2YV4A

Crystal structure of c-terminal sua5 domain from pyrococcus horikoshii hypothetical sua5 protein ph0435
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
105
structure length
102
Chain Sequence
APNAEVIVVEGPREKVKGKITELVKELKERGKKVGVIGSESYNADEFFFLGSSVEEVAKNLFKALRYMDKAGVDVVIAEGVEERGLGLAVMNRLSGYKIVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical protein PH0435
publication title Crystal Structure of C-terminal Sua5 Domain from Pyrococcus horikoshii Hypothetical Sua5 Protein PH0435
rcsb
source organism Pyrococcus horikoshii
molecule tags Rna binding protein
total genus 36
structure length 102
sequence length 105
ec nomenclature
pdb deposition date 2007-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11030 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yv4A00
2EQAA 3AJEA 2YV4A 4E1BA
chains in the Genus database with same CATH superfamily
3FPHA 10MHA 1ONPA 3LUPA 2BFDA 3LC0A 4D4LA 5I9LA 2WT9A 4W6QA 4ZYLA 5KEIA 3WFJA 3AP1A 1C1DA 1GWNA 1W85A 4O5OA 3SZMA 3JW8A 4IGFA 3WZMA 1OH7A 2JGIA 2H5IA 3EFEA 3PLNA 4HDSA 3E5HA 3UCXA 2QBYA 3U6KA 1ZMXA 3KDAA 1E94E 4OJKA 2Z2XA 4YUWA 4YRJA 1M2VB 3ZWYA 4X24A 4PYRA 1CY2A 4S1PA 1NZFA 5DCWA 4CKYA 2X4LA 3QGMA 4NV0A 1P7VA 5IJZA 4I55B 5KX5B 1L5QA 1P1FA 1U1EA 4RMIA 4EJSA 1XCBA 4OOEA 4M76B 1GQQA 1WXQA 4RD1A 2V6MA 3KVVA 1XLWA 4W1QA 3ZH9B 4CF4A 3NC0C 1EP9A 1XEXB 4ZICA 2MOKA 1OX4B 1XNGA 2I3DA 3TRHA 4A3SA 3L0IB 4COOA 4F9GA 3PEEA 1PVDA 5LB4A 1PG0A 2XGSA 1RZRA 3H2BA 4BXOB 3PQEA 4RESA 3SQWA 1C2TA 4B4DA 1SRRA 3DP9A 3HSYA 4G37A 2FPGB 4S1NA 2N75A 4M8KA 4YRPA 3WLNA 1AMNA 2IHNA 1P9WA 1QHNA 5CK5A 1JWAB 2FFHA 5DNWA 1I3CA 1ZU4A 3OQMA 2DOKA 1VM6A 5HDQA 5CD1A 1VLZA 1GZ4A 2M6KA 4PZPA 4YAGA 3TLGB 2OP0A 4GI1A 3H7AA 1PU2A 1VECA 2P9JA 1WMBA 1FRNA 1GXSB 4I9FA 2HV9A 4D9MA 4JAVC 3AEKA 4YR9A 1C9NA 1HL7A 4X94A 3DD5A 2EKPA 3CH7A 3KM0A 1ESMA 1LU9A 5IDYA 2GO1A 2I2FA 1GEEA 4ITVA 5DHTA 2FA9A 2NUBA 4J03A 4MH0R 1OGIA 1SXPA 4DA0A 1B26A 5CTJA 3LPMA 3T7TA 3T9DA 1YQ9A 1NQOA 2W2PA 5BUZA 4DT1B 4CTMA 4CR6A 4RLFA 1K8RA 2OSVA 4E5DA 4LCEA 3KCQA 4XWYA 1QF7A 1H2HA 5JQGA 1W0JA 2BMJA 4ZEXA 5LQJA 1HE5A 3L8CA 4II3A 2MSCB 4P58A 2HSJA 2H51A 3WLEA 2CVHA 2HJ9A 3IO5A 3M9LA 2D13A 2BVNA 4R16A 5EP2A 4EPTA 5C7IO 1C7JA 1FFGA 4UCFA 2Y9PB 3K70B 2WICA 1ZOLA 4UFPA 1FF9A 3ASZA 1B41A 2QMUA 4LE0A 4DC9A 4CMIB 1E9VA 4ZT4A 3VPCA 3W90A 4DWOA 4TSFA 2QL6A 1XU4A 2XNDA 2RGYA 3D1VA 3GPLA 1PSWA 4I5FA 5CDYA 1NYQA 4HQNA 3RS4A 1II0A 2F43B 4LF9B 2VYVD 4ER3A 3KJFA 1JR2A 2VJYA 5FWXB 5FI3A 4PQGA 4WERA 3VPDA 2PE5A 3O4FA 2NV2B 1GN9A 2VF7A 3JASB 3VKVA 3TQIA 2FUCA 1PAUA 3T12A 1ZH4A 4DSUA 2F8MA 2QR2A 4ARSA 3BGWA 5BSRA 1V9LA 1VGRA 5BOSB 1UINA 3DB2A 5AKYA 2HZ7A 5HUQA 4B83A 3ELDA 3VU8A 5D7BA 3GLFE 1N3IA 2QLMA 3RSSA 3DKVA 2WILA 2JFYA 2Q07A 2R5NA 2IEYA 1BA2A 2EKBA 4K28A 2AUNA 4CE6A 3G2KA 2C2GA 2BFBB 4TOIA 3PI6A 4RVGA 4ZQFA 2H4YA 2CMFA 5BRAA 4US0R 1DHRA 3LY8A 2HDHA 1N6KA 2Y0PA 3QMVA 1QORA 3PHIA 1KYQA 3O2NA 4BQEA 2BLLA 2P4EA 3PQ6A 4H0FA 3CEMA 4QYTA 4DUPA 3ERCA 2BFAA 1PZHA 2Q5OA 3VYTB 2HADA 4TMTA 2SBTA 4P3YA 5T64A 3EGIA 2B1JA 5BSVA 1HSZA 1YHZA 2AUMA 2IDMA 1Q15A 2VDWA 1A0OA 1BHO1 1SVLA 5EQJB 2UXBB 1QVZA 1PJLA 3QU5A 3SS8A 3CBQA 1H3EA 3AVQA 1RR6A 4GOJA 3M9WA 4BNHA 2GAAA 1VKHA 5BUQA 3C8DA 2X1LA 4QAQA 3DW3X 4P98A 1CXZA 8ADHA 4Z4QA 2HH9A 5M04A 1D2MA 1Y6ZA 3ELBA 1BE1A 4CV2A 2FX2A 2B1IA 4QSMA 2AOUB 1DKMA 4YAFA 3UAVA 1DCFA 4JQZA 3ICCA 3AKYA 3VO8A 1U7OA 3NEJA 3OPYA 4ACAA 5ALUA 4MDFA 3H5LA 2UYOA 4ODIA 5AKEA 4OU5A 3GL9A 3FBGA 4JASB 1E7WA 2DFNA 1L3IA 1UPUA 3MW8A 4X91A 3R9IA 3A2KA 4G0WA 4EKIA 1VJRA 1YR9A 4FWBA 1Y5MA 1JJFA 4CMAA 3N87A 2XQKA 2F2TA 1TXGA 1E7QA 1L7OA 1OLUB 2H4JA 1O9GA 3QUQA 4GRAA 4Q1VA 1M33A 5BURA 2ACKA 1AMUA 4OP3A 1CS4C 5J2TA 4BGUA 1LJUA 5B1IA 5C4IA 3RIYA 4LK2A 2CD7A 3U48A 4W5WA 5JJKA 3NAZA 3X1KA 3R3UA 3CSSA 5LJLA 3JQCA 3ZDBA 2DZDA 1Z22A 3QXCA 1G17A 2AR0A 2PT5A 4BMDA 4PGGA 4TPKA 3P45A 2HC9A 4KL8S 2ZANA 3KLBA 3N7AA 1DLJA 1GZ3A 2ZRPA 5J4VA 5GONF 2CV1A 3BL8A 1DXYA 2WJ6A 3I83A 1UPBA 3P26A 2WHYA 3T7DA 3BJEA 3NKFA 5KYGA 2CCKA 5LZ9A 5ALWA 1KVTA 1VE9A 2JPDA 3GMIA 3SYLA 1HSOA 4DMMA 1E2EA 2IOFA 3CVXA 1DMRA 3I72A 5SYMA 1C0IA 3I9V1 1UBRS 3MEQA 4NPAA 4Y6QA 1OLSA 2C5GA 4ZXFA 4CR7A 2R1TA 3KJHA 3PQ3A 4U7JA 3HKBB 1IATA 4NFHA 1GIAA 2VF5X 1H85A 4XD7A 2R6DA 4AG3A 4WGFA 4ZQHA 2X7JA 3GAAA 4F4FA 2FXIA 2OK8A 2FUEA 2XA9A 1GV0A 1NUAA 4BGEA 3LKDA 3LW8A 4PXAA 1EFVA 2ZVPX 2F8TA 3PXCX 1ZA1A 4CIYA 1KMMA 4LRQA 3FMIA 1M1YB 4AJ2A 3AJDA 2XE6A 4YAWA 5HIAA 5E8JA 3DYBA 3GYBA 2WSSD 3H1EA 2B9VA 1R4ZA 2DPXA 4BJ6A 4FJ2A 2J1LA 5JWHA 4GDFA 1Z34A 4MUEA 2ZYGA 2XV1A 3Q3CA 3QUCA 5AVKA 5TQ2A 5J3JA 4B2YA 4W5RA 3JYQA 3FAKA 1RBYA 1DAFA 3H84A 1GAWA 4PNZA 2WM9B 3TPCA 4PSUA 3ACCA 2PR2A 4YLEA 2GXQA 4FGKA 3UC5A 1NUQA 4L85A 1FP6A 1PLLA 1KFBB 4RJLA 4Q9IA 5DGDA 2JGEA 2XGOA 1H6BA 3K70D 4Q47A 3PNOA 3WC4A 4RM2A 1HFJA 3CJQA 4WLFA 5E7QA 2PVSA 3PSHA 2F64A 4HYQA 1OIXA 1OZ0A 3ZLBA 2VAVA 4YRZA 3KD2A 2W2NA 1EAYA 3SXUB 3TZHA 3SXPA 3T7RA 3TD2A 1N8TA 2OAP1 1AKUA 5E6UB 3A6JA 3CSUA 2ECPA 3OCUA 4JVNA 2BDUA 1Z4OA 3RASA 4JLOA 4PLHA 1T0PA 2GHRA 1II8B 4DZZA 4X8LA 2BP7B 1LLUA 2CXHA 3OE7D 2WHPB 2XMRA 1LA2A 5FNZA 