2AK2A

Adenylate kinase isoenzyme-2
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
220
structure length
220
Chain Sequence
PKGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDASQTPDVVFASILAAFSKATS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of bovine mitochondrial adenylate kinase: comparison with isoenzymes in other compartments.
pubmed rcsb
molecule tags Phosphotransferase
molecule keywords ADENYLATE KINASE ISOENZYME-2
total genus 76
structure length 220
sequence length 220
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ak2A00
2EFCB 2ZREA 4PPNA 1E94E 1UBEA 4KYIB 3KXKA 4LK2A 2UVQA 2XB2A 1L4YA 1KSFX 2MSDB 1CU1A 2WIAA 4M8NE 4OQMA 4UNQA 1WE2A 4Q4JB 4MGIR 1E2KA 2ZRCA 5FUXA 2G0TA 4OK3A 4L4UA 3CF6R 2WVJA 2HJVA 2JA1A 3QVUA 2FFAA 5J5CA 1Q12A 5EUMA 3SBEA 1BMFA 2ZRLA 5KSYA 1EFUA 3W5JA 3KQHA 3ZGXA 3Q85A 3ONWA 2VSXA 4B75A 4IDPA 4D6PA 2EQBA 821PA 1OFTA 4MGKR 1DAMA 1XRJA 4AG5A 3K0CC 1DOAA 5FFMA 3X1ZA 3KTAB 3HU3A 4JJKA 1N6NA 4DLZA 4EPVA 3B8HA 3AGPA 3CF0A 4B3GA 1VCMA 1W4AA 2PZEA 4DDTA 5JI2E 4KSCA 4HLUA 4Q4AB 5TARA 1KI3A 3CKLA 3T5DA 5FOTA 5LD2B 1ZJ6A 1P62B 3BB1A 2IXFA 4WIAA 2ZJOA 1DAGA 4LHWA 1YZNA 4NYJQ 1XXHB 2XNDA 4TWZA 2IUTA 2NO6A 1N5KA 2J46A 2H18A 1G3MA 3LVRE 1EGAA 3OEED 1X1RA 1KI4A 1OKKD 4W5HA 2IYLD 3K70B 2IHYA 3I8SA 4PZLA 3B13B 1E2DA 121PA 1MOZA 1NF3A 3KJGA 5JWHA 3UK6A 3WNBA 4C0HA 2VQSA 1G8HA 1W44A 4AYTA 1Z0DA 1ZINA 1FTNA 3FMIA 2GESA 4B3XA 3U7EB 3RS4A 3LX5A 3K1JA 1T3HA 2IF0A 5EQTA 1PUIA 1A1VA 4GT1A 1Z0AA 4PHTA 3FHCB 2ZJYA 4NH0A 2FSHA 1IJFA 4HLDA 3VR4A 2REBA 3EG5A 2BM0A 3C16C 1OB5A 4DLUA 2WMNB 4ESVA 4YMVA 1XP8A 2O0KA 4AC9A 1D9XA 4EIWA 4MITA 2WSSD 1NG9A 5TVKA 3H0KA 2WWGA 2ATVA 5KYKA 3THYB 4B74A 3KQKA 2V9PA 2RGNA 5HZKA 2V54A 4B47A 1G7CA 4XH9B 4LI0A 1M7GA 2KBFA 3DVLA 4C4PA 4PHGA 1N5IA 2N42A 5JCPA 2PEYA 2J0UA 1M1YE 4OHXA 1MO6A 4UJ3A 1E96A 2WOOA 5EXTA 1W4CA 2RGAA 1KAOA 2MSCB 2W2VA 3T1VA 3DEFA 3WYAA 3MWYW 3R7WB 4LBWA 4D82A 4JYCA 2JLRA 4LC0A 4RJLA 2V7QD 4Y0AA 2VP5A 5FBVB 1SXJC 1VG0B 5AUPB 2HYIC 1KKMA 2DFTA 4MRPA 2BJVA 4LHXA 3I72A 4LJ4A 3T15A 3W3AA 3GFOA 4QXAA 4V0ME 4IEEA 4OQFA 3S1AA 3VU9B 3EIEA 1BKDR 1TU4A 4YXWA 3ZVRA 4URXR 4XVQA 4A8JA 4FWTA 3MLEA 1VG1A 3A1TA 1JPNA 1KAGA 1BYIA 4JKYA 5BN5A 3UWOA 1TQ2A 2BCGY 4DSOA 3SU8A 2V7QA 5ELXA 4HAWA 5CITA 3D8BA 3QE0A 4O3MA 2G88A 1JEEA 1N0WA 4ZIRB 2R44A 3REGA 5K8TA 4L15A 2E87A 1YQTA 2PLFA 1DADA 5D3MA 5FPHA 4ZI2A 1ZUHA 1QRAA 2GTPA 4HB4A 3BFKA 3L0OA 4Z8YA 2GCNA 2AHOA 1AIPA 3T5GA 3QI2A 3N2IA 1TTTA 1KDPA 4BFUA 4M1TA 1G64A 1TQ6A 3SBDA 1OSNA 1R0ZA 1JR3E 1R5NA 2R6CA 2IYQA 4A1FA 4X8MA 3L0SA 1W0JD 4V0LA 5AUNB 5BYKA 1UBGA 3ND8A 1IN8A 3PEYA 1NKSA 4TLDA 1DELA 4QC2A 1COWD 4DLXA 2QE7D 1QHGA 1R5OA 1SVKA 1T0JB 2AD1A 2J5XA 1N6OA 3DKPA 4LV6A 3TR5A 3U7GA 2BIFA 3QPUA 4NP6A 1WXQA 1LFDB 2ZE8A 3BJIC 1GUAA 4UQOA 4PO1A 1D2MA 3CONA 3NWJA 4RD0A 1KJYA 2Q21A 2ZETA 5DGXA 3DO6A 4B43A 1GSIA 1XPUA 2OBMA 3QXJA 4Q1CA 3THXB 4WZBE 3BBPA 3AKEA 4Z1MA 1AQYA 3VKGA 3BH6A 1T9HA 1QHSA 3PUVA 1XTRA 1AKYA 3UMRA 1Z0KA 2NO0A 4BRWA 5CJPA 3M0EA 3UANA 4QGAA 1NVVQ 5EP4A 1NLYA 1II9A 2Z6VA 3R20A 4A15A 1NJGA 1OH5A 1E69A 4A0RA 3AKYA 3IEVA 1E3MA 3PUYA 1VIAA 2W6JD 1ZM9A 5TV2A 1E4VA 3SZRA 2C98A 4RZUA 3IHWA 2OCYC 1XTQA 3FKSD 4QL3A 3RS0A 2CXXA 5IDVA 2VP4A 4GI7A 2W6ID 1EFTA 2VSFA 3GJ5A 5J4YA 3CWQA 5CK4A 1W0KA 1NLZA 2J3EA 3AVPA 3QXHA 1R0WA 1Z22A 1G3QA 4AK9A 1N6LA 1FUUA 2GZDA 1G9XA 4HAVA 2IUSA 2XSZD 4TLBA 3W3ZB 3ZZUA 2X1VA 1II0A 3MJRA 4JLNA 2FPKA 2ATXA 1KK1A 2ZJAA 3R8FA 2OG2A 3ZLJA 1ZNWA 3NEYA 4IDNA 1R8QA 2PT5A 5DI3A 5LBIA 2QRZA 3WY9A 4F7WA 5DIFA 1W46A 1Z07A 2Q9BA 4B2LA 1QF9A 1N6PA 3CR8A 2EVWX 4BUJA 5E7MA 1XF9A 1ZCAA 3AB3A 4EPTA 3B82A 4OI4A 1P73A 4LPKA 4XWOA 5SZHB 1R2QA 1OIXA 2CCGA 2NGRA 4PANA 4IHQA 3CNOA 1T8TA 1SGWA 1UDXA 4QBGB 1YZQA 2GAOA 4HB0A 1FZQA 2ZSAA 3IIMA 4LYHA 2YNMA 3OIVA 1O3YA 4IW3B 2B7BA 2DCUA 4ZIRA 5FOUA 2PJZA 4FCWA 3HJNA 1KO1A 3Q7PA 5JRZA 4B2PA 2X77A 4JVLA 4W9MC 5SZKB 1FFHA 1S2MA 2ZM5A 3W6OA 3EA0A 3EXAA 1WDTA 4DVGA 2FFHA 5L3SB 1VKJA 3QF7A 2OHFA 4C0KA 3R9XA 4TTRA 1J90A 1MABB 2C77A 4QNMA 3ZZ0A 2GDJA 4KVGA 4NYMQ 3HPQA 3EARA 3OZXA 4UNPA 3PEWA 4MDEA 1JECA 3AF4A 3CPHA 4KHZA 4KO8A 1ZW6A 3TUZC 1QHHB 4ZDWA 2C2HA 2RGBA 1G4UR 1FQJA 2C8VA 1T0HB 3VAAA 4A6XA 3IGFA 2JASA 2OM2A 4S35A 1MO5A 2FMXA 2J45A 2VHJA 1VHTA 3AF0A 2GCOA 5GJVC 2BEKA 2AK3A 2B92A 4LRWA 4V0KA 3TBKA 2ZITA 1E32A 1E0KA 2RGNC 4CIDA 3BB4A 3IPYA 3AVUA 3Q5EA 2XOKD 2IS6A 6Q21A 3BERA 4US0R 3EX7C 1U2RA 5HKKD 1K5GA 2H8KA 1K5DA 1M7HA 2VLIA 2IUUA 1JJVA 1ZD9A 2DWQA 3VR1A 1E2IA 2QT1A 1E99A 2OSBA 5C46F 3K0AB 4Q4AA 2E1RA 2V1UA 2H16A 1XB2A 1G8GA 1HY3A 1TQ4A 1ODFA 2P5TB 3VHLB 4EFNA 1ZIPA 1F48A 1FQKA 2UZ3A 5L3VA 4TSFA 3C5CA 1KDOA 3QVVA 5E3HA 5KNBA 1YRAA 4Q1FA 1U8YA 1Z08A 3SC3A 2FWRA 2IW3A 4KYUA 5FL3A 2FU5C 1E6CA 4P3YA 4ACBA 5GVSA 3A4LA 5HTKA 3LQRA 3PENA 4D4JA 2IYRA 4FIDA 5JSZA 1NVUQ 4JLAA 3GLIB 2IXEA 1PZNA 1RKBA 5DN6D 2YKGA 5LDDC 1M74A 3SJAA 3B78A 1BS1A 4JT4A 5DHFA 2P2LA 4LJ5A 2PEZA 5DI3B 3WNDA 2EWWA 4ON9A 1AS3A 5JRJA 1G21E 4HZIA 4YDSA 4BFWA 2OV2A 1VDZA 2FPLA 1EFCA 5GVRA 1U99A 3KFVA 2OCBA 3E70C 4PAQA 1E2GA 