1UDBA

Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4-fluoro-alpha-d-glucose
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GALACTOSE-4-EPIMERASE
publication title Structural analysis of UDP-sugar binding to UDP-galactose 4-epimerase from Escherichia coli.
pubmed doi rcsb
molecule tags Isomerase
total genus 128
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1997-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1udbA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1udbA01
3LSYA 4E5KA 1M66A 3L4SO 3PHHA 3D4PA 3PI7A 4CLEA 1HZZA 1F14A 4E5YA 2WTBA 1LDGA 4F6LA 2GO1A 4BO6A 4XX0A 1D4FA 1AUPA 1QP8A 5C3MA 3UICA 4GL4A 2I66A 2NU8A 4BNLA 4YXFA 1WDLA 1HETA 5JE8A 2B4TO 4OHUA 1Z7BA 4RL6A 3V2HA 1MLDA 5I7EA 1ZK4A 1AE1A 1QSGA 1DSSG 1EE2A 2FP4A 2Y1EA 3BMCB 4OMUA 3ZWVA 5LDGA 3L4BA 5ILOA 2P5UA 1Z82A 1E1LA 2C5EA 4XB2A 3NYWA 3WMXA 2PD3A 3VVCA 4P22A 2D0IA 1RM0A 1V0JA 1IE3A 4IQ0A 3AFMA 2NWQA 4J16A 5DCYA 3AJRA 2PKRA 1NQ5A 1GL3A 1LDEA 3ITKA 1SPXA 2OZPA 3TL2A 3L07A 4DYVA 3EK2A 5H82A 1PR9A 3ZNQA 1LDBA 4ALIA 5L7YA 3WFIA 2W2LD 1VI2A 1Q0QA 4XR9A 3TFQA 4A0SA 1SEVA 2VOJA 4YR9A 4BNUA 1GEGA 4OIMA 1O8CA 5T8KA 4O0LA 2Q4EA 3ZDFA 1TT5B 5LDHA 1I3KA 1YDWA 4E12A 4UULA 1LEHA 3GVCA 4M8SA 4MVJP 1YBAA 4M87A 3ANMA 3MWEB 1P9LA 1DXYA 1FDVA 2QX7A 4NHEA 1YJ8A 4J6FA 1KEWA 4HNGA 4HP8A 2NM0A 3GDOA 5BR7A 2VN8A 1NPYA 5CPFA 4BQRA 1CYDA 5TF4A 4DLAA 4YQZA 3B70A 4GBJA 1NM5A 1FDSA 1GYQA 4NK5A 3D4OA 3E5RA 1ZNQO 1DLIA 3QLJA 3PIIA 4PZEA 1V3UA 5F1KA 3JQ6A 2W8ZA 2UDPA 3ANNA 2VCYA 2Y1DA 3NT2A 3PZRA 2IYPA 5AXDA 2H63A 3GR6A 4JBIA 2ZQZA 3OP4A 2GF2A 3JYNA 4UEKA 4BO5A 4OGWA 3AUTA 4DUPA 3SJUA 4BNHA 3DZFA 3IIEA 3TWOA 3UXYA 5DP2A 3HZZA 1DB3A 2P68A 2VYVA 4UEJA 2IEDA 3ZW8A 3UGKA 4FFLA 1VLLA 5A03A 1O0SA 3GAFA 1DC5A 1MGOA 1Y6JA 1WWKA 1EVYA 1G0NA 1ISFA 2VHWA 1GY8A 4WEQA 1ISMA 5BQFA 1UUFA 4GX5A 2YDYA 4OXKA 4CQLB 3R0IA 2DVMA 3JQ7B 1SNYA 1WAMA 5BSGA 4ONEA 4FS3A 2YQ4A 4J7UA 3GHYA 2GN6A 2AE1A 1NYTA 3DBRB 3GUCA 3G0OA 4B8WA 1P74A 4MP3A 1W73A 3OFSA 1NX6A 4WLVA 4DTIA 4FJ2A 3FR7A 3CH6A 3MJEA 4MKRA 4CL3A 3GVXA 4HFRA 2BD0A 3S2IA 1BRMA 4R68A 3ST7A 5EESA 4BNVA 4D44A 4IJVA 4YBZA 2QW8A 5T57A 1FDUA 3K2BA 2VNAA 2ZTMA 1EVZA 1QYCA 3ENKA 3WR5A 4BNYA 4CM4B 4N7RA 4KUEA 3HB5X 3KSDO 1E6EA 1WPQA 1T2DA 3DHEA 3PIDA 3QP9A 2X9NA 1QORA 3FTNA 3ZV6A 3BTOA 2D8AA 5ILGA 4CM7A 2I76A 3U09A 2XOXA 2ZB4A 1E7YA 1HDZA 4BO8A 2VRCA 4CM6A 1PGQA 2O3UA 1QYXA 1V3TA 4KZPA 4FPXA 4FOOA 3MCVA 4LW8A 3E48A 3QWAA 4GSLA 1AHIA 1PGNA 2P9EA 4BMSA 2IZ1A 4N5NA 4YWJA 2D2IA 1T26A 2EXXA 1NVGA 5A06A 3MJTA 4GX2A 5BNIA 8LDHA 5L95A 2HJSA 4PVCA 4EI2A 4LVUA 3O8QB 4MO2A 3U9LA 1ZK1A 4GVXA 2WE7A 3IJRA 4II2A 4K26A 4UVHA 2P9GA 4BS9A 1KYQA 4IDGA 5HS6A 4I5FA 2BFAA 2Y1GA 1CERA 3H9UA 4L4SA 1IPFA 1D8AA 4R3NA 4DLBA 4BNTA 2EHDA 3JQCA 1M6HA 2E49A 4IDFA 3A9WA 4E2ZA 3Q2KA 4HFNA 1DJQA 2JAPA 3OQ1A 2AEFA 3RUHA 1WVGA 4ALNA 1Y7TA 2ZIZA 1PQPA 1PJ4A 3ZWYA 2I3GA 4FW8A 2Z1MA 1QRRA 1R16A 1YXMA 2JFHA 2P9CA 3DHYA 3O4RA 2VUSA 3WWZA 1Y8QB 4YCAA 4CLOA 4WKGA 4LRSB 3RC1A 3M2TA 4B7XA 3E5MA 4CV0A 1I36A 2C7VA 3KZVA 3UW3A 5GZ1A 4XGIA 1QG6A 3D1LA 3BMOB 5IN5A 1VL6A 3JQ8A 2C7GA 1R4MA 3AOEA 4L74A 3NT5A 4TQGA 5FI5A 5TJ9A 4FFOA 3JQBC 4GVLA 1GYPA 3FBGA 2CFCA 4BGIA 2B0JA 3NJ4A 3W6ZA 5JDIA 1NAHA 2XXJA 3L9WA 5G4LA 4FQ8A 5L4LA 5T5QA 3JQFC 5IAAA 3T4EA 3GG2A 3EDMA 4RF4A 1ZXLA 2HMUA 3RFXA 1B7GO 2O7QA 5FFFA 4X54A 1H6AA 1BSVA 1E3JA 3U4CA 4CV1A 4DA9A 1R0KA 1DIAA 4MIOA 4G5HA 5FWNA 1WDKA 2VYVD 3TPCA 4JQCA 4XQ9A 3AFNA 1LI4A 3G17A 4ND2A 1K6IA 4NBVA 1P0CA 4AJKA 2Q99A 3DB2A 4I9UA 3EZLA 2D3TA 1T2EA 3RWBA 3DOCA 1HDCA 2EGHA 4WUVA 5DCUA 3VH3A 2EJVA 2EG9A 3UN1A 1SMKA 4XDZA 5DZSA 5JC1A 4JROA 1NP3A 4ZA2A 3TF5A 5CEEA 3DOOA 4IBOA 4E2WA 2W90A 1KEUA 2WYWA 2H5LA 3BMNA 2IODA 4L9RA 1Q0HA 4W9NA 3HB4X 4GKBA 4U8GA 2WEKA 1XSEA 2WMDA 1LSOA 4N5MA 4CMEA 1BVRA 3V2UA 3GOHA 3GPIA 4OSPA 1I2CA 3W8EA 1RKXA 4D3DA 1WLYA 2OBYA 3CSDA 2IXAA 3H9GA 3I9JA 1E1KA 4GSKA 4JN6B 3UOGA 4GGOA 4PLPA 3D4NA 1A9ZA 3VPHA 1F0YA 4QSMA 1WP4A 3KHUA 5JY6A 4K6CA 1UXHA 2Y1OA 4PLFA 4YJFA 5JDCA 4YYZA 3JD4A 2HJRA 2AQ8A 2OORA 1O9BA 2VWHA 5ER9A 3UUWA 4B4WA 4A73A 2VTEA 4M86A 4N18A 1I32A 1IUKA 4BIIA 1Z7EA 3PFFA 4CM5A 4ZICA 4MJLA 1GUFA 4J0FA 5JS6A 4UVEA 3KRTA 2VTDA 3UCEA 2CD9A 3ROPA 4BVAA 4ID9A 1U5AA 3HN7A 3WB9A 1AXEA 3T4XA 4W99A 2VRCD 4BGEA 2PK3A 3Q6IA 2GZ3A 3O9ZA 2A92A 2GCGA 4I5EA 1RYDA 5U9CA 1TI7A 3TQHA 2ZYGA 2AA3A 3ZN2A 5A5EA 1IY8A 2CVQA 2V6FA 3BTSA 3INTA 3PDJA 1HF3A 1B3BA 1IZ9A 2C82A 3LF1A 3NRCA 2OXIA 2RH4A 1DEHA 3NJ8A 4J2HA 1DRUA 5IXSA 1YOVA 3FHLA 4Z0PA 4CMIA 1AHHA 4RF2A 5DNAA 4FR5A 3SC4A 3SEFA 1U1IA 2EWMA 3ETDA 4GX0A 1ZMTA 3W6UA 3OECA 1ISIA 1T1SA 2DLDA 1OFGA 3B1FA 2DT5A 2DUWA 3CZRA 3H5RA 2R00A 4BMNA 1PX0A 1VKNA 1K3TA 2GN9A 1NXQA 4J9VA 3TZHA 1HKUA 1ZVMA 2D5AA 3C7CB 4B3IA 2H6EA 3GC6A 3IKVA 2BFMA 3F5SA 2ZTLA 1WZIA 1TXGA 1ARZA 4TVBA 2GN8A 1GQYA 1CRWG 2O4CA 3KETA 3G79A 3SX2A 1IHXA 2ZJ0A 4DL9A 4GI2A 4WGGA 1SB8A 1DOHA 2HO5A 4E13A 2C07A 2YJZA 4J0EA 3BMQB 3C85A 1HSOA 5JYEA 4J1TA 1EMDA 5G4KB 1U3TA 1YB1A 3PGXA 4CM3A 3OM9A 2A35A 3DONA 4MVJF 1QLHA 1VRWA 4BNKA 3S55A 4RF5A 