1D07A

Hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis ut26 with 1,3-propanediol, a product of debromidation of dibrompropane, at 2.0a resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
293
structure length
293
Chain Sequence
GAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the haloalkane dehalogenase from Sphingomonas paucimobilis UT26.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
molecule keywords HALOALKANE DEHALOGENASE
total genus 113
structure length 293
sequence length 293
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 1999-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1d07A00
4Y2PA 2WHRA 4H7DA 5FDFA 5CT6A 4AQDA 2WUFA 4X6YA 1ORWA 5ALEA 3P2MA 2X8BA 1CVLA 4BRZA 3HJUA 4IQ4A 4KEAA 1A8QA 4EZIA 5JAUA 1XZBA 1ZD5A 4U2GA 1J06A 1TK3A 4DNPA 3PICA 1EA5A 3WQHA 5DNVA 4PW0A 3N2ZB 3IUMA 3C5WP 5LLSA 1EI9A 5IVDA 2PUJA 4W1SA 5FRDA 2WG0A 3GROA 5EIHA 2WIFA 4ZWNA 1G4HA 4AB1A 3W04A 5JZSA 4HS9A 3VJMA 2PVSA 1TKRA 4U2BA 3AJAA 4FNGA 2ZYSA 4G8DA 1W4LA 4FLMA 4AMZA 5K3CA 2J3DA 2QTBA 5IVKA 1SCIA 2BAGA 4HZGA 3DEAA 4AN0A 3I6ZA 2ACKA 3M83A 4WDRA 3W2TA 4Y2SA 4MXDA 4DTCA 2JF0A 3SK0A 2B9VA 3LIPA 2OAEA 4AXBA 1TCAA 2R11A 1VKHA 4KE8A 4Q3KA 3ZV7A 3V9AA 3VVLA 4JYPA 4UBJA 1JJFA 1EX9A 1L7QA 4XX1A 1CUIA 3N0TA 4G8BA 3GZJA 4JNCA 4CCYA 5EHXA 2JEZA 2BFNA 3HI4A 2QM0A 5JYCA 2VJAA 4FLFA 3FSGD 2BKLA 1LPNA 4J03A 2CB9A 4DNFA 4G9GA 1THGA 3IB3A 1MT3A 2WSLA 4C4YA 3FVTA 2C4HA 1HDEA 4DMKA 2PSHA 4IH4A 1JMYA 4MJ3A 2HA3A 5AHXA 5DNWA 3G0CA 1UOPA 5I7UA 4OPMA 5H3HA 4M0FA 2G5TA 2XQKA 4DLNA 2GYUA 5CXXA 1XQYA 4N5IX 1UT6A 4BRSA 1EB8A 4HXEB 4A23A 1WB5A 4OB7A 5AOCA 4G1FA 4OYLA 4L0CA 2JEYA 2G5PA 5JADA 3G9UA 5DTJA 5AK6A 2O7RA 1JJIA 4FTWA 3LIIA 1T2NA 1MO2A 1LGYA 3BXPA 5JAOA 1KU0A 2O7VA 2I3DA 1T4MA 4UHEA 5AKIA 3I2JA 3TJMA 3RLIA 2XMZA 2VA9A 2VSQA 4PF1A 3ZI7A 1MNAA 4GECA 1X2EA 5T4FA 4L3WA 1JU4A 1ZOIA 4FMPA 4BTLA 1UOQA 1CUZA 3C45A 3DYVA 1QO9A 4AO6A 1XZFA 1K63A 3U0VA 4UBIA 3OURA 1EHYA 3UMJA 1ZD3A 5EIAA 4EBBA 4WY8A 1GGVA 1XROA 1K4YA 4X91A 3WK5A 5LZ2A 2OGZA 4QDOA 1QZ3A 2AJ8A 5JZBA 5CURA 5ALRA 1N1MA 2Y2UA 3KXPA 4E11A 4K6KA 2AJLI 2CJPA 1ETHA 4PNZA 3A6ZA 1GXSA 3WK9A 1K6EA 3H17A 1CUUA 1JJBA 3WKBA 4B83A 1EINA 3FWHA 4LXIA 2HRQA 1OILA 3ESAA 4N8SA 1BCSA 4N5HX 5AK5A 4S0XA 3H2JA 1FFEA 3T4UA 5AH0A 5CBKA 4BYMA 5DTIA 1N5MA 3WZLA 1U8EA 3AIOA 1UZAA 2PM8A 5FUMA 4C01A 1BEZA 4DMFA 1OCEA 3DKKA 4Y2JA 1XZMA 4QWWA 2QUBA 4QDZA 4IH1A 4EY7A 5DYWA 4ZGBA 2OLEA 1ODCA 2CUTA 3A2LA 3QPAA 3T52A 3ZLTA 1E66A 1CUJA 