3MSXA 4ZDKA 1XX6A 4UXHA 5KSZA 5CB6A 1NMZA 2JJ2D 4FWIB 1U94A 3FKSA 2OXCA 1U0HC 5CM9C 3R9IA 2XZPA 4BEBA 2HCBA 3WHLA 3WBKA 4CEJA 2O8EA 4YMWA 1TEXA 5BW8A 2MMGA 4AYWA 1DTSA 2GEUA 3Q9LA 4OYHA 3A4NA 5JEDA 4DLSA 4D26A 3P26A 2J0QA 2G1KA 2OFXA 5G3ZA 2NIPA 1QVAA 3IPXA 4TLEA 4G5QA 3MMPA 2K5UA 2V1XA 2GRJA 4EJSB 2IEZA 4Q4HB 5AK0A 4AI6A 2Q6TA 1P72A 2HYDA 3PUXA 5KOYA 3UATA 2CL0X 1CKEA 4S2EA 1KIMA 3K0AA 4RVCA 5CLQA 1QZXA 4RZ2A 2Z5FA 3AVXA 4ZV4A 4PPFA 5CLLA 4CZ2A 3GLHA 2H17A 1BYUA 2O8BA 2ZROA 1VYTA 4D4KA 1E9FA 3P32A 4ITRC 4XTCS 1NVWQ 4DCUA 2H5EA 1SQ5A 4BFZA 1GZSA 3JVVA 4QGFA 5E95A 1E9DA 4TT3A 3P20A 1KY2A 1VYUA 1W7AA 3BAFA 3DZ8A 4EFMA 3D31A 3UG7A 4ZCMA 3GLGB 2XTMA 4I1UA 3L0PA 1XCPA 1VG8A 4JLDA 3W6NA 3QKTA 1OLOA 1XTSA 2QT0A 3MG9A 2EFHB 1HTWA 4WOPA 2JLQA 4G5RA 3R7WA 1NY5A 3AVTA 2OT3B 2PX3A 5EE1A 4Q1DA 3Q3JB 3GEHA 4OQXA 1M2OB 1R4AA 4RFSB 4FW9A 4OBEA 1IN4A 2RCNA 2NG1A 1GTVA 1XMVA 2G77B 2UKDA 1QHNA 3CPJB 1YE8A 1OH6A 2F1HA 4HUQB 1T8UA 5L3SA 4NYIQ 5SZJA 3MRSA 1FMJA 2EFGA 3A58B 3GCGA 3NDBB 2V55B 3L82B 4RSGA 5AJYA 2I1QA 3BE4A 1DAHA 1IQPA 4XD7D 4AYXA 4JIMA 1KKLA 3X1XA 1RRGA 3AP3A 4TMWA 1H8HD 3KKOA 3SQWA 3IBYA 3K0FA 1HE8B 1JAHA 1II8A 4Q03A 1KTVA 1W2GA 1X3SA 4FD2A 1E2HA 4OQLA 1KI6B 4P32A 3QF4A 4B35A 4LHYA 3C41J 2WWYA 1UBCA 1DPFA 1GNPA 3BH0A 3TMKA 1GRNA 1UKEA 2NPFA 4M9XA 1E2MA 2OCAA 4OHVA 4XTRA 5IK2D 1UJ2A 1XMIA 2CL7X 4JBYA 3B6EA 4V0NA 2IYXA 4D81A 1XZQA 3RVBA 2XOKA 5B30A 3PUZA 1FP7A 3GD7A 3LAWA 3BB3A 2J59A 4I1VA 5AUQA 2YC4C 3ZD7A 4DEXA 2ZU0C 4TMKA 3I1FA 1E1RA 4O2LA 5G40A 1X86B 2JLXA 3U61B 1NSFA 4IVPA 2BKUA 1E79A 5E4FA 1RYHA 5FL7A 2WWWA 4EKDA 3TUIC 3TVTA 3GLGA 3OIWA 4NPHA 4MYHA 1RIFA 2WJIA 3FE2A 1XJCA 2PBRA 1E2QA 3KTAA 1F2TB 1XTIA 4GOJA 3FHTA 1FL9A 2H92A 1ZUIA 4PC2A 4HB3A 2ORIA 3REFA 2A3RA 4G0NA 3SEAA 5JCZA 2FX3A 2ZEJA 2ZRHA 3BOSA 1VIYA 1YR6A 4OL0A 4DCVA 221PA 4V02A 4BASA 4DCTA 4QNRA 2IWRA 4JLOA 2Y8EA 1P2TA 2ZSFA 2LKDA 2ZUCA 4ESHA 2Z43A 2DFNA 4PHHA 1KZGB 3ICQB 2WPDD 4X8OA 4QHYA 1OKKA 1QHYA 2OFOA 2VL7A 2WHXA 1XPRA 2A5JA 2W83A 4UNSA 3ZD6A 4D25A 1G7TA 2JAQA 4Q00A 1VMAA 2JJ2A 1EWRA 2DPXA 4B3BA 4D0LB 2V8OA 4GRAA 1W2HA 4PR0A 3K53A 2R6FA 2YWEA 2FNAA 3VNVA 4B3DA 2BBSA 4QBFA 3QJYA 2BOVA 4JVNA 1E1RD 1L7VC 3LRPA 4LHZA 3ZVNA 5DYIA 3K0CA 4NTZA 4RCYA 3LXRA 3QKUA 5FTNA 1US8B 4HAXA 1XPOA 4A2WA 3DMNA 2WWFA 3EZ2A 2ZI9A 3THYA 2F7SA 5A0FA 4A2PA 3HU1A 1R6BX 1E4YA 1SVIA 1XD2B 5UKDA 5JWRA 1A4RA 5CK5A 2MMCA 3R8CA 1OFUX 3MGCA 4II7A 2AXPA 4M9QA 3GLHB 3VR6A 3OFNA 3I3SR 1FP6A 1LY1A 2ZRDA 4RFVA 2Q3MA 5EE3A 1UAAA 1ZBDA 2PH1A 2N46A 4MRVA 1TF5A 1D6JA 3HP1A 3SHFA 5J4VA 3EWAA 4B76A 1Q21A 3SJCA 3RLFA 2GEDA 1F6BA 1OXSC 3W34A 3EC2A 4CRWB 1HH4A 1PLKA 3DMDA 3K0SA 1NVVR 3E1SA 3VR3A 2YOGA 5KHOC 2LKCA 2F55A 4FCVA 3TKLA 1R8SA 3C14C 3LQQA 4TSFD 2GBLC 2ZJ5A 2HLDA 1BO6A 2OE2A 2QMUA 3LDAA 4ZO4A 2WM9B 2VF8A 1XCGB 4QOSA 4C0AC 1A5TA 4IVRA 3VFDA 5JHGB 4GP7A 2OFWA 4JYBA 2RGEA 1AS2A 2CVHA 1G5PA 3B2EA 2FOLA 3MWLA 5F2EA 4BLQA 3FFBA 4JVMA 5IF9A 3CO5A 3B1YA 3GJ3A 4TYPA 1W0KD 4Q7KA 2DYKA 5EP1A 5JHHB 2DWPA 1GVNB 3O47A 1RVDA 2IYSA 1F5NA 1ZNXA 4OI0A 5FOXA 1ZMXA 3NBFA 3VMFA 3WMEA 1JQLB 4C2TA 2HXYA 3ZIAD 1Z2AA 2BBWA 4YQFA 1U9IC 4M22A 1B23P 1G5TA 1YVDA 3ZS9A 1HA3A 2BMJA 2WMOB 3NKVA 1A7JA 2VSOA 5L8VA 1RRFA 2O8EB 2WWIA 4GZLA 1I4TD 2J87A 5BN4A 2QA5A 3U44B 3KXLA 3GPLA 4YMUA 2VP9A 4Q9JA 2YWGA 2IWHA 4LYAA 3QSYA 2ZS9A 4BE7B 1VPLA 1D5CA 421PA 2FFBA 5EZ5A 2ZYVX 3NEJA 5FUVA 3SN6A 5C4MA 4IOMA 1CLUA 3KKPA 1U0JA 5GJBA 2W0SA 3IHLA 1KO8A 3QUSA 3W8NA 1G17A 4V0OA 2C9CA 2IBMA 4PSVA 1P75A 1KK3A 2WWHA 3MWKA 2VHUA 1KO7A 4UNNA 1IY2A 4MKFA 5FBWB 4D4LA 4QJ3A 1RYFA 4TTQA 4BEJA 3T1TA 1CJTC 2WJHA 2HT1A 5BWMA 3JZMA 2F43B 1JBKA 4JLBA 4URWR 2CE2X 4KFTA 1VECA 3JZAA 5J47A 2YWHA 3RC3A 3FPAA 4HEJA 4HLQB 2QEQA 2KWIA 1FNMA 2ZI6A 1ONBA 2ZYUX 4PTLA 2IX3A 5H8WA 3CX8A 3NH6A 1KMHB 4KBFA 4RKFA 5KDDA 1LB1B 4LHVA 4Q9IA 4DLTA 1V43A 5JSZB 3FOZA 5FPTA 2IS1A 4KAXA 2B8WA 2OCPA 2J0VA 1E1QD 5HE8A 2J7PD 3PG5A 1X1SA 2REXB 3PQCA 2QG6A 3BXZA 1PVOA 2GF9A 3QG1A 2VRWA 2A5FA 1GWNA 3V9PA 4UKDA 4E07A 1XMJA 2A5DA 1W1WA 2QSZA 2NQ2C 4LYJA 3U4QB 3K9HA 1G16A 1J7KA 4F38A 1U0LA 4ASUD 4HUTA 1P9RA 4IEIA 4EJSC 1HQYE 2WJGA 3CB4A 5FR2A 4L16A 2F43A 4FI3C 2PMDA 2QTFA 4KFUA 2XNSA 1UKYA 2AXNA 2C96A 4YLGA 3QBVA 2QSYA 3DKVA 4B34A 2ZI7A 2YYZA 1NN1A 2QRNA 1MABA 1NJFA 1W36D 2QPOA 3U5ZB 1AKEA 3BFVA 1CS4C 1KI2A 2CK3A 5LD2C 2QBYA 4PQYA 4A8JC 2AL7A 3HR7A 1QHIA 2D62A 2R65A 4IFBA 3CRVA 4CW7A 4BGDA 1G6HA 1OH7A 2WPDA 3LY5A 4DBLC 3BH7A 2ZSDA 1GKYA 1Z28A 2GJAA 2YVUA 4PXAA 1KOFA 1SVWA 1IHUA 1NSTA 4O2RA 4C0QC 1KI1A 2ZAOA 4Q19A 4Q48A 1II8B 4B3FX 1G8YA 1P9WA 4CEIB 4E03A 4A36A 3K9NA 3GLFA 1KI6A 1JEDA 1H8ED 4YONB 1KSJA 2G83A 3QKRB 3QEJA 1WQ1R 3W9YA 1I2MA 3CRMA 5ANRB 1Q1BA 4NBSA 1E2EA 3GFTA 3PR1A 4Z54A 1I4LD 2WV9A 3KQLA 4OJKA 4C0JA 2HT6A 1NI3A 4QRHA 1Z0IA 4DUGA 3AF2A 3FYHA 2WJJA 2XSZA 2ZE7A 4N3NA 3U3MA 4D2IA 3OESA 2WJYA 4ZDIA 5TY0A 4YMTA 1P9NA 3RANA 3LBNA 2QM7A 2XTNA 4UXIA 4DRZA 3MWJA 3GEEA 2VIIA 3MJHA 3GJ4A 3PCRB 4Q9LA 2FZLA 3SDZA 2P3SA 1E2FA 4AKHA 2Z83A 1KGDA 3RSOA 4KITB 5CDFA 3QXSA 5G53C 4MYCA 1S3GA 2ODWA 3SHWA 1W36C 1AJEA 