1E7QA

Gdp 4-keto-6-deoxy-d-mannose epimerase reductase s107a
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
314
structure length
314
Chain Sequence
KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGASCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQSAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the Catalytic Mechanism of Gdp-4-Keto-6-Deoxy-D-Mannose Epimerase/Reductase by Kinetic and Crystallographic Characterization of Site-Specific Mutants
pubmed doi rcsb
source organism Escherichia coli
molecule tags Epimerase/reductase
molecule keywords GDP-FUCOSE SYNTHETASE
total genus 109
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e7qA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1e7qA02
3RUHA 3PTZA 5IZ4A 3ICCA 3RCBA 3WQSB 4BHTA 2Y67A 2OL4A 3GMSA 3JQGA 4DIFA 4NJMA 3PFWO 1WMBA 2WYVA 4CMGA 1YQGA 3I9KA 3AY6A 3V2UA 1PGPA 1W6UA 3GRPA 5B4UA 1BDBA 1YB5A 1LRKA 5L7TA 4MIOA 4BIIA 4PG7A 1PJTA 4GBJA 3CXRA 1I30A 2ZB4A 5I8ZA 3VVBA 4DIOA 1PWXA 2Q4BA 3QVSA 4CLHA 4Y9DA 2DAPA 2QIOA 5L9AA 2QW8A 5I9NA 1PZGA 2ZB8A 2FZWA 3VTFA 1GYPA 4B3HA 3AM4A 4E21A 4IMRA 3I4FA 5TLSA 2AQIA 3HDJA 5JPIA 3H5NA 1E1NA 1GQYA 1I3LA 1VJTA 1NPYA 2WYUA 2NU6A 4L9RA 1PS0A 3RUIA 2C5EA 3JSAA 3WG9A 4IBOA 2DM6A 1T2CA 3JCZA 3E9QA 5ENDA 4U0KA 1Y8QB 2VHZA 5H82A 4RPGA 4M87A 4NU5A 1HF3A 3DMYA 4H16A 3MOGA 1KVUA 3PHIA 2Q2QA 3P19A 1IHXA 3UVEA 4CLOB 5IN4A 2YJZA 3AY3A 3HSKA 1YONA 4Z3DA 1WZIA 2O48X 4IMPA 4OKNA 4J4BA 3PJGA 1IZ0A 3FWZA 3ON5A 3CH6A 2DC1A 4R1SA 4DLBA 5JY1A 3JQ8B 4CMJA 4Q3CA 1TI7A 3FNFA 2PNFA 4NDNE 4PN3A 2PV7A 3GH3A 3IP1A 1CEQA 2HRBA 2JJYA 1NFFA 3HADA 1E1LA 1LC3A 5EERA 1PGOA 1NYTA 2A35A 4J2OA 2OBNA 3FPCA 3M1AA 2CNBA 3RC1A 1A7KA 1WZEA 4IDBA 5HBRA 2W4QA 5JY6A 4WK6A 3NT5A 3M2TA 4DQVA 1IY8A 3NDJA 5G0VA 3PIIA 3D5QA 4R9RA 5CPFA 1A9ZA 3ZWYA 1RM4A 4YT5A 2XPCA 1J4AA 1GY8A 4XIJA 2O50A 3AUSA 2PZKA 1YVEI 3X2FA 2VT3A 3GOHA 1PJQA 1UAYA 2CVZA 1ZK3A 4DTIA 1ISHA 3GAZA 1YS4A 4CM8A 1KERA 1X14A 1T4DA 2W90A 4RGBA 2Z1MA 2X0IA 5TGDA 3E6AA 3JQGB 3QVXA 1E7QA 1EQ2A 1XIVA 2B69A 2AXQA 1M6HA 3O26A 1IHYA 1ZJYA 2NV6A 2H9IA 2WD7B 2PKQO 4CM5A 3WGQA 4N18A 4U0JA 2B4RO 3PLNA 1MGOA 5DULA 4AJJA 3MJTA 2EW8A 5G0UA 3I9NA 3MEQA 4PG4A 4PVCA 3EZYA 1VC2A 2JD0A 1BMDA 1T1RA 2O23A 2V6FA 3B1JA 5EESA 1BW9B 1ZNQO 1LRLA 2HKIA 2NM0A 4OQYA 2NU8A 3QQPA 3ITDA 1I2BA 3VZQA 4UUPA 4P4GA 1LXCA 4RVUA 4TVOA 4H7PA 3GAFA 2HRZA 3W8DA 3PP8A 4B4VA 4JXKA 2OP0A 4BGEA 3V1TC 1MFZA 3G79A 5IAAA 1TXGA 4I5FA 4DQUA 3C1TA 4GKBA 2J3JA 4XRRA 1N92A 4LMRA 1RM5A 1Y8QA 3AOEC 3PLRA 5C7IO 5IN5A 3C7AA 2EHDA 4IJUA 3WQRA 3WR5A 2YHUA 4IIUA 4EEZA 1NWHA 4CODB 5IZCC 2OXIA 4EZBA 1SAYA 4DL9A 3PEFA 5KJCA 4QXMA 5BR7A 1HZJA 3H9GA 3GRKA 3BTUA 3I52A 2DT5A 1ARZA 4XIYA 2R2GA 2EIHA 3EK2A 8ADHA 5ES3A 4RPKA 4XQEA 4GLOA 5TNXA 4RVHA 5I7SA 2JD1A 1CYDA 2WM3A 3F5QA 3GMDA 4B7XA 2GN4A 4JJIA 3U3XA 4GMFA 4OJNA 3QE3A 1GQ2A 4KWIA 4E2WA 1NVMB 3SXPA 3TL3A 2UAGA 1VKNA 4ND5A 3S2EA 3ZI0A 1ADCA 2WEKA 3D4PA 2VN8A 1MG0A 2BHLA 4JJFA 2AA3A 3S55A 3UN1A 1KVQA 2V6MA 2WD8A 2ZJ1A 4UUMA 4YJFA 4A03A 1YO6A 1A72A 1X1TA 3VH4A 1QR6A 1NFRA 4E33A 1P74A 2NTJA 4BKOA 4Q3DA 1ZCJA 3PHLA 4RPJA 2O3QA 5JAIA 3GNTA 1DHRA 4J49A 3BTVA 1FK8A 1WMAA 1M2WA 4CM4A 1LRJA 1NX6A 1LDYA 4ALIA 4PFJA 2EERA 3FI9A 2VYVD 4HUJA 4Z0TA 3ENKA 2HMVA 4Y6RA 4CM8B 2Q1UA 3TZQA 5ICMA 1M66A 5DBIA 1O94A 2FPIA 2IXAA 4S1VA 4QX6A 2DTXA 3C1OA 1HSOA 3HB5X 3KUXA 3ZN2A 1GCUA 1MA0A 1RYDA 5KKAA 3BHIA 2YQ4A 2GPTA 1P1FA 3WFJA 2C5AA 4PRKA 2ZTLA 3O8QB 5KNLA 2GSDA 5CAEA 4G65A 2EJVA 4OKIA 5BNTA 1KVRA 2WE7A 2RCYA 1DC4A 4IDGA 4JBGA 4ALKA 3ZWNA 1T2FA 2IEDA 4WCFC 4J0FA 1PEDA 3EYWA 1QXSA 4Z9YA 1IZ9A 1PX0A 1UZLA 5AXAA 2HJSA 3A28A 2CY0A 4FJ0A 4PLZA 3DDNA 3JQEA 3OIDA 3PHJA 1EE9A 2AEFA 4XZ3A 3WXBA 1VL8A 2BGMA 1PZHA 3L07A 3WICA 3PHGA 5CPBA 3RUFA 2J3KA 5C7LO 2YFHA 1X1EA 2GZ1A 2I76A 3KV3O 1LU9A 3BZUA 4WCFB 1IULA 2WWRA 3GF4A 5IJZA 4BGIA 4BQRA 3W4KA 3A9WA 1U2DA 1T2AA 3L6OO 2NVBA 4CUZA 2B36A 5DF1A 4FFRA 3NV9A 2V6GA 1ENOA 2X86A 1I3NA 2FSVA 1KC1A 3EW7A 2O2SA 2Y66A 3VHRA 1B2LA 4YJHA 3IJRA 3PWZA 1C0LA 3DO5A 4HV4A 4YJHB 5G2OA 5BT9A 3QWFA 4M54A 3JQBC 4FC6A 1UDCA 2X22A 3GPDG 5T8KA 2CDBA 3CINA 3RFVA 1XYGA 4JX8A 4KDFA 2EGHA 1CRWG 3JQAB 4CLRA 1YL6A 1H6BA 4PLWA 5A9TA 1ZIDA 1F06A 1ZJZA 1C1DB 2IODA 1PJ4A 2O3UA 1JTVA 4XGNA 5L40A 3R1IA 4UVHA 4FC7A 1Y8RB 1JVBA 3DEYX 3Q9NA 4MVJH 3ROQA 3UHAA 1LDGA 1LDMA 4LSWA 5EN4A 1HE2A 3PJDA 3KYCB 2E4AA 1PL6A 1Z7BA 2WD7A 3F1KA 1HE4A 1HE3A 4Q3BA 3N7UA 4J7CA 3O8QA 2AW5A 4IQ8A 4RDHA 5LDGA 1HYEA 1MG5A 3HDQA 2ZB7A 4NJMB 2A9FA 5CDTA 3UXYA 2PKRA 2X9VA 2W2KB 3NEPX 4PGFA 2Q2WA 1DIGA 1JLLA 2XF8A 1CIVA 4RPLA 1BDMA 1VSVA 4MVJF 4J90A 4FR5A 1KEVA 4BS9A 5IXYA 1ENPA 1P44A 2B4QA 3LF2A 2Q1WA 2FMUA 2CF5A 1UDBA 2P68A 2GO1A 4RVSA 4XJTA 4EI2A 1GR0A 1UXHA 2NLOA 2O2YA 3ULKA 1YBVA 5T67A 4J0EA 3C1AA 1BSVA 1IE3A 1CJCA 3UICA 1NTOA 4E30A 3V1YA 2BD0A 1MXFA 3TZHA 1A4UA 4MINA 3AOGA 1PJLA 4H15A 1NVTA 3DAFA 2Y68A 4BB5A 3DTTA 3K31A 4AFNA 3QRWA 4QEDA 4NI5A 4LVCA 3ITKA 2FR1A 4YJGA 1GU7A 3ZWVA 2DFDA 1DLJA 2NQTA 3H3FA 4U5QA 5IF3A 3KVOA 5JDCA 3K8ZA 1QG6A 4FOOA 1A9YA 1AE1A 1IB6A 1P0FA 1WDKA 3PI7A 