1GY8A

Trypanosoma brucei udp-galactose 4' epimerase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
383
structure length
367
Chain Sequence
b'SHMRVLVCGGAGYIGSHFVRALLRDTNHSVVIVDSLVGTHGKSDHVETRENVARKLQQSDGPKPPWADRYAALEVGDVRNEDFLNGVFTRHGPIDAVVHMCAFLAVGESVRDPLKYYDNNVVGILRLLQAMLLHKCDKIIFSSSAAIFGNPTMNAEPIDINAKKSPESPYGESKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDIGEHYQGSTHLIPIILGRVMSDIAPDDKRMPIFGTDYPTPDGTCVRDYVHVCDLASAHILALDYVEKLGPNDKSKYFSVFNLGTSRGYSVREVIEVARKTTGHPIPVRECGRREGDPAYLVAASDKAREVLGWKPKYDTLEAIMETSWKFQRTHPNGYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GALACTOSE 4-EPIMERASE
molecule tags Oxidoreductase
source organism Trypanosoma brucei
publication title High-Resolution Crystal Structure of Trypanosoma Brucei Udp-Galactose 4'-Epimerase: A Potential Target for Structure-Based Development of Novel Trypanocides
pubmed doi rcsb
total genus 131
structure length 367
sequence length 383
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2002-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gy8A02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1gy8A01
2H63A 4LCEA 5B37A 1AHHA 3PHIA 4IJKA 3WQQA 4RZHA 4KMSA 4MP3A 1S6YA 3UCFA 3CKYA 4W9NC 1AE1A 4IZHA 4YJHA 5GZ3A 2QIOA 5L9AA 1AHIA 2DBRA 2GN9A 4B4VA 3GZNA 5JY6A 1QYDA 2NQTA 4RF5A 3FRJA 1OI7A 5L4SA 2DKNA 1PSDA 5CHEA 1B7GO 3F46A 3PGXA 4WECA 2YFHA 4HFRA 1KVRA 3WGZA 3ZU5A 2DUUA 1T2FA 3DBHA 4BKPA 1R15A 4TROA 3NT2A 2NLOA 3ZWYA 4UEOA 1EVJA 3AK4A 3CMCO 1YVEI 2CF6A 2X5KO 1FDTA 2DTXA 3D3WB 1K6XA 3QWHA 3DAFA 5A9RA 4WPGA 8ADHA 1CQIA 1DC4A 1DIGA 1X0XA 3KTDA 3E8XA 3OETA 1BVUA 4DREA 5TRTA 4CR6A 4WLOA 3VH3A 1NPYA 3I9JA 3IC5A 3LDHA 3WMXA 1DB3A 3Q2KA 1PZFA 4DMMA 1LA2A 3OEYA 4FN4A 4KP7A 4D41A 1Y9AA 3WQRA 3H5NA 2HRBA 4CM4B 1IZ9A 4YAJA 5CFZA 5COAA 2JL1A 5JAZA 4QXMA 3X2EA 1ENOA 2X4GA 1YS4A 3K96A 1NYTA 2WD8A 3RSHA 4AFNA 5K6AA 4EJ6A 4LCJA 4RVSA 3OH8A 4DL9A 4CJXA 4DYDA 4DIBA 3ZGYA 5KVSA 3H2SA 3PQDA 4H3VA 4WOJA 2B36A 3V1TC 5DP1A 1H94A 1QSGA 4KDFA 5H83A 1DHRA 3IIEA 3ZCXA 3HSKA 4J4HA 4LSMA 1VE9A 4L76A 1I3KA 1ZJYA 3W4KA 2GERA 3I5MA 2G17A 2HK9A 2JKVA 3DOOA 3WDSA 5CEJA 3ZU3A 2NVWA 2HCTA 2DTEA 2P5YA 1BW9B 3OA0A 4S3MA 1D7OA 1ISHA 4K9DA 2NTNA 5DCWA 4AICA 1ZXLA 2A94A 4TZKA 3LF2A 5JAQA 1PR3A 4ZJUA 2W98A 3QSGA 4CMGA 1VC2A 5CAEA 4INAA 3STHA 2RHCA 4ALLA 3IKVA 2O4UX 3M1LA 1YB4A 3NJ8A 3HADA 4E2YA 1LLCA 4TKMA 3D7LA 3AOEC 5GMOA 4BNLA 5BNFA 4XJTA 1EDOA 4AJPA 3RU7A 1W73A 4UUPA 3TN7A 4IDBA 3VZPA 1E7RA 3AY6A 2PZKA 1HYHA 1N5DA 4YVFA 3DWFA 1DRVA 2FWMX 3G1TA 3UVEA 3OJFA 2ZJ1A 4N5LA 1Z74A 1PQPA 1WVGA 3C7AA 2A9FA 3ZWOA 3FN4A 1CIVA 5TQVA 4QSMA 1DIAA 4BKQA 1DRWA 1IHXA 1N7HA 1KOLA 4CM8B 4CQMB 2VHXA 4FJ0A 3QP9A 4GVLA 4ZRMA 3B1FA 1Y8RA 4UUOA 1PJLA 2DTDA 1EQUA 4E5YA 3JQGA 1TT5B 3P7MA 4BNFA 4CMIB 1U8FO 1X7HA 3PZBA 4WOKA 4H16A 3HDHA 5A9SB 2FR0A 3GPDG 4G65A 1KEUA 2X0NA 4NQZA 4J91A 3DHNA 2JJYA 1YBAA 2ZB4A 3OFSA 2VRCA 5A3JA 5A9SA 1LTHR 3PDUA 1I2BA 1M66A 5EESA 1MXFA 4PLYA 4ITUA 4YJDA 1DC6A 2PGLA 1B14A 1FF9A 2CMDA 5F5LA 2W90A 4CLDA 4E32A 4YYZA 1I2CA 4TZTA 4BMSA 4UVEA 2EHDA 1GZ3A 3DR3A 2IZ0A 3TFQA 4OIMA 5KWEA 4AJJA 4XWYA 4PLZA 3CPSA 1T25A 3MJ4A 3S2GA 3I9OA 4P4GA 5HWSA 3M6IA 3TNLA 4TSKA 5JXWA 2IZZA 1EE9A 4EBFA 1ZNQO 3SX2A 1I5RA 4YXFA 2I76A 5LCXA 1JA9A 2Q49A 3ETGA 4ALKA 4KUGA 1GUFA 4AJIA 2CNBA 2WJPA 4YEDA 5CDYA 4JGBA 1LDMA 3VH1A 5THKA 4E3ZA 1YKFA 3LYLA 1WDKA 4HFNA 1XSEA 4IM7A 1E3WB 2I67A 3PQFA 1E3SA 5TLSA 4MVJG 3RJ9A 2POQX 3GVIA 4J4BA 1LRLA 1E5LA 4MVJE 2IXAA 2RIRA 1YQGA 1WXDA 2FOIA 1FDWA 3ZW8A 4BKUA 2P9EA 1T2DA 3OJ0A 1DAOA 3R6DA 4HADA 5T8KA 4MDHA 3ICCA 2PD4A 1YBMA 5JDIC 3D4NA 2JFFA 2HK8A 2RHRA 1XWFA 2W4QA 4FFNA 1DFIA 3EZLA 1Y81A 2VNSA 3PLNA 1PGOA 3GEMA 2X23A 4CLRA 1SB9A 1XCBA 2YY7A 4WK6A 4N5MA 1GZ4A 3UN1A 5L7WA 3IOYA 2CVZA 3TPCA 3AWDA 2PH3A 2WYUA 2GO1A 1LRKA 2D3TA 4IXWA 1LSSA 2J3KA 3OICA 3OA2A 4WKGA 3GRPA 5AVOA 1B16A 1Y6JA 2BRUA 1LX6A 1Q0QA 5B1YA 5DBGA 3ZV6A 1MGOA 4CM7A 1DBVO 1JKFA 3LF1A 1Y7TA 1JAYA 4MP8A 2EW8A 3SBOA 4OKIA 3MJEA 1HL3A 1T4BA 4BL5A 2A35A 2EGGA 5ADHA 1BDBA 1JKJA 1NPDA 1A72A 4BNYA 3D1LA 3L4BC 3GG9A 3SEFA 2FP4A 1ZKMA 3I23A 4CMBA 2YV2A 1UP4A 4RVDA 2CVQA 3HNPA 1E1KA 1OC2A 3KSDO 1U8XX 5G0VA 4RGBA 2ZCUA 1SEPA 3E1KA 1HRDA 2ZYDA 2YJZA 4PG8A 3CEAA 3N58A 4J16A 1EEHA 1VL0A 3K8ZA 4KUHA 2B4TO 2C59A 4LISA 2FR8A 1U4SA 1B2LA 3T4EA 3GQVA 4OYRA 2GLXA 1TT7A 3CMMA 3GT0A 3DZIA 5JW6A 1YXMA 5FFFA 3U3XA 3EDMA 4QECA 4OAQA 3V2GA 3MTJA 3ONFA 4J2OA 2JD1A 2LDXA 1GL3A 1D8AA 1SOVA 2ZK7A 3H9QA 2NVUB 4II3A 1ID1A 4BMVA 4N18A 1SB8A 3PJDA 5TSDA 4D43A 4KTVE 4BGUA 1UXKA 2ET6A 1M6HA 3DL2A 1Q7CA 1C1XB 2ZTUA 4DQXA 3SJ7A 2UDPA 4IZIA 1NVMB 4GWKA 4UAGA 4XD2A 3U4HA 1UUFA 1YOVA 5G0UA 1GD1O 1P1FA 2E49A 4Y8VA 4FJ2A 3BXXA 4XCVA 1U5CA 2O3TA 1WDMA 1OFGA 1VJ1A 2GRAA 5L3ZA 1ADBA 1JLLA 4PVDA 2O3JA 2IE0A 1HETA 1HDZA 1T1RA 4MKXA 4MP6A 1E1LA 1T1SA 3P2OA 2OP1A 3E5RA 2E6UX 4DC0A 4FCCA 3OP4A 1EK6A 4CUJA 3S2IA 4I9UA 3E5MA 5U9CA 2JCYA 1GUZA 3AY3A 5AXDA 1LLUA 5I7FA 3Q0EA 1DPGA 1BHSA 3LLVA 3PWSA 1WPQA 3KZVA 5IF3A 3WIDA 1U7HA 4CL3A 4D3DA 1BDMA 1MP0A 5BQFA 4X54A 2X8LA 4R9RA 5A06A 4P38A 3JV7A 4NBWA 4NH4A 2PA3A 2VTDA 2VYVD 2I3GA 4D42A 