1D07A

Hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis ut26 with 1,3-propanediol, a product of debromidation of dibrompropane, at 2.0a resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
293
structure length
293
Chain Sequence
GAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HALOALKANE DEHALOGENASE
publication title Crystal structure of the haloalkane dehalogenase from Sphingomonas paucimobilis UT26.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
total genus 113
structure length 293
sequence length 293
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 1999-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1d07A00
2VT6A 2O7RA 2OQIA 3E4DA 1SCKA 3LS2A 4W9RA 5C81A 1VE6A 3L1HA 4HAIA 1X70A 1DX4A 4B81A 1XZLA 1MN6A 1RWQA 4KE7A 2ACEA 4L3WA 3WKDA 5AKKA 2CMFA 1U8EA 4X71A 2XUHA 3FLBA 4AB1A 3AFIA 3WJ2A 2WG0A 1XRRA 5AIAA 1H2YA 4TGLA 5HF8A 3D2AA 5HQ3B 5HFAA 3DYIA 2PKYX 4JEIA 4WY8A 4AN0A 4AX4A 5D6OA 2VSQA 4ARAA 2HA3A 4Q3OA 1DQZA 3IUQA 4BAUA 2RAUA 3LIIA 3WZMA 1YCDA 5EHQA 1GZ7A 2WKWA 1X2EA 1Q84A 2PUHA 2BFNA 4IH1A 5EIAA 2Y6UA 5CH5A 1GXSA 1XZFA 3E1GA 5IH7A 4LYDA 1AQLA 2OXEA 4Q34A 5IVDA 1JJBA 1CLEA 2FJPA 5AH0A 3FNBA 5EFZA 4UFOA 4Y2QA 2CZQA 2XLBA 1UZAA 1JMYA 1UKCA 1TIBA 4U2GA 2WUGA 3CCBA 3STVA 3WA6A 3R3YA 2QUAA 3I6YA 2HL6A 5LKRA 5HKBA 3W05A 1H23A 2PM8A 2VA9A 3O0DA 2WIJA 4OPMA 1Q83A 2GBFA 2GBIA 2XDWA 2V9ZA 4E11A 4Y2RA 2Z8XA 5AK4A 2CKMA 1YB7A 5DTJA 5DNVA 3ILSA 3MVEA 1QIGA 4E14A 1H2ZA 4BB0A 2ONCA 4KACA 5KBYA 2DHCA 2JGKA 3AIOA 4TPKA 3D4LA 1F8UA 3O4GA 5CT4A 3L1JA 5LIPA 2PSJA 5ALJA 1K6EA 3NGMA 2JEYA 1T4MA 1SCIA 1ZD4A 1E3QA 2DQYA 4Q05A 5CXXA 5AKJA 1XQXA 3OC0A 1G66A 4FLMA 5A7GA 5JASA 3RK4A 3AJAA 1ORVA 2OAGA 4D9JA 1ZI6A 5C7YA 1X2BA 5DNWA 3DOIA 1GPNA 1THTA 4DGQA 3HACA 5AM2A 4MEAA 5ALSA 5CT6A 1TCAA 1IZ8A 3GBSA 4GW3A 4GWLA 4EUSA 2GBGA 1TK3A 4CG1A 4GEGA 3OG9A 3X3HA 4QDTA 4KAAA 5JAUA 4F5ZA 3IUMA 4Q1VA 1JU4A 4XJVA 1CUGA 2ZJ6A 1P0PA 2HA7A 1XKLA 5H3HA 1EDBA 1ZJ4A 1U65A 5FP0A 1UXOA 4JYPA 2PUJA 1QJ4A 1LBTA 3D7RA 1VLQA 3RM3A 5FDFA 5HK9A 1BE0A 4OYYA 3H2IA 4LXHA 1GPKA 2PSEA 3D0KA 2JBWA 3I1IA 4OU5A 5EIHA 4FFWA 1BEZA 2G63A 5AIBA 4OSEA 1QIMA 4H7EA 3WL5A 4HXGA 4EZIA 4HVTA 2J3DA 2OCGA 5JZSA 3QPAA 4QDOA 4AN1A 1R9MA 4HTAA 2WIFA 1EH5A 4Z49A 4WCVA 4I3FA 1QO7A 5ALTA 1EK2A 2Y6VA 4UBIA 3MGAA 2ES4A 4G5XA 1F0NA 2D5LA 3N0TA 3QMVA 3FVTA 2XT0A 2C5GA 2AJBA 1BN6A 4J0HA 2PSFA 1EVQA 3FWHA 3WIOA 3WL7A 4I4CA 2ROQA 3SWWA 1ZGBA 4G8BA 1L7RA 4YX9A 3BF8A 1XLVA 2AJDA 1J2EA 1QO9A 3G02A 2BGRA 1ODSA 1XZCA 2ZJ7A 1DT5A 4X6UA 5E4JA 4H7DA 5CBKA 1EDEA 3R3VA 1XZHA 4P93A 4X94A 1MX9A 5DWDA 4EB0A 3GELA 2RHTA 3IURA 1CUYA 3HSSA 4MYDA 3C5VA 3ESBA 4X7BA 5JAPA 2QT9A 3PF8A 4YPVA 4MWSA 3EBLA 1CIJA 1LZKA 2XMDA 3R41A 4XX1A 2JF0A 2ZSIA 5AKLA 2WQZA 3HZOA 3FYUB 1ZD2P 3DKRA 4AZ0A 5ALHA 1XKTA 1XROA 2J4CA 3BDIA 3F96A 3T52A 3I6ZA 4BYMA 5BOVA 1CPYA 1XLUA 2XQFA 3EIOA 1FFAA 2HU8A 1YA8A 2QZPA 4OB6A 1MT3A 3ESAA 3H17A 1C7IA 2WIGA 1VZ2A 4C4ZA 4UBLA 2O2IA 4CG2A 3AIKA 4G1FA 4KE6A 4QLAA 2W22A 1R4ZA 3ZWQA 2XQGA 3C45A 4B7ZA 1IUNA 2XQIA 4C89A 1XZDA 3PUHA 2QXTA 4FMPA 2VEOA 3R3ZA 4J0IA 1BEEA 5DYTA 4FBLA 3BIXA 3ZLVA 1TQHA 3L1IA 1H2XA 4AZ3A 5IVHA 5K3BA 2E3JA 5J3JA 3JWEA 5AM0A 4DNPA 4OCZA 5AKXA 2PU7A 4CI9A 2XB6A 1QLWA 5FOQA 5AI4A 4ZWNA 3O9MA 2BAGA 4UHEA 1BRTA 1LPNA 1DT3A 1UOQA 1ODCA 3VVLA 4EY4A 4B82A 1XZGA 3DCNA 1OCEA 4B80A 2QKYA 4HZGA 1P0MA 1R88A 3QITA 3HJUA 1EINA 1J06A 1LPBB 2ZJFA 4XVCA 3F8SA 4FLEA 3WWOA 4Y2JA 5JATA 1W75A 5AKHA 1ZJ5A 2VAVA 2BCEA 4B0OA 3KD2A 4FLFA 5ALZA 5IVIA 1WCYA 4Y2SA 5ALQA 4GLBA 2QVBA 1UT6A 2ZYIA 2YYSA 4BDTA 3FOBA 2XUJA 1LZLA 1XQWA 4EBBA 3QMWA 1LGYA 4X95A 5CT5A 1YAHA 3SC2A 1LPPA 5ALRA 3H2GA 3ANSA 2OGZA 2XLCA 4AQDA 4X91A 2ZVDA 3VJMA 3H2HA 1CUHA 1FFDA 2FUKA 3EQ8A 4LYEA 5AM1A 3STWA 2AJCA 2Y2UA 4BRZA 5ISMA 4LXIA 3IDAA 4PW0A 5AKIA 5DTIA 1WPRA 3F97A 1N8SA 4DNFA 1CUEA 3FYTA 1ZIYA 3CN9A 4QDUA 4AXBA 5A71A 4CG3A 4UHFA 3G9UA 3LCRA 1ODTC 3OURA 1SCQA 4H77A 3NUZA 3W06A 3D59A 4PSDA 3IULA 2DQZA 2WHPB 3DDUA 1CQZA 5HQ3A 2X76A 2XQKA 3WWCA 1RP1A 2HFKA 2O7VA 3AZPA 1YB6A 1Y7IA 1DWPA 3A2LA 4IHAA 4J0DA 5F4ZA 3C8HA 4UHHA 2CJPA 4NS4A 3C70A 2JGIA 1Q0RA 1R50A 2V97A 5A7FA 3IUNA 3PFBA 5AI6A 5K3CA 3HLKA 4UBNA 3HXKA 2QJWA 4GI1A 2RGUA 4OB8A 5K3DA 2V98A 1SOMA 3BE8A 4ZRDA 1LBSA 4BCBA 5ALIA 1GQSA 4P92A 5T4BA 1UK6A 2VQ6A 3IVMA 3FCXA 3ESDA 3B3QA 4GHWA 2R8BA 4BTVA 2VJAA 2WUFA 1E5TA 4B9AA 2B4KA 4K6KA 3ANTA 1CUWA 3D2BA 2OQVA 4PO3X 5ALWA 4YASA 4N8EA 1EK1A 5EI5A 4G4IA 1BROA 5AKYA 4X6XA 3WK5A 2XUGA 3HI4A 4B0PA 3DJYA 1A8UA 2HA6A 4UBOA 4EY8A 1YS2X 5LZ9A 2YXPX 4ROTA 4A23A 1UFOA 3ICVA 3OPMA 3R3WA 4U2CA 4C01A 1XZEA 4QA9A 1B41A 3DL7A 1QTIA 3QYJA 3G7NA 1JJIA 1UOOA 2JGLA 4J0GA 4LXGA 3I2KA 1MX5A 2C58A 2QTBA 1PV1A 3KWFA 4CIAA 5FLKA 4Y2PA 3W9BA 4BRSA 5FXMA 4L72A 3IB3A 3LLCA 5HFNA 1W6RA 3FBWA 1IUPA 3G0CA 1C4XA 4KAJA 3IUJA 4J3JA 5E2IA 2WM2A 3BJMA 5E4YA 3GFFA 3N2ZB 2HADA 2ECFA 1PJAA 4BBZA 5AKZA 1QGED 1LLFA 4FTWA 1EDDA 2IX9A 5ALYA 5AK5A 2GZRA 1USWA 2HDWA 1TRHA 5A2GA 4J0CA 4V2IA 2C7BA 4BVLA 3FSGD 4BP8A 2VJDA 4KYVA 3V1KA 2QRUA 3B5EA 1QE3A 4Q3KA 5D3KA 1CUAA 2VJCA 