2YV4A

Crystal structure of c-terminal sua5 domain from pyrococcus horikoshii hypothetical sua5 protein ph0435
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
105
structure length
102
Chain Sequence
APNAEVIVVEGPREKVKGKITELVKELKERGKKVGVIGSESYNADEFFFLGSSVEEVAKNLFKALRYMDKAGVDVVIAEGVEERGLGLAVMNRLSGYKIVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Hypothetical protein PH0435
publication title Crystal Structure of C-terminal Sua5 Domain from Pyrococcus horikoshii Hypothetical Sua5 Protein PH0435
rcsb
source organism Pyrococcus horikoshii
total genus 36
structure length 102
sequence length 105
ec nomenclature
pdb deposition date 2007-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11030 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yv4A00
3AJEA 4E1BA 2YV4A 2EQAA
chains in the Genus database with same CATH superfamily
2FEPA 4MS4A 1NUHA 3DLPX 4J8PA 5SYNA 1GTVA 2DQSA 2BFPA 3KB2A 2P62A 3EQ8A 1UBHS 3QF7A 4NOLA 5AHKA 3PFHA 4V0RA 3T5MA 4Q3BA 1PEKE 4F21A 1ZA2A 2PXAA 4CUKA 1WP9A 2IEYA 4ISBA 3EB9A 4L4RA 4P4SA 4FJ0A 1BRTA 3L01A 3B3JA 3LX5A 4MV0A 4DJEC 4E5NA 1YCDA 3CJTA 2ZWIA 3H86A 1Z4LA 1UK6A 3AETB 5IVPA 1TX4B 4W1RA 4DB4A 2HNBA 1IWPB 1U3WA 1N6KA 3PPYA 5DGTA 4BE4A 1U11A 3UFXA 4L3OA 4ZV9A 2QD4A 1MC1A 5K6AC 1DRJA 5TY0A 1K6IA 1RQ7A 5FTWA 3U7FB 5HMMA 2QRKA 5E8RA 3KZVA 3VQTA 1T4GA 1Y81A 2RH4A 4B84A 1ZK2A 2RG1A 4Q39A 1SAYA 3HABA 4I55F 3H4MA 4QM6A 2IIBA 2WPNA 3LV8A 5DWVA 3WGLA 2FZCA 3IDOA 3QKWA 4MP3A 4CM4B 1ITZA 5CW1A 2IXEA 2XWJI 4NZ9A 4OO3A 2CNDA 2EWWA 3EEIA 4M4SA 4FEYA 1ZH4A 2I7VA 2KI5A 4RACA 5CT8A 2XT0A 4ZQEA 3GDHA 3KDSE 3BXHA 4IRMA 2YWGA 3D4OA 4AKIA 3EVTA 2FSSA 3IIIA 3NT4A 1S3GA 4MR9B 1OASA 4NENB 1TO1E 1OFVA 5DTEA 1XVIA 4CM6A 3FKSA 2XNCA 1U2ZA 3WSTA 4QA9A 1GCOA 1SVLA 2GTIA 3F6EX 1EBUA 2VLBA 3FCSB 5IM4F 4TXHA 3WV5A 2IHNA 2CLLB 1RAFA 2J67A 5CHEA 2IJGX 4DA0A 3ILXA 3F6CA 3FLEA 3WVNA 5KTNA 2Y1WA 1IIBA 2WHEA 1H93A 2QENA 5KYUA 1E3WB 3O8DA 1WDLA 1ZESA 3VFDA 2Q5CA 2QLTA 4LZAA 1NX6A 4HSEA 4YV2A 7AT1A 3PQ7A 4G0PA 3PGVA 4GOKA 4UUMA 4XYLA 1OJ7A 2CW5A 5T4HA 5U4QA 2X2FA 1DQNA 2WHQA 3VNRA 4ZIRB 1AIPA 3ZDFA 4DR4B 3HO1A 2TYSB 1DIGA 2OECA 2ZIVB 3FXAA 1N7IA 2PH7A 4N48A 4NY1A 3FMFA 4HNGA 1T1EA 1X7YB 2J0EA 4MKRA 4RVCA 4IICA 4CODB 2OK8A 2D2XA 4AULA 1GOTA 3S1AA 2EKBA 3HSSA 4MR8A 4BBAA 5HP4A 2QQEA 4ND5A 4YAIA 2ZJFA 3B2EA 1G21B 3HEBA 3NEAA 3H1EA 4P36A 5EJ5A 2QR2A 3OQIA 1T5DX 1K7YA 1ZICA 1GFIA 1ULSA 1VFPA 2FPKA 4Z7JA 2QTVB 1V16B 4JP2A 2EKDA 1WDKA 1KMIY 1VRCA 3ECAA 3HBFA 3OOJA 5E1DA 2EARA 4TQAA 1V1MB 1FTNA 1YJ8A 4HNSA 2IH2A 2QUKA 2FSGA 3TZEA 1OLOA 3O95A 3V7UA 1C7FA 1G0OA 2Z9DA 4I3GA 4LWPA 4QPPA 1K4KA 1KL7A 3U2QA 4E07A 3FWYA 4MIYA 2X3FA 3QPUA 4QGHA 1UPTA 4HR7A 1T3SA 5DNYB 2OBFA 4U4AA 1QS0A 1CZUA 3T3DA 2P6NA 4DA6A 1NF3A 5CXSA 2Q0HA 4EYEA 1NV8A 3BULA 1XJWA 1YCFA 3KWMA 3KKPA 5H4GA 2HREA 4MGEA 4TMTA 3N5CA 4KQMA 2WD7B 1W5EA 2V74B 1PSWA 1NXVA 3OM0A 3JSXA 4PGHA 1X7GA 3WGTA 3DOJA 1YRWA 2H2HA 4HWTA 4ZQHA 1UJCA 2LGJA 3NKVA 1ELOA 4H60A 4XXHA 5K01A 3BH6A 3STXA 4K9NA 5B58T 5JFOA 5K7SA 2E0IA 3G6WA 3O3MB 1NTOA 5J4HA 5CCBA 3I61A 2YICA 3WL5A 3W9UA 2YRXA 5L6LB 4CM8A 3KSRA 3RSOA 4TXMA 4AG3A 4EP1A 4PAWA 4ZT4A 3CW2A 2RHTA 1GIAA 2C59A 3BDVA 3AIIA 2HMTA 4NBTA 1ZSNA 1BWSA 3HYNA 4PHFA 2ZITA 3C87A 3EC2A 3L6BA 2AUTA 4LC1A 2XHZA 3RPEA 1QHGA 1C9KA 1YKSA 3I64A 1DZ3A 5HOEA 4O4LF 1TIBA 3G17A 4OSEA 3RC7A 1L8XA 4F2GA 3KC2A 5LA6F 3GT4A 2WD8A 3U7HB 2IYOA 1RHJA 1P9WA 4MVJA 5J2UA 1MV8A 3LL4A 1LK5A 3H11A 4ND2A 2JCBA 4X7BA 2A9QA 4NCAA 3PQ4A 2C2HA 2WF9A 4MR7A 2YJ5A 1XB2A 5AJYA 4C2BA 4GOJA 3ZD7A 5EMHA 1IQUA 2FR1A 2UUCB 5LCXA 3UWSA 4CEJB 2XDYA 1IXKA 1DJQA 1GAJA 4P8RA 1LKZA 4W8GA 3WADA 2ERYA 4CG3A 1AKTA 4B3CA 3OKFA 2ZDQA 1U0NA 1WJGA 2GPBA 4J75A 4MPRA 5DH9A 5DU2A 2H63A 4B3JA 5A3RA 1YS9A 3IL2A 2B9VA 2J0QA 1SNYA 4OFBA 3BCRA 4HVCA 1P61B 1VE9A 4AN0A 4H7DA 3EIWA 4XB2A 5LQCA 2CFIA 3TD9A 5F51A 3OCXA 1JN0A 5KNBA 3OFVA 2ORWA 4BJ5A 3OEHD 2C57A 3ANYB 3BIJA 2ZB4A 3P1JA 5TMDA 3KUKA 3ZI4A 5KJ6A 1RPJA 3CX6A 1MA0A 1QR6A 3QE3A 3QMPA 3QSGA 4WZ6A 5KB3A 1F0KA 2VJBA 3K53A 1RXSA 2PT5A 1MJ5A 3LC2O 3WICA 3WWOA 1YL5A 2ZIXB 4PICA 4CTKA 4F56A 2ZLBA 3K16A 4ZAVA 1XC7A 2PD4A 4IDEA 3IJEB 1OLUB 1JT2A 4Q3EA 4E13A 2GEVA 4NHOA 3H8JA 1U1IA 3WGVA 4ZC1A 2WG2A 3ITEA 1WWKA 1XCJA 4F1JA 3PJFA 4ZDJA 3TW6A 4GECA 3NYQA 1HDEA 4X1YB 1DEKA 1A27A 4FFVA 3W04A 4B8WA 4HLDA 1X94A 1DWUA 3FTCA 4P7FA 3HJAA 2WNIA 3GRUA 1U7UA 4MVCA 4QTZA 5JRDS 1O87A 2R44A 1YK1A 3BKXA 5ADUS 5BNWA 2JAUA 1VE1A 3MJRA 4BNUA 1KBOA 2ATVA 3WLRA 1WEHA 3FCAA 2PGDA 4V3BA 1ZHFA 4XIJA 5JE8A 1FPMA 3PHIA 4G86A 1YZ3A 4WL0A 2F8MA 2ILTA 3EXIB 1VMIA 3G2QA 3IIMA 5JWOA 3HXQA 3X1YA 2GN1A 4DUGD 1I7PA 3CZ4A 2AZTA 3NM6B 3U7IA 5LQRA 3OOWA 1Z56C 5DYWA 5IZ4A 1XZHA 2HU5A 2OXEA 2Z83A 3AJAA 3C98A 1Y8AA 1IEWA 3N8DA 1S3SA 2D8MA 3QX8A 5FA5A 1HZZC 2HDOA 5K0LA 5B4UA 1JH9A 1FIUA 1GZSA 1E2KA 1QJ4A 3S2UA 5A06A 1R37A 3IP5A 3L6CA 2IQ5A 4HZUA 5K4HA 1RI3A 2C9CA 4MVYA 3BXXA 4OXRA 5J2TF 3UWMA 1IWBB 5ALIA 4EUNA 3QPBA 3ZD8A 5HPYB 5BN1A 3OFNA 1OFGA 2D0DA 3PHBE 4GYWA 5CJJA 5F52A 4DARA 4HQLA 4NFSA 5BRJA 2XZLA 1Z22A 3JWEA 4URXR 5F76A 1XA4A 3A9WA 5I4IA 1O6FA 5FKJA 