1UDBA

Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4-fluoro-alpha-d-glucose
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of UDP-sugar binding to UDP-galactose 4-epimerase from Escherichia coli.
pubmed doi rcsb
molecule tags Isomerase
molecule keywords UDP-GALACTOSE-4-EPIMERASE
total genus 128
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1997-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1udbA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1udbA01
5DNAA 3P7MA 3KEOA 4D46A 2OP0A 1LDEA 2BFOA 2P5YA 4FC7A 2O4UX 3UVEA 4KZPA 4XD2A 3GG9A 4FQ8A 3SX2A 4A0SA 4FJ2A 4CMHA 1RKXA 1DRWA 2FY8A 3JQAA 3W4JA 5CFZA 4QFDA 5T8KC 4C7KA 2DC1A 1I2BA 1KS9A 3NT4A 4J4BA 3WWZA 2W2LD 5DCWA 1DOHA 3MWEB 3QV1A 4PZCA 1PJ2A 4YQYA 4FBGA 4FFMA 3AY7A 3L9XA 4BNUA 4WUVA 1SEPA 2EG9A 3DL2A 3OIFA 4R16A 4BGUA 3PEFA 3PHIA 1MFPA 2X8LA 4L4XA 3AM5A 4JNKA 4IIVA 4PG8A 1H9AA 4QSMA 1LDGA 1MG5A 4CQMA 1EBFA 2GERA 3LK7A 1PEDA 1E0DA 2FR8A 4OAQA 5DP2A 2BHLA 1H2BA 4Q3EA 3SJ7A 3KYDA 4ESOA 4WK6A 1I24A 1JN0A 1GEGA 3U4DA 3WSVA 1EUZA 5G0WA 3RSHA 2GYYA 3KYCB 3RUCA 3C24A 3TFQA 4ZQGA 3PDUA 1OZAA 4FJ1A 3RBXA 2EP7A 2J3HA 4WJZA 1VE9A 2DUWA 2HUNA 4M8SA 2X0NA 3LC2O 3ZH2A 1TI7A 2VUSA 1FDSA 3JYQA 1I30A 3KVOA 3DAPA 4LVUA 2YV1A 3QIVA 1P1KA 1A5ZA 3DBRA 5A04A 1WZIA 1U8FO 1Q0QA 3PIDA 4KDEA 5BT9A 1X1TA 3TZ6A 3VZSA 4UEKA 2PGLA 3O4RA 4AICA 4QTZA 5CG1A 3HB4X 3SLKA 3ZWVA 4FOSA 4TKMA 1SOWA 1WW8A 5F1PA 3GC6A 4JJGA 1I36A 5ITVA 3ADPA 5BR7A 4OXNA 1VSVA 1PZEA 1F06A 4NU5A 3PJEA 2PGDA 4JX8A 3DMTC 3ETGA 3ANLA 1J49A 3C7AA 4TZKA 5F5LA 5JC1A 2RIRA 5KWEA 2HCTA 5DZSA 3W8EA 3DMYA 1GD1O 4XRRA 1NQOA 2X5OA 4BNGA 2R00A 1GYPA 3DBHB 3DBVO 1AHIA 3KTDA 1MB4A 3WNQA 1X1EA 4AG3A 4BNTA 3EVTA 3H4VA 4U8GA 2FZEA 5DBIA 3DAGA 5HA5A 1ENOA 1C1DB 1E3IA 3BTVA 1JKJA 2I76A 3RKRA 1P3DA 2PV7A 1XIVA 4KDFA 3RUAA 1ZZEA 3GEDA 3GPIA 4MJLA 2E6UX 2AEMA 1I3NA 4MVJP 3SXPA 4E3ZA 2HLPA 5I7VA 2VWQA 4JBIA 3C85A 1VSUA 1YOVA 5KCZA 4E5KA 4I5FA 4BUCA 4CM3A 4EZBA 1U9JA 4Z0HO 1E7SA 5COAA 5ILOA 2C2XA 3B20A 4P4LA 3GY0A 3RBVA 1MP0A 1A27A 1LLDA 5C7IO 3COSA 3FF4A 5G0SA 5TT1A 3FWZA 4AJPA 1CEQA 1LRJA 2TMDA 3K92A 1CERA 1HL3A 1UP6A 2HDHA 2AG5A 3B1JA 2ZTLA 2O4CA 3QVTA 3B1FA 4HFRA 1H5QA 5JAQA 5TQVA 1HE4A 4U6QA 3I9KA 4OO3A 4QXMA 2HU2A 3Q9NA 1QV6A 4JQCA 3U4IA 1Y8RB 3Q11A 4PLZA 4B3JA 3RFVA 3NV9A 3ORFA 3IAHA 2WYVA 1XA0A 3PQDA 4WCFA 3PJGA 4KUEA 2PH3A 3KSUA 3H9GA 4DQVA 4G2NA 2B4QA 2VN8A 3ZNNA 5AXBA 3ZWBA 5A9SA 1GV0A 4RPJA 1JLLA 1E7RA 2Q49A 3A14A 4M89A 4PG6A 2CMDA 4QX6A 5THKA 3RQSA 4JK3A 3RI3A 1LRKA 3PPIA 4DQUA 3BAZA 3STHA 2Y66A 4PVCA 4GAEA 2H9IA 4Y9DA 4ZRMA 1VJTA 3GHYA 4CM8B 4ONEA 2GUGA 1NX6A 3C7DB 4MO2A 2C59A 3JQ8B 1YB4A 3Q2KA 5L4SA 3L07A 3L0DA 3WDSA 3FN4A 4JBHA 5KJ6A 1EUDA 4BIIA 4M49A 4IJUA 4BO1A 3RJ5A 4J2HA 1IYZA 4J1NA 2V6BA 2WE7A 4O5OA 4UEOA 4CM9D 1NQTA 2YJZA 3LSYA 3ZWAA 4DBVO 1C1XA 1AXEA 1DJQA 3WMXA 4QECA 3I5MA 1DO8A 1Q1NA 1FXSA 4UULA 3FNFA 2WM3A 2DTDA 1QRRA 3GFGA 4IPTA 3DZJA 4M55A 5JYEA 1D8AA 2X0JA 3DZFA 4CLHA 1H9BA 1T25A 4NMHA 3TL3A 4B8WA 4JGBA 1HSZA 5ER6A 3ON5A 5A5FA 3K8ZA 2CDCA 4PLCA 1X7GA 1ZCJA 2PA3A 3H9JA 1ZSVA 4IXTA 3WLFA 4ALNA 5KJ1A 4CLDA 4TROA 4OM8A 5K9ZA 1DPGA 3BTUA 1SO8A 2P2SA 1V9LA 3GVHA 1LSOA 2GASA 2GNAA 3K30A 1HE5A 5F1KA 3BZUA 1XWFA 5AQ1A 5TF4A 3QWAA 3RUFA 1GFSA 2FPIA 4Z9XA 2OGUA 2AE1A 2DFVA 2Q1WA 2HO5A 4IS3A 4D79A 1H2HA 1SBYA 2YQ5A 5CHEA 2JAPA 3EUWA 1I2ZA 1XELA 2NU9A 2W2KB 5COQA 5CDUA 5AVOA 4BV8A 4ZU3A 3TSCA 3I23A 5FI3A 1KEUA 3I52A 5ENVA 1GYQA 1M67A 3AOGA 4BGVA 1FJHA 1U7TA 3CSDA 2AEJA 1PZHA 4M54A 2YZ7A 1N92A 1GCOA 3PZBA 3WS7A 5FWNA 3HUDA 4HUJA 2EW8A 3JYOA 1R12A 4UVEA 5JBIA 2WEKA 4G81A 2ILTA 3SLGA 1BHSA 2EV9A 2VTEA 5DULA 3WTBA 3PP8A 3MCVA 3QVWA 4N7RA 2C2YA 3W8FA 1X0VA 3WNVA 2Q2QA 3I9OA 3K6JA 1LBEA 1AHHA 1NVMB 3ZV5A 2QIOA 1PJSA 4ALMA 1E1MA 5CEFA 3S2GA 3TOXA 3FSRA 1E6WA 1YOVB 1LNQA 3DAFA 4P4NA 5KJCA 3DTTA 5CDSA 2B69A 3RASA 3S2IA 3ROKA 2C29D 5T5QA 4GL4A 1HDCA 2FR1A 2IXAA 1NXQA 3HE3A 5BSHA 2JCVA 5AXDA 3WYBA 4BNVA 3GVPA 3QWHA 3C1TA 5MGBA 1UAYA 2ZB4A 5JAZA 4S1VA 4RL6A 2QX7A 5L45A 3L77A 3OEWA 3C8MA 4R3NA 3ZW9A 4URFA 1OC2A 1N9GA 4F3YA 4WOJA 1P77A 4A7PA 4H3VA 1C0PA 3OA2A 2DKNA 4AJEA 2Z1NA 4HFNA 1R4MA 3QWFA 4OQZA 1HZJA 4RPKA 4MVJA 3D3EA 3INRA 4NDNE 4R5HA 4AJKA 3NDJA 3RVDA 2VWPA 2UDPA 1F8GA 3R1IA 4BNLA 3ZWWA 4GWGA 2W2LA 4GVXA 3ZU3A 4BNWA 1JWAB 1K2WA 2X9GA 3V1UA 2BFPA 4OGWA 2O3UA 1KEPA 1YB1A 3R3SA 4LSWA 3GK3A 1T4BA 7ADHA 4U6SA 2VRCD 4P8RA 1BDMA 3KEQA 3S55A 4OJNA 1QORA 2DM6A 3JD2A 4GLLA 1ML3A 4YCAA 3GEGA 4I9HA 3JQ9C 2Q4BA 5DOVA 3LVFO 3ADOA 2PZLA 3BHJA 4N5NA 5G4KB 5KVVA 4BNNA 4II2A 1HDOA 4FCCA 2RH8A 3DFUA 5FF9A 4BMSA 4J1SA 5I7EA 1TT7A 3G79A 1M76A 4RORA 4XB2A 4IM7A 4UUPA 1K89A 4R5MA 4BO2A 4FFOA 1UDCA 5L4LA 4MIEA 4CM7A 1CWUA 3H5NA 3RC9A 2DAPA 4KOAA 5L4NA 5JO9A 4WASA 2ZCVA 1JWBB 3FD8A 4CODB 1O6ZA 4CJXA 1P74A 3VH3A 4CQLB 3FTNA 3ZWCA 4TVOA 3VZQA 2HJSA 1HSOA 3N58A 2VYNA 1CRWG 1I3LA 2YY7A 1XGKA 4IUYA 4O1MA 1P0CA 5JCJA 4CLOB 1ENZA 1P31A 3GN2A 2B4RO 2W2KA 1EDOA 4LISA 3ZNPA 4B4UA 5JY1A 3K73O 2QZZA 5T67A 1YL7A 3FRJA 3ZDFA 5ICSA 2X58A 1SMKA 4BOYA 