1E7QA

Gdp 4-keto-6-deoxy-d-mannose epimerase reductase s107a
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
314
structure length
314
Chain Sequence
KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGASCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQSAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Epimerase/reductase
molecule keywords GDP-FUCOSE SYNTHETASE
publication title Probing the Catalytic Mechanism of Gdp-4-Keto-6-Deoxy-D-Mannose Epimerase/Reductase by Kinetic and Crystallographic Characterization of Site-Specific Mutants
pubmed doi rcsb
source organism Escherichia coli
total genus 109
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e7qA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1e7qA02
2JCXA 1R0SA 1UZNA 4WLVA 4YR9A 2H1SA 3T4EA 1GPDG 2BRUA 3ZU2A 1PZHA 1OFGA 1LDGA 3RD5A 3E03A 3JQ7A 3S55A 3H9EO 4LN1A 2YDXA 1SPXA 3LT2A 1H9BA 4GX1A 4IDDA 4YJFA 1U3TA 3FCOA 1HF3A 4R01A 3H2SA 4PIVA 4DC0A 1ENZA 4RF5A 3ROKA 4BV9A 5JMWA 3SJUA 3PQFA 4A7PA 3TQHA 1HWYA 2Q2QA 1U2DA 5A1TA 1K6XA 1SO8A 4HNGA 1NFQA 4UVGA 3ZWMA 3EDMA 2FPPA 3LYLA 1WXDA 1GZ3A 3LZ6A 3OSUA 1X0XA 2ZQZA 3A4VA 2I65A 4W82A 1ULUA 2QZZA 3CIFA 1EUDA 2YDYA 1TT5B 3ST7A 5IF3A 3ASVA 1VE9A 5EPOA 3NEPX 4XRRA 2AA3A 3UH1A 3CH6A 2BFAA 1VKOA 3L77A 1XU9A 1D4FA 3NKLA 1JKJA 2GNAA 4HWKA 3R3SA 3IIEA 2G0TA 3GVPA 4CLOB 5F3RA 4TRRA 4NFSA 1SC6A 3H65A 4Y6RA 4FFPA 3HUDA 4U7WA 3FRJA 1P45A 3JV7A 2BGMA 3ZU5A 4GWKA 3RI3A 1E3WA 5KJFA 4NBWA 3BHIA 3HNPA 4QO7A 3IUPA 4WEQA 2Z5LA 1QYXA 4R1TA 4ALLA 4EBFA 4E2ZA 3PFWO 3RFVA 2X9GA 4TQGA 3IJRA 1YOVB 3PYXA 2F00A 2YYYA 4XYLA 1Z82A 1UDAA 1GEEA 1HDCA 5CPFA 3VKUA 4P4GA 3ULKA 2IZZA 4AJNA 2QQ5A 4KWIA 4XJTA 4KDEA 3GOHA 3GRKA 2IYPA 4OSPA 3EW7A 4LSMA 3A9WA 1P74A 2C2XA 3WQRA 3PQEA 4N18A 1QV6A 3DZBA 4ZQBA 5KKCA 1PJ3A 4L4XA 3KOUA 1Q0LA 5DZSA 4K28A 3ZW8A 1HETA 3JQ8A 5GZ1A 1OMOA 5C5IA 1FDVA 3ZHZA 1Q0HA 1NQTA 1J0XO 1K5HA 1U5CA 2JFFA 3PVZA 2X58A 1ZKMA 1Q0QA 4Y98A 1GQQA 4ALKA 1Q7BA 3MOGA 2GUGA 4BQRA 1E5LA 1VC2A 1TI7A 3DWFA 1N92A 4BHTA 1PGPA 1R37A 1UXGA 2ZCUA 4H3VA 2NM0A 2GYYA 1X1EA 2GASA 1ZZEA 4FN4A 5JO9A 1I3LA 3GGOA 5IN5A 4K6CA 3MJSA 4W7HA 4ZICA 3GZNB 1DSSG 2YFHA 4ZU3A 4G2NA 5B4UA 5BSFA 4WCFA 4YT4A 3LC7O 3A14A 3KYBA 3MEQA 1GUZA 1Y8QB 4UVHA 4Y9DA 3DZGA 2NTNA 3JQCA 3DB2A 1CYDA 1DLJA 1JWAB 2HCTA 3DHYA 4ND2A 1XLTA 3G17A 2EP5A 4IXTA 3ADOA 4R3NA 4IDBA 3BMOB 1MG0A 2VTEA 1YL5A 4XB1A 3OHSX 2DBRA 4UEKA 2C07A 4XB2A 4J4BA 3PIDA 1N7HA 3WYEA 1Q7GA 4YRAA 1UZLA 4B4VA 3JQAD 2VZ8A 4CQMB 1PGQA 4CM8B 2O3TA 5JPIA 2J3JA 2OP1A 4PG5A 5A9SA 3X2EA 1LI4A 1S7CA 2NADA 3OJ0A 5TQVA 1R66A 1NNUA 3PXXA 1O89A 4IZHA 5B1YA 1D3AA 5G0SA 1SNYA 1PS9A 3I6QA 4Q3NA 2HKIA 3AI2A 2IEDA 2JHGA 1EQ2A 1M66A 4IQ8A 1FF9A 4XWYA 1PX0A 3QVSA 2JAPA 2B37A 3B1JA 1PEDA 3HDHA 2EF1A 3W4KA 1PGNA 1GFSA 1YL7A 1A5ZA 1GV0A 1W8DA 4MJLA 4QSMA 4LGVA 5HM8A 3UFXA 3MJTA 3BMCA 4CLXA 4Q3AA 3GDGA 4DPMA 1RYDA 2YV3A 2FPGA 2V65A 1DIGA 1L7EA 1YBVA 3AU9A 2NTJA 3C8MA 3GZNA 1IZ9A 1Y6JA 5U9CA 4E12A 2BI8A 3IQDB 4JNKA 5ILGA 4BIIA 5ICMA 2Y93A 4JLWA 3N58A 1UXJA 4NIMA 3FTNA 4JK3A 3U4CA 3BA1A 3MZ0A 3PDJA 4B4WA 1CIVA 2AQ8A 1WP4A 4KP7A 1VI2A 2DUWA 4DPLA 3RUHA 4EYEA 1YS4A 6LDHA 3VDQA 1P77A 1KYQA 1SB8A 3VTFA 1ZJYA 5IFLA 1HZJA 2DTEA 3TZKA 3P7MA 5I8WA 5TF4A 3F4BA 2ZATA 3N7UA 4Y6SA 1BW9B 3DBVO 4MKXA 4FOSA 4XYEA 4B7UA 1LRLA 4QX6A 1BVRA 4N7RA 3KXDA 4BMSA 1Z45A 1ZW1A 2DFDA 3OBBA 4BO5A 3T7CA 5JC8A 2CSUA 3KBOA 4IJWA 4FC6A 4ROSA 3ZHYA 3W8EA 2PZMA 3H3FA 2W8ZA 2C82A 3WX0A 2VCYA 3D4NA 1B14A 4PZCA 2OFPA 1Y81A 1CF2O 4YT8A 1B8UA 3GN1A 3Q2IA 4LK3A 4E5NA 3R1IA 1VPDA 1Y1PA 2XPCA 5BSEA 1I3KA 2X1HA 3K31A 3RQSA 3O4RA 2PWZA 4S1VA 4GBJA 1WW8A 2FSVA 3UAGA 1TXGA 3FD8A 3SXPA 4F6CA 2PK3A 3KO8A 3KVOA 5COBA 4JJGA 2V6MA 3LDHA 3KSUA 1EVJA 1QYWA 4L0QA 4RPGA 4M54A 1AE1A 1LDMA 2B4TO 3O26A 4IGFA 4Q3BA 4BGEA 4L4RA 3JQ9C 4XGKA 5I7SA 3HWRA 4TRMA 4NFYA 4I5GA 4KQWA 4RVUA 4B8WA 1NX6A 4IJUA 4UAGA 1LDNA 2Q2VA 3PGJA 4PLTA 1TEHA 1Z7BA 2CDCA 2HK8A 4J0FA 4HADA 4XZ3A 5GZ3A 1WDMA 4E5KA 3M2TA 4FPXA 4XQEA 4UVEA 3PP8A 1A27A 3AUTA 4IS3A 2VRCD 1NVTA 4DLBA 1H0KA 2O3JA 4A26A 1PZEA 4MIOA 1EE2A 2HMVA 5DOZA 5BNTA 1JKIA 4KUGA 4R5MA 2GZ3A 4CJXA 1KC1A 1ZEJA 1F17A 4CLDA 3VPFA 2X5OA 1NYTA 1RPNA 4WLEA 3ANLA 2XOXA 3OEYA 3U0BA 3U62A 4CMHA 5L4LA 1I24A 1BWSA 4D0RA 2VUTA 3GG9A 3H9UA 1HDOA 3BYZA 1TT7A 3TFQA 2F1KA 3BTOA 3C24A 1UUFA 4R1UA 1U7HA 4GPD1 4UEOA 3RROA 5JMPA 3U4DA 1P9LA 2GD1O 3WJ7A 1DC5A 2AE1A 3C7CB 3ANNA 2B36A 2NQTA 3EK2A 4AJEA 1TB4A 3NYWA 1JA9A 1HDGO 1HLDA 3DZKA 4KWHA 3WLEA 5HS6A 4CMKA 3AM3A 4CV1A 4L75A 3QVXA 1EUZA 2O3RA 3LLSA 2VHWA 2D3TA 2VWQA 2B35A 2WTBA 3PJDA 1AUPA 1GU7A 4YTEA 1KVQA 1A9ZA 3S8MA 1B3BA 1X14A 4UEJA 4PRLA 1B0AA 3C1TA 4D3FA 3U5TA 3DR3A 2JD0A 2CFCA 2QHXA 2BF7A 1KC3A 2C29D 8LDHA 4FR5A 1EFKA 2CDBA 3AY3A 2WWRA 1Z73A 3GNTA 3KYCB 4JJFA 1Q7CA 4S3MA 4DYDA 4NJOA 3DAGA 3NUGA 2P2SA 3NDIA 1ZEMA 1N9GB 3FR7A 2JD1A 3BAZA 3I3OA 4BO1A 4DREA 1V3TA 3I9MA 3RCBA 1J5PA 4OIMA 3ZWYA 4INAA 3NAQA 3NT4A 1HE3A 3BTVA 4YWJA 2GDZA 2X9VA 3VZRA 4CMEA 3LT1A 3WB9A 4ZRMA 4Q3CA 2VUSA 1X7GA 2H5LA 3ZWCA 3TDKA 2LDXA 5BSGA 2YQ4A 4OJNA 1YB1A 4PZDA 