2AK2A

Adenylate kinase isoenzyme-2
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
220
structure length
220
Chain Sequence
PKGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDASQTPDVVFASILAAFSKATS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE ISOENZYME-2
publication title The structure of bovine mitochondrial adenylate kinase: comparison with isoenzymes in other compartments.
pubmed rcsb
molecule tags Phosphotransferase
total genus 76
structure length 220
sequence length 220
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ak2A00
1GKUB 2WWGA 1R4AA 1G1MA 1NJFA 4NCIA 1SULA 3NC0C 4XWOA 4JVMA 2CMKA 2FU5C 1KHTA 5KSYA 4A8JA 2IYSA 2J1LA 1K6MA 1Q12A 4FD2A 5KNBA 3IILA 4HLCA 1V5WA 2OFOA 1UBEA 3BRWD 4IDNA 3IBYA 5E4FA 3NDBB 3OF5A 1R0YA 4UJ3A 4UNNA 4GFDA 4DLTA 3NHAA 4TL8A 1ESNA 3L8YA 1G21E 5IF9A 3U7EB 1ZM2A 3QEJA 1P62B 1GKYA 2ZRIA 4H9GA 3VX3A 2D3WA 2RGXA 3K0SA 4II7A 2F55A 3K53A 4WXRA 3LW8A 5A0FA 5EUQB 3ZZ0A 3U61B 2IUSA 5F3WB 3OIVA 3KQLA 2CL0X 2AHOA 1U81A 4Z1MD 4ACBA 1UKEA 2Q9AA 3QUSA 1N6LA 5HCNA 2ODNA 2OV2A 4QFMA 5GJVC 4EDHA 3GLIE 1BMFD 3LX5A 3M6AA 5DSZA 2XJ9A 4GMXA 3GFOA 3OESA 4EPYA 1T3SA 5IDVA 2ZJOA 4CEHA 2O8EA 1M7BA 1ZNYA 1RZ3A 1ZM4A 2RHMA 2GEUA 5FL3A 1E4VA 5H70A 1DAKA 2IYYA 4FWTA 2WTUA 3NEJA 4TSFD 2AFHE 1U98A 3HP1A 4B6EA 3SOPA 1HT1E 5AUQA 2G1JA 3GQBA 2ZS7A 3SC3A 1F3OA 1II8B 3D7MA 1S8FA 1ZW6A 1IM2A 2QP3A 1ZCBA 3BJIC 3SFVA 4B76A 4KODA 2ZROA 3R7WB 4OI4A 2BKUA 2V8OA 4TMZA 3KQKA 1OPXA 4HAVA 1YZQA 2F9LA 2ZI6A 4XH9B 4G3XA 3CIOA 1G20E 3L2OB 1EFHA 4M1SA 1XEWY 2WPDA 2ATVA 1OFIA 2H57A 2PT5A 2ATXA 3ZVLA 5J4YA 4OHVA 2GRJA 1L4UA 4OQXA 1KI9A 4NL4H 2OAP1 5JRZA 1SXJB 1TNDA 4P32A 4YMSA 3IKJA 2OZEA 1P9RA 4KXFB 3KTAB 3SN6A 4QJ3A 4D81A 3KX2A 3BFXA 4Q00A 1SVSA 3B85A 4I1UA 2DCUA 2AK2A 3LA6A 3PQCA 1ZD9A 2JLXA 3ZVMA 3VHLB 2HT1A 2DFNA 2W6IA 5GJBA 1XZQA 3MFYA 3T1VA 4HZUB 3DVLA 4NTZA 4ARZA 3OFND 4MH0R 2A2ZA 4W9MC 1Q44A 1JBKA 1S9DA 3D8BA 1R0ZA 4O2LA 3CUEF 2VSOA 4EUNA 2DR3A 4ASUA 1SVWA 2I4IA 1RYHA 4FWIB 1E9FA 1NIPA 1E9SA 2VP2A 3AF2A 4IJMA 3ZQ6A 1EWRA 4M1TA 1XBTA 2C9OA 2QGNA 5KPJA 3LQRA 4PC1A 4Q1FA 3F3YA 2QMEA 4M22A 3ND8A 3A4LA 1K5GA 1JQLB 3SEAA 2FF7A 1F2TB 1N6PA 3CX6A 1E9CA 5D3MB 1QHNA 1ZC4A 3Q5DA 3CH4B 3HJNA 2ZI3A 3PCRB 1P60A 3AVXA 2JA1A 4KLZA 1Q22A 5C1BA 4YONB 1U2RA 4EPXA 3O8DA 2I3BA 1UKVY 1Z6TA 3DEFA 2W2VA 4X8HA 1DS6A 3DO6A 2OXCA 1NN0A 4KYIB 4HZIA 2C78A 4DJTA 2CL6X 2ZE8A 3Q9LA 3H2YA 5TXGA 4AG5A 2NIPA 5JS8A 3SJCA 2J5XA 3EZFA 3NBXX 2XNDA 4XIGS 2VEDA 5EZ6B 1Z06A 1AJEA 1UKZA 3D3QA 5L3RA 4US1R 3BK7A 2V3CC 3VNVA 2VIIA 3B9PA 2CLSA 1JR3A 1Z0JA 4LYJA 4XWAA 1Z3IX 3QPUA 1TMKA 3RYTC 3MWJA 2DFKB 4LYAA 2D06A 5JCZA 2ZI5A 5EXXA 2XGJA 3AVQA 1XF9A 4XVUA 5CJPA 1E4YA 1SQ5A 2WHXA 4OI2A 3WNBA 4WBSA 4TLAA 2JJ2D 3CO5A 5G53C 1Y63A 1G5RA 1H8HA 4DRZA 4JSYA 4GP7A 3DDCA 4Q66C 4WOPA 4ZCIA 5EUMA 3SZRA 4D2IA 1Z0IA 3SYKA 4QG7A 2JJ8A 2OBNA 2JJ1A 4MQBA 5FPKA 1QBKC 3F0TA 4IOJA 3VU9B 3BS4A 3AKYA 3I1FA 3T5GA 2XZPA 4QBIA 4BLRA 4DIEA 3GPLA 5AUNB 4CEJA 3VKWA 2IYLD 1RW4A 5C2JB 3AP2A 3MD0A 4LBWA 3SBDA 5JJLA 2BIFA 4NZYA 4JL5A 4D26A 1AS0A 2J0VA 5DYIA 1NBME 3I3SR 5JEEA 4MDFA 3L43A 4Q9HA 3RRYA 1FX0A 4Q7KA 5EP4A 3TVTA 3C7KA 3EC1A 2AD5A 4JT2A 4D0NA 3LXXA 1ZAKA 1KI8A 3PUYA 1OHHA 2A7QA 1N6NA 1T0JB 3RS4A 1PUJA 2OG2A 3VFDA 1UF9A 2BJVA 2KJQA 1W5TA 2CCKA 2F9MA 1GNQA 1TQ6A 1IN6A 1IHUA 3OEHD 1EFRD 3K9GA 3OIWA 4N3NA 3WXMA 2Y8EA 1PVOA 4KCGA 4DCTA 1R5OA 2PMDA 3B6EA 5DE3A 4XTRA 4V03A 3ZVRA 4ZI3A 2ZVQX 2QQEA 1A1VA 4MKIA 1VCMA 4TL6A 1GIAA 4XD7A 5SZIA 4HUQA 2FEOA 4K46A 1PUIA 1XTIA 2ANCA 5DLQC 5DI3A 3EZ6A 3RSLA 5AWFC 5AR1A 1OLOA 4HAZA 3TNFA 2AKAB 2CEAA 1MABB 2CLDX 1BYIA 3BFKA 2EFEB 3QXHA 2JCSA 4KVAA 4S2EA 4URUR 3GJXC 2QY9A 5K8LA 4LJ4A 4HB2A 4JVSB 3QKSA 1NBMD 3AVTA 1XXHB 3FDIA 3FKSA 3O8CA 4A2PA 5EZ5A 2XAUA 1E0KA 3K0FA 2V4ZA 1IBRA 1NSTA 3NEYA 3UMRA 5A4JA 1GILA 1JPJA 3T06B 4UNQA 1GSIA 2QAGC 5FOSA 4BZPA 2JIZA 4LWZA 1HURA 4EQ6B 3W3AA 4OKSA 1VCOA 2J7PA 1PLJA 4M1WA 1VYTA 1OE0A 4WW0A 2I1VB 2GZHA 3D31A 4JVNA 1Q57A 1Z2CA 2P6UA 3W8RA 1JJ7A 5L3SB 4KBFA 1GP2A 2E1RA 2OBLA 1BKDR 3ZIAA 1UBGA 5FOTA 1BH2A 2F7SA 3BH6A 3CH5A 4B43A 1II9A 1KK3A 2HCJB 4V02A 3ZZTA 1WBDA 3NH6A 1W4RA 4NH0A 2FJUA 1G5PA 5LB2A 1N2CE 1VCNA 2R6CA 1EXMA 1G4AE 3C8UA 4QGAA 1T91A 1W36D 2ZRHA 3IEVA 2RGNC 1QG4A 3R8FA 1G8HA 3TIFA 1GL9B 5HR5A 2ZM5A 4L15A 1J7KA 1E2MA 4B3FX 1OH6A 4DWJA 2W6JA 1K5DA 3IQWA 5CYOA 4ZI2A 4P4SB 2WJGA 3AGPA 3HDTA 4IW3B 3BB1A 3QQ5A 4FI3C 3EPLA 4O2RA 4TMVA 4D80A 3A1TA 5HZHA 1EK0A 4AYWA 1E2PA 3K0CC 4Y0AA 2GCPA 4B44A 1KDPA 1N5IA 4R2IA 3DMDA 1L2TA 2J7KA 4BWYA 2J9RA 3MCAA 2CBZA 1X1RA 1EWQA 2P5TB 3K9NA 1CJMA 4Z51A 4TQAA 4HLUC 2L0XA 4XSHA 3PXGA 2XXAA 4ZDJA 3OAAD 3FYHA 2IW3A 3DHWC 3NBYC 4B34A 2WWHA 4BFVA 2HT6A 1IQPA 4GZMA 2G77B 4M1YA 1KI4A 1ZUNB 2B7BA 3CPEA 4PPQA 4MKFA 3CZQA 2GBLC 4C0SA 1N0WA 2ZJ5A 4DSNA 2NTYC 2ZSBA 4GI7A 1C1YA 3NDPA 2OXRA 2H1LA 3R20A 1DVRA 4QGHA 1R0WA 5EXPA 5FBRB 1JXOA 1YVDA 4RD1A 1IJFA 4GNKA 5CLQA 5JCPA 2YOGA 4BZXA 2REXB 3B60A 1VHTA 5DN6D 2BBSA 2JDIA 3T34A 1JEEA 2GZAA 2QGZA 4ZIRA 3K8YA 4C4PA 2F3TA 1OFHA 2ZREA 4KFTA 2OUKA 3LBIA 