1GY8A

Trypanosoma brucei udp-galactose 4' epimerase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
383
structure length
367
Chain Sequence
SHMRVLVCGGAGYIGSHFVRALLRDTNHSVVIVDSLVGTHGKSDHVETRENVARKLQQSDGPKPPWADRYAALEVGDVRNEDFLNGVFTRHGPIDAVVHMCAFLAVGESVRDPLKYYDNNVVGILRLLQAMLLHKCDKIIFSSSAAIFGNPTMNAEPIDINAKKSPESPYGESKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDIGEHYQGSTHLIPIILGRVMSDIAPDDKRMPIFGTDYPTPDGTCVRDYVHVCDLASAHILALDYVEKLGPNDKSKYFSVFNLGTSRGYSVREVIEVARKTTGHPIPVRECGRREGDPAYLVAASDKAREVLGWKPKYDTLEAIMETSWKFQRTHPNGYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Crystal Structure of Trypanosoma Brucei Udp-Galactose 4'-Epimerase: A Potential Target for Structure-Based Development of Novel Trypanocides
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
molecule keywords UDP-GALACTOSE 4-EPIMERASE
total genus 131
structure length 367
sequence length 383
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2002-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gy8A02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1gy8A01
5JCJA 4YAEA 4ALIA 2ZB3A 2OBYA 4U0JA 3E8XA 2X5KO 4N5MA 5JY1A 3C1TA 3GZ4A 5JAQA 4BUCA 4ND4A 3DTTA 2C07A 1XDWA 4IQGA 3V2UA 3QWFA 3GLQA 3MJCA 3W4KA 4NHEA 4Y6RA 2QYSA 1SB8A 3ETEA 4MKZA 3EW7A 4HFMA 5TSDA 2FWMX 1DO8A 1DIGA 2D5AA 1PSDA 4Z3DA 1I2BA 1PGPA 5CPBA 4CM9D 1ADGA 1UDCA 1ULUA 1ZVMA 5G0TA 3DQPA 1PJSA 3WGYA 2B83A 4ALJA 1NM5A 4RVSA 3OJOA 3SJUA 1MXFA 1IYZA 1P1JA 3QVWA 4P4NA 3RKUA 2WM3A 2ZB4A 2WE7A 3HN2A 4UEJA 1QLJA 2YY7A 3ORFA 4CM5A 3IQDB 1NFFA 2JHGA 1ZJZA 1I0ZA 3NX4A 1XHLA 4BO3A 2J3HA 1PWZA 1VKOA 1W8DA 2BMAA 2XXBA 3GHYA 2RAFA 3JYPA 4UEKA 4P22A 4JBIA 2PZLA 1GPDG 1H2HA 2WJPA 1Z6ZA 1VJTA 2D2IA 4N18A 2BI8A 4GI2A 4MVJP 3RIHA 7ADHA 1BMDA 4W7HA 1V35A 2R2GA 5LCXA 4ZGWA 4I5GA 3ZCXA 2PR2A 1IB6A 4AJNA 1XGKA 4PG7A 3JSAA 4W99A 1WZIA 5JAIA 3F47A 4HP8A 3ZWPA 3D64A 3PIDA 5JS6A 4RORA 4IIUA 2Q45A 2Q46A 1RM0A 4EGFA 2VYNA 1GUFA 5AOVA 4GMFA 1YB1A 4LCEA 4W9NC 1XG5A 3SBOA 2OMEA 4ZN6A 3T7CA 3I83A 4TKMA 4BIIA 1ISFA 4RPKA 4ALNA 2VOEA 4FPXA 4R1SA 3GMSA 4FC7A 5ICMA 4MVJI 4TVOA 5JAMA 1X1EA 1H2BA 1GUYA 1LXCA 1YS4A 4XA8A 1OOEA 4GX5A 5ITVA 3BMNB 4AFNA 3DOCA 1ENPA 1H6AA 1EVZA 4DTIA 3G3EA 1NAHA 4WOKA 2HDHA 3RUCA 1WDLA 2OO5A 4N54A 3KYDA 1WP4A 3PHGA 3RAJA 3GR6A 1H6CA 3VVCA 3AUTA 5CHEA 4BGEA 5A3JA 5B12A 2PKRA 4QUKA 1P1KA 1LLDA 3I9OA 4XJTA 2QRLA 2JAHA 3Q6IA 3DXFA 2EJVA 3NT5A 3GK3A 4J90A 1ONNA 5JNLA 3CXRA 1XR3A 4C7KA 4D3FA 4DPLA 4JBGA 4TRMA 5T8KA 1SMKA 3QWHA 5DDIP 3DBRB 4WEOA 4A5OA 3S1LA 1F0YA 5A4DA 1U9JA 1S6YA 3RCBA 4DIOA 4UVHA 4W9NA 3CSDA 4GWGA 5ILGA 4DQXA 2B37A 5KJCA 3A14A 4D79A 4MP6A 4NDNE 4J2OA 2OL4A 1XA0A 3BMCB 5CP8A 3SC4A 1HE2A 1A5ZA 3V1YA 2Y1FA 3OICA 3RFVA 4J7XA 4OL9A 2QRJA 1T4DA 4YACA 3V8BA 1HDOA 4BNZA 4ESOA 3D4PA 3H3JA 4M1QA 4IDAA 2GRAA 1E5QA 1LDNA 4J7CA 2FZEA 5TIIA 3TRIA 2GZ3A 1QORA 4CLXA 3ANNA 3AWDA 2CSUA 1UJMA 2ZB8A 4CMIB 3HE3A 4E30A 3JYLA 2O23A 1YQXA 3JQAD 4I5FA 1EDOA 3Q3CA 2NADA 2PA3A 4P8RA 1LSJA 1N92A 3BTVA 3QV1A 2JKVA 2X4GA 1ULSA 3QVOA 4LSWA 2EKLA 3VZSA 3D4NA 2CVOA 3W8EA 1WW8A 4E5KA 3EYWA 1U8FO 2FP4A 4ZA2A 3SJ7A 2O2YA 3DONA 1P1RA 2J8ZA 3RD5A 1DIHA 2C5EA 2DM6A 4FIZA 4LMPA 4QXMA 3JQEA 2LDXA 3OQ6A 2I9PA 3CKYA 1JVSA 3LT4A 3OQ1A 2O50A 3AW9A 2JHFA 2VHWA 1ISJA 1E77A 1E3WA 3GZNB 4YRBA 4UUOA 3ZU3A 1N1GA 4JX8A 1DFHA 4UAGA 3X2EA 4CLHA 1KETA 2O7SA 4TZTA 4XWYA 5BSGA 2WD8A 5B1YA 2B4QA 1HT0A 1VKNA 4IIVA 1YJ8A 2HRBA 2GZ2A 1FDSA 4EW6A 3H2ZA 1SB9A 5KJ1A 3P5SA 4YCAA 2GD1O 3ZW9A 1WWKA 2AQIA 1BW9B 1E3JA 1NR7A 3R1IA 4J2HA 4GVLA 4RVFA 5COAA 4OSPA 3VTZA 4CL3A 2CVQA 3VKVA 4C7JA 5ILOA 1DJQA 2C59A 4CM8A 3PLRA 2RH8A 2EIHA 1BXZA 3K73O 5LC1A 3ZGYA 5H83A 5TX7A 2YUTA 2VTEA 2W2KA 4D0RA 1NFRA 4IDBA 3TZ6A 1H0KA 4X54A 4XR4A 3ZWOA 1WVGA 4DMLA 3LU1A 2FSSA 4FC6A 4RVDA 3R3SA 1WMBA 4CQLA 5DCYA 4I9NA 1T1SA 4OOEA 3RVDA 5FF9A 2AHRA 4FDAA 1ZZEA 4NNJA 4MO2A 1V8BA 5TLSA 4XKJA 3UOGA 1NBOA 4TVBA 3TSCA 2YYYA 1P77A 2G17A 1V6AA 4XR9A 4NBRA 1TEHA 3NTOA 1LNQA 4LRSB 5IAAA 1GR0A 4AL4A 3Q9UA 2JFFA 4D43A 3O8QB 3JD1A 1KEWA 3GDFA 4MVJH 1EVIA 4W7IA 4PCVA 4BO0A 3BMQB 1PR9A 5EINA 4J43A 3T4XA 5KVVA 1U7TA 4I9HA 3WGQA 1BXKA 3KB6A 3KEQA 3SVTA 5T6BA 4Q3NA 3GFBA 4XYMA 2AXQA 1N7GA 1S7CA 4BV8A 4A27A 4BMSA 1L1FA 1R4NB 3RUAA 4H7PA 5F5NA 3LT2A 2W98A 4GPD1 5G0WA 5KKAA 1E7YA 3G79A 4PFJA 3DZFA 4N5NA 2EG9A 5A3VA 3WGIA 3ZV4A 3WYEA 1DAPA 1FDTA 2IXBA 3PJGA 1LA2A 5JAZA 3DAPA 1ZXLA 2B0JA 4B7XA 5CG1A 1SZJG 4WLNA 1E1LA 2VRCA 1X0XA 4PLCA 1C1XB 3G17A 3GUCA 5GZ6A 3UUWA 2CY0A 2Y0DA 4J1QA 3VC7A 4Z0PA 4F46A 3RC1A 3WR5A 4CLRB 3ZH2A 1EQUA 3PDUA 4BNXA 3WYCA 3RUIA 1JKIA 2JFGA 1ZCJA 3B1JA 3KVOA 3OA2A 3Q11A 3QQPA 5TGDA 2QIOA 2O3UA 3QRWA 4J4HA 1CJCA 4BGUA 3U49A 3DBRA 1EE2A 2DVMA 3GG2A 4DL9A 4U6SA 1HYEA 1XU9A 3GGPA 1E3IA 3JQ9A 1T4BA 1ZMTA 4BKOA 2VZ9A 2I3GA 3AUSA 1KVRA 4FFMA 3A28A 1U7HA 3DFUA 4UUNA 2V6GA 2ZQYA 3D3WA 4NFYA 1K6IA 1UP6A 2YFHA 4RVGA 3WYBA 2EWMA 2HMWA 2X9GA 4FFOA 2NVUA 1B0AA 5L7TA 2AA3A 2QZ9A 2YHIB 2J5QA 1D8AA 3AI3A 3HB5X 4PLYA 5DT9A 3UCEA 5AQ1A 5I7EA 4L9RA 3NDIA 4UULA 1Q2XA 4A03A 1G6KA 1E3SA 4IS3A 2I99A 4WKGA 1WZEA 4CUZA 3CE6A 2WSBA 5DBFA 2HK9A 3E1KA 2PFGA 