2OHGA

Structural basis for glutamte racemase inhibition
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
264
structure length
263
Chain Sequence
b'MDTRPIGFLDSGVGGLTVVCELIRQLPHEKIVYIGDSARAPYGPRPKKQIKEYTWELVNFLLTQNVKMIVFACNTATAVAWEEVKAALDIPVLGVVLPGASAAIKSTTKGQVGVIGTPMTVASDIYRKKIQLLAPSIQVRSLACPKFVPIVESNEMCSSIAKKIVYDSLAPLVGKIDTLVLGCTHYPLLRPIIQNVMGPSVKLIDSGAECVRDISVLLNYFDINGNYHQAVEHRFFTTANPEIFQEIASIWLKQKINVEHVTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate racemase
molecule tags Isomerase
source organism Streptococcus pyogenes m1 gas
publication title Structural basis for glutamate racemase inhibition
pubmed doi rcsb
total genus 89
structure length 263
sequence length 264
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ohgA02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ohgA01
2GZMA 2JFVA 1IU9A 3HFRA 2JFQA 2JFNA 3OJCA 5HRAA 3UHFA 2OHVA 2DX7A 2DWUA 5HQTA 2OHOA 3OUTA 4B1FA 5IJWA 2JFWA 2EQ5A 1B74A 2VVTA 2JFOA 3ISVA 3S81A 5ELLA 3UHOA 2JFPA 2OHGA 2W4IA 3UHPA 2JFYA 5HJ7A 3S7ZA 2JFUA 1JFLA 2ZSKA 5HRCA 5EVCA 1B73A 2DGDA 2JFZA 3ISTA 1ZUWA 5ELMA 2JFXA
chains in the Genus database with same CATH superfamily
2G09A 1H9BA 5E6RA 1UDWA 1XZHA 4RABA 1JHUA 3SBDA 3HHEA 4I6EA 4TWJA 4YDHB 1LB1B 3ZVLA 3IJ5A 3M6VA 3ZX4A 4YMUA 1A96A 4LY0A 3DC2A 2QW1A 2GM9A 4B83A 1FFAA 4G81A 4X1KB 4NYIR 2A8YA 4O33A 4QEZA 4MW4A 3IE1A 1P7CA 1YS1X 1W4AA 2EBUA 3HUEA 5CITA 5EJGA 3RQIA 2J3EA 1DC4A 3RG8A 1SOAA 2G67A 2WF5A 4XM0A 1YD7A 1Z74A 2X14A 2FPXA 3GLIA 2CV0A 4RQTA 4J1NA 2DPLA 3R0ZA 2CXOA 3KV1A 4IP0A 4LVUA 4ITUA 2Z08A 1TMYA 3KLNA 3UC5A 1VGRA 1D2RA 1GRNA 1WCYA 2GZMA 3AILA 2NPFA 4DIBA 3E03A 1T25A 1GFSA 1U2SA 3H18A 3T3GA 4PN3A 1Q2UA 4L02A 4JT9A 1R4NA 4H15A 1ADGA 2R6GA 1XDWA 1G6Q1 4OJKA 4Q4CA 3HXMA 5B1SA 4QUDA 1R0SA 1IOLA 1RZUA 4FW9A 2C2MA 5F1OA 2ZJ7A 3BEOA 1AZLA 1NOKA 2CHUA 3TI7A 1Z68A 5A3QA 1JDPA 1YL5A 1ULSA 2OE2A 1BU5A 1RFLA 1UPTA 1NW6A 2P4EA 1JR2A 1BXGB 2XD9A 4NZ9A 3FWYA 4MWDA 1P2VA 4MUMA 2O2EA 1THGA 3T41A 5LQUA 1AGRA 5CPBA 5CB4B 3RUFA 2CY0A 3JYPA 2Z2IA 2AS0A 3C3KA 3LNCA 3M82A 3Q7EA 4ZQFA 4HDSA 4BBZA 5I01A 2I9KA 2AQHA 1KY4A 4A3SA 2A9QA 5HKLA 1FTYA 2WYHA 3AP1A 3A9SA 4UZEA 4RDIA 3L4KA 1Y33E 3IB6A 1NVKA 1RRFA 4EB6A 4ZYXA 1KI4A 1HXHA 4HFJA 3Q3EA 3ANLA 4RETA 1CJKC 1WPXA 1IQRA 4AJHA 1OLOA 2DM6A 1SXHA 2WV9A 2EFGA 2PWZA 3PE3A 2K6GA 1ZINA 3CSUA 3LK7A 3DE1X 2ZPAA 3OQPA 1H5UA 2MSCB 5A4KA 1SC6A 1L5VA 3A4TA 3OPYI 2X9LA 4F3KA 5IBPA 2VAWA 4C7OA 3C6QA 1JSRA 1JL3A 1TD9A 3K09A 3T1OA 4IXWA 1QDUA 3A04A 5BSRA 3WB2A 1CJSA 1I32A 3N28A 3HYLA 3RBAA 4W8GA 4BE9A 4DQ0A 3NGLA 1GLVA 3H2GA 5JY1A 2X8JB 3JU3A 1JKJA 4M0MA 1SPBS 4CMJA 1EXMA 2H51A 2YWCA 3B1JA 2ZWVA 3FKQA 3R3SA 4QJ5A 4CMIB 5KDDA 3SWWA 4B4DA 4M8IA 1Q1QA 4Q9DA 5B1HA 3G5MA 4KQXA 1ITZA 3G1WA 2A94A 2XHEA 2CLEB 3GUCA 5C5CA 2C3UA 1SC4A 2OLJA 5KKNB 4QKQA 2GWRA 2YUIA 5LNK6 3MSCA 3C8DA 4ALJA 2O8BB 2WWWA 3FMIA 1A0OA 3N74A 1QGUA 2I5PO 3FWNA 3W3AA 1Y1LA 1ONBA 4E6EA 3DTVB 2REQA 5KQRA 4MR8A 2Y1XA 4DCVA 1DBQA 1SU7A 2P9YA 4CN9A 4QOGA 2HCBA 3LZDA 5CW2A 4IZHA 3QSYA 4FYHA 1CY7A 2AZXA 1O6CA 1VGQA 2C57A 3OE5A 4IIYA 1A5AB 4MIEA 4R9SA 3ZVRA 2Q8QA 2UUBB 3NV9A 2HADA 3SIRA 5HJEA 1RBZA 3OT1B 3ZZTA 1WCIA 2AOXA 4RTKA 2CWDA 1V2HE 3DHWC 1GCOA 3P2YA 5CLLA 2BFEB 3LIIA 1BSVA 1VLLA 2FKAA 2O20A 1NC1A 3R3XA 1S2MA 1W0JA 2XUJA 4PAGA 5E1OA 4WADA 3VH4A 3TQSA 2QAGA 2NXJA 2CDRA 2E4XA 2VBFA 3NAGA 1W52X 2KLHA 3UTCA 1GCGA 1UFVA 4BJHB 2R4TA 3RJMA 2BSXA 2NYRA 3BWEA 2N75A 4FP9A 1G64A 1NQVA 2JLAA 4URHA 5THKA 4DMFA 2DPGA 2JLWA 4QPZA 1PWEA 3F3SA 1CT9A 1L4UA 1TX4B 1M2OA 4ENRA 1BMDA 3N9IA 4F60A 1N6PA 3H7IA 1Q74A 2ZYRA 3QUQA 2YWFA 2XCQA 4N5LA 2JGLA 2V6MA 3OIYA 4MS3A 4GEKA 1H2WA 1RE0A 4YWJA 2VJPA 5EGSA 3KE9A 2Q4RA 2WWTA 5CAEB 1FQKA 3D0OA 1CRZA 3W90A 4OVKA 5B7GA 3QEOA 3GFFA 1P3DA 1ULBA 3DDCA 3RKSA 2MJLA 2V97A 2WU8A 1GTJ1 1I1NA 2C92A 2YOHA 5B1DA 2HJHA 4JLOA 1KS2A 4MKFA 3NHPA 4HQLA 3A3KA 1UAAA 2NNLD 3F3KA 1NW8A 1LFAA 3MRSA 3PP8A 1ZI6A 3P9ZA 4WOCA 1RXWA 1F9AA 3R2JA 3VZRA 3JQ6A 5K0FA 3L41A 3ER9A 2WTNA 4CTKA 1FNNA 3T5TA 1MCZA 1KMCA 2X0NA 4F4DA 2XMSA 4B6RA 3UMBA 3RTCA 2LCFA 2ZU0C 5C8YB 5LKRA 1AIPA 2A84A 1JDBB 4UNPA 1U8TA 2FX5A 1KRHA 2CDNA 5KQMA 1ZDMA 2XQGA 4X97A 4RE5A 5TR9A 3MB5A 5DHTA 3ZJ4A 3FVVA 2QMYA 1B0AA 3IUEA 5BW6B 3HU5A 2Q9BA 2NQ8A 2P3QA 3QF4B 3LY9A 4OYHA 3VI3B 2V74B 2XUIA 1U99A 2DAPA 3PLRA 2VPQA 3RUAA 2V7VA 1U90A 1XEWX 1U5BA 1WW2A 3IKJA 3PC3A 1DKUA 1FP1D 2I4OA 4GVPA 3CR8A 4TSFA 1Z35A 2VYND 5JFGA 3WNBA 5JH7F 2VCEA 2HU2A 5CVJA 2QR3A 4PYMA 4E2ZA 1KIAA 3KQMA 1GDDA 1I2ZA 2CVQA 3BK1A 1CNEA 4NLLA 4LJSA 4QGHA 4F4IA 1QKKA 1PNRA 3CS3A 3N7TA 3MWEB 3K0SA 4J7UA 1KOFA 1SOWA 1E6EA 5JQGF 4UPEA 1SIUA 1DUVG 1GPLA 3A4MA 1XJWA 4B73A 5IULC 1ZJ5A 2FW8A 4BB6A 1OI4A 4OAQA 4UMDA 1CZRA 5ESXA 4XUDA 1I3CA 3BH6A 1B0UA 1UBGA 2OYSA 8ABPA 5CCEA 4KPFC 4GOJA 2V4MA 2H29A 2QLTA 3FPJA 2YHBA 2CVHA 2BCEA 1UBMS 3GFTA 4WDQA 5EWJA 3ROMA 4ZXFA 4BMOB 1BE8A 4NYIQ 1PVVA 4RSGA 3T1NA 2C5FA 2XQFA 4JK3A 1UBOS 1DL5A 1ZMTA 1GQFA 2Y3IA 2ON6A 1OH6A 1X9GA 4NF2A 3ZIUA 1CRPA 1H0RA 3HSYA 3ZV6A 3JZIA 4BO8A 3MRTA 2I34A 3MLBA 1NMSA 2LDXA 4PGFA 1NU6A 4F0JA 1IEWA 1XTKA 