1YA8A 2LIPA 2XMRA 4UBMA 1QLWA 2PUHA 1U4NA 3I2GA 2XUHA 2XMDA 4UBKA 1JI3A 4K5QA 4BC0A 4H0CA 3K6KA 2HM7A 3AZPA 1DT3A 2BUBA 4B7ZA 3W05A 4RE5A 5A71A 1CRLA 2FJ0A 4XVCA 5JALA 3PF8A 1CUAA 2PBLA 4DMHA 2IX9A 4YK7A 1UWCA 5FXMA 2XUPA 5AKZA 2QVBA 3F9CA 5ALJA 4CCYB 4RE6A 4DNQA 4P9NA 3B12A 2JBWA 3WZMA 2C5FA 1J07A 4Y9SA 4UUQA 3G7NA 2PU5A 4EY6A 1HBJA 1K8QA 1CUVA 3PUIA 3FLAA 3R41A 1MX9A 1EVQA 2XLCA 4YPVA 3YASA 1NU6A 1DINA 3HC7A 2OG1A 4FHZA 2CKMA 2H7CA 1U2EA 4H77A 2WKWA 4OSEA 1UKBA 1Z68A 3LCRA 5CXUA 4KE7A 1CUFA 2JGFA 4GBGA 3MVEA 2Y1KA 2ZSHA 4OUKX 4B82A 4X7BA 3FLEA 4N8DA 1MJ5A 4UHDA 1YA4A 5T4EA 5AI5A 4PSUA 1YS2X 5ALPA 4G4JA 5BV7A 2RAUA 4AX4A 3NWOA 4KE6A 2WJ6A 1Q84A 1WHTA 5ALYA 3VKFA 3O4GA 1TQHA 1BE0A 4GLBA 3CCCA 2AJDA 3F96A 5A6VA 3LS2A 3DYIA 4FFWA 4J7AA 3RKSA 2ZYRA 3RM3A 2GBCA 3ESDA 1FFBA 3WKEA 2AXEA 4Y2UA 1BU8A 1IVYA 3FVRA 2DSNA 2QT9A 2XQFA 3WL5A 3NGMA 2Q0XA 3ESBA 4JUIA 4FBMA 1XRRA 3DL7A 2X5XA 2QMQA 2XUDA 4GWLA 2H9YA 2FX5A 1DT5A 1QJ4A 1XZKA 2RI6A 5LYYA 1WCYA 2HU8A 3R3UA 5ALFA 5CTAA 1AURA 3O0DA 1Q0ZA 3I2IA 4H7EA 5HF6A 5JANA 5LKAA 2XDWA 4ROTA 3L1JA 2Z5GA 1M33A 2RONA 4QA9A 1GPNA 4KAAA 1S8OA 3WK6A 1A88A 1CV2A 2WUDA 3WWPA 1CUEA 5ISMA 2ONCA 5AICA 1XLWA 1VLQA 1XLUA 5CT9A 5ALHA 2HRRA 3ILSA 2CZQA 5I9IA 4NMWA 4X00A 4FOLA 2QZPA 1XQXA 1F6WA 4ZV9A 1VXOA 5K3EA 1A8UA 4X97A 2C58A 2PX6A 2RHWA 3FYTA 1R50A 3WWEA 1MU0A 1XZLA 2C5GA 4CCWA 4H7KA 1BN7A 5HK9A 5EIEA 2HA7A 3E3AA 5AI9A 2QXUA 2GYVA 2PPLA 5A7FA 5LZ9A 4YX9A 2OQVA 4CIAA 1F0NA 2WIGA 3C6ZA 3IURA 3KD2A 4QWMA 3C8HA 3HACA 5AM5A 5ALIA 3TGLA 3VISA 4X6UA 4AZ0A 3QMMA 5E4TA 2VT7A 5ALZA 1KEZA 5HQ3B 5AK3A 4ARAA 5AKGA 5AI0A 4ARBA 1LLFA 4U2CA 3F98A 2XUGA 1RP1A 1GKLA 3CN7A 5AKEA 3DL4A 1EH5A 1SFRA 1XZAA 1JFRA 2P8SA 4WY5A 2QUAA 5BWCA 1J2EA 4CG1A 4HTAA 3QYJA 4Y2YA 3OTQA 3FSGA 3C43A 5FV4A 2VJDA 3STYA 1UKAA 3WKAA 1D07A 4KAFA 4LHEA 1WHSA 3MUNA 4QZVA 2BGRA 4U2FA 3WL7A 4Y2VA 2WTMA 1C7JA 1VA4A 1EK2A 4W9RA 5T4HA 5IH7A 1R9NA 1LBTA 5EFZA 4JH0A 4D9JA 1YS1X 3R0VA 1CLEA 4X71A 4B80A 5IKXA 4AMYA 1DX6A 5AM1A 3GELA 4EY8A 2ROQA 4EA6A 4TPKA 2VQ6A 3DQZA 1XRPA 3DS8A 3DOHA 3G0BA 5ALVA 3FCXA 3HSSA 3SWWA 1FSSA 2HDWA 1LPOA 2JIDA 5FKJA 4DYHA 1YR2A 4QLAA 3PFCA 5BWBA 3WA6A 2YH2A 1GQRA 1A8SA 1QIIA 3IA2A 5C8VA 3WL6A 1CUGA 5AM4A 5ALUA 3AZOA 4KACA 2VTVA 5JARA 4RPCA 1O6GA 1DQYA 3IDAA 1H2ZA 1QIMA 1WOMA 3PE6A 2Y6VA 1MNQA 2G4LA 1R88A 3C87A 1AKNA 3AUKA 2PSDA 2V98A 5DJ5A 1N8SA 3BF8A 2XB6A 4WFJA 5ALDA 1ISPA 1QONA 1W6RA 1XFDA 5C8ZA 3STWA 4FWBA 2YXPX 2WJ4A 4BZZA 1FFCA 2WUEA 4FLEA 3TRDA 3DLTA 