1D07A

Hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis ut26 with 1,3-propanediol, a product of debromidation of dibrompropane, at 2.0a resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
293
structure length
293
Chain Sequence
GAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the haloalkane dehalogenase from Sphingomonas paucimobilis UT26.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
molecule keywords HALOALKANE DEHALOGENASE
total genus 113
structure length 293
sequence length 293
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 1999-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1d07A00
3I2GA 3KWJA 4EY7A 1CRLA 1XZJA 1QE3A 3EQ9A 1NX9A 3BL8A 5FV4A 3I2FA 3H2HA 4A23A 5D7BA 4FOLA 2J3QA 4U2BA 4X00A 3NUZA 1LPMA 1MX9A 3HSSA 3WK9A 3D7RA 1MT3A 2XMZA 4IQ4A 5ISMA 2FX5A 3ZPXA 5T4EA 2VJDA 3ZWQA 1QIDA 1AC5A 1SCKA 2J4CA 1H2XA 3GELA 5DJ5A 2XMDA 3H19A 5AK5A 2WIGA 3VVLA 1CUBA 4B85A 4O08A 4B9EA 2ZJ6A 4JYMA 3R3YA 3O95A 2QJRA 2AJCA 3NWOA 5A7GA 5KBYA 2EDAA 1EDEA 2C0QA 1VE6A 3W9UA 3WJ1A 1DINA 5JD6A 3BDIA 3WK7A 3F98A 4J0GA 4M0EA 1VE7A 2B20A 3ZI7A 4OPMA 5ALRA 5K3AA 5T4BA 2RONA 4LYEA 4BAGA 4X3CA 3EQ8A 2AXEA 4QWWA 2VA9A 2HU5A 3SC2A 2OCGA 4BZWA 3U0VA 5JAHA 2H7YA 2ZYRA 3VISA 4G4JA 4Q82A 3HRHA 5K3CA 3O4IA 5AK4A 1QIEA 3Q0TA 3V1MA 3ILSA 2UZ0A 4FWBA 4E11A 3OURA 2RHWA 1EH5A 4FLFA 7YASA 3T4UA 4ZREA 3FYUC 1LNSA 2OLEA 2QZPA 4J03A 2JEYA 4TVKA 4OSEA 4X71A 4C4YA 5AOCA 2E3JA 5HFAA 3IDAA 1FFDA 4QDZA 3GROA 5AHXA 2FUKA 5BWBA 5AM1A 1XRQA 4X93A 3E3AA 2RIPA 4UFPA 1PFQA 2JGLA 4NS4A 4B6GA 5CBKA 2HA2A 5C81A 5CH8A 4JYPA 2C0PA 2ACKA 4CG3A 1J1IA 1GGVA 2Z8ZA 2WFMA 4AMZA 2O2GA 4G1FA 2BGRA 4X6UA 5IVKA 4CG1A 2WJ4A 3ED1A 1EVEA 2WIFA 1TAHA 3AILA 4H7IA 4K5QA 5DNUA 2PSDA 3Q8WA 5DNVA 5CRIA 1BEZA 3IIIA 2X76A 1Q0RA 4CG2A 3D5EA 5HF6A 3DS8A 5FPQA 2XQIA 3WK4A 3F9CA 3O4HA 1YS2X 4EHBA 3K2IA 3W05A 1E8DA 1J06A 2QJWA 3H04A 5AKZA 1ZD4A 3OC0A 4ZWNA 5JAOA 2PM8A 2HA7A 5E4TA 5ALDA 2QUAA 3STTA 4U2EA 3CN7A 1K63A 1QTIA 1UK8A 3ESAA 3C6ZA 3I1YA 4QDTA 3O9MA 1WB4A 5SYMA 1JI3A 1DQYA 4HZGA 5ALQA 4H35A 1EDDA 2JGIA 4KJXA 4BZZA 1QFSA 3DLTA 2XUPA 3MVEA 4MYDA 3C8DA 1DX6A 4IH4A 4DGQA 4BTVA 5ALPA 3FLAA 3WL8A 3F67A 2XMCA 1UOOA 3WL7A 3RARA 1R4ZA 1MTZA 1AZWA 5HKBA 4KACA 1LGYA 1QIIA 5EHNA 3KD2A 3HABA 4OUKX 4Y2RA 4H7EA 4FFWA 4YASA 1AGYA 2H9YA 3FCYA 2OQIA 4BYMA 4J0HA 2RI6A 1N5MA 2CB9A 2YXPX 3ZLTA 3HXKA 5LZ8A 4B80A 4AQDA 5AI0A 5LKRA 3H17A 2V96A 1ZI6A 2WG2A 2WHPB 1AMNA 1YASA 2XDWA 1BS9A 1JJFA 2OCLA 2WKWA 3I6YA 4UBOA 5JD4A 4Y9SA 4BC1A 2D5LA 2PBLA 1XRNA 2IIVA 3L1IA 1QLWA 3WMRA 1KU6A 3PICA 1Y7HA 2BUAA 2RGUA 2JGFA 3EIOA 2Y1KA 3ZLVA 1IUNA 1JMKC 1GQRA 3I28A 2ECFA 4HS9A 4MYSA 4HXGA 3KWFA 2C7BA 1X2BA 1AX9A 1EB8A 3DEAA 1FFEA 2QT9A 4K2AA 4AO7A 1H22A 1AURA 2YYSA 3ESDA 3H0CA 2G5TA 4L72A 4X6YA 2Z3WA 4YK7A 4H7HA 5LP1A 4K6HA 3QVMA 4DNQA 2FJ0A 2XT0A 1LPAB 3WYNA 3A2LA 4OB8A 2HFJA 2H7CA 4ETWA 1ACJA 1E89A 5HK9A 1DWQA 3G8YA 2QMQA 1XZEA 5FKJA 4Q3OA 3C6XA 5ALZA 5IVIA 1Q0ZA 1QIKA 2VEOA 3R3XA 4J0JA 5ALVA 5DYWA 2Z3ZA 3YASA 4YPVA 4WCVA 4D9JA 1OXMA 5BOVA 1GKKA 5JZSA 5JASA 5ALKA 4PSDA 3T52A 5FDFA 2R11A 3TRDA 4DSAA 3WJ2A 1XRMA 5AKEA 2WSLA 3ICVA 4KE9A 1ZD5A 4G8DA 3PFBA 4UHEA 2XMBA 4QLOA 2HU7A 2D0DA 5IH7A 2PL5A 2WLSA 5HCUA 3JYHA 1XQVA 1GPNA 3ANTA 5HKAA 1UXOA 1LPPA 5I7UA 4BCBA 4GLBA 4Y2TA 4ZV7A 1YB7A 2HDWA 5A7FA 4UHDA 3WWDA 2PU7A 3X3HA 3DJYA 3QBJA 4TPKA 1XFDA 3O4JA 1H2WA 2ZYIA 5ALTA 5DNWA 5AM5A 5AKYA 4JUIA 3PFCA 1XZLA 2O7RA 1DWOA 2DQYA 1ORWA 2GYVA 3WWPA 2QXTA 4Y7DA 1R9MA 5DYYA 4C89A 1XLWA 2XQGA 5AI9A 1G42A 2ZSIA 5T4FA 4DNFA 5AKGA 2V9ZA 4GHWA 3V9AA 3FBWA 5DTIA 3FCXA 4OYYA 1C7JA 1XZMA 2DHEA 4Y2UA 4F60A 3QMWA 1CQWA 3DCNA 4Q05A 2VJBA 4L0CA 4CI9A 4UBNA 1ZGCA 5HQ3A 4FLMA 2IITA 5H3HA 2EEPA 4Z49A 4RGYA 1NU8A 2EDCA 2ZYHA 2GBFA 1IZ7A 1PV1A 5AH0A 3PF8A 3BE8A 1UK6A 3M81A 4C01A 2ACEA 2WHRA 4IH1A 2WUEA 4BCCA 4B82A 4PW0A 5KWJA 4AN0A 5SYNA 3JWEA 1EB9A 3G9ZA 4ZV9A 1XZKA 3AIKA 3QPCA 1BN7A 5CT6A 3STUA 5CTAA 2JIDA 4C6HA 4NZZA 3G9XA 3BDVA 1CUJA 2WJ3A 2Z8XA 3WWOA 4G9EA 2XUGA 1E5TA 2PVSA 3FLEA 2I3DA 1MNQA 1BN6A 4B7ZA 2WG0A 5BV7A 2VQ6A 4QE3A 2DSNA 3QH4A 2BAGA 3NOXA 3G02A 5E2IA 3C43A 3WKEA 3VJMA 2WUFA 4Y2QA 3W2TA 4ZXFA 3C70A 1JJIA 1CUVA 4X91A 5A6VA 1SCQA 2GBIA 3STYA 4QA9A 4Y2JA 4CIAA 3I2JA 3FNBA 3DNMA 1MN6A 3PDCA 4W63A 1MAAA 5EIHA 4QDXA 2I03A 4H7KA 3VVMA 5HQ3B 2XUJA 1CUCA 3OTQA 4NVRA 3H1BA 3I6ZA 5AK3A 1ODSA 3CN9A 2HRRA 1TCAA 5A71A 1WPXA 1P0IA 3KOOA 5ALSA 1XZBA 3HI4A 5CURA 4I3FA 1N5RA 4UHCA 3QITA 4OCZA 1VZ3A 1QIJA 3HEAA 2BUCA 3BWXA 4FNMA 4XWGA 5AI5A 3STWA 3VKFA 2ROQA 4E46A 4HXEB 1FFAA 3AZOA 2HADA 5HZGA 1FFCA 1EINA 2V98A 4Q34A 3FYUA 4WY5A 2ZYSA 4OU4A 5K5EA 1THGA 2GYUA 4EY6A 2NW6A 3OM8A 3C6BA 1IZ8A 1BCRA 2O2HA 4Q3LA 4X97A 1R88A 1VZ2A 1U4NA 2PKYX 2OAEA 4B9AA 4QEKA 1QZ3A 3OOSA 4BAZA 5AO9A 3PF9A 4C4ZA 4EY4A 5AKLA 1XZHA 3CXUA 5AKXA 3IBTA 4FLEA 3IB3A 3A2NA 3HLKA 3BJMA 4CCYA 4G8BA 3VJKA 3KXPA 3NGMA 5DLPA 1XRPA 2WILA 4UBJA 2HA6A 1TCBA 4TGLA 1H2YA 5ALJA 1XZCA 5K3DA 4G4GA 4P08A 2WG1A 1YAJA 2YH2A 4BP9A 3C45A 5FPPA 3IA2A 4FNGA 3S2ZA 2Y2UA 4BATA 1E8MA 1FFBA 1LPOA 1XZFA 