3P7MA 1PZEA 4EUEA 5BR7A 3GGOA 1QYWA 4EEZA 3M2TA 1AXGA 3VPHA 3ZWAA 4OIMA 4OOFA 6LDHA 2P9EA 2I76A 8LDHA 4Y6SA 3ROQA 3TN7A 5LDGA 3MJEA 4LGVA 4CMCA 2HK7A 3I6IA 2GR9A 2GF2A 4XB2A 1HLDA 4Y6PA 1PS8A 5KVQA 3WIEA 4GVXA 3IJRA 4E2WA 3VDQA 4YAKA 1UZNA 1PQPA 3PXXA 4LVUA 5DF1A 4MIYA 2YV1A 1QV6A 3D3EA 1GV1A 1HE4A 3BA1A 1OAAA 3WQQA 2FRDA 3PQDA 1PJLA 1PU2A 3GY0A 1YRLA 5IXYA 1ZNQO 1PIWA 2OZPA 3V2HA 4CR7A 1W6UA 5JE8A 3HFSA 5K6AC 3FF4A 1QV7A 3U9LA 2GNAA 4LISA 2PK3A 4HFNA 3L9XA 5I7FA 3KSUA 3DBVO 4GQAA 3JQAB 2EV9A 4AJ1A 3DTYA 2WYUA 2YV2A 1H6DA 3VPGA 1HSZA 2JD0A 2NVWA 2O3RA 3R6DA 4FQ8A 4PLZA 5KTKA 1ENOA 2Q4EA 3NJ8A 1PZGA 3DHNA 1NQ5A 1IUKA 3FN4A 4DIBA 2DBQA 1LSOA 1R0SA 1KC1A 2IYOA 3NDJA 4NIMA 4WNCA 4D42A 3O03A 2J3KA 2CNBA 3EDMA 3FBTA 2HK8A 4R3WA 3ROKA 2Y67A 3HN7A 3B70A 4MJLA 4QT0A 5AXDA 1A9ZA 1DIBA 5L7WA 5T5QA 2BH9A 4FS3A 3QVTA 4L8VA 1F8GA 1A71A 2NSDA 3NKLA 5C7IO 1NHWA 3MOGA 2ZIZA 3UH1A 2Y1EA 4IPTA 1GTMA 3QY9A 4HXYA 4OHUA 4BNVA 2C5AA 3OSUA 1O95A 2QZZA 4PRLA 4I8XA 1Y81A 4OGWA 3EVTA 4OJNA 4XQ9A 4OYRA 3FRJA 4XGKA 5G0VA 3KHUA 4GGPA 4JJIA 1D1SA 2NQTA 2FOIA 1LUAA 2GN4A 1DLIA 1ZK0A 1MA0A 4BO7A 3F1LA 3VZPA 2YW9A 1UUFA 1WNTA 1TVEA 2A9FA 2HSDA 3EZYA 1PJCA 3N74A 4RPLA 4XJSA 1VJ0A 3I9MA 1Z7BA 1PL7A 4K28A 2LDBA 4PLVA 3HWRA 3I4CA 5DOVA 4NPCA 1NP3A 4J0FA 3H9GA 2VCYA 1MXHA 3IMFA 4NJMB 5I8ZA 1I32A 3RJ5A 3WXBA 1O94A 3K2BA 3ULKA 4DWVA 1LJ8A 3L6OO 5KCZA 1U3VA 3WOHA 5A02A 2OORA 4PGFA 2P4QA 1GQQA 1U3UA 1UP4A 2GGSA 2JCYA 4YB8A 4Q3DA 3UHAA 1A9YA 1CIVA 3WG9A 4AJ4A 3ICCA 1M76A 1I2ZA 2EF1A 1U28A 3PZRA 3C24A 4EBFA 1T1RA 2YDXA 1PQUA 4OXYA 4I1IA 2YJZA 1QXSA 1MG5A 2A4KA 3E5MA 5A06A 3TFQA 5JDCC 2F00A 1T2CA 3IAHA 3OF2A 3F3SA 1J6UA 3NYWA 2DAPA 1E7WA 3SX2A 4CV0A 3GPIA 3MJTA 3HZZA 3NEPX 3H7AA 2POQX 4WCFA 3HDHA 3DZHA 1DSSG 3L0DA 2JD2A 5CFZA 1YOVA 3ADPA 2YV3A 4NU6A 4YJFA 4WLFA 2X5JO 4A73A 1ML3A 3VHRA 3WGHA 2HMVA 5DULA 1Y8QB 4BL5A 1UZMA 3LT0A 1E1NA 3JQ7B 1RM3A 5KJFA 3QJ5A 4F45A 4CM8B 4PLFA 2GASA 1KOLA 2GZ1A 3AOEC 3LLSA 3GEGA 2HJRA 1NX6A 4LN1A 2TMDA 1I3LA 3JQGB 3MJ4A 1R12A 2A92A 3FWNA 5L4LA 1OMOA 3F4LA 5TJ9A 1QSGA 4KUEA 4IGEA 1WXDA 1QLHA 1I3KA 2VHVA 1V3VA 2JAPA 3U4HA 2Y1OA 2YFQA 1RYEA 3VPXA 1X13A 3JQ8A 4UVGA 3TL2A 3OBBA 4ND2A 2IYPA 2VYVD 1ZXBA 4Z0HO 4XD2A 2AG5A 4BKQA 1PR3A 5JDCA 3GT0A 4CMAA 1G0OA 3GVIA 4BMNA 4MPDA 2NTJA 1KY4A 1Q1NA 2PD3A 3TJRA 4E12A 3F4BA 3D5QA 3LDHA 2PV7A 4AICA 4IBOA 4F6LA 5CDGA 2VUSA 4XCVA 1HDZA 5ENVA 3KLPX 4B79A 1PGNA 3DWFA 3HNPA 4LVCA 2P91A 2X1HA 3NUGA 2O48X 1A72A 3LLVA 4L4RA 3MTJA 1VE9A 4N5LA 1F06A 5ENDA 1ADBA 1TXGA 1XCBA 2GN6A 3KV3O 1BRMA 1ZK2A 3ZHBA 2E82A 4RQTA 4PLHA 1EVJA 1KS9A 1Q7CA 4Q3AA 1A4UA 5KOIA 4DPMA 5FWNA 3WNVA 1FJHA 1T26A 1B3RA 2CUKA 4ZICA 5CDTA 2R00A 5ES3A 5FEUA 1MP0A 1JVBA 1YJQA 1PZFA 3C1AA 3LC7O 3PK0A 3UN1A 2AQHA 1ISGA 4J1NA 4PVCA 1BHSA 4WLEA 3DMYA 3JQ7A 3KXDA 1DFGA 6ADHA 1EMDA 2OHXA 3GZNA 1RM5A 2E49A 1V0JA 3EK2A 2X5OA 3JD4A 5A9TA 3U62A 4BB5A 3BZUA 3GVPA 2HKIA 1EFKA 1ZH8A 4FFLA 1I33A 5H81A 1LLCA 1U5AA 4ZVVA 1ARZA 2OOSA 3CTMA 3I23A 2QHXA 5BNTA 2WEKA 2C82A 3AU9A 3Q9NA 4CPDA 4WLVA 1E3EA 1X14A 4R68A 3CINA 1NXQA 1B15A 2ZJ0A 2O4CA 5TF4A 4BQRA 1R15A 3GNTA 3GEDA 4OSOA 3LZ6A 1P45A 4RPGA 4NZ9A 4ZD6A 3ST7A 1JWAB 2IEDA 4UVIA 4BO9A 4CV3A 1XU7A 2DU8A 4E3ZA 4TMFA 2EHDA 1GQYA 3CIFA 4DLLA 1HZZA 2EXXA 3F9IA 2QG4A 4MIOA 4PLPA 1YVEI 1DLJA 4OQZA 3ABIA 2W90A 4MIEA 4D0SA 1I30A 1BSVA 4YJDA 5JSFA 4Z9YA 3E6AA 3DOJA 5F5LA 3OJLA 2OFPA 2EKQA 5HM8A 4MVJG 4YBZA 2DFVA 4OQYA 1U1IA 4IM7A 1HLPA 4XYLA 1JWBB 3RU7A 2DFDA 2Q3EA 3NV9A 3COSA 4L74A 4GBJA 3GQVA 4DPKA 8ADHA 1WMAA 4IUYA 3DHEA 1N9GA 1ADCA 3PYXA 2Z1MA 3B1FA 4EJ6A 3FR7A 2W2LA 4O5OA 1DRWA 1Y6JA 4YTEA 4FGSA 4IJVA 4ND5A 5I7SA 3JQBA 3C7AA 3O26A 4PN3A 2W2KB 1W4ZA 2QW8A 3ZV5A 4GX0A 4PG5A 2OP1A 2Q1TA 3C7DB 4FW8A 4B4OA 4CM4A 1VL8A 4EEXA 3DBLA 4TQGA 3AM4A 1I01A 1JKFA 3GOHA 4IMPA 4MP8A 3ZWBA 4CMJA 3TZCA 1FDUA 2VWHA 5LDHA 3IP1A 4C4OA 1KEUA 4RVHA 2XXJA 3AFNA 1NFQA 1CF2O 5G4KB 4YJHA 5ER9A 1N5DA 1P0CA 5COQA 2VRCD 2XAAA 3OEWA 3TNLA 1DIRA 4J91A 5FI3A 2HMSA 4NJMA 4YVFA 5EMHA 4XIYA 4CODB 3I9NA 2ZATA 4PRKA 5JXWA 3SC6A 4IS2A 5G4LA 3VTFA 2A94A 4OAQA 1M75A 3KBOA 4GMGA 2E37A 3LT1A 1HETA 3WBBA 2PH3A 3DBHB 1HYGA 1LTHR 3ICPA 4AVYA 4CV2A 3ASVA 4RGBA 2X9NA 2DKNA 1SOVA 1YB5A 3C7CB 1N1EA 4HY3A 3KEOA 4GLOA 4XQGA 5I9LA 1YBVA 3WWZA 5THKA 1X0VA 4L75A 2FHSA 3OIFA 4ILKA 2NVBA 1LDYA 3K9QO 4BNYA 1HL3A 2D4AA 5AXBA 4ZQHA 3H4VA 2VYND 3SLKA 5B4VA 1C0LA 3MOIA 3GGGA 3JQFC 5JW6A 3NTQA 1VC2A 1GUZA 2C54A 1JN0A 1EUCA 4O63O 1YL6A 3UFXA 5HRUA 4BNLA 2Q2VA 1YONA 4ZQBA 4MKXA 3RQSA 2DTDA 3C85A 4NQZA 3JCZA 5B4TA 2X22A 3EGOA 4BO1A 4PLTA 3H5AA 3HADA 4JGBA 2X58A 4R01A 3DZKA 4WE3A 3FPCA 3LSYA 2Z95A 2H9IA 2FR8A 4B4UA 1DFIA 1HYHA 1Z7EA 3BMCA 4CQMB 1Y8RB 1X7DA 4PZDA 1LDGA 4FCCA 4DXHA 5A05A 2VTDA 4R3NA 3ONEA 1C0KA 3DBHA 4Y9DA 5ER6A 3NT4A 5BT9A 3VH3A 1HDYA 4GLLA 4O59O 2NV6A 4CMIA 5CDSA 1GZ6A 1IHYA 1LRKA 1E7MA 3LF1A 4NK4A 4CR6A 4O1MA 1GZ3A 5A03A 1YQGA 4J0EA 1A7AA 3K30A 5GY7A 5A9SA 2D5CA 3TZHA 1NVGA 1E1MA 1U8XX 2FR1A 4WUVA 3OIDA 1HE5A 2AQ8A 3JQGA 2G1UA 2EP7A 4CLRA 3AM3A 3F6YA 1MX3A 3PHIA 5T67A 3WJ7A 2PZMA 2CMDA 2IE0A 4E13A 1B8UA 1BXGB 4G5HA 1VSVA 3OECA 2CDCA 