4NDZA 1G3IA 4JVLA 2QPTA 3CNLA 4ZDWA 1NG9A 2N1BA 1CS4C 1S2MA 4FXPA 3I61A 2O8BA 4RD0A 4BLOA 4LJ6A 3EZ2A 2OCBA 1SVOA 2QSYA 3THYA 4DCNA 4EFNA 3BB3A 4POAA 1GRRA 1XCMA 1E0AA 1PLKA 2GNOA 4LI0A 4PC7A 5KOYA 4M53A 3BFVA 3LVRE 2FG5A 5E7MA 2ZJAA 1HQYE 1KK2A 3RDPA 1T6NA 2QP4A 1IJEA 3A1UA 1BOFA 3GFPA 1TL7C 2WSSA 5EE9A 4TYPA 3BE4A 1S1CA 3U2QA 1NP6A 1CU1A 3QXXA 4MGKR 3U7GA 1NY5A 4TLEA 3SE0A 3GMTA 1P2VA 1ODFA 4JMPA 4JL8A 1KKLA 4Q21A 2WOJA 4KFUA 4DDWA 1UEJA 2EFDB 1P5ZB 1FOEB 3KXKA 3BIFA 1ZIPA 2ZIAA 3SJAA 3TSWA 3OIUA 5JJIA 4KFRA 1T3HA 2MSEB 2F1JA 4YDSA 1ZJ6A 3TUIC 2W58A 2AXPA 5JSZA 4MDEA 1T8TA 4DUGA 1W0KD 2IYWA 4QOSA 5JWRA 4BFZA 1RKBA 1LF5A 621PA 3A8TA 1UKYA 1I2DA 4HAWA 2ODBA 4V0KA 4LSGA 1GM5A 4NYJQ 1F6BA 2O5VA 2GILA 5KYKA 3GLGB 3GJ6A 4B32A 4JKIA 1Q1BA 2CJWA 3RWOA 3TKLA 1OKKA 2C98A 5JI3E 1SKYB 1NN1A 3EW9A 3ZJYA 1NI3A 1OFTA 4LJYA 3UK6A 5FTLA 1TADA 4OK5A 5CIQA 3SBEA 1GL7A 2ZRFA 1TF5A 2KI5A 4FINA 1RYFA 4CYMA 2ZRJA 1FP7A 2FFBA 2VP6A 3PFIA 4RZ3A 5FOWA 1ZUHA 3IO5A 4FMDF 1RIFA 1OYWA 3AM1A 4NKRA 3HYTA 3RC3A 2OT3B 2GJSA 1U90A 3P32A 1D9XA 1ZIOA 1XNJA 3KB2A 3N2EA 3O8RA 1MT0A 5FUYA 1J99A 2YWGA 3U6BA 3K0AA 1TPZA 1G64A 4MYTA 3KJGA 4MA4A 3PJRA 1US8A 3PEYA 3U44B 4DCVA 4IEIA 1VKJA 4TMKA 3IIMA 5KO2A 2QAGB 4L5BA 1PLLA 5DHFA 4QRHA 4A4DA 3TLXA 2C77A 3VKHA 4QGFA 3IGFA 1N0UA 2ONJA 1G7CA 3QKRB 1GOTA 4E03A 3J81k 1SVLA 3ADCA 2BMFA 3C16C 2GCOA 4JYBA 2GHIA 4JLMA 4L4UA 3PUVA 1N0VC 4QHSA 2IF2A 1MH1A 2ZR7A 3DPUA 2R62A 4KU4A 5KSPA 3PUWA 1IN5A 3THWA 1JI0A 4LPKA 2O0KA 4I1VA 5J5CA 3ASZA 1Z0KA 1CR4A 2X1VA 2Q21A 4D4JA 1X3SA 1E2FA 3REGA 4I1SA 3K9HA 3QPWA 2BCJQ 1CXZA 2FSGA 3V9PA 4WZ6A 1M8PA 1E9RA 4JSTA 1KJZA 2GVDC 3I62A 1E1QA 1N6OA 3QPVA 1M7GA 1I4TD 2RGAA 2W6ID 5JJKA 2QMOA 2V7QD 3AVPA 1WE2A 4BEJA 2R9VA 3WRXC 1UJ2A 2VYFA 3JZAA 4FMDB 1Q0UA 3IPYA 5JFGA 1Z0AA 3OIYA 1JR3E 2Z0MA 1TUEA 1OF1A 4YMVA 1T3LA 1CR0A 4ASUD 4NHOA 1DARA 5JHGB 3QKSB 4B3XA 3X1ZA 3GLGE 3MMPA 4BECA 2W2TA 1M74A 2EQBA 1SKYE 3BB4A 4PXAA 3UWOA 1VDZA 3BBPA 2O8DA 4IVRA 2HEIA 1KZGB 1LVGA 1ZRHA 4KHZA 1P9NA 2VHCA 2ZUDA 2E87A 1ZU5A 5J40A 1A2BA 1I2MA 1ETUA 2AL7A 5TMPA 4TZ0A 1UM8A 2IK8A 1NSFA 4B3GA 1NN5A 2W83A 1E99A 3NG1A 3TQCA 4EJSA 3Q7PA 1JQJC 5E7IA 3SI7A 2CVHA 1MRNA 2R6DA 2IS4A 3B8HA 2A5DA 2XNSA 1CIPA 4UXJA 1E2NA 2MMGA 3ZS9A 5BQ5A 4MRVA 1G3MA 2BV3A 2CK3A 4MUBA 3CRRA 1NLYA 4B2PA 2BEJA 2XNDD 3RS2A 1LW7A 5KHOC 3QI2A 2B8TA 2W0MA 2Q9BA 1W36C 4W5WA 5TV2A 1RFLA 5JS7A 4Q4JB 4C7OA 2OESA 4Q4HA 1JR3D 2GCNA 1E79A 1KMHB 3MSXA 4OHZA 1G291 4MYCA 1XD8A 3I8SA 2E9SA 3IDQA 1M2OB 5F2EA 1W2HA 4A2QA 3FFBA 4KSBA 5BN3A 3SU8A 3TRFA 1QHGA 3SNHA 2W00A 4RKFA 3LY5A 4DCUA 3U4QB 3SYNA 3AH8A 4X8LA 1H8HD 3GLHA 2V55B 1W5SA 3GP8A 2I1QA 3WHLA 3PEVA 3DMNA 3V00A 4LHYA 3BERA 2JJ1D 5CDFA 1XCPA 4D0GA 1XPOA 2JLVA 2ZRKA 2OFXA 3FOZA 1CP2A 3OE7A 3SJBA 4JT4A 5FI0B 1KI7A 1QHXA 2NO0A 5E95A 2GWHA 4QL3A 3L82B 2QQ0A 2ZAMA 4CIDA 1JAIA 2XXAB 4GBMA 4MRNA 2NGRA 4R2HA 2BMDA 2OLJA 3KQUA 1AGPA 3WBJA 4F38A 3PVSA 4QHTA 3Q7QA 1XMIA 1XD9A 3FVQA 5KNDA 3TJZA 3U3KA 2EWVA 4IRUB 4JLAA 1GDDA 1RC8A 5F9FA 1N5LA 2PZFA 4XSGA 5JMTA 4MITA 1G8GA 2NO7A 1OHHD 4OK6A 5FL7A 4AYXA 4BFTA 1W48A 4ACAA 3K70D 4BRUA 5HZKA 5K8TA 4GDFA 4RCZA 4L16A 4PHFA 5EJEA 4US2R 5FH9A 3FMIA 1KAGA 1X8LA 2B6HA 4IDOA 2IBMA 1G6HA 3CRW1 5M04A 2BC9A 5EXSA 4GT1A 5J47A 2WWYA 2XB2A 1N5KA 4P3YA 4Q47A 2A5FA 2PLRA 2Q0HA 3WYAA 4HLQB 4JBWA 4FN5A 1E2IA 1KO5A 5SZKB 3D6TB 1CBUA 4FMCF 1XTSA 2XTMA 4KSCA 3PIRA 2ERYA 1AA9A 4XD7D 4B73A 6Q21A 3AB3A 2Z5FA 4E09A 2C5LA 3L0IB 3ONWA 3QNUA 3B2EA 2NPFA 1WB9A 3VTKA 1TF7A 4E5UA 2AX4A 3LO5A 2DWQA 4P31A 3UMFA 2G0NA 3QEOA 2VHJA 4YQFA 3L0PA 2ZRAA 1E2DA 1RVDA 4PQRA 1CJVC 1QG2A 2WZQA 3BGWA 2QBYA 4C2UA 1EFTA 2NQ2C 2O0HA 4FIDA 1YRBA 3M0EA 4B6FA 1CJKC 1KI3A 1U8YA 3KJHA 1VTKA 3U3MA 121PA 1NJGA 4NBSA 2IT1A 3BAFA 4K8OA 2ZRPA 1UBFA 3FMPB 3WYFA 3DL0A 5F98A 2REBA 1N25A 5IHPA 2VHQA 4FMBB 1E2HA 2CXXA 1AIPA 2QP9X 3B9QA 3UATA 4A8JC 4YLGA 1Z6XA 4D82A 1SKQA 1ZNXA 4JLBA 4C30A 1Z8FA 2Z4SA 2PZEA 1W0JA 1B0UA 4PO8A 3SHWA 3VR6A 3CF6R 3ZD6A 1ANKA 3HWSA 1H65A 1ZVQA 3ZIAD 5L3QB 3RS7A 1DBSA 2YWHA 2WWIA 5E3HA 2ZETA 2QZ4A 1J90A 3JVVA 2GTPA 4KLNA 3K9LA 3BWDD 1O87A 2Q3FA 2ECKA 2QAJA 1KTVA 3AVOA 3QXJA 4KO8A 2J45A 4JLNA 3SJZA 1COWA 4ITRC 1FNMA 1GKIA 2DPXA 3CLVA 1YZUA 2J0UB 1VG8A 1DAHA 4PAOA 4TL7A 5C4GB 2W6JD 2EYQA 5CLLA 4QBHA 1R8QA 1D8TA 4MKHA 1CTQA 3DOFA 4OYHA 2QENA 4C0JA 2HYIC 1Q20A 1US8B 2DHRA 1YZNA 1LY1A 1ZINA 2ZSEA 2ZS8A 2GK6A 1E3MA 2HF9A 3W3ZB 2R8RA 2FFHA 2F43B 2G0TA 3M4YA 2ZRBA 1G7SA 2YYZA 4N0EA 4BLQA 4UXHA 1FTNA 3QBVA 4CEIB 1S3SA 1FL9A 3KL4A 1G41A 1A5TA 3FFAA 3B1WA 4RFSB 1F60A 2RB4A 5JWHA 4A82A 2AXNA 3QKTA 4NYIQ 1E32A 3B5JA 1TQDA 1MR3F 2VL7A 2VA8A 4HI0E 5DNYB 5JECA 4NMMA 4Q5IA 3ZYCA 2IYRA 3V4FA 1AS3A 2AK3A 1X6VA 1KOFA 4QHYA 2ZXUA 3G5UA 3NKVA 2FX3A 2MSDB 1W36B 2WMNB 3NC1C 4DT1A 1VIAA 3GJ5A 3W9YA 4LHWA 4JLPA 1ZYUA 1XD2A 3VMFA 5TDHA 2ORIA 3REFA 1QHSA 4LBVA 2XTZA 3QVUA 2EYUA 5DH9A 4BEBA 4LBYA 2V54A 4AD8A 4DCSA 1E9EA 5KUTA 1II0A 4IFEA 4M1KA 2JDID 4PHTA 4LV5B 3CZPA 2OO7A 2WBLC 1DG3A 2G6BA 3DOEA 1S96A 4PSKA 2FSHA 2OEPA 2D7CA 4LDJA 4Q4AA 1BO6A 2GETA 2ZITA 