2ZCUA 3AU8A 3O9ZA 4GKBA 3WJAA 2X5JO 4WEOA 4XGKA 2VHXA 1EVYA 3UCFA 5ITWA 5H81A 1LRLA 3GGOA 2RHRA 3KRTA 3VVCA 3AOEA 1A9YA 4QUKA 1T1RA 4MIYA 1IHXA 2I9PA 3QE3A 4BNFA 4HWKA 1SB8A 5DBFA 4YR9A 2FHSA 2VHYA 4HX5A 3QRWA 1SPXA 1QYCA 4FR5A 3HZZA 1B16A 3OMLA 2HQ1A 3RFXA 4F6CA 5JE8A 4ZQFA 4LGVA 4OQYA 5JDIC 1TLTA 2DBZA 3R6DA 4IDAA 1LDBA 2HMVA 1B3BA 3WX0A 1CYDA 3IS3A 1HRDA 2CSUA 2CZCA 2EKLA 1YDEA 5A05A 5B4UA 1NAHA 3WG9A 4W6ZA 2VNAA 5BNIA 4D42A 1EE2A 3QHAA 1KIFA 5THQA 1E3WB 4MINA 4Q3DA 5C37A 2DPHA 1CF2O 3WYEA 1YB5A 1PL8A 1J4AA 1G6KA 3LLVA 4O0LA 4ALJA 4E5MA 3SC6A 2GD1O 3Q0EA 4B4VA 4UAGA 5JDCA 4IQ8A 3UF0A 2ZIZA 3GAZA 1GAEO 1E3LA 3H65A 4FFPA 2CVQA 4N5LA 4E2YA 2C5EA 4EEZA 3LT2A 2YQ4A 4FDAA 2IYOA 1Y1PA 1EEHA 1Q7GA 2EXXA 4GSKA 3OQBA 4XQCA 3WGGA 1NAIA 4FW8A 4MOWA 5DF1A 1YH3A 1P1FA 2JKVA 4GI2A 4J4HA 3RD5A 4DA9A 1BTOA 3DC2A 1J6UA 4YT8A 5HS4A 3PZRA 4BQPA 3T4EA 1QP8A 2G17A 5ADHA 5JMWA 3TN7A 5IXSA 1PQWA 3GRPA 4BMVA 2NTVA 4MP3A 1S7CA 3KBOA 3H8VA 3KLPX 1YXMA 2O3TA 2PZKA 1Y8RA 3WGYA 5IAAA 3RUIA 4IINA 3HDJA 2Z5LA 3VC7A 1HLPA 5EN4A 5CDYA 1IZ9A 3HHPA 5HM8A 4K26A 1YWGO 5BQFA 5F5NA 2W90A 3LLSA 3ZCXA 5A9SB 1GQQA 2A92A 2NU8A 4BS9A 5JCXA 2BELA 1PQPA 1R0KA 3F4BA 1U3WA 3RWBA 3OIGA 5BSFA 3GDOA 1PX0A 4R9SA 2LDXA 3IJRA 5ILGA 3EK2A 3JQBA 3WICA 1HE2A 4XIJA 4EBFA 4YJFA 4R69A 1WP4A 3DB2A 1RPNA 1Z75A 3L9WA 3KHUA 4NK5A 1NHWA 1HT0A 4M1QA 4J1TA 3VHRA 4F6LA 4YEDA 2OO5A 2BFMA 3VPXA 1L7DA 3GGGA 4XRGA 4WOKA 1UXGA 3WGHA 4IQGA 4EDFA 3AJRA 2Y1DA 2VT2A 2IODA 3BMQA 2PR2A 3X2EA 5GZ1A 2AEFA 1HEUA 2GRAA 1K6IA 1NVTA 3G49A 4Y6RA 2O7SA 1WMBA 3GMDA 1GPJA 1ZK4A 1ZVMA 4J0FA 3OF2A 4YAEA 2ZB8A 4YAGA 3VPGA 1YQXA 4R1NA 3UKOA 1CIVA 4U0JA 5G4LA 1LQTA 3I83A 4M86A 4RDIA 2PFGA 4G5HA 1OBFO 5I7SA 3L6OO 4YJGB 2I5PO 3PFFA 2BH9A 5EL0A 1VRWA 3HN2A 4E5PA 2ZTMA 2ZTUA 4NJMB 2QRJA 2FWMX 2G0TA 3DHYA 2CDAA 4GSLA 4LW8A 1P0FA 2V6FA 4X54A 4BL5A 3L4SO 3ZNOA 3ULKA 2NQ8A 1U4OA 4DGSA 3OQ1A 3SJUA 3OJOA 4R01A 1PJCA 1XG5A 2JFGA 1DFIA 4DMMA 4J7CA 1KETA 3NDIA 3IL2A 4IZIA 4CV2A 4BHTA 3DO5A 4XGIA 2JJYA 4ALLA 5KVSA 4BO9A 2YDXA 4WPGA 3WMWA 2HSDA 1Y9EA 3DZHA 2XXJA 4RVFA 1EUCA 3L6EA 4BO8A 1UZMA 2H63A 4TQGA 2UAGA 3GA0A 4ND4A 2WJPA 4UUOA 1ZMTA 2OUIA 3DEYX 1BW9B 5I9NA 1PGQA 4IMPA 5B12A 2BF7A 4XYGA 3ONDA 2EWMA 2HMTA 1L7EA 4L76A 1WPQA 4II3A 4BNIA 1LUAA 6LDHA 3OJLA 2FPPA 3PJDA 4BKUA 4MVJF 1ULUA 3DZIA 2Q46A 1Q2XA 2EGGA 2PD6A 4JIGA 2Y93A 3LC1O 4RQUA 3WIEA 2P4HX 4CQMD 3INGA 2HJRA 3JQEA 4B4WA 3BHIA 4B4OA 3HNPA 5IFLA 5G0TA 2DBVO 1MUUA 2IZZA 3OM9A 4AJ1A 4CM4B 1V3UA 4ND1A 4EYEA 2C7VA 3S2EA 1HXHA 1TXGA 1B7GO 1P1RA 2O2SA 1BRMA 2VHWA 3EDMA 3P5SA 2XF8A 3WQSB 2BRUA 3VZPA 4J43A 3RAJA 4GWKA 5IDYA 1SAYA 3G1UA 5JPIA 1H6DA 5TGDA 2B36A 2A9FA 4IMRA 5TS3A 2W98A 4D3FA 4E5NA 1CETA 3CPSA 4DPLA 2VT3A 2ZYGA 3AI1A 4BVAA 3OJEA 3AUAA 5T8KA 3AUTA 2WSBA 4RDHA 4K6CA 3ROPA 1HYGA 2DQ4A 4DC0A 4YRDA 2OP1A 4J91A 4F46A 3UICA 3AI3A 4EJ0A 3LYLA 4WKGA 4AJHA 1LX6A 2C54A 3E1KA 3K9QO 5CEEA 1EK6A 2YDYA 4LRTB 2SCUA 2D4AA 5JNLA 1UP7A 4PLFA 1XR3A 1UDBA 2AG8A 4NJOA 2CDBA 3RC1A 5L40A 3IKTA 4J9VA 3BMCA 4N54A 2J5RA 1RJWA 3IMFA 1OMOA 3B6ZA 5GMOA 4R51A 1ENYA 3VTFA 4MVJI 4YA6A 4MDHA 4E30A 1HTBA 1DJNA 3Q6IA 4A2CA 3MJTA 2VYVD 1OI7A 1R4NB 1RM5A 3OFSA 2I99A 4EUFA 3TNLA 1ISGA 3GVCA 2XPCA 4N18A 4YJFB 4S3MA 3CIFA 5GZ3A 3AFMA 4E33A 1LSSA 2O3SA 3TZQA 3LDHA 3GZ4A 1L1FA 3JQ8A 2NLOA 4UREA 3RUEA 1GPDG 3QY9A 4YWJA 2FZWA 3E9NA 5IDXA 1XLTA 5GZ6A 5TT0A 1QYDA 3INTA 2I6TA 3JQGB 1U3TA 3JQCA 1TA4A 2EJWA 1J0XO 1JKFA 2V6MA 2Q3EA 4WEQA 5FEUA 4WLNA 1E7YA 3R0IA 3VH2A 1XKQA 1BVUA 1T2AA 5BSEA 4J90A 4P22A 1MC4A 3JYNA 1SEVA 4YAJA 5F3RA 2NTJA 4BO0A 4ZGWA 4IY1A 4RLHA 4A26A 3ZU5A 1E77A 1T2DA 3D3WB 4H7PA 3PWKA 2NSDA 3UAGA 5IDWA 1B8VA 4J7XA 3OETA 5AXAA 1SZJG 4GQAA 1H6CA 5DP1A 1J5PA 4BB5A 2EIHA 1IPEA 1UXKA 4PG4A 3D4NA 3IQDB 5TLSA 1C14A 2EKPA 3FHLA 3GEMA 4IDGA 4PGFA 4UUNA 4PLPA 2YHIB 4R3WA 1G0OA 1RWBA 1ZEJA 2CNBA 4OSPA 2ZJ0A 2X0IA 3JQGA 1P1IA 3AUSA 4B7CA 2Y0EA 2VUTA 1U8XX 4CLXA 1XQ6A 2AA3A 4UVDA 4LSMA 4TRJA 3RROA 3GN1A 1NM5A 4WCFC 4E13A 1R16A 1YDWA 3ABIA 4CR8A 1DIGA 2NVUA 3NDRA 3PHHA 2YV2A 4YYZA 4RPHA 2IDZA 2OFPA 5EQFA 4KTTE 1RM0A 2B4TO 3BHMA 3D3WA 2IZ1A 3FWNA 1EVIA 1HYHA 3TWOA 1YKFA 1E5LA 4HFJA 1D4FA 4TVBA 5K6AC 4DIBA 5C5IA 3HSKA 3MOIA 4OMUA 2GLXA 3CMMA 3F4LA 3Q2IA 4EUEA 4ITUA 3CUKA 5JSFA 1U28A 3KO8A 4RZIA 3K2BA 4AJ4A 3CEAA 2HMUA 1R66A 3OHSX 4LVCA 3EVNA 4CLRB 1LI4A 3E9QA 1NASA 3F6YA 3IKVA 1ZO8A 4CMEC 4YXFA 1RM3A 3OIDA 4CR7A 4ND5A 2EJVA 2VCYA 3ZHBA 4XB1A 3BMCB 2Q1UA 2J6IA 3L4BA 1NQ5A 3WXBA 3WGOA 1NWHA 4WECA 1XU9A 3R3JA 2GN9A 5KVQA 1MXHA 1O0SA 5G0VA 2DU8A 1R0SA 4GX5A 1I01A 4NBRA 4YRBA 2I3GA 1P45A 4JP2A 1VM6A 2HKIA 4MPDA 4DRYA 4H15A 1IZ0A 4NU6A 3MWDB 3NUGA 4OYRA 1NBOA 3KYBA 4PVDA 3UOGA 5KOIA 3SBOA 2CY0A 2FSSA 5DDIP 1QR6A 2PD4A 3AOEC 3U09A 3F5QA 3ONFA 2Y1GA 3W1VA 4E32A 4ZICA 3WBBA 2RCYA 3D5QA 3PYLA 4LCEA 2JD2A 4TRNA 4C7JA 4HV4A 3NTQA 4XR9A 4QEDA 1MFZA 4BKPA 1Q0HA 2AXQA 2ZB7A 1LA2A 3GZNA 1ADGA 2E49A 4Y6PA 2R6JA 4CV3A 3B70A 3RBZA 4Z6KA 3I6IA 3AY6A 4D43A 4TZTA 1VJ0A 2V6GA 2X7HA 4DUPA 4YJDA 5JAMA 1EVJA 3V2GA 4AJOA 1B3RA 1PR9A 2OHXA 