2AK2A

Adenylate kinase isoenzyme-2
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
220
structure length
220
Chain Sequence
PKGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDASQTPDVVFASILAAFSKATS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of bovine mitochondrial adenylate kinase: comparison with isoenzymes in other compartments.
pubmed rcsb
molecule tags Phosphotransferase
molecule keywords ADENYLATE KINASE ISOENZYME-2
total genus 76
structure length 220
sequence length 220
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ak2A00
1AS3A 3L0IB 4EPRA 2J7PD 2W6JA 3O47A 1T91A 2NPIA 1Q12A 4FINA 1BMFD 3SJBA 5J4LA 4JMPA 5LPNA 5DN6A 2ZAOA 4OYHA 1JJ7A 5CYPA 1IAQA 4LGMA 5BQ5A 1KZGB 1PLKA 3BK7A 4ERNA 1FTSA 1DOAA 4KHZA 1ANKA 1W2GA 2ZJOA 3D3QA 4GDFA 3P1JA 1II0A 3B1YA 4CZ2A 4DKXA 1MO5A 5H8WA 3ZH9B 1G20E 3TK1A 2ZRFA 2Z0MA 4I1SA 4RVCA 3ZZTA 2ZRGA 4NYIR 2GXAA 4A2WA 2YJTD 3NC1C 2NOAA 4HZIA 2QGZA 1EFHA 2IUTA 1YRAA 2RCNA 3GEIA 2F43B 3T1TA 4OBEA 4IOKA 1S8FA 1LVGA 4BFWA 2GAOA 5C4MA 5IT5A 3DMDA 3O8RA 3BB4A 2ZRNA 1L4UA 4FCTA 4CDGA 3I8SA 5CB6A 2H57A 4ESHA 1XZPA 2GXUA 1KK0A 1P4SA 2CE7A 1XD2A 2FGKA 4KXFB 1U0LA 4UJ3A 5EXXA 3QVUA 4AG5A 4JVSB 1IXSB 3K70D 3FB4A 4TLBA 3NBZC 2LCFA 1VG1A 2DCUA 3QKUA 4IDQA 1QBKC 1CLUA 4GP7A 1G3UA 5GJWC 4AIIA 2P2LA 2IYYA 3OAAA 4TZ0A 4KSBA 4Y0VA 1R4AA 1J7KA 3RWMB 1KDPA 3Q72A 3I5YA 4K46A 1H8EA 1TTTA 4TQ9A 3U7FB 5DI9A 3RLFA 2VH5R 3T34A 4C0HA 3U3KA 2GXQA 3CF0A 4US2R 5FPTA 2WWHA 5HCNA 4LZZA 2WJGA 1ZM9A 4CYMA 2XZOA 1G7TA 3W5IA 2UKDA 4CEHB 3AEZA 2ZRKA 4MH0R 3ASZA 3C7KA 3T1VA 2WOJA 3GEHA 4L8GA 4LJAA 3TIFA 4PSAA 4C4PA 1FNNA 2A30A 3GPLA 5AJZA 1EESA 4G5OA 3CH4B 4MGIR 4O3MA 2I1QA 1S96A 4BLQA 1P6XA 4L15A 4P32A 2JLSA 2XJ9A 1Z07A 2OFWA 3RAPR 4DLVA 2ODNA 4IHQA 3LV8A 2VL7A 4ZCMA 1MR3F 3K0EA 3K0CC 4QHSA 3EXAA 1T4GA 2IW3A 2ZS8A 1HYQA 4LPSA 2XNSA 3VR1A 2RGXA 4A6XA 3B9PA 2JIZA 4B33A 4E09A 1W4BA 2PT7A 3BAFA 2QP9X 3OEED 4C0QC 1RJ9A 2R6AA 2O52A 2REOA 3K1JA 4FIDA 2MMCA 4GFDA 1JPJA 4HB3A 3W6PA 3SJCA 2F9MA 2GNOA 1ZYUA 4GP6A 4HB0A 2WWXA 4KYUA 2AKYA 2NGRA 4Q66C 3BE4A 1E2EA 4B2IA 1XMVA 2C9OA 3KUCA 4NCJA 2F3TA 2ZIAA 4CGZA 4DLTA 2A5GA 1UBGA 2BIFA 1P73A 1ZIPA 2WSMA 1BS1A 5L3QA 4AC9A 1U2RA 3OHMA 3B6EA 1SVIA 4M1KA 3BH7A 3ZGXA 2D4HA 4UNNA 1YZUA 5CDFE 4IDNA 1OYYA 1KAGA 2PLFA 1Z08A 1G17A 3WRXC 4BRWA 2XB4A 2JJ1D 3RS0A 2W2TA 1F2TA 1AZSC 1ESNA 2ZI6A 5J4VA 4NCHA 3U6BA 1J99A 3O8CA 1W0JA 4LC1A 3R9XA 1QRAA 2F3RA 1ZD8A 4MRPA 3J81k 1UM8A 3NKVA 1NKTA 4NYMR 1LV7A 2IUUA 1JPNA 3LD9A 1A1VA 1TAGA 1UADA 5FPSA 2NO9A 2CCKA 1CU1A 2ZI5A 2V7QD 4PO1A 4B76A 2ZRPA 5L8VA 4D0LB 2FX3A 3NXSA 1E2FA 4PPNA 1KO8A 2H7VA 1D2NA 4O2RA 2JDIA 2QSYA 2UZ3A 4HZUB 3WP0A 1YR6A 3KQNA 4JL6A 4Z1MD 4I1VA 4URXR 2RGNA 4D4LA 3DL0A 1BYIA 1ZM7A 2OCYC 5FR1A 5DISB 1YZLA 2OLJA 3A1SA 3ND9A 2WSSD 2WOOA 1VCOA 4JLJA 4L9WA 4HAUA 3CPHA 3U3OA 3B8HA 2IS1A 1CS4C 3KFXA 2IS2A 3KJGA 1F60A 4JIMA 3I62A 2R6CA 3KQKA 1FMLA 2ONJA 1U0JA 3G82C 5K8TA 1KZ7B 3OIYA 2CL0X 4JT4A 2NPFA 4BPBA 1ZD9A 3X1XA 3ZVRA 4EPWA 5IRCD 2GBLA 4D81A 3AB3A 3EC2A 3SJZA 3CLVA 3LQQA 4OQMA 1XMIA 4Q1AA 8OHMA 2GJSA 2QT1A 2HUPA 2C96A 4RZXA 2X1VA 1HT2E 2CVFA 1VKJA 4DWJA 4M1OA 3SBEA 3FDIA 3N2EA 2WM9B 2GCOB 1DTSA 1XEWY 3IEVA 2JAQA 3L0OA 1GL6A 4GZLA 1Q3HA 4ACAA 1KI7A 1H65A 1E2IA 4IXNA 4QM6A 3A36A 3NWJA 4BZXA 5B57C 3JZMA 1VG0B 2O8DA 1B0UA 1DS6A 4EDHA 3CZPA 5KNBA 1SVWA 3DZDA 1RW4A 2KB0A 1OPXA 1XJCA 3K09A 1TQDA 1OXUA 4OJQA 4YMWA 3T61A 4Q21A 4URVR 3RC8A 3QG5A 3WBKA 1L4YA 2ZYTX 1OB2A 1KJYA 3HR7A 3AF1A 4TTQA 4OHZA 3LW7A 3TQCA 5C18A 5JFGA 2WAYA 1E0KA 1GNRA 1TNDA 2D06A 2FG5A 1KMQA 2JLYA 3GJ6A 2KJQA 1P60A 3QBVA 3KUDA 5FPKA 1IXZA 2WKRA 3EZ2A 2O8DB 2WHXA 4HDQB 3GLGA 1RC8A 3FKSD 4DCUA 3CNNA 3GLFB 2OE2A 5HPYB 2WWGA 2IBMA 5BYJA 3A1UA 2QP3A 2EWVA 5CIQA 4KU4A 5L3RA 4MDEA 1XRJA 2Z5FA 3KXKA 4G5RA 2ZROA 5K8IA 4ILEA 2BJWA 2HLDA 3MSXA 2P6NA 2ZETA 3JVUA 3PEVA 1YR9A 4AKHA 2GZAA 1FUKA 1YZQA 4OK3A 4V03A 5AWFC 3GFOA 3B1VA 1FUUA 2NO7A 3B1XA 2CE2X 4XIGS 1Z6YA 3BOSA 4Q1FA 2WJIA 3FMPB 4ABYA 1KO7A 1TQ6A 4NCNA 2XB2A 4US1R 3VHXA 4MKHA 1WRBA 2O8FB 3IIJA 3I92A 1ZMXA 3RS2A 3QEOA 1KYIA 2FJUA 3HPRA 5KYKA 2CHGA 2RHDA 2WJHA 4NE2A 1W36B 1DADA 1EFRA 5FL7D 1MRNA 4NMMA 1YR7A 5CM9C 4DLRA 1N3BA 1M2OB 1CJVC 1GITA 4ZCLA 4MUBA 4Z8YA 1Z0AA 4IOLA 4GT1A 2IWRA 4OJKA 4WAUA 4A0FA 4WZAE 2O8CB 1YU9A 4U02A 4TT3D 4F91B 2IL1A 3AVTA 2FH5B 2MSDB 4BQSA 4XSHA 3SOPA 2CL6X 4B6FA 4TLEA 1E9DA 1IXRC 2EFHB 2JASA 2QE7A 3T5DA 3THOA 2OAQ1 1GZSA 1K5DA 2ZJ5A 3GMTA 5JSZB 2AD5A 1KTVA 2OXCA 5FTNA 4Q19A 1G6OA 4DXAA 2PZEA 3LLMA 4QBFA 4WZBE 1P9RA 2CXXA 4IDHA 4OI0A 2WICA 3A1WA 3PG5A 2VLIA 3ZD7A 3KJEA 2JA1A 5KDDA 3C5CA 4IW3B 2MMGA 4MRVA 1COWD 4ZV4A 3KX2A 1VG9B 4HLUA 5CJPA 4PSVA 2ZJBA 4QGFA 1NVWQ 4YXWA 1SZPA 2FMXA 3VR3A 1XB2A 1AA9A 2BWJA 2QORA 1N6PA 1W36C 2AXNA 5DN6D 5JCZA 2NZJA 5TXGA 4CRWB 1BO6A 2CHQA 3UPUA 2FU5C 2J87A 1W4AA 5EXPA 3NHAA 2BEJA 3W3ZB 3GLFA 2H8KA 2R6FA 3MLEA 2HT1A 2IWHA 1KI6A 4OQFA 2YWHA 2GHIA 3KFVA 2PX3A 4BRUA 4EPTA 4JKIA 1NN0A 1KI6B 4LJYA 3I3SR 3I61A 2P67A 3GLHA 1T5LA 2Z43A 1UKEA 4FMDB 2G83A 4BFYA 3A4MA 1G3RA 1OFHA 2Z4SA 