3THOA 2W2TA 2QORA 4JSTA 4QM7A 1Z47A 2IT1A 4GPTA 4DSUA 3GMTA 2PZFA 2ZRIA 4GNKA 1CIPA 4H1UA 2VH5R 4JBWA 4F4JA 2F1JA 5DE3A 2CE7A 2QNRA 3TH5A 1QDEA 1SXJE 3NG1A 5GJWC 1AQUA 1YZTA 3CM0A 2CJWA 3A1SA 1C4OA 5DISB 1AGPA 1CR2A 1ZU5A 1E9CA 3GLFE 1FMLA 1RRPA 3CIOA 5KNDA 4EDHA 1MV5A 2HEIA 5JLJA 5CB8A 3J81k 2ASEA 2BWJA 4YMSA 2FZ4A 2QAGC 5DI9A 3WYGA 4L9WA 4NYIR 4Q1AA 1GIAA 3T1OA 2QENA 1OFIA 1FTSA 3LH5A 4GBMA 4JLPA 5DH9A 1BOFA 5F3WB 4LBZA 5FR1A 1A2BA 2JJ8A 1Q1QA 5TDHA 3PUWA 1YR9A 2BKEA 2HDNB 4ZPXA 5DO9A 1DG1G 1SKYE 2C9OA 4HB2A 1AM4D 4QJ5A 3WRXC 2A5YB 2CCKA 3DM9B 2KJQA 3TQFA 2ZRJA 5DYGA 1OFHA 1JB1A 4MGYR 3QNUA 4PC6A 2VEDA 1CF4A 1CR4A 3CZPA 2QUZA 4LGMA 4BWYA 3M1IA 1GKUB 4H9GA 1KI7A 2D3WA 3FWYA 2ZSBA 2ONJA 4HDOB 4DLWA 1ETUA 1N6RA 2ORVA 2W0MA 4H1VA 3MD0A 3H1TA 1Y63A 2BMFA 5F9HA 3PEVA 1ZM2A 3ECCA 1T5IA 2WAXA 2FEOA 4NZYA 2QN6A 2WSSA 4PAMA 3KJIA 5JECA 2BM1A 4A0FA 1SVOA 5KUTA 2RMKA 3WP1B 2ODBA 4MYUA 1N25A 2ZRPA 2O8DB 1OT3A 2XZOA 1GM5A 5JFGA 4PC3A 3PVSA 5JJIA 4K81B 4FMBB 3EPLA 2A5GA 3SFZA 4NU0A 5B58C 4JT2A 3KJEA 1WCV1 1YZLA 3U7HB 1Z6GA 1TL7C 3TAUA 2LWIA 3NHAA 3NTUA 2ODNA 4B6FA 4URUR 4Q4HA 3NIBA 1M34E 2OAP1 4NCIA 4EUNA 4C0BA 4ZI3A 3GJ8A 1OIWA 1D2NA 2RGXA 5EUQB 2F9MA 1DAFA 1UFQA 2V6JA 1TNDA 3DOFA 2EFEB 4HZUB 4MRNA 2NMVA 3IQWA 2ZRGA 1TUIA 1XFAA 1XEXB 3A1VA 4PZYA 1QVRA 2ZUDA 2HXSA 1GRRA 3RS3A 4D0NA 1G3IA 1NMYA 2GNOA 2YINC 1MO3A 3T34A 5GJCA 2FDCA 4M1KA 3QG5A 3VNUA 3ZZTA 5A5GA 2R8RA 3C7KA 2WBLC 4XVUA 2VP6A 1P60A 3WMGA 4TMVA 2XEXA 3IILA 1U9IA 4DT1A 5DNYB 4OI2A 4XWKA 1EFHA 1RFLA 3CBQA 5F98A 2ZJZA 2GAAA 2IYTA 1QG4A 3WHKA 1Q3HA 3K70C 1VHLA 5H1YA 5C4GB 3AV0B 1VTKA 3K0FB 4N0DA 2VYFA 1Z6XA 2ZPTX 3TR0A 3TSZA 4OHYA 3RS7A 1P2UA 4DB4A 1Z2CA 4MQBA 1Z83A 3HYRA 5KTYA 1W48A 2ZI4A 1R5BA 2LCFA 2VO1A 4GSYA 4US2R 1DO0A 1G18A 3TAHA 2AN9A 2YWFA 3W8RA 4TL9A 4MKIA 4CDGA 2XAUA 2F1RA 1HE1C 3SR0A 5BN3A 2QGZA 5AJXA 3AVQA 5CM8B 2GBLA 3TW4A 4XSHA 1E9AA 4XD7A 3RRMA 2QAJA 3MCAA 2BMEA 5A4JA 2I4IA 1OF1A 3VR5A 2Z4SA 1KNQA 2ZJBA 1P4SA 5AJWA 4WVFA 1LS1A 1G1MA 3NC1C 5FPSA 4BZXA 2QZ4A 2OESA 3NDPA 3UIEA 1OHHD 4GOKA 2BBTA 2I1VB 4I1OA 4EPWA 4ZDJA 5IHPA 4GMDA 1COWA 2ZRMA 4ZCIA 4FN5A 2SHKA 4D0GA 5GADl 2ORWA 2ZRBA 2JLUA 2OILA 3TE6A 3ASYA 4DKXA 4Z51A 3I61A 1DG3A 4LPSA 4PQRA 4C7OB 1XDBA 4KU4A 1NBMD 2D06A 3AEZA 3K70D 2GEVA 3E5HA 1SVSA 5FBRB 2IEYA 2OLKA 4NCHA 2EWVA 3SI7A 4POAA 4BFVA 2PJRA 3B85A 3L43A 3U60B 3TSWA 5C18A 1TF7A 1XD2A 1P6XA 1P61B 1ZNYA 1G8FA 3IDQA 4I1SA 3PJRA 3NH9A 1GFIA 2GXSA 3LBHA 4PO8A 3UMSA 2JIZA 1AK2A 2HF8A 3AUYA 3U3JA 2XGJA 1Z3IX 4FMDB 3KL4A 4DB2A 3BK7A 2FA9A 2QY9A 4N1AA 1Z6YA 4KBGA 2ERXA 3FKQA 4FMDF 1NG1A 2F3RA 1TPZA 4BRUA 2PT7A 2CDNA 2ECKA 3DZDA 4TQ9A 5E7IA 4HLUC 4CEHB 1MO4A 3EIHA 4I99A 3L0IB 2OBNA 1Q1ZA 3THXA 4RD2A 3U4QA 1N5LA 1UKVY 3WBJA 2KI5A 1IBRA 2CLDX 5EJEA 5IK2A 1ZM3A 1N0UA 2WOJA 1SHZA 2RH5A 2HF9A 2ZJ8A 2ZRKA 2IXGA 3G82C 3JVUA 4A9AA 2DBYA 3QXXA 1YJ5A 1GNRA 1OIVA 1IY0A 1DS6A 3UKDA 4RZ3A 2P6NA 3BWDD 2OBLA 1SXJD 3CUEF 1XU4A 1X6VA 3H2YA 2CBZA 3ADCA 4KCGA 2GF0A 1IXZA 4NONA 4QG7A 2ZXUA 2ZQ5A 3I4LA 4BZQA 1RZ3A 4TT3D 4RD3A 1E98A 2FF7A 4R9UC 3EWSA 3UPUA 1TU3A 1N0VC 2ERYA 2GETA 2O8CA 2PX0A 2AFHE 2Q3FA 2QP3A 4P4SB 2BJWA 3WXMA 5JI3E 1WRBA 1A2KC 3LWNA 4TYWA 4U00A 4ARZA 3FFAA 4DC9A 3GLGE 4EAQA 5TXGA 3TVDA 1G7RA 2X19A 4TQUS 3IEUA 1KO4A 2QTVB 4OJQA 1LTQA 3RYTC 4TYYA 3LA6A 1EK0A 5LPNA 5E7JA 1OB2A 2IHBA 2ODEA 3CH4B 3LXXA 5KDLA 3P1JA 4FINA 3ASZA 2FG5A 4QFMA 1T6NA 2F6RA 3Q7QA 1KYIA 3AP1A 4HAUA 1N6KA 2VPPA 1NP6A 1OYYA 2GA8A 2YV5A 3D7MA 3LNCA 4M9SA 3SFVA 1GKIA 3WP0A 4G5OA 1Z6AA 2VHQA 4LJ6A 3AQ4A 2D2EA 3CNNA 1JR3A 3KDSE 1DARA 2JJ1D 2NTYC 4OK6A 4L9SA 1B0UA 2NZ8A 5HPYB 4NDZA 2VF7A 1Z63A 1KDTA 4DLRA 4B71A 4FCTA 521PA 1UPTA 1G20E 1H65A 1PLLA 1VYVA 2QTHA 2C78A 3ZQJA 3TNFA 2GK7A 2YZ2A 3G0HA 3CRQA 1ZD8A 4LJYA 3ZS8A 2HV8A 1G3UA 3DHWC 2H1LA 4KLNA 2JLVA 1CRPA 2A2ZA 1IAQA 3PXGA 3WRYC 4DDVA 1Z8FA 2RGGA 4YXWD 1S4QA 4GDFA 3RNLA 2GVDC 1XZPA 5FUWA 2GZAA 2D7DA 1GL7A 4TL7A 4YC7A 3B1XA 3VTKA 3U6BA 1S96A 1X8KA 3TLXA 1NN0A 4FMCF 2X2FA 3I92A 4TMZA 4BLSA 3NVAA 2AKAB 1M6NA 1AN0A 4DCSA 1ZVQA 1EG7A 2JDIA 3MUFA 4LJ8A 2Q9CA 3SNHA 1DEKA 4LOAA 1KZ7B 3WMFA 2WJVA 3PIRA 4UXJA 2D7CA 4HAYA 3H4MA 2J7PA 4P4UA 1S3SA 2QMEA 4A92A 2WKQA 1XEWY 5HKKA 1E9RA 1CJKC 2B8TA 4RD4A 2FFQA 2GK6A 2ZI3A 8OHMA 2BEJA 2QI9C 5EE0A 2G3YA 1DVRA 2GCOB 1O87A 1S1MA 2QQEA 1LV7A 1TEVA 2WZQA 4NHOA 1U8AA 4KSBA 2J0SA 4ASUA 2FSIA 4NE2A 4TYNA 3HU2A 3BS4A 1EFRD 3TIFA 2ZU6A 2F9LA 2QE7A 2DFKB 4LV8B 4M1SA 3BD9A 2GILA 3N5CA 4DSNA 3O8CA 1E0AA 3Q8XB 3EASA 3K09A 5HCIA 4OQNA 3N2EA 2CLSA 4Q7LA 3I5YA 3N70A 1R0XA 3GJ7A 4DDWA 2N1BA 1E1QA 1TMKA 4NMMA 4IJMA 4LWZA 2XITA 1J8YF 4KFRA 1YHNA 4J0QA 4PFSA 1NKTA 3BFXA 1DBSA 2ZTSA 1N6HA 1HUQA 1DAKA 1Q0UA 2DR3A 3LW7A 2QBYB 5KSOA 4B32A 5CYPA 3FVQA 4HYYA 1E2LA 3K9LA 1WMSA 4EPYA 2JLYA 1ZM7A 3FMOB 1US8A 3C5HA 1WBDA 2A9KA 5K8LA 2WKPA 2OO7A 3GLHE 3V00A 3BC1A 3EW9A 1YZUA 4V03A 4WZ6A 1UKZA 4D80A 3AKCA 3QY0A 4DDUA 4TL8A 1J8MF 1NN5A 3LW8A 2QMHA 3IIJA 4IFEA 3U3RA 4AWXA 1JPJA 621PA 3QPVA 2X8AA 1MRSA 3CRW1 4XIGS 5C2JB 4QHSA 3D6TB 5K8IA 1E0SA 4CVNA 2D2FA 1ZP6A 4JKIA 