4XWGA 5ILOA 2IZZA 3PX2A 2WAXA 3HRIA 1VGVA 1GNTA 3LL7A 3QU4A 2ZRBA 1K75A 4LVUA 4PS0A 4Q4DA 5EINA 4CPDA 2H17A 3L6EA 3SC2B 1KFKB 4CDRA 1F12A 4K7JA 5K09A 3C6KA 2HJGA 3RTCA 5LA6F 5KS2A 1Z07A 1Z28A 3OQVA 3P32A 4NU5A 5DNAA 5FUWA 2B9EA 3RLIA 3X1WA 2R7MA 2E21A 3A11A 4OBXA 4FB5A 1WETA 4S0XA 3M2TA 3CJRA 1F8GA 1U4NA 2ZTUA 1CZOA 2AXEA 2ZJ7A 4R3NA 2JI6A 1RAAA 4XOIA 1AM4D 4TZTA 1ZC3A 2ZTMA 3K1JA 1XX6A 5MGNA 2Q3EA 4P3XA 4IKOA 1DTWB 4HK4A 4KE7A 4KWHA 1FMTA 2O0KA 2NTJA 2GN1A 3RUPA 5T7BA 3ICEA 3ADPA 2TRSB 5EMMA 5FT9A 1YVEI 3ML1A 1CUFA 5KB3A 9MHTA 2IIBA 4PPQA 4K46A 4PO8A 4CM1A 4G8DA 2H9AA 1XALA 3O91A 4I4LA 2QN9A 3D6NB 5HF5A 2GM5A 3PJFA 3Q1LA 5A4DA 3PU6A 5KWJA 3NHRA 3IURA 4A6XA 4ENTA 5A06A 4G0MA 3KQOA 1TD9A 1SUAA 3C3YA 5MFPA 2GI4A 3H1TA 3T4UA 4DLPA 3OE5A 1XZIA 2FN4A 4O02B 1TL7C 2GVNA 1ZM9A 4IP0A 2XGMA 2XMDA 1JYFA 4TRMA 5DOZA 5TEVA 2XBUA 2PXCA 1YASA 1SUFA 3BDVA 4WZAB 3Q9LA 4XGNA 3PC3A 5BV1A 3LRTA 1SVUA 3FZGA 4JU8A 4LJ6A 4NJEB 3CNEA 3ZPXA 3BGSA 1SCIA 2ZGVA 3QTBA 5JFGA 1H2AS 1GGFA 2BMVA 3R8XA 5EXEA 4JMLA 1L5YA 2CVPA 1CKEA 4P84A 5CGQB 5EPEA 1HDEA 5FNVF 4A6PA 3GNLA 3GEIA 4NCBA 3WBKA 4ZVPA 2QWXA 3H9QA 1EAMA 1I3MA 3DZJA 5A4MS 1Z37A 2AFIB 3NYRA 4LYFA 5K45A 2CKMA 1B0AA 1THZA 3QX8A 4GL4A 8ATCA 3QX9A 5D00A 5HZGA 3V8MA 3KQMA 3RUEA 1KSJA 4FFBA 4FQ5A 4A82A 1VI5A 1PFQA 3AHEA 4QDOA 3FNGA 4H77A 2Q6OA 4L73A 3N8GA 1QP4A 3HY4A 3UQZA 4XUDA 4IDBA 3UFXB 2P2LA 5FA8A 5CLHA 1JDBB 3G13A 4BE9A 1WW3A 3AR8A 4TV9B 2OG1A 3D8UA 4B7ZA 4E5YA 3WL6A 8OHMA 1DFGA 4MV6A 4DBLC 3TG2A 5K2OA 3NNNA 1KI8A 4UXHA 3GLHA 4U1RA 4YVFA 5ALNA 2JLUA 1M73E 3IKJA 2CHEA 3KE8A 4AWAA 5GINE 1EX1A 4YRTA 3H8JA 1J8QA 2XUQA 4WADA 3A6DA 4BBAA 3EZ9A 1Y89A 1EFTA 3G17A 3I45A 1MC5A 5CH3A 2YXLA 3KFLA 5E4YA 2WB4A 1GY8A 4EKNB 3QLUA 4OSEA 1YCFA 2WTBA 1SXHA 1TVMA 1ZXXA 3LDGA 4JEUA 4RADA 4C0SA 3U19A 1Z4JA 3ZE0B 3OD5A 1CZNA 2QRZA 2Q3DA 2HA6A 4NE7A 1CZHA 5KU1A 5LDDC 3QE2A 3OCWA 1YSCA 2GDZA 1S2DA 4UUAA 2P62A 3GDFA 2I71A 3LPLA 4IS3A 3WLKX 2J9ZB 2QOEA 5T3YA 1SKQA 5FUXA 4I6EA 4G8CA 4FWTA 3BSYA 3ROMA 2R1VA 5JJBA 1IVNA 4HN2A 4JP3A 4QFMA 2Q4RA 3ZY4A 1E0AA 1CE8A 1IZ7A 3A3KA 1GZDA 4DTCA 2R62A 1FNCA 3QSGA 4OSOA 2RKOA 3B1KA 3TIXB 5K8TA 3K6SB 3KHKA 2ZYIA 4F4DA 1ORHA 3ZV6A 1IDN1 1N75A 3FMPB 3I9V6 3RFTA 3U7IA 2YWRA 3EQ2A 1Q1BA 2WJVA 2GB4A 5DO9A 5B55A 3KR1A 4ZO7A 3WJ2A 2JB9A 1G7SA 2FFBA 4GR9A 4GX2A 4XGIA 5TSDA 4YUXA 4URXR 1ATIA 2DT5A 2O5CA 2WYOA 1SEVA 4KP7A 4FMDB 3SSNA 3UJ6A 1OBCA 4B48A 1Q6YA 1RPAA 4LFAB 1KSFX 1L4LA 3OG9A 3NBMA 3A1SA 3DZIA 4IQ8A 2OGTA 3ESDA 3L7BA 5DWDA 4XRGA 3E2PA 2ALJA 3EC1A 1XMOB 3HNPA 3DEKA 4WFQA 4M1ZA 2YV3A 4QFBA 3KO8A 3D59A 3DE4X 3O93A 3BD8A 1X1DA 3TN7A 4RPJA 1I3OA 3R40A 3FYSA 2PZEA 5F5XA 2IE8A 4GOOD 4JI3B 3EDRA 1FTQA 4G63A 2NVBA 4QYXA 3BSWA 4R31A 2Z4SA 3KTFA 4FT2A 1E0SA 4RH0A 4M9QA 1EFUA 3C8MA 4D9GA 3JTMA 1SKYE 3FXAA 2KLBA 4RJ2A 1KVUA 3UA3A 4KXFB 5A6SA 5B2EA 2RHRA 4IZOA 4EX7A 2YJZA 4P2GA 2M2IA 5FOSA 1QDLB 1LQ2A 1Z7YA 4I3HA 1KEEB 3SMQA 1UBEA 3I04A 5B57C 1T3LA 4H7HA 1JIQA 3UT6A 1O77A 4YRLA 3FSEA 1T2DA 3RS3A 5F1YA 1YRQA 4LJLA 4K9QA 2LKDA 2NPIA 2R65A 4ZOLA 1R0ZA 4Q4LA 1IBMB 4MIYA 2PUEA 1E7MA 2JLRA 3WLPA 3EEIA 1YS6A 4CVNA 3HB7A 3K1TA 1EFPB 2GKOA 2QN8A 2L0XA 3NONA 1A7UA 4AUKA 2GAIA 4LJKA 4ZZ1A 3ZHUA 4GI2A 5CW1A 4B3GA 1DZIA 1AT1A 5F4ZA 4N9WA 1UK8A 4L22A 1V1RB 4ND3A 5JWOA 1L7AA 4RH1A 1AF4A 1EM8B 1VPDA 2B78A 2L82A 3N0XA 4FYVA 4TZ6A 5FOVA 3ONDA 1F1JA 5EXDA 1TM2A 1Q1EA 2Q4DA 5I8ZA 4EGAA 5JY1A 1PJZA 2W8ZA 3REQA 2PMBA 3DQPA 4KR6A 4Q39A 4FYPA 2ZYVX 1VE5A 3BXZA 3QQPA 3LC7O 2AVNA 1KEZA 4EA6A 3V7UA 2Q7XA 2ZPUA 1HZJA 4J3FA 1S2LA 3OQ6A 4NZMA 3VKUA 1EK6A 3O5AA 4ETNA 2BR3A 4S0ZA 1JIUA 2K7ZA 3W78A 1NURA 5E9QA 1GZSA 1ZINA 2L42A 4DYVA 5JMTA 1M0WA 4Q3CA 3ROGA 4EG7A 1SO8A 3V9AA 3CKLA 4LDJA 1HG0A 1KI1A 1HQCA 1PQ4A 2O06A 1UK9A 1GR0A 5T4BA 4W1SA 5TB5A 4WZBA 2MYNA 4QNRA 1CUWA 2F3SA 4UVDA 1V41E 3COVA 4CDGA 1C14A 3F78A 4MJ3A 1TM3E 5BQ3A 5IAAA 4IS2A 3GJ8A 4HNTA 1MOSA 2J8ZA 2Y1GA 3AG6A 1OLXB 3L7OA 3AHJA 1A5ZA 2MSNA 1LC3A 1S3IA 3MTGA 5H0IA 1N2SA 4EFDA 2FQQA 4BX2A 1F5NA 3RTBA 4CLXA 3IQGX 2BM9A 4DSZA 3HU2A 4L50A 2ZP1A 3L6BA 3UANA 1OH6A 2WD7B 1XAJA 4IHJB 1L5LA 1XIVA 2YZKA 2VDLB 5KC9A 4OYLA 2AYXA 1V0JA 3AM3A 3V6MA 2L17A 1QRSA 2GEDA 3CY6A 3OD1A 3QX7A 1IXKA 1G2OA 3HB1A 4EOGA 3B9QA 4HXGA 3WWYA 1NVKA 3E9EA 1XNQB 2ZJ6A 1MJGM 5JHGB 5BYKA 2CT8A 2DJ5A 2PLNA 4PC3A 4XFDA 3U4DA 2W0SA 3EXIB 1CUXA 3BGOS 4RSHA 4O4JB 3C4QA 1T8UA 1IXZA 4W7HA 4G5FA 3EOAI 4WAUA 4C0WA 5HKOA 3E58A 5JVDB 1LK7A 3AVWA 4IDFA 3R8CA 1WZUA 2B36A 2O2HA 1I2AA 2WIKA 1JHAA 4AMBA 2RGWA 5IFLA 1CK4A 1JR3D 2F62A 4BWFB 3DTVB 3SU8A 4EUHA 3FM9A 1JS1X 3R7LA 3N5KA 5ABPA 3L77A 4ITRC 1MO4A 3G1WA 5LYJB 5FUVA 4AP6A 4AJ9A 2EIHA 1WXIA 2AG6A 3KT8A 3LGAA 3BT7A 1SVKA 1Y5IA 2ZE6A 2JFZA 1L0BA 3EGXA 3IQXA 3EIQA 3KOWA 3BK2A 1RRMA 2HHJA 1YBMA 2I3GA 4DIUA 5I4KA 4URWR 4EF6A 1MRZA 4G5SA 1MB3A 1Z7WA 2ZUSA 4MAFA 3VHXB 5KTOA 3CLHA 2QQ0A 4QU0A 1YE3A 1SJ9A 1YMUA 2A84A 5F33A 5J47A 1BMTA 1G8SA 1KVRA 1M9NA 2Z5GA 3TCXB 4ZAXA 2C7QA 3B6IA 2Y9MB 3TO5A 1D3AA 2NYRA 3IE0A 2MCFA 1EWRA 5JDIA 3IIIA 4A8JC 1Z75A 1VGQA 3I2JA 3ACDA 4HXEB 3V4RA 2F4VB 2FPRA 3WA6A 1PL6A 3B5EA 4AO7A 2UZAA 2HWYA 1KWGA 