1UDBA

Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4-fluoro-alpha-d-glucose
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
338
structure length
338
Chain Sequence
b'MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GALACTOSE-4-EPIMERASE
publication title Structural analysis of UDP-sugar binding to UDP-galactose 4-epimerase from Escherichia coli.
pubmed doi rcsb
molecule tags Isomerase
total genus 128
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1997-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1udbA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1udbA01
4CLDA 4RJTA 1N9GB 2JFHA 4M55A 4NQZA 4CR7A 4U6SA 3OQ1A 2XXJA 4II2A 2VT3A 3H5RA 2YW9A 3H9EO 3GFGA 2VN8A 1QYVA 3ZV5A 5B12A 4BUCA 2X1HA 3C8MA 2PD3A 4L9RA 3ZN2A 4XQEA 4PZDA 2QQ5A 4W9NC 5A06A 3EMKA 3OEYA 1X1TA 5AXDA 2PH3A 3PJGA 5F1OA 3HN7A 3F46A 4FGWA 3C7CB 4TWRA 1PGPA 3PJEA 1EQUA 5H82A 4BNTA 4Z3KA 1C1XA 4C4OA 5MGBA 4ITUA 3GHYA 4OYRA 4FS3A 4A73A 4CM5A 1JU9A 1WDMA 3VVCA 1NP3A 1ULUA 8ADHA 1YL7A 2DBZA 1R6DA 4GVLA 2BHLA 5JCJD 1YB1A 1OI7A 2PR2A 1EE2A 3CEAA 3T7CA 4RORA 5DN9A 1XYGA 2X5KO 4U7WA 5DCUA 2NNLD 3RUIA 5L51A 3WYBA 3TZQA 1E92A 3KSZO 1H94A 4I9UA 4J2HA 2GD1O 1HZJA 1KVQA 3FSRA 5HA5A 1AN9A 2LDBA 5TC4A 4YAEA 3U4HA 1UP7A 5JAZA 4PN3A 1T25A 3ONDA 3PHGA 3WJ7A 4BO7A 4YTEA 1TVEA 3HHPA 3OJEA 1NR1A 4CM8A 1YONA 3LLVA 3UUWA 2BF7A 4XR4A 3ZHXA 5TX7A 2UUOA 3KEQA 1PS0A 4N18A 3G0OA 3NJ8A 4M87A 4G2NA 3U9LA 3WSWA 1NWHA 4YAJA 1I8TA 4II3A 3GPIA 2NADA 2JCYA 5TRTA 3WGHA 1NXQA 3JSAA 4YAGA 1CJCA 3GMDA 4JP2A 5COQA 2OP1A 3TOZA 5CAEA 2VQ3A 5KJCA 4YDRA 3DB2A 4HV4A 4RF2A 4MOWA 3FNEA 1E7QA 1HYGA 1VJTA 1U2GA 3NTQA 1X7GA 4U8GA 2HU2A 4KP7A 4MP3A 4P4GA 5LC1A 3WLEA 4BKPA 1H9AA 4JLWA 4LN1A 3U62A 3FPLA 4AVYA 3SC4A 1IOLA 1IB6A 4XDZA 4H7PA 2UUPA 2QHXA 1KC3A 2BD0A 4RLHA 4DVJA 5MDHA 4Z6KA 3LLSA 4IJUA 2PZJA 4DQVA 3FD8A 4ZQHA 1Q2XA 4ALLA 3ABIA 4I5EA 4FQ8A 2B83A 1UDBA 2PY6A 1EK6A 4NJMB 4PRKA 3PZRA 3GGOA 1IZ9A 3E5RA 1ISIA 5JPIA 4YJHB 3OEWA 4DPKA 2A94A 2JFGA 4AL4A 1E7YA 3TNLA 5G4LA 2D8AA 3GF4A 3GNSA 3PYLA 4AJ4A 3I4CA 4BKRA 5G0TA 1EVYA 2RHCA 4UVDA 4AJ1A 1L1FA 3MJCA 4YBZA 5G0WA 1KVSA 3WGOA 4ALIA 4UVIA 3U4IA 3F1LA 4MIEA 4D46A 2PWZA 4A2CA 4DC1A 3ETEA 1BRMA 3NT4A 4Q39A 1PL7A 4TVBA 1W8DA 3ZWWA 1OBFO 3JQBC 4CUJA 2DQ4A 5KCZA 4BKOA 2R00C 1D3AA 5G4KA 4MJLA 1Y5MA 1CERA 1V3VA 1R15A 1HRDA 4BQRA 3ZDFA 3HE3A 1HF3A 1QYWA 3FR7A 4J9UE 5C5IA 2J6IA 3E6AA 1GAEO 1W4ZA 1I36A 3GDGA 2H5LA 1ID1A 3H4VA 4UEOA 4D42A 4PRLA 3GAZA 1WDLA 4GWKA 3RFXA 3U4DA 5HTOA 1Q0QA 4LISA 5IDXA 4WNCA 1O95A 5B4UA 4AJ2A 2OZPA 4BMVA 5JNLA 2HMWA 3NTOA 3HFGA 5THQA 3TZ6A 1N7GA 2ZTVA 3UKOA 1PJQA 2F1KA 3HG7A 3W6ZA 1MFZA 3CPSA 2CZCA 1KVUA 3WGZA 1ZJYA 2O3TA 5HM8A 5CG1A 3TF5A 1Y8QB 2BI7A 1EUCA 5DULA 1WNTA 4EDFA 3H2ZA 4WKGA 1HDYA 2EGGA 2YV2A 2D0IA 3OQ6A 2NTJA 2TMDA 3Q2IA 2QW8A 3B1KA 4RVFA 3KTDA 5IDQA 4J7CA 3KYBA 3FF4A 1SBYA 4MVJG 2WJPA 1XR3A 1OC4A 4A03A 2JD1A 1P33A 3IUPA 4R01A 2IEBA 3JCZA 2VHYA 3W8DA 4WCFA 1JN0A 4KTVE 3JQ6A 1LSOA 2ZYAA 5G0UA 5IN5A 3OJ0A 3ETDA 1K2WA 3DBRA 5JLAA 1A71A 1N1GA 1Q1NA 2J8ZA 4UUNA 5H81A 2I5PO 3RFTA 4B4UA 4DMLA 1F8FA 3U5TA 1BSVA 3JQFC 5TQVA 3F4LA 1LBEA 1N5DA 3CE6A 1LXCA 4DLBA 4RDHA 2DUUA 1Q7GA 4GGPA 2ZB8A 1HSOA 3C7AA 4IUYA 3VH2A 4XDYA 4IGFA 5KIAA 3SLGA 3LC7O 3GRKA 3JQ8B 3RU7A 2YY7A 1H6DA 2VYND 5TLSA 3ANNA 1GPJA 2WE8A 3KLPX 4MVJH 4CV3A 2WEKA 1IUKA 3A1NA 1XIVA 3A06A 2WYVA 4JNKA 2E4AA 3QIVA 1N7HA 1WPQA 1VL0A 3JD1A 2VTDA 3ZCXA 3GK3A 4E3ZA 2E82A 4Y9DA 1NPDA 1DFGA 1V3UA 2CMDA 4A27A 1LRJA 3JQAD 4XWYA 4MVJM 4L74A 5CDSA 5I7EA 2J5QA 3K30A 3M2TA 3QVWA 2FPIA 1DLJA 2AEMA 4U0JA 2GCGA 2C5AA 1ZNQO 3Q1LA 4RGBA 3P7MA 1CF2O 1XU9A 1GL3A 2OP0A 1PR3A 3DONA 1XLTA 2RAFA 4PLCA 1JWAB 2B4RO 5ES3A 3FNGA 1DHRA 5L4SA 2D1YA 1ONOA 4PVDA 3JQ7B 3F5QA 4CLOA 4ZJUA 4KOAA 5CG2A 4R5MA 2NVUA 4FJ2A 3WLFA 2CVZA 5HBRA 4B8WA 3DMYA 4ROSA 3GQVA 2A4KA 2PKRA 2RHRA 4FC7A 3WTBA 3ZHBA 2EERA 3ZH2A 5G0SA 1NPTO 1YOVB 3I6IA 1V9LA 2JHGA 1ARZA 4A5OA 5HS4A 2YJZA 3PJFA 3TRIA 3VTFA 2EXXA 1DO8A 1QMGA 5JDIA 4CUKA 2GDZA 3GN2A 2NU9A 4R41A 4EUHA 1Z82A 3WXBA 2ZYDA 3V2HA 1NFFA 2JAPA 3PWKA 4ND3A 3I5MA 3E03A 1Y9EA 1DIHA 3R1IA 4XYMA 4DUPA 4DYDA 1PQWA 5DNAA 3EHEA 3LF2A 3OJFA 3WS7A 4OKNA 2XOXA 3UOGA 1U4OA 3BHIA 3PFWO 4E2YA 4RPKA 1WW8A 4B8ZA 2VZ0A 5B4TA 1C0KA 2DVMA 2OUIA 1J6UA 2I3GA 2PK3A 3I1JA 5C3MA 1C0IA 2ZB7A 5DP1A 4NK4A 3BZUA 1X15A 3HJAA 4OQYA 4GPD1 4QT0A 4XD2A 2DU8A 4XGIA 2WYWA 2NV6A 1I3LA 1V6AA 3JQGB 3I9LA 3T4XA 2G76A 4Q3EA 3IL2A 1P1JA 3S2FA 4CL3A 5A5FA 5LDHA 4EEZA 4HXYA 4JJFA 2EP7A 4OO3A 5JO9A 3DL2A 4MVJP 4BO6A 1IPFA 2HMVA 4R51A 3RC9A 1ZBQA 2XF8A 4ZRMA 1LLDA 4W9NA 4XGNA 3VDRA 5BSGA 1LRKA 1RM4A 3DBHB 4GL4A 3E9NA 1HKUA 2PZLA 2E6UX 4UEJA 1R0SA 3BHMA 3QV1A 1GDHA 3S2EA 1PZFA 1EFKA 4TMFA 5COAA 3ZWYA 3GY0A 5U9CA 2Q1UA 3WGTA 4LRTB 1UXJA 4E0BA 4B3JA 3B70A 2G0TA 5AOVA 3AI3A 4I5GA 5T57A 4BNWA 5AXBA 4E30A 2PA3A 4P4NA 4BO4A 1EDZA 3WWYA 4OH1A 4AICA 5KJEA 5GMOA 4QUKA 1W6UA 1NX6A 3UICA 1KY5A 4NDNE 3UW3A 4RO0A 1QYXA 1MLDA 2CDAA 4N5LA 4D3FA 5CPFA 3DHEA 4O59O 2VWQA 1C1XB 4O0LA 3IMFA 3H3FA 3IP1A 3QSGA 3GVIA 2J3JA 1YB5A 