2AK2A

Adenylate kinase isoenzyme-2
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
220
structure length
220
Chain Sequence
PKGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDASQTPDVVFASILAAFSKATS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE ISOENZYME-2
publication title The structure of bovine mitochondrial adenylate kinase: comparison with isoenzymes in other compartments.
pubmed rcsb
molecule tags Phosphotransferase
total genus 76
structure length 220
sequence length 220
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ak2A00
2B6HA 5DI3B 3AKEA 3IKJA 4X8MA 3A1VA 3QUSA 3D3QA 5CB8A 3RC3A 2OCPA 2EVWX 1IN6A 1XXHE 4QRHA 2EWVA 4OK6A 2BKEA 1JXMA 4MA4A 3TJZA 1AQYA 3QSYA 1TNDA 1HA3A 4W5JA 2JCSA 4FIDA 2NOAA 1RVDA 4P3YA 4HSEA 5DSZA 1AIPA 1G4AE 1NL3A 1G1MA 1GTVA 2O0HA 4DC9A 1TUIA 2NO1A 3BAFA 4L16A 1NN5A 2JLYA 4U00A 4S2EA 1KHTA 1UJ2A 2FSFA 2OHFA 1EG7A 1XFAA 1A7JA 1W4BA 1M34E 1QHNA 1W36D 3FTQA 2A5DA 2H5EA 4BFWA 2YWGA 4YMSA 5JCZA 1Q21A 1KO8A 4BFVA 2R62A 3U3OA 4DDUA 3QXSA 2V9PA 1G6OA 2E1RA 2WVJA 1KSFX 3O8DA 4PQFA 2GAOA 3LVQE 4LV5B 4BFXA 2BOVA 3AB3A 1G16A 1ZNZA 1E6CA 1R6BX 3BS4A 4BASA 2IS2A 3CUEF 4PX9A 4II7A 4WBSA 2WJHA 2DFNA 2PZFA 3MGCA 2WKRA 2PX0A 1JECA 3AVUA 2IS4A 4Q02A 3CR7A 1WE2A 2FPLA 4XOIA 5K8UA 3CKLA 1JI0A 5AJYA 2O8BB 3CNNA 2WPDD 2FSIA 2BV3A 2GWHA 3QKRA 1WQ1R 2E9SA 4RZ2A 4DJTA 4E03A 1RRCA 4R98A 1KI6B 3EIHA 1SVKA 4JL8A 3TH5A 2D4HA 4K81B 4OQLA 1MKYA 5HE9A 2OZEA 2YYZA 2F6RA 3THYA 2OE2A 4JSYA 4M22A 1G8FA 3LO5A 2DPXA 1HT2E 2QG6A 4NYJR 4HB2A 2F43A 3QF7A 2A5JA 3AVTA 3PUYA 5F9HA 2PZGA 1FFHA 3GEIA 2QQ0A 4POAA 3QXHA 3VNVA 3EX7C 2ZS8A 5L3QA 1S3SA 5JS7A 3CIOA 4X8LA 3SC3A 3QG1A 1KJWA 5TDHA 3IEUA 1S4QA 1GKUB 2W0MA 1NRJB 1X6VA 3EZFA 2WIAA 3QBVA 2IA5A 5DI3A 4P31A 1VIYA 4F4JA 2OV2A 2JJ8A 3AUXA 3RS2A 2GCPA 1JR6A 1OHHD 5EZ5A 5FH9A 3K9LA 1N5IA 2VYFA 3H2YA 2LCFA 3BH0A 2QP9X 1C1YA 3D6TB 1M6NA 3MG9A 2RHDA 4B75A 2R6DA 1XD8A 1OJLA 5H1YA 3AVPA 3I4LA 4FMCB 3X1WA 1E9DA 2XZOA 3U6BA 2IC5A 3DVLA 5JRJA 1XEWY 2SHKA 2YWHA 1W7AA 4W5HA 1IONA 4C2TA 3U44B 3VR3A 1EESA 3VMFA 1IAQA 1QVRA 2QENA 2D74A 5DNYB 4HUTA 3VR1A 5KNCA 5KHOC 2DWQA 1US8B 3CPEA 4D6PA 2WJIA 3MJHA 1FZQA 5KU1A 3LBHA 3QQ5A 4PC6A 4EUNA 1NP6A 4OHXA 4MKFA 5EQTA 2DHRA 1UAAA 1F48A 2YV5A 4Q4JB 1HT1E 4NH0A 2Z6VA 5DIFA 1NY6A 2ZRCA 4CT4B 4B6EA 1XJCA 1NMYA 1P60A 4JVSB 1R0XA 2ZUDA 3W5IA 1YZGA 4DCSA 4OQFA 1MRNA 4KO8A 3EASA 4Q48A 1DAKA 4XWKA 2JJ2D 1IN4A 1NG1A 2ZSEA 4HB3A 1CEEA 1OFIA 2H57A 3G82C 2O8BA 4ZCLA 3N2EA 4PC7A 4HDQB 3MRSA 2Z5FA 3PIRA 4NCIA 2JLXA 3A4LA 2H92A 1KI6A 3A1SA 3RC8A 4LPSA 2QT1A 2QORA 4OI1A 4C3ZA 1WRBA 2BJVA 3U3RA 3CX8A 1H8ED 2VEDA 4PZYA 3RNLA 4ZDJA 2EFDB 1K5GA 1KAGA 3E70C 4BLRA 3EAQA 4BFUA 5HKKD 2WWIA 3PVSA 1JJVA 2ATVA 1FTNA 2RGXA 1RJ9B 4UJ3A 3KJGA 4TN1A 2CHGA 3LXXA 4DLSA 4UNPA 1N6PA 1DS6A 1ZINA 1FX0B 1Z2AA 1CU1A 1R8QA 4H1VA 3SI7A 3I3SR 3BD9A 4F4IA 4N1AA 4JLKA 4N0DA 2ZJ5A 1AQUA 5UKDA 1NBMD 2GJSA 4EDHA 3TR0A 1KJYA 3KKPA 2RGCA 1IM2A 2J0VA 1GRRA 1EXMA 1Q1QA 2IWRA 3TVDA 1BKDR 1N6KA 3Q7QA 5JSZB 1XRJA 2ZYUX 4BWYA 4LJYA 4DSNA 3PJRA 3SQWA 2EFGA 1CJTC 2QPOA 2NO9A 2ZI7A 3GLHB 2QPAA 4FD2A 4PXAA 3GFPA 1KI1A 3GPLA 2GAAA 2RGBA 3EIEA 3O8CA 2KE5A 3U44A 1KO5A 1T91A 3LLUA 5JJIA 2CMKA 3C5CA 3TUZC 2PT7A 1VMAA 4JBWA 2QP3A 2WWYA 2A5FA 3BE4A 4LJ8A 3KQNA 2ODWA 1ELOA 5FPHA 5G53C 5JZVA 4YXWD 1US8A 3EW9A 3GJ4A 2PX3A 1TPZA 3PEUA 5H68A 4CZ2A 1KZGB 1A1VA 1D5CA 3THOA 4DXAA 2FA9A 2IBMA 3L43A 4Q4JA 4BFSA 2XXAB 3A4NA 4HEJA 3SQXA 3GP8A 2QE7A 2FF7A 2YOGA 2B92A 4U02A 4Q9IA 5EXTA 5HR5A 3FFBA 2CK3A 2C99A 2GXUA 1RRPA 1VG1A 3SYLA 1ZCBA 5CYPA 2FEOA 4Q9JA 4AKEA 2EWWA 1GILA 3K0CA 3TMKA 3GLHE 2CL7X 1CR0A 2B7BA 4BZXA 4JT2A 3PV0A 3SN6A 4DLXA 2VHTA 1E9FA 1VCMA 4KITB 4CT5A 2ZRLA 4HZUB 2A5GA 4N0EA 3PCRB 1N0WA 3TQFA 3U3JA 2GCOB 3WNCA 4URVR 1N0VC 1AM4D 4QBGB 4PR0A 5C2JB 1Z63A 3TAHA 2BM1A 4WZ6A 1FMLA 1GUAA 2AXPA 2VF7A 5EUMA 4CF7A 1U2RA 4C0QC 3ZLJA 1YRBA 3BXZA 3L0SA 4LBZA 1HYQA 5FOXA 4L9WA 4X8OA 1KKMA 3M1IA 5E4FA 1E2PA 1U90A 4NBSA 4NL4H 1LS6A 1RJ9A 4O3MA 3R9IA 1F60A 3HWSA 5EP1A 1FX0A 1KK0A 4AC9A 3PUXA 1E98A 2IXFA 3KX2A 2HYIC 3DHWC 5B64A 2ANBA 2N46A 3WMFA 5HZHA 5JI2E 1GNQA 3KB1A 1NIJA 2CLCX 4KI0A 4MYUA 2IWHA 1P3JA 5E7JA 4QBIA 3JZAA 3DMDA 3K09A 1BOFA 6Q21A 3TK1A 3L8ZA 1ZD9A 1R7RA 1G8GA 1TQDA 2ZRFA 2AKYA 2JIZA 1CXZA 3HJNA 1BH2A 1IJFA 2GESA 4MKIA 1VYUA 2OFOA 3V4FA 4JLDA 1OH8A 1BMFA 2G88A 1KZ7B 2BEKA 3GLHA 1S8FA 1MRSA 3LY5A 2NIPA 3BC1A 2XTZA 2RCNA 1EX7A 2PLRA 3DOFA 4M1KA 1GNRA 4D4MA 1J90A 4TT3A 3FHTA 1Y3AA 1S2MA 3LW7A 5CITA 3FVQA 5FOUA 1NJFA 4WXRA 3CLVA 1E9SA 5BQ5A 5P21A 1DELA 2JIZD 5DN6D 5L8VA 4GDFA 5FBRB 3LQQA 4F92B 1IXZA 3OFNA 1JEEA 1BMFD 2GVDC 1KY3A 1MR3F 2C77A 2ANCA 2WV9A 1HH4A 2QI9C 1XBTA 1XCPA 3ADBA 2D3WA 2FN4A 2V6JA 1U8YA 3DKVA 2XXAA 2DR3A 4PHGA 3TE6A 4N3NA 3ZQJA 3NG1A 2DYKA 3BFVA 4TT3D 1KDRA 4B34A 5FUVA 2VP2A 1J7KA 2Z43A 5KNBA 4C4PA 1Q3TA 4BEJA 3R9XA 2G6BA 3SDZA 5FTNA 4A1FA 2ZJYA 5M04A 1P9RA 1DADA 1RYHA 2Q0HA 5FBVB 4TTQA 1UKYA 5C46F 4FWTA 2DWPA 3OFND 4OHYA 2ORWA 4ZO4A 2WKPA 4LRWA 4Q1FA 4O2RA 2XSZA 3VR5A 2JJ1A 4HZUA 3NIBA 4LBVA 4EAQA 