1VA5A 2DQYA 3WYDA 4H7FA 1DU4A 2I3ZA 2E3JA 5A62A 3STTA 3L1IA 1VZ3A 1PFQA 2QR5A 3W06A 1HQDA 3FYUC 4MWTA 1JMKC 5C81A 5HQ3A 4FKBA 2XMQA 3JWEA 5K3BA 2O2GA 1XLVA 2JGEA 2DCMA 2VAVA 2QJWA 4HRYA 4TVKA 3GBSA 1G66A 2WHQA 2B61A 4Z49A 3FOBA 2QOEA 1GQSA 4DSZA 2I03A 1CQZA 5HKAA 5D3ZA 3TEJA 1E8DA 5FPPA 4PV7A 3E0XA 5K3AA 3H04A 1DWOA 4UFNA 4FNMA 2DQZA 3AILA 3AFIA 4ZV7A 3G0DA 3QM1A 3E4DA 4V2IA 4BCCA 2HU7A 4HXFB 2V9ZA 2PSJA 2QJRA 2ECFA 4HVTA 3ZWQA 3EBLA 1B41A 3KWFA 5JAPA 3L1HA 2OQIA 1WPXA 1LNSA 3STVA 2Z3WA 4J0KA 2YYSA 5IVHA 2WFMA 1O6FA 1ORVA 1A7UA 3ZLUA 3V1LA 4L9AA 5YASA 3QH4A 4GXNA 3QVMA 3H2HA 1EDEA 3PUHA 1SC9A 2JGLA 1TAHA 1HL7A 3EIOA 3H2GA 2Y6UA 1ODTC 1R4ZA 1AZWA 2BCEA 1BN6A 2VJCA 2VF2A 2XQGA 3H0CA 5AI4A 2ZYHA 1P0IA 1MN6A 2DHDA 3B3QA 3MGAA 1HLGA 1AUOA 2ZYIA 2EDCA 3U1TA 5F4ZA 3G0GA 3DKRA 1EDBA 3IULA 5AIBA 5AO9A 4RNCA 1BRTA 1IMJA 1E8MA 4UPDA 2VEOA 4GDMA 3WKDA 5I8PA 1R3DA 5ALKA 1EB9A 3V1KA 1CUDA 4QDXA 1UK8A 4C4ZA 1N5RA 4F5ZA 4J3JA 3WL8A 3BDIA 5SYMA 1X70A 5KBYA 3IUJA 1EDDA 4BE9A 4A16A 2W6CX 3DJYA 3R40A 5DWDA 1UK6A 1GPKA 4UFOA 5D6OA 2W22A 2CEKA 2XMCA 4WDQA 3G8YA 1ZGBA 3V1NA 5FLKA 3R3VA 3IUNA 4ZRDA 1H2WA 5ALQA 1XZJA 5AKKA 3I2FA 4JEIA 4J0IA 3K2IA 3SX4A 1QGED 1MPXA 2H7XA 4BAGA 4CG2A 2X76A 1GKKA 1ZI9A 3BWXA 4Q82A 5AKYA 5HF8A 4X6XA 5CT5A 4X92A 1VOTA 1EVEA 4J0GA 1MX5A 3IBTA 3O4JA 3MUOA 2FJPA 3PFBA 1JKMA 5EHQA 4BVJA 4DMCA 5CH8A 1YB6A 3HZOA 5EGNA 4PQEA 4Y2QA 4C4XA 2Z8ZA 4UFPA 5K3FB 4B9AA 4QDTA 4Y2TA 2WHPA 3QZUA 1ZD2P 1ZGCA 4WJLA 5ALOA 3D0KA 4K6GA 2OPHA 5AJHA 1QO7A 2OGTA 4PO3X 4BE4A 1LBSA 1ZICA 2D0DA 3EQ9A 4XJVA 1YCDA 3STUA 5CH5A 1H2YA 2JGJA 3SC2A 3DDUA 2XLBA 5ALLA 3BJRA 4UHFA 3RK4A 4I4CA 1QTRA 3D5EA 4C88A 3VJKA 1XQVA 1OXMA 1AGYA 2G63A 2XQJA 1HKHA 1FJ2A 3FAKA 3GUUA 2PSFA 3HLKA 4G4IA 1B6GA 2WG2A 1HPLA 2UZ0A 4BVKA 4OYYA 5DLPA 4Y7DA 1G5FA 4UBNA 1CEXA 2R8BA 5AKJA 4E14A 1XZDA 5HF5A 3OG9A 1ZJ4A 3VXKA 4ITVA 1EXWA 4Q3OA 3FBWA 4Q3LA 2WFLB 1GZ7A 1XRMA 1LPSA 3FYUA 3QMVA 3EQ7A 1MAHA 1VJ5A 1RWQA 3NOXA 4QEKA 3D3NA 2B4KA 1ODSA 3R3ZA 5LZ5A 1NX9A 2DHEA 2PL5A 3BIWA 4GEGA 4GI1A 4QDUA 1QOZA 3O4IA 1ACLA 3G0IA 4LYDA 1F8UA 5HZGA 3S8YA 1AQLA 2V97A 3W9UA 5AM0A 5A7HA 4KJXA 2RGUA 2HFKA 2OCKA 1DTEA 3UUEA 2XUFA 5D3KA 4FBLA 4KYVA 4OCZA 4FDMA 4X94A 1GT6A 3OC0A 3VDXA 4BB0A 2GZSA 4BZWA 4KRYA 4H7JA 3ED1A 2HIHA 3A2NA 4BAUA 1XQWA 2QXTA 1VE7A 4BCDA 2XT0A 3G9XA 4M0MA 1K5PA 3F67A 3O9VA 4MQMA 1CUWA 1QTIA 1CUBA 1ZIXA 3ANSA 4IH9A 4AO7A 1E8NA 2Y2VA 4BP9A 2VAXA 5AM3A 3WI7A 2IITA 3JYHA 3C5VA 1Y37A 3H1AA 3ANTA 4X90A 4BC1A 