4DEYA 1NZJA 1N7HA 2B2NA 2CE2X 4NDAA 3HCFA 1W5TA 3S2SA 1E9FA 2F3QA 5A9TA 1W2WB 2YVUA 3PQ8A 3AG6A 2C77A 4IDFA 2C5SA 2Q2WA 3KO8A 2GERA 5IEBA 1XWWA 1OXUA 3JVUA 1JIUA 1PBTA 2WRZA 1JB9A 3DEJA 3UQYS 1JBKA 4DM4A 4YMSA 5DB4A 1F14A 4I55B 4KOEC 2YXPX 1RC8A 4FNOA 1YS7A 3VU9B 3LA8A 2BONA 3PDUA 3QJGA 4K1XA 4KLZA 3U0VA 2CNWA 1YB5A 4TUYA 3SS7X 3OCVA 1XQ9A 2F90A 1L7MA 1UOPA 2VF4X 2AS0A 3NHSA 5DHUA 3Q5GA 1MH9A 4WXEA 2IYPA 4IJMA 1GXSA 2W8BB 3ILHA 3BORA 3NDJA 3ND9A 1E2MA 3NJ8A 3NX4A 2IUSA 5L7WA 4M6WA 1SXJA 2WTAA 1L5WA 1G60A 4P3XA 2H8KA 5EZSA 4FWTA 5CPFA 2PWAA 2PS0A 4S1VA 4U3JA 1YR2A 2H5IA 5BN4B 4NR0A 3OU7A 2OP1A 3JWHA 3QTBA 3T3PB 3JY6A 4YDRA 3ZVNA 1W0JD 5L3RA 2I55A 4C0XA 2OV1A 1P2TA 3KU4A 1U3CA 1LPOA 4WI1A 3C8ZA 5JHHB 2YYYA 5C4MA 2G04A 3QU9A 4BFWA 5DLQC 3ED5A 5BSRA 4PNHA 1IZ0A 3PC8A 4HLQB 2IV2X 1PD1A 1WMSA 2B4TO 2CMHA 3ITNA 1JDPA 2CMDA 4RS4A 4BEJA 3A4MA 4G67A 2YWBA 1KGSA 1OIXA 2HL6A 2ONCA 2QN1A 3EGCA 4IFBA 5KZMB 2QTHA 1GGNA 1OA1A 1USKA 1UEIA 2BMAA 3AKYA 3AHEA 3OT5A 1QVAA 4IMJB 4JXJA 4LECA 3V4VB 1TKRA 4OP1A 3QVXA 3I52A 5DBHX 3ADBA 2BFCB 4TV8F 3KIPA 1TUBB 5CFPA 1UFRA 1VXRA 3WMGA 3U6BA 1KRWA 1XRLA 3KSDO 5JSKA 5BRNA 3MLEA 4OUKX 2P8JA 1RMTA 4J0CA 1I5RA 3QLUA 4PPGA 3ZDZB 2XOKA 2P9BA 1G38A 1WU7A 1W2GA 1L0BA 4CV0A 4DMHA 3IB6A 4BU1A 7GPBA 3QENA 4YUYA 5KVVA 3SJAA 4E31A 4OA8A 5C8DA 1QOQB 4FMDF 1BS9A 2IW3A 1FFCA 1HOXA 2CJWB 1P8AA 4CCYB 2WTUA 3FY4A 4YT8A 4BNYA 4R2IA 1JSCA 2XKAA 1HG0A 5ALZA 3RTGA 2XUHA 2P79A 1OWNA 4BZXA 1YA4A 3FI9A 4BP8A 1Y5NA 5DCLA 1GU1A 2BEWB 2CF6A 1P81A 4H1WA 2WIGA 3K70B 4TKUB 3LF1A 5G4KB 1QP8A 4RADA 5ESXA 2ATEA 3SQWA 3MT8A 1H6BA 2B4AA 4IGFA 4BLUA 4TS1A 3K5HA 2FSVC 1XEAA 1WUTA 3QA3E 3OEEA 2VPQA 4XUGB 1U8XX 3VOBA 2QG4A 5CJ2A 3JASB 1EK1A 4HVTA 5JU6A 4OLJA 1ORRA 2XQKA 3H16A 1TMKA 3ZCTA 4CTOA 4YRGA 4PYJA 4AZSA 2R7MA 4DSZA 5LQKA 1LI4A 1UDXA 2FPLA 2JCSA 1NT4A 2ZI4A 4RAOA 4BN0A 4OI0A 4YJDA 2YXBA 3BMQB 1YVPA 2BSAA 1QIKA 2JFZA 3KT8A 1E2IA 2FKNA 4MYDA 4GHWA 4DB2A 1TW2A 3UT0A 4J0DA 1CUIA 3MMNA 3OF2A 4KIJA 2G1KA 3EW9A 1M6EX 4PFSA 4I08A 1D03A 2A0WA 4DYDA 1YF3A 1V26A 2VDNB 5IXSA 1W0KD 4LJ4A 2WMOB 3EEBA 1U0TA 2QYSA 4GOLD 2LCFA 3KQTA 1RWXA 3K32A 2BD0A 2NUTB 3FHLA 1ETHA 1M7GA 3RSSA 3CPHA 3IEPA 4TSFD 4LFBB 4IJ5A 1C14A 5FI5A 1P5FA 5G0TA 5LMNB 5AXBA 8ATCA 9LDTA 1CUEA 5D5QA 4J0HA 5GVSA 7YASA 2WF6A 4UCFA 5FNZA 2GXAA 1WDWB 1H6DA 3N8NA 3P45A 3DMGA 5DTMA 4C0AC 4EYSA 4RJTA 5PGMA 1VOTA 1GL9B 4OH7A 5CLQA 4A9AA 4AFNA 3AEKA 3J7AC 4FYYA 1NMQA 2TS1A 5CAEB 2BH2A 3OD5A 2RGAA 3MPUA 3G8YA 4JEMA 3RS2A 3FR8A 2IHBA 2V9PA 2VPTA 3DL7A 1EA7A 1CVIA 2J46A 3I01M 2ZSFA 2B6HA 2Q1XA 2JLZA 2R8EA 2JIQA 1WU8A 2QG6A 4H9GA 1FFAA 2VATA 4QOHA 4BFVA 4Q4CA 2QYHA 1L4NA 3I42A 3EVGA 2I4NA 3TR0A 2WFMA 3UIEA 1KQGA 4FSDA 2P5TB 5T8KC 4IHJF 4A82A 1QF7A 5KMGB 4RD3A 1UKCA 2HBQA 2ORED 1EUCA 3H19A 3QTTA 4M9UA 5T4BA 4D9FA 2HEGA 4ODIA 4LSGA 5DEOA 2OO3A 5LOVA 1XQVA 3BTOA 3UGQA 2GM5A 3K2IA 4J7UA 3HV2A 3IDFA 1E9CA 3NC1C 1G17A 1GPNA 3BWVA 1Q0RA 4HN2A 2CJYA 3FF4A 3TIXB 1JQBA 2I03A 4PZ0A 2BGLA 4TWRA 3VYRB 5JNSA 1QNLA 1WD5A 2ZIGA 2UXBB 1IBMB 3ZG6A 3KVOA 4GC9A 1FTYA 4D6YA 3M6IA 5DW0A 1V95A 1J09A 4E08A 1E3DA 1DQYA 1C3EA 2I7CA 2HB6A 1KAOA 1XRQA 2WZCA 1Q0LA 3GXOA 3KR9A 1BCRB 4F96A 3DE7X 1QTNA 4ZCQA 5FDFA 2DWQA 2QQ0A 4M0LA 3VNUA 3K5WA 1U9JA 3HYLA 3ZWKA 2HA6A 1J8VA 1MMFB 4F0JA 1R6UA 1DFHA 1A2OA 1E64A 1NMZA 1XD2A 3EVCA 4FP9A 4FFBA 4GKAA 4WJZA 2EL9A 1RQRA 2Z9BA 3DULA 3ISJA 4C7MA 5EXEA 3BRSA 1EXNA 3ON5A 4IRUB 4C2TA 2FP3A 3F8TA 4G2NA 4IIUA 3U4QA 1AS0A 1ZBDA 4O2RA 3EFEA 3GJSA 2QVCA 4YP7A 4OHZA 2XYRA 3NVAA 1JAZA 4P86A 3TQIA 1PYGA 2D1RA 1P1JA 3QU4A 3QXXA 3TRHA 2RD2A 3PDCA 3R5XA 5FPQA 1OFIA 2X0NA 4C0KA 1LDYA 4LTNA 3I0NA 1YC5A 1J9GA 2BRUC 4KQ6A 1ZM3A 3URMA 5LDDC 2WA1A 2DTXA 2G17A 2WNHA 3H0CA 2OK7A 5JATA 2KBFA 3QTLA 2G5CA 3T5PA 1C7JA 1VLHA 3D31A 1M34E 3L2OB 3ZDAA 4Y7DA 3F4BA 4TYPA 1T8SA 1HEYA 2V1XA 4EUHA 5AVUA 2VJLA 2A9FA 1P0QA 1R8YA 2O0JA 1VC2A 2IELA 3NKLA 4G85A 2AG1A 2FG6C 3AUXA 1RHUA 1Z25A 2NVOA 3AHDA 2D5BA 4KVGA 1DKQA 3TIFA 5FPPA 2GLTA 2M2IA 5KOHA 3KLMX 2NXCA 5JS1A 3AERB 3OPMA 1K3FA 2BFEA 2ZJ2A 3PIRA 4TLDA 4YVFA 5E9JA 5CA0A 2XKKA 1NG9A 5FB3A 2IUYA 1E98A 3OLQA 1ZDMA 5D3MA 4EG8A 1Q14A 821PA 1JHQA 1RQXA 5IC4A 5EMMA 4R01A 1BJKA 3V00A 4PC7A 1UMBA 1RACA 3D3QA 4DM7A 1UBFA 3HXMA 2ODTX 1FNBA 1WXGA 1EFVB 3QY0A 3HM9A 1Z29A 5TE9A 4ESVA 2E9SA 2UYYA 2WTXA 2YWEA 3L0SA 3RHTA 1YJQA 4OJMX 4DQLA 4NMHA 2G70A 2O2GA 2R5FA 1NL3A 2XNDA 2H06A 5EJ8A 4YO7A 4YS6A 3I34X 4RFLA 1AO3A 2NQ2C 4YRQA 5AHWA 4NH0A 1WSBA 2JLVA 3MTGA 4BBPA 3SSMA 4XYBA 1J5XA 4B3GA 4TS9A 4HYEA 4OAOA 2WABA 4A6PA 2AKYA 1JIKA 2Y1GA 3LUPA 1GZ7A 3SPXA 4E14A 5C7YA 1IOLA 1SA0A 3HKEB 1KEPA 2V7XA 1AF4A 4TV8B 2A14A 1X74A 2IEIA 2N1BA 2XCRB 4XQEA 2KHZA 4QBFA 4Y0NA 2WSIA 1CYDA 1Z4KA 2IPOA 4OK5A 3UJ9A 1DC5A 1JLSA 1GARA 1SQ6A 4HYYA 3UWPA 1V41E 2A1TR 1ULUA 3R20A 1T5BA 5SYAA 1UEXC 2P4QA 2VP2A 1ENOA 1ZI9A 3DP9A 3GA5A 3GD7A 3IOCA 3LHIA 4DV5B 1SQFA 1QAOA 2P65A 2VTBA 5BYKA 1JPVA 3H5RA 1XCBA 2GAIA 2HA4A 3BGOS 3KLNA 3K0CC 3PCTA 2J3MA 2QA5A 3MFQA 4MCAA 3EBOA 4NBKA 1JW9B 4NRDA 5AVRA 4FMDB 3LBNA 4NXNB 2ZJAA 1NR7A 4QGBA 3UAWA 3DXFA 4WA7A 1PR2A 3KPYA 5JROA 2GCOA 