2AK2A

Adenylate kinase isoenzyme-2
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
220
structure length
220
Chain Sequence
PKGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDASQTPDVVFASILAAFSKATS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords ADENYLATE KINASE ISOENZYME-2
publication title The structure of bovine mitochondrial adenylate kinase: comparison with isoenzymes in other compartments.
pubmed rcsb
total genus 76
structure length 220
sequence length 220
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ak2A00
1II8A 2VHQA 5KO2A 4CEIB 1HV8A 2EQBA 1NN3A 2BIFA 4JIMA 1F2TB 3TQFA 4M1KA 5CK5A 3LW7A 4P33A 4WZ6A 3U5ZB 2OILA 4IFBA 3HWSA 2KE5A 3B1VA 4RD6A 4TYPA 2JLQA 3R8CA 1YRAA 1S1CA 3QXHA 2ZREA 2ZE8A 3EZ7A 3NKVA 4CYMA 2FPKA 4QG7A 3KDSE 4HAZA 2ZITA 2GEUA 3KL4A 2ZSAA 2XOKA 4PHFA 1Q22A 4Q1AA 5AK0A 4ACAA 2XB2A 3QVUA 2PCJA 1Z06A 2KB0A 1P2SA 2ZRAA 2ZUCA 3ECCA 4FIDA 2NO9A 4ERNA 2I4IA 5FBLB 4CEIA 4ARZB 1F2TA 2BCJQ 2ZRGA 4MGZR 2EFGA 3O8BA 1ZP6A 2FZLA 4I1OA 2OBNA 1P72A 3FMPB 3OIWA 4RD2A 4DJTA 3ZVMA 3R9IA 1CJMA 3BAFA 1OYWA 3SYNA 4TZ6A 2ZR0A 4BLSA 5LD2B 2BMDA 4A0RA 1VDZA 1L2TA 2FSFA 3HR8A 3LNCA 4TMTA 5A0FA 3ZZ0A 5FOXA 4QOSA 3K0CA 4EFLA 3PUXA 3MAAC 3EASA 4PO9A 2WOOA 3NBFA 2YZ2A 3FWYA 4Q7JB 3TLXA 4LBWA 1WA5A 2EWWA 1OXXK 1YZNA 3B5JA 2IYTA 3P1JA 2AXPA 2FJUA 3LBIA 1KI9A 2QI9C 4G0NA 1XMSA 2WM9B 2XJ9A 1ZW6A 2W2XA 4AIIA 5DHFA 1CJKC 2W2VA 3LV8A 3I4LA 3K0EA 5FTMA 5GJBA 1UEIA 1XTKA 3VTKA 4Q01A 4PAMA 1WBDA 3AVWA 2FGJA 1BO6A 1E32A 4DLTA 1G18A 3K09C 5L3SB 4LSGA 5KSYA 1F2UB 1TTTA 4FCTA 1P4SA 3TJZA 2BEKA 3QPUA 5CIWA 4Z1MA 1VMAA 4J0QA 1NY5A 1BOFA 3CF0A 1VCNA 3ICQB 4B75A 1TEVA 1HT1E 2ZYTX 5HPYB 3BIFA 2ATVA 1U0LA 4KLZA 1FP7A 2IYQA 4US0R 1E94E 2VL7A 2R65A 2QE7A 3GP8A 1QBKC 4IDQA 4D25A 4DSOA 5EE9A 4IW3B 1NVXQ 2Q0HA 1Z2AA 3Q72A 3KJHA 3B82A 3LXRA 1F2UA 1W36D 3THYB 4LUCA 1E2PA 3NG1A 2OFWA 1S9HA 1NMXA 2YOGA 4BZQA 4DKXA 3WY9A 2QN6A 2XTMA 3PQCA 4WXPA 1RZ3A 2WAXA 5AJYA 1W0JA 1T8UA 4URUR 3IIMA 1LTQA 4DDWA 2QEQA 3MJHA 4HAUA 1GSIA 1IN5A 1W46A 2HV8A 3TMKA 4LWZA 1IXZA 4XSGA 3PUWA 4Q00A 4JJKA 2DFTA 4TLAA 1ZD9A 3QF4B 4MRRA 5F9FA 1EX6A 3CPHA 3EZFA 4M1WA 3I73A 3F3YA 3THYA 2B8WA 3AP1A 4NL4H 2H8KA 5KPDA 1KKLA 1Z2CA 2ZSDA 4GL2A 1T5IA 3ASZA 3NBZC 3RS4A 5JJIA 3UXMA 3GLFA 3TVDA 2CNWA 5J40A 2O8FB 1YR8A 2N46A 4M1OA 2IYSA 3ASYA 4YDSA 3R9WA 4EJSC 3SI7A 3SU8A 4RSGA 2GZHA 1XWIA 1GRNA 4R2IA 3CF2A 4PR0A 2WTUA 1ZM2A 3FMFA 3DKPA 3OEED 3SQWA 3ZZTA 3W3ZB 1ZJ6A 1G6HA 4IEIA 4IJMA 1W5SA 2ZRMA 4DEYA 5FOSA 3BB1A 1J8YF 3GJ3A 3EX7C 3QPWA 3A8TA 2F1HA 1MO6A 4Q4LA 5A4JA 5KSOA 3T1OA 1D9ZA 3IGFA 2V54A 3SHFA 4U5XA 2IYVA 3BJIC 3FVQA 2IWHA 2G77B 1KI3A 1G4AE 2VHUA 1SXJB 1RVDA 4II7A 1G64A 1KI7A 2YWGA 3AVUA 1X8KA 4WBSA 4LYAA 1OH5A 3Q5DA 1Z08A 3KKPA 4P31A 1FNMA 1XRJA 2ANBA 4LC1A 3QKRA 2FEMA 4URXR 2WPDA 4YLGA 1ZBDA 3SZRA 4DLZA 4WZAE 4BLPA 3VR6A 4XD7D 4HUTA 1JEDA 3U3KA 4K8OA 4LHYA 3EXAA 3KKMA 5HCNA 3QBVA 3PFIA 2JEOA 2O8EA 3MUFA 1GNRA 3A1UA 1OIXA 3AUXA 2AL7A 2J45A 2V6IA 5BN4A 1X3SA 3ZDQA 1KK1A 4CVNA 1YZTA 4QNRA 8OHMA 2A5JA 3W8RA 3A6PC 2ZE7A 2DHRA 4JVLA 3ZYCA 1P62B 3PJRA 1ESMA 3BOSA 3P26A 3CW2A 1XPUA 3IIKA 1GP2A 4KJZA 3RWOA 5FL3A 2IA5A 1COWD 2AK3A 3B8HA 4A92A 4KODA 1E99A 3TSOA 4BFUA 1E4YA 4UNPA 2P2LA 3AF4A 3OESA 4UKDA 4X8MA 4B6EA 2R6FA 4O0MA 5EP3A 2JLXA 3A1SA 5C4GB 2GESA 3K9GA 4IOJA 2ZJ2A 3F5FA 4PO1A 2F7SA 5EP1A 5C46F 1ZUNB 2WWIA 4A4DA 4D4JA 1G3MA 3RRZA 2AHOA 2KSQA 3HYRA 3SS8A 2BJVA 2RB4A 2VP9A 3H4MA 3CZPA 5FUWA 2QAJA 4GOJA 3NEJA 1P73A 3AVXA 3B6EA 3RLFA 2OSBA 4RFSB 1N5IA 4B2LA 1YZGA 3K70B 3FPAA 2ZUDA 4RD0A 1GVNB 1EK0A 1RJ9B 5CIQA 2FU5C 4IOMA 4B32A 4F7WA 4M1SA 2RAPA 4GP6A 2IK8A 1OFHA 5H8WA 1Z28A 2HUPA 4V0ME 1XXHB 3IDQA 1YU9A 4JBXA 5G41A 3WRXC 2P67A 5GJVC 3VKWA 3W9YA 1T0JB 4HLDA 1MO4A 3AKEA 4Z8YA 4C0QC 4B43A 2VQSA 3X1ZA 2XXAA 3IILA 4M8NE 1RJ9A 1Z63A 4LHWA 4NCIA 5GJWC 4BFWA 3QIAA 3O8CA 4UQOA 1HUQA 3T5DA 2JIZD 2FG5A 3LQRA 2O8DB 1T91A 2ZYVX 4MRSA 1G3RA 5FOWA 1AM4D 2HF9A 4PFSA 1C1YA 3OE7D 3A36A 2ZJZA 2ZTSA 3AVOA 5JBQA 2A78A 4JS0A 1IN8A 1L7VC 3L2OB 1SVOA 4KO8A 2FMXA 3DL0A 4X8LA 3RS0A 4IRUB 4BE7B 3UMFA 2PLFA 1ZMXA 2IEYA 1K5GA 2RGNA 4XWAA 1H65A 1QZXA 1U2RA 1UKVY 5FTLA 4MKFA 3ZD6A 4Q9IA 1NSTA 4MKHA 4M9SA 2JCSA 3KZ1E 3OHMA 3RSLA 3WNDA 3Q85A 2FFBA 4HAVA 4V0MA 2W6JD 3OAAA 4DUGD 5SZIA 4MITA 4OQMA 1GG2A 4C2TA 2O8DA 1RKBA 5FI1B 1ZINA 2D3WA 2G0TA 2ANCA 3B1XA 3N2IA 4AYTA 1CR2A 1M34E 2BMFA 2REXB 3K8YA 1IAQA 3K9LA 1OSNA 3SJBA 3T1VA 3AGPA 2Z4SA 1X86B 2ZU6A 3F0TA 4TL8A 3ZH9B 4GP7A 4FMCF 4KFUA 1US8B 3BBPA 3TRFA 1P3JA 3ZIAD 5TMPA 4C7OB 4DLYA 1BS1A 1CXZA 2WJHA 5KNDA 1ESNA 1Q3TA 2GCPA 4F92B 4JLBA 2ASEA 1Z83A 5JHHB 3UWOA 2QGNA 1RC8A 1G21E 1P75A 1W44A 4A0FA 4E5UA 3U6BA 1PVOA 4LPSA 4MKIA 5JMTA 1E4VA 3KQLA 1E9DA 2AD1A 5G3ZA 4DLWA 4IFEA 4B74A 2IYZA 5HKKA 3KKQA 2IF2A 4LBZA 4QBIA 1G7CA 5LD2C 1YR7A 1Q44A 2GXQA 3NDPA 4R98A 1T5LA 3T15A 1A2KC 3IPYA 4HZUA 4B3GA 1JECA 1NKSA 2HJVA 2ORWA 1KY2A 4XOIA 3UKDA 1FX0B 3KTAB 1E2KA 2BBSA 5CYOA 2CK3A 4C7OA 3THWA 4AWXA 2PMKA 1R4AA 4BUJA 4GNKA 2G9NA 3KKNA 3DM5A 4LJ7A 4YXWA 3QKUA 3X1DA 3AGQA 3A4NA 