1O9BA 1HSZA 1HLDA 3FWNA 1LSOA 1R0SA 3VZSA 3ONDA 1ONOA 1U3WA 2W2LA 3EK2A 4OMUA 1V3VA 1BXKA 4ZN6A 4IJUA 2XXJA 2UUOA 3G79A 4GKVA 1R4NB 4PG6A 1B8UA 2E82A 2EJWA 1DIRA 1JU9A 2I5PO 1HZJA 3O8QA 2GDZA 4L4RA 2G1UA 3F5SA 4IUYA 1E3EA 4PIVA 1VRWA 3RUEA 3U62A 3ETEA 3JQ6A 3SLKA 1FDSA 2AG8A 4BNJA 4A2CA 4E4YA 3IAHA 3QA9A 4YJHB 3JQCA 1QV6A 4TQGA 2VWHA 1A27A 1NWHA 1P0FA 1WWKA 2GN8A 1BW9A 3I6QA 4K28A 4GBJA 4L8VA 1E0DA 3R1IA 1R6DA 4GX1A 2X6TA 5DNAA 4KQXA 2PGJA 3RKRA 3PFWO 2HDHA 4G81A 5BSEA 1YJ8A 3PK0A 3L07A 3VC7A 1EUZA 1VKOA 5JO0A 5CEFA 3E03A 2OFPA 3FR8A 2DPGA 2WD7A 4ZA2A 1DDOA 2Y66A 4EITA 3EMKA 3ROKA 4E2WA 2TMDA 2QRKA 3PYLA 3VH2A 1HDXA 4XQCA 4LK3A 4QQRA 4WNCA 2V65A 3H9GA 5JSFA 2B4RO 1A4IA 2C2XA 1JAXA 3LT0A 1DJNA 3AY7A 4CM9D 4RO0A 4XYGA 5IDWA 5KJFA 2VT3A 4O63O 2Q4EA 5G4KA 5L4NA 1VLLA 1MFPA 4L9RA 2RCYA 3D5TA 4PLCA 4R68A 2R6JA 1XGKA 1LC3A 3MEQA 4MIYA 4CQMA 2HQ1A 2BFOA 4W99A 4A26A 4BNZA 4CV1A 2VWPA 3VPFA 4NG5A 3NGXA 3F3SA 4FBGA 4PLPA 3BTVA 4Q3BA 3JQBA 5I7EA 2GCGA 2VRBA 3L4SO 2BI8A 3N74A 1PJ2A 1XLTA 3DO5A 3VPXA 2BGMA 4CM5A 3SVTA 1H0KA 4YRAA 1X7DA 2YHIB 2O2SA 4BNUA 5IG2A 2Y68A 4ALIA 4OOEA 4N7RA 3FTNA 3TQHA 4WASA 3WSWA 2YQ5A 4DUPA 4R41A 4R4JA 2DBVO 2HUNA 4LN1A 4PLVA 4TVOA 2PWZA 1PGNA 3WGHA 2G82A 4WLUA 4YR9A 4RPGA 1B26A 1HYGA 4RVGA 1PJBA 1E1NA 1NNUA 2CVOA 4ILKA 4LMPA 1IY8A 4QT0A 3DOJA 1H6AA 4W82A 3C7DB 1ZEJA 4XR4A 3ZH2A 3UW3A 4H7PA 2J5KA 4B8ZA 2Z95A 3LSYA 1ISFA 4BUCA 1TVEA 5G4LA 4HWKA 3DC2A 4YT4A 2Q45A 4E2ZA 1A9ZA 3AU8A 4MVJD 2FPIA 4D79A 4E5KA 3PGJA 4EW6A 2VHVA 4CM3A 4JJIA 3E6AA 1UJMA 1WP4A 4G5HA 4U6QA 2P5UA 2O3SA 1UAGA 1UP7A 1HTBA 3BYZA 2B5WA 3DZBA 5EINA 4Z0TA 3ASUA 3GPIA 4DVJA 4EUFA 3C24A 3FNEA 5COQA 3MWEB 3WXBA 4DBZA 1GPJA 3W4JA 4YTEA 1GEEA 5KIAA 1QP8A 3PI7A 3KO8A 1LQTA 3I4CA 3WOHA 2BGKA 3HE3A 4WLVA 4O1MA 4AJLA 3K9QO 4YAGA 1EBFA 1R0LA 1VM6A 3QHAA 3NDJA 5LDHA 4NBVA 4GLLA 4IBOA 4TVBA 1EQ2A 1JQBA 3JQ7B 2YYYA 5K9ZA 4K26A 5JBIA 3ZV4A 1Y1PA 3F1KA 3OM9A 1M2WA 3O26A 4A73A 4MKZA 3MJCA 4C7JA 4DQVA 2YHUA 4Y6RA 4BQRA 3C1AA 3ZNNA 3R0IA 1Z73A 2NWQA 3K73O 3UF0A 2XXBA 3DDNA 3QJ5A 3UCXA 2DAPA 4B3HA 1HKUA 1WNTA 1U3TA 1ZSVA 3GDGA 4NR0A 1KEVA 1K3TA 2I99A 3H6KA 3DHEA 2GGSA 3NDIA 4PFJA 1A4UA 3IS3A 1Q7GA 5JAIA 2O23A 1U2DA 3KETA 5KKCA 3HFSA 3WWZA 2AE2A 4GQAA 4EUHA 4FW8A 3WR5A 3E9MA 1WW8A 1MX3A 5DBFA 4OO3A 1Q7BA 3UCEA 4ALMA 2FSSA 1EMDA 5JY1A 4IINA 2PLAA 2X22A 2ZYGA 4CMEA 1Y8QA 3SJUA 4PZDA 3ZWBA 3ZU4A 3E9QA 4RL6A 1NM5A 4XR9A 5J23A 3L9XA 3K30A 4YCAA 1JVBA 5U1PA 4IMPA 5ITWA 4NU5A 4U0KA 3TOXA 2UV8A 3WS7A 1ZK0A 3BA1A 3ROQA 3ZHZA 4J49A 3A9WA 4BO0A 2QHXA 3TSCA 5KVQA 4DWVA 4NNJA 2QYSA 3HZZA 1HE5A 2I3AA 1PJSA 4MIEA 1TI7A 3ZHXA 4CUZA 4G2NA 5TIIA 2AXQA 5A05A 3NT5A 1IULA 1TXGA 2X9VA 4GI2A 5JC8A 1LUAA 4Z3KA 4CLEA 1J5PA 1U3UA 1VJTA 4CODB 2NU8A 3QLJA 5A5FA 1FDUA 4FOSA 4M87A 3OECA 1N2SA 2BF7A 2R00A 4CR8A 4Q3NA 1XU9A 2J5RA 3BMNB 2ZJ0A 2IRWA 3OIDA 2I9PA 2V6BA 1PL7A 1R66A 4KZPA 4ZQEA 5IFLA 5A3VA 4IPTA 4J0FA 1NR1A 3K6JA 1GDHA 3OMLA 5DBIA 2EKLA 1ONNA 4FPXA 1LDYA 1QR6A 4CV2A 1EUDA 1RYDA 5JPIA 2XPCA 1H93A 2TMGA 4AJNA 2GSDA 3DBRA 3PTZA 4YJGB 4A0SA 4AJKA 5TT1A 4J2HA 1N7GA 3DBHB 4UEJA 4BNTA 2VUTA 5JDCC 1G1AA 3A14A 1C3VA 1LBEA 1ZW1A 1I24A 5LC1A 1KY4A 2C07A 2HK7A 3F4BA 4YJFB 3S2EA 4CM1A 4EYEA 2Y1EA 5C7OO 3JQFC 4BO3A 2HJSA 5L53A 3QW2A 4WGGA 4WLEA 3WGTA 1GAEO 3GGGA 4U8GA 2IODA 1PJQA 2B5VA 4IDCA 2W2KA 4RDHA 3IJPA 1ZBQA 5HTOA 4LMRA 4R1SA 3ZU2A 2CSUA 2WTBA 1XHLA 3NEPX 4WNIA 4KUEA 3RUCA 2VWGA 3C85A 3ENKA 1OBFO 3L4BA 4O6VA 1H6BA 4BB5A 4W6ZA 3BMOB 4HNHA 4GPD1 1ZK3A 2H5LA 2OXIA 3ROMA 4U0JA 5DCUA 3INGA 4DIFA 5ILOA 2BKAA 4UVIA 4ZRNA 4CQLA 3D5QA 4UREA 3X2FA 2O7SA 3RFXA 1IB6A 4O5OA 5FYDA 3H9EO 1UR5A 3MOIA 1ARZA 1H6CA 1LSJA 4B79A 4MVJP 4P22A 1Y5MA 3ITKA 2AA3A 2AQHA 2GPTA 3M1AA 5DULA 5TX7A 5CP8A 4R69A 2FZWA 1P31A 1QMGA 3KYDB 4LGVA 3EVNA 5DDIP 5A9TA 3W8EA 4CMHA 1U28A 1UH5A 3VTFA 3ON5A 1I3MA 4Z9FA 5JDIA 9LDTA 1Q2XA 3GDFA 3CINA 3EUWA 3GEGA 4CMKA 2P4QA 4IGFA 2Q99A 2GR9A 3E48A 4MINA 4PZCA 1UDAA 2P2SA 2Z5LA 5JO9A 1ISMA 2AHRA 4GH5A 4YBZA 1C1DA 2OGUA 1DFHA 5CDGA 1DSSG 3H3JA 4A7PA 3BMQB 4AL4A 4GSLA 5IN4A 2I66A 3NRCA 3VTZA 2Y1DA 3NKLA 1KERA 4YT5A 3B1KA 1H6DA 3TL2A 1EVIA 2GNAA 3QWAA 1HEUA 4E31A 9LDBA 3M2PA 3INRA 4C4OA 1C0IA 1PJ3A 2IXBA 1F12A 4JIGA 1GYRA 5I7SA 4TMFA 5KNLA 1ENPA 3OSUA 3ITDA 1HDRA 1GUYA 3K92A 3KEQA 2YDYA 4DPKA 3H8VA 4L75A 5ER6A 3ZW9A 3BIOA 4JJGA 2NVBA 2VZ0A 3HB4X 3IMFA 4B7UA 2ZQYA 3D0OA 1VSVA 3L9WA 2Y1FA 4J7CA 3VVCA 5L40A 4BV9A 3RAJA 1IOLA 1P44A 5IZCC 5B4UA 4R3NA 4R5HA 2VTEA 5AQ1A 3PLRA 4BVAA 1GV0A 2WYVA 1M67A 2P9CA 4TKLA 1HYEA 3GOHA 2WWRA 5DN9A 4CV0A 3ENNA 1UP6A 1OC4A 5EQFA 1Z75A 4J6FA 2HO5A 4OXYA 4IXTA 4GMFA 4I5DA 4NI5A 3DBLB 4KQWA 4YRDA 4O0LA 1GEGA 4XZ3A 1H9AA 1ZMTA 2WE7A 3UOGA 1MV8A 4J43A 4BHTA 5HM8A 1H5QA 3DBLA 3HG7A 2WEKA 2EERA 3T4XA 2ZTLA 1X13A 3F47A 4E0BA 2W8ZA 1V3TA 2EWMA 1PU2A 1LSUA 1A9YA 4OL9A 3KHUA 1I3NA 4PG7A 3U49A 4AG3A 4MOWA 1KS9A 3FF4A 3BMOA 2C0CA 2FSVA 4ESOA 3IUSA 5BSHA 4R1NA 4BOYA 1W8DA 1D1SA 3WYEA 3WFJA 1IYZA 2WD7B 3B20A 3PZRA 4I5FA 4CM8A 2CF5A 3G3EA 1B3BA 1ZIDA 2HMSA 4QFDA 4A03A 1N9GA 2JHGA 5JMWA 1PL8A 4GSKA 3U5TA 2C7GA 2ZB3A 4LRSB 4OXKA 1QORA 2HMVA 1L7DA 1L1FA 