1QE5A 1MEOA 2EJBA 1GT91 1IYZA 1BXKA 1FC0A 3K8YA 3QKSB 3QBJA 3VR2A 1XTTA 3ZJ4A 4A5OA 3UJCA 3CX7A 5EVCA 4H7EA 1OPRA 4M7WA 1PWYE 4OYHA 3ELBA 2CK3D 3ROPA 2PUCA 1KWKA 3LU1A 5GINE 1FVFA 2KBEA 2FZ5A 2J3QA 1AXGA 4RHCA 4WNIA 3ZVRA 3R41A 1M8JA 3FJ1A 2CDCA 2HXSA 2QNBA 4EKIA 3F5MA 5IMBA 5HW0A 1U4SA 4HK4A 1IZ7A 4R0VA 3PX3A 4TKLA 4YP5A 1SBNE 2W2KB 1EBBA 4X6XA 2CLCX 4UTRA 3QLEA 4PR0A 2NO6A 4QXMA 1MOPA 1AC5A 1HH4A 4AROA 3HACA 5EKXA 1PSZA 4CM5A 4JV5B 1DOAA 1DUSA 2ZREA 1J8DA 1LSJA 5K0TA 1GHTA 1OGYA 4E70A 1KYYA 1Z3CA 1QGUA 3I3SR 1QWSA 4LJ9A 4PLCA 3GG2A 1T3TA 2WWFA 3A4TA 3KD3A 4DZTA 1VZ2A 3K0HA 3KXPA 4ZZIA 4OJQA 3BN3A 3OMXA 1H2AS 3H2ZA 4GX1A 1E5LA 2XW6A 3VVLA 4BTVA 4DF3A 2QV7A 3M89A 3S2FA 1IHYA 4H18A 3SJ7A 5HFAA 3IKJA 3U4AA 2X8JB 3ESZA 4YCAA 3ZE2B 2WWYA 4DEVA 4YMWA 2A4MA 4TT8A 2WM2A 2E82A 1GITA 5TGTA 2VUIB 5DXJA 1DPFA 3L8YA 4KVZA 3RVMA 4DLPA 3W9BA 2FRDA 2D1QA 4QOFA 4OMUA 4KX5A 3LRXA 3WRXC 1W75A 4PIMA 3HP4A 2ZVJA 3QQ5A 2IDKA 2X7HA 3R0JA 4Q9AA 4LXQA 5HVNA 3IQEA 3KDAA 1E0JA 4CRWB 4DG9A 5J63A 4KXNA 4ZHQF 4ZT5A 3OY2A 2RGYA 3DUFA 3WDLA 2VH1A 4WESB 3ZUPA 1PWEA 3ICEA 3DMDA 4H16A 3STVA 4XVHA 2QM3A 4R98A 4YV7A 1C3OA 1GKKA 3F3SA 4RE6A 2H18A 5LLDA 2HSDA 1OYVA 1OBOA 3W78A 3FFBA 5DWQA 3SZOA 4RX1A 4J7AA 1SD5A 1YZUA 2GYVA 2WM8A 4K9KA 4IHJB 1IY1A 1FP7A 1NI5A 1LB1B 4P7JA 1L9XA 3T52A 1A0OA 1E0KA 5IVDA 5DBFA 3IGFA 1ONBA 1RWQA 2I62A 1HKUA 1O9GA 5DOZA 2G4CA 3KD2A 5EE9A 2E85A 3VHXA 4UVGA 1QSGA 3DLHA 4KLAA 4U6SA 3OOYA 5D3ZA 1ULTA 2YV5A 1NVTA 5K0BA 2YXNA 3V2HA 2P7IA 3WZLA 2QX4A 3TGWA 5SY4A 2WSSD 2RJOA 5F1OA 3E35A 1FNNA 2CLHB 2QZPA 3CLKA 2CJXA 3NNNA 1V6SA 1WR8A 2VHCA 3CHYA 3F3KA 5CH8A 3WGUA 4BUJA 1E2HA 2Q4BA 1YD7A 3SKVA 1VG8A 4MB2A 3C3PA 3GLGB 2YFHA 3ANMA 1TT5A 2F8SA 1OI3A 2FR8C 3RTBA 4S04A 2XJ9A 2I2AA 2HKIA 3ELWA 3NRCA 4Q4JA 1CHDA 1VPDA 2W11A 2ORVA 4DJ5X 1QU3A 4B75A 2CSXA 4AO7A 4AMVA 3O8QB 1O6GA 4PFJA 4FSXA 5LMUB 4QECA 2VWPA 3T9FA 1ZHOA 2XT6A 2Z2YA 3BRWD 4I6EA 4UHKA 1ZN7A 5HDBB 3WFJA 5B6IA 3OZUA 1E3JA 3SLGA 1V11B 2WIFA 1ISJA 4NU8X 4CLRA 2W42A 3H1AA 1UM9A 4JK3A 3Q9NA 1K4YA 3GYBA 4KXLA 3RNOA 1OAAA 2C5BA 4PZLA 3EUEA 1R9NA 2QMQA 4KWEA 4B35A 2R1UA 4QJ4A 5CD1A 3MTAA 1JA0A 2I22A 1ZS9A 4N5DA 1KEKA 3ZDDA 1USWA 1VJDA 2RAPA 3PSHA 1XZ8A 4ZTUB 3PG5A 3PXUA 4JLPA 4JOQA 4M9XA 4FDMA 3C3JA 5ER6A 3V80A 3L77A 5D84A 5A71A 2Z95A 1RYBA 3M4NA 3AKZA 3UBTA 4UXJA 1R0SA 3SX2A 2GD0A 1RJWA 4MP8A 4MKZA 3UWKA 3L4SO 1QJCA 1DI0A 2P2SA 4DCCA 3K9FC 2VK1A 5TV2A 1AV7A 1RKXA 2GZ3A 3JQQA 3R76A 2CXNA 2HWKA 2QJFA 2ZTMA 4URVR 4JMPA 4RZIA 4MQLA 3GGOA 3FNQA 1YZTA 4E2FA 4RF2A 1EE9A 4BUZA 4CU2A 3QJ5A 3BGDA 2QX8A 1OBHA 3I73A 4BAUA 2IZ0A 4ED9A 4RTLA 1YDHA 2NVBA 1DBSA 4HS4A 3RC2A 4YJGB 4WY2A 4ZPXA 3W7BA 5JIBA 3IUPA 3E9CA 1GG9A 2OR3A 5AK6A 5DNCA 3QWFA 3KAPA 3GT7A 1U80A 1DADA 2PSDA 4R68A 4PYKA 421PA 5LMZA 4P7BA 1FVHA 2W2NA 4UPVA 5IFKA 3D1VA 2J3HA 3IERA 2X2PA 3H5VA 4RKWA 2B30A 1EDBA 4JYCA 4OHXA 4JKYA 2W2VA 3TB6A 4BNHA 5LP1A 2Q46A 4BUCA 2QORA 3LUAA 3R09A 2CUNA 1RXIA 1JV2B 4BN4A 3A4IA 1B76A 4KJXA 4IJ6A 1TRHA 5LU9A 5G1NA 1ZMXA 1FUUA 3U3ZA 4MV3A 3ZW8A 3F5DA 4L4XA 1P2GA 2J6BA 2Q3MA 3B5JA 4YMUA 4CQLA 1L4LA 1ZONA 2HOQA 2IUFA 5AKZA 2IDJA 3W5HA 1LX7A 1MNQA 1F5SA 1Z15A 2HMWA 4MZXA 3R5TA 2F67A 5EXTA 3WRVA 4D4JA 4ZZ0A 3H84A 5FNVA 5A4IS 1H2EA 3EHEA 1PK9A 4FWIB 4I4TA 16PKA 1H2FA 3AWIA 1ZAKA 4JUDX 3KWLA 5ERGB 2H4ZA 3RUAA 2H48A 3O21A 1XK6A 5J2UF 2VFAA 1XHLA 1S7CA 5AVSA 4W1QA 1VI6A 1SOAA 2BFDB 4Z4EA 1W6UA 4RHEA 3GJ5A 3F97A 4HAVA 1NRXA 2PVPA 3BE8A 2FN4A 3L7AA 4ZAZA 3FHOA 4RA9A 4WCFC 3GBSA 4GWLA 1CERA 3SAJA 4XWYA 3SYKA 5DCWA 5IT0A 121PA 2PH5A 1XL0A 1U94A 2ZWOA 2IOFK 2QMYA 1LBHA 5FWYB 1V1RA 1V2GA 2QRVB 1YB2A 2OCLA 2OKGA 3C43A 4EECA 3THWB 1EIWA 1B0PA 2E5WA 1UJ4A 3HCPA 5EJMA 4GDFA 4EKYA 4B1FA 5CXUA 3FZGA 1TK9A 1K97A 3DB1A 2RCNA 3F71A 1Z5WA 3OQJA 5LLSA 5T6MA 2G9QA 3V4RA 1QTQA 1SIWA 1OH8A 3QE9Y 5KHAA 3S5UA 1U9IA 2BEVA 2C5FA 2VP9A 2H51A 3P0FA 4B33A 2P68A 5AW2A 4D81A 2B1IA 1EVKA 1GUZA 4BLWA 2GFQA 3LT4A 4WWHA 5KOJB 4PO3X 3SJBA 1PU2A 3W2IA 1TFUA 4RZQA 5SY6A 3WK5A 3FTQA 4CLXA 1JWBB 1SURA 2HHLA 4I4LA 3T7JA 2IEZA 5ITZA 1DDIA 1IDOA 4GGOA 5GGXA 3NJRA 3WBFA 4M8KA 2HIMA 1FE8A 5H83A 5TARA 1JFRA 3VYUB 1VSTA 1XTSA 2WJGA 3ICWA 1QF9A 1P60A 2FOXA 2BFNA 1W4AA 3ZV6A 3GJ7A 5DVZA 2Q4TA 2AQ8A 3BMOA 4JU8A 1QGAA 2BTOA 3M5CA 3ZGNA 2J45A 2NADA 3FE2A 4QVIA 1JG6A 1EWYA 1EIZA 1WLSA 4XJXA 4I1SA 4ZHQB 1ZNXA 1VJ5A 4CPDA 3AHIA 2X7XA 5CNKA 4AZ3A 3SF0A 1A4XA 5LUAA 5C8ZA 3BWXA 3NBUA 5IUKC 1GZVA 4E5SA 4MUBA 2BV3A 4P0QB 2GETA 3HCWA 3M49A 3SC4A 4MW7A 1GR0A 3JZMA 4AW9A 1O96A 2FGJA 4DDMA 4FFOA 4B2LA 5U4XA 4IIVA 1MORA 1HDGO 4MRPA 1PEAA 4XQCA 4ARZB 1QQTA 1H2HA 3R6TA 3CKLA 2CXTA 1EVZA 2WICA 5KCMA 5B2FA 1ZVVA 1LQTA 1TIKA 3WWEA 2ZRMA 1H9BA 3NH9A 1IZZA 2CLKB 1NPTO 1MO4A 1FVXA 3K4HA 3ZHUA 1I5OA 1MF7A 4FVTA 4ZYYA 2XXAA 2QAJA 4FGKA 2HM7A 2X5OA 5K0CA 2XODA 3GWZA 1SXQA 3CE9A 2IEDA 3DXZA 2DF8A 5BQOA 5BR8B 4OFXA 3ZE0B 1U8FO 4LYJA 1S8AA 5JWHA 4IOLA 1FP4B 3IESA 4ZQCB 2HRZA 4B7CA 4KDEA 2C2ZA 3V8VA 1QCZA 1F0NA 1WXWA 2EXXA 3GL9A 3HU5A 3KJXA 3FNBA 4L51A 2Y1EA 3ZE6A 3ZE7A 2W2LA 2VJMB 4IV5A 3NAQA 3LP8A 1MRNA 3VVBA 5TS2A 3FSJX 4D42A 1NW8A 1HURA 4CW7A 3CTMA 