4DLNA 5HF9A 4BE9A 4EZIA 4HAIA 3V1KA 1YCDA 1WB6A 2WFZA 1ZOIA 4B84A 1DWPA 4H18A 4HVTA 3KDAA 2OGZA 5K3EA 4LXGA 4EBBA 5ALEA 5CH3A 4RPCA 5D3KA 2C4HA 2G63A 3BF7A 1XROA 3R3UA 3LP5A 4DYHA 3JW8A 1B6GA 1X70A 2HA0A 1VA4A 2LIPA 3WA6A 4UPDA 3R41A 3D2CA 2ZSHA 1QIMA 6YASA 4X92A 3WKDA 4OB7A 3G0BA 5ALXA 1IMJA 1R50A 1CPYA 4H7DA 4DMHA 3WZMA 4ZGBA 3C8HA 5LZ7A 1T4MA 1X2EA 1QO9A 1ODCA 3FYTA 1CUGA 3AZQA 1DU4A 5JANA 3B5EA 1GQSA 1U2EA 5CMLA 5A7HA 3IVMA 3M3DA 3WLAA 1ZICA 4BRSA 1YSCA 1AKNA 4AO6A 3C6YA 1A88A 4AMYA 5K3FA 1TRHA 2W22A 2CBGA 4GI1A 3G9UA 3ESCA 4MQLA 4GW3A 1Y7IA 2WHPA 2OGTA 1AUOA 5AOBA 2OXEA 3H2JA 1BRTA 3IUMA 3AFIA 3LLCA 2PX6A 3WZLA 1Y37A 4YX9A 1XLVA 2AJLI 5AKJA 5C8VA 3GZJA 1LZKA 1LPSA 1MNAA 1JFRA 1CVLA 4GXNA 1CV2A 5EGNA 3AJAA 2GBCA 1ZD2P 1T2NA 1XQYA 4EUSA 2K2QB 4QDUA 3VXKA 2J4FA 3BIXA 4QZVA 4Y2SA 1GPLA 2VT6A 1VLQA 5BWCA 3QZUA 1TCCA 1ZD3A 2HA3A 4QLAA 2DQZA 1ZIXA 3QM1A 3DQZA 4BAUA 3BIWA 4XVCA 1QTRA 5AK6A 5HFNA 1RP1A 2BCEA 1N8SA 4UFNA 4WDRA 1CUHA 1A8SA 1SFRA 3M82A 4Y2PA 3RM3A 3EQ7A 5JAPA 2CJPA 4Y2YA 1XRRA 3D59A 4J0IA 1K8QA 4CCWA 4LIPD 3E0XA 5I8PA 3D0KA 2X5XA 4ROTA 5EIAA 1LPBB 3D4LA 4S0XA 4HTAA 4IHAA 1SC9A 2ZVDA 3VDXA 4X94A 1TQHA 1HLGA 1YB6A 1G4HA 5ALUA 1E8NA 2ONCA 4UBKA 2X8BA 1F0NA 5K3BA 1CR6A 1XQWA 3RK4A 1TK3A 3DOIA 4KRXA 3WKAA 1J2EA 4RNCA 1ZJ4A 1HKHA 5JYCA 2PSEA 3A70A 2OPHA 2CKMA 3GBSA 2HL6A 4BP8A 3I1IA 2VTVA 5LYYA 5EI5A 4X7BA 3N0TA 2PSHA 1HDEA 5LZ9A 2AJ8A 4DM7A 1Z68A 4FBLA 1EA5A 1J07A 2BFNA 3L1JA 1IVYA 5AI4A 1K4YA 3D2BA 4X6XA 4E14A 3TGLA 1YR2A 4N8SA 5I9IA 1THTA 1F8UA 3C5WP 4PF1A 5ESRA 3DDUA 1UWCA 4M0MA 2PSFA 2XUAA 4B83A 3D3NA 4HXFB 1YS1X 1B41A 4OB6A 4LXIA 4Y2XA 3I2IA 2FJPA 4Q3KA 3MUOA 2JGMA 1JKMA 5EIEA 1W52X 3HZOA 4HRXA 2OQVA 1A8QA 2WHQA 3CCCA 3GUUA 1ISPA 2OAGA 1Q83A 4KYVA 4G9GA 5LZ4A 2DFPA 1L7AA 3BF8A 4AZ0A 1L7RA 5EHQA 1JT2A 5ALIA 2GYWA 2JGJA 4LYDA 5ALOA 1KEZA 2WU4A 3D2AA 2QKYA 5AP9A 2XE4A 4INZA 5IVHA 2XQKA 1UZAA 4MJ3A 3H2GA 1F6WA 4JEIA 3ANSA 2GZRA 5E4JA 2B9VA 3SWWA 3IULA 5DYTA 2WFLA 1QIHA 1DT5A 3MGAA 5FP0A 4PO3X 2H1IA 2DCMA 5JZBA 2OGSA 4EA6A 1QGED 3WYDA 3PE6A 1M33A 1ODTC 3RKSA 3M83A 5JALA 1OCEA 2QUBA 3QMMA 2QXUA 4E15A 4CFSA 5YASA 2XQFA 1CUXA 2XUKA 4FMPA 2IX9A 2RHTA 1W1IA 1E3QA 2O2IA 2VJAA 2XUDA 4I19A 1O6FA 2WIDA 1OILA 1ZGBA 1RWQA 4DTCA 3IUQA 2CEKA 4MQMA 1BEEA 5ALFA 4ZRDA 2GZSA 4DIUA 4U2GA 2ZJFA 5CT5A 1WM1A 2OCIA 1QJ4A 2AJDA 4W9RA 3FSGD 1HL7A 3R3VA 5EHZA 2GBGA 3WA7A 5AM3A 1P0MA 4GECA 3F97A 4AB1A 5D3ZA 2WUDA 3OG9A 4GWLA 2PUJA 4CCYB 4KE8A 1BROA 4KR0A 1GZ7A 2ZJ7A 2Y6VA 1YA8A 4KAFA 5C8XA 1P0PA 4WFKA 4U2FA 1UKBA 2XI4A 3UMJA 1EXWA 2WTMA 3G0IA 3N2ZB 4Y2VA 1UKAA 2J3DA 2BGNA 1EI9A 5CT8A 3MUNA 5AM2A 4LKOA 1EHYA 4JNCA 1VXRA 3HACA 2PPLA 3I6MA 3WI7A 3QPAA 4F21A 4Q1VA 3K6KA 4B81A 4UHHA 3W06A 4K6GA 4MEBA 3WWCA 4PV7A 2HU8A 4ITVA 1UT6A 1TKRA 5CH5A 3DL4A 3C87A 3EBLA 4K6KA 2PU5A 3TJMA 3G0DA 1C4XA 3AIMA 4H7FA 1USWA 5LIPA 1ETHA 1JU3A 1W76A 1WB5A 1D07A 3W9BA 5JATA 3CCBA 2JGKA 1MJ5A 5FOQA 1HPLA 3G7NA 5ALYA 3AIOA 5T4HA 4W1PA 4IO0A 3GFFA 1CUIA 4BCDA 1BU8A 4G5XA 1ZJ5A 1VXOA 1SOMA 5HF5A 1PJAA 4N8EA 3O4GA 4BB0A 1ORVA 2BJHA 5CT4A 2P8SA 3G0GA 5AM0A 1A8UA 2HIHA 1XQXA 2CMFA 4UFOA 5AI8A 3V48A 1W75A 3QPDA 1EK1A 4FKBA 3B12A 4L3WA 2WUGA 2ES4A 4NMWA 4UBMA 4N8DA 1R3DA 4GDMA 4UHBA 3WL5A 4JH0A 3WK6A 1NU6A 4BE4A 5EFZA 5LLSA 1MO2A 1E66A 3WIOA 3DYIA 1WOMA 4W1RA 5DTJA 2WU3A 2WIJA 3DKKA 2VATA 4A16A 3VJLA 2H7XA 1GT6A 4G4IA 1DQZA 3ICWA 2VAXA 3G9TA 2WFLB 1LZLA 2VT7A 3I2KA 5K3FB 4J0DA 4W1SA 2ORYA 4BRZA 4H7JA 3LS2A 4B0PA 2JEZA 1SCIA 4M0FA 2QRUA 2G4LA 2WTNA 1ACLA 1UKCA 3PUHA 1EVQA 2HHAA 4BVKA 2O7VA 2C5GA 2XUIA 3TEJA 4BC0A 3WIBA 4B0OA 5AKKA 5ALGA 3WL6A 1CUDA 1YAHA 1UFOA 2HRQA 2OG1A 4BVJA 2I78A 5DWDA 1O6GA 2HM7A 4J0CA 3EF3A 4DMCA 4UUQA 5FLKA 5FUMA 4P93A 5HK8A 1KU0A 1UOPA 2VAVA 4BTLA 4MWSA 3O9VA 2Y6UA 2HFKA 3P2MA 2XMQA 5AKHA 2YASA 5J3JA 1GKLA 4BDSA 3IUNA 2QM0A 4GEGA 2DHDA 5LZ5A 5AM4A 5AIBA 1IUOA 4PQEA 3HJUA 1FJ2A 4IH9A 2BUBA 3H1AA 4WFIA 4FBMA 4MEAA 4W1QA 4KE7A 1HBJA 4UHFA 3I2HA 1CUYA 3FAKA 1CUFA 5EHXA 4X90A 3OPMA 1QFMA 3AINA 4XX1A 5AI6A 2RAUA 3HYSA 1UK9A 1DX4A 3ZLUA 1DT3A 3WKBA 1U65A 2JF0A 2B61A 4KEAA 2WJ6A 4OYLA 3E1GA 4EY8A 3V1NA 3WQHA 1WHSA 4PSCA 3A6ZA 1P0QA 2XQJA 1W6RA 3DYVA 2WM2A 2XUQA 5A62A 2PUHA 4QWMA 3E4DA 2R8BA 4J7AA 4PNZA 3LIPA 2XLBA 3STVA 5ALMA 3BJRA 3FYUB 1XKTA 3BXPA 4FDMA 2V97A 3GA7A 1JU4A 5AKIA 1RYYA 1MAHA 5KWIA 5JZ9A 4UBIA 5AJHA 2DHCA 1EX9A 2QTBA 1Q84A 1CIJA 1BE0A 1XZIA 1EDBA 1W4LA 3L1HA 1LBSA 4X95A 3WK8A 4L9AA 3PI6A 2VSQA 3F96A 2JBWA 3B3QA 1C7IA 4WJLA 4GBGA 5JARA 5IKXA 4DMKA 3H2KA 4DNPA 4HRYA 2DR0A 2XMSA 1XZAA 4F5ZA 1MU0A 2XB6A 1CUEA 2QOEA 1I6WA 4AN1A 2VF2A 4FTWA 3FSGA 5IVDA 1VJ5A 4BBZA 4P92A 3IURA 3UUFA 5CXUA 3K9BA 1UK7A 4MXDA 2XMGA 2XUOA 4P9NA 1UOQA 3WK5A 5C7YA 1S8OA 1MX5A 4MWTA 3FVRA 3ESBA 2Y2VA 2AJBA 4WDQA 1H2ZA 1GXSA 4I4CA 1DTEA 5E4YA 4QNNA 1CEXA 1QIFA 3KSRA 4G8CA 4PSUA 5ALNA 4N5HX 4H0CA 4V2IA 4J0KA 3H18A 1BCSA 4H77A 3DKRA 4C4XA 1L7QA 3ZV7A 1CQZA 4XIIA 1R9NA 4OD0A 2XLCA 4X85A 4OU5A 3QYJA 1K6EA 1CUUA 2Q0XA 4LHEA 1ZIYA 4KAJA 3SK0A 4ARBA 1XZDA 3LCRA 1H23A 1LLFA 2XUHA 5AICA 4EY5A 5AOAA 1QONA 