYA 4G5HA 5FWYA 1BROA 4Y2QA 4DSUA 3HADA 3OC6A 1K7YA 1TVKB 4I2VA 5A0FA 4C43A 3TM4A 2JJ8A 1TJ3A 1D3AA 4WMLA 4KQMA 4BY9E 4DARA 2JFNA 2E3JA 1PR5A 2PRKA 3DEAA 3HJGA 5D85A 1NOIA 2CNWA 3JRNA 1KA9H 2VDRB 3VR0A 2GBFA 4GRIA 3EZ2A 2CNDA 5BR8B 3C98A 1VFNA 3ENVA 1PUXA 4GGPA 4ESOA 4MKZA 2PS9A 2IKQA 4R3WA 3TVTA 3HYLA 3VNUA 4LFBB 4BTEA 3BWXA 4E12A 4QUDA 3W05A 2ODNA 4R6WA 4BXOA 1BMFA 3CNEA 3HR8A 4YPOA 2QTHA 4KFSA 1X8LA 4QQNA 1T3GA 3K73O 3OMXA 1BFKA 1FFCA 1T15A 4KN8A 4CT0A 3N8GA 4FYYA 4KTTE 2P2CA 1DAKA 2Q8QA 3MMNA 3ZQJA 4MLPA 2R47A 3VR4H 5AI0A 1ZL0A 2J32A 4HMPA 4HBGA 3OE1A 5F2NA 2RJNA 3N86A 2ZI6A 1IFXA 2PH5A 2P79A 3DZFA 4FDAA 2AYYA 3C5HA 4KMOA 5TDHA 1RXUA 3TFWA 2A86A 2MIIA 1ADJA 3R7FA 5C7IO 4GX0A 5EQTA 2FKNA 3C7CB 1KSFX 1P80A 1ZCBA 2H2GA 1RPTA 4PNPA 2OQIA 3ZCPA 3L4KA 5CB0A 1FBTA 1I9CA 4WN9A 4QJBA 1P31A 4MZDA 3LL7A 3JD0A 4PPFA 2OAGA 4LZWA 2ZBEA 1T9GS 2K87A 4BB9A 2I4LA 2IHZA 4YIHA 2XRZA 4XD7A 2RC5A 5JS2A 4ND2A 5EEHA 4F2WA 2XSZD 2PAFA 1Z6YA 2XHEA 4KVFA 2RI1A 3ISTA 3L0CA 1YZNA 3UMJA 2OFOA 4RIFA 2L18A 1PAUA 3DXXA 3TJRA 1KDZA 4C2TA 5CYFA 2GPJA 3TG8A 3MNFA 1YMVA 2E4YA 3DFZA 1SQSA 2IITA 3EQ2A 3M1IA 4WKBA 2P2SA 1DAOA 2VHCA 4BECA 4GLOA 4FQ7A 4DB4A 2OYSA 2H5JA 4LGMA 2GA8A 4KOEC 4O2AF 4C9BA 1G55A 3HCAA 3VYSB 2WC1A 5BWBA 5BPFA 1PFUA 1Z4JA 3ESZA 3ILHA 3QELA 4R1SA 4U02A 2HMVA 1P29A 5J4YA 4H18A 4JEMA 3BL5A 3RR2A 1N2CB 4C7KA 2I2DA 4HH1A 1O96B 5SYAA 1WB9A 4NECA 4BCDA 4JKYA 1PZEA 3FGPA 3JY6A 4NZNA 4OPMA 4S3MA 4QNMA 4ZAZA 2X58A 5ULLA 3DXYA 1HGXA 5C4MA 4Q1EA 3UXEA 4QARA 2VBGA 3TCNA 4K9QA 2CEAA 4PX5A 3T0GA 4WJZA 3U3RA 3AWIA 4EHDA 3RIGA 2AOTB 1KYYA 2A9KA 1IBRA 1RI1A 5DW0A 4X6LA 4M0MA 4WLNA 4IIHA 3RWOA 1N77A 2E82A 2ZTVA 3I62A 1X0XA 1R88A 1ECLA 2WNSA 3TIVA 1TT5B 1HA3A 3R76A 3TLEA 4Y2RA 2ODEA 4DGSA 4DUGA 1NT4A 3EFEA 1SC6A 3IA7A 1GPUA 4GPTA 5EWMB 4HKTA 2AX4A 1TW3A 3EA0A 4K86A 1U3CA 1L4YA 5E6SB 3CISA 3QMWA 2ODPA 3OZAA 4R2WA 1Z83A 1K8ZB 4HEHA 3O95A 4WFKA 4ZEXA 5J58A 1A8IA 1DO0A 4I6JA 