1IONA 1Z16A 1ORWA 2QTNA 1C4KA 1R9GA 3MWKA 4GL2A 2VT7A 3DV0B 4FBGA 3R8XA 4JT8A 2CYBA 2VUSA 3FTNA 2EV9A 4KC0A 4KO4S 1YQWA 5EGSA 1Z5UA 4K6KA 5LZ7A 1S2MA 3UAGA 4ABYA 1T9GR 3JQ9C 1RLMA 2JKYA 5EMNA 5CB0A 1JECA 4KBGA 3OVMA 5AI5A 4D3SA 4LN1A 4G09A 1CUYA 4XB6B 2QRQA 1Y34E 1Y82A 2AHOA 1YR6A 3MW8A 5JJ5A 3HGQA 4H7JA 3BXPA 5KUTA 1FMLA 3BA6A 4JUAA 4JUIA 1QGDA 4PG4A 3RC9A 3HZZA 3HXPA 1E2PA 2I80A 4R81A 3OOSA 2NG1A 5A4JA 2O8DA 4A0SA 3DGEC 5I4KA 1DKLA 4MV8A 1USGA 2RAUA 2WAMA 2J3LA 4RD2A 1PV2A 2IBTA 1Z62A 3NHAA 1E2FA 1KOJA 4GM4A 3ZEAA 3MJSA 4AKEA 5JYBA 1HE5A 3GEEA 1E58A 2P67A 4N49A 1TMGE 1L7DA 3TEJA 4M86A 1EP1B 2HH9A 1I36A 2IYEA 3C6XA 3E8MA 2H2WA 3L49A 4QO7A 1J9EA 5DO9A 4BWFB 1AUQA 1HNZB 3NHJA 2C58A 4RPJA 4RY0A 3EZGA 5IYZF 3F90A 3FWZA 4E2YA 1BEUB 5EGNA 3JQ7B 1Y9AA 3GFPA 2HLDD 3OHPA 4EPTA 1K06A 1TA4A 4YCMA 3M0EA 1KXJA 4JJGA 3S7ZA 2NTJA 3P9NA 3QEBZ 1L4FA 3LUJA 2NVWA 4FWBA 3JQAB 4NK4A 1PZEA 4GMFA 3RGGA 4KK3A 4BMXA 4KXVA 3DF9A 1DC4A 3AUKA 3MJEA 3HQ4O 3MOGA 3K2QA 5F4ZA 1H0RA 4ALLA 4GLOA 4YQFA 5KC9A 2XT9A 1SKUA 1VHWA 1TCCA 1VPTA 3D54D 5JNLA 4TMKA 3MK31 4EW3A 4RQBA 4BEVA 4RPCA 2I2DA 4O4HF 3E9MA 4CI9A 4P34A 4EABA 3ENZA 3IE2A 1MRZA 4JGGA 4A1FA 2HK7A 3M2TA 1GTMA 3R2JA 4X61A 5D3QA 1QPZA 1NR1A 2GBGA 2OLEA 4V38A 2J85A 3OF3A 3RVQA 4ZO8A 3BSSA 3N8IA 4IVNA 4I50F 2DB3A 2O05A 1ZPDA 4KREA 5ES4B 3D8TA 2Z6QA 3SHQA 1N0VC 3VU9A 1SCQA 5CR9A 2XBUA 2WIBA 3C14C 3KTAA 1KZ6A 4JI1B 2YVKA 1WHTB 5DNAA 1O1YA 1GTSA 4EPXA 1X7HA 4CIYA 4ZYUA 4RLSA 2CJFA 3NYIA 4AF6A 3IBYA 3M6AA 4AM8A 1M6NA 2AN5A 4LGMA 3CNLA 3VZBA 4ZU1X 3RF7A 4IYRA 2CVZA 2C92A 5G1OA 3RIMA 4YREA 4Q48A 3WKCA 3K5PA 3K30A 4I14A 4NAHA 1CJBA 4CMCA 2NQTA 3ZX5A 5ALJA 2W6ZA 3LUFA 4G36A 4IV0A 3ZXXA 3GGGA 5EUMA 5G02A 2ONYA 1CB0A 4FS8A 3U4IA 3KG2A 1TC2A 1M66A 2C0CA 1TQ2A 3BWDD 3ITKA 2HCTA 2AZMA 1P39A 2ZXFA 4XGNA 3RC3A 1ENPA 2CFTA 4X9XA 4AYWA 3CR7A 4CDNA 2CFCA 3SS8A 3KPWA 3U13A 3B6MA 5DYNA 4X64B 3I5UA 1GR1A 4BNKA 4IJWA 1GQOA 1OAOC 3AF1A 5SZJA 4GM1A 4PZZA 3SMVA 5AM3A 5JAMA 4QLBA 1EFPB 1E6WA 1H2ZA 3WLEA 2YDXA 5A5FA 2NT3A 1T2UA 3P9YA 3PJGA 3D3JA 3HB7A 4CCWA 2A35A 1DV1A 2ZWMA 4CKWA 4MJ7A 1JG1A 2GJKA 4MAMA 1R8JA 2AR0A 2RB4A 3BJZA 3VKVA 4KQJA 4MIEA 4NV1A 1H2RS 1PCXA 1FMTA 4FT4A 1PR3A 4HUQB 1B6TA 2XDQA 4M1EA 5BSUA 4KE9A 4WINA 2H1IA 4HMOA 5DZSA 5KSOA 5E6UA 1AU9A 1YAHA 2EAUA 4MLPA 3WQBA 1R16A 3V8MA 3DS8A 4BNLA 3ZPXA 2MSKA 2HQRA 4UXIA 3C6QA 5A9SB 1PQYA 2D2IA 1I2ZA 3FUVA 1VCNA 4Q1FA 3C3AA 5EHQA 1BROA 2AWOA 4IH4A 4ZKDA 3EAFA 1FL9A 2BISA 5EY5B 1IVNA 1E89A 2CZGA 2QTCA 1JZTA 9LDBA 4JASB 3PQ5A 1YBHA 3E1GA 2NUAA 3BXFA 4D46A 1Q7RA 5WRFA 2XVYA 3H87A 4F6CA 4EAAA 2DX7A 1VHTA 2O0KA 3FYUB 3HY6A 2HWUA 3UMBA 1Y1QA 4NK5A 5LOVF 3D8UA 4UVIA 2QZJA 1VBFA 3O2SB 1EYZA 2XR1A 1Q0ZA 3BFPA 4LJSA 3DTYA 3ZCSA 2VCHA 4MWZA 2RKWA 4Y9SA 4CLEA 3WNCA 3HXOA 3QQPA 3L8GA 1MVLA 2WA2A 1C0LA 1WMDA 2PXHA 3ZX4A 4HWOA 3ELUA 1Q7EA 1EK5A 3WZ2A 4DADA 5JPCA 1RD4A 2R6FA 3TR6A 3A27A 4OXYA 4EVRA 1CXZA 1PUXA 4XWGA 1E1QD 5IAEA 4GKVA 4TQUS 4DCMA 1OIWA 1MNAA 5IT9A 1H6AA 3RM3A 2OSVA 5BT9A 3FGNA 1K92A 1VMKA 3PD7A 3UH0A 1UBJS 3P0EA 4HV4A 1OLXB 1KMQA 4HGRA 3LBYA 3EQ9A 4OXKA 4TTRA 2DH5A 3N3BC 3PFIA 1QKKA 1Q50A 1PK8A 2N42A 2DGDA 1J2TA 2GA8A 2WV9A 5EVJA 5ULLA 2G09A 4HNAA 4HL6A 3CMMA 1X8JA 3E3LA 5FLKA 3H75A 4B76A 4CDMA 3M2PA 3RIEA 4C78A 4JODA 2ZI3A 1KERA 1MFPA 3OE1A 3R6GA 2UDPA 4BNGA 1KMHB 3WLFA 2OBXA 3WQQA 5IAOA 3HUEA 2YRWA 1N75A 3LOUA 1GZ3A 4N8SA 2H17A 4RHYA 3TNJA 1DUVG 1GRCA 4U7TB 4D9NA 3TLYA 1F8FA 3EIXA 4H3VA 3AB7A 4LAFA 4Y2GA 5B2ZA 1QMGA 4L74A 4M7OA 4OJKA 4MWEA 2C96A 3BH0A 3OEHA 1S2DA 2VT6A 3CISA 2NZXA 1N78A 3EARA 1QWOA 3DZ8A 3ESDA 3W8EA 5L6MB 3R24A 5E3IA 5JO9A 2DBRA 1Y5IA 4KXMA 3E3OA 4OHOA 4RW0A 3SBXA 4BO8A 4EF6A 1K7FB 3ZV3A 4KKVA 1XAIA 3UGKA 3RTAA 4K6OA 5HS6A 2JGFA 4H4EA 4M6WB 2QY6A 3NIGB 4A0RA 3PEEA 4NYJQ 3BTSA 4C4AA 4AD8A 1GNVA 1T9HA 2RBEA 4KAXA 2YJZA 4R9RA 4YO8A 4UTVA 2PL1A 5B6PA 3WO1A 3DZBA 3PNSA 1U04A 3BF7A 2P9ZA 2XUIA 2Q5QA 4QUDA 5G4LA 4FEAA 2WLSA 1E94E 1YS1X 1KZGB 4A4DA 1YRHA 2Q27A 2D5IA 3TRDA 3PXXA 4RS3A 1K6XA 1RQLA 3K1AB 4I46A 2GDZA 4JYPA 4GZ5A 5SZKB 4DR7B 3DB2A 2FX2A 4HDOB 4PFQA 5F98A 2OSBA 4DY6A 1D09A 3T0IA 3UAVA 5FCDA 1S89A 4RNCA 3VC2A 3CIFA 1AZWA 1Y33E 1KSFX 4EHHA 1PFYA 4YIKA 4DUGA 1Z6GA 1JALA 2C9MA 3VI4B 3L6OO 5IYZB 2XB6A 5LBUA 3EY9A 3MCUA 4IIJF 2AQHA 5C1BA 3A6KA 1JTEA 4MEJA 3BMXA 1JDJA 3KKQA 3RVLA 4JCOA 4B5KA 3LQQA 4RLQA 2OCYC 4CMBA 3B3GA 2I3AA 1MP0A 1WB6A 4JBNA 4JQSA 2BI4A 4I5GA 1RWNA 3I58A 3MT9A 4HGNA 4L50A 4BFSA 5CB8A 2H85A 2F9MA 4D6PA 4ZEWA 5MN5A 3COPA 2ETVA 1YQDA 1RU3A 5F21A 2RCYA 2RK4A 4A16A 1UMCB 1V47A 3KBBA 1AZTA 5C3MA 3GG9A 1SUAA 2CFRA 4FFLA 1L3IA 2MTBA 3W5AA 3O91A 1T2AA 3EBPA 3FFXA 3ICVA 4TXJA 4UNQA 2IYWA 1P7ZA 4O4HB 4IG9A 5T57A 1I13A 4ZCTA 3GLGE 4E1VA 1A2QA 4RPIA 3MWYW 2D4AA 3MMZA 4DNFA 2DKOA 3R0IA 4RPKA 2XYQA 4ICIA 1D2NA 3GDFA 3AIOA 4LGYA 2PG3A 4IKOA 2GBPA 4O29A 4Q15A 1ZSVA 3KL4A 3GLTA 3O8BA 1NF9A 3ONWA 4N0DA 4UM8B 3OFKA 4B6GA 5ADHA 3IVCA 2INGX 4I50B 4FOLA 1U0HC 4XPIA 3D4PA 2BLLA 3T9DA 1NW3A 2ZJ1A 2YX1A 1R66A 4C14A 1MU0A 2ZQZA 1LQ2A 2RH8A 4DLNA 3PUYA 2DHDA 5K09A 4FYXA 2OYSA 3BG5A 1PFUA 3JATB 2FUG1 1P2BA 3MILA 