5M04A 2IC5A 2O8FA 4MRRA 4QM6A 4PX9A 1OXUA 2XJ9A 5FTMA 3DOEA 4IVQA 4M21A 2ZAMA 1GL9B 5EE9A 1CTQA 2A7QA 1SULA 1C1YA 3A8TA 3TQCA 1IONA 3KX2A 3AH8A 4G5SA 2OXRA 2C03A 2WWXA 3KUDA 4BLOA 3H84A 2V3CC 3TJZA 2ZSEA 1IOZA 2YHSA 2ZRFA 1CR0A 2XJ4A 2GZHA 1S1CA 1W4BA 3CF2A 2GXUA 3S1AB 2BVNA 3KKNA 4Q4JA 3VU9A 1KI8A 2GXAA 2J1LA 3IQXA 3K8YA 3B1VA 3KKMA 1Y3AA 1YR8A 2Z0MA 1J99A 4TL6A 4DLYA 1PUJA 3FGNA 1XNJA 4TZ6A 3CW2A 5J4LA 3F3YA 3LO5A 1XXHE 4EPRA 4RY2A 5IT5A 3W90A 3BGWA 4KVAA 4JLJA 4G5GA 1AA9A 3NBYC 1UEIA 2XNDD 4IXNA 4AURA 5CIWA 1SXJA 4GZMA 4PC1A 5EXPA 3VR2A 2ZJ2A 1XJQA 4LX0A 4OKSA 3B1WA 1Q22A 1Z5ZA 1FW6A 4IXMA 5IRCD 4P4TA 3O8RA 1T3LA 2JGNA 5K8UA 1EESA 2CNWA 3IKJA 1R10A 2HLDD 1UM8A 3I8XA 3HR8A 2KSQA 2EU8A 5KSPA 1QG2A 4L8GA 4GFDA 4JL8A 4CF7A 2AR7A 1RJ9A 2EYQA 4DCNA 3EC1A 4RD6A 1G41A 3CX6A 3UWKA 3WYFA 1F2UB 3FDIA 1UBFA 4B6EA 5EZ6B 2NZJA 5D3QA 2G6BA 4MYTA 4IDHA 1CRQA 3VKHA 1YKSA 4LBYA 1PV4A 1G8PA 1OXXK 3EIQA 3KQNA 3LBIA 4FXPA 3GJXC 4F91B 3ZYCA 5HR5A 2ZANA 1IN5A 4M2LA 1X8LA 3U3KA 1P3JA 1Q3TA 1XMSA 3CPEA 3GJ6A 1JALA 1TF2A 1L8QA 1JR3D 3EPHA 2HCJB 2MSEB 5FOSA 1UDWA 3OHMA 2VP0A 4KXFB 2XXAA 3QEOA 4TN1A 2ZR0A 1UF9A 1R7RA 2HUPA 1E0JA 4M0LA 4EQ6A 1JR6A 1L4UA 3E2IA 3L2OB 2FSGA 2BMDA 1F3OA 3AVWA 2H7VA 3OIUA 4E22A 2R9VA 1LVGA 4ARZB 5FBQB 2HJGA 2KB0A 2BHRA 2IF2A 4BPBA 3L8YA 4WXRA 1EXMA 1D8TA 4HZUA 2C5LA 1U90A 3A36A 4OK5A 1KI9A 3ZVLA 3RSLA 1T3SA 3BIFA 2QGNA 3I5XA 4A4DA 1X8JA 1KMQA 2JJ1A 1NY6A 4LYFA 1NIPA 1VCIA 2P5SA 4CGZA 3GEIA 1E79D 1GP2A 3X1DA 4E5UA 4MUAA 4Y0VA 2FV8A 1JAIA 3QKRA 2G9NA 4C2UA 4P0TA 1OXTA 5AJVB 3KB1A 3ADKA 2GVZC 2PZGA 5LB4A 4DT1B 4M1WA 3P4YA 1FOEB 1W4RA 1RRCA 4Q21A 5TB5A 4AIIA 1IM2A 2R6AA 2J41A 1R0YA 2P65A 4G01B 4WAUA 2RAPA 1Q44A 5FOWA 2NO9A 2W6JA 3H86A 3RS5A 2W00A 3VKWA 3VQTA 3QBTA 5JS7A 3X1YA 2F1IA 2QP9X 4MUBA 2W6IA 5FTKA 5G41A 1ANKA 1QBKC 3UMFA 3CLVA 1YZGA 3QIAA 3RS2A 4W5WA 1CJMA 3PEUA 4ZKDA 1UADA 1N3BA 2BCJQ 4BFSA 3NC0C 2C95A 4B44A 1WB9A 2G0NA 1JI0A 2GCPA 3CX7A 4JBXA 1PLJA 3EZ7A 3NXSA 4PSAA 3QOFA 3CZQA 1ZAKA 1Z0JA 2FPMA 1MRNA 1ZCBA 4PSKA 2L0XA 2QPAA 1XBTA 3C15C 4G1UC 5EXSA 4DXAA 4JLVA 4BLTA 4EQ6B 4BFTA 4EFLA 1E2JA 4M4SA 4CYMA 4GOXA 2V4ZA 4A8JB 3RC8A 4WBSA 1KO5A 1EWQA 5JWOA 3EZ6A 1YU9A 4K46A 1MKYA 3LVQE 5H68A 3G5UA 2IS2A 1KJZA 5B64A 4LSGA 4PC7A 1W0JA 1CJVC 4XSGA 5FL7D 3GLIE 4BLPA 3A4MA 2ZI5A 4RD1A 1LNZA 2NPIA 4Q7JB 4TMXA 1VCOA 4D4MA 1SHKA 2BV3A 3AUXA 1DAIA 2AWOA 3KQUA 1P5ZB 2OEPA 4Z8XA 1GOTA 3B9PA 2FJUA 4B33A 3C8UA 4Q47A 4GMXA 4BECA 2AX4A 3FMFA 3AF3A 5DSZA 1G6OA 2VHTA 2JATA 2DFLA 4HAZA 1G7SA 1OW3B 1T5LA 2QAGA 1OYWA 3KXIA 4L5BA 4U5XA 4MRSA 4KFSA 5AJZA 1ZU4A 4AY2A 3TGPA 3K0EA 1RC8A 4PPGA 3CWZA 4LJAA 3OEHA 4W5JA 4IOKA 2JIZD 2Z4RA 1KSHA 2NO1A 1IXRC 2CLCX 2QL6A 2P0EA 2RHMA 3CR7A 5JZVA 4OHZA 3QF4B 3DL0A 1Z6TA 2ZVPX 2ONKA 2RHDA 4R2HA 1HQCA 2IYYA 2B21A 2IYZA 1TX4B 3AGQA 4DJTA 1T4GA 2XZLA 4CEHA 4CEJB 1CP2A 3DPUA 2GXQA 4R7ZA 4KI0A 1KSGA 1BMFD 1ZD1A 2GHIA 1HV8A 2CMKA 5JJLA 5FTLA 5JMTA 2PMKA 2VHCA 2ZE6A 1HURA 2FGKA 2QP4A 3BORA 4V0MA 3EAQA 4I81A 3W6PA 1WBBA 2ANCA 3MAAC 4C0LA 4HUQA 4TZ0A 2J7KA 3FMPB 1F2TA 1GG2A 4UJ5A 3B60A 2A78A 2C99A 3NHBA 1J2JA 1T91A 2V6IA 1GRQA 2ZRAA 4DLVA 4U02A 1SVLA 3P4XA 3U6KA 4NL4H 4IDQA 1E9BA 4Q5IA 4Q9KA 5KPJA 2QAGB 2XTZA 3Q5DA 3GQBA 4M9ZA 2DB3A 1ZC4A 4WXPA 2W58A 4OI1A 1GL6A 4GL2A 1XEXA 1NBMA 1GNQA 5P21A 1CBUA 1OPXA 1NRJB 2FGJA 2ZS7A 4ACAA 2IYVA 4X8LA 3BRWD 1OJLA 4HI0E 4AG6A 2Q9AA 5BQ5A 1E2PA 3SOPA 3T12A 2O8CB 3KB2A 2FSFA 3UXMA 2PCLA 1RE0A 3KZ1E 2P67A 4A2QA 1XJ0A 2R6GA 3AF1A 3Q72A 4Q9HA 4LBVA 1WP9A 1KK0A 2PCJA 3ZJYA 3THWB 1SKQA 2ZR7A 4ZCLA 3L8ZA 4ABYA 5AUOB 1LF5A 4MGZR 2WTUA 4P4SA 2BC9A 5HZHA 4PQFA 3IUYA 3RDPA 2R2AA 1NIJA 4C30A 3T35A 3TRFA 4DZZA 4NYJR 1KK2A 1SVMA 3QXCA 3GLIA 1G4AE 4DHEA 3P27A 3RHFA 2QQ0A 1FUKA 2O8DA 1AS0A 4QHTA 4R71A 4QGHA 2QROA 2ZRNA 4B73A 1OV4A 1S9DA 4QBHA 3W5IA 4URYR 1M7BA 4HLCA 4M1YA 1MT0A 1C9KA 4LUCA 2QPTA 4TLCA 3ZIAA 4JLKA 1IJEA 4EJSA 4F4CA 3MFYA 2WIBA 3ND9A 3T61A 2GJSA 2RKOA 5CIQA 1GDDA 4M1MA 2Q3HA 2H57A 1IXSB 4LV5B 4P33A 3VHXA 3VX3A 4A6PA 1E9EA 4IDOA 4JJZA 5LB2A 4Q66C 2VA8A 1ZIOA 4XOIA 1CR1A 1E2NA 5L3QA 2OAQ1 2W2XA 4QKQA 2FEMA 4IRUB 4TTPA 4CEIA 3SS8A 4ERNA 4F93B 4JVSB 4LJ9A 2ZS8A 1ZM4A 4FMCB 3AVVA 2ZVQX 3M6AA 1HYQA 1Q57A 3IIKA 2AD5A 3O8DA 4EPXA 5FUYA 2JEOA 3EZ9A 5FH9A 2DHRA 1Q1EA 2OZEA 3RRNA 1G291 1MH1A 3AP2A 3SYNA 2IS4A 4RZXA 1SXJB 1HEIA 2YOHA 3SJZA 1I4DD 4RFSA 3RWOA 2RGCA 2KBEA 3I32A 3NBXX 2QU8A 2REOA 4QJ4A 3VX4A 3GLFB 5D3MB 5DN6A 1W47A 5H70A 3KJHA 3V4RA 1A82A 4IOJA 3QQ5A 1YR7A 2AWNA 4Q18A 4NCKA 1OE0A 2GJKA 1NNEA 1W5TA 3OE7D 3K9GA 1EX7A 2TMKA 1XEWX 2GJ9A 4XJXA 1D2EA 3GFPA 4KJZA 4HDQB 2J9RA 3I73A 2ZYTX 2R6DA 4TQAA 4A82A 1JQJC 1SKYB 4B2IA 4BFXA 2P6RA 3M4YA 2WICA 1XWIA 2XB4A 2GKSA 5AWFC 2PL3A 3CRRA 1H8EA 4JZKA 4UNRA 4CT5A 5FPYA 3B7GA 4ZKEA 4PPQA 3C4JA 3RRYA 4C7OA 5J4HA 3UG6A 2O5VA 2D74A 4Q01A 3X1WA 2JCSA 4MA4A 1PJRA 5FI1B 1ZUNB 2WAYA 2XX3A 1OXVA 3FHOA 3HWSA 1W5SA 1ZC3A 2AFIE 3EZFA 3QENA 4MKGA 1F60A 5EP3A 1W49A 2IYWA 1XEFA 2JDID 3HDTA 4N0EA 5BYJA 4C3ZA 1W36B 1XD9A 2AKYA 2P6UA 1QHHA 1F2UA 2G1JA 3ZQ6A 3DDCA 5KU1A 