4ESVA 1U99A 1KAOA 2GCOA 3KKMA 4DSTA 3PFIA 3AP3A 1YR8A 2XGJA 4G01B 4AG6A 2AK3A 2W2TA 1OYWA 4QKQA 1ESNA 3NKVA 5JWHA 1NN0A 3DMNA 3I62A 1CR1A 2ZAMA 2L0XA 1KNXA 3MSXA 4J0QA 2AN9A 3DL0A 3LBNA 3QKTA 3U3KA 5JRZA 3AP1A 2R6CA 2JJ1D 2RHMA 3L0IB 3NEJA 4GZLA 2REBA 3IBYA 3EG5A 4LSGA 2J87A 3WXMA 4JLOA 5D3MB 3KKOA 3KJHA 2GXAA 4LJ4A 4Q7MB 3A4MA 4XSGA 4BRUA 1W1WA 4RCYA 2BBWA 3B60A 3L2OB 1YRAA 1PLKA 4CEHB 1Z0JA 3BJIC 1AJEA 3HU1A 1U98A 3WYFA 5KNDA 1DG1G 4LHZA 2GJAA 4PANA 2C9YA 2IYWA 2ZRGA 1ZD1A 2D2EA 3ZJYA 1Z5ZA 2QTHA 1SXJC 2KWIA 4Q5IA 4TMWA 4NCJA 3H4MA 4G1UC 2H17A 5JS8A 1UF9A 4A0HA 3X1DA 4C0JA 3WNBA 1UDXA 3C5HA 1R10A 1GRNA 3AF2A 4NONA 4C0HA 3BRWD 2G0TA 1VECA 1P75A 2B8WA 2PEZA 4EKDA 5C4MA 1Q12A 1G4UR 1OKKD 4MYHA 4MRVA 4PPGA 1W49A 5KDDA 3RRNA 1X8KA 1U9IC 1E79D 4DHEA 4CIDA 5KPJA 1RZ3A 1Z06A 3GJ5A 3QJYA 5TXGA 1KI3A 3NDBB 1XWIA 2FFQA 1XF9A 3JVVA 5LPNA 3U7HB 4PAMA 3BH6A 2OO7A 5FTKA 4XWOA 1DAMA 1KK1A 2DFKB 2H8KA 2XJ9A 1DO0A 1S0UA 4Q19A 4LDJA 4B3GA 1UPTA 1AS3A 3H0KA 1ZM9A 2Q9BA 4DSUA 3W9YA 4JT4A 2ZJBA 3KJEA 4HAVA 4M9ZA 1ZM7A 4Z51A 1N6IA 2AFHE 1GP2A 3I92A 3R8FA 4E5UA 2DFLA 2LKDA 4QGAA 3AVVA 1KO7A 5B57C 2ATXA 4MDFA 4LYFA 1L4YA 1XX6A 4XTCS 4E09A 3EPHA 1EX6A 3R20A 3VR6A 2HF8A 3OIUA 1CIPA 4QG7A 3SHFA 4AYTA 3O8RA 3MWJA 3BGWA 2ONKA 4P4TA 2QPTA 2ZIAA 4DLRA 1KI4A 3KJIA 4KJZA 1R5NA 4ILEA 1L7VC 3QPWA 3SNHA 4MRSA 1JXOA 8OHMA 1UKZA 3W5JA 1GNPA 5GJCA 3W6OA 3RS7A 4P4UA 4PPNA 2V4ZA 1GITA 4UNQA 5A5GA 1HQYE 1OB2A 3U7FB 5BYJA 1WBBA 3CBQA 4IW3B 5KDOA 4YMWA 2EYUA 2ZJAA 3HP1A 2AWNA 2R6GA 2BM0A 3BFXA 3K0CC 1LVGA 1P73A 3HPRA 4M9XA 1W36B 1KK2A 3IQWA 1ZBDA 4RZUA 4HLUC 3B82A 3AVQA 4G0NA 1G3MA 2REOA 3KQUA 3NHAA 5FI1B 4B3DA 1R5BA 2AD5A 1E9AA 3ASZA 3W3ZB 4CEHA 1ZAKA 1Q22A 5DHFA 1N25A 1OSNA 2CNWD 3Q9LA 3LQRA 2V1UA 3ECCA 2CLDX 4QGGA 2B8TA 4H9GA 2HCBA 3NBFA 5SZKB 3T5GA 4CDGA 1R0WA 1Q0UA 2IHBA 3LXRA 4OI2A 3NC0C 4BFYA 1G20E 4B74A 4RFSB 2EQBA 2I3BA 4KCGA 2V7QD 3K0SA 2VTKA 1FNMA 3LBIA 1NNEA 2QRZA 2BHRA 2J3EA 4LYHA 3ND9A 1VIAA 4BZQA 3ZS9A 1M1YE 2WJGA 2QA5A 4AY2A 4LPKA 1KI2A 2CLSA 2RH5A 3FMPB 4MUAA 3RSOA 1N6LA 2CDNA 2OESA 4LUCA 5GADl 4A2QA 2XZLA 4UXIA 4WA7A 2BMJA 2ZU6A 3SE0A 4BFZA 4NHOA 2F7SA 2WJJA 3CNLA 1QBKC 1DEKA 3QVUA 4Q7LA 4B71A 4QHSA 1K8RA 1JR3E 2RGNA 2GKSA 2IYRA 1KDPA 1M74A 1T3LA 3B5JA 1W46A 1XXHB 1KOFA 2XOKA 5HZKA 5BYKA 2GEDA 3H84A 2OCAA 4IVQA 1A2BA 3P20A 1LS1A 1PLLA 5J4LA 4DCNA 1OFHA 1UM8A 1DAEA 1Z08A 3CF6R 4LJ9A 4LYAA 3MD0A 5SZHB 3ZQ6A 5ANRB 2RGGA 3QPUA 4O0MA 1E2QA 3PEWA 5BN5A 1IOZA 2VA8A 2GK6A 2NZ8A 5B58C 1UBCA 1Z6TA 3IPYA 2VP4A 2JLVA 4QBFA 5A4JA 3QF4B 4JVLA 4LK2A 4DLUA 2GF0A 3EZ7A 4M1SA 3SFVA 1FW6A 2F1IA 4TL8A 4NCHA 4Q4HB 1NF3A 1ZIPA 2YZ2A 4Q01A 4OHZA 3O8BA 2HXYA 1E2DA 1TF7A 5JWRA 5IF9A 1GKYA 4GBMA 5J4KA 3CX6A 5BN3A 1YR7A 4OBEA 2VLIA 5J4HA 3AV0B 3NBXX 3WHLA 4BFTA 4GOJA 3AF0A 1E2IA 3IILA 3B8HA 1ZM4A 4XWAA 2C98A 2D2FA 4QBHA 3D31A 2ZI9A 2J0SA 1SULA 2GNOA 2FMXA 1G3UA 1E1QA 1KTVA 1YQTA 1P72A 1OFUX 4Y0AA 2J1LA 5J4YA 2YWEA 4UJ5A 5G41A 4G5OA 4TMXA 3EIQA 1OXUA 1I2MA 1ZM2A 3ZGXA 4DLVA 4M9QA 1G6HA 1GVNB 3TUJC 1G9XA 1AZSC 3X1ZA 2ZRBA 2W0SA 4IRUB 3SU8A 3DOEA 1XPRA 2A2ZA 1COWA 4ESHA 1OE0A 4OI0A 1E9EA 4HLQB 4ZKEA 2WWGA 1HURA 1RC8A 3SZRA 1E1QD 3IDQA 1IN5A 2WTUA 4XVRA 5CIQA 1MO3A 4M1YA 4TWZA 1ZNYA 1Y63A 3B1YA 3MCAA 2BVNA 4RFSA 5EE1A 2CCGA 3UATA 3CZQA 2F1HA 3MLEA 5DI9A 2C04A 3FGNA 4D82A 3W90A 5KYKA 1ZC3A 2OLJA 2WPDA 1JR3D 4MKGA 1COWD 1CBUA 2QM7A 4D0NA 2BMDA 2I1VB 4B76A 4KYIB 1P2UA 4UNRA 1T3HA 5TB5A 3LA6A 2FE4A 1LF5A 2W2VA 1Q1ZA 1M7GA 1AK2A 4Q1BA 2J7KA 3PQCA 3L8YA 2BC9A 1KKLA 4RZXA 3KUDA 2CL6X 1CR2A 2VBCA 2FNAA 2ODBA 3LLMA 1BIFA 3F0TA 2HJVA 4JLMA 3RSLA 2FX3A 1XXHA 5GJWC 4PO1A 1D8TA 2Q21A 3RLFA 1L2TA 4MH0R 4PHTA 3F8TA 1XTSA 4TLCA 4AWXA 1RE0A 2VIIA 3HU2A 1MO4A 4JSTA 4IOLA 3I73A 4ZDKA 2ZE7A 3B2EA 1IXSB 2GXSA 2QSYA 3I8SA 2WICA 2ZI4A 2YINC 1C9KA 1RPZA 1H8HA 4E22A 2ZR9A 3TSWA 2F55A 1W47A 2GBLC 1G7CA 2VO1A 1OHHA 3K0AB 3QF4A 5K8LA 2QEQA 2QTVB 2QUZA 1UDWA 521PA 2AXNA 2HDNB 4Q4HA 4AYXA 4M9SA 2DBYA 1QHIA 1G291 2YWFA 5EUQB 1LB1B 3HYRA 2HUPA 5CLQA 3WP1B 3BB4A 1K5DA 4EQ6B 2OG2A 1W2GA 4OQNA 5DYIA 3U60B 4AI6A 1H8HD 3ETLA 3SJBA 2IYQA 4KHZA 5E7MA 4M1WA 1R0YA 4V02A 2Q6TA 4GI7A 4LV6A 2ZRNA 4B2IA 2G1KA 2QAJA 3SYKA 3T35A 2J59A 2CVHA 1X8LA 2ZRMA 2ZYWX 3FMFA 2AD1A 4PZLA 4TQAA 3RRZA 1UKEA 5EZ6B 2V55B 1UEIA 3CWZA 4EJSB 3AF3A 1KY2A 2ZU0C 4JYCA 1OFTA 3P4XA 1SHZA 4G5GA 1NBME 2XZPA 2F3RA 3GLGB 4KU4A 5CB6A 5JLJA 4Q1DA 4DEYA 1D9ZA 2F1JA 5AUNB 1NLFA 1G5RA 3QBTA 1KYIA 4QM6A 3AH8A 4NYMR 1K6MA 3EWAA 3ZZTA 3ZVNA 1VG9B 3VR2A 4TYNA 5FBWB 3LH5A 5HCNA 2JJ2A 3Q3JB 4AD8A 1MH1A 1EFRA 1Q57A 4BEBA 4QHYA 1G5PA 2KBFA 2UVQA 4H1UA 3CR8A 3B1WA 1ZNXA 4PHHA 2NTYC 3RDPA 621PA 3CRW1 5TMPA 1YZQA 1U8AA 3UKDA 2FFAA 1H8EA 2HT6A 1P9NA 3MWLA 3K9GA 1E0KA 4QGFA 2JLQA 4B2LA 4Q66C 1GM5A 1DAHA 1JALA 2IS1A 1E99A 4PSVA 4MQBA 5JEDA 1EFRD 1JPNA 3GLGE 3ICQB 3FKSD 5HKKA 3MJRA 4GOXA 2OBNA 3LVRE 4C0LA 1E69A 1JB1A 1IY0A 2G0NA 2WKQA 2FDCA 2EFEB 1FUUA 2GJ8A 4Z1MD 1TF5A 4IDQA 3N70A 1ZCAA 2PMKA 4Q1EA 1WXQA 3D8BA 4DCUA 4GL2A 4EPTA 4TLDA 3X1YA 1A5TA 2J46A 1F2UB 2C2HA 3PXGA 2O8EB 3T12A 