3U3RA 3A4MA 3LY5A 2ZRFA 2CJWB 3HR7A 3CH5A 1KNQA 2RMKA 4N0EA 4US2R 4QM7A 4NCJA 5EE1A 2QT1A 4Y0AA 3K0AA 2BHRA 1OF1A 3LVRE 4NE2A 1FX0A 4JMPA 2QZ4A 4H9GA 4NYIQ 1ZYUA 4G5OA 5FBWB 3AM1A 2IF0A 2IHYA 1M7BA 1WP9A 3CH4B 4XVQA 4RCYA 4EPVA 3SJAA 5JEEA 2QM7A 1R5OA 4ZCLA 3GEIA 2ZR9A 4HB4A 3BXZA 3ONWA 5F9HA 1X1SA 2WWFA 1ELOA 2QMHA 2CJWA 2XGJA 4TT3D 4DLXA 3GJ8A 5E95A 4ASUA 3QXSA 3T12A 1QHIA 5D3QA 3Q5EA 4P0TA 3CX7A 4TLEA 2WMNB 1FFHA 1OB5A 2NO0A 1NNEA 1LNZA 3PENA 2ZVPX 4RCZA 2GBLA 5FOTA 1CJUC 1AQUA 2QG6A 1N25A 3I1FA 3IHWA 4ZDJA 2YWHA 3BC1A 2RH5A 2CCGA 3KUDA 4M2LA 5AR1A 2JLVA 1CTQA 2D62A 3LX5A 2Q6TA 4HEJA 1X1RA 2G83A 4BFVA 1G3IA 1NP6A 3PG5A 4OL0A 3LBNA 1KI6B 1AGPA 5H1YA 3D8BA 2J0UB 2WSSD 2AFHE 1X6VA 4PPGA 1QG4A 3DOEA 2J3EA 2YINC 4LCBA 3TVTA 2A5GA 1KNXA 4K81B 2DY1A 2JJ2A 4AKIA 3CRRA 2D2FA 3TAUA 1G41A 4PHHA 4OK3A 2ORIA 2GAOA 1G20E 1JXMA 1GL6A 3QJYA 4CDGA 5EE0A 3QEJA 4FN5A 5E7IA 1M1YE 2O5VA 5BN5A 5DN6D 4E09A 2JJ1D 1RFLA 1KI2A 1Z0JA 2V1UA 1SHKA 3E70C 821PA 3T61A 1DE0A 4BWYA 3KB2A 4DDUA 1KI6A 1DAIA 1X8JA 2WZQA 3UANA 2BBTA 1SGWA 2D74A 2IBMA 4LHXA 4GBMA 1M2OB 2C9CA 1UJ2A 1S3GA 2DFLA 3SNHA 1Z6XA 2BBOA 4P3YA 1GAJA 4LK2A 2ZRIA 1VCOA 1Z0KA 5TB5A 4KFTA 2IXFA 2PT5A 2DWPA 2VP0A 1CS4C 2WBLC 3DKVA 4EPYA 2Q9BA 2W6ID 4QGAA 5EUMA 4KV9A 4ZV4A 3K0SA 4MUAA 4PZZA 4QJ3A 1XX6A 5G3YA 3MFYA 2WKRA 2YJTD 3ADBA 1CU1A 1YZQA 4XWKA 3RYTC 3LLUA 1QVAA 3TQCA 3LDAA 5KSPA 1Q57A 3UK6A 1S96A 1NBMD 3HYTA 4D0NA 4WW0A 2RKOA 4RD4A 4KFRA 2MSCB 2WJJA 2YNMA 1CR1A 3LAWA 3I92A 4Q4HB 5GJCA 2QRNA 2VP4A 1D2EA 3W6NA 1KO7A 2A2ZA 1D9XA 3L8YA 3X1WA 2L0XA 1SXJC 3FB4A 2OEPA 2IYWA 3V00A 4ZO4A 1IQPA 1R0WA 1XDBA 3L0IB 3V4RA 2QTVB 5J47A 1Z07A 5J4KA 4G01B 4HUQA 3EPKA 3VR4A 3KX2A 1UFQA 2ODNA 2RGAA 1YE8A 2GEDA 1TX4B 2QUZA 3ZVNA 2CL7X 1Q1EA 3W34A 1E2HA 3U61B 2NZJA 3M1IA 3TBKA 4EKDA 4Q4HA 1UKEA 3SQXA 2F9MA 1WMSA 3MD0A 1MOZA 2GK6A 2CDNA 3UMRA 1E0JA 1OB2A 2B7CA 2XTNA 3X1YA 3BERA 1Q3HA 3UWKA 5F98A 3L82B 1P5ZB 4Z51A 4OK6A 4TTRA 4PPFA 4NCNA 4KU4A 4JKYA 2DWOA 1PLJA 3BH0A 2VEDA 3ADKA 1DBSA 4DSTA 2MMGA 2YVUA 3A1VA 2VBCA 2AWNA 2QA5A 2OE2A 2Q9CA 4LOAA 3W5IA 2HT1A 5TY0A 4XH9B 2GJ8A 2A5YB 4GFDA 4HZIA 3ETLA 2NGRA 4RD1A 4DWJA 4L5BA 4PC2A 1DG1G 4AK9A 1HE1C 1XMVA 4PSAA 1QHNA 3OZXA 3EZ2A 4TSFD 3TAHA 4ZCIA 1OT3A 1WCV1 2ZRPA 1FZQA 3LQQA 4XWOA 2VSFA 2QM8A 4KBGA 4Q7MB 2K5UA 2OAQ1 4NDZA 4OHWA 3TR5A 3FHCB 2YKGA 1VECA 4QRHA 2EVWX 2YHSA 4XVRA 4HB2A 4C0AC 3K70C 1E1RD 1SVMA 1JPNA 1NJFA 1AKEA 1SVSA 3GD7A 2C9OA 1KKMA 5G53C 3RRNA 5FTJA 3AV0B 1XMIA 2QBYB 4YQFA 2YV5A 2A5FA 3QXXA 3FHTA 2CE2X 1KK3A 1WDTA 5DIFA 2H57A 3DO6A 3OIYA 1QHXA 1S1MA 2E87A 2IYYA 4B47A 4C0KA 2AKYA 2WJVA 2UVQA 3K1JA 1JXOA 4FI3C 4PPQA 4DLUA 5JWHA 2RCNA 1VG1A 2IHBA 2KJQA 3IPXA 1LVGA 4M0LA 4Q66C 2FPLA 5KTYA 2QY9A 3KXIA 2DYKA 3CKLA 2ZPTX 4QFMA 4BASA 1L4UA 2QBYA 3O47A 2ZAOA 4D0GA 3UPUA 1GM5A 3QKTA 1YR9A 1O3YA 2B21A 3AKYA 5FPKA 3MMPA 1KDRA 3ZQ6A 4F4CA 3SC3A 1OJLA 1VG0B 2PZEA 4OJKA 3SE0A 4G5QA 3NVAA 4L9WA 2VIIA 1AJEA 1PJRA 1CBUA 2I1VB 2WOJA 1YZKA 5EXXA 4L9SA 1AGRA 2JATA 2OLKA 4G1UC 4HYYA 2ZVQX 2R6AA 3BRWD 2C2HA 3NHBA 1W4AA 3U7GA 1NMZA 3V9PA 4FW9A 1NVUQ 4XTCS 1GIAA 3H86A 4B2PA 4A8JB 1KMQA 2CCJA 3RNLA 2DR3A 3VNUA 1VCMA 3NDBB 4OBEA 3I62A 5UKDA 4ITRC 3W90A 4BEJA 5TXGA 3QG1A 4NYIR 2HJGA 2PJRA 3IQWA 1E2LA 2FF7A 4KYIB 1CF4A 4IKEA 1K5DA 2CVHA 4TYYA 2ZSBA 4RY2A 1JAIA 2NOAA 4BFZA 1E2EA 4I1UA 2P0EA 4ZKDA 1E2QA 2WSMA 3MWYW 3DMNA 4GOKA 1J2JA 1E9BA 1XNJA 2O0JA 4XTRA 2A9KA 4FWTA 4QKQA 2O52A 3CIOA 4A8JA 2TMKA 5L3QA 3P27A 1U9IC 2Z83A 1UBFA 1OHHD 2RGXA 2FFAA 1M7GA 3A1WA 3QPVA 2ZYUX 2GNOA 1V43A 2BJWA 4AY2A 1Z8FA 3KJEA 3L0SA 4DCVA 2F43A 1HQYE 2VH5R 4GMDA 1ZVQA 5P21A 1NJGA 4V0NA 2ZAMA 3AP3A 3TKLA 4B3BA 1U99A 4NKRA 3K0FB 3A1TA 2OZEA 1BYIA 4A0GA 1NVVQ 1ZNZA 3VR2A 1N0UA 4Q1BA 1UAAA 3AVVA 3UATA 4QM6A 2ZI5A 5FPHA 2UZ3A 5JWOA 3PUZA 3FGNA 3IEUA 1M6NA 2PBRA 1A7JA 2E9SA 2F3RA 2VYFA 3NC1C 1N2CE 3AVTA 3CNOA 2IL1A 5B64A 2QTFA 1RYHA 1YHNA 2WIAA 2ZS7A 5CJPA 1NLZA 3B60A 1GKIA 2ERXA 4LDJA 4S2EA 2CLSA 3K0FA 1ZM3A 3GLFE 1AQYA 1OXVA 4GRAA 4AYXA 5FUVA 4V0OA 2Q9AA 4KVAA 2FDCA 3GJ7A 3C15C 3GFPA 3NH6A 3ND8A 2BKUA 2XZPA 3NHAA 4XD7A 1QHGA 3L43A 1T3SA 1FTNA 4BQSA 4IDOA 1EGAA 5EQTA 4TL9A 1UM8A 3C5HA 1H8ED 2R8RA 4TLDA 4BRUA 4PSVA 3CX8A 4EPWA 3WP1B 3IUYA 4O2RA 5JRJA 2VF8A 4ZPXA 1KK0A 1IOZA 3B13B 3GLFB 2IX3A 3O8DA 4AKGA 4MDEA 4MRNA 2NPFA 2FSIA 5C4MA 5CM9C 2FH5B 4GZLA 1MRNA 2PJZA 4R71A 1SVWA 3H1TA 1W4RA 3BFXA 2HCJB 2F6RA 1Y63A 1FP6A 2GRJA 3SHWA 4PAOA 1GKUB 1HE8B 1KO1A 6Q21A 3N5CA 1G8HA 3ZS9A 3BFKA 3WMGA 2H1LA 2NO1A 2JLWA 3MLEA 1XJCA 1VKJA 1XEWY 3EIQA 5TV2A 1JR3E 4HDCA 2PZFA 1S2MA 2J7PD 1W1WA 5JHGB 1W5TA 2FOLA 4DB2A 4FINA 2GVZC 3VQTA 5KOYA 4B6FA 3C41J 2GK7A 1KO8A 4CT5A 2HLDD 4A2WA 3AVYA 5CB6A 4MRPA 3PIRA 2W83A 5BW8A 2V7QD 2IS6A 1XU4A 2RHDA 4WVFA 3RANA 2R6DA 2REBA 1OIWA 2YC4C 2WVJA 1ZC4A 3CF6R 4V03A 3U7EB 1G19A 3AF0A 4D82A 2GF0A 1G8PA 3QKRB 3FE2A 4IOLA 1N5JA 4QC2A 3IBGA 1IXSB 4LYJA 1CLUA 5D3MB 1FTSA 2G3YA 2AKAB 2QPOA 4DXAA 1MH1A 3IHLA 5CJ2A 3RC8A 3SFVA 1W0KD 5FL7D 2D2EA 3HP1A 4EIWA 2WMOB 3BWDD 4KVGA 5KHOC 3CPEA 2O8EB 1N6KA 1OXUA 4LYFA 2VP5A 