1GGHA 3CYFA 3F7TA 5ALHA 5FV7A 5JCXA 3IUQA 2J7KA 2QTRA 1Z8NA 5BO5A 2GZHA 4BFUA 1Y7TA 4R8KA 4JH0A 4S12A 1MOQA 3S1LA 2QAGA 3VYWA 1EP9A 4M38A 1P80A 4ZALA 1SG6A 1Y1LA 1DKUA 3GLHA 2JH9A 4HN9A 5EJAA 4LPSA 1KDYA 3ZDRA 1DCFA 4KR0A 1XNQB 1N2OA 3N2GA 2PJDA 3Q7PA 4OM7A 5REQB 3RIGA 3UXEA 1XNRB 3HI6A 3LDAA 4Y6LA 2OGTA 1PUJA 1A9RA 4H1HA 1BJTA 1G98A 3IP3A 3KHUA 4ML3A 4WIAA 3AL2A 3NBKA 5C5EA 3ZZNA 2YQ5A 3EGXB 2O8EA 4R7TA 4RK6A 1FW8A 5AKHA 3G3EA 5F3RA 4RULA 3SSAA 1W0JA 1ZLXA 2C8LA 3LPDA 2O5RA 4X8LA 5KJ1A 1AMOA 1X7WA 5ANRB 3DMTC 4C43A 3IUMA 2OHFA 5COBA 4ZV4A 1SXIA 1NVEA 3I28A 4EFKA 4ZEVA 4X54A 2FDXA 2RSLA 4M83A 1M2WA 3GXBA 3GP5A 3RBZA 1M8GA 2EX4A 1GKUB 3WC4A 3PV0A 4COOA 3HUUA 4DAEA 2ON6A 2HBRA 5C8XA 1DEAA 1E7MA 2IPMA 5BSGA 3L3BA 5JH7F 4GI5A 2ZTUA 1EG2A 2H3EA 1WOYA 1JL3A 5EAIA 5DXFA 1MB9A 3UJ8A 3ABZA 3QKRA 2PWZA 4KI7A 1ZXBA 4BO4A 4DBLC 4EYQA 2UZ1B 1OU0A 4TWJA 2HQOA 4JLAA 3VPSA 5E3HA 1I14A 1RAHA 3I9NA 5CDHA 3EEFA 1QR2A 1XRMA 2NPOA 4Y6RA 4BQSA 3B70A 3I2GA 4PSKA 3TBKA 2VSFA 1TK2A 2JIZD 2E49A 5E7IA 1HL3A 3ZWDA 4XCXA 4ENSA 3PFFA 4MYCA 3AUTA 4DGSA 2H1VA 4QUKA 4EB0A 1SQGA 4H3SA 4KPUB 1Q0UA 5CTAA 4ZVQA 2XVAA 3DOCA 3S29A 2DVMA 3QYJA 3CLHA 4S2EA 1YACA 1OX4B 5JJIA 4LRXA 1G20E 1WNTA 1X13A 3KP1A 2GJ4A 3I9JA 4BQEA 2IITA 1Y98A 4PN7A 2I29A 4GZMA 4RA6B 2VEDA 3I12A 2WJYA 5BR7A 3MXTA 4HDNA 4K6FA 3QWHA 3NTRA 5H02A 3SDZA 4HDCA 5K8TA 3BE4A 4NYIQ 1MC4A 3HH8A 4BLOA 4Q05A 3OFSA 1J00A 2H07A 5FFMA 4BCCA 4EJ6A 1II8A 1NUUA 1RI5A 4HDRB 4IHKA 3U1TA 3UC9A 4JI8B 3UT5B 3C7CB 4LHSA 2BM1A 2D1TA 6GPBA 3TX2A 1TEZA 3HZHA 2P6OA 3AHFA 4QT0A 2ZE7A 1PDWA 4Q6BA 2C2GA 4W63A 3D43A 2X0JA 4B7XA 3VR5A 2R6DA 4JY7A 4PC1A 2JFHA 3PR3A 3PVSA 3VJRA 3VDNB 1J1IA 2V5VA 1IXZA 1QIFA 4QU0A 3ROZA 7REQB 5IKMA 3B6ZA 4G0WA 3TZKA 5FOTA 4DV7B 1KRHA 3OWOA 1RYDA 1TI7A 1T0PA 5EUBA 3L6RA 5A7FA 4FFBB 4G4SO 4A6EA 2JF0A 1PW5A 1QHSA 2P77A 3MLBA 3TZHA 3WNZA 4HXEB 5FOVA 1WP4A 3OJEA 3QE2A 4I7EA 4JL5A 5JD4A 3GJXC 1RP7A 3PT9A 2GHQA 3CF0A 5ALOA 5IAGA 3EFHA 3RVOA 1FRNA 3HJUA 4X97A 2D2VA 5I7RA 3TL6A 1OR8A 1Y5MA 4B47A 1N5LA 1UKZA 3E6AA 3ZHTA 2R1TB 1W0KA 3FPHA 1DAPA 4DW8A 2XRYA 2P4HX 4KYUA 1O4WA 1SIBE 3I53A 1KC1A 2OB2A 3BRQA 3M3HA 4ZI2A 2GAOA 3Q7QA 4F93B 4EL0A 4YUWA 3NAGA 3L7CA 1JQ3A 1ZISA 4BMPB 2RGNC 5FUMA 2AK2A 2R8BA 4GYYA 4LDAA 2IWHA 4MA5A 4NG5A 5C3UA 1JSZA 4BQPA 5IN4A 5JSZB 4OLBA 3N2NA 2YZKA 3K0FA 1K98A 1R5NA 3L9WA 1EJBA 4M53A 2G9VA 4CEIA 2X1LA 1NBOA 1O94C 1JXOA 2PZMA 1ES9A 3NEJA 3OU2A 3GB9A 2H7CA 2UYOA 3OLZA 2JAOA 4YY3B 4BX3A 3Q8LA 3L4JA 3OJLA 4OGKA 1OU4A 1UJBA 2WNSA 2IGTA 3WLLA 4GR9A 2QIPA 2EERA 1MQAA 1JEQA 1JLRA 3AGPA 3GN2A 1QH8A 4PPQA 1G3RA 2NOAA 3A14A 1Q6YA 5IJAA 3NHBA 2CL5A 1NNLA 1H0HA 4FYJA 1D3AA 4Q1VA 5A5GA 5DLEA 1QHXA 1BX3A 4GBED 3QPCA 2GXQA 4YJ2B 2OKCA 2Z2ZA 2I9KA 4BO9A 1RPAA 1JMVA 4IHQA 5ALUA 3ZGXA 4RXUA 1FYEA 4OB8A 3DHVA 3ER6A 3QBEA 3QELB 1MTOA 3ZDXB 1ECCA 1E0AA 4AQDA 3RU9A 4UNRA 4MUJA 5MGBA 1Q0HA 1VLMA 2A8YA 4IIJB 4O1HA 1G0NA 1BDHA 1QPGA 3PL5A 4U9IS 3H0KA 5DK4A 2HA3A 2WWVD 2BL4A 3UXMA 1KMNA 1ISMA 4KN9S 1AHIA 3D0QA 4QAQA 2O59A 3EFOB 1VJTA 2UXCB 4Q00A 4ZEOA 1TD9A 3PNPA 1FQJA 4H0CA 4BNFA 4ZI7A 3AHJA 4Q4LA 1DXOA 3IVXA 4LNAA 3PGMA 5FWXA 4GIBA 2WKWA 3OEYA 1IAQA 1CJSA 3KSUA 3DZJA 2GZ1A 5JD5A 4DR5B 5JSHA 2WWTA 4J16A 4DIBA 1ZGJA 1DCKA 2JHCA 3WLPA 4WN3A 5HKAA 2II6A 1PKEA 1A7UA 3MIZA 2EWMA 4EZEA 1H94A 4QFMA 1Y8QA 1GQSA 3SHWA 1NBME 2FN9A 2ZIWB 4BWVA 4YECA 3ZCPA 2HPHA 4Q9DA 4RDIA 3H7IA 3U9TA 3TXXA 4DRYA 2FWRA 4TV9A 4S1WA 1Q0TA 3OQVA 4GSKA 2P5YA 4E4YA 1KOFA 4P93A 3AUJB 4FNMA 1MQ9A 2BZ1A 2P6MA 1IL0A 3GRPA 4LZPA 1UJNA 2A9JA 5KVCA 1B00A 3RYHA 2F3UA 4ND4A 1J2YA 1D1SA 4GPBA 2WJ3A 1NN0A 2RI0A 2P1DA 4NV0A 4RK1A 1L6IA 3B51X 4UMFA 4WACA 1S4MA 3EIEA 3HJGA 4KR7A 3ZVKA 3DEFA 5FEMA 3MWJA 2PUEA 1W73A 1M0EA 5H3CA 5CFMA 1JAXA 2H1SA 3L7LA 1C7IA 1YIOA 2VAXA 2ZRFA 3FDZB 3FYHA 4G8JA 5J1TB 2D13A 2M32A 2KSQA 4DCTA 4E5KA 3I6MA 5ALVA 1EDDA 3HN2A 3PNBA 1LK0A 2KS6A 2QZSA 5HCIA 3GUHA 3ZW7A 4JMLA 2D2EA 3LBFA 3PQ6A 2VJQA 3L82B 1CUZA 4EO9A 1I1NA 5FR2A 1PG0A 1PJCA 2J3JA 1HDYA 2JD1A 1DQPA 3MRVA 3PIIA 3RSFA 4UM9D 3U9SA 4QFBA 3PXBA 2VK8A 4YRKA 5CM8B 1YA8A 4QE3A 3KOZA 4YCDA 2VDMB 4D9MA 4DR1B 4F5YA 4Q7LA 5JH7B 4N6OA 1XCMA 4Q21A 3ACBA 5T3YA 4X62B 4KUHA 1KI9A 1I3NA 2XQJA 4X20B 3VR6D 3LGXA 2QLBA 5KQRA 1ND5A 1OI7A 1Z6PA 1KI8A 1RI1A 2JJQA 2VDPB 2Z6VA 4PRZA 1P5HA 5FUWA 1Y0BA 5BW4A 1XMQB 5DHRA 1P19A 3CNEA 1M8PA 4IJVA 2HDHA 4P80A 3ZHQA 3GPCA 1QP7A 2RHHA 4I1RA 5IJ9A 1RLUA 1KQFA 3TM5A 2ZFUA 1HKHA 1UEJA 3NBFA 1FQOA 3PNMA 1YZKA 3OI7A 4R1OA 4D82A 3KJZA 2O2SA 1MRSA 3EZXA 3P97A 1CQIB 4V0QA 1A2KC 1T6YA 4JLBA 5BUSA 3KTOA 1QVZA 3DVQX 4QBIA 1N2XA 3NYRA 3B1FA 4OU5A 3RUCA 4EGAA 4LC9A 1A4UA 1KYQA 1ONPA 5FFFA 1FFYA 3FFTA 3FSRA 1IEVA 2CVQA 2QZZA 2R4UA 3L1UA 2OORC 4F97A 4BMCA 1IM5A 3DVAA 2W4IA 4NIMA 4AUNA 1BFUA 2L42A 4BFXA 1AHPA 2J4FA 4GGMX 1IZ9A 1OVMA 3L0CA 4Y2JA 1I4TD 1LWOA 1ACJA 2DWPA 2J6HA 3UV7A 1XRJA 3DDWA 4EMUA 3HCBA 4HQNA 1C81A 1Y4UA 1B1CA 3ENVA 4I6GA 3I23A 3LK6A 1U2DC 1GVNB 2AUMA 2X0KA 4DWWA 3FHCB 2LV8A 2KJQA 3KYDA 3PL1A 3IALA 1SBTA 1R10A 2ZAMA 5FH9A 1RYYA 4BZWA 2AOTA 5JDCC 2GN2A 4HT3B 5HCUA 3WTBA 3NV9A 3WYEA 2BYTA 3UCFA 1DAHA 