3SVTA 1ZW1A 2G5CA 3INGA 3E9NA 4QECA 3D0OA 1Q0HA 5DCWA 2WMDA 5HWSA 3DBVO 2NVUA 1O89A 3E18A 5DBFA 3ZH2A 1E7MA 5MDHA 3ZCXA 4GWGA 2R6JA 1I2CA 3PGJA 4FOSA 2ZCUA 2AEJA 2X0JA 4GKVA 3EZLA 2HSDA 2FHSA 4E31A 3VTZA 4MVJE 3KSDO 1PL8A 1I33A 2VRCA 3I9JA 2C82A 1U3VA 1ZK2A 3DL2A 3H2SA 4R1TA 4C4OA 1YJQA 1OC2A 2GN9A 4K9DA 2YV3A 1E3WB 3NGXA 5K6AA 1VL6A 3UFXA 1NWCA 3W4JA 4F46A 2O7SA 1E3JA 1ENYA 3B70A 1RPNA 3CPSA 2EJWA 1SC6A 3QVTA 2IXBA 1B26A 3K73O 4NIMA 1GQQA 3SJ7A 1N9GB 1YB1A 4OGWA 2Y1FA 3JYNA 3ZNOA 1Y1PA 1KYQA 1YJ8A 3LC2O 2FP4A 4PLFA 3BHMA 2TMDA 3PVZA 1LSOA 3WGZA 1T2DA 3ROMA 5CG1A 3GNSA 4CJXA 4DBZA 2ZYAA 4OL9A 4J1TA 4CR6A 2ZK7A 5KWEA 1IYZA 4FFMA 3WSVA 2I67A 1HT0A 1NM5A 3L0DA 1H9BA 3ZWOA 2Q46A 4B4OA 1ADGA 5TJHA 1JKJA 1Y5RA 3H5RA 5EQFA 4JQCA 4W9NA 3H65A 3ZU2A 2IZZA 3OH8A 2TMGA 3DZJA 3LLSA 5FWNA 1MXHA 4GLLA 1KETA 4OMUA 1NHGA 3U4HA 1LDEA 2AG8A 3DMTC 1PJSA 1EFLA 4WOJA 1V3TA 3D64A 4D43A 1UP4A 5JYEA 1P1KA 2B5VA 3U4CA 1VM6A 1GUYA 3IL2A 1MB4A 3KSUA 1KIFA 1PR9A 4IDEA 3SC6A 1GAEO 4PLVA 1JVSA 1V3UA 5GZ6A 3U4IA 2X4GA 3BXXA 4TZKA 1H2BA 4FCCA 1FF9A 3OICA 3T7EA 2W2LA 4M55A 4TZTA 1GFSA 3KLPX 4R4JA 4XB1A 4FGSA 4DREA 1E3IA 4A73A 4CMIA 3KOUA 4W7IA 4J7XA 1P0CA 1V3VA 2Q49A 3L4BA 5CEJA 1B7GO 1I2ZA 5EINA 4CUKA 2EV9A 1V0JA 4XYLA 1GADO 1P9LA 2DPHA 4BNFA 5THKA 1XU9A 5JSFA 5IG2A 1PSDA 3EDMA 1QP8A 2BFMA 4KZPA 3K92A 4BNTA 1N7GA 1BGVA 1NR7A 1B0AA 5FI5A 3GN2A 2GZ2A 5ILOA 1BWSA 5C7OO 4IXWA 4FJ2A 3KETA 3ETDA 1PQPA 1Q0LA 1PU2A 4X54A 5JS6A 3ANNA 3U9LA 4BKRA 3HG7A 4XEHA 4AVYA 3H2ZA 3M6IA 3A4VA 2JHGA 3WLFA 3RU9A 3GN1A 1G0OA 2IZ1A 2BLLA 1HTBA 1FXSA 4R9SA 5JFOA 1E5QA 1HZZA 5I9MA 1R0SA 3DBRA 4ZN6A 1XCBA 4DWVA 1E3LA 3SLKA 4AJKA 4TROA 5TS3A 2YUTA 1JWAB 3E03A 1E1KA 1QYWA 3OHSX 4FPXA 5JMWA 5LDHA 1DFIA 4XGIA 3VPFA 1OFGA 3AFNA 5TIIA 2QHXA 4J9UE 4CMEA 5ER9A 1DAOA 1YKFA 5T8KC 3LYLA 3VKUA 3KEOA 3WB9A 2DFVA 3IIEA 4P4LA 4D44A 3I4CA 1RWBA 2F00A 1ZVMA 1P33A 4H3VA 4MKRA 3E82A 4OXKA 4Q3EA 3ZNNA 4AJPA 4GWKA 2EW2A 1X7HA 3H9EO 3UUWA 3EMKA 2D2IA 3GFBA 1CWUA 2CSUA 3GDOA 1UJMA 4OSOA 2QRKA 3EVTA 5JCJD 4WLVA 3TWOA 4JP3A 4XRGA 3HDHA 4XKJA 1QSGA 2Q2VA 3VH3A 4ND1A 1DLIA 1HDGO 1M67A 3WYBA 1W0CA 3E9MA 1O6ZA 4FW8A 3NX4A 3WS7A 4WEOA 2DPGA 2PTGA 2Y1EA 3RWBA 3HFSA 4QSMA 3V5NA 1GZ3A 4YRBA 4CQLB 1GPJA 3VH1A 5KJ6A 2RHRA 3L77A 1U7TA 3VOSA 1KY4A 4TRNA 5CDYA 3QWBA 4EGFA 1ULUA 1GDHA 4BNIA 1GUFA 1P1RA 3OJLA 5BSFA 1HXHA 1U4OA 1UH5A 2VYVA 3NJ4A 4MVJP 3UOGA 3GGGA 3O9ZA 1NVGA 1E6EA 4CM6A 2Q99A 2Y0EA 3JQ9C 4AJHA 4CMHA 4CM9A 2OGUA 5L3ZA 5EPOA 4NNJA 1IUKA 3ZGYA 2DBVO 2Q1TA 3K9QO 2Z5LA 3ICPA 3K96A 4D42A 3U49A 1BTOA 5U9CA 4I5DA 1E77A 2WTBA 3TNLA 4E5NA 1OC4A 2HMWA 1EK5A 1PR3A 2QQ5A 1P1JA 2VHYA 3WDSA 1X0VA 1I24A 5KVCA 2HMTA 3C7CB 2CDAA 5K9ZA 4BMVA 2E82A 3MCVA 4IZIA 1K2WA 1GTMA 1NQTA 4BNVA 4BKUA 4UUNA 1WAMA 3WGIA 3BMQA 4QT0A 4BNHA 1PWZA 4HP8A 3K30A 2JFHA 3DOJA 3JYLA 1TT5A 1AGNA 1E7WA 2ILTA 4G81A 4L0QA 4CM3A 4D0SA 1V9LA 1WP4A 3C7DB 4BKQA 4IDCA 5DP1A 1BHSA 3GZNB 3DZGA 3IP3A 4ZQFA 2Y1GA 4J2HA 1IPFA 1ULSA 2EP5A 2BFPA 5JDCC 3F1LA 5HS6A 3ZWMA 1PGJA 2B35A 2YFQA 3Q0EA 3VPGA 2X9GA 4D0RA 4MP3A 4TRRA 4LCJA 2DVMA 4RF2A 3JQAA 2D5CA 1HRDA 4TVBA 4YQYA 5DNAA 4HNHA 2X23A 2EWMA 1D1SA 3V1UA 2BGKA 4Y67A 1HWYA 1A5ZA 2O3RA 4ND3A 3CZRA 8LDHA 4I8XA 3KSZO 1LBEA 1QRRA 1V35A 4YR9A 3TOZA 4BGUA 1ADBA 3D3WA 2X1HA 5L4SA 1H5QA 4KWHA 1SBYA 4II3A 3Q2IA 3QWIA 2J6IA 2Z95A 3RU7A 1U3WA 2ZKLA 4B4UA 1MFPA 1R16A 4UUOA 1U28A 4YEDA 1QLJA 5K6AC 1XWFA 4RVGA 3QLJA 3KRTA 2FPPA 1G6KA 3H4VA 5G4LA 3VPHA 2EKQA 3JYPA 3W8EA 3OIFA 3WSWA 1BW9A 5CEEA 4FFPA 2DBRA 3DHEA 1AXGA 4LVUA 2VYND 1A7AA 1E0DA 4LN1A 1VE9A 2FR0A 1DB3A 1LLCA 1WWKA 1B15A 1EVIA 1B3BA 3NTRA 3WMWA 5A1TA 1VLLA 4ZVVA 4BNKA 5IZCA 1ZK1A 3FD8A 1DC3A 2HK9A 3WFIA 4E6PA 2PK3A 1I10A 5BQFA 1A4IA 1DEHA 2XXBA 3BAZA 1Q2XA 3OM9A 1H6CA 5MGBA 4N5LA 1EFKA 4UEOA 5DT9A 1ZFNA 1VL0A 4A10A 2NSDA 1LTHR 4FB5A 1J5PA 1C0KA 2CUKA 4J43A 2X7HA 1JWBB 4IUYA 5DN9A 4I5GA 3GVCA 1K5HA 2OP1A 3COSA 4WNIA 1TLTA 1UZNA 2FY8A 2XOXA 3N74A 4ITUA 4U6QA 5LCXA 4O5OA 2X8LA 2IYOA 1HLDA 3QW2A 4JBHA 2GN8A 3QJ5A 4CUJA 5JMPA 1F0YA 1WDMA 5JLAA 4RF4A 3DQPA 1T2EA 1YB4A 3RKUA 1VKOA 4YAIA 1PJCA 1ISIA 1GV1A 1XDWA 2EEZA 3D1LA 3G1UA 3ETGA 4G2NA 3X2EA 4NU6A 4BO0A 2X6TA 5ICSA 3ONDA 4CV2A 5CDUA 3DFUA 3FWNA 4PG6A 2AQ8A 3DR3A 2RBEA 3QWHA 6ADHA 2D1YA 3UW3A 1KY5A 2IE0A 3GEGA 3K2BA 3WOHA 3JD2A 4CV3A 3QVOA 3H9UA 3H5AA 4GX5A 3AI2A 3KBOA 3U62A 2EXXA 3S8MA 4EUHA 1GZ6A 4HFRA 4BV9A 4O59O 4DIBA 3GHHA 1Z6ZA 1NBOA 2BRUA 1U3UA 5GY7A 1HDYA 5TSDA 3HN2A 5G0SA 4I08A 3S2IA 1JDJA 3SX2A 2GCGA 3D3EA 1ZMTA 4MKXA 1R4MA 4RLSA 3L4BC 4B7UA 4ZICA 1HDZA 4KQXA 4YWJA 3QVWA 2VT2A 3EVNA 1XKQA 4F6CA 2YV2A 5C3MA 1E7YA 1XG5A 1K6JA 4GX0A 4TSKA 3DZHA 4NBTA 2OZPA 1ISJA 3HN7A 1LQTA 2B0JA 4GX2A 1SOVA 4BNMA 1AN9A 3QWAA 4RVFA 5CFZA 1U9JA 1F17A 3F4BA 1MC5A 1N9GA 5A4DA 4FFOA 4YXFA 5AVOA 4ID9A 4MP6A 4K6FA 4CV0A 4D3DA 2C29D 2PKQP 4DA9A 4M8SA 4E3ZA 5DP2A 3KYDA 1ZSNA 7MDHA 4FD3A 2YDXA 3TJRA 4Z0HO 1JN0A 4NG5A 4L76A 3Q9UA 3B20A 3WWZA 2V65A 3NTQA 1O8CA 4GGPA 1AHIA 1D8AA 1Q7GA 2W2LD 2X5JO 4M49A 4GSLA 4J4HA 4EJMA 3EGOA 3RAJA 3PXXA 4GQAA 1TA4A 1XA0A 5DOZA 1SB9A 