1JHVA 3IFSA 3EXHB 4W5HA 1XO1A 3FF4A 3JCZA 4WKPA 4B33A 4CVNA 1OFTA 2YCLA 3DLPX 3PV0A 3WYAA 4AJIA 3C6XA 3L4SO 3A1UA 2REBA 3V00A 2PWAA 1VXOA 1V4VA 1ZUNB 2OBXA 5K0BA 5DBOA 3OZXA 2Z57A 2UZ3A 2JNWA 2D2XA 4B4KA 3BL8A 3Q9UA 5AKHA 2FSPA 4DPMA 2B4YA 2G9UA 4ESVA 2OMKA 1E6LA 4QNNA 1FSPA 4IDUA 2PK3A 1OT3A 1ZFNA 4KU4A 1ZK1A 4MUHA 2QLLA 4JP5A 3F7OA 4TQAA 3HO1A 1KAHA 3CEMA 1KYQA 3O6VA 4MYCA 1J42A 4NS4A 1ZI9A 2GJ4A 1EXVA 2GM4A 2R6AA 4ITRC 1W36D 1XTJA 3KOMA 4KXMA 4R2MA 2YNMC 3TE7A 3JWIA 4RZXA 4RPKA 1S3FA 1V1JA 2OD9A 3RODA 5KWSA 1EUDA 4JZYA 4PR3A 1WCYA 4EHNA 2PUGA 4TS4A 1R10A 1NJFA 3Q10A 4MCHA 4CM4A 1DU4A 3EGOA 3K8YA 1WV1A 5GONB 5HF8A 1GA1A 3Q40A 3K9LA 1NNSA 2GBPA 3GH1A 4OU5A 4Q47A 1ECPA 3LK7A 4QPNA 4KPFC 4BP1A 3A70A 2J5QA 2M1XA 5CM9C 1UJ2A 4WKNA 1D9ZA 1E3JA 4IF6A 4B8WA 2BELA 3IRUA 5TEVA 3LCUA 4JD5A 1LX6A 5C8XA 4H35A 3GMSA 4U7FA 1E3DA 1SCUA 3FDJA 4LHEA 5KSOA 4R2JA 4Q9IA 4QDJA 4H3VA 2P3SA 4IV5A 4TVSA 1FU7A 5C1IA 3D5TA 4LSGA 4GLBA 1NW3A 2BEJA 2JIOA 5G53C 1HYQA 3ZY6A 4X24A 1YQXA 4EB8A 2WWWA 5FT9A 1R0RE 4FYKA 2YJ6A 3X2FA 1ST2A 1YWGO 4LSZA 3VVBA 1NURA 1QFJA 1F3LA 1YDHA 4KV9A 5G40A 1HY3A 5K4AA 4DNXA 5DCYA 2PD3A 4L9WA 2VDPB 4UAVA 3HVJA 3KQTA 3MWLA 4D45A 4KRGA 2Z2ZA 1Y9AA 3MINB 5KQRA 2ALJA 5AUOB 4RTNA 3W3ZB 3ET5A 1JN0A 2EJBA 3BIJA 4UFPA 1JFVA 2AG6A 4J16C 3AERA 1NJGA 4X8MA 3AGPA 3NS7A 1YVPA 5CG1A 2I91A 3AJRA 3CNQS 4IHAA 1XAGA 2QAGA 1CB7A 3AZOA 5COQA 1GDTA 2R00C 2SBTA 4UPDA 3DLCA 3C8DA 4X7MA 5EZYA 1UBCA 1USVA 1DHTA 2VKQA 821PA 2ZREA 5HCUA 3GUUA 2PO7A 1K4KA 3NHMA 2WJZB 2VQSA 2ZYGA 2PTHA 3CF2A 3OESA 4NEHB 1HE2A 3O84A 2H06A 2J3JA 4PO1A 3ZUGA 3VKGA 2EX1A 3RVQA 1KFKB 1XXHB 2B4TO 2JASA 2A9PA 3SPXA 3RYHB 3HJBA 1T2UA 1XYVA 4MEBA 3PXAA 2DLCX 4BN0A 2WIGA 1K6IA 3QX8A 1V5IA 3L7NA 2EDAA 3NHFA 4IIJA 4Q9NA 3IKLA 3SZGA 3IESA 3MGKA 4QU8A 1UC4B 3QFCA 5EHGA 4EHBA 4C05A 2VQFB 4M1QA 4ARVA 5EZQA 3I2JA 2VTVA 2JD1A 3PIIA 2IZ5A 4HPWA 4ZAYA 1DXHA 5EJFA 5BORA 2I8CA 5FXMA 1KZ7B 3WYEA 4B09A 1QG4A 