1DC3A 4C7KA 4IQ8A 1XGKA 2EJWA 4YAKA 5IZ4A 1E3SA 3FN4A 5I9MA 2FPGA 1Q7GA 3IKTA 2IEBA 3JYLA 4C7JA 3BXXA 3I4CA 4W7HA 2O3RA 4PLTA 5TC4A 1ZCJA 3FWNA 5U1PA 5KWEA 1IYZA 1GV0A 1IB6A 2E37A 1T2AA 1VC2A 3HWRA 1X1TA 3AM3A 1KEPA 3QW2A 1U3WA 4Q3BA 3RQSA 2GGSA 5A05A 3HJAA 3UVEA 3WSWA 2ZYDA 1T24A 4QQRA 1R4NA 4EUFA 1I01A 2Z95A 3U4IA 1LU9A 4WLEA 4KUHA 5AOVA 3RBVA 2UUPA 2JJYA 2X22A 3VPFA 4DREA 5IZCA 3MOIA 4IDAA 1GR0A 4NBRA 3TZCA 4A26A 4D0RA 6LDHA 3ZWMA 3WGIA 3GF4A 3R3JA 2O4UX 4B4OA 1F8GA 3DFZA 1Q2XA 4L4RA 3I52A 3WQQA 1HYHA 2Q1SA 5MGBA 5KVSA 3I23A 5C7LO 1IZ0A 1R0LA 3DFUA 4FJ1A 3GEDA 4U6SA 5K6AC 4F46A 4Q3CA 3I6IA 1RM4A 3WX0A 1UAYA 3NTQA 3FNFA 3LZ6A 2VUUA 3AUAA 3VTZA 2ZTVA 1JA9A 2X7HA 1HE5A 5B12A 4IGFA 1YVEI 2J3IA 1U4SA 3EUWA 1N9GA 3RASA 4RPJA 4RLHA 2HDHA 1HE2A 2J8ZA 1J5PA 3D7LA 3FD8A 4D41A 4EDFA 4R9RA 3GHHA 3WNQA 1DFHA 1K89A 2PKQO 4BV9A 3NDIA 4JCOA 4YPOA 4HX5A 4U0KA 4AJ1A 4ZJUA 3E9QA 3GVIA 3GZNA 5FYDA 5BNFA 1FF9A 4CUZA 4MIYA 3SXPA 1PWZA 3WSVA 3WDSA 4TKLA 1E3LA 4CUKA 5TRTA 1YQXA 5L7TA 2WD7A 2IYOA 2J3JA 3DZKA 4L4XA 4FJ0A 3WGZA 3O38A 4J43A 4QFCA 1QXSA 5C37A 3PQEA 2GRAA 3QQPA 2VWGA 2X0RA 4NI5A 3WICA 4RGBA 3E9MA 2PA3A 1N8KA 2AE2A 4H3VA 4R4JA 1YL7A 2JCXA 3RU9A 4TMFA 5JAMA 4FOSA 1T25A 4A03A 1DIRA 4KQWA 1ULSA 4KTTE 1XELA 3Q0EA 4M55A 3GGGA 4YJHA 3LC1O 2YUTA 5TT1A 4F6CA 4RPHA 2OFPA 3NDJA 4FFMA 1C0IA 1VJTA 3GVPA 2VZ0A 2AHRA 4QX6A 5JMPA 4M1QA 3LU1A 5TX7A 4ITUA 3LK7A 1MUUA 4IZIA 2H1SA 1N1EA 4IMRA 4QEDA 4RV9A 1XLTA 4EJ6A 5KJFA 5TGDA 1ISGA 2Q2VA 4Q3NA 4DBZA 5C5IA 4AJNA 2PWZA 2SCUA 1UZNA 4RVGA 3DBVO 1GDHA 3TZKA 1K6XA 2JCYA 2NVWA 3M6IA 2FSSA 3IMFA 4CLOB 1UXKA 1BXZA 2X0IA 3QVSA 4MKXA 4PG7A 1YO6A 3GT0A 4IDBA 4IIUA 3PWZA 1VPDA 3GMDA 2PV7A 4LCEA 3JQAA 1D3AA 1PGPA 4XKJA 3JQ8B 3LDHA 4BO7A 1R4MB 3ICPA 4II3A 2GUGA 5ENVA 1V9LA 3CINA 4EBFA 3ICCA 3PDUA 1GD1O 4IQGA 1NFRA 3AUSA 1P0FA 3I6QA 1YRLA 1ZJZA 1W8DA 3ZWCA 1A9YA 3V1TC 2VHXA 2Y0EA 1NQOA 4MP6A 5IDWA 2HMWA 1ZXBA 4KTVE 3RBXA 3UHAA 1A4IA 2VWQA 1C3VA 4Z9YA 2X5OA 1E3WA 2NACA 4RVUA 4FGWA 4DPMA 4J91A 4QT0A 3HSKA 5LCXA 4HWKA 3CUKA 1KETA 2RAFA 4RPLA 3UH1A 3RCBA 1HT0A 3JYQA 5T8KC 1PJ2A 5FI3A 3WNVA 4WK6A 4QXMA 3JQ9A 1DFIA 3QWIA 4HXYA 4MIEA 4XDYA 5A4DA 2JHFA 4DYDA 3TOZA 4K9DA 3K9QO 4KWIA 4RZHA 4K6FA 2CY0A 3KEQA 3T7CA 5KJ6A 4S1VA 1Z74A 3H65A 5BSEA 3IAHA 3N58A 3F1KA 3LC2O 1V35A 4KDEA 3BMNB 3SLKA 4UUMA 3NDRA 2P91A 1I30A 2JAHA 1SAYA 1ZBQA 1ONPA 2X58A 1ZZEA 2FR0A 3RUAA 3U4HA 4KMSA 2VYNA 4PZCA 3IP1A 2DBZA 1DRVA 1UP4A 4TSKA 3JQGB 3U5TA 3Q3CA 1I5RA 3NTOA 1P1FA 4YTEA 2HKIA 1ZK2A 4HBGA 3QE3A 1XG5A 3OBBA 3LT4A 2JD0A 2ZB7A 4WLFA 1GAEO 3KO8A 4ZQHA 3S2EA 2BI7A 1NPDA 2FR1A 3JD1A 5KVVA 1XKQA 1JAXA 1E6WA 3PWKA 2EV9A 1DC6A 1KVRA 3DTTA 3OA0A 3WQRA 3ZCXA 2AEMA 2PGLA 1PJ3A 1P1IA 1BWSA 1X0XA 2CVOA 3WG9A 5I7FA 2V6MA 3DO5A 3ANLA 4AG3A 4DLLA 4D46A 3DQPA 2Y1CA 2GLXA 2HRBA 4Q3EA 1YB5A 2FZEA 2HU2A 2D1YA 2DQ4A 5U4QA 1RM5A 2EERA 1PL8A 4R54A 1F12A 1OOEA 3C1AA 4IJKA 4YAJA 4E2XA 4E4YA 1NFQA 1OI7A 4O1MA 4AJHA 3DC2A 1N7HA 5A1TA 5FEUA 2DAPA 3HQ4O 4PRLA 2XAAA 4IMPA 1QV7A 3KYCB 5BSFA 4QO8A 3BAZA 2EKQA 4BNWA 1GQ2A 1GUYA 1O89A 2I67A 1YOVB 3IOYA 2FY8A 2NQTA 4Q3DA 4CMIB 2PFGA 1KERA 1BMDA 3DAGA 1LA2A 5CDTA 1LLCA 2GYYA 3FSRA 2NU6A 3GEGA 5I7VA 4FDAA 1MXHA 4J9UE 4BNFA 1C0KA 2BH9A 2G1UA 2UUOA 3DZIA 5L3ZA 4WLUA 3CEAA 2X5JO 4IJUA 3W4JA 4D43A 5CG1A 2Z5LA 5DDIP 3A4VA 5EQFA 1C14A 4I08A 4OM8A 4YRAA 4NBWA 4MINA 2OP0A 2UVDA 4GLLA 3QVXA 4CODB 3SLGA 4F45A 4ESOA 4EEXA 5K0ZA 3ZV4A 1A27A 3QVWA 1P3DA 3QA9A 4D3SA 3OJFA 5JCJA 1UDCA 3RJ5A 4WLOA 1HYGA 1ZMOA 2B36A 2HK8A 3AM4A 1O5IA 1P33A 4RDHA 3TNLA 2CZCA 3PPIA 2J3KA 4RZIA 3U3XA 3K73O 3VH4A 3H6KA 2Q3EA 1EK6A 4JJGA 1NWCA 3JTMA 1N2SA 5KJEA 1E7WA 2W98A 1HDOA 1U7HA 7MDHA 1I33A 4TRNA 1IPEA 1JWAB 1JAYA 5JMWA 1KVQA 5DBGA 4ZQGA 3WTBA 2QRJA 1CWUA 2IZ0A 2OGUA 1PTJA 5FF9A 1DAPA 1WMBA 5ER6A 3WGOA 3L9XA 4PG5A 4Y67A 2G76A 2RIRA 3AU8A 1K0UA 1JKFA 3GDFA 4IXTA 4IUYA 1V3VA 1KEVA 3ON5A 1SCUA 4FC7A 4CPDA 1O94A 2WD8A 3K2EA 4R1TA 1X1EA 1OBFO 5DP1A 5JNLA 1I0ZA 1R4NB 1XCBA 3KSUA 3KYDB 1D1TA 1Y5RA 3WJAA 4ZHSA 1MG0A 3JSAA 4JP2A 2NVUB 4O59O 4JIGA 2DTDA 2Q2QA 4CR8A 1ZO8A 4H16A 4NFHA 5DBFA 3OJ0A 2O2SA 3CKYA 3LQFA 3NGXA 4GWGA 1JW9B 4R69A 2VOEA 2EKPA 4QECA 3G1TA 3KLPX 2X0JA 2CF5A 2PD4A 1HTBA 3P2YA 3PK0A 1EUDA 1H6DA 1GCOA 2BGMA 2OP1A 5IJZA 4IZHA 4PG8A 5TNXA 1GZ4A 3ZU5A 1LRLA 3GFBA 3AI2A 2EW8A 3AOEC 1B8VA 1ONNA 1XQ6A 4BNNA 3C8MA 5A04A 1DBVO 3H7AA 3ZHYA 1Z73A 3M2PA 1N9GB 4MVJI 3JQEA 4R51A 4GX1A 3SC6A 2IZZA 3IJPA 4DIFA 2HRZA 5JDIC 3LC7O 4E5MA 1YL5A 3WLFA 4CQMA 5CEFA 4TZKA 2DPGA 4L0QA 2OOSA 2YHIA 5TS3A 4EGFA 3DMTA 5JPIA 4NBTA 4K1LA 1U7TA 2HCTA 1EZ4A 3GZNB 1LJ8A 3I83A 1DDOA 3ETGA 3ZH2A 4IDEA 3DAFA 4I5DA 3TJRA 5ITWA 2Z1NA 4QFDA 5A02A 2WD7B 1CQJA 3ZWBA 1PS0A 4ZU3A 4RQUA 5B37A 2ZCUA 4W82A 3ZWOA 1QMGA 4XD2A 2NV6A 2DFDA 1QV6A 2JD2A 1IOLA 2Y1FA 1VM6A 4RPGA 3K31A 3BIOA 4MDHA 1Q7BA 2HAEA 3RIHA 2B83A 3FNHA 4CM9A 2YDXA 4XGKA 1Y8RA 2NADA 4YJHB 2VUTA 3VDRA 4CMEC 3NV9A 4KWHA 1GQQA 1PR3A 4DPLA 2IE0A 5TIIA 3AY3A 3RUCA 2CDBA 3EVNA 3HDYA 4JK3A 1JQBA 1KIFA 3PVZA 2I6TA 2Y0DA 3D5TA 2F00A 4NR0A 2EW2A 