4L75A 1HC7A 1FFDA 4OVKA 1FZTA 5FWDA 1UPBA 2RI1A 1PE0A 3UCXA 2Z3WA 1U9YA 2CUZA 5CEJA 1PGQA 3D2LA 4PX3A 5L3QB 4DJDC 2HAEA 3ET5A 1PR5A 3FUUA 5KU1A 1YIDA 1CIPA 3A7EA 3DKKA 2JZNA 3WA7A 2W0MA 1UL1X 3WFIA 3K6SA 4O08A 1U8EA 1SHTX 4J0KA 4LA4A 5FULA 3GYGA 4FNAA 4KVAA 1C1DA 2B69A 4QC2A 4A2CA 5CFLA 3KFLA 2V59A 4AJKA 1ZKDA 2WFAA 5JZ9A 3I9FA 3JR7A 3N76A 1FTGA 2BPOA 4A0HA 2PGAA 1M10A 3A6JA 3ANSA 4PIPA 4XE5A 2ZUBA 3QF4A 1F06A 1JGTA 2F3RA 1TZMA 2QD2A 3N2KA 3OETA 4QDJA 5BY2A 2BFBB 2ET6A 3FUCA 5IJXA 2OE2A 4KNVA 3DAFA 3L8EA 5HFJA 2ZYIA 3E5NA 2ZBDA 2JANA 2O2ZA 1USVA 1X1DA 4FZ5A 3IT3A 3ORYA 4LBWA 3EWSA 1Y1RA 4CNQA 4EKDA 2GFIA 3BXZA 4RL6A 3DPIA 4KCGA 3TIGA 1SPXA 1RPNA 3WMRA 4A8HA 3BF8A 3RHSA 5JWRA 5A3QA 2QMEA 1FDTA 2ID8A 1YFLA 3IEIA 4BVFA 2P7HA 4WNCA 4Y30A 5AD1A 1XZMA 3KQNA 1KYTA 1M76A 1W47A 2VDVE 4J0JA 4PBSA 1HQKA 4XJVA 3WA6A 2HHHB 4DMCA 1W5SA 1OT3A 4JSTA 4PC2A 5IN5A 1N8KA 5B30A 3D3WA 3LPCA 4D3DA 3JAMA 3HGTA 2GK4A 4HN4B 1U7DA 3TJZA 1XVTA 3C6BA 1PR4A 4C88A 2HWWA 4PIVA 5AJXA 1ESEA 1XHFA 3VOSA 4MS1B 1KHHA 2Y93A 3KQQA 2VHUA 4MS3A 4EKEA 1HEIA 5K3FA 1YDMA 4U1RA 4D9CA 2F1KA 2JATA 3U7QA 3KB6A 1JIJA 1NZFA 4XUCA 3UUEA 4LF9B 3M4XA 2ZSDA 1NU6A 1JFSA 4FZVA 3JYNA 2OFOA 3Q3VA 2H6EA 3ZTTA 1RWMA 3LF2A 4D9IA 2QDXA 3E58A 1I7NA 2G71A 1VGRA 2QRPA 3MMXA 2R25B 3PS9A 1AQJA 1CS0A 4NTZA 4D9EA 5DI9A 5L4LA 3NNDA 1XMPA 1TYBE 3IRVA 5FWAA 3E2IA 4LE2A 6ABPA 2L2QA 4ILEA 1N6IA 2B3DA 2NXNA 4Q1AA 3SGLA 4CEHB 1YTLA 3K0KA 4I8XA 4JD5A 4Y6QA 5G3YA 2WSSA 2XD9A 3B6KA 5I9TA 2R6GA 3ENQA 2GM4A 2V0GA 4JP8A 1NVDA 4QAJA 2XAUA 2WMNB 1RAGA 2BMEA 4LEIA 4N40A 4W99A 1RVV1 3EMDA 5FOWA 5HE9A 3B13B 2AXNA 3GU3A 4AG5A 2V5AA 5A6SA 1SCNE 4DLRA 2EJUA 4Y6PA 3AKEA 1ZJ4A 1XJ0A 2AEMA 3NTLA 3Q3IA 4XTRA 3REQA 3I9KA 1SEPA 3LPNA 4MVXA 1ZAYA 2CCJA 2NUPA 2DSTA 3MAGA 1R6VA 3OZWA 2YCLA 4XZ3A 3P5SA 4WXPA 4AKSA 1I4OA 1XZLA 5GVRA 1V37A 3PZBA 2JA1A 3ETGA 4MHSA 2HBZA 3LDGA 2H5LA 2NU7A 2ZJOA 4CLOA 3DAHA 2DPHA 3BRWA 1OB2A 1CWUA 1OPXA 4ZPJA 3R9KA 5BQ3A 1NHGA 2RGWA 5EZYF 4BVHA 2VDUE 2I4RA 2Q9CA 3MSCA 3QNUA 3EHDA 5KTYA 2AMLA 1ENYA 3VNVA 1HZZA 1FTWA 3E1KA 3NFYA 2QLLA 4FINA 1DX6A 2QRLA 1XZGA 4LMAA 4XIGS 1HEUA 4FFNA 4FQ5A 4LGCA 4KQ1A 4RDHA 1E62A 4PBTA 2WOJA 1WZCA 3HZOA 5SZHB 1QZUA 2GM9A 2BM8A 1SIOA 1Q11A 1NVWQ 4JB2A 4DIEA 5F3WB 1DAKA 4YLYA 2EC5A 3JZAA 3HYTA 3CNBA 1AGPA 1E1NA 3D7MA 3OZEA 4XM1A 4AZ0A 2V45A 3KSBC 1Z36A 1A04A 3SXUA 3WBKA 4CKEA 3T9BA 4GPD1 2XWBF 2WYOA 2JKVA 4RVSA 4NBUA 1KKMA 1UIRA 3H2KA 4PO9A 1DG9A 1W7AA 2LW7A 1EA5A 1N2ZA 3IHLA 4MVWA 1K27A 2VNIA 5K6TA 3RRYA 3DWEX 3EZNA 3PNYA 1NHWA 3RDPA 4L6IA 2NMVA 1P17A 3L4KA 2XCUA 3BICA 4DMGA 1L5VA 5CBPB 2FEXA 2OCKA 6REQB 5KYWA 2WR8A 2AMYA 2VBFA 3RK1A 3NDIA 4G4IA 3RQSA 4M9RA 3T9AA 1DDGA 2I1VB 2WQ6A 4KRXA 2W5UA 3K09A 4UM7A 4UE3S 5D1HA 5KKNB 2UUAB 2F2TA 2BEJA 2WSBA 2FA9A 1L5KA 3COJA 3AEQA 3KDPA 3Q7SA 3A1UA 1LXCA 1RJGA 2GN9A 1UP7A 3LHFA 1OILA 4N7BA 2GKOA 2ODQA 2R5NA 4Z8YA 1V8FA 4QREA 2JCYA 1ISPA 1R18A 3KQWA 3L4EA 5TVGA 3BMNA 2X77A 4OJNA 1TA0A 1KK1A 5CH3A 1U2EA 1PLKA 4OUDB 2X6TA 1X70A 1O95C 4ECAA 1DJMA 4B6SA 2ODBA 5CVCA 3SVZA 5K0NA 3SMQA 3JQCA 1IHOA 1P2VA 2PVSA 4U5QA 4XPZA 5GJBA 5AW5A 4OMFG 4KNYA 1I01A 5KCZA 3D7LA 3LYHA 2QLMA 2EYQA 3LY5A 3H42B 4WVFA 3FDFA 3PDWA 3MJCA 2CV1A 4AP5A 1JSLA 2W83A 2AE1A 5JAPA 4YMIA 1RM4A 3RRZA 2BDUA 2XTZA 4RTNA 4PGGA 4EQ6A 4MARA 2XRFA 4FYVA 5BV8A 1Q7GA 3C85A 2Q6TA 4N5NA 4RO0A 1G8MA 4IQGA 4AKGA 1DC7A 2BE7A 4UHBA 2CDRA 4F3TA 2VN8A 3RG8A 3IP1A 3R7LA 1WDMA 1KJ8A 4X63A 3VR0A 1KF0A 3ZHVA 5E4FA 3A1FA 4JVNA 4YNBA 1N2IA 1QUFA 1XZIA 1S8FA 4YJHB 1SG9A 3Q3EA 1NVXQ 2UVPA 3MC1A 3GJZA 3A3OA 1V3VA 1KDRA 3QNMA 4CQMD 1NKSA 2Q4RA 2R8YA 2RHMA 3LVBA 4V39A 2OZLB 2IU4A 3RS4A 4IR7A 4B6PA 3RVSA 1J7KA 2Z58A 5FOQA 2EZ4A 1UPAA 1FUKA 4HJRA 4PPNA 1N6OA 5K0JA 4HAUA 2FN7A 2Y8EA 5JZVA 1CDDA 3KT0A 2YCBA 4KXUA 2PKEA 1C9NA 1B0AA 3ENWA 4WHMA 5CK4A 2JB9A 3TYXA 1WPGA 3BB4A 2YBDA 3LECA 3OZXA 4FCCA 2PX0A 1G9TA 2GRUA 4R8SA 2LP4Y 3O7MA 2V3WA 4PAMA 1WCYA 3DFZA 4FW8A 1LRJA 5CLJA 4J7XA 1A3CA 1WABA 2IYAA 2ZYWX 3ROKA 3TQTA 3VYSB 4C20A 2DY0A 3BJIC 4HAYA 4NBLA 3BJRA 3EUFA 3W9SA 4A1OA 5BWOA 3ER8A 1J1UA 1MIOA 1JXAA 1JDBB 3FPLA 4J9UE 4FD3A 2DLDA 2REQB 4BDTA 1TUEA 2FSVA 3PR1A 4HMQA 2I6XA 4IZIA 1E4VA 1O89A 3OPYB 4BVLA 1TVMA 4DCSA 4IIHA 1N7JA 3JYPA 3D6UA 1QVWA 3EZLA 1NV9A 2V55B 5EZ6B 2UZ0A 1O9HA 1NDUA 4WA8A 3IAUA 3HCDA 1P6UA 3HHPA 2CL6X 4S0ZA 4LFCB 4X6LA 3I04M 5DHSA 4CKXA 4YCCA 2EEZA 4EA6A 4C7KA 3DFFA 3S70A 1C2TA 4DKXA 1LVGA 3JALA 1DIOB 2IHKA 3F49S 4WPGA 3TOXA 1I0IA 2BR5A 4AY5A 4EZIA 2XGMA 3NTQA 3EIUA 1Z68A 1P7WA 3LD9A 3RI3A 4UVHA 1VHDA 3WIBA 3T1QA 5EI5A 1N2SA 3RHFA 4LF6B 4A26A 3O03A 1XU9A 2QVXX 4ACBA 2ZSEA 2CLIB 1ZD4A 4NEGA 4RVGA 2YV1A 3S2EA 3K0BA 2PT6A 1QLWA 4ZAYA 5KDDA 3CX3A 4G5OA 5FTJA 2YL2A 1EEXB 1I9CA 1QK5A 2ZJ0A 5FPKA 3SOZA 1DCTA 1GFZA 1KPGA 2YFYA 4P32A 3LL7A 4TMFA 2YS7A 3CJQA 5HQ3B 4K6CA 4IF4A 3BSFA 4H17A 4WN9A 4HSGA 4BATA 4F8YA 3QSYA 4J3JA 2AJCA 3DVRX 2PNJA 4HD8A 3DOHA 1J56A 1FU8A 1YI0A 2WJHA 2JIBA 5C37A 1KJWA 1SU6A 4HMPA 4HTAA 4ZVRA 1OREA 1O94D 2QNRA 1V5IA 4GWKA 4ZDWA 1O5OA 5DM4A 2DRIA 3GFTA 3WDMA 5JVDF 5TNXA 1EVLA 4M9SA 4QUEA 2XE4A 3D6MA 3KL2A 5C9ZA 4BJ3A 