1NBMA 2X2EA 3U61B 3K0AA 2JLWA 1JEDA 1ANKA 3R8CA 3OIYA 1ZM3A 2AWOA 2IXEA 4QL3A 4HAWA 4HAYA 2ZI3A 2CE7A 4LHXA 2PCLA 2ZROA 4TYPA 1WP9A 2PCJA 4GT1A 4GOKA 3CF2A 1SVIA 2RGNC 1YR6A 3GQBA 1AN0A 4WW0A 4LBWA 4XIGS 2HT1A 3VU9B 4W7SA 1TMKA 2GTPA 1HUQA 4EQ6A 2Z83A 1T0JB 1GZSA 5F98A 4MKHA 4KSBA 4EIWA 4Q4AB 4ZDIA 3VAAA 1FP6A 3K8YA 3GCGA 3RANA 4EFLA 2RGAA 4EPWA 2OCYC 3PITA 3X1XA 3VKGA 2ZJ2A 2Z0MA 5HPYB 2ZANA 4TZ0A 1KIMA 4DLWA 5JEEA 2ZR0A 3A8TA 1G7SA 4YXWA 4EJSA 3CPJB 3W8RA 2IYXA 4HB4A 821PA 4P32A 1J8MF 3U7EB 4ASUA 1AGRA 1CTQA 2WIBA 4HB0A 3GLGA 2W58A 3KQKA 5LD2B 2G77B 3ASYA 3UXMA 3I8XA 4LGMA 2FZ4A 4B3XA 3PEYA 4KFTA 2OXCA 1R5OA 1VHTA 4TLEA 4E07A 1LV7A 3Q7PA 3THXB 1HQCA 2OCBA 2GK7A 4EFMA 4PQYA 421PA 1VDZA 1DAFA 3DKPA 2WMOB 2IS6A 3MAAC 4TZ6A 1UEJA 3D7MA 2IYSA 3KKNA 2BCGY 2CCJA 1W0JD 4ASUD 3CO5A 1W36C 4F7WA 1T0HB 2Q3HA 4IDNA 2NZJA 2OXRA 1HTWA 4OK5A 3K70B 4LJ5A 2ZJZA 5CLLA 2VSFA 4B2PA 1II8B 5KDLA 2N42A 3QENA 3QY0A 2VPPA 3AVOA 4DDTA 2QQEA 4BE7B 1XMJA 4CGZA 4V0ME 4D26A 2GILA 5GVRA 2UZIR 1DOAA 5SZIA 4L4UA 2CCKA 3EXAA 4QM7A 2QROA 3I32A 4KBFA 2UKDA 2ZYTX 3N2IA 1IY1A 4LC1A 3VQTA 4AKGA 2QL6A 3LWNA 2H1LA 4B47A 3KUCA 4KFUA 1KSGA 1G19A 3WP0A 2VP6A 1QHXA 4TMKA 3TSOA 1SVMA 1J2JA 1BYIA 1E2LA 3K9HA 2YOFA 1JAIA 4AIIA 2IF2A 4YONB 2IW3A 1M8PA 1TUEA 4DBLC 1F2UA 2XNDD 4RD1A 2O8EA 1DAGA 3CB4A 2WOOA 3LRPA 1E96A 4R2IA 1EGAA 1S3GA 3EZ2A 4C0BA 1VYVA 4B33A 2RB4A 3M0EA 2HYDA 3WBKA 3IUYA 3SBEA 5LB4A 1P4SA 4UNNA 3NDPA 3EC1A 4R71A 1OPXA 3VU9A 1U0LA 2HEIA 3CRRA 5C18A 2FH5B 3OF5A 4OL0A 3AGQA 3ZVLA 1E2KA 3QPVA 3QXCA 4Q4AA 1G7TA 1ESMA 1V43A 2JDID 3EA5A 1N5KA 3L0PA 4KSCA 1II0A 1ZC4A 3M6AA 5JSZA 5DN6A 4JJZA 5J4VA 5JWOA 1XDBA 2CE2X 2R8RA 3EC2A 4LBYA 1E4VA 1TEXA 4CYMA 2JLRA 4FMDF 2IYUA 3PUVA 4GNKA 2J41A 5FPYA 4V0MA 3HR7A 2FG5A 5EP3A 2GHIA 5FPSA 1F5NA 5CJ2A 3B1VA 1Z6YA 3U7GA 3A1WA 1XZQA 1NMXA 4IVRA 1KDOA 3I72A 5H70A 5L3SB 1TADA 3AP2A 1P5ZB 3THXA 2W6ID 1NMZA 5KSYA 1XZPA 3FFAA 4HUQB 3NVAA 1XMVA 2J7PD 4D80A 1Q1EA 1A82A 1VHLA 4US0R 4BZPA 1E2FA 4A2WA 5IT5A 1NY5A 4JYBA 2GZAA 4BLQA 4C0AC 2CHQA 3A1TA 1PVOA 2IYTA 2X8AA 2JATA 1GG2A 2P5SA 3OEHD 4UKDA 3VKHA 1ZYUA 2ZYVX 4IFEA 3CRVA 3QEOA 1G41A 2IHYA 4TQUS 1JBKA 1ZU5A 3W6PA 1DE0A 1XTKA 3ZD6A 2BIFA 2R6FA 4NYIQ 1HE8B 4UXHA 4HDCA 2OUKA 3K70D 2PJZA 4G3XA 1T3SA 1VKJA 3C4JA 4I1VA 3CH5A 2V3CC 2P0EA 2AR7A 4WOPA 4XVUA 3G5UA 4FI3C 2O52A 2R65A 4I1UA 3QNUA 4A36A 4I1SA 4RCZA 2ZQ5A 4LC0A 3PUZA 4RKEA 4DWJA 1EFCA 2ZRHA 2IUSA 4UNSA 4DCVA 1TU4A 4AKHA 3TR5A 4QJ4A 4RD2A 3OIWA 1CULC 1TL7C 4JVNA 3FHOA 4DLTA 2ZPTX 4JLBA 3DM9B 4M8NE 3PEVA 3LDAA 4LHYA 2X19A 5AWFC 2BKUA 4ERNA 4GRAA 1GL9B 2ZRDA 1Q3HA 4FN5A 3KB2A 2J0UB 2F9LA 3NEYA 3OAAD 5D3QA 4TSFD 4PSKA 3SR0A 2GEUA 4IJMA 3V00A 1JNYA 1J99A 3TBKA 4JLVA 1I4TD 4G5RA 1OKKA 4NCNA 4PZZA 4IOKA 3LFUA 4L8GA 1ZNWA 3VHLB 5JI3E 1E79A 2O0JA 1I4DD 3HR8A 4KYUA 1T4GA 1YE8A 1XD9A 2HLDD 3GFTA 4PC3A 1YZKA 2ZS9A 2BMFA 5FOTA 1YKSA 2WOJA 1JQJC 1S1CA 2FZLA 3AUYA 4FWIB 5FTLA 1RIFA 3FPAA 2FPKA 2PBRA 5EJEA 5L3SA 3AF1A 3LW8A 1VTKA 4IVPA 1FMJA 2AK2A 2ZETA 2F9MA 1XD2B 4HUQA 4BECA 4JL6A 1PLJA 3TVTA 1JJ7A 1WB9A 3KFVA 1Z8FA 4JVMA 5CM9C 4A0GA 1G21E 3ZVRA 2H16A 3HYTA 1Z0DA 1X1SA 3ONWA 4WAUA 4JLAA 5EXPA 4U7DA 4LJAA 1IXRC 1U81A 2VQSA 1DVRA 3C14C 1HEIA 4I81A 4P4SB 3THWB 1RRGA 1V5WA 3RRMA 4ZI2A 3W34A 4JIMA 2RGDA 4S35A 4EPXA 3ZYCA 1E0JA 1G7RA 4IXMA 3IHWA 2C9OA 1IQPA 2VP9A 5GJBA 5EP4A 1W4RA 2HCJB 3UG6A 2IL1A 2FSHA 4RVCA 4PO9A 1P7CA 4PTLA 5IK2A 4AYWA 1R0ZA 3PUWA 4DB4A 2V6IA 5TARA 1EWQA 2BJWA 1XMIA 3P4YA 3PG5A 5JBQA 1N0UA 1W0KD 3FMIA 1OXVA 1KDTA 5EE3A 3W8NA 1G8PA 2XB2A 4Q9LA 4DCTA 5DHAA 2Y8EA 2NO0A 3B13B 2VP0A 2ORIA 3WY9A 1FL9A 2CNWA 2FV8A 1SVSA 2QMHA 2W6JA 1NN1A 3GJ6A 4GP7A 5DH9A 4ZPXA 5DGXA 4URXR 2IEZA 5IK2D 4XTRA 3TLXA 2AHOA 2B7CA 4D0GA 3ZIAA 2GXQA 1ZP6A 1Z6XA 1DARA 3GLFB 2J0QA 1S9DA 2FJUA 4DLZA 2V7QA 3ADCA 2XB4A 1O3YA 1T6NA 2J0UA 4I1OA 4JBYA 5D3MA 3VR4A 1CR4A 1UBGA 3UWKA 2H7VA 5C4GB 5FR1A 1IY2A 3T61A 1Z47A 3Q85A 1CRPA 3NTUA 3H86A 1TQ4A 1SHKA 3QI2A 1D2NA 2W6JD 5FI0B 3RRYA 4DIEA 2OFXA 5LB2A 4B3CA 2EFHB 4XD7A 1YZNA 3ZIAD 2OSBA 3U5ZB 1XTIA 4HLCA 3AGPA 1QZXA 2DY1A 4M2LA 5J5CA 5E3HA 3SEAA 4B73A 3KQLA 3UK6A 1C4OA 4XJXA 2WM9B 5KSZA 2QRNA 3ICEA 4HDOB 3F5FA 4GP6A 4OHWA 5JJKA 2A5YB 2VHQA 3CPHA 1J70A 3IIMA 2WSSA 4HZIA 4C0SA 3DPUA 3QE0A 3AF4A 1NLZA 4M21A 1FP7A 1Z0IA 3GLFE 4XD7D 3P27A 4QJ3A 1WCV1 1IHUA 3NXSA 3NBZC 3OEEA 1L8QA 4NYJQ 2WWHA 4KLNA 1ZJ6A 5DLQC 5G40A 1VG0B 3K09C 4TQ9A 1VYTA 2D06A 2BBTA 5JECA 1MOZA 4RFVA 2WSSD 1MV5A 2ZITA 3ZZUA 4P4SA 1O87A 3THWA 2VHUA 3CZPA 2YOHA 4A2PA 1S1MA 3ZDQA 2G9NA 2UZ3A 4Q47A 5TV2A 4ZCIA 4OYHA 2AKAB 4A15A 3OEED 3EARA 3CRQA 5EP2A 5CK4A 4GMDA 2ZI6A 1TTTA 4HATA 1ZRHA 4JJKA 4URZR 3RWMB 1Z2CA 4AK9A 4YQFA 2ZSAA 3GFOA 1GDDA 1R8SA 3IGFA 5FOWA 1UKVY 3LD9A 3PR1A 3I61A 2LKCA 3R7WB 1XJQA 4YDSA 1N5LA 1FOEB 4LCBA 4M53A 1E9RA 1M7HA 2FSGA 2ZE6A 1KSJA 5HE8A 4JS0A 1Q44A 1QG4A 1OLOA 4DUGA 1KGDA 4Q7KA 1PUIA 3L0OA 3B9PA 3P1JA 5J47A 1AKYA 1XEWX 3MMPA 1SQ5A 2HXSA 2ODNA 2GVZC 1M7BA 3GLFA 1NVVQ 4KODA 2ZJ8A 2RMKA 4Q00A 4L5BA 4IEEA 5CYOA 3UG7A 3QIAA 3SJZA 1W44A 3IIKA 3T1TA 4TMTA 