4B84A 1UK9A 3CXUA 1ZD4A 2CMFA 4HRXA 4OB8A 4BCBA 2H7YA 1C4XA 2NW6A 3ICVA 5JATA 4IO0A 4E15A 3R3XA 4GHWA 4TGLA 1IUPA 3B5EA 4MQLA 3KWJA 5HKBA 2C0PA 4H18A 1TCCA 4W63A 2YASA 4B9EA 5KWIA 5CRIA 3WJ2A 4F0JA 5ALWA 2XUQA 3KOOA 1I6WA 5JD5A 5HK8A 2FUKA 3EQ8A 5E2IA 2WU4A 6YASA 5E4JA 1Q0RA 3QPDA 2VT6A 2OGSA 3S2ZA 3UUFA 2WU3A 3WIOA 3IIIA 2DFPA 2BGNA 4G8CA 2J3QA 5JD6A 2XMGA 3WA7A 1E3QA 4WCVA 4EY4A 1BEEA 4K6HA 4H35A 5T4BA 1SCKA 5LKRA 5IVIA 3R3WA 1ZIYA 2XMBA 4EUSA 3I1YA 5AP9A 2QKYA 3WYNA 5A2GA 4ZI5A 4BDSA 2HU5A 5JASA 2WIDA 1H2XA 2PKYX 1XKTA 2WUGA 4G5XA 1CFJA 3A70A 4X85A 2XQIA 4Q34A 2O2HA 1SCQA 1IZ8A 3BIXA 4IHAA 2WFZA 3EF3A 3H2IA 1YB7A 1G42A 1XRQA 4J0JA 4UBOA 2WLSA 2PSEA 1CUXA 2OCGA 2CBGA 2XMSA 2BUAA 3C8DA 2XUAA 1U65A 4U2EA 5ESRA 3H2KA 4ZXFA 3C6YA 4MWSA 2VJBA 3DD5A 5EHZA 2C0QA 3AZQA 1XKLA 2XUKA 4J0CA 4DM7A 1W52X 4KAJA 3V1MA 1TIBA 5FOQA 5SYNA 3BF7A 4B0OA 3G9ZA 1TCBA 3ICWA 3F8SA 1R1DA 4P93A 1QIGA 4OB6A 3F97A 4JYMA 2J4FA 2V96A 3O95A 1H22A 4QE3A 2WJ3A 2BUCA 5AI6A 5FPQA 5K3DA 7YASA 2HFJA 4CG3A 1JT2A 1XZCA 2JGIA 4DSAA 2C7BA 1CUYA 2QS9A 2HA2A 4UHBA 1UXOA 4DNOA 3DCNA 3BDVA 3M3DA 5AIAA 3WLAA 3JW8A 4NS4A 2XI4A 3AIKA 2XE4A 5LP1A 5HCUA 5KREA 4C87A 1YAHA 3CN9A 3QBJA 1DX4A 1EK1A 2WFLA 1XRNA 5BOVA 3Q8WA 1DQZA 4FFVA 4YASA 2GBGA 4KRXA 4E46A 5AOBA 4Y2XA 1ACJA 3M81A 1LZKA 5C8XA 1UKCA 2J4CA 3I2KA 4W1QA 4BTVA 2GBIA 4G9EA 3KDAA 4K2AA 5DNUA 4MEAA 2PU7A 4BATA 3LLCA 2RIPA 3VVMA 4INZA 2GYWA 4UHHA 1C7IA 4PSCA 3WK4A 4C6HA 1CUCA 4MEBA 4B85A 1QFSA 3WJ1A 3D2BA 2DR0A 1QIFA 4Q05A 3VJLA 1W76A 4N8EA 1THTA 1IZ7A 1MAAA 4XIIA 1DWQA 4LXHA 5AM2A 4O08A 1FFAA 4X93A 3HEAA 2IIVA 1WPRA 4W1RA 2D5LA 4WFIA 1UOOA 3IVMA 3BL8A 4MYSA 4AN1A 4GW3A 3O9MA 3OM8A 4BVLA 1XZHA 1WB6A 3FCYA 1R9MA 5FP0A 4WFKA 5AKHA 3C70A 1CPYA 1IUNA 2ZSIA 3H1BA 2OXEA 4KE9A 3ESCA 3ZLVA 4Y2RA 5K3FA 1E5TA 3FLBA 1QIJA 1E89A 2ACEA 1AX9A 1GPLA 3V48A 2ZJFA 4ETWA 1VZ2A 1BS9A 4BAZA 1CUHA 3I6MA 4F21A 2XUOA 1CQWA 5AKXA 4LKOA 4LYEA 3I1IA 4I19A 1AMNA 3D2AA 2GBFA 5EHNA 1CUSA 2K2QB 1P0PA 1FFDA 3HRHA 1VXRA 3D59A 2AJCA 1YSCA 3HXKA 1QIHA 1LPPA 2I78A 3D7RA 4J0DA 4NVRA 3WWCA 3WMRA 4BP8A 5KWJA 3I28A 1JU3A 5A7GA 2OAGA 2WHPB 4KR0A 5JAHA 2HA0A 1Y7HA 5LZ4A 5JD4A 1P0MA 3CCBA 4B6GA 3BJMA 3WWOA 3X3HA 4C89A 4G4GA 1QE3A 4UBLA 4BBZA 1YASA 5ALSA 4X3CA 3A2MA 1XZGA 4LIPD 4F60A 4P92A 5D7BA 2DHCA 1LZLA 3AIMA 1X2BA 4M0EA 1QFMA 1Y7IA 1YAJA 5ALXA 1QIDA 4U2DA 5E4YA 4NZZA 4BDTA 2XUJA 3Q0TA 5HFAA 1QIEA 3E1GA 1PJAA 1J1IA 2GZRA 4AO8A 2EEPA 4I3FA 1LPMA 3KSRA 1H23A 1DWPA 4OU5A 3H18A 4DIUA 1CR6A 