3IIMA 2FN9A 4RK1A 1G1MA 3KZ1E 1A2QA 1GXSA 2R4QA 3D6NB 1CUAA 4L4SA 5AM4A 3EDMA 4N01A 3LT2A 3M70A 4OQFA 1XLTC 2FRDA 1WZ2A 1DZIA 3CT4A 2ZRMA 4ZRDA 3W8DA 2PMFA 1H42A 3IS3A 2IUTA 3OCWA 3FNGA 3OX1A 5E4YA 3V4RA 2RHOA 3OQIB 4K3UA 4BTVA 2ZBRA 5K0TA 5HQ3A 4LCBA 1YK0A 4LI3X 4MVXA 3IDQA 5EJGA 3SE7A 2F90A 4JFAA 1S2IA 4OAPA 1UBUS 1ZICA 2IWRA 4DAEA 1CIPA 1NMSA 4OF4A 1UBRS 4ZZ2A 4NC9A 1JLSA 1M2OB 1XT6A 3EHEA 5A3RA 2C5FA 3UB2A 2P69A 4AP6A 1WLYA 3G0IA 2C04A 4WZBE 1HZZC 1G5TA 3U4GA 3H2IA 5IZCC 2VZLA 2BUAA 4AYXA 3KWMA 3LBHA 1ZR2A 2KI5A 4MA4A 2Z43A 1KTVA 4NZ9A 4JJ8A 2GN0A 5TVKA 3VO8A 4AMZA 1PEAA 1TZMA 1MD9A 1SPBS 4RZ3A 4F5DA 3E9CA 2FF7A 1BN6A 3U1BA 1HXHA 1N2JA 1F3OA 4DVJA 4Z3DA 1RLMA 1K7EB 4Y6PA 4BX8A 1ACMA 1JHMA 2VF2A 3IVCA 4OQNA 1TK3A 4KXXA 1QHNA 2P1ZA 3UV7A 1M8KA 2AKYA 3EOZA 3WJ2A 1LCIA 2WU4A 2XYVA 2DTEA 4AJ1A 5KKAA 1G3MA 2XD9A 3W5HA 4C7OB 2J4DA 3AEUB 3AJ8A 4H3SA 1H4QA 2CUZA 2WIKA 3DZKA 3T7DA 3RV3A 5JAMA 1THTA 1VPVA 1VG9B 1ORHA 3VDNB 4CU2A 4NK5A 3ZW8A 2NO4A 3G0OA 4C3ZA 4CLDA 3THWA 2VXCA 4Y2SA 3A6DA 3NV9A 1UK6A 2HDNB 3TQRA 1AA6A 5F3WB 1W5BA 2X8AA 3IALA 1VIDA 3RBZA 1XBTA 1YB6A 3PIDA 1I32A 2HPHA 1O9HA 2WT4A 4HQLA 1UJMA 4BO6A 2F8LA 4EHKA 4EJSB 3V8EA 1N75A 3HBFA 1XJWA 2V9CA 1TM4E 3OBIA 4P33A 2WUGA 1LF0A 1QIMA 2EX4A 2XMZA 4REOA 4C1NA 2G0TA 4EGFA 2D8AA 4EG5A 5CLJA 2W11A 4FBGA 4QXPA 3QLEA 1NXVA 5CLHA 5EGNA 1E69A 1PNTA 2FMTA 1T9GR 1HT1E 5JAHA 1JEAA 2VA8A 5F9MA 4DIMA 3FG9A 13PKA 1FVFA 4HH0A 1UCFA 2Y6UA 4GMHA 2A4MA 5ALPA 4DEXA 2ZIVB 3WG9A 4OSEA 3GFQA 1F2UB 5LUAA 6REQA 1T0UA 3ITKA 1SVLA 2WF7A 3LYAA 1ZR4A 1FDIA 2C5HA 2OHHA 2ZT6A 1PHPA 3H3JA 3H5IA 5KQSA 4DMKA 3ND7A 5M3BA 1P2GA 3E7PA 4DCUA 1C7IA 3U62A 4KYVA 3SD7A 1V4BA 2GOYA 3BQNB 3AR8A 2IGTA 2ZGVA 3QY9A 3SG0A 1NMEA 5ADUS 3EY9A 3VYTB 4QBIA 3WOHA 3LD9A 1NP6A 3ENKA 5DHRA 3ZPXA 1UBMS 4DRXB 2AEJA 5I3CA 2O1EA 4XZ3A 1JNXX 4RTJA 2R3SA 2ZPTX 3GQBB 3T1QA 1B0PA 3QMVA 1Z63A 2Q3CA 4LMPA 4U3JA 2KX7A 2BGGA 4WK6A 2FGJA 4FT4A 1XD2A 5D5HA 