1D07A

Hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis ut26 with 1,3-propanediol, a product of debromidation of dibrompropane, at 2.0a resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
293
structure length
293
Chain Sequence
b'GAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HALOALKANE DEHALOGENASE
publication title Crystal structure of the haloalkane dehalogenase from Sphingomonas paucimobilis UT26.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
total genus 113
structure length 293
sequence length 293
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 1999-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1d07A00
2PSFA 2FJPA 5AHXA 3KDAA 3IUQA 2CB9A 4HTAA 5ALPA 2BUCA 4H7IA 1QJ4A 3JYHA 4L72A 5C8VA 5JAOA 2OGTA 3F67A 4UPDA 1XZGA 3STWA 1NX9A 5EIEA 5KWJA 2WUGA 2V98A 1GGVA 4F21A 2XUOA 2GZRA 2RI6A 1YAJA 4QWMA 4X91A 1G66A 3SC2A 2OCGA 5LP1A 5LZ4A 3FYUB 4C6HA 3HI4A 3B5EA 4ZXFA 3E0XA 2WIFA 5HK8A 4OYLA 1QIJA 4N8EA 4IH4A 2HA5A 3DJYA 4FHZA 5ISMA 3H17A 2Z3WA 2EDCA 5ALVA 4BVKA 3BIWA 1UOQA 4HXEB 3H0CA 4J3JA 4L9AA 4XWGA 1DWPA 2JF0A 4BDSA 1EX9A 4HZGA 4W1QA 1Q0ZA 3FLAA 2H7XA 5ALYA 3BJRA 5D3ZA 1BCSA 4L0CA 4Q3LA 5DYWA 4Y2RA 1G42A 1GXSA 5FPQA 1IUPA 3FSGD 2XMQA 1CFJA 5DTJA 3IULA 2DSNA 2BAGA 3C5WP 5A7GA 1N5RA 3R0VA 5AO9A 3WKBA 5H3HA 1U8EA 2DFPA 3IB3A 1B41A 5IVDA 3HC7A 4EUSA 3GBSA 2JIDA 1UK6A 4CG3A 1XFDA 1EDBA 3ESDA 3UMJA 4ZWNA 3WKEA 4N5IX 1USWA 2H7YA 1BS9A 3QITA 2AJCA 4N5HX 3I2JA 2DHDA 4B85A 3C6YA 2VAXA 4BC0A 5CH3A 3O4HA 2DQZA 1JMKC 2GZSA 5CT9A 1Y7HA 2E3JA 5ALLA 1UK8A 1UKCA 1U65A 3FYUA 2G5PA 4GW3A 5K3DA 4H77A 4FBMA 1OILA 3BE8A 5ALOA 3AZOA 4EA6A 1R1DA 2C7BA 4W63A 3WJ1A 5HF5A 1K63A 5LKAA 2PUJA 3GZJA 2QRUA 1QONA 4MYDA 1MN6A 3WWPA 1MNAA 1PFQA 3BF7A 4B6GA 5LYYA 4IH9A 4WFIA 2BGNA 3C6XA 5AH0A 4CI9A 2WILA 1ZICA 1CQZA 1ZOIA 3A2MA 5AIBA 2BKLA 2WFLB 3TGLA 2AJLI 3FCYA 1EHYA 3RKSA 5A62A 4GDMA 1TAHA 3H19A 3O95A 1MNQA 5AKGA 5KWIA 1AQLA 1BEEA 4W9RA 2FUKA 4RNCA 1HKHA 5FRDA 5ALMA 1FJ2A 3T52A 3IVMA 1WHTA 3L1HA 4X00A 3OPMA 1ZD4A 4N8DA 3PFBA 1EDDA 5A7FA 2QJRA 3HEAA 1CUUA 1VLQA 4Z49A 1QIIA 2VTVA 3OTQA 4KE7A 3G7NA 1AC5A 1CUDA 4Q82A 1CUEA 2HRRA 3R41A 1CUVA 1CUWA 1E3QA 3MUNA 3LLCA 1ZI9A 5AOBA 4JUIA 2I78A 5AM1A 3LIPA 3VJLA 2JGIA 5AM2A 1AURA 3R3ZA 1QIGA 4X92A 5LZ9A 1VE6A 5HFNA 1MAHA 5SYNA 5AK3A 1GPLA 5ALSA 4EY8A 2XUKA 4WCVA 1CPYA 1QFMA 4FBLA 2DHEA 1ODSA 4KAFA 1XROA 2XUJA 2XQFA 1UWCA 2VT7A 4D9JA 2GBGA 1BE0A 3ESAA 2CBGA 3ZWQA 1YB6A 4P93A 4J7AA 1O6FA 4AX4A 1L7RA 4Q34A 1TKRA 2ZVDA 4B82A 1C7IA 3E4DA 3G0IA 2QMQA 1DQYA 1EI9A 5D6OA 1N5MA 1DT3A 4TGLA 1KU6A 1LNSA 3FYTA 1JMYA 5EGNA 3QBJA 2WFLA 1G4HA 1MPXA 4WJLA 3STYA 5AI9A 4Y2VA 3QM1A 1X2EA 2JBWA 3U0VA 2PX6A 3IURA 3DDUA 3BIXA 5DNVA 3AIMA 5JADA 3H1AA 4CCYA 1LPSA 3H2IA 3WA7A 4FFVA 2XMZA 4PF1A 4ZREA 2R8BA 4BZWA 4HVTA 2VT6A 3WK7A 5ALNA 4LHEA 3C5VA 4CIAA 2XUPA 2PBLA 1K4YA 3R40A 5I9IA 1AUOA 1LPNA 3WI7A 4OU5A 2QKYA 4PSUA 2WG1A 5JD4A 3KXPA 6YASA 3Q8WA 4DNOA 3D59A 1GQSA 5EHNA 3CN9A 1QTRA 4UHBA 1JJBA 4F60A 1FSSA 4QA9A 4UHEA 1LZLA 2XUAA 3AJAA 3ESCA 4Y2JA 2PM8A 1YS2X 1XQXA 2Y6VA 5FP0A 3OC0A 4ARAA 1K6EA 4K6KA 4WDRA 3EIOA 4H7JA 3V1NA 3A2LA 1XLVA 5C7YA 1DTEA 5EFZA 2QZPA 3FOBA 4H7DA 1XKTA 1XRQA 5AI4A 3WL5A 2YYSA 4Y2PA 4W1SA 3DKKA 4PSDA 2V97A 3FCXA 5C81A 2AJBA 1H2XA 3MGAA 2XT0A 2HM7A 4C88A 1BEZA 1XQWA 3NGMA 3OG9A 2HU7A 1JKMA 1WB4A 4BRZA 5FV4A 1YR2A 4KAJA 4XX1A 2V96A 4MWTA 2XUFA 4ARBA 1E89A 3X3HA 2O7RA 3FAKA 3I6MA 1H2ZA 5YASA 1VKHA 2JGMA 4I4CA 3ZI7A 3I1IA 1CIJA 5AKJA 3STXA 3WWEA 2WJ6A 4WDQA 1DX4A 5JZ9A 1CUBA 4I3FA 2OXEA 5FDFA 2VA9A 3FNBA 3WJ2A 3VVLA 4BTVA 2WFMA 4AO7A 1XRLA 4X6XA 1J1IA 1UOOA 2HADA 3PF8A 2JGEA 3C87A 2ZYRA 2XLCA 4XJVA 5AP9A 4CIBA 3WWDA 4BCCA 5DJ5A 1HL7A 1C7JA 1VZ2A 4QNNA 4BP9A 4RE6A 4EY7A 5DNWA 4B0PA 3ZPXA 3AZQA 1MX9A 1JJFA 1X70A 2AJDA 4B9EA 5ALZA 2C0PA 2RHTA 2VQ6A 3DQZA 1ORVA 4EB0A 4C87A 1S8OA 5E2IA 4RGYA 4FNMA 1MU0A 4UFNA 1Z68A 2XMBA 1N1MA 1K5PA 1G5FA 4B9AA 1LPMA 5DTIA 3D7RA 3RARA 3ED1A 3DD5A 2ZYHA 1CEXA 4KRYA 2ONCA 4Y9SA 2XLBA 5JASA 3IDAA 4LXIA 4QDTA 5ALHA 5JZBA 5ALIA 3EQ7A 5ALDA 1FFEA 4UHHA 5AOAA 1XZJA 4OCZA 4G8CA 1WHSA 4QDXA 3WL7A 2HA7A 2J3QA 4AMYA 5CTAA 1P0IA 5K3EA 3R3WA 4INZA 4FNGA 1GT6A 5CXXA 4X6UA 3VISA 2QXUA 3N2ZB 1Y7IA 3WKCA 2RONA 3K6KA 1JU4A 2QM0A 1EK1A 4J0DA 2XE4A 2QS9A 4S0XA 4X94A 1YA4A 4Y2TA 4FDMA 1QZ3A 2XI4A 1DWQA 3BDIA 3VDXA 2H1IA 1OXMA 3ZLTA 3G9ZA 1JJIA 4G5XA 4UBLA 5CT8A 3E3AA 4NVRA 5HF8A 4K6GA 5AIAA 4L3WA 1UT6A 1W76A 1HDEA 1IZ7A 4GWLA 1THGA 1UKAA 5AK6A 4W1PA 1WB5A 2Y2UA 4KAAA 1XZCA 1FFCA 4J0IA 5AI0A 2Q0XA 1YB7A 4GLBA 4JNCA 5HKBA 3QVMA 2QVBA 3W05A 2WFZA 3EQ8A 1LZKA 2HA2A 3HSSA 4IH1A 4DTCA 4U2GA 4MYSA 3BF8A 3DNMA 3A2NA 4WFJA 5CT6A 3O0DA 5D3KA 4FLEA 1A88A 4G4JA 1LGYA 1UK9A 5SYMA 4YX9A 4J0JA 1KU0A 4M0FA 3FVTA 3A6ZA 2WTMA 4JEIA 4MQMA 3GUUA 5AOCA 3P2MA 3OURA 3IIIA 1VA4A 4YASA 1GPNA 1BN7A 5IVIA 3WWOA 5JALA 1F0PA 5CMLA 2WJ3A 4G9EA 4JYMA 4DLNA 2OGSA 3I1YA 5AKKA 4KEAA 5AKZA 2UZ0A 4QLOA 2C0QA 3I6YA 1ISPA 5JAUA 3SK0A 4OD0A 3KSRA 3DEAA 5A2GA 2X76A 3WYNA 3WL6A 5ALFA 3Q0TA 5DNUA 2J4CA 4LKOA 5BOVA 5E4YA 5AI6A 2PSJA 1CVLA 