1BMDA 4YQYA 4Z9XA 2C5AA 1MFZA 1GPDG 4BMNA 3FNGA 1UXHA 1TLTA 1XU7A 3OQ1A 3UXYA 5ICSA 1HE4A 5G0TA 4D0RA 2DPHA 3FBGA 1DHTA 2C20A 2NADA 1HE2A 3JYNA 4GVXA 3PYMA 3U4DA 4FFMA 4BO5A 2NU7A 2WYWA 1KBZA 3KEOA 3M2TA 1OOEA 3NT4A 3QQPA 3PVZA 3I9LA 3WBBA 4R3WA 3FPCA 4Z3DA 3OJOA 1QYXA 1RPNA 2X58A 1IZ0A 3I52A 4ID9A 3RJ5A 5G0WA 2B0JA 2EV9A 3VDQA 4FFOA 3FSRA 3DMYA 3MZ0A 4Z0HO 4XDZA 4FC6A 4BKRA 1B3RA 1YO6A 4ZD6A 5MGBA 3ASVA 3RUIA 5K6AC 1SC6A 2JFGA 1UZNA 4YRBA 3F9IA 5TT0A 4WLFA 2WM3A 4KWHA 3C3XA 2A92A 1HT0A 2X7HA 1LC0A 2X1HA 2P9GA 3GY0A 2B35A 4XYMA 3I9NA 4M54A 2BD0A 3QE3A 2JHFA 4FQ8A 2E48A 5U4QA 1GCOA 2Q3EA 3IDSA 4PLWA 3GMDA 4FDAA 1LDEA 2Q46A 3WYBA 3GFBA 4J3FA 4ZQHA 3EZYA 5IZ4A 4LSWA 5T8KC 4A10A 2VUUA 3E9NA 3W8DA 4N5NA 4I5EA 2IYPA 1CDOA 4XIJA 3QVOA 3TZ6A 1E3WA 4HXYA 4TWRA 3F6YA 4YJFA 1UZMA 5CG1A 1T2CA 2X9NA 3O8QB 3W6ZA 1XIVA 4RF3A 3H9UA 1NVGA 3C7CB 4GMGA 1I30A 1FXSA 4EI2A 1U3VA 3GHHA 2YV1A 2Y1CA 2V6GA 1P0CA 5KTKA 3FPLA 4ALNA 2V6FA 3PHHA 4CLOA 4R51A 1C1XA 3D4OA 3RASA 5JS6A 2FMUA 2FY8A 4PCVA 3HWRA 1R0KA 4MVJI 4IQ0A 1LDGA 2DM6A 2Y0DA 1EE2A 3KYCA 4AJ4A 3H3FA 3NGLA 4Q9NA 5THQA 3MTGA 4R1UA 1ISIA 2Z1NA 3RWBA 4NJOA 4E5MA 3ZWXA 4M49A 1FMCA 5L4LA 4FB5A 4K6CA 3SXPA 3WJAA 3E82A 4F3YA 1P74A 3OIGA 3VPHA 4M1QA 3WJ7A 1UXGA 5I7VA 4FFPA 2D2IA 5K0ZA 3GZNB 4CLXA 2ZTMA 1I01A 3Q6IA 2D0IA 2ZB7A 3GVXA 4HV4A 2H6EA 3TF5A 2J3IA 3OBBA 2OBYA 1SAYA 4GAEA 3BHMA 3FBTA 5KJCA 3MWDB 3JQAD 3RC9A 4DLAA 3PEFA 1RM0A 1I8TA 1RKXA 2J3HA 2VHWA 1E3LA 1PIWA 4D45A 1Y8RB 5C37A 5IDXA 5ITVA 5TJ9A 2PGDA 3JQGB 3LLSA 4KOAA 4Y98A 4GX2A 2OO5A 5DP2A 1GY8A 2QZ9A 4IIVA 4TRJA 5AXBA 3VZQA 2PKRA 3MJSA 3ZV5A 4XIYA 3PHLA 4FGWA 4Q39A 1V9LA 4RLHA 4UULA 1GZ6A 5G0SA 4DLBA 3AI2A 4YQZA 4NBUA 5HRUA 1UDBA 5GY7A 4OM8A 4J9VA 3OQ6A 4BNVA 5KJ6A 4ROSA 1TEHA 3AFNA 3WFIA 1M75A 1QV7A 2PZLA 2Q1UA 4QO8A 1DRUA 1KVQA 4WCFC 4NJMA 1XYGA 2JCVA 1DC5A 2NSDA 1EVYA 3IP3A 3PJFA 4DYVA 4L4SA 4JNKA 1Z7EA 5CDUA 1SZJG 4RPJA 4IIUA 1JW9B 2NVUA 4Y6SA 4E12A 2H9IA 1U7TA 4FJ1A 4FOOA 1V8BA 3AM5A 4OOFA 3GN2A 5GZ6A 4W4TA 2DLDA 1ZEMA 2EW2A 3NDRA 4CLHA 4RCVA 2C82A 1YDWA 1E1MA 4I08A 1FK8A 1P1IA 4RVHA 4OSOA 1E92A 3RC2A 4EGFA 4NFYA 1ZCJA 1GQ2A 1W4ZA 3VAZA 4BO1A 3TDKA 4BGEA 1C0KA 1NQOA 1VL8A 2IEDA 2NNLD 4Z0PA 3NJ4A 1MC4A 4IS3A 3TOZA 3JCZA 4UVDA 3S8MA 4YJGA 4OH1A 2HJRA 2P68A 1NFFA 2AMFA 2FR1A 3DOCA 3GGOA 3HHPA 3UGKA 2OP0A 1F17A 1X1EA 1YL5A 2NV6A 2Q50A 3KV3O 3RIHA 1KEPA 2DFDA 1OAAA 4BNGA 1AXEA 1K2WA 4RZIA 3GG2A 1PQWA 4MVJH 3QWFA 4MVJF 4R5MA 2BFPA 3MJVA 2OBNA 3RFVA 5IDYA 1KC3A 3U9LA 4CM4A 4RVFA 2HU2A 5T5QA 3JQ7A 3DZKA 4J90A 4WE3A 1R4MA 1ZSYA 5T67A 2J5QA 3I3OA 2OORA 5F5NA 3S55A 1O0SA 2LDBA 3WYCA 4PG5A 1P9LA 2E4AA 4XGKA 4JCOA 3NUGA 3RKUA 3GGPA 3ONEA 4Q3DA 1QLJA 2PKQP 1F06A 2AEMA 1I3LA 3RC1A 1B8VA 3HUDA 3QVSA 5A1TA 3DBVO 3CH6A 3E18A 3AM3A 1LLQA 3G1UA 4A27A 1R12A 1MG5A 4HX5A 1TB4A 4BNWA 4NK5A 3HDYA 2X86A 3BMQA 3WLEA 2OMEA 1YDEA 4Y9DA 4XB1A 3PXXA 3O9ZA 4BQPA 4CQLB 5EPOA 3H65A 1PZHA 2VHZA 3GAZA 5KCZA 1QYCA 3WQSB 3MOGA 4CMJA 3JQAB 4HUJA 1V3UA 5I9NA 5FF9A 1P33A 1KEWA 1HDOA 1Q1NA 2OZPA 3RC7A 4HNGA 2QW8A 5DCYA 4QFCA 2VQ3A 1SOWA 4U5QA 1NR7A 1R37A 2HKIA 1V35A 5KJEA 3EC7A 4ZU3A 1EFLA 2Y05A 1ZSNA 3ZWNA 1P1RA 4BGVA 1ISGA 1X15A 5JLAA 3JQEA 3O4RA 3UHAA 1NTOA 1QXSA 4DQUA 3DMTA 1IPFA 2SCUA 5AXCA 4YWJA 3K31A 3RI3A 4E33A 5T64A 3C1TA 3EY4A 4NHEA 3HDJA 4HY3A 1H9BA 1ULSA 1DO8A 1E7MA 1T26A 1XR3A 2FPPA 3L6DA 1BXGA 5IXYA 1A5ZA 3H5RA 1DLIA 4J1TA 3RU9A 1S7CA 2PY6A 3OHSX 3JD4A 2D5CA 1YB5A 3JQDA 1XDWA 1PX0A 5DOZA 5BNTA 3K5PA 3PP8A 4XEHA 3BHIA 3CTMA 1HF3A 1SNYA 3A28A 5CPFA 2QG4A 2BI7A 1T2AA 4XQ9A 1A71A 1CERA 1TT5A 3H9JA 1GR0A 1YL6A 3H2ZA 3AJRA 4J0EA 1QYVA 4ZQGA 3L6OO 3HN7A 4B4OA 3GN1A 1I10A 5A02A 1QG6A 3L6EA 1MB4A 3Q3CA 4ZQFA 2AW5A 3PPIA 5G2OA 1BWSA 1EUCA 3DAPA 2VZ9A 3SC6A 3VKVA 4M86A 3ZWWA 4B4WA 1MUUA 4OXNA 4CLRB 3AM4A 2NQ8A 3KSUA 1B0AA 3FCOA 1OZAA 5KJ1A 3ZHBA 3F4LA 1QYWA 4XDYA 5EIOA 3UFXA 4CM9A 4WUVA 1YB1A 4JBIA 1JTVA 4YACA 2ZQZA 1RM5A 2D59A 2FRDA 2HMWA 4D46A 3ZNPA 2F1KA 3QVXA 1ENZA 3TRIA 2D1YA 3PQEA 4LVUA 1MXHA 1XELA 3LC2O 3BTOA 2PK3A 1GV1A 3PWZA 3D4PA 4JQCA 4PVCA 3RVDA 2PR2A 4JBHA 1YQDA 1PJCA 4JXKA 3WNQA 4II2A 4GLOA 3D3EA 3JYPA 2W2LD 5HS6A 4BO4A 2Y0EA 3GFGA 5CG2A 1R4MB 2AE1A 2VYNA 1O8CA 4IJWA 3JQ9C 4QUKA 4UVGA 1EZ4A 4CLOB 1PZGA 1Q0HA 4F6CA 1ML3A 4AJHA 2AQIA 3HN2A 4BNKA 3AUTA 4JP2A 3EHEA 4R01A 3VHRA 2DBZA 4MPDA 4NJMB 1G6KA 3RD5A 5FWNA 2D4AA 1ONPA 4I8XA 4XRRA 2CDAA 1E7WA 2IDZA 3DZGA 2XF8A 1X1TA 3A06A 4XGIA 4ZHSA 4OSPA 3CXRA 2YQ4A 1XG5A 4E5PA 1K6IA 1DOHA 2Q2VA 1DLJA 2C54A 4XA8A 1K5HA 2CFCA 1KC1A 4H15A 3H7AA 4Q3EA 4NPCA 3LZ6A 5B12A 3K2EA 1C0PA 2DUWA 3ANLA 4JK3A 4MIOA 5L95A 1JKIA 1Y8QB 2CDBA 3ZHYA 4WCDA 2WE8A 2QZZA 4ND3A 4RV9A 4BNIA 1VL6A 5L7TA 3D3WA 3IKTA 1ZMOA 4EUEA 1AN9A 1RWBA 3ANNA 4XJSA 4PN3A 1ZZEA 4RVUA 1F0YA 2R00C 3WG9A 3G0OA 3LK7A 5IXSA 1NHWA 3GA0A 3PJGA 3C8MA 2F00A 3Q11A 1DEHA 2R2GA 1GU7A 3CIFA 3HJAA 4K1LA 5I9LA 1ADGA 4HBGA 2HSDA 3NTOA 4IDEA 3FD8A 3RCBA 2VOEA 5BSGA 1Z45A 2GASA 1PZEA 3FHLA 3ZWAA 3C1OA 4AJOA 4BO8A 6ADHA 3IJRA 4YT2A 4CMAA 4YAEA 3VOSA 5F1OA 4OGWA 4N54A 4P4LA 3NYWA 3K2BA 4FS3A 1ORRA 5DZSA 2IYOA 1KVTA 4IY1A 3DEYX 4MKRA 4OHUA 3O03A 6LDHA 