2JLZA 2BDTA 4Q7MB 4TMTA 4A0HA 4C0SA 2CJWB 2IK8A 4P31A 4BZPA 2X2EA 2CHGA 2ZYWX 2YC2C 4JMPA 4KLZA 5SZIA 2O0JA 1IY1A 2J0UB 2CL6X 4JS0A 2YJTD 2GJ8A 2ZE5A 5KDOA 3GP8A 5JJKA 1U81A 1GITA 4HATA 4JLMA 4I4LA 3R9WA 5B2ZA 5J4KA 2ZIAA 5DHAA 1TAGA 5L3QB 5F9FA 1LW7A 4NCNA 3U44A 4LC1A 4LDJA 4F92B 3ETLA 3GJ0A 4Z1MD 5G3YA 4PHFA 2B6HA 1FPMA 3SYKA 2DY1A 4K8OA 4MKHA 1J70A 4XWAA 2CHVA 5FI0B 1CULC 4MDFA 2JLSA 1OHHA 1RPZA 1LS6A 4TYQA 3NBZC 3ADBA 4U7DA 2YOFA 1M8PA 2VP2A 3F8TA 3OEEA 3OAAD 2PLRA 4JL6A 1VCNA 2B7CA 2A30A 3SQXA 4Q1BA 3OIYA 1D9ZA 2OUKA 3DM5A 4HDCA 4URZR 1NLFA 3LLMA 1KDRA 2F3TA 3ZH9B 4GP6A 3SJBA 4LY6A 1NMXA 3ZVMA 2BBOA 5J40A 4US1R 3TSOA 4YDHB 3ZDQA 4ILEA 1H8HA 3CH5A 2JLWA 3WNCA 2WSMA 5AR1A 1UEJA 5CYOA 2E9SA 2EYUA 5L3RA 1LF0A 1AZSC 1GAJA 4WA7A 1CXZA 4DWJA 3THWA 1CJUC 4RKEA 1DAEA 3OAAA 5EE5B 4NKRA 1WF3A 2CCJA 3A1UA 4AKEA 2NOAA 1IN6A 4QBIA 1E9SA 5EXXA 1KHTA 4Q4LA 1EFRA 3U3OA 1P2VA 1NL3A 1JXOA 3B9QA 2R62A 3HYTA 1ESNA 1CEEA 1GILA 5HE9A 3K09C 1BH2A 1Z0FA 2GWHA 1ELOA 1G19A 2WKRA 3RAPR 5FOVA 3O8BA 2IA5A 1KY3A 4LZZA 3U7FB 2NO7A 4CT4B 2CHQA 2CVFA 3F0TA 2I3BA 2D4HA 3AVOA 1TUEA 3EA5A 3U2QA 1AZTA 5TMPA 4W7SA 4A0GA 4DIEA 1P2SA 1S9HA 1RW4A 3IBGA 3LD9A 4X8HA 1Q20A 4IOLA 1G3RA 3OF5A 4DUGD 721PA 1KNXA 1Z29A 1L2TA 4RCZA 5KPDA 1OH8A 1S0UA 1FX0A 4OHWA 4URVR 2FN4A 4B48A 3IO5A 4Q02A 2ZUBA 4NCJA 4MH0R 3T06B 3A37A 4B3CA 3QPWA 3LV8A 3X2SA 3EPKA 3I62A 1XCMA 2UZIR 4DSTA 2IL1A 2VBCA 5HCNA 3D3QA 4NYMR 4O0MA 4E09A 1NN3A 2IYUA 1BIFA 3FB4A 1ESMA 3KFXA 3RABA 4QGGA 3SYLA 1ZYUA 1XTJA 1K8RA 3B5JA 1RJ9B 1YRBA 3TUJC 3LX8A 1HT1E 4KV9A 4BLRA 3PFIA 4R2IA 1Z06A 5DLQC 3F5FA 1EX6A 4PO9A 3AM1A 2ANBA 2O52A 2ZR9A 5KNCA 2DWOA 3QKSB 2O0HA 3SE0A 1KJWA 1WA5A 3A1WA 1I2DA 4IKEA 4M1OA 5FTJA 4LJ7A 4PAOA 2EFDB 3RWMB 4JL5A 1JNYA 5JS8A 1NBME 3ICEA 2XXAB 1XXHA 4PZZA 4LCBA 4AD8A 1YZKA 4Q1EA 5KO2A 2Q0HA 4BQSA 1N2CE 1KMHA 1DE0A 1U98A 1JJ7A 3OE7A 1MR3F 4BFYA 4DEYA 2KE5A 1U8ZA 4AKIA 3TW8B 1DO2A 4KODA 2QM8A 3PV0A 3A6PC 5EP2A 5JEEA 1S8FA 3ADDA 4WW0A 2FE4A 2CEAA 5FBLB 3OFND 2FH5B 5CDFE 2O8BB 3EPJA 1FNNA 5FPKA 1V5WA 5CJ2A 2CK3D 1ZRHA 4O25A 2OLJA 3AKDA 1QHXA 1TQDA 5JBQA 2C9YA 2RGDA 3LLUA 3FTQA 3LFUA 1HT2E 3TK1A 1N5JA 3KUCA 3T1QA 1IN7A 3IO3A 3CNLA 2AK2A 4XVRA 5C1BA 2C04A 5BXQC 4F4IA 4M53A 2RB4A 4HSEA 4R98A 1XTKA 2CNWD 1ZNZA 3OEHD 4TLAA 1FX0B 3AVYA 2QMOA 3QKSA 1JXMA 1N6IA 3RRZA 3V4FA 4DIDA 3HPRA 1XD8A 2O8FB 4AKGA 2EW1A 1AGRA 3KKQA 1P7CA 1SZPA 1G5RA 2VTKA 4JSYA 1TADA 1NVXQ 5B57C 3B1ZA 1K6MA 3PITA 4WZAE 1VG9B 4G3XA 4C9BA
chains in the Genus database with same CATH superfamily
1J5EB 2W5UA 1VKZA 2J4DA 2JFVA 1Z39A 2ZREA 3G2MA 4J07A 5FQOA 5HIJA 5JZSA 1TECE 4XIYA 1PT7A 1UBEA 3VC1A 2SKCA 2MIIA 3NASA 2UVQA 3OPYA 4LK2A 4N6OA 4WKOA 1CV2A 1L4YA 2QJFA 4QOGA 4D4IA 1T5OA 4M8NE 5CFOA 4GLBA 1XWFA 3HACA 4Q4JB 3W1WA 4LEIA 2J3QA 1OWLA 1W19A 3OU2A 5FUXA 4H4CA 4OK3A 1UWCA 2EJBA 3B52X 1R0RE 2DLDA 2O1SA 2HJVA 2WVJA 3QVUA 5J5CA 1F8UA 1Q12A 1V8BA 3DHYA 3LFTA 4D3YA 5K0EA 5LXTA 1B0AA 4OMUA 3UH0A 2ZCJA 4PFJA 4Q15A 3W5JA 1QUEA 4HD8A 5BMVB 5G0WA 5DNUA 3KQHA 4YI3A 4Q37A 5DASA 4C06A 1JDUA 1I32A 4MGKR 5AM5A 4ISCA 4AG5A 1SU8A 3K0CC 3VOBA 3K5IA 5FFMA 3X1ZA 2B36A 3HU3A 3KTAB 3ROPA 4DLZA 1JVNA 2XKAA 4PX5A 2W42A 3AGPA 1ZZGA 1N5MA 3H2SA 3OQJA 3VHXB 4BBZA 4EL0A 3UWDA 5A7HA 1VCMA 5CNMA 3KEGA 1MB9A 5ESWA 4KSCA 5HIIA 5BVHA 5C9ZA 5HSGA 2PM8A 5LD2B 3KRTA 1XHLA 4IY1A 1K4MA 1Z4NA 2LCQA 1GAXA 4CV0A 3N3AC 5BURA 4NYJQ 1XXHB 2VN8A 4H31A 5AHXA 3DBLA 4ZALA 4S1OA 3LUAA 4YRBA 3P0EA 2X6RA 4W63A 3CVXA 4PAGA 5TF0A 2FHSA 1EGAA 1GRCA 1YJBA 1JU9A 1X1RA 1T34A 3NBUA 3VJMA 5DM60 1VBFA 4CXMA 1XLTA 1MLDA 1KI4A 1OKKD 4EHAA 4ARIA 3K70B 4KMMA 3HN2A 2IHYA 3WIDA 3H97A 3LYAA 3O74A 5DK6A 2ODTX 5JWHA 3UK6A 2VJOA 3F5QA 3MWDA 3WNBA 4C0HA 2DAPA 2VJQA 4E4TA 2WU1A 5K3CA 1UKBA 1EHCA 1FYDA 4AYTA 1XMOB 5T4EA 1Z0DA 2P78A 3NVMB 1Y98A 5KCZA 2OGUA 1UT6A 2GESA 5CD1A 2QLTA 1N1DA 1H69A 2H0QA 3DC2A 4U8HA 1Z0SA 3OZ7A 2W37A 4F0JA 1A1VA 1ND5A 2OP0A 1Z0AA 4PHTA 3FHCB 2YWCA 3ZCVA 1SIUA 1SRRA 1XYGA 4ZI5A 4NH0A 5HZMA 1UMBA 2ZKIA 2XH8A 3EBLA 3VR4A 1OB5A 1PDWA 2WMNB 4G26A 3OUZA 1FDTA 5DCYA 2O0KA 4HQNA 4BWGA 1D9XA 4DV5B 1G0NA 4MITA 2WSSD 1QYRA 3V32A 2WWGA 4CLRB 1IUPA 3HKCA 1HFJA 3OJOA 1R4MB 4QELA 1VZ2A 2V9PA 5I5GA 4UDXX 4B47A 1MEOA 3H42B 2EEPA 4M83A 3LCRA 3ZC3A 2WA2A 3R3VA 3RM3A 1M7GA 1ILWA 1T0BA 3LK7A 1LUAA 1MB4A 3DWGA 2IPAB 3FYUC 1C0PA 2N42A 5JAHA 1TVKA 1M1YE 3HVKA 4OHXA 4GVLA 4UJ3A 4V1CI 2NU9A 1QH8B 3LKDA 3LO8A 1IBMB 3MMSA 2G25A 2VAPA 2XMQA 3FR7A 1NRXA 2QJWA 1M8FA 3T1VA 3DEFA 3WYAA 4BKPA 5C80A 3ZCPA 3MWYW 4LBWA 4JUAA 4JYCA 2CLLB 2JLRA 1LLQA 5LP6C 4BP1A 5TIIA 3U0VA 2RH9B 1M2VA 1JMYA 3RAJA 2VP5A 2YIDA 5B1DA 3ZDCA 1A4XA 1C9MA 1JYEA 1ISSA 1VG0B 3OBIA 4KQEA 3RJTA 3SY8A 2BJVA 3FHLA 1ULTA 2BW0A 2WYOA 1DFGA 4DMKA 3W3AA 3GFOA 4H7IA 1YASA 4QXAA 4BO4A 1SJ9A 3VU9B 3PQ2A 1UBHS 1TU4A 3L06A 3RJZA 4KX5A 3V1KA 3ZVRA 2AB0A 4URXR 4AKSA 1U7DA 1GQYA 1KH1A 3MLEA 1JDVA 1UOPA 4RGVA 1WEHA 1RYNA 1ZZEA 3A1TA 5KHLB 1N32B 3A04A 3KG2A 1U11A 4P22A 3PPYA 4JKYA 4IHAA 1TQ2A 4ZVOA 3S70A 2Q1UA 3IVRA 3SU8A 2RAUA 2V7QA 4LFAB 3GJRA 4YP1A 2J8ZA 4X93A 1KOLA 