5CT4A 3PFCA 1H23A 2OCLA 2ZSIA 3HLKA 3WLAA 4LXGA 4GI1A 1ACLA 1XZFA 4UBIA 4KE8A 5FLKA 5I8PA 2HFJA 1ETHA 4OB8A 2ZYSA 2GBFA 3RM3A 4KJXA 4G9GA 4HRYA 4AXBA 1W6RA 3AUKA 5ALGA 1AMNA 2H7CA 4P92A 3QMMA 1XZKA 1UK7A 1DX6A 3F8SA 2HU5A 1XRNA 3R3XA 4Y2QA 3O4GA 1XZHA 1H22A 2VSQA 1QIFA 4ETWA 4LYEA 2WTNA 5EIAA 3TJMA 4BTLA 4AN0A 5JANA 3AZPA 4G4GA 1W1IA 1E8NA 2PSHA 4UHFA 3G0CA 3D2CA 3C6ZA 5JYCA 5IKXA 5CRIA 5FOQA 2WU3A 4J0HA 5LZ2A 1U4NA 5AK5A 1EINA 3WIOA 1EDEA 3WYDA 3VJMA 2BUAA 1AKNA 1BRTA 4I19A 3FSGA 3PDCA 2VJAA 5ALKA 4FTWA 2JGFA 2IITA 4Y2XA 3M81A 1XZDA 1Q0RA 2VJBA 1LPOA 3VVMA 5JAHA 4J03A 1MT3A 3QMVA 1ZJ4A 3O4JA 3W2TA 2JEZA 1LBTA 4QWWA 4G8BA 1SCIA 3HJUA 5IVHA 1ACJA 1XLWA 4DMKA 2PPLA 1CUGA 4BC1A 4P9NA 5CXUA 4DNPA 4K6HA 3GROA 4H7HA 4BATA 2B4KA 4AQDA 3G02A 2AJ8A 1TK3A 1XZBA 1UZAA 4G4IA 3WK6A 1IUOA 2HA4A 1YA8A 2OQIA 2R11A 3EBLA 3PICA 5AKHA 1RWQA 4BRSA 4DM7A 3FWHA 3K9BA 2XMCA 2J4FA 5FKJA 4CCWA 1HQDA 4AZ3A 3O9VA 2OGZA 2HFKA 4DNFA 4FMPA 5DYYA 3AFIA 1DWOA 1ZJ5A 3EF3A 4KE6A 2RAUA 1QFSA 2XUQA 4Y2SA 2O2GA 1A8SA 1VOTA 4O08A 5IVKA 1VA5A 2OPHA 4GBGA 1B6GA 2IX9A 1ZIYA 1X2BA 4HS9A 5EI5A 1P0PA 3F98A 4U2FA 2OAGA 1IUNA 3WKAA 3H2JA 2I3ZA 3NUZA 1XZEA 1JFRA 3H04A 3I2HA 1R9MA 3GELA 3QPAA 4QDZA 2LIPA 5HCUA 2HL6A 1R50A 2XQKA 5A7HA 3TEJA 2Y2VA 4HRXA 1DINA 4A5SA 3W9BA 3CXUA 4PSCA 5JAPA 3M3DA 1M33A 1TIBA 2JGJA 4QZVA 4DIUA 5K3BA 1EH5A 2XMRA 2WQZA 4JYPA 1LPPA 3ICWA 5CH8A 5BWCA 3AILA 4C01A 2P8SA 2WU4A 4OYYA 4PO3X 1F6WA 3I2FA 4RE5A 5JATA 1F8UA 1VJ5A 4BAZA 1L7QA 1THTA 4QEKA 1QTIA 5HZGA 4B83A 1YAHA 1UKBA 1MX5A 5K3FB 2B61A 2VAVA 4AO6A 5HK9A 1CUCA 1XLUA 4ZV9A 1E8DA 3DL7A 4AMZA 1WM1A 1AZWA 5E4JA 3QYJA 2RGUA 3FLEA 1QIMA 4IHAA 3H2GA 2ACEA 1K8QA 2XUGA 3DS8A 4ZRDA 5AJHA 3QH4A 2Y1KA 2WHPB 2PL5A 2XQJA 1PV1A 5I7UA 1JT2A 2DQYA 2CUTA 1N8SA 1YCDA 4UBMA 1O6GA 5AM3A 4AB1A 4NMWA 3C70A 1DT5A 1QIHA 2QUBA 3WQHA 3C8HA 5HF9A 2PVSA 2WHRA 1J06A 3LCRA 5BWBA 5EHZA 1RYYA 4UHCA 2PSDA 4F0JA 4EBBA 3BXPA 2ACKA 4J0KA 3W9UA 1NU8A 3S2ZA 2O2HA 4HAIA 2WUEA 4UBNA 4Q3KA 1EXWA 4B80A 3D0KA 1JU3A 1NU6A 5F4ZA 4X93A 2HHAA 1J2EA 3L1JA 3K2IA 4MEBA 2K2QB 4H18A 4IO0A 1SCQA 3C6BA 3PE6A 4DMCA 3F96A 3JW8A 4KE9A 5LZ8A 1ZD3A 2C5GA 3D2BA 2WIDA 3LIIA 3HXKA 1FFBA 2C4HA 3V1KA 5KBYA 1GKLA 3D5EA 4GECA 3WZMA 1R4ZA 4CFSA 5K3FA 2QOEA 2OCKA 4OB7A 5K3AA 4BE4A 1FFDA 3WMRA 2OG1A 3KD2A 4X85A 2ZJFA 1XQYA 4K5QA 1XZIA 1ZGCA 1EA5A 4TPKA 4BCBA 2WM2A 3BJMA 3C43A 2X8BA 1QO7A 5ALQA 1GQRA 2WHPA 4Y2UA 3AIKA 4U2CA 5JZSA 1EB9A 2WG0A 1XZLA 4QLAA 4HXGA 4ZGBA 4FFWA 4AZ0A 2FJ0A 3VKFA 1XRRA 5A6VA 3ANTA 4BZZA 4OSEA 4BP8A 1MTZA 3N0TA 3A70A 2WIGA 4DMFA 1VZ3A 2XB6A 1BROA 2OAEA 2WSLA 1QOZA 1TQHA 3I28A 3GFFA 5HF6A 4CG1A 4DYHA 3STUA 3V48A 5EHQA 4EY6A 4QE3A 2O7VA 1W52X 2IIVA 4KACA 1MAAA 5T4FA 1A8UA 5D7BA 1PJAA 3HYSA 1XZMA 3HABA 4B81A 1VXOA 3ZV7A 5JIBA 1ODTC 3QPCA 4PQEA 3DYIA 1CUYA 4GEGA 5HQ3B 1C4XA 2PU5A 2QT9A 1CUSA 3C45A 5T4BA 1FFAA 2JGKA 3ZLUA 4B0OA 3PUHA 4C89A 3F97A 4X90A 3VJKA 3QMWA 1MX1A 2BJHA 1TCAA 2CZQA 4MXDA 4BAUA 4X6YA 3NOXA 3CN7A 5FUMA 1SOMA 3WK9A 1WCYA 2JGLA 1LPBB 2G5TA 3B3QA 4FLMA 3STVA 1CR6A 3VXKA 4NS4A 3E1GA 1XQVA 3IUNA 4C4ZA 5AKIA 1YASA 1ZD5A 3TRDA 2ORYA 1UOPA 1AX9A 1LLFA 4BE9A 1EK2A 4XIIA 5LIPA 2Z8XA 2CJPA 1CUXA 3JWEA 3QPDA 1DQZA 4UBJA 3DYVA 1T2NA 2WUDA 3IA2A 1GKKA 2XUHA 4C4YA 1H2WA 3KOOA 4UHDA 3C8DA 5AKEA 2PU7A 1HLGA 4BB0A 2ZJ7A 3DLTA 5CH5A 1Q84A 3SWWA 3M83A 4E46A 3I2GA 4H7FA 1QLWA 2DHCA 2GYUA 4QDOA 1ZI8A 5LZ5A 1LBSA 4MQLA 4FKBA 1UXOA 3G0DA 3MVEA 4X97A 4EHBA 2C58A 1UFOA 4CG2A 2XMGA 3DCNA 5HQ3A 4PW0A 1TCBA 3RK4A 4EZIA 5CBKA 2VEOA 2Z3ZA 4BAGA 4HXFB 2VJDA 2WG2A 2OQVA 4IQ4A 3SX4A 5ALXA 3HACA 1QIDA 1CQWA 5DLPA 1CUAA 5AKXA 1ORWA 3AIOA 3I2KA 3H18A 2HU8A 4XVCA 3ICVA 2YASA 1BCRA 4DMHA 5J3JA 1CLEA 4PV7A 5DYTA 4H7KA 4JH0A 1R3DA 4FWBA 3WL8A 4UBOA 1XZAA 4FOLA 4DNQA 4YK7A 1R88A 5EIHA 2OCIA 3M82A 5CW2A 2QJWA 5AKLA 3LS2A 3UUFA 2XDWA 2D5LA 2BCEA 4BCDA 1D07A 3R3YA 1HBJA 4KRXA 2C5FA 2W6CX 1MJ5A 1CRLA 5C8XA 2X5XA 2H9YA 2FX5A 1CUIA 1SC9A 1JI3A 2Z5GA 3CCBA 4TVKA 5AI5A 2GBIA 4X3CA 3L1IA 2AXEA 3I2IA 2CMFA 4EY4A 4X7BA 4NZZA 1W4LA 1DU4A 4CCYB 1XRMA 5DWDA 3G0GA 2HIHA 4OU4A 5AICA 3O9MA 1GPKA 1OCEA 1SFRA 3W06A 3ESBA 5AKYA 4AO8A 4E15A 3V1MA 2ZJ6A 3G9XA 4AN1A 3D3NA 2Y6UA 3OOSA 4G1FA 1EVQA 1J07A 3WIBA 5BV7A 2G4LA 2RHWA 4Y2YA 2BGRA 5ALRA 3R3VA 4F5ZA 1ZI6A 1ZGBA 3MUOA 3FBWA 1LPAB 3W04A 4BVLA 5EHXA 3KWFA 1TRHA 5ALUA 2W22A 5LZ7A 3WKDA 4RPCA 3EQ9A 2EDAA 4U2EA 3NWOA 4ROTA 2GBCA 3DOHA 1IZ8A 1CUHA 1P0QA 5A71A 4BDTA 4LXHA 2XQIA 1WB6A 1ZD2P 2WHQA 4OPMA 2WKWA 3FLBA 4MJ3A 2B9VA 3IUJA 4A16A 3H1BA 2HA3A 5KREA 1EB8A 1IMJA 4ZV7A 1MO2A 2G63A 1IVYA 5ALEA 3V1LA 2I3DA 5AI8A 1BU8A 4DSZA 5JD6A 4B7ZA 5C8ZA 3BL8A 4WY5A 3T4UA 4Q3OA 1W75A 2XQGA 4LIPD 1CV2A 2Z8ZA 1R9NA 2XUIA 3HZOA 5K5EA 4MEAA 2ECFA 3G9TA 4Q1VA 5AM4A 3AINA 1U2EA 4H0CA 1GZ7A 2WIJA 4A23A 4LYDA 1EVEA 2WJ4A 2B20A 3WK5A 5ALJA 2WUFA 4BVJA 1E8MA 2HA6A 4J0CA 4K2AA 2ES4A 1QE3A 2WLSA 3B12A 1QGED 2CEKA 4EY5A 1CUJA 3RLIA 3G0BA 3WK8A 4P08A 5AK4A 1WOMA 3CCCA 4FLFA 2O2IA 3F9CA 4UFOA 1VE7A 1CUFA 4ZI5A 1QIKA 2VJCA 4M0MA 1YSCA 4WFKA 2DCMA 1BN6A 2ZSHA 5E4TA 2I03A 3H2HA 2VF2A 