5F5LA 2IRWA 3UW3A 3F5QA 3F4LA 4R51A 3TZHA 3G79A 4II3A 3DOOA 5EIOA 4HUJA 1E7RA 1QKIA 5JS6A 4CPDA 3MJCA 3Q9UA 1KVTA 3FN4A 4JIGA 3L0DA 4CMAA 2XF8A 2FY8A 3ICPA 1NXQA 2NVUB 3WIEA 4L74A 3K30A 3MJ4A 3MOIA 4P4NA 4BB5A 1O9BA 1HDRA 2VYNA 1ENPA 2AQHA 1X13A 1KVRA 3WYBA 3JQ6A 1LC0A 2CDAA 3AK4A 4GKVA 1PU2A 2PH3A 4A73A 4KDFA 1NFRA 4W7IA 3ZWWA 3KETA 4NK4A 2OOSA 1KOLA 3STHA 3ASUA 4YDRA 1IL0A 2Y1DA 1DEHA 3F9IA 2RHCA 2HO5A 5JY6A 4NH4A 1D1SA 5JE8A 3VPGA 4M49A 1AN9A 3P2YA 4OGWA 3DL2A 3IDSA 1UDBA 1X0VA 1VRWA 1UAGA 2J6IA 2NSDA 2A35A 3EUWA 3H6KA 3WXBA 3LC1O 2Q1WA 4IQ0A 2G1UA 4GWGA 2GPTA 3D5QA 3RUIA 4OO3A 2I76A 4CM5A 3EC7A 1LDEA 1DBVO 1TLTA 1OC4A 3E48A 2NU8A 3ETEA 3AW9A 3PHGA 1E0DA 3NJ4A 3PJEA 4FC7A 3ZCXA 5T64A 1P1IA 5MGBA 3V1TC 3I9NA 5DNAA 3FPCA 2R00C 2IZ1A 3ENKA 4B3IA 3CKYA 2ZK7A 2V7PA 4WK6A 1K3TA 4NDNE 1ENYA 1GEGA 1CDOA 4RVFA 5T6BA 2WD7A 4A03A 2GN9A 3LF1A 4PG7A 1W73A 1YONA 3ETGA 3SC6A 2NVUA 2C20A 3WNQA 1W4ZA 1YWGO 3Q2KA 3UCXA 1JAXA 2EW2A 3DDNA 3RFTA 4FSHA 3VVBA 3W4JA 4TVOA 4BNMA 1YRLA 1LQTA 1YBMA 1BHSA 4MKRA 1LSSA 1E3SA 3DMTC 2VOJA 4XQ9A 4FJ0A 4PLWA 4OXYA 3I9KA 5KVVA 3DHEA 4Q9NA 3C7DB 3AI3A 2O4CA 2EGHA 2H63A 3MJVA 4CMJA 4J2OA 2W2LA 1KEVA 4CM4A 3K96A 1MXFA 3S2IA 3X2FA 3AUAA 5CEEA 1E1LA 3L6OO 1ISHA 1I32A 2AG8A 1H6CA 4U0KA 1B15A 1E6UA 1PJ2A 3DONA 4RDIA 1PGOA 4Z9FA 4PG6A 4D46A 3BZUA 1B2LA 3RKUA 1O8CA 4J90A 4XQCA 1WAMA 1GDHA 2WE8A 1X7DA 3TF5A 1UXHA 4CR6A 1ARZA 2EKQA 3IP1A 4UUPA 3K2BA 1MLDA 5EESA 4R1NA 1K6IA 4D44A 3ZNPA 3JYNA 3PK0A 5A5EA 3ZV4A 5KJCA 2JCYA 4C4OA 1ORRA 1DPGA 1YJQA 1GPJA 1IZ0A 1PJTA 2J3HA 3KM0A 2BKAA 5EQDA 1LTHR 4CLRB 4QQRA 3WMXA 1E3IA 4BNGA 1R12A 4YPOA 2CMDA 3DBHA 1HSZA 4JROA 1DFGA 4HNHA 2G5CA 1UH5A 3UICA 1Q2XA 3HSKA 3FI9A 3GC6A 3O8QB 3GFGA 3U49A 2UUOA 4OHUA 4GMFA 4IMRA 3DEYX 4I08A 5DCYA 1PR3A 2Y99A 4GQAA 2Y0DA 1R0KA 4RJTA 2NUAA 1O95A 5C7LO 1UP6A 1U3VA 5IAAA 3HADA 5JLAA 1V0JA 1XU7A 5BR7A 3MJEA 4YJGA 1PZGA 2ET6A 4N5NA 4HV4A 1V8BA 3EAGA 4E6PA 4ZJUA 1LC3A 2WMDA 3HN2A 5JC1A 2D0IA 4BGUA 1BXGB 3DTTA 2ZCVA 1HXHA 1YO6A 4IY1A 3ROPA 2B5WA 3I23A 4FFMA 3E5RA 4NFHA 2X4GA 3UGKA 3N74A 4KTVE 2Y67A 3ONEA 1ONNA 1PL7A 3NT5A 1DJNA 1IUKA 2CF5A 3JD1A 3JYPA 5A05A 3JYQA 5JNLA 2ZKLA 4LMRA 2FN7A 3QY9A 3OA0A 4IMPA 2PD4A 4W4TA 1GYPA 2YQ5A 5T8KC 4NR0A 3JQFA 3PHHA 1JN0A 1CERA 1GAEO 1I36A 3KZVA 4B79A 1LUAA 4RVGA 1XSEA 1HEUA 1BDMA 3AWDA 5JY1A 3UHAA 5L9AA 1ONOA 1NPYA 3PLRA 2X5JO 4DLLA 3OM9A 1EDOA 2ZB4A 4BS9A 4CMIB 4RZHA 2VWPA 4L73A 1I3MA 4IDFA 1IY8A 2HSDA 4XD2A 3OH8A 4IZIA 4JX8A 4XA8A 1OI7A 5TRTA 3WDSA 1XR3A 1F8GA 1KEUA 4A5OA 3K2EA 4E31A 4O63O 3O8QA 5GMOA 4JP2A 5EQFA 1UAYA 5AQ1A 4YA6A 3LF2A 1T26A 1Y8RA 4RVSA 1IE3A 4MOWA 1MG5A 3WOHA 1P1HA 4IDEA 4PVCA 2BFOA 4XIJA 3KYDA 1KEWA 1PJLA 3DZHA 2P4HX 4YRBA 3O9ZA 2RH8A 1UZMA 1HKUA 4BNKA 3WSVA 3L9WA 3QRWA 2I99A 2X0JA 3KRTA 3PYLA 1DRWA 3WS7A 1T4BA 1VL8A 5AXDA 3CTMA 1F0YA 5I7FA 4D45A 2I3AA 3ZU4A 2VHYA 3AOEC 1IOLA 4E5MA 4CV0A 5TS3A 4EJ0A 3P2OA 5C7IO 4Y67A 2CVQA 4LCEA 4KUHA 3FBGA 4DTIA 1T1SA 1QORA 2P91A 4JBGA 4CMBA 3IL2A 1P3DA 1RM0A 3I4CA 1E77A 1ZVMA 2VQ3A 4MVJG 5C7OO 2VHZA 5DBIA 9LDTA 1CEQA 1T25A 4R5HA 5F1PA 5JDCA 4JN6B 3DAFA 3RAJA 3TOZA 4BKQA 3GAFA 3H2ZA 5IXSA 5IZCA 1I3NA 2PV7A 1DHTA 2QZ9A 3GF4A 2QRJA 3OQBA 1KY5A 4HKTA 1K0UA 1ZCJA 1DIHA 4NI5A 4NU6A 2GN8A 3VAZA 3ZNOA 4XYGA 1QG6A 3HFSA 2GZ2A 4D3DA 1VSVA 1AXEA 4XDZA 2BGLA 3KLMX 4LVUA 9LDBA 4PRKA 2DC1A 1R6DA 1FDTA 3WLFA 4J91A 2P9GA 1SEVA 1JVBA 4OSOA 2UUPA 3G3EA 3KHUA 1ZBQA 2P9CA 2VT2A 3HN7A 4J0EA 3WGYA 3GEMA 4ALIA 1VL6A 5F1KA 3PTZA 3P19A 1R15A 2D1YA 2X22A 3VPSA 5ADHA 3D3WB 2O7SA 3L4BA 2GO1A 3G1TA 3QQPA 2G17A 4FOOA 2D4AA 4TKMA 5T57A 1H2HA 2B4RO 2YY7A 1TT5A 3NGLA 5I9LA 2GCGA 4BKUA 4E13A 3COSA 4TSKA 3R0IA 3D0OA 1PWZA 4J43A 5U1PA 3ZWVA 4CM9A 2X0IA 4IIUA 3NGXA 3RBXA 3A06A 2ILTA 5DN9A 4BO6A 4OOEA 3PPIA 4CODB 1K89A 4CLOA 5JCJD 2VYVA 1U8FO 1NR1A 2GR9A 1Z6ZA 3AFMA 2QG4A 4BNIA 2HJSA 4LRSB 3WFJA 4HFNA 2W2LD 2J5RA 2NU9A 1SZJG 2E48A 5IDYA 2CZCA 2DBVO 3WQQA 2C54A 3RUAA 4J3FA 3BHJA 3CZRA 3U4IA 2IODA 3GGPA 2P5UA 2PGJA 3PRJA 3VZPA 1O0SA 5ENDA 4EUHA 4J1QA 3LVFO 1YOVA 3U9LA 4BO2A 3D4PA 3U4HA 3WYCA 1R4NB 3IMFA 3GG2A 4MO2A 3WGTA 4CUZA 2HRZA 2ZTMA 3UCEA 4R68A 4MP3A 4DUPA 1NAIA 4F3YA 1SMKA 4D79A 1QYCA 3ORFA 1XDWA 1ZK1A 2WE7A 2PZKA 5KOIA 1I8TA 1N5DA 2RIRA 5AOVA 4TZKA 4BO4A 2IEBA 4RPHA 1H6DA 4YAJA 4W99A 1NP3A 3VOSA 3TL3A 4ESOA 2YHUA 2Q2WA 4DIBA 1FMCA 3NJ8A 3PDUA 1LSJA 4I9UA 4K26A 1GUFA 4LISA 1U8XX 5DDIP 5CG2A 1WLYA 1E7YA 4C7JA 4E2YA 4ZQHA 2VNAA 1ZK2A 4ONEA 1DRUA 3O38A 4HP8A 4BO9A 4CM7A 5K6AA 3U3XA 4RVDA 1HSOA 3WGIA 5JFOA 2VRBA 1E7MA 4Z9YA 3RC2A 4EGFA 4NBUA 4G5HA 2NQ8A 1H6AA 3MCVA 3ZNQA 1VLLA 4CMEC 1LBEA 4NBTA 1NTOA 3OIFA 2PZLA 3TPCA 2V6BA 3E8XA 5L3ZA 2O3UA 1D8AA 4DWVA 4KZPA 3JSAA 3O03A 1Y8QA 2POQX 5ER6A 3FWZA 5B12A 4U0JA 1LX6A 4P22A 4IUYA 4DBVO 1UJMA 1LLDA 5HWSA 3GHHA 2YW9A 4GVXA 4UULA 3INGA 1VSUA 4DVJA 1K6JA 1KERA 3BMOA 5K0ZA 3V2HA 4PLZA 4DPKA 3GFBA 4CL8A 2H6EA 4MVJI 2EHDA 4NJMB 1IHXA 4KOAA 3VH3A 2NVWA 1E1NA 1HYEA 1N7GA 1QMGA 2YHIB 2FRDA 4CQMA 4QEDA 3ANMA 3Q6IA 1IB6A 4CM8A 4JCOA 5AVOA 3GVHA 1EDZA 5KVCA 1V3UA 4M89A 1MGOA 2YV2A 3QVWA 3ZV3A 