1UEIA 4U7DA 2ASEA 3KKOA 2VA8A 4CF7A 5F2EA 1TF5A 1EWQA 4MYHA 4QBIA 4PZYA 4NP6A 1WQ1R 3U44A 4XVRA 3UMRA 1E1QA 4DSOA 4RKEA 1AKYA 1KO1A 3WMGA 3A1TA 3UIEA 2Q6TA 3DVLA 4V0ME 1EK0A 1PZNA 3CF2A 2KBEA 4V0MA 5JMTA 1HURA 5DYGA 3QNUA 3CR8A 5J4KA 5JZVA 2BMFA 4LV8B 2GJ8A 3WBJA 4B47A 3AKCA 4S35A 2WZQA 1FTNA 1N5LA 4GMDA 4TYPA 3U44B 4PZZA 4Q4JB 4AY2A 2QUZA 4OHXA 5KSPA 2NO1A 3CIOA 2CLCX 3CH5A 2GBLC 1K8RA 1EXMA 4FMBB 3RNLA 2GESA 1N0UA 2ZR9A 5J4HA 4X8HA 1JAIA 4ZDJA 3B82A 1TMKA 5HZHA 2F1RA 3TNFA 3DM9B 3AH8A 1MRSA 4GOXA 1SXJD 3QXHA 4J0QA 3NH6A 4LV5B 4EPYA 2ZR7A 1GNPA 3X1WA 3NIBA 3QXCA 1JALA 1QHYA 2VF8A 4HAZA 1MKYA 4IXMA 1E2LA 3DM5A 4TL8A 1EX7A 4BE7B 4D4MA 4OK6A 3OFND 1SVKA 1JXMA 2B7CA 2J3EA 3K70C 4JLPA 3GEEA 4RFSB 3P27A 4TQAA 5FI1B 3BFVA 2R6DA 1LY1A 4R7ZA 1C9KA 3AVWA 2ZYVX 3F3YA 4RFSA 5FR2A 4D82A 1DVRA 5SZHB 2PL3A 3OIUA 1Q3TA 2JIZD 2ZJ2A 1BIFA 5FUYA 1O3YA 1FP7A 1TL7C 4L4UA 2YV5A 2ZJAA 1P72A 3ZZUA 2YNMA 4RCYA 5TB5A 1XPUA 2X77A 1ZW6A 3AVOA 4A15A 1G8YA 4JJKA 1HY3A 821PA 1A82A 1ESMA 3TH5A 1ZUNB 3I4LA 4WZ6A 3HJNA 2V54A 3Q7QA 4W5JA 1DAGA 3WXMA 3PQCA 3EPJA 3SS8A 4B3XA 4F4JA 3TQFA 2IYWA 3VR2A 1W4CA 1W5TA 4PO8A 2XZLA 1Z2CA 4N3NA 1SHKA 3K0FB 1G7SA 4PC2A 121PA 1I4TD 3HYRA 4QHYA 1A2BA 3NBFA 4BLRA 1UF9A 2IK8A 4FMDF 4LHYA 5CIWA 2ZRIA 3AF2A 3C5HA 4GMXA 1RYHA 4NYJR 5F9HA 1BH2A 1EWRA 3H0KA 3AF4A 5CK4A 4QC2A 4LBVA 3QQ5A 1WP9A 1E79A 4LJ8A 3G0HA 1D6JA 3I72A 4NYJQ 1AKEA 3VX4A 2QMEA 1NVVQ 2ZANA 3MAAC 2XEXA 1U99A 5KU1A 3W34A 4NDZA 3U3JA 5CLLA 4DLUA 4JBYA 1M6NA 1G8PA 4RD6A 5AUNB 3B5JA 3K9LA 4HB2A 4XVQA 1VMAA 2IF2A 4RFVA 1CEEA 4MYCA 2JATA 1W7AA 4IDOA 4JSYA 4CW7A 1DAHA 1E94E 4XJXA 1OKKD 3EZ9A 5F98A 3MFYA 4DC9A 1R0ZA 1UKZA 1UAAA 1XEXA 1AS2A 1NY6A 2C03A 1T3SA 4PQYA 3RHFA 4FCVA 2N1BA 1VCMA 3ZYCA 4B3DA 1KK2A 1JR3D 1N2CE 3GD7A 3KTAA 1E9RA 1UKVY 1EFRD 2GEDA 5FL7A 3T1OA 5G3YA 1GSIA 4AURA 4D0GA 3C4JA 3EZ6A 3QPVA 5HKKD 3QBTA 4V0NA 2WV9A 2W00A 1RRGA 1A4RA 3VTKA 3CO5A 3VKGA 1MV5A 1R8QA 2ZJYA 1Q22A 1SKYE 4Z54A 5EZ6B 3T12A 3I5XA 1S1MA 3FOZA 5JJLA 4CEHA 5KSYA 1ZINA 1PLLA 5EP1A 3X2SA 4EIWA 2VP2A 1KMHA 2CVHA 2YWFA 4PFSA 3MG9A 4DEYA 4M9QA 3NBYC 3ZLJA 4KLZA 4Q9IA 3M0EA 2YKGA 1VYTA 3K8YA 4A0GA 1OSNA 1LS1A 5L3VA 4A0RA 1OIWA 1W1WA 1IJEA 4QKQA 4C2UA 1FPMA 3IEUA 4RD3A 5KUTA 3AGQA 2QMOA 4BGDA 4IEEA 4OHVA 4DVGA 2DWOA 3NHBA 5EUMA 2AK2A 1KY2A 2OHFA 1N5JA 5JEDA 2OBLA 3AGPA 2WMNB 4CEIA 2VHTA 1FQJA 4JVMA 1UKYA 1H8HD 4YXWD 3W6NA 3BGWA 2W0MA 3G5UA 1KHTA 2O8BA 1LF0A 2GCPA 4XD7D 5CYOA 2QGNA 3QKSA 2QPAA 4BUJA 3IILA 4WOPA 1Q57A 2A5JA 3C14C 3BERA 2ZYUX 3AP2A 2OILA 4MRSA 1XCPA 1Q1EA 1W5SA 3SEAA 1NIPA 2BBTA 1U94A 1YZGA 2VP0A 3ZVMA 2J0UA 3K0CA 3Q5DA 2PLRA 3QENA 4B48A 2BM0A 2QPTA 3AF3A 4TYYA 1QHIA 5FOWA 1NVXQ 4CEIB 4EPXA 3EIQA 1P61B 3CF6R 1SGWA 1XEWX 3HU3A 2OM2A 2QI9C 5B2ZA 1DAEA 3GFPA 1AM4D 3TGPA 1G5RA 2D7CA 4BLPA 3A58B 5BN5A 3VU9A 1ZNWA 3KQUA 1NI3A 1OH6A 3WP1B 1M8PA 2Q9AA 1NKSA 1X1SA 2JJ8A 4OQLA 1GG2A 4MQBA 4BECA 4M1YA 2ZI7A 4HLDA 5CK5A 1D2MA 4G5GA 1II8A 2GXSA 2PX0A 3WHKA 5CITA 1N6OA 4RKFA 2O8EB 1CIPA 3VR6A 5DNYB 5G53C 4KVGA 4Q1EA 2IYTA 1T8TA 1KKMA 4G01B 2X8AA 2WPDA 3UWKA 1XWIA 1G8GA 1RYFA 1XD8A 1CBUA 1DAKA 1GDDA 1XTSA 3H2YA 1E32A 3R20A 5CLQA 1G6HA 3LLUA 4JJZA 4LJ9A 4H1VA 2WTUA 2P3SA 2F55A 1TUIA 2A2ZA 3SNHA 4ZDIA 1VHLA 4C2TA 2GCNA 3QF4B 2DHRA 4M4SA 1QG2A 3BC1A 1I4DD 3SN6A 1XD2B 1S0UA 4V02A 1PJRA 2QE7D 5F3WB 1AQYA 4DDTA 4UXJA 2AXPA 2PEYA 4M8NE 4QGGA 5KHOC 2G1KA 2VQSA 1UFQA 5H68A 2BHRA 3GJ4A 3PV0A 4M1MA 3LDAA 4HAVA 4PAMA 2V1XA 4E03A 1VCNA 2PMDA 2V6JA 2BCJQ 4QM7A 1G3QA 4Q03A 4DLXA 4Q4HA 2FFQA 2OSBA 4QFMA 1RZ3A 1KMHB 1Z5ZA 4KI0A 4TLCA 5HZKA 5LD2C 3SI7A 5FOTA 4OHWA 3BS4A 1Y3AA 1WE2A 4DJTA 2ZE8A 1J8MF 4E22A 1C4OA 2YC2C 1LW7A 4Q7JB 1E9SA 3AVYA 1TQ2A 3ETLA 4NZYA 2R9VA 3NC0C 1NN1A 1ZM4A 3CX8A 5BW8A 1IONA 1QZXA 3AUXA 3WRYC 3AVUA 4IJMA 1LS6A 4X8MA 1M1YE 1OHHD 4DRZA 3R7WA 4Q1BA 1ZCAA 3R9WA 4M1WA 4G1UC 3KQHA 2ZE5A 2ZEJA 2CDNA 3VKHA 3W9YA 4KITB 3V00A 3PFIA 5BN3A 3NEYA 1G7RA 1FX0B 3TE6A 1G64A 1U9IA 2BM1A 4DUGD 4EFLA 2R6GA 4CIDA 1D9XA 4JYBA 2IYXA 4OQXA 1GKIA 3QIAA 2CLSA 4KFTA 1DO2A 3T35A 6Q21A 1SHZA 1G8HA 2XNDD 1CRQA 3LVRE 1XJQA 2QM7A 3IDQA 4OI2A 4B32A 5A4JA 2NMVA 1T3LA 3U5ZB 3CW2A 5TVKA 3K09C 5HTKA 3MRSA 3PUXA 5DI3B 4DBLC 2OCAA 4QBGB 1JI0A 1HQCA 2J59A 3NTUA 1XTKA 2H18A 2V7QA 3MJRA 3OEHD 1YJ5A 3SJAA 4BASA 2RMKA 3OZXA 1S3SA 3DMNA 4ZO4A 4ZKEA 4W7SA 2GA8A 3KJHA 4A6PA 3ZZ0A 2DYKA 4RZUA 2C9YA 5JS8A 1N25A 1JR3E 2WAXA 1KIMA 1RRPA 1J70A 2KI5A 1MOZA 3WYGA 5JWOA 2FEOA 2CK3A 2QP4A 1UDXA 2DBYA 1HTWA 2HT6A 3H4MA 2A78A 5FTMA 4W5WA 3WY9A 1B23P 5DE3A 1H8ED 4R71A 1HEIA 1KY3A 2CJWB 2GWHA 3W5JA 5L3SB 2GK6A 5TDHA 5KSOA 3D31A 3THWB 3GJXC 3TR0A 3TLXA 4I4LA 4JT2A 2J0QA 4FXPA 4DSNA 2XZPA 2RB4A 4M21A 4Q48A 4EFNA 1D8TA 4QOSA 4HSEA 5EJEA 1UDWA 4MDFA 1FQKA 2BVNA 3VU9B 2CNWD 1CF4A 1JQJC 4WVFA 5KNCA 2ORIA 3P20A 3ADCA 4EQ6A 1DO0A 2GVDC 2BBWA 2AHOA 3WHLA 2SHKA 1DPFA 1P62B 3QPWA 3GFTA 3K70B 1ZD1A 2WVJA 2NTYC 5EXTA 4HLCA 3W3AA 4M9XA 1U8AA 3S1AB 1YE8A 1Z3IX 3IUYA 3EC1A 3TMKA 1R5BA 1WXQA 4TMTA 2XOKD 3K0AA 1T5IA 4Q9KA 5JHGB 4WBSA 1OH8A 1HT1E 3CRMA 1RJ9B 2ZU0C 1NNEA 3CBQA 