2OHGA

Structural basis for glutamte racemase inhibition
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
264
structure length
263
Chain Sequence
MDTRPIGFLDSGVGGLTVVCELIRQLPHEKIVYIGDSARAPYGPRPKKQIKEYTWELVNFLLTQNVKMIVFACNTATAVAWEEVKAALDIPVLGVVLPGASAAIKSTTKGQVGVIGTPMTVASDIYRKKIQLLAPSIQVRSLACPKFVPIVESNEMCSSIAKKIVYDSLAPLVGKIDTLVLGCTHYPLLRPIIQNVMGPSVKLIDSGAECVRDISVLLNYFDINGNYHQAVEHRFFTTANPEIFQEIASIWLKQKINVEHVTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Glutamate racemase
publication title Structural basis for glutamate racemase inhibition
pubmed doi rcsb
source organism Streptococcus pyogenes m1 gas
total genus 89
structure length 263
sequence length 264
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ohgA02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ohgA01
3OUTA 3UHPA 2DWUA 2EQ5A 3ISVA 5IJWA 2OHVA 2JFOA 2ZSKA 2DX7A 5ELMA 2JFPA 2JFWA 1ZUWA 5HQTA 3UHFA 2JFXA 2JFYA 5HRCA 3ISTA 3UHOA 2JFQA 1B74A 3HFRA 3S7ZA 2JFVA 3S81A 2JFNA 2W4IA 1IU9A 3OJCA 5ELLA 1B73A 5EVCA 2VVTA 2GZMA 5HJ7A 4B1FA 2OHOA 2OHGA 2JFUA 1JFLA 2DGDA 5HRAA 2JFZA
chains in the Genus database with same CATH superfamily
4E51A 2VJKA 3M2PA 1YGYA 4PPFA 4WLVA 1SFRA 3KQHA 2PSHA 2Y0CA 3UC5A 4F21A 2FG6C 1JT2A 1QV7A 3HUUA 3IPAA 5REQB 4RU1A 3ZLTA 5AW4A 2PXHA 3OPQA 1KK2A 4IMIB 4RTPA 1W8IA 3H18A 1E4OA 3ZWOA 1RJ9B 4RKFA 4UTPA 3H97A 4H35A 3BJRA 3QFHA 2IEGA 5JD5A 2JJ2A 5DF1A 4PGMA 1FJGB 4F3TA 4J0EA 1HFEL 2FW9A 3ZG6A 4TLLB 1AJEA 3FLAA 3H6KA 3H17A 1CY2A 1KAEA 2I2AA 3C48A 5B6PA 3P32A 1EP1B 8MHTA 1RTTA 2VTVA 3IHTA 5AJTA 3MGAA 4A36A 1P8JA 3FRIA 1WOYA 2J85A 4CEIB 2HA2A 2CKMA 1QYCA 2HD4A 3D3QA 1P1HA 2YWDA 1OIWA 2C94A 1F0KA 1ZPDA 4YS6A 1X1DA 4YJGA 4AZ3B 5G3YA 5I48A 2CF5A 3ICQB 4YO8A 1B14A 1NN3A 4PLFA 1EVIA 2EVWX 3ZUGA 3PCRB 3JATA 3R7FA 2FXIA 2GAOA 3EG9B 1KYIA 5IBPA 4C04A 1B74A 1G6HA 3VPHA 5HUHA 4RK5A 4DR5B 2GBGA 3K5PA 3LW7A 5E1OA 4GWGA 3VXKA 3G9TA 3GV0A 3OLYA 4U7PB 3OE5A 5AVYA 4CM9A 2QD4A 3MTDA 3PC7A 4BEBA 2EWWA 2IUYA 3O8RA 4EG3A 2HCBA 2YHBA 2ZUFA 3K92A 1TJYA 4RFVA 3OM1A 1C1HA 5IARA 3VDNB 5IAKA 4JI0B 2CV2A 3AFGA 3HLYA 3SIPA 4AJEA 1YIAA 1HEYA 2ZG6A 5LMNB 2QOEA 1SBTA 2PLWA 4NL4H 1CUHA 3OICA 4UDXX 3S70A 3UHPA 5AVXA 5JS1A 5KKNB 1IHXA 1WCV1 1LLUA 1WBJB 2C8LA 1CVIA 4K6HA 4Z1MA 4B35A 1GKIA 2RB5A 4GGPA 4CM8B 1GXSB 5CBPB 3EFHA 3FCXA 1DT5A 4D44A 3ZX4A 4B9EA 3A2KA 3EQ7A 2COEA 1E94E 1MH9A 3L8MA 4R98A 1AV7A 3TXYA 1VRVA 1U3WA 2C5LA 2ROQA 2ZR7A 2ZUDA 2VYVA 3STTA 2QUAA 2QROA 1ZUD1 3ECCA 2PM8A 3ED5A 5KTNA 2QW0X 3DEIA 1LW6E 3IV9A 2R66A 1PEAA 1RI3A 3IUYA 1KZYC 1Q0ZA 3IIJA 4R31A 3UG7A 1AZWA 2C77A 3K70B 4TN5A 4LJ5A 3TLXA 2AUNA 2J7PA 3KR9A 1CZUA 2Y67A 4QQRA 8ADHA 3G7SA 1HTTA 2Z2KA 2BRUA 2FWBA 4MA5A 1IUOA 3STYA 1WCXA 1GQ2A 2CYCA 2DP4E 2WP8J 2O7RA 3ABRB 3HS3A 1W0KA 2C5BA 2UZ1A 3NHUA 4JVSB 4C4TA 4EB6B 3PD7A 4RADA 2IS2A 1B43A 3BFJA 3R4CA 4G8DA 1DS6A 4FKMA 4HAXA 2V6MA 1NVFA 4B6QA 1RRVA 4G0MA 2B2XA 2REOA 4UOZA 4UVIA 3I0ZA 1SVMA 2X3YA 3HZOA 4P7FA 3M1YA 2ZB3A 1QP7A 3DDSA 3ZDCA 4RQBA 1FYWA 1H2EA 5A3VA 4YT2A 4PCVA 1UWKA 4FD2A 5EQDA 3UFXB 1HFWA 4B1FA 4O4HF 5EIFA 1E0JA 5DWDA 3CEMA 3KHTA 4CL0A 4ENTA 1W75A 2FHSA 2XYVA 3KYCB 4MMYB 4YDSA 3D4LA 3HMQA 4BFLA 4X20B 1M5RA 1H3FA 3VDQA 4PYMA 3COSA 2QTMA 3QXJA 2XA9A 3SZLA 4R9NA 4A91A 4ZAYA 1CEEA 1DWPA 1NJ6A 2YXNA 4LHEA 2GF9A 1E0KA 4RBNA 1HFKA 4HR7A 3DVQX 3R4VA 1O03A 5E0KB 1E8NA 1I4LD 3ET5A 4QJ4A 5HZMA 3ZY4A 2G09A 2YWEA 1M54A 1P3DA 3STUA 5TVGA 1KBQA 5COQA 5LQMA 5ICCA 1JZSA 4BMYA 5GWXA 3N0TA 4M8LA 1NI4A 4BPBA 1YIOA 3HB4X 2VATA 4NMLA 1G8AA 1E5LA 4N8EA 3QPCA 1IBKB 4ZODA 4NFSA 3JQAA 2Y9PB 3GZNB 1ENYA 3C6YA 1OWPA 4JSTA 4B45A 5JSQA 3FNBA 2YFQA 3DL4A 3MGBA 4YHHB 2GPAA 2C03A 3ONNA 3KKZA 4PGHA 4P3XA 2M32A 4YLYA 4HWPA 3EPHA 3WRYA 3P9YA 2VZEA 1AKNA 1E62A 4YQZA 1QO0A 4G89A 1IM2A 3FOCA 1F1BA 2DWOA 2XODA 3LO8A 3UGQA 3HEBA 4OJMX 5AXAA 4EY5A 1AKQA 2H2IA 4N7MA 3THRA 1UKCA 2FFAA 3TVDA 4IKPA 1SCJA 3G1TA 4NYIR 4Q4JA 4QYWA 1QR2A 1Z0UA 3KQLA 5F7XA 4Y2UA 4C78A 1PV4A 2WYOA 3F2IA 4H3VA 3OOHA 1NULA 1IU9A 1V7CA 1WJGA 2RCYA 4F3NA 2PCLA 3FHCB 5E4TA 2HJSA 4CQMD 3OFVA 4JUFA 1LGYA 4BN5A 3EZFA 2EJCA 4W1RA 3SZ3A 2J1LA 1YIDA 2FPSA 3HZHA 2ZB4A 3R09A 1M8FA 2DC1A 3W2FA 1K7EB 1TMYA 3HU1A 1ZK1A 2NU7B 1IOLA 1HURA 1THTA 2R00C 4X8OA 4CMHA 4LMRA 4IVPA 1BEEA 3VR1A 4YRAA 3T5PA 3FMFA 3T7IA 3FNQA 5M7EA 4RV5A 4OXXA 2V1UA 1XMJA 1I30A 2P91A 3ANSA 4FT2A 1NBWB 5CM2Z 3RRBA 3RVRA 3TIIA 4DA4A 1NJ1A 4J43A 3VOTA 1ZI8A 4NXMB 4OI1A 1E2KA 4WKCA 4HX5A 1KXZA 4LC1A 1YBHA 4BZPA 1Y3IA 1YC2A 3W9BA 1M2EA 4DY6A 2ZJ5A 2JLUA 1ADCA 3VI4B 2KM1A 2VDQB 3DS8A 2J5BA 1WMSA 2F3QA 3FDFA 3NTVA 4DN6A 2HWYA 2ZZMA 1VE7A 2A5FA 2VPYA 2C1ZA 4F85A 2C84A 2JFBA 1KZHA 4DDWA 3DBHB 1EU1A 1UDBA 4LECA 5EINA 4LEIA 4E2ZA 1SKMA 1YDFA 4D8UA 3A7DA 5EXPA 1RWQA 3MFYA 1PJBA 4GQAA 3IBGA 2F62A 1EGVB 1KMMA 4Q48A 5FWDA 1ZUNB 3B6MA 1P9RA 2PYIA 4PZPA 3M3PA 3G5LA 2R8BA 5C0OE 2R751 4Z54A 4PO8A 3T5GA 1N7HA 1SQ0A 2XMBA 4AWBA 1Y5NA 1GPNA 1IIBA 5CA1B 1OPXA 2H5IA 2NYUA 3ORQA 1Y5MA 4NAUA 1J42A 1NVBA 2ZVQX 1TPZA 2C07A 2HI0A 3O8OB 1U1EA 1GZ3A 4W8HA 2XMQA 2X9QA 2B21A 1COZA 5EWLB 1TIPA 2O59A 2UKDA 3L9XA 4J1TC 2VZLA 