4WPGA 5ADHA 4D79A 4BO5A 3GPDG 2OOSA 3JQCA 4QECA 2Z1MA 1ISJA 4YJFB 4J4TA 4PLPA 1XKQA 2DPGA 1ENYA 1BHSA 2WD7A 3MZ0A 1KY4A 1DSSG 5KTKA 6ADHA 3GEMA 2AE1A 4ID9A 5IXSA 3GR6A 4ALKA 3E48A 3PDUA 3GMSA 1ENOA 2CY0A 4KUHA 2VWPA 4DREA 2RH4A 3GVCA 4LGVA 2IODA 1IPEA 1EUDA 3BIOA 4XEHA 1AHHA 1GFSA 1PGJA 3DFUA 4E13A 3MCVA 1FF9A 2P2SA 4TKLA 1BDMA 2NTVA 3QRWA 1R4NB 2YHIB 4MDHA 4KTTE 2W98A 4LMPA 4G5HA 3H9QA 1PS9A 4CMHA 1H5QA 3WR5A 4XIJA 4RQTA 3BYZA 1B8UA 4MKXA 2RIRA 4RPHA 3L6OO 4OL9A 2EP5A 2GN8A 2Z95A 2CNBA 5BSHA 2GLXA 5IF3A 2JCVA 5ICMA 1UXGA 1YQDA 5TIIA 2X22A 1U4SA 2O4UX 4M1QA 1ZSVA 4BGIA 4DLAA 3G1TA 2LDXA 3K96A 3HQ4O 1RM5A 1VLLA 1WWKA 2E37A 3INTA 3RQSA 4G65A 2VUTA 1ZO8A 3AI2A 3RUHA 1O8CA 1KIFA 4Z3DA 3ZNPA 4BO0A 3VZRA 2HMUA 5A5EA 5HS6A 1MB4A 3JQDA 4EZBA 5DOVA 3PEFA 1L7DA 4IXWA 4CLEA 4L76A 2O3JA 2PH5A 4D7AA 1K3TA 1F0YA 1KBZA 1XGKA 2W90A 3W6UA 4CUZA 1GV1A 1YVEI 2FSVA 1MA0A 2HK8A 3JQBA 1B3BA 5IXYA 4CQMD 1YS4A 4Y8VA 3I83A 3LSYA 2DLDA 2R00A 3RIHA 4B79A 4BNIA 5I7FA 4CMEC 2PD6A 1T2CA 2GERA 1Y5RA 1E5QA 5HRUA 3H6KA 4RV9A 4NIMA 4RVDA 3C3XA 3ZV4A 4E2ZA 3OHSX 3JD2A 2H6EA 3DDNA 4NFHA 4RCVA 4CMJA 3RI3A 2GN4A 2H9IA 3FNHA 3EC7A 5JC1A 3GVHA 3KBOA 2P5UA 2OGUA 3DAGA 4LVCA 4Y6PA 1BXKA 4XA8A 1K6IA 5G4KB 3Q11A 3ADOA 1FDTA 1MXFA 4ZQGA 4CM1A 3R0IA 1OZAA 3VH4A 4LCEA 3PIIA 5JXWA 3IQDB 1VJ1A 3O26A 3BTOA 1DJQA 3ASVA 1O94A 1D4FA 3PVZA 1YJQA 1RM0A 1OAAA 4UEKA 2X4GA 1O6ZA 3JQ8A 2HCTA 1PJ2A 1C1DB 3ZU3A 1LC3A 2JHFA 5A9RA 2CSUA 1HWYA 3COSA 3NRCA 4WNIA 5BNIA 3PDJA 5IDWA 3OBBA 4R5HA 4CM9D 3TFOA 2H63A 1SAYA 1ISMA 2Y99A 5KJFA 5JAIA 2C2YA 2I6TA 2NTNA 4UUOA 4TRMA 3KLMX 5EESA 1LU9A 3E18A 3HDHA 3WNQA 4L75A 4BNLA 5DT9A 1C3VA 3OIDA 3I9KA 3VDQA 4ZVVA 1A7AA 2QRLA 4PFJA 3A4VA 2D4AA 4HBGA 1Y8RB 2EF1A 5JYDA 2A35A 4CJXA 1T24A 3JYOA 2P5YA 4Q3DA 1KEWA 4JXKA 3JQEA 3JQ7A 4BKQA 3ZI0A 4E5KA 2C20A 1UZNA 5L4NA 3KSDO 2P9CA 5IDYA 3KZVA 1R16A 3GNQA 1BXGA 3WYCA 4O1MA 4AJJA 4Z9YA 4OOFA 1XA0A 1ZSNA 3AOGA 5FWNA 5ITWA 3INRA 3R3JA 1UZMA 1A7KA 1YOVA 1VKOA 4GQAA 4O5OA 4W82A 2O7SA 2FWMX 2Y1GA 3MWEB 5G2OA 3HSKA 5DBGA 2IRWA 4BL5A 1DC5A 3PQFA 3AY7A 2BELA 1NNUA 1E3SA 1OOEA 3H2SA 4N7RA 4XQ9A 3LDHA 2B5WA 2NM0A 3QWBA 4P8RA 1KC1A 1P1KA 4IDCA 1E3EA 2JFFA 4CR8A 4UUPA 3UFXA 6LDHA 1ADBA 3GA0A 3E1KA 5CP8A 4IQ0A 4CM7A 3RAJA 4ZQEA 5F5NA 5F1PA 4BOYA 4CODB 1IL0A 2FHSA 3F47A 4E33A 1YJ8A 4WLFA 3CINA 1C0PA 4IDGA 3Q2KA 1NHGA 2ZYGA 1X14A 3WSVA 4CQMA 4N5MA 4BKUA 4E5MA 2ZCUA 5JDIC 2AEJA 4PIVA 4BO1A 3JQGA 3CIFA 4E6PA 2AW5A 3H8VA 4FFNA 3KV3O 1NQTA 3OP4A 4GKVA 3MJVA 4RPGA 3S1LA 4MP6A 4QXMA 5I8WA 2EHDA 4WLEA 3TZHA 1GV0A 1TB4A 3FPCA 4FC6A 5CFZA 3RC1A 4ZGWA 3DBHA 1I30A 4XQGA 1VM6A 5IAAA 2CF5A 3NJ4A 4YT2A 4XYEA 4GSLA 4MP8A 4OGWA 4A26A 4XGKA 2GF2A 2J3HA 2PTGA 4QX6A 2FR8A 1TT5B 1E1LA 2JD2A 1E5LA 5A3VA 1PJ3A 2HDHA 4NBVA 5TS3A 5ENDA 1LDMA 4EITA 1FXSA 1JKJA 3INGA 2FZEA 4OXNA 4O63O 4R3NA 3PHIA 1LDGA 1GZ4A 1LDYA 2W2LD 5U1PA 1T2FA 5EINA 1GADO 1EUZA 2AE2A 3GG2A 3F3SA 4HFMA 1AXGA 3SXPA 4CM9A 4E31A 2VYVD 1UJMA 4PG6A 2EEZA 4FDAA 4FFPA 1RM3A 3F1KA 4PCVA 2B69A 3HB5X 1P0FA 3G79A 2AQIA 1LA2A 4HADA 4YRDA 1H0KA 1A27A 4YJFA 3OETA 3QVSA 3QWFA 4ZQBA 3WB9A 1VKNA 1BMDA 3QY9A 1PL6A 1DC6A 3FTNA 3KB6A 4I9HA 4MVJI 3BMOB 3FRJA 2C54A 4PLFA 3WFJA 3WQSB 3W8FA 1U8FO 1VC2A 4RVGA 4BIIA 1XHLA 3ZU4A 3EVNA 1M66A 3BMQB 3TZKA 1DIBA 5JY1A 5T5QA 4R54A 2BGKA 1JWBB 3QQPA 1I32A 3GNTA 3ULKA 2G5CA 4QFDA 3D7LA 1R4NA 2YHIA 3MOGA 3IDSA 2AMFA 4J9VA 3ZNQA 1F12A 1O0SA 1ZJZA 1SNYA 3P5SA 1ZK2A 2O3QA 4K28A 1DPGA 1EFLA 2JKVA 2FOIA 2X9GA 1O5IA 3A28A 1NVTA 3Q6IA 1UR5A 2Q2QA 4MIOA 5BQFA 4HP8A 1TT7A 2HRZA 4J1SA 1JTVA 4INAA 1LRLA 4WOKA 3OJLA 3IAHA 1QSGA 4BNYA 2Y1CA 3DEYX 4KQWA 3NGLA 3NT2A 4PVCA 2DBVO 2EW2A 2Y1EA 4G81A 3TL3A 4B3IA 2D59A 3K6JA 1UUFA 4FFRA 4OJNA 1I33A 4KZPA 5I9LA 2Y93A 3JQAB 2HQ1A 5JMWA 4H15A 2WD7B 1ISGA 4HUJA 4N5NA 1M67A 2NSDA 4R16A 1OFGA 3WG9A 3WBFA 3D3EA 2Y66A 1XG5A 2PZKA 1H2BA 2C29D 4HNGA 1Y7TA 4I8XA 1GTMA 4D3DA 2WWRA 1VSVA 3I6QA 3AJRA 3HDYA 1WZEA 4CMGA 1EVZA 4CMIB 2VOEA 8LDHA 2R2GA 3RUCA 2E49A 3WMXA 4ALJA 2B36A 3H5AA 4WCDA 2JD0A 3AY6A 4BNMA 2VUSA 1JDJA 2VRCD 2C2XA 1PJBA 2FN7A 1U7HA 1XEAA 3HB4X 4W7IA 2VHZA 1ADFA 2YQ4A 3ZWVA 3RFVA 4BO3A 1QV7A 4M89A 5C37A 2VTEA 1Q0LA 4JN6B 4NR0A 4YR9A 1I3NA 3IP3A 3VC7A 1TA4A 1PX0A 4NBRA 3H7AA 4EI2A 1XQ1A 4HNHA 2P4QA 3TSCA 1YL6A 2IDZA 4P38A 1BVRA 5F3RA 4XB2A 4NBWA 5FEUA 5TT0A 2DM6A 4CMEA 4J0EA 1D1TA 2CDBA 4LK3A 1JAXA 4KDEA 3C85A 4NNJA 3EDMA 5K9ZA 2C7VA 4RVSA 1P9LA 3C1TA 4WOJA 3S2IA 4L73A 2VYVA 4YAIA 1I5RA 3PGJA 1ZW1A 1C1DA 1E6EA 4ND4A 3WGGA 5DBFA 2W8ZA 1Z7EA 3KO8A 4U5QA 3EGOA 3GLQA 5A1TA 3LT1A 1GYQA 2EKPA 3GGPA 2GPTA 3I3OA 5JCJA 2GUGA 1GCUA 2G17A 4RZHA 3K92A 4PLGA 3LT4A 3GDOA 4YB8A 4Y67A 4BQPA 2DC1A 1F17A 1W73A 3PJDA 4IXTA 4WLUA 2Q4EA 4HFJA 1Y9AA 1DIAA 1MC4A 3H5NA 1Y8RA 3KSUA 2IZ1A 1ZKMA 1LTHR 5DDIP 5L7YA 4CQLA 4FOSA 4XKJA 3IJRA 3LYLA 3ROQA 5IN4A 1GZ3A 4FFMA 2VZ8A 1VI2A 4R9RA 4R9SA 4OIMA 1R0LA 4K6FA 2ZTMA 3GEGA 3DBLA 5TJ9A 1QLHA 1E0DA 3PQEA 1B8PA 2EG9A 3FBTA 4GAEA 1I10A 1T26A 3VPXA 3MJEA 3L4SO 2DPHA 4Z0PA 2Q46A 3K31A 3ITKA 4DGSA 2EWMA 5EJ2A 3QHAA 4DMMA 1LQTA 1RYDA 