1GKIA 2ADFA 4R1TA 4ZCMA 4U7PB 2FDCA 1LSOA 2IX9A 5ECGC 3ZDYB 4X1KA 1TRKA 2DYKA 5D7BA 3F98A 4KR3A 3RV4A 4EY5A 3W4JA 3ZV7A 3NTUA 1D2HA 1V9SA 4RKEA 1Z2OX 2H92A 4MWCA 4CIDA 1OXMA 1IY8A 1NE2A 1QHHA 1QC5B 3NGLA 5EWJA 2IOQA 5BWCA 4JI2B 1S0UA 4L02A 2R1VB 5HM8A 1GZUA 1I3OA 1Z4JA 2FZLA 5JADA 3QEMB 5AH0A 6PFKA 5EWLA 2EW2A 2FYTA 5TSDA 1NLFA 3MD0A 5EZYB 1NOKA 1JAHA 1EJ0A 1EK0A 1NWHA 2PD3A 3BEOA 4XCQA 2C07A 3AH8A 1C7RA 2QW1A 3BK2A 1RRGA 2X0FA 4LJKA 4YJFB 4FN5A 1XLTC 3HXTA 3WNVA 1HLPA 3TD2A 3HCCA 2XIQA 4FFSA 3PGJA 4LQ4A 1ICIA 3FDIA 4PXSA 3IMFA 3D7NA 4R0NA 2JGMA 2EG9A 4M7RA 3RBXA 1JS1X 1BJRE 2R6ZA 3RUHA 3TPZA 1JJIA 2G28A 2ZW9A 1M0SA 4P4GA 2H4YA 4IOMA 1OGJA 5KVSA 1R6TA 3TGPA 3VU3A 1IOVA 1B0ZA 1HE1C 2IUEA 2W6OA 4K0RA 5KWJA 4I9GA 1BMFA 3MQ4A 4ATNA 4MLZA 2HLDA 3G88A 3RFUA 1ZN8A 1IATA 1WX1A 6LDHA 1II0A 1KY2A 1S8OA 1UBGA 3THOA 2O9JA 3DAYA 1NRWA 2FPIA 2W0SA 2BRUA 1CUCA 2ZETA 3ZD6A 1GPBA 4G63A 1UKBA 5D3KA 2HPAA 4OKNA 5E1MA 4ZCPA 1DNPA 2NXWA 4ONEA 2BKUA 3GQBA 3ZWNA 2QEQA 2OXRA 2WVJA 4O4IA 2SBTA 3DC2A 3EGEA 1M9NA 4UFNA 2ZWAA 2XKJE 5JD6A 5BNIA 3S81A 1GQ2A 3T3HA 4LRSB 3QUSA 4MTCA 3UB4A 2VDWA 4LMRA 3M1AA 1N9KA 1XEFA 4UU1A 2A5YB 3OP1A 1GYQA 1IN8A 2WU3A 2C4WA 3IXMA 3R3YA 4IEFB 4I9HA 4QG7A 4WECA 4HRVA 5E7JA 5C4GB 2IU3A 3GUUA 4CUZA 3OG9A 3CA8A 4OQQA 3QEAZ 4HDMA 3RFTA 1IY9A 1HTBA 4NZZA 3GLQA 2I54A 4HBGA 4PS0A 4IXTA 3VJLA 3ZHRA 1MZVA 1XF1A 3OU6A 4EI2A 1F0PA 4MUIA 1TADA 4BB6A 2CB9A 3O3OB 1SVMA 5ERYA 2ATXA 1RFLA 2F6RA 2ZVQX 2A9OA 4GMKA 2H2FA 1DPGA 1OC4A 1LLUA 4CM3A 4E21A 4H1UA 4ZANA 3L7IA 1ADCA 2WF5A 3IAXA 4J49A 5EMKA 2ZKIA 4C4ZA 4C5CA 4GI2A 3UGJA 3WWDA 3I2KA 1B7GO 3H97A 3NHLA 2ZBEA 1R8SA 4KSYA 5K51A 5B3KA 1SWVA 2PYDA 5JYDA 3B9PA 5ERXA 2F8TA 4JHXA 3DE4X 3B9BA 1J22A 4CMIB 3TEFA 4EB6B 2O23A 1EM8A 3II6X 2HF2A 3THXB 4RL4A 2GCNA 1Y9ZA 3CJRA 1AA6A 1R9JA 1QHNA 1W88B 3PWTA 2LPMA 1V8BA 5CFNA 3FCCA 2LIPA 3F6RA 1KBZA 1LS6A 3CLVA 1CUXA 1ZCBA 2HJSA 3KM0A 3DZKA 4IWXA 4D4LA 1AA9A 1EFKA 2Z09A 3NALA 2J8ZA 1ZVKA 5TF0A 1Z82A 2O4UX 3QA9A 3UHAA 4NU5A 2FP4A 9GPBA 4DLTA 1TEHA 3GJ4A 2JLYA 3WLIA 4O8ZA 2FN3A 1HTWA 1NFRA 1NU8A 5E3JA 5HYVA 1ONSA 3RIYA 2D1YA 3K0CA 3HLYA 3UCEA 2B36A 1QGED 1G1MA 1XCPA 1UDAA 4KE7A 4KDRA 4H6WA 1BDIA 3MWEB 1UC5B 4JBWA 1WBBA 4KXFB 3CVWA 3B48A 1K08A 2O5VA 4I81A 5HWSA 4B81A 3L07A 2VAVA 4WERA 5AT1A 4R0MA 4WNAB 1YIAA 3VVMA 4MWTA 2O8BA 2XWQA 2C04A 4N12A 4PSDA 3I62A 4NVRA 4LG1A 5BOSB 2D1SA 3N8GA 2F9FA 3QLUC 1ZXLA 1E4EA 4JS0A 2PRSA 2PZBA 3SICE 3AEUA 1B6SA 1NW7A 2SCUA 3ZWBA 4G5QA 1DE0A 1QV7A 2KWIA 3IMGA 1E99A 1U8YA 5DT9A 4RVOA 3UFBA 4HP8A 3CRRA 1AK2A 4FLFA 4X1OA 3SX4A 1YDEA 4B3HA 4MB6A 5GPBA 3PC4A 1AQYA 4BNJA 4REOA 5A0VA 3A4NA 4ECEA 4BV3A 3EXHC 4N7MA 1MJNA 4EENA 3L0ZA 1Y4DE 2PCLA 3SZMA 4KDFA 3GEPA 3N6XA 1B8NA 2M98A 4QYMA 5HOQA 2B7BA 3VR4D 2OPBA 2XBLA 4YP1A 5BV1A 1VM6A 3Q5DA 4RZUA 4D26A 1P7PA 1SELA 3K15A 1UZAA 2MOKA 4RGYA 4AWXA 4GF5A 1E1QA 3U17A 4D56A 1OX6A 1OHHD 2FZWA 3KOXA 5HHTA 4YEDA 4GLJA 1Y7HA 5JSUA 4KSCA 1NVVR 1LLFA 4Z4GA 1MXFA 3ESYA 2B61A 1NXOA 2LKCA 1YJXA 5F7JA 4R8VA 4O3FA 4Z54A 2PZ8A 2C2BA 1BD3A 3IPXA 4NMXB 5IDXA 1ZJWA 5HZKA 2OCBA 1Y8CA 1E6EA 1Y9EA 3V33A 1ECLA 4F9EA 5CFQA 3WBJA 1AH2A 2F7SA 2IYQA 1PFVA 2E4YA 3VAZA 3WRXA 4DR2B 4U0KA 3A9SA 1D7OA 2WTMA 2ZM5A 1PTJC 1XXHA 3RRXA 2B7LA 3ZKAA 4C7XA 4ITUA 2GPTA 3F67A 1G8FA 2YH2A 3RU3A 3EIFA 3I3OA 4LYAA 2XF2A 4P0PB 2JJ2D 2AOWA 4OIFA 4RJKA 1RWPA 1XDZA 5CX1A 3WLKX 5ECDA 5JVDB 3IKMB 3INTA 2HIAA 2C8VA 4FZRA 3LPAA 4MUMA 3WLOA 1FEZA 4IWYA 3U4CA 3H5NA 4L5YA 3OLWA 3PXGA 4L5IA 3WSVA 1LU9A 4L5BA 5JHGB 1Z2DA 4JEIA 4N03A 2UZ3A 1G8GA 3GLRA 3HJHA 4FHZA 4DMFA 4YUVA 2PBZA 1BEEA 2D8AA 4KE6A 4YAKA 1I1OA 3FNEA 1FP6A 1AZLA 5J59A 4PZYA 2IZZA 1X1QA 3C1UA 3WXBA 1B42A 4AWAA 1JUDA 2PE5A 3EPJA 4D92A 1GQYA 1H42A 2BTQA 2H1HA 2Q9BA 4KLCA 4ER6A 3RS5A 2X9NA 2EBFX 4PW0A 1NBAA 1PN3A 2AA3A 1SC3A 2QTFA 4YUZA 1MJHA 4JU9A 1UDCA 4EBBA 4CU5A 1EHIA 2WFLB 5JV5A 1W85A 4NWIA 4BJ6A 4E5MA 1LDGA 1T34A 4FC7A 2ZRNA 3FZQA 3R3ZA 4L9WA 1YR1A 4B0PA 5KX5A 3HVIA 3LFHA 4QXAA 2C9BA 3N2YA 4GLBA 2YHIA 3V9AA 5IKPA 1T29A 3U09A 1ZVMA 2WF8A 4DXDA 1NNSA 4ZDKA 4E22A 4N76A 1YBMA 2VHZA 1BE8A 5DI3A 4BVEA 5FPTA 2G8LA 2C3YA 4HH1A 4YJ3B 3TS1A 3GEMA 1E60A 2WB4A 4QYWA 5HZMA 1CEQA 1O08A 2FR8A 1Y3HA 5K0ZA 3IP8A 3O0DA 4PEVA 1V5EA 3R6DA 4RPLA 4XLLA 1N9ZA 4Q0MA 1F8XA 1Q1NA 2J4CA 4QICA 3DL0A 4RK0A 4DCGA 2D59A 3GAZA 1VHJA 4MWOA 1X1EA 4DJAA 4WLEA 2Q7DA 2FUG6 1GAXA 4IBOA 1EAMA 5ENDA 1NYTA 4UBMA 5TQVA 2BCEA 1AM4D 2VOJA 3DOEA 3H4VA 3IIJA 3JQBC 4RHXA 4JI5B 2Q49A 4QGGA 1KAEA 4RHTA 1M1YA 4LZJA 5JAHA 1MEJA 1SD2A 3RCBA 3MELA 3GZ4A 4JLOA 3MN1A 2Z8YM 4MQEB 3CB4A 1BA2A 1ZLYA 3ILVA 4RGVA 2QG9A 1ADBA 3VMFA 4B8YA 1WCIA 4GBGA 3VAYA 4KPGA 3AB3A 3LXMA 4LDQA 2E1RA 3ZJUA 5E4YA 3DFKA 2QSYA 2Z5FA 2H1OA 2XA2A 1LNZA 3QE4A 3B7WA 2A9PA 2D0OB 2ERXA 1GTZA 1LLDA 3FW1A 1OW3B 4GQAA 1KI7A 2CKDA 5J2TA 3K7EA 3U39A 2CNOA 1KO7A 4HDNB 3W05A 5ES3A 5HF8A 1C80A 1PAUA 3EDQA 1LK7A 1NUTA 3CO5A 3LBAA 4IH9A 3SFZA 4ZJZA 5FA8A 1GKYA 4UAGA 3WIOA 1YQ9A 5TJHA 4EB3A 5I47A 2E4VA 1MB0A 1NMSA 1QLJA 2CJPA 4K0KB 3DE3X 1US8A 2DJIA 4FILA 2JDID 4PCLA 3GRRA 1WF3A 3LP6A 3WISA 4QO8A 3G0IA 3MWDB 1Y1KE 5H68A 