2J5RA 2Q4BA 1PS9A 1E77A 4ILKA 3LLSA 3ZWWA 2PZLA 1E5LA 1PEDA 2XPCA 3ITDA 1UJMA 1DAOA 2DU8A 3V1YA 1X15A 3NUGA 3U62A 4FN4A 3WJ7A 3GUYA 1EFLA 3CTMA 4JP3A 3PXXA 4YRDA 1EQ2A 4EYEA 4UUNA 1HLDA 5A9TA 3KTDA 1QKIA 4ND1A 1LDMA 3OQ6A 3VPXA 3V1UA 1YBVA 4P4NA 3PQFA 5A9SA 4NU6A 3B6ZA 3EC7A 3ZHZA 3KYBA 3RBZA 4BKUA 3HHPA 3I9LA 4MKZA 2B35A 4RCVA 1FMCA 1VJ0A 2ET6A 3JQAB 4Z6KA 4L73A 2AEJA 1YGYA 4YJGA 4CMBA 3ASUA 3DBHA 4FSHA 4DC1A 4INAA 3GVHA 3OICA 4DQUA 4XYEA 3B20A 3W4IA 3P5SA 1I24A 1P1RA 1UZMA 5L45A 3PLNA 4PZDA 4ZRNA 2VHZA 2UAGA 1G0OA 4AJEA 3OA2A 1HE4A 5I7SA 2R00C 5JCXA 1T1RA 1DFGA 1ZK0A 2O3SA 4WEOA 3K96A 4OQYA 4BNXA 5L9AA 1N1GA 2XXBA 1E5QA 4WOJA 4BMVA 4B79A 2PZJA 2QRKA 4XEHA 1BTOA 4D45A 1LBEA 5EJ2A 1E3WB 1U4OA 4GAEA 2C2YA 5CP8A 1PJQA 2DM6A 4TKMA 3GGPA 2O3TA 3N74A 1PZGA 2GZ1A 3IDSA 3FCOA 3TOXA 4AJ4A 3BYZA 5HTOA 1GU7A 3PQDA 3QY9A 2VT2A 1I10A 3AW9A 4WLNA 3ZNOA 4E3ZA 2NNLD 5TSDA 3DL2A 3AY7A 2BI8A 4OJNA 2BLLA 3UKOA 2GASA 4R16A 4D79A 4DIOA 3DBLA 4RJTA 4WPGA 2DBRA 1ONOA 3BMCA 1MFZA 1NHGA 3WMWA 3GNTA 4BNZA 4LSWA 4J3FA 3RI3A 5GMOA 2NVBA 5CDYA 1QYWA 3V5NA 2DTXA 4RDIA 5GZ3A 4P4GA 1TT7A 1XIVA 1ADFA 3F1LA 5L7WA 4WCFA 5IN4A 4NU5A 4Q3AA 1T2FA 2Q1UA 4EEZA 4FB5A 3OJEA 1PJBA 1YJQA 4UVDA 3KSZO 1BHSA 3VH2A 5EQDA 5DOZA 2AMFA 4FGSA 3FTPA 1JDJA 5EINA 4OQZA 5JY1A 1ZH8A 1HZJA 1T4BA 5ADHA 4NZ9A 4CM1A 4M49A 5ES3A 1XDWA 3CPSA 4R5MA 2NTNA 4Y98A 4BO9A 2E4AA 4DIBA 3EW7A 3MZ0A 5H81A 3QWBA 2CVZA 4G65A 2O3JA 4IGEA 3W1VA 3MJSA 3VZPA 5IFLA 4XQCA 5EMHA 3UCXA 1JN0A 1IULA 3W8DA 1LRKA 4BV8A 5HM8A 4EJ0A 4A27A 1KVTA 3PGJA 4AJLA 1P1KA 4KOAA 4D7AA 1ZW1A 4BNIA 1NR7A 2Q50A 4MVJA 1BXGA 4EITA 1EDOA 5EERA 2PGJA 3PHJA 3GZ4A 4BKRA 4GKVA 3ETEA 3ULKA 1J49A 2FPPA 1T4DA 3S1LA 3WYBA 1P1JA 2O7SA 1BG6A 4J90A 4WASA 1EBFA 2J5KA 3E18A 1BVUA 1WNTA 4KDFA 1ZKMA 1C1XA 2X0NA 4CLRA 1EVIA 1ZUD1 1SBYA 5JFOA 4Z3DA 2O2YA 4YEDA 2QRLA 2I5PO 2RHCA 2EKLA 4LVCA 3ZU2A 3EY4A 3ASVA 4DMLA 3S8MA 3E82A 4YT8A 1MX3A 3ZWXA 2UYYA 1PIWA 4BO2A 1J0XO 1U8XX 2NQ8A 3X2EA 4G2NA 4HY3A 4LGVA 4UVIA 3QWFA 3GLQA 4NNJA 4YQYA 3RJ9A 2FMUA 3I9OA 4P4LA 1IHYA 2ZATA 1U2DA 4I1IA 2VWPA 5EIOA 3A06A 1V6AA 3JQ7A 4CLDA 2Q1TA 1GZ3A 2IRWA 2AQKA 3HUDA 2CNBA 3ZU3A 5L4NA 1VJ1A 1F8FA 1VE9A 3NTRA 1UXGA 9LDTA 2O23A 2P2SA 1Q7CA 1JWBB 1E7SA 1YQGA 3FF4A 3JQDA 3K8ZA 3TFOA 1Y9AA 3VC7A 3VPSA 4MVJM 4BGVA 2DBVO 4OYRA 1DHRA 4HKTA 1SC6A 3IQDB 3QV1A 2QYTA 1CIVA 1YH3A 4H7PA 4CV2A 3UCFA 2I65A 2Q46A 2B69A 5KKCA 5HBRA 2X1HA 7ADHA 2RCYA 3UFXA 1JLLA 3ZWAA 4E31A 3ROKA 3DZJA 5B4UA 2ZB8A 1XU9A 1H6BA 4L76A 5EPOA 4JBHA 2CMDA 4JNKA 2UV8A 3ONFA 1UZLA 1XA0A 2LDXA 1XQ1A 4CJXA 2IXBA 2VZ8A 4N5LA 4R41A 4OSOA 1U5CA 1X13A 1C1DA 1EBUA 4B7UA 4EW6A 1ZK3A 1JVBA 1MG5A 3GG9A 4RO0A 4XYGA 2D5CA 4BO0A 2NTVA 4XRRA 4EZBA 4PLYA 1NPTO 1S6YA 1E1NA 3I9MA 2X9VA 1UAGA 1PZEA 2FR8A 3D3WA 1SO8A 1UDBA 2W2KA 3VKUA 4GWKA 3PHLA 3DAPA 1L7DA 2POQX 4LK3A 1HEUA 4RQTA 1W6UA 3O8QA 4HFJA 4UREA 4YACA 2RBEA 3H3FA 3ZNNA 2BELA 1NASA 3HN2A 3L6DA 1MC4A 4QUKA 1DJNA 4R9SA 1CF2O 2I3AA 4W7IA 4YT4A 1ADGA 1DHTA 3F9IA 3SVTA 2PNFA 1L1FA 3RUIA 3DTYA 2X6TA 3F4LA 3EGOA 3OEWA 1Z6ZA 4YT2A 1NVMB 4RVSA 4KQXA 1AXGA 5DOVA 1KOLA 1HDYA 4KUGA 4BO4A 3WTCA 2W2LA 2OUIA 4GMFA 4YAEA 1AGNA 4RPKA 3B1KA 1H93A 3CE6A 3CZMA 1PSDA 1RPNA 2J3HA 3LLVA 4B3JA 2O48X 3NX4A 3V8BA 2I99A 5G0SA 4XWYA 4GLOA 1VKOA 3GMSA 2BKAA 1ISJA 1PS8A 2VRBA 1PZHA 2PGDA 3TN7A 1TEHA 5JAIA 3C1OA 3JQ9C 4MVJD 2OHXA 4BB5A 4CMGA 3R6DA 3S2FA 2Y93A 4YAIA 4FD3A 3PZBA 3M1AA 3JYOA 4NBUA 4HNHA 5ICMA 2B5VA 1A72A 4NIMA 1DIGA 3RFVA 3O26A 4ZGWA 1YL6A 3EMKA 2H9IA 3E8XA 4R1NA 4BGUA 1YB4A 4W6ZA 3WBFA 3OH8A 1GYRA 1Y8RB 3RC7A 1LUAA 2C5AA 2JCVA 1V8BA 5JLAA 2BGLA 3DWFA 3PYXA 4JGBA 3AI1A 4OH1A 1HYEA 2YV3A 3L4BC 1S7CA 3C24A 4UEOA 1ZEJA 1LLUA 2F1KA 3MJVA 4D42A 2WJPA 3M1LA 3V2GA 5JAZA 5DBIA 3HFSA 3CMCO 3ZWNA 2J6IA 4WNIA 1F06A 1NFFA 4MVJG 1LSSA 2PKQP 4IINA 1WXDA 3LT0A 3D0OA 1R0SA 1W0CA 2E82A 1UP6A 2A94A 1K5HA 3KM0A 3NKLA 3D3EA 3PJFA 4UVGA 1ZSVA 5HRUA 1JTVA 4J1NA 2DKNA 3ZV5A 1GPJA 5A9SB 1QYVA 1EK5A 3EYWA 5AXCA 5IXYA 4Z0TA 4XRGA 3K6JA 4FFPA 3BTUA 4AJJA 5COAA 5H83A 2HLPA 4OXNA 4Y6SA 4YJGB 1PGOA 4U6QA 3DBHB 3PHGA 1BXKA 3EVTA 3ROQA 2ZTUA 4PG6A 5TT0A 4BKOA 4CMKA 4BHTA 3C1TA 4Y6PA 4YA6A 3PRJA 4WECA 3VDQA 2YV2A 4J4HA 1B3RA 3IS3A 2ZYAA 1MB4A 4J1SA 4IDDA 4EJMA 3HE3A 1YKFA 5BSHA 3I9KA 2W4QA 5ITVA 2JD1A 3NEPX 4U5QA 1GTMA 5F21A 1YE3A 4HV4A 4XB1A 2NLOA 4YJFB 1A5ZA 3IUPA 4LMRA 1HE3A 2TMDA 3LF2A 4AL4A 4NQZA 5CDSA 1R37A 4ALJA 1E7QA 2AQIA 4IPTA 1NAIA 2VZ9A 3TDKA 3I1JA 1OZAA 1GADO 4XQEA 1SOVA 2WSBA 4GGPA 3MTJA 1SZJG 3DBLB 4IDCA 4RORA 2HSDA 3A1NA 2C29D 2R2GA 4BKQA 2EP7A 3LT1A 1LX6A 3VZQA 3ZU4A 2HQ1A 5L51A 1E7RA 1R12A 3RC9A 3ZZNA 1NNUA 1H6CA 1KS9A 1ADBA 5CAEA 3W8FA 4WCFB 4Q9NA 3PP8A 4YVFA 2JHGA 1SOWA 4WE3A 2G82A 1KC1A 4EUEA 5EL0A 4CM8A 2NUAA 4GQAA 3U4DA 1H2BA 1Z75A 2JFGA 2EEZA 3R3SA 4UUOA 5AVOA 3KV3O 5IDQA 1ZEMA 2A9FA 3H5NA 1ID1A 1M6WA 4A2CA 4ALMA 3G3EA 2O50A 3P19A 4NFYA 2PH3A 3GNQA 3QVOA 4KP7A 1NWHA 3ROMA 1KC3A 1NHWA 3AK4A 3GPDG 3H2SA 3OIDA 3R1IA 4UUPA 3ONDA 5KKAA 4BNGA 2PTGA 5L4SA 3ADPA 3ONEA 4ND5A 4Z9XA 3SJ7A 3WIEA 3BMQA 3D5QA 