4ZOCA 2EGHA 4DIMA 3KOYA 4CTJA 3I6ZA 2CFRA 5KNBH 3JXEA 5TEVA 3HLKA 4KQEA 5JS7A 1FSFA 5EQTA 4EKDA 4MARA 1C4KA 1MAWA 3IL2A 1II9A 3K96A 2DPHA 1Z2NX 4YXWA 1MRSA 2X9NA 2PQ0A 3C3BA 3EH2A 3TFOA 1CQZA 3FJOA 3T06B 5AW7A 1GPKA 4HNHA 3ORFA 1E9CA 1NP6A 1S8FA 2B1GA 2RH4A 1EUZA 1P9LA 1Q84A 3DLAA 4ZVMA 5B7GA 1G7RA 2ACKA 3EB9A 4TT3D 5HQ3A 1PJ8A 3SQWA 1NLUA 4YRGA 3QH4A 3KEGA 5IK2D 1LQUA 3L92A 4F5EA 3DBVO 3DPSA 3E3OA 4DMMA 1PNTA 1PG0A 4L2IB 4G4SP 1HH4A 4NQRA 4UMVA 1NN1A 2QAGB 1ZDMA 3GRRA 4RSMA 1T9CA 5EKDA 3TOVA 5KVVA 4R2MA 2I55A 5LQCA 2X58A 4EG4A 2DHCA 4N12A 3TLYA 2PT7A 2A3RA 4B47A 4IS3A 4EZIA 4ZDIA 1I3OA 5EJ6A 5JOQA 3B3JA 3EXHC 4J0CA 4PWYA 3CN7A 3HKEB 5ETJA 4H1TA 3ZWDA 3IJ5A 5LOVA 5C7YA 1E2IA 3BBLA 3JQGA 3N6RA 4DFDA 4I5GA 1P2UA 2XUAA 3ISTA 2DSNA 3TLGB 2XNSA 3W7VA 4R2IA 1BQ4A 5LDHA 1EK5A 5LNK1 4QREA 4BNJA 2I65A 1ISHA 1NVEA 2AHRA 4M7OA 2V6BA 4UTXA 3T7TA 3VOSA 1EG2A 1ZNWA 2KMLA 4I1VA 1JPNA 4GLLA 4OHKA 4PS1A 3A1WA 2BOVA 3AMVA 3PU6A 4EENA 3NC1C 5EIBD 5LIPA 3HY6A 3F73A 4AWAA 3VNSA 3PB3A 2ZBEA 4TTAA 3H2BA 1KQNA 2B8NA 2XYPA 1S7CA 5J2TA 4O4IA 5ICFA 3L82B 2BN4A 2OCYC 3I12A 1ECCA 2PGJA 4MEBA 3ZZ0A 1YS2X 2OB1A 4WJKB 1R5OA 4WQMA 3WLJA 4KFRA 2R7MA 3GT4A 3PXEA 1JLLA 1UBMS 1T9BA 1WA5A 2QK4A 4M99A 3UANA 4DM3A 4K5QA 4CT0A 1OMOA 1W4LA 1Y81A 2ZYUX 1DG3A 2A9FA 3AB8A 1Q0UA 3TFQA 3ZE7A 2ZCJA 2Y1CA 2YNMC 4MS3A 1MN6A 3SZUA 1I7PA 4UPDA 5A3RA 3OC6A 1A8QA 1GGFA 3SAJA 2IUFA 2GXQA 4CCSA 5HEKA 2D7DA 1TYEB 2ISQA 1NURA 1IXRC 3A1EA 3CLKA 3IDZA 5AHWA 1NLMA 2VK8A 2FVXA 3I2HA 4C4AA 2P6UA 2YIVX 3L84A 1ZL0A 4QRIA 1I4TD 3FVQA 5F9FA 1HV8A 4DIKA 5B1YA 3JVVA 3M6XA 4A10A 4EHDA 4LJ8A 4OB7A 1XMXA 4BKQA 3UEOA 2XWPA 4GI1A 4O4LB 1ZIXA 3LZ6A 4ND5A 4QO7A 4U5QA 5AM4A 4LKRA 4CIVA 4B2LA 1OJ7A 3MD9A 4MW2A 1P29A 2G5GX 1SXPA 2IGBA 5HCUA 1ZHFA 1E2BA 4JEHA 3LCRA 1DJMA 4MI3A 4C2UA 4JJ8A 4MCHA 1ICIA 5DMXA 1R66A 5FOTA 2I7CA 1C3XA 1D03A 2VP6A 3HB5X 4OU4A 4QD3A 3ZU5A 4EGJA 5A1TA 4DR6B 4NKRA 4BB9A 4LQLA 1UZMA 1NQVA 1WW2A 1QRAA 5KNLA 1DWOA 1BHSA 3NTXA 3ETEA 4KSYA 8ATCA 4JT8A 4TV9F 4UVHA 4OHXA 1H8ED 3C7CB 3D7LA 1N6KA 4N6GA 5AK3A 4C6TA 1E5XA 2XF2A 3ONWA 2CXXA 4LOAA 3ZWNA 2UVDA 3ZBUA 2NUPA 1PQWA 4Q9AA 1YUBA 1IC6A 4WKPA 4BUZA 4YRBA 3EF1A 5C81A 1XIVA 3OX4A 5KIAA 2W58A 1ZIOA 4D8WA 5A5DA 4JLBA 5DNDA 2PNJA 4OQXA 3VZQA 1K8ZB 1KY5A 2ZWPA 2QY9A 2VXCA 3ZOZA 5I3CA 2VBGA 2Q9AA 4U8GA 4JLJA 1C7EA 1Y6FA 1ZK0A 2WIBA 3UWSA 4WNAB 4EPVA 3A11A 3CVXA 1DCMA 1XRLA 1UDWA 4Z9FA 3QXHA 1I3LA 3QY9A 4Q4CA 5EWJA 1XTPA 1AZSC 3PQ8A 4FS3A 5G0UA 3JWIA 4XAQA 1CRLA 2Q3DA 3LYAA 2HMSA 3K35A 1XAJA 3BMOA 4KOEC 1Z6TA 4YAJA 2OCXA 2IYLD 3N5KA 3IP3A 1YUMA 4LV5B 2Z43A 2BKVA 2QQEA 3HL0A 4TYMA 2O8FA 2FPKA 2IBTA 1YBMA 3W7BA 5H8WA 3B48A 1BWPA 3PUWA 2X4LA 4MYSA 2YHIA 4MX8A 5EWMA 1HRKA 3V4LA 4EZBA 2R6DA 3AHCA 3TLMA 3EYAA 4LQ4A 5IKPA 5DIFA 4D4MA 1KOGA 4OUDA 3NWBA 4Q4HA 1KSGA 3U4QA 2YICA 1CJMA 3RS4A 5B57C 4TQ9A 1J8YF 3DMYA 1QH8B 5IJ9B 5L40A 5CP8A 3CFYA 4RVUA 2ZWIA 3AVOA 1FEZA 3DBLB 4UJ3A 1V41E 2QQGA 1T26A 2PCJA 2TS1A 4IJUA 4Z99A 4C2BA 1F51E 3KKEA 3RSZA 1G9SA 3K9NA 3GLTA 2I1LA 2I67A 3H5IA 3T3IA 1JMVA 5K05A 3NASA 4FGJA 2DR2A 3O1HB 3UXYA 1L5YA 1SCNE 3CUSA 3KL4A 4BE4A 3ZWXA 4AYTA 2WSMA 2SNIE 3LX4A 3IB6A 2RGGA 1F3OA 2WTXA 3OOJA 4WN9A 4QDKA 5DHTA 3RRJA 3ZHOA 2LCIA 3ZIDA 4QA9A 5HWSA 3ASVA 1EFDN 2XE6A 5IUKC 3KHSA 1K06A 1ZUIA 4XDZA 5AHOA 5CM9C 3WGQA 4M9ZA 4QAJA 3PFGA 4K05A 4RW0A 5HTKA 3WWCA 5DXFA 1KEPA 1Y7LA 5E6SB 2JEZA 1Y7HA 1NJGA 3JQDA 1Z5NA 3GJ0A 5CB8A 1K0UA 5AK6A 5LN1A 1Z45A 2K87A 4G5RA 1ZH6A 4JB2A 1N4AA 4JUBA 2YY7A 4LDJA 3BSWA 3KT3A 4RVGA 2DT5A 3KB6A 3LWNA 3WGJA 3RADC 3PX2A 4X1KB 3FW1A 3FFBA 1E2DA 3HDJA 3JQBA 5ALLA 5ENVA 5J59A 4BQEA 4DMCA 2WKQA 2K7FA 3CLRD 2RHDA 3HDGA 1OBVA 3C74A 4FMDB 4HZGA 4KYVA 4YCJA 3SIRA 4YXFA 3AEZA 3S7TA 2WZDA 4S1PA 1XLUA 2I3AA 1I51A 2Q2OA 1SU6A 3TSYA 3QE0A 5JQGF 2BJHA 2Y8EA 2W37A 3VH1A 1KAMA 1MORA 1TO1E 4LZAA 5GOZA 1VJDA 3NIFB 5FWYA 3QSYA 4GIBA 5AI8A 4QTUB 3NNNA 1J9ZA 1XZLA 3HJAA 5B6JA 5B7PA 5IYZB 1GNRA 1RVV1 2GTIA 3IERA 5EJFA 5HJ2A 4ENRA 2XCOA 3QQPA 1VIYA 3GIWA 3K5IA 3M4XA 4LHYA 4Q39A 3RV4A 4F8EA 1EXNA 1C4OA 3RODA 4TMYA 2DKOA 2SKEA 4G86A 2DU8A 2HK6A 4LSGA 3SC4A 4BB0A 3TJMA 1W4AA 4BFCA 1XZIA 2QNRA 4QPNA 4PLPA 1O6FA 2NO5A 5FR2A 2EFHB 4RZIA 1NQUA 4NZPA 3GPDG 1EE1A 5BVGA 4N5NA 2WIGA 1EVLA 2GD6A 3F7NA 1DKMA 2QG4A 2R8YA 3L2OB 3KJHA 4OAPA 1R3UA 4MP8A 1JHXA 1QTRA 4I19A 5F1PA 2VKQA 5JNUA 1PBTA 4FUTA 3TE6A 5GY7A 3O9MA 1UBNA 5E3HA 5AD1A 3BRWA 1E96A 3B7WA 3TR5A 2UVQA 1N2IA 4L51A 4WAUA 4F8JA 5BPFA 1OD6A 1R0RE 2BFCB 1P5RA 1RJDA 1FXWA 1RQGA 2C95A 2WAYA 5BO5A 1XEXB 2AVDA 2YIJA 4FEEA 4WWHA 5BMOA 1G8PA 5K45A 1RLTA 1S2GA 3YASA 3CLSC 3VHQA 3GHYA 2JBAB 1YQXA 4I6GA 1NTRA 2I3DA 5DK6A 1M0EA 3IVXA 5TGZA 3EZ2A 4UUOA 4I50A 5LP6B 3BAFA 2B1JA 3LLCA 4BO9A 1G55A 4XLTA 4BRUA 2BFMA 1MQ8B 3CLVA 1J39A 1JAXA 3LH5A 4BJHB 4BVFA 1T4MA 2M2IA 4C0LA 3EDCA 3WRXA 3DLCA 2P9QA 4HPJB 4UMDA 2P4EA 3KKPA 1N8KA 5IUJC 3BFKA 3B3GA 3M2TA 1XZDA 2WWHA 3C3YA 3R3YA 4KOAA 4KQKA 4W8GA 5LA6A 4BO8A 3EHDA 3FETA 1EK2A 1BFDA 4FDMA 2VPZA 4KTTE 4NX2A 5AM0A 1KO8A 3C3CA 3NCTA 3DW1X 1OILA 5EZYA 1G3MA 3I3SR 4B43A 1G20E 1KE2A 3H4IA 1LTKA 2Y2UA 