3EUWA 4J9UE 2P5UA 3P19A 1V9LA 2F1KA 3AK4A 3G0OA 2GSDA 2FPGA 1I3NA 1XYGA 2QRKA 1IHXA 4UVDA 5IFLA 4JXKA 2D3TA 4CMHA 3I9LA 3WSVA 3UF0A 3QVSA 2VZ0A 4MP3A 4BHTA 3KETA 1UDAA 4QEDA 4Y98A 2C29D 4IDFA 1BTOA 4E2ZA 5EERA 3DAFA 4JQCA 1FMCA 1DPGA 1C0IA 1ZK3A 2YHUA 2HU2A 2I6TA 4FGWA 4YQZA 2VWGA 1YXMA 5A04A 2DBZA 1Y9AA 2EW8A 2WWRA 4IINA 2AQKA 1ZK1A 1ENYA 4JK3A 1HZJA 3TPCA 4BMVA 1X1TA 3O9ZA 4W82A 5C3MA 1DC3A 4PIVA 4Z9FA 3UICA 4OM8A 5L45A 1Z73A 3WSWA 1K0UA 3VH1A 3DR3A 5U1PA 4IGFA 4MDHA 4NJOA 4JNKA 3RU9A 1SO8A 1Z45A 4DIFA 5F1OA 4G65A 4YWJA 1P9LA 5THQA 2GO1A 3ROMA 1I3MA 4CR8A 1E6UA 2G76A 1RKXA 1GL3A 2FPPA 1DRVA 1I5RA 4XQEA 5CEJA 3D4OA 3HHPA 3IC5A 3ZWVA 3PGJA 4GKBA 3F46A 3WS7A 3DHYA 3DFZA 1GADO 1SOWA 4WK6A 4LCJA 2HAEA 2O2SA 3DB2A 1CWUA 3HUDA 4GSLA 2EJWA 3RUHA 4BNUA 4KMSA 1GEEA 4PLWA 4DLBA 4GWKA 1UP7A 4R41A 1GU7A 1UXHA 3EZLA 2YQ4A 2JD1A 4KQWA 4EZBA 5IDYA 3L4SO 5C7LO 4CMBA 5B4UA 1B14A 4YT2A 5A1TA 4RPHA 3K2EA 4G2NA 4Y8VA 4CM7A 1IZ9A 1E0DA 3WNQA 1XIVA 4K26A 1GQ2A 3G49A 4RL6A 4CQLB 3W1VA 3FCOA 1CQJA 4OO3A 4HNGA 1NNUA 1NYTA 3ANLA 4ZJUA 3FNFA 1MC4A 5AXAA 5K0ZA 3ZNQA 4H15A 3QP9A 4BNTA 1K5HA 2J5KA 2VUTA 1EQ2A 4TRRA 4QO7A 5F21A 3U4CA 2X0RA 1OC2A 3OH8A 1NHGA 2AG8A 4G81A 4HUJA 4E5NA 3DBLB 1F8FA 4R4JA 1Z75A 3ZHYA 3I52A 1PX0A 1GDHA 4ONEA 2J3IA 3AI2A 5F1PA 3VAZA 1T2AA 3KZVA 3WTBA 5L4NA 1O89A 3RKRA 4CUKA 1DHTA 1F12A 1FK8A 1RYDA 3RBVA 3AJRA 1O5IA 3B1KA 2ZJ1A 1IPEA 2GYYA 4CLEA 1QYDA 1R16A 4HADA 2IZZA 4B4WA 3RASA 4XRRA 5ICSA 1T2DA 2EGGA 4J1SA 4XGNA 4BNIA 2PGJA 1GYRA 3GNSA 1D7OA 3F5SA 4TROA 4CL8A 4R54A 4BNKA 1T2EA 1JKJA 1YWGO 3A9WA 4ALKA 4B3JA 2PGDA 1EFLA 1NWHA 5C37A 4YJFB 3TOZA 1P1HA 2NWQA 2OBNA 4IDDA 4IQ8A 3VDRA 4PVDA 4QX6A 2X0IA 1LC3A 3PDJA 2DQ4A 3NDRA 1XEAA 2RHRA 1DHRA 1L7DA 4CLDA 2Q99A 4GAEA 4CMEA 2NVUB 3QW2A 4RQUA 2OP0A 4YT8A 4KTTE 3VOSA 4B8ZA 3GVCA 2CDAA 5AVOA 2HQ1A 3DMTA 4JBHA 4E0BA 5BQFA 1E1KA 2ZQZA 4YPOA 3GG9A 5L7YA 3JQBC 5HS4A 4J6FA 1GY8A 1B3BA 2C7GA 3ZN2A 1VM6A 3BMOB 1DXYA 3GVXA 1Q0HA 1HTBA 1E3LA 3IOYA 1P1FA 1FDWA 4LRTB 4BGIA 1XKQA 1MV8A 1C1DB 1K6XA 3GA0A 2R6JA 2PKQO 4KUHA 2PNFA 3GEMA 5H82A 1LLQA 2UV8A 2P9GA 3ITKA 5T57A 1IPFA 1M6WA 5JDIC 3NGLA 4I9UA 1KYQA 2EW2A 3KLMX 3M1LA 3I6QA 2ZTVA 5EN4A 4E6PA 1VRWA 4IY1A 4BNWA 3TL3A 1BVRA 5IN5A 4EUHA 2UUOA 3EY4A 5L53A 5KKCA 2DLDA 5JPIA 1O0SA 1ZKMA 2IODA 4RVUA 2B5WA 3D7LA 3ROPA 3GUYA 1PJ2A 4E31A 3AY3A 3CH6A 1BGVA 4RO0A 4YDRA 5A9SB 1HDXA 4Q9NA 2EEZA 2FPIA 2P68A 5DOZA 5HWSA 1HWYA 4XRGA 5KIAA 1PWXA 1WDKA 3F1KA 3FTPA 1C3VA 1EBFA 2XF8A 2VZ8A 1J49A 1I2CA 2CFCA 3JQFA 3HDJA 3C1OA 3H9EO 4BKRA 4E4YA 4EJMA 3UVEA 3UCFA 3HG7A 1YB4A 5TNXA 1TI7A 2Y0EA 5I9NA 2Y0CA 4ROSA 4TKLA 2NUAA 1O6ZA 5EJ2A 4GGOA 1AN9A 2WD7A 3WLFA 4R5MA 4HV4A 1I24A 2BRUA 1T24A 2Q50A 3GAZA 1T2FA 3JQCA 4FR5A 3IDSA 1LDEA 4RDHA 3LF2A 2W4QA 5ADHA 2ZYDA 4A0SA 2BELA 4NBVA 1MFZA 4IQ0A 3QLJA 3UGKA 3WB9A 2GN9A 1PL6A 3PQFA 3ZZNA 1MLDA 2GUGA 1YE3A 1FF9A 1G0NA 4LW8A 5FFFA 3ZU4A 2O3SA 1P0FA 3W8DA 3JD0A 2EERA 3KYDB 4BO6A 1CRWG 2E6UX 1RPNA 3PJFA 2HUNA 3H3FA 2NU6A 4NBTA 1DDOA 3MCVA 2CF5A 4TWRA 4DGSA 4DYVA 1ISHA 3PGXA 3GDOA 1ID1A 1JTVA 4FOOA 1Y5MA 1YQDA 1DRUA 3OJFA 4DRYA 3GF4A 1VLLA 1EBUA 1QP8A 3EC7A 1U4SA 2RHCA 5BNFA 2FSVA 2WDZA 3BHMA 1IY8A 2QYTA 3CMCO 5HS6A 4CQMA 4CQMD 3WGZA 1I36A 2IDZA 3JYNA 1U4OA 1PJQA 3UKOA 3GDGA 4NK5A 4BNNA 1KEVA 5G4KA 3GNQA 3QWBA 1PS9A 4OXKA 1J0XO 3BIOA 5KNLA 1KEPA 2OXIA 1SEVA 3HB4X 3DZJA 3WFJA 1GPJA 4CLOA 2D8AA 3BYZA 3RUDA 3AU8A 3LC2O 3TZQA 4BO4A 1BVUA 1TA4A 3EHEA 2J5RA 5T8KC 3CEAA 4J4BA 2DPGA 2JCXA 3L9WA 3KYBA 4CM4B 1Y7TA 1YL7A 1HDGO 1DEHA 4KZPA 4FB5A 2Z1NA 1YOVB 3KUXA 5HA5A 2X7HA 5TJHA 4WCFB 3GPDG 3LYLA 4Q3BA 1XQ6A 3KSDO 1YO6A 2VOJA 4R1UA 1OI7A 3E5RA 1P33A 2I65A 2P2SA 3RJ9A 5IZCC 1ZEMA 3MTGA 4YJHB 3Q1LA 5AYVA 2ZTMA 4KWHA 3WLEA 1NASA 1TB4A 1RJWA 3NGXA 3ZNPA 5CAEA 5IZ4A 3AUAA 4E32A 4EDFA 3VPSA 5KVCA 1V3UA 2X8LA 2ZCUA 5AXCA 3M1AA 3LK7A 3WMXA 5GZ3A 1EVYA 4E5MA 4RLHA 3IL2A 4NH4A 1H9BA 1FDVA 4GKVA 3A1NA 4YT5A 1MUUA 1ZK4A 1V3TA 1SPXA 3HSKA 4YYZA 1RM4A 4B3IA 1DBVO 3WWYA 4F6CA 1UAYA 1PL8A 2UVDA 3DDNA 3F5QA 3V5NA 1JAXA 1K89A 4UEOA 4DVJA 4BNFA 3G1UA 1N9GB 3GFGA 4TZKA 3OIGA 4ND3A 3P2YA 2Q1WA 3GRPA 3OJ0A 4UUPA 2NTNA 2O4UX 3FD8A 3L07A 4YXFA 5MDHA 4ZQGA 1R4MA 3FR8A 1JDJA 3KYCA 3K6JA 3KM0A 3N7UA 5JCXA 1HE3A 3ZHXA 4CM3A 2O7QA 3L6EA 3ZU5A 4YT4A 3ZV3A 4L73A 4R1NA 1U2GA 3PP8A 1MC5A 4FJ0A 4E21A 1UXIA 3SEFA 1OZAA 1HSOA 5F1KA 1Y1PA 3OEYA 1SEPA 3NT2A 5A5EA 5JYEA 1E3WB 1E6WA 3WQRA 4XDYA 4U7WA 4BB6A 4YRDA 4M86A 3JTMA 1U3WA 1R0KA 1KVUA 3MWEB 4OXNA 1PQWA 1CETA 2P9CA 3WICA 4BGVA 4OH1A 3OMLA 4K9DA 1Y8RA 4KWIA 4PZCA 4YJGB 1ZO8A 4NR0A 5L40A 4Q3CA 5IDWA 3JQ6A 3K5PA 4RF2A 4D45A 1IL0A 4FD3A 4KUGA 4WASA 4BO2A 4MVJE 2PH5A 4QQRA 2D1YA 3MJVA 3HQ4O 3H9JA 2TMGA 4A2CA 1LLUA 3PLNA 3EMKA 4BO8A 2Y1GA 2EP5A 5HTOA 5L9AA 3PTZA 2BFAA 2UDPA 3JQ9C 1PZHA 1QMGA 1SCUA 4KOAA 4NFHA 4CM1A 3AOEA 2BF7A 1Y8QA 3L4BC 3WIDA 4YR9A 3CPSA 3ENKA 3INGA 5DBIA 1P31A 2EGHA 3R3JA 2B4RO 2Y66A 3MJSA 1H6BA 1CEQA 3U5TA 2CF6A 4EYEA 3LQFA 4RJTA 3ZHZA 3GMDA 3FBGA 1ZBQA 5G2OA 3HDQA 3LC1O 2VHXA 3B6ZA 5A9RA 1KERA 2CDBA 2O3QA 4XEHA 1B2LA 2O3JA 4INAA 3VPFA 3STHA 5U9CA 1QR6A 1EUZA 2FN7A 1EK5A 2W8ZA 