3WIBA 2RAUA 2BWJA 2DHRA 5CCXA 1Z83A 1CF9A 1OC4A 5EVJA 3FDIA 1NR1A 4KQHA 2WYIA 2QNBA 4QOEA 4RBNA 3TSCA 4C06A 2W2LD 1JU4A 2D00A 2VSNA 2Z2KA 3C1UA 3OQBA 3P0EA 4D6YA 1AKYA 1YFKA 3B6MA 2JH3A 2JIZD 4F72A 5JJ5A 1EUCA 1M6EX 2IEZA 5L7TA 3ZCRA 2MT9A 3JQEA 1L5WA 1J09A 5TMDA 2ZYAA 4O2AA 3HTXA 3ETHA 2Q5HA 4RK7A 1A3CA 3K71B 2R0QC 2YQ5A 2C58A 4JSYA 1SOMA 5SYNA 3IVRA 1YZQA 1Z12A 2RGCA 2JLBA 3F71A 4EG0A 5I7EA 2FZCA 3JQGA 1ZX1A 2B0JA 3MA0A 2XMQA 3WHIA 3ZX4A 2IU4A 3Q0TA 4YWHA 5J23A 2V5UA 2ZYSA 3C6YA 1Q17A 4L57A 5LMZA 2HRQA 2QORA 3D0RA 5F9HA 3LCUA 3VZBA 1HR0B 4DSAA 1CQIA 3ENWA 4KQIA 4HV4A 4P2BA 4UTRA 3EPHA 4HMOA 4CCWA 1PT6A 3JZDA 4JJKA 1U7WA 4J8PA 1KDTA 2YASA 3QNUA 3TSWA 3G2IA 3MZ0A 4DSNA 1WXDA 3A26A 2OD2A 3BEDA 3UT5A 2GA8A 2NSJA 1ECJA 3OEHA 2E55A 5EMKA 3EIXA 4M0PA 4TKUB 3TAUA 3G89A 5DHAA 4XSGA 1OVGA 4RSRA 2C9ZA 3WG9A 4CBVA 4W82A 4QRHA 4E5MA 4IMIB 6Q21A 2MJLA 3FGZA 2WKPA 4Z8YA 1UPTA 4URUR 1GPWB 5L3RA 2ORVA 2DPGA 1RYBA 1RAEA 3B1YA 2AOTB 1ZI6A 2QU7A 3DEHA 3IOMA 3ETCA 3JQAB 1J33A 2L2QA 4I81A 4P4NA 5I5EA 1E3EA 1RC1A 4X9XA 1X9HA 5SZIA 3TB6A 1VSQA 3PTZA 3ISJA 5EERA 1KDOA 3VR6A 1UMKA 4C7OA 2FH5B 1R4MA 5KYYB 4Y6PA 1N34B 4DC0A 4YCNA 4X45A 2B5VA 1JW9B 5DNUA 1DCTA 4RHXA 1AX9A 1GPH1 1X0XA 4HATA 1M1NB 4RCZA 4D42A 3ZDRA 4IH4A 5CVCA 1PWHA 4MLCA 3UHOA 1NJGA 4V1CI 1E79D 1DT3A 4HX5A 4AL4A 4HPXB 4BAUA 3AHCA 2P3SA 4GKKB 3ZU5A 4B40A 3BXXA 3G88A 4H0NA 3VZPA 5B4UA 2F8SA 3IPRA 4TQGA 5HILA 4KJZA 4Z9AA 4QBHA 4PTZA 1Y42X 1E3WA 4HFNA 2C1EA 1L3BA 2OYSA 4NF2A 1ONNA 1V16A 1ZUIA 3BXOA 3JQ7B 4IDDA 1Z63A 4NBUA 2IE0A 2Z2ZA 3C14C 5JPDA 3HMQA 2Z8ZA 3I8SA 5FBLB 3ZNNA 3PNMA 1QC5B 4J1TA 3MS4A 3SNKA 3FYTA 1V8OA 3JALB 3DKPA 5LKAA 1T2UA 3I9JA 4FFLA 2CNWA 1QFXA 1XMVA 3HV2A 4I5GA 3FTCA 1J23A 5F51A 4G09A 4ZDJA 3LSYA 2JGFA 1GVHA 4R2HA 1H6CA 4CF7A 2I6TA 1EVIA 3ISVA 5DWVA 3ADCA 3GLGB 5BOVA 3QEOA 1PI3A 4RENA 1FU8A 3U39A 3EGWA 4GHWA 3QV1A 4TXNA 4NJMB 3OBIA 2Y1WA 5B64A 1VI6A 2WKWA 2HIAA 2XR1A 3WO0A 4C4TA 3FKSD 4HZGA 4DUZB 2TECE 3QHAA 1QZTA 2DAPA 4D9FA 3ANSA 1XG5A 3KZNA 4AYTA 3BG5A 3FYUC 4MGYR 4GXQA 4RJIA 3ZQ4A 2AZ4A 3JQ6A 1C8BA 4J0GA 1E2GA 1MTOA 1CZKA 2O8FA 3R4VA 1X1EA 4B5KA 4X97A 1FUYB 1C3OB 3QW4B 1K7SN 1WZNA 5JYBA 2ZATA 2QW8A 1NJ8A 2BW0A 3B2QA 4YMHA 5I7WA 2BH9A 3U6BA 1IBRA 2XB9A 4HYTA 5JG7A 1L5OA 2GTIA 1BVYF 2J3LA 3FBWA 2ZTVA 4KOEC 2GLTA 2J0QA 5I7UA 4NCXA 2EHJA 1VCIA 5GWXA 2WWXA 3RV4A 2C42A 4QRIA 3RNOA 2BY4A 1L7VC 3ETJA 4RF2A 4K1XA 1Q21A 3C5CA 3H13A 4RDCA 4D8WA 1ILWA 2HQBA 2PT9A 3LFTA 1I2ZA 4GXNA 4HWRA 3U1TA 2CXSA 5CPBA 4G6ZA 4KVZA 5CFMA 2IX9A 5LZ4A 1QYCA 3EZ2A 4KGVA 1XRRA 2VYFA 1PWYE 2OQIA 3DXZA 4LVCA 5FX2A 3GRKA 1YGPA 4RKEA 4EFLA 1MN6A 1JKJB 5EZSA 3T5PA 2C4WA 1SBZA 3F7NA 2Z2JA 2VJDA 4Q3OA 4HNAA 3NBZC 1JUDA 4LC9A 3UATA 1XU9A 4ZGGA 4JX9A 3AONB 2VUSA 4UBKA 4BJHB 5IZCA 3PLAE 1FTNA 3LL4A 2EW8A 2FPOA 4TTVA 3UAZA 1MX5A 4QQKA 1L5HB 3B6EA 3FF1A 3LP6A 4I50A 1G9TA 3GH3A 4OUDA 2NU9B 3I6MA 1DARA 4UTNA 1PJQA 4MRVA 1G1AA 2OESA 2VPZA 3KALA 2H1SA 1UXOA 3PGVA 4WKPA 5EIBD 3WGVA 2BGNA 4GKBA 4YJFA 1KKMA 5C51B 4BNUA 2V45A 3LXMA 5GONB 1TCUA 4AJOA 3FNHA 1EKXA 4A4DA 1LF5A 5BSUA 3U44B 4IZ6A 1XFAA 2O19A 1E59A 3ZWMA 1Y8CA 221PA 3VR1A 2CHUA 1P7PA 3U7RA 821PA 3CB4A 3WLQA 2XAAA 4IO1A 3N5CA 2PRYA 1OBHA 2X22A 2CYBA 3AHDA 1MX1A 1ZI9A 3DXYA 4EI8A 4OOFA 5HMLA 1MEJA 1UM8A 4LCJA 1Q77A 4NYMR 3PGKA 3OTGA 5SZKB 5CH5A 1YB6A 1PK8A 3D3WB 5BWCA 5L3QB 1MBZA 4XE5A 1FDTA 4JROA 3VAYA 2ZRKA 4EO7A 3LLCA 4K0KB 3ELYA 5A4JA 1NWCA 4PPFA 4TMWA 1W30A 2DP4E 4RY8A 5CT8A 5CFOA 4HLUC 1NI4B 2FFAA 4MCJA 2IV7A 4RABA 4CHTA 1KHTA 1Z5NA 5EJGA 3ZIAD 3A6PC 1ILEA 5A62A 2BUCA 1UMDA 2PO7A 1ZH6A 3AUJB 4KXXA 3OEEA 5KINB 1QQAA 2NTYC 4YEDA 4NNOA 4WNYA 5KDLA 5FUBA 2A5GA 4DGQA 1DMSA 3FGPA 1LPPA 4AECA 1KPIA 3GLRA 1NJSA 3FUXA 3O2SB 1KQNA 2VWHA 3RKUA 1XZFA 5FDFA 1B0ZA 4GP9A 3S99A 2GJ8A 5BP7A 2BV3A 2NV0A 4UXIA 8MHTA 1FPQA 3MRVA 5AYVA 1JJIA 2HSDA 3DC2A 2OORC 3EBOA 1RCTE 3QUBA 4UE6A 1CV2A 5C5CA 3STHA 2AIRA 3SSAA 4X3CA 1S3GA 5DXFA 2BMEA 3SIRA 2IXEA 4IIEA 2VAPA 3DKIA 4OFZA 4DN6A 4H59A 4DLNA 1Z35A 2E1PA 2ID4A 1EK2A 1KEUA 1KYVA 2PH5A 1AKVA 3OIYA 4AIRA 3W5CA 3B9BA 3LBFA 3ZY3A 1ZO8A 3GRAA 4HTFA 4Y3UA 4I6JA 1W75A 2DPHA 3HVHA 1IWPB 3L1UA 5AJYA 4RVHA 5KNCH 1V3QE 3N8HA 4G0ZA 5EXTA 4RQTA 3ROZA 5HJEA 3EPLA 1FFXB 2O3UA 4UBOA 3K09C 1TDJA 3KPVA 4TXMA 2VN8A 2W98A 2O3JA 4ZOEA 3OP1A 2DQSA 3C15C 3PPWA 3UV7A 1H1LA 3ZHQA 4C0QC 4Q7MB 3M5PA 4JIMA 4WMLA 3GFOA 4OQLA 3V34A 2VDVE 3HGMA 2IQIA 1K89A 1S7CA 3A9UA 3ZCUA 1CRZA 2P2GA 1Z82A 2QI9F 4MOWA 4XQCA 4F86A 4GUAA 4D6PA 3HR7A 1GQ2A 5IH7A 1I7NA 1RM5A 4PQFA 1SQSA 2FEWB 4YJKA 1AKMA 3FJYA 4N0DA 1XQ1A 1RQXA 2BTQA 2FSPA 1FSFA 1YZGA 3K92A 3PFCA 4GLOA 5CX4A 2X77A 3RSOA 3U31A 3R09A 4IWNA 3WOHA 3BX1A 3QLVA 4D98A 2JKVA 3LLVA 3GUCA 2C9MA 3R6DA 3TSAA 4OM7A 3DDZX 1UOPA 4V0SA 4CN8A 3W6ZA 5LA6B 3CVVA 5K4GA 2R3SA 2GN8A 4MUAA 5AVSA 2QPTA 3KYIB 3PDIA 4WW0A 1HLFA 2X58A 4FKZA 1BVHA 4IDCA 4R8MA 5JS1A 4UEOA 3DKKA 3WGIA 1JVSA 2PBZA 1C4XA 1IYZA 1VG0B 5B58T 3VTKA 1RKUA 1SULA 2YXPX 3H2HA 3VMFA 3K70C 3NDIA 1JQKA 2VH1A 1O0SA 4QDZA 4ILEA 2ZROA 5JPIA 1ZZEA 2WAMA 2SKCA 1JFLA 1P39A 3DUFA 3OKFA 4J1SA 3ZN2A 1A04A 2DVMA 3QELB 4PYNA 1XROA 