1VG8A 1W4RA 4IKEA 5BN4A 1IJFA 3OAAD 2J0VA 3A37A 4YMVA 5FBLB 4O2LA 5KNDA 3KDSE 1N6HA 2W0SA 3C41J 1Z63A 4B74A 5E7MA 3VQTA 5JBQA 2REXB 2RGAA 2OBNA 2QTVB 3KL4A 1M7HA 5D3MB 2XSZD 4UJ5A 1G291 2FDCA 2OBMA 3ZDQA 4IEIA 5K8LA 1E0JA 2RKOA 3S1AA 2E9SA 2A7QA 4MUAA 4AK9A 4M9ZA 1N6KA 1VIAA 5FFMA 2C98A 4F93B 4DB4A 3QXXA 5FBQB 2CMKA 3W8RA 3RWOA 3QSYA 2K5UA 3WMFA 1AZTA 2DPXA 2WJJA 3M1IA 3IIMA 1ZIOA 2O0HA 5CDFA 2Z4RA 4BLSA 3CRQA 3KZ1E 4MGKR 3ZQJA 4PC6A 2YOHA 4B35A 1RVDA 1ZJ6A 4BFTA 4ZPXA 1R5OA 4CT5A 1ZU4A 1IN8A 4Q01A 1FW6A 5IF9A 2C78A 2P5TB 3EPLA 1DEKA 3GJ7A 4QGHA 3TW4A 3LBHA 1IQPA 1KGDA 1Z6XA 1OB5A 2B8TA 3FYHA 2ZPTX 1W0KD 4URYR 1OT3A 2AN9A 2CJWA 1NL3A 2FGJA 4TL7A 5E7JA 1J90A 5H1YA 1IN5A 2QAGC 2GDJA 4BFUA 1U8ZA 3DO6A 3KB1A 4YDSA 5IHPA 3Q5EA 2FN4A 4AYTA 2FWRA 2VTKA 3SDZA 2R62A 2EFEB 1UBEA 2VF7A 2KE5A 1G19A 2YHSA 2ZYWX 3SYKA 2ZM5A 2IHYA 1JBKA 2YOGA 4UXIA 1QHSA 3BJIC 4LJ5A 4DCVA 1HH4A 4K81B 3WNDA 4BZQA 2JJ1A 2HEIA 1GAJA 1KDRA 1Z22A 5JSZA 4UNQA 2FSHA 2Q3FA 2YYZA 2P5SA 4FN5A 4BZPA 2GZDA 4PANA 1QDEA 1UBCA 2NQ2C 4G3XA 2OLKA 1KSJA 4DT1B 2QT0A 2AWOA 4OK5A 3SR0A 4QL3A 4WXRA 4JL8A 5FBVB 1V5WA 4LHXA 5P21A 5JRZA 1G18A 2GF9A 5JI2E 2AKAB 4Z8XA 3LXRA 3BRWD 1G4AE 1SVOA 2FSGA 5EE3A 2GCOA 2RGEA 4PTLA 2IYLD 1QVAA 5EE9A 3TJZA 3NVAA 3T5GA 2V55B 3RVBA 4B6EA 3F5FA 4JSTA 1M74A 1VIYA 1Q1BA 2IXEA 4RD2A 2WSSA 1WB9A 4TTRA 4C30A 4LHVA 2IYRA 1G3MA 4B3GA 4QJ5A 5GVSA 1CJTC 4Q4LA 1NF3A 3U7HB 1W46A 4RZ2A 4HDCA 2KWIA 2YC4C 1OE0A 3QPUA 2FEMA 3QXJA 4PQFA 2VHUA 4XTRA 5JS7A 2ORWA 3IHWA 3GLGB 2WIAA 4PC3A 4CEJA 3TVTA 5JHHB 1A5TA 5KPDA 1G9XA 2PCJA 3HYTA 4GPTA 4MGZR 4GBMA 4F4IA 1S2MA 4JBWA 5DIFA 1OLOA 3R9IA 1Z83A 3GJ5A 3GQBA 4R2IA 4HATA 4KV9A 1TEVA 4DB2A 3BB1A 4TLAA 1QHNA 2FOLA 1NMZA 3HR8A 3V9PA 1P2VA 2B7BA 4RSGA 1R7RA 4F92B 1RKBA 4LHZA 2RGDA 2ZVPX 4C3ZA 4GRAA 4A36A 3OIWA 5B30A 4E07A 4CEJB 2ZRHA 1CR0A 1E2QA 1U98A 3VX3A 2OAP1 1VYVA 1J8YF 5TMPA 1XFAA 2PBRA 2BOVA 4IDPA 3ZIAD 1US8A 2EWWA 3Q85A 2A5DA 3PXGA 4ZDKA 4S2EA 1D9ZA 2XSZA 3KXIA 1L8QA 1US8B 5DGXA 4UNRA 2XXAB 1NRJB 2XTNA 1NIJA 1E69A 3PENA 1FL9A 3D6TB 2DFKB 2PT5A 2VP9A 4PHGA 2EW1A 2GILA 2XOKA 1XD9A 4A82A 2ZI9A 1OH7A 1OIXA 4F7WA 4IFEA 3VR5A 4A8JB 3AF0A 3TVDA 2V6IA 4EJSB 1KI3A 3I73A 3CWZA 3EA5A 2X2FA 2XTMA 4U5XA 3LY5A 4NTZA 4DT1A 3A1VA 3FHCB 1OFIA 3LVQE 3KKPA 3R8FA 1AS0A 4QXAA 2H1LA 5AUPB 5HR5A 2GKSA 4URUR 5JRJA 3F8TA 2YOFA 1R10A 3SFVA 5GVRA 4EPVA 2JLZA 5DSZA 2H17A 4YONB 3M4YA 5TV2A 4Q00A 5JJKA 1PUJA 2QMUA 2BKUA 2WJYA 2OCBA 1EGAA 1HE1C 1TUEA 4U00A 3E2IA 3WMEA 3H1TA 3D8BA 1IY1A 3OF5A 2ZRCA 3FMOB 1YHNA 2ZRMA 3GLHE 3KJIA 3KXLA 4Q47A 2AFHE 2WWWA 2FV8A 4R98A 5JWHA 1GM5A 3VMFA 2WWFA 4B44A 4EKDA 1XXHB 4ITRC 1GOTA 2BEKA 4RY2A 2IYSA 1N0WA 1KDOA 4DEXA 4OKSA 4D6PA 2OO7A 1K5GA 3PUZA 1L7VC 2QA5A 4BFZA 1OIVA 2NZ8A 5E7IA 2BCGY 3WNCA 4D2IA 5AJWA 2UZIR 4II7A 3TAUA 1I2DA 1KI9A 2W2VA 4ESVA 1VCIA 4URWR 3CNLA 2FA9A 4B71A 2F43A 1T0JB 4A2QA 5LD2B 4IVPA 4PR0A 1W48A 4Q9LA 2VHJA 5J47A 5EE1A 3MWKA 1I2MA 2QL6A 1G16A 4H9GA 1Z06A 1WA5A 2RHMA 1UJ2A 5A0FA 1XMJA 3N70A 3BXZA 3PVSA 1F6BA 3FE2A 1E98A 3AKYA 1X8JA 1E4YA 1SXJE 1ZVQA 3CONA 3LH5A 1KOFA 1HV8A 1SULA 3PUVA 3SBDA 1FZQA 3PJRA 1NMYA 3QI2A 4A4DA 1JB1A 1XTIA 1ZUIA 4Q4AA 1E2NA 1AGRA 2JCSA 2Q21A 3TSOA 1CRPA 2JLQA 2BDTA 3SYNA 2VSXA 3B2EA 2ZQ5A 1DAFA 4FD2A 1U90A 4Q9JA 1R0WA 1RIFA 3IGFA 2ZI3A 4ZI3A 3ADBA 1OXVA 4BLOA 4TYQA 1IN4A 2B92A 3A4LA 2W2XA 3B7GA 5JLJA 4DLSA 5KTYA 1Z8FA 1Q1ZA 1ELOA 2ZUDA 2W83A 4RZ3A 3TUIC 4YMUA 2FSFA 3NDBB 1MO3A 3LBIA 2QTFA 4NL4H 1QHXA 4CT4B 2G9NA 3O8BA 3Q3JB 2V4ZA 2J45A 1YKSA 4P31A 3W6OA 2BMDA 1JAHA 1WF3A 2GJKA 3KB2A 4BFSA 3DDCA 2IUSA 4Q4JA 5JEEA 4MKIA 1II8B 4WW0A 1WBDA 3ADKA 3BFXA 3CRVA 1JR3A 5E4FA 2VSFA 4ACBA 2C95A 3EIHA 3LX5A 2MSEB 3L82B 4HI0E 3MCAA 3U7EB 3RSOA 4DHEA 5HKKA 1GKYA 3QJYA 3Q9LA 1P7CA 2HXYA 2VP6A 3P26A 4Q18A 4P33A 3N2IA 1KI8A 2CNWA 3JVVA 3NDPA 2QM8A 4P3YA 2AX4A 4XWKA 4OI4A 3IPXA 2JLRA 5FUVA 3ZIAA 1RRCA 1Z0DA 2BC9A 4RD4A 4C7OA 4DIDA 2WKQA 4R2HA 1X1RA 5FOUA 1OJLA 3O8DA 4ZI2A 3UWOA 5J4YA 1NJFA 4LYHA 4ON9A 2HCJB 2EFDB 1EX6A 4LBWA 2W6IA 5FOXA 4MITA 1KAOA 3CRRA 2QRNA 2ZUBA 3BORA 2CCJA 1AJEA 2A3RA 5FPYA 2XAUA 3W90A 4B3BA 1P75A 2DFTA 2VP5A 3EASA 1XF9A 4Q7MB 3WYAA 3EX7C 1TX4B 1ZAKA 2ERXA 1F2TB 3GLFE 3U6KA 4A1FA 4C0AC 1FP6A 1XTQA 3QE0A 3THYB 1P5ZB 4KBGA 3MD0A 4TMZA 4Q4HB 5BXQC 4BEJA 3THYA 3RRMA 4JLVA 2CBZA 1I4LD 1K6MA 1IY2A 2FFHA 4LJ7A 1N0VC 4TYNA 1XMSA 1QG4A 1P9WA 1OFTA 1W49A 2GJAA 2YVUA 4TMKA 5LBIA 5B58C 4L5BA 3SE0A 4DCNA 1G5TA 1E9AA 1ZCBA 1L2TA 2IHBA 2QROA 3BD9A 3PEWA 1XCMA 1KI4A 1O87A 5LB4A 3NEJA 4NPHA 1RRFA 3WYFA 2D62A 2ODEA 4NYIQ 4TSFD 1R5NA 4RD0A 2TMKA 3K0FA 1TPZA 3SQWA 1T0HB 4QGAA 5EP3A 4C0JA 4YMTA 2PMKA 2HYDA 1Z28A 4OI1A 1N5KA 1JJVA 3GCGA 3THXA 3A8TA 4DIEA 2VP4A 1AN0A 2ZRDA 3T06B 1GTVA 1S4QA 1Q0UA 1IBRA 3QF7A 2IYUA 3KTAB 2G6BA 3F0TA 5AJVB 4K8OA 4NH0A 1A7JA 1WMSA 2ECKA 5A5GA 1ONBA 3LW8A 4Q7KA 2V8OA 1HA3A 4AI6A 1II9A 1E9EA 4PXAA 2QG6A 3FVQA 3TR5A 1U9IC 3EWAA 4PPFA 3EARA 1HE8B 1M7BA 1SXJC 4M53A 4PHFA 3KQLA 1X86B 3DKPA 3FWYA 4GSYA 2HJVA 4EQ6B 4FMCF 1S1CA 2C77A 3ASYA 2QMHA 5KDOA 2QBYA 1KI1A 2E1RA 3T1QA 