4JLWA 1D3AA 3ON5A 3QVXA 4RDIA 3S2FA 4BS9A 3PWZA 2R00C 4IJUA 2GCGA 2Q4BA 3V1TC 4RLSA 4XB1A 4NMHA 5I9MA 4PLGA 3H5NA 3N58A 3JQAA 4WCFC 4DUPA 1NVMB 2GN8A 3IKTA 3RFXA 4KP7A 2Z5LA 3WX0A 4EI2A 4YQYA 1MGOA 4RZIA 5JLAA 2PLAA 3AUUA 2WYWA 3ETDA 4M54A 2UAGA 1N8KA 2Y93A 3BXXA 2VT2A 1H9AA 1UAGA 1NQTA 2NLOA 3E03A 1R0LA 1AHIA 4E2YA 4I08A 3D5TA 1ZSVA 2AW5A 2VT3A 4JJGA 4U5QA 5DN9A 1PJBA 4KDEA 5JC8A 3RBXA 1PJTA 4NBUA 3I9JA 3WGGA 3GRKA 3CZRA 2NNLD 1Y5RA 2X9VA 2IZ0A 1EEHA 1JU9A 2CVZA 2Y05A 1KC3A 3Q2KA 5DCUA 4EUFA 4YAGA 4GSKA 1B16A 1KVTA 4FFPA 4RZHA 4D7AA 5COBA 3DO5A 4J9VA 1X15A 4HFRA 4QO8A 3B20A 1K3TA 5I7VA 5TT1A 1LDMA 3TOXA 3X2FA 4WPGA 3PJEA 3A06A 4IZIA 4J7UA 1EUDA 3RC7A 1B8VA 4E5YA 2VNAA 4BVAA 5BSFA 3FNEA 2PWZA 1NVTA 3ZU2A 1VL0A 2FMUA 1ZUD1 2DT5A 5JDIA 4NI5A 3FWZA 4ZU3A 1C1XA 1YBMA 1ISMA 2V6FA 3KSZO 4PG4A 3FI9A 4TRJA 1SNYA 5IXSA 3VVBA 1ZFNA 3H2SA 5B37A 3S55A 3D1LA 5IDXA 2NTVA 3I9KA 1E7SA 1UZLA 4HFJA 1Q0LA 1P44A 1Z74A 1UXGA 3PHLA 4GH5A 4L4SA 3WMWA 2G5CA 1VJ1A 2D0IA 4QSMA 1IULA 1KVSA 2H6EA 3IIEA 3UXYA 4DQVA 5K9ZA 2BD0A 3H8VA 5IG2A 1B7GO 3M6IA 1DC4A 3OQBA 3A4VA 1NR1A 4ZRMA 2DUWA 2AEMA 4FFRA 2BGMA 2RIRA 4RF5A 3U0BA 3I4FA 3FSRA 5DNAA 4B7UA 1GYQA 2WYVA 1PJ3A 4R5HA 2DPHA 4JIGA 4JJFA 3NRCA 1QG6A 1U3TA 2X6TA 3D0OA 4YJGA 3PHJA 4D3DA 4Y67A 4QFCA 4P38A 2JL1A 3QWAA 1P74A 4DREA 3AM5A 3Q0EA 3M2PA 3AI1A 1WPQA 4FOSA 3U4IA 4ALLA 3VZQA 4DQUA 2Y1CA 4D46A 4AJHA 4II3A 4GX2A 1GD1O 1BDBA 1HKUA 2W2LD 3PFFA 2ZK7A 3PYLA 1LEHA 4WLOA 1GFSA 3KRTA 3MWDB 4IDGA 2PD6A 4IDCA 4AJOA 4M49A 4XZ3A 2ZCVA 5I8WA 1M2WA 1LRJA 2D59A 3UAGA 4HBGA 1UR5A 1IE3A 3PIIA 1Q7GA 5JO0A 2YZ7A 3ENNA 3O8QA 4QECA 4DLAA 4DC0A 5IJZA 3PI7A 3RSHA 3GN2A 3PZBA 2Y68A 1LSUA 3OJEA 5K6AA 1OC4A 4ZQFA 1YKFA 4M8SA 1NQAO 3ZWCA 2X0NA 3O4RA 4BO5A 1DIAA 2B69A 1YDEA 4YAJA 3ITDA 4FJ2A 5CDYA 3W8FA 3E18A 4BKPA 2DC1A 4YA6A 4L4XA 3OM9A 4E33A 1Q0QA 1LX6A 2ET6A 3L6DA 2VN8A 2Y1DA 3GN1A 1ZJYA 1C0PA 1NAIA 4JP2A 5TQVA 5JO9A 5F3RA 1GZ4A 4D3SA 3TF5A 3E9QA 4BNGA 9LDBA 1U5CA 1B26A 5IN4A 2SCUA 3ONDA 2B4TO 2E48A 2J6IA 4OMUA 1ONOA 4UUMA 2VQ3A 1F17A 1LQTA 4R1TA 1BDMA 2VHZA 3ZWMA 4CMGA 4BOYA 2AEJA 5G0UA 1M66A 1FXSA 3ZW8A 2C2YA 2VWPA 3BTUA 3JYOA 1LI4A 2NM0A 2XPCA 4II2A 4PG6A 3C8MA 1EZ4A 3JQDA 1OBFO 4JP3A 4AG3A 1AUPA 1GCOA 1YDWA 3FPLA 2H5LA 2BI7A 2GPTA 3DMTC 4DBZA 3WBFA 4GX1A 4AJKA 1Y9EA 1HXHA 1DC6A 4WECA 2FZWA 3L77A 4UREA 1JAYA 3VZRA 4BNMA 3DOOA 4HWKA 2VYVA 3D3WB 4O0LA 1SBYA 2C0CA 3PFWO 4MOWA 4R16A 4DC1A 3ZNOA 3BMQA 2X86A 4DMMA 1GYPA 4CM9A 1DJNA 1VPDA 4XX0A 3ZI0A 1X7HA 3K96A 5FI5A 1LU9A 1LSSA 3IP3A 2ZKLA 1TT7A 1I10A 4CUJA 1UDBA 1CYDA 1XSEA 1E92A 3ONFA 5CDUA 4I5DA 4E5PA 3BHJA 1E7RA 1G1AA 1M67A 4J16A 4XYBA 3BMNA 2V7PA 2B36A 4R9SA 3HJAA 1BXGA 1R66A 4MVJD 3GHHA 5JC1A 3BMOA 2Q2QA 2BHLA 4O6VA 2Q1SA 3AY7A 5BNIA 4Q3EA 1YH3A 4QTZA 4M89A 2BFOA 1E6EA 4J49A 1KY5A 4U0KA 1MG0A 4R51A 3VKUA 3DZBA 3HFGA 1LRLA 4IXWA 2PD4A 1XWFA 3IKVA 4MKRA 1UXKA 2JFHA 4IJKA 1JLLA 4IDEA 2AE2A 4S3MA 4WGGA 2FR0A 1WDMA 5T64A 2V6BA 3UW3A 1A4IA 3PYMA 2AE1A 3I3OA 1GEGA 1BG6A 3OP4A 1R37A 4QFDA 1ZMOA 4CLOB 2I67A 1IOLA 2QQ5A 5TRTA 1DC5A 2HCTA 3JV7A 1ZSYA 4K6CA 2HMUA 1NPTO 3W4IA 3TZKA 4GL4A 1W73A 5CPFA 1DB3A 3PWSA 4IJWA 4LMRA 3C3XA 3KTDA 1NPDA 3TDKA 5JMWA 1ZEJA 3DZGA 3RUFA 3VH4A 2ZYGA 1P3DA 4JROA 1VL6A 2IZ1A 5HBRA 3E9NA 1TT5A 1DAOA 5L51A 3WDSA 2Q2WA 3WQSB 5GZ1A 1SC6A 1C14A 3NAQA 3CZMA 4OKIA 1VSUA 3RBZA 3T7EA 4RF3A 4DYDA 3O38A 3ZWYA 4A10A 4KQXA 1AE1A 2B35A 4RV9A 1MB4A 4DBVO 1NTOA 1EE9A 3RROA 2PZKA 3PPIA 3CMMA 2BFPA 3PQEA 1I8TA 3TWOA 3EVNA 3S8MA 3TFOA 2Q1UA 4AJ2A 1K2WA 2OUIA 4B3HA 3QE3A 1U2DA 1QYVA 1R6DA 2GERA 2NU7A 3PWKA 5CG2A 2BGKA 3Q2IA 3KOUA 1T25A 2I66A 3H6KA 3MZ0A 3W6ZA 4Z0TA 9LDTA 5C5IA 3WFIA 3W6UA 5JCJD 3BAZA 4KTVE 2Q49A 4ID9A 1QRRA 3QSGA 5G0SA 1XLTA 1PEDA 1TLTA 3LVFO 1GAEO 3E48A 1QKIA 4RF4A 1O9BA 2VNSA 4CM6A 2ZB7A 4XYGA 4FBGA 3U09A 4B4VA 1KBZA 2V6MA 3AFMA 4IXTA 1W0CA 2H1SA 5ITWA 1A7KA 3GH3A 4XQCA 4L76A 4YRAA 4HNHA 1ZW1A 2RCYA 5C7OO 2ZYAA 3K8ZA 3IUSA 1ENZA 4XDZA 5JY6A 3ADOA 1YL5A 3AY6A 4JN6B 3HDYA 4RCVA 3WGTA 1H93A 3INRA 3ZV6A 1EK6A 4B7CA 1ZIDA 4WJZA 5MGBA 3PHHA 4XGIA 2I3AA 4F3YA 1PTJA 1NQOA 4WCDA 2BLLA 3G1TA 3RFTA 1Q7BA 2H63A 1UH5A 4PG8A 1PGQA 3SLGA 2P4HX 3QIVA 4M55A 1H5QA 2BGLA 3PVZA 2DUUA 1LBEA 4P4GA 2HMTA 4R9RA 4U6QA 1B8PA 1E7QA 3BTOA 1O8CA 2B5VA 3RUEA 1CDOA 2HJSA 5IF3A 3QA9A 2OGUA 2JCVA 1L7EA 5KWEA 4H3VA 3T4EA 1AHHA 5DCWA 5EESA 2ZTLA 1C1DA 4YEDA 1NWCA 2IRWA 1WLYA 2Y99A 3QHAA 1PGJA 2X0JA 4M87A 1ZSNA 5EPOA 3ASUA 3H9QA 3CUKA 1HDCA 2P5YA 4EJ0A 1PS0A 5L4SA 3GVHA 3ANMA 2DTEA 3BHIA 3E9MA 4ZQEA 4CJXA 4L0QA 4MVJM 4UVEA 3DZIA 2X23A 2PY6A 4U8GA 4CMKA 5TS3A 4ND1A 1HRDA 4AJPA 3MEQA 5KVSA 1ADFA 2XOXA 5EQDA 5TT0A 2JJYA 2AEFA 4XIJA 2AMFA 5JFOA 1JA9A 3JD2A 3OETA 1X7GA 4MVJF 5DZSA 1AGNA 2RH4A 4I5EA 2WMDA 2BFMA 5U4QA 1ORRA 3DC2A 1N2SA 1N7HA 5TC4A 4BKUA 4P4LA 5JMPA 3S2EA 4NU5A 3DEYX 2PKQP 3K92A 2DTXA 3P2OA 5EIOA 4AJLA 5BSEA 1R4NA 1SAYA 2O3TA 4ZHSA 2E4AA 4W4TA 4JCOA 1E5LA 3RWBA 3ETGA 1KVQA 4MINA 5IDQA 2ZTUA 4W6ZA 1J4AA 2C20A 3U3XA 1IZ0A 1QYXA 2J3JA 5EQFA 3I5MA 2NU8A 4D41A 4YAIA 5KJ6A 4WEQA 3IUPA 3V2GA 3DL2A 4FJ1A 4NBWA 4Z9XA 3WGOA 3ZWXA 1QYCA 2IEBA 4OKNA 2V65A 