1PFUA 2RGAA 3FOWA 5HIMA 5LYYA 2NX2A 3AP2A 3E70C 4HDKB 4P3PA 2EQBA 3V55A 5M7EA 3UHPA 1M34A 3HJCA 4IM7A 5AIAA 4ZQGA 4B7AA 3JQFC 3QWFA 5AW9A 3H1FA 2I65A 5CDHA 5DI3B 3EW9A 4D8XA 5FBRB 1R88A 3PXXA 5ER6A 4INOA 5EJ9A 2HHLA 1EI9A 1TVEA 3IEKA 2WUVA 3ZNQA 2EZTA 3EA0A 1TPZA 5CX1A 4IIUA 4QJBA 3OC6A 3QPUA 4PCAA 4RVOA 4GGMX 5D01A 5JW6A 4R5HA 3WMXA 1E61A 3DOCA 3K9BA 3ABQB 1H0RA 3OQIA 4BWGA 2D1YA 5KQMA 5LXTA 3QRWA 1AZSC 4ZHSA 4IX9A 3HNOA 1Y8QA 3OKAA 3IUPA 2NZ2A 3GX1A 4PCUA 2C2XA 5FNVB 1T2NA 1D9XA 2PY6A 3HK2A 1TMOA 1RXYA 1KDVA 1QFJA 5KREA 4A2QA 1Z4NA 2XVAA 1FFBA 3S6JA 3U0BA 3WMEA 1Z26A 1DUSA 2Q2QA 1EB8A 2G0AA 4D74A 1C1XA 4KUHA 5HOEA 3TGPA 4HAWA 3QKIA 4FE7A 3DFIA 1X92A 4N5MA 4HNUA 3CB2A 1FRQA 3SZLA 2SKEA 2ZT8A 3WB2A 1NLFA 1ODFA 2QEQA 2EFDB 2SKDA 3HCAA 1R6DA 2A9OA 3FPFA 1CY7A 3QWIA 4N39A 5CNIA 3VPGA 3WKBA 2JCXA 3OBBA 4R01A 1XCJA 4Y2YA 4EYEA 4NP6A 5K0BA 4HYYA 4UXJA 1PO7A 4I14A 4H7FA 4UD2A 4TYMA 2PZKA 1W36D 2QX8A 4JJFA 2FP4A 4MROA 1ZJJA 2VRNA 1ANKA 3DBVO 4G65A 4O0MA 2DSNA 3F3YA 1KARA 5DBIA 3IA7A 1N33B 4E32A 4QG7A 3EH2A 1DEAA 2I6XA 2GZ1A 2ZYWX 3H0CA 1WKBA 4ZPXA 5I51A 4Y7DA 1HRKA 4Q9LA 3VR2A 4GSYA 4IOJA 3FZQA 5IANA 1A4RA 2ECFA 4B43A 3GLIA 2OFOA 1J8DA 2HF9A 3ILVA 2GWRA 1VYVA 2FF7A 2Y77A 1RRGA 4NTZA 4CIXA 3GWZA 1DZ3A 1MOQA 1IONA 4Q7LA 1E6UA 2IOQA 5CLFA 5K6TA 5AI9A 4JJ8A 3GEEA 4ARZA 4C6RA 4ER6A 3ZV3A 2PGJA 1LF0A 2NVWA 5K0SA 1M75A 1UXKA 1GPJA 3GGSA 4RLSA 2VJLA 4NICA 4DE5A 2R8BA 3SIPA 4BJ1A 3NTUA 3SJUA 2P40A 1QBGA 3B78A 1QOQB 4UNIA 4EDFA 2OZVA 1VIYA 2PCJA 1ZM3A 4ZI2A 1VBMA 3TGWA 2FQXA 1ENPA 3V4VB 1WDWB 2NIPA 1N3LA 4D45A 4DIDA 3BD7A 1QV6A 1SBQA 2IYTA 2FGKA 1EFRA 1RQNA 2VPIA 4E7OA 3V8VA 2HLDD 4R98A 4OHXA 2V7QA 4XUGB 4Z3KA 2E5FA 4FLMA 4IMRA 1B00A 1V25A 2I9PA 1I1HA 3A28A 4MWBA 3V4LA 2DY0A 3A27A 4WACA 2O0JA 2NYUA 3UAGA 4A0GA 1BCRB 1Y3BE 3NALA 4DTIA 4P38A 3HZZA 5IVKA 1EUDB 1OBVA 2XF8A 5KAPA 1MIOA 1ZFNA 2PN1A 3LUGA 3WK8A 3ZCXA 5CFPA 4MR8A 5KOJB 3IJPA 4LE2A 2CKDA 4BIIA 1EEHA 1CQJB 4X1IA 1G8JA 1O97D 2C98A 3ANXA 3LCJA 4PZLA 4G07A 4MWDA 1C7FA 1M67A 3DJFA 3F9CA 1NOKA 1R1DA 1VKZA 4FGSA 4R41A 5BN4B 2GD1O 5B37A 4YV7A 2G04A 1A4UA 5JQGF 2IXGA 5CNJA 3ZHBA 1QLWA 4J0EA 2NO5A 4Z53A 5CVJA 4RFSB 2UUCB 1HBJA 1R4NB 2PMFA 2WUFA 1E2KA 1KPHA 3FDFA 1OTXA 4H4EA 4OGKA 1JE0A 1QO0A 2X6RA 3QJYA 4EI2A 2IBSA 3REGA 3K6JA 4UMEA 1CUHA 4MRRA 1BKDR 1U98A 2A9VA 2PKRA 4EKEA 1A7JA 1YJ5A 1V95A 1JMYA 3NAGA 4AJKA 2DPMA 3WRYC 3J81k 4YXWD 1PW7A 2B7BA 4DC1A 2C2KA 2O2DA 3G9TA 3RB8A 1UIRA 4JCOA 4EBFA 2FRDC 2J9YB 5CA0F 3FFXA 4EKDA 2NUTA 1WZ2A 4IINA 3CX3A 4JJIA 1Z6GA 3ZNPA 1C80A 1BGWA 2CLEB 3NIFB 1GFSA 1U9CA 1XR3A 1TAUA 2EAUA 4LX8A 2B3TA 1IEWA 2QF7A 1SCJA 4OHBA 4D8TA 1BRMA 3BXGA 5A1JA 3BFVA 2H1CA 1TYBE 2QVZX 2QT9A 3GBPA 5KHOC 5DHPA 3OP4A 5HRUA 4ZOBA 4C7JA 4IUDS 5KOHA 4PRYA 4DYDA 3I2GA 2FZVA 3N0WA 2FXVA 2CDAA 3HVJA 3R5SA 4QIHA 1REQA 4AJLA 1VFNA 2PRJA 5ICSA 2DHEA 1O94A 1ABBA 4F0JA 4MPDA 5KVSA 4M7RA 2YV2A 1TOAA 5CNKA 4E2ZA 1G8YA 2P79A 3FPAA 2QUKA 3O7WA 4CLEA 1MAVA 5K3FB 1E3DA 2UZ3A 3B7PA 3ELUA 3X1ZA 2EU8A 1H3NA 4M98A 2YR0A 3R5KA 2P2YA 4OA5A 1YGYA 1KI4A 1MJHA 3UHAA 4CM4A 4R71A 2W93A 5IM4A 3FIJA 4ZC1A 4K3UA 5C3MA 5K0JA 5HTOA 1QS0B 2VP3A 4PO9A 1SNYA 4DYHA 1N5JA 3AESB 2A9FA 2Z09A 2VQFB 4DARA 2WSLA 1SCUB 5TJ9A 1E1QD 1JTEA 2FPPA 3KR2A 4C03A 1A9ZA 4WOBA 2WU0A 5EE9A 3OQJA 3OURA 2PWYA 1ELOA 4CIVA 4YY3B 2GFQA 2PPLA 4UTXA 3RT9A 4L3VA 1F9EA 4UD6A 1W1UA 4O4LA 4E09A 1YL5A 4F85A 1XRLA 2OBNA 3R0QA 4LXHA 1QVWA 1O57A 2ZFUA 5LQMA 3MCWA 3T9CA 1DB3A 2IXFA 5ESDA 4X6LA 4F2PA 2B7CA 4ZZ3A 4UU0A 3N2KB 3PWSA 4L5YA 1T2CA 5F1OA 3H7IA 2J46A 5B7QA 1RLIA 4Y9RA 2E5WA 1KFJB 4JMPA 4N12A 4RS4A 4ZP1A 2BMFA 2FMXA 5JALA 3AL0C 2D1FA 1L7RA 1ZAKA 3D3EA 1HUQA 4C1NA 3ANYB 5ITZB 2A0WA 4H16A 1JL3A 3E3MA 3RS2A 5LMNB 3KZCA 4JUCA 1IB0A 4MR7B 4LQDA 3TINA 1H1DA 4CWAA 3EGDA 1FDVA 3TDNA 4EYOA 5CDUA 2GCOA 1KE1A 3CH5A 1E89A 1ZONA 3T8YA 2WG1A 1E32A 1MTZA 1I6LA 5FI0B 3VO2A 5J2TF 4II2A 3RBZA 1KOFA 3OCXA 2H7XA 2VNSA 4ND8B 4QBGB 4YP0A 5LP6F 1F2DA 4B74A 3HFGA 4ML3A 5JAQA 2KBEA 4R2WA 1YDWA 2Y05A 3KWLA 4B09A 2C4NA 1N6OA 1GPNA 1OX6A 3IHWA 4GP6A 1BD4A 3HWX1 5EY5B 4QUDA 4MW6A 2Y68A 2ZR8A 2VS1A 3I39X 4WEOA 3V00A 1QM5A 4K9DA 3MTIA 4QFCA 2I55A 5A3QA 3L93A 2PX2A 3D2BA 2JVKA 2D0OB 4ZD6A 3IUNA 5JCJD 2OAGA 1YQUA 4EHDA 2Q50A 1JTVA 4NHOA 4MKRA 1LDGA 2O7NA 2X0IA 4YDSA 3K72B 3ROFA 5D86A 4DM7A 2O7VA 4G25A 5AM3A 3FNQA 2R96A 4PAQA 4BB9A 1T6BY 4R1OA 1NFRA 2CDNA 3EWNA 1XDGA 1KP2A 2R87A 1GEGA 1UBSB 3W3AA 4HQ0A 3N2NA 2JK1A 4WZBE 3BK1A 3HDTA 1WUJS 3WXBA 5L45A 4BUZA 3IERA 3IHLA 4EG5A 3IP3A 1PTJA 3OF3A 2GPJA 4UHKA 2X7XA 3ABIA 1FNNA 4QREA 1T4CB 3DFFA 4P7GA 1O89A 5D3ZA 2QYTA 3RBAA 1W73A 1XPJA 2OLJA 2XB4A 2XOKD 1ORTA 2ZJYA 2ZI7A 4E6EA 5CYOA 1JHXA 1CY8A 5T57A 1JPJA 4NWIA 4A10A 3KXLA 3P27A 3CF4A 4NXNB 1J90A 2AK2A 1KAQA 3OKCA 3DH0A 1ISGA 4ZHQA 4Q15A 2PO5A 4HEJA 1EK0A 1ZCZA 4RD2A 3E4CA 1QU3A 2XWJI 2HSGA 1T5BA 5MN5A 3LT1A 5J1TB 3VPHA 1U8TA 1NDHA 2IT1A 3LYLA 5AVRA 3DDSA 3JAWB 1Q3HA 5DGIA 3N75A 2QX4A 3TG8A 1IVYA 1X7ZA 1VZ3A 1Z16A 2HTFA 1V11A 3MJSA 4NOJA 2H57A 1E3TA 1AXGA 1QGYA 1TYEB 1EE1A 2A1UA 2XXBA 3FHOA 4MQEB 4ADSG 4MX8A 4LS3A 4N5LA 3K0CC 3VU3A 3ENZA 