3V4RA 5ELXA 4PPQA 4KFUA 1MT0A 4LJ6A 2AL7A 2OV2A 4ZCIA 4DDUA 1XEXB 1JR6A 2OZEA 1PLJA 4LSGA 3AUYA 2DR3A 2ZUCA 4B3FX 3BIFA 1J2JA 4Q5IA 2ZSBA 3BB3A 5SZKB 5L3SA 3AVPA 3UANA 2V1UA 2EVWX 5EQTA 1VECA 5FTLA 2D2EA 3UMFA 4LHWA 3RC3A 3EW9A 3AV0B 3GLIB 4YQFA 2NO0A 2VYFA 2O5VA 4DSTA 5FTJA 4LPKA 2G0TA 2ZE6A 3V4FA 4BWYA 4AD8A 1BKDR 1JEDA 4X8OA 2Q3HA 4TMWA 3OE7A 3VFDA 5M04A 4LUCA 3QOFA 2JDID 3QXSA 5AJXA 1ZC3A 5HE8A 3QF4A 2WKPA 2R65A 1OKKA 3WNBA 4B43A 4GL2A 3K53A 2FFAA 3PEUA 4DLWA 3MWLA 3RANA 4A0HA 4B73A 1R8SA 2Y8EA 3IBYA 2OFOA 1IM2A 1E9FA 1SXJB 4IOMA 4NCIA 4LI0A 4V0LA 1ZC4A 2HF8A 4JLMA 3PUYA 3EZ7A 1N6NA 1GL7A 2AR7A 3AVVA 4M0LA 1AQUA 4F38A 3REGA 4D4JA 2XTZA 3C15C 4TTPA 2OG2A 1G5PA 1BMFA 3KKNA 5EE0A 4UKDA 2IYVA 3L2OB 3U3MA 4ARZB 1SKYB 1X8KA 2I4IA 3QKRA 2R44A 4BFVA 4IOJA 1E2KA 3LFUA 2F1IA 2QN6A 5J5CA 3DOFA 1OXXK 4BFXA 1KO4A 2PH1A 4HAXA 4R9UC 1F2UB 5GJCA 2ANBA 4CVNA 2BMJA 1CJMA 5FUXA 2W6ID 4XTCS 4EUNA 1WBBA 4AKIA 4UNSA 1P3JA 3C16C 1S3GA 3R8CA 5C1BA 1AIPA 4UNPA 3E5HA 2J0SA 2ZRAA 1E3MA 4RCZA 2YWEA 3BH0A 1GP2A 1E2PA 1E1RA 2VRWA 2WWYA 1BOFA 2ZR0A 5KOYA 1W0JD 2F1HA 3B1ZA 4ZDWA 2AFIE 3ND8A 5EE5B 4JLOA 1DG1G 3DEFA 1FX0A 1LF5A 3L8ZA 1LNZA 3HU1A 4UXHA 3EPHA 3TUJC 4MKFA 4O0MA 5C4GB 3I8XA 3OEHA 2GEUA 4AYWA 2FFBA 2G0NA 3VAAA 4HDOB 1S9HA 3CWQA 3I1FA 2D3WA 3IQXA 3K9HA 3L0PA 5EP2A 2J9RA 4FMCB 5AUQA 1IY0A 2ZS9A 4JYCA 3AM1A 3ICQB 2ZRBA 3X1ZA 3DOEA 4D25A 1T8UA 1UBFA 3RDPA 4WIAA 4KFSA 3GJ0A 5CB8A 3ZS9A 3TAHA 1GKUB 3DZ8A 1AGPA 3TRFA 4JKYA 2RGGA 4MYUA 1KNQA 4EJSC 2EQBA 2G3YA 2DY1A 5FBRB 1Z0JA 3U2QA 4F4CA 2HDNB 2NIPA 2XJ4A 2D2FA 3MWJA 4M22A 1LTQA 2HYIC 2QBYB 1IOZA 2RGCA 1ZNXA 1Q21A 1NLZA 3FHOA 5JCPA 3GP8A 1OFUX 3QVVA 1KSFX 1MO6A 2P0EA 1XBTA 2HLDD 1DAIA 2WMOB 2OT3B 3HDTA 5FI0B 2GZHA 2PEZA 3BH6A 1X3SA 4URZR 2B8WA 4OQNA 4TSFA 3UG7A 1Z0IA 3LNCA 4KVAA 3PITA 1NN5A 2Q9BA 1P9NA 3PEYA 3L0SA 5E3HA 5EP4A 3SU8A 2WJVA 1EG7A 4C0BA 4M1TA 1HQYE 4XOIA 5C2JB 4NU0A 4LK2A 3Q8XB 3RS3A 1W36D 3P4XA 4YLGA 1DE0A 5DLQC 3IKJA 3UATA 2IXFA 2IC5A 2IT1A 1F3OA 1QVRA 2I3BA 3OEEA 4XWOA 2UVQA 2GEVA 1NMXA 1OW3B 4JLNA 2PJZA 4PC1A 2F6RA 4TL9A 2C5LA 4N1AA 4LYAA 4AG6A 2JJ2A 3CX7A 3K0AB 1N6LA 2IS6A 1DBSA 4POAA 4JLKA 4XSGA 3LXXA 4P4SA 5AK0A 3GLIA 1F5NA 1NY5A 4G5SA 4C0KA 5JJIA 4IVQA 4P4SB 1BYUA 1Z2AA 4AWXA 2QENA 3A4NA 1KI2A 1NBMD 4W9MC 3FMFA 3CB4A 1XZQA 4AKEA 2HXSA 2BV3A 4HUQB 4KCGA 2FF7A 1Z0FA 4Q9HA 5FPHA 4PSKA 4LYJA 4DUGA 5EZ5A 3FMIA 3H86A 1XU4A 4HAYA 1R0XA 2Q9CA 2YWGA 2KBFA 2J7KA 2EU8A 1XP8A 3EIEA 3FKSA 3QKRB 4LOAA 4TYWA 3W8NA 1FMJA 2E87A 2X2EA 1E96A 2ZJZA 1CR4A 5LB2A 1ZUHA 3R7WB 4X8LA 4HLQB 1SVSA 1COWA 4TZ6A 2WBLC 1MO4A 3THWA 1Z6AA 4HYYA 5G41A 5DI3A 5IK2A 1Z0KA 1Z6TA 2ZREA 3IO3A 3QKSB 2HCBA 3SC3A 2L0XA 4UQOA 4M1SA 1GRQA 1NBME 4KLNA 2H92A 5SZJA 3X1DA 4ASUA 1TF7A 1KO5A 1OHHA 1NSTA 5TARA 1R6BX 4LRWA 2R2AA 4IRUB 4NCKA 3NG1A 5DHAA 5UKDA 4KODA 4B3CA 2ZSDA 2O8FA 3BBPA 2J1LA 2KSQA 5C46F 4KFRA 2ZSAA 1XDBA 1XXHA 4I1OA 1WDTA 3LA6A 2OEPA 4HZUA 4YC7A 1JECA 5FOVA 1OH5A 2OXRA 4TLDA 3EWSA 1Z47A 1GRNA 1NLYA 1NVUQ 3UG6A 4D26A 2ODWA 5AJYA 1QHGA 5G40A 1OXSC 3LRPA 3E1SA 2J41A 4OHYA 3SHWA 5LDDC 3B78A 1CTQA 2F7SA 1E0SA 3U3RA 1E1QD 2IEYA 3QG1A 4FI3C 5KO2A 2ZSEA 721PA 3U4QA 2OUKA 2GTPA 3ZS8A 1U0HC 1P2SA 1OV4A 4DDWA 3AKDA 1NLFA 3RRNA 2OCPA 2HF9A 5DHFA 1NVVR 1TU3A 4LY6A 2GF0A 4QNMA 5FH9A 5HCIA 3IHLA 2JLUA 4G0NA 1FNMA 4O25A 4HEJA 1PUIA 3SFZA 1Q44A 2CK3D 3U7GA 1XNJA 4YDHB 5SZIA 3UMSA 4XVUA 2V9PA 4DZZA 2VSOA 3PCRB 3CRW1 4JBXA 4DLZA 2EYQA 4TMXA 2N46A 1QF9A 2DFNA 3M6AA 4JVLA 2N42A 1LFDB 2BBSA 1XX6A 2ZXUA 1TADA 3L43A 2IYZA 2YINC 3AKEA 1RFLA 4N0EA 4RD1A 3QY0A 2O0KA 4LWZA 3IO5A 2G88A 4QJ4A 1XJ0A 4GOJA 2JGNA 2PCLA 3CR7A 1VDZA 1ZM2A 5HE9A 2ANCA 4PHTA 1G21E 1GUAA 2WIBA 1GVNB 4A9AA 2JLWA 1E4VA 2A5YB 1TQ4A 1R2QA 4NHOA 3DKVA 5D3MA 1S9DA 2RGBA 2WWIA 1D2EA 2CEAA 3U60B 2GVZC 2IEZA 1D5CA 2GAAA 2MSCB 1V43A 4US0R 521PA 3JZAA 1KJZA 2F1JA 1ZM3A 3CM0A 221PA 4L9SA 4NONA 4ZIRA 2IS4A 5L3QB 2VBCA 1W2HA 2ZS7A 4NYMQ 1W0KA 2A5FA 1E9CA 1P2TA 1X8LA 3MWYW 4LBZA 2NO6A 4DSUA 2Z6VA 1KSGA 4WXPA 3VHLB 3MUFA 5CJ2A 1CJKC 5JECA 3D7MA 3SZRA 1YR8A 4PO9A 3HWSA 3IPYA 4GI7A 4C7OB 4PAOA 4I81A 5D3QA 5FUWA 5G3ZA 2CL7X 3AP3A 2X19A 2BJVA 4LV6A 3RYTC 1C1YA 1IN7A 3NBXX 2QRZA 4IVRA 4JLBA 3LWNA 3N5CA 3TW8B 3CPEA 1HUQA 4FWTA 1VHTA 1UEJA 4JLAA 2GETA 4OL0A 5KDLA 1NP6A 1EFUA 3FKQA 1T9HA 2QAJA 2ONKA 3C8UA 4JL5A 3ONWA 2B6HA 2DWPA 4DCTA 2I1VB 1T6NA 2ZI4A 2OFXA 3TUZC 3X1YA 1M7GA 2ATVA 4MA4A 2V3CC 2R8RA 1EFCA 1KSHA 3AQ4A 3DPUA 5H70A 1CR1A 3GLGE 2O8CA 2G1JA 1F48A 5GJVC 3OFNA 3CNOA 4E5UA 2JEOA 1IHUA 1EFTA 1E99A 4P4TA 3FFBA 5EXSA 4BLTA 4ZKDA 5BYKA 2JLVA 4MRNA 3QUSA 5BWMA 4FWIB 4C0LA 5ANRB 2CLDX 3ECCA 3FTQA 1X6VA 2AD1A 4NBSA 4N0DA 3GJ8A 3REFA 3U4QB 1ZBDA 1TEXA 1Y63A 2ZRJA 3E70C 1PVOA 3P4YA 3P32A 4QG7A 1ETUA 5KPJA 2AK3A 3SQXA 1KK1A 3DHWC 2P6UA 1XTJA 3TSZA 5KSZA 4GZMA 1MABA 2ERYA 3BFKA 3EAQA 5IK2D 5FBWB 4A8JC 1G8FA 2JLXA 3THXB 2H5EA 3I32A 2J7PA 3EZFA 3RRZA 2LKCA 1MABB 4AYXA 2W58A 4B34A 2C8VA 2PZFA 3AP1A 2HJGA 4TL6A 3ADDA 1GIAA 5DH9A 2Q3MA 1JEEA 2QZ4A 3VNUA 2FSIA 4PHHA 1NBMA 1NG1A 2D74A 4GOKA 3IQWA 2AWNA 