1XELA 2GDZA 3OHSX 4R69A 3H9UA 4J1TA 1PGOA 2VWQA 4D44A 4WOJA 1CERA 3PJDA 2VRBA 3E82A 1ONPA 2C2XA 3BTSA 5JYDA 3DAGA 2HLPA 4A26A 3V1UA 1AXEA 2PTGA 3FHLA 4J4TA 2PGLA 4Q39A 5GMOA 4B8WA 1CQIA 4WLUA 3JQ8B 4CMEC 4BQPA 4Z3KA 1XQ1A 2UUPA 4CV1A 4FSHA 4HKTA 3I1JA 4HX5A 4WNIA 3FNHA 4K1LA 2UYYA 5IZCA 3ZDFA 3OFSA 1PJ4A 1KIFA 2YHIA 3S2GA 5BSHA 5J23A 4ITUA 5JBIA 2CD9A 1YBAA 1H94A 3S2IA 2FY8A 3UCXA 3QWIA 1OFGA 3R0IA 2DBVO 4N7RA 1F14A 1LQUA 5DP1A 2ILTA 5DBGA 2I5PO 5KJEA 1BWSA 1M6HA 3RC9A 1ISIA 4IZHA 1GCUA 3H65A 3NTRA 4H16A 4DA9A 1YGYA 4BV9A 1Z82A 2G82A 3GAFA 2WD7B 3ZWNA 3ZNNA 2NACA 4MVJA 2NQ8A 1GV0A 2VHYA 4ALMA 1D4FA 2DBRA 4LSMA 5L3ZA 3RI3A 2HRZA 1D1TA 3W4JA 2NU9A 1NPYA 1HEUA 4AJEA 4J3FA 2CZCA 1LDBA 1TT5B 3JD3A 3FNGA 4K6FA 4E2XA 4FFNA 3RC2A 3U4DA 3IJPA 4BNHA 1K6JA 3ZWWA 4AJIA 1J5PA 2PZJA 1BW9A 3WJAA 1MFPA 3GC6A 3INTA 2WTBA 3IS3A 1HF3A 4XYEA 1JW9B 4RPJA 4TSKA 2VUUA 4IMRA 3FTNA 2YQ5A 2IXAA 2BKAA 3KYCB 1P1IA 2WE8A 2GLXA 5L95A 4KDFA 4EITA 2A35A 2EKPA 2C7VA 3VH2A 3NJ4A 1EDZA 5CEEA 3PEFA 4FN4A 1UXJA 4ZRNA 4NG5A 1A27A 3OA0A 3AOGA 3EAGA 7MDHA 5A5FA 1RWBA 1HDRA 1LC0A 4AJJA 5CEFA 3WTCA 2RBEA 3PRJA 3KO8A 1WAMA 3JYQA 5EL0A 2G0TA 3H5RA 2YDYA 3K31A 4S1VA 2QX7A 4TRNA 4URFA 1JQBA 4A7PA 1VI2A 5FYDA 2HO5A 4PZEA 3SXPA 4Z6KA 3TQHA 4BNJA 4NFSA 1DOHA 3L4BA 4LK3A 1R4MB 5DP2A
chains in the Genus database with same CATH superfamily
3OF5A 4YAEA 1VBNA 4U0JA 3V00A 3NTUA 3VX3A 3PV0A 3FTDA 1BN7A 3BILA 3C1TA 3I0NA 5H68A 2I0FA 5JAQA 2WHPA 3WB1A 4IQGA 4PHTA 1XDWA 3V2UA 3GLQA 3O21A 4G25A 4IO1A 4N5DA 4IUBS 2PM8A 1OBHA 2QYSA 4HAVA 2CNWA 1HNNA 3W9UA 4B46A 2IC5A 1NZJA 4MKZA 4HFMA 4DCNA 5K7SA 1NJGA 4CKBA 1OBOA 1ZGJA 2FWMX 3F0TA 1DO8A 1Z3CA 3LDUA 4O4JA 3QNWA 3DV2A 5HIJA 2FK8A 4Z3DA 1PGPA 2IOHA 5CPBA 2WRZA 4LUCA 1ADGA 1ZVMA 5JS7A 1WM1A 3IUJA 4X94A 1JEQB 1SBCA 1PJSA 3W9YA 3IOBA 4X65B 3Q8XB 3PEUA 4FFSA 3WGYA 5ADUS 1JFFA 1I9CA 1NKTA 3CBQA 3M6XA 5ITZB 1C7IA 2P8SA 2GKSA 4YLYA 1OVMA 1HQYE 2ZB4A 5BVGA 1R27A 2WE7A 3FOWA 3D6VA 2B9VA 4UEJA 1JFVA 3NBKA 1JAZA 4QSHA 1QZUA 3ORFA 4ASUA 1MB2A 1QCYA 2AS0A 1ZJZA 3NX4A 4HRYA 2PBFA 1R6VA 1PWZA 2J3HA 4XASA 2IKQA 4P22A 1K08A 2RI1A 3PG5A 1GPDG 4LDQA 2WJPA 1Z6ZA 4TS9A 4N9QA 2BI8A 5HJEA 1H1LB 4PZYA 4ZZ1A 2I4OA 2I29A 3C43A 2YY6A 1V35A 4ZGWA 1XI2A 1K5GA 4PC7A 2PR2A 3VZCA 5CRIA 1HH4A 1F0KA 3WJ2A 3RS5A 3S6JA 1WZIA 3EDOA 2QTFA 4Q6WA 4U3JB 3LV8A 3V7NA 3WKBA 3FOCA 3S3TA 3UJAA 1U8YA 4NABA 1AKNA 2JH3A 4QL3A 5BW6B 3ZWPA 4B2PA 3D64A 3PIDA 4TYPA 2P2DA 3DLHA 1SCNE 1F2UB 5BWLA 3DL7A 4JEHA 2Q45A 2Z08A 2Q46A 4Q00A 1RM0A 1L0BA 4EGFA 3B2QA 3SBOA 4ED9A 1BO6A 3PD1A 1DKMA 1PAUA 4A36A 3NO4A 1QC5A 2ZJ6A 3L1UA 1JQJC 1WR8A 4RPKA 4B44A 4D74A 3MGAA 3PNVA 2VOEA 1OYYA 4FPXA 4KMOA 1BEEA 4M88A 1PV4A 1Q22A 1Z2EA 3GMSA 1H42A 1GSAA 4FC7A 4D1YA 2ONZA 1NG9A 4CBVA 4HGNA 4MVJI 1Z5UA 1D0IA 2EIXA 1SVOA 1RLJA 1GUYA 4KR0A 4GX5A 5F98A 2OG2A 4ZVTA 2XZDA 1NXTA 3FYUC 3I2IA 4R8RA 1Q3HA 4AFNA 3DOCA 2O2DA 2QTLA 3AB3A 3G7NA 2JIOA 3FM9A 3JRWA 2OTCA 5ELMA 5IAJA 3R9WA 1AY0A 2W4IA 1NAHA 3LXXA 3HJNA 2HDHA 2QGNA 4JENA 1EFDN 1D09A 3NANA 4UARA 2JI7A 3RUCA 3ETHA 3QJGA 4DE5A 5JHGB 1VB3A 2E6KA 1MGPA 1SD2A 2UUCB 3PHGA 3T1TA 1RZUA 3NAMA 1K7CA 1UQUA 1GSIA 1Y89A 4JSYA 4YCSA 3EC1A 1HC7A 1J8FA 5A3JA 1XTBA 4QYSA 1GVHA 1SOUA 5I51A 5IDVA 1SC4A 2ZVDA 4FMCB 4AURA 2X1MA 4DDVA 5BT8A 3DFIA 1KYVA 1YCDA 3IDOA 5LQNA 4OVKA 3WL3A 3SQXA 1J20A 1K0FA 5DHPA 5EZYB 1CLEA 1CB7A 1UWKA 2BFCB 2JAHA 2OPBA 2QPTA 3D59A 2EJVA 3NT5A 2B6NA 1NZDA 1ONNA 2XGGA 3KR2A 2XNKA 3MC1A 4E4RA 5KTYA 4C7KA 1ZWKA 4D3FA 4NZNA 3I04A 1WLSA 4V0OA 3LIPA 3CEMA 4EG3A 2FPSA 4QYWA 3GLSA 3HJRA 4M4SA 3I2GA 3G85A 5T8KA 2YBEA 1SMKA 2AOWA 2WT8A 3DBRB 4PYOA 5ALWA 3QM1A 4KDCA 1E9EA 1SVKA 4KXQA 1Q77A 4A5OA 3S1LA 4ER6A 5DYYA 4B3GA 1F0YA 5A4DA 3NIWA 1U9JA 2WU4A 3EGIA 1N6NA 1DVRA 3NP9A 1KZ6A 4DIOA 1P8AA 3EZGA 4MCHA 4UDYX 4WZBA 4IV8A 4OHVA 5ILGA 4ZCMA 4NRDA 2EG5A 4UM9B 5KJCA 1NQWA 4B34A 3JQRA 2P2GA 3P0IA 4D79A 1U2SA 1XA0A 2IP2A 2AN3A 3BMCB 2EYQA 2RG7A 1A5ZA 1XMSA 4IHAA 3K0CC 3GLUA 4XUEA 1G6Q1 1TQ6A 4J7XA 2KHZA 2BP7B 3ID6C 4M7RA 2JLYA 3C7TA 1KDRA 4BNZA 4M1QA 2CMGA 3FKJA 2E21A 3N2KB 4MQEB 1DQNA 1A2QA 1K4KA 1T0JB 1T43A 1WSBA 1FRFS 2GRAA 1LDNA 3FJOA 3KJIA 4J7CA 2FZEA 3PNOA 5EWLA 5HILA 5TIIA 4LHSA 2GJAA 3D8NA 1QORA 4J6EA 4RKRA 3AWDA 2FEWB 4IZOA 1JZSA 4CMIB 3C45A 3H86A 2YWHA 3HE3A 1ZICA 3HU5A 4YMLA 4INJA 3JYLA 2ACVA 1TYCA 2C98A 5P21A 4BFXA 1ESEA 4C7BA 3JQAD 2R66A 1M7BA 1O2DA 1ZM7A 2Z6VA 2E5LB 2R2AA 4KXVA 3G8YA 1UZUA 2NADA 2PA3A 4P8RA 3A4MA 4DSUA 3ZBQA 3K7EA 1G16A 1C50A 1M2NA 1T3LA 1ULSA 3CR7A 1I4EB 1H0HA 3PX2A 2EKLA 4KAAA 2A0XA 4LVNA 2BFFA 3FPKA 3LW8A 1XNHA 1YAHA 4UZEA 4HN9A 4JVNA 4ZO4A 2BBOA 4ZA2A 5EFOA 3UC9A 2H48A 3DTVB 2WYOA 3I30X 3WAKA 1LCIA 1D0VA 4C6SA 4G0NA 3RD5A 1KAGA 2DM6A 4CEIB 4ZAVA 1TMOA 1EINA 5EJ5A 2LDXA 1VJRA 5B2FA 3VZDA 3LT4A 4H6WA 1ZJJA 4PAMA 2Z6QA 2BEKA 3NXKA 1P2VA 4UPDA 1Z37A 4H7DA 4YMVA 1E77A 2D1QA 3GZNB 3NWOA 1AKEA 3ZDDA 2A4MA 3ZU3A 5ALMA 3Q6MA 5GJCA 2JI6A 3D6AA 3OCCA 5DKFA 1ZN2A 2O7SA 2WUDA 2D6FA 3OZUA 1KAHA 5B1YA 2B4QA 4KE8A 5J63A 1YJ8A 1TTPB 3RR2A 4I55A 4GUDA 4AN4A 1DP4A 4B6FA 3QE9Y 2GEJA 1SKQA 3U1TA 3H5VA 2ZAGA 2GD1O 1HKHA 1HDEA 