2QE6A 1R0CA 3M6UA 1EFLA 2DUWA 4GECA 3W5SA 4RCYA 3E5RA 4G5XA 4BLRA 5HUJA 3CG0A 1RLUA 3FR7A 1VG1A 2TYSB 4LHXA 3ZWDA 1V6CA 3WYBA 5KSOA 4OXRA 3E0QA 4KRFA 1ZKDA 2ET6A 3PL5A 4M1SA 5G40A 4DR3B 1RKQA 4MVJP 4R0VA 4OAPA 1NF3A 4BN4A 5F52A 3VH3A 3JSAA 3LVFO 3BHJA 1YVUA 4GP7A 3GFQA 1L7QA 2WTMA 4RF3A 3WLAA 1SKUA 1W5EA 3IUEA 5TPWB 3BICA 4OB8A 3WHPA 3JZIA 3MLEA 5LNK1 3W6UA 4DRYA 2JIMA 4C05A 1AN9A 1EE2A 1C7QA 1HDCA 1E6KA 1JQJC 1IJEA 5AW0A 1M2JA 1UL1X 2ZRMA 3Q7PA 3QMMA 4D4JA 3KOMA 2JD1A 3EZ7A 4D4GA 1N57A 3TVDA 4E88A 3MT8A 3N6VA 5DYGA 1WV1A 5K3CA 1COWA 3U17A 1C7RA 3SBDA 4OU4A 4YRQA 4UFOA 4UDYX 2PSJA 3FNBA 4MB0A 4GXRA 2X8AA 4KNWA 4Y18A 3UJBA 2BBOA 2J3MA 2V9CA 3CVOA 3P0JA 4S2EA 4D0LB 1MT3A 3IDAA 4HUQA 2CD9A 5CJ2A 1QFZA 1U3TA 3AUSA 1YA4A 5ALZA 3GYGA 3B1WA 2G9QA 4P3OA 1GNRA 1KFEB 3ANNA 5BWBA 2JFOA 2NAPA 1SZPA 2I8LA 1H05A 1Q7EA 3LYHA 4IJQA 4JDPA 4EGCB 3ZKWA 1GGNA 2Q46A 2YS6A 2DPLA 4JD5A 3GA7A 4B47A 3SVTA 5JYCA 1UDRA 4OXKA 4OK3A 4MUFA 5IT0A 2OZLA 5E95A 4PFKA 3TZBA 1V8FA 1P31A 4V0OA 2NW6A 2EDAA 1YI1A 1YACA 4GR4A 4MTCA 1Y7LA 2VQ3A 3GJYA 2QMYA 3GUVA 3CZRA 4WJKB 1XZKA 2EF0A 4CM5A 3HE3A 4FONA 3EXG1 3AC0A 1Z4PX 2QXTA 3BYZA 4UKDA 1Q6ZA 3QVVA 1N6RA 1R00A 3PUKA 5P8WA 1FU4A 1EP2B 1DG1G 2WJ4A 3I73A 4R1UA 3OE1A 3TECE 1CVIA 3CHYA 4L02A 4LECA 1UBCA 3V33A 2VEDA 3B2EA 4JLKA 4OLHA 5T8KA 3U7JA 2GWHA 3WQBA 1G8PA 4V39A 3R0XA 4ZMSA 4AI6A 4MGKR 4IY1A 5H8WA 3FNFA 1SPXA 2VJCA 5A3RA 3FOEC 3IKLA 5DYNA 3T3NA 4I08A 5KPJA 1SKYB 2E48A 3IMGA 2XUHA 2IJGX 3JAKA 3LYAA 3KVOA 4K6GA 3L07A 1P0QA 3OTWA 2CXTA 4QYMA 5DZSA 4TYWA 3MIIA 2VDRB 1TTTA 1IY0A 3VI3B 1EWKA 2IELA 3SZUA 2QB5A 1KOJA 3BFKA 4OI4A 2IP4A 1DJMA 1V7QA 5KDOA 3C7TA 4GPAA 5J58A 1OZFA 3TNJA 2FR1A 2HBQA 2BEUB 1TAGA 3CLSD 1AIPA 2FR8A 1ZRSA 1E9SA 2JFQA 3WKAA 3KJEA 4FDUA 2HMWA 1HF3A 4I1PA 3F6SA 1S0UA 2QUIA 1T9BA 4XWWA 4IFBA 3LTEA 1KAGA 2JJYA 2PLFA 3HUDA 3AEQB 2JEOA 3HL0A 4QLOA 4RJJA 3ZDXB 1PR6A 1W8DA 2O0HA 4RH3A 5CR9A 1XTQA 5JCXA 1M6NA 2ZJBA 2V58A 2OYRA 1C3XA 5JXHA 2GK7A 3HCDA 2NYVA 4K9KA 3USES 2YMPA 3NG1A 2C83A 1P0FA 1KQPA 1QK3A 2XZOA 5HCNA 4LE1A 4BMVA 2XHZA 3NO4A 4FSDA 2JH8A 2OO5A 4JT8A 5FLXA 2IOHA 3W8FA 1KMQA 1QG0A 3BSSA 2NLOA 2Z9BA 3FZYA 1OPXA 2C54A 3Q15C 2RC5A 4NYJR 5C37A 1EXMA 4JGBA 4Z3DA 2VBIA 1X86B 4X1KA 1T6YA 3AL3A 3IMEA 3RK0A 1I4WA 2QX7A 4QHTA 3H99A 4PYLA 5HF8A 1O96B 4RZXA 3GRZA 5BRNA 1Z0ZA 3GROA 5EKDA 1QWSA 3PQ2A 1BJRE 1MGOA 1T2AA 4HQLA 1EWTA 1WU7A 5JJLA 2FG7C 4LJ9A 1W34A 3VZQA 3DLIA 5J5CA 4ABYA 1X8LA 5BWLA 2NU7A 2WJJA 2LBPA 2V03A 2Z5VA 3H87A 4R2JA 2EHDA 4E33A 5ALGA 4PYOA 1TC1A 4TKMA 3IBGA 5DMXA 4FYJA 2F55A 4C4OA 4D3YA 3G0BA 2Z1DA 3L02A 4LJAA 4RVSA 4AY6A 2NN3C 2W70A 2FLVA 4CEJA 1S02A 2FU5C 1JSCA 2R60A 3W5BA 3O4IA 3IJ5A 3IQFA 4UARA 5KNDA 1MB4A 2GOYA 2ZAYA 3O8QB 2IXDA 4KRGA 1TM5E 4XIGS 5B6IA 2B5OA 1L4FA 4MICA 4N3BA 3RFXA 1CQXA 3T9BA 4EMBA 2XTMA 3RK1A 2FSHA 1MRSA 3KB2A 4HD8A 2ZRHA 2RGEA 2I4RA 3PVCA 4FHZA 2IQ5A 2FN9A 2QD2A 4DUGD 2B34A 1G291 3RUFA 3ZI0A 3SC3A 1S2NA 1TUEA 3MQ4A 1GUZA 3BGIA 5FL7D 3QE4A 4E94A 1FBNA 1MIHA 3TZKA 4PC7A 1AD2A 1JIIA 1QSGA 2B61A 1V7PC 2QX6A 1XPOA 4UCXA 4D57A 1XXHA 3KDSE 4PLGA 1IE3A 2XE7A 2X41A 4LBYA 1UT5A 2C9YA 4FDVA 3F74A 4PVCA 4BKRA 3OTOB 5BW8A 3QF4A 4LRTB 3VKFA 1W19A 4YAIA 4YASA 1QANA 5EIBC 3BJZA 5AI6A 4YJ2F 2DUUA 3VDRA 3MD0A 4Y2RA 1UJ5A 3AERB 4BV8A 4DV3B 1YA6A 2IPAB 5HS4A 2PRSA 1E5VA 1WULS 4JJ7A 4ZOLF 1WB9A 3T38A 1D9ZA 4RKYA 2H9YA 3B52X 4OLAA 2RK3A 3UXMA 2YFKA 1WLYA 4MS1B 4JJ4A 1DV1A 5EL0A 3BB1A 3H0KA 4JLVA 4PC1A 2GYYA 4C7KA 4R0MA 2RD2A 4OYHA 1HNNA 3P20A 1H2RS 3R4CA 3SR3A 2P75A 2AD1A 3DXFA 5CMLA 3STVA 5EN4A 1Y1SA 1ZRHA 1ZYUA 4IWXA 1NASA 1FLNA 4OK5A 3VR5H 4E7PA 5I8PA 2R8PA 4LV5B 4G2TA 1NE2A 2CLHB 2Y99A 4BQPA 1ARZA 3CIFA 5LNK6 2XWQA 5TR9A 3FCEA 1DAOA 5IEJA 1I6KA 3Q7IA 1JEDA 1XI2A 4UHJA 4CQMD 1IEXA 1E2HA 4H6XA 1E18A 3ONEA 3GELA 4H1TA 1Z73A 4BVEA 2J9FB 1UFVA 2CDCA 4GYWA 4LW8A 1Q7GA 4PBSA 4ZQCB 1RI1A 2IZOA 4YA6A 1LDBA 1R9MA 1SCKA 2XDYA 4YGXB 2G40A 3P4XA 3QM1A 2Z3VA 1PT5A 1V6AA 3BXEA 5ED0A 5JWRA 2CF6A 2FSUA 4BLOA 3GFPA 1NKSA 4MP3A 2PK3A 1D2HA 4DSOA 1Q19A 3FTNA 4KIWA 1EU1A 2WSYB 3GJRA 4JODA 4DA9A 1AHIA 1ZMTA 3H1BA 4KXLA 1P5ZB 3ZU2A 4CUZA 4HDMA 2VKTA 3AOEA 4TXLA 2R25B 3AF3A 2C03A 3FHCB 1PLKA 2YIDA 2C1ZA 4V02A 3U3MA 3NV7A 4WN9B 2OGUA 4PLVA 5MN4A 4G0QA 1GRNA 3M5WA 4CM8B 3G1UA 3NDJA 2D06A 3NJ8A 3OEWA 2VUIB 5IJ9A 1JU9A 3BJIC 4A0FA 2ZEJA 1XZDA 1TT5B 2OOSA 5DTIA 1GNVA 4NX2A 3C6ZA 4IHQA 4P3NA 4P7JA 4WPGA 5A3SA 3T41A 4LV6A 2KI5A 3TRKA 1Y9ZA 3QWBA 3V7FA 5E3HA 4C2AA 1P8JA 2OL4A 1J0BA 4E5NA 1PNRA 3RS0A 1XT6A 3IDOA 4RANA 3NHJA 3L0BA 2GN6A 3DCJA 3N1UA 3UMVA 2G6TA 2PXHA 3WI7A 4PTLA 4ZI5A 1UPFA 5LZ8A 2D0DA 1GYPA 1T9HA 3D8HA 3SQLA 5IXJA 2O9JA 1EUQA 2V3CC 2CVOA 2M98A 3UH0A 1WHSB 3IAHA 4KQJA 2XXJA 1U3DA 2B1GA 3UH1A 3W2TA 4A5OA 4BAZA 3GAZA 3A2NA 2OENG 3RD5A 5DW0A 1FEZA 1DCMA 3WE7A 1QGUA 2D0PB 1LVUA 4ERXA 4FDMA 3GFRA 3URMA 1P4HA 5REQA 2IU6A 3N9IA 2OFFA 2G36A 4AP5A 3LAWA 1L5NA 1U99A 1A8UA 1JMVA 5AJUA 3L40A 4ZANA 4BQOA 3DVAA 5E9WA 1MZPA 1P7YA 2AFRA 2AT1A 3O1LA 2JJ1A 3ROPA 5C1PA 3MPUA 1OBOA 1C3VA 1KDPA 1RYHA 3B53X 4YCSA 2OAQ1 1BW9B 4FJ1A 1YKFA 3PDHA 4BKQA 4DQVA 5KTPA 1T36B 3WMGA 