1J09A 4J0FA 1V35A 2ERYA 4G0PA 4WKPA 5CJPA 3ECSA 3VHLB 2WB2A 1E1CB 2XVYA 5ENVA 1T6XA 3G0OA 2WFAA 4DOMA 5LBIA 1TQ2A 2G8NA 4CGYA 1SJ9A 2DH5A 5HGJA 3KD2A 5DP1A 3JALA 1LDEA 3JQ7B 2I7CA 1YR7A 2Q27A 2Z98A 3IAS6 1H2ZA 3KJZA 4MRMB 4OBXA 5JJIA 1QC5B 3BK2A 4BVLA 4ENTA 1T3ZA 2R2GA 3K0KA 3T5PA 3I23A 1BS2A 2IDJA 3B89A 4CQMA 3O4RA 4F06A 1XD9A 2PKWA 3KU1A 4KQKA 3EC2A 3IXQA 2NUPA 1VYUA 2QX9A 4LUCA 1PN3A 1E7MA 4BQPA 4HRYA 4TTAA 1MQ8B 3PA8A 4XPIB 1PJQA 2EGGA 2FWPA 2KBFA 3QWHA 4D4GA 2BD0A 1F8YA 2QR2A 5CH5A 3WFJA 1Z7BA 2JBHA 5FJJA 1ZN2A 1UEJA 2GMWA 2QD5A 2XJ9A 3E8XA 3LHKA 3BRSA 3LSTA 1NNI1 2FN7A 3RUIA 2XCTB 4CNBA 1IVYA 4Y2YA 5BW5A 4QBIA 4I1YA 3TR0A 3VU0A 4C7XA 5DM70 1XKTA 4NCKA 4CQLA 4ZU3A 3X1DA 1HYBA 1DIGA 1G0OA 5E9QA 1EEXB 3CX4A 4C1BA 3F7MA 3N2IA 1M2VA 3RS3A 1KYYA 1LF0A 1WO8A 4OI4A 4YJ3B 1MABA 3CHYA 2GDJA 2P6NA 4HAUA 3MPOA 3OPNA 3GVIA 4IL5A 2ZRKA 5DMHA 1MZVA 3TLMA 4BTEA 4D82A 3WHPA 1YDGA 1EJBA 2VR1A 3EQ9A 4UNQA 1G21E 4IGEA 3ZLVA 5B36A 5CXXA 3ZWNA 2G83A 2HLHA 3S6JA 3ORSA 5JG7A 3CO5A 4WX2B 4FHGA 3LO8A 1N2CE 4XJVA 4GYJA 2ZVQX 4L22A 4QXPA 5CAEA 1O95C 1D3AA 2O3QA 1M2EA 2EFEB 5KYTA 4J3FA 1D6JA 3DUWA 1S7CA 3O74A 4UW9A 5ALNA 1RKVA 2ZJ0A 4I4TF 3MFQA 4IIDA 3AKCA 3OZXA 2Q4DA 5IUNC 5IWAB 2IWRA 4Q1DA 3RBXA 4DMRA 4RFSA 3EYWA 2WY2D 1CQIA 3WGNA 1TKCA 5JJBA 3I04A 3A36A 4GBJA 1IQ0A 1ZXBA 4LE2A 1R0BA 4Z9XA 1ZD4A 2FPOA 1RYYA 4B6FA 1IEVA 4BEBA 1Y42X 4TRJA 5DLQC 3R1IA 1P5ZB 1PW5A 1V39A 1VKOA 5I9BA 5EJAA 4NEGA 1WKVA 3HCRA 4MW0A 3TLKA 3LSYA 5LMUB 4FFDA 4LMRA 3VGJA 1DU4A 3JZMA 4DR1B 4DPKA 2BAGA 2Z1MA 4JVOA 1VQ1A 3U4CA 4DDWA 3LBNA 1G16A 3HKCA 2WLTA 1JDTA 5CX1B 1KSGA 1ABBA 5CIQA 1M8JA 1P33A 2VDWB 4UEJA 3H0CA 4BRZA 4EQZA 1BD3A 1VPLA 1YMUA 5ABPA 1SXGA 4JNKA 5DCUA 1Q7EA 5K51A 3WMGA 4X62B 1GAEO 4L76A 5E7JA 1MO4A 4G0YA 4C7KA 4P4GA 3IILA 4A15A 1Z8DA 5A6VA 4WJKB 3S40A 3LYAA 4QREA 1UKCA 2SCUB 2X0RA 4QDXA 4JL6A 4TGLA 2E5LB 1MIOA 1QRRA 2AR9A 1UMCA 1I13A 1U7UA 2FXVA 5JFOA 2JD0A 3BCSA 2YS7A 5B57C 2HSGA 2WHQA 3NFYA 3NM4A 2Q5EA 1ZM9A 3L7MA 4JGGA 2WI8A 1J97A 3ZD7A 3SX4A 1B6TA 4EAAA 2X76A 3IQHX 2FWRA 4G36A 4DRXB 3LWDA 4YXWA 1QYCA 3R5JA 5LP1A 2ZRGA 1SCUB 1AJEA 2WUEA 3LQ1A 1DNPA 2EZ8A 4D5EA 3ZTWA 4G9BA 4NE2A 1DRJA 2BE7A 2QRGA 1J0DA 3ABIA 3AY0A 3PWTA 4OQXA 4W1RA 1PTKA 3VFDA 5DGXA 3JSAA 4A8HA 1UK8A 3OICA 5AVYA 4GLLA 4YAIA 3QVXA 1L7DA 1NF9A 2I87A 1JQKA 3DO8A 4H6XA 4ESVA 1XTSA 3GIDA 1ISHA 5KTRA 3THRA 3G9TA 1A2BA 1FFSA 1QB7A 1FQWA 1XTVA 2JIRA 3F96A 3GF4A 4LWQA 5E1MA 3U3OA 1QG2A 4LHSA 3ZGXA 4WINA 1G19A 2X58A 4LDJA 1NE7A 2HBRA 3IJPA 1IY9A 1Q1EA 4KN9S 4H0FA 2VWGA 5KQLA 4UOEA 3EVNA 1H0KA 3FFAA 4AJPA 5JALA 2JLXA 3W9YA 4I55B 3SEQA 5DCYA 3DLAA 3Q1KA 4OHBA 3HPQA 5G1NA 3O5AA 2F62A 3ABZA 1DAFA 1JIXA 2PDAA 3LKBA 4FINA 4G24A 4DUGD 4JI3B 4WHMA 5IN4A 2YZMA 5KCZA 5DCLA 2VJMA 3K5WA 1PCXA 2FN3A 4A0HA 4OBBA 4DB4A 1UP6A 1YK1A 1ZGCA 1DHTA 2XSZA 4AF7A 4WAUA 2VRCD 2GESA 4KOEC 1JNYA 1OBCA 1XRLA 5I9LA 2BKLA 3CX8A 1Z26A 3V7WA 3IA2A 2R62A 3OE7D 4FDLA 1IUNA 2ZE6A 2RE8A 1KVSA 4GX5A 2LZ0A 2PMKA 3UAGA 2P75A 3H2JA 1MXHA 2H2GA 5G0UA 2A7QA 4BE4A 3EGEA 4H31A 4BWVA 1KVRA 1CUIA 4L8YA 4Z9AA 4BLPA 3K70D 2LXNA 3OG9A 4QYMA 1UDAA 3OI7A 2E4VA 4JLVA 4JEMA 3IT2A 2NACA 3DHNA 1R00A 3PGA1 4A7PA 4B1FA 4C21A 3ED5A 3ZU6A 4DGQA 4LHWA 2J3LA 4JUFA 2WNSA 4INPA 4DLVA 3FHJA 3ESRA 4MLCA 2H0RA 4XWTA 2E6KA 5DTIA 4DUYB 4HAWA 3F6EX 2QAJA 5KNCA 5AVRA 1DIOB 3HGQA 1A04A 1OHHA 1DJLA 4KLNA 5J4VA 1FYDA 1E6CA 4L4SA 3TIFA 5LXTB 3UMMA 2PX2A 1F6WA 4HO1X 4M46A 4MUBA 4DSAA 3G2IA 5JH7A 2O0KA 2ZUDA 4D26A 2PS0A 4X85A 4N47A 1KK3A 4PAOA 4PWYA 4POOA 4ZGBA 3S8YA 1C7QA 1F3OA 1UWCA 5EXSA 4UASA 1PNVA 2WM8A 1P1BA 4XLTA 3IQGX 1FU7A 2X3YA 3M4JA 4BY9E 1ZOIA 2X8AA 3CKKA 1HT1E 2UV8A 1U1CA 1ZGJA 4MVJH 1NYRA 1XFAA 2WINI 1DTWB 3NLLA 3QPVA 1U2EA 4MUYA 3K70B 2BHLA 1OLSB 1NW4A 2WU4A 3C3PA 2JAHA 1VLQA 2VNIA 3W2EA 4LISA 1Z62A 4JBHA 3FYTA 4NMHA 4PX5A 4KQ2A 1GR1A 5ICCA 2FR0A 2ZRDA 3DYBA 2FN4A 1K4YA 3MCUA 5LKAA 2YINC 2ODWA 3MWYW 3ENZA 4ZICA 2QVCA 3PEVA 1IZ8A 1YONA 2HUNA 2HGSA 5IMSA 5M2QA 4EYSA 4AMZA 2J5QA 5CUQA 3BMOB 4GECA 3WYFA 2GBLA 3OLYA 1FS5A 1WOMA 2B98A 4BNYA 2GEDA 4CMCA 1GNTA 3IMGA 5TT1A 2F1RA 4MUKA 3E5RA 4JB2A 4UKDA 4Y1FA 1IWPB 1I0LA 1U2TA 2AN4A 3OCXA 3H2YA 5AI0A 5J40A 3V4VB 3IAFA 4LV5B 1N6LA 2FP4A 4CTJA 2AEJA 5KQSA 4IUDS 5LIPA 1XO1A 3O1JC 4G9EA 1UBKS 1U0HC 1WZIA 3JWJA 2D2XA 2O3TA 2J48A 4PIMA 5AQEA 4AJ9A 3H7AA 2P2DA 1LW7A 2OHFA 5EXXA 4DJJA 5HGXA 1OMOA 4EB6B 5JXGA 2QX6A 2CXXA 1JIQA 2W8BA 5JEEA 1GFIA 1XA0A 3KSRA 1D2MA 1ECFA 4TPKA 4C29A 5L51A 4N76A 2W22A 3UH1A 2VZ9A 3OZRA 4KMRA 1TZMA 3D54D 5TPWB 3WZMA 2AK3A 1RPZA 5E9JA 1CY6A 3IIKA 3KYJB 1AKNA 3P2IA 3EA4A 5HFAA 4C4SA 5AUOB 1DGQA 1NN1A 3QZUA 1S4MA 1P7PA 1ADYA 1RP7A 2FAXA 2PWYA 2Y99A 3N58A 4R2KA 3STUA 5IBCA 2FZWA 5J3JA 3RHSA 2CHFA 3KZKA 3H3FA 4R31A 1HL7A 1U9JA 1TIKA 4PC3A 4FLMA 3VR1A 4CV0A 4BNNA 2PS3A 1E3EA 4ZZ1A 1N6IA 1R4MB 3MN1A 3OOWA 2W2VA 4MHSA 3RQSA 1VP3A 4AUKA 3QE9Y 1ODTC 2IEZA 3ONWA 2HHCA 2BFWA 1UANA 3FPEA 3QMMA 1XDUA 2AXQA 4OGGA 1THMA 5K0NA 4PSUA 3VDNB 4ZVLA 2DKOA 3FPHA 1UF9A 1BX0A 2KHZA 1WCV1 4K6HA 4MV6A 4IVQA 4YO7A 3REQB 4BNLA 3AESB 5H4GA 3RRBA 5JMTA 2GK4A 2IIBA 