5D6OA 4DSZA 5JADA 2WIKA 1CUAA 4FHZA 1XLUA 4BVLA 1VA5A 1LPNA 5FXMA 4U2CA 1VKHA 2Z5GA 1HQDA 1CUZA 2VJCA 3AUKA 3O0DA 4DMFA 5HF8A 2C5FA 4AX4A 5C8ZA 1JMYA 5ALHA 1AQLA 1QIGA 3RLIA 1WHTA 3R40A 1WPRA 2QR5A 3FOBA 4UBLA 1CUWA 3H2IA 5JIBA 4QDOA 4N5IX 2CUTA 4BDTA 5JD5A 4J3JA 1MPXA 2W6CX 3DOHA 1XKLA 3U1TA 1GPKA 1MX1A 3FVTA 5ALWA 1WCYA 3DD5A 4CIBA 3FWHA 3DL7A 5ALLA 5FRDA 4C87A 1F0PA 3A2MA 2QS9A 1IUPA 5CXXA 3R3ZA 1G5FA 3HC7A 4EB0A 1XZGA 1YA4A 2I3ZA 4XJVA 2JGEA 3W04A 1CFJA 2HA5A 3PUIA 1K5PA 4C88A 2QVBA 1EK2A 5A2GA 1R1DA 5KREA 4U2DA 3WKCA 1QO7A 4AO8A 4AZ3A 1A7UA 2B4KA 2OCKA 4RE5A 3R0VA 2G5PA 1VOTA 3UUEA 2XUFA 4AXBA 1ZI9A 3C5VA 1U8EA 3WWEA 4DNOA 1LBTA 4KAAA 3G0CA 1CUSA 1TIBA 5CT9A 2PSJA 1G66A 5JAUA 3FLBA 3LIIA 4LXHA 4KE6A 5LKAA 4WY8A 1ZI8A 1CLEA 3AZPA 1QOZA 5LZ2A 3R3WA 4A5SA 1FSSA 5AIAA 2C58A 2XMRA 2HA4A 3IUJA 4WFJA 4KRYA 3V1LA 5F4ZA 1JJBA 1N1MA 2WQZA 4ZI5A 2CZQA 3S8YA 1XRLA 3QMVA 4F0JA 3STXA 5CW2A 2BKLA 4RE6A 3SX4A 4ARAA 4FFVA 3F8SA
chains in the Genus database with same CATH superfamily
3I2GA 3OJ0A 3OMXA 4O4JA 1I7SB 4EY7A 1YRLA 2WE8A 4G0PA 4QOGA 3CNHA 5FTWA 1J9GA 5BW4A 3A4TA 3D8TA 4OL9A 5KQLA 1NONA 2VHUA 4AZ0B 1OWNA 3BL8A 4L76A 3OFKA 5DWVA 2FEPA 4UTOA 2WUWE 3HVKA 5D7BA 3WBFA 2J3QA 1G59A 1VMIA 2GN6A 3SZUA 1XFAA 3ZI4A 2XX3A 1LPMA 2VSOA 1X7GA 4CDNA 3R5SA 2L2QA 4ZRMA 3U3RA 4F97A 4ZIRB 2H0QA 3A2KA 1VJRA 4F11A 3EDQA 2FR8A 4KCGA 4Y1RB 3T7KA 3FOCA 1O96B 4EO9A 2VJMA 1CQJA 4MRMA 4ZICA 4JBNA 2G67A 1YVRA 2PJUA 4M8NE 5T4EA 3ZPXA 3ZXIA 3OP4A 1Y7PA 3HYNA 5DYGA 2H2DA 1V5WA 1YZTA 1IIRA 2I2CA 2SCUA 3FYHA 4ZQFA 3ZWQA 1AC5A 1SCKA 1ZMOA 2I66A 2R8YA 2J4CA 1EJ0A 2VYCA 2W2KB 3H2ZA 1Z6TA 5I9BA 1WV0A 4E07A 3KYCA 3TX2A 1GQQA 1K6JA 1M5TA 1E5DA 3T34A 5A3SA 2JA2A 3W2EA 1CUBA 4B85A 4IRMA 4O08A 4P36A 1X1CA 1AHHA 4TLBA 4OH7A 2B92A 3WLNA 3A58B 2BHNA 1RHJA 3HDVA 4CKBA 4OX9Y 1T9ZA 1RRKA 5KHAA 5DLDA 1HYGA 3W5SA 1SHTX 3H5OA 3WE7A 2BMAA 2QYTA 3IOMA 5EP2A 1C9KA 1EDEA 2C0QA 1VE6A 2F4NA 3OVMA 2VDVE 4YV0A 2VUUA 3OZXA 4PYQA 4UTPA 5JD6A 2PGXA 1HK7A 3BDIA 3PC4A 3QTBA 1H9AA 1Z0KA 7GPBA 2ZVJA 5FJJA 1P5ZB 4M0EA 1LSUA 4YAWA 2RAVA 3HDTA 1SVLA 1VE7A 4IWYA 4HNAA 3N58A 3E70C 4V38A 1M2OB 3PFWO 2HIAA 2OAQ1 5ALRA 4OHZA 3K9NA 1I3MA 2FSSA 4CLRA 4R51A 1MEOA 5CDUA 3HB9A 1NATA 1NLUA 2ADOA 4FYWA 2PGLA 4Q18A 3TGPA 4NMHA 1LB1B 1L4EA 4FINA 2OM2A 2XITA 3LRPA 3RAJA 2AXEA 2DY1A 4B2IA 1NNLA 3ORYA 1MB2A 3R2JA 1SA0B 2Q8QA 2F3UA 1TA9A 4YWHA 2R87A 4DAOA 3GMSA 4Y18A 5DM60 1SC4A 1Y1LA 2ZXEA 2FSIA 4G0XA 5JAHA 1SR8A 4YI5A 3H9UA 4GXRA 1Z18A 1FDRA 4QBHA 5DLEA 3LQQA 2YDXA 4I4TB 3IKMB 1UH5A 1EP9A 1QH8B 5B1EA 4Q82A 3CISA 4OXKA 2AZDA 2FEKA 2P4QA 4HK4A 4MVYA 3WK6A 2PYZA 1ZYUA 2C3UA 1BO6A 4CMIB 1T5TA 1A5SB 1QIEA 2Q1WA 3DZBA 3TIXB 4JIGA 3QA9A 4RKFA 3H4IA 3VYRB 4O33A 2F9LA 3DOCA 1XTPA 3ILSA 1HFEL 5KYXB 3KKLA 1LEHA 3GP3A 2QK4A 3FAZA 4K9DA 3ZWWA 4E11A 4HDKA 4QAJA 4FDVA 4PGHA 2QNIA 1E2QA 1ESNA 1FFXA 1T0UA 2JHPA 2GASA 5G41A 3HBNA 3CPHA 2LV8A 2Y1GA 3JQ9A 1RCTE 4IUBS 1DIBA 4JVMA 2Z04A 1JDUA 1EH5A 3L7CA 4RBNA 5BWLA 5B64A 5M5BA 3U4CA 1Q7TA 4C08A 2ERYA 3DVAB 2QN2A 3T4UA 3THWB 2EHDA 3FYUC 1NHWA 1C7EA 3GFTA 3HXPA 5DLQC 3EX7C 2RGRA 3GWGA 1I7LA 1CY1A 3PE3A 1EVYA 3FPGA 5IEBA 1SZPA 2DKNA 5BT9A 5FAKA 2QZPA 4MKZA 1K7EB 4HTFB 4PXSA 4DYVA 2QSUA 2JEYA 4X71A 4CMCA 3TL3A 4GI2A 4D0SA 3H5NA 4U7WA 5ELLA 2QRHA 2YOFA 1CS4C 2IUFA 1P6XA 2IXFA 4RZHA 5HFAA 5LC1A 1TYZA 5JAQA 3WGUA 1MB3A 1U6IA 4J4TA 1J23A 1HNZB 1W1WA 2AG0A 4Z8YA 3GROA 3ZHOA 2BSXA 3A8TA 2I4OA 2B21A 1K0FA 1XRQA 4MVJA 4X93A 4X8OA 3U7HB 2ZIZA 4RNDB 5FTMA 3RVSA 2BFDB 4IOKA 1PFQA 2JGLA 2OM6A 4NS4A 4QTXA 5DSXA 3IAM1 2PUTA 3B3GA 2VXYA 3ZIAA 4C0BA 3NVMB 2GM4A 4YCCA 3DH0A 4WRRA 3UHAA 1JAZA 2BT4A 1IJFA 3LQYA 4GPIB 4BLSA 4EA7A 2C0PA 1QLJA 1NW9B 3UC9A 2OZPA 3QF4B 2JGNA 1EQUA 4OATA 3ROPA 2A14A 3EQZA 4CG3A 2DULA 4IFTA 2CNWD 4F96A 1GGVA 3CXRA 2V55B 3OKAA 4YH1A 3WX0A 2PHZA 2Z8ZA 1OZFA 1OLXA 3PL5A 2GERA 1UFKA 2XDYA 2ZQZA 3AKCA 3UK0A 4AS3A 1C7QA 2VPYA 1JLLA 1QGOA 2EBWA 3Q4GA 4LDJA 4CM7A 3P9SA 4HSEA 2P2LA 3L4JA 4I50B 1P1JA 2CFSA 1E60A 1HXHA 2FEMA 3GJ7A 3OD1A 3OQPA 4YP9A 2BGRA 3W4JA 3IALA 1NI3A 3LWZA 4U63A 4X6UA 4ZVMA 3K35A 3F73A 4CMEA 4CEIB 4TZTA 4CG1A 1Y82A 4D5EA 1HF3A 3PBKA 4Z99A 4DIMA 3AILA 3ZDEA 2HMWA 2XZPA 4IILA 4XW2A 4GVLA 1EFVB 3SS9X 4G07A 2CJXA 1BZYA 2H48A 1YK0A 3O3OB 3R0IA 3SPXA 5CRIA 1BEZA 5GZ6A 4D8WA 5AW4A 1TQDA 5KSZA 1SK8A 4HLUC 2VDRB 4QOFA 3KALA 1T6ZA 2D62A 3F6PA 3DBRA 3COPA 2VT2A 2C0CA 3UKOA 4A2QA 1C81A 1Q0RA 1WKBA 2CL6X 1PNTA 5IW8A 3UO8B 1E92A 2IHVA 4JYBA 3D5EA 5HF6A 1SB8A 1VG1A 5FPQA 1I30A 1BVYF 3VNVA 4A91A 3VZRA 2C2GA 2O4CA 1BX0A 1E5XA 3F9CA 2Q5OA 2HMTA 1CZNA 3SR0A 3DDHA 2ZLBA 4YUWA 5U1PA 1U3VA 1E8DA 1JEJA 4PC6A 3DO5A 2I55A 2R00A 4WKNA 2BFPA 3QFCA 3MJEA 1NRJB 1ZD4A 1U81A 1G8PA 3L7DA 4S3MA 4W8OA 4BWFB 1L3BA 4ZWNA 3UMCA 3MINB 2C29D 4QXOA 3WL3A 5M04A 2BTEA 3DHVA 2ZUSA 3L07A 2QLJA 2CV2A 3PXXA 2J0VA 1WMAA 3LL4A 3HZHA 3V1YA 1L4UA 1TUBB 2PM8A 3OZWA 1ZN7A 1X7XB 2HA7A 2RHJA 2I34A 3RDPA 5BW8A 5K45A 5TMPA 2IIBA 5CNKA 3E9DA 4C4AA 2JCBA 1R9JA 2ZTLA 5EIBC 4E5SA 1U1GA 2AFVA 1RXWA 4FFSA 4O5AA 1WDWB 5DMXA 3RVJA 5D8DA 1NBAA 4U2EA 