2PX3A 3KKPA 3HU2A 4OQLA 4BFSA 3CPHA 3LRPA 3QJYA 1GNRA 1VYVA 1R7RA 1XEXB 4LJAA 4DSTA 4G5GA 2DFTA 3VKGA 5DISB 4AWXA 1E9DA 3EARA 3QVVA 2B8WA 4KV9A 2NZ8A 1YHNA 2XJ4A 3HPRA 1D9ZA 1Q3TA 3S1AB 3AVVA 2ODWA 3E1SA 3RVBA 3NBZC 4CZ2A 5F9HA 1QHHA 1KI6B 3HR7A 5DYGA 1NRJB 2IYVA 2IXFA 1ZP6A 3NVAA 2RGEA 4GOKA 3MWKA 3U7HB 1KNXA 5AJXA 4BE7B 1RJ9B 4TYWA 1UDXA 2Z83A 1T9HA 4B3CA 2ZRMA 1YRAA 1A82A 2BVNA 2V1XA 3A36A 1OXVA 2ZE6A 1W1WA 2WIBA 3CRQA 4KAXA 4A0GA 3PITA 4Q9JA 3W5JA 2EFHB 3TH5A 3RANA 4LZZA 4PR0A 2ZYUX 3T12A 3AF0A 1X1SA 2YV5A 5HCIA 4LHZA 2O8CB 5AJZA 4A15A 2DY1A 2O8FB 5UKDA 3CKLA 4KITB 1CULC 4A0RA 4ESHA 3IEUA 3DM9B 1GZSA 1RRFA 4MGYR 3EAQA 4DUGD 2BBTA 3THXB 3ADDA 1IY1A 4IXNA 5G40A 2PL3A 1XJCA 3BH7A 1JJVA 2IYTA 2XB4A 4NYJR 5KPDA 2C96A 2CL7X 3TQFA 4TZ6A 3KFVA 4I99A 4AIIA 5CK4A 4Q48A 4NYMQ 1OB2A 1WBBA 2ZI9A 1NNEA 2F1RA 1OKKD 4BFYA 3CNOA 1CF4A 2VLIA 2QNRA 5BYJA 3EC2A 4IFBA 3C5CA 5L8VA 3NBFA 2X2FA 1LB1B 2X8AA 3GLHB 1T5IA 3ETLA 2VF8A 4G5RA 4PHHA 2R2AA 4RD4A 1BMFA 4GPTA 1EFCA 4DHEA 4TL9A 4PQYA 3GJ4A 2YOHA 2HLDA 1N6IA 4DLXA 3GEHA 2VSFA 4BRWA 3ASYA 4U7DA 5CM8B 4OJKA 3PENA 5FPSA 4C0KA 3I32A 2GK7A 4GOXA 2HF8A 3KUDA 1J8MF 4WAUA 3GLFA 2XITA 4WIAA 1IXSB 3WY9A 4TSFA 2YWEA 3TUZC 3KKNA 4OHYA 2R44A 1NMXA 2CVFA 1PZNA 4A8JB 1FQJA 1QHIA 2PT7A 4AC9A 3AGQA 4EKDA 4Q9KA 4R9UC 4KI0A 4OI1A 2XOKA 3I72A 1R8SA 3PEWA 3K70C 3A4NA 1TF2A 1DADA 1AS2A 3I8XA 1WF3A 1OXSC 3SR0A 1XZPA 3A1SA 1P3JA 1U9IA 4HAYA 4A6XA 1DEKA 5IK2D 5J4LA 2JLYA 2ZR9A 5J4HA 1FMLA 3FHTA 4RFVA 2NMVA 1XJQA 3IBGA 3GLIA 1OW3B 1U99A 2NO1A 4TMTA 4DBLC 4P0TA 4C2TA 1XRJA 1HH4A 2PEZA 2QI9C 4CEHB 2O8EB 3TK1A 4PSAA 4RD3A 2FOLA 4M0LA 4RSGA 1QDEA 4YC7A 5FTMA 3RSOA 1AQYA 2YVUA 1K8RA 1KO7A 1NL3A 2UVQA 5CIWA 4ZCMA 2YC2C 2RH5A 5FPHA 3OHMA 3KQNA 4XTCS 2P2LA 4IDHA 1GRQA 3GEIA 2IC5A 3KJEA 2QBYB 1RRGA 3BORA 3T1QA 2KBFA 1JPNA 4PZZA 1L7VC 3ECCA 3K09A 3TMKA 3ZQJA 4KFSA 1IAQA 1Q1EA 4RZXA 2IL1A 2XSZD 2ORVA 4GL2A 4HAXA 1TEXA 3EWSA 3EIHA 3LWNA 4BPBA 1W7AA 4X8MA 2W0SA 4YXWA 3UMSA 1W2GA 2YC4C 3GLHE 4URVR 3QF4A 3UXMA 3AVYA 2BCGY 4M9QA 3CR8A 1SHKA 2FWRA 3RRNA 1GFIA 5CDFE 2LCFA 2GESA 2A5GA 1S3GA 3P26A 1G9XA 3CPJB 3IIJA 2C04A 4AKEA 3FMOB 8OHMA 3G82C 1XEFA 2BBOA 4NU0A 2C2HA 3NIBA 4U02A 2MMCA 1GRNA 3UPUA 1N3BA 3A37A 2YJTD 1FMJA 3FKQA 2JLWA 2BJWA 1XMVA 4LC1A 4BZQA 1JNYA 4G01B 4ARZB 1NKSA 4OQNA 5FR2A 4AY2A 2ZJ8A 3UKDA 1TQ4A 3TAHA 2NZJA 3TUJC 2VHUA 2XZLA 1P75A 2QT0A 1E79D 2N46A 3SS8A 3AKEA 2IHYA 3LFUA 1KJWA 3C41J 4HDCA 4Q9LA 4UNSA 3KKMA 2EVWX 3C15C 2WVJA 1JB1A 1G3RA 2WWWA 3I4LA 2JLSA 2JJ2A 3GJ7A 4HUTA 3W90A 5JHHB 2KSQA 2JLRA 1XB2A 3PV0A 3WP1B 2EFGA 2HJGA 1EFUA 1MO5A 1U0JA 3C14C 1WRBA 3CX8A 2WKPA 3EASA 4AKHA 1KJYA 4WXPA 4TMWA 4EFMA 2VRWA 1FW6A 1OIVA 1NF3A 2GJAA 2FDCA 5G3ZA 2C99A 1F2UA 1Z63A 2NOAA 3W5IA 1Z2AA 421PA 1VG9B 3OE7D 2CHGA 1KMQA 2K5UA 4PO1A 1YR9A 1MRSA 3IUYA 1U0LA 2OFWA 5GADl 2GF0A 1L4YA 2ZANA 2EFCB 4NE2A 5DIFA 1KO4A 4GZLA 4D4MA 2FFAA 1II8A 3RABA 4ZPXA 1FFHA 2QROA 1MV5A 2VHTA 2QE7A 4IVPA 3R7WA 2UZ3A 3GFTA 4I81A 4KJZA 2F3RA 1R0XA 1Z07A 4TN1A 2BMEA 2BDTA 5LBIA 3TSOA 1Z29A 2IEZA 5FOUA 3B13B 2FN4A 2GA8A 2FZ4A 3FPAA 4IKEA 4OJQA 3KDSE 3L0OA 2P6RA 5B2ZA 3NWJA 1E9BA 5CYPA 1E1RA 2BOVA 2ZU0C 3T1TA 4CW7A 3ZD7A 1YQTA 1E0SA 3QF7A 2HDNB 5EE3A 1SXJA 5TVKA 4NPHA 2P5SA 2V1UA 3KTAA 2DWPA 4NCNA 5FI1B 1DELA 2X19A 5EE5B 2V6JA 3TBKA 5EE0A 4HB4A 1WDTA 1HEIA 2PCJA 1JECA 2P0EA 3DM5A 4HZUA 2YOFA 3B1ZA 4CEJB 3ZLJA 4JYCA 2ZR0A 4A1FA 4HYYA 4M2LA 4UKDA 3ZS8A 3CM0A 2GJ9A 3KZ1E 1FX0B 1KSHA 2WKQA 5AUOB 3RS3A 3MG9A 4NCJA 4BLPA 1KY2A 1P2SA 2VTKA 4UNRA 4LBZA 5KU1A 2YHSA 1G19A 2RHDA 1DAFA 5HE8A 2GAAA 1F2TA 3K70B 5D3MA 4WZBE 1W44A 3A1VA 3RS0A 1FZQA 5JWOA 821PA 3RLFA 1W47A 2PCLA 4ILEA 4BGDA 2WPDD 1OV4A 1NKTA 2TMKA 4D4LA 1UDWA 1XEWX 5LD2C 2JASA 1RE0A 2NG1A 3O47A 4JIMA 4TWZA 1W0JD 4QNMA 4BQSA 3GCGA 1CLUA 1XTRA 1SVIA 3ADKA 2HXSA 2QMUA 4PTLA 1LFDB 2ZYVX 1NG1A 4HUQB 3PG5A 3TW8B 4BFWA 4NCHA 1WMSA 3AEZA 5DI3B 2AD1A 1XTJA 1E2KA 2FPMA 3AKCA 1OFUX 5D3QA 1TU4A 2RAPA 2FV8A 4F4JA 1UBCA 1LS1A 1TAGA 1FPMA 1GITA 2BBWA 3BH0A 4LCBA 1VYUA 1X8JA 3K1JA 2P67A 1IN8A 2QTFA 4Q7JB 2GAOA 2XX3A 4R98A 1COWD 2WM9B 3SQWA 2IS2A 4MUAA 2OBMA 2QU8A 2VH5R 1Y3AA 4PQFA 4FCWA 4Q1DA 2IEYA 1Z6GA 3K0FB 5HE9A 1FUKA 5FBQB 1GNPA 1WP9A 5G3YA 3B1YA 5GJCA 1XWIA 5BN5A 3TW4A 2ZPTX 3ZGXA 2VF7A 2ZE7A 3FHCB 1M7HA 3HPQA 4DB4A 5CB6A 2A5YB 2ERXA 4PZLA 5BXQC 3OEEA 3LVQE 4RKEA 1RRCA 4LK2A 3VU9A 1H8EA 1XCGB 1IN4A 1VPLA 1XFAA 1KI2A 1TU3A 1N6HA 4DC9A 4MRPA 2BM0A 1D2MA 1HUQA 3BD9A 1AZSC 4Q1BA 2FGJA 4G5SA 2ZI4A 1IXZA 2BM1A 3B82A 4DDVA 1YZGA 3EIEA 1G3UA 2QUZA 4BLSA 1MOZA 4C0LA 1AKYA 4C0QC 1Q1QA 4NYIR 2HCBA 4BFUA 2GDJA 2RGCA 2G3YA 1IXRC 2J46A 5K8IA 2FE4A 3LW7A 5FFMA 3CNNA 1ZNWA 5CJ2A 4N1AA 2HJVA 4MYUA 2ZS9A 1ELOA 1Z6AA 2H92A 4HSEA 4W5HA 3H0KA 2IWHA 4QKQA 1I4LD 2FEMA 5K8UA 3W34A 4C9BA 1RRPA 4I1OA 1UFQA 4IDQA 2J41A 4F93B 1JEDA 1JXMA 1P7CA 3W6NA 5HTKA 1KO8A 2VP5A 3FGNA 3RS5A 5FBWB 2IYXA 2OE2A 1TEVA 1WXQA 4PO9A 1CRQA 2ZJZA 3MAAC 1O3YA 5LB4A 2CNWA 5AK0A 5C18A 3R9XA 4EIWA 3FTQA 4XJXA 1C4OA 1MABA 2Q3HA 3LDAA 4WVFA 3EA5A 4OQFA 1NY6A 3NXSA 2GEDA 2DFLA 2JEOA 