3PIIA 3QWHA 4BOYA 2OHXA 4W9NC 1ZK4A 4ZVVA 2Q4BA 3AY7A 3QIVA 1WZIA 5H81A 2HK7A 4BV8A 3E1KA 5COAA 3EVTA 5CDSA 2I66A 4CR7A 1JKFA 3ONDA 2ZYDA 4F46A 3JD4A 1C1XB 4KTTE 3K6JA 1XG5A 3GHYA 1FDUA 1IHYA 2QRKA 1FXSA 2BFPA 4OXNA 4ZA2A 2FMUA 3B1KA 3W6UA 4TRNA 3WGHA 5I7EA 4EI2A 4D41A 3UUWA 3WR5A 1FJHA 1E6EA 1HT0A 3Q9NA 1IPFA 3BHMA 4DBZA 4QO8A 4RGBA 4BO3A 4F45A 4GX2A 1E5QA 2R6JA 5G4KB 3PYMA 5L51A 3ZWOA 5KWEA 1XELA 5TSDA 2YUTA 5HA5A 4DXHA 3JD0A 3JQBC 4U6QA 2OP0A 3D1LA 1XHLA 4PVDA 3HQ4O 4TWRA 3H8VA 1A72A 1QLJA 1XCBA 2GN6A 3NTQA 3QP9A 3PHLA 2HMSA 2HMWA 4BNTA 2VHVA 5KIAA 1BW9A 2W2KB 3EMKA 4MP8A 4YJHB 4O59O 4DL9A 2RBEA 3GUCA 2Q46A 3BTSA 3QW2A 1JDJA 2YHIA 3HB4X 1AHIA 5GY7A 4BVAA 1Z75A 4MDHA 8ADHA 1MV8A 4AFNA 2TMGA 2E4AA 4M87A 5JYDA 2CF6A 3QWBA 2YV1A 1H93A 3OETA 3SLGA 5AYVA 3HDJA 4G81A 1M76A 1J6UA 1RM4A 4YAIA 2I9PA 1BMDA 4Y6PA 1YDWA 1EZ4A 5KJ6A 2HUNA 1JW9B 4M86A 4BNNA 4CQLB 3LK7A 3E9QA 5AXBA 3FTPA 3KSDO 4YVFA 1EEHA 1ZMOA 5CDTA 2AEJA 4CM6A 4JBHA 4H16A 1C1XA 1E1MA 3I83A 3DBRB 2CD9A 3MTJA 4CMCA 1KS9A 3WTCA 3BMQB 4TVBA 5CP8A 1BG6A 2Y1GA 4YAGA 1OOEA 3F1KA 2LDBA 1NQ5A 3QHAA 1SBYA 4M1QA 5I9MA 2EW8A 2IXAA 5I7VA 4CM9D 3CMMA 3T4XA 3EZYA 1PZFA 2D5AA 4EEZA 2Q99A 1GCOA 3BIOA 4R9SA 4E5PA 5AXAA 4K1LA 4ALNA 4ALMA 3FHLA 1M6HA 3TJRA 3GY0A 4RQUA 2PGDA 4QTZA 4OAQA 5IZ4A 4MVJE 1SAYA 5HRUA 3PLNA 3CZMA 3SEFA 4HX5A 3DBLB 4KUEA 3VZSA 2UVDA 2Y1FA 1QYVA 4HY3A 4KMSA 3I52A 1HE5A 4FFRA 2GN4A 4BNUA 1Y5MA 2W2KA 4E4YA 1C0KA 3SVTA 1CWUA 2HQ1A 3C1OA 5CG1A 4MVJA 1ZSVA 4TMFA 1A4IA 3RBZA 4BMNA 3NX4A 1LLUA 1LDYA 4AVYA 5JSFA 3A28A 4IJVA 2DTXA 3FNFA 4Z0TA 1SOVA 5GZ6A 3K92A 4OOFA 2JHFA 4LRTB 3Q3CA 2IE0A 2ZJ0A 5L95A 4L8VA 1UXKA 3E9NA 2A94A 2J8ZA 3ITDA 1P33A 2ZYGA 1U1IA 4UUOA 1NWHA 3AM5A 2JJYA 1U5AA 4QFDA 4RDHA 4RZIA 1T2AA 1X1TA 2UV8A 2P4QA 4P8RA 4URFA 3GPDG 2DBQA 3GAZA 1Y7TA 2E82A 1GD1O 4R9RA 1YB5A 3DOJA 1AXGA 4PCVA 5CAEA 4R41A 1P1KA 1RKXA 1I2BA 3JD3A 4ITUA 5CDUA 5FWNA 1PTJA 2Z1NA 4EEXA 2VUUA 5G4LA 4XR4A 4AJLA 3AFNA 2HK9A 3ITKA 3QA9A 5DT9A 4AJJA 2Y66A 4WNCA 4BGIA 4NZ9A 1Y9EA 5A03A 1GTMA 5H82A 1SCUA 1KY4A 3HG7A 1NHGA 2A92A 4PLYA 4TRJA 5IXYA 1H6BA 3F46A 4WECA 3PZRA 3ZWXA 1XYGA 1QV7A 4II2A 1KBZA 2DUUA 4DA9A 1NAHA 4EJMA 4BKOA 5DF1A 4D7AA 5KJ1A 5DP1A 2IDZA 2OBNA 2OXIA 3KYCA 3UCFA 4J9VA 4YBZA 4HFMA 4EDFA 4ID9A 4AJHA 3S1LA 4BO7A 3SBOA 3WGZA 5IDWA 3PWZA 2G82A 2QW8A 4J1SA 4P38A 2HRBA 3VH2A 1N9GA 2FSSA 1NPDA 1A7KA 1HDZA 4W6ZA 4PLFA 2VT3A 1G0OA 1UP7A 4WLUA 1LSUA 1M2WA 3WJAA 4OKNA 1QP8A 5DCUA 4I8XA 3H5AA 3RJ9A 5JDIA 3LQFA 1SB9A 1DAOA 2PKRA 4BNYA 1TVEA 4GX0A 1F12A 4OYRA 4I5FA 1WDLA 4XYMA 2QYTA 5KKAA 4PLGA 3UF0A 3ADPA 3PHIA 2A9FA 5A3VA 1DIBA 3F1LA 4RVHA 4GAEA 4E2WA 2BHLA 1CQJA 4ILKA 1B3RA 3JQGB 5IDQA 3L6EA 4BO8A 2BFMA 1B16A 3U09A 3NT2A 1H9AA 5IZCC 1W0CA 2AXQA 2P9EA 3S2FA 3V1UA 3JQAB 5FF9A 5I9NA 3DAPA 4E32A 3H3JA 2XAAA 3LU1A 3L4SO 3CMCO 5G0WA 3TFOA 2FP4A 3OIGA 3DXFA 3ZHXA 1N8KA 5BNIA 3JQ9A 4J4HA 5EINA 1DIAA 4XDYA 5A5FA 4GH5A 1ZXBA 2CUKA 1EFLA 3PI7A 4BQPA 1ADGA 1LRJA 2EG9A 2VN8A 5FI5A 1GQYA 3ZWPA 4NNJA 5B37A 1PS8A 1MFPA 4YT5A 3WFIA 3RUCA 3GDOA 1YBAA 1ID1A 1LLCA 2HAEA 4WUVA 3RWBA 2EP7A 5B4TA 3IS3A 2UYYA 3HJAA 1PSDA 4M55A 4PN3A 1BSVA 1LU9A 2D8AA 3ROQA 5A02A 5JCXA 4UVDA 1A9YA 2J3IA 2FZEA 3GNSA 1I2ZA 3RFXA 3DZJA 3RU9A 1DO8A 4AG3A 2D5CA 4UUMA 3TZCA 4YQYA 2O23A 3PEFA 4WCFC 3G0OA 2BH9A 2I5PO 3GK3A 4GX5A 3AOGA 3GA0A 4YEDA 2OGUA 5KVQA 3MWDB 1HE2A 1ISIA 4BNLA 1X7HA 5EMHA 1U3WA 4AJ2A 2PY6A 1E7SA 2NTVA 3ICCA 4GVLA 4OM8A 3DO5A 2WYWA 3BMNB 3GRPA 2ZB8A 3INTA 3JQGA 4RPKA 3TWOA 4A0SA 1VJTA 1NASA 4K9DA 1WMBA 5TJHA 3W8FA 2E49A 1H5QA 3JQ7B 2NU6A 2GF2A 4BNWA 4WOKA 4YJFB 1QR6A 3ZV5A 4PG8A 4E30A 2Y0CA 2OO5A 1SOWA 1DC3A 1RWBA 4DGSA 1BRMA 2O48X 1I0ZA 1ENOA 2C7GA 2O2YA 2WM3A 3OP4A 1D7OA 4BGVA 1BXZA 3RIHA 3L9XA 3V2UA 4XJSA 4Z3KA 6ADHA 3DZIA 3WBFA 2HDHA 1PQUA 2X0RA 3H5RA 3AU8A 2GSDA 1CJCA 3I6IA 2O4UX 4J1TA 3AY6A 2W90A 1GZ4A 4DQUA 4XKJA 2QIOA 3RC9A 4PLHA 2V6GA 4Z0PA 4J4TA 1NM5A 1LA2A 3GVIA 5KJEA 3TRIA 4BB6A 2R2GA 1ZIDA 4IDAA 3HFGA 4BNJA 4H7PA 4FGSA 2DQ4A 4JJIA 1NVMB 5A06A 1LDBA 4XRGA 4MP6A 3QWAA 3LT4A 1DDOA 2E37A 4FGWA 3ETDA 1E7QA 4M8SA 3BXXA 1DJQA 3VC7A 1PJSA 3RVDA 3QV1A 2OMEA 4MVJD 5ER9A 1G1AA 2Z95A 5DBGA 1O5IA 3OECA 1P1JA 3B1FA 2GERA 5CEFA 1VJ1A 2PKQO 2GRAA 1S6YA 2DTDA 1N1GA 2JCVA 3HDYA 3OIDA 4HFRA 4NQZA 4XGIA 4L4SA 4PZEA 3UN1A 4EUEA 5JAIA 5EL0A 3RUEA 4CLEA 5DCWA 1XWFA 2VOEA 5JYEA 4U5QA 5LDHA 4WLFA 1DLIA 4ZN6A 1E3WB 3C3XA 2EKPA 4ZQFA 1DRVA 1HE4A 3DC2A 4CLRA 4IJKA 1DAPA 4ZQGA 3IP3A 4WKGA 1I33A 2VHXA 3K8ZA 3VTZA 4Z9XA 1MB4A 1DC4A 3BMNA 4Q3DA 1DXYA 2BELA 5TC4A 4EZBA 3FNGA 1KVUA 4BKPA 1J4AA 1JLLA 3ABIA 3GDFA 1EVIA 3WG9A 4NK5A 5F1OA 2O3SA 1JWBB 4TROA 1AHHA 4B7XA 3Q11A 5EERA 1T2DA 4MVJH 5LC1A 4BKRA 3EGOA 2B0JA 2UDPA 2VYND 1ONPA 1ISGA 1XQ6A 3UOGA 3JQ8B 2Y1EA 4BO0A 3L6DA 3I5MA 1YQGA 3ZWNA 1IYZA 3GEGA 2CY0A 4XCVA 2OZPA 3LT0A 3GVCA 2AQIA 1ULSA 2IXBA 3FWNA 4O1MA 1BXGA 1A7AA 4AJKA 2JFHA 4HBGA 5IN4A 1J49A 4GLLA 3OJEA 3INRA 2QYSA 2YJZA 5B4VA 4IIVA 3KUXA 1ADFA 4N5MA 4NBVA 1GYRA 4CV2A 5T5QA 4YJDA 2JL1A 2NVBA 1JQBA 1PJQA 1VM6A 2DPHA 2G76A 4XQGA 4AJ1A 1T24A 1VL0A 2SCUA 