2QBYB 1AQNA 4D81A 1Z4QA 1OLUA 4GMDA 2ZS7A 2BGUA 3IAAA 3L8HA 2I2CA 3RYCA 4S1OA 3T3PB 3DVLA 3ZXIA 1SHLA 3NEAA 5GOTA 1N0HA 5ISMA 4PQYA 5A3JA 3CM0A 3EJWA 3VVLA 5JADA 1W581 1XN1A 1JGTA 5BW5A 3W4IA 3IBCA 1YCGA 3PFWO 2DH5A 1KFBB 3KKLA 2VZ8A 3KALA 1VLLA 4UVDA 4AKHA 2Q6LA 2FEWB 1UK6A 2B5VA 1EA7A 1QVRA 2BFNA 2YXLA 2P4HX 3AF4A 3AF5A 3GJRA 3VHXA 3VR3D 4HRYA 1NUUA 3KOZA 3MF4A 4LMAA 4W9RA 1YCFA 5ADHA 3AKEA 1WV0A 2PX3A 2YVUA 3LO5A 3RIHA 3CR3C 1Z74A 2BBSA 5A4DA 1U2QA 3L0BA 3TSCA 4F5ZA 2ODTX 3CG0A 5FPSA 1HRDA 5IHPA 3H9GA 2IFTA 4IWYA 3GGJA 5FUBA 3KD3A 2D0PB 2Z3WA 4BGEA 3UW1A 4ISCA 2Y93A 4KXMA 5HX7A 1MZPA 2UXBB 1WTAA 3JYQA 3O3NB 1XPJA 4C22A 5ALQA 2H4FA 4WK6A 5H70A 1ILEA 1QX3A 2JAOA 3LX8A 4TLAA 4B3IA 2XUDA 3LFUA 2J59A 4C76A 1XLWA 1F6WA 1PYOA 5DBOA 2AG0A 4AW9A 1U3DA 4DLVA 2XTMA 3K3PA 1K88A 3DQPA 1GAXA 5LVAA 3W8EA 2FEXA 1VPTA 2R5NA 3ONVA 3VH4A 4C6SA 1Z9BA 1B1CA 1W4CA 3A1CA 5TSDA 2YW2A 1BIFA 1NE7A 1VIMA 5DKFA 1YZNA 4I7EA 5K2MA 4IMRA 2FWMX 1OXXK 3OZCA 4ME6A 5KNDH 4JUAA 4I2VA 4G2TA 4N03A 1KJQA 2BEUB 2W0MA 3CZ9A 2C96A 3E7XA 2QZ9A 2MOKA 2PWAA 4Y2HA 3T1QA 4YQFA 1HZJA 3OZGA 1SBNE 4S35A 2D5LA 5FOQA 1PZGA 7REQA 3DF7A 3P9CA 4LVUA 3QBJA 1YRWA 4DCCA 121PA 3I6IA 2OA0A 5DU2A 3PPIA 3BMQB 1J7JA 1OWNA 3H4MA 2VJNA 4C20A 1JIXA 3UJNA 3AHIA 2ZYWX 2Q8PA 1F06A 2XADA 3BHNA 4HNRA 3UMSA 5EJ5A 4Z53A 3VZRA 1UBSB 1PR1A 3MWEB 5E9WA 1PNQA 1IBLB 5TARA 1IN8A 3K5HA 1JMYA 3DTVB 3IAHA 1PFQA 4XZ3A 1AVTA 4NP6A 3U3XA 4OL0A 5DYGA 4EO9A 3LX5A 1NUTA 1CE8A 1U94A 1Z7YA 4MYRA 1TO6A 1T5TA 2H5LA 3L7NA 3SFVA 4E5PA 2IA5A 1QF6A 1C7ZA 1N8NA 1QGZA 4GNKA 4PHTA 3DLTA 3ABOB 1JG2A 1U8UA 4D6PA 4IIHA 2V55B 4DBZA 4MUBA 4L0QA 5I8ZA 3LXUX 1F8UA 3BGSA 3RYHA 5BP7A 2WP0A 5L45A 1UC8A 3HCWA 3BWCA 2DOKA 2ZUBA 3CW8X 4CLRB 4RAQA 4GWKA 3U2QA 3ANXA 3H19A 4TKVB 1TADA 1TLTA 1QKKA 2B0JA 3NYRA 3RWMB 5BQXA 4CI9A 2I7TA 3RUIA 1AE1A 1L4EA 1K5GA 3D6VA 4KR0A 3FKJA 2QTVA 4RMGA 3KTFA 1Z0DA 4CR6A 2DETA 3BH7A 2GX6A 3CNLA 1A96A 4JBYA 4N1AA 5IAGA 4KRXA 1TF5A 4BMZA 4E5YA 4NYMQ 1X3LA 1TZJA 4XYGA 3HKBA 1CWUA 2DY0A 1G8HA 3WA7A 1GYPA 1W44A 1QMPA 1IMOA 1DC8A 1R4MA 1I36A 2P5YA 4RTMA 1DIHA 2AYZA 1EGHA 2H59A 3FYSA 5IKMA 3HJFA 2JFWA 4KEAA 1FSPA 2WG2A 5F1OA 1WAMA 3UJAA 2PMBA 4DIDA 1R8YA 1IY0A 1T6NA 1VP9A 2QVZX 2VTDA 2WLSA 3BQ9A 1I3KA 3IVCA 1K8YB 4INZA 4W63A 2D7JA 3D4PA 4IFBA 4TYNA 2QUIA 1AO3A 2BRUC 4C3VA 2N9UA 1R00A 1W2GA 3EVDA 3GA5A 2EF0A 4H31A 5BN4B 3J80A 2ZULA 2FDRA 1QJ4A 3II6X 1H0HA 4Q02A 1V1RA 3QYAA 2YN2A 2QAIA 1Y5RA 1VSUA 3SYTA 4X8LA 3TTYA 1PGPA 4PX5A 2P79A 3P0HA 4B75A 3ITEA 1L5OA 4L0DA 5T3YA 5CDYA 2WFAA 2HMWA 3R3JA 3CF2A 2BMAA 1MA0A 4DNOA 2MSLA 1KOLA 3AHJA 4X6XA 4UTVA 5KVCA 2TMYA 3GFPA 4ZVLA 4G5SA 1QG4A 3QE2A 1X7YB 4JB0A 5D2CA 1M83A 2AI3A 1LBIA 1L8OA 2H11A 5EUCA 2OFOA 5AXBA 3H1EA 1U3FA 1E99A 1SQ5A 2GKOA 2HF2A 3IMKA 2HDNB 3WX0A 1DJQA 2IP1A 1T1GA 3PJGA 3CNNA 5JXIA 2PMKA 1B6SA 3RIYA 4DBLE 1DFIA 4YUXA 1SA0B 3JW8A 6CHYA 4YMSA 1VG1A 2AOTB 3ONDA 4LPSA 1TQ2A 4MUNA 4RD4A 4BMXA 4D0GA 5I45A 2VO1A 1ZOIA 1GFZA 1RJGA 4G65A 2J3IA 3K73O 4XTCS 2OCIA 4Q21A 5AW8A 3VO8A 1VMKA 3K1ZA 1QIGA 3FNFA 2NSHA 5HIKA 2X9LA 5HMMA 4BC0A 5HKAA 4DLUA 1MHTA 1TRKA 2JAPA 1T9KA 2OAQ1 2VHXA 3Q9SA 1AD2A 3FJ1A 5CBKA 1WSAA 1Y6RA 5ECYA 2AXPA 3TTUA 2PMWB 4E21A 4GKKB 4XPIB 3JQ6A 4QGSA 2V54A 1M0TA 1S02A 4BVHA 1U6KA 5KJ1A 3OFSA 1KPGA 2GDJA 3ITNA 1E2FA 1UJ5A 4QICA 3UB2A 3KQMA 2JI8A 3OJ0A 4P3KA 4YP5A 1PTJA 3KTAA 1YMVA 1JAHA 1GEEA 3WRYC 2CLFB 1WZIA 2DBQA 3EZ7A 5CUQA 4KNYA 2R62A 1JAZA 2PTHA 3DO5A 1BD4A 5ALJA 3MCWA 2R5FA 1NW6A 2GZ3A 1WHTA 4P33A 4EATA 5EPUA 2IXTA 1JI3A 1SCAA 1WETA 3REQB 3V3KA 3E3NA 3AIOA 5F5NA 3O3OB 1EWRA 4CCYB 1NW3A 3I6MA 2IDZA 2CXOA 3DBOB 4EK9A 3FDZA 4LVNA 4TOIA 1IN4A 3U49A 1KVUA 1K7XB 3OEEA 4NS1A 5JATA 1B0UA 1JFVA 4D2IA 1HT1E 4DJJA 4CLEA 1A4IA 4XWGA 2QLTA 1T9HA 5E9QA 4Q1BA 3ILXA 3NV7A 3FB1A 3O2JA 4K3UA 4BCBA 1ZJ4A 3GWZA 4QGBA 5JMTA 4FM9A 2A0XA 3R9WA 2FN4A 1UJBA 1P33A 1BMTA 2QPLA 4M2LA 4PINA 1KQGA 3TEJA 4OSPA 4JBGA 4HYYA 2AC7A 4WXYB 4Z9BA 4B3CA 1CHDA 2HRZA 5DSXA 1B16A 1HYEA 1J2UA 3ZD7A 1DOAA 1RLOA 4UM5A 2QZPA 5D01A 5HOEA 4ND3A 1T10A 4DNFA 1CS4C 1F4PA 3KUUA 4ETNA 4JKIA 1W6RA 2D5IA 2FPIB 3X43A 1EP2B 3T3MB 1XVIA 4TXMA 4UREA 2QGNA 2CBZA 2CE2X 1GNTA 2BGJA 2PTGA 4FC7A 5FJJA 1H9BA 3EC1A 3I2KA 2Z57A 3RAFC 4O1HA 4NCHA 3UT6A 4LC0A 2RGBA 3NBAA 5EEHA 3DZ8A 1ZKMA 3IYLW 1B4DA 4RJLA 1FFAA 1HDEA 1V3VA 3PZBA 3LL4A 3DR5A 1QBGA 4ZALA 4EG5A 1Y6JA 1PFVA 2G9UA 5FEMA 4B4OA 2ZW9A 4E5KA 2DVMA 2O2YA 1E7MA 4KWTA 4V0LA 2F9LA 1GKYA 3U3KA 5JAZA 4OQEA 2ZR8A 1P1IA 2A88A 2R1UA 4XCXA 2PZMA 2VA8A 1US8A 3UTCA 4U2GA 3ZDXB 4ARAA 2CZCA 1REQA 1K8RA 2DFVA 2PKEA 1L1RA 2RGDA 5CT6A 1DE0A 4XGQA 5CG1A 2J3HA 1Q1AA 1KJNA 2IODA 3CCFA 2J33A 3FE2A 1E3WB 2GJ8A 3QVXA 5KVSA 2Z6UA 3EISA 5IG2A 1ISGA 3IJEB 3OZRA 3IQIX 1Q20A 1PFYA 2BFEA 1DUIA 4IDFA 3CT4A 2CFTA 2PL1A 1XMSA 4P32A 1M1YB 2HDOA 1NPYA 3OE7D 3ZX5A 2JBHA 3CSDA 3PLRA 1D1SA 1ISJA 2J31A 1CUWA 4ANFA 1JFFB 2XUZA 2VHEA 2ZVPX 1PNRA 3KQKA 1ETHA 2QM3A 3GFFA 3V7UA 2OP0A 1SZDA 4FPXA 1ABBA 3GH3A 3DZGA 4ZIRB 2OM6A 4FGZA 1DJOA 1DRWA 1I8TA 2G88A 4PO3X 1LW7A 4BO0A 1PR4A 2RG7A 3QQ5A 4YJHA 1J0DA 3N2GA 3WYFA 3Q72A 