3EWAA 1G4UR 4NP6A 3PEUA 1NVVQ 1KO1A 1Z28A 2FA9A 2DYKA 1VG1A 2FZLA 1XXHA 1T5LA 2ZYWX 4HDOB 2QORA 1MO3A 2IS1A 1OXXK 2Q6TA 2DB3A 4QBGB 4JBXA 4KVGA 2IWRA 4AKGA 4HEJA 3W6PA 4EQ6A 3E70C 1CJUC 4LJ9A 1X86B 1KSFX 2ZRGA 4F92B 1E2LA 4JLDA 2FGKA 2G1KA 2H5EA 3QOFA 4LGMA 1YU9A 2QTHA 3TR0A 1J70A 1D6JA 2R6FA 1G8YA 4KYUA 4Q1EA 5FOXA 4AURA 2PJRA 3SFZA 1W0KA 1KYIA 4ZIRB 3FWYA 1GL6A 4V0MA 3EZ9A 5L3SA 5KSZA 3WMFA 1UADA 4DEYA 4JS0A 2WJYA 5EXTA 3AKDA 1OXUA 2ZSAA 4HATA 2GJ8A 4B2IA 2O8BB 4B74A 5TARA 1OXTA 4X8OA 3THYB 3PUZA 4PC3A 2WKRA 4PPNA 4IDPA 4DEXA 1E2GA 4NYMR 1R10A 1UPTA 4DDTA 3ICEA 3U60B 2OCAA 1W4AA 4XVRA 5FUVA 3KFXA 1ZM3A 3AUYA 3AF3A 3H4MA 4O3MA 2ZUBA 4B71A 3ICQB 2QL6A 2C95A 2A3RA 2IX3A 3U6KA 4S35A 4V0LA 3FKSD 3AF1A 2VBCA 1G17A 2HLDD 4MGZR 3QSYA 1ZNZA 4P4SA 1F2UB 2FNAA 2C8VA 3W6OA 3MLEA 5FTJA 1KI1A 1V43A 1D2NA 1N6KA 2FH5B 1VIYA 2JIZD 3BC1A 2ZEJA 3P4XA 4JKYA 4AKIA 1E9AA 2J7PD 4A92A 2AR7A 3SHFA 2CCGA 3CX7A 5JSZB 1KK1A 1ZBDA 1SGWA 2QMHA 4FW9A 4UJ5A 5LD2B 2IF0A 3DKPA 3H1TA 4HB0A 2XOKD 2DWOA 2JATA 1LF0A 2XEXA 1VMAA 1EGAA 5C4MA 4B3DA 3KUCA 1TQ2A 2R6AA 3VNUA 2ZJBA 1Q21A 1XPUA 4JBYA 4O0MA 1XTKA 2HXYA 3VR3A 2WAXA 2KBEA 3A6PC 2BEKA 4XVQA 4CRWB 1A2KC 4FMCB 4OL0A 3X1XA 2CJWB 3ZH9B 2ASEA 3WNDA 1T4GA 2YWFA 3KJIA 1KDOA 2CDNA 1GTVA 1R5BA 2IXGA 2PEYA 3P27A 4Q1CA 5FBLB 3HR8A 1ZU4A 2LKDA 3BXZA 5EP2A 3TVDA 1HTWA 5HKKA 4M4SA 3EG5A 1Z83A 4R7ZA 1UAAA 2V9PA 1A4RA 2G83A 2VPPA 2DBYA 3QE0A 3UANA 2SHKA 2QPAA 4EPRA 4YDHB 3SQXA 2LKCA 1SVKA 3CF2A 4JL6A 2D4HA 3O8BA 2ZUCA 2V7QA 4LRWA 5DGXA 4DLZA 2REOA 4LJ8A 1IOZA 1U8AA 4B48A 3K0AB 5BW8A 5FOVA 2B21A 2JLUA 2ZJYA 4ESVA 2VO1A 2BKEA 1BS1A 1GG2A 3ND9A 4D4KA 1P73A 4PZYA 2QSZA 4C0AC 2W2XA 3U7FB 1YZLA 1KK0A 1VG0B 3ADBA 2IYZA 2H17A 2GEVA 4AK9A 4LUCA 4PC6A 3U3OA 4E07A 4U00A 4QJ4A 1DAIA 3WMEA 1DAEA 3OZXA 2RMKA 4ERNA 3LLMA 2GCOB 3QG1A 4IOMA 3TGPA 5FR1A 2F6RA 4OBEA 3WNCA 2HV8A 4RZ2A 1BYUA 3EA0A 3QY0A 4TLCA 1HT2E 4YXWD 5P21A 5DO9A 1ZC3A 3THWB 3M1IA 2GXAA 2VP0A 1G16A 1GUAA 1OJLA 1PJRA 3ZDQA 1ONBA 3CRVA 4GMDA 4TTRA 2IYUA 3WP0A 4CDGA 1RPZA 2WMOB 1IY2A 2VQSA 1G6OA 1ZUIA 5KDLA 4RCYA 2R65A 1E2JA 3LBHA 4YMUA 721PA 1KKMA 4D0LB 1S9HA 4M1MA 2B7CA 2IHBA 4G0NA 3T35A 1AKEA 2P6NA 4FCVA 3U3RA 4E22A 2AWOA 3THOA 2EW1A 3FE2A 4HAUA 1KSJA 2BWJA 2NO9A 1DG1G 2P65A 2GXQA 3LAWA 4DLUA 4C0BA 3X2SA 2VP4A 3B78A 4ZCLA 3AV0B 2AN9A 3AP3A 5EP3A 2WSMA 3VR1A 2CE2X 5EQTA 3UG6A 3GLGA 3E2IA 2PH1A 4P4UA 3LBNA 2PLFA 5CB8A 2GXSA 4TT3A 2NPIA 4GOJA 5EE1A 2KWIA 2O8DB 4Q7LA 1SXJE 2WJJA 2VP9A 1P61B 4TYQA 1OH7A 1EX7A 5JLJA 3B7GA 4QJ5A 3R9WA 1HE8B 1M6NA 4DSUA 5FBVB 5ELXA 1G8PA 1OH5A 1VCIA 4CGZA 4Q19A 1NVXQ 1OYYA 2WSSD 2HUPA 3MWYW 1XMSA 4TQ9A 1NLFA 1VHLA 2ZYTX 3GJ0A 5TB5A 4EJSB 4PC2A 3SDZA 3WMGA 1P6XA 2WAYA 1OSNA 3CF0A 3HU1A 5J4KA 1E94E 1AQUA 1G7RA 1MKYA 3U44A 4NONA 4EPWA 2QAGA 3E5HA 2QN6A 4Z54A 5H1YA 4D6PA 1R6BX 2H8KA 1E6CA 2D2FA 2ZU6A 5JBQA 4ZDKA 3QKRA 3K0EA 4Q03A 2D7DA 2BMJA 3IO3A 3L0SA 1IY0A 2QE7D 2OLKA 2AKYA 3CWQA 4C7OB 5AUPB 4Q4HB 5JI2E 5BN4A 4J0QA 4YMWA 4Q4LA 2JLQA 3CB4A 2OM2A 4L8GA 4ZV4A 5FUXA 4TYNA 4EFLA 1QF9A 4AYTA 2JLZA 1FNNA 1E1RD 1XJ0A 1T8UA 1XTQA 2YZ2A 4Z1MA 4DLVA 5JRJA 3KQHA 4JJZA 1AM4D 1DPFA 1F5NA 1SXJD 4PPGA 5HPYB 2WJIA 1E69A 1YR8A 1FQKA 1GWNA 2C9YA 4C0HA 3WHKA 4LV8B 1YR6A 1G7TA 5B30A 3KXLA 4Q9IA 1HQCA 4BFXA 2C9CA 2RGNA 1KIMA 3RHFA 1QVRA 2WICA 4L9WA 1BIFA 2G88A 4Q01A 3RRZA 3LX8A 3X1YA 3V4RA 4DLRA 4C3ZA 1L8QA 1P4SA 1Q3HA 1ESMA 2QM8A 3N5CA 1M34E 4FCTA 3QXCA 2O52A 3QXSA 3L8ZA 3WRYC 1N5JA 1D2EA 4Y0VA 5H8WA 3K0CA 1GVNB 4OHWA 3EPKA 1JR6A 3VR5A 4B35A 5KTYA 4LX0A 3FMFA 2FFQA 1KAOA 3LH5A 3LNCA 4PANA 4F91B 1E98A 3IHWA 1VECA 3H84A 4CF7A 1OIXA 4F7WA 4HLUA 4Z8YA 3CW2A 1CJTC 2Q9CA 1N6RA 3I73A 4ZO4A 3QG5A 2PJZA 2J59A 1P9WA 4NCKA 1W49A 2AWNA 3NHBA 1KSGA 2Z6VA 1ZM7A 221PA 4GP6A 3N2IA 1G8FA 4TTQA 5L3VA 1UEIA 4LOAA 1LTQA 2GBLA 2IUUA 4TTPA 1DO0A 4ZDIA 3DZDA 1W46A 5FUWA 3VQTA 3P4YA 4QXAA 4CT5A 3Q85A 1R2QA 1Z22A 5DI9A 1HV8A 2WJHA 2QM7A 1E1QD 3RC8A 2N42A 3OFNA 4PAQA 1E2QA 4M21A 1X8KA 2F1HA 2HYDA 1XDBA 3R9IA 1KDTA 2IUTA 5CM9C 1GAJA 3R8CA 4Q4JA 1DTSA 4IXMA 2ZRCA 3I92A 1KMHA 2CE7A 2O0JA 4DB2A 1SVMA 1A7JA 2ZVPX 3AUXA 4CVNA 3UIEA 3C5HA 3W8NA 4U5XA 4LPSA 5FPYA 2FSFA 3AQ4A 3Q5EA 1J8YF 1QHYA 4RJLA 3RRMA 1YJ5A 5A5GA 3LV8A 1IN7A 4QM7A 3PUXA 4P4TA 1U8ZA 4M1OA 3U4QA 4D25A 1WQ1R 2UZIR 3IQXA 4N0DA 1W4CA 1D5CA 3TSZA 1J2JA 2CCJA 2YINC 1OT3A 3A1WA 4LY6A 2A78A 3OEED 2FSIA 3MJRA 4F4CA 4IEEA 2OAQ1 4ON9A 4M9ZA 4A0HA 1H8ED 1XPRA 2ANBA 3IHLA 4GSYA 1KDRA 1KNQA 2QRNA 3RWMB 3EPHA 2G9NA 3C4JA 2WV9A 4DDUA 1Z5ZA 2GZDA 4G5QA 2QA5A 4EPTA 2XZOA 3T5DA 4RVCA 1U0HC 1MO6A 3B1XA 5IRCD 2EWWA 4OK3A 1U9IC 4G1UC 1AK2A 2CK3D 1HYQA 2ZJ2A 1XXHE 1Q1ZA 4JZKA 2R6GA 4B75A 1NVWQ 4I4LA 1QVAA 4ZKEA 2J87A 1G5TA 4ABYA 5FTKA 3Q3JB 4R71A 1EG7A 4MGIR 1R5NA 2RGBA 4DIDA 2VSXA 4LC0A 4LHXA 4QC2A 2OCPA 4TYYA 2GVZC 1OB5A 4URYR 2OILA 3T1OA 2WJVA 1JALA 2GKSA 4RZUA 3A4MA 4RY2A 1LNZA 4BLTA 2KE5A 4UNPA 4V0ME 4DSOA 4K81B 1SZPA 3QENA 1E96A 2ZRLA 2A9KA 4DVGA 3Q8XB 5JEDA 2H16A 3K09C 2CNWD 2D2EA 3AP1A 4PX9A 1G3QA 4PAMA 4V0OA 4DZZA 5GJWC 2GJKA 3UWKA 4ZKDA 2RGDA 5LDDC 3HYRA 