2E6UX 1DFIA 2Q49A 5I8ZA 4WCFB 2D2IA 3WQSB 1P44A 2JKVA 4B8ZA 4QXMA 2VZ9A 4J6FA 4RORA 1DOHA 1Y9AA 3KB6A 3WBBA 5F21A 2R00A 2DAPA 4OKIA 1T1RA 4BNHA 1ZK3A 4CMIA 2ZIZA 3E82A 3VZQA 2PH5A 1A71A 2VRCA 4OL9A 1ADCA 2ZTVA 4JP3A 2EWMA 5G2OA 3VH1A 1H94A 5JW6A 1NQAO 5U4QA 3LSYA 1ZMTA 3CE6A 4PLPA 3TZ6A 4I9NA 3W1VA 1Z74A 4RCVA 2PNFA 3GR6A 4IGEA 1NFFA 3A1NA 1GR0A 3DMTA 5A9SB 1UXIA 3RBVA 4EUFA 1M67A 4EW6A 1E3LA 2PD3A 2AHRA 1AGNA 5TT0A 1GY8A 4RPLA 4QFCA 2VNSA 4ZD6A 2DLDA 4DLAA 3Q0EA 1UR5A 3PZBA 4NHEA 1C14A 1PQPA 1RYEA 1O94A 1YKFA 2C5AA 3QSGA 4FJ2A 1U4OA 5THKA 3FR8A 5DP2A 1B8VA 4LSWA 4E33A 1QLHA 3DQPA 3GUYA 1CETA 1YL6A 5JO0A 3TZQA 2Y1OA 2BI7A 4BMVA 4I5DA 5A3JA 2FPIA 4B3HA 1B7GO 3BMCB 1F14A 4C7KA 4WGGA 1P31A 1UP4A 3NRCA 3NV9A 4ZGWA 1CQIA 2X23A 1U28A 4DIOA 1T2FA 4FFLA 4B7CA 1I2CA 4PGFA 1N1EA 1P1FA 2NACA 4PG4A 4DQVA 4IDGA 2WYUA 3KEOA 4K6FA 1G0NA 4Q39A 1ZUD1 1DIRA 4G65A 1HYHA 4NBRA 1P1RA 4XX0A 5COQA 2J5QA 1MP0A 2CNBA 2VWGA 4IBOA 2WD8A 4PFJA 4R1SA 5MDHA 5F5NA 1I5RA 5DBFA 4MIYA 1K2WA 2O3QA 2YZ7A 3G49A 5AXCA 4WASA 3B70A 3SX2A 1G6KA 2JAHA 2ZTLA 3HZZA 1V35A 3IC5A 2PR2A 5JAMA 5BSHA 2FWMX 3HHPA 3WGOA 1OC2A 4L9RA 4YAEA 1UDCA 2PFGA 1LSOA 3D3WA 3NDRA 1FK8A 4WEOA 3F47A 2B83A 1ISMA 1Q1NA 1WVGA 1X15A 3VPHA 4B4OA 4DMMA 4BNFA 1YB4A 2VTDA 3AUSA 5DOVA 4HXYA 2DKNA 3D64A 2AG5A 2D59A 5HTOA 1C1DB 1DB3A 4MPDA 4I1IA 1GADO 2IYOA 2VZ0A 5ES3A 4OMUA 1M6WA 2I6TA 5TX7A 3MWEB 4FFOA 2H9IA 2ZYAA 3EY4A 3PWKA 3OICA 4E5YA 1QSGA 1C0IA 3OQ1A 3OJLA 4IS2A 1WWKA 1MXHA 1PL6A 3FSRA 2OORA 5TJ9A 3OJFA 1U2GA 3OQ6A 1B26A 4WJZA 2V6FA 1LQUA 3H4VA 1NWCA 3I9JA 4PLCA 2FHSA 1U3UA 2AMFA 3K9QO 2BLLA 5G0UA 1XA0A 3GEDA 5T8KA 1T2CA 1MX3A 1JVSA 1R4NA 5CHEA 1C0PA 1QRRA 4H15A 3B20A 2NU7A 4D0SA 1I10A 1ISJA 4QT0A 1XEAA 4P4LA 4L76A 4UREA 5JAQA 4YYZA 2X8LA 2XXJA 3F6YA 4ND1A 4FQ8A 5HS4A 4AL4A 4RF2A 1WNTA 1NBOA 3AM4A 1JU9A 4JGBA 1NQOA 4NG5A 4R3WA 4A2CA 4IDCA 3IUSA 5JXWA 3TNLA 4Z6KA 5HBRA 3E5MA 4ZRNA 3I1JA 3R3JA 1EUCA 1BGVA 1MA0A 2AE2A 3S2EA 1KVSA 4RLHA 1SEPA 1XGKA 4FBGA 2Q1SA 2JD2A 2RH4A 4WLNA 2GGSA 2O50A 3W8DA 2FR8A 3MTGA 1E6WA 4ZQEA 1MC5A 5CPBA 3EHEA 1LNQA 4FW8A 5L7TA 3KSZO 3QWFA 2FR0A 3IAHA 4E21A 3IOYA 5LCXA 3ONFA 4B3JA 1HDXA 5JDIC 3GZ4A 1C1DA 1ADBA 1R0LA 2NWQA 2X5KO 1BXKA 1L7DA 1MFZA 5CFZA 2DPGA 4F6LA 3RKRA 3CPSA 4Y8VA 3NTOA 3KV3O 3UKOA 5H83A 1YGYA 5ITWA 4CLHA 1TA4A 3DOCA 4BNZA 3AOEA 3DTYA 1HDYA 3WWYA 2YFQA 1EBUA 2A4KA 3EZLA 2HU2A 1GQ2A 2DT5A 1JTVA 2Y05A 2OBYA 3FPLA 4O6VA 3K73O 4R69A 2W98A 1C0LA 3ZGYA 2VWHA 3H9QA 1LJ8A 1YH3A 4WPGA 3D3EA 1YDEA 4I9HA 3UXYA 3I4FA 1U4SA 5LDGA 4NJMA 4YQZA 3BTUA 3WMWA 2EKLA 1O6ZA 3VKVA 3JD2A 3RASA 4OQYA 1WPQA 4R16A 1PQWA 5BT9A 3JQEA 2X0NA 1BVUA 2B4QA 2WJPA 4MVJF 1PWXA 4J7XA 3SJ7A 5C3MA 2WSBA 1OBFO 3TN7A 4DIFA 2PZJA 5IDXA 2GLXA 1I30A 3V2GA 2TMDA 2Q45A 4AJIA 3VVCA 4DQXA 4FDAA 3AI1A 2NV6A 3M1LA 5A9RA 3WGGA 4LMPA 4AICA 2JFGA 1ZXLA 3PWSA 4PLVA 3FNEA 1ZNQO 5JAZA 1ZFNA 1PIWA 2ZTUA 3GNQA 4YACA 3E6AA 1FDSA 3ZI0A 3OFSA 1E3EA 3WICA 3FF4A 5EJ2A 2NLOA 3ENNA 3KEQA 3RC1A 3H5NA 2C59A 2ZQYA 3D5TA 3OMLA 3AUUA 5L7YA 3WTBA 1IPEA 1YQXA 2P68A 5G0VA 4TKLA 1EVYA 3E9MA 4GSKA 3JYLA 3IKVA 2ZJ1A 5G4KA 2NNLD 2VYVD 2C2YA 2OUIA 4IPTA 2PLAA 4WOJA 1EK6A 4ND3A 3WIDA 1U7TA 4YRDA 3SC4A 2W4QA 2C0CA 3B6ZA 3D7LA 1OAAA 3RC7A 5CDYA 1B8PA 3ZWBA 4E0BA 1P0FA 1KETA 3PJFA 3HE3A 3H9GA 4D43A 2WYVA 2DFVA 4CUKA 5FFFA 4IXWA 3V5NA 4GGPA 4YJHA 3JYOA 3QE3A 3ROMA 3CSDA 3D4OA 4J7UA 4D42A 1MUUA 1XIVA 1FDWA 4YCAA 3EYWA 4CV3A 3RUDA 1ML3A 4JXKA 4GI2A 4IM7A 2X6TA 1PL8A 1EQUA 3QVTA 3PGXA 1DC6A 3ZNNA 2X7HA 3JCZA 4U6SA 1LXCA 4E3ZA 2PKQP 3SLKA 5K9ZA 3QJ5A 2DBZA 3DHNA 4CUJA 1PR9A 2EIHA 1ZSYA 2QRLA 3WGQA 4ZHSA 1HRDA 4FIZA 3LC2O 4XYBA 2HJRA 1PJCA 3QLJA 2EERA 3GT0A 1R4MB 2DM6A 3V1YA 1YVEI 2O2SA 3CEAA 4CQLA 5IG2A 2CVZA 4J16A 2WDZA 4OH1A 4O5OA 5ENVA 4YT2A 2B5VA 3DBRA 4RO0A 1VKNA 2EV9A 5A4DA 3BMQA 2AW5A 2FZWA 3HDQA 2J5KA 3GVXA 4DC1A 1DHRA 4WCDA 3JQFC 3GMSA 4FCCA 2EJWA 1EVZA 3GQVA 5J23A 3I9LA 1VJ0A 4E2XA 1PJBA 3DZFA 3ZW9A 1QXSA 4MINA 3RJ5A 1GUYA 3PJGA 5BNFA 2Z1MA 2WEKA 3C85A 2HMTA 3PQDA 2EGGA 4KQXA 1OZAA 1KEPA 5L53A 1D1TA 4LCJA 5KVSA 5TLSA 1V9LA 3WSWA 4GKBA 2WD7B 1T4DA 1RJWA 2PTGA 3DBLA 3RU7A 5FEUA 1GYQA 4WE3A 1NR7A 5G0TA 4A10A 2J3KA 4IINA 2EJVA 4QUKA 1HTBA 1ZK0A 4Q3EA 4DMLA 4J1NA 3NTRA 3JQDA 1T2EA 2I3GA 1EK5A 1CRWG 2HLPA 1HL3A 4XEHA 1IULA 3DFZA 4GLOA 5T67A 5CEJA 5ILOA 2I67A 4NU5A 3C7AA 3P5SA 1F06A 1LRKA 4CQMD 4EJ6A 4FJ1A 4RV9A 2RHRA 4HFJA 4AJ4A 1ZO8A 3OF2A 4W9NA 3ZZNA 1R16A 4CM4B 3F5SA 5ICSA 1LLQA 5KTKA 1E3JA 3C1AA 4CMGA 4CM3A 2C5EA 3ZDFA 3VPXA 3VH4A 2PA3A 5THQA 3KLPX 4D3SA 2HMUA 1R4MA 3PHJA 3ZV6A 1NPTO 4R4JA 4ND4A 3RSHA 2EEZA 3IKTA 1XQ1A 3WNVA 4BUCA 1BTOA 1QYDA 4XIYA 2FR1A 1NHWA 7MDHA 3TSCA 3TL2A 3H7AA 5JDCC 3QWIA 3CUKA 2BMAA 3RUFA 5A04A 3WWZA 4EITA 4U8GA 4R54A 3OA2A 3FNHA 4FB5A 5L4NA 1ZH8A 2AQKA 3EVNA 4MVJP 5A9TA 1H2BA 1YE3A 2PD6A 2AEFA 4QECA 1A4UA 1E7WA 1GL3A 1P0CA 2UAGA 4TZTA 5L40A 3DBHB 4NMHA 3S2GA 1E92A 3JQBA 4AJOA 1GZ6A 2X9NA 4CL3A 4FS3A 3GN2A 4OXKA 3M2PA 5FYDA 3ZN2A 4DYVA 4BNXA 4LVCA 1C3VA 5DULA 1V3VA 1PS0A 2XXBA 4IQGA 1Y5RA 4J2HA 5TT1A 1XKQA 4RPJA 1EMDA 1EBFA 1WMAA 5ITVA 