4G85A 4EEXA 1LWOA 1RWNA 4G0QA 2V7QD 1YR8A 3KV1A 3IVGA 4UVIA 5B7QA 1QMPA 2FCRA 2Z2KA 4Y6QA 4QDTA 2P6UA 3K9CA 1Z73A 1EJBA 4QUGA 2A9VA 4OLFA 5EXPA 3TJRA 3MJDA 1X7ZA 2AN9A 2GM9A 4I46A 5JQWA 3VZSA 2A92A 2GJ8A 4NBSA 2ACVA 1ULHA 2JGIA 2QRPA 2AK3A 4JUCA 4ACBA 4BRUA 2HNKA 2RHBA 4IDDA 1QFSA 3F0TA 4KJXA 2BEUA 1SHUX 4HYTA 4FSHA 3DLTA 2H8KA 4O02B 2XBUA 4MYDA 4IQ8A 4BMPB 1DS6A 2Z1MA 2CV1A 4K88A 4DCGA 3DZIA 3FDIA 5MDHA 2B1IA 3FLAA 4JDUA 2VHQA 5F5LA 1I5OA 1NJSA 3NFRA 1UOOA 2P30A 3GFRA 4YHBA 5HP4A 2O8NA 3GJTA 3WL7A 1KP9A 2VBIA 1NVKA 3U37A 5KNCA 4Y6OA 2W8BA 1T9HA 4YAGA 2NNLD 1JDBB 1MTZA 4LDNA 3RS0A 4PVCA 3UF0A 5J43A 4O4LF 3KETA 1GDTA 1U0FA 1YI8A 3GLQA 4IVRA 3LCCA 1SG6A 3OTHA 4UZFA 5EESA 4I08A 4IFBA 3OQNA 3KD2A 4URYR 1BGVA 4F4JA 5AVVA 2CFRA 2XV1A 4BB9A 1R4NA 1U0SY 3MTGA 4NU0A 3PTAA 2V1UA 2ECPA 4OM7A 1AGYA 1RZUA 5DEOA 2H9YA 3RROA 1NXOA 3WNVA 4AXXA 3LFTA 2D1QA 1V9CA 1XQ9A 2OQIA 2Q6OA 4JLSA 1Z28A 2BF7A 2E9SA 4Y98A 1N5MA 2CB9A 1O97D 1X9IA 4DLZA 3A1FA 4Q4HB 1NAHA 3ZLTA 4R9NA 5LZ8A 4DABA 1TM2A 2ZB3A 4U7TB 2BLLA 2GZ1A 5LKRA 1T2VA 3I1JA 2WG2A 4O6VA 1V39A 4R5MA 2OEPA 1VGQA 1DOZA 2GJ4A 2V7VA 2XDQB 3NJ4A 3KEOA 1WW2A 4FT4A 1CY0A 3DCJA 4PYLA 1AUVA 1XCLA 2IY7A 1YASA 2HEIA 1ZXXA 4TLMB 1BX3A 4WKOA 4C7OB 4CMGA 4B31A 5KOJB 1NM5C 1CWUA 2XDWA 1XAGA 5JZVA 2OCLA 4LV5B 1Z8FA 4TOIA 3EIQA 1DI0A 1MJFA 3OIYA 5ELMA 4MINA 2WKWA 2O2JA 2IZ0A 1EM8A 1Z83A 2COKA 1W8DA 4CRWB 4Y9SA 2GB4A 3IIJA 4Q7JB 3KRTA 3RG8A 1GRCA 3GFQA 4L4RA 4NZNA 4KBYA 1Q17A 2L69A 3ENZA 1X6VA 1J6UA 1IZZA 1CF9A 1SUWA 1OLXB 2LNDA 2QDKA 2LDBA 1XDWA 2OBBA 3EVFA 3PT9A 2WF6A 1HFWA 1Q3HA 1WMEA 4JLPA 1GXSB 2IOHA 2VPQA 1F20A 3UOGA 5JJKA 2ZAOA 3LT1A 4FT2A 4OSOA 1L4YA 1VSQA 4ZOEA 3L1IA 4YMGA 1QLWA 2GHTA 1DJNA 2GZ3A 3M6WA 4PCVA 5F33A 3V7YA 1CC1S 3FCSB 4RD2A 5A5EA 4HNTA 2BI8A 3O90A 4C0KA 4PPNA 1ODFA 2GYYA 1PAUA 1DP4A 1L1QA 1A77A 3ZLVA 3UFXB 1DRKA 1KAQA 1W7AA 1O9GA 5A4DA 2F64A 2HDHA 2Q5HA 1GQRA 2CLSA 4AY2A 1RZVA 1UBEA 2LPMA 4AP5A 1MC1A 3T5TA 4R69A 2JCXA 3NHUA 4MYRA 4CE6A 3TUZC 3IMEA 5DBOA 5CB4B 2ECFA 4HS9A 3RHZA 4R3NA 2C7GA 3V7NA 2NIPA 3ZZMA 5C51B 1HMYA 3NHBA 4XRGA 3SZ3A 2ZSBA 3FPAA 4N9QA 4FYJA 4O2AA 3BIOA 3K70C 2I7DA 5BORA 4PEVA 2Z0MA 4BMZA 4K2AA 4OXIA 1TW2A 5FO1A 4OHXA 4HI0E 2XVAA 2GM3A 4KI7A 3DZGA 4INOA 4EVQA 3EXHC 2WK1A 3GG2A 3T7JA 3W5UA 5GJBA 3GUVA 1AURA 3DVAA 2JFNA 2LD4A 4ZT3A 3HPQA 1E9CA 5K4AA 1B0PA 2FW0A 3NBUA 3HVRA 4TVOA 3ESDA 1EP2B 1OMOA 4YA6A 3THWA 1VKNA 4PZPA 1KEUA 1AA6A 1CIVA 1NP7A 1VDZA 2V59A 3O3MB 2AG8A 4RS3A 3R7LA 1CYDA 1TECE 2GEDA 5IHXA 2I7XA 1Q1NA 1EUQA 1PJSA 3DONA 3QJGA 5HBGA 5JO0A 1VHTA 2NLOA 1D1SA 1ZZGA 2PH7A 2I6FA 4IGIA 4J6FA 4JGIA 4X6YA 4YK7A 3ZW8A 13PKA 2GJAA 3SKYA 3ESZA 1VFPA 5EMMA 3G6WA 3WGOA 2HJWA 4BO3A 3GLIE 1E69A 2XT0A 1ZJYA 5CA0A 4LVUA 1TT5B 2QZSA 4PX2A 1LPAB 1RWKA 3WYNA 5DSZA 4TTSA 1GEEA 2HFJA 1AY0A 3BXOA 3S27A 3I6IA 4J1NA 4EHAA 4ETWA 2HBZA 3UH0A 1QZXA 4DZZA 3N2EA 3RTDA 4OXRA 2C1EA 5COBA 1UBKS 4DDHA 5HK9A 2GZDA 3OPNA 1I9GA 2QTZA 1G7RA 4C07A 1W5EA 3C6XA 2Z98A 1I94B 1Q0ZA 1ZL0A 1KMHB 3MOIA 4HAVA 4FYKA 2O2ZA 3F5MA 4YONB 4EG3A 2BE9A 3X1DA 1V1MB 3RK4A 1SBIA 4RQBA 2LW7A 1N2CB 1FA9A 3FDFA 1NBEA 1LBEA 3ETGA 3L8GA 3TSOA 2QJOA 5KINB 8MHTA 2WY2D 3FGPA 5DYWA 2Z3ZA 1ZXLA 1YRAA 4RJLA 4EL5A 4IDEA 5JNVA 4OL0A 2J7PD 1LS6A 1ZG3A 3R1IA 5FBLB 2YHBA 5C80A 4PC1A 2JD1A 2OV1A 2C5SA 4KXNA 3U4QA 2A88A 3ADKA 3RWMB 1GAJA 4HFNA 5TV2A 2J31A 1NFQA 3QV2A 4FHGA 2PD3A 1OXMA 4MS1B 5REQB 1EIWA 5CFOA 5CJPA 1Z4IA 2H1WA 2IU0A 4QXRA 5FDFA 2R11A 5E1MA 2ADFA 1A9ZA 2BV3A 4DSAA 4RH0A 3TQCA 2ADMA 3AP1A 4HYEA 2WDPA 2Y1DA 3FG9A 3A11A 3D81A 2ATCA 3PD0A 1GYRA 1R12A 1IG3A 4KK3A 5E2AA 4QJ5A 1Y1KE 3UB4A 1DAPA 1P19A 3R6TA 3V7WA 5EY5B 2YJ6A 3GD5A 4COOA 2G1AA 1RYDA 3GI1A 3DR5A 4FZ5A 1Y1QA 4MS4B 4IZHA 4C7OA 1Z88A 3E3MA 4PYJA 3FNRA 1Y8ZA 1C8KA 3SYRA 2FEXA 2ARKA 3HB1A 2Q5CA 5IH7A 2OBXA 2V45A 4UXJA 4B6FA 4Z8XA 5EZQA 5HCUA 2IUTA 1FUKA 5EVJA 2FN4A 1N4DA 2OXIA 3JYHA 2C9BA 4HWTA 3KSMA 2AS0A 3FNIA 3HADA 3E22A 1KAHA 3IQGX 3A10A 2UYYA 1T15A 3OQHA 4JSYA 1LPPA 3PUVA 2QT0A 1RQLA 3RVNA 4YRNA 4TX1A 2C4MA 3ZU4A 4CN9A 2QBYB 1OT3A 5A7FA 2W58A 1UT8A 1XR3A 1LDMA 3C3PA 5JLAA 4AJHA 1UJMA 2PU7A 2FZCA 1T4GA 5A1JA 1IQUA 4KQJA 3QBJA 1GNTA 2GVNA 4TPKA 4CGZA 2OCAA 3VR6H 2PZAA 2FX2A 5REQA 1KIMA 1CB7A 1FS5A 4F7WA 5AKYA 1X87A 4KVFA 4JUIA 3VPXA 3ZWKA 4Z3OA 1XZLA 3OHPA 1NF9A 1PT9A 3DE4X 4YTEA 4R68A 3WNZA 4OQFA 5JV5A 2O7RA 3RWBA 1G4UR 2KMLA 1KVUA 2OKGA 4NMMA 4TKUB 5EYPA 1DWOA 4XB1A 1CZKA 3ADDA 2P6PA 2CNOA 4BP1A 1POXA 4YCDA 1L8OA 1ORWA 3DOEA 4UAGA 2QXTA 1I0ZA 4GMDA 5BYJA 3G5TA 1YB1A 1JDSA 2V3WA 1GCGA 5C8YB 1XLWA 5CIQA 1G1MA 1D03A 3OZ7A 1US8A 1NUAA 4YCBA 3C85A 1JSLA 3CTPA 1XK6A 1RJEA 1KOFA 2HRZA 3SD7A 4WNCA 1NN5A 3FCXA 4KX5A 4OYYA 1GUYA 2O2EA 1E2GA 2REQB 1ZGAA 1ZOSA 2D2IA 5JISA 4MUIA 2DHEA 3QYFA 2C3MA 1DEAA 3GN2A 2NT3A 1ENPA 2HJRA 5IAKA 2Q62A 1AZLA 4GMHA 4AZVA 2XXAB 3QMWA 1XTTA 2JZOA 3NT2A 3IAXA 3DCNA 2WD9A 3UBTA 1EE2A 2A35A 1JX6A 4X1YB 4JC4A 3U3XA 1NG9A 3F4BA 5CFQA 3EASA 4QBKA 2KLHA 4RPHA 3Q7RA 3TOCA 4P2BA 2G8LA 1JIJA 4R6WA 1PK7A 1CJTC 1I1OA 1PTJC 2EEPA 2QU7A 2CHGA 3VZDA 3P5SA 5C35A 5LSAA 