2VL7A 3KSMA 3NAQA 5KSYA 3NJ4A 2VHJA 3EIQA 1MIHA 3Q0TA 1GNSA 2L2QA 4JXJA 2ZVPX 3F7TA 3V9AA 4LMAA 3SLGA 1KDYA 1T9KA 5JAPA 5H68A 2GZ2A 2Y05A 5DWVA 5G3ZA 4DEXA 1SQSA 5TVKA 1Q0ZA 1MMFB 4PZAA 3OT1A 5HKAA 2XI4A 3E70C 4GNRA 4ND5A 2YYSA 1X7XA 2GYUA 3OCUA 2B83A 4HWRA 1N9GB 3ILYA 3S1AB 5BUSA 2F3QA 3E05A 2C1EA 4KBFA 3KXLA 3DD1A 2XCOA 3QLVA 4GICA 5CVDA 1U9IA 4CTMA 3RYIB 2IEDA 2R5NA 2GM3A 3I1IA 5JSFA 3MCWA 2W98A 2ZI4A 3U3DA 1EUQA 1QONA 2BGRA 3HCBA 4QTYA 1NA5A 3ZWQA 4MYSA 4QOIA 2GPJA 2XOKD 3QVOA 4DJTA 3FOFC 1KL7A 3OZ7A 1E7WA 4ZTUB 1M2GA 2C29D 3QF4A 2WA2A 1JEQB 3CF6R 3LDAA 1I80A 1QFSA 1KGSA 2B82A 2W58A 3DZDA 3M89A 1T13A 2OSVA 3HXQA 4KPYA 3Q3JB 4EG4A 5TIIA 4X1OA 1R6XA 1YDMA 4EUEA 4S2EA 2VO1A 4GXTA 3EHEA 5GP1A 4D9MA 1NQWA 2VSYA 1J6UA 1LLFA 3K2BA 4WESA 2GO1A 4G0QA 3PWSA 1JVSA 4M8NE 3U7QB 1P1CA 1T35A 1FVHA 5D51S 5EXEA 1TYBE 1UKEA 3M5WA 4KLZA 2XBMA 3Q3VA 2A1IA 1KJ8A 2G88A 5U9CA 1MKYA 3AVPA 3O83A 2GNPA 1LW6E 1JTFA 4B5LA 3CA8A 3A6EA 3KLOA 1RPAA 5B4TA 2HSDA 1EBUA 5AW8A 1GSHA 1CEYA 3FZEA 2WYIA 4UDNA 1XOIA 4BQOA 4MV8A 3TIVA 1Z5UA 3AETA 2NV2B 4ZOBA 3TLYA 4C43A 4KW7A 2R7KA 3PNOA 4MMXB 1Y7PA 2E1PA 2GVNA 1DOHA 2X2FA 3LKZA 4EYGA 3DR3A 3T1VA 2H0QA 1SIWA 4PC7A 4QDTA 4MDEA 3H4VA 3B9BA 4PU0A 2OQRA 1XEAA 2ATEA 1ZK4A 2ZRQA 3F7NA 4ZHSA 4Q1EA 3SVZA 3ZGVA 3KXPA 1F06A 4DJEC 2MYNA 2NU6A 4H7KA 4JJ7A 1ZEMA 4JXZA 1P44A 3KHKA 1U6KA 4IFIA 4KYTA 4AT1A 2AHOA 5DM4A 2DFKB 4E30A 4ISCA 4O08A 1KEKA 3ESDA 1L7RA 4HDRA 4CM4B 3T7RA 3FTFA 2I3GA 1C1HA 4UAUA 4PTLA 2GHIA 1OBVA 2JA1A 1YB4A 2JGKA 2BZSA 4R1MA 4F46A 2PD6A 1BNCA 4GKAA 1WEKA 2R1TB 5JT1A 3NZEA 1BYIA 4B2PA 4AN0A 1NVEA 4K88A 3I4FA 4M9QA 1K3TA 3GVXA 3OJFA 1HOTA 3MHPA 1OR8A 2XQJA 1N5MA 1UUFA 4FOPA 3B85A 4HNTA 9LDTA 2I1WA 4Z54A 4RZHA 4X1IB 4E7PA 3AUAA 3OJOA 2ONYA 2QTRA 2XDQB 4QBKA 4XXHA 3GNTA 3DDUA 3CTMA 4IIXA 3O8CA 8MHTA 4TVSA 1KEUA 2V0NA 5A5VA 1VYVA 2MIIA 5JDIC 4LDNA 1YA8A 4IJ6A 1RWPA 1ZU5A 4GI3A 1Q77A 4QATA 2BJWA 2JFGA 4I9NA 1Z63A 2AD1A 2ODEA 3EF1A 4E5UA 4XQ0A 5K99A 2QTVB 1QIHA 2ZE5A 4MR7A 2AJTA 2FQQA 3TLJA 3GLKA 2JGRA 3DNMA 1T2CA 5J43A 2W71A 4EW2A 3EW7A 4KVZA 2YRFA 3PQCA 4HLUA 3DQQA 4KREA 1P3Y1 3VR3D 1WUIS 2BFDB 3GYBA 3TM4A 1EGHA 1P39A 1T29A 2XDYA 1G8PA 1M7HA 2YVLA 3ZN2A 1E6WA 4B7ZA 2FUEA 3AIMA 4AU1A 3KZ1E 4XCVA 1FOEB 5I4KA 5BN3B 5IJ0A 3M6WA 1M75A 2PQMA 2XKAA 2YVAA 3K92A 4MQUA 4HDMB 4H1WA 5T6MA 1KVUA 4OSOA 3OX1A 4XGNA 2R1VA 4KQGA 3OIUA 1NVVR 1ZUD1 2AR0A 2EG9A 4U7GA 4ZARA 4ZWNA 4C88A 1CLUA 4B6SA 4ZZ0A 5LQMA 1NXWA 3BCHA 4HGZA 1Z4MA 3HFJA 3L7CA 1IG3A 4WFKA 1N6NA 1Z2NX 2FUKA 3B6IA 1XLTC 3FLEA 1BGWA 5LQSA 3K71B 2JFOA 5TJHA 3VAZA 2AWOA 2VH2A 5A3RA 1EVYA 1Y3IA 4BQFA 1M6HA 2D7CA 4DA9A 1KI6B 1W4LA 4Y6SA 4LK3A 3IELA 4AMBA 1GEEA 3IDFA 1OFIA 2O0JA 1PF7E 3FDZB 4BASA 3VKVA 4OY3A 2AN1A 4LE1A 4EMUA 3A06A 5HKKD 2G9QA 1S02A 3LXRA 3ROGA 2R7MA 1EK5A 5DF1A 2C07A 4FW8A 1PJCA 3V1TC 1J2YA 4K3UA 1S2IA 2A0WA 2CXRA 5KHOC 4PFJA 1BS1A 1FFXB 5GZ6A 4JWTA 3AKYA 3JWIA 1JYSA 4MUEA 1ULUA 3LFTA 3TTWA 3VO2A 1E77A 1PGPA 1V37A 3N0RA 1E6LA 1HE8B 2X2EA 3PGKA 1KJNA 5LZ4A 4BXOA 3JATB 1AV6A 4Q82A 1US8A 4LDZA 4ZOCA 1E3LA 2Y71A 4MAMA 3PF8A 2FMHA 1V4BA 2DGDA 2VJMB 2YMQA 1QQTA 2BHRA 2VJAA 5IT9A 4DV2B 4AI6A 1T5BA 2QTFA 1MT0A 1LPMA 3DDNA 1OZFA 1PS9A 4PYRA 3RC1A 3U80A 5I48A 4P0QB 1ILEA 1O95D 3WIDA 4YDQA 3GFRA 5E0KB 2FHSA 2C9ZA 2R85A 5HNKA 1CTQA 1S4QA 3JQ8A 1XALA 3I8OA 2IE0A 1GZ5A 2GCIA 4RA6B 2YY5A 3BXOA 4M4SA 1O77A 2NO5A 1HYEA 3GJYA 4ZO8A 1N2ZA 4XPIA 2QSZA 4CEJB 2BTQB 3BHNA 4B3GA 4J4HA 4RZSA 1N0IA 3L0ZA 2XUDA 2ZXEA 4ZVKA 3CSDA 5SV2A 4CKBA 3O8RA 1ADJA 3ZKAA 1QB8A 5KYVA 3VPCA 5J1TB 3RROA 1P18A 2P5YA 3KWMA 5E2AA 3AFIA 3TZHA 5DYYA 3R3ZA 4B9AA 5CBPA 3NQ41 4Z0TA 4CZ2A 2WDPA 2ZP1A 3NORA 3FD8A 3OLZA 2FSGA 2IYPA 4QOSA 1GQYA 4OHUA 5IP5A 5LQKA 2PIAA 1H2FA 4M99A 3D4OA 1EWVA 3ON5A 1FRVA 4BWGA 3LRXA 3LT0A 1LPNA 3DTVD 2J0QA 2BONA 3RJZA 2GFIA 3A4LA 1K8QA 2NWQA 2GARA 4TVKA 4Y6GB 3TS1A 3OWOA 4HP8A 3AUJB 2D0PB 5JAIA 4MSUA 4YXWD 1ZD9A 2DLNA 2NZ2A 1CF9A 3LBHA 3QMVA 2AFIE 2V1XA 5B1EA 3K35A 3ZXUB 1NDQA 2K7ZA 1ID8A 5DYGA 2DB3A 4HV4A 1RHMA 5L9AA 2D6FA 1CHDA 2X1HA 3DOJA 3F5MA 1AO3A 2CNLA 3IVXA 5FUBA 3QGMA 3T95A 4WFIA 4BP3A 5BYJA 1K8RA 2ONJA 4D8VA 4N5HX 2HBYA 4P3XA 3FR8A 4W1SA 5GV8A 5H80A 4JKYA 3V7FA 1ORDA 2R6JA 4F04A 3FY4A 1VHLA 2DULA 4M60A 3TLZA 4A1FA 1BX1A 1QNFA 1YQDA 3QE4A 2Q9UA 3EFHA 3BXFA 4D42A 1PFVA 4D6PA 1X7DA 1E9DA 5IAGA 2BKAA 3P2EA 4FFOA 2ZAYA 1EG2A 1F6DA 2BW0A 3Q5EA 4DLAA 1R6AA 2XZPA 3ONFA 4NZZA 1ZJZA 4AUMA 1IZYA 5A5GA 1P17A 1GSIA 2JNWA 4KAXA 1C80A 3V5NA 5JS8A 1F17A 3DMRA 1Y37A 2INGX 1NTOA 2P3SA 3NNNA 2WVHA 4YT4A 4AYWA 2LGJA 1PJZA 2ZANA 3HCFA 3RBVA 3TCNA 3WIVA 4OA5A 4OSEA 2WJGA 5K05A 5KNDA 1C3VA 2IL1A 3IEVA 2JFBA 3MGGA 3O1HB 1T8PA 5CLHA 2M32A 1KEPA 1ISPA 3DULA 4K40A 5SY6A 4PZ0A 1RQGA 4AVYA 2IDZA 1JFFB 4WFQA 4RTQA 1D5CA 3Q8XB 3DB2A 3CV3A 5CFLA 2R68A 5LU9A 4KX3A 4YV7A 1WXWA 1PQUA 1TA9A 2AG5A 3OVMA 5K3FA 3UPDA 2A92A 4F93B 3NPMA 5BNZA 5FBWB 4K1XA 3DVRX 3D6JA 1N2EA 4D45A 1YAHA 3W5VA 3KEMA 2NOAA 1OXVA 1JFLA 3KVRA 1U4OA 4W9NA 2HMTA 2JJ1A 2CZGA 1ML3A 4P80A 4BFLA 7REQA 3DE2X 4CT5A 2BFBA 2FR8A 2HSEA 2O0HA 3OFKA 2I2CA 3QLVC 4R1SA 3ZWYA 