2X86A 3WWZA 3SX2A 1YB4A 3RD5A 2O7QA 2NVWA 5K6AC 1UDCA 1E1NA 4MVJF 3PZBA 3L9XA 5BNFA 3SLKA 3PI7A 3DAPA 1XDWA 1E3WA 3OF2A 1I2ZA 4GSKA 5EN4A 3MJ4A 4CLRB 2X0IA 1U3UA 1BDBA 3PIDA 3AW9A 4GGOA 2P9GA 4TRJA 5DZSA 1D8AA 2YV1A 4IM7A 1D1SA 4OSPA 1UZLA 5ICSA 2VRCA 4FBGA 5KVVA 3DZFA 4F45A 1C0LA 3K73O 4XYBA 3D5TA 1BXZA 3HDQA 3MTGA 1BXGB 5DCWA 3G1UA 3DXFA 1N2SA 3PFFA 1R4MA 2PZMA 4EW6A 4YRAA 2UYYA 2UAGA 3HWRA 3PWZA 3ZWAA 3DZBA 4GX2A 1T1RA 1AHIA 1IZ0A 3DZIA 1A4IA 1GY8A 1Q0HA 1Y81A 4FSHA 4U0KA 2IYOA 4QO7A 4YA6A 2NQ8A 4QSMA 3LF1A 1BTOA 4QO8A 1TT5A 1A5ZA 1JKIA 4TVOA 4UVGA 2EW8A 4OAQA 3GHHA 4W7HA 3WYEA 3MEQA 3RKUA 3WFIA 3DOOA 4DL9A 5A02A 5L9AA 2ZK7A 1ZK0A 3NT5A 4RPJA 5BT9A 5A3JA 1QORA 1N1EA 3LC1O 1BW9B 3U0BA 1LDEA 4NJOA 3V5NA 1LSSA 5CEEA 4GX1A 4J6FA 5BNTA 1G1AA 2C5EA 4ND5A 3KYDB 4I08A 5A9TA 1U2DA 5A9SA 3G3EA 2D2IA 3JD3A 3OIFA 4CQMB 5A04A 2BFAA 3CUKA 1HDCA 1NWCA 3PLRA 1E77A 1B16A 4BNHA 1YQGA 2C07A 2BLLA 1YGYA 4MIYA 1A4UA 5TNXA 2GN9A 4FIZA 2GNAA 2PGDA 1EMDA 5JAMA 3F9IA 4YXFA 4AJEA 1M76A 3AM4A 4AFNA 2X5JO 4IJKA 3V2GA 3BMOA 1FDSA 1ZK3A 1P3DA 3OFSA 4WECA 2IYPA 3QP9A 3RUEA 5EPOA 3BMQA 1X7DA 1PWZA 3K5PA 4U6QA 4ZU3A 1E7SA 1DFIA 4E2XA 1M6HA 5L3ZA 3ZWPA 4KDFA 4WEOA 3H65A 1GQQA 1NVGA 1YDWA 2I76A 2CVQA 1HDRA 1LUAA 2UDPA 1DC4A 1IULA 3NGXA 3OJOA 3WIEA 2V65A 2AQKA 2HKIA 2YYYA 3NDIA 3OH8A 5IJZA 1K5HA 3EVTA 5HWSA 4D3SA 3QWIA 1MGOA 2A92A 3FN4A 1DC3A 4F6LA 1F8GA 1NAHA 2D5CA 1MXHA 1LJ8A 2VYNA 7ADHA 4PGFA 2YFHA 1MP0A 2HJRA 1G0NA 3BTVA 3GZNB 4N54A 3BMNB 4BNVA 2X9VA 3G17A 4NG5A 3U09A 1B26A 3Q9NA 1PZGA 3H3JA 1ZXBA 3OIGA 1KVTA 3P2OA 3M1LA 4IJWA 4OXKA 4E32A 1RKXA 3JQAA 4K26A 2DFDA 5KVQA 2V6BA 3I52A 1IHXA 3U4CA 3LT0A 4BMNA 1P31A 4JBHA 3KVOA 4M86A 3KHUA 1Z74A 5CDGA 1ISFA 4FR5A 4XQCA 2VZ9A 4CMKA 4YQYA 3WIDA 3NEPX 1VL8A 4L0QA 2EJWA 3MJTA 1EZ4A 2HLPA 3Q9UA 3GG9A 4MO2A 4TZKA 4L4SA 1L7EA 1MX3A 2FPGA 3D5QA 3ZWCA 4CMIA 3KEOA 3ZV6A 4OHUA 4PZCA 5KVCA 3I9OA 4IIUA 2DAPA 4YAKA 1MG5A 2EIHA 1LSUA 5AXCA 1E3JA 1NBOA 3C1AA 2Y67A 4WUVA 3DWFA 4BO8A 2UVDA 4KWHA 1XQ6A 1JVSA 4J2OA 1RYEA 3NKLA 1I2CA 3FR8A 5COBA 3R6DA 5KNLA 1P77A 4Z9XA 4CM4B 3F5SA 3N58A 3VKVA 5AXAA 2I99A 5FI3A 1NR7A 1CEQA 1GEGA 2AG8A 3ORFA 2ET6A 2O2SA 1B15A 1MV8A 4IZHA 4ND2A 2Q49A 4XX0A 4A0SA 4IQGA 1PWXA 2D5AA 3MJSA 3C7DB 4WK6A 1J49A 3GAFA 2IZ0A 2VCYA 4JROA 2PD4A 5I7VA 1EBUA 4JK3A 3UCEA 3AUSA 1ULSA 1YBVA 2I67A 1NAIA 4J1TA 4OSOA 3RWBA 3D3WB 2NQTA 3D4OA 5B37A 1AE1A 4CV1A 5I7SA 2DTEA 5JSFA 2QYSA 5CHEA 1E7WA 3S2GA 1NHWA 2VNAA 4KWIA 3RBXA 2I65A 2EGHA 3PTZA 2OO5A 4GWGA 1VRWA 2CD9A 4GMFA 3QVTA 4R1SA 5EMHA 2GRAA 4RF3A 3GVPA 4D45A 1T2DA 2GN6A 3JYPA 4B4OA 1I2BA 2CFCA 3OSUA 1FK8A 3DFZA 2IE0A 3KXDA 4B7XA 2IXBA 4GX0A 1K0UA 1ZEJA 2P68A 4J49A 5KOIA 3I9MA 3T7EA 3D4NA 4Y6RA 2ZB3A 4YACA 4AJIA 3ZWMA 2YV3A 4EYEA 3P2YA 3ST7A 2FRDA 1PEDA 1B7GO 2AG5A 2UV8A 3IKTA 3GFBA 3FWNA 4IZIA 3LZ6A 1PR9A 4LMRA 2GZ2A 5DOZA 4FJ1A 4LW8A 3N7UA 2Q4BA 1JQBA 3A14A 4GVXA 1Z73A 4FOOA 4IY1A 4DBVO 4K6CA 2BGLA 5ER6A 3PYXA 3DZHA 3AU8A 4CR6A 3ITDA 1C14A 1TI7A 2VT2A 3SC6A 4AJOA 1LLCA 3U3XA 1Y6JA 3LT2A 1YKFA 2C7GA 4E5NA 1DEHA 1PL8A 1S6YA 2G1UA 1NQOA 1UDAA 2Q1SA 3ANMA 1FMCA 4MVJD 4ND1A 4RQUA 5CEJA 1U8XX 5JO0A 1G6KA 4DYVA 1U5CA 4IMPA 1U7TA 1HETA 5I9NA 4WASA 3GEDA 4XRRA 1R66A 1H6AA 1B0AA 2CUKA 2YUTA 4BNGA 4E4YA 1B14A 4R68A 4IPTA 4IMRA 5TF4A 3HDJA 1P44A 1V35A 1YBAA 4R3WA 5JFOA 1ZXLA 2PKQP 3DZGA 4WLOA 1BGVA 3L9WA 4K9DA 3VTZA 3ZU2A 1NVMB 4NBTA 1P45A 5L7TA 2VHVA 5J23A 2EKLA 5LDGA 1KYQA 4CLRA 1PIWA 3NDRA 4FJ0A 3H9JA 3AY3A 4FD3A 1DFHA 4CQLB 4BNUA 5BSFA 4YT8A 4J7XA 1Z7BA 3CTMA 3WICA 4BO2A 2H1SA 2HAEA 2YDXA 2DT5A 1PS8A 4UREA 1Z75A 4R69A 2GZ1A 4NHEA 3BMCB 2GGSA 3DBLB 3TPCA 1HL3A 3SVTA 3D0OA 3I4FA 5K6AA 4TKMA 3GN1A 1JLLA 2BFPA 3JYLA 3PPIA 5ILGA 2X7HA 3M1AA 3NV9A 4PLVA 3AK4A 1HDZA 2QX7A 4HY3A 4W6ZA 1XU7A 3B6ZA 4BNZA 2DBRA 3PK0A 4F3YA 3TFQA 1FDUA 5TGDA 3UCXA 3EW7A 4Q3BA 1E3IA 1BWSA 1YL5A 4BNKA 1FDVA 1ONPA 4DPMA 3LC2O 2BRUA 1X1EA 3LU1A 1BW9A 1O89A 5EIOA 2VHWA 1PJTA 2RH8A 4IDEA 4IQ8A 3DAFA 1WVGA 2AA3A 3IKVA 3NX4A 1LI4A 3VPHA 4DWVA 1E3WB 1SO8A 5U4QA 2ZB4A 1M75A 1LLQA 3KYDA 3RJ5A 3W4IA 4ALMA 4CV0A 4XB1A 4FW8A 4JCOA 5JDCC 1ZIDA 1WZIA 3ONFA 1MG0A 4B7UA 4DQXA 1YXMA 1NQ5A 3F6YA 3RKRA 1I24A 4RZIA 3ZHYA 2WTBA 1XELA 2NLOA 2B5VA 1KEVA 1WAMA 3WJAA 1LLUA 2YZ7A 4URFA 1AXEA 3VH1A 3ZWBA 3AI1A 1K6XA 3RSHA 5JS6A 4IIVA 4JX8A 4XJTA 5AYVA 2QYTA 3OA0A 3TJRA 3E5MA 1R4MB 3EAGA 3VOSA 4MVJE 4R1UA 2HUNA 5KKCA 3ZGYA 4F6CA 3V1YA 1XWFA 2BFMA 3H9GA 4ZRNA 5TSDA 3V1UA 4PG7A 3BXXA 1CRWG 4YQZA 3X2EA 2YQ5A 2AEFA 3PLNA 3VPGA 3CMCO 1FDWA 5FFFA 3LK7A 2A9FA 3GH3A 3VZPA 1GCOA 4QTZA 2V7PA 3M2PA 4J7UA 4R4JA 3ENNA 3GRPA 5T67A 4BGVA 4TROA 3AWDA 3KETA 5KWEA 2OXIA 2D3TA 4MVJA 5KJ1A 5T6BA 3ZW9A 3RVDA 3EZYA 1VSUA 2OORA 1DDOA 1E7MA 1XSEA 2HSDA 5A9SB 1SB9A 1Y1PA 2Q1WA 1DIRA 4FFLA 3GZNA 4LSWA 3BMNA 4ZA2A 3QA9A 5A05A 2Y1DA 4ZD6A 1DXYA 5KVSA 3K2BA 3BA1A 1ENPA 5EQDA 3TWOA 1F06A 2O2YA 3TZCA 1UP4A 4NFYA 3UN1A 2W4QA 2BI8A 1CDOA 2AQ8A 1PJ4A 1GR0A 5CDUA 4JBGA 3C24A 4QQRA 1LEHA 3MTJA 1UXHA 1HTBA 3RUDA 1J4AA 1HE5A 1J0XO 4NMHA 4AG3A 2FMUA 4TRNA 5JW6A 2Z5LA 4J16A 4TQGA 