3IBTA 1WPXA 5ESRA 3PI6A 1RP1A 4DSAA 1XKLA 3IUMA 1KEZA 4DGQA 3HRHA 3O4IA 5AM5A 3BWXA 1A8QA 2QUAA 5LKRA 4BYMA 2QTBA 4KR0A 5HKAA 5AM0A 1Y37A 4GHWA 3G8YA 5JARA 4KYVA 1AGYA 4UFPA 3U1TA 5T4HA 3WA6A 5ALTA 3PUIA 3WWCA 3DOIA 4UBKA 3FVRA 1CUZA 5JD5A 1VXRA 2WIKA 1H2YA 3D4LA 1XRPA 7YASA 1YS1X 2GYVA 1Q83A 4MWSA 3S8YA 4J0GA 2GYWA 3G9UA 2QR5A 4B84A 1QIEA 2VATA 3FYUC 4OB6A 4Q05A 2YXPX 4OUKX 3H2KA 3STTA 4GXNA 5FPPA 2NW6A 3ZLVA 1QO9A 1HPLA 5ALWA 3YASA 2CKMA 2XMDA 2DR0A 1ODCA 2XUDA 4N8SA 3KWJA 1P0MA 4QDUA 3R3UA 4H35A 2PKYX 1A7UA 3D2AA 2PUHA 2ZYIA 3PF9A 5FXMA 2J3DA 4W1RA 1TCCA 1WPRA 4G8DA 4X95A 1E66A 4U2BA 2BUBA 2D0DA 2XMSA 3WK4A 2QXTA 4E14A 3UUEA 3V9AA 1T4MA 3GA7A 5CT5A 2HDWA 3ILSA 1L7AA 4X71A 4M0EA 1F0NA 3OM8A 1SCKA 2ROQA 3DL4A 2PSEA 5LLSA 5HFAA 4PNZA 3QZUA 3BDVA 2BFNA 4WY8A 5K3CA 2EEPA 4UUQA 5CURA 2YH2A 1E5TA 3I6ZA 2HA0A 2V9ZA 4U2DA 4E11A 2JEYA 5T4EA 3ANSA 3LP5A 1I6WA 3DKRA 4ITVA 4Y7DA 2RIPA 4BBZA 4V2IA 5IH7A 1ZIXA 4H7EA 4C4XA 2OLEA 3WZLA 2HRQA 4YPVA
chains in the Genus database with same CATH superfamily
2FJPA 3KDAA 4LE2A 1LDNA 2OXTA 4WKOA 4RK4A 2QX8A 4IMRA 4JOQA 3SR0A 5FUYA 3TM5A 3I32A 3DLPX 3TVYA 1I4EB 2QW1A 4I2NA 3DVAB 2CLEB 2ENWA 3JYHA 1VLJA 4L72A 5C8VA 5JTTA 3GFVA 3SYLA 1SMKA 2A6PA 2P4UA 3C8UA 5JAQA 1RKBA 4YROA 4ZQHA 2C2GA 2ZBVA 4BEJA 4HN2A 4Q9AA 3RABA 1BH6A 3P0FA 2WSBA 4Y9DA 4CMBA 2QTLA 1XZGA 3BERA 4MVXA 4DV0B 4CDNA 3HDVA 4JBGA 4MW7A 1NX9A 4YV0A 5FOSA 1RLJA 2R84A 2V98A 3NVAA 2ZR9A 2PUAA 2HJSA 2WZCA 1JXMA 5IT5A 3LPNA 3WGYA 1EX6A 4P98A 4QWMA 1Z7EA 3GRRA 3ZU5A 1G66A 1HT3A 1W48A 3J7TA 3L06A 3EGEA 2BFPA 4PYJA 3NIBA 1XNJA 1J9GA 2QVGA 4LYAA 2H2DA 3W1VA 5LZ4A 2PGNA 2ODAA 4TMVA 3B5EA 1HFKA 3DHWC 2BF7A 2YWFA 1BYIA 1OZAA 2XBUA 4L0MA 4QUJA 3GVPA 3NLLA 4N8EA 2VCYA 4JNKA 4KWCA 4EPYA 1SBYA 1E0KA 3NP9A 2ANBA 1UC4B 3EA4A 4D80A 1GLGA 2HA5A 3HKEB 3B9BA 3BJEA 3KJNA 3UC9A 1J24A 3KLOA 3MFQA 3BTVA 3DWEX 5HFJA 4NF2A 2CHVA 3EF0A 4PR0A 4P4TA 3HY3A 1GYRA 1JQDA 3ZHVA 5ICGA 2Z3WA 1Q0HA 1OD6A 5J4VA 3E53A 2PBRA 1KAHA 4ENQA 1SIWA 3I9KA 4OJNA 1ULUA 3HJBA 1OVMA 5E3JA 3VH2A 1WD5A 2HJHA 4EUFA 1XIVA 2DPYA 4K3VA 3RT9A 3U49A 4URHA 2PMBA 1DFGA 2NUAB 4MOWA 2VPTA 3AC0A 5AD1A 3AP1A 4TTRA 1DWPA 1Q0SA 2J1LA 1EX9A 3CH6A 4AKEA 1NW9B 1PDWA 1M34B 1XT6A 5FNVA 2ONYA 3H1EA 2I3AA 4B3FX 3QX7A 3FLAA 2YWRA 1Q50A 1E98A 4P53A 3BJRA 3KVYA 1R6BX 4EZEA 3F4KA 4OXYA 4LMBA 3IJPA 1AUVA 3N59A 3WYGA 4BWYA 5FWYA 2BR4A 3FPFA 5K45A 3CNNA 4A8HA 4C08A 5H80A 4Y2RA 4FFBA 3KQOA 4QPJC 3UT5B 3AG5A 2AD1A 4RPLA 1T2VA 3QVGA 3H0EA 2B8WA 3T12A 2YWXA 3IPLA 2PWAA 3GPLA 1Q14A 5FPQA 3EYWA 5CXQA 1CFJA 3HN6A 4KSYA 2E87A 1DUVG 3W6ZA 5M29A 5DTJA 2PS3A 1V8OA 4Y6GB 1N5RA 2FQWA 1BS1A 3EZNA 1HFWA 1X1RA 4MCAA 4RVDA 3KSAC 5EUQB 4A10A 3D8BA 3HEBA 4CIDA 5KZMB 5AVXA 2G88A 1E2HA 1NQTA 2A9PA 3QTTA 2JH3A 1UDCA 3T1HB 2BKEA 4ZOEA 1ADGA 3HC7A 3PC6A 4GUAA 4UC0A 5DBEX 1O6ZA 3FSEA 3RUIA 1O8BA 2D13A 3M4NA 4Z99A 4DQLA 1EDBA 2X4IA 4GYWA 4TRMA 2WKRA 5KNCH 3WKEA 5L3VA 5CFZA 2A92A 4NOLA 3C3WA 4IILA 4BS9A 1H1TA 7GPBA 4B35A 4ZARA 1OWPA 3AG6A 3NC4A 2AJCA 2XNHA 4N5HX 5CCDA 3CX6A 4DQUA 1L8AA 3G6KA 3MMPA 1H9AA 1T3SA 1DV2A 1JH8A 3NHRA 4EY3A 3AKZA 4CM1A 1V7QA 3W34A 2V03A 4XXHA 4U9HS 1KWGA 3QNUA 3S2SA 1D3AA 2Q41A 3UA4A 5HQTA 4G5YA 3PC4A 5KYWA 2XXAB 4YA6A 3ADCA 2JIRA 1XAJA 1QZXA 2DQZA 3QJ5A 4JBHA 5BVGB 2GN4A 3KKEA 4F3TA 2PGXA 1SXJC 5CT9A 4ZT2A 2HLPA 2VUSA 3GBVA 4CETA 1YJ8A 1JEQA 3JQAD 3A3PA 5F1KA 2Q5LA 1WCIB 2PYIA 4DWVA 1KMHB 1TQ6A 4P31A 2PUCA 3ND9A 3A28A 3U0BA 1SUPA 1QHSA 3EVFA 4LWPA 3UPUA 4L73A 3FAZA 1VHLA 1ZGJA 4K1XA 4DIOA 2P41A 3JAMA 4L8VA 3X2EA 4H77A 2PVPA 3A36A 1GZDA 3KVOA 3BE8A 5ALOA 3H87A 1C8BA 3KOYA 4UUOA 3H16A 1K88A 1YDHA 1J9ZA 3GA5A 3OH8A 4Q1DA 4EA6A 4ED9A 1DXQA 4G1MB 2C7BA 1R0RE 2E6UX 2HEGA 4JHLA 1M74A 3WJ1A 5K01A 1RXWA 3HUTA 2VS1A 4FGWA 1ORTA 4TTPA 4ZVVA 2EBHX 2PUJA 3NNDA 3QENA 1D4ZA 2QRUA 2XCOA 2WV7A 4XUEA 3SQMA 1YVPA 3C7DB 4Y98A 2CJFA 3RHZA 3GI1A 5IHXA 1NV8A 2QRPA 4Z8XA 3WGGA 3M4JA 3I9NA 4CE6A 4F5WA 3A1VA 1Z35A 3CUUA 3WWPA 2VBCA 1PFQA 4LOKA 2JG3A 1AZLA 1GGNA 3L7LA 4E33A 1ES9A 1Z5PA 4KQMA 3BF7A 2XGSA 4YJ3A 2GJSA 3MRVA 5CX4A 3V8RA 4B6GA 1WABA 2APJA 2E5LB 4RTKA 4NBTA 4RIFA 3P2KA 2H8GA 1B6TA 1FZQA 3I39X 3IOBA 2OHHA 4IDEA 2BGNA 4MR8B 2J45A 4N12A 4NP6A 2RJ3A 4WFIA 2OFOA 3I92A 5LA6A 3R8XA 4D4KA 4BRUA 2X3UA 2WILA 4NICA 1G63A 1K6MA 2O2JA 3SQNA 5J2TA 4MVWA 4CKCA 3V8QA 4I5DA 1LKZA 4B3IA 4I9UA 1ZOIA 1ENOA 2WVGA 1XKQA 1NAHA 1J6UA 5CLIA 5TS3A 4ALNA 2NACA 1UPTA 3IT1A 4DBVO 2O1EA 1LDYA 4R9SA 5AIBA 1JEAA 2H52A 3KE8A 5JCZA 4PLHA 3RVDA 3TGLA 2NADA 2AJLI 4XWKA 2DF8A 1Z13A 2W6PA 2YZNA 1NUAA 3MAJA 3C5EA 1IY8A 4YRZA 1C9EA 4FHEA 4L2IB 1U31A 4GDMA 3UUWA 1YJ5A 2B7BA 1VJGA 4F4IA 4KIUA 4Z7OB 3O95A 1MNQA 1U7UA 1DS6A 3ZY6A 5IKPA 1WCV1 5KWIA 2VTEA 3PX2A 2DPGA 4QXPA 4N82A 1AQLA 5H4HA 2FPKA 4BO6A 3M1LA 4PYRA 1BEEA 3IEMA 2DX7A 5LQCA 3T52A 3E1KA 3IVMA 3WAKA 1JLRA 1M83A 1WHTA 4JC5A 3OPMA 5KNBH 4IINA 5KTNA 1V6AA 1OLSB 4IQFA 1K9VF 4GQAA 4OHVA 3PFBA 2IL1A 3TSOA 3O47A 3QLJA 2GXQA 1CUUA 3H75A 3L6RA 4IDHA 4ZOLF 2FXIA 3UK2A 3MJHA 1O5OA 4Z1OA 2CLIB 3ANLA 2V0GA 2VTVA 5BQ5A 4NFHA 3SYTA 1GUYA 3OTQA 1YVEI 