3W9BA 1L7AA 1ZI8A 3M82A 5ALTA 1TRHA 4A5SA 3RARA 4DGQA 3QMWA 5CW2A 5HF9A 3GFFA 1BROA 3PDCA 3G02A 4QNNA 1KU6A 4ZREA 4CI9A 1MX1A 3OOSA 4B0PA 3BE8A 5JZ9A 1ZJ5A 1RYYA 1XZEA 4X95A 2VATA 3D2CA 1NU8A 3WWDA 2ORYA 1W1IA 2WIJA 1XZIA 4RGYA 5AK4A 3WK8A 3C6BA 3AINA 2H1IA 3IUQA 1UK7A 2WG1A 1AC5A 5CH3A 1LPAB 2Z8XA 3LP5A 2WTNA 4H7HA 5AOAA 2QRUA 2HL6A 2ZVDA 2ZJ6A 2HA6A 5LZ7A 5LZ8A 2ES4A 3WIBA 3PF9A 5ALNA 2AJBA 5K5EA 3C6XA 3WK7A 3HYSA 4W1PA 3QPCA 4Q1VA 4UHCA 1L7RA 1MTZA 3DOIA 3O4HA 2EDAA 3WKCA 2RHTA 5AKLA 3FYUB 3ZPXA 2ZJ7A 4CIBA 3I2HA 5AI8A 1ZI6A 4HAIA 3QITA 2WQZA 2HHAA 3H19A 5HFNA 1W75A 4L72A 4XWGA 4CFSA 4HXGA 2Z3ZA 4J0HA 2WM2A 4PSDA 1IUOA 2WILA 1XRLA 3D4LA 2HA4A 1Q83A 2B20A 3G9TA 1F0PA 2HADA 2JGKA 3NUZA 1PV1A 5C7YA 1SOMA 1USWA 1WB4A 3I6YA 1P0QA 2O2IA 4OU4A 1UFOA 2BJHA 5J3JA 1BCRA 4H7IA 4P08A 4AZ3A 3R3YA 3PI6A 2JGMA 3HABA 5ALGA 5LIPA 2HA5A 4EY5A 2XUIA 3GA7A 5EI5A 4MYDA 1LPBB 4LXGA 5CMLA 1VE6A 3OPMA 5CT4A 4EB0A 2WIKA 5DYTA 2OCIA 5DYYA 3K9BA 4EHBA 3DNMA 1QIKA 1WM1A 2OCLA 3FNBA 5CT8A 5ALMA 4OD0A 5JIBA 3STXA 4B81A 4QLOA 1CIJA
chains in the Genus database with same CATH superfamily
3B82A 4H7DA 4MQEB 2XVZA 4IXMA 1XTSA 4E12A 4S3MA 5ALEA 1JKJA 4M87A 4JEMA 3FZEA 1CU1A 1MB9A 4MUIA 2QVXX 4DV2B 1YVRA 4D5EA 1W46A 3HJUA 4C4RA 1XJWA 1PEAA 3E27A 3IQZA 3RREA 3MUFA 4HS4A 2L2QA 3DLAA 4L08A 4M38A 3UB3A 5ICGA 4P33A 1Z25A 1EFHA 1NA5A 3CH7A 2FPSA 3IE2A 4HGYA 3R7WB 1SH7A 4O2BA 2ZTLA 2JK0A 1TK3A 1RHRA 4QM7A 5LQKA 3A3PA 3RUIA 5ETJA 1WXEA 1XL0A 1LF5A 1WD5A 2PMCA 5EP4A 4AKEA 3T3IA 4PW0A 5IAEA 4W5RA 1Z7BA 2YV5A 3P4YA 1VG1A 5LLSA 1PQ4A 5LN1A 2ZIXA 2X5KO 4FWIB 2QL9A 4HC4A 1NXXA 5TGZA 2CVFA 5LB4A 4TUYB 4GEKA 5CIQA 3EIEA 4N3BA 2R6CA 1V48A 2WG0A 1OVMA 3IOYA 2VYCA 5K03A 1CBUA 3RADC 3U37A 2QTCA 1NRXA 4ZWNA 1IY0A 3R7DA 3AJ9A 4ZGWA 4DV3B 1G4HA 1Q1BA 4IL5A 1TU3A 1AE1A 2OK8A 4FZ3A 4IJUA 1ODIA 4ZC1A 5C9ZA 5JI3E 1YXMA 2C0CA 4FGKA 4H31A 4LAFA 2UDPA 4B40A 2ZQ5A 1S3FA 3EC1A 3I8OA 3ZU2A 2I71A 3EXIB 2DR2A 1VPDA 1ZJ6A 1EG7A 3K2QA 3AVQA 5HYVA 1AM4D 1XF9A 3LXMA 4N3CA 2WUWE 3AVOA 4REMA 4YP6A 1C9JA 3HBAA 1VPVA 4ZVTA 3WGIA 1RC0A 1U1DA 2FN9A 3R7LA 3ZDYB 1TK9A 3ZXIA 2ZYSA 3PA8A 3SF8A 4G8DA 2PX0A 4JOBA 4AMZA 4B31A 4YAKA 4Y6LA 2CNNA 2QA5A 2YDYA 4RYDA 3PZBA 3RYFA 5H81A 3TW8A 1NOJA 2Q8QA 3NMUF 3LI2A 3TNLA 5JSKA 3B38A 3V8QA 1LI5A 1P77A 3TSCA 4GUDA 4EMUA 4UAVA 2QTBA 5F76A 4HYEA 1JYFA 2B9EA 3B78A 1FTQA 1QS0A 1FOEB 2Q3BA 4AN0A 1CEYA 4R6WA 4L2IA 1UPAA 1JR2A 4QTXA 1M3SA 3VH3A 5CA0B 1KAGA 1KL7A 4WDRA 2WYHA 4U5XA 5FUWA 3ZH2A 2GO7A 