2JI4A 1MA3A 2W11A 3GMDA 4G36A 1JHZA 4IQ0A 4OKIA 5ALIA 3FHLA 2CEKA 5FUMA 5TMPA 4ARUA 3QWAA 1TW2A 4GRAA 4QT0A 3T61A 4C9BA 4U7DA 4WCVA 3DLHA 2IYRA 4K9DA 1QDUA 4P6VF 2EW8A 3LGSA 1ZD3A 4HGQA 4LJ7A 4KR7A 4LAFA 3ELDA 2W93A 3BSSA 3R3WA 4JVNA 4R1LA 2ZI6A 3F1LA 4YAKA 1E1MA 4HYQA 2QNBA 3UUEA 2C57A 1E1CA 3ROEA 1RAGA 1W25A 3AFIA 3EUFA 1JQBA 2Q50A 2IITA 3F49S 2GJKA 1XDGA 5I7WA 1OPRA 2CLSA 2AFHA 4TRNA 4UPVA 4PSUA 1N9GB 1Q3KA 1YKSA 4OXIA 4UXJA 4GOOD 2B4RO 2NG1A 2Q4DA 1T1SA 3VH3A 2X19A 2H7YA 3BORA 4BNXA 4W5RA 5ELLA 3RR2A 1FFSA 2R8EA 4QOEA 2I1VB 1E69A 3QHPA 1FVXA 3DAGA 3QTBA 1JWLA 4KV9A 4ZYLA 3PS9A 4PC7A 4GYJA 3KKOA 2FP3A 3IQDB 3M6AA 3ZQJA 3NHKA 4ESVA 4MMXB 1T8UA 3C16C 1FJHA 3BD6A 2Q62A 2BHNA 5HZKA 5I5EA 3HM9A 4ZU3A 1DIOB 2OHVA 3A4IA 3HLTA 2WT4A 4F7WA 4ND1A 2G6TA 2VA9A 2QU8A 1ZKDA 3EXEA 4QSMA 3PWTA 5ENDA 2P41A 3UKOA 2QRLA 5DM4A 5EIOA 5I9LA 3PNPA 3FUCA 1UDAA 1ZCZA 3L8GA 1XUOA 4RD2A 3SCZA 3LGXA 3SQDA 4DCGA 1W36C 1HO3A 2G9RA 3C85A 1AUQA 3JASB 1DAHA 5HFAA 3DMDA 3DOHA 4X90A 3CNQS 3L0YA 4UBNA 2H2FA 4B6PA 1VHWA 4E09A 2UU9B 5K4AA 1LTHR 5J2UA 4KDCA 2G07A 3KB1A 2O52A 5BPHA 3OF2A 1L4GA 2X6TA 3MJ4A 1K08A 5GONF 3RWBA 2CV0A 1TUIA 4KGVA 5HG0A 4FZRA 3DMPA 4WCFA 5JSZA 3DGEC 3IBTA 2IY7A 4JU9A 3DOIA 4CG2A 2EP7A 4YFVA 2XGMA 3OZUA 3BD7A 5CNKA 4MPPA 1E7RA 5H3LA 1KS9A 4A0GA 2ZWVA 4DLWA 3FCAA 3EPLA 1I1OA 2Z9CA 4OQLA 4TQAA 3DH0A 5A0FA 4LXYA 2W6PA 3MZ0A 3FVTA 3PK0A 1SEPA 1FE8A 2DFTA 4CHGA 2YWFA 1VL8A 3SFZA 3IJPA 5HKOA 3DDUA 1RRKA 1Y4UA 1RAIA 3BF7A 4DW8A 3GP8A 1FW8A 2XEXA 2ZRGA 3G8AA 2XCLA 2UYOA 2OC9A 4L0MA 3STVA 5CX4A 1WG8A 3ECSA 4ZJYA 4X1IA 2ILVA 3RF7A 1DV1A 4MDHA 1IZ7A 2BBTA 2PKCA 4NDAA 1LI5A 5DNVA 1YR3A 3N5CA 1T43A 2FGJA 4HDNA 3LCUA 3GJ3A 2FZKA 1NF8A 3KOXA 4Y7DA 2VP3A 3FDXA 2PS3A 4TV8F 1FTWA 2WD9A 1ADYA 1TQDA 1UH5A 1O08A 4PQEA 4EYEA 5CFMA 2WR8A 2WYHA 4MAMA 5EXDA 4A3SA 4ZT6A 4Z0TA 3L79A 3Q5GA 1B6GA 2R79A 2ZKLA 2GO7A 1XTTA 1G5TA 4CTKA 1D1PA 2ABWA 2R2GA 2P9BA 3DJYA 3E22B 3I6BA 4GW3A 4UARA 1SZCA 3CEPB 2OCLA 1G19A 1UM9B 5K3BA 3OIUA 1UKEA 2VDJA 5IAJA 4URXR 1QIKA 2V0CA 1QNLA 3EDOA 1B73A 4C07A 4M89A 4CLOB 3UOGA 3KG2A 4PG6A 3H5TA 2C1EA 3H4VA 4X5OA 2COKA 1U11A 2NV0A 5DTEA 5FD8A 2XX3A 4B81A 1A8HA 1R1DA 4AY5A 2BIFA 3RC8A 3IGFA 3PHHA 2WRZA 2BSXA 5JAOA 2C7RA 3NIBA 4HGNA 5C53B 4MRSA 5A4AA 1FQKA 1ODSA 1T2UA 1KSFX 1IXKA 3FVRA 1ZG3A 3QKTA 6Q21A 4M6WA 4KWIA 1XL1A 4HWRA 3RV3A 1T2EA 1JJAA 1X7WA 5DTIA 5K3CA 4TTTS 3WKBA 5L4NA 1ZOOA 1Z4OA 2FN8A 1XZJA 1FJ2A 2IPXA 1DX9A 3GQBB 1IG3A 1SRQA 4NE2A 1VKJA 4CVNA 2ONJA 2JLYA 1JQDA 1L7OA 1PLJA 2QORA 3K32A 1AT1A 3AVQA 1BXZA 1IY1A 3VU9A 4DXAA 4AJKA 5LQRA 3CRZA 1E2UA 1GNSA 4EP1A 2VDWA 4EJ0A 4Z7QB 5KWVA 3LD9A 1GRNA 4IDOA 2CNOA 3T0IA 4YRZA 3K1YA 4DLXA 1Z4JA 1NW9B 1ZN8A 2ZE7A 1OWOA 5D6NA 3D8TA 2W5UA 5KYUA 3DUWA 4FYYA 4HS4A 2DLDA 4QQFA 5IVKA 3FIUA 3Q8LA 1WD5A 4BN4A 1O94D 1L4UA 1L7QA 2IQIA 3AI2A 1UBJS 3IAS6 1DAGA 2YYSA 4MI9A 2XVYA 1HNNA 3IP8A 1YK0A 1ORIA 4UTNA 4E46A 3P71T 4B4VA 5GINE 3S7ZA 1KJJA 2EDCA 3R0JA 3A6HA 3UOWA 1NASA 1G8MA 3LQ4A 4MVJA 5EVCA 3B6EA 1CRWG 2Q29A 4K9RA 2GM5A 1X6VA 3MBOA 4FFOA 5ENZA 1YVRA 3JQBC 5A2GA 2VPXA 5KYGA 2QIOA 2ECOA 1D8AA 5F12A 5AJYA 3O4FA 5FBLB 5IN4A 3S27A 2AC2A 2IZ1A 3GUVA 1HEIA 2P30A 2QLNA 1VSVA 4NH4A 1N5KA 4C4OA 1QANA 5DLDA 4J3NA 5I9NA 2R1TA 3PD0A 1EEXB 4I9HA 4P53A 3TAXA 1UF9A 3BG5A 4YCMA 4MRMA 1N1MA 1JLMA 3OIDA 5JBQA 3U7HB 1SBYA 1VA5A 2J0VA 2WT9A 3LHSA 4IEFB 1NR5A 1W93A 1VG8A 2PQ2A 4V0ME 1TZBA 1LSSA 3BYZA 2Y77A 1W34A 5JWHA 1U9JA 3CE9A 1JTVA 4EKGA 3C0KA 3AF1A 2FCRA 1AGNA 2C5HA 4R8RA 4RKRA 3PUYA 2PZFA 4URFA 3TB4A 2J3QA 1WULS 2CGEA 3VNAA 5F33A 3WADA 4BVGA 2ECPA 1QHHA 3R3ZA 5TGTA 3ENWA 4DNPA 2VJPA 4XGIA 4MPJA 3DUFA 4M21A 3R3HA 4HAOA 2QX7A 3I9JA 3MWKA 2DBYA 3PRHA 3GDOA 2F2TA 2WBLC 1Y8RB 1TX4B 4I5IA 3R1IA 3RKRA 3RUHA 4B71A 4XARA 5IBCA 3JVEA 3AQ4A 3GZTB 1DAFA 4RMNA 1RHMA 2K2QB 2ZIAA 3AFOA 4YMWA 1MDBA 5AUOB 2QV0A 5L51A 1OQAA 2P2ZA 1T0UA 2ODNA 3PFFA 4HWKA 3TKLA 2FNAA 3N2NA 4UPEA 2IPOA 1SXIA 4DSNA 2WINI 3FN4A 3BKXA 5JCOA 1MJ5A 3DTNA 3FKSD 3LDAA 3O9ZA 1EWYA 1W0KD 5IVDA 2IWHA 3S28A 2ECQA 2B98A 4L73A 3EVZA 4L72A 4LW8A 3C3EA 2VCHA 2V6JA 1Y3AA 3W4JA 1WL8A 4QUBA 2HSWA 3MLBA 1J22A 3IP6A 2CJYA 2O14A 1WZNA 2Q1WA 2GFHA 2YYYA 1S1CA 2YX1A 5H3CA 3VR4D 3LKDA 4DEXA 9MHTA 2YCBA 3OWOA 2QLMA 3P2MA 4WZBB 3DDNA 3MERA 3UAVA 3BMNA 3T35A 5KOHA 3ILVA 1T35A 2O7NA 5LZ5A 1WXFA 2XCUA 3PEWA 3SQLA 3VSBA 2AE2A 3WRXC 3TPCA 1WPRA 1CCWA 3G9XA 4N4AA 2WJ4A 3GAAA 4TXHA 1N5RA 1WLYA 1ESCA 2OZPA 1FDUA 3CONA 3QWHA 5FBVB 5IPFA 1AHPA 2AEFA 4JP1A 3HJNA 5BYJA 1ZD8A 3LUKA 1FS6A 5H9VA 2V7UA 1OJLA 3T5DA 2CB0A 5IAOA 3KV1A 3HJTA 2WTBA 3EZLA 1UT8A 1JP7A 3UMYA 1YSCA 1Q1ZA 3MRXA 2WUDA 1QXSA 2V58A 1V7ZA 3HGTA 4X8MA 1CUJA 5JJBA 1XEAA 5BN3B 2UAGA 3AU8A 1ZXLA 3KWMA 3L07A 1BU8A 1DVRA 3K1AB 1F14A 1Z5ZA 4MGYR 2QM0A 2LZ0A 4EY6A 3Q12A 4NYJR 5EC8A 4J49A 4BZXA 1YL6A 3GVCA 4AWXA 1SUBA 4G4GA 1ETUA 5BSVA 4BMVA 3DYBA 1E2PA 3BEOA 2B69A 5JFOA 2WILA 1TJ3A 3IELA 1Z6YA 2YJTD 4BJ5A 1U04A 5SZIA 1RNLA 2BLLA 3ADDA 1QVVA 4YPOA 4OHFA 3GOHA 1MH1A 2C4HA 4A0SA 2GUWA 1QO0D 5HGJA 3RI3A 1UDRA 4KO2S 3VU3A 4QKQA 3IEPA 2GRAA 3DKVA 2WF8A 3BE4A 3T41A 1MB0A 