1AGRA 2C03A 1AN0A 2RGGA 4IOLA 4OQMA 3WYGA 1CR1A 1B23P 1KY3A 3GJ3A 1NVVR 1SHZA 2FPKA 5AJVB 3AVWA 1DAMA 3P20A 3B1VA 4OI0A 4DLWA 1AZTA 1FP6A 1S0UA 1W4BA 5KNCA 3NTUA 5FL7D 3MUFA 3AVUA 4DT1B 1YE8A 2F1IA 1XMJA 2J3EA 3BOSA 2QG6A 4M8NE 3I5XA 1C9KA 1XD2B 1ZMXA 1T0HB 4DLSA 3HU3A 4PFSA 2GF9A 4HLDA 4Z8XA 5EP1A 5LPNA 3OEHA 3CRMA 3FB4A 4WA7A 1EFRA 1TUIA 2YNMA 4URWR 3FHOA 5C46F 1XP8A 2WOOA 2FMXA 2H7VA 4B47A 4WZAE 1XU4A 1P72A 4H1UA 5FTNA 3AF4A 4F4IA 4EAQA 1ZM9A 5L3QA 4Q4AB 2D62A 2WWXA 1TX4B 3VAAA 1TTTA 3U5ZB 2QTVB 2D74A 3KXIA 1LV7A 2CLCX 3X1DA 1LS6A 1YZKA 1Z47A 3F8TA 4W7SA 3EPJA 2IYQA 2ZE5A 4Q1AA 4TLBA 2ZAOA 3QBTA 1Z6YA 2X77A 3IIKA 1ZD1A 3X1WA 4A36A 3TR5A 3I5YA 5B58C 4QNRA 5DHAA 4LHVA 3KB1A 3LD9A 5KDOA 4B3BA 1NBMA 4PSVA 1E0JA 1Z0FA 1QHHB 2CHQA 4QBFA 2ZRNA 4EPVA 2Q3MA 1Z0DA 2J0UA 1Z08A 3WBKA 1I4DD 2LWIA 1YZTA 4JLJA 3GJ8A 4A0FA 2UKDA 1MO4A 4G5OA 3RNLA 5B64A 4TLDA 1F48A 4V0NA 2IA5A 1S4QA 3QKUA 5J4VA 1U94A 1NVUQ 4A9AA 4BUJA 1QRAA 3VR4A 4LYFA 1JAHA 4A6PA 2J0QA 2F43A 4W5JA 5CK5A 3EZ7A 5BYKA 3CR7A 2EU8A 1HY3A 3Q72A 3VHXA 2FPLA 4PHGA 2GXUA 2ZTSA 4GRAA 1CKEA 2ODEA 2ZI7A 3CONA 5E7JA 4CEIA 2A5JA 1NIJA 2CHVA 2XTNA 4RFSA 3TE6A 3PR1A 4DKXA 5CITA 5JZVA 1FTSA 2ZSFA 1HA3A 1P2TA 4P33A 2ZSDA 1SXJC 5IK2A 4XWKA 4LJ5A 4Q02A 3VR2A 2ZQ5A 1PV4A 1E2EA 1WCV1 4CT4B 4OHXA 4B33A 1DO2A 3UG7A 4UQOA 5HKKD 5KDDA 3CBQA 2OSBA 2PX0A 1G18A 1OIWA 5GVSA 3A58B 4AI6A 4JLKA 1NLZA 3DKVA 2ORWA 2YKGA 1KZ7B 3EXAA 4JLOA 4JJKA 4TMXA 4A2WA 2BHRA 2NO6A 4Q7MB 2RKOA 3F5FA 1YR7A 3GLFB 2AFIE 2Z4RA 3LXRA 1YKSA 4MKGA 3MGCA 4MRRA 2B92A 2ZRDA 2WIAA 521PA 1ZCAA 4O25A 4H1VA 5ANRB 4BASA 4YMTA 1NMYA 4M9SA 1FUUA 1XEXA 2MSCB 4LJ7A 3NH9A 3SYLA 4IVQA 5KSOA 2XSZA 5H68A 3KKQA 3OAAA 1M1YE 4DLYA 4JLVA 2QRZA 3N70A 5B57C 4QGGA 2A30A 3S1AA 2IXEA 4MYHA 4MRSA 2IS6A 1KI6A 1DAGA 4HDQB 1NMZA 4QM6A 4US0R 1RJ9A 4B2LA 2QPOA 2PMKA 4IOKA 1P2UA 2H18A 2RCNA 1XX6A 3T15A 1IONA 4KBGA 4UXIA 3MRSA 3QIAA 5TY0A 1KGDA 3GLIB 3GD7A 1WA5A 1ZD8A 2ONKA 4URZR 5DN6A 1HE1C 3G0HA 3DZ8A 4RD6A 5G41A 2J0SA 2O8CA 5AJYA 2O8FA 4LYHA 3EIQA 3TAUA 5BWMA 2OHFA 3LLUA 5AJWA 4DXAA 3THXA 1CR2A 2P3SA 5SZHB 1CRPA 4IHQA 1NN3A 1OH8A 2X2EA 3JZMA 3U3JA 4LV6A 2QT1A 2QEQA 3KKOA 5IT5A 3CWZA 5FPTA 2V6IA 3GEEA 4Q18A 2WWFA 3MJHA 4TT3D 2Z43A 4L9SA 3MWLA 2JAQA 4XOIA 3ZVNA 2PBRA 4PPFA 3RAPR 4AG6A 3H86A 2OCYC 3QF4B 3T61A 4TQUS 1QZXA 4M9XA 3LQQA 1DOAA 4HB3A 4EJSC 3IPXA 5SZJA 4URXR 2JGNA 1EX6A 2PZGA 3JVUA 5GVRA 1DE0A 1CEEA 3EX7C 3VX4A 2KB0A 4RD2A 3GLFE 1S1MA 1EESA 3P1JA 3ZZUA
chains in the Genus database with same CATH superfamily
5BR1A 1EP9A 2D1YA 3TPFA 2DUMA 1RAGA 4XX0B 5DOVA 4Y30A 2G70A 1R4AA 2I66A 1DFGA 3JCZA 3K5WA 2XQGA 5AVOA 3JVDA 2PXAA 4XWOA 3OX3A 1NKVA 1KH3A 2CMKA 2PGDA 1KHTA 1XYVA 3DKRA 3H0CA 2AOXA 1Y3DE 1I24A 4I3GA 4PZCA 4NENA 3BXPA 1SUCA 3ONFA 1WWKA 1EVKA 1V25A 3BRWD 3F8WA 4GKKB 3HKBA 2RI6A 3OF5A 3ZHTA 1R0YA 1TFRA 1Z7BA 1SUWA 2A67A 3AEKB 4LWOA 2SBTA 4AZSA 3L8YA 1V2HE 2WJZB 1ZM2A 3WX0A 3S81A 4H9GA 1UMBA 2PZBA 3IEXA 2RGXA 5F73A 3UYLA 4DZRA 1RU3A 5A0FA 5J5AA 4EF4A 3K0SA 4D8VA 1M9NA 1XU9A 2HRRA 3ZDFA 1N75A 4CKEB 3CEMA 3NIGB 2DGDA 4Z1MD 2O07A 5C8YF 2Q9AA 3EUFA 2QD4A 4XQCA 2OV2A 4TTAA 4C6TB 2HFJA 4TOIA 3R7DA 3VH1A 2PPVA 2PIAA 4CV3A 4UQPA 4G86A 4TUYB 2X7JA 2XJ9A 3WLHA 4EPYA 2GM3A 3JQGA 2QVGA 4OJNA 2OORC 2ZJOA 5FADA 1ZM4A 1DMSA 2GWRA 5E6SB 3EFOB 1E4VA 2WF7A 1DG9A 1VKRA 1P1CA 3F47A 5F5XA 2QTNA 4D7AA 1JFTA 3KALA 4MWOA 2PSSA 3VBEA 4DNXA 2WTUA 1YTUA 3AI3A 3I58A 2XB6A 3DV2A 1U98A 3HP1A 3HJGA 4C4TA 2ZBRA 1BCRA 3NXKA 4MVCA 1ONPA 5DBIA 2ZCUA 1YDEA 2A1TS 4GEGA 2V03A 4G85A 5HR5A 2OOSA 3I52A 1FE8A 1S8FA 1J8VA 3VR5D 4DW8A 1NFFA 1EDZA 3AB8A 4NJOA 5BW5A 2FETA 4KODA 4YRFA 3IAXA 3GDGA 3KQKA 5E6RA 4EF6A 1PE0A 3EGXB 1EU1A 2F9LA 4EG8A 5ALFA 4G3XA 4PTYA 3OPYB 3A9SA 2WINI 1G20E 1MNQA 1PSZA 3AR2A 4YASA 4Q4CA 3NUQA 1K8YB 2X0KA 4HQOA 1GTZA 1XEWY 1AUVA 1CUGA 3FAKA 4JBHA 3PNPA 1OFIA 3ZVLA 2ATXA 2QJFA 1CE8A 1JWAB 2C4HA 3CE6A 3PWKA 5JAHA 4RVDA 5JRZA 2AMVA 2XOXA 3NYQA 2QU7A 3B70A 1NPTO 4YMSA 3IKJA 2G7MC 2OZEA 2PXXA 5C1IA 2IIVA 2RHBA 3KX2A 4MNTA 4PRYA 2G72A 5K3BA 1N78A 2OP1A 4MS4A 3E3LA 3UW3A 2AK2A 1GGEA 4MPTA 3WS7A 4FB4A 2VT7A 2JLXA 1QFZA 2FZKA 3AFMA 2W6IA 3E5NA 1E1MA 2EDCA 3OO0A 3MFYA 3TJMA 1NV9A 3DVLA 3FROA 1UMCB 2W2MA 1UR5A 4JC8A 5FA5A 3K4HA 4MH0R 6YASA 2A2ZA 3CLSC 2ZG6A 1Q44A 4E15A 3UV6A 4BJ1A 4JKOA 2NXEA 2I80A 5C7YA 4F9FA 3D8BA 4XDGA 1I80A 3UK0A 3HA3A 4MS3B 2ZUUA 1ECBA 1J2RA 1OROA 3GMIA 3I6YA 4M0PA 3BA1A 3I01A 4UM5A 5CCEA 4FWIB 2E85A 1UMDA 2PANA 3O74A 3T9FA 3TL6A 4W5NA 4MUEA 2B25A 3P9YA 4F97A 1DT5A 4S3MA 5JANA 1CJSA 2C9OA 5LYJB 3WJ2A 1BE8A 2GTIA 4PR3A 3F3YA 2QMEA 3RM3A 4NPCA 1JQLB 4KQ9A 1MDBA 1XAIA 3CX6A 4NNOA 1QHNA 3TB6A 3EG9B 2AC2A 3CH4B 3HJNA 1GYQA 2B99A 1AMOA 2HJHA 3TFOA 1PG2A 1DIAA 3W8FA 4KACA 2JA1A 2J8ZA 3HY3A 4TWIA 4C43A 1NI4A 4YONB 1U2RA 1Q11A 2HDHA 4LZNA 1DOZA 2PUJA 3C97A 4GU5A 1SCUB 1HGXA 2YMQA 3DEFA 3R6DA 3I30X 3NYIA 2AJ8A 1Y3HA 1SNYA 3WK5A 2GD0A 2IP2A 4KXYA 3ICPA 4DJTA 4FSHA 1N1GA 4AG5A 3RVOA 3ANNA 1ML4A 3HFJA 4YT2A 4XIGS 2HA3A 2OCIA 2XNDA 1Z06A 2XCLA 4C1NA 4R4JA 4CM1A 1DKMA 5KQPA 1IWPB 