4MRAA 4FI3C 3KQWA 4P80A 5GJWC 2IUEA 3HYLA 1G8YA 3U7RA 5HZHA 1F9AA 2YIVX 1CUDA 1FNNA 3G8CA 2OXCA 1GKIA 2QI9F 2DJIA 3R41A 1JQJC 1L5VA 4Q82A 1FRZA 3IUBA 3QQPA 3ZCPA 4BFXA 4DLSA 1Z6XA 3QUSA 1CUWA 5LQSA 3TQTA 1LSOA 4BNYA 5LU8A 4TLCA 3WMGA 2VRCD 4G97A 1W6UA 5I45A 4JJIA 1BYUA 1RBYA 2ZRQA 4O4IF 1V48A 3L9WA 3EPRA 1ZI9A 1ULHA 4BWGA 4JVMA 1AQ6A 1U02A 2B1IA 2CXOA 3SJZA 1D03A 4OH7A 3ILYA 4OTZA 1CD5A 4Z7NB 3KOMA 1H3FA 1P1CA 2I78A 5DSZA 3SP1A 3B2EA 4I4TB 4UU1A 5AM2A 5F2NA 3VHXB 3ABRB 2QRMA 5DRYA 2B4AA 4O25A 4WT7A 2BEKA 2DUUA 2W6NA 4RPIA 3N2GB 4IZ6A 1M2OA 3JQAA 1EQUA 3VYUB 1JR3D 3QP9A 3GPCA 4P82A 3WGUA 1GPLA 1G0NA 4NCHA 2WHEA 3HUUA 1CT9A 4UQOA 1NY5A 1UQUA 3P45A 1VI2A 4WCVA 5CYFA 3U3OA 3W3AH 2R6CA 1AA6A 1KVUA 4MKXA 4JJ8A 1M7GA 4MP3A 1HEYA 4DCNA 3QX3A 4J9VA 2R0QC 1CPYA 1QFMA 4V0QA 3WNCA 4KAFA 4QOGA 3DW3X 3WR5A 1WU8A 2XQFA 3LHFA 3NT2A 1UWCA 1ZIPA 3ZJYA 3RO7A 4QOJA 3VC2A 4D9JA 1XCOA 4DOMA 1A9TA 1KRHA 2ZJ5A 3R8CA 4YAEA 2AKEA 4KCGA 3HLYA 3E9DA 4JC4A 3W78A 1YB6A 2HBRA 4HB4A 4N76A 3OSUA 1GITA 5EKSA 4AX4A 1JBKA 2B30A 2ZQYA 2DHRA 2ZVDA 3CLRD 3OO1A 3W9SA 4B82A 1C7IA 1SWWA 1JBQA 2QGNA 1ZHFA 3BAFA 1RWNA 3G0IA 4GUDA 4HGRA 4JDUA 3HDGA 2ISSD 3RW9A 3ZHBA 1N5MA 1EWTA 1N2XA 5BSVA 1DT3A 1Q1EA 1G3IA 4FB5A 4OM7A 3WQRA 3B9QA 4HSEA 3TUIC 1E3EA 2WB4A 2G6TA 2W2TA 1JMYA 5CFLA 4MYCA 1XCMA 5EGNA 4WQMA 1NPDA 4DW8A 1YZTA 2C59A 1LK7A 3FTDA 4OG2A 2F8SA 2H1CA 2B8TA 2BTQA 2CNBA 4ZVLA 4D8UA 4IG9A 4GX1A 3ZV4A 3SD7A 4WJLA 4PPYA 1NM5C 1TA9A 4XARA 1GGMA 4F5YA 5IM5A 4C4PA 5B7NA 4EMUA 1YMUA 2EJWA 2WPNA 3RU9A 1IBMB 1A7KA 4Y2VA 8AT1A 1PNVA 3K2EA 1P1JA 1A71A 3EH1A 3X1JA 4XWYA 1NG9A 4KGXA 4S35A 3DHYA 2Q3JA 4ND5A 3TIVA 4OQMA 4F4CA 2PX6A 3IURA 5LQDA 4Z4IA 1GNPA 1C9YA 3CF4A 4MQEA 4B2LA 5HRUA 1IAQA 2IY8A 2EU8A 5DNVA 2QM7A 2CJYA 3SF8A 3C8ZA 4XKJA 4F4FA 4PC7A 4URUR 1BMFA 4KTTE 5BN5A 3JWJA 1KETA 3H1AA 4YDHB 4AJJA 2Z4SA 3H2IA 1JDZA 4FFVA 2ZWAA 4PF1A 4ZREA 3WAGA 3RSFA 2EF1A 4RA6A 4HVTA 4LSGA 2I91A 1BNCA 4NU0A 3ZW9A 3UPTA 1IONA 2R7KA 4KZPA 4YRLA 3SXUA 1Y5NA 1W4AA 4R6WA 5IEJA 4MKIA 1YZYA 1R6XA 2EVWX 4RQAA 4WACA 4CIAA 1U28A 2VHYA 4KYUA 1ZBDA 3Q6MA 2DG2A 4CU2A 1A9PA 3ITKA 4KTVE 1MRZA 1DNPA 3RRXA 4H17A 5CD9A 4YONB 1OTXA 3KOZA 5TGZA 5I9IA 4CTOA 4KI0A 1O89A 3WI7A 2EZ9A 1JG3A 4OU5A 1ZD1A 5KSYA 1J7JA 3FKSD 4PSUA 3BHNA 2JEOA 2FSIA 2WG1A 1L4NA 5JWOA 6YASA 1KRXA 1P5FA 2X4GA 1XCLA 4OK3A 4DNOA 4YRIA 1C3XA 3LCMA 3LLMA 2V6IA 3U7HB 1BMDA 3M9XA 4ZK6A 4LI3X 1JJBA 1TD9A 1AE1A 5B36A 4QPPA 1Z8NA 2IP1A 4N1AA 1V2GA 1LB1B 3V1YA 3ZUGA 3DO8A 1LZLA 2BMDA 4KV9A 2Q9CA 4IDNA 3QVUA 3GMTA 3OX2A 4YO7A 3U31A 3B6IA 1DFHA 1UMCB 1XDGA 3L0CA 3D0RA 1YS2X 2J31A 2RHJA 4MW6A 4P38A 4XGQA 4XIJA 1RTTA 1NUUA 4RVFA 2WYUA 4G85A 4ER3A 1M2VA 5CNJA 1YRWA 2RIRA 1C1DA 4M60A 5B7QA 2WPDA 3OC0A 1P8AA 1F51E 3AB7A 3DEKA 4GI3A 2HI0A 2MINA 2YN4A 2IV3A 3TH5A 3LU1A 4CQLB 2PUVA 3EIOA 1G9TA 2VL7A 2JJ8A 3MQ2A 3EIXA 3QHPA 5DYNA 3P9ZA 1DTEA 4QHTA 5C7YA 3TD6A 1YDMA 2YDXA 2QT0A 5EWJA 5HS4A 1CS4C 2H57A 2D1SA 3S8MA 2FFJA 3GRVA 3U4MA 1IJKA 1NRIA 1W47A 4IXMA 4JODA 1EUDB 4PINA 2EIXA 1DC6A 4FZ3A 5AI4A 1ZOSA 4MQ5A 3TR5A 5EE0A 4QTYA 1GAWA 1EPUA 3CUWA 5KI6A 3T9BA 1D5CA 3LY9A 2PT7A 1FDSA 4P3PA 5BYBA 1NP7A 1GQOA 3FCXA 5C81A 3EXEA 1W5EA 4QBKA 2J07A 4HBZA 1G4AE 1F8XA 2Q3LA 1IHUA 4TKUA 2P65A 2XT0A 3W1WA 2OEPA 4ARSA 1IY1A 1XJCA 2BFCA 5A04A 5J4KA 5DU2A 3V7WA 3O2SB 4GZ3A 3DKVA 2X6QA 1OGYA 4UDXX 1XAGA 1XQWA 3IP9A 1SVIA 2HU7A 4C20A 1OXBB 2PX2A 3EAGA 5TV2A 4BRZA 4MVYA 4MA5A 1NVKA 5G0VA 3ETDA 3T9EA 2ZIGA 2RSLA 3BTUA 3NIDB 3OPXA 4ZZ3A 3PSHA 4PZZA 4ZOQI 1XZ8A 3MTEA 4W5QA 1YR2A 1MQ9A 3E3LA 3PL5A 4LK3A 1RHQA 4WXHA 1KOLA 5LM3A 4KAJA 2GZAA 3AONB 3FR7A 1GQ2A 5AHOA 5E9QA 1BMQA 4EFNA 4L50A 1WHSB 2BM9A 1GY8A 3FJ1A 1YV9A 3IIMA 3Q5DA 3ZWAA 4X1KA 1ZIOA 2F8MA 5AJXA 4P0QB 3AEKA 3HBJA 5A9SB 1NKVA 5JNUA 5LJLA 2Y99A 5FNVF 1VKHA 2JGMA 4PPNA 4KXUA 5J5AA 3B48A 5YASA 3S99A 2FH5B 3DR3A 1MTOA 4UDNA 1FUIA 1A9ZA 4LQDA 1BVUA 3STXA 1W7AA 3VO1A 1E9VA 1JZQA 2WJ6A 3WWEA 1GL6A 3HCAA 3X1ZA 3X1DA 3CSDA 4JQCA 2HLNA 2BMVA 1N33B 2XNDA 3DOOA 1I7NA 4KYTA 1PT7A 4JSTA 5IEBA 3MBKA 1M75A 2RH8A 1BGVA 1E9EA 3A1FA 3SC6A 4B4UA 3VNAA 2CXRA 3CIFA 4ZDJA 5K0GA 1VBMA 1H94A 5DVZA 4DV3B 3VVBA 4DNXA 3JQDA 4DLLA 4K05A 1YD7A 3LDUA 5REQA 1A2BA 1RIFA 3CONA 4KFRA 1IEWA 4D8TA 3AVTA 3ZI4A 3S27A 4OHCA 1XRLA 2QAGA 3DVSX 3E84A 4IUDS 4X6XA 1RLUA 3FPLA 5F4BA 1I33A 3OE7D 4PR3A 1BWQA 1X8LA 3K9HA 5HMMA 3PF8A 1FJGB 1QNLA 2ZYRA 2GBLC 3EGXB 4E12A 3PYXA 4YCSA 2XLCA 1QCYA 1Y34E 3K15A 4R2LA 3BMCB 2JGRA 3IAM1 4LQ4A 1HLPA 4UUBA 2BMJA 5FFFA 3GEEA 2IS2A 1N3IA 3G5LA 5KDOA 1T24A 3HVIA 3TTSA 4DR5B 1DAOA 2FR8A 1HL7A 2NWQA 3KYCA 2GEKA 4DBLE 3TKAA 3FKSA 1U0JA 1UXKA 4IIEA 5CLFA 4YQFA 3CKLA 3L0PA 3DAOA 3QLTA 2R8OA 2BFMA 4Q9IA 4GMDA 4I36A 3U60B 3MOIA 2HSZA 3FRJA 4KWEA 4Y3UA 4GPTA 2JLBA 5KVQA 2AOUB 3SQLA 1HEIA 2X3FA 3JQBA 5H8WA 1X70A 4B9EA 2Z1MA 2PX3A 3VKVA 4L8LA 3N2LA 5BT8A 3TK1A 1LI4A 3Q8LA 3IEKA 4JI4B 2H9AA 2OK7A 5KVSA 3ZXYA 1E9DA 5AW8A 1WUHS 2G3YA 4HGYA 2CMDA 3OICA 4AF7A 1JQLB 2E4ZA 1UFRA 2VPYA 3AVPA 5B3KA 5ICMA 2OE2A 2R00C 5KNLA 5FPYA 1S7CA 4L1KA 1NF8A 4TTJA 2OV1A 3USZA 1EJ0A 3CUTA 3G89A 