4Q9NA 1BXZA 2C5AA 1YRLA 3PQEA 3NGXA 3DHNA 3VOSA 1K3TA 4JCOA 1PZFA 2HK9A 4O59O 3N7UA 1TT5B 1PIWA 4HNGA 1Z73A 3WYCA 4HKTA 1N7GA 1ISJA 4Z9FA 1LU9A 1WDLA 2ET6A 3IOYA 5GY7A 1N1GA 5CPBA 3U62A 5LC1A 1H6AA 3MOGA 5DCYA 5DBGA 1H0KA 4ND3A 1GYRA 4DIFA 2PH5A 3JYPA 4DYDA 1VLLA 1NPYA 1Z7BA 3WGQA 4XWYA 4I08A 2XAAA 2Y1FA 1KYQA 1P9LA 2NVUB 3JD0A 4YJGA 1FK8A 2X86A 2GR9A 1D1TA 1UH5A 1BMDA 3P19A 3HDQA 3UHAA 4PLTA 5H82A 4OOEA 4XYMA 1XEAA 2EF1A 3LF1A 4RPGA 1YE3A 1PQUA 3IC5A 4A5OA 5G4KA 1JW9B 2Y68A 1LDYA 1KY4A 3DR3A 4RO0A 4O6VA 4UUMA 3QVXA 3ZV6A 3F47A 3H2ZA 1ZSNA 1PWZA 1QYWA 4B79A 3C1OA 4I5DA 4KUGA 4W82A 2GPTA 4ZN6A 3RJ9A 4DMLA 3BIOA 2EERA 1DSSG 1HDZA 1E6UA 1KVQA 3I9JA 2C7GA 4FFLA 5HWSA 3K96A 4YJHA 2YYYA 5L53A 1AE1A 5L51A 3D4PA 3PHGA 4WGGA 4XGNA 4CQLA 1NFQA 3GHHA 4BO5A 1XCBA 5CPFA 1XSEA 4Y98A 5L95A 1Y81A 2ZYAA 4E6PA 4O63O 4CLOA 4BO6A 3NYWA 2WWRA 3QLJA 4E2ZA 4LCJA 3D7LA 3E5MA 4N5MA 4XDZA 1WLYA 2AHRA 1AXGA 5EIOA 3OICA 3AK4A 3ST7A 3B1KA 1ISMA 4OXYA 4NBUA 5JC8A 3CTMA 1U5CA 4RVDA 4JBGA 3UCEA 4BO7A 4JN6B 3V2HA 1GQYA 4RVSA 4XQ9A 5KJEA 4B8ZA 4L74A 1EK5A 5TRTA 3M6IA 1WDMA 3H2SA 1N9GB 3VKVA 3WIDA 1HDXA 1IUKA 3WR5A 4D3SA 3V2UA 4RCVA 2C0CA 4ZVVA 3JV7A 4DYVA 5DN9A 4WE3A 1VI2A 3O8QA 3WSWA 5A9RA 4BV9A 2PD3A 4CR6A 2Q1TA 4IS2A 1I33A 2Q50A 3V8BA 3DHEA 1A4UA 4BO3A 4CM6A 1U7HA 5JYDA 2JFFA 3DOJA 2AQ8A 4CL8A 1IHYA 3GQVA 4TRMA 2HMSA 4PG5A 2A35A 4MVJG 4ZRNA 3F1KA 5L3ZA 4AJ2A 5JXWA 4J7UA 3IIEA 3TF5A 4RF2A 3PGXA 2ZTVA 1NR1A 1PGPA 2R2GA 5G0UA 4W7HA 1ISHA 1H6BA 4JJIA 4D41A 4I8XA 2O3RA 4DLLA 3UXYA 4YACA 1JQBA 5U9CA 2Q2VA 4ZQBA 3WQRA 1PL7A 3H7AA 4CM4A 3F9IA 3GNQA 3QA9A 4DBZA 2W8ZA 2YHUA 4ZA2A 2AQHA 2X1HA 4W4TA 2BGMA 3FI9A 4KP7A 4NFSA 3FNEA 2WD8A 3K2EA 1YVEI 3RUHA 3ZWPA 1ZBQA 5AOVA 3GVIA 1XYGA 3W8DA 3FR8A 5JDIA 5U4QA 3VH1A 2Q45A 1ADBA 1ENPA 3U3XA 1PGNA 1W4ZA 4K9DA 4XDYA 1V8BA 1E7WA 1A7KA 2VHZA 1LTHR 1X7HA 4YT4A 4XA8A 1SC6A 2VTDA 3RC2A 1BGVA 4FOOA 3H9UA 2QZ9A 1WXDA 4I9NA 6ADHA 1GUZA 4R1TA 1TT5A 1EFKA 3NJ4A 4QO7A 3MZ0A 3GRKA 3ZWYA 1YQDA 3PRJA 1PS0A 5A3VA 2GN8A 2CUKA 1DC5A 4PRLA 4ID9A 1DEHA 4XQEA 4QQRA 3ZWMA 3WLEA 1ZNQO 3ZGYA 1EZ4A 4CMIB 1W73A 4QFCA 1NYTA 3X2FA 5A4DA 3KZVA 4FSHA 2BD0A 4BNHA 3ENKA 4QT0A 4KQXA 4AJNA 5F1OA 3TDKA 1XHLA 1N8KA 2BI8A 3SVTA 3AM3A 4TWRA 3P2YA 1TB4A 1UZNA 1JTVA 3E8XA 2PNFA 3OBBA 1KOLA 2OXIA 4BB6A 3BMNA 4HNHA 1MGOA 1Y7TA 3ICCA 1DFHA 4EJMA 2TMGA 2WMDA 4FFNA 3FBGA 2POQX 3I4CA 4DLBA 4YQZA 5JMPA 1UUFA 3ETEA 1ZJYA 1GDHA 4PLHA 3JQ7A 4G65A 3O26A 1T1SA 1MXFA 3JYLA 2UUPA 4XYBA 1NP3A 2X5KO 1ID1A 1NHGA 4L9RA 1MV8A 4JLWA 4FPXA 1ZFNA 3AW9A 1ONOA 3FCOA 2Y1OA 3CZRA 1FDTA 2V7PA 4E2XA 2CFCA 3ZU4A 1DIHA 2GGSA 4OH1A 1U1IA 4YJHB 3UCXA 5KJFA 3WWYA 2WYWA 1UDAA 1P1HA 4AJIA 3WGZA 1UZLA 2HMWA 4R4JA 2HAEA 3P2OA 3DBLB 3QVOA 1DAOA 1DDOA 1G1AA 1M6WA 2B83A 4R1UA 5T57A 3GMSA 1ZIDA 1I2CA 1PJBA 3EMKA 3GGPA 2IEBA 1PZGA 3HN7A 4KWHA 4Q39A 4P38A 1IPFA 5TJ9A 3SC4A 1UAGA 4YT2A 4W9NC 4BNKA 4YPOA 3TJRA 1ZXLA 2VRBA 4MP6A 3PDJA 1ZK3A 3KETA 4NH4A 4RZHA 2I3AA 4OKIA 4RPLA 1H93A 4DWVA 3ZN2A 5ER9A 4CMAA 4WCDA 2GCGA 1ZH8A 4Z0TA 1DRUA 4CLEA 4CM5A 1C0LA 3VDRA 3EZYA 4TKLA 4W99A 1Z45A 5ENDA 1DLIA 4GX2A 5JDCC 1MX3A 2HRBA 1K5HA 4CMKA 2X4GA 2CF5A 4CUKA 1PS8A 2DVMA 1WZEA 2BKAA 4NBWA 1PJ4A 1Y8QA 4PZDA 3LQFA 4GVLA 1B8UA 1HZZA 5EPOA 4CM8A 3PYMA 3DZGA 4P4GA 1LJ8A 1KC1A 4PLYA 1NWCA 4XZ3A 3K31A 1EFLA 4LMRA 3JQ7B 4MVJM 1B8PA 2OBYA 4FC6A 5I8ZA 3GDFA 4GKVA 3TOZA 3FPLA 5I7FA 4FN4A 4E4YA 3AWDA 1LXCA 3VAZA 3D4OA 1EQ2A 2FN7A 5TX7A 4DIOA 5TC4A 3GF4A 5T64A 2QG4A 4AVYA 4YVFA 4A27A 5B4TA 2Q99A 1E1KA 1GADO 1SCUA 1Y6JA 2NTNA 3PI7A 4ZQEA 4BKOA 4BNJA 3QSGA 2P9EA 2WDZA 1FDUA 1I10A 4Z0PA 5KKAA 1PJLA 1U3VA 4EUHA 5K0ZA 1YL6A 3ITKA 4PIVA 2D3TA 1OOEA 3I9NA 3JD1A 4ZQHA 5DOZA 1PSDA 1KVUA 1Y8QB 1PWXA 4FD3A 3S8MA 3L4BC 1AUPA 4GX1A 5JY6A 3IUSA 4FFRA 5LDGA 2PTGA 5BSGA 2Q2WA 1JVBA 2Y1CA 3HADA 4OL9A 3EYWA 4L75A 3SEFA 1I8TA 4NPCA 4AFNA 5C3MA 1EBUA 2GN6A 1KVRA 1GZ4A 1SNYA 5A06A 2PZJA 1C1DA 2P9CA 4HFMA 2J5KA 1Q7CA 1A4IA 4CV1A 3VPHA 4E5YA 1QV7A 3UN1A 4U7WA 3PLRA 1H94A 2VWHA 4IXWA 3HJAA 1NPTO 1OAAA 4YT5A 2WD7B 3JQBC 1F0YA 1MC5A 2DBRA 1DLJA 1A72A 3GLQA 1P44A 3ITDA 4JJFA 4PZEA 1NTOA 3PJFA 5C7LO 1ZJZA 1BXGA 3G0OA 3NTOA 3WQQA 2VOEA 1N5DA 2E4AA 3EAGA 3KV3O 1PJQA 2J3JA 2NU7A 1ZMOA 4E0BA 3DWFA 1F14A 1GU7A 2Y0DA 2H6EA 3QWIA 1OC4A 2CF6A 3S2FA 3NRCA 2QW8A 2VZ8A 2G82A 1N1EA 4L4RA 1E5QA 4NIMA 2NV6A 2G1UA 4D3DA 2VZ9A 3CINA 1DHRA 1JVSA 2Y99A 3FPCA 3IDSA 3H5AA 2VZ0A 1ADCA 1SOVA 1XU7A 1EMDA 2EHDA 3U49A 1MG0A 1E1LA 4MKRA 3HDHA 2O2YA 1R6DA 1WNTA 1U5AA 3VZRA 4R54A 2R00C 2XOXA 2JD1A 1QLJA 4NR0A 4PN3A 1LC0A 3DBLA 3PVZA 5EINA 3ONEA 4RJTA 1KERA 1UJMA 2ZYDA 4EI2A 5JFOA 4L8VA 3OSUA 4FJ0A 4HP8A 2X22A 1UXHA 1Z6ZA 3JQAB 1T2CA 2UUOA 1GR0A 1AN9A 1E3WA 2PLAA 1K6XA 2YV3A 2BI7A 3BMQB 4LRSB 1NPDA 1ZK2A 2AQIA 5A9TA 3LT0A 4GGPA 2AW5A 4QO8A 5TNXA 1JDJA 2ZATA 5F21A 4AJJA 4BNZA 1JAXA 4UEJA 2AE2A 3RC7A 1DIBA 4A73A 2Y67A 3ANNA 2WE8A 4UVIA 3TZHA 2CVZA 1X15A 3BXXA 4IDBA 2JD0A 5IJZA 4PLVA 2FSVA 1ISIA 5LCXA 3OH8A 3CKYA 3EY4A 3TQHA 1FDVA 3MTGA 5K6AA 2PY6A 1I3KA 3KXDA 1BXGB 3EC7A 1R15A 1W0CA 4HXYA 