2QPAA 1KJZA 3OEHD 4AYWA 3GFOA 1E9CA 1NIPA 1NSFA 3VX4A 2HYDA 4HLUC 5JZVA 1JR3A 4M53A 5J5CA 2C95A 1Z0IA 2ZI7A 2F55A 3KJGA 5L3VA 1UBCA 1DAMA 2JIZA 3VX3A 2BC9A 5K8IA 2FV8A 1BKDR 3BK7A 5D3MA 3TUZC 3CLVA 2G6BA 2A3RA 2CE7A 2AX4A 3C8UA 1F48A 3PITA 1NY6A 2DFNA 4OHYA 3NWJA 2OO7A 2H18A 1G7TA 3OE7A 5DISB 4YONB 1XTIA 4QHTA 2CLDX 1N5LA 4B73A 2OUKA 2HEIA 1EFTA 2WICA 2GCOB 3QENA 1GFIA 3UG6A 2ZU0C 2GF9A 4DCSA 2F1RA 2IXGA 1GITA 1M8PA 2JAQA 4NZYA 4DCUA 2GCNA 2O8BA 2REOA 4TL6A 1L8QA 5DHAA 5DSZA 2VHCA 2B6HA 2RGCA 2F1JA 4HB0A 4A9AA 2A5DA 1G4UR 1NG1A 2EWVA 2W00A 3AF3A 4DEXA 3IEVA 1W7AA 3TUIC 3A4LA 2QAGB 5JJKA 2ZJYA 3ZZUA 1N0VC 3W3AA 3CO5A 2W6JA 2VPPA 1KK2A 3HU2A 2VP2A 4CEJB 5JLJA 1TQDA 3HU1A 1Z0FA 2CLCX 4QJ4A 3T35A 3OIUA 3TE6A 3T06B 1Z6YA 2O0HA 2R9VA 3TSZA 3SDZA 1G3QA 2GCOA 2BMEA 3C7KA 3N2EA 1D2MA 4F4JA 1Q20A 4V0LA 1F60A 3QY0A 1YKSA 4ESVA 3TH5A 721PA 2JDID 4A6PA 4HAYA 2QAGA 1SKQA 2VHJA 4DDVA 1TUIA 4L16A 4JLJA 1VHLA 2ZSEA 4CEJA 4QJ5A 4KCGA 2R44A 5FUXA 3TGPA 1XCPA 5K8UA 4AD8A 4OJQA 1VYVA 3QF7A 1ZRHA 3FYHA 1DVRA 2HXYA 2J87A 4UXJA 3K9NA 3NEYA 1BMFD 2QPTA 4PC1A 2XXAB 1UDWA 1KAGA 1XJ0A 4TMKA 1N6PA 2ZRDA 3CRQA 3EW9A 2FZ4A 4FWIB 4TMVA 1U0HC 2DB3A 1RRPA 2WWYA 4IDNA 2W58A 1ONBA 1U8ZA 1GDDA 3WMEA 1XEXA 3KQNA 3WBKA 4GDFA 1XF9A 3HPQA 1E96A 3BH6A 3GLHE 4M4SA 1S8FA 4KXFB 2PL3A 4DIDA 1PV4A 4FMDB 5SZKB 5AJXA 3U7FB 3W6PA 4IOKA 1J99A 1TMKA 4LPKA 3AUYA 3M0EA 4HAWA 1NN5A 3HU3A 2AR7A 4PO8A 3DDCA 1R0YA 1ZUHA 3CPJB 5SZJA 3X2SA 4Q4JB 4Q7KA 5FPTA 5EUQB 2JLRA 5IT5A 2HT6A 1IM2A 4LV8B 2A7QA 1HTWA 3F8TA 121PA 2OCPA 1N6HA 4DLSA 4DRZA 4TT3A 4F4IA 4FD2A 1IJEA 2YWFA 4BRWA 5JEDA 1CR0A 4WOPA 2WJYA 4NYJQ 4Q4AA 4ACBA 1XTSA 4L15A 3C5CA 3EZ6A 3SYLA 1G8FA 3GLIE 1U8AA 1Z3IX 2BMJA 2ZXUA 2C04A 1XTJA 2ZUBA 2J5XA 2VP6A 3QKSB 1NVVR 4D4KA 2XNSA 4Q4JA 1Q12A 3I8SA 3B1WA 4B35A 1ZNWA 2GXUA 3VMFA 1EFHA 1OLOA 3GLHA 4V02A 1EFCA 1YVDA 3QSYA 1UBGA 2PEZA 2WSSA 4DSNA 1U81A 2H7VA 2F3TA 1GWNA 1SXJD 3FKQA 1NBME 1NMYA 4HZUB 4C4PA 3GPLA 2HYIC 3GLIB 5FPYA 5IK2D 3ICEA 3CBQA 3K0CC 4D80A 3THWB 1GL7A 1DARA 1VCIA 3QKSA 5DN6A 2JJ1A 3SEAA 3I61A 2Z4RA 4E22A 2IS2A 4IVPA 3VR1A 4LV5B 5HZHA 3WBJA 3RRYA 4MUBA 2W0SA 2IS1A 3E5HA 3LA6A 3SFZA 3U4QB 4QBGB 4MGIR 5JRZA 1JQJC 4A2PA 5KSZA 3TW4A 3GJ5A 3K0AB 5JI3E 3GLIA 2EFCB 2LCFA 4JZKA 3ZS8A 2LKDA 1E9AA 1OFIA 1E6CA 2WJIA 1WBBA 1E3MA 2X2EA 5E4FA 1CRPA 4PZLA 2W6IA 2ORVA 2QNRA 2QT0A 2XNDD 1SHZA 3AH8A 3R7WB 1ANKA 1NN0A 3B78A 1RRGA 2QGZA 2QENA 2GEVA 1T3LA 5EXTA 4BLRA 1BYUA 4OI1A 4NBSA 3U4QA 4RZ3A 2ZJ8A 1OH6A 2D7CA 1VG9B 2AD5A 2WHXA 2EU8A 2C5LA 4MGYR 1N0WA 3U3MA 1NI3A 1NBMA 2GJSA 2XEXA 1XCMA 4LJ4A 4P32A 4Q5IA 4R7ZA 4HB3A 4B3XA 1EG7A 3CZQA 1Z6AA 1ZU4A 3W6OA 2FA9A 2FFHA 4Q18A 5L3RA 3ND9A 2EW1A 3EA5A 3IO3A 3R7WA 2R6GA 1NVWQ 1NN1A 4B3CA 3MJRA 1JR6A 1DELA 2OCAA 2NIPA 1LS1A 4UXIA 2UKDA 4BGDA 3K70D 2KI5A 4E07A 4KITB 2QTHA 1DAGA 1DO2A 1UEJA 2IYLD 2OAP1 5AJWA 4M9ZA 4IEEA 2Z6VA 4HATA 2FPMA 1IONA 4Q1CA 1XD2A 1S4QA 4PQRA 3KXLA 1E2GA 4YMWA 5GVRA 4HSEA 4Z8XA 1IXRC 2BOVA 2QP3A 1W47A 5HZKA 1GZSA 2D7DA 3K09A 1G7SA 5FOUA 4JLVA 5AUOB 1XPOA 1AS3A 1E1QD 2O8CB 5AUNB 5FBRB 2OFOA 2C78A 3C16C 1KO4A 2WWGA 4F38A 4BFSA 2DBYA 3P20A 2IS4A 1SVLA 3EPHA 2IUTA 3KQHA 4G3XA 4U00A 5KU1A 2ZS9A 4IHQA 5FOVA 2FX3A 1ZNYA 4GOXA 3WYFA 3OAAD 1M7HA 1KZGB 4M9QA 4JLMA 1MO3A 2XAUA 4DB4A 3ZD7A 4EPXA 4LHZA 3PCRB 2OCBA 2QL6A 4TSFA 1O87A 3GEEA 2NO7A 4L8GA 4NONA 2QSYA 4DLRA 3CB4A 2O8CA 5CDFA 4Q7LA 4RJLA 4F91B 5JJLA 4JLDA 4D6PA 3J81k 1XMJA 1G8GA 4TMXA 2WWWA 2ODWA 5ANRB 3HJNA 1HYQA 1KYIA 2ZQ5A 1OE0A 2J7KA 4JKIA 1E1RA 5HR5A 3IO5A 1FQJA 1DEKA 1GL9B 2J59A 3U60B 2BM1A 3NH9A 4JL8A 4TMZA 2PX3A 3QXJA 4HUQB 1ZCAA 2Q3FA 2ZI9A 4NCHA 2DWQA 1FL9A 221PA 1HY3A 3D6TB 1KSFX 5F3WB 4N3NA 3I5YA 2V1XA 4B34A 2B7BA 1S3SA 3G5UA 1EWRA 2EYUA 3MWLA 1KOFA 5H68A 4O25A 4WIAA 4EPRA 1AK2A 2PCLA 1T8TA 1G3UA 4A0HA 5KNBA 3LBHA 3DEFA 2WWXA 3GJ6A 4WZBE 4DIEA 2C77A 4TYQA 5DH9A 2C8VA 4DVGA 4EJSA 1GKYA 1OXTA 3BD9A 3KUCA 4G5GA 3REFA 4P4SB 1T4GA 1G16A 5EZ5A 4ZIRA 3EARA 2OXCA 3EC2A 3Q7QA 3L0OA 2OHFA 4TLBA 3RABA 4I1VA 3TW8B 1TU4A 1MO5A 2ZRLA 3EIHA 4D81A 1DS6A 1PZNA 2VTKA 1WXQA 5EXPA 2HDNB 1G7RA 3BB3A 5GADl 3QQ5A 2QRZA 2NPIA 3EPJA 5DI3A 1YJ5A 4YMSA 4P4SA 2RGGA 3RWMB 1OW3B 2HXSA 2JLZA 1TF5A 2ZS8A 3NTUA 3DVLA 4JBYA 1UDXA 4UJ5A 2IC5A 2ZSFA 3JVVA 4PTLA 4QNMA 4JBWA 3M4YA 2CCKA 1XPRA 1W48A 1Q1BA 1NLYA 2WJGA 4JT2A 5EE3A 1D8TA 4Y0VA 2DPXA 3EWAA 4NP6A 1GNPA 4DT1B 1CKEA 1IN7A 5IHPA 2XTZA 4RD3A 3QOFA 1G8YA 1TEXA 4M1MA 1C4OA 1XD8A 1GNQA 2ZE5A 4URWR 2BCGY 1J70A 1KDTA 1E0KA 1OHHA 2JJ2D 3GEHA 2C9YA 4FXPA 5IDVA 1KZ7B 3CUEF 5L8VA 4LGMA 1EFRD 4DCTA 4L4UA 1AS2A 2Q21A 2ZIAA 5H70A 4NTZA 1HH4A 2BM0A 4RZ2A 3W5JA 2KBFA 2J0QA 4KHZA 1WF3A 5DE3A 2PH1A 1MT0A 2HF8A 5FUYA 2V8OA 4RFVA 4DT1A 3SBDA 2KBEA 3IKJA 4B3FX 4TMWA 3AEZA 3LO5A 1JBKA 5EZ6B 2OXRA 4MQBA 1E98A 4XJXA 1JNYA 5KDDA 2Y8EA 1OKKD 3OFND 3CR7A 4B2IA 1J8MF 1DAFA 3P4YA 2BVNA 4OI2A 4LHVA 4P4TA 3RS5A 1RPZA 4OI0A 1JAHA 2ZM5A 2ERYA 3PUVA 1W36B 1Z6GA 3WRYC 1OFTA 1DOAA 2OFXA 4Q19A 1FW6A 1QG2A 2ONJA 2ODEA 2QQEA 2PMDA 1E2IA 3VFDA 2GZDA 4GT1A 2R6CA 1IY1A 2RGNC 2ZYWX 1N6RA 