2JD0A 3I83A 2D8AA 4A5OA 3UUWA 2ZCVA 4ND2A 1P77A 1UDCA 3AOGA 4LRTB 5T57A 3T7CA 1PJTA 1T4DA 1RYEA 2UYYA 1VPDA 3RUDA 4Q3CA 2Y0CA 3ZNOA 5H81A 2EKPA 5H82A 4CMEC 3LT2A 5KOIA 2X0JA 2QYTA 2YZ7A 3OJLA 1N1GA 4R9SA 4D7AA 1GFSA 4ZICA 1KVUA 3AUUA 4Q3AA 2NUAA 5IAAA 5CDTA 4QEDA 1LI4A 1N8KA 2YDXA 2ZKLA 3DONA 4LVCA 4RPKA 1NAIA 1GCUA 1W6UA 1ZO8A 2GD1O 2O2YA 2WSBA 3BMCA 3JQ8A 3BHJA 2EKQA 3GMSA 4D3FA 1CWUA 2B69A 1E7QA 2PKQO 4DC1A 1BTOA 1P1KA 1YOVB 4PG4A 3KRTA 5HBRA 4M89A 3EGOA 2UAGA 5IDQA 3TJRA 1A7AA 4BNMA 1H2HA 4P8RA 3JSAA 3RUHA 3ORFA 2DU8A 1LNQA 3JYQA 3P19A 2PNFA 3OIFA 5ENVA 4YA6A 4YDRA 3RBZA 4BNNA 4CL8A 4DA9A 3TZKA 4AJEA 4UUNA 1U1IA 3IQDB 1HSOA 2X0RA 4KWIA 1DXYA 3FWZA 2UVDA 4RQTA 1LEHA 4K6FA 4PLHA 1L7EA 2YV3A 2YW9A 5EL0A 1WAMA 1IL0A 1VI2A 3GZ4A 5ILGA 4M55A 1Y5RA 1N92A 4ZGWA 1QKIA 4RPHA 1LXCA 5IN5A 5TF4A 5JNLA 1QLHA 2CD9A 1SO8A 4HP8A 1IPEA 5CDSA 1ZK2A 3P2YA 1TA4A 3WTBA 3U4CA 2DFVA 3AUSA 3KBOA 1JN0A 1DAPA 4F45A 4B7XA 4FR5A 2HMTA 4UEKA 2YFQA 3IL2A 5F1PA 4CR7A 2BLLA 2AQ8A 1PS0A 5C7LO 4XRGA 5I8ZA 1LDBA 1KIFA 2Z1MA 1P45A 2HLPA 2BFMA 3DZJA 2PTGA 1YH3A 1CRWG 1R4NA 1PL6A 4J1SA 1BG6A 3FNHA 4WCFB 3V1UA 5JAMA 4MJLA 3G17A 1G0OA 5AXAA 5A5EA 1I32A 3P5SA 1MLDA 1NPTO 5FI3A 1A7KA 3D64A 1LU9A 3DZFA 2OOSA 2VT2A 2OHXA 3IUPA 1N1EA 3ADOA 5JC1A 2X5JO 4OKNA 4P4NA 3WBFA 1PS8A 2UUPA 3ABIA 5GZ1A 1Z7BA 1PGPA 1Z82A 3AI3A 3UH1A 3KOUA 4HKTA 2JCXA 3PIIA 1P3DA 3KVOA 4HFMA 2J6IA 4PGFA 3RBVA 4M8SA 1NQTA 1ZK4A 5C3MA 3AFMA 1KY5A 2O50A 5BT9A 4BO9A 3ANMA 1X14A 2EGHA 1PWZA 4D44A 3CZRA 4FGSA 1B15A 4CM6A 4Y67A 2EJVA 3KUXA 4J7XA 1ZJZA 4R54A 5TJHA 1C14A 5TNXA 4BKOA 3ETDA 4IDAA 4DPLA 1HZZA 4F6LA 3WWYA 2DQ4A 4OQZA 1IE3A 1ADFA 3PHJA 2FHSA 3AU9A 3RUFA 2CY0A 3PIDA 2JFHA 1RM3A 4ZVVA 5EQDA 3Q2IA 3I6IA 1YE3A 4QX6A 2B4QA 3ZN2A 2Q2QA 3WLFA 3Q9UA 4AJ1A 3WGQA 3ZWMA 1XA0A 3GK3A 4NZ9A 1FJHA 5C5IA 3JQAA 3W8FA 2AQKA 3TL3A 4DPMA 1GQQA 1ISJA 4XX0A 1YONA 2AEFA 4FFRA 4OJNA 5MDHA 3V2UA 1N9GB 5L7YA 2Q1TA 3BMNA 3GLQA 3WX0A 3WGOA 5BNIA 2ZB8A 4E13A 3WB9A 1MG0A 4ND4A 1QRRA 2AG5A 2DC1A 4CPDA 1M76A 2NU6A 2VN8A 3QWIA 1HLPA 2FZEA 5ENDA 3WMWA 7ADHA 5C7IO 3VZRA 3GDOA 5F3RA 3LVFO 1D1TA 3KM0A 2JAHA 2NM0A 5TS3A 4IJVA 2C7VA 3WGGA 3TFOA 2GF2A 3H4VA 2ZIZA 1XKQA 1DJQA 1EK5A 4JJFA 4ALJA 3WIEA 2V7PA 2XAAA 1NP3A 2FPGA 3EW7A 4TRNA 1C0LA 3JQBC 3NTRA 4E5NA 4RLSA 2NTJA 4W9NA 3WSVA 1YRLA 2EF1A 3ZWVA 1VJ0A 4ZQBA 4BO2A 1E7SA 5G4KB 1NAHA 1NX6A 3RBXA 3DAGA 1FDVA 5EN4A 3HFGA 5ES3A 1WZIA 5JCXA 3CUKA 1DC3A 1OMOA 2HAEA 2GZ1A 3JYOA 3S2FA 2QRLA 4UVHA 1RJWA 4IDGA 3B1JA 2XOXA 1E5QA 2O3RA 4WJZA 1M6WA 1E6WA 1U2GA 3GAFA 4TRRA 1YBVA 2ZYAA 4S1VA 3TZHA 1I36A 1BXGB 4YPOA 4EEZA 1T24A 3A1NA 3Q9NA 3LU1A 4GKBA 3KB6A 4NFHA 3LC1O 2O4CA 3OF2A 4F46A 3EVTA 3B6ZA 1ZUD1 3ZDFA 4UUMA 2WMDA 4NFSA 2BELA 3QY9A 2O48X 4R1TA 4NIMA 3U4IA 4WCFA 4DMLA 4QO7A 2Q1SA 2B83A 4L4XA 1EVZA 2JAPA 1IUKA 1Q0LA 4D0SA 5BR7A 4Z6KA 1LDNA 2Y67A 4RF4A 1HDYA 2G0TA 2I6TA 4JP3A 4XYEA 4CQMD 1I33A 1IHYA 4JX8A 2RAFA 5IJZA 4YB8A 4URFA 1F14A 4Y6PA 4YAIA 4GGOA 3EAGA 4JLWA 5JMPA 2OL4A 3S1LA 4I1IA 5KVVA 2J8ZA 5TC4A 3BTSA 5BSFA 1K6JA 1CYDA 2VCYA 2QX7A 5F21A 4I5GA 3ZWPA 1V6AA 1WMBA 1NBOA 2GYYA 1F8FA 3QIVA 2C5EA 4RF2A 3GF4A 3KYDA 5I8WA 1B8PA 4DBVO 3PHGA 2JD2A 4FD3A 1KETA 4PLGA 1E7YA 1U9JA 1NXQA 4U7WA 5AOVA 4XKJA 1O95A 4J1NA 5KVCA 3FR7A 1V0JA 3A4VA 4I9NA 2P4HX 1SCUA 4NBTA 4MVJA 3JD0A 3CSDA 5CEEA 4PRLA 2RH8A 1BSVA 1PEDA 1ZK1A 2NACA 1O94A 5FI5A 3ZV3A 5JCJD 2VYVA 3GHYA 3JQ9A 4R16A 4GGPA 2BGLA 1X7GA 3NV9A 4W7HA 3AW9A 3WNVA 1CQJA 3I4FA 5FEUA 4BS9A 2EEZA 2IEBA 2ZATA 2VWQA 3CZMA 3QVTA 4NBRA 4W7IA 1MC5A 3DQPA 3QV1A 1BGVA 2Y93A 3VPGA 1PJ4A 3BMCB 8LDHA 1I2ZA 3I9KA 3QVWA 2O3QA 3WGIA 2EP5A 2BH9A 4NMHA 4ND5A 3KYCB 3BZUA 1NFQA 1NFRA 3MJTA 3VPSA 3DBRB 1HE3A 4RPLA 1HDCA 2VNAA 3GRKA 4J7UA 4L73A 1LJ8A 4Z9YA 4BNHA 1ADCA 4PRKA 3RUAA 4CMIA 3RFTA 4CUKA 4DRYA 4E21A 3L0DA 1BXZA 3JYLA 1X0VA 1U5AA 3ZNQA 4B3IA 1GYQA 3GVHA 1MA0A 5AYVA 2Q1WA 4RQUA 3KSZO 2V6MA 3LC7O 5CPBA 3DTYA 4DLLA 1PWXA 2QQ5A 5A03A 2O3UA 3WGYA 1NQ5A 3HQ4O 1E6EA 4GX0A 7MDHA 1F8GA 4ONEA 2PFGA 2GN4A 2VUSA 5HS4A 1HDGO 3LT1A 1ZH8A 4J1QA 3GVPA 4ND1A 5JCJA 2PH5A 2CUKA 4FFLA 1UXJA 5EERA 4NU6A 5A4DA 2H1SA 3PFFA 1P1JA 1PS9A 2ILTA 2EP7A 4WEQA 2FN7A 4AVYA 1SBYA 3CE6A 3IP1A 1J49A 4C7KA 4E2XA 1HXHA 2AEJA 5IZCA 2BFAA 1LRJA 5EMHA 2Q2WA 2BHLA 3DFZA 4PLTA 5F1KA 2EIHA 3GNSA 3JQFA 4NK4A 5ER9A 2BMAA 3NX4A 1EBUA 4BB6A 4TRMA 4BO6A 1DIHA 4IDDA 3ZWCA 1T2EA 1GYPA 1ULUA 4FSHA 4QTZA 4RJTA 5JDCA 5DF1A 4JROA 3JTMA 3GR6A 4IGEA 5A04A 3KLPX 2W2KB 5JYDA 1E77A 2X0IA 1E6UA 1EFKA 3B70A 4MVJM 4IMRA 2E37A 4NDNE 1YL7A 3AUAA 3VVBA 1C1DB 1GTMA 3DFUA 2D5AA 2EG9A 3DTTA 1D4FA 3GUYA 4FC7A 5LDGA 3PWKA 3FNFA 3I1JA 5T6BA 3L77A 3GNTA 1WLYA 1HWYA 4EEXA 2Y1OA 1YJQA 2J3JA 3VH4A 3GEDA 4J9UE 2VYND 4RDIA 2C29D 1JVSA 3NAQA 4J4TA 1SPXA 4E30A 1K89A 4PLFA 1JWAB 1KVSA 4EJMA 4BGIA 5JFOA 3U09A 2VZ8A 2GN6A 1CJCA 1JDJA 1YGYA 1U4OA 1DFGA 3FTPA 3LT4A 1NWCA 3QRWA 3UICA 1JWBB 3T7EA 5JYEA 3G49A 4U6SA 4L74A 3KLMX 1CETA 1AUPA 2GUGA 1WDLA 1WZEA 3U0BA 3QWBA 4IDFA 2HRZA 4XYLA 4DIOA 3COSA 1XEAA 1WMAA 3GUCA 2B37A 1W0CA 3W1VA 3RQSA 2Y99A 1ZVMA 1UXIA 5I9MA 1BVRA 5B4VA 4GWGA 2PV7A 3OJEA 1LQUA 2HMUA 3UAGA 