4G0ZA 2VK1A 2C4UA 4LXXA 4AQYB 2B8JA 4CIYA 4MWDA 4QQRA 4HDOB 2GPYA 2VTKA 1GCGA 2HBYA 2QSUA 3UNXA 1JMVA 2Z1DA 3VR2A 4C4RA 4D4JA 1GAEO 2GTPA 3PK0A 3BULA 2GPNA 1QP4A 3ABZA 3OHPA 3K3PA 4JBGA 4P7GA 1CQWA 4ZT6A 5G41A 1ZPDA 3GK3A 1AS2A 1JR4A 1U7OA 1IE3A 3IJPA 4DA8A 3IEXA 4DN6A 1PT5A 1GD1O 5ERYA 7ABPA 3U4QB 4LJKA 4DKJA 1OKKA 2ZQZA 5CFRA 2YWXA 1J99A 2DSTA 3OF3A 4GG1A 3PWTA 2NGRA 1Z39A 4WHMA 3CX8A 4NBKA 4Y0AA 3V8MA 1OC2A 2XQJA 4U7TB 1XMVA 4L5YA 1THZA 1S8AA 1QDUA 3GNLA 4FP9A 4JLSA 3EUEA 4J43A 4KI7A 2Y05A 4YV1A 4YECA 1YBHA 4IQ8A 1WA5A 2ZM6B 3Q3EA 1ZGZA 3A1TA 4PCAA 5LU9A 4CF3A 4NPCA 3M6UA 4RK5A 5HCNA 4B48A 4QYTA 4C01A 3QU4A 4LRXA 3VNBA 3ESYA 4CL2A 2QNBA 5U4XA 4B6OA 3BTOA 1PS9A 1WPXA 4M1TA 1CZLA 1R74A 2H4HA 4BFXA 4BNKA 3ZCRA 3RS5A 2Y77A 1MW8X 4DBZA 2PZBA 2XBUA 4WBNF 4WN9B 3NOXA 4NNJA 2BHRA 3AHEA 5I4BA 3WYGA 2GI4A 1Y89A 3FTDA 1N78A 2C07A 4URZR 3ROMA 4D3YA 3EGEA 1I30A 4I7EA 2UV8A 2LWIA 2QV7A 2OSVA 1KMHB 1YZQA 1N5KA 1DJLA 1C3OA 2VNKA 4GEKA 1TO2E 3FLMA 2XQGA 2VJLA 2PHZA 2ECPA 3NCTA 3VKFA 2RI0A 1J1IA 3DJFA 3QKTA 4MCIA 5T64A 2YDYA 4I9UA 2QUHA 2PRIA 4C07A 2B1JA 2B37A 2EZ8A 4PGHA 3ZEAA 1JLMA 5DNDA 4B8ZA 2IV3A 2TSYB 3KUUA 1E60A 2EOAA 2OLEA 4HNHA 4GFDA 3U80A 4DXDA 1EGQA 3EOBI 3QUAA 5ES3A 3VAZA 5CNJA 3M4JA 3FPEA 4NYJR 3GNTA 4PIMA 5TQJA 1KZHA 1V5GA 3F1LA 1X15A 2OCIA 3FOZA 2Q3LA 2JJYA 4A8JA 2D2FA 3UMCA 2IYEA 4BZWA 5B2EA 3VYVA 3QTTA 3VHLB 5AFSA 4CKEB 4RPHA 5IT9A 2IH2A 3H05A 3RSQA 3M6XA 1LDMA 3TKAA 5DBHX 1S8OA 1T5HX 2O1XA 1L4HA 1JG3A 4HRYA 4RY8A 2W6ZA 4HWSA 1DAEA 4XUGB 1L1EA 1B00A 2V7QD 2Y68A 1HM5A 1XIVA 1ZZGA 2HO4A 3TXAA 4DWVA 4EA7A 5KHOC 5LPNA 1QTRA 3ELWA 1K06A 1GRCA 4GMDA 1C0KA 1OFIA 1XWIA 1ZISA 1EZ4A 1ODCA 4O59O 4DBLE 3QVXA 1WPRA 3PKJA 3RS7A 1ICEA 1P4HA 2FWRA 3IAHA 4PZPA 4X41A 3W9UA 5JBNA 2ZI3A 4AY5A 2ZE6A 3RGWS 2G06A 3HWSA 2RH8A 3P2JA 1JHQA 3BZBA 4MS3B 4W7IA 3RHFA 4CETA 1DRJA 2I76A 5I4IA 2ZT8A 2E4AA 3UWPA 1Y7TA 1EG7A 2WR8A 5DI3B 2HBRA 2Z04A 1WXGA 2PLFA 3O2QB 1W0JA 