2OILA 4A9AA 3H1TA 4NTZA 2QMOA 2X77A 4BQSA 2CJWB 1JR3A 4ACBA 3LV8A 5KSPA 1G8YA 1WMSA 4DUGD 1E4YA 1XCMA 1BS1A 2QAGB 4A8JB 1IN8A 1GAJA 2R44A 5IDVA 2J45A 1OXTA 2Q3FA 3WRXC 2VHJA 4NP6A 4QHTA 4Q1AA 5K8IA 3KXIA 4MRNA 1NN3A 1ZU4A 2GA8A 4ITRC 4M1OA 4MRRA 3RS4A 3RYTC 1I4LD 5FUYA 4TTRA 1XTQA 1OIWA 4TYQA 1E3MA 1OIXA 1F6BA 2CXXA 2IUUA 1UBEA 1E94E 3BB3A 1YVDA 3QKSB 2PZEA 2YNMA 5TVKA 1VG8A 1GL6A 1U94A 2QGNA 4NCKA 4QOSA 1QHYA 1ZMXA 1Z29A 1Z6GA 2XJ4A 3Q5EA 4FMDB 4L15A 4PPQA 4YMVA 3U4QB 1M2OB 5LDDC 3WYAA 1FQKA 3WNDA 3RABA 4US1R 2C96A 5SZJA 3V9PA 2GJ9A 3QOFA 4UXJA 5AK0A 2GDJA 4LHVA 4BLOA 4OJKA 4ZI3A 1JQLB 1ZD8A 4CRWB 4OQXA 2ECKA 1E9CA 1LW7A 1GRQA 3IPXA 1OW3B 4K46A 3SJAA 4A0RA 3BH7A 1NI3A 4IDHA 1FNNA 2D7DA 1ZW6A 1N6NA 2HF9A 3RS5A 4EPRA 4A6XA 5DE3A 2IX3A 5AUOB 4U5XA 3CWQA 2WBLC 1YR9A 2P6RA 3E5HA 5EXXA 2ZI5A 3OE7A 3VX3A 4B6FA 1AGPA 1TF2A 3B6EA 3FWYA 3C7KA 4ZIRB 4TLBA 1AA9A 4OKSA 5FFMA 1ZIOA 4WVFA 4P33A 1XMSA 2C9CA 4DVGA 3IQXA 1E2GA 1TU3A 3IHLA 1GKIA 1NVXQ 2PLFA 1UFQA 4V0LA 5DO9A 2NMVA 1DAIA 5B30A 3MWYW 4LZZA 2GCNA 4ZCMA 5K8TA 3R7WA 1XCGB 4FCVA 1IBRA 1XU4A 2CVFA 4M0LA 3T1OA 3OE7D 4X8HA 1QHGA 1ETUA 3EZ9A 1P2TA 4TMZA 1P2SA 4PC2A 4RD3A 1QF9A 2NG1A 2QMEA 4LOAA 1SXJB 4MDEA 2QBYB 2GZDA 2IK8A 1PUJA 1CJUC 5H8WA 3B9QA 3A58B 3FMOB 3GJ0A 3NH9A 1E1RA 1UBFA 2IYVA 2QTFA 4D25A 3OZXA 2WJVA 2P6UA 1LTQA 2CJWA 2Q9AA 2ZS7A 3AKCA 3DM5A 4HAXA 2ZR7A 1WBDA 1HV8A 1II9A 4DRZA 1BYUA 4R9UC 1NSTA 2QAGA 4DLYA 1QVAA 3BFKA 4A8JA 1A2KC 4WZAE 3TSZA 4FMBB 4GMXA 4RZ3A 1DG3A 4B35A 3GMTA 4V0KA 3W6NA 3T1VA 1E1RD 4LI0A 4LV8B 4Q9HA 1ZUNB 3VKWA 2D62A 3W3AA 2IYYA 1S9HA 3FKSA 2ZJOA 3VFDA 4JZKA 3GLIB 2KBEA 4V0OA 1T9HA 5CK5A 1LNZA 2REXB 1SXJE 1YZLA 4TYWA 3QKSA 1GWNA 5FBQB 4A92A 1EWRA 5EE5B 1MO5A 2A7QA 3EPKA 4MYCA 4LY6A 1Q1BA 5TY0A 3U4QA 3I5YA 4Z1MA 4DB2A 4PC1A 4RD4A 2O0KA 2ZEJA 1XJ0A 1NVVR 1U0HC 1RW4A 4GZMA 3AQ4A 5AJXA 4HYYA 1N6OA 2Z4SA 1KJZA 4KVGA 2QSZA 4QNRA 2IYLD 2EU8A 1CJVC 4URUR 4TLAA 4V0NA 3FKQA 5HCIA 1SVOA 4OK3A 4G5SA 4C0KA 1E2MA 1FUKA 4MGZR 1EFHA 2RGEA 3QEJA 4EPVA 5KSOA 3JZMA 4XH9B 2YC4C 4KV9A 4ZIRA 3WMGA 4GPTA 3AEZA 4B44A 4QFMA 1B0UA 1R2QA 3TNFA 4BPBA 1OF1A 4D0LB 2J9RA 1G3IA 2ZRJA 1T5IA 3DDCA 2NPIA 3GLIE 1N3BA 3CM0A 4JMPA 4NE2A 4ZV4A 4O2LA 2XTNA 2QT0A 2BBOA 1G17A 2QY9A 4Q1CA 4Q4LA 2R6AA 5ELXA 2JLUA 2MSDB 1E9BA 4C7OB 4C9BA 1OYYA 3MWKA 4FCWA 2R9VA 4M1MA 5KPDA 1JAHA 4OI4A 3KL4A 5AR1A 1XPUA 2QMUA 4A82A 1U8ZA 4CW7A 1SXJA 4JLPA 1SVWA 2QBYA 4B48A 1TQ2A 4D4KA 4AURA 1KNQA 2O8FB 3CONA 2PJRA 1P61B 1TX4B 2ZVPX 2DWOA 2BEJA 4MRPA 4R2HA 5FR2A 2ODEA 3FDIA 1D9XA 4RD0A 2ZREA 4NZYA 1IN7A 3CW2A 1GL7A 2JA1A 5HTKA 1HE1C 5AUPB 3UMSA 4DEXA 4F4CA 1AKEA 5AJWA 3TAUA 1U9IA 1W0JA 5GVSA 4YLGA 3TW8B 5AJZA 1CJKC 5CDFE 5CM8B 1CS4C 4Z8XA 1SXJD 1LFDB 4OHVA 4RKFA 1E0AA 2JAQA 4EFNA 3U2QA 2F1RA 2QP4A 1X8JA 1XPOA 4WIAA 3S1AB 2P65A 1XTRA 3QG5A 4WXPA 3M4YA 5B2ZA 2P6NA 4BGDA 2VP5A 5JCPA 5FOSA 5CJPA 4TTPA 2OLKA 5EE0A 4Q03A 3QXXA 3SHWA 1P2VA 1OH7A 1TAGA 3GLIA 4JLJA 4HLDA 4A6PA 2F3TA 1RFLA 1SKYB 2IT1A 3EPLA 3SYNA 2GF9A 1HY3A 4KVAA 5FTMA 2OBLA 4ON9A 1NVUQ 2OEPA 3VTKA 1D2EA 1DTSA 1N2CE 5L3VA 1DBSA 3OESA 3LAWA 1GOTA 2J5XA 4GFDA 1H65A 721PA 3QKUA 2IYZA 2ZSFA 1QG2A 3HU3A 4PAQA 4XVQA 2XNDA 2BBSA 2G3YA 2VRWA 2YVUA 3B1XA 3KZ1E 221PA 1YJ5A 4XSHA 1CJMA 3UMRA 2FU5C 2OBMA 1G5TA 2QZ4A 4PFSA 3NBYC 3TIFA 2XTMA 3K0FB 4M1TA 2NGRA 2AL7A 4AG5A 3DZDA 2GZHA 3UWOA 5J40A 3BK7A 1WA5A 2IUTA 3WYGA 5IHPA 1ONBA 3Q8XB 2KJQA 3A36A 1FTSA 3WBJA 1RYFA 3BWDD 1QRAA 3ZD7A 4R7ZA 1Z6AA 1CKEA 3SJCA 3AKYA 5F9FA 3K53A 1SKYE 2W2XA 5CDFA 4HLUA 3T15A 2JDIA 3OIVA 2H18A 2OM2A 4JL5A 3MFYA 3GEEA 1SKQA 1OXSC 2D7CA 2QE7D 4JKYA 1S96A 2VHCA 2V54A 5LBIA 2WAXA 4C7OA 2P5TB 2CK3D 2ZRKA 2P2LA 3KXKA 4DT1B 1SVLA 3BORA 3B1ZA 4AKIA 3E2IA 3IIJA 4IFBA 2JGNA 1LF0A 5KOYA 3EWSA 2O8DB 3UIEA 1PZNA 3C15C 2EFCB 2JLZA 1OT3A 1PV4A 1KSHA 3FE2A 2O8FA 2RKOA 2WHXA 3L82B 4RD6A 1W4AA 2W6IA 2FEMA 3U6KA 4LJ7A 1FQJA 2J7PA 2ZUBA 3FHCB 2PEYA 2EYQA 4CVNA 1F3OA 3HDTA 4IOMA 2ONJA 1RRFA 4DZZA 2YJTD 5CIWA 2ZRIA 3EA0A 2X2FA 1ZUHA 5JMTA 4OQMA 4F91B 4D81A 4JBXA 3OEHA 4ARZB 3NH6A 4BUJA 5EXSA 3R9WA 3S1AA 2QM8A 4KFSA 3KKQA 4BLPA 2HV8A 4MGYR 1KMHB 4K8OA 4LWZA 5FOVA 1TEVA 3RAPR 5FL3A 3FB4A 5KO2A 1E2EA 2X1VA 1VPLA 5FUWA 3GJXC 3TRFA 2MSCB 2XITA 2I4IA 1E0SA 3C8UA 4D2IA 1YHNA 5E7IA 5FL7A 3ND8A 1A4RA 2ZE5A 4KLZA 2C95A 5KUTA 1F2TB 2WWFA 5DISB 3AVXA 1XEXB 1LY1A 1SGWA 1XB2A 3EZ6A 5L3RA 2N1BA 1II8A 5FBLB 1CRQA 1XEFA 1YU9A 3ZH9B 2LWIA 1OH5A 2AX4A 3EPJA 2QAGC 4PQRA 4TL7A 2TMKA 4A8JC 2XAUA 5FTJA 3TW4A 2NPFA 1W4CA 4DDWA 2P67A 5FL7D 3K0FA 4HI0E 3ZZ0A 1AS0A 4NDZA 4PHFA 2MMCA 2IEYA 4IKEA 4IHQA 5E95A 4QNMA 4D4JA 2JLSA 2VSOA 4GSYA 4V03A 1G3QA 4NPHA 3FYHA 3Q72A 2IF0A 1Z0AA 3UANA 3OAAA 3QXJA 1NG9A 2A30A 4NKRA 4TSFA 2YHSA 3N5CA 4FXPA 2FGKA 2G1JA 3KXLA 3T1QA 1W48A 4YDHB 3BIFA 4F38A 3CF0A 5A0FA 2V1XA 1D2MA 4Z8YA 1GSIA 4Y0VA 2QNRA 2R2AA 1XP8A 3KTAB 2MMGA 1L4UA 2HLDA 4URYR 1KMQA 3C16C 3REFA 1P62B 4MUBA 2FWRA 3TGPA 4Q9KA 2GEVA 2OAP1 1OB5A 4YC7A 3IBGA 2IXGA 2ORVA 3K0EA 3CX7A 4DT1A 1W5TA 1AZTA 1MT0A 4TL6A 2B21A 2PT5A 3ADDA 2O8DA 1DO2A 3WHKA 1Z0KA 2WWWA 4KFRA 