1O57A 4Z4EA 3LL7A 3SJZA 2C2WA 4EHDA 5DHSA 3R1IA 1E3JA 4P83A 3X1DA 3L8ZA 3FOAA 4GVLA 3TTVA 2QVBA 2N46A 2XECA 2EFJA 3MT0A 4LXTA 3D8TA 2CKDA 4O2LA 5ERXA 1Q0RA 5KO2A 5ILOA 4U8HA 3A4IA 3M9WA 2RH8A 1J9GA 3NOQA 5HCIA 2JIMA 1RYHA 1Y5LA 4K9MA 1A8IA 3K70D 3O2SB 3KSMA 3P52A 4K5QA 3K73O 2QB5A 1L2TA 4NYJR 5TX7A 1SRQA 1H69A 1RJ9A 1K27A 1OFIA 2VTEA 4PR3A 4DMRA 1SFRA 2OYSA 2ZIEA 4QPJC 3T38A 2ZI4A 2AFIA 4GMDA 4IDBA 4C5AA 2ZIFA 5EUQB 3D31A 4ZOAA 2R96A 1L5HA 3ZTYA 3F78A 2JRLA 2WWVD 1DUVG 1UEXC 2WNHA 2XLCA 3L5OA 3LU1A 3AESB 4S1TA 4FC6A 3U81A 4DM7A 1XZ8A 2FJ0A 4DR3B 1P80A 1QH8A 1L5MA 1WMBA 2VT7A 2XRFA 1RI2A 3EXHB 3R3SA 4MK4A 4CI0B 3RADC 1YULA 3PLAE 1G41A 2YOFA 4OOEA 1MC1A 3RVDA 5AVWA 2AX4A 2JCGA 5M34A 5EJEA 5MN4A 1ZZEA 1CFJA 2QZPA 4B47A 2EFGA 5LBTA 1GGKA 5TLSA 3BDVA 3UOGA 4A0RA 1NBOA 2QRPA 4N47A 2QE6A 2YYYA 1RNLA 2BMEA 1X42A 5K1ZA 4AY4A 1HK7A 2DPMA 2F90A 3V46A 3HLKA 4M76B 4Q1VA 1JBKA 1YZKA 4EYSA 1LNQA 3T7RA 4DIMA 2PUDA 1PSWA 4LRSB 3PHCA 1GTRA 1OF1A 2D62A 4GR5A 1IUNA 1GR0A 3Q9UA 1Y82A 2JFFA 4IZ6A 5FI1B 3EBPA 1GCIA 1UAAA 3N2KA 3JD1A 2ZYRA 4MVJH 4EA6A 4OGKA 3FUXA 2PZ8A 3GEIA 4LXHA 4PCVA 3HNRA 4QM7A 5HE8A 5C8YB 4NU8X 1AA6A 3BMQB 3N75A 4LZAA 1IBSA 1GXSA 1VCNA 4LXQA 3UKJA 4B6OA 1VPTA 4C3UA 5ULLA 1YE8A 3T4XA 1U7TA 2IHNA 3WGQA 2GCPA 4YMIA 1U31A 3KB6A 2UYCA 3GFBA 3SYNA 4A2PA 2Y77A 5TB5A 5KYUB 2IITA 1S7CA 1OBCA 1I94B 5LJIA 1R4NB 3RUAA 2OVBA 1GPWB 2IOFA 5F5NA 2VSYA 3LT2A 4JJKA 4R05A 1KOFA 1XRNA 2R1TA 1VZ2A 4Y2RA 1SUCA 1UJ5A 1TRKA 3HP1A 4I2VA 5G0WA 2O05A 4Y2JA 3V1YA 2DHDA 2GHQA 5KKAA 4PSCA 3CGGA 2PXXA 4JT8A 4PPFA 5LOVB 3DTVA 3ZZ1A 5ICFA 1II9A 3KOWA 3AF6A 4KODA 3M4YA 1BGWA 3L0ZA 4DCJA 2B78A 1L4GA 2B25A 3ZV4A 2PUAA 1DAPA 3PJGA 3GLRA 3GWZA 4DCVA 1ZXLA 2AOXA 1VXRA 2NIPA 3H18A 3NZEA 4PZLA 1VE6A 4MAMA 4F84A 4CN8A 3VU8A 1U1FA 1HLFA 2Y0DA 3VC7A 4HDQB 4HC4A 2VYQA 3B1WA 4Q9KA 5JIBA 3ZH2A 4JBXA 3IT3A 3WYCA 1RLMA 4I81A 1ODKA 3Q11A 5FOXA 1DAMA 1G4UR 3KQNA 2QIOA 3NFYA 1EI9A 1B1CA 3ROEA 2Q1XA 3CRVA 1S2LA 3GU3A 4EQ6A 1TE2A 2CL0X 1XYYA 3OZBA 2FFHA 3HPQA 1J99A 3N70A 4HWTA 4L27A 1LZKA 1XU9A 3B48A 3ZX5A 1RS0A 3AUSA 4XDHA 1N2IA 1KVRA 1MORA 3IUBA 4HPWA 3A28A 4LX8A 3DFUA 4R0NA 4BTLA 2V6GA 4C0HA 1MNQA 1UP6A 5HKOA 2I8CA 3LFUA 3N3AC 3WYBA 2V3CC 3LPAA 3L4EA 2O2EA 3H4IA 1E9RA 1HE1C 1PVDA 1YZTA 3GUHA 5DNWA 5LZ5A 1FSGA 1HM5A 1W2GA 4PLYA 1FP4A 5E1BA 3S29A 5AQ1A 5BQXA 3K0KA 1XZQA 2VKTA 3M5WA 3QKTA 3EAQA 5CB4F 1ZA2A 3MB8A 1G6KA 2EJBA 1E3SA 4IS3A 2CCKA 3L0YA 3RO7A 4FEEA 3E1KA 4FDUA 4HO1X 4TUYF 5T4EA 3P45A 1PZEA 3CA8A 3RV4A 3QX8A 2FRDC 3GGOA 4EF4A 4AF8A 5ISMA 2CV0A 2WMYA 1SQ0A 5AHXA 1AXGA 3C3WA 2BTQA 2ODQA 4DZRA 3U44B 6LDHA 1E1CB 3LYAA 2I76A 6ABPA 5LDGA 3PGVA 1Y6RA 3BCHA 3MJEA 3RT9A 4DSOA 3O90A 3VDMA 2GF2A 4Y6PA 4UUQA 4F97A 2OZEA 4MTCA 3IJRA 4YAKA 3W9SA 4I50F 3FLMA 3DH0A 4ZEWA 3WDMA 4MRRA 4QFBA 2YV1A 1MABA 2ZS8A 1EWKA 3WQQA 4KC0A 3K4HA 5F4ZA 5IVPA 1PU2A 2QLFA 3GY0A 1YRLA 5IXYA 2P9QA 1QS0A 2BHTA 3WKCA 1XCJA 3QFRA 4UBNA 3HFSA 3LXMA 3MTBA 4DAOA 4K8OA 4Y0AA 2PT7A 1M2VB 3REFA 1AHPA 2GNAA 1J9EA 3JATB 5AM0A 2XE8A 3FB4A 2DPLA 4NV3A 3CUEF 5I7FA 3KSUA 4EI8A 1Q15A 5J3JA 3QLUC 4M0LA 5BN3A 5EJMA 3T1YB 3AEXA 1XHFA 5BMVF 5CH3A 4ZVRA 2CXNA 3GRAA 1HSZA 3V8EA 2NVWA 3L7BA 3SHFA 3B78A 1RAIA 5C1OA 3ESXA 5E95A 9GPBA 1ENOA 1KJJA 2Q4EA 5EPUA 5BMVA 2VTBB 1E5XA 1YDMA 4IDUB 2G72A 1IQUA 2BDTA 3E58A 4LOLA 4WVLA 1GUAA 3FN4A 1XD2B 2SECE 3CNEA 1H22A 4EGJA 3JVEA 1CJVC 2V9ZA 2IY7A 1E98A 3BWVA 3EMDA 4FQ5A 4N7JA 3ZDQA 4D42A 1KEEA 4NESA 4W5RA 2IS1A 5I01A 3FBTA 2HK8A 2I4LA 3ES9A 2Y67A 2XB8A 4TV8F 5ALNA 3FOZA 1S2MA 2H31A 3C5CA 5EWJB 4LWPA 4MW9A 4ER7A 1R6XA 4G3XA 5F77A 1WSWA 3HZRA 1P2UA 2IKSA 2H3HA 2K2WA 4PGAA 3CRQA 1E8NA 5DISB 2PJRA 3BERA 5E6RB 3NKLA 2GBIA 4LZNA 3I8XA 3SKVA 1ECGA 2ZIZA 5JR3A 4A8JB 2YVKA 2GPJA 3QY9A 4HXYA 4OHUA 3LP6A 3SYLA 2YXBA 2XA9A 4L5JA 4HVTA 4XFJA 3KAPA 1FFHA 5A4MS 4Y1FA 3KQUA 3L1HA 1U9IA 1Q50A 3UQZA 2F8TA 2G9QA 3MPUA 3J81k 1JQLB 4DLPA 3EGDB 3UJ8A 4GGPA 4EGCB 2PE5A 3F4KA 5DYWA 1D1SA 1NVBA 2NQTA 3OC6A 4X1YB 5BOSA 2GPAA 1KZHA 2JFZA 4PSKA 1RRVA 1RWMA 4L0DA 1UBNA 4EY8A 1H3EA 2FPPB 4BO7A 1FQWA 4RJKA 1TTHA 1UADA 3TB6A 1TM7E 2X77A 1L8XA 1O3YA 1QE0A 3ICVA 1UMDB 1ZRMA 1NUAA 4EZIA 1PJCA 2BT4A 3N74A 4EY3A 1Z7BA 5D3QA 4KN6A 2GARA 2LDBA 2POCA 4X44A 5DHAA 4L6CA 3DZCA 4P58A 3V33A 4AU1A 1VP9A 4J0FA 2IPLA 4BAGA 1VMKA 3H9GA 1MXHA 1I9GA 2ZREA 5I8ZA 1NBEA 4XSVA 3L8GA 3RJ5A 1WCXA 5AW0A 1W0JA 4LZOA 4RDCA 3L6OO 3DWGA 1U3VA 4ODIA 2JFBA 2EC5A 5A02A 4FE7A 2OORA 1TC2A 4PGFA 3SJAA 1QM5A 1UP4A 4RETA 3R5XA 1OJLA 4Q3DA 3UHAA 2LCFA 4NBSA 1T1GA 3EEQA 1BD3A 3WG9A 1PFKA 1U7UA 2XYPA 3K1AB 3OT1A 1I2ZA 2CXQA 2FVYA 4EBFA 1EFVB 4DLUA 4WDQA 1G20E 1DXQA 2A1TS 4RVCA 1YJAA 3EWNA 3I32A 1GPNA 3NTXA 3IR6A 3PCTA 1MG5A 1TEVA 2WFAA 3DEKA 3E5MA 3R77A 3O82A 4LNAA 2RMKA 3WHIA 2YR0A 5CB6A 1NP7A 4R3UC 1U0BB 1XXHB 4QNRA 3F3SA 5IVIA 3QGMA 4CV0A 5EJFA 3A9TA 5FKJA 1E9SA 1HZZC 4HDRB 2QN2A 3GPIA 3MJTA 3V6LA 5KKNB 4JT4A 3H7AA 2POQX 2YZ2A 1XD9A 1AMNA 3DZHA 3KWFA 1DSSG 3M3PA 4L78A 3VR3A 1V71A 5CFZA 5FT9A 4YJFA 3K5IA 3F8WA 4LYYA 5DULA 1BWRA 1Y8QB 5EKDA 3LA8A 6GPBA 1RM3A 2O7RA 2D1RA 1QE3A 4KACA 4CM8B 4OHPA 2ES4A 2XBUA 2QRHA 4D4HA 1XLVA 