4B48A 4B8WA 4BO8A 4R54A 2XYRA 4DGSA 1T1JA 3LIPA 2JCXA 2PX3A 2FR0A 4PX3A 4WGGA 4AXXA 4Q18A 5M29A 2ZJ3A 3I62A 1UBLS 3UG7A 2O0JA 2IYEA 4HUTA 2IJGX 4KE8A 4RHFA 4RWEA 2BMWA 2O6LA 5SYAA 3ZV7A 4YLYA 4CTJA 3G85A 1ZR4A 4YC7A 5C8YA 4LJYA 3WSTA 1IDN1 4XEHA 1HDIA 1A8HA 2CYBA 1RRGA 3DULA 2HR1A 2YC4C 5JSZA 4B8ZA 3JTEA 2VPWA 2H0RA 2BW0A 3AHJA 3GZJA 4FT2A 2JEZA 2KS6A 1EVKA 4YUZA 2QM0A 1IOZA 1BQEA 3KZCA 4MWZA 3SSMA 2VJAA 4QGSA 4TOIA 2IUTA 1B8OA 4FLFA 4CF7A 1VIAA 4KI7A 1HDOA 3WNZA 3ZGXA 5CJPA 3TL6A 3TZQA 4GOLD 3KVVA 1UODA 1XTJA 1LPNA 1PKXA 2RGDA 4J03A 4D4LA 1JV2B 3SP1A 3DFIA 3TTVA 2XGJA 3JQCA 2AW3A 4G9GA 3TR6A 1T36A 3GLUA 3BGWA 1S8FA 2PD3A 3QI2A 2WSLA 1QRDA 2O4UX 1V4BA 4ODIA 4C4YA 3AU9A 5C4IA 1H3EA 4RCZA 3PKJA 2O5RA 1KJIA 4OMFG 4Y1RB 5AVOA 4YMIA 3SEZA 2GFIA 3ZHYA 2CNKA 4DMKA 4IMIB 5BORA 1VP3A 3F90A 2C9OA 1JHPA 4EF6A 2B34A 1JMYA 3NANA 4MJ3A 1XE3A 4PYRA 3RRFA 2HA3A 3GLSA 5AHXA 3L07A 4PSVA 3G0CA 2JGDB 3GA0A 5G1NA 3MS7A 1U7ZA 4DR2B 2XJ4A 4OPMA 4W5HA 2V59A 4LEIA 3OMLA 3VBEA 4CM8A 3P7MA 2CV0A 4RXUA 4DLNA 4FINA 1Y9DA 1AKQA 2G0NA 1WMFA 2ZXFA 3RYIB 1XQYA 3F7NA 3H9BA 4WESB 2JFYA 4BZQA 3V00A 1UT6A 3FUWA 2PZJA 4BRSA 4ARVA 1EP9A 4MS1B 3IC5A 5AT1A 1Y7PA 3WYFA 3GNQA 5BT8A 5IVPA 4A23A 1PZGA 4LMRA 3NNNA 2H3EA 5AOCA 3P5SA 4G1FA 2K87A 4JXJA 4PZAA 1HMPA 1P8AA 4Z7QB 5CVCA 1M1XB 3PSHA 1VLHA 1Z08A 4R41A 1N0HA 1K7EB 3LCUA 2GN4A 4D4HA 2NUPB 4IIJF 4GPAA 1KJ9A 1T43A 3D6TB 1BOOA 2MR5A 5AK6A 1HSZA 4G5HA 1Y8AA 3H6HA 4NMLA 5I9TA 1R0WA 2VP4A 4F6LA 4FTWA 3HK2A 1QXSA 5LM3A 1TO1E 3EK2A 1FDUA 4CMIB 4MSUA 3WYGA 4B3TB 3BGIA 2HHJA 4MYUA 1FFXA 1K3FA 4TS4A 5ILOA 2DBVO 3O03A 1CYEA 2O7VA 1VL2A 3G5AA 2RSLA 3OT1A 3BRSA 3TRJA 1OD6A 2NX2A 4E09A 5AKIA 2P2GA 5KYGA 4NZMA 2BRUA 1E2EA 1ZGAA 3CPSA 3AH8A 2VA9A 4FMDB 3LVBA 2JIZD 4PF1A 3KKKA 3NEPX 3HY4A 1MNAA 3N70A 2O2SA 1JN0A 4PBRA 4GECA 5T4FA 1Z6AA 3HEMA 3HR4A 1NW4A 2C03A 1KDYA 3W6NA 2IL1A 1G8GA 3WLLA 4EQ6A 4BTLA 1GZ6A 2HU2A 1GUFA 1UOQA 5HUQA 1CUZA 4QAJA 4J16A 2HLDA 3TDKA 2PUVA 4BGEA 1E9AA 3IJRA 1DSSG 3RTGA 2JAUA 3ORHA 5TPZA 4R31A 4HNVA 2ZTHA 7MHTA 1MDBA 3G23A 1KERA 2ATVA 4UBIA 1DAEA 4X65B 3UMJA 3GO4A 5TVGA 4CFYA 2XRMA 3WMXA 2C8LA 4JJKA 1T3GA 4WY8A 4A15A 4NX2A 1FU8A 1U8FO 2NZ8A 1P7CA 3SEFA 1AGPA 3NIWA 4QLBA 3R5HA 4R1QA 2BM1A 2YYAA 3I61A 4X91A 2ZVPX 3WK5A 1DUSA 1TKBA 4RMHA 1CWUA 1DP4A 3UMMA 3WQSB 2DX7A 3H9JA 4M22A 4DUGD 4YY3B 2OGZA 1OWNA 3NNDA 3URMA 2MSKA 4EPYA 3II6X 1IJBA 2DKFA 1J2JA 5ALRA 3A31A 3UGJA 5FBWB 3KXPA 5TNXA 1WABA 2CK3A 4TVSA 3JWIA 3CF2A 1U2GC 4N7MA 4MI1A 4ONEA 