3ZIAD 4GPBA 3I42A 3H4TA 4ZD6A 4B9AA 1LPMA 4PYOA 5LBIA 1QFYA 2VUTA 5C31A 4FDUA 3G2NA 5KKAA 1I7SB 4PBTA 4B7XA 1UBLS 2R7MA 3AF3A 3SYRA 2B69A 4ENTA 5KAMA 3EUEA 4L4SA 3DD5A 3OU7A 2ZYHA 4KVZA 1COZA 3C3CA 4UU8A 3RS5A 2C3YA 1SCDA 2WT9A 4BFWA 1QYVA 4D3DA 2MYNA 1NJ6A 1W9HA 3EAQA 4HFMA 2QJFA 2VHUA 4PQYA 4NBKA 1YI0A 5JASA 1A3CA 4PCVA 1KXZA 3C7TA 1G0OA 4EO7A 5KNDH 2I1QA 1CY4A 5JZBA 2D1YA 2CYAA 3DV0B 3ZGLA 2Q4DA 3I83A 3JWGA 2R5FA 1FMCA 2NO0A 2WUVA 3PGMA 1YIOA 4GVXA 5E38A 4YMLA 2WMOB 3GJSA 4TYPA 4YJ3F 4BVFA 5JSQA 1KFBB 1RM3A 4P4NA 4IIGA 2ZETA 4JCOA 2R6GA 3SHQA 3IEUA 4MUJA 3JATB 2UZIR 1KI7A 1ZIDA 1GN8A 2ZRJA 3WL7A 4F5DA 2QP3A 5LA6F 1VDMA 3FHJA 4JMLA 5C37A 1FUEA 4D9HA 2I4OA 5JECA 2NVOA 4LRTB 5CTAA 2GZ2A 5J2TF 1Q95A 1SBZA 3R6GA 2JFVA 5EJ5A 4V0SA 4KHPB 4KFUA 1IZYA 2B21A 3BG5A 3WGQA 3JYNA 2YVAA 3GRYA 5CXXA 1JXOA 4UD2A 3ZHCA 5C3MA 3H1PA 1VTKA 2QXUA 3NONA 3OEHD 4I8IA 4YWHA 4R3WA 3TLCA 3MCVA 2DT8A 2RONA 3B85A 2ESRA 3QV2A 2CFRA 3ZE6A 1JZSA 3SR3A 2QM0A 4R8LA 3U61B 2SKEA 3ELUA 1VKZA 4KUEA 1YRHA 1ODFA 5EHGA 4AJIA 1ID1A 1KZGB 5A06A 2P27A 2QZZA 1WQ4A 1TKBA 3HVUA 4H0FA 1VMDA 4NMMA 5JEDA 2A9FA 3KKQA 2XI4A 4C7KA 5AVKA 5ADVA 3B7PA 3FFAA 3DKPA 3QEJA 3JPWA 1U5CA 4MWOA 3NW9A 3C74A 1LRLA 1UBRS 3BMNB 3VOBA 2FX2A 4CLRA 2BGWA 3NG1A 3BDIA 1UBFA 2PUTA 3MFYA 1PQPA 3CLUD 3O38A 3T5MA 4WNIA 1TFUA 2A5DA 3U9SA 3Q8MA 2PX5A 3OE7A 2HD4A 4UVIA 3ZZUA 3M9LA 4E5DA 2A8YA 1M6WA 2O2ZA 4WY2A 2R1TB 1XALA 2D0OB 3H13A 2ZFUA 3QLVA 4NVRA 3E7WA 5LFAA 3TRIA 1ZU5A 5AIAA 5TQJA 4I1PA 3UYKA 3E2MA 3PVSA 4EELA 2GA8A 1K5HA 3O93A 3THRA 1F7UA 4J0FA 2PFKA 2FFQA 2GPJA 3QBTA 1L5HB 1OI2A 3CYFA 1Q44A 1VKOA 1S2LA 5CLGA 1WB5A 4W1PA 2GN8A 4IJWA 3GV0A 5FBWB 1HTTA 5B6IA 4IOLA 5KJ6A 3L3BA 2F1HA 2Q0XA 3TO5A 4LYFA 4ZQEA 5AOVA 4F3NA 5K8CA 3ZNQA 3KKLA 3L07A 4LJ7A 2FZKA 3HSSA 4IH1A 5KYUB 2ET6A 2JD1A 4DTCA 2BMFA 3TAUA 5A5DA 3GP8A 2QD5A 3FFBA 2W11A 1JA1A 3EZFA 4TZKA 1M8JA 4DT1A 5BQXA 3BF8A 3DNMA 5JS6A 4NONA 3AP3A 4LQLA 4WFJA 2GPSA 3K3PA 3O0DA 5DHSA 3WQSB 3L4JA 5D3KA 1IMOA 4ENRA 4ARUA 5CIYA 3WYCA 2UVDA 4G4JA 4CMCA 5JXHA 1UK9A 1LF5A 3OEED 3ZIAA 3KNZA 4Z2YA 2VTBA 3DWGA 1FUKA 4ZYYA 1TKAA 3AEYA 2QTCA 1YR1A 4EDFA 1U80A 3SG0A 5B6PA 4LXTA 3BB1A 2HRBA 2VSNA 3GP5A 3O75A 2ZGVA 3AM1A 4MW1A 2J0QA 3AEUB 3L8ZA 3HUEA 4URVR 1VA4A 1XP8A 3NDPA 5KCZA 4YASA 1G21B 1GPNA 2FEOA 4RPGA 3OTOB 2OBNA 3R74A 3WWOA 2DKNA 3BH6A 3FSRA 5JALA 4PCLA 2MSEB 1GZ6A 2WM8A 1NJ2A 3KFVA 5KAPA 4XWOA 2YL2A 4XOUA 5E6RB 4F8EA 3SX2A 1AQYA 2OGSA 3SY8A 2Q28A 2X0DA 4NE9A 4C14A 5AKKA 4EUHA 2I22A 4CIWA 5HNKA 3PS9A 1JKIA 4HH0A 4J9UE 2C0QA 1SUFA 2R6ZA 1C4WA 1WCXA 1DKRA 3AETB 3L4SO 4M1QA 1I5RA 1PYGA 1ISPA 2LP4Y 1Y9ZA 1MF7A 2PLRA 3EZYA 3QF7A 4CM4B 4E5UA 3UF0A 4PPGA 3SK0A 2FR1A 2YINC 2C5AA 1EXDA 4C6TA 4ENWA 5JLJA 1O4VA 1N6KA 4GX2A 4B33A 4QT4A 2QTWB 4BFVA 4JXZA 1PFVA 4EVIA 4HVLA 2FMXA 4GGPA 5K2MA 4KSBA 1JP7A 2IYWA 4A0RA 4IOKA 4DBZA 2IKSA 5EGSA 5DNUA 2W8ZA 2IPXA 2SNIE 4J2OA 3OPYA 1FLVA 2EFDB 2J4CA 4YXWD 3A1DA 4LV8B 5E4YA 5CDUA 5ICFA 2AG6A 5FBKA 3CS3A 5AI6A 2PSJA 3UGQA 3RRNA 4Q1AA 5J5CA 1K89A 1TPYA 4H08A 5JO9A 3TZ6A 3L18A 5AUNB 1PEAA 4YJ2A 1E3JA 2PCJA 3FGNA 1RM0A 2NZXA 1DAPA 3F2VA 4GE0A 4LHSA 2G6BA 3EF1A 5IAOA 3KYJB 5I7EA 1N8KA 4CKZA 1ACLA 5EP1A 5I9TA 4PXSA 3ITEA 2XJ4A 4LZZA 9MHTA 4UBIA 4ID9A 4MV8A 1QLJA 1U0LA 2P75A 2VBFA 4LPKA 2HWXA 2HUPA 4FD2A 2OB1A 4PIVA 2ORED 2GBFA 2JI6A 4IEEA 1LQUA 3GB9A 4G9GA 4AXBA 4RGVA 1VIDA 2XKJE 5KNCD 1PJ2A 1AMNA 4RTMA 4ZA2A 4M21A 2PPVA 1ZESA 2H63A 2ZSKA 3BL5A 1R18A 5IH3A 2Y0CA 3U4HA 4D0SA 5CBPB 4PYKA 1IM2A 3SBOA 1K7XB 4JVLA 1IHYA 1Y8QA 2FMIA 2DQSA 4LRWA 3VYSB 3U81A 4C0AC 5KSOA 1MLDA 5J47A 4HZIA 1U0TA 2ONKA 2ZJAA 4RSRA 4XDYA 5BMVA 3EPLA 5EYPA 2IYRA 4KX3A 2YWBA 2XYQA 1UMBB 2AYXA 1GPDG 2IZ1A 1JIQA 2VAWA 4CMJA 1T8SA 3N3AC 4CL2A 1OH5A 2HU5A 2Q3HA 5TPWB 3OZFA 3TZLA 4DC0A 1QHHB 3MHTA 3ZDBA 4MGZR 4Y2QA 5JCPA 3Q2KA 3DB2A 1OX6A 4Z9BA 5TXGA 2BSQA 3FPCA 1V1RB 3OIFA 4DQ0A 2HCBA 4J16C 4NJMB 4DEYA 1Z63A 4GX5A 1U0GA 1LWOA 1KZHA 5KMGB 1P7YA 4C7JA 2JJ2D 2IIPA 1Z56C 3PNOA 2D2VA 2XYRA 4LYEA 4TXJA 2CHFA 1RQXA 3PNVA 1YZFA 1U9JA 4MAAA 5JANA 1UBUS 3PEUA 2QJOA 3EWNA 4L8FA 2ZI6A 4OATA 1W1IA 1E8NA 3LQKA 1VHQA 4YAWA 2IYAA 3WVNA 1PDOA 4DC9A 2Y8EA 4UHFA 3JWPA 4ALLA 1RR6A 1MABA 3NX4A 4PVDA 1S9DA 2DVMA 3ZQKA 1C3JA 4ZEMA 1IN8A 3VDNB 5JYCA 3TL6A 1L6RA 1UJCA 2OD2A 1RS0A 2ZSAA 4K0RA 4LVOA 5DP2A 3HCNA 1YF3A 3F7OA 3AERA 2VUHB 4KLZA 3OWXA 1U4NA 1G8GA 1NFRA 1EINA 4POAA 2HCFA 4WE3A 5AK5A 3WIOA 2CV2A 1DJPA 1XCGB 3ZZTA 4KXVA 4MV3A 5JSZA 2MIIA 2BBOA 2KQUA 5GOZA 5AFSA 3AVUA 2GHTA 3MWJA 2NM0A 4HG2A 3RG8A 3I8OA 1CR1A 5I5GA 4FZRA 5CX1A 1RLOA 2EFHB 2Q7XA 2VJAA 2W0MA 3GJQA 4LJ4A 2WYOA 2QYSA 2C4UA 4UAGA 2GF9A 3AHFA 4QSMA 2JGFA 4NZYA 4OQ4A 3T1TA 5EP2A 1GNLA 1B6RA 3M81A 5CFQA 2WAYA 4BBPA 5DXJA 2BFDA 1TADA 4XGIA 3WLEA 3KPVA 4PZEA 3I30X 4AWBA 2E1PA 1U1IA 4ZIRB 1JSLA 4MV6A 4DJEC 5EPEA 1DHTA 2D6FA 1TMKA 2AMYA 4KMRA 4RJ2A 4II7A 3RU2A 2WJWA 2YOFA 3HJUA 3VU1A 1O94A 3H3JA 4COOA 4YV7A 3OQMA 1ACJA 2MSWA 3PPYA 4JLSA 4L22A 1Z4IA 3I2YX 1J8VA 4REQA 3BWBA 4F96A 1KARA 1ULAA 4YPOA 1DJNA 3BGVA 3V6LA 1NN0A 4MA4A 3VX3A 2HYDA 2E21A 5E9WA 