2Y1CA 3L4BC 2EXXA 2Q50A 2Y68A 4GL4A 4RQTA 5CDGA 3M1AA 3CINA 3ZH2A 4JQCA 3T7EA 5TIIA 4NPCA 3PFFA 4RLSA 5C37A 2IZ0A 3F3SA 7ADHA 2Y0EA 3IJPA 4WNIA 1DFHA 1PGJA 2Q4EA 3CXRA 3GPIA 3LLVA 4UUNA 1L1FA 4YJGB 5JCJA 4MVJM 3H9JA 3ZWAA 3V8BA 4RF3A 2Q1TA 1HYGA 3I9OA 3DFUA 5TNXA 3GLQA 3VDRA 1N2SA 2BD0A 5L45A 1I01A 1GCUA 3AJRA 3FBTA 1U9JA 2RCYA 1MC4A 4N54A 5TGDA 4CR8A 3W6ZA 5L4SA 3TOXA 5EN4A 4CM1A 4BNVA 2FOIA 1V6AA 2Q1UA 1E1KA 4YB8A 4GSLA 1RM5A 3VHRA 1BDBA 3R6DA 3JQAA 3K5PA 4J7CA 3GH3A 4WLOA 2CVOA 1M75A 1YQDA 1Z7EA 1WZEA 4XR9A 1PJ4A 4LW8A 1GV1A 3JTMA 4B4UA 1ZJZA 2OL4A 1LEHA 4YAKA 5JBIA 4DRYA 4O0LA 4BL5A 2C7VA 3W4IA 3DMYA 1HZZA 4FD3A 4OQZA 5IJZA 5BQFA 3ZU3A 3NDJA 1KIFA 1RM3A 1JAYA 4GMGA 2O7QA 1F8FA 1ISFA 2P5YA 4RF4A 2X86A 3G1UA 1YXMA 2ZB3A 5L7WA 4GGOA 4Z0HO 4J49A 3KTDA 4MIEA 3GGGA 5KCZA 1Y8RB 2QX7A 4A27A 1EE9A 4YXFA 3HB5X 4N5LA 4X54A 5K6AC 3KYDB 3OEWA 3Q1LA 5FI3A 1W6UA 2RAFA 4FFNA 1WDKA 1ZSNA 4UVIA 5KNLA 2DU8A 4ALJA 3L07A 4AJPA 2PGLA 4JBIA 3M6IA 4RL6A 4XGNA 3ON5A 1NVGA 1HLPA 2AEMA 2B69A 2GZ1A 2BGKA 2ZB7A 3GMDA 4MKZA 4Z3DA 3UVEA 3ZHBA 2DVMA 1YJ8A 4ND5A 4I5EA 2Q3EA 3OJOA 3E18A 4J9UE 3QVOA
chains in the Genus database with same CATH superfamily
4B6SA 3C15C 1G3MA 4ZC8A 2J9ZB 3OE4A 1Q2UA 2JIDA 3T4EA 1GPDG 1V8FA 2BRUA 2R8PA 2A67A 2H29A 2PKCA 4POAA 4PCUA 1LDGA 1JU4A 1Z2EA 5HXAA 3TK1A 4G01B 4KPEC 3JQ7A 1WM1A 3EHDA 3KTOA 3H9EO 3VTAA 1ULZA 2D0PB 3L1HA 4IDDA 2DG2A 1K5DA 2F1IA 2XTMA 4N6NA 4EYKA 1VHJA 4RIEA 1U3TA 5BSMA 2M6LA 5LQDA 1HF3A 3S27A 2I2XB 3ZKAA 5M7EA 3IIIA 3MUFA 4WZAE 1FSSA 5AHWA 1SUPA 4BV9A 4F04A 5JMWA 2C4UA 3VSAA 1FDRA 3BWXA 4HGOA 4OA5A 1FRZA 4A7PA 4BVHA 1OZ0A 3Q2OA 1ODTC 3T0FA 4BUZA 3MAGA 2Q2QA 3K9HA 1DC8A 5H16A 3GZTB 2Z2ZA 3VC3A 2PA0A 1D04A 4HNGA 3ZWMA 3IB6A 3RC8A 3BBPA 2FFRA 4RU1A 1DRJA 1YTUA 1ORTA 1P75A 3LZ6A 5H3CA 5I4IA 3OSUA 2BZSA 3RGGA 4ENPA 1S02A 1K5GA 3LA8A 3QF4A 5SZKB 4G5RA 2CLOB 3UB4A 4E11A 2BE7A 2ICAA 2P2CA 1E64A 1Y42X 2ZQZA 3A4VA 3FYUC 3N2GB 3STVA 5IJ0B 2C7QA 2P0AA 2BFFA 2OM2A 4K6GA 3CIFA 3B1YA 4IDPA 1H2RS 2UVQA 1PX2A 2B92A 1E0JA 2FMXA 3ST7A 1XD8A 5IF3A 1D6NA 3NHFA 1R9JA 1Y5NA 3I01A 3PSAA 3S68A 4IWNA 3UH1A 4X64B 2JA2A 3ZK8A 4FLMA 1QIEA 3CH6A 3I2JA 3C6XA 5EP2A 5C4MA 1XU9A 3NKLA 1QGZA 3E4CA 1JKJA 2SNIE 2VJQA 1CRLA 2V58A 3AI7A 3DKVA 4L0MA 5BMVF 2X3FA 1ZMBA 1H4SA 1DAEA 2BM0A 3I76A 1LPNA 3GLRA 3I92A 3IIEA 4GZ6A 1PDWA 3BCHA 4EO9A 3EDQA 1D1PA 1MO5A 2CBGA 2IOFA 4JLKA 1SC6A 4U7WA 5AKGA 3TPZA 3AHCA 1WE2A 4DEVA 3UANA 1G64A 3WIBA 4OTZA 2BGMA 1UMBB 2JCGA 4R0VA 4DNPA 3BHIA 3KSBC 3L3BA 4FHZA 4WEQA 4IKPA 2J30A 5DM70 2Z5LA 4R1TA 4URUR 4ALLA 1E9FA 4BLOA 3FPBA 3PFWO 3AESB 1GRQA 2X9GA 2R48A 4L78A 4BQQA 4EHJA 5IVPA 1AG9A 1TAQA 5FFMA 2F00A 3WL6A 1T9GR 2PX2A 1Z82A 5DFAA 4BCBA 1U3DA 5CPFA 2IS4A 1SXQA 1ID8A 1P19A 2AWOA 1JJ7A 4LHXA 1XVIA 2Y4OA 4ATNA 1SD5A 4KWIA 3TOVA 2P5TB 4KDEA 5E2IA 1T5SA 1GG2A 5KYKA 4NBNA 1ONBA 4JSYA 4OSPA 2IF2A 4N3AA 1CNMA 4OD0A 1OTYA 3VKFA 2C2XA 1IG0A 2ZSAA 4ZQBA 1PJ3A 4MV4A 1FSPA 4L4XA 2V4ZA 2XZPA 4IX1A 5EMKA 5TPZD 2A14A 2VF2A 3X44A 2X3UA 3ZW8A 1TFRA 5GZ1A 2JJ8A 3TRHA 3COPA 1R5NA 1G3IA 3WYAA 4AP9A 1EXVA 1FDVA 2EYQA 3KQHA 5ITZB 1P5JA 2QR5A 3B6JA 1UBSB 3L7NA 5LYJF 2X58A 4BCDA 2L42A 5IJ0A 5IM4F 5DBHX 4UBKA 1ECCA 4YAFA 1ZKMA 2QX6A 2XSZA 3OQIB 5JVDB 4ALKA 4P5PA 4IDUA 4RQAA 1X92A 1Z8FA 3TNJA 4DWOA 1E5LA 1ODKA 1VC2A 1TI7A 3DWFA 5IAOA 2C7RA 1U0JA 5FLEX 1XN4A 5I7AA 1N36B 1PGPA 1XZNA 3SJ7A 1AQJA 4IL5A 1RR6A 1ZZEA 5FWYA 1OFHA 3TSYA 4ZYWA 2FPGB 2NYVA 3TOSA 3G5TA 4ZICA 4JQOA 3GZNB 1L5KA 2XTNA 2RHDA 1DSSG 4Q1VA 2YFHA 3IJEB 1KI1A 1CUIA 2P40A 4ACAA 5BR4A 1IY9A 3I5XA 2OENG 1EX7A 1KPGA 3GFPA 1EFVA 1ZPDA 5BSFA 4WCFA 4YT4A 3A14A 1L5LA 3KYBA 3SX0A 3MEQA 2WP8J 4FFVA 3OSZA 1ZCFA 4AN0A 1UINA 1T2VA 1YFZA 4N7MA 2CXTA 1CYDA 4LJ8A 5D3MB 4UAVA 4A0HA 5HF9A 3K1AB 5TQ2B 5H4GA 1C0EA 3ADOA 1M0SA 1TECE 4IDBA 3AFOA 3BMOB 1M6VB 4IV5A 4YCBA 2GBCA 5YASA 1L1RA 5DGDA 1YL5A 5C1BA 2IHJA 1G5FA 2AMVA 5FWAA 2W0MA 2V54A 3LVQE 4UEKA 5DM60 3RRNA 1ETUA 2CYBA 5F73A 4G5QA 1NG1A 1M2OB 2JANA 4MR7A 3MGKA 1EB8A 3QJGA 5KNBH 3PIDA 2FPMA 3IQHX 4QIHA 2NUBA 2OG1A 2Z4SA 2F90A 1X1SA 2IPOA 3AZPA 5CJPA 1K98A 1QH1A 1WMDA 4Y30A 3D6HA 1DTWA 1YQWA 3VOTA 2YIDA 2PMBA 4PYRA 4TYWA 3R7FA 2NADA 3OJ0A 1Y3AA 3L7YA 2IWRA 3W5CA 3LWNA 5ULLA 5B1YA 5G0SA 3TOCA 1SNYA 1PS9A 3I6QA 4G0WA 1NV9A 1U3FA 4DDUA 3C4QA 3RR2A 2HKIA 2IU4A 3P2JA 4TVKA 2JHGA 4F86A 2LZ0A 5LMZA 1M66A 3FYCA 3K5WA 3MS2A 1QVWA 1PX0A 2B37A 2GZRA 1PEDA 2GHRA 2FSIA 4HR7A 1TO2E 3W4KA 1PGNA 4ES6A 3VMFA 2V6IA 1D6MA 1DKUA 3IEMA 2UUCB 4V1CI 2DFLA 1FS6A 1JHXA 1NNSA 3BMCA 1OT5A 1RYDA 2YV3A 2FPGA 4ZREA 3T5GA 4W5JA 2R5WA 1YBVA 4GZ5A 3S99A 3ZHCA 3GZNA 1QAQA 4CEIB 2GF9A 4BMDA 2I34A 5U9CA 5LMUB 2CV0A 4UQOA 4E12A 4JNKA 1WB4A 3DE5X 5BWBA 1A4RA 2V45A 2YWEA 2Y93A 3PFKA 4X8OA 3QW4B 1I1NA 2WVGA 4JA2A 3I8OA 1CUEA 2QRQA 3BA1A 3PDJA 4WH0A 2BEWA 1CIVA 2FSUA 3ND6A 4ML3A 3TZLA 3HM9A 1KU0A 3LUHA 4IHQA 5AJHA 4X7PA 2I2CA 1VI2A 5EJMA 3WZ2A 2GPWA 4XPZA 1IFXA 1YS4A 3QENA 2G80A 5B58C 4UHJA 1AO3A 2VHQA 3RSGA 2CVHA 6ADHA 1EGMB 3FX2A 1IEQA 2OAEA 2WK1A 3UUEA 1Q20A 1ZM9A 2J41A 5IFLA 2DTEA 3OI7A 3TZKA 5BXQC 5I8WA 