3V2HA 3HB5X 4I9HA 1UZLA 3H5AA 4FIZA 4KTTE 3PYXA 1J6UA 3DMTC 4B3JA 4D3SA 2O7QA 2X5OA 1NVTA 1GQYA 3JD2A 1J0XO 3JQ8B 3JD3A 4DTIA 4EDFA 1VSUA 4B4UA 2X9GA 2VHYA 1NQAO 4O59O 2QRJA 3PRJA 1NASA 3F1LA 2IZ1A 1PGQA 3KXDA 4XQEA 4YAKA 1VKNA 3V1YA 3DB2A 1PTJA 1Z6ZA 2G76A 3UKOA 3SC4A 3FI9A 4IS2A 1XQ6A 1E3JA 3R3SA 3BTUA 4IQGA 4CMCA 3R3JA 1SEVA 1UAYA 3GC6A 3WICA 1O89A 4E6PA 2RH4A 3ST7A 3SLGA 4BIIA 4AJ2A 2YHIA 4B8WA 4IQ8A 4YT8A 3ICPA 3EYWA 4DGSA 5B4TA 1E3IA 1ZXBA 2NU9A 3ROPA 3TZQA 3LQFA 1H2BA 3ZI0A 3W6UA 5COBA 1J4AA 1P1HA 3PDJA 2DBQA 4LW8A 1CEQA 4XB2A 1PR9A 1GADO 4L0QA 3BAZA 3TZCA 2Q4BA 3GVCA 3VDRA 1YWGO 3O38A 2PD3A 3V8BA 3V5NA 2PZJA 5L51A 1K0UA 3AOEA 4BO7A 1ENYA 4EZBA 2WDZA 3GH3A 3DHYA 4JN6B 3AI1A 3N7UA 3VKUA 2VRCD 3TWOA 1SMKA 2A4KA 3F5QA 1Y9EA 2GZ3A 1XQ1A 4B7CA 5ICMA 1O6ZA 3I9MA 4DXHA 3NTQA 3HDQA 3ULKA 3WTCA 4JBGA 5EJ2A 2DVMA 2I65A 2Y1GA 3PJEA 4OQYA 3ZZNA 1AGNA 1D3AA 3JD1A 2OUIA 3OEWA 4EJ0A 5L45A 4KDEA 4WEOA 4BNXA 1O5IA 4HFJA 2G5CA 4GX5A 4RORA 2RBEA 4BV8A 5KKAA 1KYQA 3DXFA 5DOVA 3KYBA 3DZHA 3W4IA 1LLDA 1CF2O 4PZEA 1EDZA 2EXXA 1ZFNA 2PD6A 5DT9A 2DT5A 2P91A 2PZMA 2YUTA 5JE8A 3INTA 4XQGA 1PQUA 3RROA 1I0ZA 4WLNA 3ADPA 3GNQA 1G0NA 2CZCA 1R16A 2GZ2A 1PGJA 2C2YA 4CV3A 1DIBA 2VOJA 3OQBA 4XYBA 5TGDA 1BRMA 2CDCA 4GL4A 1YQXA 1NHGA 5HA5A 3MCVA 1AXGA 2NTVA 3Q1LA 1RM4A 4MO2A 4XGNA 2ZTVA
chains in the Genus database with same CATH superfamily
2H63A 5B37A 1Z5VA 3LOPA 2HSWA 1T0UA 2QUIA 5DTJA 4IWNA 4CIWA 5JJIA 4RZHA 3DYBA 3PHBE 4KMSA 4BUZA 4MP3A 3UCFA 3C6XA 4PN7A 3VOTA 1AZLA 1FE8A 2QIOA 3PITA 5L9AA 2DBRA 4E14A 4N5HX 3RADC 5HF6A 1QYDA 2I6SA 3C5HA 5K0SA 5FTMA 3LQYA 4FI3F 4RF5A 1OI7A 2ZOSA 2ATXA 3NTVA 4N3CA 5L4SA 1N5IA 3C6KA 1T36A 2QL9A 3BB4A 3D7MA 1CZNA 2R7AA 1IAQA 2W11A 1Y4DE 3CX7A 3FHTA 1B7GO 2G0AA 2YXPX 5KTRA 1W4AA 5EWJB 2R1ZA 2XI4A 2PVPA 2YIVX 1KGDA 1PK8A 5H1YA 1XKTA 4NHOA 3TW6A 3ZU5A 5IULC 4ZTUB 3HU5A 5CFQA 1BMFA 5FKJA 5EJ8A 4PZLA 4GUDA 3ONWA 1MW8X 1EVJA 1TE2A 2Y0PA 1YVEI 5FA6A 2DTXA 1ZHFA 2C8JA 1K6XA 1DVRA 2UUBB 3BXHA 4P33A 5A9RA 3U4QB 3BD6A 3AVYA 2RGGA 3ZKWB 3ISJA 5AIBA 3E8XA 3OETA 1DTEA 2PEYA 3ENZA 2FEPA 5DWQA 3PF8A 3TD2A 2PEZA 1MNAA 3Q2KA 2QN1A 4BBZA 4ZVPA 1PVOA 1S8AA 1Z06A 3ESYA 3Q4GA 1F48A 3ODPA 3VO8A 1LNZA 4DMMA 3PPWA 4KP7A 1JHAA 1DWPA 1E66A 1ORDA 1R8XA 1Y9AA 4RD6A 3FZEA 1MO6A 1NVAA 1QHNA 3NBZC 2QLTA 2WC1A 1QKJA 3OD1A 2EFEB 1IZ9A 4YAJA 5JSZB 3OLVA 4MWOA 1XZ8A 5COAA 1E64A 3ACCA 3NVKI 1A8UA 1L5VA 5JAZA 5AKZA 5K3BA 4D9FA 3G6WA 1ENOA 2OAGA 2P67A 4IXDA 4Z3KA 1XFAA 3U37A 1NY5A 3HGTA 5IYZF 3RSHA 1PWEA 2QAJA 2YJTD 4LCJA 4AFNA 4ZYYA 1M33A 4K3UA 1F3OA 3OH8A 1OILA 2HBQA 2EZ8A 3PGLA 4XE5A 3CNLA 3ZE9A 4CJXA 4B84A 4F8JA 4DIBA 2D54A 2I87A 1J99A 3ZGYA 4KE7A 5KVSA 2P75A 3DV0A 3PQDA 4YNBA 3GJ4A 2I22A 5EZSA 1BN7A 4KDFA 1Y33E 3CB2A 3W7BA 1PZMA 3ZCXA 3HSKA 4M7PA 3OO1A 1VE9A 4V24A 4RD2A 2AJ8A 4R6XA 4IIJA 2ACEA 2GERA 2Q5OA 3I5MA 2F8LA 3UWMA 2XLBA 1ULZA 3L82B 1PJAA 1Q19A 3KQHA 2H18A 3MMPA 2DTEA 1OBCA 2P5YA 5E9AA 4RKFA 3CRNA 1D7OA 1ESZA 1ISHA 3F2IA 4FK8A 1HFWA 4NZNA 5CLJA 1XTUA 1L5HB 4AICA 1Y0BA 5IT9A 3WO1A 4YP1A 3PSHA 2W98A 1FTYA 2X8JA 3L7OA 1D2RA 3QSGA 1EX6A 3OFKA 4Q34A 2FLVA 3HYLA 3IKVA 4V38A 1NKSA 2F59A 5HQTA 1NZDA 4Q4JA 1V4VA 1XWIA 3HADA 5A4JA 4TKMA 1JSXA 3AOEC 4RE5A 4HLQB 4PWYA 4RK5A 3ITNA 5DTMA 2X3YA 1SC4A 2FZVA 3P2EA 4UUPA 4W1SA 4B2PA 2H54A 4IDBA 1WUTA 2ZUSA 2XWPA 4EPTA 5B58C 5SY6A 2YWFA 1EXNA 4GDMA 1A2QA 4IYRA 3WGKA 3EG9A 3OJFA 4LPKA 1BQEA 4ZODA 1UIRA 1QPZA 3UQZA 2ZSKA 1U0FA 3DW3X 4P6VF 3OT4A 1PQPA 1WVGA 3C7AA 4OXRA 1H22A 1R9NA 3Q8MA 2O2GA 2BBSA 4BKQA 3JZAA 2O2HA 3O4HA 1HI9A 3IIIA 1TUBB 4CQMB 3QP9A 4INPA 4JJZA 3EPPA 2YX1A 1SQ6A 5DW3A 5CYGA 3T52A 2PZ8A 1PJLA 4EMSA 5D6OA 4E5YA 1ZOPA 1PR4A 1TT5B 2QAGA 1JV2B 2R5WA 1QH8A 2H17A 3IVRA 3M5CA 4O33A 4OHMA 4ZGBA 2IOQA 3E8MA 3RVQA 1PLLA 4QU0A 3I9V1 4H16A 4S1OA 3EBLA 3SJCA 2I34A 1W88B 1L4EA 2FR0A 3GPDG 3D3QA 3IFSA 2X5XA 2PUJA 4C7OA 1WCXA 3FVQA 4J91A 3DHNA 5EE3A 4DLXA 1EESA 1KO7A 3OTIA 4HGZA 3OFSA 3K2QA 5A3JA 1LX7A 2EWWA 4ZOLA 2QDXA 3KTAA 3PUWA 3D5EA 4X8OA 5JSHA 4KR2A 3BSSA 3D2BA 1CEEA 4ITUA 2WIFA 1BD4A 3K72B 3O1LA 4DV4B 2WPNA 4WZZA 2HLNA 1U0JA 4CTJA 4K9SA 3WKAA 2O8FB 3HA7A 1MZVA 5BMOA 5F5LA 4CLDA 4KKXB 4TZTA 3ZLJA 2J9YB 3F5DA 3F90A 3AX6A 5HZKA 2J48A 2GJ4A 3TFQA 5BW4A 4AJJA 5DXFA 1ABBA 4PLZA 5F2EA 4KRXA 1OBOA 5HWSA 4AC9A 3EBPA 2B0CA 5JXWA 2XYVA 5HYVA 2JJ2D 1J1IA 1F51E 3SX2A 3LNTA 5GONF 3JVDA 2RBGA 1XQ9A 2BCEA 1Q1EA 3IQXA 4JMPA 3VR6A 3PXAA 3ZDRA 2RHBA 4FS8A 3ZIAA 3E22A 1YR9A 3GU3A 3LKVA 3PXCX 2NV0A 4KU4A 3M5PA 3MWJA 4KUGA 5IKPA 4N8EA 5ECYA 2WINI 1N6KA 1K88A 1V43A 4MRSA 1VGQA 3HP4A 1RXSA 1WDKA 2LCFA 1MA3A 2ON6A 3EIWA 2JJ1A 4GLJA 1X1SA 1E3WB 3DE5X 3N2IA 2I67A 2PBLA 5HK9A 1HLGA 4MVJG 5TLSA 3RJ9A 2WYOA 3GO4A 3GVIA 3H8SA 5AUPB 4PSAA 5IYZB 4MVJE 2RIRA 2HADA 4WQMA 1WU7A 4Z86A 2X19A 4HADA 4NLLA 1JHUA 1Y3HA 4D99A 3D4NA 3H0CA 4Q21A 4ME6A 2DEUA 1U1DA 1TFUA 4GP6A 2GM4A 1TVKA 2JBHA 2VPQA 4G85A 3U4AA 4NCJA 1N25A 2FSIA 3ABOB 2XVMA 3IHTA 1O58A 3PLNA 1PGOA 5H16A 3GELA 5KTSA 3LPAA 4OK6A 5KX5B 1XCBA 1BCSA 3N2KA 4WK6A 3D8NA 3SPXA 3PXGA 3R9IA 2PKYX 2P65A 1I9CA 3IOYA 1NQWA 4LWPA 4NESA 1QAOA 2GO1A 1LRKA 4C87A 4UHKA 1LSSA 