1E8NA 1YAJA 1K4YA 1Z68A 3BL8A 5A7HA 5CH8A 1AMNA 4ZI5A 2JEZA 2WTMA 4J7AA 1VE7A 1TAHA 3V48A 5AM3A 4ITVA 1JT2A 2PSDA 1AURA 4G9EA 3DLTA 1QIIA 5ALGA 4H7FA 1DX6A 3C6ZA 1MAHA 4WDQA 1XFDA 4EA6A 4AMZA 1KEZA 4G8CA 4TVKA 3HEAA 2PL5A 1HL7A 4UHDA 2G5PA 1J07A 1GKLA 5JANA 1K8QA 3R3UA 3Q8WA 2GYUA 3IA2A 1CVLA 4PSCA 1QZ3A 3G0GA 3IIIA 3QZUA 5K3FB 3ICWA 2WJ3A 4G9GA 2UZ0A 5FUMA 1A8QA 3KSRA 2ZYSA 2XMGA 2H9YA 3UUEA 5JZ9A 1JMKC 4BTLA 2XE4A 3JW8A 3ZI7A 3A2NA 4UFNA 4BE4A 2WU3A 4F60A 2DHEA 2GBCA 3RLIA 2PSHA 4E15A 3WZLA 3A6ZA 3W04A 2OLEA 2WFLA 4DSZA 2BKLA 4CFSA 1FFEA 1XZJA 5LZ2A 1MJ5A 5I7UA 1GQRA 2XMBA 2I78A 4FNGA 2DHDA 1FFBA 1H22A 3D5EA 3TGLA 5DYWA 2HHAA 3AZOA 2BGNA 3ZPXA 5AP9A 2GYVA 3CCCA 1XLWA 1XRQA 4I19A 3STXA 5AKEA 5DYYA 1VOTA 4OU4A 3PDCA 5HZGA 4BAGA 5EHZA 2XMSA 3FYUC 3PFCA 5C8VA 4P08A 2VATA 3GROA 5I9IA 4HRXA 4RPCA 5CT9A 5AKGA 2JIDA 1R3DA 4N8DA 3VJLA 2ACKA 3QH4A 3FYUA 4KRYA 1VZ3A 5AM4A 2WFLB 2QJRA 1DWQA 3R40A 1MAAA 3WIBA 4X00A 5AO9A 4JNCA 2YH2A 3I6MA 4S0XA 5JYCA 2JGMA 1XRPA 1B6GA 1CUZA 3NOXA 3GUUA 1MX1A 1Y7HA 1YASA 3F67A 5LLSA 3BIWA 3I2IA 3H1BA 5JIBA 1AC5A 2QXUA 1JU3A 5JAHA 2QS9A 1QFSA 3HC7A 2QUBA 3HRHA 2CBGA 4UPDA 5T4HA 1ZI8A 2V96A 5FRDA 2WLSA 4E46A 4QDZA 1BCRA 2EDCA 1RYYA 2OGSA 3DQZA 5EHNA 5HCUA 1CEXA 2WFZA 1ACJA 5HF9A 2XUDA 3AUKA 4H18A 2RHWA 3STYA 4L0CA 2BUBA 1C7JA 2AJLI 3BF7A 4MJ3A 1CRLA 1VXOA 1BN7A 2J4FA 1FFCA 2HM7A 3G9ZA 2OCKA 4N5IX 4W1SA 3TEJA 3BWXA 4MQMA 1DINA 3O4JA 3F98A 5YASA 5HKAA 2H7XA 1E8MA 3KOOA 4OD0A 2XMRA 1QFMA 5D3ZA 2W6CX 2WTNA 1UOPA 5IVKA 5LP1A 4HXEB 3DYVA 5IKXA 4UUQA 1U2EA 2DR0A 4KJXA 5CURA 5BV7A 2OCLA 1G42A 3T4UA 4BATA 4Y2VA 3WK9A 1FJ2A 1MTZA 1W1IA 2O2HA 4UHBA 3NWOA 2JGJA 1LPSA 1YSCA 3WKBA 4CCYA 4YK7A 5CW2A 4UHCA 3KWJA 2WG1A 1VKHA 1GKKA 2C0QA 2O2GA 2XUAA 4P9NA 5AI8A 1AGYA 5AM5A 3VDXA 1L7AA 3M83A 3UMJA 2HU7A 3R0VA 2IITA 3OOSA 3EF3A 1QONA 3U0VA 3DEAA 3EQ7A 4QWMA 2XUQA 3WWEA 3E3AA 1KU0A 4DTCA 4ETWA 5I8PA 1ORWA 5EGNA 4MYSA 1Q0ZA 3C8DA 2WHRA 4J03A 4BC1A 3PICA 4X85A 2VJBA 1QIFA 1N5MA 4AO6A 5FKJA 4OUKX 4EY5A 1EVEA 3HYSA 1HBJA 4CCYB 3WWDA 3EQ9A 1WOMA 2JGEA 2B20A 3SX4A 1OXMA 3G8YA 4CIBA 3WK7A 5T4EA 5KWIA 2X5XA 2WHPA 4BCDA 1WHSA 3O4HA 3BDVA 1ZD5A 2QM0A 4IQ4A 3MUOA 1M33A 4QWWA 3V1MA 5LKAA 3WKAA 3I1YA 4Q82A 4Y9SA 3MUNA 1BU8A 1W52X 2CUTA 5ALUA 3RKSA 3D3NA 3YASA 1MPXA 3QPDA 4FNMA 4PF1A 3STUA 3C5WP 4H7IA 5A62A 5AJHA 2VAXA 1TKRA 3BXPA 3S8YA 2HU5A 5AOBA 5CT8A 4DMCA 1NX9A 3OTQA 4WY5A 1EX9A 3C6YA 1D07A 1XRLA 4BVKA 1IVYA 4OYLA 1E8DA 1WM1A 1LPAB 1L7QA 2WIDA 4O08A 5JD4A 1ZIXA 1CUDA 3W9UA 5AICA 2LIPA 4X3CA 4W1QA 4U2FA 4J0JA 1XZMA 1O6GA 4UBJA 1VA5A 1XRMA 4LIPD 4KE8A 3WK6A 4U2DA 1MU0A 2HIHA 1N1MA 4DMFA 2VF2A 4LHEA 3JYHA 4WFKA 5ALMA 5ALPA 4UFPA 5JZBA 4C87A 3VVMA 5CH3A 3WKCA 4C6HA 2ZYHA 1HKHA 1ZGCA 1LPMA 1DWOA 2C4HA 5JALA 1TCCA 3O9VA 4NMWA 1ZD3A 3K6KA 1CUFA 5K3EA 2WHQA 1TCBA 1UKAA 2PU5A 4DLNA 4XWGA 1XQVA 4X93A 5ALOA 3I2FA 2HRQA 5CMLA 3WK8A 1R9NA 1U4NA 5LZ8A 1N5RA 1IZ7A 5KREA 3ZLTA 2XQJA 5FPQA 3UUFA 4UBMA 2WJ6A 3C43A 1DQYA 1T2NA 5LZ7A 4Y2UA 2XUPA 1H2WA 1CUVA 4IH9A 4NVRA 3WYDA 1S8OA 1O6FA 2CB9A 3CN7A 1DTEA 1K63A 1CQWA 5FV4A 2WG2A 4G4JA 2G5TA 3BJRA 4HS9A 1P0IA 4ZGBA 1BCSA 2B61A 2HFJA 5LYYA 4Y7DA 1GT6A 1AX9A 3FLAA 3AILA 2QOEA 4FWBA 5ALNA 3LP5A 4FBMA 3M3DA 2GYWA 4AO7A 1CR6A 2I3DA 2HA0A 5K5EA 4W1RA 3VKFA 3C6BA 1AKNA 1VA4A 1NU6A 4N5HX 4B85A 4DMHA 4GDMA 2XUIA 1VJ5A 4BVJA 5AHXA 2XUOA 3C87A 2PBLA 4HXFB 1HLGA 3AINA 1F6WA 3PUIA 5K3FA 1EB9A 2AXEA 4M0FA 3H2JA 1GGVA 4L9AA 1GPLA 2D0DA 6YASA 4JUIA 1WB4A 3SK0A 2H7CA 4X6YA 2Z8ZA 1OILA 3M81A 2XI4A 2HA5A 3V1NA 1MNAA 5AK6A 3I2GA 3OM8A 4PV7A 5AI9A 3QVMA 3A2MA 1EB8A 5E4TA 5HF5A 4WFJA 1QIKA 1CUXA 2R11A 2DSNA 3D2CA 4CCWA 5HF6A 4DYHA 3K9BA 2C0PA 3O4IA 5JD5A 1IUOA 3M82A 3AIMA 1CV2A 3WL8A 4M0MA 4INZA 4QNNA 3GZJA 3H04A 4KEAA 4N8SA 1CUIA 5KWJA 3WK4A 4BE9A 1MNQA 5CTAA 2AJ8A 4GBGA 3G9TA 3RARA 4DSAA 3KXPA 1JKMA 4K2AA 1CUSA 1EI9A 4RNCA 5ALEA 2HA2A 5CRIA 1W4LA 4UBKA 3G9XA 3P2MA 1CUJA 4BCCA 3B12A 5AI0A 2XMCA 2ZYRA 1BS9A 4BZZA 4BZWA 1A88A 2RIPA 1UK8A 3S2ZA 1YA4A 4MWTA 4RE5A 4AO8A 2WUDA 1QTRA 2Z5GA 3DKKA 4C88A 4KR0A 4DM7A 1CUUA 3DS8A 1JI3A 2B9VA 4C4YA 1CUCA 4QZVA 7YASA 4H7KA 2DCMA 2WJ4A 4H0CA 1EXWA 2PPLA 3DD5A 3V1LA 1ISPA 4B84A 3TJMA 3GA7A 4EY6A 2JGFA 1ZI9A 3WMRA 2Z3ZA 3PI6A 1VXRA 1K5PA 1UK9A 3HABA 4Y2TA 3F9CA 3QMMA 2XMQA 2H1IA 4B6GA 4QE3A 4EY7A 1WHTA 1KU6A 3LIPA 3E0XA 2RONA 1IMJA 2C5FA 3WYNA 4JH0A 1F0PA 2ORYA 1ACLA 1WPXA 3R3XA 4PSUA 4RGYA 1AUOA 2Z3WA 1J1IA 4FDMA 1XZAA 2NW6A 2ZSHA 1LNSA 4GXNA 1HDEA 1Y37A 1EA5A 4PNZA 1E66A 3V9AA 5JD6A 1CFJA 2WSLA 2GZSA 2I3ZA 1QIJA 5D7BA 1YS1X 2QMQA 5DJ5A 3IBTA 3WQHA 5A6VA 4FOLA 2Y2VA 4KE9A 1THGA 5AOCA 1AZWA 3O95A 2WILA 2RI6A 3H2KA 2WUEA 4ZV9A 2IIVA 2BUAA 4J0KA 3ZLUA 2OG1A 4ARBA 4DIUA 4C4XA 1UK7A 3H18A 4W1PA 2DFPA 3FAKA 4B9EA 2BJHA 1XZIA 4MQLA 4H7JA 2OPHA 1P0QA 5LZ5A 4F0JA 4X92A 4DMKA 1JFRA 2FX5A 3DOHA 4G4GA 2EDAA 2XUFA 4JYMA 1EHYA 4B83A 3WJ1A 4RE6A 1W76A 3WA7A 4F21A 1QIDA 3I28A 4K6GA 3H19A 4WFIA 2FJ0A 2Y1KA 2Q0XA 4DNQA 3AZQA 5SYMA 1XZKA 3WWPA 1ETHA 1PFQA 1WB5A 4BC0A 4FHZA 2QR5A 4GECA 3W2TA 4QLOA 4G8DA 1CUBA 2G4LA 1A8SA 2P8SA 5T4FA 