1YQTA 3LO5A 2QAGA 1E2HA 3BWDD 1GNQA 1E6CA 4LX0A 3K0SA 621PA 1E9BA 2QAGB 3RSLA 1DARA 2QNRA 4KBFA 4MRRA 2FPMA 4Y0AA 4DDVA 4LDJA 1E1RD 1E79D 4A8JA 1XXHE 1KKLA 1M34E 2B21A 1W44A 3ZD6A 1VPLA 4A2PA 3RABA 5GADl 2FNAA 2IX3A 3LQRA 5F9FA 1NJGA 3ZVLA 1JQLB 1SQ5A 1FOEB 4TWZA 1OYWA 1WCV1 1GRRA 2NG1A 2QTHA 5J40A 3L8YA 2ZSFA 1OXTA 1CULC 5B64A 4ASUD 4HLUC 2IYQA 4XD7A 1XPOA 4B75A 4Z1MA 4D0NA 1YVDA 2VHCA 2ZU6A 1N5IA 1DELA 2YZ2A 2QQ0A 3RRYA 3GLIE 1G3IA 1ZRHA 4LYFA 5E95A 3B13B 5JI3E 1IN6A 2BBOA 3LBNA 1E2MA 2ODBA 1ZNYA 4FW9A 2P65A 1RPZA 4I1UA 3FFAA 3U61B 3GLHB 3KKQA 4EJSA 1GWNA 4LJ4A 1GILA 3B60A 3OESA 3GJ3A 4DLYA 3QEJA 2XXAA 1QHHA 2FE4A 3FHTA 5TY0A 2W6JD 1W47A 3KKMA 1FFHA 3VKWA 4M2LA 5FL3A 4ZIRB 3B85A 1CP2A 4LBYA 3PR1A 1SXJA 3CPJB 4PC7A 2F9LA 4RJLA 1RE0A 1ZP6A 2BMEA 4WA7A 1XTRA 4HAWA 4TMVA 1SKQA 4Q7LA 3IIKA 4EAQA 5AR1A 2LWIA 5EUQB 3SHFA 1KJWA 3AVQA 4QNRA 1E0AA 1N6IA 3T15A 2C04A 2XITA 1A2KC 1AK2A 1XCGB 2XX3A 2ZAMA 4ARZA 2CHVA 1YZKA 2IA5A 2IF0A 4Q1DA 4A92A 4NKRA 1U81A 1Z29A 2VHQA 3LAWA 4KAXA 1N6RA 1YZNA 2VIIA 4C9BA 2J0UB 2QPOA 4TQUS 4LC0A 4MYTA 3EG5A 3HU2A 4MKGA 1ZNZA 5JWRA 1XEFA 3K9GA 1TU4A 3A6PC 2O8BB 2JJ2D 5GJBA 4JLDA 2P6RA 4Q1CA 3CX6A 2ZRLA 1H8HA 4YMSA 4C0SA 1G41A 3HPQA 3PUWA 3CUEF 2ZE7A 4JVNA 1CJUC 4B2LA 1SVMA 5AUOB 1JNYA 2C9CA 1KK3A 2CCGA 3PIRA 4Q02A 5FTKA 2VEDA 1KNXA 2G77B 2LKDA 4XWAA 2C2HA 1VTKA 3FGNA 4KO8A 2XGJA 2ZVQX 2FPLA 2QEQA 3VR4A 4XH9B 4L16A 5IDVA 2QSZA 4PX9A 4QBHA 3AVXA 2WPDD 1U8YA 4KYIB 1R0YA 1ZU5A 2RAPA 4V0OA 1CXZA 1E2GA 1NG9A 3MMPA 1YZTA 4FCWA 4Q4AB 3CZQA 1G1MA 1E2JA 4QHTA 4P4UA 2QQEA 2ZJ8A 3HP1A 5CM8B 3TBKA 3TKLA 4PQRA 3QKTA 2VO1A 4B2PA 3EPKA 2PJRA 2GRJA 2ZITA 2FPKA 2FZLA 2BKEA 2ZTSA 2RGNC 3UXMA 3EA0A 1Z6GA 4EFMA 2C99A 1PV4A 2H16A 4PPGA 1CR2A 2GJ9A 4PZLA 4D80A 2ORVA 2RH5A 3VNVA 1G4UR 4TN1A 2DB3A 421PA 4AKGA 2GK7A 2EFGA 4MGYR 3MGCA 1NN3A 4P0TA 2DWQA 1YRBA 1MH1A 4LCBA 4QRHA 3RS4A 2QY9A 2DFLA 3B9QA 2FZ4A 4G5QA 3RS5A 1GL9B 5K8UA 2O8EA 3MJHA 4KSCA 2EFCB 1DG3A 2HV8A 3NH9A 5DYIA 3UK6A 2ATXA 2XNDA 4BEBA 4V0KA 3ICEA 3SYLA 1VYUA 1JXOA 2Z83A 4TT3A 4KJZA 2Q0HA 1TF2A 4QJ3A 2J46A 3IBGA 4DCSA 3LX8A 4I99A 4PAQA 4W5HA 1GFIA 4IFBA 1P2UA 2OESA 1DAMA 4HB4A 3H84A 2QU8A 3RS7A 1ODFA 3ZVNA 4Z51A 4D4KA 3K9NA 3OE7D 2J5XA 1G7CA 2EYUA 2IXGA 3B1WA 1E2DA 1F2UA 5FOSA 3OIVA 3UKDA 2REBA 2VPPA 1NSFA 3CKLA 4GNKA 1SVLA 4H1UA 4JS0A 3TSWA 1Q1QA 3Q7PA 4HUQA 4M9SA 1Q20A 3ZJYA 1LB1B 2D7DA 5DO9A 3ZQ6A 1CKEA 1T3HA 4HUTA 1KDTA 4JZKA 2PZGA 1OF1A 1XPRA 1QHHB 3FPAA 2A9KA 2O0JA 1UPTA
chains in the Genus database with same CATH superfamily
4ZODA 3V48A 1X39A 2XKBA 4M0CA 3AR4A 4UUMA 4EPRA 4U2FA 1IH8A 1ITZA 2J7PD 4ERXA 3L7NA 4LNUB 1Q12A 3L0ZA 1U1CA 1BMFD 1U8UA 3GRYA 1J56A 2E4ZA 4D0RA 3J7AC 4HGPA 2ZAOA 3N2GB 4OYHA 1JJ7A 2H29A 3V8MA 1IAQA 2ZYDA 5BO5A 1N1EA 2R6R1 4ERNA 1FTSA 2QTZA 3K8ZA 1XJWA 3BWBA 1W2GA 3I2IA 4J2OA 2ZJOA 3D5EA 2NO5A 4CZ2A 3B1YA 2P4EA 3AW9A 4FU0A 4Z49A 1MO5A 5A4AA 4LF5B 3JQFC 6PFKA 3PKIA 4LE0A 2P4HX 1E6LA 1M6VB 3R2JA 4KYTA 5KOHA 2QXUA 2YJTD 3BJEA 2DPYA 2QGZA 3VOSA 3E6AA 1FYEA 3KLBA 4RESA 1A98A 4YCMA 4ZCTA 1WD5A 4O4LB 1XG5A 3EGDA 1A7AA 4Y8VA 2ZK7A 2F43B 3UT5A 3LYAA 3O4IA 5FJJA 1Y4UA 4BFWA 4E6EA 4HDMA 5IT5A 1YUNA 3HJHA 1HE4A 1VRVA 2ZRNA 1M5UA 1YJ8A 3DDNA 3KZCA 3P9CA 3BIXA 4MUEA 4CV2A 2ZIVB 1MQ9A 2QGFA 3GEGA 1YASA 4K28A 4U6NA 1JQKA 1KK0A 1P4SA 2CE7A 1U0LA 2PIAA 2JARA 3HYNA 1H4TA 3I1IA 5CU7A 5L7TA 1HTTA 1IXSB 3FFXA 2VP3A 4TLBA 3DKRA 1PYDA 3ROXA 1JEQB 1Z7EA 3RRFA 2XB8A 1NONA 3EW7A 1TTHA 4WCFC 2HHJA 3ZHVA 5GJWC 4HRVA 3TTUA 1C9MA 1V3TA 2FFRA 2QG9A 3MTBA 3C98A 4U3JA 4HP8A 4IGIA 3WGZA 3JZDA 4TQ9A 4R16A 2XH8A 3I3OA 3P2EA 2VH5R 3DL2A 1RKXA 5DM1A 3U3KA 4X44A 4AWBA 1ZD3A 1WPRA 5LOVB 3CF0A 4O59O 5FPTA 1L5RA 5HCNA 4US2R 4PS1A 2WJGA 1KZ1A 1ZM9A 2BR3A 3IKLA 1TPYA 2HU8A 4CYMA 1EIZA 3ZY2A 2YZKA 1GLNA 3WLJA 3RGWS 3LS2A 4OBWA 3A7EA 1U0GA 3OTQA 4OHRA 1UWCA 2ZYSA 1WMFA 5KNBH 3FNIA 2ZIXB 2OOSA 3P94A 5KU7A 3CH4B 4M7OA 2BFOA 4BNZA 3EWIA 1I10A 2ZSHA 2P6OA 2YRFA 4I9FA 4P80A 4BLQA 4NNJA 2PXXA 4DLVA 4EY6A 1Z07A 2OFWA 3TPCA 4KPUB 2VDUE 1QWOA 1XRPA 2P1DA 2ZAIA 4M86A 4TX1A 3VU8A 3K0CC 1WPGA 3F47A 3JYOA 3ZIUA 4QZVA 3BYZA 2A9OA 4HDSA 1RTKA 2XNSA 3VH1A 5AIBA 3AXTA 3AIOA 2PT7A 2YH2A 2B4QA 2QP9X 1RJ9A 2R6AA 5HP4A 3H2IA 4FNGA 4PRLA 3RUIA 4FIDA 5HUQA 5J43A 3AYXB 5K0EA 4P35A 3EPKA 1Q7EA 3EVBA 2OCDA 1ZYUA 1JEJA 4HB0A 4B0PA 2WWXA 5HUHA 2NGRA 4Q66C 4PAWA 3S1LA 5H59A 5MFPA 3ZJTA 1E2EA 2E21A 5K03A 3DOOA 3WDMA 4RMHA 4NCJA 2ZIAA 1NYTA 1Z35A 1RKVA 3MGBA 4QO7A 3W5DA 1R3DA 4QVIA 2WWYA 3NAZA 1K1EA 1UBGA 3V8RA 3RG8A 5DEIA 1CIVA 1L4LA 3KD2A 3H2JA 4HXEB 3QU4A 4ZPJA 1B8NA 2R1VB 4BC0A 3WA7A 4P34A 1XTTA 5I8WA 2PSEA 1BHQ1 5IJWA 4UNNA 1ILEA 1YZUA 1ODCA 2HU7A 1L5SA 4F5YA 5FWAA 3SR3A 3VR5H 1YU6A 3AT1A 4CKWB 1J42A 2A1UA 2JJ1D 2GX6A 4UZSA 1ZW1A 1U3VA 3C3EA 2JGLA 2QW0X 3JQCA 3U6BA 1D1PA 2C4UA 1E0DA 2BFNA 2X8BA 3IP1A 3OM1A 3D6FA 3ZXUB 4TMYA 4CMJA 4ZI7F 5HOEA 3IP3A 3R9XA 1X70A 2GZRA 1Z38A 5IM5A 4DV3B 3A1EA 3QTTA 4BCCA 4BP8A 3DEZA 1JPNA 3F96A 1Z8NA 1ADJA 2H59A 2PX4A 3GP3A 5EMNA 5C51B 1A1VA 1CU1A 4OLAA 1E5LA 2WUGA 3D5QA 4J07A 1KU6A 1PV1A 4N0MA 