1PGNA 2FWJA 4LXHA 1UP4A 3REFA 3ZY2A 1LV7A 4RSRA 3RSQA 1L5HA 3RK0A 2PV0A 2UVDA 2BT4A 1A5AB 1M8KA 3LZCA 4PCVA 3C7DB 3UFXB 2Y2UA 1P1FA 1I94B 1H2WA 2H52A 3SDSA 1ZK3A 4UQPA 2W2PA 4WKGA 1C0KA 5AKEA 3RYIA 4K81B 4UTOA 4FHCA 4WOCA 2P5SA 2AJDA 5ALWA 3T41A 4MH0R 3VYTB 4EMTA 3W6NA 4Z7OB 5KTKA 1KMCA 3AVWA 5IAKA 4E2ZA 2RH5A 3RKSA 1O95D 4GP6A 4WZBB 4COKA 3PRHA 3DBLB 2H11A 5ICFA 3HB4X 4JJZA 1MBZA 4GE3A 3PFGA 4PAOA 4LBZA 2JLBA 3LVQE 3MLAA 5TPWA 2H54A 1EFHA 4FKMA 5AESA 3CO0S 4ARCA 1G8HA 1RI4A 1SIUA 3CVOA 4HGQA 4PYIA 1FJGB 3CLSC 1RT9A 2GEBA 4PYRA 3F5SA 1Y7IA 2GF0A 3RVDA 3T1YB 2DUWA 4YP9A 3GRVA 1ZRNA 2V0CA 3QUAA 4X65B 2OC4A 5AVKA 3CONA 5BWMA 3OTOB 1PS0A 4C7OA 1VKZA 4E5UA 1RI2A 1C1HA 4EFMA 3T7TA 3W5UA 4BVKA 5LJLA 1ILEA 2JEOA 4EFNA 4R8MA 1SQ5A 2B8NA 2JGLA 1KP2A 2W4QA 3BHMA 3H9UA 4YAUA 4UMEA 1H9AA 1XDGA 3T1TA 4HWPA 4ALKA 2UKDA 1JE1A 3LO5A 4UZSA 4H7KA 1UH5A 5EFOA 3RJ9A 3NYWA 4OQ4A 1G5HA 4JUFA 1HT3A 3WGHA 3SIWA 5JXGA 1GD1O 2MYUA 3VKFA 3ZHXA 2JIZA 4WCFA 2W2TA 3FOEC 1GA4A 4IIFA 2DBZA 1VYVA 2QE7D 2W48A 1XKXA 2AX3A 3W7VA 4TKMA 4J1TC 2AFIA 4YRRA 4GE0A 3Q2OA 1LBIA 1QIMA 1YCGA 3U3XA 4QHYA 3FI0A 3BMCA 3EFBA 3M82A 5A4FS 1W34A 2IIPA 3A58B 3HZRA 4NMLA 5GONF 1E5XA 1IVSA 1C7EA 4K88A 1OBFO 3IE0A 4KN5A 3UC5A 2Q4DA 1GPWB 1CJMA 2GPYA 4GVPA 4GRIA 4MW0A 4RVFA 1CNEA 5AWFC 3GHYA 1N5KA 3ANNA 4YALA 2FZVA 3PHHA 4K9DA 1GRVA 2PIDA 1D4FA 4LVCA 5D85A 1JEDA 1QTRA 1BNCA 1Z0FA 4C03A 1TU4A 3BFXA 3K0AA 1JVBA 1BE0A 1F9EA 3LX6A 5KYYB 1ZUNA 3M8KA 3SQDA 2CYCA 4Z3DA 5FRDA 1J1ZA 3ZNQA 1NOJA 3BOSA 2FX3A 3MRSA 1BS1A 1YDGA 1IOZA 4KIGA 4M55A 4DV1B 1PJ8A 1E8MA 2J41A 4IZOA 5EL0A 3BGWA 2SECE 2V54A 5TEVA 1YFJA 4N18A 3OJFA 1U2TA 1ODKA 4FFRA 1E2GA 3WHLA 4Y0AA 1OWPA 1JKJB 4NBWA 2VPIA 1U8CB 2BZSA 5TQ2B 3OJCA 1GU7A 1VRVA 4YRIA 2R7LA 1A95A 1HYQA 2R8XA 3E53A 1CSEE 2F43A 2VJDA 3QVUA 4ZRMA 3OTWA 2JFGA 5IKOA 4EHDA 3VZRA 2RHBA 5EJ9A 1AUVA 1JDUA 1R12A 1SHUX 1XQ6A 2V9CA 1QCCA 1XYVA 1TZCA 4HRXA 1CNMA 5KQPA 5H7XA 3EXFB 3G9TA 2MYTA 1AB6A 2JARA 4UBJA 1VRWA 3O6VA 4E30A 3PX7A 3JS5A 4V1CA 2FRVA 2HPVA 5BWLA 4ZMBA 3CINA 4J76A 3IUSA 5I5EA 3DONA 5CCXA 4R1UA 4V0MA 2R8OA 4S24A 1OV6A 1Z18A 4ZO7A 1VLJA 4QTTB 3DE2X 4TS4A 1P18A 4GUDA 4HZIA 4RMGA 4RJLA 4B80A 4BMNA 4IG4A 2GKSA 5C4IA 3D8HA 5F7XA 3CF4G 1C8LA 1UOEA 3I04A 3JQ8B 3PA8A 2XQFA 3JQ6A 8MHTA 2ONZA 4K9RA 3SZGA 4QPDA 1T2VA 2NU6A 1CEEA 5KTSA 4GSLA 2I4LA 4QYIB 1D1TA 2JFWA 5E2IA 1PZGA 3TTTA 4QD3A 3H7AA 4CKCB 4DC0A 2JFBA 1VDZA 3KZKA 4XGQA 1XWFA 3JAKA 3KOUA 1XTPA 3LNCA 1Z33A 5TB5A 5JZBA 3L41A 4C0BA 1E6MA 2VJCA 4BNDB 4XFJA 5EIBC 3O8LA 3QVJA 3VVCA 5CVDA 4M8IA 1S4QA 4H59A 3ZIDA 3TLMA 5BSKA 4XGRA 2EFYA 4N5LA 4ZRDA 3UMFA 5EJIA 1I4DD 2XDAA 4ENPA 3A2NA 3DGFC 1A88A 2QMUA 3FZNA 1EUZA 4WZAA 5T5QA 4YMTA 4R83A 3R5SA 5ITWA 4NCJA 3WGJA 4R1LA 3KELA 2ETXA 1H3FA 1GCUA 2N0SA 4KFSA 4P3YA 2AOUA 1Z5ZA 3JQ9A 1PHPA 3PR2B 4N6NA 2I4IA 3ZY5A 4MCHA 5H9VA 1KEUA 2GEDA 3BCHA 3BILA 4G0NA 5L45A 5MHTA 4S05A 1JBQA 4TMWA 2NUBA 3RYTC 3A1DA 3FMOB 3QFCA 4FE4A 3Q7EA 2ASVA 2G0NA 2XRMA 3JQRA 4HATA 3TXAA 5KYXA 1OH6A 4PLWA 1SULA 1Z7YA 2ZYDA 5BR1A 2IA5A 2OBBA 3FRIA 2C9DA 3IR6A 2AQIA 2BGJA 2JAPA 2VG8A 2PZFA 3D59A 3R3UA 4NCKA 3LGAA 4II3A 1A5SB 4QVKA 1SMKA 5F1PA 1BXGA 1OKKD 3A3YA 3AVVA 3M6MD 1PTKA 2L18A 4I36A 5CURA 4JGIA 2QX7A 5JZSA 3HYRA 2QT1A 4M22A 5JMTA 2YV3A 3Q6MA 1IZYA 4DV6B 1W5FA 2XSZD 3MCAA 1U2SA 1WDTA 5E9AA 4M0KA 3GLKA 5FAXA 1FX0A 3H3JA 4ZAFA 5AUQA 3VPHA 2CNLA 3VZQA 2WSYB 2VBGA 4CMGA 5I7OA 2VQFB 5C81A 1MQ8B 4LF4B 1S6YA 4PBRA 4MJ3A 2BBTA 3PWSA 2B83A 4Z51A 2AZXA 3DTVD 3NPMA 1HPLA 1S9HA 4LZZA 1Q1ZA 2J0UB 2HF7A 4NPAA 4AJ2A 1YS6A 4Y2TA 2JK0A 4JEUA 3SYNA 3K70C 4M87A 3C3MA 4CR8A 3BSYA 3V46A 2CHQA 1ZIOA 2GILA 3PP8A 4BFTA 1TVKA 1U1FA 4GOND 4BNZA 4MUYA 4PG6A 4G8CA 3OPYI 3ROGA 5M29A 1P9RA 2IY8A 2OT3B 5HIKA 3TJMA 1P6XA 3OIWA 1SGWA 2GD1O 2X4LA 4NMMA 3INNA 4Y1RA 1RZUA 4GZ6A 1GSHA 2YWJA 3E4DA 3HY3A 4WEOA 1X7XA 1P4AA 4KZKA 5FBZA 4UEJA 3UMCA 3EGDA 4CKYA 4ZU6X 5HJ7A 4RSGA 4CL8A 3EMKA 2RARA 1C3LA 3AOEC 1AKQA 1D9XA 4UTZA 3RLFA 1SVIA 1XVAA 2NPIA 3T1NA 1MAWA 1XTUA 4M8NE 4JJ8A 1PNRA 4M49A 3WOVA 1CLEA 4JR1A 1HQDA 2HJHA 4DIUA 4EG6A 2ZE5A 4JBXA 4QJIA 3S99A 2WC1A 3VR6A 1MUUA 3WGNA 1XVUA 4OHBA 1T1SA 3VNAA 1JTVA 2WHPA 3WE7A 1Q1GA 2IOYA 2OD9A 1IY2A 1X8KA 4G1CA 4CJXA 4D9GA 4UUQA 1LC3A 3KAQA 2DFNA 3MRXA 4QBHA 3RVKA 3QOXA 2CB0A 2DJ5A 3ANXA 4ALJA 1HLDA 3JPYA 4EG7A 1GGMA 1NSYA 5FFNA 4R41A 1GEGA 1UK9A 2XQGA 1EEHA 1FBNA 3DHEA 1QP4A 2IYFA 3D3WB 2JRCA 1EZ4A 5HUHA 1TOAA 2IS2A 3AR3A 4UJ3A 2VQEB 2QKYA 1MZPA 4G56A 4EMSA 2VJNA 3PXDA 2A5DA 1VSQA 5LMCA 1TCVA 3M1LA 1OAOA 1SC1A 3A6LA 1PIWA 5JS6A 4NS1A 1U0JA 2OUIA 4QOIA 2CDBA 4LBVA 4YONB 2E1PA 5GONB 2D6FA 1SH7A 4LCBA 5EYPB 3IMKA 4FYHA 2Z4RA 1CRPA 3D4IA 2FMUA 1GA1A 1TGVA 2XZTA 3OIDA 2FW8A 4EFDA 2WKRA 3S2GA 4WFIA 3NFRA 4PGMA 2P0YA 5HJ2A 3UPTA 4NULA 3DL2A 3TLCA 4DSUA 1R6DA 3KB8A 2XUJA 3ZTYA 2ZVDA 4DDVA 1E20A 3E9RA 3LMKA 5B6JA 2Z2XA 3R9WA 3TCNA 1V1JA 2Q5OA 4J1SA 4JBIA 1B43A 5NULA 2OBLA 2QVZX 4OQMA 4U2DA 3IUNA 4REQB 4ALMA 2E18A 3KVNA 4RLFA 3KKZA 2IPAB 1YB7A 3FBWA 3GFFA 3A6PC 2QM0A 1Y48E 4NZPA 4Z9AA 2BC9A 1UMKA 3ZTWA 1NLZA 3ETHA 2HBYA 5GZ6A 2XVMA 2JGDA 3A1TA 2C4TA 4ZK2A