4KBGA 2B4AA 2FQ1A 1DOAA 1YJBA 4TMVA 1ONSA 2CVFA 4U5QA 3UA4A 3DE2X 4AU1A 1XAHA 1HH4A 2G4VA 1QH1B 5ALOA 2OORA 3F2VA 3PEWA 2AQKA 1WM1A 4B6OA 2E9SA 5TE9A 5DEOA 4DRXB 3WLRA 1VC2A 1TMKA 1DAPA 3MBIA 3T3GA 2XDQA 3A3NA 3M6LA 1GRVA 3M1LA 3RAPR 2CZQA 2ZUBA 1QHHA 4BO0A 4CQNA 2QE7D 1ZK2A 2VSYA 4LZPA 4IBOA 4TYPA 3MSXA 4ASUA 1CUBA 2QGFA 3LUDA 2LDBA 2OPHA 2DQZA 2YWEA 3UJHA 1TAQA 2P9GA 2CFOA 1GFZA 4QBTA 3JQ9A 2FWMX 2UUAB 2Y1XA 1DAIA 2WW8A 4TRRA 3VKHA 4ND6A 1FFCA 1UWLA 1QO9A 1FX1A 1QYIA 2HCFA 2QSYA 2ZBVA 2Z8YM 3E22A 4O5AA 3WSWA 3JWGA 3R3JA 1TIKA 3H1PA 3K1YA 4RV5A 3IIEA 1WMSA 5CU7A 1Y4UA 1GGEA 4ZARA 4TLBA 4NMMA 1ZL2A 3MINB 3IC5A 3QYJA 4KH0A 3JPYA 3K1AB 2PNJA 5KHLB 1WNTA 3Q41A 2JGDB 1I7DA 1W46A 1JLMA 5EE1A 4IDHA 2HD4A 2EFCB 1QYVA 3H3JA 3GJQA 3RLFA 2UAGA 3ZYCA 4PSKA 3QFTA 5EJAA 1P6QA 3ET4A 3GZJA 1DWPA 3SGLA 4HDSB 3JARB 1H4SA 2GJ4A 1E69A 2BHLA 2G63A 2XQIA 3JWIA 1KORA 5GQSA 3BWVA 3OJWA 2ZWIA 1T10A 4O2AF 1G21A 4G24A 2BI4A 2PQ0A 3B36A 1JN0A 2W2KB 3O47A 1CUIA 1YRBA 2ASEA 4ZAWA 5KAMA 2J4DA 1UWKA 3VYWA 4AZ3A 4F8EA 3E8SA 2D2EA 4Q1AA 1Z06A 3KJZA 121PA 4GQBA 4M1QA 3HKCB 4OB7A 3QOYA 5G1NA 4CTJA 1B8UA 2XZPA 3S2ZA 1O6FA 3ZV4A 1ZNYA 5BRJA 3OX4A 1Z2CA 1T1RA 4AQDA 2RJOA 1BVRA 5CXQA 4TLAA 4ZJPA 3VVCA 1UR5A 4HMQA 3BJMA 3RABA 5ERGB 1D6MA 1XEWX 4CM9D 4YUAA 4D43A 2PDAA 1L5RA 3ZWAA 3SE7A 4KAJA 4Q48A 3A6ZA 1VMAA 1W36C 5GIOE 2W6JD 1G1MA 1NSFA 2F8LA 4J3NA 3JD0A 4TMZA 3VX3A 2HRBA 2GZHA 3TKYA 4W99A 1WS6A 5HJ2A 1KZHA 1XZPA 3NIDB 5HRAA 2LXNA 2ZJ5A 4NK4A 2K6GA 2CNLA 1UAAA 2ZS7A 1WRBA 1TZBA 4OQXA 3I4LA 1G20E 5JSZA 1FMLA 1GZ5A 1QTNA 1RM4A 2CJWA 3AEKB 3H17A 3OUTA 3CF6R 1IOVA 3S68A 3W2IA 3L4JA 3SS9X 1C8LA 4DJDC 3O92A 3KZMA 1NW9B 4YK7A 3JWEA 2P0YA 4U2FA 2RH8A 4D4IA 3BORA 5FADA 2IYVA 2VDKB 3NEPX 1VP3A 4F96A 3EBLA 5AJTA 3D5QA 3QPCA 5L95A 2J09A 4BNWA 1O1YA 4LISA 3KPWA 4BFWA 3K0HA 4BKMA 1VL1A 2PSEA 5JQGB 1Z47A 1KFCB 3EXFA 4ZREA 4CL8A 4RS3A 4LHSA 4CG0A 3F47A 3NHFA 1GDTA 1PP4A 3ABRB 4BFCA 3AI1A 4Q4HB 2J4FA 1CR1A 2X4IA 2VCYA 1POWA 3H18A 3TZEA 2O5VA 1FPMA 3WMRA 1NMQA 3ECSA 1MAUA 4RIGA 4EABA 4RTOA 4MI3A 1X94A 1M8GA 1UXJA 3GDWA 3ZU4A 3RC1A 2C31A 4U7FA 2RH4A 3B7WA 4L28A 4ZT5A 4V0QA 3TVTA 5CA0B 1E3MA 4EELA 3C3XA 3RJ5A 5D2CA 4HHEA 1NSTA 3SEFA 1NI3A 3JS5A 4RK5A 4CMEC 1GPKA 4HDCA 3GLIE 4YUYA 3P9NA 1WCYA 3ZGYA 8ABPA 5INTA 2WWVD 1UBUS 1W47A 5FUMA 5L3SB 2HQSA 4LKOA 1PNOA 5IXYA 3ITNA 4JGGA 6LDHA 1QBKC 3SMVA 3GT0A 4Y2TA 1EXDA 1O97C 1NA5A 2YN4A 2J0VA 2QSUA 5ETJA 2YNMA 5D3MB 1PLJA 2C77A 3HB5X 1SFRA 4JWKA 5FOQA 4J0IA 1RAHA 1TJPB 2YWGA 3ZDEA 1Z74A 2C5LA 1MABA 2QMQA 4R4JA 4BUCA 5CDGA 1KK2A 3TZ6A 4MYCA 3OU2A 2P1DA 1NQUA 2PSSA 3Q98A 2GNAA 1KYWA 3GRRA 5AT1A 3VISA 4KXYA 3OZWA 4TZKA 1WZCA 3GNSA 1OA1A 1JXMA 2OECA 1T3TA 4FYKA 4IWYA 4QJIA 4WCFA 2WE7A 4XJSA 3TQQA 1CDEA 4LCBA 5JARA 1UZMA 1W2HA 3PHJA 1C81A 3T3MB 1QRDA 3D4BA 4XCVA 4K9NA 4CM7A 4TQUS 1PT7A 1DP4A 5KJ1A 3L04A 1NNLA 1GPAA 2XEDA 1FYDA 1R8YA 4FR2A 1NR5A 3DWIA 2QX9A 4DLRA 4Q4JB 3NT2A 4WT7A 2A4MA 1K7CA 2C2HA 4HVAA 4WINA 4X3OA 5FPQA 5KNBH 2WF7A 4I5IA 4P32A 4JBGA 4RK6A 2WA1A 3LYUA 2VXOA 4CKBA 3EZXA 3K0BA 3KR0A 4ZMBA 4OJMX 2NYAA 1JNYA 3PPXA 5LZ7A 3X1MA 3CISA 1KY5A 3IEVA 1KP9A 2HPZA 1PZGA 2Z30A 2HQOA 1I80A 3AR9A 3ETEA 4KDCA 1MD9A 3WJ7A 3C24A 2DU8A 2MYPA 1UBNA 4MS3B 2YH2A 4MI1A 3CVYA 1EX6A 6CHYA 3UXYA 4CIAA 3MJDA 4P9NA 3OPYB 3BB3A 3FPKA 1T9CA 5KSZA 1VPWA 2DE0X 4AXBA 4F3KA 1SXJE 1U9IC 2O3SA 3BCHA 1XVTA 2FW1A 2LD4A 3JZFA 3IILA 5FA5A 3M89A 1DWQA 3BMQB 5SYAA 5ITVA 2NWQA 1PFYA 3QY9A 2QN6A 5ISMA 1E1RA 1W5SA 3D54D 4GT1A 1D1QA 4ZOCA 4ZEOA 4TYYA 1XHLA 2HCJB 3RIMA 3O3MB 4MKFA 4ZV4A 1T9GS 3L7AA 1W0CA 3FUTA 3DFMA 5A02A 4GRIA 4B6PA 1TU0A 1OTHA 4YJDA 1MXFA 2X9NA 5J2TB 1JG6A 1J2UA 1WVGA 4ZOQI 4CFZA 1TF2A 3HPRA 2ZRQA 4N3GA 5ENZA 1F6WA 5LP6B 5DJ5A 2ODBA 5FFFA 4I6GA 2VA8A 4POAA 1P1JA 4ZV7A 4MDEA 3LKVA 2JAWA 4P6VF 1UBOS 4XX0B 1B8NA 2IUFA 4PSDA 1GPDG 2ZU0C 5F1PA 1E63A 4I9UA 3EDYA 1ECGA 4L5IA 4JA2A 2ONJA 4BZXA 5LPNA 1NNI1 1W88A 4B44A 1EVEA 3GRUA 1GTMA 2W6NA 4Q7JB 2ZXEA 1T9GR 3HFSA 4J0QA 5IVIA 5FBVB 1K5PA 4KQKA 3V32A 3A1TA 2RI6A 1KI6B 3DD1A 1XJQA 3BMXA 4I1IA 2D62A 5K20A 5ALSA 2I34A 1RZRD 2ECKA 4EITA 2ERXA 2OV3A 3E35A 4HEA1 2JJ8A 2ORED 3I9NA 4C3ZA 1VHDA 1NQAO 3QE0A 1EK5A 4AZ0A 1SOWA 3I52A 1A98A 3H1GA 2ATIA 1H42A 2JIQA 3TVYA 4L72A 4CFYA 5U4XA 2QENA 4CV0A 2VF2A 4PV7A 1DO0A 4JS0A 3ZCQA 3SHQA 1HRDA 1EFVB 4ZALA 4MCAA 3FWYA 1IY9A 1CBUA 2CV2A 4PHFA 5HK9A 5KQLA 3RH0A 1GU0A 1RRFA 2JZNA 3EIUA 5AKIA 5I9SA 3ZK9A 2G07A 3WK6A 1DCKA 1NVUQ 1PD0A 2QRMA 2WYVA 4OATA 2P4HX 3OLXA 3LPDA 1F51E 2Q99A 3CN9A 4K1LA 4NBVA 4X7MA 5F1KA 5TQ2B 1TLFA 4KVFA 4QELA 1NPTO 2IGBA 4KYTA 1H2WA 4H3VA 1GTG1 3CIOA 4AJIA 3U7HB 2FW6A 1X7YA 4X1YA 2XADA 2D1TA 1W0JD 3DE0X 3WZ2A 3FYCA 1PVOA 1BEUB 3CNLA 4MA4A 3JQQA 2K4MA 2OQVA 1V4VA 2QAIA 2V0CA 3JATB 3M6IA 2D2VA 5FAKA 5J5AA 3WRXC 1P73A 4ZVLA 1XA4A 2FW9A 5MHTA 2WFLA 1N7HA 3MRXA 4AJNA 4Y6GB 1KI3A 2R8YA 3RBVA 4KK4A 5TVKA 1JHUA 3C48A 3OWHA 2KB0A 3ZV7A 3ZCTA 2C29D 1ULBA 4TSFD 1BN7A 3H9CA 2XNDD 3F97A 4XLTA 2NVOA 2YZGA 4Z9XA 1BOFA 1TYAE 4QO7A 2ZXFA 3PI7A 4WXRA 3CUUA 4XAQA 5DBGA 1DKOA 3CZPA 1DBRA 3DE5X 4ZYWA 4M0UA 3GLUA 3LNTA 4Z3OA 2WFMA 2Q8QA 