3L0PA 5HE8A 2PT7A 3CWQA 2XSZD 1OXSC 3AB3A 3LLMA 5FR1A 1AS0A 2CL0X 3LFUA 3WP0A 1NKTA 4PHTA 3PVSA 4B48A 1EWQA 2QQ0A 1YR6A 1Z6TA 3KJIA 2QMOA 1GOTA 1XCGB 4HDOB 1KI4A 5AUQA 1H8EA 1B23P 1OFUX 1MABB 1U0JA 1II9A 3ADDA 2Z5FA 1Z0DA 3FFBA 1Z5ZA 1CEEA 2JA1A 3E2IA 3QVVA 1ZM4A 5AJZA 2EYQA 4TQ9A 4OHZA 1E79D 3D3QA 1KJYA 1PUJA 1P2VA 1UKZA 1CULC 3I32A 5L3QB 3FMOB 5LDDC 3TK1A 1IN6A 3KB1A 3ZVRA 4U7DA 5AUPB 1TQ4A 4B71A 4URVR 5KYKA 2X77A 3I8XA 4LZZA 5CM8B 4DC9A 2GDJA 4MYCA 4A1FA 2F43B 1FUUA 3PV0A 1Q0UA 4BZPA 1MRSA 1MABA 1KGDA 2MSEB 4MYTA 4A36A 3ADCA 3U44A 1HA3A 3EA0A 5G40A 4A15A 4Q9HA 3LWNA 4POAA 2P65A 3NC0C 2J7PA 2J1LA 1F5NA 2LWIA 1LFDB 3V4FA 1ZNXA 4PPNA 5FBVB 2C99A 1JJVA 1LF5A 2RGBA 1AKYA 1JEEA 2HLDA 1IBRA 3UG7A 2H92A 2JLUA 2IYRA 2ZEJA 1WE2A 3FKSD 4TTPA 2Z0MA 2V7QA 4LC0A 3CX6A 3OEEA 1PLLA 1VIAA 1GRQA 4AG5A 2H17A 1UKYA 1W4BA 3GFTA 4W9MC 2P6NA 3KQUA 1M74A 5KDLA 2D4HA 3ZGXA 4QGFA 5IRCD 5DLQC 1DTSA 2V55B 4D4MA 2R2AA 4PZYA 3GLGE 2N1BA 2IXEA 4ARZA 3PXGA 1SVIA 1W0KA 1ZC3A 4MGKR 5FL7A 1H8HD 2ZI4A 1VHTA 1R5BA 5CITA 1UF9A 2ZJ5A 3OEHA 3L8ZA 2OCYC 1TADA 3U2QA 2GBLC 2IT1A 1L4YA 3D7MA 1E9FA 2NMVA 2VA8A 5DI9A 4BZXA 1MV5A 2XJ4A 4NU0A 1XP8A 2FGKA 1QHYA 1EXMA 2NO6A 2VSXA 2UZIR 3QUSA 3GLGB 2XZOA 4Q1DA 3AVPA 1R2QA 1D5CA 3SJZA 1JQLB 1AZSC 1EFUA 2JGNA 3VKHA 1U94A 1R7RA 3P32A 4PQFA 4KFSA 3TNFA 1N6NA 1TU3A 5AWFC 5FBQB 4UNNA 1E0AA 4RZUA 2MSDB 3HDTA 2N42A 4TWZA 4ABYA 2LKCA 1XTRA 1K8RA 5DNYB 1NG9A 4TYNA 3WYAA 1COWA 2WKQA 3CR8A 2AWOA 3GLGA 5BYJA 4B3DA 5L3SA 5M04A 4KYUA 3U6KA 1XZPA 3GQBA 1AA9A 1CIPA 1KSJA 4R9UC 1JJ7A 5F2EA 1A1VA 3FHOA 1JALA 4D0LB 2OBMA 1Z22A 2G1KA 4PQYA 3R9XA 5LBIA 3VR5A 4MYHA 3RS7A 2ATXA 5JS8A 1G5TA 4URYR 3B1YA 2OBLA 4QHSA 2JDIA 2IWRA 2YWEA 2CHVA 1W49A 5KUTA 5B58C 2XOKD 1Q21A 4JLNA 1B0UA 4JL6A 2EFHB 1XFAA 4HLQB 3WYGA 1P9RA 1MR3F 2A30A 5KNCA 2P3SA 3EAQA 1PUIA 5CK4A 1RE0A 3EPLA 1QVRA 3WHLA 4NMMA 1BMFA 1TL7C 2IEZA 2GXSA 3R20A 1YZLA 4BFYA 5ELXA 2YYZA 4V0KA 4MYUA 1T3HA 2GXAA 4JYBA 1DPFA 1SKYE 1OV4A 2P6UA 4LY6A 1EESA 2CHQA 3BGWA 1IN4A 3PEYA 3P4XA 1FQKA 1TPZA 5SZHB 3VAAA 4AG6A 4YMTA 3BH7A 2NTYC 3QF4A 1E2NA 1E2MA 1A4RA 1V5WA 4FMCB 2GTPA 1DADA 1E9EA 3CONA 2GETA 5JWRA 1CJVC 1SXJE 3IQXA 4XVUA 2VHTA 4PXAA 1ETUA 2ZRBA 4M1TA 4RVCA 2O8BB 4TTQA 3T34A 4YMVA 1AN0A 5B2ZA 3S1AB 5E3HA 2O8FA 3LH5A 3KQKA 5TDHA 1X8LA 4G5SA 1SKYB 2F1IA 5IF9A 1DG3A 3Q7PA 2GA8A 4JLAA 4ESHA 4EFNA 1CJTC 1VIYA 3SYKA 4C0BA 5C1BA 2ONKA 4I81A 4W5JA 1T6NA 3Q9LA 4DLVA 4BFXA 4D2IA 1OIVA 3BORA 4Z1MD 1OH8A 4KAXA 3WHKA 1KDOA 4WAUA 2V4ZA 4Q03A 2BBWA 3KFXA 2EFDB 3OF5A 4ILEA 2YOFA 2ZANA 1OYYA 3MSXA 4OI4A 2WAYA 3S1AA 2PZGA 4LJ8A 3SBEA 1U90A 3I72A 1KMHB 5C2JB 2QE7D 1ZD1A 3B85A 1UBEA 4Q02A 2GZAA 1SULA 4DUGA 3GJ4A 4BLQA 4UNSA 4LV6A 3T1QA 5CB8A 2QP4A 4MDFA 3H2YA 3RVBA 4DBLC 2FSGA 4ZCMA 1VYTA 3G0HA 2O0KA 1SXJA 2P5SA 3GMTA 2MMCA 4ZDKA 4IDHA 2VO1A 1ZM9A 2YC2C 3ZIAA 5IK2A 1I2MA 3K9HA 3REGA 1TAGA 1W0JD 2FE4A 1XB2A 5HCIA 3B2EA 3EIEA 1XBTA 2CMKA 4I1SA 1KMHA 5A5GA 4DHEA 1XEXB 1CR4A 2FSHA 4PX9A 4ZI3A 5JS7A 2JJ8A 5GVSA 3GJ0A 5JSZB 4US1R 3E1SA 2C96A 2GJ9A 4GZMA 4OKSA 4JJZA 4JVNA 2ODBA 2OM2A 2QMUA 3TUJC 3CRVA 4W5HA 4AURA 1W2HA 5B57C 4KI0A 4QHYA 4JVSB 1KSGA 4WXRA 4YMUA 4MA4A 2CNWD 4C0JA 1R8SA 1EX7A 2AN9A 2PEYA 4EAQA 3RDPA 1RRCA 1W2GA 5J4VA 4QBHA 1ZAKA 4KSCA 2R62A 2G0NA 2XNDA 3X1XA 3VKGA 1BIFA 5JSZA 1A2BA 5LB2A 1Z0AA 1QHHB 1XXHE 2BEJA 1DAHA 1KAOA 1TF2A 2OT3B 1XD9A 4LBYA 3WNCA 5BXQC 2G88A 1C9KA 3AP2A 4H1VA 4OQNA 4FCWA 1R0ZA 1TQ2A 4PHGA 4Q4AB 4NYMQ 4C2UA 4LJ5A 1F6BA 3VNVA 1RRFA 1YZUA 3FTQA 2OESA 3DMDA 2DFKB 4M21A 3WXMA 4M9XA 3R8FA 1W36C 5FFMA 1LB1B 4O2LA 1N6IA 3C4JA 1RYFA 4P4UA 3AF1A 3ZVLA 4ZDIA 4CEHB 3THXB 2G1JA 1SZPA 2J0SA 3VHXA 3FDIA 4Q47A 1QHHA 3GLHB 1E0SA 4U02A 4DCNA 4C0LA 2ZJOA 4RFSA 2CEAA 4BPBA 4JLPA 3JVUA 1D6JA 4LI0A 2WV9A 1NF3A 3DPUA 5DGXA 5FR2A 2ZRHA 3N70A 2GWHA 2D06A 2GILA 4Q9LA 2W0MA 3EG5A 1JR3D 1N6LA 4BEBA 1WB9A 2JASA 4GPTA 4AI6A 3ZLJA 2NQ2C 2WPDD 5K8TA 4LRWA 4CEHA 5J4YA 2RHMA 4OQXA 4E03A 3RAPR 3THXA 3H84A 1MKYA 1XXHA 1E69A 2ZETA 2I1QA 4A2QA 4Q1FA 4IDPA 1R6BX 4RZXA 1E1QA 4A8JC 2SHKA 1P2UA 4TQAA 3KKOA 5EP4A 3BE4A 4LJYA 4Q1EA 1XZQA 1ZUIA 3RS2A 3PEVA 2IYUA 4KBFA 3C14C 1TQ6A 1ZD8A 3RHFA 1QF9A 3OIVA 1Z29A 4LJAA 2RGDA 2QP9X 1R0XA 2IUSA 4MRVA 1P7CA 4XSHA 4JSYA 4BFTA 1N5KA 3BFVA 1FMLA 5TARA 2GKSA 5EP2A 1VG8A 1IY2A 1D2NA 2E1RA 1HEIA 5DYIA 4S35A 3LX8A 4IVRA 1YRBA 1G6OA 2AXNA 1Q1ZA 3SJCA 3VR3A 1JI0A 1Q1QA 1SQ5A 1YQTA 4D26A 2BV3A 3QI2A 4G5RA 4JT4A 3AF2A 4IXNA 1KY3A 2VRWA 2ZRNA 3M6AA 4IVQA 4LBVA 1E2FA 1LF0A 4R2HA 1AIPA 3CWZA 2GJAA 2H5EA 5TVKA 5CLQA 5BYKA 5FI0B 2FN4A 3FFAA 1GILA 1I4TD 3VHLB 4O3MA 3DHWC 2AK2A 2VSOA 621PA 4Q9KA 3W8NA 1J7KA 4UXHA 1KJWA 2RGEA 5DO9A 5LB4A 1US8A 3VU9B 2GAAA 1IY0A 3AQ4A 3CRW1 1XD2B 4BLOA 4OHXA 2ZE6A 4UNRA 2PLRA 1KI1A 5K8LA 2QU8A 2W2TA 1RIFA 1U9IA 2ZRCA 4PC7A 1I4LD 4QBFA 5EXSA 5EE5B 4XIGS 2OG2A 1E9RA 1S9DA 2QSZA 4KSBA 2FWRA 3NXSA 3U3OA 5JI2E 4HAXA 3U3JA 4X8OA 4GI7A 5CDFE 2AFIE 4WA7A 1FMJA 2HCBA 5FTNA 5FTKA 1P9WA 1XJQA 2V9PA 3GCGA 3KTAA 2XX3A 3KXKA 2OV2A 3VU9A 5JCZA 1A5TA 3Q3JB 2NZ8A 4JLOA 5J4LA 1QDEA 3GJXC 4N0DA 