1P0CA 1DRVA 1U9JA 2Y05A 3WTCA 4AJHA 3DMTA 1GPDG 5A03A 1GUYA 4CL8A 1PU2A 3ICPA 1DJNA 3W4JA 4D0RA 2IXAA 3V1TC 4RLSA 4TRRA 4FN4A 1JW9B 1KETA 3ROMA 2X0RA 1U3WA 1D7OA 1KEUA 2X5OA 1LQUA 3I23A 4JP3A 4RL6A 4UVEA 2FZWA 3ZWNA 4CM4A 1CQJA 5B1YA 4GX5A 1SZJG 1KOLA 1O9BA 4BV8A 2OL4A 1U1IA 4FCCA 4IS2A 5AQ1A 1VE9A 5GZ1A 5LCXA 2WD8A 1CYDA 5L40A 4XJSA 1NYTA 1HE4A 4EBFA 1QKIA 5DF1A 1CETA 3WQQA 4DPLA 3T4EA 1H93A 4UAGA 4BNNA 4CM6A 5L4LA 3L77A 4CMBA 3VVBA 1H6CA 2Q2VA 3H9UA 3EUWA 4XIYA 1SC6A 3D3WA 2OBNA 5B4VA 4Q3NA 4GBJA 3W8EA 1IYZA 3W4KA 3GUYA 5F5LA 4ZN6A 4NI5A 2DFVA 1SCUA 3LVFO 1HEUA 1E3LA 3EYWA 1SMKA 2OMEA 3NTRA 5EQFA 3GT0A 1B3RA 2PKQO 5I9MA 5IFLA 2O3SA 3RC7A 4YT4A 1MUUA 1PJLA 3KYCA 5TJHA 4DIOA 3DOJA 1YO6A 2VUUA 3EK2A 4GI2A 4IDBA 4I5FA 3CZMA 3AUUA 3O4RA 2DUWA 1OMOA 4ESOA 1GYPA 4J3FA 3V2UA 4CMAA 1ZK4A 4YYZA 5C7OO 5EERA 1T2AA 1DRWA 1KERA 3B1FA 1HYHA 2E48A 3RASA 1ZMOA 1U3TA 3C1OA 3VPFA 3FWZA 3NDJA 2XAAA 2X23A 2B35A 1K6JA 5CEFA 3K9QO 2W2LA 4XRGA 4W99A 3DQPA 4JJIA 1N92A 3X2FA 3JQ9A 3MWDB 3ZHZA 4B4VA 3KOUA 4XR9A 3UF0A 1LX6A 5ITVA 4NK5A 4TZTA 2VNSA 2Z1NA 4EUEA 4JBIA 2HK9A 1RWBA 3VHRA 2ZIZA 3SBOA 3PP8A 4X54A 4K1LA 4L4XA 1WXDA 4ONEA 3L4BC 2X6TA 1PTJA 3PXXA 1IY8A 1ISHA 2V6MA 2W2KB 5DBIA 4A7PA 3PWSA 5GZ3A 2Y0EA 5FF9A 1F14A 1P1IA 2ZKLA 1QYDA 1LNQA 3FHLA 4HKTA 3E82A 1W0CA 3QWHA 3O38A 4BS9A 3KM0A 4JGBA 4YJGA 3L6DA 2B0JA 4AJNA 3CMMA 4B3HA 1Q7BA 2ILTA 5F21A 1M2WA 3ANLA 4XYGA 4D41A 2HRBA 4E2WA 5KJ6A 3NYWA 4DIBA 1TXGA 2YDYA 3P19A 1YE3A 3QWAA 1WMAA 1A9YA 1G0OA 2GSDA 3BMCA 3O9ZA 3Q3CA 4PLWA 2ZATA 1SEVA 2I9PA 4HFRA 2PLAA 2NWQA 5L95A 4KUGA 4DBZA 1YQXA 3QLJA 4BV9A 2Q3EA 3GVXA 4LSMA 4B7CA 1ADCA 1LDBA 4F46A 1H6BA 3PHHA 1H9BA 2DKNA 3CH6A 1DBVO 3FI9A 1P74A 3O8QB 2J5RA 2PV7A 4UUMA 4DIFA 4PG8A 2G82A 3JTMA 4NU6A 3KRTA 1QG6A 4IBOA 4PZEA 3HN2A 2GR9A 2I3AA 3GGGA 3JD4A 4IDAA 4CLHA 1IHYA 5L7WA 1RPNA 1QRRA 1K89A 1GD1O 1HYEA 1XCBA 3D1LA 4NZ9A 3L07A 3PRJA 4DQUA 3LQFA 1CIVA 4CV2A 4J4HA 2JJYA 5IG2A 3B1JA 3AOEC 4Q3CA 4Y98A 3IS3A 3IOYA 3O03A 4EUFA 3E9QA 1KVRA 5FYDA 3JYNA 4J43A 1UXKA 1ZFNA 4RVUA 4CM3A 4H16A 4PG5A 2GYYA 2TMGA 2POQX 1HLPA 1QV6A 4CMCA 1UH5A 3HUDA 4P22A 2CDCA 3PQDA 4BNJA 4HWKA 4D43A 1SEPA 2WYUA 1S7CA 2NU6A 3AM3A 5IZCC 2EKQA 4J0FA 2BGMA 3UXYA 2DTXA 2Q99A 4LCJA 5JDCA 1HDOA 3RROA 3RC2A 1DHTA 4A10A 2Y0DA 4GH5A 1U5AA 4WEQA 2AXQA 1P1HA 5CDTA 1WMBA 4AJPA 2V6GA 2HK7A 3JYQA 1ZVMA 4LVUA 4RF4A 5T8KC 1YBMA 2PFGA 3ETGA 2WSBA 3K2EA 3RBVA 1DLIA 3SJUA 4D0SA 1B2LA 1QP8A 2Q45A 4XZ3A 2DBQA 1N9GA 5JY6A 4DRYA 2OHXA 1ZH8A 1A9ZA 3G49A 2R6JA 2NU8A 3HNPA 4IINA 3OECA 2FSSA 3BTSA 9LDBA 3ICCA 3WBBA 4GLOA 1T4DA 1JAYA 2X9NA 1I3MA 4QFCA 5L53A 1OC2A 1H2HA 3TN7A 4HFNA 2FP4A 1GZ6A 4O6VA 1LDNA 1V8BA 3S55A 3TQHA 4YT5A 5ILOA 1LC0A 4H3VA 3PHJA 2P91A 2JAHA 5C7LO 1PJSA 2VWHA 3HFSA 2CVOA 3JD0A 1HZZA 3GC6A 4B4WA 4J1QA 5T64A 4JIGA 1YWGO 2XXBA 4NFSA 2Q50A 2QZZA 4IDDA 3ZWXA 3PGXA 1YDEA 4M54A 1FJHA 3ZNNA 3FTPA 4LRSB 3DZKA 5THKA 4MKRA 5CPBA 1SOVA 3SEFA 3ZV3A 2OBYA 2ZQZA 2ZTUA 3ROPA 5L45A 4J4BA 3S8MA 5JAQA 3KUXA 4NPCA 4EGFA 2SCUA 1A72A 4I9NA 1X13A 4D44A 1GEEA 4IJVA 1PZEA 3UHAA 1U3VA 3EY4A 2AQHA 4GKBA 1ORRA 1JVBA 1T1SA 2ZJ1A 3GDFA 3GZ4A 3R3SA 1WLYA 3WQRA 3ZNOA 2FPPA 1I01A 4QEDA 3A9WA 3ZU5A 3QW2A 3RBZA 1HE2A 4MKZA 3ON5A 4GMGA 3NUGA 3DMTC 4BB6A 2ZQYA 1EQ2A 5DCYA 3DO5A 5CDYA 1EBFA 4ALNA 1BG6A 5TT1A 4ZHSA 3Q0EA 4ZQFA 1LSJA 2NVBA 5G0VA 2HJSA 2IZZA 3AU9A 3DHNA 2ZCVA 3IUSA 4AJKA 2J3IA 3TOXA 3HZZA 2HMSA 4M8SA 1DRUA 2F00A 2J5KA 3WGIA 3NAQA 1CWUA 3UCFA 3DTTA 2GO1A 1ZSYA 1QYCA 1SPXA 3CXRA 5KKAA 4BMSA 2Y0CA 4PG4A 3RUFA 2WE7A 4DXHA 4EJ0A 1YH3A 5EL0A 1RJWA 4YWJA 3AFMA 3DOCA 2BH9A 2PGLA 2IEDA 3WOHA 2Q2WA 5JE8A 4DC0A 3M6IA 3WNVA 3VZQA 5BR7A 3TL2A 1HDGO 3ADPA 4RDIA 1NM5A 4RVHA 2C59A 3DC2A 4NJMA 3STHA 4E5YA 3DR3A 2O3RA 3MOIA 2WMDA 4YJHA 4BB5A 2RBEA 4R1TA 3QVOA 4YVFA 5JBIA 3E9MA 4EEXA 4BGEA 4FFOA 4BNFA 4JJGA 3I9JA 4CM8B 4PLHA 1QR6A 3OMLA 5ENVA 3V8BA 3DZJA 2FY8A 4OKIA 1EEHA 4YEDA 4Z0TA 1NTOA 5BSEA 1DAPA 1DIGA 2BFOA 2VHXA 3VPSA 4BVAA 3BTUA 2YHUA 1DB3A 1VL6A 5C7IO 4XYLA 3IIEA 5F1KA 4Z9FA 2HO5A 4BO9A 2Y1FA 4DLLA 4NU5A 5K0ZA 4RPLA 4AJLA 1ADGA 2Q1TA 4S3MA 1PGQA 3PYMA 3KYCB 3ZZNA 1JKFA 4OQZA 1HDXA 4I5DA 2V6FA 4OOEA 4YJDA 2W2KA 3RCBA 3L6EA 1ML3A 3OA2A 2OFPA 3UAGA 1PQUA 3UVEA 3JQ9C 4CLXA 5I8ZA 1TLTA 2CF6A 3FCOA 4KQXA 2QG4A 4L8VA 4TSKA 3BHJA 1QLJA 1U28A 3ASUA 2J3KA 5JMPA 3UH1A 1N8KA 4R1NA 1YRLA 3FNFA 1ENZA 2O3UA 4UULA 4C7JA 3ENKA 1V3TA 2BMAA 3CZRA 1Y8QA 2P9EA 1HE3A 2X0JA 3L4BA 3OICA 1M6WA 1WDKA 3UGKA 4BNXA 2GZ3A 4DA9A 4DTIA 2BKAA 1X0XA 2HMTA 1EDOA 1R12A 3SJ7A 3WX0A 3AUAA 3WGYA 4W4TA 4YPOA 3JV7A 4UVHA 1MFPA 1AGNA 3U49A 1Z45A 1ZZEA 3I9NA 4GLLA 4E5PA 2O50A 1E1MA 4FPXA 3O8QA 1EE9A 4NH4A 1Q7CA 4Q9NA 5H83A 4E12A 3PHLA 4PLTA 2QIOA 4OM8A 2X8LA 3BAZA 3E8XA 2B37A 3K8ZA 3WDSA 4KMSA 1UAGA 1E7RA 1NFRA 3GUCA 4WGGA 4WJZA 1VJ0A 3QVXA 1NASA 1AUPA 4Y6SA 4Q3AA 1NFQA 1ZMTA 2I66A 1EK5A 4JQCA 2B4TO 3AFNA 1QXSA 4WCFC 5JYEA 3IJPA 2WDZA 2P4HX 4YJGB 3DHYA 2QRKA 2X58A 3ONEA 3CSDA 4FB5A 2NACA 1HT0A 3RJ9A 1EVIA 5A4DA 4WE3A 5ER9A 1UAYA 2JL1A 4OXYA 2EV9A 3TDKA 1J5PA 3HADA 4L4RA 1ZUD1 1SOWA 