2WPNA 2IV7A 2EFEB 4GMFA 2EAUA 2I4NA 5KHOC 4OBWA 2XUQA 4H7FA 1J2TA 4GOJA 4UFNA 1DC3A 1XYYA 3PDCA 3OURA 3FVVA 5TXGA 1SC6A 3ZK7A 1X14A 2HKIA 5HDQA 2WABA 4KDEA 3HO1A 1KJWA 5KCMA 2ODWA 4MRPA 2GEVA 4G0VA 5CITA 3U44B 4AC9A 3AR3A 1HZZA 4NTZA 4GBMA 2BKXA 4JH0A 3V8EA 2MR6A 3I9NA 1EFRD 4KAAA 1LKZA 1Z6PA 4MUYA 4E07A 2Q6KA 3S55A 2XDAA 4TSKA 2DM6A 2XTAA 2BEWB 5BWBA 1G2PA 4HVAA 4LDAA 2BKAA 1R5BA 2LKCA 3E27A 4MPTA 5DHPA 4LBWA 1XTSA 1TYCA 2F43B 5KNCA 3QMWA 5GM1A 4KREA 2A5LA 2G1AA 4UEQA 2VPTA 4PC3A 4RA9B 4ZCQA 5A2QA 1C9MA 2AOWA 3P0JA 3H04A 1YBAA 4HQKA 4MW9A 4M7WA 5KYWB 2IZ6A 5C4IA 4R54A 4ARCA 4BVEA 3KYBA 5BQFA 3AF2A 3TOZA 2IKQA 2BEVB 2KPOA 2V7VA 3PQFA 4JLMA 2IW1A 1GR1A 2CDAA 4DEYA 3TIVA 2QMOA 3EEIA 4E5UA 5I5GA 1O3YA 1ESDA 5ALZA 4DADA 2OCPA 2GAIA 3O74A 2V96A 2O2ZA 4RHXA 4L0CA 1TCCA 1ZCJA 3H0EA 1WCYA 3GI1A 3V80A 3SZGA 1IZYA 1B42A 3K4PA 5ALNA 1Y9DA 5B1IA 1WX1A 4HRAA 5BV7A 3ESDA 3GU3A 4ZEMA 4FFSA 2C00A 4OF4A 1E6WA 3L77A 4URVR 4W9NA 3ZWWA 1W4RA 4JI5B 4AJLA 3PL1A 4HH0A 4WXPA 5BWLA 1UODA 4WKOA 3DMRA 1VHJA 4RHFA 3WIEA 4CM7A 3WDSA 5IAEA 2AJTA 4HVCA 4TS9A 3WL8A 3X1KA 1QMGA 1VDZA 4H27A 4EF4A 2E2WA 2LCFA 4GH5A 4DXHA 5CB4F 3GCZA 1WUYA 3IX7A 5BUSA 1YTUA 1J1IA 1K3TA 1U0NA 4GOND 1YS6A 2DECA 3CKMA 1A8PA 3H65A 4RTKA 1M6HA 2ZDHA 3ZD9A 1PLLA 3FRHA 4QDJA 4R69A 1I4OA 4ZCIA 3AOGA 2R25B 2VIIA 4LZWA 4JI2B 5ALXA 4BYGA 2QUZA 2HA0A 3VR6A 1T0IA 1V2GA 2CMGA 2JFYA 1X87A 1EFPA 4G26A 1LXCA 4JBLA 3ZW7A 2Y1KA 5HOQA 2F1OA 1XAGA 5CDGA 1R6DA 2PANA 2DQYA 2Q3EA 3CWCA 5DYTA 1SQSA 4OMDA 3TL3A 4RK4A 3H83A 3DT9A 3FUXA 3JWEA 2OQIA 4R3WA 4JC0A 4KLCA 2B99A 2ST1A 2AHOA 3C1UA 4RH1A 4DMGA 4MHSA 2JLQA 1YZGA 1IXSB 1NUQA 3S2YA 1G291 2WHRA 5C8DA 3WC4A 4AJ2A 2BVNA 4EUFA 1ZMRA 1WU8A 3HBNA 4RPHA 2OPHA 3HXMA 5JAQA 3IKMB 1XX6A 3OF5A 3ELYA 2I8CA 2E1PA 3LTNC 4AO8A 2J6CA 4WGGA 3SMQA 2F3SA 3UV7A 1BCRA 1TVMA 4OLAA 2HC9A 2IU4A 5E2IA 3NUGA 4BLPA 4Z3KA 1T5DX 2X8JA 5G1PA 2CVHA 2BHSA 4ZK2A 3GPIA 3E82A 4P5DA 5D3MB 4KNWA 1A1VA 2EQBA 1F2UA 2E87A 2VK2A 1G38A 5ALTA 1EWTA 2O8EB 4KN9S 3C1AA 4UFOA 4AJ9A 5L6LB 1SHZA 2PS1A 3BKWA 3PGLA 1U90A 1JA0A 3ANTA 2QMUA 4EKEA 3O26A 3A4NA 3L6CA 1P5JA 2D0DA 4OAOA 1GL3A 4IKOA 3RROA 3STHA 3IDSA 2P7HA 4S2EA 1D2RA 4BLRA 4CUKA 2R65A 3RJ5A 4DV5B 1SPBS 2ZBGA 1N0VC 2D5BA 3BWBA 5CFNA 1XXHE 5REQA 2PGDA 2OOKA 1C50A 1FPMA 3IR6A 4D0SA 4YRTA 1YJ5A 1RJ9A 3FTQA 4MUFA 4X71A 3AF0A 3GD7A 1CETA 4F71A 1ADFA 2NXCA 3IEIA 4MGZR 2YV1A 4QHTA 5JASA 3L7KA 4TLEA 2UUCB 3PKIA 5GIOE 1YZVA 3D3EA 4O4HB 4OFZA 3MGGA 2HY7A 2JH3A 4PIPA 4FOSA 4O33A 1YOVB 2G9ZA 3ZHSA 2QY6A 2WZQA 1DARA 1AK2A 5IMSA 4CEIA 1EHCA 2CUNA 3HA5A 4QATA 4ZREA 3RS0A 4EFNA 1PTJC 4HUJA 4U6QA 4YASA 4CKZA 4DUZB 1P91A 4AZ3A 1ZA2A 2BSAA 4DVJA 3DONA 2N0SA 3E61A 2FMIA 3EPPA 3KZNA 1E1NA 3QU5A 1P6QA 3CKKA 1BDBA 3CUEF 1U1CA 3OM9A 1LDYA 3C8HA 3KLOA 4RZQA 3EG9A 2LTAA 1XV5A 1TC2A 1LVUA 4LYFA 2VEOA 1TJ5A 4ZICA 3U9LA 5TT1A 4BRWA 1OF1A 1NBAA 4KVFA 3WNVA 4B09A 3H5VA 2ZSBA 4Y2GA 3ZZ1A 3ORYA 4OPMA 3AETB 2XSZD 2ZFUA 4C3OB 3NBKA 1KY4A 1YHZA 2Q0SA 1EK1A 4W9MC 3TEMA 3VFDA 4Z4EA 1T8WA 3A6GA 4X0EA 4MUXA 3RUCA 4GYWA 5FFFA 5KAPA 2C5SA 3ZXXA 2IY8A 2R8RA 3CNBA 4IIDA 4TROA 1U0JA 1L7EA 3EQ6A 3LQFA 4CM8A 2RK6A 1GXSA 3NVAA 1ZU4A 1O57A 1YR6A 2R8XA 4EHIA 3ZHBA 2O5VA 2E18A 1W46A 3D9QX 4AUEA 3P96A 2UYQA 2WYIA 4HX2A 2H7XA 4NBNA 4AMZA 4AUNA 5EIAA 5EJEA 1QQAA 4UZSA 4JHLA 1BOFA 1NNSA 1KFKB 3QKSB 3NTQA 4OLJA 1ISRA 3M5WA 1JF8A 4G3XA 4L15A 3UH0A 4LX0A 1WUTA 3L7DA 1J6UA 1Y98A 2X0KA 4QOSA 4R0VA 1NOKA 2QN1A 5H5JA 5D5QA 1QIEA 1JG6A 4EB6A 4S05A 2HW8A 2QMHA 3GGGA 3K0KA 1DXQA 5K0CA 5MFPA 3CH6A 1RBYA 4OK6A 1S7GA 4DT1B 1GZDA 4FNAA 4DXDA 4GEGA 2AKAB 3B9QA 4KN5A 3LWDA 1KS2A 2JFNA 1Y4AE 1F4VA 5J63A 4QPZA 3PJRA 5A4IS 3ZEIA 1JL3A 3S6JA 4EJSB 4JI8B 3FGNA 4OGFA 1D4OA 2ZIEA 4S12A 2ONYA 4DA6A 3BXHA 2P0YA 3EOBI 5LNK6 4IRUB 4R3UC 5DYNA 3UFXA 3ST7A 5DI9A 5DK4A 3WNDA 4ZZ2A 4OATA 3KYCA 1Z34A 1CYDA 1SUDA 1D5CA 2W6ID 1SMKA 2E4ZA 3D8HA 4X20A 4Y9TA 2G5PA 1QF9A 5JEDA 3RG2A 1JTEA 5EVJA 3AEYA 1A2KC 5AHXA 2A94A 3F4KA 1EHYA 3UT5B 5K6AA 4G9GA 2O8DB 3T5BA 2PKQP 3O8CA 4FHFA 4JXXA 3TO5A 3ABQB 5DW0A 1WKBA 2MTBA 2WVHA 3P2IA 4JNCA 4BDTA 4RPLA 4Y2VA 3KVRA 3FCOA 1LSOA 2JD1A 4ZO9A 5BV1A 1P9WA 2FAXA 2WTAA 4JI4B 1GN8A 4GBJA 2R7KA 1QHYA 5AT1A 1WVIA 1NXQA 1JDTA 2WWRA 1G4HA 3BK1A 3BMCB 1NF9A 1ZNZA 3E7PA 3Q7PA 2H2DA 5FHRA 3RIGA 3LFHA 4JYCA 1U1IA 5HKKD 3O83A 1YU6A 3SYRA 1SIWA 2PL3A 3GZNA 3QTTA 4M1OA 4FFWA 1E32A 1DLJA 1TAGA 1VPVA 3IDAA 3GVHA 3M6WA 3R7AA 2HF9A 2M6KA 4Y6PA 3SJ7A 1XMQB 3K09A 3EF0A 3ASYA 3SBDA 1E6CA 3BQMB 2OV1A 2DWPA 1ZK4A 4WOJA 1BMDA 4U1RA 2DHEA 2I6GA 2PT5A 3G59A 2AB0A 3IMGA 4HDOB 4KLNA 4PZ9A 5J5AA 1A8UA 3T7AA 4UU8A 1OAOA 1VPDA 1P2TA 3M6IA 3W5IA 1DEHA 4FFDA 4XVQA 1QRTA 2ZAGA 1YVPA 3A3YA 4AAYA 3GXBA 3E9ZA 4DVGA 3P5SA 2B92A 2JLCA 3HJHA 4RA6B 4YC7A 3L6EA 4J03A 3VH2A 2J0UB 2JCYA 1XP8A 3FPJA 1IBMB 4BO7A 2WU0A 1ARZA 2AOXA 1H94A 1L4MA 4JSRA 3CMMA 3FKQA 4ZAGA 3T9DA 3PDIB 1E7WA 4PAMA 3ED1A 1VECA 4IINA 1ODJA 2NU7A 1P9NA 4F6CA 1XTUA 4H15A 1NMQA 3T3OA 5FWAA 1R8QA 4II3A 4W99A 4X61A 3Q85A 2Q3BA 4GOMD 1E2MA 2R97A 4TYWA 1JXOA 2ZJ3A 5F5XA 2W2KB 2J5QA 3D59A 4TN1A 2H1CA 3UVEA 1EVYA 