4QGHA 4QGGA 2BDTA 4DDTA 1F3OA 1JB1A 1G9XA 4NCKA 4OQLA 4RKEA 3A58B 2Q3HA 1A82A 4B76A 1WQ1R 1ZU5A 4UNQA 3EZ9A 3UIEA 3D31A 1W4CA 3TSWA 4TYWA 4NHOA 2DCUA 1VTKA 521PA 1DAEA 4EUNA 1U8YA 1J90A 4CW7A 2QMEA 2H16A 4A6XA 1P9NA 1G1MA 1KIMA 1ZIPA 2I3BA 1FNNA 2X1VA 4URZR 2JLYA 1ZCBA 1HURA 2ZROA 3DZ8A 4TN1A 5KDOA 4CF7A 1QRAA 2CXXA 3CNNA 4FMBB 3T5GA 4EPTA 3HPRA 4TZ0A 1R8QA 1LY1A 4JL5A 1U98A 3MGCA 3QXCA 4EQ6B 4X8HA 2CVFA 3IBYA 4FMDF 2X2FA 1P6XA 3WNBA 3SR0A 3MG9A 3PEUA 4LJ9A 2J0VA 1EFRA 1ZM7A 4KLNA 1AZTA 1GRRA 4PANA 4N1AA 3DZDA 2GVDC 5JFGA 2ZRJA 3QEOA 5C18A 4RKFA 5LPNA 1DO0A 1VYUA 3LRPA 4PAQA 4EJSB 2WKPA 1WRBA 1I2DA 2J0UA 3LVQE 3FMIA 3KFVA 3AVQA 1LW7A 4H1UA 2PX0A 2FNAA 5HKKD 1OKKA 2WIBA 3OFNA 4ZIRB 4HLCA 4EQ6A 2CHGA 3LXXA 3NBYC 3NBXX 2ZR7A 3QNUA 2Q3MA 2QORA 4CGZA 3PR1A 1T0HB 1ZIOA 4GMXA 1FPMA 1KSHA 2CK3D 4MH0R 3FOZA 3PUYA 4I99A 4NPHA 1E9SA 1VPLA 2ZI6A 2J9RA 3DM9B 5JCPA 1GUAA 2Z43A 3QE0A 4MKGA 5HTKA 4DZZA 5BQ5A 421PA 4YXWD 3QG5A 3CM0A 3MWKA 5DI3B 4BLTA 4CIDA 4EFMA 1KO5A 1NLFA 4QXAA 4GSYA 1II0A 3BB4A 2XSZA 1XTQA 2EFEB 1KI8A 2V6JA 1G17A 1QHSA 2YOHA 4TL7A 4EDHA 1NL3A 2B8TA 5HE9A 4M22A 1PLKA 1NRJB 5KPJA 3H0KA 3LD9A 4C3ZA 3SN6A 2IUUA 1R10A 2X19A 2IW3A 1S0UA 2BWJA 1RW4A 3TIFA 2XITA 5AJVB 4AKHA 1NIJA 4AKEA 4K46A 1P60A 1Z47A 1G5PA 1E79A 2ECKA 2GJKA 2XB4A 1I4DD 3THOA 4ASUD 1P2TA 2IYXA 2QAGC 4OQFA 4PC3A 2ZRKA 4YC7A 2KWIA 1HQCA 2V3CC 4NYMR 1N3BA 1Y3AA 3MCAA 2J41A 4UJ3A 4HLUA 3O8RA 5BN3A 2ZI3A 1XEWX 5CYPA 5E7JA 1UADA 3WMFA 4Z54A 4M1YA 4C30A 5BWMA 4DSUA 2NG1A 1CRQA 1G291 1R5NA 1IJFA 4ZKEA 4C0SA 5CLLA 5JECA 2XZLA 1G5RA 4I4LA 1JPJA 3MRSA 4YDHB 4TLCA 4IXMA 4NYJR 3B9PA 1GTVA 1HT2E 4OK5A 4TQUS 1FOEB 4HDQB 4W7SA 4Q9JA 3RRMA 3RSOA 5FH9A 1P61B 2WWHA 4HI0E 4JVMA 3A37A 1CP2A 4F93B 4CT4B 3TR0A 3AKCA 3FKSA 3B7GA 2VF7A 4C0HA 1TF7A 1FUKA 3BS4A 2J46A 4LYHA 3I3SR 3CNLA 2QROA 2VLIA 1LV7A 3NIBA 3LW8A 3Q8XB 4D4LA 3U7HB 4A82A 2C03A 4ZI2A 3EWSA 4ON9A 5J4HA 3B1ZA 4AC9A 2P5TB 1BH2A 3AKDA 4QL3A 3RC3A 4PC6A 1TNDA 2ZJAA 4C9BA 4NH0A 2OLJA 5DYGA 1XEFA 4CZ2A 1LS6A 1H8HA 1KDPA 4JYCA 4B33A 4FCVA 4Q21A 2C98A 1TUEA 2P6RA 3DOFA 4BECA 1OPXA 1SVKA 1E2JA 5FPSA 3CRMA 3RS3A 4OYHA 4LJ6A 3JZMA 2X8AA 2CBZA 4B44A 2BKEA 3T1TA 3SOPA 3B9QA 1E2DA 1DAKA 2CL6X 3PEWA 1KHTA 4OHVA 1ODFA 1T9HA 5EJEA 1II8B 2FFQA 4LX0A 4CRWB 2JLSA 3QBTA 2ZJBA 1N6OA 3I5XA 4PSKA 3ZQJA 1K6MA 1UPTA 4ZDWA 3JZAA 3ZJYA 4JLKA 1KTVA 4Q48A 3IIJA 3U44B 3G82C 1OH7A 4JSTA 5E7MA 3K53A 2FEOA 4W5WA 2F9LA 2GHIA 3EC1A 3UMSA 1IHUA 2B92A 3MWJA 5B30A
chains in the Genus database with same CATH superfamily
2GEJA 3MMZA 4G41A 3NONA 4DSZA 4OXXA 4CEIB 4KPUB 1NQVA 4PY2A 4EA9A 3N6RA 4XB6B 1DDGA 3LW7A 4P33A 4LGYA 1WQ3A 4R16A 4ERXA 2KE5A 3B1VA 1MVOA 4H77A 4WDQA 2AT1A 3RTEA 4MS3B 2V6GA 1YA4A 4FLEA 1Z56C 2G04A 3TPFA 4L0CA 5ECWA 2ZREA 2ZE8A 2TYSB 1V6CA 2PGDA 2QYTA 1SBIA 2NXEA 2EIHA 2ZITA 4G26A 4QG7A 3ICPA 5AK0A 2R60A 3K6RA 4P4LA 4X1KB 1U2TA 1Z06A 3ECCA 3MERA 4BP1A 3LGSA 2O3SA 5FBLB 5CFPA 1HYBA 2IUFA 4CEIA 4KPUA 2GARA 2Z3ZA 1GVHA 1XZJA 3EFOB 3P94A 5AM0A 5HW0A 3F46A 3KM0A 3VZQA 4HFNA 5CW1A 2WF7A 3NJ4A 4MGZR 4WESB 5BOVA 1OA1A 5DBFA 4R83A 1I5EA 1VJGA 5IJ0A 3ZVMA 3HBMA 3B36A 5LZ7A 1XZIA 2BF4A 2QL9A 4C6HA 1DKOA 3BAFA 1FRQA 1KMIY 1T9DA 3UHAA 3PA8A 3EULA 1EEXB 3LWDA 4AJNA 2BMDA 4R0NA 5SY9A 3GG2A 4A0RA 4X1KA 1JDNA 5JU6A 1D2HA 4B8WA 4AJLA 1YKGA 5HQ3B 4FFRA 2HMAA 4GOMD 4OEHA 5FOXA 5F2OA 3WWEA 5C1PA 1XZDA 1E1MA 2AFRA 3EFOA 3ER6A 3PUXA 4N0QA 4PO9A 4BPRA 2WFAA 3O82A 3OLYA 1E7MA 4MUMA 4HWKA 4WESA 1WA5A 2OYRA 4Z4CA 4LTDA 3UO8B 3P1JA 2B1IA 5TPZA 1KI9A 3BE8A 5K0BA 3FBWA 4YN3A 3RAGA 2DLNA 4EMBA 4AIIA 1CJKC 1YF3A 3I4LA 1NYRA 3BMOB 3LCMA 1E3SA 5CA0A 2AOUB 4I36A 1EHIA 3UCXA 3AVWA 1RHUA 1ARZA 4Z2YA 4EYOA 4EAAA 5D84A 3K09C 3ZOZA 2G36A 2VPYA 2ZSHA 2QDKA 1F2UB 3DR3A 3X1JA 1NHGA 3A6GA 4NIMA 4LXQA 1RM5A 4QPPA 1U6IA 3QPUA 2ZG6A 2FK7A 3PF9A 2JI9A 3RJZA 1RP7A 1K06A 3CF0A 4YV0A 5KQSA 1I3KA 3ICQB 3HABA 1BU5A 1F1BA 3WQRA 1BA3A 1ZN8A 2ZYTX 4RJIA 5HPYB 4NAHA 1S8OA 4UCWA 3AR8A 1RYMA 4FYIA 4US0R 3SYMA 2REQB 5A3QA 3VNRA 2R65A 4OSEA 2QE7A 3FHJA 4IDQA 5EEHA 5MN5A 3BMOA 2VWGA 2R8XA 3IE2A 2VUTA 4K2HA 2AOUA 4MINA 5JO0A 1N32B 1Z2AA 3F2VA 3Q72A 4WNCA 4QEKA 4J43A 4IFIA 3BTSA 1WAMA 4GP9A 4EJ0A 5LYJB 3B82A 3LXRA 1YJBA 1F2UA 1MB0A 2AC2A 4RA9A 4WECA 4CQJA 3NG1A 3HHEA 1YQQA 2X3UA 3QVOA 3B6MA 2HJSA 2QX6A 2GM9A 3PHCA 3KEQA 3L9XA 4YUZA 4PYIA 2X0KA 1W8IA 2EL7A 5CLGA 2BSAA 1VKZA 3K4HA 2YOGA 4NOKA 4BZQA 1LK7A 3A9UA 3IURA 4I8XA 2XTMA 2O1EA 4OO3A 4WXPA 5CB0A 4AF8A 1RZ3A 2Y1XA 2WJ6A 5AJYA 1LPBB 4URUR 3IIMA 1UZLA 2C4HA 2REQA 4DDWA 5KVCA 4N5NA 1NOKA 3EUFA 3W4IA 4D3DA 1IN5A 4EGSA 1RYZA 1O0SA 1F4VA 1P77A 3F6BX 4K0RA 3OE1A 2DFTA 1L5LA 3LM8A 1ZOPA 4ZGBA 1WG8A 2V4UA 4MRRA 4M1WA 4QUDA 4UUNA 3I73A 2VNIA 4RADA 4NL4H 1WXIA 1EXWA 4XIJA 4GL2A 4H1HA 3COPA 4P86A 3WQSB 4DAOA 3HHPA 3I9FA 4CF5A 4LC9A 3UT5B 3ZWKA 4CXMA 3WQHA 3TVDA 4Z6KA 1YONA 1WUKS 2B3DA 2Q2NA 3DZGA 4AP5A 1LVHA 2XKAA 2O8FB 2OXEA 5HOQA 1D6SA 3W4JA 1WUHS 1YR8A 2N46A 4R2MA 2CBXA 1V8FA 3WIUA 4M1OA 5J5AA 4QXRA 1M0EA 5DF1A 3OO0A 3C0KA 2EFJA 3E9DA 4QQKA 4RX1A 4AY6A 4AJ4A 4FDTA 3SU8A 1S3IA 