3JQFA 2O23A 1VPDA 3OM9A 1NQAO 1I3KA 3N74A 1ZK1A 3W1VA 4XCVA 3B20A 1ONNA 2EJVA 1GUFA 4WCFB 1PQPA 3CKYA 1ZEMA 3D4PA 3VH3A 2FR0A 4MINA 3VZSA 1EVJA 1JA9A 3WGQA 5FI5A 4BHTA 4EJ6A 3AOEA 3RUAA 3DBRB 1DOHA 4IS3A 1HXHA 1IE3A 4IDFA 1PSDA 1V0JA 2X0NA 1E6UA 2AHRA 2QRJA 3AM5A 3AUTA 3DBVO 1E1KA 4PLZA 2VRBA 1BVUA 3EZLA 4E21A 3VAZA 2XPCA 4C7KA 2NUAA 4ILKA 4EJMA 4J91A 3F4BA 4Z0HO 3RU9A 3FBGA 1CQIA 1GQYA 3ROKA 3ZWOA 1P1RA 4FGSA 4OMUA 2PGJA 2VWGA 3IC5A 1SB8A 5IZCA 5GZ6A 1GUZA 4WLVA 2Y68A 2VOJA 2C82A 3OQBA 3QE3A 2FR1A 5AVOA 5GY7A 5DP2A 1HSZA 2JCXA 1MC5A 4HX5A 3ZW8A 1PJCA 4J90A 1X7HA 1TEHA 2ZTLA 3GOHA 4NBUA 4RF5A 1PZHA 1KEPA 4IGEA 4I1IA 4YRBA 9LDTA 4P4LA 5T8KA 5JCXA 1GU7A 1GQ2A 1KS9A 1T4BA 2O4CA 1PGOA 5IZ4A 1WP4A 2PNFA 2GASA 4MPDA 1NPYA 4S1VA 2DTDA 1R37A 1PGNA 3L0DA 2ZJ0A 3D64A 4J1NA 5JC8A 2B4QA 1ZCJA 4WLNA 1I0ZA 1DAOA 4CLOB 1R0KA 2C0CA 2Y1OA 1T2EA 2NVUB 1UXIA 3QJ5A 2NU7A 1Z6ZA 2WM3A 3VKUA 1HLDA 3WMWA 4YCAA 7MDHA 4CPDA 4ZICA 4PLYA 3DTYA 2O48X 1UP6A 4BGUA 4KUEA 2RCYA 1B8VA 1GYRA 1X0VA 2YFQA 2QZ9A 4M49A 1P1FA 1E6WA
chains in the Genus database with same CATH superfamily
2AFVA 3OAAD 4ZT7A 1N9GB 1CC1S 4EMTA 1JHXA 4AUNA 1XK6A 2AXNA 3G2MA 2DWUA 3DE5X 2QB5A 3NM4A 4II2A 4JZYA 2NU8B 1OXXK 3QEKA 1ODFA 3GFGA 2Y9MB 3TK1A 3U60B 1QYVA 2IBTA 3SHVA 5EVJA 1GPLA 4BUCA 5E6RB 2O2HA 2X1HA 4W5RA 3C8MA 2J0VA 3OX1A 5TV2A 5ICEA 4XQEA 3LBYA 1Z2AA 2XVZA 2QQ5A 3DV9A 5EHNA 1TZCA 2GN2A 3QI7A 5AXDA 2QBYA 1GZUA 1GL9B 2W2XA 4FQ7A 4B17A 4HNUA 4CT0A 1KXZA 4BEJA 4QTUB 2XZPA 3ETNA 2G36A 3C7CB 2B6NA 1IZ7A 2HYDA 3KTOA 4FKBA 4IH1A 4BVBA 4BVLA 3NPAA 1QTIA 1X92A 1PGPA 2H5EA 2MJLA 1WTCA 5ALIA 3KQHA 2WB2A 1C1XA 4C4OA 5LQKA 3E5HA 3UEOA 4ITUA 2G6TA 1KJIA 2F9MA 3EAFA 5H80A 3FKSD 5JIBA 2L2QA 1E4VA 1KEEA 3NATA 4DSZA 1JU9A 1WDMA 1Y8AA 2PO7A 4LDRA 2IXGA 1YL7A 4WVLA 2GJAA 3L40A 2DBZA 1R6DA 2PKYX 1F8XA 1U11A 5K09A 3OWOA 4K8OA 2QU8A 3T35A 3IHWA 4JGIA 3WL7A 1J8FA 1EE2A 3AEQA 2FZCA 2JCBA 3JU3A 3QYAA 1QQBA 3ZK8A 1XYGA 3GFVA 1OLOA 2R47A 3BH7A 3BK7A 3IUBA 4U7WA 4DMGA 5L51A 1W35A 4HO1X 2GO7A 3TBHA 1SG0A 5JSFA 4YP0A 3KSZO 1BD4A 1HC7A 5LD2B 1PNOA 1UQUA 5JXJA 3FSRA 3NNSA 1AN9A 5AR1A 2JGJA 5HA5A 1T15A 5BORA 4AZSA 1UP7A 4IJ5A 3WK6A 4X1OA 3AI7A 5FUQA 1KY3A 4NF2A 2H4ZA 3IQGX 1JSZA 5JAHA 2D2FA 1I7LA 1NJ2A 5DLPA 3KOMA 4Z7NB 1M34E 1M1UA 1TVEA 1XPJA 3GEBA 3OJEA 4LPKA 2ZU0C 1I80A 1MJGA 1ZN8A 2QGNA 2ZJFA 3I37X 4GXQA 3B48A 4K6MA 3ZHXA 1UBSB 2UUOA 3M49A 3KB1A 3G0OA 3C0KA 4G2NA 2UZIR 3RR2A 1VE7A 4DWOA 3AP3A 3RTCA 2OGSA 3OY7A 5DV9A 2NADA 1AUVA 2HIAA 3EASA 4QGGA 4MQMA 1P4RA 1L7QA 2K87A 3JSAA 5TRTA 3GMDA 3M9XA 5I47A 1FA9A 4UQLA 4JIMA 1U8ZA 4LXXA 3DL0A 3N8DA 4HV4A 1Q2UA 4ARZA 2FMFA 3FNEA 5AW4A 4ZI7B 3C8UA 1IN5A 1TO2E 4RM3A 4DV7B 5GJBA 1BIFA 5TGTA 5B2FA 2VRWA 3X1DA 2N0SA 5J2UB 2AB0A 4LN1A 1UT6A 2VSNA 2XDQB 3GFPA 1U2EA 5AW2A 1KC3A 3DW3X 1TZKA 2CDRA 4LWZA 2FWAA 4Q1FA 3HA2A 4RLHA 1QQ6A 4B87A 3P9NA 1QWOA 1XN1A 4NOJA 5JJLA 4NABA 2PZJA 2V7GA 2MINA 4ZQHA 4ALLA 4YAUA 3Q0TA 4I5EA 4V0SA 3O47A 4ZYLA 4Q7KA 1A97A 1MOPA 4JOSA 3WDKA 4EHIA 1UM9A 2XVMA 1V4BA 3BSWA 3LO5A 1FP1D 4NQRA 4KX3A 4QOSA 3T1OA 4TV8B 1IZ9A 1ISIA 5AKHA 1PKXA 4YJHB 2QVGA 1IY0A 2YY5A 2ZI3A 4DPKA 4S05A 5EP4A 1E6MA 4HRVA 4B09A 5BWCA 1E7YA 3GA5A 5G4LA 3TNLA 2D8AA 2QJTA 4ANFA 1VJRA 1WXXA 2CXNA 1QZUA 2PX5A 2XB4A 3K4HA 5G0TA 3EGEA 3RKSA 2C5FA 3HO6A 3MNFA 4EKDA 4XB6B 3MJCA 3QY0A 5DGCA 5G0WA 1OBOA 3MMZA 1Q22A 3U4AA 3WO0A 3U4IA 1KA9H 2WABA 1TMGE 4ML3A 4MIEA 1A5BB 1QF6A 1NC1A 2BKXA 3NT4A 4YUWA 5DRYA 3WL3A 1QB8A 1ZD2P 2WJIA 3RB8A 4RH1A 4IF4A 2ZROA 3BFVA 2WSYB 2PRSA 2VP9A 1EFTA 1BRTA 3T7JA 3AUJB 1RI1A 1D3AA 4QQFA 5G4KA 4MJLA 5G40A 3ZIAD 4BNDB 1CERA 1RZUA 3KT6A 1HRDA 1ZIXA 4BQRA 4G0MA 3ZDFA 2GS9A 1JQDA 4ZCTA 3L0SA 3FR7A 4A0HA 1WRBA 1FMJA 2EGUA 3QEMB 1T1JA 5CJJA 1W4ZA 2R62A 2H5LA 1ID1A 1OFVA 3C3CA 2VDOB 4MW0A 2CV0A 4FWBA 5MFPA 1WDLA 2ACWA 3DG9A 3RFXA 2C3YA 1Q0QA 4LISA 5B4UA 3UC5A 2L69A 3AG6A 4AJ2A 4ED9A 2VPYA 1XTIA 4ZO6A 3UKOA 3HG7A 5EP1A 3E9CA 4V38A 4AURA 1BX3A 1JXMA 3EIUA 4ARIA 1GPNA 2JEZA 1P7YA 4OD0A 5HM6A 5E7QA 5FQOA 3WGZA 3LNTA 2O3TA 5HM8A 3PUXA 4N39A 2BI7A 4EUSA 1CVLA 1WNTA 5DULA 4IH9A 3X1MA 1NMZA 1OU4A 4WKGA 1HR0B 1O94C 2EGGA 2D0IA 4ZZ2A 3IIMA 1NVAA 2QW8A 5CIQA 4IDUA 3SP1A 4C0BA 4J7CA 1MB0A 3H99A 3IEKA 2HV9A 1SBYA 3WKDA 4ZOLA 5EQTA 1OC4A 1SVOA 1L3IA 2O6LA 4ZO7A 1BFDA 3LG2A 2C58A 4Z2YA 4D74A 3OZCA 1JKXA 2ZAGA 1U8YA 3MAJA 3BEOA 5JATA 2BP7B 1JN0A 1J2RA 2BMWA 3WKEA 4V24A 2G9QA 4MR8A 2JI8A 5IN5A 4ZAFA 4ZVLA 4ZCMA 5JHGB 3ETDA 1K2WA 4WBNB 3L49A 1KQFA 4D25A 3SLRA 2BUCA 3DBRA 2BTQA 4ODIA 4FVTA 1A71A 2KS6A 4XASA 1XHFA 1F8FA 2FPWA 2OC4A 4S1WA 3U5TA 5TQVA 4KQMA 1R8JA 4BLWA 1A9SA 3IR5A 4RDHA 1Z29A 4TPKA 1Q7GA 3HS3A 2ZB8A 2PGOA 3C7AA 4GGPA 3DE7X 1EXDA 1ZRMA 3OIVA 3VH2A 2IYXA 1G5IA 3LC7O 3GRKA 3HRIA 5E95A 2H3HA 5F35A 1TPYA 1CD5A 2VTKA 1VCOA 1IUPA 3LVBA 1AHNA 4RZXA 1EESA 2BEWA 5IJ0A 3QVGB 3BXGA 1XKXA 3BGSA 3ANNA 5CVVA 2RGNA 3ZDRA 3GUVA 2Q1XA 4JB0A 3LX8A 2WYVA 1Q21A 5EWJA 2NO7A 5CCBA 4DY4A 2N47A 5E1DA 3EVGA 3RVPA 4EVRA 4E3ZA 2YRFA 4Y9DA 1NPDA 2JLVA 1DFGA 3DTVD 5DH9A 4ITRC 2LR0A 3PVCA 3JQAD 1KNXA 4XWYA 2HT6A 