3PHJA 1HDRA 4L73A 1ZXBA 4DQXA 1CQJA 3ROQA 1YJ8A 3AI2A 1DFGA 4CV0A 3M2PA 3U4HA 1DRVA 2ZK7A 3E9MA 3BA1A 1DC3A 3H9EO 1E3SA 1Z7EA 5HBRA 2OOSA 4E21A 4XJTA 4CLRA 1WAMA 2X6TA 1LDMA 4E31A 4HBGA 4GMFA 4B3HA 1X7DA 1EQUA 3DQPA 4RQTA 5TJHA 4IQ0A 1RM4A 3T7CA 1ZSYA 3AY3A 3LZ6A 1I3MA 1R0LA 2V65A 2GZ1A 2BGKA 3JTMA 4RF4A 4NBVA 5JAIA 1YBAA 2OBNA 2QQ5A 3WOHA 3NKLA 1UXIA 3V1TC 3WGIA 4GMGA 4ILKA 4L4SA 3OECA 3HDYA 3PTZA 4TRRA 2NACA 1LDNA 4CPDA 3L6DA 3AU9A 4E12A 3O38A 2LDBA 3Q3CA 1C3VA 3ZI0A 1CDOA 3F3SA 2VUUA 2CVOA 5EMHA 3WBFA 4M87A 5I8WA 1LLCA 5HS6A 5EERA 2EEZA 3I1JA 4DXHA 5J23A 2X9VA 3NTRA 3WGTA 1UR5A 3ICPA 2DFDA 4XCVA 5A5EA 2OZPA 1HF3A 1I32A 3RIHA 2EP5A 4K1LA 4XX0A 1HWYA 2ZQYA 1I0ZA 3BMOA 3K5PA 1DXYA 1JAYA 3O03A 4ALIA 1K6JA 3W6ZA 1QSGA 4KWIA 1V6AA 1HETA 1F8FA 1F12A 3NGLA 4GX0A 5B4VA 5IZ4A 3GNSA 5KIAA 4FS3A 1Q7BA 3AM4A 3KYCA 1Y9AA 3U5TA 2GF2A 3C7CB 3I9MA 4J1QA 3JD3A 1T4DA 3IUPA 4IDCA 1E7QA 3JCZA 5C7OO 7MDHA 2NVWA 3KOUA 4KQWA 2D2IA 4JP3A 3EZLA 1YO6A 2FMUA 1Y5RA 4GLOA 4KTVE 2ZJ1A 1T24A 2I66A 2O48X 4NFYA 3G3EA 3VPFA 4Y8VA 3W4KA 3QQPA 3BYZA 5CDGA 1F17A 2Y0CA 2QRLA 2YW9A 3VPSA 2IXBA 1DBVO 4RVUA 2VOJA 5TSDA 1JA9A 1HYEA 4JROA 4ZHSA 2RAFA 1E6EA 3ETDA 3UFXA 3C3XA 1T2EA 3HWRA 3CH6A 2DUUA 2Y1EA 3ZZNA 2NQTA 9LDTA 3QVSA 1IL0A 2X9NA 1HDGO 3M1AA 1B0AA 3I9LA 2XXBA 5IF3A 5KKCA 3MJVA 4ND2A 1A71A 2B5VA 2OMEA 1VPDA 1E92A 2QRKA 3JQ6A 5L9AA 4AL4A 2EGHA 4XEHA 2J3IA 4NJMA 2IYPA 2QYSA 3F1LA 3GOHA 4Y6SA 1VKNA 1IE3A 1DIAA 1DC6A 4CM9A 1A7AA 4ZJUA 1LQUA 3ZU2A 2D5CA 4WNIA 5BNTA 3DFZA 1QXSA 2VYND 5IXYA 2Q1SA 2IEDA 2CD9A 2AQKA 2WYUA 3NAQA 5HTOA 2W4QA 2GZ2A 3FTPA 1V35A 5DCUA 4HADA 4RV9A 4DL9A 3CXRA 2D0IA 3A4VA 3GNTA 4CMEA 1QG6A 3ZV4A 1M2WA 1T2FA 1C0KA 5U1PA 3GG2A 3MJ4A 3ZW8A 3PYXA 1C1XB 3D0OA 1LLQA 4IIUA 5CDTA 2NM0A 4DPKA 2E82A 1PR3A 3LU1A 4J9UE 1KC3A 2DT5A 4EJ6A 4DLAA 1U3UA 1EDZA 2OL4A 3S1LA 3OJ0A 1YJQA 1KEWA 3C1AA 3UW3A 4E2WA 1GCUA 1RYEA 1BVRA 1GZ6A 2G5CA 2VHVA 2Z1MA 1ULSA 1JKIA 2FP4A 3MTJA 3WTCA 1I5RA 4TSKA 1LEHA 1U2GA 3KSDO 1YS4A 2UVDA 4XQGA 4WNCA 3GFBA 2NWQA 4D0RA 1VL0A 3H5RA 1X13A 3KSZO 2IZ0A 2B5WA 4XR4A 5AXCA 1NFFA 3ZNQA 3V1YA 3GAFA 1BXKA 5MDHA 2J3KA 4LMPA 3WFIA 4DVJA 3BMOB 1KBZA 2P9GA 4B7UA 4LK3A 1PGOA 2VQ3A 3KYDB 1B26A 4MIOA 4HY3A 3PGJA 3RUDA 3CZMA 4CUJA 4R9RA 4GH5A 3TL2A 1NQAO 2JHGA 3DOCA 4RF5A 2IE0A 3IP3A 5COBA 3DMTA 3E18A 3EGOA 1EVZA 4NQZA 1PJ3A 1AGNA 2GO1A 3ZHYA 4DREA 1A9ZA 1S6YA 5CP8A 3H3FA 1BSVA 2BMAA 2H5LA 5CAEA 1GL3A 3ASVA 4BNMA 1EE9A 4CL3A 3NT2A 2GDZA 3IJPA 1BG6A 4MVJH 3JSAA 2JCXA 1ZUD1 2FR0A 2P4QA 4NI5A 1GV1A 3H6KA 4DTIA 3TZKA 3BTSA 4IJWA 2GSDA 3JQDA 4K6FA 2QHXA 1R37A 4LN1A 1VC2A 4RGBA 3UH1A 1WDKA 4ZD6A 2JHFA 2DBQA 4PLWA 4YB8A 1VKOA 3DONA 2HK8A 4GGOA 4R68A 4Q3CA 2DPGA 3HB5X 4A10A 1HE3A 8ADHA 5DT9A 5IN4A 3A28A 1IB6A 2JL1A 5JS6A 3PWZA 3PLNA 3PXXA 2C20A 3DZKA 4RF3A 2J8ZA 3WJ7A 2O50A 2JAHA 4WLVA 5I9LA 3DZBA 3FNGA 3VDQA 4DC1A 4I5EA 4R41A 5IG2A 1LSUA 1Z74A 4IJKA 4WLOA 3DXFA 3D5TA 1M75A 5EQDA 3H9QA 4R1SA 3OEYA 2BLLA 4WLUA 4AJLA 4D0SA 1PU2A 1ZK1A 5IDQA 3KM0A 4PCVA 4W7IA 3CMCO 2OORA 3WB9A 2E37A 4F45A 2X0RA 3E6AA 4NFHA 4CMIA 1D3AA 4MKXA 4Z3DA 4XJSA 1ARZA 4PFJA 4J3FA 4EEXA 1V3VA 2C07A 3O8QB 4D7AA 4NNJA 1ADFA 2I65A 2X23A 2YFHA 3GUCA 9LDBA 4UVGA 2IRWA 1XDWA 5EESA 3RU9A 1N2SA 4IGEA 1SB9A 1HLDA 3HFSA 1IY8A 3JD4A 1PGJA 4BKRA 1QKIA 1Y5MA 5L7WA 2G76A 3ZWOA 4UVHA 1T26A 1ZEMA 4D44A 2JFHA 3DBHA 1G0NA 3T4XA 4XYEA 1GEEA 1GUFA 1X14A 2D5AA 3A9WA 4MVJE 4NBTA 2YHIA 1GQ2A 3DBRB 1KEVA 4IDEA 3ZHXA 1DIRA 1QLHA 3PFWO 3GUYA 4GPD1 3V5NA 5FI5A 5B1YA 5JW6A 4TMFA 3ROMA 3TZCA 3OP4A 3KB6A 3AFNA 4OKNA 4WLFA 3U4CA 4K28A 4Q3NA 4Q3BA 1O94A 4KUHA 2HK7A 4YTEA 4L0QA 3MEQA 5HRUA 3F46A 3VTZA 2NUAA 4J0EA 4GBJA 2GN4A 3JQAD 1BWSA 4I1IA 1LC3A 1VL8A 3QP9A 4PG7A 4BGIA 2YUTA 2A4KA 1ONPA 2H1SA 3EW7A 1TVEA 3W6UA 1LSJA 4XIYA 1NNUA 1GTMA 1ZKMA 2GZ3A 4CMBA 2BFAA 2EKQA 2PKQO 3ANMA 1YGYA 2PKRA 2P91A 3PIIA 3JQFA 4U0KA 4C4OA 4RLSA 1TEHA 1E3JA 1GZ3A 1V0JA 3F5SA 3PK0A 1OFGA 4XKJA 4YAIA 3GR6A 2FOIA 3NJ8A 4PRKA 3PQFA 3HFGA 4YRAA 5CG2A 3DOOA 4BQRA 4MKZA 1U2DA 1KVSA 1D1SA 1YBMA 3N74A 4OXKA 3D1LA 3GT0A 3ENNA 4WCFB 4Y67A 1M66A 1LLUA 1NR7A 1NFRA 1BDBA 1DAPA 2PK3A 3DDNA 3E48A 3NEPX 1HKUA 1O9BA 4BKQA 3M2TA 4I9UA 4IZHA 2ZB3A 1MLDA 4IGFA 4W9NA 4I5GA 1BW9A 1IULA 1M6HA 1FF9A 2FPGA 1RYDA 4J2OA 1E7MA 1MA0A 1WVGA 3CE6A 4Z9YA 1D7OA 3KLMX 5FFFA 4IDFA 4EITA 5A02A 2B0JA 2J5QA 2RH4A 3TRIA 3U9LA 1W8DA 4FB5A 1UP4A 4A03A 1PJTA 1DHTA 3LT1A 2DLDA 2D8AA 1UXJA 1E1NA 4IJVA 2C82A 1QYXA 4INAA 1P1JA 3VKUA 2O3QA 1B14A 5A3JA 1O95A 2NNLD 2UYYA 3A1NA 4OSOA 2WTBA 1HDYA 3GZNB 3GVXA 4XYLA 1X0XA 5L7YA 2WD7A 2P68A 4RVGA 3KUXA 1B15A 2NADA 3LT4A 4OHUA 4NZ9A 4D45A 2B37A 4JXKA 1FDWA 4MP8A 1W6UA 1O5IA 3JQFC 3PHLA 1CJCA 3MJEA 3NT5A 5AYVA 2JCYA 2E48A 3ZHZA 2FRDA 4CM1A 8LDHA 2HRZA 1KVTA 2VWGA 3A06A 5IZCA 1P33A 4CUZA 1PS9A 2UV8A 1CQIA 5T6BA 3BTOA 5ES3A 3Q1LA 3FBTA 1VJ1A 4NK4A 5LDHA 3I6QA 3MJCA 5A03A 4J4TA 4OIMA 1PL6A 3QJ5A 3AUUA 1R4MB 1YL5A 5FYDA 3G17A 2YFQA 3I3OA 4BO4A 1K0UA 2O3JA 3QW2A 4YDRA 3LF2A 3TPCA 1C0IA 4J49A 1ORRA 3DTYA 3FNHA 1Q0LA 4IBOA 5ICMA 3W4IA 3E82A 