5G4KA 4B8ZA 4E0BA 2Y67A 3BHMA 1HLPA 4ZQEA 4TRRA 1ENOA 3GNSA 1MV8A 2JL1A 1PL6A 4YRBA 4DXHA 1G6KA 4DQVA 1ISHA 4WOKA 4Z3KA 1KBZA 1BXGB 3L6OO 1U28A 3GFGA 1A7AA 2G17A 1JVSA 3KVOA 2HK9A 3MEQA 1XU7A 3FPLA 2Y0CA 3RC2A 3RSHA 3IL2A 1PJLA 4IY1A 1C1XB 5T64A 4CLRB 1CQIA 4J49A 2BHLA 1UH5A 3H9QA 3N7UA 4M89A 4NDNE 2C20A 3ZI0A 1HL3A 1HDXA 3JQAD 4MVJH 1X7GA 3AY6A 3TSCA 5T67A 3VHRA 5G2OA 5LC1A 1BW9A 4CMJA 3HDJA 3T7EA 2CSUA 2ZK7A 1EFKA 2A4KA 4BUCA 2V6BA 2PR2A 3G1UA 2GD1O 1FXSA 3DMTC 5CEJA 2LDBA 1ZJYA 3PYLA 1RYEA 3HFGA 4ZN6A 1DIBA 3G49A 1FK8A 8ADHA 2PH5A 1ENYA 4N54A 3VVBA 4ZVVA 4PRKA 2Q1WA 3PJDA 5DCWA 2FPIA 2HMSA 4P8RA 3H8VA 2AQHA 3KUXA 3WWYA 1GUZA 4NG5A 5CPBA 4GH5A 2G5CA 2FSVA 2OMEA 2VNSA 1GFSA 3OETA 1PU2A 2C2XA 5TQVA 4OXYA 4ALLA 3E9NA 4GMGA 1E7MA 1I8TA 5TJHA 1OAAA 2GERA 3AU9A 2QIOA 1ENPA 4R1SA 2XF8A 5COQA 4BO1A 3H3JA 4CLXA 3H9JA 5DULA 1H9BA 1ENZA 3MJCA 5J23A 1UP7A 5L40A 3Q11A 1VL0A 5G0WA 3WQSB 4A5OA 1LDNA 3D64A 4PLZA 5KOIA 3ZHXA 5MDHA 2VYND 3UF0A 5G0TA 4HADA 5I9LA 1H0KA 1U3VA 2ZB3A 4NH4A 1GEEA 1D1SA 2RHRA 2X9GA 3WYCA 1C1DB 3EAGA 3JCZA 1WMAA 4JXKA 4OKIA 2DUUA 2R6JA 1LLQA 1VL8A 1WW8A 1O6ZA 1EUCA 3I5MA 1K2WA 1EE9A 1A4UA 3RUFA 3BHJA 4QTZA 5ENDA 3VTFA 1PJCA 1FDTA 3GRKA 3D3WB 2V6GA 5C7OO 4DVJA 1X0VA 2W2KB 3WBBA 1M76A 1ML3A 4R1UA 5IDXA 4BKPA 1M75A 2V65A 3C7DB 1MP0A 3FNGA 1H5QA 4FIZA 2AW5A 1Q1NA 1A7KA 3CXRA 4JJIA 3NT4A 4DMMA 4XR4A 4WJZA 1B8PA 5GZ6A 5CG2A 2E6UX 2YYYA 4CV3A 5B4VA 5JC8A 2FZWA 3JD3A 2BGKA 4CR6A 3STHA 3VAZA 4W9NC 1I3MA 2GZ2A 4Z9FA 2CDAA 1D7OA 1X7HA 4XZ3A 5COBA 2BFPA 2FOIA 4E21A 3OMLA 4HFMA 5IF3A 1DIHA 1H9AA 1RWBA 4CMCA 4I9HA 4D0SA 5KVCA 1SB9A 1Y81A 4LCJA 4JJFA 3K5PA 1F17A 4XIJA 3ZV3A 4IM7A 4PLVA 3E1KA 3E6AA 5JDCC 4R5HA 1XWFA 4RVDA 1NTOA 5KVQA 3DR3A 3FR8A 1DPGA 1B14A 1NBOA 2CF6A 5AYVA 2WE8A 1GPDG 3OJOA 1E1MA 4AICA 4JX8A 1U3UA 4OO3A 4ZQFA 5KIAA 4GPD1 5JCJD 1K6JA 1MA0A 3Q9NA 5G0UA 1H94A 5AQ1A 2X8LA 5HWSA 5BNTA 3JYPA 2DFVA 2V7PA 4CL8A 4TZTA 4A7PA 1DRWA 4QO7A 4BO3A 4NJMA 3PWSA 4OKNA 4AJIA 3VPGA 4E5NA 3LYLA 1YQDA 4TRJA 3QHAA 2C54A 4WCFC 5G0VA 3TRIA 2E48A 5THQA 1YWGO 3EZYA 2AG5A 5F3RA 2FN7A 4PG4A 2D4AA 5A3JA 2CUKA 3WGYA 3QVTA 3GH3A 4PFJA 4BNMA 1NQTA 3GK3A 1YDEA 4ZRMA 1FJHA 1NQAO 1KVUA 2DBQA 2P5YA 4L75A 3AM5A 1XEAA 3VZSA 1LTHR 1P45A 1PZFA 3QSGA 3RFTA 3Q9UA 3KEOA 5JW6A 2VT3A 1CJCA 1Y5MA 3I9NA 2YY7A 3AOGA 4I8XA 3ZGYA 3L6EA 2HMTA 4H15A 4NJOA 1R6DA 4BB6A 2BF7A 5TLSA 2HMVA 1EQUA 3DDNA 1BDMA 1YONA 3UAGA 1B0AA 4E32A 4LMPA 3PHIA 1UXJA 2YFHA 1J6UA 4MOWA 3NGLA 4A10A 2QYSA 1BGVA 4Y6RA 1ORRA 3TZQA 3P7MA 4E33A 4IJWA 1GZ6A 1JU9A 1LNQA 1KY4A 3HNPA 2EF1A 2Q49A 3I4FA 3JV7A 3JQGA 4TRMA 5AXBA 1I2BA 1YS4A 1LRJA 3LT2A 3WLEA 6ADHA 2FHSA 3JQBA 5EN4A 1PL7A 4I5GA 4YAGA 2OO5A 3LVFO 1P1HA 2OL4A 1M67A 4D3FA 2NU9A 5I8ZA 4B4VA 3JQFA 3GA0A 3H9EO 1C0PA 3IC5A 3Q1LA 1QYDA 3WGTA 3GY0A 1PGJA 5F1OA 3F3SA 2GNAA 4LN1A 1HWYA 4PGFA 3WGGA 1TA4A 1WDMA 4YT5A 5JYDA 1G1AA 3ABIA 2QHXA 4CQMD 1RJWA 3F46A 1N92A 5JBIA 3OF2A 3KXDA 1TT5A 3QIVA 4OOEA 3VOSA 1E92A 5BT9A 3WFJA 4J7CA 1R66A 3KLMX 3O03A 2B37A 2QQ5A 3BZUA 3KYCA 4Q39A 3ZW9A 5CFZA 5IZCC 5L53A 3PEFA 5KNLA 4J7XA 1U8FO 1LC3A 3WGQA 2HK7A 3AUUA 1HXHA 2ZKLA 1TVEA 3GGOA 3QWHA 4DRYA 1EEHA 4YDRA 5JO9A 1RM3A 4AFNA 2WYVA 1B15A 3GN2A 3OHSX 2B4RO 3PTZA 4XJTA 5DN9A 5JAQA 1ADCA 1B8UA 1FDWA 1VSVA 3H2ZA 2ZCVA 3L0DA 2JFFA 2NTJA 5F5LA 3WOHA 4PCVA 1MC5A 4CM8B 4XQGA 3RROA 3DMYA 1LDYA 3ORFA 1P31A 3NAQA 3DXFA 3U0BA 4CM9D 3H4VA 3GN1A 4RLSA 1M2WA 1LSJA 3EHEA 2VHYA 3F4BA 4IS2A 4UAGA 4WNCA 5B4TA 2WWRA 4PLWA 4Z0HO 5HA5A 1LSUA 3OIGA 1PJSA 2C0CA 3ADOA 4U0JA 4G81A 4LISA 4PVDA 1W4ZA 4XYMA 3PYMA 1NR1A 1I3NA 3W4KA 1P77A 3L77A 3RAJA 2O3QA 2GSDA 4TWRA 3OQBA 4IS3A 4J4TA 4XYBA 4E30A 5A9RA 1LLDA 2BRUA 4WCDA 5JSFA 2YHUA 3HDHA 3OIFA 3WIDA 1MFPA 4E5PA 2WM3A 2PY6A 5GY7A 3CMMA 1UXIA 4NFSA 3P2OA 3TL3A 1HDRA 1MXFA 3PLRA 3COSA 3PJEA 4CQLA 1Y1PA 4CUJA 2PLAA 1QLJA 2X4GA 1B16A 3MJ4A 4PLGA 1H2HA 3WYEA 1HDGO 4K28A 2AG8A 3HADA 3B1JA 5CDUA 5DT9A 4ZD6A 4XGNA 3WS7A 3DBRA 3FI9A 1T2CA 4DQXA 4O63O 1LC0A 3DEYX 5I8WA 3OSUA 1U9JA 4J2OA 1LQUA 2YFQA 3Q2IA 2TMGA 4B4UA 1JKJA 4J1QA 1A71A 4Y9DA 2QZZA 1BW9B 1DO8A 2IDZA 3FPCA 4XA8A 4L8VA 3KYDA 3KB6A 5KTKA 1B2LA 4M54A 3CIFA 3INRA 4CM4A 2NVUA 4NMHA 4ROSA 3MOGA 5A3VA 4PLHA 4XJSA 1SEPA 3U49A 2P4QA 2PZMA 1R15A 2VQ3A 5IDYA 4CR7A 3DOJA 1IL0A 1UDAA 1GV1A 1KVSA 4P38A 1PWXA 2Y66A 4YJDA 1LXCA 2X23A 4R01A 4CMAA 3TZ6A 2AXQA 3BTVA 3INGA 5C7IO 4NK4A 1LQTA 3F5QA 2PZKA 2WYUA 2NSDA 1E3EA 5I9NA 2Q45A 1CETA 4XYLA 4JBGA 1EVJA 1DC4A 2D59A 2Y68A 4DC0A 3K30A 4R3WA 3DZGA 1XYGA 3F47A 4ND3A 4MPDA 1OC2A 2PD6A 3F6YA 4Y8VA 2G0TA 4XIYA 5KJCA 2GDZA 4ALKA 3HG7A 4LSMA 4F3YA 5F5NA 3RD5A 1JKIA 2JKVA 1E6UA 2EIHA 4PN3A 4NPCA 4DPKA 1XR3A 4TROA 2C59A 2I9PA 3AWDA 2J5QA 1XHLA 5KCZA 1E3IA 2B4QA 2FWMX 3BHIA 5A5FA 3GAZA 1EUZA 4BOYA 3FWZA 1WZEA 4E2YA 9LDBA 1HSZA 1PJTA 3ENNA 3S2GA 3GRPA 1Y9EA 3KBOA 4MVJE 5AXAA 3VH1A 4RVHA 4CQMB 5JXWA 2B5WA 2YHIB 4RF3A 1DLJA 1PQUA 4RVFA 4C4OA 5CDGA 1OC4A 1E0DA 2X86A 2VHVA 4AVYA 2EP5A 2HUNA 3JD0A 2BFOA 5IG2A 1Y8QA 4ND4A 4DGSA 4DWVA 1VSUA 5HS4A 1J4AA 1NVTA 1X14A 1ZFNA 3GDGA 