2W2LD 4IZIA 1CUGA 2HCJB 3PRJA 4ZFNA 5B4TA 4LBZA 1EP9A 3INYA 4P9NA 5IMSA 4DNPA 5HKKD 4E0BA 3GROA 3NHKA 4KN5A 1NE7A 4MI1A 4XSHA 4ESVA 2HTEA 3JVVA 1OB5A 2B4KA 1WEHA 4HB3A 5G0SA 2ZRLA 3G02A 1GJRA 4FBGA 2VP0A 4M89A 2ZDGA 1HG0A 3DL2A 3KFLA 2P9JA 3WK6A 5DGCA 1PKEA 4RCVA 1E1NA 3IL2A 5B4VA 4KHZA 1GIAA 3AYZB 3GLUA 3PICA 3JALB 3ZU6A 4A4DA 5KNBD 4N5LA 2E6KA 1RWQA 4U7HA 5ENDA 3JQ6A 2J4FA 4V38A 5BR4A 1BXGB 4ZQIA 3E5MA 1MQAA 1LLCA 2OWEA 3SJBA 3H0KA 4AIIA 1GV1A 5T6MA 2QY9A 3I9V1 3M70A 3R7NA 4QBIA 1YRYE 3AFIA 5DYYA 4F6CA 3OESA 4YMHA 3DV9A 4R2HA 1NHGA 4RUKA 1VCNA 1BKSB 1KORA 4KE6A 3I09A 5AXCA 1HM5A 1WOYA 3DVRX 4C0HA 1QNFA 2XUQA 2GD0A 2QYHA 2GCOB 4N0QA 4P33A 5BN3A 3QKIA 4S24A 1D4FA 3L05A 4JLUA 3WC4A 5F7OA 1VOTA 3TLGB 1F20A 1U2RA 1IL0A 2HHJA 4YP0A 4LUCA 1JB9A 1OJ7A 4GBGA 3SN6A 1CNEA 4JR0A 3LJKA 3N2EA 5WRFA 4RD2A 3SMVA 2C5SA 1U9YA 4ND8B 3EG9B 5DZSA 3RC7A 1JWAB 4RIHA 1Y5RA 1ESZA 5EJ8A 3JVDA 2P62A 1PIWA 2DT5A 4MIOA 2ZRHA 1MAUA 4Q4JB 4UMFA 3F5QA 3NM4A 1YL6A 1C14A 1I2CA 2HSWA 5EI5A 4FN5A 4U2FA 5DOVA 4XCQA 2GM4A 5C5DA 1IUNA 4RA9B 2YWEA 3NUZA 4B3DA 3N5CA 4LECA 3B1ZA 1N8TA 1Z0SA 3FMOB 1VGRA 3FTFA 3WRXC 1I4DD 1NSFA 1FQJA 3GELA 3JR3A 3Q2IA 2J33A 5AVSA 3SHFA 3MJDA 2JJ2A 4TXNA 1ZL0A 3KJGA 1Y8CA 4A92A 5H3LA 4QDZA 3OF3A 2LIPA 1Z83A 2J7KA 3AY0A 3DMRA 2DERA 5ERXA 1E5XA 1QR6A 5A7HA 1C0PA 1P33A 1ZM3A 2BTOA 2Y2VA 2GD6A 4F7WA 3VBCA 2ZRFA 4HKTA 3QPVA 4MUKA 4IVNA 1UOEA 2WTBA 3KKMA 3DZHA 2NZWA 5JROA 3F1LA 5FUVA 5EOVA 1NBHA 4AXXA 3GOHA 4MJXA 4CM9D 1QG2A 2JLWA 3M3DA 2AMVA 4CMAA 1TIBA 1JZTA 2FKAA 4ZOLB 3BUSA 3KS9A 1CY2A 3UBTA 4JA0A 4N0MA 4IX9A 4YMTA 5K8TA 1LC0A 3DCYA 3N2IA 3BZUA 1EH5A 1KF0A 3ABOB 1XU7A 4OQDA 5I48A 1LBHA 2AC2A 5K0NA 3WLRA 1U8UA 1NZDA 3HKBA 2VHXA 1UAGA 2VP5A 3C3BA 3ICWA 4PCUA 5BWCA 2ZSUA 4IDPA 5FBQB 2O7NA 3AILA 2BHRA 4FPXA 2P8SA 4QRIA 1L5SA 1HSOA 1KIFA 1U90A 2MSNA 2P2NA 4OYYA 4IFIA 3R9WA 3ITDA 1OFVA 3HBAA 4O4HA 5L53A 2C92A 3AESB 1U3DA 4GFDA 2NU8B 4DLYA 3RLFA 1WUYA 4KQWA 5JATA 1I10A 1F8UA 3CF4G 4RFSB 4NATA 5ENZA 2OA0A 3RS0A 4BASA 2H0AA 1GNSA 3PR3A 3EXIA 5JCJD 3R44A 1H2RS 5LQNA 2R1VB 3DZIA 3QEMA 1EMDA 4PN3A 3TRFA 1QTIA 1J56A 2YNMC 1V9SA 3HCFA 2AK3A 1LSJA 4DSTA 3I62A 1BJRE 4LVNA 3GCWA 4NENB 1YAHA 1GRQA 1G8PA 3A9CA 3B7GA 3VMFA 1VHTA 4ZVQA 2W2LA 3RSOA 3CRNA 3KYDA 4RU1A 1LJUA 1UFVA 3PEVA 3IKLA 1T43A 2B61A 4AO6A 1BVHA 3ORYA 2QBYB 5EJ4A 4QNRA 1RXYA 2K87A 4FFRA 4Z86A 3EA5A 3LHSA 4WUTA 2QVZX 1VYVA 3AOGA 1AKTA 2YOHA 3AR5A 3NT4A 3RWOA 1RWPA 4NK5A 1YQXA 5DHQA 1BDIA 3FPJA 4ZV9A 1SXJA 2FCAA 3ZGVA 1O87A 2HSEA 3DL7A 1WM1A 2IHBA 2OB2A 4TTIA 5E4JA 1E2GA 1GDHA 1M1ZA 2JRLA 2B4RO 3JD3A 4GH5A 5E0KB 4Q7JB 3SEQA 3WX0A 1T5IA 1YFLA 3FLEA 1CP3A 2BP7B 1A98A 1G3UA 3K1ZA 5KNBA 3SJAA 1SC1A 1NAIA 3UIEA 3FCOA 4DYDA 4DV7B 5EESA 2Z95A 3ESZA 4BTEA 4A0GA 1VE3A 1NW5A 3VYVA 4TTVA 4HDRA 2Y1KA 1T4DA 2FDRA 2VF4X 3OJFA 2PZMA 4PNHA 2PL5A 3UMVA 4X20B 2XQJA 3IE0A 5I7UA 4V0ME 1Z34A 1FBTA 4AP6A 4B6JA 1QM5A 2WTAA 3W6PA 1TJYA 1PLJA 4LWOA 4WKGA 4C3VA 3F3MA 3VR4H 2DQYA 2A59A 3EDQA 3F71A 3I9OA 3L6DA 3MWYW 4KSCA 2AX3A 1N8SA 4MGYR 1RPZA 3BE6A 1DOHA 4RMNA 3RODA 4DIEA 5FPKA 4UBMA 2HMSA 4ZQCB 3OU6A 1UFQA 5FTWA 3NEAA 1BFDA 4OI2A 1W4ZA 4NMWA 4M8LA 4H3SA 4DHWA 2XECA 1Y63A 5C1IA 1T1IA 4G23A 3HXPA 2ZAYA 3FNQA 1PU2A 3C8HA 3IS3A 4XPIB 1EFPA 2ZUBA 5EE9A 4PNEA 1N5JA 1U5BB 2Y66A 2FN7A 2VDMB 3LZCA 5A0TA 2XA9A 5HIIA 1DAKA 2QR3A 2W37A 3BE4A 4QOHA 1DXYA 4JI5B 2D2IA 4D9GA 1RYYA 3WB9A 1XJWA 4UHCA 5E7JA 1GL3A 5IULC 3W3AA 1NQVA 1E3LA 3J81k 2HR1A 2LDXA 3Q12A 1L1RA 5HCNA 2PNJA 1F3OA 1JS1X 3BXPA 4IIUA 4J0KA 4MQ4A 3PEYA 3MTIA 4FEGA 1EEXB 4QQKA 4B3HA 2AI3A 1BWRA 1EGVB 1PLKA 2FA9A 3S2ZA 1R8JA 2I65A 2A35A 4MULA 2OBMA 2WUEA 1UWVA 2C5HA 3IDQA 4LTMA 4UBNA 3W2EA 4Q9LA 5EWLB 3IHKA 4RJJA 4AF6A 1ZR2A 3NC1C 1RLMA 4Y30A 4I46A 1ENZA 1JU3A 1NU6A 4ALIA 3BGOS 3NXSA 1WCWA 2VP9A 1RI3A 4O4LB 2VCHA 3L1JA 4G25A 2JDIA 4LJ9A 1DWUA 2B9EA 2OZKA 2YVLA 4MEBA 4YPFA 3DBHB 1KOFA 2AXPA 1AM4D 1EFDN 5C1PA 4KO1S 2CVFA 2O3QA 1Z74A 1EG7A 2WWWA 2JI9A 3L7OA 1TTHA 1OGIA 4GMKA 3DWFA 4IFEA 3KLBA 1IXZA 2FPSA 4MLPA 3C6BA 4NMXB 4A2PA 4U7DA 1P61B 3F96A 1KO7A 5FOUA 4LBVA 2J6BA 4DWOA 1PX0A 3TDKA 1IXSB 2EP7A 2C5GA 3IODA 4OQLA 5LZ8A 1RMTA 1ZYUA 3EVDA 3LIIA 3K70C 2C4HA 2HNKA 2WU1A 2ZRPA 5EJIA 5KCMA 4RQTA 3ZKWB 2BGUA 4H7PA 3O2QB 4D6YA 5GADl 4EFMA 5H81A 2A9KA 5K3FA 4YJGA 4HH4A 4RF3A 5JCJA 3ZY2A 5CYPA 5THKA 3AIIA 3CQ9A 2QN9A 2W70A 1J9EA 4AULA 1FFDA 3A10A 4UOEA 1QGYA 2C8VA 1QORA 1KEKA 1FNMA 2IH2A 5GZ3A 4HWPA 4B09A 1EK0A 2R6AA 1BH2A 2OG1A 3KEOA 2R1UA 3FIUA 2UYGA 1K8RA 4G07A 4GLJA 4ALKA 4H3VA 4B46A 1O9GA 2ZJFA 5EMLA 1Z8FA 2FUG1 4NESA 1ZC3A 3JASA 1EHCA 1MB2A 1I5EA 1NUQA 1NLUA 1ULBA 1XQYA 4IX1A 3S2GA 2YBDA 4HV4A 4D4IA 1NASA 2GZDA 3R09A 5CCXA 5KSPA 1EA5A 4PEVA 5E9AA 3C43A 1Z06A 2OHXA 2X8BA 4YJ2F 1G8SA 2C8LA 4OAPA 2WWIA 4WZAE 1H6BA 4XGNA 5TLSA 3S5UA 2CUZA 2IYNA 2UYCA 4L5CA 3VMMA 5JH7A 3IKTA 1SKUA 2YQ4A 3JTEA 1Q7CA 1ZXLA 1XDBA 3N75A 4MVJH 4PHCA 1P81A 3BMQA 4BKRA 2PZAA 1GEEA 4F6LA 4RDIA 4EW6A 5CVTA 4EG8A 2VPZA 4UE3S 5CG1A 5HSGA 1F2DA 2EATA 1SIOA 2PS9A 1T5HX 3R6LA 2DFNA 3C97A 4QEZA 5BMVF 3KG2A 3DDHA 3WNDA 4MTLA 