4IDDA 2BGLA 1R4NA 3D64A 4PLGA 5IN5A 5H83A 4CMJA 1U4SA 2VRCA 3ZWNA 4YBZA 3RKUA 1VL6A 4NG5A 2NU6A 3VVBA 4YAKA 1XQ1A 4ROSA 1ONNA 2B35A 3OQ6A 4CMCA 2ZKLA 1FMCA 1IOLA 1JU9A 2F1KA 1ISFA 4B3IA 1O8CA 3RU7A 1YBVA 2D1YA 3IP1A 3G1TA 4J16A 3ZV3A 1GY8A 2Z95A 1O89A 3E5RA 5IZCC 4MVJD 3JQ9A 3PWSA 1QYVA 2Q4EA 1GUYA 3GH3A 4KMSA 2PGJA 1QMGA 3OJFA 1ZK0A 2PKQP 2I67A 4U5QA 5KTKA 2Y05A 5I9MA 2PZMA 4NHEA 5KVCA 1Z82A 1DC4A 3LC7O 4EW6A 4BMNA 3UUWA 4CQMB 2A94A 2RBEA 3GDGA 3RFTA 4EGFA 4J6FA 3HG7A 2O23A 3BMNB 4Z3KA 3FR7A 2O7QA 2VNSA 4WLEA 3HQ4O 2P5UA 5JLAA 3Q9UA 5BNFA 5B37A 1V3TA 3EHEA 3I4FA 5EJ2A 2RHCA 5KNLA 2VYVA 4ALKA 3TFOA 2D59A 4CMGA 3MJSA 4BNXA 2AMFA 1YONA 5TIIA 3ZWXA 3ASUA 1PTJA 1WMAA 4BNYA 5JCJD 4DPMA 4BGEA 4H16A 2DTEA 5L7TA 3NX4A 1E3EA 4RVHA 3RCBA 5G2OA 1NVGA 3T7EA 4B7XA 1YQGA 2PWZA 1N7HA 1WWKA 3WFJA 2QYTA 2EW2A 4FGSA 3UGKA 2NVBA 3GPDG 5JO0A 2F00A 3U0BA 2ZQZA 3E03A 4Q3AA 3H3JA 4FGWA 3OA0A 1ZW1A 2DTXA 3M1LA 3VH4A 5A1TA 5CEJA 1KY5A 3QWBA 4OOFA 4FIZA 1B2LA 1DB3A
chains in the Genus database with same CATH superfamily
5HVNA 3ZBQA 1A5TA 2QM0A 5HE9A 1T0PA 4LE1A 1NU8A 5FLYA 1FLAA 3FDJA 2MSDB 3KUCA 3KEOA 3KG2A 2XTZA 4D46A 1KI6A 1LDEA 3EGXB 4PYRA 4FC7A 3ELBA 4HAIA 1EHCA 2O4UX 4LXHA 3QEAZ 3UVEA 4Q12A 1FS5A 4BMDA 1JHDA 2ZITA 3KXKA 4LDRA 2HB6A 3ABSB 1U8UA 1OWOA 3MPUA 5D1HA 5F73A 4EHKA 4NQRA 5KTTA 1Z4KA 3W4JA 1NYLA 5BSKA 2P3SA 3BIFA 5A0FA 3H8JA 3JPYA 5T8KC 3AC0A 1I2BA 4J4BA 2A58A 5KYWB 4EHFA 3AKZA 1BCSA 3QV1A 5IM4F 4YQYA 2ZCJA 2Q7XA 1QRSA 2NPFA 1BOOA 2IYQA 5KBYA 1KEEB 1PD1A 3CO5A 4H1UA 1T1IA 4WUVA 2EG9A 1HT3A 4R16A 3OOSA 4DSTA 5F7JA 1ZU5A 4EHIA 5JZSA 3I1FA 4KE9A 2FEKA 4MUIA 4ZCQA 1ND5A 3AVOA 5EGNA 2A30A 2GERA 2QROA 1CUVA 1TEVA 3VJRA 1XX6A 4ZOLF 1DELA 4M7WA 1TUBA 3KYDA 1UK6A 4FWBA 3FAZA 3U4DA 3A05A 1T9BA 3W5UA 3EX7C 4EQ6B 1COWA 3AJEA 1RJ9B 2QIPA 3PX7A 3CUYA 4ZQGA 4FJ1A 4D97A 4IWXA 1EFRD 3GGCA 1VE9A 2DUWA 3RUPA 4G0WA 1TI7A 3CVUA 5KYGA 1FDSA 3CJTA 3KVOA 2ZAIA 5BW6B 3GRYA 3T7TA 3QIVA 1YR9A 3EPRA 3GEBA 1P1KA 4W1PA 1JWLA 5BN5B 4BEBA 1PTKA 3D8NA 1WZIA 3ISJA 1U8FO 1Q0QA 1ZICA 2D5BA 2R1TB 4ZDIA 2VJBA 1BFDA 4G09A 4JVOA 4CGZA 2PGLA 1VJDA 4U9HS 4QTZA 5DIFA 5CG1A 3GROA 3SLKA 4D3YA 3SNHA 2OC9A 3ZWVA 3AR4A 4YJ3A 2NO4A 4N47A 3OZRA 1BN7A 5CH8A 1LVGA 4DNOA 4AW9A 2P77A 1OV4A 3TOVA 3GC6A 2JLWA 1R6XA 1AGYA 4PSAA 1PT9A 4KXQA 5KC9A 4TS9A 4F3RA 1F06A 3V1KA 2BCJQ 1J70A 4D5EA 4GKJB 4JITA 5EFOA 4DLSA 3CSUA 2X3UA 3ANLA 2G5TA 4N3NA 4ODIA 4RC9A 5JC1A 2RIRA 3IKJA 4Q66C 1T3GA 1FFYA 2AFHA 3UWOA 4WBXC 4KJZA 4RXMA 2E55A 4KXMA 3NYQA 4JJEA 2IX3A 1ND6A 2BPOA 2X5OA 5JXJA 3QFHA 2A7QA 1WXQA 5A4JA 2PH7A 3TSOA 1IQ0A 2I2AA 4TS1A 4HNUA 2A0XA 2QD1A 1X1EA 2OD9A 2ZJFA 1D2GA 4AG3A 3EVTA 3H4VA 4QM7A 4U8GA 4EGAA 1KO8A 3T52A 3KJIA 3PEUA 1ENOA 3GLHA 3RHSA 5DNUA 1IHOA 4TMKA 4WJLA 2FYTA 1SBCA 3FHJA 1S2NA 4BYGA 4JLJA 1P3DA 1Q22A 1XIVA 4KDFA 3RUAA 2PLNA 1Y1SA 2QN9A 3QFCA 4F9TA 3NDPA 2ZBDA 3V8MA 2QOEA 3NB0A 1A8IA 2EJBA 3GPIA 1NNI1 1BYIA 3D7SA 4M21A 2AEMA 2C1EA 4TXJA 3SXPA 4E3ZA 4EG1A 2HLPA 3ETCA 2MR5A 2WM9B 3NONA 4BECA 3MJDA 1OVGA 4QREA 1RWVA 1VSUA 4UU1A 5KCZA 1GQFA 3LW8A 3QLTA 1L5WA 2APJA 1WKBA 1E7SA 1N5JA 3CX8A 4WXPA 3B20A 3K2QA 2HA2A 3FNBA 3DDWA 3GY0A 4L57A 3RBVA 1K4MA 3UHJA 5C7IO 1TF7A 3K92A 2QLFA 3C6BA 3K1ZA 1CZNA 1QGUA 5LB4A 1HQCA 3TTWA 3B1JA 4DSZA 3ZVMA 2Q6LA 3B1FA 4I1OA 4TMXA 3SVZA 2YKGA 1JLKA 1JHUA 4LQ4A 4U6QA 4Y1RB 5CBKA 10MHA 2BDUA 4KFUA 5AVJA 4HNQA 4K9MA 4RZQA 1M8JA 3Q11A 1OAOC 1JJAA 2JDIA 4PLZA 4Y1GA 4B3JA 2PZAA 5F7OA 3IAHA 1Y3AA 4P3OA 2WYVA 3RS2A 3PQDA 2QMQA 1UKYA 3SQNA 1XK7A 4DNPA 2F1HA 2VN8A 1ZIPA 3GMTA 3ZWBA 1GV0A 1RMTA 4H0NA 4XLZA 1JAZA 1E7RA 1MU0A 5LUBA 3D59A 3A14A 4LYFA 4M89A 4OQ4A 4QAQA 2CMDA 3OOYA 2GZRA 1KP3A 1MC1A 4HQKA 1YDHA 5IPFA 3C43A 2GBGA 2QWXA 1RBYA 1O03A 1JS1X 2NO0A 2VG8A 3L06A 5SZIA 1XFDA 4I1SA 4HI0E 4PVCA 3VR5H 4DQUA 5JQGB 1AQLA 4GAEA 5J9FA 4BN0A 3A04A 3NBUA 4WK0B 4W9MC 5K4GA 1NVDA 1ZD1A 4QJ4A 1VJTA 2HA5A 2PKXA 2X8JB 3CHYA 3RRNA 1GTZA 1X9IA 2X2OA 3GD5A 4XASA 4A23A 2W6OA 2YNMA 3ZXSA 3DVRX 3SP1A 2OPBA 3B2EA 3CPJB 2NUPB 2NZ2A 4LYGA 3UANA 1RDFA 2COEA 2EDAA 1QP4A 2E5FA 1IOZA 1KAEA 5L4SA 1DADA 1AKRA 1L5VA 1FYXA 4HTFA 2IV2X 3L0DA 1GPYA 1I6WA 3ESDA 2JLQA 1KFJB 4X65B 1UM9B 5LLTA 4KLAA 3I2YX 2XGMA 2O7RA 1C9MA 2F3PA 4ENWA 2BBWA 5LJLA 1K1EA 3WLNA 1IY2A 1FXWF 3WDLA 4ZPXA 2GNPA 1RXYA 5AVVA 4DHEA 2J59A 3FUTA 3RJ5A 4J2HA 1IYZA 4N7BA 4Q4JB 5I7WA 2A3RA 2WU0A 4N9WA 4GQBA 4MRSA 1J5XA 4F1JA 3OY7A 3PFBA 2G36A 1XRNA 4UEOA 4Z99A 4EYOA 3V33A 1L7RA 3LSYA 3ZWAA 4DABA 3NHZA 5BYJA 3L7MA 3UNXA 3EB9A 3MT7A 1XTIA 1UMDA 3TTTA 5ICEA 1IIBA 4QECA 1Q1NA 1M34E 2K7ZA 2P65A 2IKQA 3H1BA 2QTNA 2IYUA 5E0OA 1QRRA 3FOEC 4IPTA 4EJSB 4CG3A 3M5WA 3IT3A 3UUGA 4NYJR 4BLPA 5JYEA 1D8AA 2IOFK 2X0JA 3ECCA 3GGSA 1GFIA 2A1IA 3RYFA 4DCPA 2OEPA 3VPDA 1I2DA 2JK1A 2WUVA 3P9ZA 1SQFA 4DRXA 5BMOA 1FUYB 3KR9A 3NBQA 2P9TA 3N75A 2ID7A 1UINA 4P58A 3BFVA 4DB2A 1HSZA 1QOPB 3PFGA 3T06B 1A98A 4NULA 1E2JA 5FWXB 1E9EA 3GLHB 1JQEA 1TVKB 1L7AA 1ZCJA 4IXTA 3WLFA 1ZSVA 2QUJA 1E2LA 3F8SA 2BMDA 5K9ZA 2B9VA 1X1AA 3KL4A 1JHOA 5ELMA 4B75A 3QOYA 4KNVA 4MUMA 1GGVA 