4IXWA 4TVOA 3BMOA 3H5AA 5K6AA 1U2GA 2NU7A 5F1PA 2GR9A 2Y99A 2YZ7A 3K92A 3RVDA 2EGGA 2YV1A 3A14A 4URFA 3VZRA 4CLHA 1TB4A 2ILTA 4JLWA 3IUSA 1HRDA 1BDBA 2QZ9A 3ZWPA 3RKRA 2QG4A 3WGHA 3FNEA 4HUJA 3GEMA 4AJ2A 1ULUA 5CHEA 1CDOA 2DPHA 2FRDA 4I9NA 5B1YA 3DHNA 3DZHA 3I3OA 3C7AA 3OEYA 4OL9A 3WXBA 3A28A 1EDZA 2CDCA 5ICSA 4B7CA 4FFRA 4MP8A 1KY5A 5JO0A 3QRWA 4OOFA 3GQVA 2YQ5A 2WDZA 5DF1A 4OAQA 1ZIDA 4E6PA 1C0LA 1PQWA 1ZSNA 4BQPA 5K9ZA 2YW9A 3JD2A 1B26A 2P4HX 4O6VA 5KJ1A 1O95A 2DC1A 4PLCA 4AJPA 1OMOA 3KOUA 2BMAA 4O5OA 2GN4A 2DTEA 3X2FA 3ZHBA 4B3HA 1AN9A 4DBVO 3QJ5A 3HDQA 1YBMA 1Z45A 1I2ZA 1TLTA 2ZJ1A 2OBNA 3FBTA 4S3MA 4XCVA 4NJMB 3SBOA 1GCUA 2Q2WA 3AI3A 4CMHA 3E03A 4EUHA 3BA1A 4LRTB 3VKVA 4FBGA 2RH8A 3OJLA 4FFNA 4FCCA 4BL5A 4W4TA 3ZNPA 3RUDA 4YB8A 4PIVA 3RUEA 1N7GA 4J4BA 3C3XA 2Y05A 4AJOA 3FRJA 3MTGA 4ZQBA 3PJGA 5THKA 1CEQA 4FC6A 4IIVA 2ZQYA 2X5KO 3IP3A 3RKUA 2GPTA 1L7EA 4BNJA 4U7WA 3DZBA 1I3LA 3PFWO 3MWDB 1P44A 5T6BA 1UR5A 1Q0LA 1QR6A 1X7DA 1N5DA 3RU7A 1ZSYA
chains in the Genus database with same CATH superfamily
4DY4A 3COVA 3H8JA 4RPIA 3TAHA 3D4PA 1F14A 2BP7A 4QT4A 2Z9BA 3QXXA 5FUXA 8AT1A 3IR7A 4F6LA 3VR5D 3NH6A 1N2HA 2HJ9A 4G0OA 5H4GA 4QDJA 1TK2A 3T7AA 3UICA 5JJIA 2I66A 4WY2A 3ZBTA 4LFBB 2HPZA 5KOYA 2UZIR 4L50A 4TTAA 1I2DA 4OHUA 4HXGA 5JE8A 2V7EA 5K3BA 4AU1A 3AF6A 3V2HA 3AKZA 1R5BA 2WB2A 1MQSA 4OXIA 2I4TA 4YLEA 3T7KA 1JIVA 5KNDD 4G67A 3LS2A 3LUAA 5AI0A 5LDGA 4Q7QA 1QO9A 1SG9A 1Z35A 3QE0A 4KZKA 4NBLA 4B6JA 3DE1X 1TEXA 4EJFA 3SF8B 3QNUA 2WJGA 1XDZA 1BCSB 1G6OA 4GPBA 2GCNA 4P22A 1RJEA 1V0JA 1YJBA 1NW7A 5K0GA 2GNOA 2B8TA 2E4ZA 2NWQA 4R1QA 1ZG3A 2JIOA 1TGYA 2PKRA 3MMSA 3ITKA 4TTRA 4LECA 1O96A 1JDBC 4UNNA 4XPZA 4K86A 2NYVA 2ZRFA 5CVDA 5CJ2A 4AJ9A 4K3UA 4ALIA 2ES4A 1VI2A 1Q0QA 3ESDA 4ARVA 1DQZA 5FR2A 5CB0A 2R4TA 1TEVA 3SC2B 3WL7A 5LDHA 2W58A 3RU2A 1I3KA 3K0FB 4DY6A 2GLTA 3KXIA 3L6BA 4X20A 4C21A 4LMBA 3BL8A 1YBAA 2IPAB 4LY9A 4PQYA 1P9LA 4US1R 1DXYA 1MAAA 1QH1A 4ND8B 4PYKA 4UEQA 4NHEA 1TUGA 3AZQA 1SHLA 1KEWA 1ZUHA 4ZDKA 1Q3KA 1KSFX 4M1TA 1RSZA 2AFIA 4R2XA 2WAOA 3TS1A 4D74A 1NPYA 3PNQA 3LUFA 4L3WA 1FSZA 2BMDA 4LUCA 4BQRA 2Q7XA 3BZWA 3Q0TA 3OZGA 4C0HA 1FB5A 3U80A 2HO4A 1J00A 4GBJA 4WOBA 2Y3IA 4G37A 3E5RA 4YHHB 2VJCA 2WLTA 4KMMA 2C5SA 1ZNQO 4YP1A 2HA6A 2GWRA 1S0UA 3A2LA 4OHMA 3N6RA 4GOXA 3AYZB 4PZEA 2FW6A 2YX1A 2W11A 3JQRA 4JOCA 1AA9A 3WKCA 4UBOA 3JQ6A 1DX6A 1GKIA 2H3EA 4D9MA 5B5SA 2UDPA 1WRBA 2XLCA 5AJXA 3W5JA 1FUUA 1GSIA 3MWJA 2IYPA 2JZCA 2V58A 3QUCA 2R8BA 1SXQA 2JLQA 3OP4A 4K8RB 4H1HA 3GP5A 4PXAA 4BO5A 2G25A 4FI3F 5DI3B 2F8TA 2D7JA 2IJGX 1E8NA 3LXMA 5JNRA 3HLTA 5DP2A 1JI3A 1NLUA 4E46A 1DB3A 4PQRA 2INGX 1JALA 1T8UA 4U2CA 4KGXA 3G2PA 2D2XA 4FFLA 2J9GA 3BQ9A 3EIXA 3GAFA 1JHOA 2ZVQX 4O4HF 4TSFD 3SQNA 4UBIA 1EVYA 2PXCA 1RI2A 4GC5A 5EYPA 1N5RA 4UHJA 2Z2JA 3H0EA 4GX5A 1ORTA 2BMFA 1KJ9A 2YDYA 3HV0A 3KLOA 4KO3S 1EFTA 4LJ5A 4OXKA 3RR2A 3QVGB 3DTVD 3L0IB 2DVMA 3R0IA 5E4FA 4CQLB 2R5FA 4IFTA 3BF7A 1UKAA 1BFDA 2TMYA 3N59A 4DOMA 1VG0B 4ONEA 3P2IA 4FS3A 4J7UA 2M9MA 2HZBA 2ZIAA 3R8CA 4IGKA 2AE1A 4MTLA 4RTOA 5F76A 4MQ4A 1IOVA 1G19A 1P74A 1XC7A 4MP3A 3LDFA 1Z6XA 2WWVD 3BE5A 1BJRE 3OFSA 5JROA 1OXVA 5FEMA 1P0PA 1R9MA 3FR7A 4FJ2A 4XVQA 4DTIA 1NMEA 4TSRA 4CL3A 3A7DA 1RAIA 3DF7A 4HFRA 3EOZA 4U9UA 3CZ9A 2ZQ5A 4FDLA 4J2TA 3K0CC 3S2IA 4CDGA 4R68A 4IJVA 4RMIA 4YBZA 5A7HA 4B43A 1VG8A 4E1AA 1VE5A 2Q28A 4U2GA 3WR5A 4BNYA 2XUHA 4N7RA 1T3GA 4KUEA 2V4ZA 4RV5A 1WPQA 4EJSA 1T2DA 3DT8A 2FX3A 3QP9A 4A4DA 3GCXA 2WU1A 2VAMA 1OLXA 1WSAA 1XRQA 3B48A 5AK0A 3ZV6A 4DT1A 4MQLA 4YRZA 3OZUA 1EEXB 1JJVA 3KR9A 5JWHA 4NTZA 4XLZA 3N7TA 4PWZA 2IP1A 4WK4B 4TTVA 5ERGB 3HY6A 2ZB4A 1A1VA 5DU2A 2JH9A 3VPAA 3P4XA 1XZEA 4ZQIA 4TMYA 3TYXA 2JI6A 1PGQA 1U7UA 1QYXA 1Z5WA 1M7GA 2O3UA 2RGBA 3OJXA 4CM6A 5JBNA 3B78A 3UPUA 3QWAA 5KNCH 1Q21A 2IYQA 1I7DA 1Q16A 5KUTA 3ONWA 1EINA 4BMSA 3DLCA 4F38A 4AMGA 2CLIB 2BFDA 2JHCA 2CLEB 5H4HA 4RIIA 2V0GA 4ZZ0A 2BT4A 4GLFA 1T26A 5E9WA 3UA4A 2EXXA 2ROQA 1NSYA 4L78A 2PUDA 3R7FA 4JQZA 4M6WA 3C3PA 5L95A 4ZAFA 4PVCA 2QTTA 4LC0A 4K5QA 6Q21A 1EX1A 5T7BA 1Z5VA 4WGFA 2O5EA 2QB5A 1KJQA 1YZTA 2ZSEA 2WW8A 1NC3A 4II2A 2BKUA 4K26A 1QU3A 4ISBA 2PRKA 2P9GA 4BJ3A 1KK1A 2ECOA 2VT7A 1YAJA 5CURA 1JDSA 3AEZA 4I5FA 4B87A 1Z2OX 3REQB 4RTQA 4JR0A 1EG2A 1GGNA 2WSYB 1ZOLA 4HQOA 4L4SA 2R3SA 4MVWA 2O1XA 2GSWA 4ZXFA 5J1TB 4DLBA 3FRIA 4LF6B 2GCIA 3P96A 1CY8A 1LZLA 1E99A 1M6HA 4AF6A 2WNSA 4YY3B 4YRJA 4PPFA 4E2ZA 3Q2KA 3SSNA 3O1IC 4HFNA 4WACA 3TGLA 1DJQA 2JAPA 2DUNA 1OX4B 3H2GA 1ZJJA 2EL9A 2GBGA 3RUHA 4C7XA 3OHPA 2BVNA 4BGPA 1VLHA 1WR8A 2J41A 3BHNA 3L2OB 1QDLB 1T6NA 2HPAA 5MN4A 3PR3A 1GKYA 1U8UA 4Y2JA 3ZWYA 1GPUA 4QZVA 2P9CA 5TQ2A 1CDZA 1OQAA 2JFHA 1FLNA 2ZJYA 3DHYA 2IUYA 2VUSA 1Y8QB 2W6OA 4GP7A 5DV9A 4BQOA 4F4IA 4YRFA 5HOEA 5JMOA 4CV0A 1D1PA 1F3LA 3OCZA 4I6GA 2RARA 3R75A 4XGIA 4ZU6X 1QG6A 1NF9A 1W5AA 2GCPA 2IV3A 1M3SA 2NU7B 3A6EA 3A9VA 3RSOA 5IX8A 1I4TD 1UMBA 3FNBA 3ZKWB 1UMKA 3I34X 1T29A 1XTRA 1Z8HA 2B1QA 1TJNA 2NZYA 1JR3A 3E2IA 4QIHA 4FFOA 5JG7A 1Y3DE 2H65A 2ZEJA 2HGSA 2JJ1D 3RUPA 4HWTA 1U0JA 4GVLA 4QOSA 