3TDNA 2VPWA 1B16A 1PNTA 4CKXA 2A9QA 3SSAA 3N2LA 4F4JA 3NANA 3LCUA 3AW8A 3P4UA 3CM0A 3OM1A 1DRJA 4OBBA 5DLQC 4YUYA 3W9UA 4O4HB 3F73A 3ICEA 4CM7A 2BDUA 2GKGA 2VDKB 1ZI9A 4KAXA 3JW8A 2ZIUB 3K53A 3OOSA 4JD5A 2ZSEA 1HL3A 3AHJA 2A35A 2E7ZA 3PNBA 4I66A 4NSNA 1BDBA 5EJFA 3BDAA 1JFFA 3EF0A 3WRXA 1U2PA 4OG2A 3SBDA 3PNOA 3CPHA 2O6LA 1E2MA 2HIMA 4ES6A 2FEKA 3PKIA 4UEWA 4ZAWA 4CMBA 2ZZMA 1RJEA 2WP8J 3DW1X 2J41A 3GFTA 2ZYVX 3AILA 5CMLA 1SVIA 6CHYA 4QTUB 1CY4A 4TL8A 2ZCJA 1QWOA 2CVQA 2EYUA 3HNPA 2J9ZB 3PEEA 4TTJA 5DYNA 2H59A 2XZLA 3FMGA 4NBSA 4YP7A 2ZCUA 4MWSA 2Y3IA 1FTQA 3OU2A 3A58B 4EJSB 1YF3A 2TS1A 4YLEA 3KQTA 3V8PA 4PG8A 2CLFB 1G20B 2G77B 2F9MA 3GJ6A 3N58A 4J16A 3K8ZA 4KUHA 3OZBA 4OFXA 1L1EA 1MVLA 3AKZA 2Y4OA 1VOTA 1U4SA 2O0MA 3Q9SA 3FPEA 3T4EA 4OYRA 5CCXA 5CYPA 1TT7A 1U0SY 2I78A 4KYTA 3MJRA 2VDLB 3U3XA 2P2LA 1FUKA 1W5AA 3BL5A 4FNAA 1T5OA 1CJUC 2F90A 4OAQA 3V2GA 1XDSA 3OPMA 5B30A 4LOJA 3S2YA 2PZBA 2XT0A 5I5EA 2RBKA 3W5VA 1SUBA 4DDVA 1A9TA 4DMRA 1W2HA 2ACKA 5K4GA 3MGAA 1JR2A 1QFXA 2VNJA 6AT1A 3OZGA 3F3YA 2Q5EA 3G0CA 1VLQA 5E6UA 4FKMA 3QSYA 2B6HA 3USZA 5A2QA 2HA3A 5ELXA 3U1TA 1JEYB 3SMVA 5JSZA 1S4MA 1YKSA 2AXEA 5BWLA 3IB3A 5EXXA 1WSWA 1UUFA 3KIPA 1XDDA 4ZCTA 4D56A 1ODKA 4DUZB 2GXAA 1B23P 4FJ2A 3K8QA 2P9YA 4LZZA 3PT5A 2H1OA 2JW5A 1VJ1A 4DV7B 1ADBA 1RKVA 1T15A 2O3JA 2OV1A 1HETA 2B8JA 1JG3A 2DGDA 4HWTA 4DWOA 3CO5A 4MP6A 4QUEA 4G9GA 5JNUA 1RMYA 2OP1A 5K2MA 5M34A 4NABA 5LP6A 3DO6A 1Q0SA 4DC0A 3U7EB 2Q3HA 3W04A 3PCTA 4CUJA 3IE1A 3EGDB 1SVWA 4N9QA 5E1OA 3N05A 4OHXA 1X87A 1M34B 4DJ5X 1NG9A 3TTWA 3LLVA 5CUQA 3R9XA 5DLEA 3UPTA 5ALQA 2QP3A 1G5HA 2FHPA 5BRJA 5IF3A 1HR0B 3V8QA 5I3ZA 2NO9A 3ZR4B 3GWGA 4IKPA 3OTGA 1Z6YA 1RQ2A 3TQIA 5CH5A 5BQFA 4X54A 1MNQA 2V54A 2X8LA 4MWDA 3UT5A 4EA7A 1G4AE 1PZXA 2QG9A 2Q6VA 3A7EA 2APJA 2PA3A 2YZKA 3UAYA 3CEJA 4YYEA 1ESDA 2I3GA 3EFOB 3TQCA 1MDFA 4BIMA 1Z07A 2DERA 4D42A 3QW4B 4H18A 4D9NA 3G0GA 1SC9A 2VK1A 4CE6A 1QRAA 5MN6A 1UINA 1LSOA 1R0SA 3ZTYA 3ICVA 3VZSA 1KI7A 3M4XA 4QOSA 1ONOA 1M8KA 4QPPA 1ICIA 4RE6A 3EEBA 4OMUA 1FFHA 3SMQA 3EX7C 4IJUA 1K75A 2QUAA 1S1MA 1RTTA 2VKQA 2ZJ4A 1TU0A 4IXNA 1R4NB 1M0WA 4KITB 5JXIA 2CB0A 4ED9A 1B8UA 5DXJA 4B8YA 2HA7A 2EJWA 3OZFA 3UWKA 4Y3UA 5CBPB 4MUKA 1GM5A 4EG5A 3WLKX 1L8AA 4BHHB 3RFFA 3MWYW 2JLRA 4N0EA 4TTRA 4Q5IA 4KJXA 1P5FA 1Z2EA 3JATB 4LYHA 4UMDA 3OQMA 3IDAA 1WHTB 3N07A 4ZYVA 3FLMA 4G1UC 4LE0A 2B61A 3ANTA 3ETEA 1B74A 1HURA 3JQ6A 3MJHA 4MS3B 4OBWA 1FDSA 3BWCA 5DPMA 1Z2DA 5EIAA 2VR1A 2ZJ2A 1QHEA 3IVXA 4OLHA 4PSUA 4WOCA 1DCKA 2CLIB 2XR1A 3AO0B 1A27A 1WWKA 1CQWA 1KA9H 1W85B 2VWHA 3O7WA 4UQPA 4DDTA 4GBJA 3RKRA 4GX1A 1D0SA 1R6DA 4J0JA 4XJVA 4ARBA 3GCZA 2PGJA 2P6UA 3GBSA 4ZO7A 1QIKA 4IG9A 3ZY6A 4JI3B 4P7BA 4C88A 2VJCA 3SIRA 4QLBA 3HYCA 4P92A 4XJXA 4F3RA 3FR8A 1AKQA 3QTTA 3D2AA 4DEXA 1E8NA 4P80A 2X0DA 4F2GA 5JZOA 3EMKA 4MWGA 4HDKB 1VIAA 4ZOLB 3SZUA 2GJAA 1JR3D 4CETA 5AM2A 3EGXB 4YMTA 3R7LA 3ACBA 4R1QA 5IHXA 4XQCA 1L8LA 4PYKA 4HC4A 4U9UA 2FSUA 2R0QC 3H9GA 4R3UC 5M7EA 2YWHA 2A3NA 1GKYA 3TAUA 4EQZA 1P4AA 5IFKA 2PX4A 3KXPA 3UK0A 4CM9D 3THXB 4WKNA 4XYGA 5JU6A 3A1WA 2BZSA 1Z4NA 4L2IA 4B17A 5CB6A 3M3HA 3NBYC 4UTRA 4CCSA 1Y7HA 2MT9A 4HEA6 4L9RA 2QX4A 1IC6A 3D5TA 1CZKA 2OB2A 4R68A 3HNRA 3WYAA 3Q98A 4CQMA 4IV0A 1NKVA 4W99A 4A26A 1S4QA 1BE8A 5ALIA 2ETVA 4EFNA 4HAXA 1NDHA 4LV6A 1J70A 4HZGA 4TLDA 5JFGA 6ABPA 1F0NA 5AJHA 5F1YA 4V1CI 1QG2A 2GCGA 4JL8A 1U1EA 3WSTA 5FBRB 3N74A 3T3DA 3MOSA 4MAAA 2C9YA 3VPXA 4RUKA 3U5ZB 2BGMA 1KJYA 1JHMA 1MO2A 1FRZA 1DWOA 3AGPA 3CVOA 3L01A 1X7DA 4HEQA 5C7YA 3G1WA 4B6RA 4D9GA 3TRDA 2YV5A 4G3XA 5IG2A 1W7AA 1A4XA 3BRWA 5HIIA 2HU7A 1E60A 4TVKA 6Q21A 3QH4A 4WL0A 2WHRA 4E51A 2YS7A 1M10A 2EEPA 4R41A 1BOFA 2ZPTX 4UDNA 3B9PA 1YIDA 1PF7E 2R86A 3I0ZA 5K3OA 2CXXA 1ODLA 4G26A 2G82A 4GHWA 1UQUA 2C5LA 3H13A 4RPGA 3JAWA 2VXOA 2XMBA 4CF3A 3T3MB 3R3WA 1EUDB 2ZWOA 3EVAA 3KQMA 4A0RA 3ESRA 3MM4A 1IY8A 3TIXB 3RH0A 4GI7A 2CGEA 1H6AA 1QYRA 2FK7A 2WU4A 3A10A 1ZEJA 2QN3A 3C7DB 2O57A 2ZIAA 2EQ5A 2UZIR 3RSZA 3TI9A 2HCFA 4I14A 1EVKA 3D7SA 4B8ZA 5CA1B 4HWGA 1LK0A 2GK4A 4JLVA 2DWUA 2FAXA 5ALZA 2G63A 4RMIA 3B36A 2QENA 2J1LA 4XFKA 3SSMA 3E6AA 4MYTA 2FB9A 3CY6A 5F2KA 1ELOA 1WP4A 3QFCA 4LSGA 4U6QA 1WTAA 3LCMA 2JDIA 2P5UA 3K70C 5AM1A 1UP7A 1Z4IA 4FOLA 4LI3X 4JS0A 1Z22A 1V45E 4NONA 5EINA 1JEAA 4Z0TA 1OROA 3GPIA 3HSSA 4YAOA 5DRYA 3C24A 4YK7A 4EUFA 2ATIA 3OOEA 3GJ3A 5ESRA 4DA0A 1CZLA 1L5MA 1OLSA 4KSYA 1ZAKA 2ZJAA 3FYDA 1GEEA 4DOMA 1E2PA 2OBXA 4OIFA 1N2HA 4LHZA 1E0AA 4C7BA 2P7IA 3ABZA 5FUVA 2IH2A 1Z6TA 3DF9A 1VPLA 1E20A 1Z4LA 3NMUF 1J8QA 2BFCA 2QSZA 3Q12A 3L7MA 1SUEA 4QTTB 4AO7A 4DR6B 4AJLA 4YAGA 5T4EA 1EBFA 2C0PA 3K16A 1NW8A 1KMMA 1PJRA 3NDJA 3PFNA 1TEVA 3QHAA 4GLLA 4IBOA 4MPJA 5LDHA 1QQ6A 4KFCA 4BX3A 2YYYA 2FPXA 3CR3C 3KYJB 5GJVC 5I9SA 5JBIA 3C4VA 2BFBA 4AY4A 2X9QA 2R6GA 3D0RA 4F96A 4QDTA 3F1KA 3LCRA 4DLNA 4MKZA 3HTXA 1PKXA 4F5DA 1XUOA 4O2AB 4UM8B 1MO3A 1SG0A 4I46A 3C1AA 5J4YA 3EYAA 4PC2A 1Z3IX 3D6FA 3IBYA 1V6SA 2I2WA 4MCJA 4NCNA 4Q24A 5DN9A 1G38A 5GTDA 2G1PA 5EXPA 3DDNA 4Q3OA 3JATA 4DT1A 4E1AA 2W6MA 4PNEA 1Y42X 4NR0A 4DBLE 1K3TA 3DV9A 3AESB 2I99A 4X1KA 4ZOLF 3AJDA 1SWVA 5KKNB 