4PO8A 5I7EA 4B44A 2J5QA 3K30A 4WN9B 3UFBA 3QU5A 3ZY2A 4D9GA 4DFDA 1XX6A 2FPIA 1W0JD 3S4YA 1DLJA 4DA7A 1XZ8A 1TCBA 4GZ5A 5K0LA 2X8AA 4RGBA 3EEQA 3P7MA 1PR0A 3MT9A 1CF2O 1XU9A 4QBFA 3SKXA 2OP0A 1OH7A 4OP3A 3IDQA 3GFRA 1GT6A 1M2KA 1P2TA 3KFXA 1ZQ1A 3PB3A 4HWGA 4W6QA 5FIUA 4DBLC 2I71A 4AP5A 3QV2A 5ES3A 4OLHA 5EMJA 3TSAA 3V80A 4OXIA 3UMVA 4PVDA 1MABA 3R44A 1S9DA 3F5QA 4CLOA 5TVKA 3CLUD 5CLIA 4KOAA 4ZJUA 3PSHA 5CLQA 2H85A 4D4GA 3CX4A 3I72A 5CG2A 1R1DA 3Q9LA 4GLJA 4KHPB 2IZOA 4Q7LA 4ROSA 3GQVA 2XMQA 3D8RA 2PKRA 4INPA 3WTBA 1X7YB 1FBNA 3E15A 2COUA 2JLXA 2Q5QA 3PF8A 2EERA 3PFHA 4R8RA 2KX7A 3IVMA 3FWKA 1KRXA 1KGDA 1OY1A 1JQKA 1IXRC 4YROA 1YOVB 2AJCA 2G4VA 1G8HA 1LW6E 2HGZA 1M2FA 3GJSA 3SE7A 3C6XA 2QLTA 3O91A 5HS4A 3I39X 3U1BA 2BCJQ 1FFAA 4I55B 3ZIAA 3BK2A 1L1RA 2QP9X 5BMOA 1ZJ6A 2NU9A 2G83A 3HVUA 4EUHA 3UXMA 4DEVA 4JUFA 5FO1A 2JAPA 4ND3A 3Q3HA 2O7RA 2PBFA 1DIHA 3IPCA 3C4QA 1O0CA 3EXEA 4DUPA 4DYDA 1RPAA 5K01A 3EZ6A 3CJQA 1DQSA 3OJFA 2XOXA 3KWFA 3UOGA 4CT4B 4V3BA 2ZSHA 4EMSA 4MGIR 1XZJA 5J5AA 2QAJA 4BLOA 1C0KA 4EPTA 2DVMA 3LVQE 5M7EA 3QSYA 2OUIA 2ROQA 3QVVA 3E7XA 2F1IA 1N2CB 1BZYA 2PK3A 4YCLA 2YJ5A 1ZAYA 2ZB7A 2ZJOA 5DP1A 4DLZA 4GPBA 1WUYA 3BB4A 3WHKA 2RI0A 4OQYA 2Z1DA 1FDOA 3F6EX 1Q0PA 5JRZA 1VYHA 2ZSAA 2RCNA 1I3LA 1V6AA 4INZA 4I50A 3I9LA 2J46A 2R48A 4IHJB 1GSHA 1SRRA 2APJA 2R85A 3IOCA 4IXNA 4R7ZA 4UU8A 1NW4A 1XOIA 1P1JA 4CL3A 5A5FA 3K3PA 1EHYA 4ND6A 4KRXA 4JLAA 5J5VA 5JO9A 5TMDA 5FTLA 3KVVA 2ZJBA 4XUEA 3MWKA 3P0FA 5ENZA 2HMVA 2PMWB 5KREA 1CS4C 1RXSA 3MELA 1R2QA 1G7SA 1JB1A 1ZBQA 4LNUA 4XGNA 3FPEA 3WGNA 4A8JB 4BVJA 2GX6A 5BSGA 2ZRMA 3T7AA 1ZGAA 3BWCA 3W34A 2KE5A 2ZAIA 1YQWA 3ACDA 3FFXA 5JNRA 3R9XA 3VSCA 3QV1A 1U2TA 1GDHA 3HBMA 1ZONA 5EMKA 2F9FA 4P3NA 3S2EA 2XKKA 1Z63A 1GCGA 2PX0A 4IIGA 4Q4HB 1NF9A 1Z4PX 5U9CA 1VYUA 4M53A 1AMUA 4FSDA 4BEBA 1ZCFA 2XNSA 2J32A 2G0TA 2GVZC 2HUPA 3G5LA 1S8NA 3SF0A 8OHMA 2WF6A 3GRZA 5KTYA 2F1JA 3BH6A 5BVGB 4M9ZA 5K0SA 5K05A 4YUYA 5CVUA 3WWYA 1KRHA 3UNXA 4ZKDA 4BAGA 4M6WA 1UJ6A 5I9SA 2NZYA 4DV0B 3SYLA 1WXWA 2ID8A 5GMOA 4YRJA 4JA2A 1XJ5A 2OWDA 2YV5A 5IARA 3AKDA 3OCVA 2TECE 1KY5A 3UICA 4DJTA 1QYXA 4UTZA 5KSOA 5CPFA 2J0UA 2Z09A 3WLHA 2B9VA 2C2BA 2VWQA 4QDXA 1GGNA 2B0CA 1A4XA 1HYQA 1KMNA 5H02A 3DTVA 2D7DA 3GPDG 2R7AA 3X1ZA 4BV3A 2Z1MA 1RS0A 3VR2A 2V4MA 4J4TA 4FYMA 1R18A 4CKCA 1ENYA 2Y1LA 5KYXA 3II6X 1KY4A 1DSSG 3SICE 3MT0A 1UJ5A 3IEVA 4D4MA 2QJRA 5KKNB 3CZQA 4GZ6A 3JR7A 4F92B 2ZM5A 2PZ8A 2AMLA 4WCVA 1FSZA 1SXJB 4E7OA 4KUHA 3USES 4DS3A 4MWTA 5EUMA 4LGVA 4P31A 2D2EA 5EKSA 4XEHA 2X8WA 2EDCA 1DPFA 1AKWA 2XYGA 1PGJA 2ZRNA 3IIJA 4TQUS 4F4DA 5BN1A 1FF9A 3AB3A 3AF6A 2CBGA 3M6FA 1L4YA 2X0FA 2ECFA 4MDHA 1LK7A 4LMPA 3O0DA 5C5DA 5IPFA 1PS9A 2CXHA 4ICIA 4GU5A 3MYYA 1MH1A 3CB2A 3EGXB 1QV9A 2M6KA 3OM8A 3UOWA 4OL9A 2EP5A 3A3YA 3HLTA 4RY8A 2IV3A 2XRFA 4IIYA 5ICMA 4L07A 2YX1A 1HT3A 1N0WA 1GAJA 4I2VA 4B3MB 1LPSA 4R3UC 2GWHA 4C0WA 1NV9A 5CH8A 4I8DA 4M1QA 5AM1A 1WSWA 4GWLA 5D3MA 5CH5A 1M1NB 1E2PA 1WWKA 1DUVG 2OLJA 3SE0A 3INTA 4G65A 1KZ4A 3UJ8A 3DB1A 1RLMA 1VSTA 2GETA 1IM2A 1PAUA 4FYPA 4LY9A 2HA5A 4MRAA 1O8CA 4CQLA 3MCTA 2FG6C 3BK1A 5BUZA 2P9JA 3OJWA 5FORA 3H5IA 1UBCA 3JQDA 4LHXA 5DOVA 4EZBA 4IXWA 3FMFA 4IZ6A 4ASUD 1PZMA 3WAKA 2CK3D 4KOEC 1QDLB 4NU0A 4ZMRA 4CUZA 3PRKE 2A1TS 2GK7A 2DLCX 1K92A 3GCXA 1V39A 4GKJB 2CE7A 3G6KA 2JK1A 3JAKB 3KJGA 2FSVA 4M8NE 3JQBA 3W2FA 1I7PA 1B3BA 1QFZA 1XEXB 3D3JA 3E3LA 3P8ZA 4RY2A 3V55A 1SUPA 3KL2A 4IQFA 5JCZA 4NCAA 3LSYA 5EHIA 2WTNA 5AUQA 4Z49A 3JWIA 4B79A 4BNIA 4AKEA 2DFPA 1QHFA 4IV5A 2FV8A 2GERA 1TFUA 2G3YA 2J7PD 1E5QA 4MI1A 3LCUA 5HRUA 3ICQB 1W44A 3NQ41 1KZHA 2R96A 4IUBS 4OI1A 3VRHA 4NIMA 4RVDA 3VR5D 1RBMA 3LPNA 4GHWA 3NI2A 2XB6A 3L7AA 4RCVA 3EF3A 3OQMA 1QP7A 4YHHB 3P32A 3RU3A 5AI4A 4BAUA 2XWPA 3PIRA 3TRKA 3CJTA 2P5UA 2XMGA 4MCJA 4R9VA 2DPLA 5AP9A 2YZ2A 1JBEA 4PQGA 2GHRA 4B3CA 3C45A 2P40A 3P52A 2RSLA 3AKZA 3IEMA 1Z07A 1Z39A 3KQVA 1ZRNA 4G2TA 5CMLA 4TYPA 4TOIA 1Z4NA 4KMRA 3DPIA 4KEAA 4CM1A 1TQ2A 1C0EA 3R0IA 3KKEA 2YJ6A 3NVDA 5IKEA 5JXWA 1J8QA 1VJ1A 3IQDB 1O6CA 3PVZA 5LLSA 1YJQA 3GLGE 1RM0A 1OAAA 3CUYA 4Y7DA 1WZUA 3IVGA 1BA3A 4PZUA 3V6LA 4HWRA 1SD5A 3EIHA 3NVMB 1KIAA 5FBHA 4CGYA 5BNIA 1LC3A 2JHFA 5DTIA 1SIUA 2M2IA 4MS3A 2VNKA 3HJRA 4UDXX 4WNIA 4C7VA 4DQUA 3O8OA 3T34A 1G2IA 2CKDA 4EA7A 2ZETA 5GM1A 4DG5A 3AKCA 1U0BB 5P21A 5KJFA 5JAIA 1CG6A 4K88A 1E3QA 2HA0A 2GEBA 4KNWA 2H17A 3PPWA 3WL4A 3FDXA 3LWBA 4TRMA 1BVHA 1EUCB 1UKAA 2QMUA 3KLMX 1WVIA 2UUAB 1IHPA 2D7CA 4RTKA 3N2KB 3P20A 5BT8A 3FLEA 2WWYA 4D8YA 3ZDEA 4WKCA 3KQSA 4ZANA 1PEKE 2YIDA 4QYIB 4BNLA 4N7JA 1SVWA 4XWTA 3OIDA 2WPDA 3VDQA 5K3AA 3HXMA 1A7AA 4TL9A 1VE1A 1XC7A 4F0JA 3B3QA 3QYFA 3TX6A 3MJHA 2D4AA 1RRVA 4U7HA 3GCGA 3U3JA 3LV8A 2A35A 4CJXA 4D3XA 1DRJA 1SHKA 1T24A 3RS9A 3SYNA 3VYRB 2NP6A 2WWHA 3N0XA 2PRIA 1QO7A 3A27A 4K8RB 2P30A 2QNIA 2GWRA 1Z47A 4JBXA 2C20A 3SNKA 1XD2A 4RIEA 5HFJA 4L8GA 2RI6A 1W36D 4HAZA 3EPPA 1O2DA 2PBLA 2VJNA 1KWGA 1R16A 5IT5A 3WA7A 1GU0A 1HQDA 2IE8A 4YMSA 2QT0A 1CJTC 4L95C 5ITWA 1FZTA 4LFAB 4RS4A 3INRA 3R3JA 1E2JA 2Y9PB 4L8FA 4ENUA 1CR2A 1NVVQ 