3JVUA 3AVYA 2C78A 4BRWA 2EW1A 4CEIB 2PL3A 4FMCF 2XSZD 2KSQA 1X1RA 3KFXA 1ZUIA 4W9MC 3NC1C 4F93B 1WF3A 4PO8A 3LX5A 3K9NA 3TQCA 4IDOA 2PH1A 2FGJA 4YMUA 4L9SA 4I4LA 4DSOA 5AJVB 4YMTA 3F3YA 5JFGA 1NKTA 4URWR 3SOPA 3PENA 2YKGA 3GJ7A 4HAZA 1N6RA 3AM1A 1EFTA 1BO6A 2DCUA 2QN6A 3AKDA 3SFZA 1Z3IX 4ARZA 4BLTA 1E2HA 4IOJA 3T34A 2CEAA 1J8YF 2ERXA 2ZAOA 3BOSA 1QHSA 1KMHA 4NU0A 3ZS8A 2FOLA 2VL7A 5G3ZA 3VX4A 1Z83A 1G64A 3HPQA 2Q3MA 4BLSA 4CEJB 2QGZA 2V8OA 3KQHA 3IEVA 1OV4A 2XEXA 4IXNA 3WRYC 1CP2A 3J81k 1OIVA 4Q7JB 4TYYA 1F2TA 2XNSA 2FFBA 4EJSC 3KDSE 4ZKDA 1KI9A 2WWXA 1PJRA 1E2JA 1XEXA 4HAUA 1MABB 1YZTA 2GBLA 2QU8A 1W0KA 4QJ5A 5F3WB 3B78A 2ASEA 2BMEA 4C30A 1E2NA 1QHHB 3FOZA 3OHMA 4MITA 2JEOA 2CHVA 4P0TA 2FPMA 3C41J 5BWMA 1NSFA 1E32A 2PMDA 1W2HA 2E87A 4TL9A 3Q5DA 3VNUA 3A1UA 2A9KA 3LNCA 3P32A 4US2R 1QDEA 4C2UA 1X3SA 1AS2A 3CNOA 3RS3A 1R4AA 1I2DA 2C8VA 1NLYA 1NIPA 5BN4A 1W5SA 1OH6A 1JPJA 4Q21A 1KO4A 3X2SA 2VF8A 2GRJA 1UADA 4W5WA 4B43A 3E1SA 5DYGA 4OJQA 4B3BA 2ZE8A 3UMFA 1IJEA 2A3RA 5C1BA 3CH4B 3MUFA 1N5JA 2VSXA 2WAYA 3KTAA 3O47A 4LYJA 4ACAA 2CBZA 4D4LA 2P3SA 2ZM5A 3T06B 1RKBA 2ERYA 1Z28A 1Z0FA 2VH5R 1U0JA 3DEFA 4UQOA 3IO3A 4JLNA 4M4SA 2A78A 2O8CB 1T8TA 1KK3A 1CF4A 5AUQA 1T8UA 5IRCD 4LHWA 1Z07A 1YZUA 1P6XA 4WZBE 5FUXA 2ZSBA 2DB3A 1N6HA 3GJ8A 4QC2A 4TMVA 1XTJA 4CEIA 4NYIR 5JJLA 2GETA 4ABYA 2ZRAA 2ZUCA 4B32A 121PA 1G8HA 1FPMA 2W00A 2JASA 1GFIA 2C03A 3I1FA 4MGIR 2RAPA 4IEIA 3SBDA 4IDPA 5GJVC 2ZRPA 2OAQ1 2MSEB 2DFTA 2ZTSA 3NHBA 4G5QA 5FPKA 5KTYA 3RWOA 1MO6A 3CRMA 1EFUA 4ZDWA 1T5LA 1VCIA 1X86B 3REGA 3ZVMA 1NJGA 3TUIC 2O5VA 1NKSA 4B3FX 1XD2A 2WMNB 4QGHA 2I1QA 2HJGA 2ZSDA 2BDTA 5JHGB 3G0HA 1KO1A 4QXAA 1VCNA 2OFWA 4A0FA 3RVBA 4KBGA 1Z22A 1XNJA 4CEJA 2AFIE 1KI7A 1WDTA 3A37A 4O25A 2NQ2C 4EPYA 5FPTA 5JHHB 3P26A 4RSGA 4RY2A 4JKIA 2G83A 4LX0A 1MABA 4KAXA 3LX8A 1D6JA 2K5UA 3RS0A 2BWJA 1G18A 4MYTA 1GIAA 4PAOA 2NO7A 3A6PC 1QHHA 5LD2C 4FCTA 2FFHA 4A4DA 3BBPA 2WZQA 2GJKA 5EE9A 2WJYA 1EK0A 2ZVQX 1G3RA 4FW9A 4Z54A 2Z4RA 2BCJQ 4RJLA 4DDVA 2YC2C 3QKRB 1ZVQA 4PSAA 3IO5A 1OXXK 5BXQC 1VCOA 4I99A 5BW8A 2C5LA 3I5XA 1TQ6A 2Q9CA 2OT3B 3GD7A 3TKLA 3THYB 3U3MA 1SZPA 2CL0X 1KI8A 2XX3A 3B85A 3DZ8A 3T5DA 2ZXUA 5G3YA 3K70C 1DPFA 3V4RA 3VHXA 2F43B 4PPFA 1NVWQ 3GEHA 3NWJA 4MGKR 2NO6A 3RHFA 2KB0A 4KXFB 2W83A 4FINA 4NMMA 2KI5A 4DIDA 3DO6A 3B7GA 5F2EA 4DKXA 4LJ6A 3BB1A 4NYMQ 2XOKD 3WMEA 5L3QB 4Q18A 3ADKA 2WSMA 3SS8A 1P9WA 3QVVA 3GJ3A 1B23P 3K1JA 1ODFA 3AVWA 3BERA 1CLUA 2O8CA 3UPUA 1Q20A
chains in the Genus database with same CATH superfamily
2B6HA 3GLUA 1QIHA 5DI3B 3JYOA 2EKDA 3IKJA 1A5BB 1V0JA 3A1VA 3H75A 2J9GA 1JPUA 1NE2A 2NVOA 3IV9A 1MCZA 1Z37A 4UMVA 2OCPA 2Q50A 4C87A 4DMRA 3OA0A 3LECA 2EWVA 3DTTA 3DYIA 3WLFA 3DO5A 1KOLA 3KG2A 4MA4A 2ZB7A 1V8DA 4XUDA 4W8OA 1K6EA 1EVIA 2QOEA 3CMCO 5GPBA 1QVVA 3H6KA 2Z6AA 3LT4A 4LYGA 5MGBA 4NJEA 1A69A 1ADBA 5LXTB 4C22A 4E31A 4H6XA 4FIDA 4GWKA 2BDEA 1JFVA 5G2OA 3IDZA 1WY7A 1YVRA 2D0PB 3NWPA 1NL3A 1G4AE 4NU5A 4YCDA 2O0HA 4DC9A 3DWGA 4H3SA 5IANA 4CPDA 4L16A 2GN6A 1NN5A 4G5HA 4KE9A 4Y6OA 5KYYA 5J2TF 2GPNA 1KHTA 5C3MA 3L0ZA 3SYMA 2YFYA 4B9EA 1UJ2A 1WF6A 2OHFA 1NOJA 2SKEA 2XGSA 3LRTA 4X6LA 1A7JA 4CXMA 3O9VA 1YB6A 4LWOA 3KPJA 2PL5A 4N0MA 5I5GA 3QVKA 4Z9YA 1C14A 3ZGYA 3U80A 1L4HA 4BFVA 3FJOA 3LFHA 1VQ1A 2X86A 3ETGA 5EZSA 1CDEA 3F2IA 2OZPA 3G7NA 4R3WA 4BMCA 5EWMB 2UXDB 4LV5B 3SIRA 4IMRA 4JXZA 5ALQA 1G16A 2WU4A 4DV3B 5TGZA 4QX6A 3EIWA 1RJDA 4BASA 4XFJA 2IS2A 4JUDX 5KU7A 3CUEF 4PX9A 3ZCSA 5IN4A 4WBSA 2J07A 4AQYB 3QQPA 2DFNA 4DFDA 1EJ6A 2FB9A 2PX0A 1JECA 4QDUA 2LCQA 5DV9A 4Q02A 3URKA 3AVUA 2IS4A 3CR7A 1DKNA 4A6EA 4O29A 4RY0A 4YCBA 3EXFB 3PD1A 4XOIA 4WJLA 5K8UA 3VPHA 4C2UA 1STOA 2EIHA 5AJYA 1SQSA 2AXQA 2PSSA 2Z2KA 2O8BB 2BV3A 2GWHA 2VJKA 4G07A 4NV3A 2VI5A 3SZUA 3TSYA 3EEIA 1PZMA 1HDIA 4JL8A 1WTCA 3OCWA 4J03A 5I9NA 2D1SA 2W2LA 4K81B 2KS6A 4CI9A 2RIPA 3M3DA 3RKUA 2F6RA 2OE2A 4JSYA 5EG5A 3P8ZA 1Y82A 1QGZA 1FYDA 2DPXA 3TOZA 4NYJR 3DNPA 3FPKA 3MAGA 5BURA 4NICA 2GZ1A 2F43A 3QF7A 4LISA 3ZNNA 5HYVA 5K3EA 3AVTA 1HC7A 1MAWA 2DT5A 2DUNA 3MWEB 4PEVA 1P1IA 2OB1A 2QQ0A 4ZZ1A 1N2OA 4JBHA 2XCIA 4M7PA 3EX7C 4DAEA 2RGWA 5CT5A 4UPEA 1S3SA 5L3QA 2HB6A 1LW6E 4HTFB 1TJ3A 4GX5A 3SC3A 4GG1A 4PU0A 2XZDA 1L3CA 1S4QA 1GKUB 3ZUPA 1NM5A 1M34A 5A62A 5IARA 2HSWA 4BO5A 1NRJB 1X6VA 3D3NA 4CLRA 2WIAA 3TWOA 2IA5A 1H85A 1BVRA 2WDZA 5IMBA 1PGQA 1VIYA 3JQBC 5SV2A 2OV2A 3DONA 1M2EA 2C2MA 5F23A 4INJA 1NZJA 3OPYB 1AA6A 1CIVA 2YIJA 3NYQA 4KDFA 3T9AA 2BGRA 1OHHD 2CFCA 4OQPA 4GKVA 2DRIA 5J43A 4DRXA 5K9ZA 2JD2A 3D6TB 1M6NA 2RHDA 1YK1A 2BEVA 5H5JA 4JJ4A 5I01A 2L17A 5H1YA 2COEA 3AVPA 1XZGA 5L4LA 3JALB 1PV4A 3X1WA 2PJRA 3U6BA 1NI4B 3BD8A 1SC1A 3CLKA 4LFAB 3DVLA 4CM9D 3CX4A 3EB9A 3PXCX 3RFTA 3I04A 2Z58A 4W5HA 3U44B 2HY7A 5KNDD 1QNLA 1C4WA 2J5QA 3DBHB 1IAQA 3ZK7A 2HDWA 5CX1A 3HXTA 4S12A 2D74A 3HUFA 3O38A 4LYYA 1OTYA 3R3HA 3VR1A 5KHOC 2EGUA 5KNCA 4YP0A 3BMCA 2DWQA 3PGJA 4KLRA 1US8B 5EJMA 1X0VA 4LJLA 1FUEA 5BV2P 2PRYA 4PGHA 2H1RA 2G28A 1NQWA 1XCBA 1PBNA 3LBHA 1WOYA 1XKXA 2B99A 2DHRA 1HT1E 2YQ4A 2VQ6A 2VJAA 1NUQA 2FQXA 