4O0MA 1DCTA 1Y1LA 3ROMA 4L22A 1NDQA 4MCJA 3EVFA 4Y2XA 4FBMA 1J0XO 4L4UA 5A3QA 1KYQA 3EH1A 1NV9A 1J21A 1P73A 1TRHA 3PA6A 4UHHA 4BV8A 2WNSA 1KVQA 4BFTA 1Q1EA 4IDHA 2RC5A 2AWNA 2A14A 3F7MA 3VR2A 2FWIA 1QHSA 3DBHA 3VYUB 2C58A 4JT2A 2GQ0A 2PVPA 4FW9A 2IYVA 2XY4A 3OT4A 4LV6A 4ND8B 3VVMA 4ABYA 1ZUNA 2N47A 4X7RA 5ALVA 1JH9A 1W1WA 4K2AA 4JX8A 4PLWA 4QXOA 3SDZA 1RAFA 4GGOA 4WCFC 3SKVA 5CA1A 2CVQA 3BCUA 3DKIA 5DJ5A 4I14A 2O06A 4LRYA 3O8OA 4IDDA 2G9NA 2A1IA 4FDAA 4MR7B 1X9HA 3OD1A 4CG3A 2FEPA 1XT6A 3ZLBA 2OHOA 3DE7X 4Q34A 5EWLA 1V0JA 4GZ6A 4KQHA 4UU1A 2FU5C 2RI1A 3ZK8A 4DRZA 1Z88A 3KYIB 2IE0A 4PW0A 2NZXA 1SQFA 3DBRB 3W2IA 5KINB 1GGEA 4DLTA 4NXNB 5EPOA 2MCFA 1ZP6A 1I3MA 5HQTA 1TLLA 4D74A 2JZOA 1TL7C 4IJKA 4RVCA 2GCOB 1X1QA 3I4LA 4I8XA 1PG2A 4K28A 3DLPX 1JQLB 2XV1A 4I9GA 3NVDA 5T3UA 2KI5A 1UDCA 4C0JA 4E6EA 3D1LA 1NVAA 2H2HA 2QSUA 4BNHA 2VUUA 1JVBA 1PZNA 1VJRA 1M6WA 2WQ6A 1DX6A 4TV9B 5CCXA 2PGLA 5TDHA 2QP3A 4LSMA 1UQTA 4L2IA 3SC2B 3KKKA 3RKSA 1XKXA 2QAGA 3RBXA 1XCGB 4EHFA 2F1HA 2IYYA 1XJWA 2BTQB 1J2YA 4W5JA 1EFAA 4FBGA 2Y6VA 1PSZA 2P27A 3D6UA 3G7UA 2FUEA 2E82A 1C7FA 3IPCA 3H2JA 5FPTA 3TLJA 1ZZEA 2V5UA 4EUEA 4PM4A 3INNA 3MWJA 3TG8A 3FPLA 3HKEA 1XK6A 3K9QO 1XQVA 3NAZA 5E38A 4LZJA 1IM8A 1J23A 2PUHA 1X9GA 3TLGA 1JR3A 1G4AE 1KAQA 1PL0A 2NQTA 1Q44A 2ZDGA 3LKZA 4WL0A 3JD4A 4R1SA 3WFZA 5F7OA 1CT9A 3KRTA 5I7FA 5KVQA 1BGXT 3S2ZA 5KJ6A 1J5XA 1KARA 4CMBA 2MJLA 1OH5A 4DDKA 3EBPA 3G1WA 4BNGA 2EJUA 1H69A 3JZAA 3NVKI 2IYTA 2G04A 1PAUA 5A5VA 5BV0A 4KFTA 3DPUA 3EARA 4TTVA 2R4UA 4NV0A 5LU8A 2WK1A 3KXDA 2XYRA 3KDPA 2B34A 2QE7A 2X1HA 3MHTA 2R4QA 2LBPA 3NFRA 3ZCXA 4V2IA 1CUUA 3FPFA 3K53A 4L3WA 3ZGVA 1AX9A 2O8VA 4AMUA 4CBVA 1GUDA 3I04A 4I1OA 4IV0A 3USZA 3RYFB 2EIXA 4U63A 4ER6A 1R5NA 1U7WA 3K94A 2KB0A 4DC0A 3JQEA 5FP0A 1T2NA 2EKDA 1LPNA 2CVZA 3OBBA 4JUIA 4BX2A 3WK9A 3GDWA 2YCLA 3JD3A 4FLMA 4BLQA 1U6IA 2AQ8A 2HWUA 5FWXB 1JFLA 4F3RA 4C5BA 5KUTA 3N05A 5CJ2A 5AOAA 3PUZA 1QG0A 2K7ZA 3GRKA 2VJLA 4DKJA 1R0YA 4QVGA 2IC5A 2ZT5A 1XDSA 2GBLA 3FPBA 3P19A 4O4LA 2IHZA 1FQOA 1H05A 2R6ZA 3FTNA 4I9NA 3QJYA 1VPWA 1LLFA 5MN4A 4KCGA 2FOIA 1SD1A 3G23A 3E6AA 1X7GA 2DRIA 1KKUA 4FYKA 5IEJA 1EWKA 3JY6A 4PZAA 1T36B 1FYFA 1HI9A 1Q7CA 1U8AA 1CZOA 1FDOA 1U3TA 4OYHA 4RQTA 1Y1TA 1OGJA 4GYKA 4AKIA 3AFNA 4R7TA 2C7PA 1NUHA 2ZATA 4R8MA 1TYBE 3NLLA 1SN7A 4KWEA 1C1DB 1JAYA 2R48A 2VHZA 4L02A 2D8AA 4Y7CA 1HM5A 4UD2A 4BOYA 3IIEA 4HEQA 3MW8A 3CVJA 3K6JA 4OU5A 5BYKA 2A9PA 1JJBA 1P31A 1H1TA 1KEEB 2G67A 2H6EA 3KC2A 2QVXX 3R40A 3CJQA 3IP5A 4OXKA 3FRJA 4QBGB 5BOVA 1OH6A 2Z3VA 2WWYA 3G13A 1XAIA 3D7SA 4RMIA 2X0JA 4B6EA 2JI6A 5EJMA 2I4IA 2MYPA 5BSFA 4L8YA 2YY6A 3DB1A 4LXIA 2AGVA 3JQ9A 1O9GA 1XMVA 2FX3A 1Z17A 4J4BA 4D9HA 2NT4A 2EP5A 4QLBA 2IY9A 1FBNA 3AKZA 5J4YA 5JQGB 2J08A 1LA2A 2P75A 3GRAA 4WNAA 3HU3A 1K2VN 1MAUA 2BMJA 2YIMA 4TZKA 5KJEA 1M2OB 3RU3A 3DCIA 2PX5A 1JHUA 3F67A 3L0IB 3LWBA 4JJFA 2C42A 5FUXA 3TZBA 5TNXA 2Q3FA 5K7SA 2AOVA 1N34B 1ICEA 2RGNA 2GF2A 4LZNA 1KAOA 3QF4B 4U6SA 4U7FA 4UM8B 4XYMA 1QE5A 3HYTA 3F71A 2B94A 3G88A 1JU4A 1KO5A 4JHXA 5JCOC 5T64A 3PHGA 4TTIA 4K9SA 3A70A 2R6JA 3LQ1A 2HSGA 1WHSB 3KOOA 3IDFA 3FFTA 2EKPA 4C5CA 2IOFA 1JDJA 4C03A 1QHIA 1QU2A 4H1UA 1N75A 4PLTA 3RIMA 2X5XA 4US0R 5K4HA 1ZJWA 1CUXA 2O2JA 1V25A 1F17A 3HBFA 1U98A 1XU7A 4IH4A 4FE4A 2BKLA 1NVKA 1QH8A 4G5OA 5IJ9A 1WB9A 2QRPA 3CGGA 2JRCA 2HH9A 1PR9A 4P3NA 1P1CA 2XXBA 4TTJA 4TYQA 1LNSA 3A6KA 3UMBA 4EL0A 3DBLA 1E7SA 4DAEA 3C15C 1RFLA 3DHNA 5HR5A 3I34X 3HA2A 2A0FA 3QBTA 3NM5A 4OQZA 4YRNA 2FRVA 1CUFA 1P75A 3RSHA 4V0QA 1GWNA 1XTRA 4Y2YA 2Z5LA 3FAZA 5JYEA 1XE3A 1LEHA 1KPHA 3UMJA 2BGKA 4DLAA 1L8AA 2IRWA 4TKUB 2D1SA 1ZM3A 5HUQA 2BE7A 2RG1A 3PDHA 3M4ZA 3PNOA 3NDJA 4NU5A 1NLFA 1MD9A 4O8CA 3KOUA 2ZIWB 3X1ZA 3NOQA 3BM5A 4Q00A 1TU4A 2ISCA 1F8XA 1T5IA 4GNRA 1HMPA 2YV5A 4QRDA 4YRCA 5G41A 2PV7A 2QYHA 1NN0A 3ZC3A 4DV1B 2EXXA 3GG2A 3SC3A 2B83A 3LKVA 4NBWA 5E6SA 1GQFA 2C8KA 1RCTE 3LU1A 4HDKB 2V7WA 3DAOA 4HYEA 3RRZA 4DJFC 2XB9A 1D2MA 1W0JD 3FOFC 1MW9X 1PDWA 4BC1A 3CISA 3H8VA 4J91A 4G5FA 1YU9A 1CQPA 2PD6A 3H2ZA 1F2TB 1T8PA 2BR4A 4BB6A 3HY4A 4K6FA 4QFDA 5LM3A 2GEDA 1NHWA 4HFNA 1JIIA 4WNCA 1KO1A 2HCFA 3EMDA 4X1KA 1IUPA 2GASA 4HDSB 5T41A 5TY0A 3ROXA 2EW1A 2RONA 4B3HA 3DEZA 4RTLA 1P72A 3VTFA 2VWQA 5CFQA 3AM1A 1HLDA 3GYBA 3CKLA 4OJYA 3TOCA 1TTQB 2FMKA 2Y05A 1SVIA 1RQ7A 4CE6A 2XLCA 4COOA 4AQYB 3JU3A 4PYLA 4X92A 4BQRA 3F47A 3GUHA 3TRKA 2Q6IA 5KHAA 5DULA 4MLCA 2JGLA 5SICE 2HLDD 2ZSJA 2FMTA 4TVBA 2AN9A 5IYZA 3E84A 4PHHA 3LPAA 3NKFA 1L6RA 2R44A 4CKEB 5FI1B 4NFHA 2XQFA 5ILGA 3V4SA 1W87A 1HZZC 2IEYA 2I2DA 3A9SA 2DJIA 5CT8A 3R7WB 1Q16A 3WB9A 2XRMA 2CHVA 1EJBA 4L5AA 4TSFD 4HUTA 1U9YA 2QN9A 1KC3A 3R3SA 4BGVA 4RY8A 5HSGA 3O2QB 1L4KA 1KP2A 1RPNA 1YQGA 1HL3A 3I2YX 3KPYA 3OI7A 4GDMA 3G68A 5DNEA 2CHQA 2NSDA 1Y5IA 1XPUA 1SKYE 4TYYA 1S8NA 1A5SB 3CLTC 1O54A 3CRQA 3BIXA 3URMA 3T99A 5LD2C 2ASEA 3PRYA 3X2FA 1T34A 3FWHA 3ITKA 3MIIA 5IDXA 1A76A 2J4FA 1G6OA 3GT7A 3JPWA 1XLVA 3R24A 4N40A 1ZGBA 1NQXA 1CR0A 1Z2AA 3IKLA 1M8GA 5JJIA 3P2EA 4MRNA 1K8XB 1MVOA 1VLHA 5FFNA 3DXXA 3WGMA 1TLFA 4CMKA 5AHRA 5H4HA 4MMZB 5FT9A 1N6NA 