1HE5A 3GLFA 3R7AA 2J32A 1XWFA 4PONA 2WIBA 4JL8A 3RUFA 1Z06A 3G2OA 3K0BA 3P9QA 2EVWX 1GFSA 1CLEA 3H2BA 3T3EA 4KRFA 4IDUA 1N7JA 3QFFA 2DR0A 3AEQB 2AMVA 3WHPA 1G8YA 2Q1WA 4Q15A 3TTUA 2ZAYA 1O96B 1SBYA 1HZZC 2PQ0A 2XE4A 1S2IA 3AV0B 1WSBA 1NMEA 1VLVA 1D2EA 2GM9A 3PUZA 4KE6A 1QLWA 2WABA 3TYXA 3KAKA 5FI3A 3W0LB 3ZY4A 4WNYA 4XUGB 5ENVA 5KYVA 2CL5A 1QZZA 1KZYC 2IY9A 3ZCTA 1KAHA 1U7TA 2IU6A 2XYVA 3OPYI 1CY6A 2AEJA 4OJQA 2PSDA 4OHMA 1GCOA 4BN4A 2CWDA 5M3BA 2CE2X 2PXCA 4AY6A 3HUDA 3FDFA 3V9PA 5DMHA 3JYOA 3EW9A 2DFTA 2Z2XA 5DGCA 2C31A 4RA9A 2ILTA 4XIIA 4UU0A 4P82A 4RFLA 1H66A 4FXOA 5ALZA 5ALLA 3WTBA 3ZGXA 3MCVA 3N0VA 3QVWA 3JALA 2SICE 3CZCA 4N7RA 4Q7JB 3V9AA 1IH8A 3I9OA 5IHXA 1CUWA 5CFOA 4F8JA 621PA 1NVMB 1PJSA 4PXAA 5HKAA 2M2IA 4RK0A 1FNMA 2JANA 2PKCA 2KMLA 5EE1A 3F0TA 1R8QA 3DBIA 3V1LA 1L1RA 1T4MA 2O8CA 4P4NA 5KJCA 2B69A 3BD6A 3S2IA 4GMHA 2BFBA 2JGKA 5BO5A 2N1BA 2WZQA 3R74A 3ZLUA 1UWLA 4X7PA 1OF1A 1TCBA 3LY5A 4HQNA 5FAKA 1A4RA 4QZVA 5IU6A 1NXQA 4GMKA 2JCVA 5AXDA 4BNVA 3GVPA 5AQEA 1T6BY 2PO5A 3C1TA 2XWPA 4JHXA 4YJKA 1B23P 3IO5A 5JAZA 4R1MA 4YRMA 2DPXA 3Q3VA 3A7DA 3DMFA 1SU7A 3TQRA 2JGAA 5KYWA 4LE2A 4EYKA 1F0NA 2BFDA 5EE9A 5F4ZA 1B0ZA 3ZW9A 1WBJB 1ZD2P 1VPWA 2YC4C 3GBPA 1RFLA 3IJ5A 3PXEA 5EWLA 1O4WA 5ERGB 2VHQA 4H3VA 2FFJA 5A71A 2DKNA 2VSQA 3LY9A 1R4MA 3Q7QA 3QWFA 1C0EA 4RPKA 3D3EA 1VQ1A 4NDNE 2D6FA 1WLSA 4YRLA 3F3MA 4JC5A 1DQYA 3RVDA 4F38A 2FUNB 1A1VA 4I2NA 2BEUB 1U8TA 4GWGA 1JWAB 4X84A 2X9GA 4CF6A 3AF2A 5A1JA 5K01A 2BTEA 4NFLA 4DF3A 1KEPA 3SKXA 4YYEA 1BJTA 1Q21A 1CNFA 1G20E 1T4BA 3KEGA 3EPPA 3JAMA 3VTKA 3IBSA 4MPPA 2OMKA 1GVNB 4R2IA 4AF6A 4TYYA 1QORA 4GLLA 2PSFA 2BSQA 1ML3A 2P8JA 2YIVX 2Q7DA 2UUBB 4CQJA 5DOVA 3RLFA 3ADOA 3BHJA 2VTKA 5EHZA 4U9UA 1S1CA 3ELDA 2RH8A 4FCCA 5FF9A 2WU8A 4K6OA 2PRJA 4KXUA 4URZR 3G79A 3S1AA 1ESZA 1H5UA 3M4XA 3OKFA 1A50B 4RORA 2DGDA 4IM7A 4IF6A 4J94A 1RRPA 4BO2A 2O2IA 5HEKA 1FLVA 1TTPB 2WG0A 2PCJA 2R0QC 4K0RA 3NC4A 1CWUA 3H5NA 3CZ4A 1N9ZA 1OBVA 3C3DA 5IJWA 4I6JA 2AMYA 3SOZA 5JO9A 4GR5A 1JWBB 3KPUA 1SQ0A 5DYNA 4CODB 2BCGY 4HMQA 1DAKA 4HHEA 4MRAA 1UWKA 3NIDB 4WVLA 2Y1LA 1TM1E 2FAXA 2GKGA 2CVFA 2B25A 4LHWA 4I4LA 3OPNA 3OZXA 1M8KA 1NJSA 3I28A 3KR0A 4PAOA 5JCJA 3QZUA 1ENZA 2V4ZA 1DEOA 4DEVA 3C3YA 3B6EA 3GN2A 3PQ4A 4MV7A 4LISA 3IIIA 1HYQA 2HCFA 5LZ5A 1MIOB 3ND7A 5KTSA 5EAIA 4MMYB 5ICSA 1THZA 1XP8A 1SMKA 4G5SA 4NZYA 4JP8A 3AU8A 4NNOA 3ZS9A 4EHAA 5HZMA 4GKBA 4K6GA 2QL9A 5F76A 4CDNA 4WZBA 2QBYA 2X5JO 3KEMA 4URVR 1EVYA 4MW2A 2C97A 3GRVA 1RKQA 1K8ZB 1T34A 1ZA2A 2PUJA 4JL6A 3VVCA 5FL3A 4Z4CA 4NCXA 5LPNA 2H4WA 2SHKA 1U2ZA 2E4VA 2Q7OE 1X70A 3T4EA 4ERNA 1W94A 5KOYA 2NAPA 1IHXA 1O95D 3KU1A 1G8AA 3QE3A 4ZGGA 2A9VA 3WB0A 2CVHA 7MHTA 4HWKA 4OMCA 4P6VF 3MGKA 3K70D 1YUMA 5AM4A 5CT5A 3DZDA 1C7EA 3PC6A 5LP6B 4XIFA 1QYCA 1UC4B 1H05A 1YASA 3EY9A 1R6VA 2HQ1A 2RAPA 3RFXA 4F6CA 2O19A 4P0QB 2FVYA 1KHTA 1QOZA 2FWIA 3JS5A 1BJKA 4PNHA 2DBZA 1RQ2A 3G5LA 1ZI9A 2OD7A 3QOFA 2WV7A 3R6DA 4G5FA 1JIIA 4IDAA 3QKRA 3KQKA 2FFBA 3GUHA 4OHKA 2LCQA 4EY8A 1EP9A 2NXCA 4B48A 5B4UA 4JLVA 1IMOA 3TNYA 1NAHA 2E5WA 4W6ZA 3BCSA 3BXGA 1SUEA 2VNAA 5GTDA 5C1BA 2XNKA 2FR8C 4RUKA 1KY2A 3FWKA 3PC4A 121PA 4C5CA 3WAGA 3KYJB 1ZGAA 2DPHA 4DILA 1Z6TA 1CF2O 1XEFA 5AK5A 1WXIA 3WYEA 3ZZTA 2HSEA 3GFTA 3SQWA 1J4AA 1M1ZA 3LLVA 4O0LA 4BB9A 2I91A 1R0BA 3I53A 2ZRMA 2QXTA 3LBAA 2OQVA 1RP1A 4G0YA 4KO4S 1TM4E 4B4VA 1X1RA 4JJ7A 2JHCA 4M9XA 4YRQA 5DKFA 3UF0A 3QBVA 1U7UA 2WHYA 1GAEO 3TB4A 4MYHA 1EAYA 4F3KA 2Z6QA 3JY6A 4A2QA 2AFIA 1J1IA 4N5LA 3WWEA 2IEZA 1U6IA 1RE1A 1F1JA 1ZD8A 1CUEA 3KLOA 2YJ5A 1V71A 3F78A 5AIAA 2E4YA 4KIUA 4EEZA 1KZ4A 1HNZB 3V4LA 4FEYA 1JEEA 4OXXA 1NAIA 4V0SA 4DY6A 3EDRA 5M29A 3IVRA 3PG5A 2HZ7A 3LMKA 4Q3KA 2IP2A 4UJ5A 8LDHA 1JLSA 5BYKA 4I46A 4HWGA 5DM70 1P1FA 1SM4A 5ARDA 4DA9A 5K4AA 1J6UA 2LCFA 5HS4A 1Y89A 3MVEA 2YXNA 3H87A 1UJBA 4D57A 4IHJB 4RKFA 5ADHA 1KMNA 1TADA 2X15A 3M1IA 1G8MA 1NU6A 4PHGA 1XO1A 3AMVA 3MBKA 3T1NA 3VZBA 1PQWA 5AHOA 4E46A 2O57A 2NTVA 1LW7A 2VPZA 5DM60 3HVUA 4W5NA 3N05A 1JGTA 2O52A 1S3IA 1QP7A 2V7GA 4D0NA 4Y9SA 5BOSA 4I55F 4JLKA 3PDIB 3V4OA 1G8JA 2EFYA 2VPWA 3V4FA 4B6FA 5EN4A 5K0EA 4N8DA 1ZJWA 3HHPA 1QIGA 3MLBA 3PLAE 4N3BA 4R84A 2ZT5A 2W90A 1I4WA 1KYVA 3VKFA 4BS9A 3ONVA 3JVUA 1F8UA 4AJ9A 3EG9B 3RWBA 1FUKA 1JPUA 2HIMA 3AR7A 1XJ0A 4G67A 1AM4D 2I80A 4RW0A 5AMXA 3AVUA 3JQBA 2C5GA 2D1TA 2QLMA 3MJRA 5E1BA 4ZT4A 2JJ2D 2ZSUA 4RH3A 3HBMA 4R69A 2ERXA 2PU7A 4GBMA 1RPNA 4NOKA 4KFRA 2JGMA 1UBLS 4U7TB 3GWZA 1BMFA 2MSWA 3IOMA 2QX4A 2HF8A 3D1VA 5FLKA 1Z5UA 4GP7A 1Y7LA 1ZOPA 1NHWA 2A0UA 2BN4A 2H4HA 1TPZA 3F9CA 1M1UA 3VHRA 1YSCA 4CIAA 2R1ZA 2C8LA 1EZZA 4IJMA 4XRGA 4QXQA 1UXGA 1DIOB 3QJYA 4YDHB 3AJRA 5FNVB 1CQIB 4UMVA 4F97A 1OH6A 4G5OA 4F4HA 2QDKA 1SOUA 3AF5A 3OWOA 4TV9F 2PR2A 3BD7A 1JDBC 1YOBA 2HRRA 3TD6A 3U31A 3X2EA 1E2EA 2GRAA 2G8LA 2CL6X 2V6JA 1M72A 3G49A 3KKNA 1VMKA 3KKQA 4JI2B 5FI1B 1KEKA 4QUGA 1G5RA 1WMBA 2XUZA 4J0FA 3WGKA 3OF2A 1BCRA 1U98A 2PUTA 2RKOA 2ZB8A 4KN9S 3UKOA 4BTEA 4EATA 2W6ID 4YAGA 1K97A 1Z4IA 3UJHA 1J97A 1Z0FA 3IBTA 2ZUDA 4KO3S 2PFGA 1SBNE 4RS3A 