1ZL2A 3BK7A 4US1R 2VIIA 4AZ0B 1JYEA 4UU7A 2PD4A 1Z0JA 2QW8A 1E3WA 2HBZA 4HNHA 5AI4A 4Y6PA 5B7NA 3RYTC 2H2HA 1ES9A 3GIDA 4CFSA 3MWJA 2DFKB 1VSQA 4LYAA 3AMVA 2D06A 4MW0A 2PFSA 2ZI5A 1QGED 4RESA 5JCZA 4HMQA 1U80A 4G1FA 1E4YA 2DHCA 4FSXA 3HKEB 4BKOA 3UY4A 3WNBA 4CMBA 1TT5B 2EL9A 4NBKA 4WBSA 3UBTA 1VFPA 1OWPA 5G53C 1M6VB 5LUAA 1BVRA 3QWBA 4FUQA 4KYTA 5AVTA 4JSYA 4GP7A 3DDCA 3PEEA 4WOPA 3RFUA 2RH8A 4MRMB 4WE3A 4DCPA 4JEMA 4MQBA 2X9GA 4I1PA 5KSOA 1W5AA 1U3WA 1QBKC 1N3IA 3H6GA 1QG6A 5IASA 2CV2A 2IKSA 2VWGA 4NNJA 3I1FA 1WQ4A 5JY1A 4JCCA 4NZ9A 3VKWA 4H6PA 2IPOA 4ERXA 3PA8A 5FP0A 2R6HA 3G68A 2E21A 3PVCA 4JB8A 4PZDA 2BIFA 2X4DA 4HDMB 2Q4OA 5B3JC 3A9TA 5BR4A 2RHJA 2ZIWB 3ODPA 4W5OA 1NBME 3ABOB 1PEDA 3L7BA 2XUIA 4Q9HA 5DSXA 2EW2A 5FYDA 4BTEA 3EC1A 4AKTA 4JT2A 3DKIA 1QQTA 1HSZA 3LZCA 2A9PA 2V9CA 5IDXA 2CXHA 1C2YA 1YRQA 3QV2A 1JE0A 1N7JA 3LFTA 3R6TA 4IV5A 3HBLA 4AN1A 5KNCD 5JTTA 5LZ9A 1W5TA 2CCKA 2F9MA 1LI5A 1BQ3A 1HWYA 1B93A 3WQHA 1ENZA 4CKCB 4W82A 1IN6A 1ZH4A 2K87A 3U26A 3OEHD 4GVXA 4HYQA 3LDFA 3K9GA 1H2EA 1QPGA 3OIWA 1EUCB 4OHUA 4CM6A 2D1SA 4X63A 4CTJA 2XB8A 5CM2Z 1I7QB 4R9SA 4OVKA 4FFOA 4FGZA 3H8WA 1ZY2A 3JD0A 5AK4A 3QKWA 1PF7E 3U37A 3L8CA 2Z3VA 3SJUA 1GIAA 2QZPA 3WQQA 3UJAA 1M5UA 2A9VA 2VQDA 4HUQA 2FEOA 4K46A 1RQRA 3EVGA 1PUIA 2ANCA 3CRNA 3FVTA 3MYYA 4HRAA 4OMDA 5DI3A 2AKEA 1ZXBA 3PQFA 4HAZA 3DS8A 4F3CA 3A26A 3FRIA 3HUEA 1H22A 2CLDX 3L92A 4C21A 4DLPA 1ACLA 4GI3A 1Z6PA 4A7PA 1YVPA 2EFEB 3HBAA 2MIIA 2JCSA 4KVAA 4S2EA 2FQWA 4I19A 4URUR 4WA8A 2QY9A 5I9LA 4L57A 5EKTA 3PC8C 3LVFO 2RIRA 4RS4A 1O9HA 4XYEA 1O58A 1SBYA 1Z45A 3E3NA 3ER6A 2Y27A 1B2RA 3SQMA 3FKSA 1RAAA 4EJ2A 1E8DA 3A6EA 2XKBA 5EZ5A 2LUOA 4KQJA 2XAUA 3RRJA 3U0VA 2H6EA 2X15A 1DIRA 5D1HA 3UMRA 2G4CA 1GILA 2QT9A 1FFXB 1JPJA 1MP0A 3HY6A 1JJBA 3T06B 3ORHA 1GSIA 3OCCA 2QAGC 4PNHA 4UNQA 4BZPA 1H4SA 1WXWA 2FPWA 3DMRA 1B6SA 5EIEA 2KLHA 1PT9A 2P68A 3W5AA 2B98A 3CLRD 4NG4A 1GTG1 1OE0A 4J3JA 1XLTA 2Y3IA 3DLTA 5C9ZA 2X23A 2IHNA 2JFVA 2SCUA 1RXSA 1NURA 3MTEA 2VHVA 4RF5A 4S1NA 1Q57A 1Z2CA 1IY9A 3MA0A 1J6UA 4N5DA 1U1FA 3UT5B 1ZHFA 2BZGA 4KBFA 1Q0RA 3AL2A 3JD1A 3OEYA 2E1RA 3ZCUA 1BKDR 3OOWA 2IOQA 4L95C 4C7VA 4LZPA 3WLKX 1RPJA 2OCKA 3DUFB 3QFRA 3I83A 3K6KA 4GZ3A 2X7XA 2WFLB 4OHBA 3D43A 1RKQA 1T9DA 4FYMA 1SHLA 3LBYA 4NH0A 1SUPA 1JQKA 4B7CA 2I4NA 4PN3A 4D44A 4PLYA 2BFOA 2TS1A 2FN9A 2WNHA 3H2SA 3NLLA 4EHKA 5LQJA 2NV0A 1N2CE 1VCNA 1QX3A 1Y37A 1IHDA 3HVIA 3HVJA 1P5HA 4AL4A 1IMJA 4OKIA 3PCTA 5BSFA 2VQ3A 2NUPA 4GLLA 4LEIA 2XCRB 1BJRE 2EJUA 5L45A 1W36D 2AS0A 5DGTA 3HGQA 2C0CA 1Z4QA 4UVDA 1RQPA 1TUBB 2ONYA 1YJ8A 1J7JA 4FFBB 2OYRA 1GDTA 4L15A 2W6JA 4GPEA 1B16A 4KPGA 3EXHC 1N2OA 4IW3B 3BB1A 4FI3C 3EPLA 2WQZA 1M5TA 1P33A 1EK0A 2ONCA 1E2PA 3EFBA 3K0CC 4Y0AA 3WIDA 3O3CA 1NNI1 1DKQA 4R2IA 4X6YA 2NUTA 3DMDA 3LCCA 5C0OE 3RS8A 2Z9CA 2BF7A 1L2TA 3C24A 4YYEA 3IL2A 1VGQA 5CDYA 2CBZA 2OV6A 4FYJA 1X1RA 3HA7A 1C41A 3WLLA 4ZTUB 1O77A 4ALLA 2VOJA 4WZAB 4E0BA 3L40A 4XSHA 5HA5A 1YHZA 4ZVRA 1WDWB 2BSQA 2WYHA 5EUBA 2EKQA 4P80A 1D0VA 4MROA 3VNBA 2IW3A 4B34A 2AW5A 3OQIA 4RPKA 4WNIA 3CLTD 1IHYA 5FHQA 4GZMA 2QHXA 4M1YA 2OBYA 3VO9A 1U2TA 2L69A 1GSHA 1TJNA 4JFAA 3UEOA 4ZK2A 1L1EA 2JFOA 1A8PA 1LZKA 4ZCRA 2Q5LA 2NTYC 4GI7A 5DYNA 3FZYA 5LKRA 4PG7A 4EW1A 2QVXX 1SH7A 5GP1A 4V39A 4FSDA 3T9CA 3PR2B 4LSZA 3BHJA 3KM0A 5IVDA 5CLQA 2PUDA 1NI5A 1SPXA 5JUWA 4P93A 1QGUB 3VISA 4BZXA 4JC5A 1VE9A 5I5GA 4K9OA 2AOUA 1ARZA 1GDHA 1E89A 2JDIA 1P7YA 3Q9SA 3T34A 3NTQA 2R96A 1JEEA 2GZAA 3H2HA 4K9KA 2YRWA 3K8YA 2NUAB 1OFHA 1YQ9A 1N0HA 3FLBA 4HFMA 3JAKA 4KFTA 2OUKA 4GC5A 5CB4A 5EPUA 4R1PA 2W43A 1UJCA 1JEQA 1ETHA 1NVTA 1CS4C 1VP3A 1YBAA 2CUKA 2O2JA 4FXPA 5A3SA 3S2FA 1KJ9A 3DW3X 4QPZA 4LJ6A 4RD0A 2IRWA 4BLOA 2O8BA 1FX1A 3T7CA 4BKQA 4DCNA 2I0FA 4G25A 4BP3A 3W78A 4HJXA 4CU5A 1VL5A 5IYZB 3PUHA 2OAGA 3RYHA 4LOLA 3GRUA 3QUTA 4PC7A 2IGBA 4JIGA 4I14A 4M53A 4QPPA 1ODIA 1OMOA 4ZQFA 5I7SA 3JZIA 2Z3ZA 3RDPA 1T6NA 2H8GA 3ND5A 3RG2A 2QP4A 3AL0C 4KPEC 3A4YA 1IOVA 3LZ6A 4LKRA 1KJQA 2HU8A 4TYPA 3U2QA 3JQ8A 4GKVA 3TIXB 3L3BA 2QN1A 1CU1A 3QXXA 4OJYA 1RWMA 2NYUA 5TEVA 3CVWA 1B4DA 3PHLA 1P2VA 3K1AA 5CVVA 3GRFA 5K7SA 1RAHA 5IHXA 1YD7A 3MLAA 1P8AA 1M66A 4I5FA 1E7YA 4M60A 5REQB 3DOOA 3AYZB 5JALA 2O3TA 3SJAA 3KXKA 2VDUE 1KMNA 1MQAA 2D0DA 3OIUA 3D6AA 4HD8A 3T9EA 3WGIA 2MSEB 4E6EA 1XK6A 1ZJ6A 3GWZA 1HFEL 3EXEA 4YALA 2AXPA 2XBUA 4RHYA 4IIHA 3VNQA 4REQB 1U7TA 1W0KD 2CXQA 4QOSA 3LUBA 3WR5A 4C01A 4BFZA 1RKBA 4C4AA 4CIAA 1O0BA 3L41A 1LPPA 2HCRA 3AETB 3KYCB 2JC3A 3T7IA 1I2DA 2QL7A 3D4NA 1DBVO 1O6ZA 1KAMA 2X8JB 1ECFA 3QHAA 3ZW9A 4FQ8A 2RJNA 1T3GA 1I13A 2C7GA 4L75A 4G63A 2D2VA 3AIOA 3J7AC 3H5VA 4UUNA 3DTVD 5K8VA 1Q1BA 3TKLA 1DXQA 1WUYA 4IFIA 4G07A 4CKYA 3ZJYA 1P6QA 1NI3A 1M1YB 3A2MA 2D59A 5FYQA 4OK5A 4JI2B 3KQQA 1NF9A 3PFHA 2ZRFA 3NUGA 5FWDA 4V1CB 5K3OA 3R5HA 1CY4A 4IM7A 4LA4A 2XUPA 1IJBA 3RTCA 1PJCA 5E0KB 4JBIA 1YRLA 2QGFA 2WJWA 5AOVA 4FX5A 1ZUHA 5F7ZA 3T4UA 3IO5A 3E05A 2QI9F 4QWMA 5BUZA 3RC3A 3JATA 4D6XA 3KB2A 3O8RA 3K0BA 5FUYA 3GGOA 1Q0LA 1J99A 2YWGA 4UBNA 4UUPA 3VH4A 1LU9A 3VJKA 1AMUA 1CZUA 3KPVA 1DCMA 