2BFCA 3HQ4O 3RHTA 3VJLA 4URHA 4F91B 1EB8A 4FOTA 5CIQA 1XEXA 4OH7A 1NI3A 4RVHA 4JODA 1MJGA 4CJXA 2GPTA 5KNBA 2F67A 2JBAA 3CVWA 1WW3A 1QP4A 3R6LA 1K6MA 5GJVC 3SJCA 1P2DA 3DL2A 1L6IA 4F84A 4NCJA 1FDVA 1B0ZA 1HE8B 3FNIA 3EGEA 3ZI0A 4GE0A 3QFCA 4E2XA 1FRZA 2YMMA 1NXXA 3ESZA 1FFDA 1RHRA 3W8FA 5FOVA 5CXSA 2JK0A 1C30B 2A5GA 4P34A 2QZ4A 1XD2B 2IOQA 3HYNA 2SKDA 3PG5A 5L3SB 2Z8YM 4W9NC 5FTLA 1WF6A 4L07A 3HEMA 1GZ4A 2HBYA 3Q3HA 4L5YA 5B53A 4BJ3A 1ZNXA 3KT0A 2Z2JA 3MUFA 2VL7A 3IOMA 4PWZA 2A30A 2EIHA 2XJ9A 3DEAA 3OPMA 1GPBA 3RSFA 3WJ7A 2WW8A 4G56A 1P4HA 4AO6A 5ED4A 3A58B 2O8CB 1JXAA 4R5HA 4IQGA 4B2YA 2P8SA 1IN7A 1RXCA 2QBYA 3ER8A 1NJ5A 1CVRA 2RHLA 4PZUA 3AGPA 1IB0A 2RCNA 3WQRA 1RYZA 1FFCA 3GJYA 4ZTZB 3FHJA 2M98A 3PC4A 4BNTA 1IPFA 3ICWA 2C2BA 1GJRA 3P9ZA 2LD4A 2PA3A 2IDJA 4KBGA 2V1XA 5K0JA 4GC9A 3DTTA 4F8YA 2WMYA 1SUEA 3E0QA 4ROSA 5DT2A 3SK0A 3RVLA 4C43A 2WV7A 1IEXA 3NRJA 1FLVA 2CW5A 4PBSA 2Q3LA 1FOEB 3NAMA 5LIRA 5FUQA 4C0XA 2PFSA 2BI4A 5SV2A 4P4TA 4RELA 5JRJA 3PX3A 1H4SA 4RQUA 1N2JA 1R9JA 2HPHA 2P2GA 2FEAA 2F3RA 3EIOA 2IQ5A 2RHOA 2G40A 4H08A 5A0VA 3BN3A 2WD7B 5HHTA 3Q87B 1GDHA 5HBRA 1WKVA 3ME5A 3M8KA 2PZKA 1FXUA 1N2SA 3LMKA 4KO4S 2OENG 3F5FA 5JJCA 1SWVA 3B2EA 4C7JA 1W73A 3RW9A 5BURA 4D8VA 1MPTA 1Y8CA 3RD5A 1BE8A 3H4TA 2I62A 2YJZA 1ULAA 3PNYA 3JVUA 3WGNA 1EFKA 2KW5A 3VHLB 4EA8A 5E3JA 4JY7A 4CNQA 3VPFA 4U02A 4ZVOA 5CEEA 2ZUWA 2ANBA 2WVGA 5HYVA 3ZW9A 5SY9A 4DR2B 2AE1A 1YE5A 4DEVA 5BNZA 1QFYA 3AWIA 4RCVA 4LIPD 3C3JA 1H5QA 1PJTA 1ZITA 5JLJA 1SVWA 1IZ9A 5L6MB 1ZOLA 4F9EA 1M76A 5DVZA 3GJ5A 1IUKA 2ON6A 2HQBA 1LX6A 4A8HA 3WGLA 2WUWE 2P6RA 3WXBA 5A3SA 2BYTA 2XNHA 2WEKA 1X74A 2BEUA 2G36A 1ZM7A 3DAFA 3KVVA 4LRTB 3P4UA 5TPWB 3E5RA 1YXMA 1FLDA 4L1KA 2QGFA 4B4WA 1EK0A 1JZQA 4V3CA 3D8SA 3HXLA 3EF3A 2YS7A 1VGQA 1DINA 3AVPA 3HDYA 3OT5A 4IPTA 5M04A 4GI7A 2EJTA 3BMQA 5ESWA 3PBKA 3MJEA 4XVHA 4FGSA 4ENPA 2Q1TA 1L5WA 5K3OA 2IXDA 5THKA 4KXXA 1T25A 1Z2DA 3I30X 4PGGA 2HU7A 4QU0A 2KJQA 3MWEA 4XCQA 1O95A 2QPTA 3AIMA 5ALOA 2ZYIA 5JJ5A 2QJWA 3P0RA 2ZYHA 2C7QA 1LZKA 3DTVA 3V4VB 1JPVA 1W1IA 3R5XA 1C3EA 1HFJA 3H2IA 2GFIA 3BWYA 5KTOA 2BKEA 1FVOA 1MNAA 3A1UA 1UWVA 4RHTA 3W77A 1MW8X 1L4FA 3ZNOA 1SUSA 3G49A 4CCAA 1XLTA 2PUWA 4NIMA 4BVAA 2LDXA 2FTKE 4JGBA 4ZVRA 2F90A 4PQRA 1R64A 2Z08A 4Q3NA 2V9CA 1EVQA 1JIJA 4O2BF 4YBZA 3TUIC 5IASA 4QPCA 3BHIA 4YCLA 2CK3A 1D2CA 3SBXA 5CH3A 3BK7A 3EVAA 1RXYA 4TT8A 5TMDA 1GUBA 3RT1A 2V6FA 5AXDA 3P4YA 5CLIA 1ZK2A 1Z6XA 2I1WA 4JJ7A 2YDYA 2DKFA 4J0JA 3TDKA 2PRYA 4G81A 3VM6A 2HMVA 1N0UA 4M7RA 1ZC4A 4TKVA 4ZVSA 3ABZA 3FZNA 2IUUA 1M2FA 3QLJA 3T4PA 4WBNF 4AVYA 1KP3A 4PYIA 1AKVA 1ZMBA 1I1NA 3VR0A 2JH8A 3REFA 1FTSA 1BVHA 1DB3A 1YDMA 1WNTA 2QZSA 2VHTA 1B41A 4QUGA 2ZRCA 1YFLA 4WW0A 4CLHA 1O5IA 2VP2A 4UU7A 1GT91 1UWCA 4NJMB 1RABA 2OVBA 4Q3OA 4X94A 3AJ9A 2O9JA 1GL9B 3PEEA 2XE4A 5I9TA 1T5HX 5I7OA 2MR5A 5KSWB 4FYHA 1MMFB 4M1QA 3FZEA 4M3NA 3DAYA 5K0SA 1XCMA 5TF0A 2G1JA 1ZVMA 2ARKA 2HRQA 3IJRA 4I1RA 2GXUA 5E9AA 4ALJA 3K70C 2GLXA 2FJPA 3EQ2A 5HPYB 5ALEA 4ZT4A 4OG2A 5EA2A 1OC4A 1Z6AA 1USGA 3IUNA 3SQMA 2BR3A 3VR5A 4ACBA 4X7MA 5BN4A 2GBFA 2J48A 3SC6A 4DLYA 2VBFA 1I7QB 3DULA 5I8WA 2ANCA 3E48A 3EZNA 3G02A 3QFFA 2NAFA 3WL7A 2IEAA 1JIKA 2O50A 5C1DA 1J8FA 3J81k 3RFUA 1O6BA 3O90A 5LPNA 3LJKA 4R2WA 4XB6B 1FP7A 2YTZA 3C6QA 1PQPA 4DUGA 4WACA 4TWAA 3MLEA 2PZGA 3SLGA 2H0RA 2NADA 1ZONA 4OBEA 2W22A 1X7YA 1ECPA 1X80B 3QEMB 2YWCA 2OG2A 1Y34E 2G72A 5FI3A 2QG6A 3E9DA 1JDZA 3PNLA 5DGDA 4D79A 2CMFA 2IS1A 4QULA 5FNVB 2L69A 1JMKC 2VH5R 1O2DA 5FL7A 1SA0A 4F4HA 1IEWA 5K6AC 3HVKA 2AOTA 3P9KA 4K81B 3LHKA 2GDZA 3V4PB 1PUXA 4AX4A 4AP6A 2JHAA 4RFSB 1PK7A 4PZZA 1LPPA 1L1EA 2O05A 3OLZA 3PR3A 4I8DA 4O02B 4UAUA 3K2QA 3TOSA 4DILA 1BEZA 2Z56A 4FFBB 3KUDA 1W52X 1YRYE 1SK8A 3C8MA 3E7DA 3M6FA 3ROTA 2D2XA 4ZXPA 2BTOA 3OLQA 2P40A 4JENA 4MW1A 4RPCA 3C7TA 2B0CA 1F5SA 3ETGA 1WM1A 3HFJA 1QGUB 3OCYA 1N5DA 1OKKA 2PLAA 4FIDA 4P54A 5TE9A 3LDHA 3UAWA 1CUSA 1XYGA 3FYCA 3IESA 3R5SA 2YV2A 4IYRA 3Q5EA 4OM7A 3CRW1 4FHGA 1UXGA 4Q7LA 4UD6A 3S2GA 1NX6A 2NO4A 1XZMA 3K09C 4MW5A 4BTVA 4PSVA 3SD7A 3HDVA 1MX5A 2GXAA 2XE8A 2DCMA 2WHPB 3NDBB 1DRJA 1OAOC 4ZPXA 3GAFA 1GUAA 4G1VA 4QFMA 1NC3A 1Q15A 4YP1A 4G1BA 1CQXA 1RVDA 2BZSA 2VJQA 2CNNA 2OXCA 4OJKA 5EP3A 3REQA 5HUJA 4IMJB 1QIJA 1IPHA 2G77B 4AL4A 4CCYA 3ABSB 1FTYA 4B32A 4B3TB 3PR1A 4WK2B 1T29A 4RSRA 3ECAA 2MINB 1XL0A 5FTJA 1R37A 3F96A 4WADA 3RT7A 2O5EA 4JR0A 3NI2A 5EZ5A 1A9PA 1VRWA 1OHHA 2N46A 4X9XA 4FT4A 3QLEA 4FI3F 4DB4A 3THOA 3G3EA 4A2CA 4R1MA 5C7OO 5AVWA 1SZJG 1SXQA 1X8LA 4QX6A 5AWFC 4B0PA 1TDJA 2O57A 3B2NA 4JV5B 2EG5A 3MMXA 4AQDA 1JQ3A 1NVVQ 2Y1EA 4HBZA 1FS4A 1I0LA 3NHWA 5AKHA 3HCPA 1VSQA 3TSOA 1EDDA 4ZOEA 2FGKA 4G6ZA 1H65A 3ESXA 3RG8A 1UK8A 3NEYA 3BPSA 3CB4A 4REQB 4IIFA 2FMHA 1GPAA 3FPCA 3R5HA 1K6EA 1TYAE 2FEKA 2FPIA 5FOXA 4J0GA 3SHOA 1E3TA 2PYDA 4HEA1 2ZIVB 2WMNB 3EGOA 4JS0A 1EIZA 5DE3A 3RUPA 4J9VA 1EBUA 1YOBA 4CWAA 3WOVA 1A0OA 1KIAA 1SHJA 4KQWA 1ST2A 5DPMA 3KKQA 3GLQA 1R5JA 3IPXA 1E92A 4RK1A 1FFGA 5EY5B 4XM2A 3NHZA 4RD1A 4A2WA 4UMFA 3T4XA 1UFRA 1XP5A 4UHDA 1GGMA 2W6CX 3H8SA 1BW9B 3RF6A 4EWLA 4B6FA 3A2LA 