2VTVA 1DU4A 1R1DA 4M0EA 3WKEA 5ALFA 2X8BA 2HRRA 4XIIA 2I03A 4Q3LA 5ALDA 3H1AA 4U2EA 1G4HA 1QIEA 4IO0A 4K5QA 3QM1A 4H7HA 4FFVA 2VT7A 3G0IA 3FCYA 4PQEA 3I2JA 5AI5A 3K2IA 3DL4A 3VXKA 3FVRA 2J3QA 1I6WA 4BDSA 3CXUA 4QEKA 3VISA 2WFMA 2PVSA 4AMYA 1HQDA 5AK3A 5BWCA 1QOZA 3H0CA 2OAEA 3U1TA 1E89A 5C8ZA 3DNMA 3WI7A 3A70A 3I2HA 1HPLA 1ZICA 5DNUA 4KAFA 4WJLA 1XZBA 5BWBA 4IH4A 4OB7A 1NU8A 3G0BA 5ALXA 4EHBA 1ZOIA 1A7UA 4ZV7A 3C6XA 4U2BA 4QDXA 1SFRA 1JJFA 3STTA 5EHXA 3VJKA 4H35A 4W63A 3PE6A 4LKOA 2H7YA 5C8XA 1QIHA 4MEBA 5ALVA 5JADA 3PF9A 2K2QB 2WU4A 4FKBA 4ZREA 1UKBA 2EEPA 4A16A 1XRNA 2XMZA 3QBJA 4MXDA 1UWCA 5JAOA 4Y2XA 5FPPA 3ZV7A 5ALKA 2YASA 5AOAA 2BUCA 1SC9A 5SYNA 4K6HA 3FSGA 3Q0TA 4HRYA 3KDAA 5DLPA 5EIEA 5JARA 3FLEA 2CEKA 1XQYA 3QPCA 2PX6A 1WB6A 4X90A 4X97A 5ESRA 5CXUA 4DNOA 4ZXFA 4A5SA 2OGTA 5K3AA 1YR2A 3G0DA 5ALLA 2OCIA 4Y2YA 3ED1A 4WDRA 5HK8A 1LPOA 3ESCA 4NZZA 4BAZA 3TRDA 4BP9A 1G5FA 2HA4A 3WLAA 2XUKA 2WIKA 1FSSA 5LZ4A 1MO2A 3WL6A 4KRXA
chains in the Genus database with same CATH superfamily
1ODLA 2IBTA 1QYRA 2AEJA 4PSKA 4EHNA 5C1PA 5EQTA 1NA5A 2HF7A 1WP4A 5C81A 1OYYA 3BREA 2HEGA 2B3TA 1T5OA 1BH6A 1XG5A 2OFXA 2CLOB 1JTVA 1MENA 3L1HA 4QOGA 4RY9A 5D01A 1XZLA 3O31A 1Q0SA 1A77A 4LWPA 3P4YA 1N3BA 1N9GB 2NVBA 2FETA 3UT5B 1XRJA 4D8UA 4YJFB 2UYHA 1U8EA 1V5IA 5KYYB 5CPBA 4F4IA 4DDUA 3MFYA 3WJ2A 2RHGB 3DZDA 2Q62A 1IRIA 2FPOA 2ZRBA 3ENQA 3L0OA 1IPFA 4PLWA 2CUZA 2FCRA 2R4UA 4LRYA 3Q85A 2IT1A 4XSVA 1Z6YA 4TGLA 4CLRA 1LDEA 1XELA 4JB0A 2QE6A 1MGOA 3EK2A 5ERGB 4BLVA 3AONB 4JJFA 4LF4B 4E09A 2PKCA 4XRRA 4TV8F 5EUMA 3IYLW 4GPEA 4PC1A 4UD2A 4FDLA 2O3SA 1KDYA 2M6KA 4JLAA 4DCCA 2Q1UA 1EIZA 1V8ZA 4CR7A 3VHXB 5IUJC 2VFAA 5A4KA 4CLDA 4KCGA 3IUQA 1TKAA 1PL8A 5HBRA 3F1LA 2I8AA 4ZEXA 1FTSA 2FUG1 2BEVA 3AL2A 4OK5A 4IIHA 1Q21A 4LBWA 1RDFA 5EHQA 5CM9C 1QE5A 4C0LA 3OCYA 1SBIA 1TPYA 1RHKA 2PO5A 1D2GA 3ADOA 2YZ2A 3WMXA 4ZIRA 5MN6A 1O0BA 5KQRA 2BFNA 3OEEA 3I1JA 1FS6A 2CJFA 4L6CA 2A3NA 2PHZA 1C4OA 1GXSA 3KDSE 3FZEA 3KVVA 3MCAA 5JI3E 4FGJA 2W90A 1KK0A 4Q1AA 2ZREA 4OHXA 2BISA 2BM0A 2KQUA 5C7OO 1ZGHA 4Z2AA 3KEOA 1EUQA 2OXEA 1LFDB 3D7MA 4OXNA 3T7AA 2J1LA 5AH0A 1M72A 4B3SB 2HO5A 4V0MA 2J0QA 4UFOA 3IP5A 4Y2QA 5KYWB 2XNKA 2G9NA 3QHQA 2GCGA 1SAYA 1UZAA 3ZQ6A 3V4RA 4U2GA 3IIJA 4PGGA 1H1LA 1BHSA 3MS7A 3S6JA 1SOVA 3E9YA 3CCBA 2PSSA 3HKDA 2R0QC 4NARA 1UDAA 1KEWA 1ONOA 3EWNA 1VLLA 2WA2A 4X20B 3R3YA 5ENDA 2QUAA 3GNQA 3OO0A 1RYHA 2WF6A 3B6ZA 4TV8A 3V1YA 3WMGA 3BGSA 4QGAA 5KX5B 2YV2A 3C3BA 1NYLA 1H23A 2FQWA 2QUJA 2VA9A 2ZRGA 4OHZA 3G0OA 3Q8MA 2C92A 1ZRSA 1ONNA 3CZRA 1IDN1 2ZG6A 3PU6A 1D03A 5JEDA 2QTGA 3L1KA 1Q57A 1WW8A 4I1IA 4AYXA 3H75A 1A7JA 4RQTA 4US2R 3EMDA 10MHA 5IJ0A 4RKEA 3K70C 3THXA 1SQ6A 3DHEA 5AK4A 4B7CA 1PK8A 2OD7A 3PHBE 4DR6B 3PEFA 4MV6A 4Q7JB 2H92A 1QDEA 1FOEB 3BT7A 3ILSA 2UVPB 2GPYA 3AY7A 4GPBA 4OOEA 4BHTA 5B30A 5JW6A 3KQKA 3JQGA 3EUFA 4E4TA 3LZ6A 1T5TA 4Z4IA 2H1SA 1GM5A 4BKOA 3ZCQA 2NSDA 2HHJA 2F4NA 4C1NA 5LDDC 1YZNA 2D0PB 1MV5A 3T7IA 4D9BA 3PTZA 4QGSA 4G4SO 3ZWYA 5IDXA 1P5ZB 3U3RA 1IHXA 4KACA 4F1WA 1ZNYA 2XYGA 4X41A 1NVVQ 3PENA 4K9RA 3L06A 4DLPA 2UUCB 1F8UA 2Q2VA 3O4GA 1ZOSA 1M1XB 4ZJPA 3L1JA 5KHAA 1LK7A 2NO0A 5JSZB 3RVBA 5KMGB 5LIPA 1Y5RA 2O2CA 2ZAOA 2ZIGA 3H8JA 5B2ZA 3UH1A 4Q9HA 3QHAA 1VG8A 2QD4A 5FLYA 4AYTA 1KYVA 3VYVA 1QYCA 1XN4A 2FPKA 3V4ZA 4DDWA 5ICCA 1C7RA 1E3QA 5JQWA 2Q3BA 1TUIA 4X62B 2O1XA 3NHSA 3R44A 2DQYA 4TQUS 2QP3A 4OXXA 4RS3A 1VJ0A 1FF9A 5CXXA 3RB8A 4B5LA 1WMEA 3KALA 1XDUA 1XQXA 2PUGA 1T8RA 1G66A 4PN3A 1YHYA 4J1NA 1UQRA 1YI1A 3D6TB 4KYIB 5JASA 2YFYA 3K8ZA 3RK4A 4C78A 4D9JA 1YULA 1IAVA 2FFQA 2NUAB 1P75A 2C1XA 3L41A 5KQSA 1VHWA 3JVDA 1HG1A 1ZMBA 3DMYA 1YL6A 3I83A 2LKDA 3UMSA 2OMKA 3EOBI 3DE1X 4MQ4A 5AW6A 2DPLA 4ZANA 3I2YX 1JEAA 5AM2A 4BUZA 5AOVA 3ENKA 3NYRA 2A5DA 1PSWA 4MEAA 4JFRA 5FYDA 3ZLBA 4I5DA 5IXYA 5KYUB 4AQ7A 2QBYB 1KC1A 1TCAA 3MJDA 4CT5A 3PEYA 1CDDA 3HLTA 1IZ8A 2Q2QA 2PQ2A 2C61A 4PTZA 4FMBB 4RCZA 1C1XA 4EUSA 1TK3A 1F06A 3GLGB 3HKCA 2QRGA 3HP4A 5FL7D 3WRXA 3X3HA 4QDTA 1P1FA 5FNVA 5BSKA 3ABRB 4OQNA 2M6RA 4X1IB 2O0HA 4KO2S 5C5DA 3EPJA 3CVYA 3JX9A 4M6WA 3DWIA 1H6CA 4L8FA 4LYHA 1XDBA 4V38A 1QO0A 3REQB 1CJVC 2ZJ6A 1GZSA 4GM0A 5JNUA 3U7QB 4KXNA 1YQUA 5GGXA 3WV4A 1EXNA 1YVRA 2HA7A 2IXGA 2Q46A 3CT4A 4ZOEA 4ZAYA 3ZVMA 4GMXA 1UC9A 1J5EB 2FX3A 3M6UA 3Q15C 3VH2A 1MXHA 1ZL2A 1ZJ4A 2Q1YA 4KSBA 1QCYA 1W73A 1U65A 2TRSB 3TM4A 4RJTA 5KYXA 5FP0A 4DLKA 3LL7A 1GYQA 1YRWA 4Y98A 4QQ8A 4WCFC 3QX3A 1O7JA 4ERXA 1I6KA 3G6WA 3ZIUA 4BNKA 2V7WA 3ELBA 3C4VA 1Y4DE 1LBTA 3D7RA 3PDHA 4PIPA 5KSYA 1POWA 5ILQA 5HK9A 1UM9B 1BE0A 4MS1A 3U4AA 4G37A 3THSA 1T2EA 5J4VA 2JI4A 2B1QA 2V6JA 4IJUA 3N6XA 2JBHA 2J9RA 3D0KA 4PSVA 1YFLA 2C3OA 4BMNA 1IBMB 1K68A 2AFHB 1IUKA 4UCXA 3RS7A 3I1IA 2FR8C 3V2GA 5LWHA 2NO1A 1FX0A 5EIHA 1M1YB 3D2LA 3F47A 1NW3A 3T7KA 2Z8YM 5K0NA 4DM3A 1KQGA 1V5WA 4IEEA 1QIMA 4UPVA 5CDSA 4EJSC 4H7EA 4P81A 2HD4A 4ARIA 2J3DA 2ZUCA 3TAXA 4DCTA 2DKOA 4NDZA 1EXMA 2JIZD 3PJRA 4C0BA 4QDOA 1UKEA 1C3JA 2ZWOA 4QULA 4DMUB 4N5DA 1WBJB 1BDJA 2NWQA 2YYAA 4XM2A 4M7RA 5CUQA 3ZW9A 3O03A 4J3FA 3FJOA 1HT1E 1V39A 