4ZOLB 5EMKA 1CULC 4M86A 4V2IA 3ZWVA 5ITVA 2EBWA 2AW5A 2F9FA 3OCVA 2Q2VA 4OB7A 2HJVA 1J2UA 4MQFB 1BHJA 2PYDA 1JR4A 3IAUA 3AJAA 2PTHA 2BY4A 1W4ZA 5IF9A 1ONPA 3SQLA 2Q28A 1TLLA 3TX6A 4PC1A 3OX2A 1P0FA 3HVRA 2BEKA 2PSSA 1BTOA 1RIIA 3HCAA 3KQWA 2JHFA 4H4EA 4RJIA 3I6YA 2AC4A 2W4IA 2X2PA 1ISIA 2QGFA 3EAFA 5J47A 4IJKA 2V3CC 1Z5PA 1YRWA 2BI8A 2AGVA 4ACAA 5DBIA 1IN7A 4AQYB 5KX5A 2VF2A 1OAAA 3PFCA 4MO2A 3RVOA 4O5AA 2GFHA 1NBMA 4CM6A 4H3SA 4TQGA 3A14A 1YC5A 4QBGB 1DIRA 1GO2A 1GFWA 1Y5RA 1K97A 3I83A 1H9AA 3BWDD 2QN6A 3HDHA 4KWIA 4X44A 3H1GA 3EZGA 5AM5A 4HDNA 1UL1X 4LOHA 4PXYA 3ST7A 8OHMA 2FWMX 3OSZA 1U7HA 3LPMA 1TF7A 3OFVA 4TN5A 3DYVA 3IE0A 1K08A 5DW3A 4BMSA 4QLAA 4WKOA 5BN1A 3KELA 5SZHB 1OI7A 5U4QA 1L1QA 4D0LB 2XCLA 2VBIA 1UC4B 1P1FA 5GM2A 4Z8YA 2NTYC 3ZNNA 1BN7A 2E9SA 2L69A 1BXZA 1BRTA 2OORA 3OZDA 5F5NA 3W8RA 4TX1A 2RGGA 1VRWA 3EASA 4II7A 4BO6A 1XTRA 1ZKMA 3A6PC 3JQQA 1JP7A 2GASA 1Z7WA 3EHDA 3MJRA 3R7NA 4JJGA 5ECWA 2OG2A 2QRZA 1CQPA 3JQFA 4ER3A 1U0NA 4IIFA 2JIQA 4IGKA 3LLSA 4ID3A 4MRRA 4EB8A 4ZFNA 3RF6A 3E15A 4L0MA 1UK9A 5EIWA 1DS6A 3GG9A 3FHLA 1KMIY 1JG2A 2WWRA 4GZLA 1C9NA 3G23A 3WJ2A 2QN3A 2C42A 4D4IA 1VLJA 5ECYA 1YB6A 3LG2A 4HGNA 2XIJA 1PK7A 4IJQA 4ZAXA 3ISVA 3ZJVA 4G0MA 1VBKA 3L40A 1TEVA 1ZK3A 4YV2A 2ECPA 3JQAA 2GBLC 2GN1A 3A7EA 1WD7A 1UBCA 5K8CA 3ZE9A 4F92B 1ECPA 2IUUA 2W6ZA 5H1YA 3EIWA 2DETA 4M1KA 1PX0A 4FSDA 3SS9X 3X44A 3C3YA 2GPSA 1PTJC 1V5FA 4HADA 4IIJF 4LRWA 4YACA 4GNKA 1KZ7B 1P7ZA 1JAHA 1WVGA 1TT5B 3GDFA 4P5EA 3WLKX 1VL0A 3ROXA 4JASB 1NZDA 1BKDR 1X74A 3PS9A 4MYRA 5DB4A 3R41A 3RRJA 2DU8A 4HUQA 1L1EA 2D1FA 2VCYA 4KE8A 2RCNA 1Y3FE 2WUDA 1C81A 1YKSA 4YBZA 4IV5A 1CQIB 2Z3WA 2ZVJA 5AXCA 2PR2A 2NM0A 3RADC 3DEFA 4L5YA 4MOWA 1QVWA 2X41A 2P30A 2ZBPA 3HYRA 1Z28A 2OZLB 4PR0A 1LU9A 5JECA 1B6SA 3AZOA 3L7YA 3WLAA 1C3OB 4RORA 1JPUA 3H8VA 4AP9A 1TVEA 2BBWA 3AVQA 4HB4A 2R44A 1E3MA 3ROFA 3R0JA 5TC4A 4QPCA 4FIZA 2C0PA 1M6VB 3WRVA 4U9HS 5GZ1A 4IH1A 3HB1A 4JLUA 2OO5C 1FMFA 4AY5A 4MITA 4LF4B 3RNOA 3H2BA 3ZWDA 1T0IA 3NC0C 1OOEA 1XQWA 2A58A 2NTNA 3GHYA 3GFPA 1PGNA 3GI1A 3GRRA 4UXJA 2H5IA 5EZYA 4X71A 1SUPA 1U31A 2R751 2DSTA 5F7XA 3PFIA 2O2IA 2QQ0A 3FMOB 1DRVA 3SE0A 1EDEA 2MSDB 1Z08A 1IK4A 2QSJA 3UJ8A 1L4KA 2Q7XA 3ENNA 2CMKA 5FBLB 3W78A 1BCSB 2UYGA 3VSBA 4ASUA 5KS2A 3E18A 1H4TA 1R0RE 2OP0A 3GUHA 1CY2A 1YJBA 1QYVA 1LA2A 3DQPA 2Y4NA 3CF4A 3ZCVA 1YQXA 1NVXQ 2BJVA 2IP4A 4FD2A 3TF5A 4RD6A 5FWAA 5HMMA 5CB4F 4YPFA 1NN5A 3T06B 1LBSA 1RWBA 3B7GA 2J6CA 3G79A 3TCKA 2G9RA 1DJNA 4CYMA 1G2IA 4CQMD 2IQ5A 4ARSA 4BBPA 1DQSA 2C7BA 4PCVA 1PGQA 1X7WA 3T61A 2J59A 4AKIA 4GX2A 4FX5A 2I2XB 4KPUA 4D74A 5LZ9A 3DEHA 5LMCA 1XVUA 1P45A 3B6MA 3QX7A 3GLFA 1Y5IA 1LPBB 3SOPA 1DWQA 1KAMA 2P4SA 4JMPA 2YFYA 1R27A 1A50B 1UP4A 2C8VA 2Z5FA 3WK5A 1VLZA 1Z5ZA 3D6VA 1V9CA 2R8XA 2P9FA 4H3KB 3R7LA 2ZSUA 1WLSA 4G1CA 4F5YA 1GSOA 4MROA 1LX7A 3VJLA 4E4YA 5DASA 2ZXUA 2JI7A 4MWEA 3B5JA 4XGIA 2XPCA 5ERXA 1JYEA 2EXXA 4A8JA 5BMVA 2QRLA 5L3SA 3ROZA 1SUAA 2AXNA 2X2OA 2PUBA 4HEHA 2KB0A 2YFHA 3F4BA 3UW1A 4DZTA 4HG2A 5EJ7A 2ZB3A 3TGLA 1DC6A 3R75A 2VVTA 3OPVA 5CXSA 5D86A 5FIUA 1P0QA 2EP5A 3A1CA 1KDZA 5D7BA 3WK6A 1JFVA 4LNAA 3BKXA 2QJWA 3VPXA 1C9JA 2PRSA 2R8OA 2G77B 4KBGA 4CPDA 2IYOA 2NU8A 3GAAA 4Q3DA 1J5EB 1RWOA 4K6OA 1CKEA 4CRWB 4L08A 3BPSA 4HL6A 2R3SA 3Q9UA 1Z88A 2Q4EA 4OYLA 4RFLA 1F2TB 4MWZA 4CODB 1QK3A 4LJ8A 3ZDCA 1XCMA 4QU9A 4BPRA 2J6HA 4MI6A 4WKNA 4HXYA 2QDKA 4F2WA 4JOQA 2DQKA 4ZA2A 1C30B 1NQUA 1RBQA 1PNQA 2ZYWX 3NGXA 4JLSA 5C0OE 1YKGA 4BU1A 1Z38A 3KZXA 3EK2A 1FFDA 1SVIA 4GQIA 4GP9A 5BO5A 1ADBA 2C3MA 2B7LA 1E5DA 4MDHA 1PK9A 5KNLA 4MUNA 1WVMA 4ZDWA 3WQSB 3FUVA 3IDQA 4J7XA 4W5HA 2ZRLA 5CNIA 1V3TA 4UOZA 1YS6A 4PG5A 3Q7RA 3BL8A 1DBRA 1RXEA 3GJQA 4MLDA 4RU1A 1TQ8A 2P0YA 2G5CA 2O07A 1JXMA 5DULA 5CLFA 2Q1YA 1WW3A 4XARA 2VHEA 3H9CA 1L9XA 2WV7A 2YV5A 2CHQA 4JP8A 2Y4OA 1OU0A 4FLEA 1RKUA 1TI7A 3HO8A 4LX8A 3PT9A 2DUUA 1GTL1 2XNDD 4BAZA 4Z1MD 3FTCA 2CW5A 4OL9A 4RK4A 4YRNA 4YAKA 3R7SA 2EKBA 1A8HA 3ZCQA 2BFPA 2QN9A 3PL5A 1JA1A 2YC4C 5EFZA 1HEYA 4CLRB 4UE2A 4BP8A 1NE2A 3F0TA 1HKUA 1M0WA 1BAPA 2N47A 3Q6MA 4E32A 1LQTA 4AIIA 2W8BB 2EX0A 4NMLA 3T4UA 4EEKA 1NW9B 2HA0A 1GYPA 3I2FA 4BXOB 4N3NA 3NBQA 1P1KA 2VZ8A 3IALA 1KJZA 1BO6A 1FFWA 1PL8A 3N0VA 2WWGA 4U1RA 4CTOA 1ZHHA 1V95A 1NXVA 2YOFA 2JEYA 2Q1WA 2W5UA 3ESCA 4WOPA 5JSYA 3FVWA 3HDYA 3N86A 3FI9A 4Y98A 1P81A 4EHNA 2OD2A 2IYFA 2YFKA 4J1SA 4O4HA 4CIXA 2QW8A 1W0JD 1P9OA 3D2AA 1TTPB 4IOLA 1PEYA 4XVRA 2IDKA 4KG7A 5CM9C 2DT5A 4IMJB 5LXTF 1H42A 1LVUA 1Y80A 2C9BA 2XUKA 2LDBA 1H1TA 5H7XA 2G9NA 3PE6A 5JNVA 4JLMA 4LJYA 1TCVA 1ENOA 3AVOA 4AN4A 1ULZA 1JFSA 1JPJA 1CCWA 1X1RA 3Q8MA 4YNBA 1RXCA 4PVCA 3NT5A 2OYCA 4F9EA 3CZ9A 4S1WA 4FOLA 1PR4A 3CLSD 4LJ9A 4UE3S 4BC1A 4MPTA 4MS1B 1KJYA 1JILA 3KC2A 4RPKA 1T0UA 1Y9AA 2BF4A 1UPCA 4YI3A 1NVMB 3AHFA 1WZ2A 1SBNE 1KFJB 1OGJA 2WJPA 3GOHA 4Y2PA 4RDHA 2ZRJA 3DBLB 4AZ3A 1ZMRA 2CL0X 3BMCA 4DJ5X 3FCXA 4BIIA 1RJEA 3PPIA 3LO5A 1QH1A 4KSYA 2PUJA 4K0KB 1H1DA 1C2YA 3DT6A 4EQ6B 1NBMD 4F9GA 4XASA 5EKUA 3FAKA 1PS8A 4OO3A 4YMSA 2W48A 3TAHA 1MZPA 1AURA 2IP2A 4WLOA 4Y6RA 3BFKA 3CY6A 3SF0A 5DLEA 1U3TA 1Z7YA 