1YA8A 2ZRPA 4W5RA 4D0LB 5IDQA 3WLIA 3UENA 4FYIA 5EPEA 2IEGA 1F51E 2GZ2A 3ZWNA 1XDDA 5JAOA 5CYFA 5GPBA 1KDVA 3KQNA 4GXRA 3WP0A 3AMVA 1YR6A 1WS6A 4JL6A 4UTXA 1HDZA 1MQ8B 4PIVA 3T7EA 3QVLA 3TZEA 1OD6A 1ZM7A 1V3VA 3JALB 5FR1A 4IM7A 1A9XA 2XKKA 1YQGA 1R8YA 4IKPA 5I9LA 1M2NA 1WWKA 3JW8A 2WSSD 3OJOA 1CE8A 2J4DA 4L9WA 1NU6A 3CPHA 3IDZA 1WV0A 1NGSA 2I7TA 1ICEA 5AM1A 1BW9A 2Z5GA 1CS4C 4J2TA 4P5PA 4ARIA 3OM8A 1GPJA 1F60A 2WUVA 2R6CA 1NBEA 3ETCA 2HC9A 2X9LA 1RQGA 1VXRA 1IOLA 3HSSA 2ONJA 4WCDA 2VDNB 1KZ7B 1N33B 4Q3OA 5A62A 2NXCA 3OIYA 4JEUA 2NPFA 3OQJA 1ZD9A 4JUAA 4OH1A 4TUYB 3D64A 2DBQA 4X6LA 4YT2A 1M6WA 4FR0A 3N3AC 5IRCD 4D81A 4DIFA 1PUXA 2QHXA 5DWQA 4B3RB 3CVVA 2B61A 1XMIA 3O5AA 1F38A 2QNIA 4B40A 3BDIA 3DEIA 4ZN6A 1A8SA 3K6KA 3QELA 1EXVA 2X1VA 1P31A 4YRNA 2G09A 1C0LA 5EZYB 3JVEA 4DDKA 2I2XB 1QLWA 2P9ZA 3N2EA 2WTAA 2WM9B 3QELB 5KINB 2JIDA 2GCOB 1XEWY 4J9VA 3WGLA 1I5EA 3UMVA 1EWYA 4ZCPA 3ZWOA 2Q8QA 4J1TA 2O7VA 2QN9A 3UB2A 3IURA 1SC3A 2HUNA 4OXNA 1ZK2A 1GL6A 1ZJ4A 3FNGA 4GZLA 1TMYA 1KI7A 1H65A 4IXNA 3SEQA 1KVSA 3CUUA 2YIMA 2Z5LA 4D9IA 3LC1O 1BOOA 3NWJA 3OPXA 5H80A 1V2HE 5B7PA 3QA9A 4ARVA 3KE9A 4CMIA 4TRMA 1OPRA 2C1XA 1N3LA 4EB6B 1DS6A 5KNBA 1CQPA 1S2NA 4J94A 3R7NA 3T9AA 3C43A 4TPKA 2KB0A 4YMWA 1XJCA 1TQDA 3HTXA 3F78A 1KMNA 2QL5A 1SU8A 3ILXA 4R54A 3AHJA 4N48A 1OB2A 3X1KA 1C1XB 3M9LA 2WPNA 1Y42X 2BEVB 1C81A 1T9CA 2HK8A 2QIOA 3EGVA 3LW7A 4JP2A 4KB5A 1Z2EA 4LTNA 3TQCA 2E18A 3VMMA 5U1PA 3GQBB 1V3UA 4C3OB 2QX4A 5AI9A 3DOUA 2D1SA 3V8VA 1TNDA 1T2VA 2BM8A 2NAFA 1JG4A 3GJ6A 1ECLA 5E1MA 4P3PA 3JARA 1I36A 4O3FA 1IXZA 1XU9A 4XI9A 1ZN8A 4TVKA 3C7TA 1Z18A 5YASA 4TWIA 3IMGA 1KA9H 3P2YA 4HWRA 1RAFA 3CNNA 4ZQBA 3GLFB 5DCLA 3L6UA 3MMXA 3F6BX 4BNGA 3W5BA 3A1UA 2QP3A 4H3SA 2ACVA 3FRJA 4Q39A 1JFFB 2I4TA 5LYJA 4EEKA 4EGAA 1CUSA 4YV1A 4XSVA 3RYFB 2VSQA 2HQRA 3COZA 4QJIA 3K20A 3D02A 4N5DA 3SVZA 1OC2A 1LFAA 1YR9A 2WWTA 1FUKA 4AZ0A 4AKHA 2C61A 4V03A 3B1VA 3PNSA 3ICOA 4OXKA 4UU7A 3CY6A 3B1XA 4M6WA 2R47A 3IDFA 1Z6YA 3BOSA 2OBYA 2QX8A 3FMPB 3MTQA 1TQ6A 1BHSA 1NJSA 1XA4A 4HBZA 1EHYA 4NCNA 3PA6A 4GBGA 4US1R 1RFGE 1MX1A 1MC1A 2VZ9A 2YHIB 3EWNA 2F4NA 4GGPA 3IB3A 3NHMA 2KX7A 4FYJA 2O8FB 1A9PA 4NMLA 3RIGA 3HZOA 3OKFA 1VIDA 5F9MA 3RS2A 4DQKA 1OLUB 4S1TA 4MV0A 1KYIA 2FJUA 4K0RA 4EF5A 1KFBB 4I50A 4NE2A 3OJLA 1LLCA 2YHUA 4R8RA 3N8HA 4X7BA 5FL7D 1CERA 1YZYA 3V2HA 1U2DA 1Y1PA 4QYMA 4BZZA 1M2OB 1V5IA 4ZCLA 4MUBA 4A26A 4Y6OA 4DA6A 4HOYA 2KLBA 3A10A 4OJKA 3A2NA 2R7NA 3CZ5A 4A0FA 4WZAE 2O8CB 1RC0A 4BJ6A 2ZWIA 4F91B 4GYYA 2B82A 2KLHA 2XUFA 5LJLA 1J5XA 2BUCA 1XC7A 3DHNA 4XSHA 1YI1A 4BQQA 5KWJA 2AGVA 4BVKA 2G67A 5H3CA 4YRAA 1CDDA 4NBWA 4P7KA 2X0DA 1G1AA 1P1JA 2I2FA 3PDHA 5K05A 3IR5A 2OAQ1 1GZSA 1K5DA 2XGMA 5C8YA 1VE5A 1YI8A 2AD5A 3HM2A 3CQ9A 1KTVA 2Y1GA 2OXCA 5B37A 3M4NA 1RWWA 3BCRA 4GQAA 1WABA 3CH6A 4WK4B 1AK1A 3H83A 4HRXA 5M5BA 4JBGA 3GC6A 2PZEA 3LLMA 2ECOA 3N86A 4PPYA 4QBFA 4RS3A 2G63A 5CA1B 4OI0A 4MWTA 3GAZA 1IJBA 1JSRA 3KOYA 4RSHA 3PG5A 1X7HA 2NO4A 1ECBA 1YQWA 5D85A 4RY8A 5F33A 3AETA 4HNTA 2WJ3A 3KJEA 3DUWA 4HR7A 5TR9A 3BXEA 4FFOA 3RVQA 5L95A 2IQ5A 2MMGA 4JX9A 3RVDA 2XD4A 1Y3HA 3BD8A 4DIUA 3COSA 4EARA 3B9BA 1JVNA 1G6KA 4QGFA 4YJFB 1SZPA 3BAZA 3RODA 5A0VA 3B5IA 1EBBA 1AA9A 2A59A 3K1YA 4YRQA 1LU9A 1N6PA 1W36C 1IBKB 1MX3A 1GTG1 1DB3A 2P69A 1XKLA 2C59A 1XQ6A 3O8OB 4AS2A 3NHAA 2V45A 1N77A 3W3ZB 3GLFA 4D1YA 2HT1A 2XDQA 4ODIA 4AP6A 3ANYB 4EUEA 1BX0A 4NE9A 5M34A 5C81A 2GHIA 4D9NA 3FLBA 4RPGA 4YJKA 1O89A 2UXCB 1ISPA 1C7QA 4YI5A 1KI6B 3LGSA 4BNFA 3KT0A 5FUQA 4BFYA 3A4MA 1DBPA 1G3RA 3R41A 1UEIA 2UYCA 2ACKA 2VA8A 5F2EA 3F5QA 1EWQA 3B1JA 3PJGA 3LECA 5ECDA 3PGXA 4MQEB 4YAEA 3ENZA 3OO0A 3HJBA 5HWSA 1JB9A 1HOTA 1X87A 4Z9XA 4DSOA 3BICA 2PJDA 3AFNA 1CZOA 1PNTA 3UIEA 1GPNA 1FSPA 4DJAA 3DVLA 3COYA 1EK0A 2VT2A 1PZNA 4RAQA 3CF2A 1OX4A 2HGSA 1EP1B 3GFFA 4V0MA 1HURA 3E3MA 5JMTA 2AFHB 3FYTA 3GIWA 2QTWB 4BV9A 5LR6A 4YCNA 5DBGA 2EKZA 3VPDA 1YS9A 4WKBA 1CUDA 3AKCA 3FOWA 2WYUA 3PNLA 4S35A 2AYYA 4DCMA 1N5LA 4GMDA 4TYPA 2Q2QA 1ACMA 4Q4JB 5AW9A 1CV2A 1OWLA 1ZDMA 2D2VA 2P6MA 4OHXA 4L76A 3JY6A 5L4NA 3L46A 1EXMA 2IHTA 1DWPA 5DTRA 2B9VA 4X8HA 1XZHA 3OOJA 3OVMA 1O94A 1TMKA 2VEOA 1DL5A 2F1RA 3KU1A 1S6YA 2C97A 3DM9B 3PQ2A 4N65A 1H6BA 5C8VA 4OGGA 4PSDA 4EG3A 4LGVA 3AUAA 1XTUA 3NHRA 4WNCA 3NH6A 4MINA 4O4HA 2BMVA 2ZR7A 3X1WA 3NIBA 2AN3A 4EABA 1ABFA 1NRIA 3G59A 4X20B 2NYVA 1JALA 2JGKA 2VF8A 4HAZA 4IXMA 4JCCA 4QYXA 1E2LA 4WN9B 5DOZA 4TL8A 4BE7B 2VDWA 1RMYA 2W4MA 4MVJD 2WWVD 1UBTS 5EZSA 1LDGA 1FDRA 3DMTA 4PLYA 4TKUA 4TQAA 3S0JA 1MA0A 5DOVA 3ZGNA 3RR2A 4D56A 4XJTA 2ZYVX 2VHYA 4EK9A 1EJ2A 3F3YA 4BO1A 4D82A 1DVRA 4IL5A 5SZHB 3WLLA 3EOZA 1Q3TA 5ALPA 3QX7A 1D1TA 4A6DA 1V1MA 4H7PA 1FP7A 2VYVD 4UHKA 5TMEA 2ZJAA 3H9QA 4CM5A 1JSLA 1XAGA 3RG2A 2QVBA 2YNMA 1EZ4A 4MLCA 4KH0A 3OH8A 4O4HB 2KHZA 5AM3A 4E2FA 3W0LB 4PRZA 1CS0B 3JZFA 1G8YA 3NIGB 1HY3A 1JQBA 4WNYA 2J4FA 821PA 1ESMA 2DY0A 4WZ6A 1LI4A 5EIBC 3HJNA 3Q7QA 1GQQA 1S02A 2H1WA 3H11B 5AI8A 5EC8A 4WZBA 4ED9A 2R66A 3S2GA 3V7WA 1ZUNA 1KYXA 3SS8A 4NFSA 2IEBA 4F4JA 2IYWA 1DC4A 3VR2A 1SKMA 1W4CA 