1SIUA 1E1DA 1KMIY 3EGDB 3RVQA 3LGSA 1ZK0A 4KWTA 4PYMA 3G5LA 2PXCA 2ZYHA 1PNQA 4PAGA 1LTKA 3SC4A 1LUAA 5KOHB 1FSFA 4I4TF 4BO9A 1IN1A 1QH8A 4L16A 5AH0A 3WRWA 1QGDA 1V41E 3O7MA 5GWXA 4WE3A 4HCJA 3D4OA 4EAQA 4JB8A 3V42A 1U8YA 4GEKA 4BKRA 4NOKA 3UY4A 1VCIA 4IH1A 1P4JA 4ESHA 2YNMD 2OFWA 2WUEA 5CHYA 1XTBA 1JIIA 4BCCA 1BMTA 2AI2A 4BFZA 2IQ5A 4XVHA 2P4EA 4DA4A 2OV4A 2P3SA 4PAOA 5E6SA 3AW8A 1NF2A 2WAYA 3DBLA 2EVWX 4Z9BA 3TTVA 1UJBA 1GPBA 1RQ7A 4PQYA 3ZKWA 3PYMA 4ESVA 3ESYA 1J0XO 1DQSA 1B2LA 1GG2A 4HN2A 1K98A 5ENVA 4S1OA 4RLHA 4AJOA 3FGOA 3OLZA 4B3SB 1R4MB 3GT3A 1I33A 1CCWA 1TGYA 1XZKA 1IJBA 1QGYA 3QPCA 4NOLA 1D0SA 4TN1A 3TD6A 3GHYA 2NO9A 3DFKA 4CMEC 1BMFA 2A0WA 4FPXA 5F2KA 2B5WA 3A37A 3G9XA 5A0TA 1E94E 2I6QA 4ZOLF 5HBRA 2IWRA 4NFSA 3VPCA 4M4SA 3H5VA 3JVVA 2QM3A 1U9CA 1NPTO 4DC0A 5CB0A 3VX4A 1KEEA 1AN0A 3LSTA 3ZBPA 5I47A 1DEOA 2PKQP 4YP6A 5IAGA 4DIFA 5TX7A 3R0XA 1E5TA 3BFJA 2LKDA 4KFTA 4OQ4A 2QTGA 3FLEA 2I3DA 3WIVA 3I39X 5WRFA 1MOSA 3SIRA 1CE8A 3DTVA 4YJ3B 3DC7A 2DTEA 1G2OA 2EX0A 2JI6A 3K2QA 4F71A 3F6SA 3KT8A 4RMJA 2D2VA 1JHDA 1XDUA 3QH4A 5D01A 3B7GA 1KVRA 2BAGA 3Q88A 5BN1A 1Z6QA 3NU1A 4YJFB 3NOXA 2NP6A 1MD9A 2VXOA 3U81A 4B09A 4P7FA 3IJRA 3UENA 2IHZA 2YJ4A 1N2SA 4TMVA 4Y2QA 3H3JA 3GT4A 1NUTA 3ET5A 1JJIA 1YZHA 1CUVA 1I1QB 1V9SA 5A6VA 5F7XA 2OO5A 5KSWB 2Q9CA 2VC2B 2W2LD 2AOTB 3ENQA 2GBIA 3RF6A 3P9PA 1UBRS 3S1AA 5C5DA 4L8LA 3TM5A 4UNIA 3D5TA 1EBUA 1AE1A 1DXOA 4N82A 5GTDA 5EMLA 3B1KA 2GEKA 3FNBA 4UUMA 1D8AA 2NYUA 4EYSA 2R8PA 2RH5A 4U7DA 2GTPA 1PUJA 1CDOA 4W63A 1XCBA 1P72A 1SVOA 3RUDA 1AKYA 2FMXA 3A3PA 2A2ZA 4K9KA 3QYPA 5BV1A 2NU9A 1WXEA 2I03A 3MRTA 4PS0A 3UTCA 3S4YA 1RQGA 5B53A 2XRFA 3R6DA 3PNOA 5L8VA 5IM4F 4JU8A 4LFAB 1ZJ6A 4BNWA 5LQMA 1T9AA 4EKIA 3OHSX 1O94D 3QLVC 2L18A 1V8BA 2O6LA 1GUZA 4XQCA 4YDHB 5HQ3B 4D57A 2ZE6A 2OD7A 4N0MA 2GEUA 3OTQA 3VVCA 4ATNA 4F6LA 2V9CA 3KIPA 5B1SA 3VI4B 3J80A 1GGMA 4MW6A 2BP7A 2D1RA 4CF4A 4DLPA 1EFUA 1WP9A 4J76A 2OENG 1ZSYA 4N18A 1OQAA 3ERCA 3OU6A 4NZYA 1R18A 1WPXA 3KOOA 2C78A 2VJPA 2PX3A 2QPOA 4XQ0A 4YJDA 4ZDIA 2R1ZA 2HF7A 2O1XA 3PGMA 4D3FA 5B1DA 3AF4A 2QM7A 1X1AA 2ID9A 3I58A 2FKNA 2OVBA 4XWGA 2IH2A 2B8TA 5EA2A 3U80A 1Q92A 2ROQA 4H0FA 4XEUA 4ZJZA 1FFAA 4Q7QA 4IDFA 1O57A 2GEVA 5M2QA 4LYFA 1C1YA 1L5WA 5F9MA 4F3YA 3NBXX 4W5OA 3KDSE 2O52A 3LKDA 2BOVA 4NCNA 3G1TA 3LCMA 1EINA 1N5DA 3AHCA 2BGWA 1C5KA 2ZCJA 3OF2A 2F55A 3FYUA 1X92A 4GOOD 4DCVA 4D9MA 1SXJA 1UKVY 3F5DA 4JIMA 1DEXA 3IC5A 3KQMA 4OU4A 2C88A 4OI2A 1LCIA 2ZTVA 2GESA 3OZAA 5DHFA 1SD2A 5K1ZA 4MGHA 2FFRA 1QE0A 2FUG6 2PKCA 3JQFC 3KELA 2B35A 3UEOA 5E1BA 2BH2A 5FOXA 4Q15A 1AQYA 3OM8A 5IBPA 3JQ8A 3ST7A 1V3QE 2WJAA 2O2HA 4MV9A 3U60B 1QS0B 1Z2DA 1DEHA 1USUA 2PKYX 4LY9A 4N3NA 3K1AB 1YOBA 3KUDA 4QFBA 3VU3A 4CDRA 5ABPA 3D3KA 4C5AA 2Z09A 3DYBA 3ANMA 1ZGGA 4XQ9A 3S5UA 3LFUA 3OOSA 5AO9A 4HWKA 1XZHA 3ZHZA 4CKYA 1NUUA 4HT3B 3NTVA 3TJZA 3BIFA 3CXUA 4ANFA 3N6VA 4MJLA 3THYA 4CIDA 3EVBA 4K40A 2HMSA 4S1VA 4LYJA 4S0ZA 1C9MA 2O1WA 3A1UA 2PMKA 4RPIA 2PL9A 3RVMA 1GARA 3GPIA 4G0MA 2X2EA 2WF5A 5CJ2A 3JQGA 3QV1A 2C9OA 2QGNA 3AFOA 3DTVB 4YJ3A 4NYJR 4D9HA 3NGMA 2R7MA 1EBBA 2WTXA 4G8JA 1FNBA 5DLPA 1QKKA 1PJLA 3L7LA 3P9YA 1VE1A 1VI5A 4UBJA 5BSTA 2XB4A 2Y4NA 5ALJA 2QZ4A 4DXHA 1JMVA 1QM5A 1L7OA 2WG1A 3AV0B 3BH6A 3EPRA 4M98A 3EIEA 2YWFA 4AJKA 3M9WA 1E9RA 4G67A 5JYEA 5K8CA 5CYGA 3ORFA 1QP7A 4CR8A 3CRNA 2E87A 2GDZA 1DE0A 3LOQA 4LY3A 4DCPA 3RU2A 3RBAA 3C45A 2PYDA 2FRDC 4CNBA 3CRVA 2ZFUA 3S2ZA 2Y2UA 1UQTA 5L4LA 1E8MA 2Q3MA 4XGIA 1EIZA 2O5VA 1BHJA 1QR2A 1EM8B 4KIGA 3PQEA 5IKPA 2PL1A 4KRGA 4J1SA 3WB1A 2QJFA 3L4BC 3QW4B 4CM9D 3AUFA 5FQNA 4P35A 3PNSA 1NV8A 4HAIA 4GM4A 2PNFA 1XZQA 1NLFA 3FRHA 4G0VA 2BM1A 4H60A 2Q3EA 1II8B 3MRVA 4UC0A 5DYNA 1M8JA 4ZALA 4CWAA 5BSGA 3EMDA 1BHQ1 1I3CA 2O57A 2RKWA 4BX3A 4CKXA 2HMVA 4R1SA 1EFTA 3KDAA 2ECQA 3CX4A 2UV8A 4LXGA 3EB9A 1ZITA 4RXUA 5J23A 1QKJA 2VPZA 3U7IA 2FH5B 1V6AA 3I32A 4MGEA 4JT2A 1Q6YA 4ZAXA 4Z7NB 2Q6TA 2AF3C 1KZ9A 1OTHA 2Q3DA 2VO1A 4RPCA 2CLKB 2G76A 2YWBA 1S2MA 1O87A 5TNXA 3C97A 4MV3A 2X42A 3TZCA 2G63A 2YC4C 1XROA 5KTYA 3MJRA 2JLSA 1CKEA 1HDCA 3O8LA 5FUXA 2VTBB 3PG5A 5F21A 3RC1A 1W47A 1G8HA 3BRWD 3WNBA 2O2SA 2X0JA 2XOXA 1BYIA 2JJYA 2IV3A 4BQQA 1LNZA 4INPA 2AFIE 3ISTA 1VFNA 3JW8A 1EX7A 4XIYA 2P78A 5F1OA 3TBKA 1LJUA 4K2HA 2WU1A 1RW4A 4FNAA 4MAFA 4B34A 3WA6A 1GTJ1 1XWFA 3OICA 2JFHA 3D6TB 4D9IA 4RELA 4RTLA 4BWVA 4UPDA 3R41A 1B2RA 3D2CA 3BHIA 4M9CA 4YN3A 3VBEA 1QK5A 3ZVRA 4GWKA 2RAPA 4ZU3A 2H9AA 5CA0F 5CB4A 3COZA 2QPAA 1MOPA 1DFGA 4HMQA 4LCJA 3RIYA 3T3OA 2JI9A 1GPWB 1ULZA 3LJKA 5I48A 3PC8C 5LQUA 2ZRQA 4EITA 1M6VA 4TKZA 3VAAA 4G0WA 4OX9B 5H16A 3FPFA 4LF6B 1UXJA 2OZLB 4RIGA 1OY1A 1FW8A 1VL0A 5GADl 4DR7B 4CV2A 2OO7A 1PDOA 4JXJA 5IPFA 2AOUB 1K6IA 2BY4A 5CG1A 2XXBA 3R6WA 3UCFA 3DB2A 1CYEA 2P77A 3FYTA 5AD1A 4ZHQA 4JENA 1CUGA 4FQ7A 1Z4NA 2ZWMA 4YIHA 2GLXA 2HLDD 2VUTA 4HNAB 1XNJA 4YP5A 4HC4A 2X6TA 3OZCA 1YQQA 3KKNA 4ZVTA 1JL3A 1BW9B 2Y0DA 1BE8A 3C3KA 3M9XA 1JFFA 4PIPA 4RDCA 1OW3B 1U1IA 2C2KA 4BRSA 5G4LA 3NQ41 1REQA 3Q7EA 4QELA 4YNBA 3AHGA 1E59A 3DHNA 5LLTA 3GLTA 5HE9A 4MIEA 4G5FA 2R1VA 