3F4BA 1OLSB 3ONWA 3KUKA 1FDIA 4X6XA 4Y6SA 1BW9B 3DBVO 4GM1A 1XTSA 3SBXA 2CJWB 5JCOA 3KP1A 4YK7A 2F6RA 3O7WA 4DLKA 5WRFA 3WLMA 1RJFA 4XXHA 1XCLA 3T1OA 5CH8A 3L6BA 3SKYA 3KBOA 4BX3A 1XZFA 1VHTA 2PIDA 1HRKA 3ZHYA 1KMQA 1UMKA 3W7VA 1YU6A 3HVRA 4IQFA 4UTVA 5CM2Z 2C57A 3H3FA 3W5AA 4GR5A 2B8TA 1GKKA 2C82A 4I1RA 4PHCA 1J9GA 3C3YA 1N75A 1VCOA 2Q5FA 3ETHA 5J4HA 1VXOA 2BP7B 2VCYA 3PQ7A 4PZCA 3GROA 2YTZA 3MWEA 1LWNA 1GUBA 3FCSB 3OFJA 4QBGB 3MCUA 3G23A 1B8UA 3Q2IA 4HGYA 4LK3A 5D2CA 3H1AA 2QAGB 1I4EB 3CLVA 5BSEA 1UC9A 4ENTA 4URWR 1UBNA 4S1VA 3ZVRA 1ZAKA 2M98A 4G6ZA 4WINA 5EWMB 4XW2A 3NQ41 3QKWA 4I6JA 2PL9A 4QUAA 5DLEA 4E51A 3UAGA 1TXGA 3SXPA 4IIFA 1QK3A 2FUEA 3R76A 1PCXA 2IUFA 2FMHA 2O0KA 3HYTA 4JFAA 1AU9A 3KO8A 3OD5A 5COBA 4DSZA 1RHJA 2QM0A 4RMIA 4RM2A 4BUJA 1LLFA 4D9NA 5BN5B 3N0TA 4M54A 3P0RA 4HWTA 4IFIA 4ASUD 3V3KA 3ETLA 4XGKA 3HWRA 4TRMA 4I5GA 4YLGA 4BMCA 2I9KA 1TCAA 3WISA 3ZD7A 4K46A 4P58A 3KOZA 5ECGC 4TT3A 3DJYA 4IH4A 2LWIA 1E5XA 2IK8A 2ECOA 2Z30A 4IJUA 2F1HA 4UAGA 1YS7A 5C1DA 1F20A 1LDNA 1VJDA 2Q2VA 2XKKA 1FLAA 5L3QB 2PT5A 4YGYA 4KO8A 5CIYA 2HWYA 3V8RA 2ZZNA 4V02A 5EJGA 1RBMA 3ILVA 3TL6A 3Q40A 3W1WA 4XZ3A 5GZ3A 5KVAA 1WDMA 2QL6A 2IC5A 2MR6A 2I2DA 1YZHA 3KYIB 2X0FA 1W0KA 2JGNA 4DS3A 3KZKA 3ZHOA 1RWMA 4X97A 2PZGA 1L3CA 2ACWA 3PP8A 4E3WA 2ZIXB 2AK2A 2EJTA 2C42A 3EBLA 4WOBA 5J4KA 2UZ0A 5CDFA 4A26A 5EJ5A 3U5ZB 3CRW1 1PZEA 4KQCA 1KI6B 4MIOA 4ZOAA 1S5PA 4EDHA 3G2JA 5BN3A 2NZJA 3D8SA 4ZO6A 1JKIA 2VNHA 4TMYA 4UE2A 4CU5A 2ZAMA 5G40A 2QTNA 1NYTA 3IOEA 4IIJB 1ZR4A 4AUNA 3U7QB 1P60A 3G2LA 1BH6A 3UGTA 2Q5HA 3CUVA 5BUZA 1WP9A 4XM1A 5EYPB 2BR5A 4QHSA 1UM9A 3BYZA 1ORWA 221PA 5D3QA 3UAYA 1L7VC 3C24A 1YIDA 4OQQA 1RBQA 3K9LA 1C7RA 4HQRA 4QVKA 4U7JA 4UARA 5HRAA 3EPHA 2YS7A 1UUFA 2IYTA 2QPOA 4N3CA 2GKOA 3MT0A 1ND5A 2C2OA 1YQQA 3NOQA 4FEAA 4GUDA 3ZV7A 2AE1A 2AYXA 4XVHA 5ICEA 1MDBA 3QYFA 2XNJA 4JH0A 4WY5A 1C3OB 1GRCA 2OO5C 2REQB 3OIVA 1JA9A 1HDGO 3DZKA 1NVFA 3CNHA 4G8BA 4PQEA 1JIXA 3IALA 4CMKA 2ZT8A 1I9GA 2XTJA 3M33A 3NUQA 4GP7A 3QVXA 1SCUB 1CR2A 1OQAA 4YRSA 3RVMA 2X0KA 4HEA6 3C74A 2JVJA 4IYRA 4OGLA 1TJ3A 1A9ZA 1QANA 3S8MA 4PRLA 1S2NA 1NI3A 2C0PA 2I7CA 3QLTA 1BA3A 2QHXA 4BX2A 4LZNA 4MKGA 3PFGA 4MQUA 1KC3A 1OX5A 4FR5A 2CDBA 2FLWA 4IIDA 3TTTA 3WADA 2WWRA 3S7TA 2Q5IA 4KVZA 5LFAA 4JJFA 3EGEA 3LYUA 2O8NA 2JGJA 2VQSA 1TF2A 3EEIA 3HLKA 4IW3B 4HGNA 4NZPA 4G5XA 4B9EA 2IY8A 5SYNA 2IL1A 2W00A 5EVCA 2HO4A 1VLQA 4JT4A 4DRXA 1J33A 3NDIA 2QD5A 2H1HA 2OK7A 5A6VA 2PJUA 4Q9JA 1Z0SA 3GUHA 5LD2C 1TADA 4DDWA 3FJOA 3FLMA 2JD1A 3BAZA 3OVMA 3TLBA 2FJUA 2GXSA 3D8TA 5LZ7A 3TLAA 4C4XA 4NJEA 5CVTA 3K9NA 3RCBA 3VAYA 1J5PA 2YHAA 3CLRD 2RBGA 3BXHA 3NAQA 3BTVA 3V8QA 3IILA 5DNUA 4YWJA 1GKYA 3T52A 1EXMA 1G8AA 2XWPA 2GDZA 1QFYA 2C5LA 2NVOA 4LOJA 4CMEA 3LT1A 1V7QA 1WW2A 4DNFA 1Q1BA 1UWLA 2QP9X 1KDPA 3KX2A 2LKCA 3AC0A 1X7GA 3QEOA 3ABZA 2ZG6A 2ABWA 3MM4A 4L85A 5FEMA 2YQ4A 4IVRA 4PZDA 5EYPA 2IRWA 2A5JA 2FDCA 4R51A 2XUQA 1TMYA 2KBFA 2DQKA 3G79A 3A2LA 5DT2A 5EIOA 5JS6A 4HUJA 4B45A 3VKWA 4TTIA 1E9DA 3MIZA 1C41A 4JXJA 2GXUA 4YMGA 2FY8A 5CG2A 4RK5A 1T9CA 2PZ8A 4FFSA 3K30A 2WJYA 2WUFA 2J0QA 1T8SA 3HO1A 1KJWA 2RONA 5GAJA 4P4NA 3EGWA 4KN6A 4QPPA 1P7CA 3CLHA 2R7MA 4OJKA 3R4VA 2B4AA 3HKDA 2BEUB 3MIIA 4MWEA 2R96A 1LC0A 2CDAA 4ARIA 4CNQA 4JI2B 3GLGB 4GKVA 2ZWOA 4OI2A 1G5IA 2PH3A 1ORVA 1NFRA 1NL3A 1RIIA 2R7LA 2QI9C 4JODA 4WZZA 3SZUA 1ZOSA 4OBWA 6YASA 3SQXA 3KLOA 1DO0A 3ASUA 2DKOA 2C9DA 3NW9A 3QA3E 2Y1DA 4L3VA 4RJIA 2PUHA 3S0JA 5B2FA 4Z4EA 5B64A 1XTUA 1ZWKA 2CB9A 4MRVA 1WDTA 1ZDMA 2GT1A 3F9IA 4FD2A 3FUVA 3DDCA 4MWOA 4NH4A 3T61A 3KJGA 4EVQA 2W6OA 1OH8A 4OQPA 4M49A 4QU0A 4MB2A 2XUJA 1M8JA 4RQBA 3Q0TA 2Q6OA 1X0VA 1F51E 1JE0A 5A1JA 2VH2A 1SG6A 1ZAYA 1VJGA 4UUAA 1IBMB 3WP0A 1XMXA 4LXTA 2NXEA 5K3SA 3TB4A 3WXBA 2AJTA 2G3YA 4GWGA 3I05A 2A8YA 3HRKA 4JQZA 5FL7A 4S05A 1ILEA 2ZULA 3D5QA 3HP4A 5EKTA 1PKXA 1U90A 1SD1A 2I76A 1AT1A 1LDEA 1MNQA 2ZITA 5H4HA 1B0UA 1DBVO 4UBLA 4XFDA 1OC4A 2NU8A 3ZDDA 4JI7B 1ZUNA 1MAAA 4QBTA 1JR6A 1FP4B 3PHGA 1E0DA 1UBHS 1AA9A 1YZFA 4O4JB 4U2EA 3L8YA 3DMRA 5AM5A 1P80A 1TUEA 3VNRA 4OHKA 3NMUF 3FGOA 2DLNA 2ODAA 1I6WA 4NMMA 2DULA 2Z1DA 2ECQA 4TM8A 3V7FA 3VJKA 3CKYA 4B3IA 2ZK7A 3DMHA 4NDNE 4P84A 1ENYA 2MR5A 3IVCA 3LZCA 1P0PA 2XWBF 4C6SA 2PUAA 1MQAA 1IY0A 2PZAA 3AFGA 4PG7A 4Z5XA 1C1HA 2I7VA 3FMIA 1DDIA 2UVPA 4EKIA 4J0CA 1W4ZA 3R7NA 3UCXA 3WNQA 3ETJA 3RFTA 3VVBA 1T0IA 2Q3BA 4ZCQA 1Z62A 3H04A 2Q4DA 1BHSA 3E2IA 4MKRA 1CYEA 4MW5A 1D1QA 2IFTA 1BH2A 2BEUA 3OOSA 4HDKB 4KIFA 5CT4A 4C4AA 1EUYA 3ZBQA 1X39A 3BIWA 3D0KA 2X76A 3GRYA 3FGPA 3ET4A 3EZGA 1M34B 3GLKA 3JVDA 5EJFA 4F1KA 1RXCA 3H16A 3L40A 3LO5A 1JIIA 5JHGB 1AKYA 5KQSA 3IYLW 3LVBA 4ZALA 3MJVA 4LFAB 3A3OA 3GRCA 4JJ8A 1BJKA 3E3MA 2WV7A 1GXSB 3U56A 4N8SA 2ZBVA 3W77A 4FYIA 2ZJ8A 3ZG6A 2AR7A 3IURA 4ZQCB 3WWEA 5AVTA 3LMKA 1IPHA 1KOGA 1W36B 5F35A 2ZWPA 1IEVA 4U7TB 1QCDA 1H6CA 1TMKA 2AR0A 2J6BA 2E21A 3HPQA 1B15A 5DK6A 2V9CA 1E6UA 4DAOA 3DONA 4RDIA 1EFRA 3H19A 4Z9FA 4Z4CA 4CBVA 4YCJA 3GRUA 5AVJA 1SQ0A 2VTVA 5AUOB 4IFEA 1FLDA 1O8CA 1OU0A 1GL6A 4N65A 2G9NA 5CB4F 1GDHA 2WE8A 1X7DA 3PC8A 4RVCA 