1W5TA 5DWDA 4PO8A 1N3YA 1P2DA 2B4KA 1SHKA 2E4AA 3CNQS 3T7IA 1G7SA 1O6BA 1AKNA 2BFBB 2PSJA 1LBQA 1O6ZA 3GUVA 4R1LA 1FP4A 3UGTA 1UF9A 4LHYA 3JYHA 2TSYB 3O91A 2I2CA 2LVBA 4NYJR 4DIMA 1WQ3A 2FE1A 2XDYA 1SOVA 3AF4A 3MBOA 3PE3A 1L7XA 1CY8A 1GZ6A 1JLLA 2ZIGA 4CM4B 1E79A 4E11A 4HQ6A 3G0HA 1LBHA 4G1FA 4NYJQ 4OQ4A 4F3RA 3UOGA 2G28A 3LRXA 1N7IA 3SHQA 1U99A 4KQ1A 3E8MA 3ZOZA 4BIIA 4JBYA 4HNHA 4FZRA 4RD6A 5AUNB 4G4SP 4AB1A 3R6GA 4NX2A 1VMAA 3SYMA 4MYCA 1A0OA 1JHQA 1M6EX 3D54D 3FX2A 4YPVA 4Z7QB 3V1TC 3C1UA 3EGWA 2DERA 4OHKA 2YZGA 4IDOA 4JSYA 4AMUA 4BWGA 2JFPA 1FYWA 1YB4A 2Q29A 3N0RA 4XJXA 1OKKD 1FNBA 4QEDA 2JW5A 3EZ9A 4R84A 1JTFA 1GT91 3F6CA 5JXHA 4BATA 3FCOA 4EECA 1VLQA 1R4MB 1XEXA 4AJNA 4PYOA 4U8GA 1VCMA 2W2MA 1SFRA 1KK2A 3P5BA 4YGXB 3T0FA 4C7BA 5KQMA 3IR6A 1JA0A 5E2IA 4PYJA 1EFRD 4IEFB 5A6SB 3ECAA 1E1DA 2QVZX 4REQB 1D7AA 4W9NC 3DCJA 1B14A 3URKA 5BSFA 5LOVF 2J31A 4RIEA 4V0NA 4LKOA 1H5QA 1AE1A 3VTKA 2XW6A 1TLLA 4HDSB 3VKGA 2VJCA 4DOMA 5EMKA 1MV5A 1G8AA 2VDWB 1DQSA 3FM9A 4LWOA 3AFOA 1OX6A 1TD1A 2ZJYA 5AKGA 1SKYE 4Z54A 4K9LA 5EZ6B 1JR4A 3CUKA 5IFLA 3L5KA 3ZR4B 3FOZA 5JJLA 3N0XA 1ZINA 4S1OA 4RJJA 5DBFA 3GZNB 4L50A 3PS9A 3R3JA 3JRNA 4W1RA 5IJXA 1FK8A 1LQTA 2Q8NA 2VP2A 4YT5A 3ZBPA 2ZUWA 1P5FA 4UARA 4E4TA 2GPBA 1WOMA 4X0EA 5HZGA 4DEYA 2O3UA 4AXXA 1A71A 2ETVA 1XQ9A 2ID9A 3FYCA 5A5DA 5ALJA 4YJ3B 4ZK2A 1VYTA 3ENNA 1TM4E 1OSNA 3EEIA 4G86A 5A3SA 1Y8QA 4NS4A 4B6PA 3R7LA 1OIWA 1IJEA 4GX5A 3M3DA 3PFBA 4QKQA 3OMLA 5A9RA 4JI4B 1AQLA 2PGXA 2XUHA 1TJ5A 4XQEA 5JNUA 3ITDA 1JT2A 3IA2A 4BGDA 2WLTA 3DEJA 1OA0A 2O1WA 4MVJI 4UBIA 5DTMA 4B7UA 2EP5A 7ADHA 4I6JA 1TM2A 1F14A 2H4ZA 1RP1A 2I76A 3C2QA 3R4CA 5AKXA 5EUMA 3SIPA 5JXJA 4IMJB 1U11A 2BPOA 2DUJA 5BNFA 3ZCXA 1CQIB 2WMNB 2Z2JA 3D3NA 3ABRB 4DIKA 3VR6H 3ZCSA 4PX5A 5EAIA 2P4SA 3C6YA 5TIIA 1W4LA 1BAPA 5FA5A 1KHTA 3G9ZA 3ZDFA 3HSYA 4FI3F 1KEUA 2GCPA 4J0HA 4JY7A 3JU3A 4Q15A 4XD7D 2CD9A 3I8OA 4Z0TA 5J5VA 3QKSA 4G84A 1BXRB 3QLTA 1E3TA 2C29D 1LSSA 2RAFA 2FHPA 3OEYA 1LSJA 2PQ6A 1IVNA 2GAIA 2PXHA 3GRFA 2ZYUX 1YB7A 3D0OA 2OILA 3PD7A 2HNKA 4KZPA 1YS1X 1ONPA 5DXAA 3G23A 1W5SA 2AR0A 5IULC 3A05A 2BBTA 3DZKA 1U94A 1UMBB 4LXGA 4DPLA 2VQFB 2VP0A 4QQKA 1D0IA 3IAM1 1ENZA 2G4LA 3IDSA 3QYAA 4RGQA 2BM0A 5DGIA 3CX3A 4YUWA 1JA1A 1XKQA 1PQPA 3IEKA 3K32A 3Q2KA 2EJVA 1IUPA 2IY9A 2LPMA 1YCDA 1HBJA 2OHGA 3ZNPA 4NBKA 4I50F 2OM2A 2QI9C 3ZJVA 4ND5A 1H2AS 3IS3A 5KNDD 1HEYA 1QPBA 1WEKA 5FKJA 4BLPA 4ND3A 1M6VA 4EI2A 3RYIB 4WXHA 5A4MS 1ZNWA 1JDZA 2ZLBA 1YL7A 3A28A 1SC4A 4WK6A 2Y0PA 6LDHA 1N92A 1QH8A 3L6DA 2BAGA 4Q3DA 4RQTA 3N2KB 4ZTBA 1GG2A 4KR9A 4BECA 5AD1A 5FWXB 4ABTA 1WXGA 5CLHA 2PS0A 2YQ4A 3MF4A 2PUFA 2JAPA 3DHVA 3EZXA 1D2MA 1O6GA 2MR6A 1JEAA 4G5GA 1JKFA 4TLLB 2GXSA 4NI5A 2G06A 1ZWKA 1N6OA 1EG2A 5BT9A 4KXYA 2EBWA 4HX5A 4IRMA 3C8HA 2IV7A 1CUAA 3P2JA 5DNYB 1F7UA 3ENKA 4KVGA 3OIFA 1A77A 4HK4A 5BWCA 4M49A 1NT4A 3G9UA 3P9RA 4OFBA 3GCZA 4JBIA 1VXOA 1VE1A 4LCEA 5DRYA 4AJPA 4F6RA 1N0IA 1G8GA 4I0WB 2HM7A 1RYFA 3T3OA 1GDDA 3N7UA 5IXYA 3KVRA 4Z53A 4LJ9A 4F5ZA 4L0CA 4H1VA 2WTUA 2O5CA 2B1GA 1MZVA 3D8UA 3SNHA 3OX3A 1VHLA 4ZDIA 1UC8A 2GCNA 4YTEA 4C2TA 4OEHA 3QF4B 1XFDA 2DHRA 1QG2A 4XLLA 2GA9A 4WLVA 5C32A 3KVNA 4GI2A 1WUTA 5AXCA 2FSVC 2FF5A 4HGNA 1ZN2A 4HMQA 3JATA 4RHYA 1PJRA 3TJRA 1DTWB 3ESBA 3HB4X 3KTFA 4UXJA 5FV7A 5B7QA 4FSHA 4GS5A 1SG6A 2VBGA 4RHCA 4MX8A 5KIAA 1EVKA 1NJ8A 3IUJA 4FYMA 1LVHA 2VT7A 4RHTA 1PZHA 3T7TA 2BHLA 3DHEA 4RDHA 1EVLA 2OV3A 4M1MA 1NDUA 5AKKA 5HGXA 4YAGA 2BZ0A 5KJFA 1DTEA 3A11A 1KVQA 5DXFA 5DASA 2V6JA 3YASA 4YUYA 3ZXYA 4Q03A 4DLXA 5ALXA 3WWCA 4UUQA 1MTZA 2ZDHA 4KI0A 3GU3A 3MN1A 5JVDF 3OURA 3BS4A 1NF8A 3F8SA 4D8XA 4U6QA 4B4KA 1XWFA 2YC2C 3ECSA 4U9HS 1CNFA 3EQ7A 2PK3A 3DAHA 1L8OA 2H4JA 4TS1A 1DHTA 3HCWA 1J0CA 4HDRB 5JALA 4YJ2A 2GYWA 3ETLA 2OFPA 2VQDA 2XMRA 3GJYA 4ZT4A 1QYVA 3CX8A 1ZM4A 1YRWA 3NC0C 1QZXA 2BKLA 2P41A 4FOSA 4WOBA 1DZIA 1L5ZA 3H1BA 3AVUA 1J49A 1VL8A 1CUBA 2JEYA 1M1YE 1K4YA 1OHHD 4UC0A 1RLJA 3R7WA 5TGTA 2C2YA 4TKVB 4ER5A 3EIXA 3IQDB 5AI6A 3QBJA 4GNRA 3WB0A 2Q2OA 3C3JA 2FZKA 3CE6A 3NAGA 3ODGA 4Y1EA 5DULA 3UTDA 2HHAA 2YUTA 2FKAA 4AO6A 4E5NA 4YRIA 4KITB 5JS2A 2O2GA 3KU4A 4AN4A 5BUQA 3PQDA 1KOGA 1L7EA 2NX2A 5BN3A 1RXEA 3QUQA 3UQZA 2BM1A 1U9IA 1K6XA 1X1BA 2CD7A 1NLMA 4CIDA 2R7AA 5JVDB 1GKIA 3ZHUA 4IHJF 4KFTA 3BF7A 2BGRA 3INNA 3T35A 2NU9B 2XNDD 3LVRE 4OI2A 3IDQA 4E5KA 2GRUA 5A4JA 2NMVA 1BE0A 4D4GA 3GDFA 4C5AA 3K94A 4O5OA 3MRSA 4O4JA 3R5SA 3PX3A 3EDOA 3D8NA 4EDFA 3LUAA 4EW6A 2P11A 4F3TA 1JMYA 4P36A 4KR2A 2NU8B 3NTUA 1XTKA 3GCXA 1T3ZA 4N3BA 3IVAA 3FNEA 3OZXA 3ANSA 3IV9A 3JX9A 2RGUA 1EJ6A 2E4YA 2Q2VA 4ZVPA 1JHMA 3PDIA 1MZPA 4U7HA 2P1RA 5KVVA 2YFYA 1M8KA 3TTTA 4PSCA 2PMWB 1HYEA 5ER9A 4UUNA 1NVGA 2AUTA 3DWFA 1J70A 3R3WA 1U8XX 2M6SA 1U8TA 1ZD2P 2C4MA 4H31A 2FEOA 3GL9A 2CK3A 2QP4A 5C5IA 1KMMA 2DBYA 1HTWA 1SZJG 2CJYA 2VDOB 2E4UA 2QTTA 4JN6B 1H8ED 1B23P 1HEIA 2CJWB 2Z1MA 3TXYA 3A31A 3NAMA 3SZ3A 2GK6A 4FHCA 3D31A 1IZ9A 5HVNA 3UTCA 3THWB 1AQ6A 3TR0A 3UJAA 2I03A 4RTQA 5T57A 2Y3IA 4M21A 3T5MA 5H16A 4KSYA 3HYSA 1NVKA 3H9EO 4MP8A 5DBHX 1CF4A 3IT2A 5KNCA 5AP9A 