4DCJA 2JA2A 2WIFA 4Z49A 2GPBA 4PHHA 2Q2NA 1N0HA 2JH3A 3G2LA 4F6RB 4MHSA 4OA5A 1AO0A 2EBWA 2J7KA 5H5JA 4FFOA 2R85A 1QO7A 2XAUA 3CLSD 4M9QA 4TS9A 4XFJA 7ABPA 4CXMA 5C80A 3QLUC 3C8ZA 2V7QA 3PLAE 1M66A 4HJXA 2ES4A 3GRAA 1RRVA 3EXEB 3FX2A 4OKNA 5LCXA 4HN2A 3IT2A 4DB4A 3TJRA 5DFAA 3BFKA 2A3RA 4MUXA 1V0JA 4X8HA 4KR9A 1XZ8A 1JKJA 1YBMA 2HPHA 2I4LA 3G1UA 1ISJA 1BN6A 3CGWA 3PNLA 1IZZA 4IXMA 2C5HA 1LRKA 4ZMRA 2PSFA 1D2MA 4O4IF 1XPRA 1SCBA 4G1BA 4HADA 2I4MA 2GXSA 1KS9A 2JKVA 5AJZA 1W35A 3K15A 1A1SA 1O9GA 2OBBA 1QQBA 2M6LA 3WIOA 3DL0A 2Y9MB 4MPPA 5BVHB 1Y8RB 1C50A 1ZKDA 2C83A 3O21A 4K9LA 3JQ7A 1S2GA 1W0KD 3DEYX 4JC5A 1L7RA 4YX9A 5HHTA 4Q4AB 5K8UA 1X1AA 5T3UA 2AJDA 2FPLA 1SHTX 2HK8A 2O6HA 4RYDA 3KB6A 1Z4PX 2NT3A 1VJTA 1KJWA 3BSYA 4UVGA 4XWKA 1NXPA 1J2EA 1SRRA 4BBPA 2I8CA 4HDQB 1JG1A 4CN9A 4JITA 5KIAA 2OK8A 3NH6A 4QELA 4KXVA 5K8IA 2XNDD 3KL2A 1S96A 1DT5A 3P9IA 3ISTA 1H3EA 1SBYA 1CHNA 1KIMA 3LY9A 3LPNA 3SQDA 2CN1A 2HQSA 5CBKA 5FULA 1SBZA 5BQXA 1VI6A 3HA2A 3R3VA 3ADCA 5I5EA 4XDZA 1D3AA 1O4VA 2BR4A 4IW3B 3D4IA 2Y66A 3BSWA 4X94A 4CQNA 4WOCA 4YDQA 3VNVA 1P4GA 1BJRE 4FKMA 5DWDA 2Y1FA 4M1MA 2BL4A 3M4JA 4PNPA 3OECA 2GZDA 4R2XA 3LLMA 1N92A 2PE5A 3IILA 3GELA 1AZLA 2WM8A 3KQQA 2CGEA 4INJA 4L5YA 3V4SA 4RLQA 2EW2A 4QNRA 3ETEA 3OZFA 2H08A 4W5RA 3FDJA 2PKRA 4ZI7A 3DEKA 2X2FA 4MYDA 2QD2A 5B1EA 3I45A 3BTOA 1AHIA 1V48A 1KAHA 1YK1A 4HWPA 2I2BA 3ESBA 3IIEA 3MGKA 4NJMB 2UUPA 4O4IA 3RRJA 2P9BA 2VP5A 4BMVA 2LPMA 5JAPA 4YPVA 3EBLA 4KFUA 1CIJA 3QNUA 2ABWA 2ACVA 1WKBA 4REQA 1EFCA 2BFPA 1RRCA 1FY2A 2OCBA 1PQWA 3EGWA 5BWNA 2QJTA 3IUYA 4GVPA 4TL6A 5E9QA 3DFIA 5AW1A 1VRCA 3EPRA 3EUEA 4L5CA 2X1LA 5AKLA 2WQZA 1BOFA 3CWQA 4KNWA 4RYLA 3ZIAA 2F1HA 3RYHA 1BHO1 2EGUA 1ZD2P 2H4FA 5LC1A 1FFGA 2CCJA 2ILTA 2HIGA 1Z7EA 4IIEA 3BD8A 1GQQA 2RKBA 3R23A 3T99A 3UK7A 4CPDA 2A4KA 3MJ4A 2I2CA 3KV3O 3RSCA 4KN5A 4DIOA 5KTPA 1WDTA 1F51E 1C2YA 1EM8B 3HKBB 3F96A 3T0IA 4TN1A 4I2VA 5TS3A 4V1CB 5IULC 3I6ZA 3MILA 1XQ9A 5LLDA 1CDZA 1VLJA 3FUTA 4FS8A 1NY5A 4ZCLA 1RHRA 1G16A 3L2OB 3L4JA 1ZC4A 1QMPA 1VSUA 2XA2A 3LDAA 4CTMA 1GTRA 2YV4A 4CL2A 1DKOA 3HXTA 4IILA 4WAUA 3QBDA 1NPYA 1QSGA 4AICA 4BQRA 4YRIA 3UJDA 5LA6F 3ZDDA 1JX6A 2O54A 4Z3KA 5FWNA 1M5UA 2QQ0A 3GCDA 3G68A 3L49A 3IQEA 3TRIA 1QQAA 1AKVA 4UNIA 3PFIA 2CE7A 3NXSA 4UBLA 3ZJ4A 4F1KA 1YTUA 1C29B 3AIKA 3MT0A 3UV3A 2BJVA 2I6QA 1G8AA 3NBFA 2H6EA 2XGGA 4HFRA 1R4ZA 1K7FB 1TLLA 3IH5A 3LXRA 5JY6A 5EJ9A 5TRTA 1KBOA 2YL2A 1H9AA 1CJSA 4PX9A 4WN9A 1HWYA 4ZVTA 1T6NA 2EV9A 3C5CA 5E7QA 4LWQA 3PIIA 4J2TA 5ICFA 3ZKWB 2O5EA 4XYBA 2IH2A 1IUNA 2XQIA 2WU0A 4BVBA 2C03A 3G2HA 4C89A 5DP2A 1XUOA 1XZDA 4DHWA 3PUHA 1D2CA 2Q5CA 5E6RA 1NXVA 2R3SA 4GBJA 1XTPA 3MMSA 1M8GA 1JLMA 5DYTA 4ND8A 2QENA 4I3GA 4WRRA 3OLWA 3QBVA 1KKLA 1OAAA 2CY0A 2LGJA 4Q12A 1ZZEA 1XZNA 5FPYA 5GY7A 2NU8B 4LHSA 1NPDA 3SKXA 4UHFA 5E1DA 1TKCA 1V11A 3DDHA 3ZLVA 1ZPDA 3PDJA 3L1IA 1H2XA 3E6AA 3W79A 4FWTA 2Q3FA 1VIYA 3VMFA 1CWUA 1K1EA 4WZBB 4I1PA 2X9NA 3L0DA 4JP5A 3M89A 3ODGA 4A92A 4DNPA 5HGJA 2YBDA 5AKXA 4M9RA 3TXAA 3RC3A 2XB6A 5DHQA 2Q8NA 4RFLA 4CI9A 2R4QA 1KGDA 4BLUA 5AJWA 1AGNA 4UOZA 2BBSA 4QU8A 5I01A 5FOQA 1RJWA 4GM4A 3U81A 3UPUA 1HUQA 6LDHA 5IJZA 4YAEA 1CEYA 1RCTE 4ENQA 5AVSA 5LA6A 3DW3X 1M75A 3LXUX 1Q15A 1LSOA 4WWHA 5TQ2A 2PVPA 2BAGA 4OEHA 2YRWA 1NAHA 1YS9A 4MRNA 4XSHA 1ODCA 3HKEA 4R2KA 2O8CA 3DLAA 3U7JA 1H0RA 1XZGA 4GOXA 4MUYA 4DUGA 1GZ6A 5IZCA 1GAWA 3EEFA 2EZ9A 2NU7A 1OPRA 2CXNA 4HKTA 3RRFA 2OXFA 2PGAA 3I30X 3NTRA 4O5OA 2ZPTX 4CMJA 1R88A 2GDJA 5BVGA 4UM9B 5KYNA 1EINA 1J06A 3RFTA 1QGZA 1AKUA 3R5KA 3ZVKA 4FLEA 2GAJA 1NONA 4IY1A 1N25A 1ZWKA 5DM60 3UC9A 5ICMA 3UGKA 1ZBDA 5IASA 1M5RA 1TZJA 3ZHZA 1E9SA 1WULS 2GTPA 2MSLA 2VDNB 4B0OA 4CJXA 4YP9A 3DMTA 5ALZA 3A1VA 4RVUA 1K9SA 3OFNA 4ARCA 4YJ2F 4HAUA 2W2QA 2JJ8A 4KFSA 5FTNA 3UFXB 4GLBA 1DHTA 2R47A 4KZKA 4ZARA 3SYKA 5F3WB 2ZYIA 1ZFNA 1YB4A 4NMLA 5TC4A 4FT2A 3ZU6A 2XUJA 1TYBE 3LV8A 1VHQA 4P84A 1LRJA 5ADWA 3V2HA 1GZDA 3QMWA 1G21E 5A06A 3BHNA 2BFBA 1JUDA 4JQSA 1HDIA 4WINA 4X61A 2FLKA 2W6JD 1PR5A 1QE0A 4KIUA 2DY1A 1DBPA 4X95A 2DFDA 1J0CA 1AKQA 1X92A 3KTAB 1TJ4A 2CUKA 2IRWA 4QECA 4YRKA 3RIMA 1QDUA 2W6IA 4NESA 2I1QA 4RD1A 3TBKA 5BMVF 4DA7A 2WQ7A 3QX9A 3ANSA 1FTGA 3ER8A 2UDPA 3KTOA 1JH9A 1W49A 5L9AA 1BZYA 1R0YA 2VSXA 3EZLA 2IU4A 3HFJA 3I0ZA 4X91A 4AQDA 2YOGA 3EXG2 3OQBA 2NU9A 3PSAA 2MSDB 1BSVA 2CLSA 5E7MA 1USKA 2GD0A 3H2HA 5LQSA 1OKKD 5KB3A 5MN4A 2YMQA 3C85A 4DBVO 2VXOA 2O2JA 3CNNA 3LX4A 3V7FA 5AM1A 1Z6ZA 3GFOA 3PNSA 2H2HA 3NHJA 2Q9UA 4M22A 4UCQA 5BR8B 4MROA 2QTVB 1I1NA 1JP7A 2JFVA 1SEVA 2FLWA 5J23A 4L9RA 3VR5H 2FAXA 3P0HA 4XZ3A 1SWVA 3H9EO 3IDAA 2H7VA 5DEOA 5AKIA 1WPRA 3F97A 1N8SA 1QH1B 1MAWA 2BR5A 3OEHD 4JJGA 1BC5A 4YJ2A 4BXOB 2LTAA 3I5YA 3OKAA 4KK4A 4PVCA 4E88A 2ZIXA 1N7JA 1R37A 4XPZA 2J8ZA 3QOYA 3AR4A 2W11A 3AVUA 2EERA 3D7SA 1GRVA 4AXBA 3RC8A 3ZC3A 1R0BA 4DLAA 3AV3A 2P9EA 3HDJA 4BX8A 2WNHA 3N8KA 3G9UA 3Q7IA 3UWKA 4B3RB 1D2AA 1YOBA 2HZ7A 3FDZA 5C7IO 2SCUB 3W06A 4E3ZA 1KQNA 2DQZA 1D04A 4P54A 2FWPA 1M8KA 4U7WA 5BQ3A 1CQZA 2UZ3A 1JT9A 5FF9A 4ZCPA 1ONPA 2FWJA 1HMYA 1P5RA 2Y0CA 4K8OA 1N2JA 2BONA 