1DKNA 3CJTA 3MXOA 1KI8A 1SBQA 2XE6A 4EHFA 3F5MA 2TMDA 5LP6B 1I3LA 4QXAA 2G71A 3MJ4A 1R12A 1ZZGA 4KXNA 3SI7A 5C81A 5TJ9A 1QSGA 2WHEA 1PK8A 5BSKA 1NSYA 1UMBA 1UMCA 2FG6C 5EIWA 2R62A 1XMIA 1ZG3A 5KOJB 1R4ZA 3E2MA 4ZV7A 1GU1A 3DBIA 3LHFA 4YO8A 2JIQA 3TL2A 2BGUA 2WJJA 3M1AA 3LVBA 1PK9A 4Z7OB 1RPTA 2CMKA 4ND2A 5HDBB 2IYPA 2ZE7A 3TQRA 1ZXBA 1QCDA 5B64A 2I2BA 4XD2A 3CSUA 2AG5A 1UKEA 5JDCA 2C8VA 3HBFA 1KAOA 3FYSA 4MI1A 1G0OA 2LW7A 1V7CA 4BMNA 1QE5A 4HWRA 5KBYA 4E12A 1ZM4A 2WV9A 1RXCA 1CJBA 1U28C 5TMDA 2HT6A 1M2HA 4PEVA 1NN1A 4CF5A 5JJCA 1V7QA 5AJXA 4ZOLF 1X7XA 3O2NA 5ENVA 2OHGA 1P7CA 2ZIGA 3L4JA 4LVCA 4OI4A 3TQOA 2X8BA 3U19A 3NUGA 4PCUA 5DTQA 2JBAB 5CB0A 2O48X 2QMYA 3LLVA 3EEBA 5IKPA 5K8VA 4PGMA 3SZLA 1UFQA 4X9XA 4JI6B 3FYUA 3PNPA 4N5LA 4W1QA 1IBKB 4HT3B 4Q4LA 4RAQA 3QPCA 1ADBA 4LHXA 4WFQA 4KR7A 2GN6A 1BRMA 3EIFA 1VL5A 3R6WA 4L8GA 3TD9A 3ZHBA 1SBNE 4RQTA 2J3QA 2BUCA 2VSOA 3ZK9A 5K3DA 5IBCA 1C9EA 3DNPA 5K3FA 1SOMA 1KFEB 2AKAB 1FUIA 5GQSA 3OOWA 4X1IA 3WNVA 1W75A 3IBGA 4P80A 1H65A 2WD9A 4WAUA 1B3RA 4MROA 2DP4E 1J06A 4KK3A 5CDTA 5FEUA 3RYCB 1M5RA 1CUBA 1GPYA 1JVBA 1YJQA 3C1AA 4IYRA 1HORA 3UN1A 1WULS 1YS9A 4P86A 3DW3X 4PVCA 1BHSA 5DM2A 3DMYA 4V1CA 1WB6A 1NQVA 2O52A 2ODEA 3KXDA 5FTKA 1EMDA 2G6TA 3OPYI 1TKCA 3F7OA 3GZNA 2EFDB 2XHEA 5DGHA 4X00A 1EDDA 2X5OA 3JD4A 3U62A 3CH5A 4BB5A 3R8CA 2WVJA 2XNDA 2V1XA 3SBXA 3PFNA 4INPA 4U2KA 1I33A 1FUUA 2XCIA 3KSAC 2O8BA 4ZREA 1U5AA 2I87A 2DMRA 1JQDA 3F3KA 3FCAA 1Y80A 2QHXA 4TKZA 3EH2A 3WLAA 1SIUA 3AU9A 1S2DA 5LU9A 2QYHA 3RFUA 2AN9A 1X14A 5F52A 3ASYA 5TF4A 5KTTA 2L82A 3DD1A 4BQRA 4RPGA 5FNVF 1P45A 2H7XA 5CFPA 3VV3A 5FLKA 2OCXA 3QLVA 4CV3A 1YB6A 2F4NA 1B76A 2EHDA 3CIFA 1HZZA 2OLJA 2EXXA 2QG4A 3JXEA 1YVEI 2Y71A 1F4VA 1P0MA 2CFRA 2CHGA 4WK2B 2CV2A 1QTQA 1BSVA 3EPHA 1A8SA 3ZZTA 3K09A 2YX1A 1QX4A 3A9RA 4G24A 2B8TA 1SC9A 4U7PB 2G70A 5LLSA 4KWEA 4L7QA 3MMNA 3OJLA 5AOCA 1LK5A 1Q21A 2OFPA 1W19A 3WNBA 5CA0B 3O8DA 1K6MA 4PHCA 3TCKA 1H3FA 2YXEA 4FYHA 2DFVA 2XV1A 4MRNA 4RVNA 4YBZA 2ZSEA 1U1IA 1HLPA 2ZBPA 3CM0A 3RS2A 4XYLA 3BXGA 3RU7A 2X2FA 2ISCA 2UYOA 3COSA 4RULA 4GBJA 3AEYA 4FKZA 1J0AA 2GNOA 3FNRA 4ISCA 1VFNA 2MJLA 2PT9A 2QPOA 1OREA 3BIJA 8ADHA 7GPBA 2GVDC 4IUYA 4RNDB 1OZ0A 4QU9A 2CB9A 5BV1A 2P1RA 1CW2B 4QBTA 1O7JA 2J09A 4GP7A 1C3EA 2XKBA 4K88A 3TLAA 3FR7A 4Q93A 2O8BB 2W2LA 4KV7A 4H7EA 1DRWA 4G0XA 1SURA 4FGSA 4ND5A 3WO0A 5I7SA 3K9FC 1W48A 1T6BY 1QHIA 1BROA 5D8DA 2QW8A 4PG5A 2A7XA 3VJMA 3R6TA 4FW8A 4B4OA 4CM4A 4N5IX 1MN6A 1CY0A 4MA4A 2I22A 1XZPA 3DBLA 4AG5A 1TFUA 1UKCA 2JA1A 4ND8A 1JKFA 4WZBE 1EFUA 1XTQA 5BRNA 2BKLA 4ZMSA 4CW7A 4OXIA 2XMPA 1PHPA 4ESHA 5LDHA 1ZRSA 3NCTA 1O96A 2YYZA 4RENA 4M8LA 3OZTA 4P0TA 3AFNA 1NFQA 4JU8A 5B7NA 5TE9A 5JTTA 1L7AA 4X8OA 5HJ7A 3PGMA 5J2UA 1N5DA 2ZT5A 5IVDA 1W1UA 5E1DA 5BVHB 4LEIA 1K06A 1AK9A 1QAMA 3ECSA 3WYNA 1X94A 4J91A 5I7OA 5FI3A 1S3IA 2PLFA 4NBNA 3VFDA 3GIDA 2FPUA 3I58A 3ABSB 4JYPA 5TQJA 2DPYA 4OAQA 3ZLTA 2I3BA 2QP9X 3SICE 3JWEA 5HKBA 3W6PA 2EZ9A 1HETA 5DTEA 2B21A 2PH3A 4CG2A 2YJGA 2PHZA 3DBHB 3LX6A 1LTHR 4Q1EA 4AVYA 5CB8A 2PSSA 3CLVA 4OHKA 3C7CB 2R0QC 3BSYA 4HY3A 3FCEA 2Z5VA 1P73A 3JAWA 3DWIA 3UGQA 2NZ2A 2VDNB 3RYFB 3DLIA 1X0VA 2GAOA 2SKCA 1LDYA 1J07A 1KA9H 2RSLA 4LXGA 4ZQHA 1MHPA 3TGWA 4FNAA 1P2GA 4MRSA 3SLKA 1GU0A 1V96A 1C0LA 3MB5A 4IIJF 3MOIA 4OFWA 4L8LA 1QHYA 3JQFC 1VC2A 4H4DA 1JN0A 3ZIDA 1TCVA 1CQXA 1JT2A 1W581 1W5FA 1WD7A 3IALA 2ZSHA 5CK5A 3UWKA 2VDVE 5FTJA 3LCJA 5HRUA 4ZQBA 3TOSA 4L4UA 2XB9A 4NQZA 4LNUA 5LQCA 3JCZA 4ZT2A 3R3ZA 4V3CA 5B4TA 1C8VB 4UMEA 2CFSA 3WAGA 3TNJA 3MBOA 5B55A 3LWBA 4OX9Y 4PLTA 2D1TA 3H5AA 3HADA 1SUEA 4JGBA 3RGWS 4E22A 2HQSA 2JI8A 3A7DA 4TS1A 3EOAI 2WZBA 4WE3A 1JHMA 5JD3A 1P0IA 2ZOSA 3FNBA 5AW4A 3LSYA 2HQBA 4LDAA 2QM0A 2OLKA 2Z95A 2FMTA 5E9JA 5IJ0A 2B98A 2R86A 3PUJA 3OZEA 5EE0A 1GAXA 4P9NA 1Z7EA 5AJYA 1HFEL 1Y8RB 4GE3A 5CD9A 1X7DA 4KRGA 4O4LA 1LDGA 4PZDA 3KYJB 3Q3JB 1Q7RA 2H2GA 1B6GA 3K1YA 5LKAA 5AW5A 3V4VB 3KQHA 2IQ5A 3H8WA 3NT4A 3CNBA 1E1CA 2QVYX 4PPYA 2Z2ZA 2NV6A 3UWSA 3U13A 3GRRA 1OCEA 3OZSA 3AHHA 5LNK1 2QUBA 2J9YB 4KAFA 1J8VA 1MAHA 3LF1A 3LDGA 2QJFA 1QQTA 5GY7A 5A9SA 4GPTA 5DM0A 3ZWKA 1ZVVA 2D5CA 2Y1KA 1NVGA 5DTMA 1L4MA 4ZT6A 4MCIA 4EFDA 3IGFA 1RAFA 5DN6D 2N1MA 2EJTA 1HE5A 1TJPB 1Z4JA 2VA8A 3ZYZA 3K9HA 3IRUA 2Z0MA 1QH9A 3AM3A 3LP5A 2XT9A 4TWIA 1R5BA 1RAGA 4MV5A 2PZMA 1CG6A 3U7QB 2QD4A 1MVLA 4Y6LA 2WKWA 4I4IA 1B8UA 1RSZA 4QRIA 3I72A 4EPYA 4G5HA 3TO5A 2PKXA 3PUXA 4E5PA 5CBPB 4J9UE 2H0QA 1D6MA 1XTIA 3P19A 2F1KA 5FLEX 2GS9A 5B3AA 3DAOA 2FP3A 4U1RA 1SA0A 1CIPA 1ZESA 2W37A 1MU0A 2QRKA 3C8HA 4UVDA 4X1KA 2GESA 2OEPA 4MQ6A 3I9LA 4MUHA 2CVPA 4WH0A 3TS1A 4F04A 3OLCX 2P11A 3HJTA 4CKXA 4ZVLA 2JFVA 2OV4A 2GZSA 3ZX4A 4BP1A 1KYZA 2BM1A 1C0IA 2QJTA 1W4AA 1N0VC 1T4CB 2WYIA 4ISBA 4XPIB 5A4AA 2I6XA 4M1OA 5CT5A 1FYVA 3W6NA 1OXVA 5D01A 2E85A 4IINA 1ADJA 2ODTX 1D07A 2Q3CA 4V0SA 5AKHA 1M0TA 2WQ7A 2FEXA 2EBUA 2PSFA 3DCYA 2AQKA 1ZK1A 3D8SA 3GLKA 1ENYA 2XZTA 2RB4A 4JK3A 1DG3A 3TPCA 1A5SB 1X1TA 1JUDA 3O9ZA 5I48A 1XEFA 2Q5EA 2QTRA 2PRZA 3HR4A 1N2JA 1QBGA 2I2AA 2MSNA 5TQ2B 3IAXA 4RGYA 1K0UA 3ND8A 4NATA 3ZDYB 2GEUA 1Z6TA 3EZXA 3UK2A 4BVLA 3EX7C 