1VJ1A 3M1LA 1B14A 5DDIP 2NACA 2P2SA 3RC2A 3ZWCA 5B4TA 2H1SA 4OQZA 3OJ0A 1MLDA 2BH9A 3QIVA 3I3OA 4CMEC 4YT8A 1EQUA 1Q7BA 3WMXA 1FDSA 1OBFO 1RM0A 2JFGA 1I36A 3NDRA 4WE3A 3TZ6A 4DQXA 3AM3A 3CEAA 3B6ZA 1H9AA 3DAPA 1EDZA 5F1KA 3TF5A 1M75A 1LQUA 4BNWA 3GVHA 3NKLA 3R0IA 2EKLA 3GUCA 4GVXA 3ZDFA 2Q50A 4GGOA 4RO0A 1GPDG 1LC0A 4FS3A 3RROA 3WQQA 4NK4A 1DRVA 1XQ6A 3JQ6A 1R4MB 2Y99A 1UXKA 2RIRA 5I7FA 3KHUA 2DTDA 3AI1A 1C1DA 4KTTE 3RBZA 2D8AA 1ZK4A 2DUUA 3AUTA 4O0LA 5I7EA 3LT2A 4MDHA 4M1QA 2ZQZA 4ALMA 3LU1A 3MWDB 1ZXLA 1YRLA 3GY0A 1GCOA 1UZMA 2D3TA 4E5KA 4LW8A 5JC8A 4TKMA 2P5UA 3WLEA 5IDXA 3GA0A 3OQBA 1BG6A 1MX3A 5L95A 1S7CA 5GMOA 3HDYA 3Q2KA 3PDUA 4BQPA 1I8TA 1CDOA 2VZ0A 1JA9A 3JYQA 4XQ9A 3GVXA 1U2GA 5KVQA 3ENNA 2OO5A 3P2OA 4RLHA 2VHVA 4ONEA 2W8ZA 1EDOA 3U5TA 5A04A 2FSSA 5CHEA 2PWZA 2ZCVA 1DRWA 2O3JA 4OSPA 2JCXA 3ZU5A 1IOLA 1C3VA 1SZJG 3ABIA 1I0ZA 3B1FA 2AMFA 5KVSA 3DWFA 3FSRA 1M76A 1YBAA 4D46A 3F6YA 1GZ4A 1RJWA 2QX7A 4R51A 5B1YA 4IDDA 5AXBA 2VUTA 5FFFA 4CM4B 5JO0A 3DZIA 3DTYA 5A9SA 2B37A 3OJOA 3TSCA 3ETEA 4MVJI 4NR0A 3ST7A 4FJ1A 5KTKA 3LDHA 5G4KA 4XR9A 1ZXBA 2H6EA 3G1TA 4WLOA 3LT4A 2PA3A 1VRWA 1Y5MA 3JQCA 3KO8A 3E8XA 3OF2A 4OM8A 2JCYA 4JP2A 2PH5A 2WE8A 1ML3A 4IGFA 4L4RA 1UAGA 3PQFA 2OFPA 2CDCA 3OQ6A 3G0OA 4JIGA 4QUKA 3RQSA 3E48A 1CQJA 1HEUA 1VI2A 3GPIA 3OFSA 3RASA 2GDZA 4E0BA 4HNGA 3NT2A 4MVJG 1YDEA 4MPDA 4J7UA 4TRJA 4OXYA 3TRIA 3ADOA 4KMSA 3R3SA 4CLOA 3HZZA 4RV9A 4B8ZA 3RC9A 3WGYA 4AJ2A 3IDSA 4ZQBA 5F1PA 4BUCA 1K0UA 1LX6A 1ORRA 1DFHA 4C7JA 4GVLA 3OBBA 4QFDA 4YB8A 4IZHA 3V8BA 4XR4A 1X15A 3GDGA 3DHYA 3FCOA 3S2FA 1AHHA 1E92A 1JAXA 1O5IA 3GGOA 2P91A 4GH5A 4I1IA 2EGGA 5F5LA 2CZCA 2I65A 1E3SA 3GEMA 1UXIA 3BTSA 3IAHA 2VWGA 3P2YA 3HE3A 1SO8A 4DVJA 4N54A 2QG4A 1MC4A 4J1NA 3B1KA 3CZMA 2DU8A 1KS9A 1TT7A 2GGSA 3WIEA 3I83A 1ISFA 3FTNA 2EKPA 4G5HA 4B3JA 1EE2A 1UP6A 3STHA 4WLUA 1HDXA 3FR7A 4BO2A 2Q4EA 2VUSA 2WDZA 1YXMA 4YBZA 3GNQA 1WPQA 1LSJA 5FF9A 2ZIZA 4WNCA 4EW6A 4ALNA 2GN6A 3TOXA 3EAGA 4NFYA 4XQGA 2YHIA 5C5IA 3W6UA 4YRDA 4IXTA 3HJAA 1YWGO 3DZFA 1NQOA 2Y0CA 2OOSA 4CQMD 5HA5A 1G0NA 2FOIA 2OHXA 3FF4A 4HX5A 3U4DA 4TRMA 1UXGA 3R6DA 4P22A 4U8GA 1R0LA 4GSKA 4URFA 4W7HA 2IZ0A 3OJEA 3WJAA 1H0KA 1FMCA 2O4UX 4KUEA 3GG2A 5BSEA 1EEHA 4YDRA 1X13A 5G0TA 5L4NA 2FPGA 4IS2A 4UEKA 4DPLA 4W4TA 1PIWA 3G3EA 3PWKA 2OMEA 5FI3A 3VH2A 1SNYA 3OP4A 1WXDA 2C20A 3PQEA 4L74A 3EY4A 4R5MA 3ZW8A 3JQAD 5DZSA 4EBFA 2LDXA 3Q6IA 4U7WA 2FR8A 3W6ZA 2G82A 4B7CA 3IUPA 4DMLA 4ZHSA 1E3EA 2DLDA 3JV7A 1QYVA 3GZ4A 1P31A 2I6TA 4A27A 5DBGA 3ZNPA 5ENVA 3IUSA 4BO6A 2C0CA 1YQXA 4D7AA 3QP9A 4NBUA 1NQAO 1QLHA 3GVIA 4CM7A 3JQ8A 4YTEA 4AJOA 2GRAA 2QRLA 1YL7A 5L7YA 1AUPA 2YW9A 4WASA 3VC7A 3AY7A 1QYDA 1NASA 3RKRA 4NK5A 3RIHA 3F9IA 1DC6A 4CV1A 3CMCO 4J91A 1SB8A 1EVYA 1IPEA 1E3WA 4E2ZA 2OBYA 3IJPA 3PPIA 4ZU3A 4M86A 3ORFA 3PZBA 4ZRNA 2RH4A 3H6KA 2HJRA 3DHNA 1CQIA 2RH8A 1DXYA 1R37A 2VTEA 4D41A 3LZ6A 3LLVA 4CM1A 4IJWA 4JCOA 4NHEA 1HL3A 4AJ4A 1PS8A 4E2YA 1UP7A 3DOCA 4LMPA 4Q3NA 5A5EA 4R54A 1HDRA 1O9BA 3NDIA 1LJ8A 1DOHA 5HRUA 1M6WA 1J6UA 1R6DA 4XB2A 3BMOB 5L45A 1KC3A 1PS9A 4PZDA 3ZHZA 2BGLA 3IMFA 4CQMA 1U5CA 1U1IA 5JC1A 3RVDA 2XXJA 4E5YA 1KVSA 2C07A 4DXHA 1DJQA 4CMKA 2JCVA 5A3JA 3ZWAA 1JU9A 3EUWA 2I66A 2I3GA 4MVJA 1PJBA 1KEUA 1VSUA 1K3TA 3FBGA 3UGKA 1T1SA 4UAGA 5DCUA 4YRAA 3OETA 3V2HA 3PRJA 3ASUA 2UV8A 4J1SA 4MP8A 2ZTMA 3KTDA 1GEGA 2I99A 3AWDA 3AK4A 3CUKA 5DOVA 2FZEA 2GF2A 2Y0DA 3HQ4O 3AM5A 5F3RA 1PQUA 2OUIA 1N5DA 2D59A 4J9VA 3WYCA 1ONNA 4FSHA 4Y6SA 4UEJA 5JAMA 3MWEB 1Y9AA 4OO3A 4K1LA 3BMCA 2NWQA 1YE3A 4ZA2A 5A9RA 4B8WA 3QSGA 1EUZA 3WBFA 1E6WA 5A3VA 1O0SA 3IC5A 3GR6A 3I6QA 4PLGA 1FDWA 2X9NA 4A26A 1YQDA 3PFFA 1S6YA 5IDYA 1JW9B 2YV1A 1BVUA 1XU7A 2G76A 4FQ8A 3JQ9A 1U5AA 4RZIA 4WGGA 4BO3A 1NP3A 4KTVE 5TJ9A 5K0ZA 3KYBA 2VNSA 2VWQA 1J0XO 3NYWA 4DC0A 4IM7A 4A7PA 5A9SB 4IPTA 3ZU4A 3WGHA 3H8VA 1JKIA 2H5LA 2GLXA 4R16A 4PLTA 2VHWA 2I9PA 5TT1A 3QY9A 4K28A 4HY3A 4R3WA 4BO9A 5AYVA 1WLYA 4ILKA 5F1OA 4B3IA 4UVIA 2HCTA 3LK7A 2B4TO 1DC5A 1F8FA 3D4NA 3NTOA 5ADHA 4WUVA 4BO1A 4WOKA 4F3YA 3PYLA 2FN7A 1DDOA 3SC4A 3DBHA 2W98A 4AICA 4BL5A 3JQ7A 1MUUA 5AXCA 4CMCA 4JROA 3KB6A 4E13A 4GPD1 4ZQHA 4Y8VA 4I5EA 3RJ5A 2NADA 2C2XA 2NU7A 4TMFA 4D3FA 1CF2O 4J1QA 3QV1A 2ZQYA 5U4QA 1FDVA 1JKFA 3DBLA 1T25A 1MP0A 2JFFA 1XSEA 1B8PA 1ZMOA 3OMLA 3DBLB 2WSBA 3JQFC 3PK0A 2PZMA 3ZHXA 4WLEA 3UH1A 4E4YA 1D1TA 4ZGWA 1W8DA 5LC1A 1VPDA 1Z7EA 1R15A 4RF3A 1PL7A 2PD3A 4EJ0A 3L9XA 5GZ1A 3GEDA 3D3WB 5TT0A 1N1GA 4AJEA 1PGQA 4BO7A 1SEPA 2BELA 4DMMA 3KYCA 1F8GA 3E5RA 4MIEA 4HFNA 5KKCA 4YPOA 4P4NA 3W8FA 4E2XA 3CMMA 5AXDA 4CPDA 1P77A 1DIBA 4EUEA 5B4VA 1NFQA 4OYRA 1PGNA 5JAZA 3TPCA 1A27A 4R68A 9LDBA 3O4RA 2NU9A 2R00A 2ZJ0A 3NJ8A 1GUZA 3A1NA 3CKYA 3DOOA 4GI2A 4YJDA 3HWRA 1HETA 1QV7A 3GC6A 4B79A 2P9GA 1LDNA 1U8XX 1Z75A 1SMKA 1P1HA 3WYEA 3GVPA 4CR8A 1KEWA 4HADA 5T6BA 3MJVA 2GASA 1R4NA 4S3MA 1D3AA 1J49A 5THQA 5GZ3A 1H93A 3CE6A 3RD5A 4R41A 3WGOA 4E5MA 4YACA 4DLAA 1ZH8A 5J23A 4KDEA 2A94A 1ZK0A 3CTMA 1QYXA 3ZWPA 1LUAA 1RYEA 2HLPA 2J3HA 2BKAA 3OA2A 4YAEA 3ZV3A 4BB6A 2HUNA 2PD6A 3JQDA 4IINA 5A06A 4Z9XA 4J3FA 