1ZM2A 1CRZA 1V48A 2GGSA 1EFPB 2NU6B 1HDEA 1QPBA 1M5RA 4NCAA 1A4UA 2Q7XA 3O7MA 1HL7A 2YCBA 3AR3A 5DGHA 3KETA 5LZ2A 1OB2A 3D3NA 2E4ZA 5EKSA 2OZLA 1Y1SA 3IAAA 3LWZA 3MINA 3QLUA 4NYMQ 4GQAA 2QGNA 2C31A 2Z4SA 1GCIA 2ZRQA 4FW8A 3WR5A 3TLGB 2C5SA 2HEGA 4JR1A 3UJ9A 4IIBA 1VRCA 4QBGB 4EOGA 3FBWA 5JY1A 2OPBA 2WKWA 1QM5A 5K8UA 2BMDA 4IINA 5JJKA 5JAUA 1R27A 2H0QA 1QQ7A 4O4IB 4UDOA 1BNCA 5JD3A 1B6GA 1SQ5A 1ZONA 2C96A 3NRBA 5JUWA 4YONB 3RFUA 5J23A 4QHTA 5LLSA 4YCAA 2WJAA 3K30A 3WV5A 2ZREA 5U1PA 4MSUA 3KKQA 1URPA 3AXTA 4F84A 4DR4B 5KVAA 4U0KA 2ZE5A 4IICA 2IWRA 4PNPA 3MCTA 3WS7A 1OPXA 4WWHA 1B8OA 3BSWA 6REQA 4QVIA 4MQ5A 1SXPA 3A3YA 3QG5A 3MRTA 3R9XB 2CUNA 4LJ8A 2CC2A 1TM7E 2XZDA 2Y77A 1GOTA 1CQJB 2WZCA 3GGJA 3REGA 1KPIA 5C81A 1T91A 2AZTA 3FROA 3ZHXA 5TIIA 4Q02A 4BDTA 1DXQA 3HJGA 5ADWA 5AK3A 4YDQA 4C21A 2X9VA 4Q9LA 2TYSB 2V7UA 2AMVA 3D4LA 3A3NA 4E5VA 2A7XA 1A98A 2QJWA 5J5VA 4JLPA 4CLEA 3D43A 1NYQA 1VJTA 3PUKA 5JRDS 3TNYA 3QLJA 4WN3A 5A5FA 3ICWA 4M87A 3L6RA 3R77A 1IG0A 1U0RA 5JQWA 2PFSA 3CH7A 2GWHA 2V7WA 1GQRA 2H51A 2YJ4A 2YRFA 1KS2A 3C87A 3IT0A 1NU6A 1KTVA 4DS3A 5G3ZA 2IRWA 2OR3A 3MPOA 1KKMA 1VMIA 2V6BA 3T12A 5F52A 5HK8A 1W30A 4X45A 2VHEA 4MV3A 3SDSA 5CVDA 5IANA 1WOYA 1HLFA 1Z2NX 4V3BA 1EWKA 1TCCA 3CONA 4M1MA 3W9YA 4EQ6B 2A5JA 3BJZA 4XVQA 5J2TA 2EKLA 1ONNA 1Q83A 1GCAA 2FFHA 2MSLA 5ALKA 1QR6A 1BDIA 3H2YA 1EUDA 1MJFA 1RYDA 1VBMA 2QM3A 2ZSIA 1HOXA 1T6NA 3VR2A 4YJGB 2XTNA 2QGFA 4A0SA 4KN8A 4Y2JA 1UANA 4UEJA 4OD0A 5B2ZA 2VUTA 3P8ZA 4K9LA 3AERB 1PNOA 3JASB 1OV6A 4G5YA 4JB3A 4QOGA 2R6AA 4XVHA 1NLFA 1CLEA 3K5WA 3KVRA 1LBEA 3VBCA 4JNGA 1KY4A 1C9JA 1LPNA 1MORA 4S1WA 1LI5A 1YE5A 2HK7A 2R97A 3F4BA 4GM0A 4GXTA 4H1VA 2Y1EA 4JBNA 3SCZA 4A92A 2XY4A 1WZUA 5C7OO 2ATCA 3JQFC 3NKFA 5AVQA 3JPWA 1Y6QA 1CQZA 2BBOA 3MFYA 2RE8A 2JRLA 4WGGA 3WGTA 1ZRMA 2UYHA 1DPFA 1QFZA 2LV8A 4O29A 1FU7A 5I7FA 1F7VA 2B5VA 1JG7A 1AUQA 3UOWA 1KJQA 2B1RA 1B93A 1K86A 3IJPA 1ZBQA 3N2GB 4JC5A 5ARCA 2DHDA 5B5SA 4R1SA 5LWHA 4PAMA 4PFKA 1XHLA 5ECGC 4EG7A 3M9XA 2VWGA 2V7QD 2CNWD 4JC0A 4JLSA 4ZKDA 4CDMA 4TL7A 1EHCA 4BB5A 5FNVA 2B3TA 4A15A 3BMOB 4R1OA 2OY0A 1WM1A 4HNHA 5D86A 5HILA 1JIJA 1XALA 3N3BC 1EFTA 2FPKA 2IUFA 3AVOA 3BXOA 1QDEA 3MCZA 3N8IA 5DCUA 1AY0A 1XNHA 3TVTA 5DIZA 2UXDB 3PKJA 1U99A 2W6NA 3D5QA 3M82A 2MMGA 4KXMA 3IEVA 2C8VA 1IQRA 5EI5A 2IYXA 5EGSA 5AVTA 4O5OA 3MOIA 3DA8A 5FOUA 3ZHVA 1P7CA 3SQWA 1RI3A 2WWTA 4RVCA 2PJUA 5BWCA 1CJKC 3N9IA 2IYWA 4DM4A 1IY0A 1KZ7B 2P2DA 3PXUA 3G6KA 4ID3A 5CP8A 2QRZA 3LBNA 4PYLA 4DAOA 5LQRA 1P31A 3KYDB 2AKEA 1FBTA 3EVNA 5A4AA 1U28A 1OBHA 1UH5A 3O3MB 1S1CA 2WPDA 2RI1A 4G0XA 2YXEA 5KC8A 3MA0A 3N87A 1I3MA 3F2VA 1A5BB 1TVKB 5G1NA 4LRYA 1RJFA 3KR9A 4HEA1 9LDTA 2Z3VA 1WRBA 4AKHA 3CINA 4CMKA 1ZNYA 2C7OA 1C8BA 2P4QA 3OVMA 2GR9A 4MINA 4DSAA 2QLBA 5KHAA 4I3FA 4L16A 5JO9A 2QTBA 1QP4A 1POXA 4GMXA 2YJNA 1QIFA 1SBNE 2OGUA 2V0GA 5CDGA 5DGTA 4ISBA 3H3JA 2ZBRA 2QX6A 4Q66C 1NJ1A 4P4SA 1QRSA 3G9QA 1Y98A 5ICFA 1QIEA 3TUJC 1KSGA 1P7YA 3B1KA 2GCOB 3E7PA 2J30A 2GNAA 4L0CA 1KPHA 3L5OA 3HPQA 2C5FA 9LDBA 5ALSA 3NRJA 1C0IA 4QJBA 3S0JA 4B2YA 10MHA 1JTFA 3WRXC 1XTKA 3ITDA 2MYUA 2GSWA 4X90A 1SU4A 4L5JA 1GUYA 1GZDA 2DY0A 3KEQA 4Q7KA 3A25A 4QDOA 2C5GA 4YPFA 3WLSA 4AZ0A 1CUXA 2IELA 4JT2A 4DPKA 1W36B 3W5BA 3Q85A 5IMSA 4TLEA 2HLDA 4BQEA 4DVGA 5F3WB 1E0JA 2JHAA 2NVBA 3BIFA 1IH8A 3IMFA 3NHJA 4FE4A 4HQKA 4IV5A 4JY7A 5EEHA 3D0OA 3L9WA 5EMKA 2Y1FA 4OHYA 3SZGA 3UUGA 1ZL0A 1AS3A 5DEOA 3MW8A 1P44A 1W4CA 2QNRA 3A4NA 5IZCC 5B4UA 2LWIA 1J33A 2IQ5A 2NN3C 2VTEA 2W83A 4R5HA 2G7ZA 1G20A 2H29A 2BKLA 5ALXA 1M67A 3Q5GA 1I14A 4ZEWA 4BEBA 3G82C 2GPWA 3N0WA 4PQEA 1JPJA 4FWBA 4EI9A 4YV2A 1PR6A 5EQFA 1X8JA 3V33A 2A9RA 3MUEA 1R1DA 4M1WA 4JR2A 4YRDA 1E5DA 4O0LA 4UAUA 1VFNA 4XZ3A 3H87A 1ZMTA 5GJWC 4TMVA 4CHGA 1G4HA 5SY9A 3IKLA 3R3VA 1H5QA 1RC0A 2IYVA 3DBLA 3NEAA 1XTJA 3CLSC 1VSTA 2EERA 2WM9B 1DG9A 4KWEA 1NVBA 4ZAYA 2EWMA 1FNSA 2W8ZA 4H7EA 4TXNA 5EMJA 3JRXA 1PU2A 3LHDA 2K5UA 4ZQCB 3VOBA 3H17A 1KO4A 3U49A 1NRJB 1FTNA 4MOWA 4L8LA 3VSCA 1E99A 4JLDA 3ZCQA 1JXQA 4G4JA 4U7PB 3EIXA 2MINA 4PSVA 5J63A 4R1NA 4CZ2A 2PUCA 4B5LA 3HKDA 1EQAA 5AKGA 3WYEA 4ACAA 3OI7A 1IYZA 4H4CA 3STWA 3WYDA 2CF5A 3AR2A 1KFCB 4HDMB 1ZIDA 2HMSA 3I8OA 4JYBA 5JEEA 3E9YA 1TQHA 2YVLA 5ALVA 5JIBA 1PL8A 1S0UA 5K0JA 3AF2A 3MBKA 3U5TA 1PUXA 2KQUA 3OOWA 2ZB3A 3PX7A 5F9FA 3M6UA 4LRSB 4OTZA 4DQKA 3B1VA 3HYRA 3ZYZA 3S68A 1P3Y1 1VE6A 4O5AA 4LJLA 1GPDG 4OQXA 3VA7A 1N8SA 3FNGA 3RAFC 1XU7A 3OQ1A 4ZHQB 5G0TA 4ML3A 1NLMA 5GM1A 1BX1A 3FBGA 2GPAA 3IBGA 4RD1A 4EHAA 3DQZA 2I3BA 1DJPA 3PDHA 1HRKA 4M8LA 3U4DA 4J1GA 4TV8A 1NVUQ 2PQ0A 1JBQA 3AFIA 3BZWA 4INJA 3FAZA 5GGXA 5B55A 2W6JD 5BSKA 2HJHA 1Z26A 2C3OA 3ZHTA 5F9HA 2YZNA 3P2JA 1KK0A 2HXGA 2EV9A 4MDYA 3FSRA 4CCYA 1XWWA 4FC6A 3R3YA 1L4KA 3PNQA 3O82A 3QVJA 4KREA 5EZ6B 2Q5LA 1MKYA 4ZD6A 3UHOA 3T1NA 4QUBA 2PANA 4OGKA 2WUGA 3DDSA 4QFMA 1J1ZA 1UZNA 2ZU0C 3L7AA 3NWBA 1JJVA 4QJ4A 2OGZA 1DE0A 4I55B 5SV2A 1TDJA 4AMGA 5F2NA 1G19A 1T3SA 3GFFA 4ADSG 1QK3A 1LC0A 1NYLA 4US1R 3CNEA 1U28C 1Z0AA 3R0XA 3I64A 5REQA 3AVQA 4M54A 2BMJA 1RYHA 3K8YA 3BBLA 3PI6A 4LF8B 1E4EB 3FDFA 3HPRA 2F64A 2WKPA 3OZAA 3COPA 1KNXA 3L8GA 