3AYXB 3O0TA 3VH1A 5CDFA 4AI6A 3B5IA 1ZH6A 2J85A 4MDHA 1AS3A 1L7XA 1N7JA 4KXMA 1KZGB 1PQ4A 3RU9A 3RVSA 3WYFA 4DHWA 1IIRA 3MINA 2CLEB 4ZI3A 3KZOA 3RYTC 4DIFA 3VA7A 2I9KA 3R3HA 4G65A 3WNDA 5THQA 1P9LA 1DGQA 2GO1A 4O2BB 2I4TA 4P5EA 5E8RA 3ROMA 3TMKA 1E6UA 1DEOA 1VHQA 1SK8A 4L72A 2JGRA 2PRJA 2FPPA 2QRVB 5CEJA 1YF3A 2DECA 4I1PA 1CZKA 1R0YA 1Z5OA 3QNMA 1C80A 4MPTA 1CZLA 4DWWA 1M1NA 2PVCA 2ZT6A 3GXBA 4PYNA 5EP3A 2DJIA 4IL5A 5FBKA 2BR3A 1C2YA 2BFEB 1COZA 1GPBA 3BXFA 3DFZA 3RVQA 4ZOLB 3CZ9A 3U3DA 4BVKA 2G40A 4GSLA 5F9HA 2QRQA 3CTPA 1ETUA 3T9EA 4JL6A 5E9WA 3TJZA 4BV2A 3O73A 4DLBA 1VJ5A 4GWKA 5LIRA 2Q29A 1XCMA 4HWGA 1EGHA 1TQ8A 3HBJA 4EZBA 1WMDA 5LMZA 3ZLAA 3K16A 4CMBA 1B14A 1O03A 2HXYA 5CJJA 2HH9A 3MPOA 2NO7A 3K2EA 3NBYC 4RPHA 4Y8VA 4CM7A 2Z04A 3LX4A 1BQEA 3EIXA 1PFQA 5C35A 4ZK6A 3ND9A 2IEGA 1FU8A 4OQDA 2ZM6B 1RR6A 5LR6A 4ZTUB 421PA 4XTRA 4TLLB 1AKVA 3UWDA 4BBAA 1YTLA 2ZJYA 1J8DA 3CHYA 3L01A 3W1VA 5LDDC 1X80A 1CQJA 1NJFA 1JJ7A 4B3CA 4BNDB 3KVNA 4HS9A 1VE7A 2AR0A 3EPJA 3DGEC 1MC4A 5AXAA 3H5TA 1ZGCA 4MYUA 5DYNA 4BNTA 4TXNA 4G0WA 1XZNA 4NE9A 5F21A 4D8TA 1FSSA 2X0RA 2NYAA 3OH8A 2WHRA 3REOA 4JHXA 1RYZA 2HYIC 4H27A 4LOIA 1Q12A 3ZHYA 1Z75A 2XUGA 2R1VA 3OQIA 4N3CA 4R8VA 2VXYA 4RYLA 4RTKA 1BOFA 1PX0A 4ONEA 1V16B 4MV9A 4MI6A 1FYFA 3AI2A 4V1CI 4G1EB 3LL4A 2F17A 5A3RA 2JFYA 5F1PA 5FBVB 2PFKA 1T2AA 3WTBA 1LVUA 1C8KA 4RY9A 2PMDA 1O89A 3RKRA 1XRQA 3EUEA 5FADA 3KOYA 2XAUA 2ZYIA 3B1KA 3LFTA 5JNWA 5JG7A 6PFKA 2GYYA 3ZK8A 4URZR 2C4NA 4G4JA 4IF6A 4R2WA 1IHPA 5JAPA 1VDMA 5TVGA 4BNIA 5HZHA 3L79A 4BLWA 3CX7A 1OWLA 4M0MA 3NHKA 3IKJA 1RADA 4ZO8A 1WF6A 4Z4QA 1C0EA 3QG5A 3A9WA 1JKJA 3M33A 4YMWA 2SNIE 4GP9A 4B3JA 5JCPA 1RIFA 4XWKA 1T34A 3RV3A 2H5JA 2ZAIA 3O3NB 2C7RA 2FZKA 3SDSA 4BP9A 3B6MA 5LL6P 4NBKA 2P6RA 2NWQA 3C4VA 4TXHA 4PVDA 1I7SB 5EE3A 1FP1D 4BNDA 4D6XA 1ESNA 1LC3A 4YRNA 3MNFA 3DLTA 2DQ4A 4TV9A 2NUPA 2WW8A 2Q99A 3M34A 1KPGA 4GAEA 2NVUB 1WPXA 3BRSA 3QW2A 1ZQ1A 2CJWB 2I2DA 3KXKA 4YT8A 4KTTE 2WKPA 4L9SA 4GUAA 3VOSA 3GVCA 1EB9A 3KKEA 5AVOA 2HTEA 3FMFA 4JYAB 2NPIA 2CHVA 2JDIA 4TT3D 4UXJA 4GKAA 5AVJA 1LBIA 3LOQA 2H85A 1WW3A 3B36A 3ZN2A 2QTVB 3GVXA 4US2R 2G5TA 2IYNA 4EA8A 3IOYA 1AQLA 4FUQA 4FEAA 3LY7A 1NW4A 4LRTB 2PGIA 4PXAA 2CJYA 1MV8A 4HAUA 1XZIA 3N2LA 4K46A 4LVOA 4NYJQ 2ECFA 2R6JA 1KI2A 2XMRA 2PKQO 4TWBA 3BB4A 3GEMA 5CTAA 2R6AA 4CKBB 3DMGA 3KQQA 1YI1A 3PD7A 4KO2S 3HY4A 5LFAA 2D7DA 2UV8A 4UU0A 4AZTA 2F3SA 1UBLS 4PYMA 1IPFA 2QDXA 3HH8A 2XCTB 2FDXA 1VG9B 2W2XA 2JEOA 4FX2A 4D9FA 3SWWA 1N0WA 1S9HA 1CNFA 2J0UA 3NGLA 5LZ2A 3KLMX 4DR4B 3GGCA 3I6QA 2ZTVA 1P4HA 5ALJA 5EN4A 1J42A 1XHEA 2VPXA 4DADA 4E6PA 4KFSA 4BNWA 1QG2A 4DNXA 2BEVB 3QI7A 1L5FA 2NZJA 2QX6A 3TRKA 2WTAA 4KVFA 2DLDA 4X92A 1JEOA 5JPIA 3S7ZA 7ABPA 3BGWA 1XEXA 2VJKA 4EQZA 3AL0C 2B5WA 2X3FA 3UK0A 4JEIA 3LS2A 2B9EA 1HYQA 3OPVA 3RVBA 4YDRA 3CH6A 3R0VA 2FMHA 3SZ3A 2P68A 3DLCA 4Z4GA 1A9OA 3EASA 1W34A 2QTGA 5DOZA 1HWYA 3DULA 1JZQA 1YMVA 2OZLB 2C9MA 2YTZA 3FTPA 1C3VA 4YXWA 1VP3A 1NYRA 2XF8A 2VZ8A 4OUDB 4ZU1X 1J49A 4JI0B 1THZA 1NW7A 2X0DA 1I2CA 1U6IA 2CFCA 3JQFA 1KJ9A 2F8MA 4LJ9A 3BRWA 1EAYA 3C1OA 3KB1A 5KUTA 5B58C 2GHTA 3H9EO 2C2MA 1FTNA 4X97A 1G5RA 4DQKA 1M1YA 3SEAA 5B3KA 3SZMA 3UCFA 1L8OA 4QWMA 1YB4A 4E70A 3RVOA 2Y0EA 4J03A 2JF0A 1Q1BA 2C58A 2YMLA 2KLBA 4K9LA 2EZTA 4TKLA 1OLUA 3MELA 2WIAA 4PZ9A 2H2WA 3WLFA 2C42A 1QC5B 2P27A 2CDNA 2NXJA 1V7ZA 2XOKA 1Z0FA 3C6KA 3WDLA 1JB1A 1P5RA 1RAEA 1NT2A 2UZIR 3CWQA 3FWYA 2A0FA 1LDEA 4RDHA 5AKGA 3CF4G 2ZSAA 2QN8A 5LBUA 1QNLA 4D8UA 2ZRBA 5JATA 3MT9A 3O1IC 4XVQA 4X6YA 4ZDKA 4YV2A 4TN1A 3UGKA 2AXPA 2GN9A 2O2IA 2P4SA 3FMOB 3QJYA 4ZT7A 2QVXX 3WB9A 2V7UA 3L7DA 3G7UA 4YPFA 1MLDA 1VHDA 2XADA 4R0VA 1AGYA 2GUGA 1XLUA 4OMFG 1F20A 4CE6A 1YE3A 3W2HA 5FFFA 4G0VA 3EXG2 1CY2A 3ZU4A 3QUAA 1TD1A 3JD0A 2BF4A 5F9MA 1T4MA 1C7FA 4QOGA 3DFMA 2ZUTA 4NBTA 2HUNA 1QHSA 3C6ZA 3K6SA 2L0XA 3MCVA 2E4ZA 2K87A 4L5BA 2ZR0A 4TWRA 4RWEA 2F1IA 1VBKA 5AQEA 4DGSA 4G0QA 5DCLA 1ISHA 1BEUB 5KC8A 4ZMRA 1BRTA 1JTVA 1WOYA 4KIJA 4FOOA 1Y5MA 1JJIA 4QBKA 4ZZ0A 4RTPA 4DRYA 4X7BA 2JGAA 1G7CA 3CPJB 1QP8A 3EC7A 1U4SA 2FSVA 3R7DA 1IY8A 2QYTA 1Q2UA 4KLAA 5HS6A 1GRRA 4CQMD 4S24A 2KBFA 1P9OA 1RTTA 1URPA 2O2HA 3JYNA 3ZD7A 2J6BA 1N6LA 3KG2A 3Q0IA 2HSGA 4LJLA 2Q1YA 1N0HA 1NMQA 4ZGBA 3GNQA 1M6YA 4J0KA 5EJ7A 2J3DA 1MC8A 3BIOA 1U9CA 4UJ5A 5C31A 3V8RA 4QLAA 3GFOA 4A6PA 1EJBA 1D6SA 1UPTA 1Y3AA 3CV3A 4LMAA 1SEVA 4N8SA 1R4AA 1UMDA 3HB4X 2DERA 1X8KA 1QF7A 4CLOA 5AKZA 2WIBA 3RUDA 4UBOA 1UC4B 1YUMA 3AU8A 3OX3A 1VG1A 3TZQA 3O2JA 5J1TB 1TA4A 1T1JA 1YQQA 4H08A 3TW8A 1CJTC 2VQDA 4J4BA 1B8NA 3GT3A 3L9WA 3KYBA 1M2OB 4EG8A 4OYHA 2CHUA 2YYAA 1XYVA 2D2EA 4MV3A 1M8PA 3RBAA 1YL7A 2ZUBA 1DEHA 1SXIA 3KHSA 4I99A 4KZPA 3IJ5A 1OW3B 4TS4A 5DBHX 1ODLA 2X7HA 4JOBA 4QA9A 4WCFB 3GPDG 3W7VA 2OQIA 4YAOA 3WJ1A 2ZXUA 3II6X 4BWGA 4MPPA 4ILEA 4FGZA 1YO6A 2R79A 3HS3A 4R1UA 5JYCA 5DTJA 2BBWA 1CR2A 1B74A 3HL4A 1U7WA 4QICA 2QSYA 5EP4A 1RPZA 3W5JA 4GU5A 3DMFA 2JLZA 3RHZA 4FR2A 3DXYA 3QXSA 1KYYA 1TB4A 3OUZA 5CXUA 1FY2A 4ATNA 1HPLA 3G9TA 1E0KA 1SG9A 4M8IA 1Y1QA 5DEIA 2CNKA 5IZ4A 3AUAA 2FW7A 2J9FB 2FFAA 2AW3A 3OX2A 5IJXA 3WMEA 2O8VA 2N1BA 1YRHA