2NNWB 2FUEA 4U6SA 3IKMB 1HTBA 1RQ7A 1ODLA 4PO9A 3N7UA 4ETMA 3KL2A 4JN6B 4GDFA 3LVRE 4J2TA 1TQHA 3K8ZA 3NVMB 1RAHA 4O3MA 5FQOA 4L7VA 5FUXA 3ZVNA 3OA2A 2F43A 2I3BA 2W2NA 2FPGA 3GFFA 3WLIA 4ZZIA 1X7YB 1QK5A 1F2UA 2GNPA 2PMFA 4QO7A 3STUA 2KMLA 1V8ZA 3OQ1A 5EHQA 2F90A 4FFBB 4QE3A 4AZTA 2O7VA 3HYCA 1L8XA 4QXRA 2BEJA 4CI0B 1R12A 2ZU6A 4CMIB 3GLGB 3H6GA 3FF4A 4INPA 5LXTA 4BJ1A 1GD1O 3EQZA 5T4FA 5D7BA 3BHJA 4ENSA 1LDMA 3BQMB 1QOPB 1V3QE 3GPDG 2Q6TA 3BD6A 1N8NA 2FSVC 1OAKA 1FRNA 2QQGA 5JIBA 2GM3A 2XVMA 5J4HA 2H4HA 3OOHA 1ODTC 4MIYA 1ZNZA 4WZZA 2QTMA 2VA8A 5IKEA 4FCTA 5KNDD 3D7LA 1QUEA 4P3YA 4YI5A 4EKGA 4W9NA 4QUKA 2B8EA 4LF4B 1CUSA 3C45A 3R5JA 1RC0A 3DBRA 3BBPA 4Y2HA 3LWDA 3U3MA 2RH5A 5TNXA 3HKCA 1ZG3A 3CR8A 4X90A 2VN8A 5D5PA 3QNWA 3WIUA 2O05A 4LQCA 1TCAA 3LLUA 2HREA 4R2WA 4KAXA 4KDRA 2MSDB 5F3RA 4AURA 1RFGE 3TSCA 4AROA 5KTKA 1Z08A 3BXXA 3KIPA 1P2SA 2NUPA 2PZEA 2VBIA 4CUJA 3KHSA 6LDHA 1T9DA 3TCKA 5CFMA 4MB0A 5FUMA 1TZBA 2C9CA 1SOMA 2Z6AA 3OZ7A 7ADHA 2X8LA 2PXAA 4M99A 2KJQA 2ZB8A 2ZIAA 3VH4A 1FTSA 3L84A 1MW8X 4CU5A 4TV8F 1DQPA 1RXUA 3L4BC 4PFKA 1JEQB 2IZ0A 4WSOA 3WLSA 1ZKDA 1WEKA 4WN9A 5IZCA 1N2ZA 4HQ6A 3K09C 3N6XA 2CLSA 2QRKA 4JC8A 4R40A 3EPHA 1CR6A 2FZWA 2HF7A 4NS4A 2I6TA 5G0UA 4C5CA 4ZI7A 4NDNE 1I4TD 2EEZA 2Q50A 5SY4A 3FZGA 1D2HA 1UJMA 3SDSA 3RC8A 2W7TA 3MB5A 3ZD7A 1IN6A 1ZD5A 3CX7A 5ANRB 3FTNA 2NG1A 2J9FA 3BILA 1O0SA 5DT2A 1EK2A 4OHYA 1N2CE 2Z8XA 2ZBQA 2M2IA 1P0CA 3PQ4A 3MGBA 2FFBA 2VAPA 2ZIEA 3ZCQA 5DO9A 1BO6A 3ZCSA 1RHUA 5C35A 1R4NA 2WV9A 3PBKA 1A2QA 4RGBA 3GQBB 3JWEA 3MSCA 1YUBA 4PANA 1R0CA 3KETA 5HQJA 3D64A 5G3ZA 2W2QA 1EUZA 1DQZA 4FOOA 4YJ3B 5A0FA 4AJ9A 5F9HA 1EFKA 3I4FA 1OLUA 3BCSA 4UBJA 4F2HA 4G0UA 1S2GA 2IHTA 1GKKA 1M2WA 5EUMA 5FL7A 2P3SA 2O48X 3I5XA 1L2TA 5A5FA 3EMBA 1KI6A 4C4YA 3F6BX 2P4HX 5CTJA 1M2EA 3A4NA 2PA0A 3C8DA 3OCWA 4UHDA 1LRJA 4B7CA 1Z25A 3LPAA 3Q0IA 1DX9A 4Q6BA 4UE6A 3T9CA 5K0FA 1ECBA 4KR2A 3PPWA 5CH5A 1GUBA 2VYVA 2FPMA 3TSWA 5KVAA 2X9QA 4G5SA 3O1HB 4GRAA 3KXIA 4WOBA 1WTCA 3MWDA 4BKOA 1K4MA 3S5JA 2NV0A 1MOSA 2PCLA 4Q9HA 4QDOA 3LOPA 4JP3A 1WSAA 1ZUD1 5FPSA 4PS0A 1SVNA 1RMYA 1D1QA 2GAJA 5KINB 4OH1A 3CGGA 3HXLA 1JFSA 4Y6OA 1IDOA 4FKBA 3A6KA 4WEQA 4JLJA 1XR3A 1UXOA 2C8JA 1B6SA 1E32A 1FU4A 3L4EA 5D00A 4DCGA 3D6VA 5DTEA 3B13B 4X97A 4U0JA 3T9FA 3TBHA 3ZHSA 4IMIB 2O5VA 2BDEA 2ETVA 3D4OA 3OE4A 3EXHC 3TOZA 4BUJA 4CG2A 2P9EA 3VU0A 3WOHA 4PW0A 1TGYA 1SUSA 4KIGA 1WHTB 3RK4A 3ITNA 4UU7A 3IUPA 5BP7A 2GF0A 2JHCA 4Q4AA 5KVCA 4EZIA 2OMKA 3OEYA 5SY9A 4LKRA 4FCCA 3RS4A 4HXFB 2WSYB 1O0BA 1NW7A 2WG2A 5AJUA 1D2CA 1ISFA 3ZDCA 3PYMA 4O8CA 1JUDA 3MEQA 3QUBA 2PT5A 4J0EA 4V03A 4LHVA 2HV8A 3GJRA 5KNDA 3JSAA 2AUNA 2YCLA 4WA7A 2RB5A 3EVTA 4IQ8A 3IPRA 5JVDB 5K2OA 2V7QA 4XR9A 2ZTLA 5EQTA 2BF4A 2PE5A 5B1HA 1DSSG 1PE0A 3BXGA 2J3MA 4H6PA 3V4LA 5I4KA 1JN0A 5CUQA 3E22A 3PEWA 3RUAA 1CQWA 1RP7A 1VBKA 4L7QA 4D9IA 3IHLA 1V11A 2MSKA 4XVQA 4YECA 5DI9A 1CJKC 3UQYS 2VJMB 3CB4A 3UWDA 2FGJA 1CUAA 1RWXA 2J5KA 4O4HF 1FDTA 1TT5B 1ZLXA 1G64A 4YP7A 3KZNA 1V5FA 2C4WA 1EZZA 3Q1KA 4O1IA 1WQ1R 5T41A 5BWNA 4Y8VA 4XD2A 1K2VN 2XITA 1BG6A 2G9VA 4WADA 1H4SA 3AIOA 3H5OA 5FFMA 5LP6C 1MRNA 2AZTA 4YCAA 5D3QA 1A72A 1QHFA 1U3VA 2NT3A 2XUZA 5IARA 4XB6B 1YOBA 4JYBA 1YZ3A 1KERA 1NN3A 1PT9A 1G8AA 1RQLA 3NHMA 4M7PA 4PLPA 5BSEA 1TZMA 2F00A 4PV7A 1P6UA 1Z4QA 3OIWA 4JL5A 3TM4A 2Q1XA 4MRNA 1MP0A 3WL8A 3FTEA 3KLMX 3KWLA 1TPZA 1W34A 5A3SA 4UBOA 3FUXA 3UG7A 1NP6A 3GPIA 3VVCA 4LNUB 1XVLA 2Q2WA 4B48A 1P1IA 5EIHA 1HDGO 5DHFA 2LGJA 3OQBA 1KEVA 1XMSA 3SIPA 4TN5A 2HKIA 4HC4A 4XFJA 1GOTA 4GPEA 2C7VA 4E1VA 1JKJA 3M82A 4BVHA 4QTXA 1ZY2A 3FNFA 4NCBA 3ONWA 3LS2A 4HB0A 2V7EA 3CT6A 1AHNA 4X1OA 3W5BA 4CTKA 3JYLA 4R1SA 2VLIA 1AZTA 2D5LA 3EHEA 3BIFA 3GLSA 4TROA 1CZOA 3LI2A 1NMXA 3RYHA 4FUTA 4ALMA 4EEXA 4ATNA 1ZX1A 4QPCA 4YRQA 4N5MA 1XDUA 1HBJA 3V4VB 3ZQ4A 1BQ3A 1SG6A 4QG7A 3OOJA 5EJEA 2YV3A 3SI7A 2PO5A 4ZVRA 3BFJA 3N2KA 3PUZA 3ASUA 5J4YA 2YS7A 1N5LA 1BJKA 3C6MA 3O8OA 4G1UC 2FX5A 1UKEA 1Z6TA 2YRFA 3WGOA 1BXKA 4B17A 5K8LA 3GZNB 3NJRA 4B8ZA 4TWAA 2Z5GA 3HFGA 3B9PA 3UT0A 1O97C 5DW3A 5J40A 3AOEC 5JU6A 1E2BA 4TVKA 4NCNA 2PJUA 3ZWPA 1SBCA 1MXFA 3CUYA 4MQEB 4R1MA 4TMFA 5A4AA 3HWSA 1Q1QA 2I6FA 1A77A 3LPCA 3SF8B 4RSHA 5LC1A 1CE8B 4WOPA 1BHJA 2HQBA 4X7BA 2QPAA 1W4LA 3K0EA 3V97A 1RPJA 4GBED 2PLFA 3EC1A 4EYKA 2UVQA 4S2UA 4H0NA 3KKZA 4DJAA 2D8MA 4PG4A 3WDLA 1BXZA 4OU4A 1S89A 4BP1A 2JLUA 3CE6A 1PQYA 2BTEA 4WCFB 3W06A 4DSNA 1IOWA 2XAAA 1AV7A 2Z4RA 3JY6A 4AO8A 4LDQA 5C32A 5I3ZA 4EW3A 3U44B 1NZJA 1E18A 2VHJA 3DM5A 3NV7A 4QUIA 3U7IA 4C0LA 4JJZA 2P1ZA 3G7UA 4D9BA 2FAXA 4BY9E 5EJ7A 5KUTA 3UHFA 4JLKA 5EFOA 4C22A 2G28A 1KI1A 3MSXA 5JQGA 1PW7A 3BFXA 3D3NA 3LUHA 4G1FA 4KR7A 3OVMA 4LXUA 4CF6A 3V7FA 2IH5A 1UBOS 2PZFA 4ZO7A 4DUGD 2VQSA 4JZYA 4KW7A 1IVSA 3T0IA 4IJMA 1JHRA 4ACAA 5LPNA 2IXDA 1OIXA 1UEJA 3ROPA 1FLNA 5KYYB 3T15A 3O73A 2AZ4A 1PR6A 4Y2YA 4ZI5A 2A1UB 4KXYA 1CJSA 1KDVA 3W7VA 1X7WA 3QTLA 3IP6A 1Q6YA 3R3VA 1IJFA 3AHJA 4KVGA 5MN4A 3MUOA 3T7JA 3OTWA 3FBWA 3DNFA 2A5JA 1XYGA 1ECPA 1QYDA 4HMQA 1PSZA 5B58T 4V1CB 1C0KA 4M9SA 1YU6A 2R4TA 1VMEA 5FJIA 1KDPA 