1XWIA 1V0JA 1QRDA 4PR0A 2WTUA 3GFBA 4XJTA 1MLDA 3DZCA 4R6XA 1Z5VA 3OEED 4QPCA 1FFWA 3F47A 3ZZTA 3HXKA 3N6XA 2AR0A 4XUDA 1FLVA 3TRJA 1ZJ6A 1BXKA 1HRKA 2I2FA 5CPBA 5AKJA 3SDSA 3UT5A 4BX3A 2WWTA 4FYJA 4Y98A 1B0PA 3K0BA 2F62A 1W5SA 5I7RA 4BO3A 1RWOA 4E6EA 5CGZA 1KFCB 2W4QA 3KQWA 4LDNA 4DEYA 3C2QA 5KX5F 1ODLA 4DPKA 1J8YF 2F8TA 2O7NA 3K2BA 1OX4B 1UMBA 4HTFB 4A6EA 2AOTB 3O9ZA 1MHPA 1PJ4A 2E18A 4IS2A 2FMUA 2V54A 4HDKA 4X1IB 6CHYA 1L1FA 1H94A 1YS1X 3FVQA 3OZEA 2G77B 4AN1A 1KI3A 2VHUA 1JJAA 3V1TC 5JT1A 3OZFA 2B1RA 1G64A 4I9FA 1FYVA 4BKOA 3R7NA 3H7AA 5K4GA 3AVUA 3LHDA 3UOAB 3KKPA 4HGZA 4BJ3A 1ZD3A 2RKWA 2ONZA 3C6KA 3CXRA 5I4CA 4E5NA 3QKRA 2R11A 3QW4B 4KGDA 3IEPA 3K96A 1OX4A 3SZRA 2XHEA 4HTFA 3TZBA 3F73A 4ATNA 5FA8A 4BLPA 3VR6A 4HUTA 3FI9A 5E6RA 1JEDA 1R0SA 1C7JA 1T9BA 2IXBA 4Q05A 4WX2B 2VAMA 3SLKA 4MWEA 3EEYA 4TTJA 3A1CA 3V7NA 3VDXA 4F8JA 1YMUA 1V9LA 4ID9A 3VDMA 5BUQA 2G80A 3QBVA 3R3YA 5CVUA 2JEOA 3MUFA 1T6XA 1SY7A 1USVA 3FRJA 3GDGA 3WFZA 1ZGBA 2AL7A 3SX4A 3SJUA 3O21A 4DV3B 2VTVA 4MQLA 1X3SA 3ZDQA 3V7WA 3FTFA 4OY3A 2A5JA 3W8RA 4D3ZA 2ZE7A 4JVLA 3ZYCA 1ADJA 1TEZA 4NU5A 2PYZA 3AR9A 3CA8A 2HU5A 1GP2A 5ESWA 2UYGA 4KR7A 3FSJX 4JI8B 1LXCA 1EU1A 5FL3A 2IA5A 2W5UA 2DUMA 3KCQA 2WQ7A 1YBHA 3B8HA 1MAHA 2YRXA 5CG2A 1U7UA 1ZSYA 4QXOA 2P2LA 3AF4A 4UKDA 4ZANA 3CLUC 3GK3A 2VNAA 4E94A 1FTGA 4BNKA 4RPLA 4UMFA 1V5GA 2A0KA 4MROA 4QQNA 4UW9A 4G84A 3U16A 4TM8A 3H4IA 3RK4A 3UC9A 4OA5A 1KC1A 4O1MA 1HNNA 4BLVA 4D4JA 1TCBA 2LRHA 4HX9A 4NRDA 1ECFA 3VKFA 3KLBA 5FORA 3WKCA 3BWEA 3CG0A 3C43A 3NIFB 4G37A 3U9LA 5LMZA 2QB5A 2BJVA 3HCNA 5A3RA 2W4MA 4LMAA 1WZIA 3HKDB 4HT3B 2ZBFA 3GUUA 3NDRA 1GG5A 4RJ2A 2QAJA 3VHXB 3M4NA 2HIMA 5A1TA 1KS9A 3MWDB 3FW1A 1P73A 3RLFA 1ZWKA 2OSBA 4CF6A 4KWIA 4B2LA 1S01A 3OBBA 4ZQEA 4JN6B 5I4BA 3MQFA 4ALMA 1N0IA 4LWQA 4EG1A 3QWAA 5CIQA 5TGTA 2FU5C 3GGOA 4BQEA 1O2DA 1XI2A 3KLOA 1W6RA 4M49A 1O95A 1CY7A 2RAPA 4TMFA 5BYBA 5GOZA 3WI7A 2CWWA 7REQA 4BOYA 5H8WA 2EX1A 1I3MA 2JK0A 4GX2A 3RVPA 3DOUA 4G24A 3HKDA 4V0ME 3V8QA 4MWTA 1XXHB 3JQGB 5E8JA 3WYDA 1YE5A 1Q6ZA 1K6IA 3PB3A 1ULUA 3OH8A 4QU0A 3ZI4A 1H9AA 1QYXA 2OBBA 3GVIA 1PK8A 4U2GA 3WV4A 4C0QC 1T43A 4F6CA 4EABA 3CEAA 4B43A 5HOEA 1U1IA 3ESRA 3JX9A 5LYJF 2XXAA 5CX1B 1T35A 3WGJA 2R6ZA 4X3CA 1Y6FA 4NVRA 4ZHQF 4DR1B 2BR3A 1RAGA 4K2AA 1PKXA 5KEIA 4L51A 4EW3A 1PQYA 3P9IA 2QNBA 3TE7A 1HUQA 3T5DA 3JALA 4QSHA 3JWJA 3V1NA 5H83A 5LDGA 4BCBA 2A0WA 4PS0A 1XCLA 1T91A 3IAHA 1JWAB 2ZYVX 4DNFA 2O8DB 3FSGD 1G3RA 3CLSC 3WDSA 1OXMA 2HF9A 3K05A 4B3RB 1HOXA 2BHTA 2H9AA 3A36A 3FD8A 4B0OA 2ZJZA 1TD1A 3QLVC 4BLWA 1NURA 2AEJA 1JFFB 2FWMX 2C1ZA 2RGUA 3N2ZB 5CX1A 4IMPA 1GRVA 3DL0A 2GHTA 5KSOA 3KKKA 1TW3A 1EP3B 1SQFA 1ZMXA 2FP4B 3GFVA 3KE8A 4MPDA 4NMHA 4XWAA 3ZD9A 1PZMA 2NP7A 4PYKA 1QZXA 1U2RA 2ZBGA 2VYVA 4Q9IA 2VT7A 3KZ1E 3RVDA 1TZBA 1A1SA 2FFBA 2I3AA 2E4XA 4OHUA 3OAAA 1RP1A 4KE6A 4OQMA 5SZIA 1QAOA 3GCXA 2O8DA 1T2AA 1ZINA 1CNEA 1KR2A 1MOQA 2D3WA 5CLJA 2ANCA 1ID8A 1M34E 2BMFA 3K8YA 3IJRA 4LVUA 1OSNA 3JARB 4R3UC 1JFFA 2H2DA 3ZH9B 1SUBA 3F0TA 3DFFA 3IVXA 3NGLA 3T94A 1US8B 1UMCB 2GCGA 2Y9MB 3BBPA 3K9QO 1PS9A 3ZIAD 4HNAA 1CXZA 2VJCA 3VRHA 4XCVA 5C7YA 2I4NA 1ESNA 2D0IA 2GCPA 3K1YA 4FHGA 3I76A 4F92B 2ASEA 1SCBA 2ODQA 4R3WA 5FF9A 2SNIE 3DEKA 2QGNA 1Y1RA 4XFDA 1RC8A 3GT4A 2XB8A 4KMRA 2FG6C 4H4DA 4P22A 4BTEA 1JQ5A 1X87A 1E4VA 1VGRA 2AD1A 3MEQA 5G3ZA 3T9FA 1HT0A 1NX6A 4IFEA 4PCLA 3IJPA 4B74A 2NP6A 2O8NA 3KKQA 1AHHA 2IF2A 3FNFA 5HKKA 2XUFA 1YR7A 5LD2C 1Q44A 4X6LA 4FGLA 3JARA 3S2ZA 4J4BA 4A5OA 3KTAB 1E2KA 2BBSA 1SHLA 5K2MA 3EF1A 2AEEA 3GO4A 4NNOA 3MINB 1X19A 2Z30A 4QPZA 4BUJA 4GNKA 1LLFA 3KKNA 1AKVA 3KZVA 5ENDA 4AVYA 1E92A 3UCEA 4LJ7A 4YXWA 2PU5A 3QKUA 1X74A 3K6KA 4M37A 1XU9A 3A4NA 4RKQA 4F2DA 2YMMA 2VWQA 5KYGA 2YVAA 4H6XA 5FWXA 4LZLA 1WXWA 4WEQA 4N0EA 4KK4A 4NCJA 4RIHA 1Z35A 2Y92A 4PQEA 4ZZ0A 4R0VA 2BUAA 2J9ZB 4N3GA 1WCIA 3PKIA 3K0AA 2BHRA 1DCFA 1MQ9A 2RGRA 5KREA 5AKIA 4JMPA 2QZ4A 3RRFA 1M7BA 3MINA 2J3KA 2JCYA 3BTVA 4IGIA 4GPEA 3KALA 2C88A 1ZD4A 1SZCA 5JEEA 1Q7EA 2QRLA 2BRUA 1KA9H 3HDGA 3P9KA 4ZP1A 5GTDA 1ELOA 4BAGA 4RDCA 5E95A 1YD7A 3G2LA 1OA0A 2VF4X 2HHAA 3G17A 2JEZA 1XDWA 3DONA 4XDHA 5ITSA 4L6AA 2PR7A 1QHIA 3M5DA 1CYEA 3KUUA 3T7RA 2WMNB 3CG4A 3ZX4A 4EZEA 4U5QA 2NO0A 2PMWB 2XBUA 2I7XA 1JMYA 1QGAA 2GBLA 2VAXA 1AXEA 3MB5A 2A1UB 3OCYA 3WB1A 1L1RA 3BPSA 1IZ9A 2HK9A 2O54A 2FHSA 4QAJA 3OKAA 2D62A 2VZ8A 3L7CA 5EHIA 2QIPA 3VZPA 4BFVA 1G3IA 3PG5A 4FFDA 3ZJTA 1LDNA 1RKQA 2A0YA 5IWCA 4URHA 1XZKA 2J0UB 2PANA 3K5HA 4HPJB 4LRUA 4OMFG 4JODA 2ZYDA 4PPGA 2QY6A 4LCBA 1TTHA 2YINC 4H3HB 2WZBA 4K81B 3TVTA 4EATA 2WJAA 1QTNA 1QZ3A 4PLHA 1PBTA 3GJRA 4JB2A 2ORIA 4I3GA 4OK3A 3KIPA 4CDGA 4YUXA 5EE0A 1TO2E 2NTEA 3QEJA 2A1UA 2Y05A 5KHAA 2ADOA 3AJDA 5K0FA 3HL0A 3GPCA 2QLMA 4YMGA 1OI3A 2X0FA 5HS4A 1DE0A 2P35A 4BV3A 5JCOC 4EI8A 4HMPA 1UC4B 2V5AA 2WZQA 2BBTA 1SGWA 4IP0A 3WFJA 3J81A 5F51A 2BUCA 1XKXA 2QLTA 1UJ2A 1DXQA 1V9SA 5EJMA 4BVAA 4DJJA 2DFLA 1Z6XA 4P53A 4ZEOA 3N7UA 1YB5A 4JLSA 1VBKA 1IY8A 2HWYA 2UV8A 3HYCA 1Z0KA 4TN5A 1A9SA 4WK6A 3HN6A 5LC1A 1LDBA 3TCXB 4KN6A 2DWPA 4FB4A 