1YL5A 4P8RA 4EDFA 1YBMA 3IOYA 3U09A 3PIDA 1E7RA 3G17A 5AOVA 4NMHA 1H6AA 4BNZA 2JHFA 4K26A 2LDBA 5JAQA 1BXZA 2GYYA 4WECA 3L4SO 3INTA 3ANMA 6LDHA 2P9EA 4XYEA 3GDFA 1DBVO 5B37A 2HO5A 2VCYA 3IQDB 1E5LA 4IY1A 3GK3A 4E32A 3Q11A 2Y1OA 4FN4A 4XJSA 4BO4A 5G4KB 1O95A 1WVGA 3ZZNA 4NFSA 1MV8A 3F4LA 1ISGA 4IDAA 2HK8A 4PZEA 4ALJA 4RORA 3LC1O 4LISA 4Q3AA 3ZV6A 1XLTA 3FNGA 3BMNB 2NVUB 1R12A 1Z45A 3MZ0A 4PVDA 5COAA 3RFXA 1A71A 3JQ7B 3DXFA 2VWPA 3FRJA 2FWMX 2C7VA 3LT1A 1GYQA 4M89A 3ANLA 3DZKA 1BXKA 1EK6A 2VRCD 3NGLA 4GMGA 5I7VA 5KVVA 5A03A 1HDOA 4AG3A 4XX0A 3GQVA 2X5OA 3UCEA 3UCFA 3CSDA 4AJ1A 3E5MA 2CVQA 3PDJA 4IDFA 4XWYA 4BNJA 4J6FA 1CERA 4DC1A 1JQBA 1YOVB 2UUOA 4IS3A 1QYCA 1P3DA 3JD4A 3I9LA 4CL3A 1NNUA 2ZYGA 4R1NA 3ONEA 1PJ2A 1DPGA 2P9CA 4YT4A 3Q1LA 2VUUA 2P4QA 2YHIB 4XA8A 5B12A 2HMUA 2J8ZA 2PY6A 1LEHA 1PQWA 1Z73A 3L6EA 2VZ8A 4ZRMA 3SBOA 3TFOA 5BSGA 1U4SA 1Y9EA 4A5OA 3ZHYA 2Q3EA 4MVJD 4CL8A 4YAKA 2GD1O 3DC2A 1E7SA 3TFQA 3LF1A 3ROKA 4LRSB 4YCAA 1R66A 1ZEMA 1HSZA 4FFLA 1EVZA 3VZRA 2WYWA 4L73A 3NAQA 3KLMX 1N1EA 4RQUA 5IXSA 2D0IA 5A5FA 2P5YA 3SEFA 3NT4A 1YGYA 4NBVA 1PZFA 1Q0QA 3TZKA 4Y98A 3GFGA 3OEWA 3IKVA 4EUFA 4UVGA 1NPTO 5TC4A 3T4XA 2HDHA 3ONFA 4NBWA 4W99A 1B8VA 1SCUA 4RCVA 4BMSA 1LDBA 3JD0A 4BNLA 2AE1A 4HXYA 2VTDA 2PR2A 4RF5A 3WJ7A 1N2SA 2YY7A 3I9MA 1LLDA 3C8MA 3D4OA 1EUCA 5CG2A 4MOWA 4UVEA 3BMCB 2CMDA 3O03A 3MOIA 1XELA 4I9NA 5G0WA 3VAZA 1NPDA 2J5KA 5COBA 2E48A 1EMDA 3K5PA 4MVJM 4BMNA 1V8BA 1CETA 2AG5A 1R0KA 2AHRA 1BRMA 4CQLA 3A14A 3PHHA 4O6VA 3I1JA 3LVFO 1UR5A 1LLQA 5FYDA 1WNTA 3AOEA 2BFOA 4ZQEA 4I9UA 2NUAA 1OOEA 3IS3A 2BFAA 2GUGA 2IEBA 4IJKA 4W6ZA 3RI3A 2ZATA 2YZ7A 2EF1A 4OOFA 1B3RA 3PJEA 4AJLA 4BO5A 4EYEA 1LA2A 4Z3KA 1D7OA 4DPKA 5JBIA 2DUWA 2Q45A 3LSYA 1SEVA 3GZNA 3P7MA 5A05A 3DBHB 1WW8A 3WBBA 1GYRA 3R3JA 4R01A 3E1KA 4QQRA 3JD3A 4R5HA 3VPXA 2EP7A 2DBQA 4HWKA 5TF4A 2QYSA 2VRBA 5EMHA 2JD2A 3VDRA 3VZPA 1E1MA 5I8WA 1PTJA 4BNUA 1YDWA 2YDYA 5JO9A 4EITA 1U3TA 3AU8A 2V6BA 1GD1O 3FBTA 4PLCA 1K6IA 5BNIA 1HYGA 1NHWA 1OZAA 1DFGA 2JAHA 1DIHA 3RUEA 3TL2A 4Q39A 3ZWWA 2GERA 1C1XB 3ZNQA 5T64A 4O63O 1Z82A 4R1UA 4DPMA 4CQMB 2J5QA 4ND4A 4B4WA 2V7PA 3RBVA 3K2EA 2HAEA 3RFTA 4BGVA 3AUAA 1L1FA 4Z9FA 2CVOA 2POQX 2X0RA 3GUYA 2CFCA 2DQ4A 3MJEA 4HBGA 5JE8A 1DJNA 3JQFA 4U6SA 5JDIC 4INAA 4N7RA 4HFMA 3DONA 2H63A 3DZBA 5F5NA 3RBXA 5L4LA 2NNLD 2NVWA 1LSSA 4ZJUA 2VHXA 4K6CA 4RJTA 3HFGA 4L4SA 4XDZA 1VJ0A 4HFJA 5KJ1A 1C0IA 1PJ3A 1EUDA 4UREA 3RSHA 4CMBA 2C59A 5IDWA 2RHCA 2PD4A 4QFCA 1ZSVA 1UUFA 5HS4A 1KBZA 4RDIA 5TQVA 2VWHA 3H7AA 5ILGA 4RZHA 2PZLA 4CR7A 4KQWA 4Q9NA 2I3AA 2X5KO 5U1PA 2AEMA 3I5MA 4Z0PA 4R3NA 3NRCA 4ZQGA 2Y1CA 3GLQA 4DLLA 5T5QA 3BA1A 1FDTA 4JJGA 3QHAA 2QZ9A 2G17A 1PZEA 1E6UA 1XGKA 2ET6A 2IYPA 2RAFA 3C85A 4RPHA 4WCFA 4IQGA 1SOWA 2NTVA 4LCEA 2AQHA 5T57A 3UKOA 4E5PA 3WNVA 2E49A 3H3JA 4PLYA 1G1AA 4P38A 2X58A 4GAEA 4NJOA 1DO8A 3SLGA 5AQ1A 2PZJA 4UVDA 1HLPA 4PLPA 1I01A 4J16A 2UVDA 2DBZA 3Q3CA 1FJHA 4TQGA 1QV6A 1HE5A 5IFLA 1NAHA 1TEHA 2JKVA 3EHEA 4CLDA 1WDLA 3D5TA 1ZKMA 1OAAA 1RM3A 2O7QA 2GNAA 4DRYA 4KOAA 3ZWXA 1UDAA 1GV0A 1SPXA 2D5AA 5EIOA 1X7GA 5EQDA 4FFNA 4OH1A 5TRTA 4NFHA 3A06A 3AU9A 3RUAA 1P1IA 2JAPA 4JGBA 1B16A 5COQA 1GEEA 3F3SA 2Y05A 4JNKA 4TWRA 1H2HA 3VDQA 1DSSG 3WGTA 4E12A 3W4IA 3BHJA 3BTOA 3JQBA 3QA9A 3T4EA 1D4FA 1U7HA 4N5NA 2YYYA 3IKTA 5JNLA 3BMOA 1Y7TA 4C7KA 3FR8A 4YJFB 4FIZA 3ZU3A 1N7HA 4MO2A 4ALLA 4NBRA 4NZ9A 1Z74A 3UCXA 2C2YA 2IDZA 3WTCA 4CLRB 3H9JA 1EBFA 2B83A 2BI7A 1QMGA 3JYOA 2ZB3A 1ONOA 1DHTA 2WJPA 3DFZA 3I6IA 4MKZA 2E6UX 4RQTA 1ZSYA 4YT2A 3M2PA 3JTMA 1DIRA 3NUGA 3OECA 3WIDA 5JYDA 2F1KA 4ROSA 4EEXA 2P4HX 2VNAA 3CIFA 3PJFA 5CDSA 1H94A 3ZHBA 4KUGA 3U0BA 2AE2A 2ZTUA 2C54A 1H6DA 3VZSA 4PG8A 2NTNA 5HTOA 4IIVA 3OA0A 3ROPA 4DYVA 5JCXA 3PGXA 1DAPA 3C3XA 2Z1NA 3HHPA 5L51A 2PLAA 1LNQA 4GX1A 3RC7A 2EG9A 3N58A 4NPCA 4XDYA 3KYDB 3MJSA 2UUPA 3FNHA 5H83A 4OIMA 4AJNA 3OSUA 1BVRA 3GGPA 4F45A 3PZRA 5C37A 4JLWA 4XYGA 5HM8A 2IRWA 2W2KA 4XCVA 1F14A 3T7CA 3FHLA 1HYHA 3S2GA 3RJ9A 5I9LA 3UAGA 3MTJA 1V6AA 3F47A 3MTGA 1NXQA 1LI4A 1RKXA 3FPLA 1Q7CA 2PH3A 1DIAA 1B8UA 4IGEA 1XHLA 3PWSA 4ZD6A 3WX0A 3PYXA 1YH3A 4LK3A 4DBVO 3LC7O 4A0SA 3WNQA 4L75A 4XYMA 4AL4A 3HB4X 4JN6B 4R69A 5ITWA 4QO7A 2O3SA 3K6JA 4DYDA 1ENZA 2OORA 4PLHA 1ZZEA 4D79A 2B5WA 3KM0A 3BMNA 3F46A 4A2CA 4EJ6A 3AFMA 1ZUD1 1TB4A 4YJGB 1ZEJA 4DGSA 4BOYA 3INRA 3VKVA 3MJCA 4YYZA 3AI3A 3PQDA 3WWYA 1ID1A 1NAIA 3AW9A 2X0NA 1HDCA 3VVCA 2UDPA 3DAGA 3LT0A 4BVAA 2VQ3A 2HQ1A 4BNYA 1ONPA 1W73A 2Y93A 2A4KA 1Y81A 5JXWA 1XEAA 2QYTA 3EC7A 3SJUA 1I5RA 2ZTVA 4MIYA 1Y8RA 2PFGA 3F5SA 2UYYA 1W4ZA 3GT0A 4II2A 3FN4A 1DRUA 4KP7A 4CM9D 3BIOA 5KJEA 4BKPA 3MJ4A 1K89A 3TDKA 2FRDA 3P5SA 4CLXA 3OJFA 4PZCA 1Q1NA 2ZYDA 1T24A 2DTEA 4YQZA 3LQFA 5CP8A 3ADPA 3ZV5A 1EBUA 4FBGA 4TKLA 2G0TA 3FNEA 2D4AA 1F12A 3FTPA 4IJVA 5CEFA 1HKUA 5TX7A 1QORA 7ADHA 2QRJA 4GL4A 4HKTA 1Y6JA 4WEQA 4XD2A 1YOVA 5DCYA 2CD9A 3WGGA 5ITVA 1QKIA 2O4CA 4KUHA 2J5RA 3L6DA 4J4TA 4OOEA 1JAYA 4PCVA 4YA6A 5JCJA 4OXNA 5KIAA 4WCDA 2I5PO 4XGKA 4FGWA 4BNNA 2AQKA 3KEQA 3ASVA 1L7DA 1R4NB 3HUDA 4LSMA 4WKGA 4YVFA 4ESOA 