2D1SA 4R71A 5JXHA 3TF5A 5EP4A 2Q5OA 3CF4A 1KFKB 1HC7A 2EKQA 2EJBA 2IYAA 3Q7PA 4XD7D 4UUPA 3K2BA 4TXHA 1Q0PA 1K6IA 4IIXA 4CKZA 2N0SA 1FNMA 3BM5A 4L57A 1QP0A 5A5EA 1DKQA 1RAGA 2AC2A 2JCYA 2PJDA 3H97A 1YJQA 4V0KA 1PJTA 1QONA 3BJEA 1OIXA 4HQKA 2PMEA 521PA 1UDRA 3UB2A 3WMXA 4B6RA 5HM6A 1ZNXA 3PUWA 1JGTA 2CXQA 2WF5A 4I1YA 2JIZD 5E1BA 3Q3GE 2J1LA 2C84A 2D1FA 4WQMA 2BHTA 5EXEA 1HSZA 3O4JA 4XEUA 4D57A 4JROA 2P67A 1FNDA 1QFJA 2G5CA 4YJ2B 2QXYA 2VSNA 2Z3WA 5BR1A 2YFYA 3DEAA 3HSKA 3L0YA 3QYPA 3GC6A 4UDYX 4G56A 3RSCA 1JG3A 3UOAB 3W0LB 4HQFA 4EOGA 2JRLA 2UUOA 2FG7C 4BFSA 3ZS9A 2D5BA 4ZVLA 3DEYX 2ZANA 5LOVB 1O6BA 5A3SA 2Y99A 4CEJB 1NF8A 2JHAA 2QD1A 3HV0A 3E9RA 5CCDA 1QU2A 4ER0A 4RJTA 5C7LO 3ANYB 1Y5IA 4BU1A 1U3VA 3HADA 4BBAA 1V0JA 1XU7A 3PQCA 1YC2A 2HXSA 1FNSA 1BU5A 2G09A 1W9HA 2ET6A 4I6GA 4DCPA 3C5WP 4HV4A 3HCEA 4FMCB 1V8BA 3A6EA 1XZJA 1GXSA 4KX5A 1T2NA 3V9PA 3VBEA 4ZJUA 4PO1A 4DQXA 5K4GA 2WMDA 5JC1A 2D0IA 5LLTA 1BXGB 4B2IA 2P9TA 4IY1A 1JG2A 2B5WA 3I23A 3F3KA 2OB1A 4FFMA 1QUEA 4NZOA 2Z58A 4RHTA 5TQJA 3PNPA 2DPMA 3N74A 2P6UA 2XITA 1U2GC 1X1QA 1CS4C 1QHSA 3GFTA 4KTVE 1NLFA 2PUCA 2X8JB 4L1KA 1ONNA 2FX5A 3NT5A 4BZWA 2CT8A 1EFDN 3MYYA 2CF5A 3NEAA 2QN3A 1TZCA 1MTOA 2ZKLA 4HC4A 3QY9A 3FKSA 2PSDA 3KJIA 2G71A 4OXIA 3T7RA 4HN2A 5CITA 2QVCA 2YQ5A 3ZWKA 3C39A 3JQFA 3PHHA 5E1DA 2QTRA 1QX4A 1JR3E 4TXJA 5HG0A 1RFLA 2JARA 5KC9A 2F4VB 3MCTA 1V95A 8AT1A 3BQNB 1BDMA 3AWDA 5HIIA 4GWLA 3UJ7A 4DSAA 5JY1A 2RHGB 4YLYA 2KLHA 1WD7A 1QHHA 4DLLA 3J80A 3OLQA 1WSAA 3OE5A 3V4FA 2PRSA 1XQVA 3AKZA 2IBMA 2PXCA 5AVKA 4YYEA 2ZB4A 4HNRA 5FA5A 2C77A 3RVBA 4CMIB 4KE7A 4UASA 1Y7LA 3ORYA 5AI8A 2HSDA 1QIJA 4DR6B 1U2SA 2H4WA 3EGXA 4XA8A 4YJ2A 1NRIA 1IN1A 3HA2A 1OI7A 3GWZA 5TRTA 1XR3A 1LK0A 4E31A 2E4YA 1N25A 2B1IA 1XTBA 5GGXA 4DY4A 2RHHA 2BZ0A 4RENA 3ZUPA 1ZD8A 3RIMA 4HAWA 1DCMA 4JX9A 5IARA 5K8CA 4WA7A 1TYZA 1E2HA 4MW1A 1T26A 1Y8RA 3LGAA 2HIMA 4PHGA 4ZEOA 4MOWA 1LB1B 4QJ5A 2HOQA 3KXPA 1NMYA 1SC3A 2FWJA 2QTHA 4PVCA 3CUYA 3P8ZA 1QFZA 1E5VA 1FZQA 2OCGA 3DZHA 3ET5A 5LB2A 1RC8A 2E18A 4K6MA 2WY2D 3X1XA 3WSVA 5KOJA 5M29A 4OCZA 1KY3A 3L9WA 4P7JA 1XJ0A 4ER7A 1DRWA 1EFCA 1X9HA 4G5YA 5KDOA 3T3GA 2W2XA 3G2NA 4GVPA 2W6ID 3CTMA 5AXDA 5HF6A 1VE7A 1LKZA 2I3AA 1RLMA 3U3DA 2VDKB 4QUGA 3SIXA 2XZLA 3O47A 3UA4A 4E5MA 4CV0A 1T9ZA 4EJ0A 5ALSA 1DL5A 5B5SA 3LBAA 4LCEA 4Y67A 4YMSA 4KUHA 4MPJA 4FK8A 2P91A 4AUMA 5BMVB 3Q8MA 4CMBA 3IL2A 3E7DA 1RM0A 5HQJA 5EE1A 2APJA 4MVJG 1XEWX 3QYAA 4QOFA 4AXBA 1Y98A 2CNWD 1CEQA 4NARA 1V1JA 4JN6B 4UBOA 1JHAA 5IT5A 3DOHA 4S24A 3W3ZB 4IJSA 5ALVA 1FNBA 2BEVB 4EB0A 3OO1A 4RNCA 3TNDA 4XWOA 1HBJA 1M2HA 3MJRA 3RTEA 4Z49A 3EVGA 4YCCA 1OI4A 1D2HA 2QRJA 1JAHA 1KY5A 1L7RA 4HKTA 2RGGA 4PFQA 4ZO7A 4DLSA 5L6LB 4A92A 2YWRA 3ZNOA 1J8YF 4D0LB 2GZ2A 5E8JA 2JFWA 1AXEA 3AB7A 3JZMA 2WSSA 4XX0B 2BGLA 3AY0A 4G0YA 4PZ9A 4RIFA 9LDBA 1X3SA 1UFOA 3N2LA 1R6DA 5BV8A 3RVQA 3EEYA 2HF7A 1SEVA 5B3LA 1QM5A 1ZBQA 2VT2A 3HN7A 4HGRA 3WGYA 4J29A 1VL6A 1XDDA 1I4LD 2MDTA 2ZJ2A 1RCFA 1EM6A 1R15A 3P19A 2D1YA 4MLZA 4O2AB 1C4KA 4RFLA 4CEHB 1NYLA 4JLJA 3TMAA 3QLUC 5H59A 3VVMA 3M6VA 4UPVA 1WU8A 2GO1A 2NZ8A 3G1TA 3L4BA 2WINI 4FOOA 1AKQA 1N1DA 2PPVA 1ZG3A 2JFVA 2VZEA 4C0SA 1X70A 3NGLA 2C9BA 4QJIA 5I9LA 1FMFA 5I9IA 5AI0A 5JZOA 1F4LA 3LQQA 4PYMA 5K0GA 3R0IA 3BE5A 3GFOA 3QFFA 4WBNF 1PWZA 3G02A 2R47A 3DE3X 2FE1A 4HQ6A 5LYJB 3UJ8A 3B3GA 1T5TA 2C8KA 1AQYA 1AN0A 5B1EA 3VNAA 5J3JA 1R1DA 3RBXA 1J22A 2ILTA 3EFHA 4P5DA 4EAAA 3OT1A 4KE8A 5FOVA 4CODB 2YCLA 2G1JA 1DZ3A 3P9NA 4BP1A 2RGDA 4CLOA 2W5UA 3L7LA 2PO5A 4FZ5A 3AFMA 3UG7A 4RIIA 3NIWA 2HJSA 4HFNA 2W2LD 4HVAA 5EHGA 4OXRA 4ZMSA 1W5SA 2E48A 4LZLA 4GPZA 4YX9A 5INTA 1XPJA 4M9RA 4Y2RA 3U4IA 3WWPA 1F2VA 1Z7YA 3PRJA 5ALZA 3VZPA 3ZW7A 4MV9A 3P9PA 3P1JA 3HJCA 1G291 5ENDA 2G77B 1BE1A 3O2JA 3PDWA 3GQBB 3U9LA 3UJDA 2JEZA 2UYGA 4BO2A 1CUZA 4ZK2A 4B3GA 1R4NB 3IMFA 3GG2A 1NN0A 5KTPA 4CUZA 2NV0A 4XUGB 4O0MA 2ZTMA 3UYLA 5H3HA 3WMFA 4YMVA 3ECCA 3FUXA 1AF4A 3L7OA 4D79A 5JPCA 2YBEA 1YF3A 1QE5A 1ZK1A 2P9ZA 2PZKA 1ND6A 3FZNA 1BOFA 2RIRA 3F97A 2OR3A 1UFQA 3EQ7A 2IEBA 3OG9A 4RPHA 3UMRA 4CKEB 1H6DA 3QX3A 4JNGA 1IBLB 4YAJA 1N8TA 1IOWA 4P36A 1B1CA 1NP3A 1UPTA 5DX1A 4BJ1A 5IASA 3B85A 3CVYA 2J31A 3PFHA 1SHZA 2Q2WA 4ME6A 3Q7QA 3PDUA 5LVAA 2FTKE 2V6JA 1KRXA 2WKQA 3CZQA 4K26A 1Z16A 1U8XX 3C5HA 1U9IC 1XI2A 1QO9A 4X3OA 5CVJA 1Q1GA 4C7JA 2RGXA 5J5VA 2Z2JA 2GEKA 2VNAA 4J16C 4BZQA 4Z9BA 4PO9A 1SOAA 4QDKA 3U3XA 4CM7A 1HSOA 2PEZA 3WGIA 1BYUA 3HR4A 2FUG1 2Z9BA 3I32A 3L79A 5JFOA 5LR6A 2K4MA 5LYJA 1E7MA 3DLPX 4TTSA 4P3PA 3IR5A 3OEHA 5E0KB 1O4WA 1H6AA 3MCVA 5IJXA 1PNVA 1VLLA 1F6BA 4CMEC 3JS5A 3JQPA 1VKJA 1T0HB 3KC2A 3E3AA 3LX4A 2YQZA 1U0EA 2O3UA 2FUKA 4KZPA 4MTCA 4XWKA 2IYUA 2P2ZA 5LKRA 2W83A 4GZ3A 5ALHA 1U0BB 4LDQA 4WOCA 3TGWA 3KKNA 5LQKA 2AIRA 3OZSA 4B44A 3GHHA 3RF7A 5J1SB 3R24A 3ZZ0A 4QTTB 4BGPA 3V2HA 3KR0A 1SU6A 2PXXA 2IXTA 2JEYA 2YVLA 1OPRA 2Q28A 3BSFA 3IP8A 4DCNA 4DPKA 2HMYB 4Y9TA 3ICQB 4MVJI 4KR0A 3THXB 1LBIA 2EHDA 1CZKA 1W1WA 3BICA 1KO4A 5K8IA 2PUWA 5KYYA 3TR0A 2QBYB 1UPXA 3DYIA 2G04A 4KOAA 3W7BA 5KYXB 2JLUA 1WLSA 3QX8A 3DVQX 4MGHA 4DR3B 