4OYYA 3QVVA 2B1GA 5AM5A 2O0LA 3KOXA 4DXDA 3R5SA 5LMNB 4YI5A 4QE3A 4FDAA 4P83A 4H7FA 1O57A 1RKBA 1FL9A 3GFBA 1SFRA 2WT4A 3OZ7A 2OENG 2FPLA 2JFYA 1PT8A 3SYRA 4DEYA 5IZ4A 1G7CA 4RHXA 4RVNA 4UDXX 3TSWA 4C43A 2C7BA 1KWKA 1P2UA 2VUUA 2I7DA 3NHWA 4DIKA 3C3PA 3E9NA 2QXTA 3U80A 1NLZA 4I5EA 5JR3A 1CDOA 3IA2A 3N6RA 5IVIA 5FYQA 5DHAA 3KOMA 3F6YA 3PUJA 1RLTA 2E89A 4MARA 1T2CA 3RO7A 4RTRA 4KE6A 4RF3A 3UYLA 2J33A 1EWVA 4QYMA 1FXSA 1OAKA 1YR6A 3H7IA 4EI2A 4Y18A 3EGIA 3E35A 2JIPA 3PL5A 2Y1CA 3QKRA 1NF9A 3IXLA 1WOMA 3NHFA 3B6JA 3UXHA 2O8CA 3FPJA 3DMFA 2PJZA 4M9ZA 4ALNA 1ZGBA 4CLOA 3EWAA 4JEIA 2FLWA 3D4OA 8ATCA 1VL1A 5JS6A 2FY8A 3D8SA 4O2AA 3I12A 1R0KA 1J8YF 1JDVA 3DEKA 5CLGA 1KGSA 3OCCA 1LDGA 3OPNA 1AKNA 2ZAGA 3EMDA 4HQFA 4MQMA 1GLVA 5HFJA 5A5VA 2EFGA 1CUYA 4NJOA 1T1EA 2L17A 2BSAA 4Q1EA 4LMAA 2G9ZA 4B6EA 3ICOA 1SKMA 3ITEA 1E9CA 3WJAA 3CA8A 5BRNA 3TJZA 3NHZA 3TIIA 4FHCA 2WAAA 4FFPA 4O2BA 4R7TA 1YE8A 4EVRA 1XCOA 1CY0A 4QUGA 2ZTMA 1GZ7A 2D0IA 4HV4A 1PN3A 1DAMA 1JKJB 1R8YA 2AYXA 2Q6OA 1L4BA 2NXEA 3SP1A 4C0WA 3I73A 4E4RA 2HWYA 3L0SA 5DI3A 1UM9B 3FBTA 1CP3A 2YOFA 3JQAD 3GDWA 4DLAA 1O97D 3N1UA 1L4LA 2PMBA 4CFZA 1E3LA 1PIWA 1Y8RB 3IV9A 1J5XA 5YASA 4WVFA 1NMYA 1S02A 4KOAA 1EP1B 1RP1A 4GX2A 2IV3A 2H7XA 1GY8A 3DPSA 4IIVA 4JELA 3MJSA 2RH5A 3OLWA 4XIYA 2BHRA 1QGOA 3D2CA 4FGWA 4NPAA 2WJIA 4M0DA 4RLHA 4RSMA 1XDGA 4UULA 1H2RS 1UDBA 1KYIA 2Q6TA 4OM8A 2CLSA 4OQFA 4ZHQF 3P9ZA 5DFAA 2CEKA 3WFIA 2Q1UA 5JD5A 5HIJA 1KVQA 3K9CA 1SK8A 2JK0A 4CN8A 2L69A 5CT8A 1XEWY 2AMYA 1GILA 1M72A 3EIOA 2QSJA 2BM0A 3MUOA 3P9SA 4ZCLA 3FETA 3TLKA 5K20A 2CBGA 2QN9A 3TW8A 1VG9B 3HKEB 3KTFA 3RF7A 2PMWB 4IIUA 3PNKA 4RPJA 2NVUA 3TNFA 4ZALA 4YRGA 5I01A 2AV6A 1U7TA 2H9IA 2HK6A 4Q05A 1WLSA 2F4NA 3OQPA 4FOOA 1RPZA 3EWSA 1CXZA 3R74A 4OOFA 3WBJA 2KB0A 2R1UA 1QGZA 3B3GA 3T0GA 5FPPA 2P8JA 3IHLA 4WXEA 3RS0A 4CLHA 1PWYE 1E4OA 2C82A 2OA0A 4AZ0B 5JSQA 3T41A 4I55F 3RTDA 2YHAA 3H5IA 2AD5A 4LRWA 4NXNB 1T9CA 5EYPA 4REQB 5FFMA 1FCJA 2KX7A 4AY5A 4EGFA 1XXHB 4MRVA 1X8KA 5E9WA 4JB2A 4O25A 1OTXA 1IXSB 4OHKA 1V7CA 1ZCJA 1GQ2A 3E58A 4MW2A 4Q9HA 4BGEA 4O08A 4BLUA 2X3FA 4JT8A 1NQOA 1XRSB 1YU6A 2NNLD 2G4VA 4Z0PA 4M53A 4XPIA 1MC4A 2ZPUA 4O4JA 4IS3A 3QKIA 4JT9A 3RSLA 4YJGA 4LE2A 1GDDA 2HJRA 2BFBB 2P68A 1MB0A 2AMFA 2FR1A 3H5TA 3HCRA 4R31A 3UGKA 3A6EA 3FGPA 1YL5A 3NBUA 2Q50A 3QPDA 2NUPB 2FE4A 2HYIC 2DFDA 3NHBA 4PQGA 3GJTA 4BNGA 5CBKA 5IF9A 4RZIA 3DMHA 3UAOA 3EVGA 3R5TA 4PANA 3FA2A 3SU8A 4ASUA 4JI7B 2CNNA 3I6ZA 1T9ZA 3MB5A 4OVKA 2BFPA 2ZE6A 4P2BA 4JR0A 3TLYA 3BA6A 3KFVA 3MJVA 2GEBA 4I1RA 3AIMA 2NUBA 3FMPB 5AW7A 4FYPA 2A0KA 3D8BA 3C8HA 5AW8A 3ZJVA 4FZVA 1CZOA 1EZZA 1VHJA 5E2BA 1PFKA 3AQIA 4CM4A 4MYHA 1ZIOA 4FEGA 4PEVA 1N7IA 1XLVA 2H4ZA 4WE3A 1ZSYA 3Q3VA 1PW5A 3SG0A 1RI4A 3DZCA 4C7XA 5B1EA 1UF9A 3GXBA 3I3OA 5HCIA 3N0TA 4IDUA 3S55A 2IHTA 1P9OA 3B1YA 3O2NA 3WIOA 1NXVA 1V8ZA 4H59A 3PNPA 1IN1A 1C9NA 3CWCA 4JCOA 2VHTA 3NUGA 3ROXA 4CG2A 3RKUA 1RVDA 3RDPA 3ZVLA 3LUPA 3AZOA 3VGJA 3DV2A 2D2FA 1AKEA 1FRFS 2YWJA 3B5JA 4EMUA 4HQ6A 4HXGA 2ADFA 2HXYA 5F51A 4Z1MD 5GIOE 2AEMA 1RWVA 1Z29A 3A2MA 4CDRA 3RC1A 1B8VA 1GQSA 4TMTA 1OJLA 3KJEA 1XZPA 4GEKA 4L27A 4ETNA 3FFWA 2D1QA 2IWHA 2I2AA 3ME5A 4TWJA 4V1CA 1QVAA 3T3HA 2J9FB 1G21B 1F4VA 3GRCA 4HX5A 3KQNA 2JATA 3OOJA 4AJ9A 4QUIA 2YXNA 3CV3A 1AN0A 3LMKA 4NK5A 4S35A 2YNMC 1FYWA 3K8OE 3L8YA 4N8DA 5ARDA 2QBYB 4G09A 1II9A 1EGQA 4G63A 5FX2A 2V7XA 3LZDA 3PXXA 1FFBA 1UMCB 4BQPA 4Y2RA 2GA8A 3GMTA 5EPOA 1J97A 4FYKA 4AY3A 2VHZA 1QYCA 3WQSB 1JA0A 3H5VA 4Q15A 3JQAB 1I1HA 1LWOA 1V26A 2NO5A 4R81A 4UFOA 5FF9A 1KEWA 1HDOA 2EIXA 4Y2VA 4B34A 2P69A 4HNGA 4NAUA 1O0BA 3CZ5A 1FUIA 2DQSA 3UGJA 2O52A 1YFLA 5DCYA 5EQJB 4QFCA 5BN3B 1ZQ1A 4UXJA 2ES4A 1Z0JA 3IBCA 3OX1A 1NR7A 1Y7IA 1V35A 1YQUA 2YN2A 4K81B 4X7BA 4G24A 3CRVA 2VVTA 2C1XA 4EX7A 5AI4A 4CF6A 4RLFA 4BGVA 4EGSA 2FEMA 4AMZA 5JLAA 1N5JA 1WW2A 2CE7A 4KI0A 4M83A 3RS5A 3LO5A 3V5NA 3DMTA 3RHTA 4UFNA 4EY7A 1ILWA 2Q07A 3N0RA 3U3RA 2QN8A 4E33A 3IT2A 5J2TB 1KPGA 1WUHS 2VF8A 2GN2A 3TGWA 1VIMA 3C1TA 4NHEA 1P80A 4NH0A 1P2FA 3NP9A 4MW0A 3ZZ1A 3HDJA 1H9BA 1RHJA 1ULSA 2RAUA 1E7MA 1T26A 1RKQA 1F4LA 1V7PC 3QEAZ 4KPEC 3KR2A 4TPKA 1KF0A 3KXKA 4EG4A 2JFQA 5H7XA 1GU0A 2P41A 3GA5A 4HDSA 1GSOA 3EXEB 3KJZA 3KPJA 3OHSX 1L5GB 1FXWA 1UWLA 3A36A 3B1ZA 4BQOA 1XDWA 2Z6QA 4LXTA 1PX0A 4CEIA 2EGUA 5AOCA 3BWXA 3K5PA 1GXSB 1W4BA 4LDAA 4MV0A 2II6A 4DJFC 3GFOA 4EI8A 1J09A 3P4XA 2VFAA 3K6RA 5CPFA 5DK6A 4I36A 4BN5A 4LRUA 1A71A 1RE0A 4MA4A 1E61A 4YROA 1AB5A 1CDDA 1ZJJA 2B5OA 2HSEA 1GR0A 2VH1A 4FNGA 4I55A 3FPKA 3NLLA 1TCAA 3ZCUA 1YS2X 3NV7A 1SUPA 1QYVA 3P26A 1E96A 4XWAA 1T8PA 5J43A 3L0CA 1XTIA 1I10A 3VI4B 821PA 2QUKA 2NO7A 3C16C 2RSLA 1MABA 8GPBA 5I4IA 2Y6UA 3DAPA 2VZ9A 2EJBA 5SZJA 1MRSA 5JS2A 1AMUA 4OXNA 1X9GA 2RGYA 1MAVA 2V5VA 4WA8A 1KFJB 5BSWA 4UHDA 1FDIA 2OM2A 4ZDWA 3K1TA 2QM8A 1U8ZA 4YRKA 1IOZA 2CWDA 4YS6A 5FTJA 1WS6A 4X7RA 2QD1A 3ZHBA 4XDYA 5EIOA 3FVVA 2QTWB 6NULA 2JLZA 3KSAC 2R7MA 1OV4A 2X41A 1YB1A 3CLRC 4I6GA 4WUVA 4B31A 1RM5A 5ELMA 3TKAA 2D59A 5TB5A 3QVXA 1YASA 4G9EA 2WZBA 2J6CA 4N0QA 4EA9A 2W42A 2D1YA 4H7IA 4LVUA 3PQCA 2BTQB 2RONA 4FYMA 2WSSA 2OB1A 1KFKB 2BKEA 1USKA