4OFXA 1GCIA 1F20A 1NMYA 1P60A 2DERA 2VC2B 3VR3D 4BE9A 3MXTA 1PT6A 4JJ8A 4J0HA 2DEUA 1IUNA 2RFLA 5JLAA 4DCSA 4OREX 4R1LA 1RBYA 3V1NA 4NJMA 3EASA 4Q48A 1DAKA 1SU4A 3N0XA 3GYBA 4PY2A 3ZH2A 4D9BA 5K2OA 1EP1B 1H0HA 2ZSEA 4DG5A 1CEEA 2R96A 2WJ4A 1S3FA 1ZGJA 3C5WP 1DB3A 3WVNA 4OX9Y 1MC5A 4M0FA 3GT4A 4FYYA 2DQKA 1XEAA 3WXBA 5JUWA 2H92A 4D3FA 1DRJA 3O8LA 3HTXA 3KTFA 1A04A 3DQPA 4HWPA 4LPSA 5I9TA 4XYLA 3RC8A 2WUVA 1AURA 1M8JA 1RWPA 3V1LA 4RLFA 3U3RA 4EO4A 2GK3A 1JTVA 3AEUA 2C4VA 3TAXA 4UE3S 3O8QA 4ZDJA 5TC4A 2IYPA 2UUPA 2YY5A 2HV9A 2JFGA 2P9FA 2WZDA 3E70C 1PFKA 2I2CA 3N2KA 3O0TA 4KVFA 4RK0A 3G0OA 4CLEA 2XKBA 2E4UA 3FUCA 4OP3A 4ANFA 3AY0A 1KAEA 1HDZA 1ABBA 2WWIA 3G8AA 3F46A 3Q10A 1PJBA 1JJVA 5TX7A 3ONDA 1I1QB 3DHEA 3KJGA 4OUDB 1HTBA 3DB1A 3E0XA 2IDJA 1N6PA 4QO7A 4UNPA 3MTQA 3UVEA 1FX0B 1L5OA 4KDEA 2FX2A 3UUEA 1FDOA 1U28A 3I09A 1CU1A 4LIPD 1K08A 4AP9A 5CGZA 5CB4A 1CQIA 2YZMA 2QJWA 4H1VA 5I9BA 4KREA 2QW8A 1H66A 1BKYA 2CDAA 4N39A 3T3HA 5KS2A 1TW2A 5LLTA 5ALWA 3GCZA 3FFTA 2XBUA 5UKDA 5EMNA 2Z04A 4IX1A 4I9HA 3TR0A 3A3NA 4G25A 3C3JA 1KJYA 5AM3A 3DBOB 3PF8A 2VK4A 5IAEA 2J0VA 1V7QA 4ZJUA 1GRRA 1CJBA 3GH1A 3P9IA 1BKDR 3OEWA 3Q7QA 4I4TA 4AJ4A 3CLUD 3GJQA 4HNQA 3L01A 2QPOA 1JHZA 2VXBA 1PEYA 3G2NA 4CV1A 4RV9A 3LPDA 4PXAA 2G5GX 3MCWA 4PZDA 1JEQA 3EIEA 3FIJA 4P83A 2YFQA 3AM3A 3OZDA 4P3NA 4B6GA 5JJIA 3JATA 3C5CA 3ZWAA 2H1OA 4B7ZA 1TKRA 1UK8A 1YCGA 3HS3A 4JBWA 4ROTA 3AY6A 4CKWB 2AYYA 3KQNA 3I76A 5REQB 2PUBA 1AUVA 1QG6A 3G2QA 4QGBA 3AFOA 5B58T 5GIPE 2NT4A 3ZZ1A 1G60A 1UBNA 2PX3A 1IUKA 4FKZA 4JY7A 4UBJA 5EQDA 3OOHA 1TRKA 3SF8B 4Q1VA 1BWPA 2VUIB 1KZGB 1DJOA 3N8DA 2JGMA 4E12A 4TTIA 4DXAA 5ERGB 1GSAA 2E0IA 2FA9A 2E5FA 2Q8QA 1I0LA 2Y0PA 3L1IA 4C4AA 5CD9A 3A4NA 4HEJA 4KE7A 1DC8A 1CYDA 5DYNA 2YOGA 3SJUA 1M2VB 2QVYX 1JQEA 5EXTA 3BHNA 3BA6A 2I6FA 2WAMA 2ES4A 4LTNA 2C99A 2OZLA 3EA4A 2HUNA 4MIKA 2AA3A 2AH5A 2ORED 3I4FA 3R9XB 1YMQA 5CYPA 3NVMB 2DH6A 1MOPA 3OX1A 3TOVA 4KNVA 3GLHE 3NO4A 5KQLA 3L6EA 4H0FA 3DMTC 3E9RA 1L7BA 5K3DA 1UQUA 4JT2A 5AVTA 2EOAA 3PV0A 4JYAB 3SN6A 1JWBB 2C8LA 1Z4OA 2HM7A 3QVSA 1OGYA 3KEOA 3WJ2A 1N0WA 4BKRA 3U3JA 2BFDA 3LPMA 3FFXA 2WD7A 3OJFA 2IEGA 3OP4A 4PR0A 1MENA 1PFVA 1BVYF 1ZZEA 3T5CA 1Z63A 4JC5A 4RKRA 1B74A 4PIMA 2VF7A 3WS7A 1E5DA 3BTUA 5EUMA 1U63A 1QX4A 2WUEA 3MJSA 5I51A 2O6LA 4DQ0A 4EK9A 1U2RA 3F5DA 4C0QC 5JAIA 1SG6A 2XLCA 3V4SA 2VRCA 1HYQA 4UTVA 4WFQA 3EN0A 4H6PA 2ILVA 1P31A 5AHXA 2GCIA 1Q6ZA 3K72B 2QZSA 3OWOA 5B6JA 1FJHA 1H4QA 3NVKI 1ICEA 3O5AA 3DV0B 3ZCPA 1PK9A 3DP7A 4NFSA 4LVCA 4ROSA 2AN1A 3Q40A 4F1JA 2QNBA 3KZMA 3RD5A 2XCUA 4H4EA 4TXHA 5JZ9A 1FVFA 4X6XA 5AMXA 1KK0A 3WYNA 4AC9A 3PUXA 4D0RA 3KX2A 4QJIA 3VKUA 3SFTA 3DHWC 5AQ1A 4K9NA 4MK4A 2N46A 1Q7TA 3KEMA 3ESAA 4IIVA 1TUBB 2GNAA 3R4VA 4PLHA 2DKOA 3RF7A 2PKWA 5F3DA 5HZHA 3GDHA 5JI2E 1QCZA 1JG2A 3HEBA 2OXIA 1N2IA 4MYUA 2IWHA 4KPUB 5J23A 4QBIA 1UFRA 3JZAA 4GPZA 3K09A 4WCDA 1BOFA 2X5KO 1TC1A 3EMBA 3MS4A 4NY1A 1SU8A 2IU3A 4R81A 3JAWA 3I53A 1UMBA 1ZD9A 1R7RA 2XHEA 3HCPA 3I58A 1XVLA 2MU1A 3X43A 2NUPB 3HNRA 4UFOA 2R8EA 2OV8A 3IBTA 3SYRA 4D9CA 4EMTA 5SY9A 2C1EA 1EMDA 1BMFA 2Y4OA 1E8DA 4MA5A 4COOA 1FF9A 3IAS1 5ESDA 2YX1A 3O1JC 1DIHA 4DTCA 2EGHA 1IE3A 4M1KA 2DPMA 1GNRA 2JCGA 2VJBA 3AWDA 1FTYA 1J90A 1MBZA 1V11B 3BKWA 3JX9A 1Y3AA 5E1BA 3FHTA 3OM0A 3LW7A 4FFDA 4LXUA 3SNKA 5KX5A 4B09A 4L76A 4EZBA 5FORA 2ETVA 3F6CA 2UAGA 1B6SA 4C7BA 5L8VA 5DTIA 1RLTA 3LQQA 4F92B 4MWTA 3GAFA 2GWRA 4Q3LA 1M67A 5FCDA 4X9XA 3A6DA 3NXKA 2C77A 4NDAA 2ATCA 5EIHA 1Q17A 2FN4A 2V6JA 3RF6A 3EF1A 3F97A 3ADBA 3ZE2B 1IPFA 4EJFA 2XXAA 4DY6A 2OGTA 3OWXA 3MTGA 4TT3D 4WK6A 1CS0A 4ZQGA 4LKRA 1J7KA 5KNBA 4C4PA 4F3CA 1EVEA 2HDOA 2ZJYA 3L7JA 1WB5A 5L6LB 4I55B 1WXFA 4TTQA 4RHEA 2MOKA 1GRVA 4J1TA 4C4ZA 4CMIA 3FYUC 3OFND 4TROA 4EFDA 5EGNA 2COKA 1WM1A 1DCMA 4Q1FA 3DBLB 2M6SA 1NVDA 1QPZA 1Q92A 4K05A 1GZVA 3TJMA 1IEVA 6GPBA 4NE9A 1L4BA 3RHSA 4DSTA 3UB3A 3KLBA 1T4MA 2XGJA 1I0ZA 2NACA 1HZZC 4G01B 4HQNA 2W2TA 4OLBA 3LUFA 4QKQA 1Q0TA 1ZICA 3NKVA 1Z5NA 1NN0A 1PFUA 3DMNA 3LUGA 4ZARA 3ZX4A 3I62A 3E5NA 1P80A 3VU1A 2CUZA 4HGOA 4HBZA 3K1YA 4BBZA 1ESCA 1KNXA 3U31A 2XUIA 2HU2A 2QUHA 3DE6X 1W75A 2AC2A 1NVAA 3DL0A 3LBNA 4J0QA 4ENQA 4MUHA 3U3KA 1EK6A 4ZT5A 1NQXA 3AETA 3WWEA 1I94B 3DGFC 4FZVA 10MHA 1PQPA 1QYWA 2Q5EA 2J87A 3ELYA 4ZHSA 1XQ9A 3UFBA 6PFKA 4JLOA 4MW0A 2WMDA 1PL7A 5TGTA 3A1DA 3LFTA 3A1CA 3L0CA 4I9FA 4HYQA 4RADA 1L5VA 2NWQA 5A1JA 4NXNB 1XA0A 2OBFA 3EVZA 1T5SA 3PIIA 1W1WA 4FJ2A 2JGKA 3IEKA 4RCYA 3TL6A 5L6MB 1YRAA 4X1IA 2PZJA 1KKUA 3LHSA 3PVZA 1YZFA 4XRGA 1C0LA 1FFSA 3ZCTA 1LSUA 4S0ZA 4MKXA 4EZIA 4FYHA 1MRZA 2ZUFA 3WMWA 3IUQA 3GP5A 1ZD1A 5FD8A 1KA9H 4XPIA 2C4KA 3WGGA 4C76A 3K0HA 4ENTA 1VBKA 3EQ8A 1PR5A 2BMWA 4OGKA 1O0CA 3HVIA 1Z2NX 2C84A 5E9QA 2P0AA 3F5MA 3NUQA 3F9RA 3WNBA 3IQEA 3ZI0A 3ZVKA 4J7AA 5DGIA 3DUFB 3BVPA 2G0TA 2B8WA 2PEZA 2BGJA 4IHJB 1G9TA 5KHAA 5JPCA 2ZWOA 5F12A 1Q12A 3IQDB 4MRVA 4PPGA 1W49A 3E53A 2H2HA 5I7AA 3HWRA 4YT8A 1U9IC 1E79D 1B1CA 1YRLA 5AI0A 3LQ2A 3PTZA 3GJ5A 3QJYA 1E2UA 4BOYA 5LMUB 3NDBB 4J1SA 5BT8A 1VMDA 2FFQA 2GLTA 4O5OA 4OGLA 4PCUA 3W5UA 