4KK4A 3N86A 1F2VA 2X77A 3GDWA 3P0JA 4RL4A 5LZ7A 1WXXA 3PHBE 1ZNYA 4IRXA 2EDAA 3FOFC 1JDPA 4U2EA 3I3OA 1CF2O 1TK9A 4GP7A 3I6BA 1W85B 2FZVA 4QUHA 2GD1O 1P0QA 2BFEB 3JVEA 3RBAA 4C0KA 2XQIA 3UVEA 3IQZA 5BV1A 4R2MA 2ARKA 1WB6A 3WFIA 1EKXA 2NX2A 2QQEA 3ONVA 1M1UA 1U0NA 3JQPA 3OZTA 1D9XA 3GUHA 3UGJA 3CZMA 5IDXA 3VAAA 2WHQA 5CDSA 4MI3A 1Z6GA 2AL7A 4RWZA 1GR1A 5GM2A 4MJ3A 1RU3A 4BVEA 1CZLA 4PN7A 5HHTA 1QQAA 1J4AA 1KO4A 1RRVA 3N8IA 3NPMA 2NYVA 2P8JA 3PUWA 3Q1LA 4UEQA 1SHZA 4NEQA 4Q7QA 3H1BA 2VHCA 4A5OA 5JH7F 1KAOA 1RVV1 2VAMA 2EBUA 1EB8A 2BFCB 1S02A 4P3XA 1Z0AA 2JGDA 1MO2A 4ZOCA 5KB3A 3VNUA 3LLVA 2RD2A 3QELA 4NG4A 3URMA 2OHGA 1EM8A 2QG6A 4W6ZA 2I87A 1FUUA 5BV2P 1S3IA 1ZU4A 4Z0HO 5JXJA 1Y3FE 4GQIA 4MUFA 2FSPA 2NXNA 4LZLA 2A0WA 4GM0A 1FX0B 3G2IA 4QOIA 1O7JA 2ZT8A 4LYJA 1M5UA 5I7AA 2I3DA 4H4DA 4NFSA 1U2ZA 4DSZA 1L4HA 2Z57A 2ZOSA 1RHMA 1XLTA 1E1QD 4ND4A 4F1KA 2FZEA 2CE7A 3WBBA 5TF4A 5C8ZA 3B89A 3UV6A 3LH5A 3W77A 4DLZA 1J00A 4TRNA 5KTYA 2Y0BA 4Q3OA 1W75A 3GRUA 4IAOA 1C2YA 4GXRA 4YYZA 2NMVA 3FOWA 3G85A 2L82A 4X1KB 2PR2A 5J2UB 2L2QA 4XYEA 3AEKB 1Z4KA 1OFGA 4PYLA 2VNJA 2XWBF 3ZIUA 1RZRD 1N3YA 2J87A 4CT5A 2O1SA 4P34A 5KKCA 1GZHB 3AHHA 3HZOA 5IUJC 5KVVA 1P60A 3E03A 2FFAA 5CM8B 1U1EA 4TOIA 1GUZA 2LR0A 4QYXA 2G9ZA 1FXWA 1VJTA 4M0CA 5DBHX 4URZR 3FDIA 3URKA 2Y93A 1BFKA 4H0CA 1SHUX 2HBYA 4GS5A 1YE3A 4JYCA 1FFHA 3D4NA 2NN3C 4UJ3A 1APBA 5LXTF 2Q2OA 3BRWA 2WIJA 1CERA 4HFJA 5AJTA 5BRNA 3IAS1 1L7OA 2XTZA 2I8AA 3E8XA 2QAGB 5CIQA 1E8MA 3LQFA 3L7AA 2HA6A 1H1DA 1T25A 1XZPA 1MIHA 2IXAA 4MQFA 3Q9LA 4JEHA 5IAGA 4A91A 1SAYA 4Q15A 5CFOA 2TECE 1FXUA 3JQGA 1SULA 2J5BA 1KSHA 3WSVA 5TGDA 4NNPA 1F8FA 2IX3A 3T0GA 4BKMA 1RXEA 1KDTA 1JQ5A 5L7TA 1C29B 3TPFA 2IELA 3L7JA 4LFBB 3S1SA 3PFHA 1VRCA 1MB4A 3EEBA 1RRGA 2FG5A 3G0BA 3JZIA 4L0DA 3WK8A 4BNZA 1U2GC 2Q27A 4P08A 4QBFA 3KYCB 5AK4A 4CVNA 5F9FA 1YFJA 4HYQA 4BNLA 2JHFA 3T6KA 3K53A 1WZCA 1H93A 3CCCA 3FMGA 3LL7A 3Q5GA 4NV3A 1W96A 4C21A 3HBFA 4UFOA 1OGJA 1KWKA 2ZRDA 1XTZA 5DIZA 1PS8A 5C34B 1QIKA 1ZCBA 3H5AA 3ENVA 4JR1A 4M0MA 4MQUA 4U7WA 5DGTA 3GXBA 1BOFA 3SFVA 1QCCA 1KVQA 5E4TA 3WQBA 1O3YA 5C5CA 4CDRA 3KR1A 4J1TC 1PR3A 2P4EA 4O6VA 3TNDA 3FNRA 2IGTA 4BO2A 4FOSA 4RK6A 1E6WA 5ESRA 5EZYB 3DTVA 5BURA 3OZDA 3FCSB 3OY7A 1S3FA 1VLVA 3DZCA 1A82A 1QH9A 1ZVVA 1GL7A 1MC5A 1FOEB 1XKLA 3PKJA 5DFAA 3IUMA 3S81A 2Z08A 4B74A 4A03A 2O1XA 4ZI7F 4CKWA 1KEZA 3ENKA 3HRHA 3CEJA 5AM5A 5HEKA 3BWXA 5C8YA 1G3RA 5JD3A 5LKRA 1CJBA 3GC6A 1Q77A 3VHRA 3H8WA 2HO5A 4CWAA 1XMOB 4HDSA 1PGOA 2DUNA 2XVYA 5HKAA 1ADBA 3DFMA 2XDQB 4LSWA 4R8RA 3D6HA 3FNEA 5TPZA 3G8YA 2IUUA 4BMXA 5JARA 3OQIA 3QE2A 5U9CA 2IFTA 3OFSA 4UFPA 3QK7A 3UK7A 2B1RA 1JAIA 2NAPA 3FJYA 4FHDA 3DE7X 3FOAA 4FS3A 1P7CA 2V6GA 3CMMA 5MF6A 4CKEA 3PUIA 5DBOA 5L6MB 4INOA 1IN1A 1MKYA 5CB8A 1JEOA 3QVTA 3WWCA 1G8KA 3LHKA 3U7GA 4BLRA 1MJGM 1U7TA 1V6CA 1WZIA 3NTOA 1AB6A 2QN2A 2Y68A 3FVRA 1Q74A 3LQRA 3LX5A 1V1MA 4PLZA 1CIVA 1E4YA 3B6MA 1E1CA 1VXRA 1W9MA 1H2YA 2B36A 1OYYA 2AK2A 2ZAGA 1J0EA 2YVKA 3CRMA 4RSMA 2DETA 1XRPA 1T15A 1I4LD 1Z0JA 2GPBA 4EPRA 7YASA 1TF7A 5I4BA 4JP8A 3ABSB 3N05A 4GI7A 3TZHA 3H9EO 1E1QA 4B8WA 5HXAA 3O2JA 4MWSA 5IDVA 4LSMA 2CXQA 2R8XA 2BFWA 2X7HA 2OK8A 4EMBA 1A27A 2CWDA 3G9UA 1T0BA 2P9TA 1J2UA 5T3UA 3UWOA 4L5BA 8ATCA 1FIUA 2YXNA 4M6WB 1YIAA 2W6ZA 2AQHA 4ZJPA 4AJNA 1RZRA 2FK8A 2A2ZA 3BD7A 2OBFA 1JB1A 5GQSA 1JFVA 1R27A 3T7CA 3FYUC 3ZH9B 3AY7A 3LXXA 4U6QA 3R7BA 4Q05A 2YXPX 4ETIA 1OWOA 3MA0A 1MIOA 3PRKE 4LWQA 5A4IS 3F6YA 2NVWA 4FQ8A 4KQFA 5HIJA 3STTA 1RAEA 3PXCX 4WXMA 2VDKB 3QE0A 1RZUA 2J3LA 2PL1A 1QO9A 3IUYA 4EHAA 3FVQA 3KRTA 1KRWA 3WP0A 3K0AB 4CLRB 1VB3A 5A4JA 1RLIA 1E0DA 2XVXA 4AJ4A 4AYTA 5LMZA 3GH1A 3UJ9A 2PWBA 3DBIA 4M9RA 1B0PA 1QC5A 1VCOA 1TQ8A 2X9GA 2XRFA 1IATA 3OECA 3SC2B 4YCCA 4ARCA 4A2CA 5IUKC 5FA8A 1CULC 3EA0A 3IP8A 4YYEA 3OJLA 4QDUA 2YX1A 2PKYX 4LX0A 1T1JA 1XAIA 3AQIA 3AUFA 3UM9A 3DGFC 2J3DA 4W1RA 3HXQA 1VL2A 2NZUG 2K2WA 3T3MB 1W36C 3V80A 1KMMA 1WMSA 3L7CA 1MHTA 3H11A 1D2GA 3EEFA 5JCOA 4O0LA 1E2KA 4DDKA 4TV9A 2A78A 2FUG6 3DXZA 4HLQB 2JKYA 2C9MA 4J90A 1W2HA 2BUBA 2CLOB 2P9YA 3L0IB 3M1IA 2CT8A 1NW8A 1YO6A 3VC3A 1NL3A 2C4TA 2J8ZA 2D0DA 3RBVA 1J22A 5CXSA 1M1YB 1PNRA 2IRWA 3BREA 4CDGA 2JBHA 2L17A 4R81A 4LF5B 2A7XA 2NSJA 2FB9A 2BFAA 5IJXA 5F52A 5CT5A 4QULA 4CCSA 4L5AA 1WVMA 2LCQA 2GPWA 2DFKB 2WC1A 2O4CA 3MJRA 1L7AA 3CMCO 2R6FA 4B3SB 3JQFA 4KGDA 1F0NA 1YC5A 4DIMA 1SCKA 3FDXA 2XB8A 1EG2A 1W5FA 1OAOA 2DBYA 4C4OA 5LLSA 3VTKA 4WIAA 3ZDAA 4G1VA 4TWBA 3WP1B 1F6DA 3QU7A 4KYIB 3NBFA 1S3GA 1CSEE 2I7XA 2V3WA 4ANFA 5IYZA 3MERA 3FY4A 4K8OA 3W0LB 5JNRA 1EVKA 4ZT3A 1A50B 1RMQA 3EGDB 1RJEA 1T2AA 3PC3A 3K9FC 3COJA 1M6VB 3KQQA 5AW7A 1RWMA 2B7CA 4X7PA 2ATIA 2BDUA 3Q98A 3H42B 4V02A 4AL4A 2XMPA 1XYYA 3IEPA 2BFNA 4GOOD 3DUWA 4KXXA 4RK5A 5K3CA 3TL3A 1JV2B 2B5VA 2WNHA 4YUXA 4OSOA 1GLNA 4CLDA 5I01A 2C94A 1E5TA 1GXSB 2QTAA 4MVJD 3ONNA 2HA0A 2QNRA 3AKDA 4BLTA 2CJXA 1VIMA 2OKCA 2FNAA 3BD8A 2JJYA 1E7MA 1FFXB 1U1DA 4BKUA 2V65A 1MJNA 5E6SA 4WI1A 2E89A 3EULA 2Y1WA 4NZNA 3MMSA 2QDKA 4FUQA 1NPYA 5BOSB 1OFTA 3Q7IA 4R01A 4ITVA 3VR4A 3TIXB 1TYBE