2IELA 1VJ5A 2LKDA 2CLKB 5BURA 4PBSA 1OASA 4YJGB 3TX6A 2F3RA 2EX0A 2XNHA 2IIBA 5EL0A 4XFJA 1NNEA 1JKMA 4RIEA 3D0QA 3QX3A 3TLKA 3WGUA 3QYFA 2QNIA 4NJMB 4I1UA 3R8CA 1UDXA 2G0TA 1V26A 2CDAA 4GSLA 2V6FA 1Q16A 3F6RA 3L4SO 4K2AA 4LXIA 1U4OA 3ZNOA 4DGSA 1JHAA 4D6PA 4CTNA 1SKMA 3HLKA 3AF6A 4FKMA 4R01A 4DMMA 3B1ZA 1DFIA 1U0GA 1MO3A 2ZLBA 1M2FA 2Y1WA 1DQNA 3NDIA 4J7CA 4E09A 4OB7A 2PFKA 3ESQA 3L4KA 4CV2A 4TTJA 2A9KA 3DO5A 2P0YA 4XGIA 4FINA 5F98A 1IB0A 2FOLA 2DPLA 1QIHA 2CXPA 4A1FA 1E3TA 1X1QA 4Z7NB 4F2PA 2YDXA 4WPGA 4EKGA 1EM6A 4FWIB 3DZHA 2AS0A 2ZR0A 2PXAA 4RZSA 3L6EA 4BZWA 4U39A 3N2KA 1WPGA 1JQJC 3BRQA 2AL7A 4U7FA 1VB5A 2ID9A 3B1XA 3UB2A 4O5AA 2WJPA 1G291 4UUOA 2OUIA 5CCXA 4KXWA 1BW9B 2PDAA 2W83A 4YONB 5B12A 4XM1A 5ETJA 3F97A 5GJVC 4ZXFA 3W2IA 4OK3A 3PFCA 1UWVA 4YAFA 4PQFA 3T1OA 3NBYC 1L7EA 2QAIA 1UMDB 3PCXA 4II3A 2HSGA 1CBUA 2WV9A 2WQ7A 1LUAA 3A1CA 3NASA 3OJLA 5KU7A 2FPPA 4BZQA 5J4VA 2R5NA 2X2PA 4IIGA 2F3UA 1Y5NA 3LPNA 4L6CA 2FI1A 2VFAA 1SXPA 4JUIA 1NW8A 1U80A 1ZL2A 2PD6A 3LC1O 3WIEA 1JYSA 2P4HX 3EEBA 1PHPA 4CQMD 2DFLA 4FGUA 5IFLA 4V39A 4RABA 2ZBEA 3HACA 4XAQA 1S7GA 1T0IA 5F5XA 1YFKA 1Q7EA 1U0BB 4ND1A 1U99A 4EYEA 1H0SA 2C7VA 3S2EA 4C2BA 5C51B 1HXHA 2VHWA 2O2SA 3WRVA 1IM8A 1MO6A 1RLIA 4Q4HB 5H7XA 2PS0A 3AH8A 3CNBA 3EC2A 3M70A 3WQSB 5G41A 3SIWA 3IESA 3O47A 5F78A 1ILEA 4D6YA 4GWKA 3OWHA 4Q9LA 4P81A 2SNIE 4IG9A 5IDYA 1VTKA 1P9OA 3DFFA 3W6NA 5HZHA 4IMRA 2QYHA 1RQPA 2AJBA 1FNCA 5TS3A 2W98A 1GQRA 2F3SA 3I8SA 5IF9A 1EIWA 4BVAA 2EJTA 3F7NA 5T8KA 1KF0A 3DV9A 3VO1A 2O8BB 1YD7A 2WSBA 2BRUC 2DQ4A 1P73A 4UD2A 5I9SA 1U3FA 4BFCA 2LIPA 1L3BA 3IP6A 3EWAA 5DEOA 1A8UA 3A58B 4J91A 3U80A 3UJ7A 4ECEA 2YMLA 2UZ0A 3E9YA 3UICA 3QIAA 5HMMA 3V8QA 3U3OA 4AJHA 3VVLA 3FZNA 4WCVA 4RX1A 2PKWA 2ZRFA 2FZGA 2VF7A 4BZXA 1C9EA 4WI1A 5CEEA 3QPWA 3M5CA 2YMPA 5LP6C 3OU7A 3WK6A 1AQIA 1W4CA 2SCUA 2D4AA 2WWHA 4NJOA 4H1WA 1FZTA 1C3JA 2SBTA 3BMCA 5JSZB 2J5RA 3TRDA 3IV7A 5LA6A 5TMEA 3B6ZA 1E2BA 1QFJA 3D3JA 4QDXA 2WG2A 2C83A 3NVMB 4YA6A 1LKZA 2Q6IA 4Y2TA 1XMJA 3LY7A 1DJNA 3ZDXB 4ZGBA 7YASA 5E6UB 1QH9A 1IJKA 1OI7A 4BYMA 1RM5A 2X1MA 4EUNA 5CFQA 3QPCA 3RRZA 5CYFA 3RF7A 4J3JA 1DX9A 3TLAA 1AKNA 4ND8B 4X8HA 4HNAA 3BWMA 2B78A 3LLCA 1CZOA 2FMFA 3MMXA 5B7NA 4I50B 4UDXX 2IPXA 3WB2A 3K1JA 1L1FA 2QNRA 2NLOA 1TJ4A 2Z2ZA 4D96A 3IB3A 3RUEA 2QPOA 5CXQA 2ZVJA 3ONWA 1O5OA 3DL4A 4KX3A 4TL6A 4ZAYA 4G8DA 4IWNA 5GZ6A 1QZTA 5HHTA 1SCQA 2QG6A 3O7WA 3PX3A 4Y2XA 3CT6A 4KH1A 4MGEA 1U3TA 3JQCA 3H5WA 3VYSB 4HGOA 1P6QA 1SU6A 1S3GA 2BONA 5JCPA 2J3MA 2P2NA 3LXMA 1G41A 3VSBA 1GTVA 3DTVB 3T8YA 1Z4MA 2QORA 1HX7A 4WLNA 1KSJA 2OCLA 1MQAA 3VH2A 3UYLA 1TYEB 4P22A 3WAJA 4ACBA 4CG2A 1ACMA 4HNTA 1EI9A 3ZVNA 4M4SA 3JYNA 1HDIA 2ASVA 4JOQA 2ZWVA 2R9VA 4ZGWA 1L6RA 1NL3A 4DXDA 1Q0TA 4C7MA 2IOFA 4D4MA 4NVRA 4IX9A 5KNDD 4MIKA 3D3WB 5DNYB 4GPZA 4H7PA 4P7GA 1D9ZA 2YYAA 2ODPA 3OETA 2IF2A 1VMAA 5AXAA 4GQAA 3RYFB 3NIGB 5IANA 1ZD9A 3TTSA 3THSA 4D5GA 1XTRA 4PX5A 1NLZA 2W6JD 3DWIA 3CEPB 1IPEA 2C2BA 4BP9A 4Y1RA 2QTVA 1EPUA 1JEJA 1C14A 2EKPA 1JDTA 2QK4A 2X14A 4OU5A 2BTQB 4GU5A 4PC3A 4PGFA 4UUNA 1G0OA 5FR2A 3ZEAA 4KPYA 1RWBA 2C2WA 2CNBA 5LQMA 4KODA 3B5JA 2C03A 4ISBA 3PUWA 1V7CA 2VJNA 1W29A 3GO4A 4GOJA 4C6TB 3RTGA 4CKCB 5HQTA 3AJ9A 5D7BA 5BT8A 2XXAA 4LSMA 1OH7A 1V25A 3NBXX 4WCFC 4HPWA 3M4ZA 1R16A 1C1HA 3EEQA 2OFXA 4ZT6A 1R6TA 1V8DA 1M1YB 4L4ZA 3SQLA 1H1DA 2WB4A 1PFYA 2VKQA 1IK6A 2OFPA 3TQQA 3KQUA 1W1IA 3FYSA 4KTTE 2B4TO 2OXCA 3D3WA 2O2DA 3FDIA 4NHOA 1EVIA 1KNQA 5TXGA 1JAIA 5CHYA 3RW9A 4D99A 1IEXA 4R6WA 3JYHA 5DI3B 1D4FA 1DBQA 5K6AC 2C92A 4GZ6A 4C4TA 2VUIB 1H65A 2D0PB 2GLXA 3F4LA 4CCWA 3LPMA 3FZGA 4EO9A 5CTAA 4UTVA 4BJ6A 1U9IA 1JAHA 4BQNA 4BWGA 5JSFA 3MXTA 3HU1A 4RZIA 1XTKA 4G9EA 4DT1B 3CEAA 4MO9A 5IUJC 1IN8A 4CLRB 5EEHA 1KK2A 4CTMA 5M34A 1CP2A 3HKEB 3M5PA 4IZOA 4CMEC 4YXFA 5EIWA 2Q21A 2Q5FA 4TTAA 1RAIA 2EJVA 4I5IA 4BE9A 4XB1A 4OATA 3G2QA 2OM6A 3IVGA 3NM4A 1PR0A 3OEHD 3OTQA 4Y9UA 1NQ5A 3PNLA 1A8PA 3WGOA 1N0WA 3IGFA 3UZUA 4IYJA 2G83A 4EPYA 1XTVA 3O83A 5REQB 5KVQA 1Z38A 2FSUA 2Q4OA 1MXHA 4R0MA 4PCAA 1T9GS 2FPIB 1QTIA 4E1BA 8GPBA 2DU8A 1RC8A 3DNMA 3QVGA 4CTJA 2XBLA 4L8WB 5DIZA 4HVLA 1TYBE 1JEDA 1L8XA 1U63A 4JP2A 3BJEA 4X95A 1VM6A 2HKIA 3A6HA 2AJDA 4H15A 4NU6A 2Q5JA 4UM9B 3HLYA 2ZRBA 3J7AC 2IGBA 1NDQA 4EJSA 1UZAA 1XZBA 2RHGB 4GXNA 1FIUA 1EQAA 3S8EA 4LXYA 1MRSA 3BBPA 2OYCA 3KU4A 1RWKA 4BY9E 4TLMB 4Q1DA 4BBZA 2D3WA 3R3HA 1GNTA 4HQFA 4RTOA 2PVCA 3CNQS 3KOWA 3F5QA 4LI3X 4B6EA 3WBBA 2ZUUA 1QB8A 2B98A 2RCYA 3D5QA 2GBCA 3F9RA 3NHLA 3ZWKA 4EBBA 5KOJB 1TIBA 3AHJA 3AFGA 4NOMA 4QEDA 4WN9A 4XM0A 4KK4A 3PGKA 4BKPA 5M2QA 4YRJA 4U8HA 3P5BA 4WXRA 4G0XA 5ISMA 1M9NA 1DRKA 2YOFA 3AHEA 1ADGA 1F8XA 2E49A 1PRYA 5CB8A 5HNKA 1ULZA 5AW5A 4PQEA 4CV3A 3B70A 4BVKA 3RBZA 4ZZIA 4KI7A 2C9DA 2V98A 2V54A 2Q3LA 1NP6A 3QU9A 4U2KA 4HZGA 3LNTA 4DUPA 1MDFA 3IP8A 4YJDA 4HPXB 3MC1A 1EVJA 3PHCA 3P9SA 3TXAA 4AJOA 4D74A 2IBSA 4BVEA 2ADMA 3ZCUA 1AKWA 2OHXA 1TCUA 4H7HA 2OLJA 4MRPA 1N78A 3CVYA 1SU8A 2DECA 3PQEA 1RLOA 4C0JA 2GHRA 2HK9A 3DFIA 4JKYA 4RMNA 3N7UA 1XP5A 3N5KA 3QMWA 1KQGA 1W59A 