1UKZA 2HF9A 1JIIA 1MJFA 4RHEA 3D81A 1ZR2A 2FWMX 4CF4A 5G2OA 2Y2UA 4HSGA 1TVKB 1O6BA 4OMFG 3SKYA 4R71A 2G70A 4ZGBA 1F4LA 2XRMA 3TTWA 3U61B 1U6KA 4EA8A 1SBTA 1NNI1 2RC6A 5DXAA 1NNUA 5C1OA 4FE7A 4N7RA 3RJZA 3T0FA 1Z8DA 2IGTA 3F98A 1ECLA 3D6TB 4XCVA 2ZT8A 5FPYA 4H7IA 1FC0A 4H6WA 1D5WA 1CUAA 5HF6A 2P41A 1E3EA 2O07A 4YAWA 4JYZA 4B83A 4L72A 3ZH9B 6LDHA 5CM2Z 3PX7A 3GA0A 3E1KA 4KWTA 5CP8A 4IQ0A 1SCBA 4N47A 4CM7A 4C7OA 3RK4A 3JVDA 4A8HA 4PX9A 1YUBA 1EXWA 2PH1A 3LDFA 1LVUA 1EGAA 3R7FA 3WY9A 5F5NA 5JI3E 1KS2A 5JPCA 4TQAA 4I4IA 2H3EA 2CHUA 5FUVA 3F74A 3OHMA 3QKUA 5HR5A 1C0PA 5LYJF 1NHGA 3GWZA 1FX0A 4E5MA 4BY9E 4LWOA 4Y2PA 3RYIA 2VLBA 3KQLA 3I61A 3H8VA 1YU9A 3M6LA 1PJZA 4Y6LA 5HFNA 2XDYA 4DM7A 4DUGA 1NQTA 5KUTA 2P6MA 1IRXA 5SYAA 3VYSB 5JOQA 5LM3A 5HFAA 1FS4A 1CR0A 5FPKA 3VR5A 3IOEA 3Q9SA 4QXMA 5F2EA 4DQKA 3BIXA 3UK7A 4PTYA 5HIIA 3TZHA 1GV0A 1REQA 4FC6A 3P2IA 4WY2A 3RC1A 5LMUB 1L8XA 4ZGWA 2YXEA 5DHUA 3OCXA 1WEKA 4DDKA 2V0GA 4BFVA 3W9BA 4J6EA 3IQHX 3NJ4A 3TLXA 3F5DA 4U2DA 3PPYA 3AHCA 1RD4A 5DEOA 1W6RA 2D0OB 2I3DA 4Q6BA 2YYAA 3C97A 2XE6A 4WHMA 3IXLA 1ABBA 2FR8A 4EEKA 2JD2A 1LW7A 3WGQA 1R8QA 3SYMA 4M4SA 5J1SB 2QYHA 4ZODA 2BGRA 3RPEA 2X41A 2EYQA 3TL6A 3V9PA 1IZ8A 3UGQA 2H48A 4AM8A 1TVMA 3LGAA 2P3LA 1XXHB 4O63O 2O7NA 1EK1A 2XWSA 4KYVA 1IWOA 4YDQA 3MRSA 2PVSA 1LDYA 4LDNA 3V46A 5MF6A 2W2LD 1V16A 4MW5A 1YR1A 1GN9A 1TLFA 1Z37A 4J29A 1SQ0A 1AXGA 3DVQX 2OB2A 2HL6A 4CZ2A 3OPMA 3QEOA 2HSZA 2VAVA 2F62A 3BCSA 1L5MA 2AXPA 3MWFA 5HKOA 3HB5X 1P0FA 4HVLA 5LZ9A 2JLZA 1F7VA 4GDMA 3THSA 3FX2A 4L57A 4YJFA 2GESA 3FYHA 3OETA 4RWZA 1VPTA 3QWFA 3QPAA 4DV5B 1F7UA 4ZQBA 2XCQA 4YECA 3WB9A 1NXXA 2IU6A 1BMDA 1O4VA 3W05A 4L7VA 1O1YA 2Q8NA 2VG8A 1DC6A 4V0LA 4F60A 3BMOB 3WFJA 1CP3A 1Y80A 3W8FA 1XHLA 3N3AC 1OLSA 4IJQA 3TZKA 2IK8A 1DIBA 4Y0AA 4BYMA 4LQCA 5T5QA 3MFYA 2C61A 4PRYA 2BGKA 3DBOB 3LS2A 4QXQA 4ZOQI 1RU3A 2H0RA 3QQPA 1I32A 5JEEA 5AKEA 5FRDA 3ULKA 4HBZA 1PT7A 2YYZA 2O8CB 1E5VA 3HYCA 4C21A 1A9RA 5C1PA 2A0WA 1G55A 4TXJA 1R4NA 2YHIA 4FE3A 1QGUB 4P4TA 3IDSA 4NV3A 4XXHA 2H1WA 4J9VA 5K3EA 1PRYA 4GBGA 1O0SA 1GXSB 2WPNA 1ZJZA 3O2NA 3OQVA 5DIFA 4CQMA 3SC2B 1ZK2A 5JCPA 1DPGA 1IWPB 1O5IA 2OK8A 4AECA 4AN1A 1SWVA 1UR5A 4FZVA 1XQXA 4HP8A 4INAA 1K7CA 1T36A 1LRLA 2OG2A 1QIGA 4ZT3A 4DR2B 1JIQA 3IAHA 1QSGA 5GJVC 4DIEA 5DJ5A 4PVCA 1PNQA 1EI9A 1RZ3A 3CA8A 3CLUC 5FTNA 1D2GA 2JGIA 2ZYTX 3LPCA 2J9RA 1CRZA 1G7RA 1HA3A 3K6JA 4G81A 3TL3A 3K71B 1I33A 1V11A 2EJCA 4KZPA 1Z4OA 3W7AA 3G8AA 2PMDA 5AJYA 4OHYA 3LOPA 1EGHA 2Y93A 3OCWA 2WD9A 2SICE 4JLKA 521PA 2QENA 2BFBB 1MW8X 2PPVA 4UOZA 1M67A 4CG1A 2VK2A 3EN0A 1ECGA 1WR8A 2VXCA 1MX1A 2JFZA 4GI7A 4R1LA 2WW8A 3KUCA 4POOA 3PTAA 3ADDA 1KJ9A 1XG5A 2C9BA 1VGVA 2PZKA 5IC4A 4QATA 1F8YA 2C29D 1FYFA 4HVCA 4I8XA 4RQAA 4D9FA 4F56A 3I6QA 3STWA 3RVJA 2CXOA 3AJRA 1WZEA 4N12A 3OF3A 1YS7A 2FKNA 1QONA 2PO5A 4FEAA 2YICA 2E49A 3AR8A 4BRZA 4E09A 2NOAA 3TNJA 4PR3A 3H5AA 5DWDA 2JD0A 4EZEA 1YF3A 4LY3A 4Q1CA 3U31A 4GF5A 3ZE8A 1RTTA 1W88B 3AYXB 2I4NA 2VRCD 3A6DA 1YRHA 3FLMA 2FN7A 4O2BF 5BPHA 3A1CA 4V02A 1TZMA 2IPNA 2ZZMA 4NZPA 2H08A 2ZS7A 3BOSA 1QH8A 1ADFA 1AUQA 4MV9A 3ZWVA 4NYJQ 3NONA 4BO3A 2EFCB 4C6SA 2ZAOA 2C0QA 3B9QA 3EXG1 4HPXB 4YR9A 1COZA 3IP3A 4PAMA 3IBCA 1NMYA 1TD1A 4GZ3A 1GDDA 1KU0A 5J2TF 1N36B 3KELA 1EG7A 5HZGA 2JZCA 1X94A 2P4QA 1YL6A 2IDZA 4HNHA 4P33A 4LGCA 1IN8A 5E9WA 2XCRB 3M4JA 4NBWA 4N7MA 1NUSA 5I48A 3CS3A 4IKPA 3B3AA 4GUAA 3F97A 3HBAA 2BH2A 1IXZA 4QOEA 1M1ZA 1OXBB 5JD4A 2RHHA 1DMSA 5FTWA 3LUBA 2C4NA 1W25A 4RVSA 1OPXA 4W63A 1PVDA 1QX4A 5CNKA 4WOJA 3WYGA 4ZYWA 4O3MA 3AF5A 3LX4A 3EC2A 1FSFA 1KARA 1I5RA 1ZW1A 3VR4D 1ITZA 1QZXA 3DKVA 1JH8A 3TMAA 2PUTA 2FSHA 1WXEA 2W8ZA 2G04A 3ZJ5A 4EVQA 3IODA 3SHOA 1HTWA 3REQA 1TD9A 4B5KA 2JBAA 3K09C 4WNAB 1GYQA 3F7NA 4FE4A 2OECA 2GPTA 2QL6A 3TW8A 3ZBUA 1GCUA 2G17A 4RZHA 3T9EA 4EK9A 4PLGA 1F2TA 1XZAA 1Z9BA 3LT4A 3N6XA 2PH7A 2OQVA 2GILA 4PSKA 4E7PA 2J5BA 2DC1A 4KG7A 2K2QB 4R2KA 1RXCA 3ESBA 3CH5A 4X41A 4X60A 4ZOAA 5BN3B 4QVIA 3Q7QA 3ZGNA 3FYDA 1Z6XA 3SK0A 1Y9AA 2XQIA 3A2KA 4WWHA 2WP0A 2QLNA 1ELOA 3HCEA 4LF5B 4RWEA 2XBUA 3ONNA 3DTNA 2WNIA 1H4SA 1IJFA 2Q9UA 1JQ5A 4QNRA 1MZPA 2DKOA 2H9AA 3I6ZA 4Z8YA 2I2AA 3LBAA 2ZZNA 3RRNA 4EG3A 4PIPA 1BS9A 5IN4A 1O6FA 1U2ZA 2ZRHA 4FFMA 4XSGA 5CRIA 2EC5A 4HGRA 1VI2A 1TZ2A 2BZGA 4NEHB 3AO0B 1TMOA 4ETWA 4R9SA 4OIMA 2ZTMA 2MHCA 1SD1A 4YLEA 3IX7A 1OWMA 3SHQA 3VI3B 1EFPA 2X2FA 3QVLA 3S99A 3LPAA 3CNOA 3CPJB 1N7IA 2P27A 1B8PA 2ZKIA 3PQEA 4MW7A 4AWXA 5JQGF 4K03A 3BAFA 3C87A 1FYVA 2ONYA 2LKDA 3UWPA 1Q11A 2GOYA 5IC5A 1X1DA 2XD9A 3PNQA 4U2BA 4R98A 5EJ5A 1LVGA 1MQAA 1QIIA 3UO8B 1VHJA 3OT5A 2I78A 4C3ZA 3LZDA 3WWZA 4X97A 3SX2A 3OI7A 3F2IA 1PG2A 3STYA 1U8AA 1YR3A 3CXUA 1KOGA 1JHUA 1C7ZA 2XGJA 1DBPA 2CBZA 2GJ8A 2O7QA 4Y1EA 4CG3A 5BNFA 3L9XA 2H4WA 2VPPA 1U81A 3E5NA 2RMKA 1K7YA 1V8PA 4YRQA 3EAQA 5F9FA 4GBED 2DECA 1NUUA 4JGGA 1A3CA 2H1FA 1C4XA 4NYJR 3NHWA 5BSUA 5CXUA 4FUQA 3DYVA 2GJ9A 1BDBA 4MMZB 3L93A 2Z5FA 2FMXA 3V1LA 3RRFA 3WWEA 2P9GA 4N9WA 2NZUG 3D43A 1D8AA 1WO8A 2L0XA 2ID4A 1SCNE 2YV1A 3ECCA 4IM7A 2OYRA 4BASA 3MPUA 3SLGA 2VRCA 