5H16A 2I2WA 4LZJA 3QBEA 5EHNA 1KBOA 4ZKEA 2C0QA 3T15A 2E55A 1FDSA 1EEHA 5LB4A 3C5EA 1MRSA 4KO3S 1CS4C 3WNZA 4D8YA 5HM8A 4U9UA 2IYUA 2ZB2A 5EXPA 3OEHD 1ZL0A 3WGHA 4QUGA 4Z4EA 1F8XA 3OQHA 3AXTA 1KORA 4B4KA 1P91A 2G9ZA 1J39A 1ODCA 2JI4A 3SHTA 3LBIA 5KAPA 1OFUA 2VAPA 4DR4B 2FCRA 4O3FA 4NBKA 3PQ8A 1BHSA 4HZUA 3MUFA 4QE3A 5BWBA 5A0VA 5FWNA 4N5MA 1Q1AA 1XDZA 2B8NA 4NOKA 4CMGA 1G9XA 4KPUB 3H9UA 4Q4LA 3SMQA 4A26A 4BLSA 2XYRA 3AJ9A 5CYPA 2H92A 3RBZA 2DFNA 5JAMA 1CZUA 3R8XA 2F17A 4CM9A 1I3LA 4PQRA 2GK3A 1IFXA 1N5JA 2CDBA 3W5IA 5BV7A 3C4VA 2G82A 1OIXA 2WKWA 4K03A 3AWIA 2E7ZA 4GRDA 5CCDA 3FYUA 5AVJA 4C6RA 1PJRA 4P4LA 3DKIA 2ZWMA 5DYTA 3SF8A 4C3ZA 2ROQA 1ULTA 3TRIA 5K0SA 1I4OA 1XZPA 2BMDA 1J99A 4GPBA 5LUAA 4KK3A 5FHQA 2YHIA 4YI5A 2IS4A 5J2UF 3E7FA 2ZI3A 4IIJB 4O2LA 3KXIA 2OZPA 4FC6A 4IHJA 2V98A 2DHEA 3B5EA 2VXCA 3DL0A 3RUHA 1CUHA 1RJ9A 4US2R 3QEJA 1K6EA 1MVNA 1RAAA 1EE2A 2Q3CA 4GMFA 3LVBA 3M33A 4S1OA 6Q21A 4QJIA 2J09A 5LR6A 2AZTA 3A27A 4J0KA 1RP1A 1TVMA 4HB3A 1I7NA 3N1UA 2ZUTA 4CQLB 3I92A 2DTXA 3KUXA 4ZAVA 1GA1A 3HNOA 3U0VA 4BGDA 2WE7A 3EEYA 3IIJA 3KOWA 1JIVA 5F76A 4P38A 1DKLA 2QG9A 3QFSA 2FPMA 3H5WA 4K7JA 4MX8A 4UUOA 4Z2AA 4O1IA 1TUIA 2BZ1A 2XZTA 3G2OA 2OEPA 2QLLA 5I9TA 5TGZA 4D9BA 1MR3F 4FYIA 4BGIA 4A03A 4BQEA 2GHQA 4Y2XA 1OGYA 4Q7LA 3RABA 2QE7A 3M70A 4PGGA 1E0AA 1C7RA 4ABYA 2WM3A 3H3JA 2Z4SA 5IVIA 3SHVA 4RQUA 4ANFA 1EMDA 2JJQA 4YMVA 5LMNB 2HRDA 3VDXA 1KGDA 4DJAA 4EK9A 5HKKA 1MB2A 4ZAWA 2OAGA 1YH3A 3HM2A 3KU4A 4L5AA 4WWHA 2O5CA 1W36B 2IZ0A 3V1LA 1QX3A 1IHUA 2Z4TA 4F2GA 1RR6A 2FEAA 3KSUA 2I6GA 3D6HA 3HL0A 3EVEA 3AX6A 3USZA 5A3VA 1H0HA 5EJEA 4WKCA 4NJEB 5BSMA 3N2YA 1RHKA 4Q39A 3F1KA 3ZY5A 5LQCA 2YZ2A 2FGKA 3ER6A 1GR0A 1ONOA 3EY9A 1NXQA 1OZAA 2WSBA 5DDIP 1JU4A 3JW8A 2Z56A 2G07A 5JE8A 4R1OA 5L3ZA 1IHXA 2Q7DA 3SVLA 1HFKA 3AB8A 1V8OA 1E92A 3VBCA 3BXEA 3GFSA 2F4NA 4NK4A 4Q4DA 3OF5A 5B58C 2ZJZA 2Z2JA 3ZG6A 3IXLA 1PHRA 3BZUA 2YRWA 1A71A 3AH8A 1B1CA 4FYYA 4NX2A 2V8BA 1S2GA 3D5TA 3IQZA 2H1CA 3WQQA 5BUQA 5KI6A 2DR2A 3A6FA 4RHXA 2EX1A 5LD2B 1RHQA 1U3CA 3JPYA 4GFDA 5SY4A 4LV8B 1WE2A 3K2IA 1SQ6A 1ZA2A 4FEAA 1G20E 2DBQA 5A4IS 3I5MA 3NIDB 1D03A 1W9HA 4N54A 1E58A 1OAOA 5CVTA 3AO0B 2ONCA 3NJ8A 5A3JA 5AM4A 2ZT8A 3B53X 1KDVA 4WBNF 3DEAA 2XUGA 3KEQA 4JJ6A 4RX1A 1KO5A 1J07A 2OV8A 4MVYA 1P5JA 1ST2A 1YI1A 5AICA 4HKTA 1RABA 2NZUG 4OJTA 1ZH4A 3LF1A 2RH9B 5D00A 4QUHA 5TMDA 3SXUB 1KC1A 3NBAA 5D84A 2V0CA 4Q7QA 3X1WA 4JJKA 3BH7A 1K3UB 4O8CA 4WVFA 5DW0A 4D81A 3NVAA 1BFKA 1U5CA 2IOYA 1XKLA 3D3JA 2VJQA 3T5GA 5EP4A 1Y6FA 4I4CA 4N3CA 4XDYA 1MC8A 3FMGA 4K6MA 3V3KA 4AJLA 3NEPX 4UBJA 1M1XB 2V7WA 3OESA 3VDMA 1R6DA 1TXGA 2PT9A 4TSRA 3T5MA 2AFHE 2I3ZA 1M76A 4KO2S 3HP4A 3N8HA 5M3BA 2GCOB 3UMCA 2HIHA 4AZVA 4ETMA 4HS4A 1N0VC 4YYZA 3AFMA 4DBVO 1Z6GA 3N76A 4LFCB 1QAMA 4LOLA 3W3AH 1NUSA 3INRA 3M6AA 3RSFA 3AV3A 4MJLA 2IEGA 3DMNA 1G5PA 3LHSA 1N2GA 2JHAA 2X3UA 4MWGA 2PXHA 4RTSA 5FTJA 1DLJA 3LOPA 4OUDA 5HTKA 3OETA 4WNYA 2L42A 5J5CA 4WJLA 2WWVD 2ZQZA 3BORA 3ZX5A 3M49A 5AM0A 3SP1A 1SXPA 1JKFA 4NJMB 3ORRA 1GT91 5C18A 3ELDA 3NDRA 5TS3A 1GA6A 1VHDA 2G8LA 4H35A 4NDNE 4TYWA 4N5DA 2W6PA 3UPUA 1AQYA 1U8FO 2AI3A 4O4JB 5I9NA 1FPMA 1V43A 3R3JA 2KM1A 3RT7A 3PA6A 4B3XA 3AOGA 2NZWA 3Q5DA 4UFPA 1FYVA 4XEHA 3U7IA 2CJPA 3U4DA 1WXXA 1R0ZA 3Q10A 1INLA 4Z7QB 4MS4B 4EG7A 1C4XA 3UB3A 2EL7A 4Z9FA 1OIWA 4MZDA 2Z1DA 4AY3A 5A7GA 3A6LA 5FLYA 3L18A 2OD9A 3C6KA 4DA0A 1HNNA 2JH9A 5FP0A 2RK3A 4F3CA 2CYCA 1F4LA 4ZQHA 2NGRA 1SCJA 1NBIA 2WNHA 2X23A 1OX5A 1GPYA 1I24A 2AW3A 1KP3A 2VS1A 3II6X 3V42A 3VNUA 1QHXA 3T3OA 1EUZA 1XF1A 3O73A 4NATA 2PJDA 5H8WA 1S01A 2Y0PA 1RLUA 2MDTA 3EUWA 4KNYA 1KO7A 3THOA 1QRSA 4X54A 1EFKA 1I7LA 3ZDQA 2JBAA 4LNHA 5H82A 4G5HA 1DJQA 3RFVA 4F4FA 3BCRA 2C7GA 1J06A 1LJLA 4V39A 1RFGE 3DZJA 1MO3A 1RYFA 1NVAA 1DWOA 4X7MA 3D8BA 4XYMA 4NESA 2PLWA 4LRUA 4LW8A 4P81A 5EE1A 3P9KA 3GJ7A 1PEDA 3HA7A 5EKSA 3UWMA 1X80A 3V7UA 1JSXA 4RTOA 2WIDA 3L1HA 1REQA 1D0IA 1WHSB 2ZM6B 2GXQA 3MB8A 3IUBA 2VSQA 3S5UA 5BN5A 7MHTA 1K6MA 1E94E 1RJWA 3C43A 3R9WA 2JH8A 1XCPA 3NHLA 4G0ZA 4D98A 2Z8ZA 1CPYA 2VUUA 1UQTA 2D1YA 3D8HA 4CG0A 1GADO 1Y7HA 3VKWA 5BYAA 3EWIA 4ZAYA 1CR6A 5JISA 2O8DB 3TE6A 2JCSA 3I5UA 1E9RA 4IRMA 3DAHA 1YFKA 3OOSA 4FHDA 1GVHA 3FSRA 3MJ4A 3G1UA 1Y6ZA 4XD2A 4JBNA 4ND1A 3JAKA 3QPCA 4CN8A 3VJKA 1SUEA 5IK2D 3WRXC 1Q50A 4ZREA 3ADPA 4RMNA 4LDAA 1E8DA 4JOBA 1QANA 3OT4A 5IH3A 1TZ2A 2PKXA 3JQDA 1K9SA 5HQTA 1IPEA 4OXRA 3IB3A 1GL9B 4QL3A 2C7QA 5ESRA 1CJVC 1L3BA 4B79A 1VPVA 3TQQA 121PA 2BUAA 3Q8WA 1N2BA 1NVWQ 3KOMA 4C4ZA 1JHVA 3GGJA 2PA0A 4YBRA 4R5MA 2ZBGA 5C9ZA 1G5HA 1YQUA 3OHSX 4DRYA 2XT9A 1WAMA 1O9BA 2EFDB 3OZTA 4IX1A 3QU4A 3E9NA 1GGVA 2YRXA 3ZHCA 2NMVA 1H6CA 3CG4A 2VKQA 3E8SA 1MABB 1JA0A 2X5KO 2AMFA 2VXYA 3IHKA 1N0WA 4TV8B 4OQFA 4ZT7A 1G5QA 3A2KA 4QGBA 3AINA 2P1RA 5T5QA 1Y3DE 9LDBA 4ERXA 1PK8A 2VUIB 5EP1A 1HDZA 2J87A 4ZOLF 3A3OA 4BRWA 5DT2A 2N9UA 4OAOA 5DNAA 4RL6A 1UOQA 1CQJB 4DEVA 1OB2A 4RS3A 3MJFA 4RVCA 3CIOA 5A6SA 1EFUA 5HQJA 4DA4A 1PJBA 3TVDA 4DM4A 4C5AA 2W11A 1PFUA 1WCWA 2RIPA 3LYHA 5CBKA 3IOEA 4Y30A 3GLVA 3RANA 3F2IA 1KOLA 1T3HA 4L1KA 1B93A 3VHRA 3LC2O 