1MJFA 4M9XA 5AM3A 3N2LA 4TWRA 2JHPA 1GZVA 2ZJ0A 1Q12A 3GMSA 3MBIA 5IH3A 1A2OA 1K1EA 4CQLB 3RSLA 4IWNA 2NOAA 4JL8A 4UUMA 3RH0A 3VUFA 4KUGA 1UBOS 3LT4A 9LDBA 3C3AA 2DH6A 4P36A 3RAGA 5LR6A 5CLJA 1E3WA 2FR0A 2X6RA 3GFTA 1FZTA 1GQYA 2P78A 2RAVA 1GUZA 2Q45A 4HEJA 3E9QA 5FDFA 4PLCA 4N47A 4BEVA 2G06A 2L42A 4MW6A 5GONB 1SD5A 3LDGA 1M1YA 2HPZA 4YV7A 2C8JA 4ZRNA 4B7AA 3NR2A 4FR0A 1PX0A 4M9CA 4UEKA 1JFFA 4D3FA 5BRAA 3RHFA 2GYWA 1RAEA 3RDPA 2R47A 1QX4A 3P94A 3B1YA 1M0WA 1SOUA 5HMLA 4ZIRA 3NH6A 5LJIA 3PDJA 4ZC8A 3UBMA 5C8VA 3K05A 1VYVA 1Z2PX 3E35A 2GH1A 3QXCA 2QAGC 4HNVA 2XKJE 3ACCA 4QU5A 5EHIA 2IXFA 3F98A 3ZWKA 4B6SA 2FW0A 2W2LA 2AJLI 3KB2A 3LC1O 3EIXA 2WM9B 4L78A 4L7QA 3ESCA 3PFBA 2O3QA 1MABB 4RH3A 5FJIA 4D82A 2QN8A 1KBZA 3DT6A 3DKRA 1XFDA 3L06A 4NABA 4CQMB 1JEJA 3VUEA 4BTLA 5EIHA 3UH1A 3AUTA 3T34A 3ZBQA 3RB8A 4BIMA 4X24A 5B64A 2JJMA 1JR4A 4MV7A 4RS3A 3CF4G 4TV8B 5H3HA 1GCGA 4FDLA 3T7RA 1THMA 3ZQ4A 2BUCA 2IX3A 5E1BA 3ZVKA 2Q9UA 1JIQA 3A9WA 1W2HA 3MPOA 1XGKA 2P2YA 2LE0A 4IFEA 2V59A 3TNYA 4QHYA 2BGRA 3RYIB 5JALA 1Q1GA 2CNLA 2P2CA 3LUJA 4K6CA 1UP7A 4LJLA 4XGRA 3R5FA 1AXEA 1UJ4A 2WIJA 4PSDA 4FZJA 3W0LB 2A0WA 3FUWA 1MB2A 1VJGA 1N9GA 1O6ZA 1P6XA 3ORHA 2H1SA 2O3TA 1TA9A 2HJRA 4MB6A 3CWQA 4LJYA 1CF2O 2B35A 2Q6TA 3NP9A 3RFVA 3RBZA 2W98A 1KDZA 5HIMA 4FKBA 4EVQA 2RH8A 1D8TA 5FCDA 4C87A 3KAJA 4EA6A 5IVIA 4EYGA 4HC4A 2DG2A 2HT6A 2JFOA 4RMJA 1QH1B 3D4BA 4M8KA 3ACDA 4U0KA 5DTJA 3MFQA 1YWGO 4I3GA 1KGDA 4XUCA 4R16A 1J7KA 3F7OA 4FMPA 4N54A 1RLUA 3WWOA 1IZ0A 2WJHA 1CJVC 2O2EA 4OEHA 5I7UA 1IAVA 3PPYA 3PX7A 3HGQA 3NBUA 3SM9A 5A1JA 3JASA 1X1SA 5EMHA 2Q6VA 4GMHA 2ZYGA 4YYEA 2GBLC 4ZAXA 1A9TA 4L4RA 1E8DA 1RI4A 3C45A 1ECGA 1BRMA 1BMQA 1NW7A 1QYIA 1T6YA 2VQ6A 1YR8A 4H3KB 3U9TA 3EGDB 4MJXA 1NVWQ 3OECA 4XD7D 4CKBB 3GLIB 3FSJX 5B4TA 3IOBA 2JEOA 3TTTA 4XFDA 1JHAA 1M66A 4LUCA 5EHGA 3TJZA 2WNHA 4QBFA 4KPYA 2IIVA 4N6OA 4OYLA 3JR3A 3PNSA 4EH1A 3QE4A 4N18A 2AC4A 1PYDA 3TSWA 3WWPA 2DPGA 2YWXA 1GDTA 1ZGAA 2H17A 5ADWA 4P35A 3EC2A 5J1SB 1XFAA 3CO5A 1Z33A 2XWBF 2V6GA 4OJQA 5TVKA 3CVYA 3OZTA 1T13A 1M3SA 1VHDA 3LF1A 2A58A 5BMVF 3ZJYA 1K4MA 1P5HA 1Z5VA 2I9PA 2GN6A 4WLEA 4QE3A 3EFBA 5AW9A 4EGCB 5L7YA 5KVAA 1BHQ1 3JQ9C 1NW5A 2QXUA 3QPAA 2WM3A 3KXKA 4H1VA 3R41A 3KXPA 3MGCA 3NTRA 4HXFB 4HY3A 4A0FA 5CFRA 1P0IA 1DIGA 4RVSA 1QZXA 5CYPA 2ZM5A 2ZJ2A 2CXSA 1N6IA 2PQMA 1UUFA 5I47A 3HXQA 1ECJA 5EZ6B 3ZLUA 1SH7A 1N2BA 3A3PA 3HJRA 3W8NA 3WRVA 5CLHA 1ULUA 2J5RA 2NQ2C 2RGNC 4WERA 4AS3A 3ZHVA 4ZMBA 1VL2A 3E22A 3EVCA 2V3VA 3CURA 4XQ9A 1RJWA 2EF1A 3GLSA 1SCIA 1BGVA 3V7WA 2H63A 2A86A 4G07A 1UM9A 4BU0A 4ZKDA 4GMGA 3BFPA 3EDMA 1AU9A 5JECA 3MTAA 3SX0A 3BXZA 1CF4A 4D99A 5JCXA 4CLOA 2CUKA 3GFSA 3ZXSA 4E5VA 1ORWA 1R4AA 2W6MA 5GVRA 1DEKA 3FLMA 5JDCA 5D7NA 2AX4A 1YL5A 3OUTA 4Q3KA 1UZUA 5CNMA 4DWWA 5BSEA 2IH2A 1ZI6A 5HIJA 3W34A 2P0EA 2ZJAA 3E5MA 5EXXA 1RM5A 2BJVA 3UAYA 2GB4A 4NI5A 2WUGA 3WV5A 3U16A 2OHJA 2R11A 2PUBA 4YROA 1QHFA 4XWYA 2DF8A 2HLNA 2VNJA 4JI1B 4LZOA 4FXOA 4IJ6A 1UJMA 5ITWA 4FB4A 3HO6A 3GHHA 2JFVA 1U5AA 4NVRA 2FK7A 2AXNA 2O8BB 4M9UA 3QXSA 1IK6A 5AI5A 3GQBA 2JA2A 3WWYA 4B31A 2C20A 5JD6A 3OKCA 2X0FA 1RWVA 4G4SO 4I4NA 4LF9B 3QU2A 1AN9A 3SM3A 2Z1NA 2R8PA 2BR5A 1HG1A 2V5VA 1AQ6A 2WHQA 1MJHA 4EHHA 3BGOS 2TMDA 1YA6A 4TLBA 2RHTA 4DLLA 5JDIA 3U1TA 3CBGA 3I5AA 4OQYA 3V55A 1Z28A 3BA1A 1AN0A 5C8YF 3VGPA 4GKJB 4QYIB 1UT5A 4P7BA 2FRDC 4N5HX 1QIMA 4EVRA 4ZHQF 1VRCA 2YV3A 4CIBA 1QYVA 3LCMA 4GQIA 4P84A 4MQEB 1NVXQ 3ZU6A 3B1KA 3T15A 4JGIA 1NF3A 2QZZA 3BB1A 1BMFA 3HCOA 1I3CA 4HDCA 1PEDA 1F2VA 2G8LA 3DBIA 3T3GA 4LF6B 5FH9A 4JLPA 1YO6A 1SU4A 2J3JA 2YBEA 2GPJA 4UCWA 4OYYA 4C1NA 1Q2UA 1T3LA 2OXFA 5AESA 1LD3A 5BWOA 5K3EA 2WQ7A 5CVUA 4HV4A 4C6RA 4Z5XA 2XMCA 4S04A 1DQSA 4LJ6A 4C7VA 5IF9A 4HNUA 5KJFA 3NBQA 2AXQA 3NDIA 4MCAA 3V9AA 1RBQA 4XTRA 2I7VA 1XAHA 4YT5A 2DMRA 3CE6A 5F64A 1LJUA 4AYWA 3NUZA 2IWRA 1TQHA 4BE7B 2G28A 1Q6YA 2EG9A 2FF7A 3K1JA 4BO3A 1YKFA 3MMPA 4Q9LA 5K20A 2YWJA 3K8OE 3TD9A 4FMBB 2X8BA 4PRKA 4XQCA 4BN0A 3MS2A 4EA7A 4L5IA 1LBTA 2NXEA 1MTZA 1NXVA 1I01A 2B61A 2DY1A 4KACA 4O4JF 4EGQA 3U40A 5DOVA 3V32A 3NHYA 1CJTC 1SG0A 4G4IA 2G1KA 1BAPA 5I4CA 2YMQA 1RWPA 2BFDB 5KEIA 4UE6A 2BKUA 1OUMA 3HA3A 3BIWA 1WMDA 3IIIA 4B6JA 4EJMA 1Y8RA 3N0VA 3RKUA 4BPRA 1E66A 4MO9A 5AJZA 3K9FC 1E64A 4RE6A 3KQUA 1SY7A 2V3WA 3MGKA 3VKWA 3ZHXA 4MYDA 2Q3JA 2KS6A 4RVNA 2CFIA 4F3CA 2GN2A 2ONZA 3AFMA 5DHSA 3GRZA 1MEJA 1YZHA 5EUMA 3WJAA 1B76A 3FCUB 4WASA 4B3BA 4XD2A 4BNKA 4EVSA 1RWXA 4Q15A 3UBTA 1Y3HA 4H3SA 4YP0A 4MUIA 3C97A 2W2MA 4ZEXA 5ARCA 4HB0A 4TQGA 2X5KO 3IILA 1KWGA 2QP9X 1YULA 2EHDA 3AIIA 1U63A 1U8FO 2VUTA 5LP6C 3NXKA 2OV4A 1ZRHA 3OCXA 4WZBA 3AB7A 1RPAA 3UCFA 5MN5A 4HNQA 1MGPA 2YUTA 1JWAB 3MYRA 5CDFA 4GL4A 3T9AA 5DGHA 1SC1A 5C51B 3L6DA 2UYYA 2GPSA 3LP5A 1MR3F 4FGUA 3G2IA 4RM2A 4J2HA 3EEOA 4R4JA 4RY2A 1L7RA 4CODB 4JA2A 1TM7E 3FYDA 2X7HA 5JZMA 3CUVA 1QRRA 1IJEA 3F6CA 3R6GA 4I5EA 1I2DA 4XGKA 5CXUA 2WIDA 5IVPA 4BNYA 1NQTA 5BN3A 4E88A 4EG8A 4U7TB 2DX7A 3SR4A 1AGPA 4CG0A 3K1AA 1OFGA 1YCHA 1XXHB 2G4LA 2HHLA 5A7HA 1VL1A 2Y3IA 3RSCA 4QGFA 2LVBA 3T38A 4PC1A 1T9GS 3HFRA 1XTZA 1RAAA