3WMFA 1KMNA 2FE4A 4IKPA 1L8AA 2NZUG 4IGAA 4ZEOA 3A3YA 3JZIA 1AKEA 3E5NA 3ZCVA 1GXSA 5HOEA 1N4DA 2CFRA 3LO5A 1E1KA 2DFKB 3QELA 3H17A 1C0IA 4EVRA 2WFAA 1GTL1 1IIRA 4B83A 2GYYA 3WKBA 3VKHA 1UDBA 5AW5A 5K6AC 2AK3A 3F4KA 3FWHA 2HRQA 5DHQA 2BT4A 1VL8A 4P22A 2Q4BA 1Z5ZA 2N46A 4E13A 3W2GA 4ZVSA 5A04A 4HGQA 3B36A 2HLPA 1QP4A 1YS4A 4DLZA 2W4QA 2VOJA 4UUAA 4B4WA 1BG6A 4S0XA 4UNRA 3HUUA 4WXPA 1DTWB 4UQLA 2IDJA 3H2JA 3D3WA 3TI9A 2A33A 1G6OA 2GASA 2HTFA 2ODTX 2ZG6A 3F0TA 4RGBA 3SXUB 4BYMA 1UJ4A 3KRTA 3KQHA 3IEVA 3WZLA 1KRHA 1EZ4A 1BH2A 2AIRA 2GA8A 2O50A 1YHNA 1ZMRA 3EGDA 1ES9A 2PM8A 3NTXA 2JFVA 1W25A 5BR7A 5IEJA 1N9KA 1RE0A 5GONA 1X8LA 3VTAA 1CZHA 1T9GS 1KYXA 4ZPJA 3DKKA 4Y2JA 3BB4A 4AKTA 3UPTA 1XZMA 2NO4A 1KPHA 2HHHB 2BY4A 4QWWA 1U7DA 3E7DA 1ID8A 2XWJI 3OM9A 1GCAA 1RAHA 3R5JA 4QDZA 4BBPA 2B2XA 3R75A 2F4VB 1H8ED 3PE3A 4ZMRA 3G2HA 4QPCA 4NV1A 1MP0A 4EY7A 1U4SA 1SBIA 1EP3B 3QVXA 1X74A 4EABA 4ZGBA 5L3SA 2OLEA 5DV9A 1UPTA 4CT5A 5A1TA 1PKEA 3QPAA 3QIAA 3EGWA 3D64A 4FFSA 4X20A 5HFJA 4B6FA 4C7BA 1YZHA 1XR3A 4EX6A 1AQYA 2CW5A 3X43A 3PRHA 3RC7A 1KOGA 1QLWA 2P3QA 1UOEA 3U40A 3EG9B 5BSFA 1CDEA 4DBLC 2JVKA 3ORRA 3F4LA 2BEVB 3SYMA 1ADBA 2M9MA 3I2GA 5K6AA 2QTTA 4INPA 4LTMA 4XCXA 3Q5EA 4CM8B 2XMDA 2NTEA 1E9FA 3HMKA 4TTJA 4HCJA 4R1UA 5C4GB 1JI3A 4GP9A 3SC2B 3BQMB 3Q1LA 1JHAA 2YV1A 3IAS6 3PC4A 1TNDA 4BVAA 4QT4A 3U16A 1F7UA 4YUVA 5KDDA 4K5QA 4RK4A 3SS9X 5IT5A 3U39A 1NVKA 2I6FA 4H0CA 5CFOA 4N5NA 1BVUA 2YMPA 1MRNA 1NE7A 1SXJB 1WQ4A 2RHBA 3LP6A 3NAMA 4HB0A 3THYB 1IVSA 2HMTA 4AJOA 1VI5A 5A71A 5GM1A 4HWKA 4Y6GB 3PF8A 3MTGA 4BIIA 5EJ8A 1LI4A 1NSTA 4HATA 1OLXA 1NVDA 3ZZUA 1E3JA 2OD2A 2JBAA 1SQ6A 3OCVA 5FXMA 2A9OA 4GLFA 3CWCA 3WICA 5AKZA 4DSNA 1AV6A 1T3LA 3G8DA 2WKRA 2OB2A 4LQ4A 3DBLB 2QVBA 1W73A 4PSKA 1SD1A 2KJQA 4RBNA 1Q1AA 1KJ8A 3DVRX 3CVOA 3VX4A 4CCYB 2DP4E 4XSVA 3G2LA 2XX3A 4GX5A 4NF2A 2EX4A 3OP4A 4BLOA 1IRIA 3T7RA 2TMKA 2EGUA 3A3OA 3B12A 3FPSA 3PYMA 1WCIA 3CWQA 3DT9A 1NM5C 3CUSA 1KA9H 3B52X 3K0EA 1TYDE 3NVDA 1VB3A 4XW2A 2KBEA 3D7LA 3I0ZA 2C5HA 1EX7A 1E1QA 2C5FA 3FGZA 1S3SA 4LOLA 4UNIA 3I9JA 3IEUA 1J07A 4Y9SA 3KLNA 2YWRA 3G7NA 4EMTA 2ECKA 5K0EA 4DVGA 4HN9A 4WOCA 4GM4A 3DFUA 3ZWYA 1HBJA 5B1EA 3HVJA 2L42A 4PN3A 4WZBE 1J2RA 3V7NA 1KI4A 1L7VC 2FETA 1S4MA 1EQAA 1TGVA 2H57A 3OF5A 4CEHA 3VR3A 3R41A 1MX9A 4CR8A 3DVAB 4HB4A 5CVEA 2O59A 4LWZA 3NP7A 4JXZA 1RRPA 2IU0A 3F5DA 1L5HB 3I37X 3ISVA 4FYYA 1W6UA 4N03A 1N6KA 4XA8A 1PWXA 3W8DA 1NULA 4YPVA 1IBMB 1GUBA 2LNDA 4CBVA 3C5EA 1JNYA 1A96A 1TAQA 