2PT9A 4G0NA 3WGZA 3TLMA 5K3SA 4W5QA 2FMIA 1RP1A 5HA5A 1YRQA 5TPWA 3AZPA 1EAYA 3HCRA 2QVCA 3OQNA 4X64B 4N76A 1E5LA 4BNIA 1G6OA 4IHAA 4BKUA 1O87A 1ZISA 2X19A 3L3BA 2YHSA 3U13A 2HWYA 4IWXA 4I99A 3VM6A 2Q6KA 4UHHA 3KJFA 3BRWD 2CJPA 4FR0A 5SY4A 4CBVA 1SHLA 1ZEJA 2NTEA 1NFFA 2CCKA 3IEUA 1KDVA 2XXAA 2WJWA 5FPSA 4G0QA 3DT6A 1SZJG 3ZDXB 3HBJA 5D5QA 2V97A 1JA1A 3KOZA 3LYHA 2UAGA 3IUNA 4V0RA 3PFBA 1NP6A 3H3XA 4MW2A 4S3MA 3J80A 2I7XA 2FPMA 3HLKA 4M99A 1UMCA 4ZEVA 2RGNC 4QOFA 4M89A 4GPZA 1KRWA 2RGUA 2XCSB 1SIWA 1SUFA 3JD2A 5TIIA 1XKXA 4Q24A 1T8SA 4NG4A 5AW7A 4FQ8A 3NETA 4FMCF 5IT0A 2HMTA 1SOMA 3JD1A 2CJYA 1JEYA 5HWSA 1RSZA 4YRDA 3WHPA 2FN7A 2HJSA 4O4JA 1N6NA 5DE3A 4QQNA 2YINC 4BCBA 3ONVA 2Z6QA 4LX0A 4LXYA 2O3TA 3BIFA 1GQSA 5K9ZA 4YAGA 5T4BA 1EE9A 2B98A 3E5MA 1AK1A 1EQ2A 1CRZA 1L3IA 2H63A 2Q0SA 3EGDB 3TB6A 2XBMA 2PGLA 3ZJUA 3SM3A 2BEWB 2BGKA 4YFVA 1N9KA 5FUWA 3RYCA 1KAGA 3C3AA 3CSUA 2VIIA 3N76A 4AWBA 4C7BA 1C0EA 3A6KA 4D5EA 1WEHA 2UXCB 3RFFA 3B3QA 4U7DA 4FFBA 2YWBA 1KWKA 1E1CA 3TE6A 1PT6A 3DMHA 4A8JB 4MS3B 3P0RA 1LW6E 3GRUA 4BTVA 1PG5A 3WADA 2UYYA 2PZKA 1WZUA 4H1TA 3KSUA 4RV5A 3IAHA 1E5TA 3PNBA 5AK0A 4B9AA 1XBTA 4RFVA 1P2UA 5KNCA 2RHJA 3LUBA 4K6KA 5IAOA 4NMHA 4DR4B 1GTL1 3R4VA 3E3LA 5KYGA 3HJFA 2AOTA 2R2GA 2VQDA 4PO3X 4MYUA 4RHUA 3MZ0A 3QV2A 4JT2A 1FX1A 4LNHA 3TSWA 2J08A 1EK1A 1T3HA 4J9UE 4N8EA 5WRFA 1YDWA 4GPTA 5TGDA 5CYGA 5D51S 3WK5A 3ZDBA 3HY4A 5CJPA 2X86A 3DFKA 5EEGA 1GRQA 3DJYA 4XE5A 2HA6A 1LJUA 1T1IA 4EY8A 3AYXB 4GOJA 1XA4A 1YS2X 3WTCA 2HN9A 2YXPX 4X7RA 1R6BX 3THWA 2YHIA 1EA7A 4B3XA 3IO5A 1UFOA 4ZAXA 2WVJA 1E77A 3R3WA 4U2CA 4CM4A 4Y9DA 1XZEA 1ZR2A 5A9SA 1X77A 1XVTA 4R01A 4KQHA 3G2OA 1MIOA 1EBUA 1UOOA 2JGLA 1G3QA 1P31A 4YWJA 3W78A 3ZCXA 3MTEA 3INRA 3SLRA 2CDNA 1MH1A 2QTBA 2NUTB 3HI6A 5B7QA 2PEYA 4RJKA 1GILA 5FLKA 4BV8A 3GEIA 4WECA 4BV3A 2FXVA 4BRSA 1QMGA 3ML1A 4CUJA 4L72A 4PG8A 4IJ6A 3VU9B 3FTFA 3KZCA 3MMPA 2YCLA 3I37X 3OIUA 4D46A 1W6RA 1Q0TA 1P81A 1W29A 1VB5A 4R8SA 4LDJA 2HRBA 1ZO8A 1N6HA 5CB4F 3FGPA 1XNHA 1KZ6A 2FEMA 3PWTA 3P2OA 1SURA 3FCSB 3GFFA 1E5QA 2D5AA 5EKDA 2YY6A 2HHCA 2ZTVA 2WUWE 4ZQHA 1RBMA 4YMIA 3JAMA 4XPIB 3LC2O 4U2KA 2ECFA 1LFAA 1F14A 3SZ3A 4YXWA 1KC3A 1XDGA 4YRZA 3CMCO 5AVVA 2E4VA 4YMWA 2WWWA 3K0KA 4FTWA 3N2YA 1JNXX 1HV8A 1T0UA 4DCNA 5TMPA 4Q4HB 1HETA 1GTG1 1YDEA 2IX9A 2W93A 3HB9A 2V7BA 3O0TA 1GFIA 2GZRA 1RRGA 4D92A 3NI2A 1TRHA 5A2GA 4V2IA 4Y2HA 2QQGA 2XD4A 2ZWAA 1B3BA 3L6OO 3E2PA 4MNTA 3RC1A 1T13A 1CNMA 2GA9A 2HYDA 2PEZA 1ZS9A 4R1OA 2ERCA 3T15A 4UTOA 3L5OA 3SJZA 3JPWA 3FPKA 2XCTB 4BP8A 3KZVA 3ITNA 4CKWA 2GBLA 5KVQA 4YP1A 1LC0A 2VJDA 1LRLA 4NICA 3IB6A 4GX0A 3FCOA 3KR1A 3T38A 4MHOA 5LP6A 1OXXK 1KYQA 4RJ2A 3HHEA 1UZMA 2WFAA 4EP1A 5LMCA 1QC5B 1QE3A 4Q3KA 1WLSA 2IHBA 3QLTA 1S8FA 4ZT4A 1FP7A 1WXFA 1IWOA 1NVFA 5DN9A 4GE3A 3BULA 1H6AA 4YNBA 4CQMA 5JPDA 4DV6B 1Z68A 1D6NA 1Q50A 2OT3B 3TVDA 1TO6A 3BHIA 3CZCA 4Q7QA 2CLKB 2Z04A 1P1HA 3BGWA 3O73A 3LC7O 3QNMA 3NORA 1VKNA 1LX6A 2WTMA 2YDXA 1VE7A 3SAJA 3JATA 3Q98A 2B4RO 3WRXC 2C2BA 2YXLA 3OICA 2R65A 5DGDA 2CV2A 2XTJA 5L3QA 2C4UA 3BB4A 1F8YA 1YE8A 2JCSA 2P27A 3CLUC 3FNQA 4UNSA 4BFZA 2GJKA 2PSDA 3E7PA 1XTSA 1BFKA 3DLTA 4W7HA 3VZCA 5JAIA 3KAQA 3DZHA 5AQEA 2IF2A 2HGZA 1KZYC 3OPYI 4IJ5A 5ALGA 3SFVA 3TSAA 5ARBA 1AF7A 3F8WA 4EPVA 1JEOA 2GNAA 1IB0A 5DXAA 1XFDA 3QVJA 1G2IA 1PL6A 1YJAA 2IPOA 3NB0A 2RG7A 3HEAA 3H6HA 1IEVA 2AG6A 4FEAA 4J8PA 4US1R 2PL5A 3TW8A 1HL7A 4B0PA 3L7AA 4EG0A 3PX2A 4YN3A 4FDVA 3QJGA 3IKMB 3DTYA 4CKEB 2DPMA 3PGVA 1A4IA 1Q44A 3KDPA 3Q8WA 4D8YA 1A4UA 4YO7A 4MKIA 2Q6LA 3E1KA 2HCFA 4PSCA 2QZJA 4RVNA 5LPNA 2JLWA 1KO4A 2PA3A 3QZUA 4QXMA 3CO5A 2DBRA 2P2LA 3ROTA 3S27A 4A82A 2WJ3A 4G9GA 3AEKB 1QFYA 5GVSA 3IHKA 1H2AS 4OAQA 2M9MA 1LNZA 5EWJA 4ETIA 1KETA 3GP3A 2BP7B 4G85A 3B7PA 1A8QA 2GJ8A 4DEVA 2EQBA 1JDZA 2YFQA 3DG9A 4JSYA 3VYUB 3WHKA 4II2A 5EZ5A 2ZYSA 4ZT3A 4H31A 3SF8B 1W2WB 2J33A 5CP8A 4TS1A 2W6QA 2GPJA 3R7DA 4K0KB 3ZE7A 3A1EA 1IBRA 4AF7A 4FFMA 4CLOB 4DLLA 3GLRA 3IVCA 4GAEA 2DMRA 4JI3B 4PYIA 3UMFA 1CJTC 2RGCA 2G76A 1FA9A 2E6UX 2TS1A 4F04A 1W4BA 2DHEA 2GBCA 3Q2OA 5CCDA 4A0FA 1JHXA 1KDOA 1PZNA 3RLIA 4RDXA 2FFBA 4E15A 2C42A 4MYRA 5TQJA 2FHPA 3PGLA 3WLKX 4AD8A 2FNAA 1ISMA 3FRIA 4HQLA 3FGNA 4X1OA 3WZLA 2JLZA 3EDYA 2VNJA 3FIUA 3GBPA 3VZDA 1HQCA 2AFRA 1LD3A 2OLEA 3LA8A 2RK6A 1RE1A 3K32A 1RI1A 4P4LA 1RE0A 4Q16A 4QSHA 4DSZA 4NENA 1NVXQ 2V1XA 3EOAI 3WGHA 1M2HA 2C5AA 2HQ1A 1J2JA 1BWQA 3AY3A 1ATIA 4KMRA 4HDSA 4BOYA 1BVHA 2P0EA 1I6MA 1FFEA 5CNJA 5LZ2A 1D2EA 3FNFA 1TGVA 1OW3B 4L4ZA 1GQRA 1NZJA 3TS1A 1N78A 1PO7A 2PXAA 1U7TA 1Z6GA 2RGXA 2ZXUA 1FVFA 2O8EA 1TE2A 5IAKA 4TV9A 3NJ8A 2GH1A 2ZUUA 3SBXA 4BBJA 1QHXA 2QVLA 3NBYC 2HHAA 3E2MA 1ZG3A 2XZDA 3AZOA 3L01A 3RAEC 4DLWA 3USZA 4DRXA 5AP9A 4I6EA 2GYVA 3TJZA 4MDYA 5HDBB 1T36B 3VH1A 4CIYA 1XRQA 3TLCA 4C22A 3L77A 4BNGA 1LV7A 1MA0A 3QQPA 4I8IA 4IDHA 5DCWA 3F4LA 4RJIA 1NKSA 2J0UB 2ERXA 4YUYA 1P2TA 2OP1A 2W8BA 1IY9A 2FE4A 2MSWA 1VOTA 1DUVG 3DLPX 3DVAA 4GXTA 4OU4A 3BGIA 3PDCA 5HZGA 1HEYA 4D99A 5J2TB 1PD1A 3VNAA 3FYUC 5HJ5A 1IJBA 2P1DA 5KOYA 2PMDA 4NHEA 1OX4A 4IKEA 2VZ9A 5GOZA 