3BJEA 1SVLA 1Z82A 7REQB 3LWNA 2ZREA 1JKMA 2B8EA 5DO9A 2FGJA 3B52X 3R24A 4K9QA 2CJYA 2I65A 1E79A 3REOA 3S27A 3SXUA 3RS8A 1BU8A 2JBWA 3VR5A 1SOUA 3WY9A 2Y93A 1OF1A 2W9XA 5E38A 4XRGA 1XNRB 1G8JA 1R0LA 2YY7A 1KE2A 1Q16A 3I6IA 4URUR 4YMTA 3TIIA 3UT5B 3KG2A 2ZYIA 3WAKA 4RVUA 3GQVA 1X87A 3C45A 2PKQP 3EG5A 4DR5B 2R6DA 2IELA 3CJQA 3LM8A 4E4RA 421PA 3GDOA 4DQUA 4YRGA 1N5KA 1ZG3A 2PX3A 1RQLA 5LDDC 5HTOA 1CR4A 1GGNA 1N5OX 2DVMA 3H4IA 3K8OE 2FX2A 4WK2B 4EX6A 5DIZA 4OFWA 1TTQB 3HEAA 2QG4A 4RPJA 2HWKA 3PFKA 3WYEA 3I9LA 1P7WA 3AB7A 2GYYA 2WP8J 4PXAA 1E9AA 5ER6A 4NBTA 4KE6A 3U3XA 1CQXA 3V8NA 5EL0A 5B55A 3FN4A 4J0GA 2PA3A 3OUTA 1HDEA 5A04A 1MENA 1QGOA 2XNHA 2I3DA 1G4AE 1HQDA 1N7HA 2AN5A 2B8TA 3IC5A 2RSLA 3CXRA 3QITA 3F4KA 4ZOAA 5AKXA 3ZGYA 1KOGA 4B45A 2R96A 4KPGA 4A8JC 3C3JA 2ZUUA 1FW8A 1AH2A 1G6HA 1P75A 2HNBA 4ODIA 3H5LA 5LOVF 4C87A 1I1OA 2FEMA 1S3GA 1CLEA 1XU9A 4ZPJA 2F1OA 3KL2A 2O2ZA 2J9FA 3NU1A 3KZVA 1Y6RA 1E9BA 5CK4A 3JQBC 1WG8A 1W73A 1K0UA 3DVAB 1XI2A 3EOBI 3VXKA 4C7OB 2C94A 3FUCA 3IQDB 5JS7A 2DWOA 2XGJA 1L7QA 2YIJA 3HACA 5AKKA 1O97D 2VNKA 2WMDA 3ZD9A 5F9FA 5K7SA 1JHXA 1LV8A 4RL4A 3MPUA 3H16A 5HBRA 5AKZA 2J45A 3P19A 4JJ8A 2Y66A 1P19A 2P9BA 5AVUA 2ZT7A 1E2UA 4CWAA 3V1MA 2JASA 3P97A 2GBFA 3QOWA 4LYGA 4DC0A 4BN0A 3QU5A 4QYTA 5CCXA 1ZC4A 1YJXA 2I3BA 3GJZA 2DSNA 5ELMA 3ITEA 1Q14A 5FTLA 1DIBA 3FOZA 2BEVB 4BX9A 3JYLA 1Q0TA 1G2PA 4CQMB 5K8TA 2VBGA 3LHIA 4L4RA 1OLXB 1E1DA 4B7AA 2E4ZA 5E6UA 2HIMA 2NVWA 3IA7A 3PPVA 2QLMA 2D5CA 1Z0SA 2VPTA 1RAFA 5ARBA 3GT0A 1TUBA 5EJFA 4GH5A 2VA9A 3E4DA 5CK5A 3KKPA 4W1QA 2RAVA 5GQSA 2PU5A 4LF9B 5D6NA 4URYR 4CU2A 1BDBA 4MEAA 4RF5A 5BSFA 2VTDA 2MOKA 2WMNB 3GLSA 2Z3ZA 3HTXA 4O2BF 2HK7A 3QXXA 4YAEA 2A5DA 5FWYA 1Z18A 1S3FA 3OZUA 3AR6A 4GZMA 4R2JA 2FEPA 1QAOA 5AHOA 3KXDA 4PNEA 5B6IA 4RAQA 1Q0PA 3QFFA 5A5EA 3I4LA 3T3NA 3JZFA 1K92A 3V2IA 2JCYA 4TKLA 2A7XA 2QROA 2RARA 2YN2A 1P4RA 4ZMRA 5CA0F 3HXLA 4EVRA 3BHIA 3LUBA 5G0WA 1RLMA 5CH3A 4DXHA 5HS6A 1U3WA 3CRRA 3AYZB 1L7AA 4KV7A 4Q3AA 1MA0A 5AQ1A 3BE5A 3D6NB 3BJZA 1VRCA 4XYLA 1HFJA 4QXOA 4XVHA 4ND7A 3SDSA 2O8FA 3O3CA 1EXWA 2QMUA 2QM3A 3WLEA 5JYBA 3TQFA 2AYYA 2H5LA 5G0VA 3SJBA 2QVYX 4RLSA 4HAIA 1Y7IA 1XL0A 2PBRA 3N3BC 3QY9A 1EFPA 5AKYA 2VHYA 3E2MA 3T7AA 5KYUB 1WPGA 2QTMA 2Z6VA 4Z53A 2UZAA 3DPSA 5CX4A 5D1NA 3P2KA 2ZYVX 4FR2A 4M0UA 3HUTA 1HMPA 5HFJA 2PRIA 4QODA 4C0HA 5KDOA 1OD6A 4D43A 2HQOA 4UCXA 5BRAA 2J85A 4S1NA 4D9CA 3P9RA 1AC5A 1HYGA 1O6BA 1TRKA 2IF2A 3S44A 3GRPA 4BNVA 3FSJX 4IWXA 2GAIA 1FUEA 2OMEA 3HA5A 3ICOA 4OLJA 3AHDA 4AX8A 3VI4B 5JASA 5B58T 2XEDA 1UXGA 3K30A 4W9MC 4C78A 1UCFA 3WJ7A 4B5KA 1Z5GA 2P6OA 4QQNA 5TQJA 1FX1A 1N5LA 4AJJA 4G0UA 1W0CA 1BEEA 2NU8B 4H3HB 4RGQA 1JDSA 1IAQA 1QHYA 1ECJA 3L0BA 1SBYA 4IHKA 4ARUA 1BEUB 1YZNA 1IONA 4MUAA 4MB2A 4RXMA 2AC2A 2ZIZA 4EHIA 4DNXA 1L4LA 1ST3A 4UM8B 1M3SA 4AMUA 3MINB 4YCDA 1P5RA 4B7UA 4L6CA 2C96A 4PO8A 1V1MB 1THTA 4AXXA 3ZHSA 1TKAA 1WDTA 1HBJA 4HATA 5EESA 3SHQA 4G85A 4PRYA 4UNSA 4GPEA 4PBTA 1ZR2A 3SYKA 2ZIWB 5BPFA 4ZI7F 3NXSA 5LD2C 1Y4SA 3OMXA 3PPYA 2P35A 4ZQCB 1YS7A 4FFSA 3PJRA 4RJTA 4EQ6A 2C31A 1K27A 2OCDA 1EHYA 4KEAA 3CF0A 4QT4A 3LU1A 3K9BA 3E9MA 4UQPA 2G0AA 1JJBA 1G21A 3CUYA 1PG2A 2FEWB 1LPOA 1F51E 2W37A 3EMVA 2OCKA 2HGZA 4G5QA 1SKYE 2GRJA 4RVDA 5H9VA 1NQAO 5JYDA 4JT2A 1CZNA 4RVNA 4E0BA 1PSWA 1U8XX 4NI5A 2GN6A 5HDQA 4E13A 1ECGA 3K9QO 5JW6A 3LIPA 3P0HA 2N46A 4WE3A 5BOVA 2FRDC 5KVCA 1F14A 1YZYA 2E4WA 3RPEA 2EW8A 4JUCA 1QFJA 8AT1A 2OCBA 1G66A 1RAEA 3BBPA 4K9LA 5HPYB 1UBEA 3ND9A 3S7ZA 2K7FA 2WU0A 3ASUA 2ZOSA 3KLBA 3AEQA 2HQRA 5T7BA 3LT4A 1S6YA 1E3WA 1WLYA 2CFOA 2JAUA 1MU0A 3L7JA 4U5QA 3WDLA 1WHTB 3EVTA 4WNCA 4V0RA 4U2BA 4QYWA 4MKZA 3TMKA 4UVDA 4MWOA 1NBHA 4BJ6A 4Z4IA 2PJZA 2NU7A 2ZUBA 2VWPA 3B7PA 3HVKA 4ESHA 1TZJA 4FB4A 1JU3A 4Z3OA 1IPFA 5JC8A 4LECA 3H04A 3VZQA 3DONA 4Y9SA 1AKQA 1QZXA 2QX4A 3GRFA 3LZ6A 4XTRA 3ZY2A 3E9DA 2OM6A 3WIEA 2PCJA 3TEJA 1E8MA 4LDPA 4R7ZA 3C2QA 5EERA 4FE3A 2GKGA 5F78A 2ORED 3W7AA 3AHEA 3PQEA 5B3LA 1O7JA 4JHLA 2I6XA 2R48A 1CZLA 5ALQA 2ZFUA 3UJBA 4XQEA 3BRCA 3PRJA 1AZSC 3NTXA 2IZZA 5LA6B 5BSHA 2B61A 1JVNA 2RG7A 1NYLA 3OJWA 4JUIA 5TPWA 2RGEA 9MHTA 2Q07A 1P60A 3AHIA 1YBAA 2B1JA 3L8YA 4NCIA 3WSWA 4BAGA 4DSUA 1W5BA 5SZJA 1XCLA 2IH5A 3LFHA 3Q7TA 1UR5A 4MI9A 1X39A 5DXFA 2E3JA 3SDZA 3EUEA 2OO3A 4LIPD 2DBYA 1Q57A 4P93A 2V3WA 1N33B 3UJPA 3PQ5A 5EPOA 3ERCA 4HVLA 1MPTA 5KJCA 4YQYA 4NJEA 1K8ZB 5DSXA 2EJWA 1J8VA 2J08A 2O9JA 3FPCA 2WHXA 3R6TA 4JP3A 4WY2A 2AMLA 1N78A 2DMRA 2OC9A 1ACLA 3ULKA 4LRTB 5EIFA 3K5IA 4DCMA 5AHXA 9ABPA 2H1LA 1XMOB 1OLUA 4GR4A 1N75A 2GTPA 1J0CA 1Q0RA 3RU2A 3KQYA 3R74A 1EFPB 1GL7A 3M3PA 4LPKA 4ZKDA 4JY7A 3IUJA 1DX9A 2WUGA 4GOKA 3DOOA 3PZRA 4G89A 3A28A 2R6HA 3SBXA 4G1BA 1DAKA 1H4SA 3PCRB 2DFLA 1JRLA 1UZNA 2VK4A 1EHIA 3EEIA 4JCOA 2Y9MB 3B82A 5JWHA 4PLZA 3MCAA 4AWAA 2FFHA 5JANA 1U0JA 3ZWBA 4ND3A 3AFHA 2PS9A 3KTDA 2ARKA 4FNGA 4MDFA 1Z0UA 3V1NA 3QLUC 4G23A 5EKXA 2BHSA 5JOQA 5IN5A 5BQPA 3QELA 4D8XA 1YCFA 4OQDA 3D1VA 5LBTA 2DFDA 3IVRA 2XD4A 2B5WA 2OBXA 3HE3A 4UHKA 5KJ1A 1D7OA 1QGDA 4MRNA 1HDGO 4M1MA 4RANA 4INZA 4EITA 3WK7A 2RFLA 4EG5A 3AYXB 4HGRA 