5FEUA 5KCZA 5L53A 3ZW9A 3JD1A 1ZO8A 1ISMA 3OQ1A 4CLEA 5A02A 4NH4A 2O3TA 1I3MA 3DB2A 4RVDA 2PGJA 4PRLA 1P45A 4BNXA 4I9HA 3V2GA 4O1MA 4Z6KA 1GL3A 3GG9A 3KZVA 1AXEA 2E37A 4LRTB 3UF0A 5EL0A 4D45A 2QZZA 1FDUA 4UULA 2JL1A 3HNPA 4W9NC 3VPSA 1K6XA 3GHYA 4XQCA 4WPGA 1I3KA 2A92A 2PGLA 4F6LA 1X0XA 5CDGA 1EZ4A 4FDAA 5ER6A 2Q1SA 3PYMA 3DMTA 4WLNA 4BV8A 4RL6A 3TN7A 3I23A 3D7LA 4PG5A 4WJZA 3H9QA 2CF6A 1ZBQA 4MJLA 4LGVA 5KJFA 4D3SA 1OI7A 3ZV4A 1EVJA 1KEPA 4YAGA 3I9OA 4N5MA 1C0PA 4XYBA 3BMQB 2HK7A 4IQ0A 4CMIB 5L7WA 3RUDA 4OHUA 4DUPA 1LLUA 5JDIA 4W82A 3G49A 4JBIA 3KXDA 1T4BA 4BNGA 4QO8A 1T26A 1XR3A 2Y1DA 3RUCA 5EJ2A 1C14A 5KOIA 1UXJA 3OEYA 3O38A 1U8FO 1KVTA 3WTBA 5BSHA 2VOJA 2DKNA 2VOEA 2HMSA 2VZ9A 3OIGA 3S1LA 1KOLA 2GR9A 4OAQA 1L7EA 2HU2A 2XAAA 2J3IA 4CMAA 2BF7A 4L4XA 2GZ3A 2C7GA 2BMAA 4L8VA 3C24A 4AJIA 2VYNA 4Y6PA 5IDQA 1BXGA 2SCUA 4JK3A 4WLFA 5JW6A 2R00C 3AJRA 2G1UA 3BYZA 5F21A 1BXGB 4PIVA 4ND2A 3W1VA 1OMOA 5H81A 2BI8A 1NR1A 1TVEA 2YQ5A 3DBRB 5BNFA 4YAJA 3ZWBA 9LDTA 2PGDA 4QTZA 1N8KA 1XQ1A 3L9WA 3AUUA 1X7DA 1ADFA 2NQ8A 4NQZA 1TT5B 1C1XA 1LSUA 4BO8A 1NQ5A 3TZCA 3TQHA 1I32A 1IL0A
chains in the Genus database with same CATH superfamily
3RUHA 1M2GA 2VDNB 3G1WA 3ICCA 1ODIA 1OT3A 3RCBA 2Y67A 3GMSA 5IKXA 1Y6RA 3E23A 4C88A 2P30A 2V5AA 4JU9A 1WMBA 2AN9A 3FWPA 2VK4A 3R75A 1XPRA 2RHDA 1RQXA 3N2NA 3NHYA 5LQAA 3MUOA 1O08A 1GAWA 1UPAA 2F4NA 1T8YA 2IY8A 3LNTA 3NAMA 5C5EA 3L7DA 2QA5A 2HI0A 3RFFA 1LRKA 1O8BA 1TCCA 3K5IA 1L5QA 3GUVA 4GBJA 4HPWA 1XQXA 5I8ZA 5ADWA 4CFSA 1UWLA 4EPWA 1DC7A 2NO9A 2XLBA 3QVSA 3T38A 5C8DA 2QIOA 3ZQKA 2CYBA 5I9NA 1GN8A 3MJHA 2GJ4A 1GYPA 1GRNA 3T7JA 4MLPA 4B3HA 3R40A 4XSHA 1SKBA 2VH1A 3AVQA 4IMRA 2PO5A 2CHFA 3I4FA 2AQIA 3HDJA 3OZDA 5H68A 1QC5A 1XBTA 3GL9A 4R71A 5JSUA 5KAPA 4D0LB 2J9RA 1H23A 1TTHA 3HI4A 2NU6A 3PXDA 1UK7A 2GM4A 5NULA 1SZDA 1K4KA 2R97A 5CK4A 2ZSEA 1HFWA 1M5TA 3MCWA 4MW9A 1CNEA 3GLVA 2Q7XA 3WG9A 4BNDB 4DL9A 3BAFA 5KPJA 3RSQA 2DM6A 1T2CA 1W36D 1INLA 1JG7A 4R0MA 5BMOA 4U0KA 4DOMA 4B85A 1RLOA 4OXIA 4HR7A 7AT1A 4NCNA 2IYWA 3OLWA 3P9QA 3PFBA 1HF3A 4QDJA 4D8YA 3DMYA 4BMYA 1H4VB 1PR2A 2BN4A 2JLAA 4U2GA 5B2EA 4IGKA 4LE1A 1GPAA 5K2OA 3C8HA 3QNMA 1QWSA 2OCGA 3EASA 7REQB 1K75A 1A04A 3FG9A 1IHXA 4QLAA 3AHGA 3LW8A 4RIIA 3TO5A 1WHTB 2Y2UA 3CUTA 5IN4A 4BPRA 2PZ8A 1KF0A 4URHA 4HDOB 5FYQA 2IYSA 2QZJA 1F4PA 2JB9A 2BI4A 2O48X 3R2JA 4IMPA 4OKNA 4RMJA 4A6DA 2L42A 1IZ0A 1V1RA 3FWZA 3ON5A 2DC1A 1J09A 4R1SA 2CNWA 4DLBA 4FHFA 4F3TA 2HIMA 3FHOA 1GUDA 5JY1A 1N3BA 2R5WA 3FNFA 1UPUA 2PNFA 3SBDA 1YI0A 1GAXA 1YVDA 1UZUA 2DWUA 2HRBA 2VK2A 3K71B 5D3KA 1E1LA 2GDJA 3VU0A 1CEEA 3FAZA 1NYTA 2A35A 4G0PA 4WTOA 5IJ9A 3D6NB 2GHIA 2CNBA 5BWLA 1E6LA 2NV2B 1WZEA 3Q3GE 621PA 3OQNA 3BFKA 3RO7A 3IX7A 4FEGA 3ZK8A 4L3OA 1WXGA 2ZR7A 3LHDA 4ZCSA 4MQEB 2W4QA 1BAPA 5GINE 3NIBA 3C5HA 1IY8A 3D0QA 5G0VA 2JLCA 3A2KA 3IURA 1Q7TA 4GYJA 1DQPA 3D5QA 4R9RA 1UC4B 5DX1A 1C7JA 3H87A 2V1UA 2QR3A 3FKSA 1L4MA 1Z29A 4PPFA 1A9ZA 4DZZA 3HGTA 1G18A 2XPCA 1TECE 2O50A 2ROQA 5K7SA 3U3RA 4J0JA 3G2MA 4PPNA 1YVEI 2R87A 2VT3A 2WJ4A 3BS4A 2CVZA 2JRLA 3O84A 3RYFA 3REQB 4EUKA 3I2IA 2GPAA 3IULA 4O2RA 2E21A 5D3QA 1I7NA 1VCNA 2PSDA 4U2BA 3GXBA 4BKMA 2Z1MA 4DR3B 4LG1A 3KQKA 1QVZA 3BIFA 1W1UA 3QG1A 4ZREA 3QVXA 1PNOA 2QPAA 1EIZA 3CPJB 1EQ2A 1XIVA 1NR5A 2H5IA 4HQKA 3P26A 4L7QA 4LMBA 4X5OA 2HM7A 5JFGA 3TIGA 2DFLA 1M6HA 2OC4A 3O26A 2WD7B 5EXDA 4CM5A 4N18A 2A9RA 2N46A 4U0JA 2B4RO 3HI6A 4XSGA 1WHSB 5FJJA 1XVTA 1JEQB 4XXHA 2XV1A 2YMMA 3RVLA 3JAKB 3UG7A 3H9BA 3IQEA 5AJVB 3EIUA 2VDKB 3H5WA 1PCXA 2IOFK 1NDQA 2L2QA 3EVZA 3I9NA 4FDUA 4EHJA 3OPYA 4UEWA 3W3ZB 1SM4A 1V47A 4QPZA 4EIWA 5JJKA 3ED1A 3D0KA 4G1VA 1ITZA 4X91A 3UJDA 3NASA 5EESA 4MV3A 1TOAA 2PGOA 3HCEA 1HNWB 2HKIA 4QDOA 3ND6A 3ITDA 2GVNA 1U2ZA 2YZMA 1YZ3A 4P4GA 1LXCA 3SHVA 4K6HA 3IBYA 2IS4A 2C4MA 1DMSA 1QHHA 2WNIA 2Z6UA 5AKKA 3G79A 1J7KA 3DC7A 4JLDA 5EVJA 3PTAA 1GP2A 4DLKA 5A62A 4ETIA 5A3SA 1E1CA 5JYBA 3UV3A 5LA6B 1KTIA 4LMRA 3KOMA 2PNJA 3EGEA 1WUTA 1PR5A 1RM5A 1Y8QA 4UD6A 4DLNA 4X24A 3SQDA 1HL7A 2FFRA 3KZMA 3WQRA 2OB1A 5KWVA 1K27A 2YJGA 5J2UF 2XGJA 1USKA 4LMAA 3F3MA 1RPZA 3PDIA 4C0AC 5BR7A 1HZJA 1I13A 2JIZD 3GRKA 5K3EA 1Y3AA 1GIAA 3BVPA 1B73A 2VBFA 4GC5A 4KAJA 5E2BA 2REQB 8ADHA 3VPAA 4RPKA 1V48A 5REQB 1UANA 2ID4A 4WK4B 2WZQA 3QJYA 2JD1A 1NUPA 1IAQA 1R6TA 3Q3HA 5I7SA 4J1TC 3F5QA 3GMDA 4GLFA 4N01A 4P7JA 4B7XA 2QVCA 1KYXA 1ZR4A 3FYHA 2VYCA 2HU8A 4EKIA 4KWIA 1P19A 5TGZA 4E2WA 5KVAA 1FDIA 4LYHA 1AKYA 5G3ZA 1G63A 4CQNA 1EGAA 2DWCA 3S2EA 4BC0A 3GT4A 2BHLA 4DIEA 4MW4A 4UNRA 4RDCA 4JJ4A 3O8LA 1Q1AA 2MSWA 4G0MA 3B48A 3OPYI 5EYPA 1N8TA 3ZK9A 4N8DA 1X1TA 1U7PA 3MTDA 1P74A 1M1ZA 5JNRA 4Q3DA 3U7FB 3K2QA 3PHLA 3MRXA 4RMHA 2P3LA 3BXOA 4J49A 4DCUA 4KDCA 2AZTA 1WMAA 3BTVA 4FHDA 1M2WA 1VLMA 5BN4A 1H1DA 2JEOA 1ZU4A 3MWJA 5JTTA 3OTQA 2RGAA 2WZDA 4CEJB 1SR8A 5I3CA 4KK4A 1VSQA 3EVBA 2HMVA 4Y6RA 1XTVA 2Q5HA 3UT0A 2I2BA 3TZQA 5AO9A 4AQDA 1JTEA 3HJBA 2C7RA 5DBIA 4EB6A 2FPIA 1BXRB 3T1HB 4QX6A 2DTXA 3TQRA 3V48A 1BGXT 3B36A 5FULA 2ZE5A 1HSOA 3M9XA 1V9SA 3BM5A 2V59A 3KUXA 1TYDE 2R7NA 3AZQA 1GCUA 1MA0A 4JA2A 4EHFA 