1WNTA 3KLPX 4NAHA 1T29A 721PA 4RULA 1K6EA 2OM2A 2DR2A 1NJ8A 3LXRA 4HJXA 4BNYA 3LH5A 2XVZA 1Y1KE 3V6LA 5KBYA 3NC0C 1CIVA 4EF5A 4FN5A 4GOXA 1F1BA 4UEWA 1J5XA 1KIAA 1BW9B 1T6BY 3G9TA 1EXNA 2PMWB 3O3CA 4PYOA 5ALXA 2ZSUA 1ELOA 4E3ZA 1RWWA 1DKRA 4ZU6X 1MIHA 3DMTA 1AGXA 3QW2A 2HK9A 5JD5A 1L7MA 2DPYA 2P41A 2F3PA 3ON5A 2X2OA 3WLNA 2YH2A 2OE2A 2NSHA 5JFGA 3BA6A 3CO5A 4OKNA 3T1OA 4IIUA 4MGHA 1NXXA 2ISCA 2WWIA 4JQZA 1KYWA 3IAUA 3O2SB 1FP2A 1QK5A 1L4GA 3LYLA 7AT1A 1HDXA 1QH8A 3V97A 3A36A 2ODTX 1UBOS 4JDPA 5ECDA 1TCVA 4PYJA 2XUJA 4GQAA 2G1JA 2J3HA 1VYVA 3IAM6 1I4OA 4TTVA 5K8LA 2CXSA 4GL4A 3WTCA 5A3JA 1PRYA 3O8OA 4HEA6 3GRZA 1D2AA 3I72A 1LS6A 3D5EA 3DFFA 5DSTA 5BSEA 2M98A 3IP5A 4S2UA 2A7XA 1EP9A 5KWJA 1JKFA 1XCBA 4OQ4A 1OV6A 4D1YA 3T1YB 2N3ZA 4E1AA 4IHJA 4YLEA 1Z5UA 3H13A 3BCUA 4IZIA 3KQPA 4DMHA 3CVVA 1UFQA 3NTRA 3K0KA 5FWAA 2ZE7A 1H5QA 4IGAA 1M0EA 1SKAA 4IJKA 3AR2A 4G0WA 3F3MA 2OO7A 3VNAA 1U6KA 4KL8S 1UIMA 1NBWB 3PFBA 2OKCA 3CUVA 3E2IA 3KHUA 4BHHB 4EJ2A 5K45A 3HJUA 1T4DA 3RSLA 2DE0X 1ZOIA 1GAWA 5FLYA 3NWPA 4FPXA 4DEVA 4I1YA 1PJAA 3QEAZ 4R5MA 3TBHA 4NYIQ 4A2WA 4GBED 3VR6D 1AZLA 3D6AA 3DEFA 3ONEA 2AMVA 5KNCH 1E4YA 4K5QA 4LNUB 2QJRA 5A4IS 1YOVA 5BMVF 1HDRA 3L7JA 1V5FA 4KQ2A 1BEUB 4RORA 5BQPA 3U48A 3PQ8A 3DZ8A 2LPMA 121PA 5E7JA 1U8TA 5AK5A 3VVMA 2X0KA 2AYXA 3DMGA 4ER3A 3GZ4A 3UHOA 1DI0A 1TI7A 2ZDGA 2V8OA 1DQRA 1Z6TA 2VKTA 3IJ5A 3JAKA 1I9GA 3TTTA 4D41A 3EVTA 2W58A 1SG6A 3QK7A 3KDPA 2D62A 2X9GA 4UZFA 4BHTA 4PG8A 1IHYA 4LYHA 4I1IA 2H5EA 2XY4A 4CEIA 2DHQA 3FNIA 3DMDA 4JR0A 1CNMA 3SHOA 1JFFA 2A9JA 1JKMA 4K26A 1TUBB 4CCSA 4KR6A 1OI2A 1NATA 4RPLA 2BFCA 1J8FA 3HVKA 4NZMA 1U0JA 2XRFA 3EMVA 3B8HA 2A9OA 5ALQA 5JIBA 2BMEA 2E4VA 2QQEA 5F5XA 4BLVA 5T3UA 5KTNA 5KJ1A 1SKYE 3B9QA 1X1CA 1IVYA 1NBIA 1XLVA 2AN1A 2Q4BA 3KSRA 4IIJB 1CQXA 4BLPA 4XPIB 3TNLA 1PR4A 3B6IA 3H3XA 3I1IA 4IDEA 4KSCA 1CP2A 2XZDA 3KPUA 4RENA 1L5LA 3U6KA 3Q8LA 1RJ9B 4IBOA 3SYNA 2FZEA 4PPQA 5ENVA 4RUKA 