1FRFS 4EENA 4PZEA 3ADCA 3LLVA 1QS0A 1TKRA 4QULA 2C7RA 3WHLA 2SHKA 2OHXA 3ZWVA 4BN5A 1X9HA 1AY0A 3WL3A 2O2YA 4MR7B 3HGMA 4HLCA 4LY9A 5EXTA 3UW1A 2QTRA 2WF9A 3ABZA 4M1EA 1R88A 1BJRE 2P2GA 2Q4DA 4FFVA 3JYNA 5DZSA 3EC1A 1R5BA 1WXQA 2X9VA 4TMTA 4W8GA 4YJ2B 4ZOLA 5F1OA 3K0AA 4MW9A 1T5IA 4YMGA 1BC5A 4WBSA 3A1FA 3CLSC 1KVTA 5CDYA 1CQJB 2CFOA 1P0PA 2X1MA 4LZWA 4R7TA 1ZH4A 3OAAD 2CHFA 2HTFA 4RJIA 5CGZA 5FBLB 4O2LA 4PZAA 1Q92A 2W0SA 1IHPA 3QQPA 5E7MA 2BKXA 3VQTA 1UUFA 3I2JA 2REXB 4J3NA 4C01A 1RLTA 5IBCA 2B7LA 3H3FA 2I5PO 1ZVJA 1G291 2ZJFA 2FUEA 4FOOA 2HF2A 1E0JA 4F1WA 1N2IA 3BRCA 4E70A 3LDFA 2E9SA 2WTNA 3LXMA 4MUAA 3VTZA 4AK9A 1DPGA 3B9RA 3E4DA 4J2HA 5CMLA 5FFMA 2D0IA 2C98A 4INPA 3DVRX 4F93B 1G63A 2VK2A 2Z1NA 4UM9D 2OZLB 5D87A 1A4IA 4HFMA 5EJ7A 3VPSA 3RWOA 3PEFA 5ICSA 4OMDA 3Q5GA 4EX6A 3QSYA 4G8DA 5CX1A 3CH7A 1AZTA 3WMFA 1KAQA 3SEFA 3H7AA 1ZIOA 2JAXA 3CX4A 2ECFA 4ZEWA 3W2HA 4B5KA 2Z4RA 3K5WA 2YJ5A 1UPBA 3OP4A 3F9IA 4TSRA 2L82A 3EOBI 4MGKR 1AVTA 1SG0A 3H5TA 2EBUA 1NHWA 4PC6A 3WMWA 4I5DA 2YOHA 1ZJZA 3C39A 1K7EB 2AN5A 1RVDA 2X22A 1SPXA 4KQ6A 4ZPXA 3G6WA 3Q3CA 3DB1A 1G2QA 3W3AH 3D3JA 4CT5A 4Q01A 1A8PA 4WKGA 1EFPA 2CGEA 2FWJA 2P5TB 4JC8A 2DQYA 3TW4A 4Q12A 4A5OA 1O8BA 2P9BA 2B8TA 1IG3A 1Y81A 3NHJA 3QBDA 3FOEC 3H2ZA 4URYR 2B99A 2QLLA 2CJWA 2FGJA 2BGJA 2WC1A 1D6SA 2WE7A 4TL7A 5H1YA 3ZBUA 2QAGC 4RA6A 4D9GA 2B5OA 3GGPA 5LMZA 3D4BA 2BP7A 4HWPA 1TCBA 4OB6A 1WQ4A 4YDSA 5F7JA 4EA7A 3OTOB 5KYUB 2Y0EA 1C0IA 3Q5EA 3V4ZA 2PZ8A 5M3BA 2FWRA 2F8MA 2NN3C 2FW0A 3SDZA 4Q24A 1UBEA 5KYUA 2VF7A 2ZYWX 2WD9A 3W2GA 2ZM5A 1QZUA 4RVDA 4GBJA 4ZT5A 3T3HA 4ZMSA 1CZLA 5JW6A 1IWOA 3GI1A 3TZLA 4HN9A 2ZYRA 3WTCA 2AI2A 3AETB 5AJYA 3V5NA 4Z4CA 5LYJF 5AVKA 4BZQA 3GLSA 3QOWA 1ZHHA 2JJ1A 2IPNA 1QGAA 4UNQA 2FSHA 2C7GA 3ZLTA 1MG0A 1TJ3A 2P5SA 1OI4A 4GBED 5EKTA 5A06A 1T2AA 3DT6A 1QGUB 2MYNA 4EY3A 1TZCA 4BZPA 3AEUA 4LDAA 3NW9A 3NANA 2YZNA 4UHFA 3PX7A 4TXJA 2J33A 2OLKA 2DUUA 3ZDRA 4BJ1A 3STXA 4KYVA 4Z3DA 5IAAA 1MJ5A 3SR0A 5SYMA 5JRZA 3L7MA 4JL8A 3FZGA 1FFAA 2JRLA 3QVGA 5JI2E 1T0PA 1SD2A 5A1JA 1QTRA 1G4AE 4UBNA 3ISJA 1VL2A 2JHFA 1R15A 3VZQA 2GCOA 3LSTA 4HQ0A 4UUBA 3AOGA 2NV2B 3ESAA 3VPFA 1QVAA 4OTZA 3KC2A 3M1AA 3TJZA 2C2OA 4NF2A 1KJIA 3DE3X 1NR7A 1KHHA 2G70A 3SKYA 1PF7E 1NQOA 2APJA 3HCEA 2Z3WA 4QOEA 1TGYA 3RVBA 4B6EA 2G7MC 1VIYA 3FRIA 1JDJA 3S2UA 5HHTA 3JQBC 1Z5OA 5B1IA 1KOLA 2HA2A 1M66A 2WSSA 3BQNB 4J1QA 3PC7A 4BO4A 1WB9A 2IYRA 3D3WA 4QJ5A 4ZQHA 3ZTYA 3NQ41 1J4AA 5GVSA 4Q4LA 5IABA 3K6SA 3WK6A 5C5DA 4ZV7A 2XQFA 3IJEB 2KWIA 2PZBA 2YC4C 4HDCA 2IE8A 3DXFA 1YB1A 1D5WA 4X1IA 3GLGB 1E3LA 2JFVA 5L51A 4CEJA 1XMXA 5JHHB 5CUQA 4CIVA 1G9XA 5FJIA 3V9AA 4G89A 2GYYA 4GPTA 4MGZR 4AY5A 1S2MA 2Z6QA 1OLOA 4J03A 1J9EA 1Z83A 4QLOA 4R2IA 4JJ8A 4ER0A 4F11A 3GZTB 5LBUA 4UBMA 3U16A 1I1NA 2PH7A 4N8SA 2X0FA 4YY3B 3EQ6A 7REQA 1NMZA 4C04A 3HR8A 3R8XA 2C9DA 2BTEA 4RSGA 4L5AA 1N9GB 1J8QA 1VP9A 5CVDA 2OHOA 5H81A 4YRTA 4C3ZA 4B3SB 2XZTA 3JXEA 5B30A 1V48A 3NOQA 5DN9A 3EEQA 1XIVA 2Z2XA 1PGJA 2UUCB 2YRXA 1K0UA 3V1YA 2WUEA 2TS1A 3IMKA 5J58A 1QU2A 2P3QA 2GR9A 1BCSA 1I7SB 1J8YF 5TMPA 2A67A 5B12A 4IDPA 5ALIA 3P0EA 2EWWA 3I04M 4LAFA 6REQB 2O59A 3KQVA 4ZDKA 1LJ8A 5CBKA 1D9ZA 2XSZA 4OJYA 2OGZA 1TYAE 1UBHS 3V8EA 1US8B 2XXAB 1RXUA 3LCUA 2XADA 3PD1A 1RYBA 1Q2XA 1MGOA 4XWYA 4F9TA 2HLHA 4GWGA 5K0GA 1U2TA 3NBAA 1L5YA 3PGA1 4XYLA 3OLWA 1PFUA 1OIXA 4B6GA 4F7WA 4Y9RA 1MRZA 1UP6A 1R9JA 4KQFA 2RJNA 2V6IA 4MVYA 4QOFA 3RAGA 3TVDA 4A8JB 4EJSB 1MEJA 4ZGWA 3I45A 3CWZA 3E9NA 4NZPA 2PX6A 2XE8A 5EJIA 4CKWA 1SBYA 5HX7A 1V8BA 3ZGZA 1AS0A 1BE1A 4NV0A 5AUPB 2ZBRA 5D00A 3V42A 2O7NA 2YOFA 3SFVA 5DJ5A 2HBQA 4UHCA 3WKEA 2XCTB 3GH3A 2BZGA 4DUZB 1OILA 4J3FA 3S7TA 4DCPA 1E8MA 3L6CA 3NYWA 2QMUA 3B52X 3I0NA 4HN4B 4WV3A 4XR9A 5FNZA 3T95A 3HHEA 5LQMA 3E2IA 1IHYA 3WMEA 5DLEA 1TLTA 3HH8A 2D7JA 2G9QA 3D8BA 4LXHA 5LUBA 4R3WA 2J5BA 2ZRCA 3N8KA 3GLHE 1P9OA 1K3FA 4OVKA 5IAEA 4B83A 4F6LA 1ZIYA 2AFHE 5LNK1 2WR8A 1Q1GA 5JWHA 2FMIA 1CF2O 1VRCA 2JGIA 1W9MA 2OGTA 2PFKA 2WWFA 1DWQA 5CLIA 3NTVA 1Y9DA 5HOQA 3UGJA 4H7FA 1Q83A 4KNYA 1GN9A 2EKLA 1GOTA 2O3RA 2R79A 2WDPA 3R44A 2LE0A 1K8XB 4K6GA 4L5CA 5ALSA 4UTRA 4AZWA 3DE6X 5GAJA 2HR1A 3IEXA 2I6XA 4ER7A 2Q4TA 1K5GA 4U2DA 1ZO8A 1SXHA 5E7IA 4KN5A 2JH8A 2C92A 4M1ZA 1T9AA 3WNCA 5EVCA 3TAUA 2UZIR 4HGOA 4HTFB 4L51A 1AXGA 4PBTA 2MYTA 1KI9A 1O97D 1TT5A 1Q0RA 2PA3A 3DAGA 3FYUA 2D1RA 2AUMA 3CNLA 4B71A 2OAGA 2GD1O 1OAOC 2IIQA 4G1VA 4RL6A 5IEBA 4BQOA 3LHIA 1QK3A 3FHLA 4OAQA 1YRQA 4P7GA 4C6SA 1W48A 4P84A 1I8TA 3CEMA 4C5BA 5J47A 1LTHR 1XZLA 4NESA 4YWJA 1ZS9A 1FTQA 1RSZA 3EZNA 1J9ZA 3F4KA 4RE5A 3P9PA 5A0FA 3KPYA 3U7QB 5EGNA 1ZK0A 1KQ3A 3AHDA 3KUXA 4G81A 3ZBTA 1SXJE 3CONA 2A84A 1XYGA 1DJLA 2HK9A 2NXEA 3AZPA 3PQ7A 4YCDA 4K3UA 3ML1A 3QI2A 1YFKA 3SBDA 3TE7A 3DVSX 4F60A 5K3EA 1RABA 1XTIA 4I4NA 3ZK9A 5B1HA 4LY0A 1CRPA 1C2TA 3V7FA 2JLQA 2BDTA 1KU0A 4BUCA 2FUCA 2YVAA 3E35A 2OVFA 3H17A 4NENB 5JO9A 1J0EA 3AXSA 3A2LA 1VSTA 4GAEA 5IJAA 4FD2A 5T4BA 5FOTA 3KETA 1R0WA 1MT3A 1OQAA 1RIFA 4QPNA 2VKTA 4H3HB 3IGFA 1OI3A 2ZI3A 1TCAA 4HPJB 4UEOA 1VLZA 1Y6RA 2PLWA 3PPVA 4G1MB