3HGMA 3WO1A 1TFUA 3WFJA 4AECA 5KNLA 1EM8A 1P4RA 1YJBA 1R8XA 4FYIA 1TLFA 4G65A 5E3IA 1GGNA 2ORWA 3IDFA 4OKIA 1US8B 1N3YA 2Y2VA 4F4UA 4HGRA 3FETA 1IEWA 4CBVA 4ZK6A 3FLEA 2P3SA 1RYZA 2WF5A 2IEDA 3HKEB 4QJ3A 1PEDA 3QNWA 2UYHA 1BCRB 2ZB2A 1CLEA 1PX0A 5K3BA 3GJTA 1UZLA 1GZHB 1U63A 1DBWA 4AN4A 4RAOA 4JR2A 3NBYC 2ZBDA 1V5EA 2Q0HA 4NSNA 4U8HA 4XGQA 2VSNA 4RH1A 4H7EA 1IDN1 3U1TA 1KQFA 3HCOA 3PHJA 4ZMRA 3M6FA 3KK0A 3ZZ0A 2BGMA 5A4KA 5H4GA 3PHGA 1AURA 1R18A 5C7LO 5IASA 2I76A 2YFHA 3KV3O 1LU9A 1JJAA 3BZUA 1IULA 3OSZA 4R31A 1QU3A 2FQ1A 4FM9A 2ILVA 1TQ8A 1ZC4A 4BGIA 3NUQA 3W4KA 3DYIA 3MQ4A 2VHUA 3OFVA 4EA7A 3A9WA 4CDGA 1T0UA 4AZ0A 4QPDA 4CUZA 2B36A 4OA8A 1P9RA 2GBPA 4P2BA 5F1YA 2V6GA 4P08A 2YW2A 5LZ9A 5DISB 3CO0S 3ZV7A 4GXNA 2O2SA 2Y66A 3BULA 5LZ5A 3R5KA 1EAMA 3IJRA 1AT1A 2PX2A 1C0LA 4JSRA 1PP4A 3HYTA 2ZVPX 1M2VB 3DVQX 4JB2A 4V24A 3T4UA 2DPLA 1U0NA 3BIWA 3FVWA 3QWFA 3H2HA 4FC6A 4B6GA 1GTG1 5C51B 5LZ4A 1JNXX 3L8MA 1TPYA 3CINA 3V6MA 4JX8A 1EX9A 4CLRA 3JQAB 4AIRA 2C31A 1FUUA 4PLWA 5BW8A 2PR7A 3UHOA 2QLBA 1ZIDA 1C1DB 3WGUA 3AUKA 4AY3A 1WY7A 3K9NA 4K6MA 3KQPA 5GV7A 2R751 3R1IA 2PXCA 3L0ZA 1A8SA 4ML3A 4FC7A 4UVHA 1Y8RB 1Z2EA 3CX7A 3Q9NA 4NZNA 4UZFA 1SUAA 1LDGA 4CHGA 3ELDA 5LPNA 3G2HA 2CV0A 3PJDA 1XTSA 1D2MA 3KYCB 1DTSA 2ZR9A 3R24A 4V3BA 3ICOA 3ZBPA 5G41A 4LWOA 3IPRA 1W7AA 2CUTA 4R2KA 3B9RA 3OZUA 2CE7A 2H8GA 4B0PA 1KKUA 3C8DA 4XX0B 5E6RA 1I7LA 1DGQA 3A9RA 2BMWA 2I6SA 4CCWA 2VEDA 1MG5A 1IRXA 3IMGA 3MCZA 2A9FA 4NJMB 4P58A 5EHQA 3GCGA 3V55A 1F3OA 3UXYA 4LXQA 3VGJA 4DUGD 2Q2WA 4JKIA 2XF8A 3SSMA 1OFIA 4RPLA 3A6GA 1W9MA 2IPXA 5DLQC 1N57A 3ZBTA 4ZTUB 2JGAA 4BS9A 5IEJA 1G6Q1 5M29A 2ZWAA 1F5NA 3L49A 1G20E 2RG1A 2WTXA 4QNNA 1Q21A 1F2UB 1WBJB 2F7SA 3ML1A 4HDAA 4YV0A 4Q7KA 2I1QA 4NJEB 4HVAA 2QAGA 1IJFA 2O2YA 1ESNA 1C30B 4OK3A 3C1AA 1HMPA 3CH4B 3NS7A 2MT9A 4RTRA 3LVBA 4PY2A 1NTOA 1DWPA 2X6RA 2E2WA 1SCIA 1T0IA 1CUIA 3G5UA 4Q34A 1A4UA 2QTBA 2QLLA 1HDIA 2WIJA 4MINA 1PJLA 2ERYA 4UBOA 4RX1A 4TN5A 1E2KA 3MWKA 3LFUA 1L0BA 3UPDA 4QEDA 5FR2A 1I1OA 4F9TA 1GGVA 1CNFA 1E2NA 2O06A 3G23A 4N7BA 4RD4A 3T3MB 1U31A 1QK5A 3T7DA 3LRPA 2GTIA 2GKSA 1DLJA 2NQTA 3ENQA 3T4PA 4HWSA 3TW8B 5FWXA 2AFHB 4ACBA 3BEDA 3BA6A 4R7TA 4TL8A 5IMBA 4AN0A 1A9QA 1I94B 1Q14A 3D2BA 4CI9A 4UEQA 4E51A 1MBZA 2VP3A 5J5AA 5EA2A 1DWQA 2H1IA 5EJMA 3CVVA 4MGZR 1NJFA 4BCBA 1FFHA 3E9NA 3K9GA 1DDIA 3AKDA 1E63A 2FCAA 3I2JA 2WMDA 2HYDA 5HWSA 1O89A 4HGYA 3ZH2A 2BM8A 4TT3D 2OVBA 3HXOA 4M76B 2IYXA 5A4JA 1QOQB 3Q7RA 2ZRFA 4AMZA 5JRJA 3IALA 4KPFC 2RGNC 4MCHA 1I2CA 2OKGA 3PGJA 1E9DA 4CEIA 4FOSA 1E1QD 2PKXA 2ZCUA 4GKVA 3O0TA 4IHJA 4PYOA 3V4VB 4XM1A 2FHSA 3D9QX 4DMCA 1ZIXA 2B9VA 4DNPA 1NX9A 4MVJE 2CNOA 2X13A 3KQWA 4I6EA 4IIFA 5EGSA 3DPUA 4IKPA 1I33A 4I2VA 2M6KA 5AMXA 3PU6A 1P80A 2C82A 1JU3A 5HKBA 3RC3A 3P9ZA 3U81A 3PITA 1SK8A 5FADA 1ZD3A 4NBNA 4C4OA 1YJQA 3NC4A 4YCDA 1DEXA 2UVPB 1VTKA 1NNLA 2FK8A 1J70A 4A5SA 3S0JA 4UM9B 4P0QB 1CD5A 3QEMB 1PQYA 3AQIA 3DT9A 2AOUA 1FVHA 3T61A 1JLLB 3CY6A 5AKEA 1KYVA 3W4JA 4Z4QA 1ENYA 4TS4A 3RSSA 2CK3D 3LVQE 3MRSA 3R23A 4CGYA 2XRYA 2IXBA 3BXGA 3T5MA 4NIMA 3SJ7A 4M53A 2PGXA 1K3FA 3MWEA 1WULS 1Y1PA 3PEVA 3LQ2A 5AVKA 5LP6F 4M1WA 1KYQA 4GMKA 4DNQA 3CSUA 3OLYA 1G4HA 2IL1A 5LQMA 1Y4AE 3BHMA 4KVAA 4HMPA 4IZOA 1FU4A 1T0HB 3DKRA 1LSOA 1UDXA 1NLUA 5GGYA 3ROMA 4KX3A 4IGIA 3R6WA 1RVDA 2ZYAA 5A7HA 1ZRNA 1TMYA 1DXQA 3QE2A 2FGJA 2WQZA 2A59A 5HTKA 1HT0A 3FKJA 1CRQA 3KQSA 3L0DA 3ZWOA 1ADGA 1WZNA 1H69A 4ZIRB 1TA0A 2CLEB 4JQCA 3NOQA 3CX3A 1X3LA 4JT8A 3LLSA 1AKWA 4LQDA 3UMBA 5F2OA 1VLHA 1KETA 4OMUA 3HCFA 4LNUB 2EAUA 1P5RA 1KDVA 4TKVA 1QU2A 3PPWA 4H2DA 1Q74A 2ZBVA 1PJSA 2VTKA 3FYCA 3O1IC 4YJ3B 5HCNA 3X1WA 2EGUA 1FUKA 3SZRA 5FV4A 2C4WA 3P9PA 4FP9A 1CE8A 3AERA 5DK6A 1P1KA 2J33A 1VM6A 4N7MA 5K8TA 1KSHA 1KIFA 1Z6XA 1HKHA 3VAYA 2WOJA 1M6YA 5EUBA 4XIGS 3FOFC 1OXBB 1PEYA 3ZD7A 4AZWA 1G60A 2B30A 4Q9LA 3M4JA 1U9YA 4O2LA 1FF9A 3T7EA 1A9RA 5E6SB 2Z57A 1VBFA 1YDFA 4BVAA 1VLJA 3T5GA 3C3KA 3NM5A 5KPDA 1O4VA 4DREA 1VYTA 2I55A 2VEOA 5HKOA 1JHXA 4FMPA 4D0NA 4A73A 3DLTA 5HSGA 1LBIA 4AP6A 4JITA 2DY0A 5K20A 5JECA 4JJ6A 4G0UA 4R2XA 4IDUB 2CEAA 2X15A 5TDHA 3CZPA 1V3VA 2R6R1 5KTMA 4GI1A 1I2ZA 5DE3A 4CUKA 2IXEA 3EQ2A 4QODA 2LPMA 1V0JA 3QG5A 1JALA 2B6HA 1QNLA 2DPHA 3O4FA 5EMLA 3UA4A 2G09A 1QR2A 2Q0SA 5IG2A 1J20A 2Y9MB 1IPHA 5JAHA 4AY2A 1FY2A 3N8GA 4Q37A 3W06A 2BFMA 3PXCX 4Q9HA 2VZLA 3EPRA 3ESDA 4URUR 1EFDN 1KP3A 5FI5A 5EXSA 2M98A 3RT9A 1SKUA 3G82C 2JVJA 3GJSA 1FXUA 4CW7A 1E79D 4ZEMA 2BDUA 2PA0A 1XAGA 1LY1A 3QY0A 2YVQA 2BM0A 2F1IA 5LA6F 2EKZA 5JS6A 5HR5A 2W2PA 5AFSA 4DV5B 3A10A 3N59A 1SHTX 2DQZA 3LLCA 4X7MA 4BRSA 5IANA 5JFTA 3NVKI 3KT3A 4XEHA 3JARB 3UXEA 2FMHA 1XVIA 1Z0FA 2WF6A 5ALFA 1LBSA 1LPMA 1M6VA 2QY9A 3VTAA 1K7CA 1N75A 2H4HA 3HDGA 4R9SA 2AOTA 1KI7A 3UJBA 3OQOA 2UZ0A 1HZZA 3U4QB 3QHQA 3DBRA 1CZNA 3NHRA 4E08A 2NQ2C 4EO9A 3ZCPA 4HEA6 3VMMA 5EJ9A 1SA0A 2RIPA 4Y2HA 3SLKA 5H5JA 2ZCJA 4CN8A 2YUTA 1N1MA 3LKVA 4YECA 2FSIA 4LC0A 4S35A 1QYWA 1UBSB 1DV2A 5BR1A 2HU7A 1A9SA 5I5GA 4YDHB 5DO9A 5H16A 1RQPA 2QHXA 5EKUA 5FB3A 4D4LA 5JU6A 4QICA 5ER9A 1YKFA 5T8KC 1V11B 3VKUA 