5M2QA 1QMGA 1ST2A 4FVTA 4CQMA 1RAAA 2NO6A 3TRFA 2OCBA 3GJ7A 2BKLA 1M10A 2DMRA 3MQ2A 3OQVA 4CKEA 5DHUA 1EDZA 4YMLA 4K2AA 4PFKA 1CP3A 1FXUA 5KVCA 5GONF 1EWKA 4M89A 2C9YA 5E2BA 5LMNB 3CCCA 3PIIA 4L5AA 5K6RA 2OQIA 1TQ8A 3BORA 1ZRNA 1ECFA 3AY7A 3DNMA 4RK0A 5H81A 5DSZA 2JLXA 1RI1A 5COAA 3HCRA 4L8WB 4RCZA 1Y4SA 1CV2A 1I4TD 1TMGE 3AP2A 3SDBA 4AMBA 4P54A 2XNCA 4ND6A 3T9DA 3U4GA 5I7WA 1KXJA 3MRTA 1IU9A 1XG5A 3LVRE 5HE8A 7YASA 3R3WA 1KMCA 2QRKA 4YPFA 2SKEA 1PG0A 4DUGD 1PNOA 3IAS1 4II7A 5GP1A 4UQLA 4M1OA 4G63A 4RSHA 2FMUA 4EFNA 5EWJB 4MS3B 4P3KA 4C76A 4KSCA 1Y3BE 5J43A 2VJYA 2XDQA 4I81A 3S81A 5FORA 3BHMA 4FR2A 1PLKA 4F45A 2GUWA 1E5QA 2R7AA 2WUGA 3B82A 4KRYA 4QYXA 5JOQA 2O59A 1VB5A 5CNJA 3SSAA 5KWEA 3AUKA 3Q10A 1J2EA 4CKCA 4U6QA 4TS9A 1E58A 1XHLA 1P2UA 3NNDA 5HK9A 2A84A 5CCXA 4V1CB 3T5MA 2VUHB 4JSRA 1D7AA 3BMXA 3FSEA 1YE8A 2EWWA 2VHVA 3I5YA 3THXA 1CVRA 8ATCA 3I72A 3AF3A 1DQNA 821PA 2FEKA 2QBYA 2N1BA 2Q46A 3CY6A 3G1WA 4RZ3A 3Q8KA 1L1QA 1JDJA 1QHEA 1YB7A 4L4ZA 4M0LA 4NAHA 3HB4X 5GY7A 1EIWA 4OI0A 8ADHA 1Y6FA 3CN7A 1Y9ZA 3KVNA 4QM7A 4AFNA 2PRJA 2TMGA 2H4FA 4KHZA 2OQRA 5AW2A 2H1IA 1N2IA 3OETA 4JY7A 3SLGA 2IP2A 3AVVA 3VR3A 5EGSA 2HNKA 3HDJA 2V3WA 4F5DA 4TTJA 4C7OB 1RM4A 5HJ5A 3LYHA 4X5OA 1Z5UA 1YIAA 2I9PA 1AGPA 3R3XA 1GAWA 2WHXA 1EZ4A 3K20A 4NPHA 4Y6PA 1JFSA 3MS4A 4WGFA 5EHNA 3NDBB 3DPSA 4HWGA 4RXTA 3H3XA 2XMGA 3B3JA 3ND7A 4YVFA 1EEHA 1NJFA 3FTCA 5ECWA 3FUCA 2AOUA 3MTJA 3T3OA 3UPUA 4CMCA 4LF8B 4P3YA 4TVBA 1NOIA 5CP8A 1Q0TA 2WT8A 4DR7B 1CF4A 3QHAA 4RANA 3T1VA 1SBYA 2EW8A 2NXWA 2IXAA 1EG7A 3CMMA 3T4XA 1MAHA 3BIOA 2XCTB 1Z7WA 1AURA 13PKA 1PO7A 1ZIOA 1E1QD 2ANCA 2OCKA 1L9XA 4HZUA 4Y2QA 4PYKA 1DG9A 1L3BA 3FHLA 1M6HA 4NF2A 1K3FA 3TJRA 3DHWC 1RYMA 4F3KA 1URPA 4JYPA 4ZYUA 5I4BA 3I1IA 2OSVA 2PGDA 1F7VA 2RGUA 1T5LA 4EZEA 3NU1A 1MZVA 2J9XB 3IAM1 1JHMA 3B48A 1V8PA 3PLNA 1HOXA 1U0GA 3S6JA 1Z6TA 4MQ5A 4EG0A 1RHMA 2P2LA 3QLEA 3VZSA 1S1CA 1TOAA 1KKUA 2PXAA 3RRBA 2PZFA 4HY3A 4UHEA 4EMBA 4RTMA 3ZHSA 4GLFA 1YCDA 4Y1EA 1C1YA 2GN4A 1LBTA 1GHTA 1QBGA 2AFIB 5LQAA 4YIKA 3SVTA 1N1MA 4XPIB 3ZXUB 4E5DA 2HQ1A 4OH7A 1CPYA 4WUTA 4B6FA 1DARA 2FDXA 2J07A 4Q4HA 4TMFA 1BRTA 4HPJB 3RBZA 3T1NA 4N0DA 4XOIA 1PEYA 2BJVA 3B52X 2SKCA 2MU1A 2Y1XA 1A97A 3K15A 2BFWA 4FBMA 1AKMA 3NHKA 1E61A 3K92A 3R77A 3RIXA 1XDBA 3VR4A 1N3BA 4LRTB 1E69A 5H5JA 3M4JA 4LFBB 2AL7A 3WLRA 3K05A 3FYTA 1O6GA 2B3TA 5M3BA 3ZDAA 2R11A 1TK2A 3E9NA 5JSKA 3UHFA 1PT6A 3AL2A 3IBSA 3ITDA 2OHVA 3AKCA 4UUOA 3DCYA 3UA3A 3U44B 5LBUA 4I2VA 4YIHA 3CU5A 4B43A 3O8NA 2GSWA 4RHFA 1U5AA 1IM8A 4DIUA 3K9WA 4QRIA 1ESCA 4JI8B 3F78A 5DNWA 5BUQA 4BRZA 4YCNA 2UV8A 4P8RA 5EMMA 1TZKA 4JYZA 3P2IA 2X40A 1VIMA 1ZD1A 3GAZA 3N07A 1Y7TA 1II9A 1U94A 4R9RA 3DOJA 3BZBA 1YR6A 4KE6A 2ZBDA 4R41A 1XAIA 1P1KA 1RKXA 1ZRMA 1WCXA 2J9FA 4ITUA 1BWRA 4TTRA 3HK2A 3FTEA 1FW6A 1ZQ1A 1OE0A 2A6PA 2Z1NA 4JL6A 4WXMA 1TRKA 4GMDA 1MEEA 2ZYSA 3CNNA 3O73A 5CT9A 3S44A 4LDAA 3VUFA 4AJJA 2OQ2A 2X4IA 3QJYA 1X2BA 5DNEA 3EISA 1IQRA 1Y9EA 1VCHA 3GDHA 1ZOOA 3N3BC 3NTXA 4QVGA 3AHHA 5HJ2A 3TSAA 4JR2A 1V3QE 5KHOC 3E27A 3FOCA 5HYVA 2J87A 2A92A 1TLFA 4LFCB 4C43A 1H6BA 3FDIA 1JEYA 1Z17A 4L9AA 3CNLA 3GBVA 2QSZA 5JNTA 1FTQA 2XI4A 3H05A 2QMZA 1NUTA 1ODJA 5DF1A 1NVBA 3RT1A 3DUWA 4UMVA 3LCVB 3BFKA 1YD7A 3MMZA 5LQUA 4WVFA 1O57A 4DJJA 2OBNA 4C4RA 3KYCA 3L1KA 3X0DA 1FNCA 2AFIA 1KNXA 3QEBZ 4RY8A 3BL5A 3D43A 3WE7A 4BO7A 1LBHA 1Z5GA 4F92B 5IDWA 3PWZA 2G82A 2QW8A 4JI5B 2G70A 3C8UA 1N9GA 4H3SA 1QMPA 2A5DA 3SHQA 4QU9A 3P0JA 2CLKB 3QPBA 4JKOA 2IVZA 5FPYA 4WLUA 3CPHA 4KNVA 3OFVA 1QP8A 2Y27A 1DKRA 2AN5A 3E7PA 3H5AA 3TTVA 4MIKA 4FMPA 3RS7A 1SB9A 2BFDB 3SSNA 4TQAA 5ALMA 5IX8A 3RADC 1RI2A 4P31A 1L5FA 3MRVA 4ZO4A 5AW5A 2XGMA 1UFKA 4HAVA 1KIMA 3SDSA 3WIOA 1DKNA 3S4YA 4LHEA 2LTAA 4KQ6A 2BBTA 2QYTA 5GJVC 2XJ9A 3LHDA 3TUIC 2R0QC 2BFNA 2A9FA 2VSYA 5BVGB 1XFAA 4KR3A 1A8PA 5A3VA 3FOWA 1INLA 4RVHA 2RGBA 1GAJA 5CJ2A 4A4DA 5JZ9A 4E2WA 2BHLA 1QF6A 3NHRA 1O0BA 1P7WA 4HDNB 2Z83A 2NO0A 3L6EA 1WCV1 2BFMA 1CSEE 5BW8A 3U09A 3GLGE 1Z28A 3NGMA 2NZXA 4OLJA 5EE9A 1ODIA 4KXNA 4Q00A 5FHRA 5IZCC 1Y8ZA 4GI5A 1W0CA 1W48A 2AXQA 2HW8A 4UAUA 4M6WA 5KYGA 1QOQB 2QSUA 2FZLA 4NHOA 4TLAA 2JNWA 5FO0A 3F7MA 3JALB 3STUA 3EZ2A 2I7TA 5G0WA 5TPZA 2CE2X 1AZWA 3AERB 3GXOA 4L0CA 4R9UC 3HTXA 1O5TA 4B32A 4TL7A 2XB6A 3AF2A 3CBQA 4DMKA 2BTEA 1GG5A 4L2IB 4J4HA 4AULA 5CD1A 1W6RA 1DIAA 2F2TA 5HDQA 1Z3CA 4BQSA 3OZEA 5A5FA 4QZVA 1RZRD 3ILSA 1BWQA 2YN4A 1EFLA 1IBRA 4CHTA 1R8JA 5HCUA 2WYIA 3FCEA 3NEJA 4E5VA 3PI7A 1MRNA 4HGPA 1TYAE 4YP6A 1LRJA 1TQHA 5DEIA 2ZU6A 2EL9A 2KS6A 3EIEA 2J0SA 3GP8A 2H9AA 5BUSA 5C2JB 4MQEB 1WULS 1LLCA 2R8YA 1IK4A 2EP7A 3BXZA 4YRTA 4ZIRA 2ZR0A 4C07A 1V4NA 3AMVA 2CEKA 2VDJA 1T3ZA 1WX1A 1LU9A 4IDXA 2JHCA 5C8YB 2HIGA 1I6LA 1AQIA 3V7WA 1CZOA 1TVKA 1U1GA 5A02A 2B7LA 3Q9SA 2J3IA 1Z5ZA 1T4CA 1YK1A 4A8PA 3AR2A 1IJFA 4NCHA 1TLLA 2FUNB 1AX9A 5A6SB 2IUTA 2PAAA 2ZYRA 3ZE1B 1R0CA 3RU9A 2CXRA 3KPVA 2BFDA 4GBGA 4V0RA 5DE3A 3LRXA 1GN8A 2CHEA 3K1YA 4G1VA 2DBYA 2HSEA 3H5OA 1FBNA 3TSZA 5M5BA 1E62A 4KVGA 1YB6A 3G0OA 4EW2A 9MHTA 3WKEA 1AS2A 5E8RA 4MV0A 3AKYA 3B36A 3FWHA 4Q12A 4K2HA