3SEAA 2ZAOA 2QG4A 3LBNA 4IJVA 4QRHA 5IBRA 4DM4A 5F4ZA 2P0AA 1DEHA 4JHXA 3WWDA 1GXSB 5C3UA 5IJ0B 4Z5XA 1K92A 2P27A 3SX0A 2VPIA 1XPJA 2DSNA 1Y3CE 3TZKA 2XB9A 3VDRA 1O08A 2YMMA 4HLDA 4DCMA 1ZLXA 2V55B 3VSDA 5E3IA 1A9YA 1IXKA 1D6NA 1JU4A 3N6XA 5KTTA 5KYXB 2XGJA 1NKSA 4HUQA 3FHJA 5FWXA 2CCKA 4QGSA 5HQ3B 1C0IA 1CD5A 2V6BA 5ED4A 4ZANA 3CH7A 2QBYA 2QMUA 5ITSA 2P77A 2GYVA 2YXDA 4OI2A 3U26A 1IM8A 3FD8A 2HD4A 2R5NA 6GPBA 1M76A 4NV1A 3A2NA 3C8ZA 4FHDA 4Q9LA 5HE9A 2ORVA 3SC2B 3WL5A 2GF0A 3WRYC 4B84A 4EVQA 1MTZA 1UQUA 2A7QA 2D1SA 3A2KA 4C4ZA 1J8QA 2IIPA 1OSNA 1GFSA 2GK6A 3B70A 4HPXB 5JYBA 2WYHA 1V8OA 1KARA 3SIRA 4EG1A 2ACWA 5IM4F 4NFHA 2XGMA 4B4OA 2YX1A 2QM8A 3RUIA 2WABA 2WEKA 1KSGA 4OH7A 4NEGA 3UOAB 1KI7A 2P1DA 3IP3A 5DYWA 2GNAA 1HO3A 3K0CC 2ZJ8A 3PX3A 1FP7A 2CUNA 1QCZA 2IDZA 3E84A 3PEVA 3UJAA 4A6EA 3OJFA 5JDIC 1PW7A 5EUQB 1JQKA 2Z5GA 4EGQA 2QRGA 3LLUA 5FF9A 2Q46A 5FFMA 5AIBA 3QHQA 2PMKA 3SOPA 3CH5A 2QLJA 3DWIA 2ZM5A 3USES 1QZUA 3QEBZ 4KQ1A 4GKJB 4JI8B 1MVLA 1E8NA 1UKVY 3HLTA 3FA2A 4FMDF 3W4KA 2A3NA 2FB9A 5JALA 3FTQA 1BXGB 4EL5A 2OV8A 1MNAA 8MHTA 4IEEA 1JHDA 1II9A 1FA9A 2YQZA 3AUAA 1TQ8A 4S1VA 3ZQ4A 1JW9B 3JYHA 2O05A 5EHXA 1H2ZA 3TOSA 3GVCA 5HS6A 1VIMA 4NKRA 3G88A 4UUAA 1ZNYA 1TC2A 4HFMA 4MUIA 1MQ8B 2NTYC 4F96A 1XYYA 3KAKA 2F1KA 4LXUA 1VGRA 4J49A 2EKQA 2I3BA 3KYIB 4Q4LA 4LC0A 4RTQA 3PYLA 2GDZA 3HFRA 1O6BA 1R0BA 5LLDA 5LWHA 2WUDA 4RESA 4ZK6A 1GNTA 3PQ5A 4MUFA 3D6VA 4MH0R 4HR7A 3ICQB 3SFTA 1BTOA 1EUZA 2FQQA 3ND5A 4V0ME 3ZLJA 2C9MA 3DBOB 4DC0A 4F85A 1DNPA 5IXYA 1XFAA 3UV3A 2IQ5A 1NXPA 2RK3A 4AQDA 1XKLA 3E9DA 4PIPA 1IDOA 3RJTA 2BGMA 2FPGB 2JD0A 2SCUB 2WY2D 4PAOA 3SE0A 1PI3A 1E2DA 1Q5PA 3KUCA 1HDGO 4HYYA 4PX9A 2G25A 1V4NA 2W98A 3ZE7A 1XU7A 2I7TA 1YMQA 2OHOA 3IJEB 1OZHA 3NIWA 3NORA 4NPAA 2QX9A 3HZHA 3AINA 4L3OA 1D8TA 2YWHA 3ORRA 3G2LA 3ANNA 5KTSA 1BVHA 5FTNA 3VU9B 1P62B 2EYUA 2J87A 3QVJA 2X0RA 4IDBA 2O3UA 2AFIA 4Y1EA 5IVKA 1NX9A 1R0LA 4CKWA 3CZQA 5IJ9A 4OV6B 