1YULA 4OUDA 1JSZA 1F9AA 4DT1A 3AONB 2J3DA 3MLEA 1ISJA 1YUBA 4FQ5A 1BDJA 1WDLA 4Z9FA 4X6YA 4GOKA 4D8YA 5FUBA 4M8LA 1N1GA 5CPBA 4G26A 2RHLA 1SXJD 3PBKA 4P5DA 3GRFA 4RH0A 5AVXA 3MHTA 5DBGA 1G6Q1 4ND3A 4ZDKA 4N39A 3CJRA 5FKJA 2C98A 4GS5A 1H85A 1VLLA 1HG1A 1NPYA 2R6DA 2BEJA 4O2RA 3HBAA 3C6MA 5CH3A 4I08A 4BGDA 1FSZA 4HD8A 1KYQA 3H5VA 1RIFA 3RNLA 4Q16A 4B87A 4D9FA 5A3QA 4C30A 2H1IA 2V8BA 1W0JD 2QLTA 1EEXB 2WMYA 4DLTA 1UH5A 2XUGA 3D7NA 4KOEC 3HDQA 1L0BA 1C81A 2WAOA 3EVFA 2RE8A 4XYMA 3GP8A 3LF1A 4FGKA 1YE3A 1PQUA 3K6RA 1Y0BA 1KMIY 2G40A 2WM8A 2JI6A 4ARBA 1QVAA 2Y68A 1T9GR 1B76A 5TGTA 1LDYA 3TEFA 3NC1C 1K6EA 1XCGB 2ATIA 2LVBA 3O9MA 1U9CA 3F47A 4NY1A 4X8LA 5CLHA 1ILWA 4OHFA 3UJPA 4EX7A 4ARZB 1QYWA 3L0SA 4DCJA 2XE6A 3ETNA 4F5ZA 2O2ZA 2OLEA 4I5DA 3MMZA 4B79A 4DIEA 4JEIA 4AQDA 3B53X 3CZQA 2OZLB 2K87A 2IYZA 2NO7A 3A6DA 4LAFA 5HWSA 3M4NA 3K96A 1PVOA 1DJOA 2VYCA 4OP1A 4RENA 4X3CA 4KFSA 1GRCA 5CNIA 1DCTA 5REQA 3N59A 1JU4A 1E3QA 2JIRA 4HOYA 3CN9A 3R5JA 4OK6A 1XCBA 2P9QA 4HDNA 4Y98A 5L95A 3KHTA 5FTJA 2GYUA 4KYVA 3TQIA 2W71A 3LXXA 3D7LA 3D8UA 1JECA 1QO0A 2PA0A 1WLYA 5JJBA 2CJFA 3OICA 3ST7A 4GXTA 4UPEA 1AV6A 3CTMA 3L0YA 4AROA 2OUKA 5B7QA 1ZOSA 2NYVA 3UCEA 4JN6B 3ZJ5A 7REQB 1GQYA 3EQ6A 3TMKA 2IC5A 2AG0A 1CHNA 2ANBA 2Y6UA 4ZP1A 3HBNA 4L74A 1E9SA 2FFQA 2Z98A 4JODA 3M6IA 1WDMA 4MWTA 1G1MA 3PA8A 3H2SA 1Q1GA 3JSXA 4NNPA 1IUKA 2Y2VA 1SUBA 3WL5A 2C0CA 4DYVA 1K27A 4WE3A 4MV8A 1U2TA 2WFZA 3TINA 1KFCB 4LX0A 3R5XA 4A9AA 4FXPA 2Q1TA 2ZZNA 2C3MA 3NWJA 1I33A 1KIAA 2XSZA 3Q3HA 5E6UA 4M0KA 4B3XA 4DJFC 4C03A 3BK2A 4DR6B 4CL8A 5JXIA 2OGZA 2X40A 1W2HA 4A3SA 2HNAA 3E0QA 3F1KA 2I7VA 3RAEC 1TJYA 4Z9BA 2GFQA 1L5GB 4RF2A 2IEYA 2J9YB 1EUYA 4UZEA 4DTCA 2PVPA 4RK5A 3NHJA 1W88B 1XNHA 4W7HA 1JZQA 2YWXA 4M0EA 4U6NA 3A6KA 3TBFA 4D41A 4DPMA 1WX1A 4RMHA 4D8UA 2C9YA 1REQA 4S2EA 4DLLA 4EECA 1JQBA 3UAYA 1AG9A 1PL7A 3ILSA 1CR0A 3F9IA 1H8EA 2ZYHA 4H6PA 1EK1A 3QA9A 5ITZA 5D2CA 1FFCA 2AC7A 2YHUA 4ZPJA 4NEQA 4RTJA 4ZYWA 4UMEA 1HC7A 4LJ5A 3Q9LA 4O4LF 4W4TA 4TWZA 3HA7A 4M0CA 4NFSA 1SG0A 1DZ3A 1NVWQ 3KFXA 4MHOA 2ZBVA 4TLEA 3VVMA 3PB3A 4ETMA 4CIWA 2OXEA 1Y3BE 3TUIC 4DLPA 5IYZA 5LWQA 2IUTA 3NU1A 1I3OA 2Q45A 1ADBA 5GOTA 2CYAA 3VH1A 1A2KC 4LRQA 4YMUA 1P2GA 1RPAA 4MUFA 2GEFA 1UJ4A 2JAWA 4MW1A 5ALSA 2ZRKA 3EZ9A 4RS4A 1A7KA 3TTYA 3UT6A 4NJEA 1N2CA 1X2EA 1LTHR 1X7HA 2KQUA 4YT4A 3QVJA 1IN5A 4HRXA 4MS1B 1H9CA 1DAIA 4OA8A 4RGVA 1MABB 4QWMA 4CEHA 4JXJA 4I9NA 1YZUA 4C4XA 4WY5A 6ADHA 2D5IA 1SELA 1YRAA 3VC2A 3H2IA 3BILA 3K09A 1PK9A 4QO7A 3I01M 1F60A 4DCNA 1EFTA 1Q77A 1KRHA 3SFTA 2XJ4A 2GK3A 3IQWA 3F8WA 5A3VA 3WI7A 1ESEA 4DDMA 5B2EA 2VBFA 3OE5A 4IWYA 2P8SA 1IQPA 2DUJA 4XQEA 3T7SA 4C05A 2AR9A 5EHXA 5IT0A 3ZWMA 3CC8A 2VPQA 4CMIB 3BH7A 1W73A 4P32A 4US2R 5I8PA 4C6HA 1C3OB 4KQFA 2VR1A 1B6GA 4QHSA 2HBYA 3OZDA 4KQXA 4P08A 5D84A 5F1OA 4HQ6A 5J59A 2BDTA 3TDKA 2VPPA 2I03A 2CBXA 4TWRA 1Z4OA 2VRNA 1UZNA 3B6IA 5AJUA 5A4FS 4QYMA 4BB6A 3H83A 4HNHA 4Y6GB 3Q8KA 4B3TB 1VMDA 2OKCA 1DFHA 3ZDDA 1E9DA 1CZUA 2IHNA 2CNLA 2WUGA 2WMDA 3DKPA 3FBGA 2OQRA 2POQX 3ZXYA 2O2HA 5LYJF 5EMNA 2UVPA 1Q57A 3GU3A 1AA6A 4H1HA 5L3QA 3ETEA 3B89A 3QNUA 1ZHOA 1PV2A 2R7MA 3Q3GE 2CLEB 1G4UR 2W0SA 4FK8A 4KR0A 4PLHA 4Q1AA 1KMHA 5LNK6 2BBSA 1T1SA 1MXFA 2EKDA 2UUPA 1W49A 4XYBA 1FQOA 4J16C 4AO8A 1ID1A 3TZBA 5I9BA 3AKYA 3QLEA 1SJ9A 4L9RA 1ETHA 4UHBA 5BRJA 4FPXA 3HI6A 1R3UA 1ZFNA 2XUJA 1ONOA 2GARA 3MWLA 3FCOA 3V6MA 5AVSA 1CKEA 1WHTB 3S7TA 4R2KA 5AKLA 3VFDA 4OH1A 3N87A 1SCBA 1XI2A 2ZB2A 3WWYA 5IYZB 1QDEA 1QRDA 2R8XA 5BWNA 1QUFA 4DWOA 4OTZA 2TMYA 4R4JA 4LPKA 5F9FA 3GLFB 3DBLB 2FG5A 2EJUA 3I32A 3WGJA 1QVZA 3GMSA 1ZIDA 3EASA 1YJAA 3GGPA 1EM8A 1I0IA 5L3QB 5LLDA 2CLDX 1F6BA 4KWHA 4Q39A 4I55A 5GV7A 2WYIA 1UAGA 1TYDE 5AK4A 1I94B 4W9NC 2BIFA 5BUQA 1YR6A 2ETVA 2VRBA 2PTHA 1ZM4A 4HB2A 4MGYR 3PHBE 2C95A 4X61A 2BY4A 4PU0A 2WJJA 4ND6A 1QQBA 3D8BA 1DXQA 4RPLA 5JVDB 5BVGA 2H1LA 1TUGA 4M6WB 5J40A 1A9PA 2VUHB 3CF4G 2V1XA 4GL2A 3O8BA 5ABPA 4HRAA 4WCDA 2PANA 1CVIA 2G71A 2QW1A 1C3OA 2MHCA 2IH2A 3LTEA 3IP5A 3K4PA 3WLIA 4CM5A 3CH4B 4EMUA 3EZYA 3SZOA 1QRUA 4TKLA 5LZ2A 1CQZA 2RAUA 4DV5B 5K03A 2EFHB 1R4ZA 1JALA 1MX3A 1NUHA 2C3OA 1FTNA 3QEJA 4Z51A 1PS8A 1ZBDA 3OOWA 1E1QA 3OOEA 1BS9A 5AUPB 1LK5A 5EHIA 5BN4A 3CWZA 2BH2A 4G1BA 4MYCA 5K20A 1EM8B 3W9BA 5TQ0A 4G8JA 4W1RA 3ZZMA 1ATZA 3KHSA 3QSYA 4XARA 4C7OA 3PYMA 3DZGA 4P4GA 3ZWQA 1KC1A 3LDFA 1XTSA 1YKGA 4MICA 1PUJA 5FOTA 4BWFB 4B7AA 4CEHB 1W19A 1GNSA 1EFLA 3EJWA 3JQ7B 5E9WA 2OBYA 3WRXC 3ZIAA 2YWBA 3I6MA 4JD5A 5I8ZA 2ZETA 3ZDCA 3GDFA 4GKVA 3KB8A 4JQOA 5JYBA 3TGPA 5ULLA 2K7FA 1B8OA 2BZSA 2I1LA 3T9FA 4ANFA 4S05A 4Q3LA 1TECE 3UPDA 2B8JA 1KOJA 1O94C 3M81A 4C7VA 3D4OA 3H04A 3K8YA 5HFJA 5K8CA 2IH4A 1EQ2A 3L6UA 5TX7A 3ESAA 5E2AA 3T7AA 2ZIWB 3W3AH 1UBNA 2QG4A 5T64A 4OX9Y 1SZCA 1GADO 1SCUA 2PGAA 3AP3A 1KK0A 4ZQEA 4PYOA 4RJ2A 2E18A 1IY9A 2VJDA 4R0NA 2P9EA 4FT4A 1FDUA 2FPMA 3B7PA 4FX5A 5LU8A 4KQ1A 1IXKA 1PJLA 4GSYA 4GF5A 2JFZA 3ITKA 3OAAD 4XDHA 2E5LB 1CFZA 3I9NA 1JH8A 2CJPA 1GHTA 4JBYA 2VNHA 3L5KA 2AOUA 4HLDA 4INJA 1M33A 4FCVA 3TE7A 2F9LA 3KKPA 3L4BC