4M0CA 3WVNA 2V1UA 4C21A 1IPEA 3LWBA 1NN1A 4P08A 2JLSA 3KHSA 4EPYA 3K9NA 1QGUA 3IQZA 4R40A 1L4HA 2WK1A 4Z8YA 1R0XA 4RPCA 4E5UA 3HXLA 3L0SA 1E3SA 4YLGA 5AKGA 1UZUA 1Z36A 1W5SA 5BYBA 2WUVA 1HE1C 1SOWA 3LTNC 4I6JA 2JIDA 4EDFA 1TEZA 3SF0A 2VRNA 1ZCFA 1W36C 1S02A 1K75A 1CZKA 3ZUGA 2ODBA 2IKQA 2EKDA 3L8MA 2ACKA 2YX1A 5JXWA 3ZWMA 4KRYA 3HR7A 1TECE 5JOQA 1DKNA 1HSZA 3SEZA 4RVDA 1DWQA 1NYRA 1P9OA 2QA5A 3C3KA 4LTNA 3UXYA 4EA7A 5AO9A 1G59A 2MINB 5ANRB 1Y7PA 3UM9A 3LWZA 5K20A 3BC1A 3HA3A 2FX2A 2R8YA 1XRPA 3HXQA 1PTKA 3QUQA 3M5PA 3A0UA 3CJQA 3CA8A 4M1QA 5TQVA 4AMVA 2CXUA 3NOXA 3AEZA 5LL6P 4LE0A 1ICIA 3F67A 1SVIA 2HDHA 3F6YA 3IMFA 3IMKA 1G8JA 3DR5A 2FPSA 4G0PA 1R0RE 1RIIA 5AW0A 1Y6GA 1Z06A 2CVZA 2EJWA 2PD3A 1RPAA 3IAM6 1M6VA 2ZANA 2I33A 1TTHA 1IK4A 3HJCA 2GILA 3IMEA 1VCHA 2JIPA 4PICA 4QYTA 3HRHA 2FSVC 3EODA 5T4HA 3RBVA 3K70D 5FWXA 1HDRA 3NS7A 1UBLS 3KJHA 4QO7A 4GLOA 2V96A 2AFIB 3GFGA 2VHEA 3T5TA 2WLSA 4E46A 1TZBA 5AESA 1CJCA 1W44A 4QU0A 5BY2A 2EIHA 1WXWA 2EDCA 1G41A 5C31A 5KTMA 4JC8A 2ZQ5A 1UDXA 4NH0A 1CCWA 4M9XA 2OGSA 3FPAA 5BMVA 2VRCA 3N2KB 3PHJA 4WJKB 3QRWA 4YQZA 3SSMA 4BFUA 1YR1A 4I8DA 4B2YA 2FEWB 3ZGVA 5JFGA 5EHNA 1AZSC 1C4KA 1FFXB 3KOUA 2WFZA 4S05A 2HSDA 4PSAA 4YMSA 1SCNE 2R9VA 5ITWA 1VL5A 4H18A 4BWYA 3E8XA 3SGLA 3UOWA 3STYA 1OFUA 3QKRA 3CE6A 2LP4Y 3FKSA 2F1IA 2ZBVA 3CZPA 3RVNA 5FOVA 5HUJA 1EHIA 1C7JA 1II0A 3EDRA 4R05A 5CBPB 1WUYA 3B89A 5IJ9B 4DPLA 3AYZB 2BSAA 2C1EA 4DJDC 1YQDA 2IE0A 1LXCA 2QMUA 1P6UA 3QG5A 1CERA 2J4FA 1FFCA 2HM7A 1H1TA 5IK2A 5P8WA 4N5IX 4P82A 1UINA 1YR6A 1OFTA 3GRCA 1U9JA 3O92A 1VCOA 2YVAA 2DKNA 3BWXA 2CXTA 1XAGA 2VA8A 2WMYA 3W5CA 3WYBA 4FYVA 2VHVA 3WDKA 5MDHA 4FYYA 4N0QA 3V6MA 3WP0A 4NE2A 3T7JA 3KJGA 2C77A 2P4EA 2IYWA 1AXRA 1W48A 2EU8A 1KDZA 1H2RS 4LW8A 4RTQA 4DV4B 4K81B 3UTDA 4Z1OA 2EOAA 1E8MA 4BJHB 4NABA 3G7UA 2XMRA 3ZWVA 2D3TA 4RANA 5D3ZA 3H6KA 1VECA 4DIKA 3N86A 1EWYA 1E69A 2ZI9A 1UOPA 1Q2XA 4RF5A 1OLSB 2D5BA 4G23A 1BCRB 1RHQA 2H5EA 4F2PA 1L1RA 3A3YA 4E5YA 3FSJX 4GOOD 1YJQA 4ZYZA 3NHYA 2IQ5A 3DYVA 5DXJA 1U2EA 2FZVA 2OYSA 2DR0A 2QR3A 5DK6A 4DG5A 1FTNA 1U2RA 1RAIA 2GS9A 2OCLA 4LE2A 1IZ9A 2ZWPA 3HBAA 4U3JA 3CE9A 4UDXX 3U3MA 3S68A 3NH9A 1BQEA 2OLJA 1QHGA 3OO1A 1MMFB 1BW9B 1H6BA 2D4AA 4RV9A 1VDMA 4JC0A 1HT0A 2OZLB 3E3MA 2O2HA 1SA0A 1G18A 4UHBA 1S9DA 1R0ZA 5FUYA 2O3JA 3QYPA 3EXHB 3VR4H 3OQVA 1A9RA 3E9CA 4LPSA 3AL3A 4PG4A 4N6OA 3W2IA 2AEEA 3JXEA 2DVMA 2YHAA 3N5CA 1JQLB 2X4GA 3KWJA 1W94A 4WQMA 2HV8A 2CF5A 1NI5A 1V8PA 2HMVA 1JDNA 4CI0B 3K5HA 2PVCA 1CJUC 5IZCC 2QL9A 4P9NA 4QXPA 1PQ4A 2FW7A 5AI8A 1N7HA 5GJCA 5ELXA 1HYQA 2K7ZA 4WK4B 3L6DA 4HQOA 3JQPA 3T1OA 1ID1A 3OQMA 2FW9A 2FQQA 5CXSA 2RB4A 3TXYA 5HE8A 4DMGA 4OI4A 1XQ6A 3ER9A 1VL8A 5E6UA 2DY0A 4WKGA 3EF3A 4FHGA 4IEFB 2PLAA 4KODA 3GJ3A 1OLXB 1WXHA 5LMUB 1E2MA 1PZFA 3PE4A 3DEAA 1HEUA 4LJYA 4B76A 2GYYA 3PX7A 3FUVA 3ZBUA 2PKQO 4GLFA 3DMTC 1K8ZB 1SNYA 3E3AA 4R2JA 3ACBA 4RH0A 3WWEA 1JSRA 1CY0A 4XOUA 3NDPA 2ZGVA 1UP4A 3Q9SA 2IHVA 5CAEB 4X1KA 4LDQA 3NGXA 1Z5ZA 4GYWA 2CDCA 2DULA 2ZATA 3PG5A 4MYSA 4R8LA 1ZVMA 1SD5A 4RHYA 1OLOA 4HCJA 5A4MS 3PC3A 3ZN2A 2NP6A 1QF6A 3DBRA 1K97A 1P8JA 2VJPA 4X85A 3ZD6A 3MOIA 2VDOB 2VJBA 4J16C 1QIFA 3THYB 1N5MA 3Q6IA 1C8BA 1EFVA 1KJZA 2NQ8A 4O1MA 3TX2A 2BHNA 3W3ZB 1E2DA 2LKCA 2SKCA 3GN2A 4AO6A 4EY5A 1GAJA 1MOQA 4I9FA 1A7AA 5FBKA 3TG8A 4CEHA 1HBJA 2NGRA 2VBCA 4UARA 3WWDA 4BO9A 3EQ9A 3H1TA 4CCYB 4JGGA 3T3DA 3SX4A 1EGHA 1VIVA 2F7SA 4FNAA 5K2MA 4B4VA 4OQYA 3WGNA 2R96A 3QF4B 1BNCA 4FOSA 3TL6A 5KWIA 1NTOA 3K7EA 4Q4CA 1SBTA 3RVDA 1PJ8A 3DLBA 3FLMA 4Q7LA 4TM7A 4HEA1 4ZI3A 5JXGA 4TXLA 1KR2A 3IAXA 2P6OA 4NMXB 3KKOA 4C7VA 1ZD5A 3SZMA 1M33A 3OPQA 4QWWA 4C6RA 3U44B 2RK4A 3P0EA 1XEFA 3NVAA 3W5IA 4E2WA 2D74A 3BWVA 3IX7A 1BE6A 2XZPA 3JPYA 4C7XA 1E0JA 2XNJA 1TW2A 2YN0A 3HYNA 4UOEA 5BURA 3QLEA 1SBHA 5LBUA 4G1MB 4YAKA 3AWDA 2CHEA 2BHRA 3AESB 4Y6GB 3MUNA 1W52X 4K03A 4D3YA 3K73O 3ESYA 2QTFA 3EBOA 1LX7A 1XPUA 4C43A 1G5QA 1FUEA 1MPXA 2QZ9A 1KFCB 3STUA 2O19A 1SUAA 4NYJQ 3LSTA 1FEZA 2E18A 3CB2A 3ORYA 2CYCA 3JAWB 4MMYB 4QUGA 2X1MA 4YPOA 3DZFA 4DXDA 1I7QB 3C5WP 4H7IA 2ZI7A 3H5TA 4XB6B 4MYHA 3BB3A 3RTBA 1T0BA 5IS2A 2FY8A 4JYZA 2DGDA 4B8WA 1FMCA 3E70C 3F6RA 3HWRA 1TKRA 4MR8A 2JAXA 4LN1A 2DC1A 1N77A 5LQKA 2A6PA 4PCVA 1L2TA 1O97C 3CMMA 1NX9A 3E9DA 4Z9BA 5B3KA 4C2AA 3A1FA 3ZNOA 1TPZA 5M5BA 1Z2DA 3AEXA 1L7NA 2OD2A 4MQFB 3OI7A 1H93A 4B8ZA 3P9QA 5PNTA 2Y77A 3HCEA 2HPVA 3AJDA 1Y80A 1E8DA 2V8OA 2PKXA 3T1NA 3DBHA 5JJKA 2YV5A 5BN5A 3DBVO 2WABA 3LF2A 4KG7A 2XCRB 4ZHQF 5JFTA 3T5PA 3W9UA 5DRTA 5HFJA 1OHHD 3L82B 1IAQA 4A36A 1XDWA 3OLXA 1YONA 4UATA 1TVKA 2ZB8A 2D8AA 2OFPA 2Y05A 2XR1A 4OHCA 4W1QA 4G0MA 5LBIA 5AVWA 1Y4UA 5I8ZA 1O6GA 1C9KA 4G65A 1HDOA 3E23A 5EXTA 4B5KA 2A4MA 4NMMA 2XE8A 5AW3A 2ZJOA 1XE3A 4UBJA 1PIWA 4FOPA 3AC0A 4GUAA 3EASA 4L28A 1IC6A 2Q3EA 3WS7A 2EQ5A 2GUGA 2DCUA 2OZEA 3KYCA 4BVGA 5BT8A 2HQRA 3H4MA 5NULA 3AEQB 3KE9A 4G26A 4I08A 5H9WA 4LSWA 1GRCA 1SHKA 5GQSA 1Z9BA 2PUCA 3UOAB 2DB3A 3D4NA 4U1RA 1AUPA 2NZXA 4D45A 2GEVA 5CH3A 4UFPA 3DB2A 4CLHA 3BHJA 2MYNA 4DFDA 2ZYHA 4P5EA 4IFIA 5HJEA 3VVCA 3RAFC 1FW6A 