3V4ZA 1SUAA 1QIIA 1RJWA 2G88A 1NNSA 3USZA 1YKGA 4ZIRB 4O3MA 5KWJA 2ZYIA 3I6ZA 2CV0A 3NGLA 5LQNA 3N05A 3UJ3X 4PFQA 3ZCSA 1W5BA 5TQ2A 1QGOA 5FPHA 4M9UA 1ECFA 4HB4A 4UUOA 3STWA 2GCNA 1O97D 4WPGA 2Y27A 3KYDA 5EIOA 2PGNA 4HWSA 3FDXA 2G36A 4JY7A 5K0ZA 1G64A 3RG8A 1TQ6A 3E58A 4QYIA 2R6CA 4GUAA 4FNMA 1I0IA 2L19A 4MGEA 4QECA 1XFDA 4V0LA 3SPXA 4BVFA 2IEIA 5CH8A 3UT6A 1UBGA 1W4LA 4F3CA 3NFYA 2VTBB 5A4FS 2MINB 2BDEA 2BH2A 1IN8A 2O2DA 2Q1WA 2JI8A 1TYZA 4TLDA 2DKNA 2XCSB 1ISIA 2HZBA 2J5XA 2DSNA 3I9KA 1WV1A 2R25B 1WAMA 1GQ2A 3DKPA 5H80A 4GC5A 2QRMA 4MCAA 4WFQA 3ZZNA 4ZAYA 2XCQA 3QPUA 3U7GA 4LGYA 3BJIC 4GX0A 4HFMA 1GUAA 3FD8A 1HG1A 1D2MA 3O93A 4X84A 4KX3A 3VYTB 1NXSA 1S89A 1PI3A 5G02A 4CR7A 4RYLA 7MDHA 5CFNA 3IDAA 1A9QA 2ARKA 2QTMA 3UOAB 3MCVA 3AKEA 3G2IA 3F7NA 4Z1MA 3WZ2A 2EAUA 3BMXA 2GFHA 4P36A 3HADA 4MI1A 5CHEA 3NGXA 3MOIA 3TZCA 2Z6VA 3G8DA 3K16A 4NCXA 1RACA 1NJGA 3NXKA 4WJLA 4MVJE 4V1CB 1CZLA 2BI8A 2CFRA 1VIAA 3EVDA 3QMWA 4QSMA 1FVOA 1K8QA 2NXNA 5DLEA 3V80A 4F6LA 3SZRA 3EJWA 2C98A 5K99A 2FEPA 4TUYF 3D0KA 2FP4A 1XU7A 2X1HA 3IHWA 1XTQA 2AW5A 3QPBA 2UZAA 1P17A 4JB0A 4QD3A 4LMBA 2BGRA 5IDVA 5I7WA 3DCJA 2VUHB 1Z6ZA 4WCFC 4QQ8A 4GI7A 1EFTA 3HO8A 4B82A 1MJGA 1EVYA 4KQ1A 5TJHA 3N2NA 3DVQX 4MB6A 1NLZA 1SK8A 3SZUA 3WB0A 3QXHA 3UUFA 1N6LA 1FUUA 2GZDA 4I2VA 4TLBA 2GTIA 1KPIA 5CLIA 5F52A 3VNRA 3E7FA 3W3ZB 4YYZA 9LDBA 1II0A 1J56A 1XVLA 2FPKA 3JR3A 2ATXA 4JLNA 2CNOA 4IJKA 3R8FA 1V7CA 3R77A 1R8QA 3OZAA 4IVNA 5DI3A 3WY9A 1AXEA 3ZHYA 2QTTA 4F7WA 3GW8A 1C7JA 3K4QA 3PDHA 4BO7A 1HDRA 4KQMA 3O38A 4FB4A 3IPCA 4PZAA 4DQKA 2GYVA 2X7XA 1N6PA 4PG5A 3AQIA 3G9UA 3HWX1 2BGMA 2EVWX 2E3JA 3I01M 4RELA 5CGQB 2AI2A 2XUGA 2E82A 1L7MA 1C7QA 1VFNA 3DDOA 3IEPA 5E7MA 3BULA 5E6UA 5SYAA 3TX2A 2VDNB 1P73A 4LPKA 4WOJA 5LQMA 2CCGA 1OIXA 2NGRA 4YQYA 2PSJA 2MTBA 4CODB 4HB0A 1FZQA 5DVZA 2HB6A 2HSEA 2IHZA 2WM8A 3EXHA 3KOOA 2GTHA 2JAPA 2B7BA 4IIGA 5C32A 2WQ7A 3AJDA 4ZIRA 5FOUA 5IBCA 3RADC 4Q3OA 1N8SA 1NW9B 4IGFA 4FCWA 4OLJA 5HQ3B 1ZSVA 3HJNA 3O4VA 4KNYA 1J39A 5DYTA 5LNK6 3V8NA 1CUHA 1I80A 2X77A 4JVLA 2ZM5A 5SZKB 3JALA 3EN0A 1BXKA 2YHAA 3TQRA 2VPQA 2G5TA 3A1CA 2H2AA 3D4OA 5ISMA 1MP0A 4QX6A 1E2BA 4B4WA 1SC6A 1VKJA 3H18A 2XZDA 2OHFA 4UMDA 3AI1A 1VJ1A 1KDYA 1MABB 4QNMA 4WLUA 5ALSA 2YJ4A 4BMCA 5A0VA 1M0EA 3UUEA 2GN1A 3AFHA 1JDNA 3HPQA 4YAEA 4UNPA 3UJ6A 3PEWA 4MDEA 4GLOA 2IY7A 4MJLA 1ZW6A 4EG3A 3ZG6A 5EIWA 1ZGHA 2X1LA 2YWRA 4I4TA 1O89A 1XCLA 4MQMA 2JFWA 3VAAA 3G0IA 1RWPA 3C87A 1GFWA 4NESA 1IUKA 3CV3A 1TTHA 2JASA 2OM2A 1JG2A 2JI7A 3RS9A 1TD9A 4UHHA 2GCOA 5GJVC 1B8VA 2V5AA 2AK3A 1L7PA 5AW0A 4HDSB 3AYXB 4I19A 1KFCB 1FF9A 3K1ZA 2AZTA 3BB4A 3U4IA 4I0WB 4P3PA 3BERA 1USUA 1DTEA 2H52A 4YGXB 3WLEA 1K5DA 4UMFA 2GSWA 2VLIA 4NBUA 5F73A 1ZD9A 2CHFA 4CU5A 2YMMA 3MT8A 4EMUA 2W71A 3ETCA 4XEUA 5SICE 2BFFA 1A76A 3TKYA 4E2ZA 4KC0A 5EJAA 2Q6KA 5LUBA 3UAZA 4ZI7B 5BVHB 4HH1A 5THXA 1Y8AA 4M49A 3DVRX 1BXZA 2IHUA 3HBLA 4QUHA 4AWBA 5B7PA 2QUHA 2G82A 2A9JA 3HZZA 4HGNA 1G8GA 2OP1A 4RK7A 3K72B 4QG3A 2P5TB 3ANYB 1YZVA 2V7BA 3EGWA 2UZ3A 1T0UA 2CNBA 3VH3A 2H48A 2LGJA 1U8YA 1RZVA 3N58A 1CUFA 3ZHBA 4CM1A 2UUAB 5K0CA 4TVSA 4HXGA 4WKCA 4WNCA 4I66A 4MCJA 4ACBA 3F73A 1QTRA 4UCWA 4G9BA 5HTKA 2R8BA 4RYDA 4M36A 2IYRA 4FIDA 5JSZA 2ZDQA 3CH7A 1NVUQ 3M89A 3BWBA 2XCRB 3GLIB 3OOHA 4DIFA 1RKBA 3JPWA 5JY6A 2O19A 5LDDC 1M74A 3EBPA 1UMCA 2GASA 2ODQA 1D4FA 4MQFB 4RMIA 3SJAA 3T5BA 3OA2A 3HXMA 1N2BA 4UC0A 1YGPA 4OMCA 2PEZA 3RVPA 2YICA 4D8YA 5ICCA 4NXNB 2OV2A 1P8JA 1X7ZA 4DDHA 4QFCA 3AL3A 3E70C 2JK1A 4PAQA 4C6TA 2WUEA 4B3HA 1GNTA 1P29A 3MSXA 4YXFA 1J2YA 4KWEA 5BT8A 1JN0A 3AU9A 3L7BA 3GIDA 5KYVA 3MJEA 3LP8A 3R5HA 5DBOA 4RKWA 4L73A 1V5FA 3T54A 3LUGA 4CEJA 4NFYA 3VNBA 4AYWA 3MT9A 4LGCA 2B1RA 4OYHA 3CUYA 3D8UA 3A4NA 4DLSA 2HCFA 5HQTA 1G8MA 5JZOA 3C3BA 2H59A 4D26A 2J0QA 5FV7A 5G3ZA 2GUWA 4U7WA 1PVVA 2O0MA 4RY0A 1QVVA 3DR5A 3SM3A 1AUPA 1IM5A 5EC8A 5C53B 4CCYA 3FJOA 3R5SA 2ZULA 2IEZA 2E4AA 5P8WA 1QH9A 1AMOA 3UXHA 3PUXA 2HYDA 5KOYA 2FWNA 3UATA 1JTEA 4EJ6A 1HSOA 4C3OB 5BP7A 4S2EA 3IQZA 1KIMA 4FHEA 2Q3BA 5CLQA 1QZXA 4RZ2A 4B7CA 4YV0A 4DADA 4B4KA 5I9IA 1TTQB 4ZV4A 4ZZ0A 3AVXA 2H85A 4XWYA 3GRRA 3ORSA 5IBPA 2ZROA 2RARA 3ICPA 3P19A 4UPEA 2OK8A 2VC2B 3HY4A 1BOOA 1E9FA 1EG2A 4D4KA 4XRGA 3TGLA 1EUQA 4OSOA 1NQUA 3BTOA 4YAUA 3QE3A 5F7JA 3QSGA 4MW6A 4BFZA 2C59A 3NV9A 1E9DA 5F3DA 2D1QA 3K2BA 1ZJ5A 1ISRA 3DZ8A 3KOZA 3LE8A 1CJSA 3LCCA 3P9PA 3V4LA 4E51A 1GZ7A 2NLOA 3DD1A 3AHJA 1RWNA 5AVOA 1IPFA 2XTMA 1W75A 4OA8A 4G0QA 1V25A 1OLOA 1HE3A 2QT0A 3CGWA 3W5SA 5T3UA 4G5RA 5IANA 1NWHA 4UU1A 1GTZA 4BX2A 1SVNA 5EE1A 4PG7A 4Q1DA 7ABPA 4EHLA 1JL3A 3L6EA 3TF5A 1NR1A 2IOFK 2R6ZA 3EFBA 1IN4A 3PNLA 1LC3A 1MIOB 1GTVA 3I2FA 3ZJ5A 5DGTA 5EIHA 3CPJB 2ECQA 1SCJA 1GU0A 1PZXA 3OFKA 1W581 1T8UA 2W2KB 1XZIA 3GEBA 3L9WA 2VYCA 4TGLA 3AZQA 4MV0A 3PSHA 3L82B 4FBGA 3A6HA 3DAHA 1WNFA 1T8SA 1UBOS 4PCLA 3ZKAA 1DAHA 1AN9A 4XD7D 2H8GA 13PKA 4JIMA 3SSAA 1KKLA 3AP3A 4G56A 1IL0A 4OATA 1VA4A 3OUUA 3GOQA 3OH8A 3I5UA 4YCDA 1EJ2A 1DX9A 2D5IA 3KEMA 3KSUA 2R1TA 5C8YA 1H0HA 2MYUA 2WZDA 3GWGA 1HE8B 1II8A 2OTCA 3C7AA 