3ND6A 3CS3A 4QEZA 5AJXA 2VL7A 2P1ZA 2PQ2A 5FOXA 4ZV9A 1IJKA 2JG3A 4YROA 5IKMA 4DM4A 1RYFA 5DI9A 1VSUA 1GL6A 2X5XA 2CEAA 4LHWA 1ZU5A 3OM1A 4PNPA 4F06A 5F2NA 4L4ZA 1P6XA 1QHGA 5D6NA 3VYRB 3K94A 3T99A 3AT1A 1H2BA 1IEQA 1PUJA 1GAEO 1HDIA 2GYVA 3DE6X 3KSBC 2RKBA 3AHGA 3EAGA 1X77A 1ZA2A 1NFQA 4NATA 4AUNA 2EBWA 2XGJA 3CLVA 1YI8A 1JYEA 1JLLA 2QL7A 2C57A 3JRXA 4KI0A 2C7OA 3HM2A 4Z6KA 3BUSA 1GGVA 1XYVA 2B8TA 2O2SA 3FTQA 3HUUA 1Z56C 1P0PA 2GCPA 3AR5A 3KEFA 4IDQA 2HMTA 2I2WA 1G19A 3F7TA 3L7KA 4HB3A 5FR1A 5SY6A 4DQLA 3C98A 2H18A 3G68A 1E1CB 2WMDA 3A0UA 2VP4A 3O0TA 3FUWA 1HWYA 3I30X 1E6CA 1AKRA 1P1HA 3L7DA 1QRTA 4F1KA 2D5BA 2VT3A 2H4ZA 2CHQA 3UVEA 3NP9A 3ZDCA 4XW2A 5K0LA 3GH1A 3RK4A 3ZGVA 1NF8A 3CONA 1AKQA 3PHHA 5KYWB 2G82A 2HSEA 1M6VA 2A5LA 2JLZA 1M2HA 3UKDA 3NMUF 1Y3HA 3P9SA 4N49A 3S2GA 2OY0A 3DHWC 3F8WA 4QU5A 5JAUA 5JJCA 3A7DA 3D02A 3T5AA 2WINI 3SF8A 2VTBA 3HZOA 5FWYB 1XTUA 2BFCB 4O4HA 4LXXA 3WY9A 4D9JA 4EAAA 4UTPA 4XVHA 5ARBA 5FORA 1M0EA 1PSZA 4OXIA 1XN1A 4LC1A 2JIBA 4C08A 4E6PA 5IMSA 3G82C 1EDEA 2HJWA 4IJVA 4R1SA 5LXTF 4JYBA 2E85A 4JR0A 3EVNA 4Y98A 1E4VA 1XU7A 2LKCA 3GLKA 4FTWA 4DIMA 5CB4A 3ZXXA 1ODJA 4LF8B 3IVMA 2E89A 2XVYA 4I7EA 3SZOA 2GS9A 2P6NA 2RCNA 3T7EA 2Z58A 3VNBA 5IK2A 1QCZA 3IUYA 5FTMA 2HN9A 2OB2A 4ENWA 2ZQYA 4IIBA 1AHHA 2LZ0A 4MQMA 4FFBB 4H1HA 1MVNA 3HYLA 3PC8C 5C81A 4WXPA 4R68A 3AKCA 1N9ZA 2ZQZA 2AE1A 3AR2A 3TW8A 3RG8A 5D85A 4BVHA 4IDEA 2ZJ1A 4QGSA 3IOYA 4Q02A 4M0FA 5ALXA 4K3VA 2OV6A 1Y5LA 1LTKA 5DHQA 5AM1A 3TFWA 3W7VA 4B31A 3TBHA 3GLHB 2QNIA 3W5IA 3LPAA 2BR5A 5BSTA 5A9SB 5FPSA 2JVJA 2WNIA 1ENZA 1O5TA 2HZBA 2FSFA 1VTKA 3A9WA 3B2NA 4FXPA 4GBED 4UATA 5AR1A 3X44A 4I8IA 4M7WA 4LIPD 3I23A 3EGOA 1Q92A 1FDSA 1WXHA 1FFWA 3OM0A 5DMHA 5T67A 3U2QA 3NB0A 4F38A 1FFYA 4FCCA 4P22A 3T54A 5D7NA 5IW8A 4RA9A 2FVXA 5EKXA 3QOFA 3HKEA 3VOBA 1ML3A 3F0TA 1ZS9A 2ZQ5A 3BMCB 4OGGA 5TX7A 1DIHA 4RV4A 1R15A 4K2HA 2PV0A 4DDWA 1MB9A 4UHEA 3A1EA 2HREA 5KVVA 3ZVKA 1OFUA 2FB9A 2R1VB 3KZXA 1B2RA 1FX0B 2HWUA 5HMMA 1UJBA 1CE8B 3LUFA 5HQ3B 4ZK2A 1ISFA 2PH3A 4BMXA 5ECGC 3QITA 4KR3A 3IKTA 5DBFA 4GWKA 5KI6A 1SH7A 5LMUB 3EF3A 1R8XA 3EZLA 3HCNA 2V7EA 3DE3X 4YHBA 3PWZA 4FPXA 5TPZA 1G7CA 3ZV5A 2X6TA 2FSGA 3I2HA 4A6DA 4BNIA 3UBTA 2IBTA 3WP0A 3NU1A 4J1QA 3GB9A 3CLSC 4XOUA 3QEMA 4HEA6 1MRNA 3E27A 1K9SA 1A9SA 4Q1CA 2VDJA 1E3SA 4J0HA 4OFBA 5T41A 4ID9A 4RDXA 1NBIA 2YVAA 5BPHA 1G66A 2RG1A 1CUCA 4HR7A 3WGZA 4LWQA 2F1RA 2ISCA 2VZLA 2XQVA 1SUSA 3WJAA 5CXSA 2ZULA 1CX9B 1OAKA 4JL5A 3SYRA 4A6EA 4P0PB 4L4YA 2CJYA 2OTCA 5TV2A 1Y9EA 1ND5A 1QTQA 3KB8A 5TGTA 3VDQA 4WE3A 3VYVA 4Z1OA 3ESAA 1WTAA 1VFPA 1TZCA 2ZOSA 4MI6A 2OG2A 2PTGA 2XRMA 2EJTA 4C4AA 4BFLA 521PA 4P4SA 1NVAA 3M6AA 4EMSA 3DAFA 4M9RA 4EUNA 1K6EA 1DJQA 3JSXA 1JDVA 1GYQA 2FETA 3OPQA 4JX8A 3T34A 3T4XA 3TLZA 1F7VA 5TT0A 4IFIA 3ZIDA 2CCJA 2OA0A 4YRNA 1VE1A 3TX6A 1ECPA 4JQYA 1YJQA 2IPOA 1P77A 3F5DA 3QBTA 5DK6A 1DPGA 5A6SB 3W4JA 1G4HA 4K9PA 4ROSA 5DYTA 4ZYVA 2WF9A 2H1FA 3JQ8B 1I33A 1ZJ5A 3CC8A 1R5BA 1HYQA 1Z5VA 3DOOA 3EVGA 3MGGA 4M21A 2FQYA 4I2VA 3EQ6A 4G1VA 4HRVA 3NPMA 1YZLA 4HC4A 3JD2A 2GASA 3P9PA 4LX0A 2CWDA 3VKGA 4YJ2B 4DQUA 1MH1A 1K1EA 1YR8A 3KKNA 2GCIA 1K9VF 4HP8A 2I4NA 4GOMD 4F04A 3TPFA 4PGMA 1QZXA 1PJ3A 1YBAA 4IDAA 4ZOLB 3ADDA 1JXOA 3A9TA 4RD3A 4EI7A 4D25A 4Y9TA 1L5ZA 4C4RA 1CW2B 3LQQA 4FD3A 4A26A 4FOLA 3RRZA 5JSQA 4MRAA 4DM3A 4EEZA 4EJMA 1W29A 1O95C 4ZXPA 2B4KA 1EHCA 2XUPA 4MQ4A 5EQDA 4EY7A 4B5LA 4G9EA 5DXJA 1V5GA 5A71A 4FZ3A 1EX7A 3BTUA 1BWRA 3PD1A 2ZT7A 3K15A 5BW6B 3QVGA 3AUKA 1XJ0A 3DR5A 3Q8XB 3TQOA 1Z18A 5DP1A 1EUZA 3J80A 3MNFA 1N7IA 1QYXA 3CFYA 4WASA 1E1YA 3K9HA 3S8MA 1NKVA 2I76A 1KK1A 2QVXX 4UDNA 4QVKA 3S40A 4RWZA 3O03A 1SIBE 4JHXA 1GZ6A 4AWXA 3D6VA 1IIRA 2HV8A 3BK7A 3GVCA 3PDCA 3A4IA 4MV5A 3S1AA 3SIWA 4P7BA 2E4AA 2PT7A 1UDBA 5HIIA 4OHMA 5TRTA 5IM4F 3AF4A 2IXBA 1XBTA 1G6HA 1J06A 1KR2A 3W9SA 2YIMA 4LGCA 4DMLA 5IBPA 3L4BC 3S29A 2XTZA 4LRXA 5HE9A 3CNBA 1N1DA 5KQSA 4CZ2A 1BX0A 4WZBB 3TBKA 2O2XA 2F7SA 2XYVA 1C7EA 5A5GA 3N0RA 4INJA 1YIAA 3C3WA 1HE1C 1XTZA 1ZUNA 3OI7A 4ZO6A 1BEEA 3GG2A 5ALDA 1QHFA 4D79A 2IEGA 4A92A 1I5EA 1JA1A 2AXQA 1SC4A 1ISIA 1FJXA 4O4LF 3C6XA 3HB0A 4PG7A 4TVBA 3W6OA 1UKBA 3BVPA 4UOQA 5IPFA 4JZYA 1SK9A 2CNOA 3GCZA 3H4TA 2HNAA 1L4HA 1AQYA 4YRKA 1U7XA 5JD5A 4BO8A 1WSWA 3MILA 1F20A 1RKXA 3U4HA 1RWPA 5CXUA 1XXHE 4IV0A 3UUEA 2I7VA 4M0KA 2IYQA 4NKRA 4XQ0A 1Y4SA 4YJHB 1BC5A 4F3CA 2HUNA 1LPBB 3W1WA 2EW2A 2RBGA 3MB5A 1OH8A 3B48A 2LUOA 1LLCA 4IVQA 3T3EA 5J4KA 5DCUA 1JFTA 4GZ5A 1NXPA 2VA9A 3MF4A 1Y6FA 5AI8A 1SD2A 5FHQA 2PUGA 4DCPA 4WXMA 1W4AA 3LDFA 3PJEA 4KWTA 1U7PA 2VUHB 2WAYA 2F48A 2IF2A 3RVOA 1VRWA 1JDZA 4A5SA 3L7JA 1QV7A 4UBIA 2OXRA 4AJ4A 1DHTA 4FILA 5EJ2A 2P78A 3A9SA 4P8RA 2FLKA 3FOCA 3GUYA 3HCCA 3VA7A 1U0OC 2OBYA 3DOIA 4JGIA 2G5PA 5AXDA 1DIRA 1WUTA 4HVCA 5DSXA 2O3QA 3LOUA 3EGXB 2CV0A 2W71A 3WQQA 5IASA 4O4IA 5B58C 1J99A 1U94A 1QTIA 3PQFA 3CLUC 4BS9A 4DPMA 1YDGA 2KHZA 3AJAA 5F21A 1RNLA 1YJXA 3CWQA 1XZHA 4GE3A 4Z7OB 3JZAA 1UJNA 3UJDA 3A1WA 4CU5A 1T2EA 3H65A 4Q1BA 1LJ8A 1WO8A 2O59A 2QG4A 5HIKA 4UBNA 1ZCBA 4RW0A 2ZSFA 3MFQA 3KKKA 1P1BA 2XNSA 3EXHA 3H5RA 1SK8A 4ECEA 1JHDA 