4EEZA 1PVDA 3TYXA 4EKGA 5HE9A 5BV1A 4RPKA 2RARA 2H4YA 1SXJB 3VAZA 1W85B 1GTMA 2ZDGA 2C4HA 4IG9A 3MRVA 3O9VA 3SQNA 4TKVA 3M5DA 3PUZA 5BUZA 2AOXA 1XWIA 3QXXA 4OXRA 2BI8A 2MIIA 2QTRA 4RTPA 2P41A 4C0WA 3DTNA 5L4NA 2JLYA 3K6KA 4PRLA 2C2WA 4QXRA 3UKJA 1CUFA 4ESOA 3PXAA 3LECA 2WHQA 3FWYA 2ZS9A 5KS2A 2PU5A 4DLNA 3PPWA 4KKVA 3S99A 2XWQA 3EVFA 3MWJA 3CEHA 4GC5A 2O3UA 4X93A 3BWEA 3VI4B 1I3CA 2FMHA 4OXYA 3MPUA 3DXYA 2NX2A 5DLQC 2CWDA 2P4QA 2QYOA 3EFOA 1U4NA 3DTVD 1YJBA 4BNHA 5JZVA 5A5EA 3T1TA 3QW2A 4LJRA 4NOLA 2XTNA 5KKNB 3VBEA 1JFSA 3QPUA 4GYKA 4XD2A 5E1BA 4OFBA 5FA8A 4Q3EA 4EI2A 1XNRB 2WYHA 4UDNA 1P73A 3ZLTA 1P1BA 1Q5PA 4ARZB 2AFVA 1M0EA 1Z5WA 1YNOA 1U6KA 3UUFA 1DDOA 3UBTA 1QWSA 1DG3A 1FSFA 2XZTA 2PV7A 2XGMA 1OGJA 3D6HA 3JS5A 4GQIA 1PTJA 1ZR4A 4IDOA 4J1TA 1M0TA 3RABA 3BILA 4XFKA 3TUZC 1T2NA 1NL3A 4OF4A 3CRRA 1NW5A 2H29A 3CSSA 4OQQA 3BEDA 4J94A 3TG2A 4LXTA 4FFNA 4RMGA 4LMAA 5KCMA 3QW4B 3TQSA 3NC0C 3G0HA 1ZAYA 3COWA 4NJEB 4IH9A 4OP3A 1TMOA 3QFSA 3ZKAA 5IT5A 2V3WA 3WYDA 1QYDA 2PGOA 2WWVD 1T9ZA 3WFIA 2Z0MA 1ESMA 1FZQA 1T3ZA 4JT8A 1CQWA 3BA1A 4MVJG 13PKA 1E7WA 1BXGB 2I4NA 2ZB2A 4QPDA 3WAJA 2PXHA 3H99A 2J9YB 3AERB 4AI6A 3Q3HA 4B6PA 2P75A 6NULA 1K5GA 4TXMA 2QL7A 2PGXA 1NUAA 1M83A 2C8VA 1KRHA 5DP1A 3MGCA 1KEEA 2QI9C 5D3QA 3HXOA 5DHTA 4CMBA 2QM8A 4DWWA 2HLNA 1BD4A 1N2CE 2BZGA 2HFJA 3NTXA 3PK0A 5FBHA 1B6SA 3UATA 4Y7DA 4UNQA 1UPTA 5CVCA 1GT6A 2IFTA 3KZOA 4G5OA 2FWBA 2AKEA 1ZCAA 3BD9A 3C16C 2QOEA 4FWBA 4HNAA 2ZU0C 2O8FA 4OQ4A 4G6ZA 3CRMA 3GHYA 2GARA 4TRRA 4LV6A 3G2JA 1CR6A 1ZEMA 4BGDA 4UVDA 1QH0A 2XRFA 2JJMA 2EATA 4L15A 2DT8A 6PFKA 3AKCA 4L16A 5AHOA 2XA1A 3OEWA 3VKFA 2Y1WA 3C6BA 2VHZA 2X7XA 1E0AA 5TMBA 4IQGA 2B8JA 1Z0IA 4N5HX 1UBHS 1TM1E 4HO1X 4CLRB 5K0LA 1NBMA 1RZUA 1Z8NA 4HGRA 2DEUA 3AM5A 2GBLC 2W6MA 1KK2A 1YS6A 1VJ5A 4R5MA 4RAOA 2GZAA 3OCCA 1EJ0A 2GCOA 2UUOA 4OGLA 3ZE0B 2JJ1A 3C87A 2VO1A 4EABA 1Q3TA 2WYOA 1XPJA 2BFMA 2VDUE 1RZRD 2PGIA 5LP6C 1WZIA 2E4UA 4KN8A 1GGHA 4PAMA 4F84A 3KXKA 1EFPB 2V54A 3U9SA 3HU1A 1UAYA 3MTDA 5BO5A 2X9QA 3EHDA 1S3IA 1SY7A 2EL9A 2ZE8A 3PGJA 1HI9A 4U7JA 3J7TA 1GPLA 2I7DA 1GTJ1 2V5VA 3IUSA 5I4IA 3JSXA 2FN3A 5C8YF 2HV9A 3Q7TA 1TFRA 5SZHB 4RNDB 5DGXA 3WHIA 3TUJC 4DR7B 1M9NA 2CFIA 3SK0A 4NBKA 3DOEA 3K6JA 5TGZA 5IRCD 3O83A 1J4AA 4O2AF 4MARA 3GMSA 1DC8A 4XLZA 3ILHA 2BELA 1MR3F 5LUBA 1EUYA 5DYNA 3ZU4A 2HTEA 4QPJC 4N3CA 3AEYA 5DW3A 2YTZA 2NP7A 4M98A 4MZXA 1ISSA 4MLCA 5CDFE 3W5AA 3AM3A 3E9QA 1IY1A 4TTPA 2O2XA 3FPEA 4MPRA 1EB8A 1P17A 2ZIUB 1QOQB 5E4TA 5I5GA 3A8TA 3KT6A 3RPEA 4A7PA 2HHHB 2VDRB 3VOBA 1QIKA 1Z25A 3Q3CA 4Q7MB 3ZTWA 4EAQA 1CUXA 5BQFA 1G6Q1 1YRHA 1DELA 1RLMA 4LCJA 1SCUA 3RSGA 3L6CA 2DSNA 2VDJA 4HAWA 4CCWA 1TTQB 3T8YA 1H1LB 4Z4GA 4DYHA 3GDOA 1TK9A 2RDMA 1E32A 3FG9A 4YJGA 4F46A 1DQNA 4QTXA 3ZH9B 1GUZA 1XP5A 2ZJ8A 1JDBB 3S8EA 1XMOB 3EFBA 2P9YA 2W83A 5IXJA 4TV8B 5JDIA 1XYYA 3AIMA 1BWPA 1CV2A 4M0KA 3PR2B 1E1NA 2X0DA 3VYRB 4XIJA 3OJOA 1QWOA 3WL8A 2ISSD 2BFAA 2PZBA 1N2HA 4QNNA 1XHFA 3UQZA 1XTUA 3CH5A 3E5RA 1CUIA 3TVYA 1PZMA 1J24A 2JI6A 4KLAA 5C8YA 5KWJA 1P4JA 2C7VA 2PWYA 3QXSA 1E1QD 4BE9A 4Q5IA 5BV2P 1XU4A 4HQ6A 3EVCA 2W48A 3BQ9A 1JKMA 1J5PA 2V6MA 3OZAA 5CK4A 3THXB 1EI9A 5IJXA 5TXGA 4YUZA 1MB9A 1NTRA 3O2JA 4RIHA 1IOZA 1IN5A 2HA2A 3LT2A 4YDHB 3T1YB 1B73A 1F1BA 2DZDA 2LIVA 4X1YA 1U0EA 3QWFA 2C2MA 4G67A 3JQGB 4PGAA 1QU3A 1ODKA 1T25A 1KSHA 1ZN9A 2B4QA 1CUJA 1D5CA 3QVWA 3HE3A 2A1IA 2XMCA 4LZJA 2ZYRA 4P32A 1BS9A 1RPJA 4EKNB 1KSGA 4DY4A 3TTTA 1QHHA 4NZ9A 4O29A 1WAMA 5CDHA 4YRLA 3AU8A 3I9V1 1FMLA 4MRMA 3O2SB 2RIPA 1UK8A 3P9XA 1EX1A 4GGPA 3S2ZA 1NR5A 3FBTA 1RS0A 4NU5A 3PEVA 4MWTA 4WLEA 2IVFA 3RAJA 1DKLA 1TQ6A 3CX6A 4KLRA 3HPQA 1NSTA 5I9BA 2WDPA 1I2CA 4JKYA 5IC4A 4CIDA 4C88A 3WGTA 1JSZA 2FWMX 4MRAA 2Q45A 4KR0A 4CM9A 4G84A 4DCOA 2FW8A 3JALB 1Y3BE 4AZTA 1HK7A 2B9VA 2M1ZA 1OX6A 3L6EA 4PGHA 3R7NA 1QVRA 4BLTA 2VJQA 2X6RA 1CFZA 4UVEA 4UOQA 5CLGA 7YASA 2AC2A 1PJQA 1YB5A 1OIXA 3PNKA 1KZ9A 1LH0A 2RGAA 2CDRA 2F64A 3DYBA 3LRXA 1F6BA 2EF0A 1C9YA 2JAOA 3BWYA 4EMBA 5DBFA 4H6PA 5LQNA 1VHJA 4UQLA 2G40A 3PCXA 3G79A 1U4OA 5FNZA 3TJMA 3GQBA 1JILA 4EY6A 5I7RA 3OC6A 4RTNA 1KKUA 1N6PA 1KZ7B 3PI6A 4ZCSA 3RBAA 4JLNA 1R66A 1V96A 2VPPA 2CV0A 2BGJA 4BQOA 1XMPA 2NUBA 1UBNA 4S12A 2D5IA 2X15A 1VYTA 4ZAFA 4FM9A 4RHFA 1O8BA 1JKXA 2ZI3A 3AX6A 3PC2A 2ZUTA 1UBTS 1BFDA 4DQXA 1JIXA 3L0BA 4FWIB 1WDMA 3DCIA 1C1XB 2QN1A 1UCFA 1JEJA 2XA9A 3JD0A 3HKCB 3JR3A 3PNQA 4H6XA 4BGIA 1SG0A 4HATA 2JFBA 3HABA 3HUTA 2FZ5A 3EAQA 3F9CA 1U1CA 4X66B 2XMQA 1I0IA 3HR8A 4PAGA 1W1WA 3PL1A 2A57A 4LXXA 5ECWA 2C2HA 1ZL0A 3L7YA 5A6SA 3MCTA 1V7CA 2BKAA 4I9GA 4P6VF 4ZVNA 1KU6A 1Y3IA 3ITDA 3E0XA 3OHPA 2RONA 3SQLA 1E2EA 2HAEA 4R8KA 1I6LA 2B78A 1SJ9A 3FD8A 3UN1A 3WYNA 5AVUA 3A6FA 3LUKA 4FEGA 3CEPB 2P77A 3DSRA 2CK3A 1JKIA 4F5EA 1S2IA 1F0PA 1GIAA 3DOUA 5IEJA 3KLOA 1OI2A 3U4IA 5FR2A 4HUQA 8ABPA 3UWPA 3R3XA 2QU7A 4RK7A 1ATZA 4GBMA 1GARA 4WW0A 3SS9X 2IHJA 4RZIA 4WVFA 4PSUA 1J2YA 5CIQA 4TMFA 5L3ZA 4DT1A 2NZUG 3K9FC 3ZGOA 5CNKA 3VUFA 2PKWA 1FFHA 1J20A 1AUOA 3UAYA 2D1QA 3JAKA 3B38A 3KQVA 4BWGA 4QJ3A 4ZAVA 1IIBA 1AGRA 3I4FA 2HX1A 1TO1E 