1E1CB 1U0SY 1Z16A 3CMCO 4H3VA 3WI7A 3U44B 3CS3A 3A9RA 4P4GA 5AYVA 3RREA 1CW2B 4L5BA 5HWSA 3VZBA 1RHJA 1PLLA 5DHFA 1SXGA 3PSAA 4QRHA 5F5NA 4RTLA 4A4DA 5DYYA 5C4IA 1JVNA 2G5PA 2D2IA 4QGFA 2VR1A 3G0OA 2PL1A 1G7CA 3QKRB 4NBUA 4ARBA 1IQRA 2NVOA 3BE5A 4Z7NB 2JIOA 1N2XA 1L7AA 2GCOA 3IAFA 3MJ4A 3NYRA 5LXTA 2GHIA 1DKUA 5K0FA 1I5RA 1N0VC 4K3VA 4RZSA 2ET6A 3CUUA 1KZ6A 4L27A 4EY3A 1VPEA 2IF2A 4RLSA 4R84A 5L7YA 4A16A 2ZR7A 3GRPA 2JZOA 2YNMC 3Q3EA 1YDWA 1JI0A 3AM5A 2ZWOA 4PBTA 5BURA 4JSRA 3ZIDA 1ORWA 1PNRA 1VPWA 1DIGA 3ASZA 1DINA 1QIEA 2Q21A 3MD9A 4Z4EA 4MV6A 2BFCA 2FQ1A 1OBVA 3OE4A 1X1BA 4RK5A 5EJ8A 1AGNA 4I1SA 3RYCA 5HUHA 3PXUA 5DTQA 2REQA 4BYMA 2FPGA 3A0UA 2QR2A 3P8ZA 1FRNA 1UDBA 3DDSA 4I9HA 4BVBA 3I62A 3OCUA 4TRJA 5DXFA 3QPVA 1M7GA 1I4TD 1MNAA 2PMWB 2QMOA 1ZUWA 3TTUA 1WE2A 1X38A 3DBIA 4FMDB 5T4EA 3M49A 3TFQA 1M34A 4NQRA 4D3XA 2GA9A 1JR3E 1MPXA 1PR5A 4E6PA 4G5XA 4UULA 3AZQA 3VJMA 5IKEA 1VIVA 1T3LA 1ZJ4A 5F4ZA 1CR0A 1ZIYA 3PQ4A 1DARA 1DAPA 2BI7A 2XQKA 4Y6QA 4H4EA 2UYYA 4BECA 4HWGA 2X22A 4DYHA 1RBQA 4HGPA 1Y4DE 2Q5QA 5JNTA 1R4MA 1E5LA 2O8DA 4D3SA 3DF7A 1TM5E 4UU1A 1BVYF 4DA4A 1U3DA 1H0SA 3G49A 1I6MA 4GPZA 4ESOA 1V48A 4LXUA 4XEUA 2XCSB 3CGGA 1I2MA 4JOSA 5EMKA 1WUJS 3PKIA 1UM8A 2IK8A 1NSFA 1T8SA 4B3GA 1XVUA 4L0CA 4TVBA 3CVOA 1JHPA 4D56A 1LLFA 4YAKA 2JAXA 3ZG6A 4CWAA 3VXKA 3NG1A 1TM7E 2O4UX 3Q7PA 1LPAB 1UJBA 3MW8A 3UK1A 2CVHA 2XYVA 3FPBA 4RVSA 1R00A 3HY4A 2A5DA 4K8RB 2C92A 4GBJA 1IBMB 4CCYB 3INYA 5EAIA 1U8XX 4BLWA 2AFVA 3IBFA 2JEZA 4QELA 4MRVA 2V8BA 1X9HA 2VEOA 2CVPA 1QTQA 4K05A 3CRRA 1RSZA 4UC0A 4RO0A 4B2PA 1XC7A 2A9JA 3FI0A 3OOHA 3QI2A 1I9CA 2B8TA 2PGLA 5KWEA 3E8MA 1TEHA 1PJSA 4HH0A 2B0CA 3KVNA 1L7OA 4JJ4A 4Q4JB 4IX9A 5D6NA 5IW8A 4C7OA 1TYAE 1KMHB 4HVAA 3IUPA 4JJGA 5FAKA 2Y71A 1Y1SA 1LSOA 3DA8A 3LUHA 2CFSA 4F0JA 4JJEA 4TTSA 1BJTA 3FFBA 3COWA 1LPNA 1QHGA 1VMDA 4FPXA 3B3AA 2QD5A 1Y89A 3M6XA 4MGEA 3SNHA 9MHTA 5CB4F 4ALNA 4JP5A 4QXRA 3RIEA 3V1UA 1B1CA 1FSSA 1GYRA 2X9QA 5TT1A 4CQLB 4HBGA 1G20B 1PX0A 4YT5A 2P11A 3LHIA 4L0MA 3GP8A 3IVRA 1DMRA 1NTRA 1GGMA 1W88A 3KQMA 1R1DA 3PEVA 5LU9A 4M6WA 4WBNA 2VBFA 2JJ1D 1XCPA 4D0GA 1OZHA 2ZRKA 2OFXA 3M6WA 1CP2A 2R8BA 1WZEA 3OE7A 3UT0A 5G0VA 4Q3DA 4F1WA 2V7VA 4FOOA 1QHXA 5FI0B 1EWYA 1JHAA 5AI8A 5E95A 2BMWA 2QUHA 3OLWA 3L82B 5AHRA 3ZWVA 2R8OA 1L7PA 1JAIA 2NYAA 3A31A 2IZ1A 4IJQA 1BWSA 2X5KO 4GYJA 1U6IA 4MRNA 1K4KA 2CZQA 2P9FA 2YZ7A 3PVSA 2BE7A 4F38A 4WGFA 5L51A 2ZGVA 4CMCA 5AJHA 2QB5A 4MQ6A 5KU7A 2IP4A 3U3KA 1LDYA 1N5LA 1WB5A 1QC5A 4WERA 3H0EA 5HUQA 4XSVA 4OPMA 1I36A 4YIHA 2PUTA 1PKXA 4U7PB 1KZ4A 2O0LA 1V4BA 3O8OA 4GKBA 1JTVA 1AURA 4YRRA 3JQAA 2HA2A 4KE6A 4MR8A 4R1LA 1GEGA 5SV2A 3V2HA 3OPQA 3S2EA 4PHFA 1D1QA 3HEMA 1L0BA 2GBPA 5FH9A 1KAGA 1IE3A 1Y4SA 2XHZA 3NEPX 4JNCA 3ZWPA 1P3Y1 2GD1O 3CRW1 4NLLA 4P4LA 3VKVA 4UPDA 5DGIA 2J6IA 1CY0A 3LZDA 5D51S 1U2GA 1ATIA 5HHTA 1N5KA 3H1BA 1GZVA 1K6XA 2A5FA 3LWBA 4HLQB 1KU0A 5GONF 5ILOA 1A27A 3IBSA 4FN5A 3TDKA 5SZKB 3D6TB 4KSCA 1H0RA 1XTSA 4O2AA 2BAGA 3PIRA 4XD7D 1Z4OA 3DE1X 5D85A 5B3AA 4KREA 4BO6A 1N2ZA 4E09A 3IEMA 2DAPA 3L0IB 3QNUA 3B2EA 4H7FA 1QF7A 1RLMA 3ACCA 4EUSA 7MDHA 3DB1A 2AX4A 2V7TA 1Q6ZA 1APBA 3AJEA 4EY8A 4B83A 5B55A 3ZWKA 2VHJA 1NXVA 3ESQA 2ZRAA 2PAAA 2VTEA 2PWYA 3PPYA 4XGQA 1CJVC 1QG2A 1DQZA 5KVSA 1CP3A 4NICA 3ZWQA 4IMJB 1AKRA 2QTAA 1WXGA 1RQLA 1TE2A 5ALJA 3OA2A 5I9BA 5AKGA 1KI3A 1WCWA 2JG3A 1C1DB 3BXOA 3R24A 2NPOA 5I8WA 4NBSA 3LTEA 2I6XA 1H05A 1H2XA 2MHCA 3BAFA 3C5WP 1NXPA 2ZRPA 2XDWA 3D8NA 4N9WA 3RJMA 2I7TA 4IQGA 4KAJA 2IH2A 4HDNB 2CLLB 4HV4A 3U7IA 2VHQA 1E2HA 3N76A 5CT8A 3RTEA 4OLAA 1L5HB 2FW9A 4A8JC 2R8ZA 4YLGA 1Z6XA 3F7MA 3P0FA 3U4HA 2ILTA 4EKEA 3EF3A 1QM5A 5KWJA 2IPLA 1GA6A 2C54A 1TZBA 3PQ5A 2PZEA 4ER3A 3ZGZA 1M2VB 1C3VA 2HY7A 3JARA 2C1ZA 2QLNA 1U3VA 3R0JA 3VR6A 4JJIA 1ANKA 1DBQA 1EINA 1M2KA 1H65A 1ZVQA 3SX4A 2W93A 4C05A 4F85A 1DBSA 2EF0A 2C7PA 4YP9A 5I47A 3JU3A 3D3WA 1W2WB 3SDBA 1YULA 2NU8A 3V4OA 4G81A 4J16C 4MYRA 2GTPA 1BGVA 5AKHA 3HJHA 2PQ0A 2I55A 1K4YA 4O4IB 3JSAA 3WLJA 4XJTA 3AVOA 3PYXA 3U56A 5EZYB 1SHUX 3SJZA 3K9WA 2JFPA 2A4MA 3LQFA 2O19A 1E5VA 4MUHA 4MAAA 1Z4LA 3IB3A 2JCBA 2XMSA 4NX2A 3AEQB 1YZUA 2J0UB 4YRDA 4N3AA 4AY6A 4O4LB 3TXXA 2I1WA 5HJEA 2D1FA 3SXUA 1CZOA 4IP0A 2C20A 4AMVA 4QBHA 4DARA 4MKHA 1D8TA 2KMLA 1C7QA 3NT2A 4ZO6A 4X24A 5TJHA 2QENA 4R9NA 2HYIC 1TI7A 3J80A 1US8B 2DHRA 2P9HA 1T26A 1LY1A 1YZNA 1ZINA 2VXBA 2ZS8A 3FPLA 2X0IA 3OWOA 5G02A 4BBPA 1L6IA 1E3MA 1J5EB 3QYPA 3M33A 3M4YA 2AG8A 1TZMA 2G0TA 3L9WA 1WCYA 4YBZA 4EHHA 1GCGA 3I12A 5HIAA 2ZRBA 3BL6A 1G7SA 3QK7A 3PQ7A 4G4GA 3VHXB 5C52B 2HK7A 3L7NA 4BLQA 2BFBB 4NZOA 4XLLA 4MV1A 3SE7A 4EW2A 3MTAA 4CEIB 3QBVA 3RC9A 3IUSA 3UNXA 1QO9A 4JJ7A 3FFAA 4RFSB 4WV3A 1F60A 1UL1X 1JMKC 2Q1TA 5K0NA 5HQTA 3ANXA 3BIJA 1NLUA 3QKTA 1IEVA 2C2GA 4UTOA 1XMXA 4CT0A 1JB9A 2RHWA 3TZHA 2WHRA 4KO1S 4HI0E 4NMMA 3CN7A 4ZQCB 4CKZA 1WZCA 1X7GA 1YBMA 2PMEA 4XUEA 4BWGA 3K7EA 4QHYA 3TIVA 2ZXUA 1USVA 1JVSA 1XTTA 2L42A 2WMNB 3HA5A 3KPUA 3NC1C 2KLBA 2JH9A 3GJ5A 3M4JA 3QNMA 1WG8A 3VYSB 3VMFA 1LW6E 1TOAA 2BEUB 4Z9XA 2HQSA 3C3YA 3T3GA 4CIBA 