1JHUA 1M1YB 1N2OA 2BR4A 2WBLC 5JSKA 1LUAA 2IHZA 1BW9B 4RV4A 4GE0A 1FUEA 2OGSA 2W6ID 3G23A 3GW8A 2VZ9A 3AHFA 1NPTO 4R9SA 5EUMA 2PX2A 1OLXA 4MUAA 4QDKA 4JENA 4RY8A 2ACKA 1MVLA 4ZMSA 1F6DA 2AFHA 3N2KB 1KZHA 4PZ9A 3ADBA 2BGNA 3K2QA 4L50A 1YZQA 1AK1A 4YT5A 4XWKA 3ORFA 4QX6A 1H4TA 3FPKA 1QVAA 4HX2A 3U19A 5A2GA 3UK6A 3EZYA 4EWLA 4FYMA 3SNKA 4D0NA 3LGAA 3U9SA 4RD4A 5DNAA 1M8FA 3L84A 1F8UA 3NYRA 3H99A 2VP4A 3K16A 3QFFA 3W6NA 1FDUA 3EOBI 5BYAA 1KO7A 4H15A 1RYBA 1XALA 5IN5A 2P1DA 4YFVA 3X1WA 3L0CA 3E9NA 1D1SA 4HX5A 2NUBA 1SM4A 1IQPA 1XDBA 4GWKA 3L0IB 3W78A 4L3VA 5TT0A 1ISGA 1NQWA 2OVBA 1K8YB 1TT5B 3IBCA 3N2KA 1QO7A 3SOZA 1X14A 1JZSA 2Q2VA 3VR4A 5K3OA 1YBVA 4DBLE 3CUYA 4BE4A 2BH2A 1Y3CE 1IEXA 1Q1EA 3M1IA 1O6FA 2C0QA 1N4DA 3PHBE 4MQUA 3CX3A 4WGGA 1UKEA 3F90A 1XDZA 3MD0A 1AQJA 1MOZA 4Q4CA 3GRCA 2JI6A 1ECPA 4LZPA 3NIWA 3NWEA 4EG6A 2B7CA 3X1YA 2C5GA 4YLEA 1Q3HA 4A1OA 3EIXA 5HFJA 3M6FA 2ADMA 5F98A 1NGSA 4PU0A 1TT5A 1C14A 1JHRA 5LA6B 5JYDA 3H1PA 4PPFA 3FZGA 4KU4A 3SX0A 4Z49A 1GQOA 2DWOA 4GMGA 1PLJA 2FCAA 2WYUA 3VBEA 4ENTA 5MGNA 3BH0A 4F2GA 5ERYA 5A4KA 1O54A 2B30A 2QA5A 3PCTA 1JYFA 2R47A 2Q9CA 1TYDE 1UFKA 4TM7A 2GJ8A 4DEVA 2PT9A 4GFDA 1NNLA 1NNI1 3B1JA 3BXHA 3KLPX 5FBHA 4Q9AA 3OUZA 4YJ3B 1OFGA 4S1TA 5BO5A 2V7TA 3UJ3X 1FYDA 4TSFD 5LA6A 2DMRA 1S7GA 4AB1A 2SBTA 3B53X 4GLBA 2VSFA 4P0QB 1Z45A 1KH3A 4IGAA 3AINA 1MEOA 2GAFA 2FW9A 1TUGA 2FHPA 4IV8A 5AVKA 3STYA 1CUUA 2E48A 2G8NA 1A27A 2IIQA 3DZIA 3LCRA 3FNHA 1VL5A 4MW2A 5B6PA 1QCYA 1AQNA 1CS0A 4DQ0A 4F6LA 4LKOA 1LWOA 5AH0A 3RBVA 1SVSA 1Y3BE 2C9OA 1KKMA 2Q7XA 2H8GA 3AW9A 1UBSB 4P1ZA 4YJ3A 4BMXA 3LO8A 5JAMA 1ZMBA 1RHQA 2XAAA 5JDCC 2QJOA 2IEBA 2QBYB 5H82A 4O63O 3QXXA 3CVUA 2XLBA 1T10A 2AB0A 1IVNA 4J2HA 2Q1XA 2Z09A 1L5ZA 5DIFA 4ZQFA 1DRWA 4BB9A 3DO6A 1FTWA 2FN3A 2E87A 4ZOBA 3HKBB 4UPVA 2WJVA 1T8SA 4UVGA 4K88A 2GVNA 3K1JA 4FI3C 2IEAA 2V7GA 4PPQA 3PE4A 4NMWA 2RCNA 5I7FA 3P2YA 1A9XB 2KJQA 3IPXA 1LVGA 4M0LA 4WOBA 4Q66C 2PGOA 5CDSA 1DZ3A 3SIWA 3LBFA 5A04A 1KETA 3DLIA 1BQ4A 1VLJA 3E81A 3ICOA 2ZPTX 2BMWA 4YRZA 5FPPA 4GSLA 2QBYA 1O5OA 2WYIA 3LUPA 2ZAOA 3L18A 3O47A 3WA6A 3ZW8A 4DILA 5B55A 2AR9A 4DMGA 3AHCA 3MMPA 1KDRA 4F4CA 4EECA 2X3YA 3HKBA 1Q7CA 3FIJA 3PCXA 1KDYA 5BT9A 3W8DA 2VTDA 1Z7EA 1ZOOA 2PZEA 3CEPB 3F9IA 3KT8A 1TVMA 3HB5X 4XXHA 5CM2Z 3SE0A 3O8QA 3CUWA 2GBIA 5LNK6 1PV2A 1EIZA 2G82A 2I1VB 5EXXA 1YAHA 2JATA 3GX1A 4HYYA 5G0WA 4DC1A 2QVGA 4G4GA 3UVEA 2VYNA 2RD2A 3NHBA 2CN1A 3RR2A 3TRIA 1NMZA 1ZRMA 1GU1A 1NW6A 1B76A 4N01A 1MH9A 3H86A 4B2PA 4IIHA 1BSVA 1PR1A 5EQFA 3FCOA 5I5GA 3ZBUA 3RNLA 3PFKA 4K6KA 1ES9A 4WFJA 4WXYB 1CFJA 3QFRA 3OZIA 4RVOA 4CIXA 3OIDA 2ECPA 3QG1A 3RVKA 3LQKA 3NP7A 3CZ5A 4M98A 1E2LA 1V2GA 3R6TA 2JHAA 2Q1UA 3FLMA 3R4CA 4YP9A 3E7FA 3G2IA 4JQYA 4RY2A 4TYYA 1X0VA 1JA0A 1N3YA 4IR7A 1E2QA 1L4HA 1SHUX 3TCKA 3FA2A 1RZVA 1XWFA 3IUJA 3DMNA 4RVDA 1QGZA 3V6LA 2JIRA 2YWBA 4F96A 4RSRA 3W7BA 4YV7A 2ZUFA 4EEZA 2CUTA 1GA1A 4N8SA 1OTHA 3W2HA 2PRSA 1QQAA 2HPAA 1J22A 1EFVB 1YH3A 2C1XA 2RGXA 2IEDA 3IAS1 1MAWA 3P0FA 3PQ4A 3QPVA 5B2FA 5CD9A 2R97A 2GNOA 2BJWA 3RRBA 1Z8FA 4D92A 4AMZA 1QQ7A 4R68A 1VLMA 1KMMA 1GV0A 4DCVA 5HKAA 5EJ2A 4YRPA 4ZGWA 2QRHA 4HNSA 2VH5R 4YMHA 5HA5A 1TKRA 4EO9A 2CNDA 1L5QA 2FW8A 3OZAA 1ZVQA 4P84A 5P21A 1NJGA 1WHTB 4K3VA 4P7GA 3AP3A 1F8XA 3C3KA 5FNVB 1U99A 2WA1A 3O0DA 3B5EA 3LYAA 3A1TA 4JEMA 5AYVA 2GT1A 3G0OA 1Q14A 1ZGCA 1XRRA 5IMBA 1OZ0A 1G8AA 4L7VA 3NM6B 4MHOA 3UATA 4LE2A 1T1EA 3U3XA 5M5BA 4EKEA 1KZ9A 4QTUB 4EVSA 1ZL0A 2YFYA 1FFGA 1CUHA 1NJSA 3BHIA 3GFGA 4J75A 3EEBA 4LRQA 4S1NA 2NYVA 4FOPA 5JZSA 2DZDA 2F3RA 4P3OA 5IFLA 3OCCA 1ZD5A 1N2CE 3U3ZA 3IXMA 2JJQA 4G4IA 1P45A 3JVEA 2R68A 2QL5A 2QTFA 3A9WA 2R6JA 3IA2A 4QYMA 5CJPA 1WHTA 2QRKA 2UDPA 4NEQA 4S2EA 1K89A 5FNVA 3LOUA 1Q92A 2CLSA 2EBWA 3IQIX 1I0LA 4BKRA 2ERCA 1K4MA 3HUTA 1C81A 1N5RA 5FUVA 3WGQA 5ALGA 1CP3A 4DMMA 2PUBA 4C5CA 5FQOA 1DKLA 3NH6A 4ZAXA 4KN9S 2BEVA 3HN7A 1GA6A 4NCBA 1NFQA 5DRTA 5HK8A 1TFRA 3L43A 3CNHA 2QX8A 3SJ7A 1QNLA 4BQSA 3AFGA 4WT7A 1ISSA 4TL9A 2UZ4A 1V8BA 1H8ED 1I9CA 5ILQA 2AUMA 3ORSA 4PSVA 3WGGA 4FKMA 1T13A 3L46A 3PK0A 1KK0A 3RV3A 5K0ZA 2BZ0A 2AH5A 2Z08A 2QRPA 2PQ2A 1RMYA 1ZWLA 2IP2A 4JU9A 2Y2VA 3NB0A 2FSIA 3CH7A 3IMCA 2B0JA 3GARA 5CM9C 1K92A 3GVCA 4D9KA 4R71A 1SXQA 2EDCA 3ZG6A 4CWAA 1W4RA 2A8YA 3H8JA 3VVCA 3N76A 3QWIA 3KOMA 3VVLA 1X38A 3L4JA 1KO1A 4LQ4A 4BMZA 3N5CA 2BGRA 2IPNA 5LZ2A 2H1LA 1G5IA 1KYXA 1XJCA 1P0IA 1VKJA 2RI6A 3KFLA 4B2YA 4IIXA 2BM9A 4CE6A 3TIVA 1XEWY 4DV6B 5EXEA 3JSXA 5ED0A 2HA4A 5B7QA 2GRAA 3C3JA 4MHSA 5I9NA 3CFYA 3NNDA 4RXTA 1EUYA 3H4TA 4WOCA 4YRLA 3QTTA 2FOLA 3RW9A 4DV0B 2YIVX 4JJAA 2GN9A 1GUFA 5J1TB 4DB2A 1RJFA 1XTTA 1U2QA 2HWKA 1RAIA 2WFZA 3C41J 3EMBA 3FLEA 4DGQA 1A9PA 3UXHA 1KXZA 3KE9A 3LUHA 3PNYA 2PSDA 2OV3A 4FYKA 3ST7A 4BVKA 5CB6A 3AVYA 2FPGB 5JDIC 1NI5A 4R7GA 1S8AA 5BW8A 2V7QD 4CQNA 1A8IA 1NXOA 1XU4A 3RANA 3E0XA 4DQVA 2REBA 2R48A 4JB3A 2OV6A 2NSLA 2YC4C 4V03A 2C3OA 3U7EB 5K1ZA 1G19A 3DVRX 1BE8A 3ESQA 4JIGA 4X84A 1UDRA 1JZQA 2O9JA 3DHNA 3GMSA 2YZKA 3DNMA 4IDAA 1G8PA 2LTAA 3L0ZA 4PLWA 4RPIA 1RLIA 1T4DA 1JHXA 2EZ4A 