1GV0A 1PNVA 3L7MA 2HF7A 4OQLA 1X1TA 3CS3A 3KWMA 5I8WA 1ADCA 1ZS9A 2HPHA 4OHPA 4LHYA 2X0FA 5JT1A 2WWYA 4D99A 1B2RA 3AHEA 3HE3A 5AW8A 1GNPA 2RHRA 3TMKA 5AVUA 2NPFA 5LUAA 1MX1A 2RB5A 1E2MA 1YI8A 5IK2D 5K45A 3ZDDA 5EUCA 2VKTA 4PGAA 4V0NA 5JNTA 4HNRA 1PHPA 1ZK1A 3PUZA 4DLKA 3GD7A 3L77A 3LAWA 1R0CA 3BB3A 2CY0A 1K4KA 2I71A 3O1LA 4I1VA 5AUQA 3IT2A 4TWAA 1P4RA 3E7WA 5DOVA 5AVQA 2P8JA 5F21A 2ZU0C 4RGYA 3I1FA 4TMKA 1E1RA 1FQOA 1G2IA 3K5HA 4ZGBA 1GLNA 4BWVA 2BGWA 5M5BA 3U61B 3FRHA 5LQCA 2AGVA 1EIZA 1R74A 2BKUA 3EXEB 4IVPA 3N2GB 4P4NA 4ANFA 4DNPA 1O8CA 2WWWA 3GLGA 3OIWA 2IHNA 1UL1X 1NONA 1CJCA 1H4SA 3E84A 3E82A 1CRZA 1GPWB 1H2ZA 3C6ZA 1IEQA 3JD1A 4OHBA 4TROA 4CCSA 2VUIB 1RFGE 4LNAA 4QVIA 1XTIA 2CFOA 1K06A 1LV8A 3V4SA 1HYGA 5HTOA 1PS8A 2HFKA 3H11A 2VUTA 4FDUA 3TNDA 1USVA 4IINA 5LWQA 2BSXA 1ZITA 2HA4A 4CCAA 4DLBA 1E5VA 2H3EA 4GR4A 4I55F 1SG6A 1CRWG 1RAEA 3AIOA 4RJ2A 4DCVA 3FNGA 2ZJ7A 4RDXA 3RYCA 3M6LA 3KC2A 3WXBA 3W5CA 1DRKA 2AA3A 2LKDA 3GUUA 1XA3A 1X92A 4FE7A 3KDAA 4V1CA 3ICQB 4DCMA 2WPDD 3C3PA 4X8OA 4NULA 1QHYA 1XPRA 1YQ9A 5I5EA 1GTG1 4B3TB 2A5JA 1CY8A 1NATA 4UNSA 4DV4B 1NJ8A 1I3KA 2O2CA 5A05A 4CMJA 4C4ZA 4WBNA 3ZV6A 2JJ2A 4HNUA 5GPBA 1EWRA 2DPXA 4TRRA 5EMKA 2B5OA 2WTBA 1NVTA 3NOOA 5CXSA 2YWEA 3L7LA 3RTGA 2BLLA 4DR5B 4CWAA 1SD1A 3MW8A 3NYRA 1SMKA 3O8OA 4C4TA 1FC0A 1IG0A 2PIAA 2IPOA 4HEHA 1WXWA 1RWQA 4U2DA 3KQVA 4JVNA 5FLKA 1JQ5A 2FY8A 1BWRA 3LRPA 4KWHA 3NOQA 3NTOA 3QUQA 3EGDB 3LXRA 2PBLA 4TLMB 2NZXA 5FTNA 1JHPA 3LSTA 5KCMA 3V4PB 4R1LA 3DMNA 3RVJA 4A2WA 1QTQA 1ZH6A 2PZMA 2ZI9A 3TTUA 3F6RA 2F7SA 3HU1A 5BWNA 5UKDA 1E4YA 4BKQA 3DG9A 5FJJA 1VA5A 2MMCA 2N0SA 2WEKA 3DFZA 3MGCA 4II7A 2AXPA 1ZJZA 1IBSA 2VDUE 2B5VA 4J2HA 4M9QA 2I8AA 1FP6A 1LY1A 4RFVA 1U4SA 2Q3MA 1CD5A 3C3YA 3IP3A 5KMGA 1UAAA 1ZBDA 2PH1A 1WU8A 2VXYA 1Z62A 4MVJF 5FOQA 4NATA 2N46A 1V41E 1TF5A 3SHFA 5BSWA 3OZFA 4BV2A 1M0TA 1Q21A 1J1IA 3FAZA 3SJCA 2GEDA 3IMCA 1TCUA 5IJWA 2KPOA 3VU0A 4RM2A 1XALA 3DMDA 1C7FA 3K0SA 1TMOA 3KDPA 3E1SA 2XUHA 3NHUA 2O5CA 1LWOA 2Z6QA 1H3EA 1CUGA 4ZA2A 4BQRA 2F55A 4GYWA 3K6SB 3E3LA 3C14C 3ZBUA 2RGYA 5BWBA 1JUDA 2ZJ5A 5T8KA 4FHZA 2LDBA 2JVKA 1A7UA 3CA8A 3CNQS 1Z73A 4O4HA 1REQA 1PJQA 4ENRA 3R5XA 4C0AC 4IVRA 5JHGB 1ZR4A 1NBHA 3EXEA 1YQQA 5CA0F 2XIQA 1G5PA 3HRHA 5F2EA 4AB1A 4L02A 1ZH0A 2B69A 4CKZA 4LE1A 4MYDA 2Z2KA 3B1YA 4TYPA 4BC1A 1W0KD 4HV4A 2DYKA 3ZHRA 4GBJA 5JHHB 3ER9A 2DWPA 1RVDA 1BTOA 2IXBA 1F12A 3K2IA 3MUNA 1I94B 3OJ0A 1QGED 2F9FA 2OXEA 2FFRA 4IYRA 2GEKA 3VPFA 3WMEA 3NIDB 4C2TA 5ARCA 1YIOA 2HXYA 2RI0A 3RUFA 3T5TA 3SVLA 2PIDA 1TA9A 4AJKA 1U7UA 5H02A 3HP7A 1YVDA 3WLPA 1N78A 1VC2A 5FO0A 3UK1A 2BMJA 3T3EA 1SOWA 1PR0A 2O8EB 2I6GA 2WWIA 1Q15A 1RC1A 2IYEA 3ICOA 1I4TD 1U7PA 1P1CA 3IP8A 4GVXA 4ZJZA 2QNBA 1DCKA 3MGKA 2VP9A 1ZICA 4Q9JA 1EVKA 5F5XA 1SOAA 3QSYA 1P7ZA 1D5CA 3D4IA 2EW2A 5EIFA 4H4DA 3ELYA 1Z82A 2ZAGA 5FUVA 1SC9A 2P77A 3RGGA 4IOMA 2BPOA 3U0BA 5A4DA 4XYGA 5CT4A 4B44A 5BV8A 3L7IA 2W0SA 3IHLA 1KO8A 3QUSA 4H6VA 3ZEIA 4V0OA 4B7UA 2ZBUA 1P75A 1QHEA 3TLAA 4NHEA 3T1YB 3I2IA 3LKBA 2BFWA 1U7OA 2F67A 4BNHA 5FBWB 1IY2A 3QTLA 5BUSA 1H6BA 1T2NA 3GRVA 1KEVA 4R31A 4TTQA 4EBBA 1CJTC 3FMGA 4JKOA 4EW1A 1K86A 1VPWA 4OM7A 1EM8A 1IRIA 4UUQA 2F43B 2WJPA 4WHMA 5CNKA 1BQEA 4LZJA 4P9NA 2PAAA 3RW9A 5K09A 2GEFA 1MQ8B 1ODLA 3FPAA 4HEJA 4D3DA 2C2XA 3I01A 4RETA 5DWDA 2QEQA 1PBTA 3PICA 1G21A 3EXHC 3OF3A 4WY8A 1JU3A 1BJRE 4ARSA 2IX3A 1DKOA 3VISA 3CX8A 4LJRA 4RKFA 3CW8X 3BZUA 3TNJA 4MHOA 4LHVA 2NZYA 2C1ZA 2O7VA 2WFLB 5AKEA 4YJ3A 1JWBB 2P9YA 2YZ7A 4Q3BA 1PWHA 2HBYA 5HCUA 5ILQA 1WZNA 4A5SA 3FOZA 4FZ5A 2W48A 1HMPA 1PGPA 1NTOA 3M70A 5DNEA 3CQ9A 2MR6A 2WD9A 3J7TA 2J0VA 1E1QD 1CDEA 3MBOA 4U39A 2J7PD 4MUGA 4QARA 4RIFA 4YP5A 4NU5A 1X1SA 3PQCA 2QG6A 1VBMA 3HV0A 3KR9A 3SICE 4DBZA 1KP2A 4P6VF 5JOQA 1PVOA 2II6A 3LXMA 2HRRA 2VRWA 2EQAA 4R8KA 4W99A 5CA0B 4UKDA 1CRLA 1XMJA 3MIIA 3SP1A 1VLMA 3PTZA 2QSZA 1T2CA 2NQ2C 1UJCA 3FLEA 3OOWA 5ELMA 3U4QB 2PO5A 3QTTA 4HDMA 2MHCA 4DMUB 1P9OA 4ZVUA 2HJWA 1U0LA 3TM4A 4HUTA 5AQ1A 3ILHA 1XKTA 2ZIZA 4IEIA 4RVFA 1SCUA 4UDYX 4AF7A 4EJSC 4TS3A 5BSFA 3CB4A 4OFZA 2F43A 3ZWMA 4KXWA 2DKOA 3TIXB 2OECA 4KFUA 2AXNA 4RS3A 4YLGA 1WO8A 1SBNE 4GI2A 4RJJA 5EJ2A 4R40A 5FWYA 1DDOA 1ONSA 2WHPB 2WYIA 1LBTA 1M2KA 3K2EA 3LQ1A 4Y1FA 1NJFA 5C34B 5MDHA 3I2GA 1AKEA 2VYVD 3ICVA 4J1NA 4WINA 3U5ZB 4R2MA 4BGUA 1UKCA 4RSRA 2QBYA 2AL7A 3C3KA 2D62A 1DKQA 1NQVA 1VB3A 1WTCA 2QX8A 1QH1B 4DY6A 1XQWA 1ZUWA 4CW7A 6ADHA 1G6HA 1HFEL 1QQBA 2W2MA 1IJKA 3HWWA 3PXBA 4OMDA 3D2BA 4IWYA 2ZSDA 1GKYA 2UUBB 1K97A 4NMLA 5LQSA 3FZNA 2R6R1 3A0RB 3R5FA 1M5UA 2YVUA 3GMSA 5ER6A 2IHTA 2YVQA 1SVWA 3GEMA 2EZUA 4B79A 4C0QC 5KJCA 1Z7BA 2J5RA 2ZAOA 3DLHA 5JTTA 4E7OA 4Q48A 1PX2A 3QFSA 1CS0B 3LPAA 4ZEXA 5CBKA 1GQSA 2O3RA 4A36A 3V46A 3H2HA 1FFWA 5FA6A 1H2BA 3QEMA 2L42A 3P2JA 2G83A 4YONB 2R3SA 2J3MA 3QEJA 3QKRB 1E7RA 4Z7JA 1P6UA 4WUVA 3KLNA 4MIKA 2XT0A 3E48A 1RXCA 4RIEA 4Z9XA 4LZNA 4JYPA 3KQLA 2FZEA 4C0JA 4R1QA 1CY6A 4HWOA 4QRHA 2DH5A 3TIGA 3G8YA 3GPBA 1JQKA 1DKNA 2WJJA 2XSZA 2ZE7A 3FYHA 3ORRA 5AOBA 1L7RA 4CM3A 4B3SB 1TE2A 1XZKA 3UWMA 3RANA 2AMJA 