4BV8A 4EZEA 3U7HB 4FEAA 2WUFA 5J2TA 4DC0A 4PAMA 3BH6A 3HO8A 5FTKA 3M6LA 5D7BA 1B8UA 1T5BA 4XGQA 3ECAA 4BNUA 4M6WA 5A9SB 4Q19A 2ZZMA 1K4YA 5F3RA 3RV4A 2Q9BA 4FS3A 4LZJA 4PTZA 3W9YA 4CKEB 4DUYB 2VT7A 5A2GA 4JBLA 4HAVA 3IUMA 1ZM7A 3HSSA 2Q27A 3C5EA 2AFHE 5GP1A 1GP2A 1U9ZA 3T3OA 4E5UA 3AJEA 4C1NA 3LCJA 1XKQA 4L3WA 4N8DA 1NQOA 1QP7A 1HFEL 4R51A 3AVVA 3VR6H 5B57C 2ATXA 1DFIA 1MAUA 3NNNA 2R5NA 3G59A 4HCJA 2X58A 4JUFA 1PSWA 4XTCS 4KWHA 1KWKA 1EX6A 3OIUA 1CIPA 1U5BA 4XQ9A 1XTZA 2OY0A 2Z8ZA 4P98A 3T9EA 1TK9A 1X38A 1PJ8A 3BGWA 2ONKA 3QELA 3S7TA 3LZCA 4DQVA 2IP4A 2IE8A 3AFMA 2ZIAA 3KUXA 3PLNA 4KJZA 5EYPA 3E18A 3OZ7A 1FNSA 4IQ0A 4ILEA 3BIJA 4NEHB 4MRSA 3VU3A 4RQUA 4L85A 1H2WA 5ILGA 1SBCA 4J1QA 4IZOA 5B4TA 4QYTA 5BV1A 1E20A 2J8ZA 1R0KA 3NTRA 4PPNA 3STHA 3O21A 3Q7RA 5A5GA 1HQYE 1U8FO 4LF9B 1T4CA 1EI9A 4X85A 5EERA 3M1YA 3K2QA 5ICSA 4P0PB 1NSYA 3OBBA 2AWNA 3BFXA 2BM0A 2B4QA 1N2SA 4UUPA 1W36B 3EGDA 1KK2A 5GZ3A 4RZUA 5L9AA 2CMDA 1ST3A 4DAOA 4IIBA 1KP3A 4G0NA 1G3MA 3Q98A 3V8NA 3NHAA 3ZY4A 2XDQA 1CC1S 1R5BA 2AD5A 1CFZA 4G9BA 1EK5A 2O2XA 1C4KA 4GQIA 1RI5A 3ZE7A 1SUCA 3E05A 1N25A 4RL4A 1Z6QA 3Q9LA 2GAJA 2B8TA 3FPCA 1E5QA 3NBFA 1WLYA 3RTCA 1LQ2A 1IOLA 2J0EA 2XBLA 3NC0C 5GMOA 3UY4A 3GJTA 1RQ7A 1I3LA 2V7QD 3CX3A 1FFXA 4LFBB 3OC0A 2PO5A 3RE1A 4A73A 4BZQA 5LKAA 4EYGA 4WFJA 2WJGA 3WLJA 3L8FA 1JDJA 4LPKA 4EA7A 1UDAA 1KI2A 2B34A 3H99A 2AZMA 3JWHA 3MTAA 1HDXA 4LVOA 1N6LA 2CDNA 2OESA 2PLWA 1TYAE 4F6RB 1XLUA 5TT0A 1TUGA 4QZVA 1X8XA 5KVAA 4DCCA 5C7LO 3ZJVA 5I8PA 3RU2A 2OCKA 5JQWA 4NHOA 3ILXA 2H1SA 2W6NA 3ANYB 3CNLA 2Z98A 3WBBA 1DEKA 3RNOA 1QH9A 4L5IA 4L78A 2PHZA 1K8RA 3CB2A 3PXAA 2A3NA 3ZQ4A 2VJNA 4NBNA 2BH2A 1JR3E 2IYRA 2CXHA 3MB5A 4BQRA 1JA1A 1M74A 3I2GA 3MB8A 1ORRA 1HOXA 4JXJA 3PCXA 5HZKA 5BYKA 2OCAA 4JQOA 1YQDA 5JFOA 1LS1A 1GLVA 1PLLA 2IQIA 4FZJA 3SKVA 4AF7A 4AO8A 4DCNA 1CZRA 1DAEA 3CF6R 1LK5A 4LJ9A 4LYAA 4E11A 5SZHB 3ZQ6A 1C9EA 1Y6RA 2GN0A 4JT9A 5IJ0B 4RGYA 2R6ZA 1SHTX 2EZ4A 4ZP1A 1NNLA 1CQXA 4ZVSA 1IOZA 1Q7GA 4IIGA 2NAFA 2AI3A 2GK6A 3TXXA 3WQSB 1DRKA 2WKWA 5B58C 5ITVA 1I8TA 1UBCA 3IPYA 4EKIA 1EFPB 5A4JA 3JD3A 3DL2A 4B0OA 2QLNA 3SFVA 3EZ7A 3ZX5A 1R4MA 4EQZA 2F1IA 4E46A 4Q4HB 1EUYA 2O2YA 4EY6A 1E2DA 1J0CA 2N9UA 4AN0A 5IF9A 4GBMA 5C8YB 5BN3A 4L6IA 2FHPA 2VLIA 3LSTA 3WHLA 1KPIA 3NBXX 1ISGA 1KU0A 5IYZF 4GOJA 2NU7B 2X8LA 1AC5A 3AF0A 1ZM4A 2JIMA 4EG3A 5CFOA 3GPLA 1LPOA 3DJFA 4ZYYA 3GAAA 3L6OO 4QBHA 4CODB 3VYVA 1EUQA 2J0SA 2GNOA 1YCFA 4UTZA 5HRUA 1FDTA 2J1LA 4KXUA 4UJ5A 3HM9A 4YQYA 1K2VN 4JLSA 4NIMA 3FYSA 1TYEB 3KNZA 4G5OA 1LRKA 3EIQA 4TMXA 1DC6A 3D7LA 4IH1A 2H2AA 3ETDA 3STTA 4AECA 1UXKA 4OQDA 1G6HA 3OTQA 1N5RA 1QWOA 3ZJUA 4C4YA 3KYCB 2I9KA 2ZRBA 2W0SA 4X97A 4IRUB 2B5VA 4O2AB 1ADJA 1KMNA 2PKEA 3RIGA 1K4MA 1EDZA 1ID8A 1T2VA 3ASVA 1E9EA 3M81A 4ZKEA 1KOJA 5C1PA 4KYVA 2WTUA 1ZHHA 5CIQA 1MO3A 4Y8VA 4DQLA 1E6MA 1Y63A 1ZKMA 1W29A 2ZCVA 4PPYA 4ENPA 2BVNA 4RFSA 5EE1A 4BIIA 4HY3A 3AFIA 3RUFA 3PQ6A 3I12A 2DM6A 4KDCA 5DI9A 1CK4A 4WXMA 3GC6A 2E4YA 5TMBA 1T9AA 4V24A 5T4FA 4B76A 1CNFA 3EAGA 4BTLA 2EAUA 2W2MA 3QBJA 3UMGA 2WE7A 3K9BA 5TEVA 4UNRA 3JRWA 5BWCA 2FE4A 3QOXA 2HA6A 1VLHA 1M7GA 1ZIYA 4A7PA 3PQCA 4XZ3A 3SBXA 1HXHA 1ZISA 3WC4A 4TS9A 4DM3A 2DBVO 4HPXB 3LQYA 5K4HA 1OLXA 1SUWA 2ODBA 2VBCA 3ZWWA 3O1IC 5HJ2A 1BIFA 3F0TA 2FEPA 3UYKA 3ZZMA 3KPVA 1PSDA 5LSAA 4HAIA 1HMPA 3FNRA 1ZPDA 1XXHA 3CRZA 2PX6A 2DFVA 3SICE 2Q0SA 3I37X 3U1VA 1WP4A 4N5DA 3ZE6A 3IMEA 1UZLA 2CJXA 3PQ3A 1E6KA 4DR3B 2GO1A 1GT6A 1NQVA 2X9GA 4JSTA 4JQSA 1G2PA 3PE6A 5BVGB 2YJ4A 4WNCA 2OK7A 1IXSB 1YZVA 3I8SA 4C6TA 2WI8A 1YS6A 4D3DA 2XUPA 1IWBB 3DFIA 2YINC 1GPUA 1OVGA 2GCEA 4NG5A 4YT4A 2IOYA 2ZR9A 5FWXA 2F55A 3TGLA 3V55A 2VO1A 3WL4A 3K0AB 2VAWA 3LIIA 4CL8A 3QF4A 2WYHA 1O6BA 4HGRA 3RK4A 2QUZA 1P4GA 4M98A 1L7EA 2AXNA 4MJ3A 3FSJX 3LDUA 3CEPB 2I6GA 3ASUA 3EVGA 4XIIA 2XWJI 4AROA 5IVHA 1C9DB 1UBRS 1QHIA 5ALYA 1DQRA 2YWFA 2CXPA 2HUPA 5CLQA 3WP1B 4CWAA 1OFUA 1W2GA 2FP4B 4K9LA 1ZCJA 4KGXA 4U0KA 3ST7A 4AI6A 1FK8A 3BXFA 2EARA 2RARA 5AHWA 1QOZA 3HUTA 4FGUA 3RYHA 3DE4X 8ADHA 5KTMA 3UTDA 1ZAYA 3DEYX 5E7MA 2HNKA 1P5JA 1CG6A 2Q6TA 3T3PB 4ALJA 3ZHUA 1N1MA 2I6TA 1CVLA 2G1KA 1T10A 1NA5A 2ODAA 2QAJA 3F3SA 3SYKA 4B6OA 2ZRMA 2IHTA 3N8GA 2AD1A 4PZLA 4TQAA 1MFZA 2XMGA 4UOZA 2CUKA 1RKXA 2X40A 1UKEA 5EZ6B 1D6MA 2AW5A 1AUPA 1IB6A 2ACWA 2CXOA 2BZGA 2EX1A 3OY2A 1OFTA 4JYCA 5CT9A 3ZDFA 4CG3A 4M7WA 5H82A 1SHZA 1ULUA 3G7SA 4I8DA 3B7PA 3EYAA 3MTIA 4R9RA 5CURA 3DBRB 5DDIP 3JQFC 5EWJB 5CB6A 5JLJA 3HFGA 3M6VA 4QXRA 4D43A 1M6VA 5AUNB 1COZA 2Z8XA 1TA4A 3MZ0A 2QIOA 4OSOA 3K9FC 3EJWA 4UEWA 4BWFB 4YJ2A 1Z5VA 3VR2A 2X42A 3PFFA 3KCQA 3KWJA 1JIIA 5FBWB 2I3AA 3Q3JB 4AD8A 4CFYA 1MH1A 3C4QA 2BUCA 1YI0A 2EERA 1EFRA 5JCOC 3FG9A 1RPTA 2RJNA 3FYDA 1XAIA 3KVVA 3HKCB 4F6CA 1MPXA 3KD3A 4H1UA 4EG8A 2V59A 1GSOA 4PHHA 4URFA 621PA 3C3CA 4IMPA 4UM9B 4N3BA 1XZKA 3UKDA 2FOXA 3CSDA 1H8EA 2DLNA 2ZB8A 3JQCA 3KHSA 3K9GA 3H4TA 5F4ZA 1GM5A 2JLQA 3AXTA 1EKXA 1OASA 3HABA 4LCJA 3WOVA 4BMSA 4D57A 1E99A 4PSVA 5AYVA 1JPNA 5ERXA 1GN8A 3O2SB 2CL5A 2CV1A 2C54A 4L2IA 3FKSD 3ICQB 4KTVE 1N7HA 1R6UA 