2ZUSA 4ZYTA 1E3TA 4TMYA 4RDXA 5E7QA 3TD6A 3AM1A 1H2BA 1DX6A 1HSZA 5DLDA 1C1YA 3MGCA 3I2HA 1Q3TA 1K5DA 3FIJA 1CY0A 1D8TA 1X15A 1Z4IA 3KYDB 4Q02A 10MHA 1E5LA 3BILA 5IJWA 4X20B 3V34A 3HV2A 4NNJA 1TQHA 2G9UA 2PGDA 3KQSA 4KLAA 3WHIA 1XEXB 3OO0A 4IDNA 1OYWA 2MSLA 1SNYA 2HUPA 3O8NA 5KYGA 1X0XA 4XH9B 3GRCA 4R1PA 1SELA 4RKYA 1GA4A 4Y6QA 1BQ4A 4QYIA 4BMDA 3ICWA 1JG7A 4HGYA 2IPOA 3L7LA 3RS5A 4YT8A 5EMNA 3JQEA 5ALRA 4FI3C 1AB5A 2OVFA 3A6ZA 2Q5CA 1Z29A 1SVMA 2FW9A 3KDPA 1UDXA 2C4HA 3AR2A 2JFHA 5EWLA 3EW9A 4EJSA 3ZS8A 4EBBA 3H5NA 4PBRA 3NP9A 2CJWB 1AF4A 3E0QA 1UM8A 2FEXA 4J0EA 3BWYA 1P1HA 3ILSA 3O93A 5ALWA 4IUYA 3CJTA 3U3RA 5F5XA 3NBZC 3ICPA 4PQYA 3OUUA 5ITSA 2V7EA 3NS7A 2VF8A 2F1HA 1O03A 1V47A 4TVOA 5JZ9A 1K7XB 2XNCA 1K7EB 1XXHB 2FZLA 1MO6A 4IZOA 3M1LA 4UREA 1QFZA 2ZRAA 4WXHA 2ZPTX 5E6SA 2HJSA 4FMDF 2QY6A 3U9SA 2DPYA 5J4LA 2C04A 3GL9A 3TZCA 3O1IC 1WU7A 2PX5A 3BYZA 4NHOA 4NWIA 4TL6A 1Z3CA 2XR1A 1CS0B 4INAA 4RV4A 1E6KA 3MAJA 4YMIA 4DCCA 2BEUA 3WGUA 2NP7A 2O6LA 5AM3A 2Q62A 3K96A 2RCYA 2IYQA 3I9FA 4LYEA 2XB8A 1PJ3A 5FEMA 2A33A 5EXTA 5IHPA 3GD7A 3I5YA 2C88A 2Z6QA 5KNCD 2V1UA 3LUCA 4YK7A 3JQFC 4Q48A 3ORFA 4DRXA 1RXVA 1E32A 4OI1A 2FEOA 5IS2A 3DZKA 1I01A 2GO7A 1PSDA 2R9VA 3IV7A 1JLLA 1NYTA 3NHMA 3CNLA 3ZPXA 3DVSX 3E2PA 3EFEA 3G0BA 4UJ3A 4BX2A 4M1EA 4MS4A 2WJVA 4NCJA 1ZCZA 1RQ2A 3NR2A 2FPPA 4L7QA 1OBOA 2D5IA 4WJZA 2NVBA 3Q9LA 3IVAA 1EFVB 4OHFA 4H18A 1OTXA 2HHHB 1U2QA 4TLBA 1N6OA 5ES3A 3CZ4A 4ZJUA 4M6WA 4AO6A 4DHWA 3MWEA 2UYYA 1NI5A 3EXG2 5TQ2B 1KDPA 3VTKA 3E3OA 4DG8A 4R51A 1TCCA 4TTIA 2FWNA 1JIUA 3C48A 3GGPA 5IASA 5LWHA 4B74A 3RDPA 1IN1A 2V03A 3O4VA 2VWHA 3SC3A 4GOMD 4F8EA 1OWMA 3J7AC 1Y81A 4CFYA 1GG9A 1HQCA 5HCNA 1ZGBA 2AQIA 4WBSA 4K9NA 2VYCA 2TMDA 2Y76A 3UWKA 3VYSB 4BP9A 4JT8A 1TQ4A 5HUQA 1GY8A 2WG2A 3AUYA 3AI3A 4CF5A 3CZCA 4QQFA 3BXXA 2WJWA 1QIFA 3W2HA 1ESEA 4RF2A 1JLMA 1O0CA 1GUYA 4J4BA 2C9MA 3QSGA 3KKKA 2O5RA 3W06A 2FZEA 2G6TA 3FRIA 2HFKA 4FFNA 1Z8HA 4P92A 1ETUA 1DTEA 4Y7DA 4A6DA 2HI0A 2XQKA 1Q0UA 3KK0A 5K5EA 3FETA 3FTPA 1G8YA 1H0SA 1ULHA 2CHVA 2F3UA 2BCJQ 2XVZA 4MRMA 3OZIA 3EOAI 3U7GA 2ZUEA 1FTWA 1N25A 3P4UA 1LBTA 5TEWA 4MK4A 3VDQA 3VPAA 1XMVA 3LQKA 4DIFA 1KIMA 4DUZB 3C7TA 2YQ5A 3OCCA 2EKQA 3WDSA 2QLNA 1XZNA 4TWIA 1YRHA 2ZIXA 3N7UA 1K88A 1PZEA 1J9EA 1U8AA 2H3EA 2IEYA 5E7MA 2BFAA 1RC0A 5BMVF 1VJ1A 1Y5NA 3ML1A 4GLJA 4KHZA 4IDHA 5JJLA 3PNQA 2CSUA 4NBSA 5JSUA 2B94A 1YULA 4FJ1A 1RQXA 2H7VA 2QA5A 2RB4A 2ZR9A 1SCAA 1Q6YA 3RJ5A 1TM4E 2YWDA 1BYUA 3K0AA 4J94A 4LZAA 4YTEA 3V1UA 1GPAA 1IC6A 2QMEA 2P41A 3GEGA 1A2QA 1RM5A 3PQFA 4PLHA 4HNUA 2BL4A 4LZNA 5LYJB 3U5TA 3ZWPA 5IPFA 5EG5A 3PQ6A 4WCFB 1P6QA 1H2YA 1SU6A 3LLUA 4TMVA 4UEOA 2O2CA 4EY4A 4GD3Q 2PSHA 2DPMA 2ORYA 5MN5A 4HGPA 1E61A 1PR9A 5DU2A 4ZOLA 2ISCA 3AGPA 3GBSA 1CP3A 2J3IA 3VZCA 1ZD2P 2I4IA 3FMFA 4NZPA 3UK7A 1DG1G 1Q2XA 3E5MA 1VE7A 1JJAA 2G9VA 3AHCA 2QNRA 5ARDA 4C0XA 3ZWWA 3KJXA 3ZLUA 5BVGA 1NT4A 1TT5A 3NDBB 1I8TA 2BTOA 2DQYA 2HF8A 2GQ0A 2GILA 5JZVA 2W42A 2GZRA 2Q5JA 3E9QA 1LUAA 1P7YA 1E9VA 1U0TA 1C0LA 1PJ4A 1UPUA 3PVCA 4OB6A 2IU0A 4PLVA 1P2FA 2FMTA 3SS7X 1BE1A 1JMYA 4RD0A 4DDUA 1XXHA 3TUZC 1H1LA 2XB9A 3R7BA 4EYOA 2QRKA 1EB9A 5F21A 4EELA 3UHFA 2OVBA 4GX1A 4C0JA 1C8KA 4JI1B 4IDBA 1WDMA 3X1ZA 1BW9B 3AU9A 3K1TA 1J5PA 2XKKA 3H2KA 1WPQA 3M9WA 3LPNA 2C2WA 1CRQA 4KH1A 4RVSA 3P9XA 2CEAA 1ZCAA 2B99A 3DDOA 4C0SA 2PLNA 3Q11A 1JH8A 4RTJA 3AVVA 2XF2A 3Q3GE 4ZO7A 1GTG1 1Z7EA 2PKCA 3NUZA 5BRJA 1N57A 1LWNA 2HA5A 2J8ZA 4QWWA 3T7IA 2Q2OA 3W8DA 5E3IA 5HIMA 4URXR 4NY1A 4MV1A 4OREX 1X1BA 3TZLA 3OIVA 5KEIA 5BSWA 1U0GA 1VJ0A 1ZP6A 1YQQA 2Y0DA 1GIAA 4HXFB 3JQGB 5TF0A 2Q5OA 3G2QA 5JRDS 5JSHA 2KWIA 1Q92A 2CD7A 5HEKA 1LJ8A 1ZNQO 4UBNA 1NLFA 3GLQA 3UMSA 4D9KA 3NOQA 3ZW7A 5B37A 1WMSA 1F7UA 1UWKA 1KWKA 1TPYA 3KT8A 1E9CA 4YJGB 3EXEA 1FNSA 1NJ1A 3GNSA 1HKHA 3WV4A 1A8IA 1WBDA 2H00A 2NU7B 4I7EA 3CFYA 3PUIA 5ECGC 1F7VA 3EFOA 1BXGA 3F4LA 4KZKA 3CEHA 2ZETA 3IAM6 3NEYA 4FYWA 4N0PA 1R8JA 3REQA 3W3ZB 2H4FA 3LT2A 1FP4B 2RC6A 4E5PA 4COOA 1IUKA 2KI5A 3ADOA 3PIDA 4ZQEA 4TYPA 3X2SA 3UB4A 2Q3EA 1PWXA 1JWBB 1VL2A 9GPBA 2XMRA 3FSGA 4ZOQI 3G88A 3TKYA 4CV3A 4HMPA 5HP4A 4X61A 1E2BA 1Y1SA 3B3GA 1OFGA 3TN7A 1Z5WA 1EJ0A 1RI5A 2VDPB 1Q91A 3G1TA 3PQ3A 4E5NA 1O6ZA 3LX8A 4PX3A 4JUDX 2ZW9A 4DZZA 1X1SA 2HF9A 2ZUWA 5HX7A 4Q3LA 3MGAA 2DWCA 3OE7A 4KRXA 5CNJA 4OH1A 2J3JA 3CUTA 4QWMA 1IZ7A 3NHAA 1SCIA 2FLVA 2R8RA 3RFFA 3VQTA 1YL7A 3RAEC 1H1LB 1GGMA 1HQYE 3HN7A 4ZZ2A 3J80A 3UOAB 4I1PA 1S8FA 3V4RA 3U16A 2HJGA 2MMGA 4DIKA 1ZUWA 3IUQA 1V9LA 2O2DA 3DA8A 4OKSA 1I5OA 3ADBA 1Y1KE 3NYRA 3QPUA 3OX4A 4BO5A 1AM4D 3GEIA 4JBIA 4BVHA 1QOZA 1CC1S 1EQAA 3BL6A 2HWXA 2BT4A 3SHFA 2X0KA 5H3HA 4B2YA 1UT6A 2VDJA 2QL5A 5DWDA 2ACWA 1GGJA 1PZFA 4G3XA 4XYBA 3JAKB 2PGIA 4BFVA 4Z4HA 1MQ9A 2AOTB 3ANMA 3F47A 2DPXA 1H93A 5TQ0B 3DOFA 1E4EB 1E9SA 2BI4A 3PNVA 4KODA 1UKZA 4P3YA 1JDZA 2JI6A 3FOBA 2FW0A 1QH1B 2JCGA 2P0AA 4H6PA 4EAQA 4N0EA 2N1MA 4EHBA 2PRJA 3DQZA 3ESYA 3H17A 4PQFA 1IBLB 4AUNA 5L3QB 1DG9A 2B4QA 2IUSA 4WEOA 3ZU4A 1L5SA 2XYGA 3KZNA 3ETHA 3O4IA 4OM8A 4P9NA 1U0FA 2MMCA 1WCIB 4Q1BA 5JNSA 1RW4A 1T0JB 3COPA 3R8FA 4PFKA 3VA7A 1YK0A 