2C5AA 2Y1DA 1T5TA 3IQZA 3L05A 5H81A 5KYTA 1G63A 4FZVA 4R2MA 3LHDA 4OO3A 5E4JA 3U3RA 3UENA 2IXAA 2EEZA 5KMGA 3U5TA 2YVQA 1U2TA 4AB1A 2ZAOA 3P2MA 1UDWA 2C7RA 3E5MA 3OC0A 1EUCB 5I7SA 2AQHA 3OECA 4HB4A 4O2AB 1ZVMA 3HYRA 4WFKA 2H0AA 4FFPA 4OV6B 4ZHQF 1FRFS 3AVYA 2F67A 3BPSA 2XH8A 3JQGB 4REQA 3EZ6A 3EVAA 1H5UA 4IUYA 3R9XB 3DDHA 4MS4A 5A5VA 5IC4A 3AR3A 4P80A 4YRGA 4BO7A 3W4IA 2PWPA 1KGSA 4Q34A 3LIPA 3GPBA 1QWOA 2EP8A 4D0NA 1QIMA 1HKHA 1X80B 2P3OA 1TQHA 1NN1A 4G0XA 4II7A 4JVMA 4RSGA 2P8SA 1U5CA 3RYIA 4ZYUA 3FSJX 3VKWA 2I22A 1E0KA 1QF9A 2AH5A 3OZBA 1AS0A 3ZYZA 3KT6A 4DBVO 2F00A 2PLAA 1PJSA 2WA2A 3GEGA 5K0NA 2ZDGA 3UT5B 2R00A 1TVCA 3HVKA 3QPBA 5CFRA 3HCFA 1M8FA 5FV4A 1PYDA 4JEHA 1E5DA 3WIUA 4BLPA 4KK3A 5BWMA 1IL0A 1TKBA 4QOGA 3NEYA 3SX4A 2B83A 5JQWA 1PR5A 3VYSB 3H2IA 3OICA 3H8WA 4AVYA 3RSQA 5K0CA 2RIRA 1TZMA 5IWAB 2DUMA 2PJUA 1W0KA 3H6HA 3RUHA 4DEXA 5G0VA 2GBCA 1E2QA 1G3IA 1C4OA 1JJVA 2R85A 2BAGA 3AGQA 2GKGA 3R0VA 4IJWA 4U39A 1J42A 2YX1A 1Z2AA 4ETWA 4N76A 4URHA 4XDHA 4OI0A 4C7OB 1DC7A 4NH0A 2OVFA 2E1RA 2DHCA 2AF3C 4LJ4A 4IYRA 1CEEA 1ORDA 4CTKA 4CKCA 4MQLA 4N1AA 1FLVA 1RWWA 5D84A 3U3OA 1ACLA 1D4AA 4IEFB 3SFTA 2BHNA 3WICA 3RC7A 2BZGA 3KK0A 1U9ZA 5DX1A 4H60A 3DBRB 4CL2A 1T13A 1W9MA 4BHTA 4LF5B 4JC8A 2IS1A 4N82A 5ITWA 4NENA 3OF5A 1SWVA 1HTBA 1MQ9A 3CV3A 5ALKA 4AZSA 1E3WB 2FAXA 3E5NA 3W2GA 3M2PA 4ED9A 1P61B 3UK6A 5KYUB 1KYTA 3HJAA 4X6UA 2IZ0A 2Q27A 3ICVA 2R84A 4E4RA 1PQWA 1A9XA 3KSAC 1U6KA 2ST1A 2ZRAA 4GF5A 2WM8A 3H2JA 5JO0A 7MHTA 4JLSA 3IP6A 4NYMQ 3HDQA 3NTOA 3JYOA 1XLUA 1OXTA 4QASA 1YBVA 2EP5A 1EVQA 3IXLA 1KXJA 2HIMA 3CCFA 2QN7A 1EQUA 2M1XA 4DV0B 2EZ4A 3PITA 5ALPA 1ZPDA 3FB1A 2I2AA 1FTSA 3QMWA 3T1TA 4TMYA 4N03A 1E5TA 1CFJA 1LI4A 1TUIA 2O2JA 3R3WA 1T25A 2I4IA 4N7RA 3RWOA 2FVYA 3ZXYA 4CF3A 4HJXA 4KFTA 1ZQ1A 1LFAA 4EY3A 3OO1A 1AUOA 2JFGA 2YJ3A 5EWJB 4LJSA 5KWEA 5C8DA 3IXMA 3WWDA 2PKQP 1XCGB 1IJBA 1AGXA 1FQOA 1GTJ1 2ZI3A 3I8OA 4FNGA 4LZLA 1Q0ZA 2C7PA 4PC6A 2NPFA 2D5CA 4RPKA 1SBTA 3G85A 2B4QA 2NTEA 2Z3WA 4HEHA 1C1HA 2RH5A 4DA8A 3SEQA 3D2AA 1BWPA 2EARA 1QNLA 1UBGA 4PO1A 1QRAA 2B8NA 4ZO8A 3TSYA 3UGJA 3TMYA 2PS3A 3R3SA 1JHMA 5FKJA 4C5BA 4BECA 1WF6A 1QIHA 1NWHA 3QEBZ 3PEVA 3C85A 1KDZA 3LXXA 5EIEA 2JI9A 2C9DA 2BKLA 4QTZA 3SZGA 3G5MA 3D7NA 4C3OB 4OAQA 2VNIA 2AJTA 5ICEA 3LCMA 3TOVA 4B6QA 1LNZA 1LC0A 1B3RA 1D04A 1QVVA 2IHUA 3BC1A 4FEEA 4N54A 5H3CA 4TYNA 5LLDA 3SZ3A 4R6WA 1WBDA 2CN1A 5TF4A 3E03A 5HM8A 4ETIA 3WSVA 3L8ZA 1CHNA 2H9IA 3WKEA 1YB7A 2NO4A 4ALMA 3RVLA 3COPA 3W6PA 5KQPA 2GMWA 1D1SA 4CTOA 4H7JA 3G5LA 4DB2A 3FAZA 4AURA 4X7BA 4ZGBA 5AVZA 1VBKA 1VZ2A 3COWA 3VZDA 2ZW9A 4XRRA 1NP3A 1FNDA 4JXKA 4YJ3F 2ZE5A 4MV9A 4BX3A 3N86A 1KNXA 3R0ZA 5A2QA 3RRFA 2WSBA 3PQ5A 4RHYA 4ESVA 4BVBA 4HQKA 3KVNA 3S2IA 5IJ0A 5FH9A 1ID1A 1L7MA 3KETA 5AVXA 1PRYA 2Q3MA 4NDNE 2I3AA 2XITA 1GZHB 3TLMA 2GD2A 3X43A 4OUDB 4XR9A 1RRCA 1XJCA 1B8PA 1PJ8A 4XJTA 5TGZA 3K2QA 5GGXA 1ZXBA 1OXBB 1AF7A 3NXKA 1TM1E 2PGAA 2J41A 4FXOA 1SIOA 2TMDA 4RHTA 1QK4A 4YJFB 1P4JA 3D7MA 2I6GA 1BCSA 3A6EA 2JJQA 2PZAA 4ID3A 5KKAA 5JS2A 2Q5FA 1ADYA 1P2GA 3QUAA 4MW5A 2QDXA 4B4WA 4G1CA 1BDIA 2VVTA 1UP4A 3KQLA 1YNOA 4W9RA 3QFCA 3H16A 1GKKA 3KYDA 4KFUA 4TRJA 3RYHA 1GKIA 5WRFA 5TS2A 1UKYA 2EWMA 2XNJA 1U2DC 4XUEA 4BFYA 1DQPA 2GSWA 5A5EA 2RGNA 2ZUFA 1T24A 2ADOA 2VRCD 3RRBA 3VR6H 3SR4A 3QP9A 4FMCF 1A69A 1KQ3A 2W4QA 2ZI9A 1TLLA 4G0NA 1VHTA 4P4UA 3IVGA 3SG0A 3I32A 3A4YA 1VL5A 4G41A 2VSXA 1QAQA 4EY8A 2WJYA 2B5WA 3AUUA 3LT4A 4EB3A 2GD6A 1J20A 1SHJA 1HE8B 2FJUA 1PQUA 3OEHD 2NSYA 4XM1A 5ICFA 3QU2A 1Z6QA 1YR7A 2VLBA 4MVCA 4XX1A 4LWOA 1UMDB 1V1MA 3SQNA 2ZVDA 3OQNA 3U4QA 2VNAA 1VOTA 4KMMA 4D0RA 2XUGA 1ZOPA 5AKHA 4D8UA 2UXCB 2ECQA 1EZ4A 4WLVA 5LOVA 1ETUA 2FPXA 4EA9A 1XNRB 4PLTA 1ZIOA 1SD1A 3VTFA 3RRNA 4LXIA 1KL7A 3GRVA 1O9BA 2APJA 3NC4A 4QDUA 1XTSA 5DT9A 5B53A 1GU1A 1L7EA 3KKLA 2GBGA 3OUZA 2VZ8A 4WI1A 5C1OA 2DETA 1Z4KA 4LTDA 1SQFA 2YHIA 4KN6A 1GPBA 3WFIA 2OXCA 1YZYA 3VR6D 8LDHA 5LWHA 1G0NA 1QDUA 2BELA 4D46A 4EJSC 1TKRA 3UMBA 1YT5A 2PUJA 3AUYA 1AHNA 3P0RA 1MENA 1UZUA 2E7ZA 2W48A 4PLFA 4Q7EA 5H7XA 1ACMA 1KE2A 4R9SA 3MM4A 2BF4A 1N1MA 3ZE1B 4KFCA 3M6VA 1PJBA 1I4LD 3EMKA 2WWYA 1PJRA 2A94A 4IXWA 3SHOA 4BVLA 5DASA 4AWBA 4NDZA 3RKSA 3G7UA 2J32A 3B9PA 5DDIP 2WNSA 3KXPA 4WKCA 3F4LA 3M8KA 4YECA 3WLFA 3ZOKA 2AW3A 4QTUB 4B45A 1XF9A 4CT4B 4XKJA 2Q5QA 4KQCA 1Q0SA 4LNUA 3FMFA 4OCZA 2ZSAA 5ALQA 1OWMA 3VX4A 3WGQA 3E9QA 3U9TA 4TKVA 2POCA 1T34A 4Y2SA 2CNWD 2WFZA 2GK3A 1U1IA 2GAJA 3NZEA 4IDNA 4KFRA 4KODA 4MZXA 5KWVA 1NF2A 3A10A 3E3NA 5EIWA 3O8OA 2BTQB 1L1EA 4RU1A 1Z4MA 1F06A 1KTIA 4TXHA 2Q29A 2L19A 3ZWCA 2AEFA 1DRWA 2QRVA 4OREX 2VNJA 5JR3A 3OE4A 3I92A 1I5OA 1L4NA 4LNAA 4U5XA 4XB2A 1DT5A 2QYSA 2R1UA 3CF2A 3DF9A 3RC9A 3AZPA 1V1JA 1BEZA 3TNYA 3FB4A 3L8HA 1M2WA 2QXUA 3DQQA 4MQ6A 3Q2KA 2G1PA 1JEQB 4MIEA 2I9KA 1NQVA 3G0DA 3H9UA 3FFAA 3O95A 1CUGA 3T5DA 1Z6ZA 4MYRA 1K98A 1EGQA 1OV6A 3G2QA 4EG1A 4ZCIA 3U13A 5IBRA 2DUNA 3I0MA 5LLTA 3WJ1A 3GDGA 5KYNA 3WK7A 1QKJA 1Z39A 1HLDA 1NYRA 2MHCA 4CDNA 4GC5A 1KY3A 1OGJA 1HTWA 1OR8A 1X2EA 3A37A 4Y2XA 5IUJC 5K8IA 3X3HA 5J2UA 1TJ3A 3QXHA 1M34B 1OAAA 3LC2O 4IIFA 4IQFA 2WMNB