3N2YA 1HNXB 1ECBA 1VJDA 2WD8A 5K3FA 3HUEA 5KKCA 1Y1SA 3B8HA 3BEDA 3BMOA 5DHRA 1WXXA 3TYXA 2AYXA 3T9BA 1Z6PA 4BBAA 3G9UA 2CDAA 2PAAA 4ZQBA 4GG1A 3W0LB 2FPGB 1YUBA 2ZT8A 3DBHB 4MQLA 4PYNA 4WPGA 4GSLA 2OY0A 1Z5VA 2YC2C 3H87A 4NJEB 5J4HA 4KN8A 1XNHA 2WHPA 2PE5A 4YRCA 5JC8A 2RBGA 1HEUA 2CB0A 1XTJA 4NSNA 2VH2A 5CDFA 2H52A 2SCUB 2FQ1A 4GGMX 2G9NA 2W42A 5FBWB 3FYCA 3ONFA 3AB3A 3PNYA 2ZJ2A 3K9GA 4OKIA 3VPFA 1LH0A 3ZZ0A 2J3JA 3GNLA 4IGFA 1J0DA 1PR6A 3SSAA 5L51A 1J33A 1Z39A 3KTOA 5C0OE 4RHFA 5FWXA 1E2FA 1JE0A 2E1RA 1DRVA 4LC0A 2R7NA 3HJRA 1Z2AA 3VNRA 1CDEA 3T38A 4KO3S 4I1VA 3KQNA 1YL5A 1K3FA 2PX6A 1IEVA 2ZI6A 1VYVA 2J4DA 3C3CA 3MD0A 1YGPA 3CLUC 3KAQA 5K0LA 1XLVA 3R9KA 4OIMA 5C8VA 3IV6A 2QQ5A 2H5LA 4UVHA 5LM3A 1Y3BE 1SWVA 3H9CA 1V25A 2QAGC 1CV2A 4QARA 5EGNA 2KX7A 3ZY2A 4R2WA 4M0LA 1T2NA 5GONF 4Z86A 4U02A 2GSDA 1ZRSA 4NEHB 3VTAA 3ANNA 4OI0A 2C96A 1PP4A 1GFZA 4B3RB 4R7TA 3KZ1E 4K28A 3OTGA 2PQ6A 4LSGA 1G3UA 2IUYA 1WXQA 2HH9A 4MZXA 4ZDWA 2FOXA 2O1EA 4OHBA 3FFTA 3IUSA 2IPXA 1NBME 5EJ2A 8ATCA 3QZUA 2BFCB 1Q0PA 5KQRA 1TCCA 5AWFC 1U1CA 4J90A 1XYGA 2UAGA 3G89A 4B48A 2DQZA 2R60A 5T8KC 1KE1A 2NTYC 2WOJA 5B4VA 4YV7A 2GCOB 1HYBA 5AXAA 4BAUA 3L6EA 5IF9A 4RHCA 3OP1A 2BGLA 3PRKE 2BCEA 1UJ6A 2BFAA 2AR9A 1PQPA 2G40A 4CIYA 2EATA 4F2PA 2QN8A 4QHSA 4WDRA 4ER3A 3UZUA 1SKUA 4XX0A 2FW6A 1L8AA 1CUHA 1WHTB 1MOZA 3MQ2A 5BNWA 1QF6A 5CA0B 3M82A 1N8KA 4NLLA 1QX4A 3E5NA 4RSRA 4FZJA 1GNPA 4O2LA 4GI7A 3BORA 4CLRB 1UJCA 4CCWA 4DJTA 2VS1A 2P67A 4COKA 3DV9A 2JIMA 3JARB 3P45A 5SY9A 3MXTA 3M5WA 2X5XA 4YJGB 3TE7A 3PJRA 5IABA 1HT1E 2WYHA 3QY0A 4JI7B 1Y42X 2EWWA 3EUAA 3GA5A 5GVSA 2IS1A 2YFKA 5BSRA 3FTFA 2C61A 3RSQA 3O2SB 1M34B 2XTZA 2K4MA 5FTNA 3CBGA 2ZVDA 1QH0A 3PD1A 4MW4A 3PIDA 4X94A 5JDCC 2I22A 2WUVA 1U9IC 5AJVB 5KTOA 1GZ6A 3LI2A 3RQIA 2ZUFA 2MR6A 1HLGA 2CK3D 2AXPA 4L4SA 4NAHA 4FZ3A 4LVOA 1LW6E 1T8WA 3KQWA 3MGKA 4D82A 4KIUA 1K7FB 1UANA 2OESA 3AUSA 5EZYA 3U3JA 4AZ3B 2NYAA 4CN8A 3KWMA 2GNOA 4L95C 5CVCA 3DMHA 1OWLA 5C8YF 4BKPA 3PVSA 4BGEA 2ONCA 4UBKA 4CLEA 1JBEA 3UJBA 2X8BA 3HKCB 4CQNA 3OM0A 3N0WA 1F0NA 4OHMA 5K3BA 1CR6A 1TXGA 1T36B 1SVUA 1TFRA 1XQWA 3GEGA 3PNVA 4LQDA 5BRNA 1IHOA 4RESA 1OIVA 2MSLA 3PJFA 3GGOA 3SJBA 3F8WA 5A03A 2ZPTX 1HTTA 3KQHA 2FXIA 4FW8A 5DW3A 1OE0A 2IK8A 2H54A 3COJA 4JKYA 1SEVA 5GQSA 3SMQA 4OY3A 3NDIA 1AGXA 1HKHA 3CUYA 4YJFA 1S7CA 2PSEA 1QXSA 3FUVA 1PG5A 4IZ6A 4B4UA 2GHRA 5ENDA 3A70A 2OPHA 1FMTA 4RWEA 1JR3E 1W5TA 1YDWA 2JZNA 3NS7A 4BP8A 1S89A 2WOOA 5FT9A 1J49A 1OFVA 4JJ4A 1G9SA 1IH8A 4NJEA 4LZLA 2ZS9A 3CW8X 4LS3A 4CCAA 1ZN9A 1II8A 2PSHA 3EDCA 1P0CA 3NPMA 4HDMA 4WEQA 2HHLA 5KC9A 5LZ9A 4LJ7A 1ZUD1 2G9RA 2YJTD 3OCJA 3D4IA 4GVXA 1D5WA 2ZB8A 4YP0A 3V5NA 1J07A 3MGBA 3TK1A 3Q8LA 2JH8A 1PEYA 2VYFA 2PL3A 4R16A 1PFGA 2BFNA 3AJEA 3HEBA 3L8DA 3Q3IA 5AI4A 1K68A 2JHCA 3UJ7A 5IKEA 3FGZA 1NXTA 2DB3A 4KVZA 4X6XA 3PEWA 3DDNA 2VPPA 5A04A 4KMSA 1YDFA 3DMTA 4L5YA 1L9XA 4N8SA 5G0UA 4KDCA 1THTA 1TMGE 1V7CA 3B89A 3H99A 3C5WP 2ZR9A 3T8YA 4C0AC 1H8HA 1X1QA 3P8ZA 4GNKA 4HJXA 5ESRA 3TXYA 3DDUA 5B3JC 1YR3A 4TWBA 4RYDA 3U1VA 4YYEA 4DIBA 3L6OO 4KFCA 1BD3A 5GONB 3G8AA 3QBDA 1NYLA 1TOAA 3K0CC 5H3LA 3D3NA 3HYRA 1SRRA 2HCBA 3AX6A 2DT5A 1Y4DE 4AJLA 3SVTA 2PTHA 2FUEA 2DY0A 1LY1A 1FLDA 1TMYA 1MF7A 2CDNA 1JNXX 5KC8A 2AYYA 3M8KA 4Y2XA 1FUYB 4JASB 3F4LA 1RLMA 2R6R1 1SXPA 1I4DD 3HBJA 3UWSA 2GN1A 3OTWA 1JKMA 1YH3A 3ITEA 5EIEA 2GA8A 1N9KA 2O0LA 2XTAA 3B6MA 4MWBA 3BQMB 4G5YA 1VJCA 5H70A 3LYHA 5AK0A 2HMYB 1V3TA 2ZIFA 3B82A 3CJQA 4OHPA 2P0AA 1P3JA 2WHQA 3HUUA 1T3TA 3C3WA 3V7UA 1BQ3A 4OHCA 5TARA 4CTJA 4RHUA 3QWFA 1WL8A 4L50A 4D42A 3HU5A 4OTZA 2DFPA 4DLVA 5ELXA 1JDBC 1G0OA 4R9SA 1GILA 2BGMA 4PHTA 3K5IA 5C8DA 2BLNA 2ZT6A 3IEKA 2COUA 4AZ0A 5J4KA 4ER7A 6REQA 2UUPA 4OXNA 2WLTA 5CFZA 2ORWA 3CKKA 2QD4A 1A7JA 1RR6A 1A5BB 4LYDA 5LA6F 3ZNPA 2P91A 3ZBUA 1XG5A 4EJSA 2EL7A 2WU4A 1W87A 3SJUA 3THOA 4DY4A 3P4UA 1P2DA 4GPAA 4QGFA 3OJXA 4RVGA 3TL6A 3SIXA 4B43A 2XQKA 3FCEA 1DAHA 2CHFA 1VHQA 3QVOA 1JA9A 3TEFA 2DUMA 3V7FA 4YFVA 2UZ3A 4J16A 1WU7A 2E49A 4MJ3A 5I4CA 3O03A 4J91A 3H0KA 3H2GA 1E58A 4ZV4A 3I6QA 1CZHA 3O8QA 4TXLA 4LZPA 2RGXA 1Z56C 3NP7A 1PWZA 3ANSA 2MSDB 4M7WA 1PV2A 2B9VA 5BNFA 3ZBQA 4DPKA 5JAIA 1C8BA 2PZBA 2QX7A 3QXCA 3SWWA 3LD9A 2G4VA 4YS6A 3GRFA 5D2CA 1RHKA 2CJWB 2CLLB 1DT5A 2W6PA 3MGAA 4PO3X 2HBQA 2CF6A 3Q3HA 2J33A 4NU8X 2ZR8A 1WSDA 2DCMA 3PTLA 3ODPA 4MHTA 2VJQA 3MT7A 3I83A 1ZW1A 1QFXA 1RHMA 1QGED 3SYNA 1NVXQ 3PE6A 2GRAA 1M33A 3ZR4B 1LVGA 3K1TA 1ODTC 4LJ8A 5COAA 2QT1A 1VYTA 4RDXA 3VC1A 4ZQHA 3ZWDA 3TQQA 4RZUA 4O59O 4BB5A 2QXUA 4FC7A 4BRWA 1D9XA 3OKFA 4GICA 4RD3A 1KBOA 4S12A 5IK2A 1A9XA 1CRZA 2N1MA 2NGRA 2XQFA 2YVAA 2ZUCA 5JE8A 2WQ6A 2VHZA 4HH4A 4I5IA 2XUKA 3B1VA 3C3DA 3FUUA 5A0FA 1MVNA 3TSCA 1OR8A 2IX9A 2J3MA 3R09A 3TW0A 2AFRA 1B43A 1CW2B 1NT4A 1RS0A 2AD1A 3KOWA 1X94A 1R5BA 3EXIB 1YVEI 3GEDA 3MZ0A 3RIMA 1WZNA 4V1CI 4OGWA 2XADA 2Z1DA 5LB4A 3UMMA 1BXRB 1FTNA 2C7VA 2ZRCA 3IKTA 2YQZA 3U4DA 3UAXA 5GZ3A 1TJ4A 4N41A 2XY4A 1O6FA 5DKFA 2ZUWA 3PI7A 1NAIA 2B8JA 2JLZA 4HGYA 2A7XA 1RWQA 1Z9BA 3NWEA 1XNQB 2IS2A 3HP7A 4M54A 3UMVA 1RAIA 3UTDA 