3R0XA 1KRWA 4FFBB 5JATA 1F51E 4X20B 1ZH2A 4DRZA 1Q14A 1YR3A 1SBTA 2LPMA 4YBRA 1GTRA 4MW2A 2DLCX 4ZGWA 2VIIA 2H4JA 1Y0BA 2ZDGA 4WK0B 4RHXA 1OT5A 1XZEA 2WLSA 4XX1A 2FZLA 3SDZA 3DEZA 1UK7A 5HX7A 2P3SA 4GRIA 1HL3A 1WM1A 3QV2A 3COJA 4KO2S 1T5SA 3LP6A 5TRTA 2P2DA 5G53C 2E37A 1S3GA 2ODWA 4MYCA 4D4GA 1W36C 2PRZA 4EMBA 2QORA 4CLEA 4NBVA 3LVBA 1NVFA 3F5SA 1N1MA 2IT1A 5LCXA 3RYFA 4DSUA 4ARCA 1ZKMA 3DDNA 4LE0A 3DNMA 2ZBEA 2ZRIA 3FIUA 3FYTA 4HMQA 3ZWYA 4F71A 5IKPA 1T1RA 1ODIA 5IKMA 1B41A 5EG5A 2PSDA 4N5LA 2W4MA 4Y6LA 4ZRNA 3T3GA 2BEUA 3STTA 5FA5A 2V9CA 3KL2A 2E85A 1J0XO 3LS2A 3OU6A 4R01A 1HMYA 1QDEA 4QICA 2X42A 1BEEA 2BKLA 3FBTA 3HBNA 3KVOA 3NG1A 1IXYA 3NVDA 5JC8A 1FMTA 2GD0A 2VF4X 1C4OA 5U4XA 1AGPA 3E27A 3OO0A 1ZU5A 4DTIA 2IDMA 1E9CA 1ENOA 1FMLA 1UFKA 5AKZA 4R68A 4EDHA 5JLJA 3C8DA 3EDQA 4UZFA 2AF4C 2BWJA 2W7TA 1JLMA 4YMSA 5AKHA 2Z9CA 2X9QA 3GHYA 2EGUA 5DI9A 1OA0A 2F8SA 3T1OA 4YRLA 1FTSA 1QPBA 3LH5A 3PT9A 3UNXA 1RMTA 5L6MB 4U0JA 5FR1A 1JDSA 2JJ8A 2Y99A 4NOMA 3UB4A 3ZDYB 1YR9A 3UQZA 1YOVA 3DV9A 1HG0A 3U1BA 1DG1G 3VO8A 2NXJA 2FEWB 2HTEA 2CLIB 1AM4D 3P0RA 3EUWA 4QJ5A 3GAFA 4M38A 3HDHA 5DLYA 3UH1A 2X0DA 4MGYR 2GA9A 3H4IA 4PLYA 5PGMA 5K2OA 1CR4A 3BVPA 2QI9F 2GRUA 4LGMA 3GC6A 3OECA 3O2QB 4QOIA 5BSHA 3N0RA 4L51A 1M1ZA 4D3ZA 1KAHA 1YK1A 2ONJA 4HDOB 1Y81A 1YQGA 3VMMA 2W0MA 3H6HA 4EJMA 4UOZA 4PYMA 1SPBS 1JFTA 3ZHQA 2BMFA 3TEJA 3VR3D 2JBWA 3OP1A 2PYDA 5DHTA 2FEOA 4EB3A 4ZP1A 2QN6A 2XWPA 3HY6A 4KLRA 1HZZC 4JT8A 4QRDA 4WBNB 5KUTA 5CVEA 2D1YA 2RMKA 3QP9A 1UJ4A 3N74A 3WP1B 1Z15A 3BXXA 1TEHA 2O54A 3RK1A 3A0UA 3JQFA 3WNZA 4X6LA 3WFIA 4P4LA 4W9NC 2XZOA 4U3JB 4RIHA 1ISMA 3LUPA 1HI9A 4PLWA 3EPLA 2IDJA 3GLSA 3KWJA 2VXCA 3MBIA 4OAPA 1ZJWA 2EIXA 2FWAA 1V8ZA 5H5JA 4PYLA 1KDVA 3TEMA 4D9FA 4MMXB 3NYIA 2CF5A 5MFZA 1S01A 4P38A 3S1SA 2ZWAA 4FT2A 1P0PA 3MS2A 1KZ6A 1U3CA 2FRDC 4URUR 4Q4HA 5ED4A 2VJBA 2OAP1 3H0CA 4NCIA 1IOWA 4QYWA 2NSHA 3MJCA 3N8GA 3VU1A 2BGTA 4JDPA 3ZXIA 3W4JA 4I46A 2VQEB 3QE2A 4MRNA 5EHGA 3LQYA 3IQWA 3NV7A 1TUIA 1XFAA 3ACBA 4ZYTA 4AQDA 2A8YA 1G2PA 1QK3A 2I6QA 3LY9A 1C0KA 1Y5MA 1IK6A 4D0NA 1NMYA 3AETA 1UAYA 1L4GA 3C5VA 3IKVA 2F3PA 2XWBF 4Y9SA 5H3HA 2YV2A 3HCOA 3WL5A 3H2JA 1UZLA 3Q12A 4MS4A 5ECYA 5GJCA 2XKKA 3NONA 4O63O 4Z49A 4EQZA 4M1KA 3QG5A 1C3XA 1YZ3A 3ZZTA 1YONA 1RU3A 3MT7A 2R8RA 4ZWNA 2WBLC 1ILEA 1XQYA 2VP6A 3OQVA 4DT1A 5DNYB 2XEXA 3IILA 1U9IA 5F98A 4OI2A 1EFHA 3U31A 2PGAA 2PLAA 4Y2VA 3WHKA 3I6IA 1Z2DA 3GT3A 5EWLA 2YWJA 1J49A 3GGPA 3C7CB 1Z6XA 2FZCA 4OHUA 3QELA 3EFOA 4XM0A 5C0OE 1LPBB 3TR0A 3TSZA 2O1WA 4DB4A 2O1EA 4CUZA 1QYCA 2B0JA 3HYRA 2Q2VA 1LC0A 1ESEA 1T8PA 1W48A 3AUSA 4OXRA 3IOMA 4GE3A 4MR8B 4US2R 3ESQA 2YIMA 3OZVA 4HDNA 5IWAB 4M3NA 2AN9A 2HHLA 2YWFA 4WACA 1EBFA 4MKIA 5T57A 2GPWA 1HE1C 4DV3B 3N2YA 3C8ZA 3AVQA 3GT7A 3OIDA 2B83A 2GBLA 2NU7A 1BFKA 1SHTX 4IJUA 4YROA 2VDVE 4RUKA 3EISA 3GFVA 3RYCB 1SN7A 2BMEA 3L1JA 1RAIA 3VR5A 2PRKA 4WTOA 1FFYA 2ZJBA 2R47A 4UQPA 4RA6B 4MUXA 4QQFA 3VSDA 3QE9Y 5ULLA 4OEHA 4UVDA 4CNBA 1CC1S 1YKFA 4IJ5A 5JJBA 4BZXA 5EZSA 5H3LA 2QZ4A 1MQSA 3NDJA 3ETHA 1YUNA 5IHPA 4EPWA 1KJQA 2ZWPA 1HT3A 3D3JA 2ZRMA 4IPTA 3HHEA 1FXSA 2NWQA 3HEBA 2PXXA 4PS0A 3OKFA 3O1JC 3E2MA 3R7SA 2ZRBA 5JAZA 3TE6A 1RHKA 2ZJ4A 4Z51A 1Z3CA 4KDEA 3I61A 4LPSA 4PQRA 1FUIA 1UXIA 3QYAA 4KU4A 2XXJA 5DTJA 4EO7A 4Z6KA 3PDJA 2Z1NA 3TLZA 2VSYA 1Q7EA 4HWTA 4RTSA 4FONA 3KPYA 4ARBA 3L7DA 3R8XA 3G2QA 1BVRA 3G8BA 1Y6QA 2OR3A 3Q98A 3PU6A 3L8FA 3ORHA 4KQXA 9LDTA 4XPIB 2E4YA 3L43A 1MOQA 1BXGB 2OZLB 2PRYA 1TF7A 1EP9A 1PG2A 4G0YA 2L82A 4JSRA 2L18A 3OZSA 4ZQEA 2D54A 1J33A 2GXSA 1Z4IA 3AUYA 1CUJA 3P9SA 3TS1A 3U3JA 3V8MA 2WAAA 3DTVB 3WL4A 2GCIA 2CT8A 2YY6A 4KZPA 2DFDA 1R9MA 5KJ6A 2J08A 2QY9A 3VPSA 1QQ5A 3E6AA 1VB5A 3ZWVA 4DC1A 3AB8A 5IAJA 5K3BA 2ERXA 3ZWAA 4NEGA 4WLNA 3STHA 1DC7A 2BGNA 1CJBA 2XUDA 3DZDA 1F0KA 4TQ9A 1V8OA 3TSYA 3D0OA 1MO4A 1FS6A 3EIHA 4PVDA 3R7FA 4RD2A 1UKVY 3SEFA 1LBQA 3ECSA 3HDJA 4OGWA 4L8LA 5CA0A 2J9YB 3IIIA 3MYRA 4LQDA 3TRDA 1ZM3A 3LQ4A 4JBLA 4XUDA 3V97A 2HF9A 4UAUA 1TXGA 4G1FA 3JVUA 1H2WA 3QXXA 4OCZA 3EVNA 2J3JA 1IC6A 1GNRA 1OIVA 1IY0A 3GD5A 1QAMA 2PX6A 1HDIA 3OWHA 1OBVA 4PZPA 1PFKA 4AJLA 1I10A 1SXJD 1XU4A 1X6VA 1NULA 4AVYA 7GPBA 3ADCA 3QVJA 1D03A 1GNVA 4W1RA 4GUDA 1D1PA 1Q1NA 1Y9EA 1IXZA 4FN4A 4NONA 4QG7A 3VZPA 3DBLB 5ADUS 4BN5A 5LKRA 1GQOA 4CL8A 2ZUUA 2BHNA 3IALA 1CP3A 4FX5A 3W06A 5IX8A 2FF7A 4R9UC 3QE4A 3UPUA 1RE1A 3KOMA 5A62A 5IAOA 2ERYA 5FWXB 4F60A 4FFWA 1I7DA 2O8CA 2NAFA 2PX0A 2QP3A 4P4SB 3WXMA 4E1AA 2FOIA 4EYQA 1A2KC 3M5WA 1JQBA 4U00A 2GZMA 1YS1X 1H0RA 2OGZA 4UASA 3ZBQA 4RV5A 3ZE8A 3FFAA 4ARZA 3SSMA 4EAQA 5KAPA 4AS3A 1PJ8A 2X19A 3F47A 4XIJA 4TQUS 4Q3DA 1EJBA 1JVBA 1UBNA 1FSSA 4RTQA 3F9CA 1NE2A 2NW6A 2PWBA 1KGSA 1VE5A 2PMBA 4N6GA 1KO4A 4KDFA 3QFHA 1LTQA 5E9AA 3T94A 2AI1A 4WJZA 4YPFA 1ORRA 1VHQA 2P27A 3CVJA 3OCJA 5CA1A 1BE6A 4TYYA 1EP3B 1P77A 2DMRA 1OB2A 2ZQZA 2NXEA 4P86A 2J6HA 1BQ4A 4J0GA 4CIVA 2PD3A 1O97C 4CM4B 3KSZO 1FFBA 2V7XA 3P1JA 3REOA 1Z68A 3TLJA 2I33A 5TE9A 4HPXB 1OI7A 1KYIA 4NZNA 3ITDA 3TG2A 3UHPA 3RK0A 3WRXA 5JBIA 3D7MA 2GA8A 3SFVA 2UXBB 2YS6A 1GKIA