4LBVA 1XTVA 4I1YA 2EYUA 4NARA 4R31A 3UFXA 3L7LA 1P19A 1NWHA 4QFCA 4LBYA 5ECYA 4AUKA 1TC2A 3GVHA 4HWKA 1RYBA 5KUTA 3C3XA 3OE1A 2FSVA 1C4XA 1OZGA 1UIMA 1QGOA 2FWBA 3CZCA 1DG3A 3B20A 5LL6P 3MCVA 1G8AA 2WD8A 4PSKA 4QDXA 2C42A 4PEVA 4UNIA 3VGPA 2IUEA 6GPBA 2VDNB 2JHFA 5KNBH 4IJUA 4OU4A 4QPJC 4PZUA 5JROA 3ST7A 3KKPA 1TLFA 1T9CA 3DBOB 1RM5A 2ZB4A 4NCBA 1MLDA 1VYVA 4FE7A 2OZLB 4LJAA 4DSTA 2Q46A 1ZHHA 4UMDA 4W5TA 4WASA 3QVTA 5DISB 4ZRMA 2QRPA 2V3WA 1DP4A 1SUIA 2MR6A 1QJ4A 3EARA 4ND7A 2NZ8A 4OBXA 3HPRA 3CUWA 3S1AB 1B43A 4WBNF 2ODWA 3IQEA 3G85A 2JD2A 3E7PA 3RVBA 1T5SA 1E3IA 1QFJA 1CLEA 2YVKA 1A9RA 3EVTA 3OMXA 3QM1A 2PGOA 3KYBA 4BP8A 5DYGA 3WRYA 3BJZA 3TQOA 4ZYUA 2IYVA 3BEOA 1ZP6A 4YECA 3HB9A 4PF1A 3TI7A 3KJQA 1L3BA 1GLVA 1N2CB 1RJ9B 4BE7B 1M1XB 2Z83A 4IHJB 2WVGA 4RJTA 1M8FA 3PP8A 1P2BA 2QMYA 2D8MA 2YFYA 4Q4DA 2ZE6A 1VE3A 3OZUA 3A9UA 3PLAE 3AI2A 3W5JA 2B37A 1B0AA 2BFEA 2XD9A 2YIVX 4RY9A 3SX2A 4R1QA 3KAKA 3RR2A 1HETA 1RZVA 3DL4A 3DYBA 5HCIA 5AI5A 4DMLA 1TCBA 2JGAA 3PC2A 5DM0A 4A15A 1L5VA 2O06A 5UKDA 1T8WA 4H3KB 1CULC 1LTKA 2CLKB 3IEUA 1QRUA 1QU3A 1GZSA 1RRFA 4DUGD 3EAQA 2HHHB 1IHPA 2BBTA 5DLDA 3A4IA 3DDWA 4IXNA 1LBSA 5CYGA 2VYVA 4Q34A 4JUAA 4LHSA 3HXOA 4P7KA 3SXPA 5F9HA 3E9YA 2C8KA 1SK8A 2DT8A 3TKAA 3TQQA 5KPDA 2FAXA 4UEJA 2H31A 2XDYA 4F6RA 3KFVA 2I6QA 3GB9A 5E38A 3CLUC 1XVVA 1WBBA 4PIPA 2RGRA 2X4LA 1G0NA 1OKKD 2CDBA 5ITWA 4G4IA 1CF4A 3P9IA 1SXQA 5C8ZA 2I29A 3BGSA 3ESCA 3H2IA 5AVKA 3K2IA 3ZWBA 4DADA 4ZMSA 3QOWA 3UCFA 4IDGA 3R3ZA 2RE8A 1LB1B 2X8AA 1T5IA 3ETLA 4ZVKA 4ML3A 4I2NA 1OX4A 1P5FA 1YCFA 3GEHA 4U0KA 4R2WA 3ASYA 4BRWA 4LE0A 3PCXA 2OBXA 4TKVA 2GCGA 1YO6A 4ZEXA 4DLKA 1DRVA 1S01A 2VK4A 3PENA 5E2IA 2OGUA 1FC0A 3FSRA 4GOXA 2HF8A 1ZGAA 3ZNNA 4C0KA 2XITA 5LLDA 4WIAA 4ZVPA 5C34B 5U4QA 1HNXB 4TSFA 1TMOA 4WN9B 2KM1A 3NDJA 5CGQB 2CVQA 1NMXA 4YJHA 2UUPA 5KCMA 1ESEA 5HILA 4BP9A 2VTBB 4XIFA 1FQJA 4MUFA 5BSWA 3FTDA 4EG1A 1Y3FE 3A7DA 4ENUA 5A5VA 1KRXA 4OI1A 3BTSA 3NDIA 2M2IA 4GMKA 4I2VA 4KC0A 3SLKA 5IM4F 2WPNA 1PS0A 5BNTA 1XZ8A 3A4NA 1B2LA 3OPMA 5HG0A 2P79A 1R0KA 3F5MA 4RK1A 3USCS 2NADA 4NEQA 1RAEA 5D87A 4GS5A 1N1DA 1RYZA 5HFJA 5JMWA 2P2YA 4C4SA 1V5FA 3SR0A 1XZPA 3FHJA 1NVMB 1WW2A 3HP4A 3OI7A 3M1LA 3CQ9A 4HAYA 1H23A 3DAGA 4I3FA 4OJMX 5IK2D 2C31A 5J4LA 2XBLA 1YMVA 1AE1A 3IS3A 3G2LA 5HS6A 4RFVA 1X42A 2G0AA 1T2EA 2FKAA 2WZCA 1FTGA 1XJQA 2H07A 1WV1A 4JT8A 3NONA 5AXAA 3KL2A 4C4OA 2DJ5A 1FSZA 4TMTA 7ADHA 2PX2A 4TWAA 3HA2A 1O8BA 4K26A 4X7MA 5F76A 1KE1A 1HH4A 4CEHB 3OCZA 5LU8A 4RD3A 3I2KA 5ALNA 4YC7A 5M7EA 3P96A 2O2IA 4MV0A 1AQYA 1NNUA 4Y1GA 1NL3A 1V11A 1YUNA 4RPHA 1QP7A 2RH5A 1NJ6A 1OCEA 2W48A 5EIOA 1TAHA 4MVJE 4EHBA 3S7ZA 4JU9A 1H2YA 3EVAA 3SF8A 2N0SA 1U1CA 2BGUA 3PHCA 4AS2A 3P2JA 1XVIA 1RRGA 2DHDA 2YBDA 3BORA 3GQBB 3HKDA 2WHEA 2XWPA 1C4WA 4NFLA 3F9RA 2IDJA 4R69A 4WXHA 3MMSA 3GVIA 2B6NA 1IAQA 2BM9A 2VJBA 3JQQA 2Q5EA 4UBIA 5E9AA 5FPQA 3ZOZA 2GYYA 4GL2A 1IWBB 4HAXA 4G97A 5BV2P 3CMMA 4BPBA 2NLOA 3H4IA 5KMGA 3WMRA 3BT7A 4TV8A 2YS6A 3LT1A 5L53A 3QF4A 3UXMA 4F6LA 2ATEA 1F0KA 2BCGY 4WHMA 4NV3A 3CR8A 1GFIA 2LCFA 5BT8A 1K6JA 3LU1A 3OJLA 4RDHA 4ONEA 1R4NA 2OBBA 4F2HA 1ZI8A 3CPJB 3IIJA 2C04A 3LK7A 3FMOB 8OHMA 1XNGA 1ZGJA 1VB3A 4AZ3A 5C37A 3QIVA 4R1NA 2BBOA 4KQKA 4NU0A 5FTWA 5T6BA 4GXQA 3C3DA 4CTNA 1QYIA 3G8YA 1NUAA 5L4SA 2C5AA 2MMCA 4BO5A 1GRNA 4RETA 1TD9A 3WKEA 3L5OA 1VCHA 3GRCA 2OHXA 3HDYA 9LDBA 4BV8A 2BJWA 4LC1A 4TM7A 2IV7A 5B37A 3D7RA 3VZDA 1FYWA 4HC4A 4DA8A 2BGLA 2A9QA 1RQXA 1IG0A 1NKSA 2FZGA 1RM0A 4KMSA 5FR2A 4CHTA 3ML1A 3WGJA 1Q84A 1ZX1A 1I7PA 2Q1WA 4J94A 2IYFA 4RANA 3GPCA 4K1LA 3TAHA 3JQ7A 3NRCA 1TYEB 1TJ4A 2HXGA 1E79D 1LPMA 1G66A 3AKEA 3DVRX 4FYKA 3JD3A 3FR7A 3LFUA 3IEIA 1KJWA 1JI3A 4Y1RA 5IJAA 7REQB 5FWXB 2B7LA 3GFVA 5DFAA 1R6AA 2PMCA 4GR5A 2H2IA 1JIKA 3KKMA 1YDMA 2EVWX 1JB1A 1G3RA 5ECDA 2JLSA 4CM7A 4ND8A 1C7JA 3GJ7A 2HDOA 2KSQA 2JLRA 2BUCA 3NVKI 1H85A 2JI9A 1SCDA 4XJSA 1GCIA 3NBQA 4GMFA 4YJGB 3VKUA 1WRBA 1Y7IA 5HM6A 3EEBA 2E5LB 5E8JA 1KJYA 4WZBB 2WC1A 4EFMA 3C6KA 2Z04A 1AF4A 2OXTA 1P0CA 2AF4C 1SBCA 5CW2A 1J39A 5IBPA 4QXOA 5G3ZA 3QPDA 4F3TA 2NOAA 2VNJA 4ZRNA 3FG9A 2PUAA 1VG9B 4ZC1A 4F5YA 3MINB 1DBPA 2CHGA 2VTDA 5BNFA 4GPBA 5C7IO 4KFCA 5K3FA 2D6FA 2OQVA 3DG9A 5ESXA 2VRCD 4R7GA 1BTOA 1NDQA 3CGWA 3OJFA 1UJMA 4TXNA 2XNHA 3EUWA 1ONNA 1JSCA 3PXEA 3NHUA 3R7AA 2NXJA 2ZANA 4YIKA 1N2JA 2DQZA 4NE2A 5KX5A 1KO4A 4D4MA 2Y1OA 2UZAA 1ADFA 1BE1A 3E82A 3AFOA 4W7IA 4FGLA 4IVPA 2QE7A 5E9WA 2LRHA 3EZXA 3GFTA 5AI0A 2CXRA 1FB5A 2F3RA 1MHPA 1NX9A 3FJOA 1KBOA 3T7SA 3TLBA 2BDTA 1UXGA 3DAPA 3IESA 2GA8A 2FZ4A 3FLEA 3H2BA 1KZ9A 4IF6A 1UJ5A 3S2SA 4DYDA 5B2ZA 5CYPA 1AQ6A 3NASA 3EVZA 4PLTA 1WVMA 1RLUA 1NE7A 1E4OA 2BOVA 1P4AA 3RYIB 2ZU0C 3COSA 3ZD7A 2QLMA 4CW7A 2HDNB 4KDFA 1I2BA 4L72A 5FIUA 5TVKA 1D6NA 3QEMB 5KHAA 4N7BA 1XZLA 4NPHA 8ABPA 1W8IA 3GGJA 3KTAA 2DWPA 4NCNA 5JXJA 2MSKA 4QYIB 4MVJM 1P39A 2V6JA 2VPXA 2QPLA 4C1BA 1R74A 1FPQA 2V7UA 2PCJA 1PEAA 1MJGA 1EP3B 2FPIA 2P0EA 3DM5A 1R0BA 3G8CA 5F1KA 3ZDRA 3CX3A 1PD0A 5BSTA 4R1SA 4HZUA 4J4TA 5CD9A 3OQ1A 1CYEA 4M7PA 1DBWA 1AXEA 4JYCA 4ER5A 4M87A 2ZR0A <