1RMYA 2WHXA 3HR7A 3N6RA 3L1UA 2OPBA 3ICVA 1GPWB 3BUSA 3JQAA 4QUKA 4BO0A 5AVRA 1YDFA 2QRQA 4K9SA 1ONPA 4F9FA 2BHLA 3WGVA 4KLCA 4A8HA 2G71A 4WNIA 1CDOA 2QP3A 3NHBA 4ABTA 4J3FA 2AK3A 1KNQA 3ZNPA 5AIAA 3WR5A 4OB8A 2DT8A 3KTAB 4WBXC 3RD5A 4FOLA 5FBRB 3V4OA 4XLZA 3BEDA 1VGVA 1NWCA 3BGIA 4IV8A 1JIKA 2ZU6A 4QOJA 4RA6B 3T99A 4CI9A 5BMVB 3A10A 4G9EA 2L19A 2WM9B 2C03A 5EUCA 2NQ2C 2PU7A 1L3CA 3I39X 3KSUA 1HKHA 4F21A 1Q0QA 3QTLA 1P2DA 2BTQA 2XVXA 2HR1A 1RBQA 2GEBA 1ZA2A 1BXKA 2QIOA 2XF8A 4RK4A 4YJ2F 3L8MA 4BO3A 3GLFA 2GLTA 1YAHA 1R0ZA 4RVDA 5FBQB 4BO5A 1XNQB 1VHJA 5FWDA 2OAEA 1QK4A 4RS3A 1J21A 5DIFA 3EC7A 2IELA 1B8UA 3JV7A 1LTHR 2EG5A 4QTZA 1BYUA 1G4AE 1O5TA 1XL1A 1GAQA 3QF7A 2ZUVA 4URWR 5K8CA 2GT1A 1KDYA 3WXMA 1PDWA 2BFDA 1X9GA 2COUA 2WWHA 3BWMA 1NYLA 3KKEA 3KQYA 4GI5A 3KOZA 4C03A 3LO5A 2M1ZA 5CTJA 5DLQC 4URVR 5KYWA 3O1IC 3FMVA 3KP1A 2YHIB 2EYQA 3ASZA 1DJQA 3E9YA 4A0HA 2I2WA 2JH9A 3TLAA 3BB3A 4W5TA 2ONJA 3W2HA 1KC1A 2NU6B 3IUQA 1VB3A 5BWCA 3EQ7A 1ILEA 3DYVA 3R8CA 1RKUA 2PQ2A 4G41A 4G81A 2B7CA 3ECSA 4K3VA 1TYAE 4XCXA 4EUKA 1FMLA 3OHMA 3I01A 3CZ4A 1J1ZA 3CURA 4OKSA 1ZHOA 2WLSA 1C3OB 1T4CA 3A4VA 4IG9A 5FUBA 1N5MA 2WFZA 4LJYA 4M1EA 3ZIAD 2YV5A 3KB2A 2AVNA 1JEYB 4QVIA 1YR9A 2PZMA 1FFHA 3T1VA 4YC7A 1L4UA 3UWKA 2PS1A 5TS3A 4XIGS 3C1OA 2CK3D 4C5AA 1EWRA 1ZL2A 2P9JA 5JTUA 1U2PA 2HSWA 3BWYA 4EEZA 3IV9A 4OHMA 1PJCA 3PNPA 1DC5A 2FU5C 4RCYA 4KUHA 3SHTA 1POWA 4A8JB 4BFLA 2I6FA 3A1WA 4E4RA 1EXMA 4JWKA 5B4UA 2YXNA 3AB3A 3LT4A 1ATIA 1IUOA 3KHKA 3G13A 4J1GA 2P5TB 2WE7A 1K5PA 5T4BA 3KZKA 1UL1X 1D2HA 5AVWA 1NUUA 2QF7A 4B4WA 1U5CA 3GVHA 3G1TA 3ABSB 3M6AA 3IJRA 3I34X 1T2EA 2AEEA 3K0BA 3QRWA 5ALKA 1P0CA 1BH2A 4MRNA 3HKEB 4B3XA 1U0SY 4KO3S 4NCBA 1KEUA 2O7NA 1KL7A 1N0IA 3ZTWA 4BMZA 4KE7A 4WCFA 1ZBQA 3N70A 4IDGA 1ZD9A 4PZCA 1TT7A 2AYZA 4KSYA 1IBSA 4DWWA 1TIPA 2XT9A 4L76A 2BMJA 5BSKA 3PQ4A 2O19A 1NNI1 1PEKE 2OXTA 3TDNA 4PHCA 4PWZA 2PVSA 3MWDB 4OHUA 3GJXC 3OEHD 3RV4A 3NDJA 5F33A 