3D6VA 1Z4MA 1DOZA 5DW0A 3STTA 4R2IA 1EB8A 3UGQA 3WB9A 5IVKA 3EAQA 2F00A 2H57A 1WVIA 4ESVA 3D6JA 1M2OA 1B0PA 1QGED 4Q3EA 3UAYA 5JZVA 5KDDA 5K09A 3F7OA 2MMCA 3CVYA 1X7HA 3VTKA 1TVKB 4HGQA 2I7CA 3OT1A 1JQAA 2CSUA 4XWTA 5E1MA 4TLEA 5KX5A 2GPWA 2YCLA 2QRKA 3I1IA 1AKVA 1AX9A 3S2UA 3VHLB 5JCJD 3RSGA 4XRGA 2XUHA 3HDHA 3IRUA 1G9XA 4Z0NA 2J0UA 2ZUSA 1TO6A 2B0CA 4MRSA 2YN0A 1QSGA 1YJXA 4Q3OA 1RLTA 2PX8A 2C9DA 4ND1A 1M67A 3HCPA 1M73E 1JYSA 2GARA 3E9MA 4UQOA 3NX4A 3VA7A 3I6MA 5C80A 1COWA 3CLVA 2DUMA 4IDPA 1USWA 1BHQ1 4EYQA 1KMCA 1ZD4A 3R5SA 4KGZA 1T9CA 3K1JA 1DTEA 2H1VA 2XKJE 2FW1A 3ZZ1A 2NPFA 3WL7A 4ZI5A 1GDHA 4EHHA 1GUFA 2KHZA 3CPEA 1DT5A 5L3QB 5BSFA 3DUWA 1HXHA 3QYFA 3MT9A 2QGFA 5C8XA 2DLCX 4A2WA 1TUBB 2XJ9A 3O2NA 3TD9A 1IJEA 1EFVB 2G07A 3EG9B 1E6EA 1UJCA 3JQ9C 4E4TA 4AJHA 4CMHA 1BD4A 4IDQA 5EPOA 1GITA 2XUJA 3HO6A 4NNJA 1GNTA 2OILA 2DBVO 4Q7QA 4YH1A 1CDDA 2JGDB 2CKDA 3U49A 1BTOA 3RJTA 4I5DA 2Q9BA 1XDUA 5ENZA 5FBRB 3H8SA 1CEYA 4DDKA 4DGQA 4N49A 2HIGA 4BCDA 2GEVA 2VHYA 1F9EA 1X0VA 4IDNA 1I5EA 2R2AA 4FNOA 3WDSA 2HMTA 5KVCA 4DR2B 4AD8A 2CDAA 4NOMA 5LQSA 2CVHA 3F49S 3DKKA 1DJLA 3EC2A 3LD9A 2AWNA 4UD2A 3MCVA 1FPMA 1NQTA 2WYHA 3FTDA 4IZIA 4M60A 2EFEB 4UUNA 4CCAA 2CHGA 5GIOE 3BMQA 2CBGA 2GAJA 3LHSA 2WHYA 5GPBA 3VQTA 1FMTA 3DOJA 4RD3A 4MLDA 2H2IA 1E7WA 4L0QA 2ILTA 4PC3A 5K1ZA 2VHCA 1GSOA 1M7BA 4KO8A 4CM3A 1OX5A 1ZI6A 3HBJA 1ELOA 2SICE 4IDCA 4BKQA 1V43A 5BV8A 1C7EA 4D98A 2R8RA 1P17A 4RABA 1EPUA 2Y1GA 3BGOS 1ULSA 1PSWA 2EP5A 2B9EA 3K9BA 3F1LA 4RVOA 3U9TA 2H7YA 3CKKA 1G4AE 2B35A 1KQOA 2YFQA 3Q0EA 3QXXA 5CB6A 1XZIA 2VDUE 1SXQA 2EHJA 4QWMA 2R4QA 1HOXA 2DVMA 3S7ZA 5C52B 1CZUA 2BGUA 3TLGA 4P7FA 2LRHA 4DSUA 1ZMBA 3PGMA 1P2TA 4YJKA 4YQYA 1A97A 1E1QA 2I2FA 1T5OA 1H4TA 2X23A 1SQ5A 2EYQA 2UUAB 1E2JA 3IV6A 4MQUA 2AFIE 3VJKA 2I9KA 1A5ZA 2O3RA 4YIKA 2HSJA 2QROA 3KSZO 5CFNA 3TTVA 1QRRA 1Z4QA 2EG5A 3F8TA 4MWDA 3DCIA 2GXQA 3W2GA 4KFSA 1UMKA 2A8YA 2MSKA 3G2OA 3WLHA 1M0EA 1SBYA 4II3A 5D87A 1R8YA 4ZYYA 2GAFA 3QWIA 3B9QA 2KW5A 3KALA 2Z95A 2XWBF 2DETA 2ZKLA 1E9BA 4ZAXA 2OK8A 3JAWA 3TNDA 2ZZKA 5F3DA 5ARCA 1GTRA 4G5RA 2WFMA 4XFDA 1XWFA 3QLJA 3TECE 3ZCVA 3M5CA 4IYJA 3R3HA 4M6WB 5BWCA 3SFVA 3G0HA 4WD3A 1RKQA 3VPHA 1MRZA 4TWJA 1LWOA 5E8JA 4OMCA 2OYRA 2EKQA 2XUPA 2FG6C 4DC9A 5CFPA 1BW9A 2EEPA 3EXFA 3RV3A 3UV7A 3DHEA 1T5LA 4N65A 2DJ5A 5EHGA 2CGEA 3FDIA 3O1LA 4Y2YA 1VE9A 1X1DA 2FR0A 4JL6A 4ZOEA 1Z28A 4A0HA 1LLCA 1JKJB 4NCAA 1WWKA 3Q1KA 1FP1D 1E2PA 5LB4A 1T6BY 3NTRA 3WNDA 3NWPA 2XWJI 1QX4A 4XWKA 4BMCA 4R2JA 5EJEA 4BLOA 1DC3A 2GCOA 3QYJA 3E8SA 1FSSA 1MABA 1I10A 3WL4A 3FTQA 5BQFA 3BAZA 3TOSA 1DXHA 3OM9A 1M5UA 4UXHA 4Z4FA 3SLRA 2PZGA 3MLEA 5MGBA 4GMXA 3TLYA 3K0FB 3SVLA 3TUIC 4HX2A 4A10A 2FA9A 3LPDA 2NSDA 2C95A 5KMGB 1SELA 1PNRA 4YHBA 1J5PA 1JLRA 1KYZA 2CUKA 1DAHA 2CCGA 2QI9C 3EZGA 2X7HA 3HVHA 3GUHA 3SF8A 4YBRA 1XCMA 4NG4A 2I8CA 3I0ZA 1H3EA 3D6AA 3EF1A 2WPNA 3Q72A 4CF3A 3EVAA 4S04A 1OXKB 5HF6A 3RVJA 1LI7A 4O5OA 2DH6A 4H0CA 1WVMA 1J90A 3MINA 2HBZA 2NXJA 3QW2A 4RMIA 5HJEA 2GN8A 1KK2A 4CUJA 1ZM7A 1GKKA 1X8JA 3DQPA 2VF5X 1JPJA 4M46A 3RSLA 4YMTA 3V1KA 4PPYA 3RHFA 4YAIA 2PMFA 1ABBA 2B7LA 3ACCA 4G2NA 3ETGA 4NU6A 3D31A 3CW8X 3ROGA 3TW0A 2L18A 1RBZA 4PG6A 2AQ8A 1GPH1 3DR3A 2RBEA 3GFRA 1KY5A 3WOHA 1GSHA 3FWYA 3E5NA 2SKCA 3QIAA 3E7PA 4GC9A 1WLSA 5HOQA 1MJHA 3S8MA 4EUHA 3GP5A 1F20A 2WG0A 4Z54A 3ELWA 3GHHA 1ZN8A 2PSHA 3E3AA 1HDYA 4GR9A 5BQPA 5TQ2B 3BXFA 3R76A 5G0SA 2YX1A 1N36B 1L7MA 3O7MA 1JEQA 2I33A 3QVKA 4V38A 3UWDA 1GNRA 1XD9A 2HLHA 2GCGA 4MH0R 2EU8A 4RLSA 5IMSA 1WMFA 3FMVA 4QUHA 1HDZA 4KQXA 1RBMA 4UPVA 4D56A 2HF9A 4YWJA 3S5UA 3ZE6A 1U8YA 4F6CA 2BMVA 1W8IA 4UDYX 3DV0A 1R6VA 1DTWA 2C2BA 5A4AA 1SCJA 2XVAA 3FHJA 2NX2A 4DM7A 2LR0A 3KJFA 1LQTA 3TLBA 3SP1A 1SOVA 2E9SA 3NOVA 2G77B 4MICA 5GJWC 2GTPA 3DL7A 2NSHA 4QDZA 4REOA 4WGFA 3QWAA 1F3LA 4QOJA 1GQSA 1U9JA 1F17A 1LTKA 3IKMB 4X60A 3AJEA 3OBIA 3T52A 2OHFA 2CNNA 3JWGA 4TM7A 4ID9A 2IXDA 4K6FA 4MP6A 5AVZA 4ACAA 4Q3LA 3PT5A 2PKQP 2QVXX 4RVCA 1LK5A 4X6LA 4M8SA 5LA6A 5DP2A 1LH0A 3H2KA 2B4YA 3V8RA 7MDHA 4FD3A 5HW0A 3F4KA 3TJRA 4Z0HO 4U3JA 2ZTSA 4RDXA 1JN0A 3SU8A 3ZGXA 1EB9A 2ATXA 3BWEA 2VT7A 5AVXA 1OLUA 1VBNA 3FY4A 3DLHA 4F97A 2AJTA 4MV8A 1YA4A 4RMNA 4LFCB 3AHJA 2ODNA 4B2PA 3W8RA 1JI0A 1KK0A 4LC1A 4JEIA 1D8AA 2AN1A 1FFEA 4J4HA 1HBJA 4JYPA 1B41A 4IV5A 2P1DA 4P3NA 4TSRA 5FI0B 4RK5A 4CG0A 1R0YA 3GT3A 3OZBA 4RYLA 1DAEA 4L08A 3QMWA 1SB9A 1VJ1A 2REQA 3IAS6 4O29A 4E4RA 3HXLA 3LOUA 2K2QB 2VPIA 4FS8A 3D8SA 4Z7NB 5B4TA 1S2LA 1MLDA 2BH9A 4PO3X 4F8YA 5CA1F 2P2LA 4Z1MA 2HHCA 5AW2A 4YT8A 1NATA 2IWRA 5KYKA 1Q7BA 1J0AA 5DSZA 3LOQA 2P2YA 1T35A 3P1JA 4ARUA 2XNHA 4DWOA 1JEJA 1UBMS 2OT3B 5H80A 1VA5A 2CHVA 1EXWA 3HGQA 3LWBA 3WFZA 5B30A 1UOPA 2QTVB 5CBKA 3H3XA 3IQZA 3ETNA 3AM3A 4MQFA 4PSAA 3U1BA 3B6ZA 4TXLA 1H9AA 5KC9A 3QOFA 3SFTA 3WNBA 1RWXA 5A5GA 4HNVA 2HRQA 2FQWA 3GGCA 1MCZA 4H18A 1IU9A 2WICA 3GUCA 1H0HA 4HZUA 4YIHA 2VXCA 1DRKA 1UF9A 1ILWA 4W8OA 4OHFA 3R9IA 3K0BA 4LF5B 1PVOA 1JEDA 3SG0A 4QGBA 1KZ4A 3C3BA 3BE5A 4ZAGA 4BYGA 1LC0A 2CXPA 4FS3A 4QARA 1WDWB 2PSFA 3WQQA 1K97A 1DRVA 2Q5CA 1H0SA 1UXKA 2HA6A 