5CYGA 4TX1A 1XJCA 1X77A 1JR2A 4LY3A 4RIEA 3VTAA 4BGIA 5EIEA 4F86A 1LPBB 4MGHA 2PMDA 2F6RA 3HJGA 4AN0A 3EH2A 4B6QA 3GG2A 3CF0A 3EDMA 1HRKA 3NHAA 2ONJA 2IZ7A 1J2TA 4B9EA 1JNYA 1G16A 2HMUA 2IOYA 2WF6A 4MV1A 1RLOA 2NVOA 2X6QA 4R0VA 3SSOA 3I58A 4N49A 1K7CA 3LQRA 3NQ41 3NUQA 4HDSA 1Y6FA 1G3QA 5A4IS 3CEJA 4LJKA 4CV1A 4URUR 4MIOA 5ALUA 5EIFA 1H4TA 3AGQA 2VYVD 4GC9A 3NW9A 4JQCA 2VDVE 1KAOA 1FP7A 4MZDA 2P40A 3GO4A 1LI4A 4G09A 4NBVA 1K6IA 1ZX1A 4CDRA 3UMGA 2RKWA 4HEJA 5FA8A 3DB2A 5CBPB 1F8XA 2QGZA 3HU1A 3MYYA 3QY0A 4JKOA 2FFRA 1EG7A 2I33A 2QZJA 4UD2A 5JZBA 1KGSA 3F8SA 5DZSA 3LBAA 4QOHA 3KJNA 3GRZA 5DX1A 4FMDF 1RXVA 1SN7A 3AEXA 3OAAA 4IBOA 1OB5A 1KEUA 3AR4A 4L16A 1C7EA 5F23A 1ZWKA 3BMNA 4L9RA 5BMOA 4LNUA 1MIHA 1GCGA 2WEKA 2I8LA 1J22A 1CLEA 1Z5PA 2FSHA 2YZ2A 1DAHA 4PCLA 1D2EA 1HOXA 2W93A 3KLNA 1SVWA 3AVOA 1WQ1R 3B82A 2IXAA 5F7XA 3UOGA 1E1KA 1FTGA 4GGOA 3GLVA 4JGGA 5DBHX 1A9ZA 5I51A 5C4MA 2V7WA 2RHMA 1UXHA 3PKJA 2Y1OA 2ZRBA 4NV1A 4YJFA 5JDCA 3DCYA 1VHJA 2TMKA 1Y3IA 2CUZA 3EUFA 3WL4A 4EY3A 4CKXA 2VWHA 4A73A 3P0FA 4M86A 3GLKA 4LJ7A 1Z7EA 3PFFA 1FFAA 2DLNA 4CM5A 1G8YA 4MJLA 2X5XA 1W9MA 1Q3TA 3JYHA 4J0FA 1FSFA 3KRTA 4GDMA 4OFWA 3K9WA 4XFKA 4ZT5A 4ID9A 3ROPA 1U5AA 3HN7A 3TLGA 3WB9A 5IANA 3KAJA 2WJYA 4HN9A 4PPNA 3LBYA 4W99A 2WWHA 3IIKA 3T4XA 2PK3A 4HVLA 5JAOA 2C7RA 1DWQA 1FZQA 3VC1A 2JCGA 5ANRB 4EY6A 4JEHA 2YJ4A 4ZVUA 3P9XA 4I5EA 5KSWB 4TMXA 3U6KA 2ODTX 1TI7A 1CUIA 3QU7A 4JAVC 1U02A 3L7DA 1J0EA 4XX0B 2CVQA 2V6FA 3PDJA 3PXUA 4GR4A 5IWAB 1NATA 4M83A 2NU8B 1HF3A 1RXIA 2C82A 3VAYA 3NRCA 3WKEA 3OPYA 3HSSA 3RDPA 4J2HA 4X6XA 5CFNA 2HN9A 2YKGA 4CN8A 2IZ6A 5K3EA 3FHLA 3CUUA 1XLVA 2VP9A 3SEFA 5LD2B 4WTOA 4GMHA 1ZMTA 5BN4A 2RAVA 1F38A 1T1SA 2HIMA 4PO1A 5DBOA 5AKJA 2IBMA 1OBVA 1GPH1 4BMNA 3JATB 1QRAA 5IVIA 1XJ5A 1ZESA 3Q7IA 3TZHA 1HKUA 2QR2A 4UTOA 3CU5A 1H3EA 2GM9A 2W8BB 2H6EA 3VX4A 2DWCA 3IKVA 2C94A 1TYDE 2A78A 3RHFA 5JYBA 1OXBB 1TVKB 2A84A 2COEA 2Z3WA 1YQTA 4HUTA 5EZ6B 3MTAA 5LNK1 1URPA 1YQQA 4I46A 2PZ8A 1X2BA 4MV7A 4TVBA 5L3SA 4I8DA 5LXTB 1CPYA 3B3GA 1MRSA 3AV0B 3K9GA 3UHJA 3G79A 1U9YA 3QNMA 5ALRA 1GAXA 4N39A 2P2NA 4PNZA 4LHSA 4JL5A 1BFKA 1WJGA 2BEJA 2QJRA 4MQFB 1R6UA 4NE2A 4QUAA 2UYHA 4TQ9A 2FEMA 4IX1A 4NECA 4PTLA 2YJ6A 4LOHA 3R8FA 3I30X 1ZM9A 3X1MA 2G28A 5G4KB 1T13A 4F6RB 4MWCA 5IHXA 5E2AA 4F9TA 3NMUF 4OHYA 1P4JA 1JR4A 3PGXA 1E2JA 2A35A 4BNKA 4Q4LA 1Z5ZA 4ZOEA 3ZLTA 4TXMA 1DEXA 3AP3A 4XVCA 5LP6A 1RCUA 5EG5A 4YAKA 2EJWA 3V7YA 4ZCSA 2ZU0C 1XMSA 3M3HA 3VSCA 2WAXA 1Q7GA 2IEBA 3TNJA 2PR7A 3M8KA 5BURA 2ABWA 1LI5A 2DCMA 3NHZA 2X2OA 4W7HA 5IBQA 1Q0UA 5TC4A 1WTAA 2GN1A 2VJYA 4JBYA 4GBGA 4U00A 3R9XA 1Z8DA 3D59A 3VNSA 2E37A 1T2AA 1VC2A 4D8XA 3HWRA 1X1TA 2WKRA 1KI1A 4Q3BA 3RQSA 3PTAA 2E4WA 2R4QA 3RRFA 4MJ3A 4G5FA 2KLBA 3PXEA 2ZYDA 4PZAA 1KARA 1R4NA 3TSOA 1EP2B 4HC4A 3WSWA 1JB1A 1LU9A 1ODIA 3TKYA 5AOVA 1XZ8A 2IV2X 3AG5A 1M74A 2UUPA 3SMQA 3VPFA 1V7PC 1U3CA 5AIAA 1P4AA 3MOIA 1GR0A 4BAZA 3D6VA 2F62A 3DMNA 3L05A 3TZCA 3N5KA 4R6WA 4A26A 5IASA 1XJWA 4FFBB 5JTTA 2I2DA 2B1JA 2A9KA 4MQEA 4OVKA 2G4CA 3K16A 1SCNE 2ALJA 3F6RA 3UGQA 4DDKA 5LFAA 1SQ5A 2BMJA 3BDIA 3R3XA 1N75A 1YR2A 1E32A 2WAYA 2ZXEA 3PUJA 1II9A 1DZIA 2C8KA 4B2YA 1FQKA 3DE4X 3K5IA 2HEGA 1O6GA 2O9JA 4TN5A 4Y9RA 5KVSA 1PJ8A 3FVQA 3ZXSA 2BL4A 2FVYA 1EAMA 2CYCA 1MNQA 1T4CA 2C8VA 1VMIA 1QYIA 2GYUA 3WX0A 5IC5A 3KFLA 2YNMA 1B93A 1GN8A 3Q40A 4RZXA 3EEIA 2ZTVA 2JEZA 1PFGA 1YBHA 3QLTA 5B12A 4IGFA 1R4AA 4CGZA 2O8DB 3EUWA 4N41A 2XA9A 5FUVA 1U80A 3SD7A 3BWDD 4RA6A 2B21A 2HDHA 1HE2A 2CFTA 1NRJB 2RK3A 2W0SA 2PKQO 3NDIA 1WB9A 4ZJUA 2FSUA 4ER5A 1VBFA 2BTQB 3NTXA 3GVIA 3BJIC 3F2VA 4Q6WA 4LRWA 4LYHA 2OCLA 3IA2A 1J1IA 5IS2A 1GTG1 2MSNA 5DMHA 2P7HA 3NHSA 1PWZA 3SXPA 2JGJA 2QORA 5CVVA 4FSDA 4ENSA 1DQYA 1E3LA 1RRPA 3DL0A 4CUKA 3FUVA 3SBEA 2IYOA 1IBLB 3QU2A 4DJTA 2C83A 1P7YA 2L19A 3H18A 3LHKA 4F4DA 3IEMA 2SKEA 2QY9A 1YB2A 3O38A 3P27A 2ACKA 1IBMB 5E6SB 4J43A 2F4VB 2RC5A 2PWPA 1FDOA 2ZUUA 1MHTA 1UEXC 1C9KA 4K05A 4DZTA 3EODA 3FCAA 3MAJA 5EHZA 3G13A 1IAQA 3RS4A 2C1XA 4RGBA 3E9MA 4G1BA 1E2NA 1B23P 4H3VA 1OTHA 3EULA 4JU9A 3RU9A 5IJ9A 5E4YA 5JAMA 4A03A 3KL4A 4ARCA 1DIRA 1JFFB 1XELA 3Q0EA 1C30B 2PZEA 2UXCB 3B1ZA 3LC1O 2YUTA 3ZDDA 5K09A 5TT1A 2CJYA 2O2DA 2OHIA 3IQGX 4L0DA 4RPHA 4AZ3B 4F6CA 3BS4A 3UXEA 5KX5B 1VLZA 2VZ0A 3KB8A 3QMVA 2CXOA 4JT4A 4V38A 6AT1A 4P86A 2E5FA 2CXHA 3MTIA 1TQ2A 4MB6A 3PUYA 4ITUA 2JGRA 2PAFA 3LO5A 1GQFA 3UJCA 1MUUA 4IZIA 5LZ2A 2H1SA 3EGXB 1C7IA 3B9BA 5ALKA 4IMRA 2FJ0A 5LOVA 4ETWA 4RV9A 4DR6B 5CJPA 5TGDA 5BYAA 2CT8A 3BE8A 2YQZA 4V0LA 1LB1B 1GSOA 3EA4A 3JALA 1Y1QA 2RBGA 2OGTA 1FFWA 2W2OA 4JMLA 5G3YA 4DBZA 5DNCA 2QUAA 3AT1A 1RKBA 1FXWA 1Q20A 3ZQKA 1OFTA 2PWZA 2SCUA 4B6GA 1UZNA 1VFNA 3CVOA 4PE5B 3WP1B 2Q0SA 5FL7A 1GDHA 1F2UB 3NWBA 1K6XA 3M6IA 3TZKA 2OC9A 3L0OA 4HEA6 3H17A 3I8OA 4PG7A 3BH0A 3PWZA 1H8HA 5AK6A 4URHA 4WN9B 4DW8A 2PJZA 1XDSA 4PZYA 3OFND 3QEOA 1J23A 3M5WA 1PGPA 1WMFA 4XKJA 3TSWA 3JQ8B 3LDHA 1FNSA 3I3SR 4BO7A 2C5BA 5ENVA 4BFYA 1FNMA 5MF6A 1V9LA 1VECA 2WF8A 4EBFA 3ICCA 3OIYA 3TLBA 4EHFA 3NKFA 3MCUA 5LD2C 4MW7A 1IWBB 