4B4DA 4H6VA 4EKDA 3QVGB 4Q9DA 1OPXA 1VI2A 4K05A 5GY7A 4AMVA 3EIXA 4HTFA 2XEXA 4PCLA 2O59A 1LV7A 3PENA 1QNFA 3MZ0A 4B3RB 4QTYA 1UODA 4FWIB 4XFDA 1BRMA 1CW2B 2VT3A 5G2OA 2GPWA 1H8HA 1RYYA 4RHXA 5DVZA 2OT3B 2IL1A 3R6TA 1AU9A 2H1SA 4UEQA 2VK8A 3ESBA 5L3ZA 3WQBA 1R8XA 4BEBA 3VC7A 3ZLBA 1IBKB 5A9SA 3OLZA 1F1JA 4FYMA 3A1EA 4HDAA 4QREA 5FA6A 3EIFA 4ZVOA 3TUZC 3OZFA 2QZ4A 3D9QX 4CV0A 5A71A 3DQZA 2DHDA 4Z8XA 1TKCA 2D74A 4NU8X 4KQWA 5DNUA 3B6MA 1WKVA 4W4TA 4LTDA 3VJLA 5E3JA 2PGOA 3DL0A 1SXJE 1FL9A 2CJXA 1AQ6A 3O1LA 4GP7A 1QH8B 4YJ3F 4DCTA 4TX1A 1TMGE 2X5JO 5H9WA 2ZRAA 2O57A 1F17A 3UT5B 2X8WA 5H8WA 2P6MA 3GLIB 3KWFA 2PGAA 4CIXA 1ODLA 2JFHA 3LDAA 3CLTC 4RDHA 5CH5A 4A03A 1WKBA 1OD6A 2FRXA 3M1AA 3M1LA 3R3HA 4MV0A 4S0ZA 4KO8A 4GQIA 3QVKA 3KZCA 1E18A 2CLKB 2Q3BA 4GBMA 4LHVA 5FADA 2D0OB 2AOUB 1P77A 1N6PA 3DZIA 2YC2C 1ZCZA 1W4ZA 4NOLA 5AJWA 5SZKB 3JSXA 2GPBA 3EZLA 3M5WA 4WCDA 4BLUA 4ZDIA 1L9XA 1CUVA 2BBWA 1A7JA 2CWDA 2HRZA 3T5BA 4HB2A 3L7KA 5TGTA 4H59A 3UAXA 4UOEA 2VZ9A 2ZR8A 2F1HA 2HXGA 5MN6A 3N28A 4JGBA 3QG5A 2H4ZA 2A58A 3GNSA 4QEZA 2E18A 3GEDA 4C78A 3RVKA 1W94A 3IMKA 1I7NA 2GZRA 3GVIA 1UC9A 1UIRA 5FYDA 4OMCA 3AUJB 4YMSA 4JODA 3RSCA 1WY5A 1J7KA 3AJDA 2CV1A 3EMKA 4RD4A 4YUXA 2AKAB 2QDKA 4GPAA 4R8SA 3TUIC 3WIBA 5K8IA 4FUQA 3LPCA 1TYZA 2AJBA 2ZROA 3F5DA 1K3TA 2CDNA 3DDZX 3HUDA 2RK4A 4JROA 5F76A 3U3XA 5KVCA 4KFCA 5ITWA 3BBPA 4H7DA 3LECA 3NHWA 4BV3A 3RREA 1Q17A 3N76A 3GLTA 3O8NA 4BQIA 3A9UA 4DLLA 4DCJA 1IZ8A 1X1QA 1N9KA 2OO5C 4P5PA 2NT4A 1VSUA 3ZN2A 4WOKA 1Q95A 3PPWA 3QQPA 3EYWA 4C06A 3OZVA 2GJSA 3ZCTA 3S6JA 3EIOA 1W8IA 1YSCA 2J0VA 1Y7HA 2QU8A 2OQ2A 4YNBA 5B36A 3RSGA 4H1VA 4NCIA 3KAJA 4E6PA 1CG6A 4FI3F 3FZEA 2LP4Y 1YC2A 1YE3A 2I22A 4TXLA 5JZBA 3CLUD 2VHJA 2BDTA 3IIJA 2FKAA 3IIKA 4M0LA 1UPAA 4IP0A 3TIFA 1DO2A 5BURA 4CM9D 3TDMA 3B52X 3DGFC 1UJ5A 2FK7A 3U56A 3LC2O 4MUAA 1P7CA 4ER0A 4P36A 2YZ2A 4HGQA 1G17A 3SBXA 3TAUA 1Q0HA 5AUNB 2C8VA 2JGAA 4FEAA 1A2BA 3WK9A 3WSTA