2RGCA 4OQQA 4ZT7A 2Z2IA 2Q6TA 3D7RA 5SYAA 3RBZA 3HZOA 2D8AA 1ZK4A 2DUUA 3HUFA 4A6XA 3EWSA 3QTBA 4MDHA 1AA6A 1J21A 3LU1A 2QVYX 5LZ2A 1SD5A 5K0BA 1H66A 1FU8A 3GY0A 4I4TA 1UKEA 2K6GA 2QLTA 1QIEA 2CFTA 4TKMA 3USES 3BZWA 5JSHA 4BX2A 3WLEA 3P9NA 4ZCMA 2CXHA 5IDXA 5K0JA 2JH8A 1U3DA 4IMIB 1MX3A 4LWPA 1EM8B 4AWBA 5KYUB 4H08A 3K20A 4OHXA 1YA6A 4FWIB 4KCGA 1JA9A 3ORQA 1U2GA 3IOMA 4Y6LA 3FTFA 3LDFA 4F3CA 3PFKA 1PR0A 1W85B 3LBAA 1B6SA 2VHVA 2RI0A 1VQ1A 2HNAA 2IXFA 2FSPA 3TGWA 4OSPA 1SXHA 2FW7A 4K26A 1JSZA 5MFPA 4MGKR 1X1BA 2HXGA 3D3KA 3PNVA 1QP7A 1M76A 4JBXA 4JL5A 3TLZA 2XQVA 3NNDA 4ERXA 3OQMA 1RJWA 1U1EA 5AJXA 4F1JA 1Y6GA 1ZD8A 2ZUTA 3MPUA 4WFIA 4L3VA 3DTYA 2WAMA 3OPXA 3RB8A 2A6PA 1M54A 3LLUA 4IVRA 2AWOA 2W2VA 1WF3A 2BHTA 1F1JA 3ETEA 4EG4A 4MVJI 3M5WA 3ST7A 3L8ZA 4FJ1A 1WDTA 4B9EA 1NIJA 3NANA 4DJFC 4XR9A 1W30A 1ZXBA 4XUEA 1VFNA 3DPIA 3U4AA 4PHGA 1Z08A 5BRJA 5JH7F 3T1OA 2R5FA 5ALLA 1D1PA 3BDIA 1JAHA 1BJRE 1PR1A 3EBPA 2A9JA 2OB2A 1Y7PA 1Y5MA 4N4AA 1XZNA 2B25A 3E8XA 1U8EA 2J5BA 2O2CA 4OGLA 2J67A 1EFUA 2O6HA 2PH5A 1U0TA 4GU5A 1SHKA 1C8KA 2PMKA 1VHDA 3WB1A 3L7NA 3RQSA 3TM5A 3OFSA 1EUCB 1UBCA 4FCWA 2GDZA 1L3IA 5C5CA 1II0A 4TYMA 4AULA 2BM1A 1MVOA 1L8LA 1GKYA 2RGNA 4MVJG 1E2DA 1WABA 4J7UA 3TTXA 4WY5A 2WKSA 3QBEA 5FUYA 2ZAIA 3TRHA 4XI9A 1MOSA 1Z35A 3CCFA 4UFNA 5LKRA 3DWGA 1TM4E 3W05A 4AG6A 3LY8A 2D5IA 5JVDF 1D0IA 4HDNA 2FZ5A 1TW3A 2WUWE 3OESA 5F1PA 3LX5A 3T3DA 1ORRA 1JDSA 4GVLA 4E6EA 2ACVA 2PWAA 4FNMA 2GBGA 1EK2A 2QWXA 3FCOA 2ZIFA 3R7BA 1YQTA 3CUVA 1AHHA 1SZPA 3S2FA 1QJCA 1M5RA 3EFBA 4OI1A 1BS1A 4B45A 1Y7LA 2EGGA 3FH0A 1Y9DA 3TSZA 2XHEA 4H6VA 1XDGA 4IWYA 2OSVA 4L5JA 4PQYA 4RQAA 4QAJA 5F5LA 2CZCA 2I65A 1E3SA 3FCXA 3ZQ4A 2F8TA 3NTUA 3GEMA 1UXIA 1RZUA 1CT9A 3IAHA 3V97A 4YMUA 1KI6B 1TF2A 1TUGA 2FMKA 2P5TB 1F60A 4N54A 4DVJA 3ZCSA 3FYUA 2FLVA 4C4PA 2GGSA 2OAP1 4M22A 1R27A 4MR7B 3TI9A 3RRYA 4B6EA 1ISFA 2GWHA 2EKPA 1JUDA 5K0TA 3WI7A 3LWDA 3H2JA 1PVVA 2G83A 1LCIA 4QNRA 1Z6GA 3ITNA 4GBMA 2WY2D 4BO2A 2Q4EA 4G8CA 4PNZA 5FNVF 5JS8A 3OPNA 3TQSA 3GNQA 1GUAA 3BRSA 4QJBA 4WKBA 5FF9A 4CVNA 5DLPA 4WNCA 4KYUA 4EW6A 4G1CA 2FLKA 2GN6A 4F5YA 5EUQB 4XQGA 1AF7A 2REBA 4P3XA 4RD6A 5C5IA 3W6UA 1EYZA 4IXTA 1YUNA 2HX1A 1EX6A 3DZFA 1L4GA 2IU6A 5M5BA 4XASA 1GZ7A 3EWNA 3ER8A 5JI3E 4PIMA 4DSOA 3EA0A 3LT5A 4OBWA 5I5EA 1R9JA 3DB1A 3OMXA 1GNLA 2OA0A 4B33A 2A14A 3B8HA 3EDQA 1HX7A 5BOSB 1UXGA 3B2EA 4MB6A 3WE7A 2HPAA 4WX2B 5SZJA 3ZG6A 4OK5A 4GSKA 1E20A 4M38A 2IZ0A 5J4KA 1H0KA 2JNWA 2BFWA 2RKWA 1AS3A 2O4UX 1BH6A 4EF4A 4KUEA 5HFNA 3K0AB 1RRCA 1NGSA 4WIAA 5BSEA 1QRSA 1X13A 2QD5A 3H7IA 4G4JA 4UEKA 2AX3A 5JBQA 2D2EA 3X1KA 4RULA 3DCNA 2O54A 4NECA 2B99A 1JFFB 2H1WA 2SHKA 1Y89A 3FOBA 4M1SA 4NZMA 2VQFB 2G1AA 1UBFA 3H4TA 3HKEA 3RVQA 1QJ4A 1NVAA 3FYDA 4EBFA 3A6HA 1NJ5A 1QHGA 3Q6IA 3SAJA 4HEHA 2G82A 4FTWA 1KOJA 3LQRA 4CWAA 1REQA 1N8SA 1K8RA 5D3ZA 1BA3A 2BRUC 2VL7A 4DCPA 5JR3A 5IVPA 2CXQA 1P2DA 3JV7A 3G2QA 2BEJA 4RQBA 4BMZA 1NBMA 2ZXUA 2C7BA 4HDCA 5DGCA 5PGMA 2WNHA 3QPVA 2VBGA 3PGKA 3F9RA 4M2LA 4LYJA 4RM3A 1N2IA 4QHYA 2O14A 2R5NA 1JQLB 2ECFA 1S3SA 4MS1B 2C3PA 2Q4TA 1O6BA 4FE3A 4XFKA 3SF0A 2K87A 4CM7A 4G9EA 1BDIA 1FQJA 5FPQA 2FPRA 4YTEA 3VKWA 3ASYA 3IR5A 4RS3A 4GP9A 3DM5A 2O7RA 1U9ZA 2WK1A 3PCXA 4D4KA 3HUEA 1ZICA 4CU2A 3N39C 1QYDA 3W5UA 5FPYA 3QELA 1YR7A 5DM60 3O6VA 4KQFA 2GN1A 4OHYA 4NC9A 2B2XA 4QFMA 5BOVA 1JHOA 1OAKA 3CMCO 3M5PA 2NZJA 1EVYA 1L5VA 4MWOA 4QL3A 4C0JA 5BW5A 4RXMA 2BFCA 2BTEA 3WK5A 2XUKA 4ZU3A 2QD1A 5HOEA 4XDGA 1WF6A 4JT2A 4ZRNA 3VUFA 5FOSA 5AT1A 4MQ5A 3F5DA 1RRGA 1D2CA 2HJGA 1V5FA 4ZQCB 5FA6A 3R5FA 4BBZA 3DHNA 4B2YA 5D6NA 1R37A 1E5DA 1NVUQ 1SXGA 2H59A 4IJWA 4V2IA 2EFHB 1Q2UA 3RRJA 3UAZA 4RJIA 2X8BA 4C6HA 5KOJB 4U7DA 2V97A 3LPCA 4ZVQA 3SQWA 5E1OA 1UP7A 3QYPA 1W5FA 4EHAA 4W8GA 2HADA 5A5EA 2XVYA 3UATA 3V9PA 1HDRA 1HZZC 1EGMB 2IYFA 3IPLA 3NDIA 1DOHA 5DGHA 3KZCA 1NUUA 4MKFA 4OGGA 4H60A 5TQ0B 1L7XA 2OOKA 4GM1A 4GL2A 1WR8A 3E0XA 1YC5A 2C4TA 1U1IA 5DI3A 2RAUA 3A9CA 1AJEA 1C7RA 2E5FA 1UOEA 4P86A 2A5FA 1V4BA 2Y9PB 3QKTA 1DJQA 2ZRHA 3OOHA 4CMKA 4YO7A 4YUVA 4V2UA 5CBPA 4S24A 1SG6A 2WSSD 2GFHA 3QXGA 4G0QA 3ZWAA 1UK8A 4WZBB 2WRZA 2B78A 2KLHA 4K6GA 4MI6A 1DG9A 1U2PA 4LZLA 3D6TB 3F6CA 2DR0A 2CL6X 2PL9A 3FBGA 1T1SA 4UAGA 4W5TA 3OETA 1XFDA 4PC6A 3WGJA 1XXHB 4XJVA 2GKOA 3ASUA 3VR5H 2UV8A 2XW6A 4O4LA 4ZANA 2EZTA 2VJCA 2H0AA 2ZTMA 5BURA 3QU9A 1X7ZA 2Q3FA 1GEGA 2I99A 4FZRA 2R6DA 2ZRAA 3OI7A 2B1QA 1QVWA 1JRLA 2JHPA 4DA7A 3EIXA 3UTDA 2OUIA 1WPGA 4ZC8A 4QPJC 1ONNA 2PZAA 2E4WA 2Q3MA 4DNOA 4UEJA 1DCMA 5C46F 4WT7A 3ZHSA 4UBLA 1GQOA 1T6YA 3MWEB 3QBTA 5FTJA 3O1JC 1GRQA 2VDJA 5FTNA 1W88A 1S8FA 4K1LA 3VZBA 2B8NA 4ZA2A 5A9RA 1GLGA 1YR2A 2KJQA 3R9XA 3CZAA 3EX7C 3RADC 3FZNA 1GCIA 4L5YA 3GR6A 3HDVA 4DABA 4R7ZA 4E1VA 3OOWA 4LUCA 4Z7QB 2AOVA 3I6QA 4PLGA 3SNHA 3LM8A 4OBXA 1FDWA 5B7GA 4RY8A 4CNBA 5IDYA 1GA4A 1L5MA 3CIOA 4DJJA 4ITRC 3BCUA 1XU7A 3AXTA 2G76A 3HRKA 4FQ8A 3P4XA 3N0XA 1OTYA 2QAIA 1SY7A 1II8A 4KTVE 4BO3A 1IEVA 4DDHA 5K0ZA 3ER9A 4TYYA 2VNSA 1T5BA 5MN4A 3M4NA 5JYCA 4A7PA 1T8PA 4JLKA 5A9SB 3D4BA 3TLJA 5IX8A 3WL8A 4ID3A 2FH5B 3WGHA 5BMVF </