2QVXX 3JQAB 5IC5A 1L1FA 1H1DA 2F1OA 5ALFA 5FWXB 3BGVA 3WOVA 4ZCIA 3JASB 4BNDB 2WZQA 4DIUA 1QV7A 1VMDA 2POCA 4N54A 5IG2A 4V1CA 4MV7A 1W9MA 2ZJFA 5CT5A 1QJ4A 1J5XA 3STHA 2NOAA 1VE5A 4FFBB 1FNMA 4HUQA 1HL7A 3M1AA 2A6PA 3CLSC 4GE3A 4CFZA 1W5BA 3GMDA 1VIYA 4JLAA 4PLCA 3RYCB 3K9FC 1IOVA 4OJTA 3ZEAA 1E5QA 1P0MA 1VPDA 2JA1A 2JIZA 3F97A 3K0EA 2VPXA 4GECA 2C5EA 4I99A 4II2A 1ZS9A 4B4OA 1SXJE 2WUDA 3I1FA 1IN6A 1ONOA 3RANA 3JZAA 4QU0A 2PUJA 4AJJA 2AEEA 4OSPA 3AR6A 3DNFA 5AW8A 3AVUA 1B3BA 1D8TA 1E3LA 4DDWA 4A0FA 3HGTA 3QENA 4B2YA 2R5NA 2PRKA 4LBZA 4YAFA 2GLUA 5HNKA 3OQ6A 3CUVA 2R62A 2OOKA 2G1KA 3VI3B 5HRCA 4LYHA 5C8XA 4FI3C 3FOWA 1PBTA 3PQFA 3KQQA 1QC5A 3CPSA 3QUCA 2XNCA 4WFKA 2X41A 4WN3A 3U7QA 4EB6B 4U2FA 4EELA 4YRKA 3ZW9A 2XI4A 4AMGA 3AVXA 4GYWA 4LWZA 1N2OA 3ZD8A 1B6RA 5J2TB 1EXWA 1JB1A 1N57A 2ZXUA 1QV9A 4RK7A 4GL2A 1NVGA 3N7TA 5ARDA 5FCDA 2NV0A 4B3JA 1WLYA 3N3AC 4ISCA 3BXZA 2FE1A 5B6JA 1I3KA 1P1FA 1Z0DA 1DCTA 2PTGA 2XT9A 4AJIA 2Q2WA 5HRUA 5AXDA 5CT8A 5I4IA 2C77A 1EAYA 3KOZA 3LRXA 1TW3A 4LFCB 2HJHA 1JSRA 3CT6A 4LKOA 4RJTA 5ICCA 4ZMRA 4YI3A 2QE7D 1G3IA 3A05A 5EQDA 3ZE8A 4JNCA 4D4GA 4YDQA 1GZ4A 1ADYA 3ZDXB 4LHVA 3LLSA 1T1SA 4KHZA 2Q6IA 3KVOA 1IHDA 2PPLA 4UPVA 1OFUX 4UCQA 1UP4A 4A8JB 4BNTA 4R6XA 4KU4A 4BLPA 4YCSA 4NH0A 2XCSB 1W5SA 4IL5A 1J8VA 3OX3A 2Q9BA 4YRQA 1MA3A 4B81A 5I7OA 5JS1A 1E2MA 8OHMA 4IIVA 4MEBA 1DARA 3MJCA 3NDBB 2LCFA 1M34A 3L1VA 4PV7A 1N6LA 3U17A 2J3KA 1E6EA 4HL6A 1C3VA 1FDSA 4PWZA 3QEOA 3EBLA 2YBEA 1MUUA 3KP1A 4ZOCA 3SR3A 3ETLA 3AIMA 4OBEA 3LCVB 3REGA 3HJFA 3T5PA 2ODWA 4XYLA 4JYAB 5J5VA 3I5XA 3DUWA 1USWA 3TSWA 4D98A 4LYAA 2O2YA 1A9SA 1ETHA 1EFRD 3PE4A 4X1OA 4N0EA 1E2NA 1MVOA 5AW3A 1OZGA 1TM4E 1U0GA 4J49A 2ZWOA 1U80A 1D07A 3W9BA 5KJFA 2MDTA 1STOA 1F12A 3LLMA 4ZC1A 5LQJA 3PRHA 3UJAA 4BO7A 1N2JA 3JWJA 5KDOA 1DCMA 3ETDA 1PT5A 2JGKA 1QFYA 3QX8A 5ENZA 3VSEA 4BNZA 1E7WA 1ZDMA 5IDWA 2N3ZA 1C0LA 2IPOA 4XUGB 5ALYA 5T4HA 4H3SA 4IPTA 4RWZA 3ZGNA 4CM1A 3KPWA 4MX8A 4IO0A 2J5RA 4QUKA 1MO5A 3E7PA 1BU8A 4S35A 2X7HA 2G0NA 4PNPA 3IR7A 1ZJ5A 3R9IA 3PDHA 1SCNE 1RU3A 3UG7A 2OCPA 4RA6B 3WG9A 3AVPA 2PO5A 3PHGA 4M21A 4QVGA 3FMVA 4MUGA 4Y0AA 1CULC 3PQ8A 4B3MB 3NWBA 4Q7KA 4EUHA 4BB0A 3BTOA 1R16A 2RH4A 4PLPA 3TAXA 1VHJA 2G80A 3FIUA 2P8SA 2XKJE 2Q9AA 3G8CA 3HSKA 5AM0A 4MKHA 1NJ6A 5EHGA 1XQXA 2CMFA 2J5KA 5AI8A 1ZHFA 3WYGA 2W2OA 1EHIA 1GUFA 1W49A 1LLCA 2FP3A 4KQ1A 3RLFA 4DLBA 1MH1A 5DSTA 1NXQA 4YMWA 5LA6A 1QFJA 3P19A 3WNDA 5HTOA 4FKBA 1CEQA 3N53A 5A3JA 2WUGA 2CFIA 4PG7A 5FD8A 4UBMA 1J8MF 3HHEA 4R8KA 2IU6A 2Q3HA 4N8DA 4GDMA 5FPYA 4C2AA 3R3JA 4TYMA 3VR5D 4JP5A 2Y1XA 4E2ZA 3HQ4O 2E5WA 4RHYA 5JTTA 3OIGA 2J9GA 5LBUA 3GB9A 5EFZA 4F7DA 1NBWB 2IA5A 2X4IA 5LLSA 2EQ5A 2FLVA 1SQFA 4AJNA 5B6IA 2ZAGA 1P1CA 2VDMB 2VDNB 1T9KA 3IESA 3JQAA 3N74A 3WIOA 2ZGVA 4DCCA 2WU3A 4LHZA 3AY6A 1E3JA 4RMIA 2I80A 4QVKA 1OFIA 4XFDA 5ICFA 3C98A 3QX3A 3ER8A 4A16A 3RSLA 3TQOA 3GH1A 1SCAA 4RTNA 1EK6A 2A3NA 1CJKC 1UBLS 2DT8A 2VDPB 2WVAA 3D9QX 2C8VA 1KQNA 1XYYA 1DQZA 3A32A 4LBYA 5FL7D 2LUOA 4FW9A 5I4BA 2CXUA 4Q9IA 2P6NA 3ZDFA 2QB5A 1J70A 3LU1A 4BHTA 5KOIA 2FW7A 3CEJA 1TM7E 5H02A 2WFLB 2VT7A 2F48A 4FGLA 5K3FB 5KNDA 5HR5A 1DQRA 1DC6A 1FDOA 3EGDA 2QD5A 2XWQA 4UUPA 1A4XA 3TRFA 1H66A 3ZLJA 5LOVB 3PP8A 4C0WA 1IPFA 2XVZA 5COQA 4QT4A 4W1SA 1K7SN 5PNTA 3L43A 1A97A 2QMZA 4IGEA 3MHTA 1ADBA 3C7TA 4LZWA 4P84A 4H7JA 4HXYA 5FFNA 4BRZA 1JQKA 1ZC4A 1VL2A 1SCIA 4M0FA 3U7FB 2P69A 2JJ8A 2FVYA 1I6LA 5M7EA 2BHRA 1KJ9A 2QRUA 2RHRA 5EJMA 2Q3BA 3DM9B 1LC0A 4LI0A 5HS6A 1EVQA 5SZIA 2X14A 2WJHA 4FGZA 3DAGA 4MVJP 4YUXA 2WMYA 4N7RA 2GEJA 1NRWA 1U8FO 1YKGA 2HSWA 4OI1A 1L5NA 5I4KA 4AU1A 1RXCA 1QVZA 1U2ZA 1P80A 3B1WA 4KL8S 4XGNA 4PPQA 2YKGA 1LK7A 2E89A 4J29A 2XB8A 4KAXA 4KSCA 2CXXA 5ALGA 3LM8A 3T1VA 2P5SA 4DZTA 1IBLB 3AEUB 3HKEB 1NKSA 2E0IA 2OP1A 4FOTA 4LW8A 1WVMA 4YALA 3TO5A 3VU9A 4RY0A 2RG1A 3V4ZA 2XCIA 2VZLA 1YBMA 1UDBA 3B78A 4TS1A 3V4SA 5L6LB 3MT8A 4GFDA 4MR8A 2X8AA 4KK4A 1KAMA 1VRWA 1YMQA 2WABA 2ZU0C 3EVAA 1NSFA 1NXSA 3C4VA 1RPNA 4Q9HA 4DQDA 5ADWA 4X65B 3COSA 4LBVA 4DA6A 1D2RA 2DKFA 4F4HA 3KKOA 4FX5A 4ASUD 4DMCA 2IFTA 4UUQA 5FLKA 3SZLA 1DRWA 3IERA 2K5UA 4EPTA 2I9PA 4KFSA 3LPDA 4MUAA 1RIIA 1R27A 4XVRA 4X61A 5F1PA 4BTLA 4FMBB 1N6KA 5EIWA 1ZBDA 4YBRA 1DC3A 4DPMA 3FWYA 1TJPB 2XNDD 3IP7A 4I1UA 2Y6UA 1YBVA 3IAS6 3P2MA 2UZ1B 5FIUA 1NUQA 4CTNA 2AWNA 4MW2A 4BMCA 5DBHX 2CVHA 4K05A 3B2QA 1NBOA 1M7HA 2GHQA 3DBIA 4X45A 3D8SA 2GX6A 4IXDA 3NXKA 3V2IA 1R6VA 4YMIA 1Z4LA 2JLQA 4X60A 3M0EA 1DAEA 1KBQA 4JT4A 2GZMA 3E48A 3HPRA 5A2QA 4QPPA 5DBIA 1R15A 5LZ5A 3ZQJA 2XPCA 1OB2A 4M1WA 4LJKA 4FB4A 5AM4A 5GGXA 1B0UA 5JCJD 4MOWA 3UOAB 3VNSA 5IJ9B 3GUHA 2AK2A 4P22A 3HJUA 3KXLA 3L6DA 1H2HA 1OH7A 8ABPA 1T0BA 5A4MS 1U0RA 1SUDA 3H1AA 1QYRA 2VP0A 3TL2A 4LV8B 1BWRA 2JD2A 4W1QA 4QNMA 2ZSJA 3F5QA 1JBKA 1W4CA 1CUYA 5JU6A 1T2FA 1FPMA 2XVMA 4W8HA 3LECA 1W36B 3ICQB 3NMUF 3WMFA 2ODEA 1S9DA 3CEHA 3GEBA 3CNBA 3QG5A 4LWPA 1YXMA 1PTJA 5E7JA 4BECA 4XX1A 3KHTA 3HUTA 3HYSA 3KPJA 4S1PA 2MHCA 3WADA 5BUSA 2YNMA 1XU7A 3ENWA 2D4AA 1I4LD 1R0LA 4FJ1A 1FMJA 4D8TA 1FUUA 3EFEA 1IHYA 3KEGA 621PA 