5FO0A 1A7AA 3JPWA 3WIOA 5SYAA 3CIFA 1PW7A 3N70A 1L7EA 4KXWA 3ICCA 1DFHA 5H9WA 1M2FA 3BQNB 5AKGA 3K4PA 4O2AF 1YR3A 5REQB 2P3LA 1TMKA 4OQMA 4AYTA 2GCNA 3FZQA 4FTWA 1WQ3A 2CL5A 5FHRA 1FSGA 1CF2O 1CP2A 2EC5A 2JRCA 2GJSA 2X9QA 3K0EA 5TQVA 4ZN6A 3DR5A 4GOOD 1GKYA 3SC2A 4UEWA 3TH5A 4AJOA 2OHHA 4MW1A 3E9RA 4EG1A 5CIWA 4A16A 1XU4A 2RGNA 2IXGA 3R40A 1T5TA 5KX5F 2R5FA 3BMQB 3VPGA 4IILA 5JNRA 4C2TA 4TMWA 5FV7A 4R2WA 4WD3A 5DHSA 1DCFA 1ZAKA 4P2GA 3ES9A 4RLFA 4XOIA 4AJ1A 1XTZA 1H6BA 1SUDA 1HFEL 1J5XA 1RCUA 2E4AA 1U7DA 4HWPA 2WT9A 3F90A 3UK0A 3SF8B 1AF7A 1VI2A 2FV8A 3KAQA 4D46A 2PGNA 1L4EA 1YZFA 1FEZA 4QUJA 2ADMA 1XSEA 2D62A 4WXEA 3ZQ4A 1WXFA 3B6KA 1C8LA 5TF4A 4CG2A 8ATCA 2P6PA 1P77A 4R9RA 4XB1A 3CWCA 2Q29A 4Q47A 2XTNA 1NFRA 2ID8A 3V4LA 4MYDA 3CURA 4EHHA 1U2PA 2LKDA 4EL5A 1IOZA 5EOVA 2PXXA 3GB9A 1IK6A 2BKUA 4BLOA 1Z47A 2FETA 4KQFA 4M8KA 2P90A 4Q7JB 4MS3B 1J7KA 4BX0A 3AY7A 4NTZA 2JDID 5C81A 3K9CA 2IFTA 3NHUA 4KJZA 5LDGA 3RTAA 4AAYA 4IDAA 2VDMB 1YNSA 2BFNA 3M3DA 3KEFA 1U4SA 2W6JD 3MS4A 3O03A 3NI2A 3RGWS 2QNIA 4Q9NA 3V8QA 3HWRA 4R3NA 1PEAA 3VR0A 4FMDB 5KYKA 1GQSA 4EVIA 4YJHA 5DI3A 4IOKA 4RPLA 4AUEA 1N0HA 2AF4C 2V6BA 3PHBE 3QWIA 1PQYA 4MLZA 4C30A 3F5SA 3IUNA 3PXBA 2CDCA 4R54A 4HUTA 1XMIA 3T7EA 1B73A 2YJZA 1C1XA 2HLDD 4PAWA 2LW7A 4JFAA 3A1WA 3DUFB 3P71T 2C20A 2ZCVA 3FZNA 1O9HA 3W7VA 4BLVA 4LF7B 3DH0A 1P74A 3FM9A 5B3JA 1JN0A 1V3UA 3NCTA 1NV9A 3HEMA 2EFYA 3FHTA 1Y9JA 1G291 4K28A 4UMVA 1G21B 1T1EA 1YO6A 2HQBA 3HEBA 3C8UA 1IZZA 4OKIA 1IY0A 4KYIB 4WZAB 3R5HA 1G98A 3QMWA 4DCTA 4C4TA 3T7CA 3E8MA 2BF7A 4P86A 3PVZA 3IH5A 4NCXA 1YZKA 1A97A 1F60A 2JGEA 3AF3A 3KSDO 4K9KA 4GMKA 1KEEB 3FRJA 2QD2A 3PR2B 3I5XA 1B16A 3U60B 4GBGA 4K87A 2B5OA 2C9YA 4HCJA 2JJ2D 2GPNA 3IAS1 3RODA 5KMGB 4Q7MB 2ZIUB 3TW8A 1HLFA 1RS0A 3ENWA 3M6MD 1BE0A 5L53A 1NLZA 2GOYA 1I14A 3LMKA 1MX1A 4J91A 4CBVA 4D92A 3BT7A 2A35A 5HRAA 1WHTA 2YHSA 2BUBA 1I4TD 4YRCA 1JDJA 1JPNA 1T1JA 2GYWA 3D6UA 1N7GA 3MUNA 3INYA 5CRIA 2BM0A 2XOXA 4F12A 2GBCA 4QM7A 5AUQA 1AD2A 1PL7A 1RCFA 1UDCA 5ED0A 3VO9A 1D1SA 1X7XB 1YHYA 3ZLJA 4PLTA 2D74A 1QFXA 2Q3LA 2R79A 2QL9A 4B6JA 3ASZA 2QUHA 3V8PA 1I2BA 2BGTA 3DEZA 4H2DA 1Q0SA 3LK6A 1M7GA 3AK4A 3T3PB 2ID7A 4GZ5A 5BWCA 4UOQA 1GPUA 1UBFA 5CGQB 4IW3B 4ZIRB 5LA6A 2VF7A 5EGNA 4X8LA 2N3ZA 3FBWA 1NX9A 4D7AA 1XZKA 1J22A 3HV0A 1UJNA 2HL6A 3PG5A 3VNAA 1RDFA 3FWPA 1P5FA 1OQAA 2PZKA 4NC9A 4F4JA 4DVJA 2YJ3A 1WX1A 2C2GA 2G25A 2NZYA 2YV1A 4V1CB 2HD4A 4W63A 3RHFA 2HO4A 4F97A 5CYGA 1YSCA 3KBOA 4CLOB 3HPRA 3L5KA 3Q2OA 1Y8QA 4XLZA 2HRCA 1XT6A 3QQPA 2R7AA 3TZQA 3IBGA 2WHYA 5KOHA 4F1WA 3UGJA 5EZYF 4FIDA 4Q4JA 5EHXA 3H99A 2VK1A 2ZS9A 3URKA 4N8SA 4ROTA 4XWWA 3HZZA 4BZPA 1WUKS 4LI3X 1XMSA 3TYXA 5KX5B 1GLNA 4DSNA 3GU3A 4XSVA 5AUPB 3ZWXA 4BO1A 3UIEA 5K6AC 3AESA 2X1MA 3SHOA 2RGDA 4RCVA 1CJTC 4GKBA 2PUHA 5HQ3B 3CSSA 5JR3A 3MMPA 1E0SA 3VU9B 2JGIA 3BH0A 1L8AA 1DKMA 1TPZA 5IK2A 3SYRA 3WL3A 2IPLA 4EM6A 3G89A 3I42A 4IDOA 4E5YA 4MQFA 5T57A 2Y2UA 3S8EA 1OZGA 1QYXA 4KXVA 1T4BA 3AUFA 1RT9A 1J1ZA 1GUDA 3AJ8A 2XTJA 4ALKA 4W8OA 3ZH9B 1M6NA 1RNLA 1X6VA 3A7DA 3A6KA 1GPWB 5KWSA 3H84A 1KZ9A 3P9NA 4ZV9A 4XOUA 4C7VA 2A3NA 2X0EA 4ES6A 4JR1A 5G40A 1J24A 1Z6ZA 4M9SA 1U0SY 3TNYA 3C6YA 4ZGWA 5BORA 3AEKA 3ZNPA 1KI2A 3C5VA 4HTFA 4DPMA 5L7TA 2LWIA 2GZHA 5ES4B 2OQVA 1NP3A 4PSDA 2O14A 2WVGA 2N42A 3BJMA 1YRBA 4L16A 3T7SA 3WGVA 1KH1A 4XCQA 4J1TA 3PEEA 1FDUA 4PFQA 3U49A 3U6KA 1TM7E 2ZZKA 4LNUA 4YCNA 3WLTA 3B3QA 3GC6A 3H8JA 4UM9D 4GQAA 3V48A 4BNTA 3J7TA 1JT2A 4JLJA 3TL2A 3ANYB 4Q3OA 5DGCA 5IAEA 2ZBDA 1U3VA 4R8VA 3SLKA 3B12A 2I1VB 4UBOA 3A10A 3TOVA 5A4FS 4MRPA 1Y6QA 1X94A 3PIIA 1YZGA 1QGYA 1EDDA 1U3DA 2H2DA 5DTQA 1L1FA 4U2EA 2P6UA 5AOCA 2A59A 3CLSC 2UZ0A 3LJKA 4Q6WA 4R83A 4KV9A 2Y0BA 5EMJA 4OJMX 521PA 4W6QA 1ZHOA 3UJ7A 2GS9A 3EIFA 4ALIA 2BFFA 4HZIA 3FYSA 4G5FA 4AC9A 4F21A 1R5BA 1Q6ZA 1ZOLA 1KEEA 2W2MA 4AZTA 1IXZA 3OZSA 4BBAA 1OHHD 4N7RA 5BRNA 4EARA 2AKAB 3D3WB 4P83A 3FPFA 1G41A 2J0SA 2OLEA 5E4TA 3WWEA 2PJRA 3RVKA 1UKBA 1VBNA 1XELA 1P61B 4G97A 1QIDA 3HBNA 3H1BA 3NGMA 1DQYA 1JMVA 1YVDA 2W6IA 1G6OA 4RPGA 3D02A 4O8ZA 1C7EA 1H8HA 1QK4A 5EE5B 3D8SA 3UG7A 1DPGA 1V8PA 3TIGA 1XEFA 5K01A 4UHEA 2NG1A 2VJBA 4KZPA 4B32A 1TZKA 3QU2A 4JVLA 4KQWA 4LOAA 4RJ2A 3RRNA 2H1VA 1NOJA 5JI2E 3WFZA 5EP2A 1DQZA 4I55F 4CM5A 1XIVA 2LBPA 3C87A 3FYCA 4BV2A 4OQQA 3ZU3A 4C2BA 3CE9A 3H1AA 1Y5MA 3UA4A 4DLWA 1FJ2A 4N12A 4UZFA 1UH5A 4TZ0A 4DQVA 4RKQA 1YBMA 4C76A 5HE8A 3C6BA 4UDOA 4KVFA 3C7KA 3DVAA 3LVFO 4Q9KA 1PZXA 1VSBA 3QKUA 2DE0X 1N2CB 1FMJA 2V59A 3Q9SA 4NL4H 4QELA 1O5OA 4JIGA 3WL7A 2VQ3A 1RRPA 2POQX 2QT9A 3JY6A 2B6NA 4QTTB 1WSAA 2Y2VA 4ZVVA 2JLYA 2WK1A 1TIPA 4YAWA 1ORHA 1H9CA 1UXKA 1QE5A 3WLJA 4F86A 3AQIA 5KOIA 3RFTA 4PO9A 3D7KA 2FUG1 3OIDA 1DRKA 3C6XA 4BIMA 1AHIA 4C4PA 1E1LA 1E2LA 3R5TA 1MNQA 2WA1A 5J1SB 3KUDA 5ADVA 1N1EA 2ZJ8A 2RONA 3QJGA 4KMSA 3G9UA 3VMMA 1U0RA 4QU8A 3BIJA 1FXWF 5H70A 1X1CA 3A9VA 3T3EA 1ZI8A 2P2NA 4KMMA 4LXQA 1H6DA 3D4PA 1XYYA 4IQFA 1JXOA 2OO5A 3DAFA 4Q0MA 4QQRA 4LY9A 5JUWA 2AOUB 2PCLA 4R8KA 1GXSB 5I7EA 4LFAB 5FR2A 5FQNA 1MAHA 1FP6A 3LX4A 2NTVA 2OXIA 1H8HD 3L0DA 4KE7A 4MUJA 3M2TA <