3H65A 3QVJA 2VUHB 2OBNA 4ZYXA 4C0LA 3UJPA 2FN3A 4I6JA 1IWOA 2QWXA 1IY0A 2G0NA 2XE6A 3U7QA 5M29A 4GI3A 4MAFA 1C8BA 3UA4A 5G1PA 3DKKA 3M1LA 3RG8A 1N9ZA 4I5FA 4GECA 4BJ3A 1IEXA 2AJCA 1QK3A 2CV2A 1JDVA 1YS7A 3OT1A 4O2BB 3X1YA 4NU6A 2BFCB 5A5DA 4JUAA 2JAWA 3R8CA 2JF0A 4CETA 4CLOA 2IXEA 2QTNA 4M83A 4MNTA 4HAWA 4LI3X 2ZI3A 4DUPA 1SUAA 4E5KA 5HRAA 4IUDS 4YMIA 3I9MA 3P9XA 4AMUA 1DCTA 4GM1A 3P71T 3G9UA 1WUJS 1CUFA 1SBNE 2P91A 5IABA 1CB0A 4P6VF 4HZGA 4LBWA 4N0PA 4YCMA 1TMKA 3HXOA 4GUDA 4GXQA 1Z0UA 2Z83A 3INYA 3L7KA 3L4KA 4DR2B 4MKHA 4KSBA 1H6AA 5ESWA 5LIPA 4ER7A 1H2FA 4TKVA 5LQJA 5DX0A 3TF5A 4YGXB 3K8YA 4BBJA 1GDHA 1R27A 2C61A 4DNQA 2LIVA 1CRLA 1O95D 1YNOA 2OCYC 5CM2Z 3V3KA 1L3IA 8GPBA 2XVXA 3ZR4B 2RIRA 1P91A 3KBOA 4LNUA 1UZUA 4YXWA 2FW6A 1KERA 4EJSA 3QU9A 5K5EA 2G67A 4HB4A 1VE1A 4LVUA 1ST2A 1J8MF 1WCIA 3GDWA 2AE2A 2BI7A 2G9VA 4IZIA 4JBGA 3OICA 4FZ3A 1UAYA 3OT5A 1X87A 3R7LA 1Q0RA 3N3AC 2W58A 4QJBA 1U6KA 4L5AA 3KQKA 3K16A 1QXSA 1Y98A 1V3VA 3R0JA 5DNCA 1TEHA 4MVJI 5CXQA 4LY0A 1PR6A 3DTYA 4IXDA 3NUGA 1LV7A 3A4YA 3HRIA 3THXB 4U5QA 1HQCA 1GJRA 4AL4A 1EAMA 3DE3X 1HSOA 1LU9A 1ISRA 4E6PA 3BXGA 5BSVA 5CW1A 1K3FA 3IBSA 5A04A 1YVPA 4ARAA 3NBUA 2WMOB 4LDRA 3RYCB 3MAAC 1T3ZA 2Q4TA 4IINA 2LRHA 1FFBA 1U0GA 4ASUD 1KP9A 4YJKA 1ZW1A 2CLKB 2B8NA 2OAGA 4MEAA 2P2ZA 4MVJP 5AJTA 1W36C 4E4RA 3DKRA 1U4NA 3F4BA 2P75A 2WWRA 3KVRA 1WWKA 1AKQA 4CU2A 2ZJZA 4BGVA 3OA2A 1TCUA 2QL9A 3P2JA 3BT7A 2P30A 1DSSG 1QYCA 3GROA 4OIMA 4G1CA 1II8B 5JDIA 3QY0A 2VPPA 3D6JA 3PLRA 1P45A 4RPIA 3WDSA 1CE8A 2PJUA 3C3DA 1KJQA 1AT1A 3GQVA 3KKEA 3JYHA 2QQEA 1RBQA 2DTXA 1BHJA 3NPMA 3N39C 3PGVA 5THKA 2D0IA 3SX4A 4IRXA 4D26A 1HMYA 5GVRA 4KXMA 3TPCA 1QGYA 3OOJA 4QM7A 3QOWA 2QLMA 3LWNA 1P6QA 2BPOA 2P4UA 1KSGA 4L8VA 5K0BA 4E14A 3RYFA 3TSOA 4BQFA 1R8YA 3H16A 3EQZA 3K9HA 2GHTA 2VWQA 3QLVC 1BHQ1 3C3BA 1JAIA 2E85A 2AJBA 3DL7A 4A5SA 1RHMA 2VCHA 2EKPA 4QDJA 1TUEA 3KQTA 3O84A 4NATA 4RD1A 4W82A 4DBLC 2Y1DA 2ROQA 1AMOA 3BXPA 5K20A 2WUWE 2XT6A 3GYGA 4MMYB 2VUUA 2C42A 4AWAA 2AB0A 1V1RB 4R2IA 1JDBB 1XZCA 3I05A 3L93A 3M0EA 3PR2B 3IEMA 2WKSA 1EDDA 3TR6A 3VNBA 3KJFA 2JVKA 2X0FA 1C7IA 2BTEA 3ZE9A 3EC1A 1WMDA 2YIDA 1OPXA 2J3DA 2I2XB 4ZEWA 5KZMB 2HEIA 5C18A 3QX9A 3JD2A 5H59A 3HKEB 2PXCA 5SYMA 1WO8A 2AZXA 2VWHA 5F21A 1UUFA 4CIXA 3O0DA 2ZBQA 5AW1A 5LWHA 4MYRA 3CF4G 4TV8B 5LZ2A 2DXIA 1KRXA 3MEQA 2W6CX 3FWPA 4CKCA 2JDID 3EA5A 3PS9A 4IRMA 4XYBA 2PU7A 1X70A 3T4UA 5KI6A 1ZC4A 1JLHA 2Q1TA 3HA3A 2YVKA 2L42A 3B1KA 3I6IA 4ZQFA 3QI2A 1MUUA 2REQB 4LBYA 4X61A 4B9AA 4EA6A 5J4VA 1TEXA 4RA9A 5JWOA 4W5OA 2QYSA 1Q95A 3OQBA 4CEIB 4PSDA 1UK6A 4PLFA 3HCAA 3ZXUB 2UVDA 5ILOA 1S7GA 3MQ4A 4GNKA 4PE5B 4V0MA 4EYQA 1VL8A 4HJRA 5EP3A 4QOJA 5LKRA 1F5NA 3KR0A 3L6UA 1LSSA 4YK7A 4PZEA 2G36A 4FOPA 2PS9A 3E6AA 3A1WA 2IOQA 1NMXA 5L3SB 1KDOA 3I72A 3QKWA 3U7GA 2V0GA 2QGFA 1SY7A 4H15A 4J75A 5DULA 2WPNA 4GX0A 2HK7A 3EGIA 4DMUB 5MFPA 1UT5A 4HUQB 4AY6A 1K8XB 3AUFA 1Q1EA 1A82A 1VHLA 4UTXA 3B5EA 4US0R 4BZPA 1E2FA 2CDCA 3ND6A 4WCFB 4JYBA 4BLQA 4C0AC 2C4HA 1ESZA 2DHCA 3D1JA 5J2UF 3DA8A 4EG6A 1OTHA 2IYTA 2WAAA 3F8SA 5JARA 1LPSA 1GG2A 2E5WA 2CNOA 1QGUB 3DS8A 3O8OA 3G5AA 1OD6A 4HXEB 2F9FA 5E6RA 3VKHA 1ZYUA 1UIRA 3D54D 2IHYA 1Y1PA 4JHXA 4TQUS 3LHKA 4C5BA 2Q5LA 2G1UA 4D3XA 3C4VA 1SAYA 2AG0A 4D79A 2BIFA 3BMQB 1Q0HA 3EFOB 1VLVA 5BSFA 5KC9A 4RTNA 4D5EA 2J3MA 5E8JA 1HE8B 3CWCA 4Q05A 4UXHA 3GCWA 3WRVA 1XZBA 1Z35A 4C29A 2OUKA 1UIMA 1JU3A 4HQLA 3A28A 2GR9A 3OCJA 4B80A 2VPQA 3QTTA 2P0EA 1I7LA 1NQTA 1V39A 2V3CC 2V5UA 4FI3C 1Y6QA 4ZVVA 2DH5A 2ZYSA 3HRHA 5K6AA 1BZYA 5LA6F 4A36A 5LQNA 2A6PA 5IXYA 4MQMA 1CUCA 1PCXA 3RIHA 3G1WA 1SNYA 3IVCA 1I30A 3HHPA 2V7PA 2IUSA 2FRDC 3VHRA 2EW8A 4MPTA 1VSUA 4FD3A 5IZCC 1PD1A 3TL3A 1XZNA 2UVPB 2C4TA 4L02A 4PV7A 4DLTA 3S81A 5FUBA 1KQOA 4WN3A 2HIHA 3DM9B 2IOFA 3PEVA 1CZUA 4MSUA 2DCMA 1MVLA 4J3JA 2X19A 2H4HA 4L4XA 4OHOA 1RPAA 3ZI7A 5F2NA 2GQ0A 1MH9A 3IFSA 1WTAA 2EX4A 3KHKA 4GRAA 4C5AA 2QHXA 2ZRDA 4ZYZA 3KB2A 2W2PA 3SC2A 4AS1A 3L1HA 3OAAD 5D3QA 1PRYA 5KJ6A 1LI5A 4GQBA 1SXIA 2EKBA 5M2QA 1SQFA 4H31A 4JC8A 5D1NA 1Z5GA 1VGRA 1J99A 4G5RA 2O57A 5K3BA 2CXNA 3TQQA 3F4LA 4L8GA 1Z4MA 5CNKA 4IX9A 3CA8A 2WYOA 5ALFA 1DFGA 2O0JA 1I4DD 2Q6LA 2NN3C 1E1CA 3HR8A 2PJDA 4HH1A 5IYZA 4MQLA 1XK7A 4HP8A 3GFTA 3T3NA 2VAVA 3Q8WA 3DOHA 5BSUA 1M6HA 3F4KA 3T5AA 4E21A 2ZS9A 5CLJA 5FOTA 3ZOKA 3VVLA 1WCWA 1PJ3A 1YKSA 3K6SB 4LHEA 1QVZA 3G9ZA 2CHEA 2WU0A 1DX6A 3FGPA 4LW8A 1XNGA 4MDHA 3RVKA 5FTLA 1V2HE 2JAOA 2JCXA 1YC2A 4HH0A 2JD1A 2QZZA 2L82A 2CXQA 2PK3A 2QTAA 4ZEOA 1EUCA 3M33A 1SCUA 4IVPA 1XGKA 2NUTB 2HKIA 1V1MB 4E1BA 1BDIA 1XD2B 2XF2A 2C2OA 4YASA 4YUXA 4MR9A 3SIWA 3TVTA 1NP3A 2VNIA 3IQGX 2FPSA 3KFVA 4JVMA 1MJ5A 3BGIA 3BL6A 4NK5A 4QUKA 4S1TA 4A0GA 1L5MA 3COYA 5CNMA 4HDKB 5HQ3B 1G21E 1TPYA 3R0XA 4KRYA 1YDWA 2H16A 1JQAA 3UZUA 4P5PA 2I2DA 2QJFA 4LJAA 4CMCA 2H31A 3W5DA 4MVJD 4XEUA 3UXYA 2YHBA 4CDNA 4LZOA 3QTBA 4C3OB 2GOYA 2HBRA 1DHTA 5C1DA 1GAWA 1N2HA 2YUIA 3BFJA 1TEZA 1HL7A 2ZULA 2YJ6A 2VP9A 2UZ0A 4D5GA 2IL1A 3PXEA 5EJ2A 2FSHA 5C51B 2K7FA 4NBTA 2VDOB 1MU0A 1NYLA 3ZEAA 5JT1A 1KEEA 3IB6A 2HX1A <