2ZSHA 3QUCA 3TSOA 1GL3A 1XA0A 2BFCA 2VHUA 4ALLA 5L95A 2YJGA 3ROGA 1EA5A 5G4KB 1D9XA 1RWPA 2PKEA 3R6GA 1NQOA 3V9AA 4OK6A 1JAIA 1J49A 1Z17A 3WTBA 5LFAA 3IDQA 3NHPA 4RSRA 3F2VA 3I12A 3IQDB 2QNRA 4JJ4A 4BNUA 2AZMA 1VGQA 1TAUA 3HMKA 1E98A 5CEJA 2FZKA 4NL4H 1VMIA 3CYFA 1HT3A 2YHUA 4LGMA 2ILVA 2HCTA 1MFZA 2QUIA 2NYAA 3PWSA 1X0VA 2PO7A 3M70A 3PR1A 2IP1A 3PIDA 2ZDQA 4IF6A 3H86A 4TTQA 2ZRMA 1YMVA 3OWOA 4HDCA 4ZCQA 1XT6A 3G82C 3MLEA 4L95C 4TT8A 1SC6A 2CXOA 3NAQA 3O75A 1YS4A 3H13A 3WKCA 5JCPA 4E4RA 5A6VA 5FL3A 3WRWA 4FOLA 1O95D 4G0ZA 2Y2VA 3E4CA 3LUPA 4ZD6A 1Y89A 1K6MA 2I9PA 2WT4A 5AOCA 1GPJA 1AZWA 1Q0LA 4RS4A 3WP1B 1TVCA 4EO4A 2ZTLA 3EJ6A 3HB4X 4F9TA 2WWGA 3N53A 1ID8A 2IHKA 3DHWC 5A0TA 5JS8A 5A3SA 1LK5A 1T2UA 3DC2A 2X0EA 3PUJA 4ZV9A 4FCCA 3QXHA 2BUAA 3AFNA 4EECA 1HZZA 5K6RA 5CGZA 1G20B 1OSNA 4ZC8A 2X5KO 2JG3A 4ARBA 3JASB 4D8WA 1VG1A 4Z4HA 1R6DA 3BE5A 4R6XA 4CMGA 1JKJB 2DFPA 5ILOA 1P18A 3G5UA 4MMZB 3TLKA 3NP7A 1P7WA 2B1IA 1BOOA 1IEXA 2BJHA 4MQLA 4OHVA 4H7JA 5TMDA 3LL4A 2VKTA 5TB5A 1V4VA 1UBCA 3IDZA 3R6TA 4PWZA 3V32A 2D1YA 3TLXA 4AAYA 1RLTA 4RTMA 4YMGA 3NBUA 4OHPA 4F0JA 2EX1A 2AZDA 5HQTA 3DXFA 4IJWA 3LSYA 3E53A 3PQ7A 3M33A 2C57A 4W5NA 3CLUD 4F3NA 5B2EA 1GUDA 2WWTA 4PY2A 2N47A 5D86A 3CURA 2P2SA 1M6YA 4XUCA 3QP9A 2MSKA 2ZIVB 1T24A 5ULLA 1Z56C 3I28A 1Y1RA 2QX6A 3O2NA 4I7EA 4E31A 2Q0XA 1X80B 2ZITA 3GXBA 2GERA 2Z9CA 5CA1F 1OXBB 3BICA 4F92B 4DNQA 3KEMA 3O9ZA 3HJBA 5TARA 1Y8QA 5ERYA 3LPDA 4H6WA 3OZSA 2WD9A 1SZCA 1O0CA 4MITA 1WU7A 3I9NA 3BTUA 3RASA 1IVSA 1KH1A 1R74A 4D6XA 1MT0A 4JYBA 4YJDA 3AF3A 4KIFA 3KV1A 4ZI7B 4HAOA 4JUDX 1C7FA 1LV8A 2XCIA 4GGMX 4B6EA 4GKKB 4P53A 2DFNA 5FIUA 1BTOA 2UYOA 1YRAA 4JYCA 4O4IB 1PK9A 4OATA 3NV9A 1SVSA 1CUBA 4G8DA 4M9CA 3CVUA 3AKYA 3C5HA 2XCOA 3PQDA 4FK8A 2ZAMA 2ZSEA 4LMBA 1C9EA 3O8QB 2ZCVA 1N57A 4CM3A 3U4MA 4FGKA 5K8VA 1TU3A 3NOVA 3Q7QA 4PANA 2FJUA 2PBZA 1OFUX 1P1IA 1U3WA 4M0EA 4ZOLF 3WKEA 3V2UA 5EE5B 2AG0A 2WPNA 1IZ0A 4CL0A 3K4PA 4DA9A 2J7PD 4EDHA 2RH9B 2D7JA 3G49A 3JZIA 4JU9A 3W6ZA 4PLTA 4BFYA 1U0NA 2PXXA 4Q3LA 5ALDA 5DWQA 3RFVA 3WGKA 5K4GA 1MB0A 2P69A 2W2XA 3MIIA 4MYCA 1SKYE 3C5EA 4P33A 3FTNA 1CQJB 1XJCA 3D6FA 1G4AE 4ZAWA 5IDVA 2X77A 4MUHA 4C08A 3KU4A 4HDMB 1AS2A 4K5QA 4CKXA 2XF2A 1RLOA 3IXMA 1DKPA 4FFVA 4J4HA 4NEGA 3G0IA 3ZU5A 3BXHA 3RC2A 3LLSA 5AI5A 5CIYA 1NSFA 1LF0A 2CJWA 1GN8A 3DL4A 4KOAA 3WL4A 5CA1A 3NC4A 4F96A 2P7HA 1ZN2A 3G2NA 4EW2A 3QVGA 1QPZA 4UAGA 4RXTA 2J3QA 2ZVPX 1E79D 3CXUA 4QEKA 2G0AA 4XDYA 5ECDA 2Z6AA 3V7UA 4KWTA 1KO7A 4K9OA 2GCEA 2RHBA 4OIMA 1XK6A 1DRKA 3KZMA 1F8FA 1NOKA 1WUKS 3ADPA 2RGYA 3JYOA 5COAA 4F4HA 1U7ZA 4UU8A 3E22B 4DJTA 4MCAA 1UBUS 2R8PA 2J46A 3D5TA 3E15A 1GG9A 4MIYA 1WW3A 2ODQA 1Z6AA 2JGRA 2OAEA 3QWIA 1AUVA 2PZEA 1NF9A 3CBQA 4MSUA 1S2NA 3P4UA 3DOOA 1SCJA 2EAUA 3P9KA 4JDUA 4RW0A 4S0ZA 4Y9RA 3DNMA 5F77A 1UDRA 2G06A 4F3TA 4NHOA 3PJFA 5HW0A 1UBSB 3H2YA 1P7YA 3LC0A 1HPLA 2XJ9A 3AHJA 3DKIA 1ZICA 4V0NA 3II6X 1PR4A 3DV9A 1WQ1R 4HZUB 2BTQA 5FLXA 2WB2A 3BDAA 1QRTA 4KMOA 2QX8A 1ULZA 3WGGA 2X14A 4IH4A 1YVEI 1XD8A 2FRXA 1NU8A 3G0BA 4EHBA 3B2EA 1CVIA 1R8JA 1II9A 1KZ4A 2E4AA 2FVXA 3P32A 4KIGA 3VU8A 1A7UA 3DUFA 3IALA 2WE8A 1Q12A 4D3FA 3LZDA 5DIFA 2J67A 2X3YA 4K9PA 1OH5A 1TD9A 1OY1A 3C6XA 2JEOA 2ZXEA 3KPUA 1ENZA 2QX4A 2RGGA 5JLJA 2DETA 2PZLA 2XXBA 1SFRA 4K9KA 4MAAA 5EYPA 5KNBD 3FOEC 1FYFA 1JJFA 1V11B 4AM8A 4EPTA 2Q1SA 2PX0A 3QVTA 3VJKA 4HNVA 5KQLA 1V8FA 5CLLA 3DW1X 4W99A 3WGQA 4Q9KA 3UAOA 1RC1A 4HGOA 4EHKA 5CW1A 3KQSA 2WKSA 3FKJA 3FPJA 4LKOA 2VJYA 1GTVA 3W4JA 2IW3A 3FSEA 1N9ZA 3H7IA 3CRW1 2H0RA 3HU2A 4K88A 3NBAA 1T9BA 4IX1A 2PV0A 1J6UA 1XF1A 4OBWA 3L8YA 4CM6A 4BQPA 4M53A 5BWLA 4PZYA 2ZSJA 5LA6B 2P91A 4LFCB 4ZDJA 5ALVA 5JADA 1EXVA 5TQ2B 1WWKA 2FSHA 4IMJB 4ZREA 3UJ7A 5CDUA 3IV9A 2EEPA 1MPTA 2O8CB 1UT5A 3HKEB 1YZFA 2NYVA 5DN6A 3GLHA 1HA3A 4JELA 1H3NA 2O23A 1L4KA 3EVTA 1M7GA 1SC4A 1XD2A 4TUYF 2XZOA 2V3CC 4I14A 3ASVA 3QBJA 3NTVA 4HX5A 4MXDA 4FVTA 5GM2A 2A92A 2PUTA 5IJAA 3BS4A 4MKRA 3G2KA 1XNQB 5HSGA 1PR0A 1MEEA 3DZJA 4Y2XA 3TE7A 3ZIAD 3A9SA 4KLNA 4E2YA 1SPBS 3B8EA 3R0XA 3TTWA 3LVBA 1PVOA 4LZPA 5SYNA 4KQWA 1RJ9B 2XUZA 1AKTA 4WJZA 3FSGA 3O74A 1P7ZA 1BMDA 2HOQA 3A1SA 3SHVA 2O20A 4Y6QA 4BN0A 4MGYR 2AI1A 2ZVJA 4FX2A 4Y6RA 2OD9A 1L5SA 3W5SA 1MHTA 2VP3A 1GAEO 4JA0A 2BKVA 2CEKA 3QA3E 1Z5UA 2QE7D 3EY4A 3QUAA 3WLRA 1QJCA 2PX6A 3UT5A 4EEXA 5AJYA 3I0MA 1OH6A 1ZNZA 3K0FA 3GCZA 2GD2A 5EWMB 5KYYA 4YYZA 2B69A 2IYYA 3CLHA 3HHPA 1SU7A 2QNBA 2FPUA 1KE2A 1URPA 3RUEA 2QRVB 4PIMA 2ZR0A 5ESRA 4UAUA 4EG8A 1S2OA 5A03A 1TTPB 3FNHA 5K01A 4G0OA 1Y33E 3VR2D 1LLUA 1H94A 4WVLA 2FP3A 1V5EA 3WGYA 5H70A 3W4KA 1Z15A 2EZTA 1QP0A 4KO8A 1OF1A 1BEUB 1F8GA 4TUYA 3G13A 2VDVE 2UV8A 1BYIA 5IDQA 3ED1A 2FR1A 2WTXA 4M76B 3VHXA 5GADl 3E5NA 3N87A 4DEXA 1XCJA 2JZOA 2HKIA 4HTFA 3FTEA 3ZK8A 1FMFA 5BRAA 4PWYA 2L69A 3NRBA 3KHUA 4NZZA 1LBQA 3GGSA 4DR5B 1VSQA 2H1WA 5CNMA 3AMVA 3WISA 3IEIA 1MG0A 1WZCA 1YRLA 3WLAA 4BP9A 2FWRA 2XUKA 3DULA 3CKYA 1FSSA 3GG2A 2JAPA 3JVUA 1BE8A 2G4CA 2COKA 4K1XA 2NSHA 1E61A 2RAPA 5ITZB 3CH6A 3VSBA 4YJ2B 5I4BA 2F3RA 1TM7E 3EMBA 1DJMA 2VT6A 1KPGA 2OQIA