1DT5A 1P0FA 3UWKA 4Z4IA 1R9GA 1FEZA 1ZJZA 2IP4A 1W8DA 3HYLA 3VTKA 4O1HA 5IT0A 3ZWCA 3ZDAA 1A9YA 4WADA 3V1TC 2C9ZA 4GUDA 1JSLA 4RMJA 4XVHA 4KAXA 1F4PA 2HMWA 3RBXA 1QP7A 1ZINA 1Y6ZA 3N0RA 1FJGB 4EMSA 4BXOB 2XB9A 3LWBA 4KDRA 4C4PA 3Q7QA 2C8JA 5D3ZA 2JNWA 2ZTHA 4PNHA 4Q3OA 2R6ZA 3ZHRA 3HL0A 1P73A 1ZWLA 4BU1A 2AN9A 2YWHA 2ZS8A 3FVRA 1MABA 1W47A 3OEED 4HWKA 5FWYB 4A8PA 1CZNA 4WKOA 1BQ4A 3RCBA 5EZQA 1XVAA 1OLSA 2P3OA 1OW3B 1QFJA 1MPTA 1SKAA 2R87A 2XUOA 4RVOA 1RC8A 1OREA 4P7KA 4Y2RA 1M7BA 4BVFA 4RIGA 4QXMA 3EH1A 3JQ9A 2Q4RA 3O2SB 1DFIA 3ZVLA 5B7NA 4MWBA 1CKEA 4A0HA 2JHFA 2P6MA 4ZMBA 4E1BA 2PGNA 1CY2A 1EM6A 4KWIA 3PXBA 3QX7A 4K6FA 3KEQA 3OWXA 4Y0AA 3MGBA 1UJCA 4S1VA 3HO1A 1TQDA 3A36A 3G8BA 4LF7B 1KOGA 1V35A 3EZGA 4KDEA 3SLKA 5SZIA 4XFJA 4BJHB 4UUMA 3NDRA 1DAKA 3FGOA 5M04A 1A0OA 2XTNA 4QATA 1NM5C 1ONPA 2CLOB 2FXIA 2QN9A 2H2HA 1UBCA 3KU4A 3O3NB 4QXRA 5D6NA 5DTQA 5FWXA 4LWPA 3BD8A 4EL0A 1T5SA 1YBFA 1DTSA 3WGLA 4KSCA 4AP9A 1JLSA 3D8NA 5HUJA 1Z16A 2IXTA 3ILSA 2BR5A 3QELB 3ADCA 3NTOA 2CLLB 1UEIA 1X1AA 2HKIA 4J7AA 4IH1A 3M4XA 2XVXA 1U7DA 2V0CA 4HBGA 1VRVA 4JIMA 5IVHA 2VL7A 3ILYA 3KO8A 3S2EA 2BI7A 1NPDA 2FR1A 3EGDA 2R8PA 5H9VA 2EBUA 1G60A 4I55B 1JAXA 2A57A 1E6WA 1OYVA 2EV9A 3PWKA 1KVRA 3DTTA 3OA0A 4IL5A 1FW6A 2AEMA 2QAJA 4JODA 1PJ3A 2PLFA 3NS7A 1BWSA 1X0XA 1NULA 3W9SA 2V6MA 1AUQA 3DO5A 4AMVA 1T9DA 4TKVA 4O1IA 4PQGA 3HUEA 1P2TA 4DLLA 4D46A 1GFZA 2Y1CA 2HRBA 3IEIA 1YB5A 4PXSA 2GETA 3ILXA 5J2TF 3F5MA 4X1OA 2FZEA 2B25A 2D1YA 4FEYA 1SUWA 1UWKA 4XGQA 3PGMA 4R54A 1OOEA 1LTKA 2YMPA 3AW8A 3C4QA 5D3MB 3ZHCA 2Z8ZA 5L3RA 3D02A 1ECJA 3DLPX 1E79A 3DKRA 4HRAA 5BMVF 1XTIA 3HKBB 2J0SA 5I4CA 2DAPA 3HQ4O 2HRCA 4H60A 4LXTA 3TUJC 4DSNA 4EY8A 1HPLA 3VYVA 1JIQA 3KYCB 4FTWA 1ULAA 5BSFA 1SQFA 1WZNA 4QO8A 4BBJA 5LL6P 4M9QA 3V4PB 3QX3A 3CTPA 3GRVA 2WHEA 1YOVB 1IN6A 2D3WA 4RJKA 4BEJA 1ZUNB 4QGAA 1HQKA 5CA0F 3E4CA 1BMDA 1C0EA 1O6FA 1OCEA 2CLCX 4LTDA 3VOAA 5C9ZA 4LFAB 2POCA 3CWQA 3FSRA 2GYYA 3GEGA 5JH7F 3VYWA 5KMGB 4FDAA 4P3KA 1MXHA 1C0KA 4G1CA 1R6VA 2BH9A 3DZIA 5L3ZA 4N82A 4AKSA 4X66B 5CG1A 3VPCA 1RZRD 3EIHA 4AY3A 3QA3E 5AM3A 1SIBE 5LQCA 3A4VA 2CLKB 4I08A 5LYJA 2ZJ4A 1RBQA 2P9JA 4KIUA 2WVHA 3QPVA 1TUIA 2XNDA 3QVXA 3GJYA 4O29A 2JA2A 3MQ2A 3FDZB 5EGSA 2G9VA 2J9ZB 5HDQA 2OA0A 4W5OA 1EXNA 1BVYF 1X1RA 2VH5R 3QA9A 1F7UA 1XNRB 3KQQA 4JC8A 1EK0A 2PPLA 5JCJA 1BQEA 1AQYA 4MYTA 1JS1X 2H1IA 3KZOA 3O1JC 2D1SA 4V0QA 4UBJA 1ZMOA 3WLSA 2HK8A 3FYTA 2GRJA 2ODPA 5IBRA 3KQPA 4KE7A 4KFRA 4UC0A 4FKBA 4MWSA 1USVA 1TO6A 3NAMA 4EHJA 2C5GA 1GVHA 3L8ZA 5GONB 3T1VA 1IONA 3Q98A 1PQ4A 4NESA 2IXFA 3GJ5A 4YXWA 4FKZA 4M0FA 1R8YA 3WKAA 3VU0A 1OYYA 4HZUB 3JTMA 3UW1A 1U99A 1E0AA 3FSGA 1TAGA 2W98A 1HDOA 4ZVQA 1OVGA 4MHSA 1ESCA 3D6JA 3L1KA 4BMYA 4D25A 2AG6A 5HFNA 3EY9A 1IPEA 5KHOC 3C98A 1RNLA 4JLVA 4QDKA 5DBGA 4ZQGA 3QBVA 5A4KA 2OO3A 3VSDA 3HR8A 3TLXA 5FF9A 1LW7A 3QYAA 4KFSA 5ER6A 2YFKA 3WGOA 4YMVA 2XKKA 2H0QA 1IEQA 2IUTA 4LJ8A 1DG3A 2G76A 1D9XA 1U6IA 2FI1A 3D1VA 2V74B 3FB4A 3G85A 2V6IA 1CJKC 2IEYA 2VAPA 3GRFA 3D2AA 3IIMA 1P72A 4RANA 1K7YA 1NZFA 1TIKA 2VPTA 4IUYA 4RYDA 1A5TA 2Q5LA 1W88A 3S99A 2WT4A 4PPGA 5EMJA 5I9IA 1J8QA 1NOIA 3AR3A 5JNLA 3EF1A 3NHYA 1O8BA 5A4MS 3G0CA 4XDHA 4YMSA 4JP2A 2AWNA 1V3QE 4KG7A 1FE8A 1KI2A 1NXOA 2NVUB 3U16A 4O59O 4I5IA 1NONA 4KJZA 4CR8A 3FHJA 4H16A 2EKBA 1PV1A 1LBSA 2FXVA 3VBEA 4D4HA 3PC4A 5LUAA 3LGSA 4BQEA 1JDTA 5HUQA 3LQFA 4E7PA 1JW9B 2VJMA 3QKRA 4TT3A 2JFPA 4H3SA 2J3QA 5J5VA 1DWOA 3M33A 3GFPA 4RDXA 2PUCA 1GUDA 3U37A 2PD4A 4BMPB 4EWLA 2Y2VA 1G6HA 3G9TA 2V1UA 3SZ3A 3PK0A 4NARA 3GLIB 4Q02A 1EUDA 2O8EB 1GCOA 1G38A 1NVEA 1PUIA 2PT5A 2P9ZA 3VGJA 4KIWA 4QLBA 5IJZA 4HWGA 3ZU5A 3GP3A 1J39A 1J5EB 1GNPA 1O6BA 5KYXA 5JXIA 4X1KB 2HHAA 1JP7A 1LY1A 3EAFA 3GFSA 3O9MA 4UKDA 3R5TA 2RG1A 3H7AA 3UJDA 2X3UA 1E0JA 2IYTA 3N0XA 4EYGA 4KOEC 3T06B 4L5IA 1N9GB 4MVJI 4CG1A 4GKJB 1ID8A 4GX1A 1OXSC 6CHYA 2IZZA 4TS4A 2OLEA 3WLFA 2G7MC 2PYIA 4CQMA 5CEFA 1YFJA 3KAPA 4TZKA 4L0QA 3KD3A 3T4PA 1EPUA 1T2NA 3K1JA 5TS3A 4P32A 4EGFA 1U7TA 4FHDA 3D3NA 2G5GX 4JVMA 4FNOA 2HC9A 4HS9A 4LBZA 3D6HA 1QS0B 3D2CA 1LJ8A 2A0YA 2PUEA 2FN8A 1NX9A 5DNDA 4I5DA 2BEVA 2QRZA 3LUGA 3HM9A 3QLUC 3ZIAD 1UK7A 3FHOA 1C9JA 5EMMA 2Z1NA 3V7NA 2AFIE 2A0FA 4DLZA 4F1JA 4KR3A 1CQJA 4ZU3A 4N5DA 4ZV9A 1UMDA 5B37A 3JARA 3CRMA 2ZPAA 4QGFA 4G9BA 4KV7A 1ZP6A 1J8FA 4DAOA 5JJLA 1O5OA 2G67A 2DFDA 1TYAE 2JAWA 2R97A 4I4IA 3T5BA 3C43A 1QRUA 2ID9A 2C95A 1IOLA 5CYPA 4DRZA 2WABA 3VDXA 2A9VA 4HBZA 3STYA 3KWMA 4FX2A 4C0WA 1PHRA 3U3ZA 1RI1A 3ORHA 5AHRA 5BN3B 1FVHA 2E5LB 1E59A 4HCJA 5AHXA 3JRNA 2AOUA 3EFHA 1G21A 4ZEVA 3T9BA 3FNHA 5E38A 2A9JA 5CJJA 3LNCA 4DLSA 2H00A 4E88A 2NG1A 3CFYA 3L0BA 5KS2A 1QJ4A 2H3HA 2E89A 3DO8A 5GIPE 5B7PA 1RRKA 4CMEC 1HFJA 3NV9A 4KWHA 5EZYF 4HWSA 2ZAIA 3AY3A 3HHEA 1N1DA 2QLMA 3ZQ4A 4A8JB 1BQ3A 3HDYA 4JK3A 1GM5A 3U7EB 1JQBA 2R6FA 3I01A 3OU2A 2I6TA 3D5TA 3PVZA 5JSHA 1I9GA 1E77A 1E1CB 2OAGA 4NOKA 3YASA 1YACA 3LLSA 2ZJBA 1IDN1 5FPYA 3TD6A 1Q12A 3UAYA 4K2AA 1QP0A 2DKOA 1U4NA 3ZWWA 5CX4A 3LBNA 3NXSA 2RHHA 2XPCA 3ITDA 2OORC 3QBEA 1UJMA 2CJXA 2DU8A 