2FWIA 3I34X 4D02A 1GCAA 2FG7C 3U7JA 1E1KA 2QAGA 2X3YA 3OIVA 3NRBA 4IXMA 4OYLA 5F5NA 3WQHA 1WHSA 1Z5ZA 4MROA 5IANA 1FRNA 4N4AA 4TYWA 2YIMA 2AVDA 2CBZA 5IKOA 1M1YB 1KYYA 2C5LA 3UJ9A 1A7KA 2JLWA 2V74B 2VPWA 1UMCB 3KSAC 4E2YA 1A50B 1RAGA 2ESRA 4PLFA 1KYVA 5ECYA 2DFKB 4EO7A 4FN4A 5A62A 4RGVA 4QWMA 5FX2A 4LHWA 2R8BA 3LVFO 1EQ2A 1V5FA 1WZEA 3E5MA 3UYKA 4ER5A 5CD9A 5HM8A 4B40A 2XLBA 2WWRA 3STVA 1U3GA 4AQ7A 1G5QA 2NU7B 1K06A 4R2JA 5ALMA 2P2GA 5LXTB 2JHFA 2QP9X 3ZXSA 4M88A 5JCOA 1AZTA 5TQJA 1XKTA 1MJGA 3D5QA 5ADHA 3CLRC 5K3SA 1E3IA 3LUPA 3R77A 4AY4A 1MC5A 4QXAA 3I4LA 3W8FA 4GKJB 1MAHA 3KQTA 5KWIA 1JEDA 1HMPA 1JG7A 4A0HA 2DHCA 4NZ9A 2CMGA 1Q11A 1Z06A 1Q84A 1K6MA 1CIJA 3MWJA 4EGAA 1Z0AA 5F3DA 4DLLA 1BVHA 2JIZD 3SN6A 4CKWA 1IFXA 2QI9F 4QOEA 3U9SA 5JEEA 3L1HA 3OLCX 3NCTA 5EQTA 5KNLA 4KSBA 1A98A 4YJGA 3WK8A 4L9AA 3RWOA 1EFCA 4L02A 3COVA 4FHFA 2R96A 3R7SA 1US8B 3DLHA 1T5BA 1NVBA 3TSZA 5I7SA 3GUYA 1YC2A 1SC6A 1VP3A 4R54A 3CX6A 1YRWA 4YAKA 1OF1A 1DCKA 2WKPA 1ID1A 3BGOS 3KPUA 3NAZA 4HP8A 4N65A 3CONA 1SVKA 2C5BA 3ZWXA 3VO1A 4DNPA 1HTBA 2WPNA 5HKLA 3RYTC 5CAEA 2WF7A 4PO8A 3FROA 2CD7A 3VU9B 4UCFA 1V3VA 2PXHA 3I12A 4OXXA 3LXUX 2C1XA 1Y3FE 1SUAA 4PCLA 4RAQA 1X7HA 2DQKA 1V7ZA 2BEUB 2NO0A 1WZ2A 2YV1A 3FNQA 4FGUA 2C92A 5TPZA 1ZW6A 3CO5A 1HRKA 2AHRA 4S2UA 3TECE 1JYEA 2A86A 3AF5A 3BBPA 3QLEA 4IG4A 3K6SB 2CXHA 3CS3A 3H6KA 2G5GX 3MLAA 1SHJA 2ZIUB 3BICA 4FTWA 2Q4RA 3R7FA 1T5LA 1IOZA 3JX9A 1RBMA 3FSGA 3O21A 5IVDA 4QJ3A 1F8GA 2AFIA 2D5CA 5JO9A 1MA0A 1S8FA 2ON6A 4IDAA 4OBWA 2JHGA 1F5SA 3GWZA 1GEGA 1WLSA 3CLKA 3IURA 4L51A 4P92A 5BSEA 2PMCA 3K9BA 1S3IA 1UK7A 1Z82A 4HN9A 3HI6A 2FWNA 5JCXA 1RMTA 3PUXA 2IXAA 1TUBA 3PPWA 4WBXC 3CUWA 4DE5A 2FU5C 2I6UA 3ESBA 4UZSA 1R8JA 5FO0A 5EWJB 3OU7A 4KVGA 2CGEA 2F17A 3GH3A 1QGZA 1C3OA 2ET6A 1QYVA 2ZSFA 5C31A 4LWOA 4FM9A 3QBTA 3CZ4A 1N8TA 4PGMA 3ZVKA 3ND6A 2GEBA 2OZVA 3DGFC 3KL4A 1Z75A 4QNNA 2VF4X 5ICSA 3CV3A 4CMHA 3ZDZB 2A1TR 3MRSA 4PSUA 2ZI3A 4WCFB 4V2IA 1SG0A 3DVRX 4J0KA 3AVWA 3OOWA 4GGPA 5AVJA 5I9MA 1KBZA 5C7LO 2GHIA 2WTAA 4Q16A 4OIFA 2P0YA 4II7A 2FEAA 4UCWA 1L7QA 1V45E 2XNJA 2ERXA 2LVBA 5AQ1A 2QVLA 3GYBA 1TM5E 4PG4A 3SMVA 1NFFA 3U2QA 1BVUA 4JFRA 2VQ3A 2C8KA 4DEYA 3AG6A 1NF8A 3NG1A 1JEOA 4P3NA 1KEEB 4MUKA 4C0HA 1RAAA 2ZE7A 1RCFA 2XGMA 4GRAA 4TQAA 4LMRA 4V2UA 4D99A 4D80A 4PSAA 4C06A 3ZX5A 4RVUA 2YNMC 4MQFA 2Q0XA 4RKEA 1YTUA 4LHEA 2PA3A 4QUHA 3OLWA 1RTKA 1XMOB 1MHTA 1LK0A 4Q21A 4RTPA 4Y67A 3SR4A 4KAJA 1LV8A 2GNAA 4GAEA 4Y0NA 4YT5A 3SK0A 1U2TA 5CXQA 3RJMA 4A0GA 3LCRA 4Q3AA 2G7MC 1NOKA 3FZEA 4G65A 4IJUA 2J59A 4QOIA 5AICA 4TTTS 4DCJA 1P81A 2C07A 1BNCA 2WKSA 2N9UA 3DAYA 5L7WA 2AT1A 3A1CA 3TLMA 4DV4B 5JAMA 3DBOB 4FJ2A 1KETA 1T2AA 3U48A 4FP9A 2J08A 5JADA 5DCWA 2FMTA 2VI5A 3MIZA 1ZUNA 4MR9B 5A4FS 3IBGA 3TLZA 2FQYA 5K8TA 4O2BA 4IRUB 4IICA 4FHZA 1OB5A 4P82A 4F84A 4U3JA 1PS0A 4RULA 2OPBA 4RAOA 1LPNA 4KQ6A 3TF5A 5FXMA 3AUTA 3GX1A 3HA3A 2F3PA 1KYIA 2BFMA 3IHWA 4J6EA 1YIAA 3AKDA 3TNFA 4HV4A 1CUZA 2VJCA 3HP1A 3FI9A 2GVDC 2HLNA 1PR9A 5LUBA 5HF8A 2WWVD 2ZBFA 4WADA 3R7AA 1JDTA 3SJAA 1EUDB 5D51S 2A9KA 2JJ1A 3AF0A 5CVUA 1M8KA 2A5YB 1T2CA 1O95C 1WUTA 2CFOA 2JLCA 1PKEA 3F2IA 3N70A 4FFPA 4Z9AA 4DCNA 1W59A 1XTZA 4BY9E 1C9NA 1G98A 3DNPA 4IQFA 2PWPA 1G18A 1HZZA 3V8EA 3BAZA 2CZCA 4IDNA 4INJA 1G16A 2I91A 4U9UA 1FNCA 1NMQA 3NT4A 4L9SA 3RS3A 1WPRA 4M36A 3EXG2 1VG8A 1JG1A 2ZJAA 4HRAA 1BDBA 1T3LA 2PZJA 1W30A 1FTSA 3TUJC 4C29A 1P77A 2H18A 3FOBA 5FTLA 4EARA 2CHVA 2C3PA 3GAAA 3O92A 4MR8B 1JSCA 1YOVA 1XQ1A 4NOMA 1Q3TA 4UVEA 2NTJA 4XDHA 1WBBA 3KG2A 5F76A 3DLIA 2IXEA 1JV2B 2CUTA 2GPBA 4HDAA 1KZ7B 4BDTA 1QQ7A 2GCPA 2I8CA 1SCJA 5DNDA 1VHLA 1T4CA 2HQBA 3G23A 1MPXA 4MYHA 2W4QA 2W6CX 3G2KA 1Y34E 3DOHA 2WSYB 1S01A 3ZZTA 2ZTSA 3F7TA 4MVJD 1AUQA 1S2DA 1M5UA 1XKLA 2A5JA 3MK31 1JN0A 1BMDA 4JELA 1PD0A 4XAQA 3U1TA 5JNUA 2MSNA 3L8FA 1F4LA 3MJ4A 5L3ZA 5EJ6A 4BLWA 3L7BA 4LCEA 2FPSA 4W4TA 3RYIB 3GJYA 3ER6A 2EFGA 4JYZA 4IV8A 1CBUA 1RZRD 5A6SB 1MQSA 3AESB 3ZD9A 3CVYA 1QQAA 1G19A 1UBCA 4REMA 5AR1A 1K9VF 3ZGZA 5IRCD 2HXGA 1NNUA 2D2EA 1O03A 1W0KD 2I2WA 3HZZA 1J4AA 3VUEA 1FMFA 4XYMA 1DKOA 2Y77A 3OWHA 5HOQA 3NV7A 3E2MA 1L5RA 4CDGA 2Z9DA 1F0PA 4NCJA 2NXEA 2WRZA 2QS9A 3MWEB 2QLBA 3CPEA 2JAWA 1O89A 1ZD8A 4TMWA 4C04A 3BEOA 1FJGB 4DR5B 2G6BA 3SG0A 3ZJ5A 1B8PA 8AT1A 2VR1A 4PHHA 4F04A 4B2LA 2ZRMA 1NYQA 1ZKMA 1PGNA 1ZBQA 2W6MA 4MEJA 3QFHA 1YL6A 2DC1A 2NXWA 3D6NB 2HW8A 2YV4A 1CJVC 4EW6A 1IJKA 1TIPA 2PANA 2ID8A 2D5IA 1QFZA 2C94A 2I3BA 3H3XA 3BTUA 1K97A 3O74A 4LA4A 3RODA 5KYGA 821PA 4B8ZA 2H29A 5JI3E 1UM9B 4H08A 4JR2A 4XJVA 4JBLA 1MRNA 4CTKA 5A9SA 4KSYA 1S2GA 3K0AA 4RPJA 5TPZD 4HB0A 3NHPA 1CFJA 4JHXA 1GG9A 1E98A 4FONA 1MO6A 5KYWB 2ZZMA 1WTAA 1Z0SA 1GVHA 3T0IA 4ID9A 1ST3A 3DXZA 3EW7A 1Z8HA 3OOJA 2QVBA 3THRA 3UMRA 5A2GA 4Z4QA 5HUQA 1O77A 1Q16A 2C8LA 2Q4EA 4KKXB 4HBGA 4MIKA 3O83A 1K88A 1C1XA 4AN4A 3Q40A 1ND5A 1XN4A 1TDJA 2GCIA 3QVJA 3IUYA 1JJ7A 1RLOA 3NC1C 1GO2A 3KUXA 4LFBB 2WSSA 2WJPA 1SGWA 2J41A 3GG9A 3QFRA 1M8PA 1HYQA 1ZJWA 5HUJA 3HXMA 5EZYB 4AZ3A 4BYGA 5JAZA 4N5LA 1A7UA 3UC5A 2B4KA 1J56A 2JJ2D 4GE0A 4MWOA 1J42A