3UH1A 1E6UA 4MAMA 1HKHA 5C8XA 2ECFA 1IXSB 2FW6A 2G71A 2WF8A 1CLUA 1ZZEA 1FTSA 2UZAA 1E1KA 1JQDA 4J7XA 1SUCA 5EWLA 2CLOB 4DXAA 3DW1X 4E1BA 2VXCA 1NYTA 5IKMA 1LNSA 5KHOC 2D2EA 1EE9A 4BGUA 2WMOB 3BWDD 3LDGA 5J43A 3WR5A 3GFQA 3T6KA 2O8EB 1OXUA 2ZIFA 3J7AC 1LK5A 4J49A 1NIPA 3K2EA 3IKTA 1QHEA 3VX4A 5TPZD 2R8EA 4M53A 4RMHA 3L02A 4Y2JA 4E6PA 2ZI7A 1EXDA 3KJGA 3FH0A 3HN2A 1FRVA 1RR6A 1UBCA 4NMLA 1ULZA 2JIZA 4XE5A 2BC9A 1MC5A 5B7PA 3R3VA 1U7WA 4JC5A 1FW8A 4UBJA 1Z7BA 2A3RA 4RMIA 5JLAA 3RHTA 2DFNA 3NWJA 5D1HA 1TC2A 2IP4A 1XFDA 4TWAA 1GSHA 4F9TA 1UINA 4X91A 2A84A 2OUKA 1MD9A 4YUAA 2GCOB 1GFIA 1ONNA 1U2EA 4DCUA 5E2IA 4NZYA 5HUJA 2REOA 3HB0A 1L8QA 4TL6A 1MGPA 3LPCA 2VHCA 2RGCA 4AG3A 5C7OO 1CB0A 2Q0XA 2W00A 4A9AA 2EWVA 2XCTB 2ZATA 1KYYA 1JL3A 3NVMB 5AI5A 1PQ4A 3D7LA 5JJKA 2YBDA 1N0VC 3G8DA 3CO5A 3W3AA 4CEJB 1GQYA 2B4YA 3OT1B 2RHWA 1YNOA 2IVZA 5IULC 2JHCA 2A59A 4EUSA 1XA0A 1Z0FA 3R0VA 1I1OA 3FR7A 1R0CA 1NYLA 1B42A 2HSGA 4R1LA 3T06B 3UJBA 3A3KA 3BGSA 5A2QA 4ZN6A 3P9PA 2VDRB 4YJFB 1FYXA 2IIBA 2R9VA 4WFIA 5M29A 5HGJA 2ZLBA 2GCOA 3B89A 1D2MA 4F4JA 2OL4A 1F60A 1T4BA 5D6OA 1YKSA 2Q50A 1K63A 3M4JA 4KMMA 2CLLB 1AF7A 3P2IA 3G5LA 1MBZA 1M0TA 1Q7GA 2J4FA 2QTNA 1BX1A 4N6OA 1CUAA 5DBOA 3K1TA 3MIZA 3TDKA 4CKYA 5IMSA 5JMWA 1DJLA 4WCFB 3P9CA 2INGX 2ZSEA 4TV8F 4CEJA 3OT1A 4Q3AA 4KCGA 3L07A 4L9AA 2HBQA 1CRLA 1XCPA 1J0AA 3LT1A 2FSUA 4TRNA 2DHEA 4YRDA 3M34A 4AD8A 4R1SA 5KNCD 1TAUA 1VYVA 2JRLA 4YJFA 4JLUA 1DVRA 1FNBA 2HXYA 5E1DA 5F3RA 2AGVA 4KGVA 2SCUB 3K9NA 1T25A 3NEYA 1W35A 2Y66A 4IS3A 4J1QA 1UDWA 1KAGA 4NBVA 5EIFA 3A6HA 3BXGA 3WA7A 1N6PA 3C3MA 3TOVA 1VSTA 3RFTA 2VHWA 2VUUA 1LI4A 1L5VA 1U0HC 4O1HA 4RANA 3SFTA 2WWYA 3D4LA 3O83A 4IDNA 2P79A 1G5FA 1ONBA 1U8ZA 4LW8A 4LN1A 1XEXA 3WBKA 1GKLA 4GDFA 1F20A 2C4VA 4GRIA 2CF5A 1PEKE 1SCQA 3EQ9A 3GZNB 1CJCA 1S8FA 1JEAA 3PYLA 4KXFB 4DIDA 4MKRA 1YAJA 2CXUA 2NSHA 1PV4A 1EDOA 2C3MA 2WT4A 1K66A 1TOAA 3EGXB 4IOKA 5AJXA 5H3HA 3A9TA 3IAS6 1TMKA 3USZA 3KEGA 1V3VA 3TLGB 3PC8C 2R7KA 1K1EA 3RYFA 2SCUA 4NZZA 4OBXA 2AR7A 5A9RA 4MV9A 3P2JA 4EY5A 5BMVF 4CR6A 1J49A 2CB0A 4FVTA 4S2UA 1V11B 4LMPA 1H0HA 1YXMA 1AU9A 1D6NA 1M1NB 4Q4JB 3GT3A 2HT6A 1PNQA 2G40A 3DNPA 2WR8A 2EKPA 1JTVA 1N0HA 3KLNA 3QEKA 3GRAA 3T5TA 3GZNA 3I45A 1KEWA 121PA 1AHNA 2W93A 5EYPB 5DCLA 2IYPA 1KEEB 2F48A 4QFDA 4DABA 4TT3A 4M0PA 1XN1A 3ORRA 4MVJM 1SOMA 2YJZA 3LTNC 1AB5A 1YZVA 4LNUB 4WOPA 4Q4AA 4DMHA 3TLGA 2NACA 1U9YA 1Z34A 1FXWF 1XTSA 3EAFA 3IFSA 1K8QA 4LDZA 3NYWA 2FLKA 4P7BA 4QTZA 5AJTA 4YCAA 3TRHA 4HVCA 3LPAA 3UMYA 3LP6A 4MTCA 4EHHA 3QKSB 3R6LA 3ITDA 5G1NA 2E5WA 3HA2A 1C8BA 3B1WA 3G9ZA 4Q4JA 3U4GA 4Z0HO 1ZNWA 1NRIA 5A4MS 2ILTA 4M88A 2K6GA 3K8OE 5EYPA 1U7PA 1QB8A 1YVDA 1KEEA 4FM9A 1Z4IA 3VNBA 1BFUA 1U81A 3LKDA 4RM3A 3MT9A 4YEDA 1DX6A 4J2TA 3NBUA 4DMRA 1XO1A 3L6OO 3MXOA 4MA5A 4ZVSA 1OVGA 5DBGA 3CT6A 2R00A 2VJQA 3P9NA 4V39A 4WK4B 3LC7O 4X6YA 4B3IA 5K0TA 2DQYA 2Z3WA 3OOJA 4OXNA 4ED9A 2HYIC 4AP9A 3ZOKA 1I6KA 2O14A 3CLHA 4B87A 3ICEA 3K0CC 3OECA 3CR3C 1GL7A 5KTMA 3QKSA 4UHDA 2R25B 2WJWA 2V5UA 2H1VA 4TZTA 3C7TA 3RTCA 4H3KB 4EFDA 1TJ5A 4DIFA 2Z4RA 1ECJA 4E22A 4EGJA 4MO2A 3IMFA 1RQXA 5KJ1A 1F2VA 3EE6A 4LV5B 5HZHA 3RRYA 4OLBA 1LPMA 3AUTA 4F3RA 5C5EA 1DB3A 5CVDA 1BEUB 1JI3A 1NUPA 4FHZA 2YRFA 4DXDA 2GB4A 4MGIR 4O59O 4UM7A 2CFTA 3PXUA 4A2PA 2A6PA 2GPNA 3E7PA 3IC5A 3TW4A 1XZCA 2GBFA 3N8NA 3RFXA 4CT0A 1QJ4A 1SU8A 2LCFA 3BIWA 1ZCFA 1C8LA 4DG8A 1Q19A 1BJKA 2E2WA 4RQTA 1OFIA 2HC9A 1HM5A 3E9YA 5FEMA 1IM5A 1EX1A 5EJ8A 1IN1A 4NICA 3ZI7A 5I5EA 1SPBS 2D6FA 4X85A 4ID3A 4KRFA 1JG2A 4HZGA 5CRIA 4BS9A 2XNDD 3AH8A 3FZYA 3R7DA 1ANKA 3RVJA 1KJQA 1ZUWA 5EXTA 4IIUA 3OFSA 3ANNA 4JNKA 3KT6A 4N5LA 2EEPA 2Q5IA 2ZJ8A 3MS4A 2F8LA 3WO0A 2AD5A 3BREA 4JBGA 4KR2A 3DP7A 4IUDS 3ZDYB 5FBZA 4MVCA 3TDNA 3RB8A 1W5AA 4HFJA 1V41E 1Y7HA 1ZEJA 3D0QA 4Q15A 2JLAA 3ZQKA 4OQQA 1EG7A 3D3EA 4HGPA 4AZ3A 1EZZA 3W5CA 1CLEA 2FA9A 2VDVE 4Q18A 3TQTA 4CG2A 1JNXX 4BBZA 5EJ4A 1TMOA 4QUBA 2XIQA 3KNZA 4C4TA 2R6GA 3KSDO 4YT8A 4RU1A 4B3CA 3W5HA 3CLKA 2OCAA 5CEJA 1AMNA 1FLAA 4XX1A 3KTFA 4OGKA 2AOXA 4IIFA 3WWOA 4BGDA 4KITB 4EUFA 1W94A 2OOKA 4M38A 4ROTA 2NZUG 2OAP1 1Q0HA 5AJWA 4M0EA 4CUJA 1P2DA 3OLCX 3M89A 2B9VA 4IEEA 4MUIA 3TZLA 3FAZA 1RXCA 1IONA 1EPUA 3QOYA 3C1AA 4FEAA 4F3CA 3S2EA 1JQEA 5BN5B 4ZYWA 1GU7A 2FDXA 2JFHA 4C05A 5LBTA 2IOFA 2C58A 3M9WA 5LUBA 2X8JB 3LP5A 2BKAA 1IXRC 2QP3A 9ABPA 1NPDA 3U56A 3H11B 1IZ0A 4MLZA 4R9RA 1DCKA 4XRRA 4ZD6A 1QDUA 2EKQA 4JLVA 5AUOB 3L92A 4G07A 1E1QD 4DLKA 3ZE1B 1R9NA 1L7MA 5K03A 1MGOA 5FBRB 1XHLA 5FPQA 1EZ4A 4G0WA 2C78A 4KREA 5KMGA 1KO4A 2QNIA 4BFSA 2JNWA 4ZC1A 1KZYC 1KJ8A 1SVLA 4ENSA 1FP1D 3EPHA 1CUSA 5JJ5A 4E11A 2IUTA 3A0RB 3RQIA 1QOQB 3ITKA 2EIXA 2ZS9A 3STVA 3ZDAA 4IHQA 4CQLB 3OKCA 4IJUA 3RVLA 1JWBB 4ARCA 2X8JA 2J6HA 3OAAD 4MGHA 1UJNA 4DB4A 1B43A 2VQDA 5JPDA 5IC6A 4Z3OA 3DR5A 2P77A 4MV8A 5FV7A 4GEKA 4B17A 3KOUA 1CETA 2Z2XA 2H06A 1YRLA 2Z04A 4TMXA 5BWBA 1SXHA 2DH6A 3LCVB 3FVVA 1Y6GA 2ZQ5A 2XWJI 5ESXA 1OE0A 3N0TA 4LSZA 1D7AA 2Z2IA 2YMPA 3MCZA 4CQLA 2BM1A 1XK6A 4JL8A 3QVXA 1X39A 1MU0A 3FF4A 4TMZA 1N8SA 4AW9A 1DGQA 3DTTA