3NUGA 4FN4A 3ILVA 3ICWA 3G5UA 4G36A 4JP3A 4QFMA 4HNAA 4LV8B 4C7OB 1JXOA 1NVBA 2CXUA 4UUNA 2W37A 4YRTA 3LP6A 3S3TA 4DHWA 4XJXA 1W93A 1U6KA 2A9PA 3ETJA 4O3FA 4Z2YA 5A9TA 4DVGA 1DP4A 4DLRA 4Z54A 5FX2A 3FMVA 1GGFA 3QUTA 4JVLA 4RZ2A 2P4EA 4KRGA 1RWPA 4L7QA 1GPNA 3RAFC 2IP2A 2VK2A 2GAOA 5H59A 3RT7A 1YBVA 1GU0A 1QX3A 1JJIA 2NIPA 4NU6A 3MTEA 5MGNA 4HNUA 1R4ZA 4Z4FA 5EHQA 3SDSA 3RBZA 4BKUA 4WY8A 4KO8A 1WSDA 1JX6A 1DX9A 3OM1A 1WVIA 4QXPA 1QHIA 4UMEA 1YGYA 1MT0A 5AH0A 3DM9B 1NVUQ 4CMBA 3ASUA 4D56A 2N42A 4H7DA 4DC1A 4INAA 5K4HA 3LY9A 4KIJA 1IY2A 2FUCA 2XV1A 2QROA 5CLQA 3F97A 3AO0B 3P5SA 4IWYA 4KPEC 2XNHA 1W34A 3A32A 4PZDA 3JASB 2B9VA 4AJEA 4WD3A 2R00C 2VNJA 2QAGA 4J0KA 2MMGA 4WEOA 5GWXA 4H1WA 2DUMA 4OQYA 4J1GA 4FHCA 1X1SA 4WOJA 5DWQA 4B79A 3PRYA 2O7NA 2MSDB 2PGOA 2PZJA 1IOZA 4Q9IA 3WIOA 3BPSA 5ALQA 1LBEA 4GAEA 3HGTA 3O73A 1Y3BE 4HLQB 4OHPA 1CZKA 4QNMA 5CP8A 4OQNA 2F67A 3ZXYA 2JVIA 3GGPA 3CF2A 3HYTA 5H8WA 3SHOA 1SIWA 2RCNA 1D6NA 2VCHA 1Z13A 1IBSA 3N2IA 2VQDA 2RAPA 1P9OA 2F64A 3PQDA 3AW9A 1P2VA 5B1EA 5T6MA 2N46A 2QJTA 3AHCA 4R8VA 5TSDA 2PWBA 4NLLA 3AY7A 2ONKA 1YS1X 2REBA 1FNBA 2G5PA 4ITRC 5K6RA 4KQEA 3WNBA 1RWOA 2BLLA 2GASA 3CUSA 4Q7JB 4R16A 5AVYA 5NULA 3EIUA 4HI0E 1OV6A 4AKHA 3GNTA 2QMUA 3RI3A 4ZOLB 1DC7A 2NVBA 1VCNA 1EP3B 4ND7A 4KO2S 1KRWA 1OXMA 4MPRA 3TKAA 1XKXA 2MTBA 4MI3A 4CF6A 2VK8A 1TT7A 1XIVA 2JVJA 4LQDA 3EHDA 3SHTA 1RCTE 4YP6A 3CX8A 2CFOA 4NU5A 1Y3CE 3LCCA 1T2FA 3P26A 1F2VA 3QE4A 5K0FA 3AR5A 2NXWA 3DDOA 2FNAA 4KI0A 5AKEA 4IHKA 3V46A 1PJBA 1YJQA 1CY0A 2GCOA 4B7AA 3ITNA 3MFQA 2QMYA 4H27A 2WNHA 4CXMA 1PV2A 1UJBA 2AMFA 4P3XA 4PBTA 5DOZA 1G8SA 1PG2A 5EQDA 4YRIA 1ZH8A 4UPDA 2YW2A 1KIMA 3OP1A 5DIFA 1RLMA 3CPSA 3A2MA 3ZE2B 2NTNA 4M36A 3OZXA 4BO9A 1QP4A 4E5UA 1A2QA 3IT1A 4RFVA 2WUGA 4NYIQ 1YA4A 1VJCA 2N0SA 2O0MA 4UBNA 1X74A 4IGEA 4MUBA 3W1VA 3B9PA 1TD9A 3G9ZA 3HABA 4RV4A 3CO0S 4EX6A 2Z5VA 5K0NA 3OMWA 2QVGA 3LUDA 4GMXA 2DT8A 3UCXA 5I9SA 3FZEA 3TR0A 2PLWA 4KR9A 1BEZA 4J0IA 4EATA 1V41E 4TLLB 2M6RA 3DO6A 4A27A 3PGJA 3TQFA 3AVVA 3VNVA 2OG2A 1P1KA 3IURA 4OQDA 1CFJA 4KOAA 4D7AA 2IU4A 2J3MA 2QRUA 1NR7A 2Q50A 3RABA 1A8IA 3KC2A 1EDOA 1B6RA 1JR3E 3EVEA 3A9CA 3BE4A 1PYDA 3KKQA 3HXTA 4DWOA 4GECA 4F4UA 5C18A 2C4TA 3EDRA 5KYWB 1HQCA 2FPPA 4RABA 4YHBA 4M98A 3SYNA 3T61A 4EUNA 2O7SA 1BNCA 2ZROA 4J90A 5BUZA 5FV7A 3KAKA 1JFSA 3HYNA 1DCTA 3FNIA 4KDFA 2X0NA 1V9SA 5DEOA 4TLEA 4FCWA 1ZUD1 4BIMA 3SBDA 1SBYA 4FWIB 4QTUB 4K9NA 5JFOA 1PNRA 1G66A 5FR1A 1FMFA 3V7WA 2RHCA 2EKLA 3EMDA 4HDNA 5JASA 1BN7A 1UFKA 2IC5A 2NU6B 2ZGVA 1KOFA 1EJ6A 1A2KC 3PEUA 4UARA 4URWR 4J3JA 3WY9A 1V5GA 2BR4A 1RLJA 3ZWXA 1FVXA 2UYYA 1MNAA 1L4LA 3TQQA 1PIWA 1L7RA 2I6QA 2VYQA 4R1MA 3A04A 2H1LA 4RKQA 3UPDA 1JECA 2Z5GA 3DLIA 2VSNA 4Q4AA 5HMMA 2NQ2C 3X2EA 1S2OA 4LGVA 2D54A 2JLYA 3QWFA 3GLQA 3CW2A 2DECA 2P67A 2FMUA 5CLIA 5B3JA 2P30A 1IHYA 2BFWA 2BFCB 2ZRPA 4XW2A 4HAVA 3AR8A 3ERCA 1L5FA 3M4YA 5THXA 4F91B 2VNHA 1XDDA 2R8OA 3A06A 3FOCA 4M88A 4PM4A 5JS8A 2GPWA 1CU1A 3JQ7A 2EFGA 5CXSA 4ZU1X 4NCNA 2JCBA 3HUDA 1GNVA 1JR6A 2QM8A 1T36A 1QHHA 1OFIA 1UKBA 3NJRA 4RD3A 4ZVPA 1VJ1A 1JHZA 3VX3A 3VYSB 5E9QA 3M6FA 3SKYA 2C2KA 1QU2A 3VNQA 1E0KA 4D8UA 2PJRA 2YWGA 1Q7CA 1YI8A 2VDRB 1JWBB 5E6UB 4UZEA 1JQEA 3K8ZA 4AX8A 2FFBA 1ZGHA 4OXRA 2GEUA 3KJQA 4LJ4A 4TTJA 3VC7A 3VPSA 4BGVA 5IXJA 3GJRA 2CC2A 4CCWA 1Z9BA 1K7SN 2C2BA 4EO7A 4XLLA 4EHIA 1SC6A 2Y8EA 3IQDB 1L9XA 1CIVA 4H7PA 3RF6A 5AKGA 5L3QB 4YLGA 5KQRA 2I65A 1RQLA 2Q46A 3OAAD 1WP9A 2RI6A 3WIVA 5JMTA 1AHPA 3RYFB 2X1HA 5AVRA 5CX1B 1AKRA 2RGNA 4IIEA 4ZYVA 2RCYA 4E31A 5AFSA 2DR2A 3M83A 3B85A 1UBLS 1ZOSA 3K9CA 4RZSA 4A8JC 3RAGA 5B4UA 5UKDA 1UOEA 3ZQUA 3LY7A 4KQHA 2BMEA 2FFHA 2CMDA 1SKQA 4CKWA 3KXKA 3OTOB 4JUFA 1UZLA 5HQJA 3RANA 2O0KA 5CB8A 1QGED 3CLKA 1M1UA 4N5LA 1XZHA 1D8TA 2OBFA 3ZLVA 2PG3A 2F8LA 4A2QA 1KKUA 1RJ9B 3N2GB 4B7UA 1UQUA 3LOPA 1JVBA 4RO0A 1NC1A 2A59A 3I2HA 2WINI 4HB2A 4EG0A 4EZBA 1S6YA 3CNNA 2ISSD 1Q91A 1CULC 3ESBA 3I9MA 4QBIA 4RJLA 5A4JA 4M9XA 1UAGA 2OCBA 3A6GA 4MRMA 5IAJA 1SO8A 2Y1WA 2W2KA 3T5MA 3PHLA 3KVYA 4PU0A 1IMJA 1XZPA 3GARA 3DMDA 4GMKA 4LK3A 4U2BA 5CW1A 3ZWDA 1X7YB 4RQTA 4BP9A 5L3VA 2XXAB 1W6UA 2XZLA 2HQBA 4F92B 1P0MA 4L4ZA 4E09A 4YUVA 1KMCA 3FWPA 5A5GA 2HIHA 3AVWA 1E9BA 4EGQA 1SFRA 5LZ7A 3GL9A 1FNDA 1G20A 3HYSA 2RGCA 3Q15C 3QXHA 3F9IA 1PDOA 2Q3FA 4AZTA 1L1FA 5FTWA 3W6PA 4UTZA 4A92A 2QI9F 1J2RA 1JIKA 3LL4A 1G2OA 5LDDC 1O97C 4IX9A 1YMQA 4YT2A 8OHMA 4EPWA 1NVMB 4EY4A 2QENA 3LCRA 4RVSA 4KQXA 1AXGA 4UHDA 5K51A 3T34A 4B6EA 3IVXA 3WTCA 1QOPB 4DV7B 1AU9A 2OGWA 4LHEA 2OUIA 2O8BB 5ALLA 4R3UC 2CXRA 1AGNA 4UZFA 4KI7A 2FZ4A 4QOJA 1H93A 3CE6A 3C5VA 1V8FA 1SKYE 1ZAYA 1DX4A 3ECCA 1NXWA 2FCAA 5FOSA 5ULLA 1EFAA 1CQPA 5CVCA 2BM9A 4PZUA 2J48A 4RH3A 1ZJ5A 1VKOA 2PZBA 5TF0A 3TQCA 4C6HA 1ISJA 2J46A 3GBVA 2WLSA 4C76A 1PZHA 4UU7A 4R9VA 2HSGA 2HY7A 3JS5A 4JBXA 3EMVA 2BFFB 4EECA 5JAIA 1OWMA 1DE0A 1U8ZA 3R5KA 2P90A 4G4GA 4MVJD 2PL3A 4P1ZA 3QPUA 1A88A 4YAIA 1P0QA 2OGSA 1L4KA 3HKDA 3ISJA 4LWQA 1E66A 3QKUA 2EFCB 2RGDA 2IEZA 2WKSA 2A1UA 3CX6A 3HA5A 3L6RA 1LBHA 1JPJA 1DELA 4PX3A 2VF4X