4FBGA 1W581 2WKWA 5EMMA 4F45A 5LOVA 3K73O 2BRUC 3D5TA 1BXZA 2BEKA 3SD7A 1CZUA 1VSQA 5DCWA 4OAOA 3N7TA 3DXFA 3OEHD 5CXQA 3GJZA 1I7NA 3PFFA 4Q05A 4GOLD 2C9CA 5T41A 1NXPA 4DQ0A 4EW6A 4AKTA 3ZY3A 3OTOB 2X9QA 4NATA 2C5LA 3PWZA 1J0DA 4KR0A 4Q7MB 1DXQA 4BC1A 4GX2A 3R7BA 1IZ0A 1PG0A 1A4IA 3WI7A 1GY8A 4U0KA 4YA6A 4H1TA 1O7JA 2QI9F 1ZUIA 4Z53A 2V58A 4WESB 4QO8A 5C1BA 1TT5A 1IY1A 3UMFA 4UVGA 3D8SA 4LJKA 3U9TA 2QD2A 4UCFA 3SS9X 3A1WA 3DJYA 1N2IA 3RKUA 2ORVA 1I1QB 2VJDA 4A6PA 1SUFA 4ENSA 4GR5A 4B34A 2JH3A 4B2YA 5GWXA 1ZD4A 1DO2A 3B13B 4RPJA 3UFXB 3MFQA 3EZ7A 4FFSA 3U0BA 4NCKA 3KBBA 4XE5A 2WIAA 2CC2A 2F48A 4NJOA 1U0EA 1ZN9A 3NXKA 5KYVA 3VR4A 5AWFC 4A8PA 1DEXA 1GU1A 4GX1A 2OWEA 5TE9A 2YMPA 3EVCA 3EQ7A 2OCGA 5BMVA 2QZSA 4ND5A 4I08A 5A9TA 5H8WA 2VT6A 2NYAA 4H7DA 2FFHA 1FBTA 1L7RA 1U7XA 2D2IA 3JD3A 3T9FA 1FJGB 4QRIA 1W75A 3DQZA 3S68A 3GEIA 3NOQA 3CC8A 4BNHA 3PLRA 1E77A 1B16A 1I6KA 2GAFA 1PFWA 4GXNA 1YQGA 4HQKA 5A7HA 4EENA 4YV1A 4FIZA 4JVSB 2C4TA 3HP4A 4JWKA 1NI4B 2HU5A 4YXFA 4KMOA 2QU7A 4QUHA 3AM4A 4AFNA 4AMUA 4RJJA 1XTBA 3FHCB 1XA3A 3V2GA 3DNFA 2IHUA 2EJBA 1M3SA 2AG1A 2P2GA 3M1IA 4HWPA 5D3ZA 2IYPA 4DEXA 3QP9A 3BF8A 2ZWIA 1PWZA 2ZXEA 3R5JA 1U63A 5B3JC 2HHAA 4OQDA 3RSQA 4B3XA 4ZU3A 3LCRA 1DFIA 4M0MA 5DGDA 1M6HA 3NW9A 4BHHB 3ZWPA 3VFDA 5IAOA 2QR2A 2XOKA 3UB4A 1FFBA 2B8NA 2G7ZA 4KK3A 2AFHE 3CU5A 4A6DA 1YDWA 4YN3A 1HUQA 3VAYA 3LC0A 3QOXA 1T6YA 1HDRA 1LUAA 5DKFA 4Q9HA 3HKBA 5ADVA 5IJZA 5HK8A 2WJVA 1DBWA 1J0BA 1JKJB 3EVTA 3EXHB 3MTAA 2P78A 4HDMA 4MUJA 5EKTA 3QWIA 4BB0A 1MGOA 3MIIA 4CEJA 1P17A 2HGSA 3ZDDA 1QOQB 2D5CA 1LI5A 2B4KA 2IITA 1MXHA 2WG1A 2YIVX 4GKKB 7ADHA 2VYNA 1ZGCA 2V45A 1G7CA 1Z0JA 5C4IA 1AQIA 1M1YB 4TN1A 5CUQA 3QG1A 4IDQA 4OQEA 1JE0A 5A04A 4J03A 4BNVA 2X9VA 1E2DA 2AFHA 4S0ZA 3WB1A 1Z83A 1X80B 2JFVA 5KSYA 4ZT2A 4GOKA 2HWXA 2DFDA 3HGTA 1JG7A 1ZD8A 1IY2A 4DDMA 4EX7A 4EGSA 3G82C 1C80A 4RD3A 1B1AA 1IHXA 2ECPA 2V7EA 3O7MA 3R0ZA 1P31A 4LZJA 3KVOA 4M86A 4FLEA 3RWMB 4FR5A 2QXTA 3FMPB 4XQCA 4E5UA 1R3UA 4Z5XA 1NUHA 4CMKA 3VU9B 1X7WA 1TOAA 3NEPX 3AJ9A 5KYNA 3FPFA 4B73A 3S8EA 3OFND 4QASA 3G5TA 1K7XB 1EZ4A 2HLPA 4Y9UA 3N5CA 4QPCA 4TZKA 5B1EA 3RS4A 1MX3A 4CMIA 3KEOA 3ILSA 1QRAA 3M82A 2B21A 3OZIA 2QRHA 5TQ0B 3B1YA 3AW8A 2ZJ4A 1FNMA 2EIHA 3KSBC 1LSUA 1LFAA 3EZGA 1C7IA 1I3CA 1NBOA 3URMA 3OEHA 2JI6A 3QE0A 3OVMA 3O21A 2HF7A 3R0VA 3WLQA 4BO8A 1MQSA 2PQ0A 3DOFA 3AESB 1O57A 2OCIA 4BYGA 4ZK6A 3RRMA 3VNRA 3FSGD 2C78A 4GMHA 2R68A 4RESA 3F5SA 2WA1A 1CQJB 1KAEA 3VKVA 4ESVA 4IDXA 1SA0B 1R6BX 4MWDA 1V95A 1NN3A 4U7GA 1CJKC 1GEGA 1NR7A 2IYQA 3FXAA 3ZYZA 2ATEA 1RMTA 3VSEA 1X1RA 3R3VA 4XX0A 4IZHA 1YUMA 2Q49A 1PZXA 3MJSA 1JXAA 1P6XA 2KYRA 3GAFA 1NY6A 2VCYA 3I8OA 3RADC 4KLRA 2HRDA 2PJDA 4PZLA 3CZ9A 1EBUA 4JK3A 2QSZA 2PEYA 3UCEA 3PGVA 1C3OA 1OBHA 4NENB 3T5AA 2I67A 1EFUA 2EATA 4R8MA 4G24A 2B99A 3CX3A 3D3WB 3Q7SA 2AD5A 5EKXA 5B37A 5EZQA 4I1YA 4RTMA 5BR4A 2JB9A 1MJ5A 1KAQA 2JFXA 2ORED 2B94A 3OZXA 1B73A 1E7WA 1W1IA 3PEUA 3VOBA 3W8NA 3S2GA 1NHWA 1R7RA 3H2YA 4MVYA 2QTRA 4PNPA 1S2DA 2EGHA 2WMNB 1P81A 4GWGA 5JAUA 3O3CA 3UAXA 3G8BA 4JY7A 1QGAA 3OUZA 4GMFA 6YASA 5KO2A 3S6JA 4HZUB 4DHEA 1QQ5A 1SU7A 3IUJA 1Y33E 2VK8A 4FKZA 2ERXA 4HDKA 1E64A 1KDOA 1T2DA 5AJWA 4B4OA 4D45A 4QWMA 2WSIA 1UDXA 2RGXA 1LWNA 5B7NA 4F4UA 4RFSB 4RU1A 2NO9A 2IXBA 4GX0A 1IVSA 1K0UA 4J49A 3L5OA 5LA6A 2DHCA 4KRYA 3ZE7A 3ROFA 3RWOA 5D7NA 1D07A 2ZB3A 4RIFA 3Q8MA 4LJ4A 3VKHA 4JT2A 5K3FB 1QB7A 4EYEA 1AURA 2PWAA 1VPWA 2XXAB 1B7GO 4Y2RA 3TVYA 4KZKA 3LTNC 1TW2A 2I80A 4LMRA 5C34B 3RRJA 1O96B 1XZBA 2Q5JA 2GZ2A 5HG0A 4AS1A 4K2AA 4G23A 4MV3A 1FTYA 4LW8A 5JU6A 1GSAA 3JWEA 4GVXA 4RVNA 4DBVO 3AEKA 4D0GA 3PYXA 3QNUA 3DZHA 2CLLB 1FCJA 1FMTA 1ZH4A 2HC9A 4PNEA 2E5FA 2YQZA 1TI7A 3SC6A 4AJOA 1LLCA 1K3UB 2WV7A 1YKFA 2IHYA 5DHRA 3H04A 1DEHA 1GPMA 2G1UA 1PSWA 3M9WA 3TEFA 1MEEA 4UM9B 3MLEA 1MA3A 1BVYF 2P2ZA 5DASA 4WMLA 3SM3A 3SSOA 3NBFA 2XQKA 5BWBA 2WJGA 4Z1OA 1ZDMA 3ANTA 4IMPA 3N2EA 1U7TA 2R751 4QTXA 4R83A 1YNOA 2XR1A 1DADA 1B0AA 2CUKA 1VKRA 2YXBA 1Y3CE 1C30B 2RK4A 1P44A 1YBAA 2J4DA 1Y4ZA 3UJHA 4B31A 5CFNA 4I4LA 1ZXLA 3DZGA 1ECJA 3OQJA 4WLOA 3VTZA 3ZU2A 4PBTA 3EMVA 1EX1A 3QBTA 1G17A 1NVMB 1CZHA 1XRNA 2QV7A 4ZZIA 5L7TA 3K1ZA 3EE6A 2WWTA 1KFJB 5DK6A 5EWLA 1CJSA 2YWBA 5LDGA 3TIVA 5AK5A 1PIWA 3OWHA 4TZ0A 4FJ0A 3K0FB 3B3JA 1E0KA 3PFKA 1RQPA 5AW0A 2K6GA 2ZE6A 3CNHA 4A0RA 4BNUA 4KDRA 1SK8A 2ONJA 4YJ2A 1CUUA 1M8FA 2INGX 1HBJA 2OG1A 2WJYA 3IAFA 1G42A 1Z7BA 3CTMA 1ORVA 1OI2A 2E1RA 1S1CA 4F2PA 4R69A 4Y6OA 2HMYB 3S7ZA 5CLGA 1RHMA 3KJZA 2GGSA 3LY5A 3AXTA 1YFLA 3E7FA 4P34A 2X2EA 5KYGA 3SVTA 3D0OA 5K6AA 1I4TD 3M4ZA 3QLTA 2ZDHA 1RE1A 2ZBPA 4HQNA 3TXXA 1Q50A 3GN1A 1JLLA 2J59A 2BFPA 4LYYA 1FVXA 2X7HA 1M0TA 5LU8A 2Z6VA 1T0HB 2Q4OA 4RW0A 2YC4C 4LS3A 3LBIA 3RH0A 2XIJA 2VJLA 1J9EA 4HY3A 4OHWA 4KXLA 4K0RA 4W6ZA 2R86A 2ZUWA 3SXUA 3WRWA 4TWIA 3ZD7A 3C6KA 4D57A 1FDUA 1WD7A 2OKGA 2Q07A 4UTVA 4Q3BA 2HIHA 3PQ6A 2FZ4A 5TVGA 4BNKA 1QZ3A 4OHFA 4US2R 1JB9A 1U0GA 4H18A 1NVXQ 4F86A 2ZIXB 1MPXA 2VHWA 3D6VA 3QA3E 4QOIA 4XWKA 1PJTA 3HBNA 3A70A 3GXBA 1N2EA 1PJAA 1WVGA 2AA3A 3IKVA 3MCZA