1NU6A 1GITA 2IYQA 2OG1A 2JS7A 2ZRQA 4KQXA 1TLLA 4RPHA 2CKMA 4BMPB 3SM3A 5FNVA 3FZGA 3KD3A 3HJAA 3O3MB 1U2EA 1T6BY 3ND7A 3ORSA 4BNNA 4L15A 2GPSA 1NMXA 1UZMA 2V6FA 3EFOA 4W82A 3TSOA 4OSPA 1N0WA 3DUFA 4JP2A 3IV9A 3L0ZA 2WF9A 2WJIA 3OCXA 2NQ2C 1SCUB 3KL4A 2QRNA 2UZ1B 2YQZA 3LT2A 1Q7RA 3N2KA 2W83A 1TQ6A 2JLSA 2AQHA 1DIGA 2Y1KA 3NM6B 5CAEB 3VR6A 2IW1A 3PPYA 3RUHA 5LD2C 1HZZC 3RK1A 4HVLA 1OBCA 1K75A 4Z4EA 5H9WA 3T3DA 3BSSA 3L7MA 2Q99A 1IFXA 1PTJA 4NFHA 5EESA 3U4IA 4E4RA 4XCQA 3UICA 4ZYZA 1ZNZA 5E9JA 4R1TA 4O5AA 3A04A 2WQ6A 2QDKA 3QVKA 4AX4A 3IP1A 4TSKA 2ZS9A 3SU8A 3ZZ0A 1R64A 3G2KA 3L7IA 1BWSA 3OTGA 5F64A 3VNQA 3ZGYA 2NTNA 4FCVA 4XVQA 5C7IO 4KRFA 3UJDA 3LT0A 4ZC8A 1DXOA 2PH1A 2OYCA 3OZXA 4DANA 4F4HA 1PWZA 4MR9B 4ATNA 4EELA 5T41A 5CDYA 1IOVA 3V2HA 3OIFA 2NZYA 3ENZA 2FY8A 3CX8A 2QD5A 3B60A 3RTCA 4HFRA 1E77A 3TD2A 3QNUA 3IAXA 1PVOA 4S35A 3E7WA 1NV8A 4U9IS 1AQJA 2AJDA 1F3OA 5A6VA 3NR2A 2Y0DA 5TV2A 3DYIA 1U80A 2V0NA 4FFWA 4J7AA 4PYLA 2GBCA 4GMXA 1ZUWA 3DMRA 4ZT7A 3ESDA 3MS2A 4GPTA 4LPKA 2BHLA 2XZOA 4OREX 5C53B 1ONSA 2AXEA 1IVYA 2YV4A 2XB4A 2CZGA 1M34B 3FVRA 4LZJA 4MVYA 5IM5A 4P3YA 4B3CA 1U0SY 1UMBA 1Z4NA 2H4WA 4OV6B 4RX1A 5DT2A 1OYOA 1MOQA 4MS4B 2ERCA 2QL6A 3K5PA 4GZ3A 5EPEA 4E2XA 5GY7A 3AOEC 1PGNA 1Z7WA 3ADCA 1L7OA 3HCEA 4JLAA 4QOGA 4TKMA 3SJAA 3ZK7A 2WDPA 1TYZA 4FP9A 5DGXA 1A4RA 1P4AA 1VCMA 2XUDA 4PHTA 4RDCA 4GWLA 4RTRA 4YYZA 4PTYA 3BRWD 4HO1X 1Q20A 2RI6A 4G5OA 1R8YA 3R5TA 4OKNA 1WCYA 4OGLA 4BJHB 3R5FA 2HU8A 2D3TA 3R3UA 5FO0A 1I0LA 1HWYA 4O02B 4KV7A 4ZEMA 5ALFA 5CTAA 1V16A 2I9PA 2IV7A 1YR7A 2XITA 3OY2A 1BZYA 1AHHA 5HF6A 4EEZA 1RW4A 2BR5A 4UD2A 1ISMA 3BGVA 3FTCA 2EZ4A 5LKAA 2UZ4A 3PXEA 4HX5A 5IHPA 4RJKA 2UYGA 4Z4CA 3MTDA 2VH1A 2KE5A 3L1JA 1GA6A 1M33A 3DBIA 5E6RB 4DEVA 3OCUA 1JI0A 5GJVC 4L95C 2GJ4A 4BRWA 4CTMA 1P2FA 2P9BA 2YWBA 3EXHC 1TCUA 3MOSA 3N7AA 4GFDA 1GPH1 1C9MA 1UMCB 2YJNA 2ZK7A 2H29A 3AX6A 2HK6A 3KEQA 5CVVA 5AJWA 4KSYA 5DE3A 4QBIA 1ZJZA 4DLVA 2JLVA 1XNRB 1NF3A 3C1AA 2HRRA 3REQA 3ILSA 3O92A 4PAQA 3S55A 2ODWA 4KDCA 5JLJA 1BCRB 4X00A 1U6IA 1MR3F 3AONB 2PL3A 3OJOA 1S8AA 2CCKA 2AOUB 2VTBB 1XQXA 1YB2A 2G71A 1VXOA 2V8BA 2WBLC 1GN9A 1GNQA 1JQLB 1ESMA 2X8LA 1POWA 3OTIA 1OTXA 2WYOA 4AY6A 2RHLA 5JAQA 1NYLA 1O95D 1M74A 2YXLA 3H2ZA 1ZWKA 1TF5A 1XJQA 3CEJA 1QH9A 4WECA 1JTVA 2NO6A 3KKPA 2C5GA 4RANA 5LQSA 3VO8A 1WTAA 2BR3A 4CCWA 1GNPA 1NRWA 3IP3A 2Q7OE 3QXGA 1CZKA 2NP6A 3DOOA 5FPTA 4LV6A 2QV7A 4XIJA 5HK9A 4YP9A 3UMSA 1TM2A 2C4WA 2QYSA 4GNRA 5DZSA 3R7BA 2HA7A 2PGJA 3E3AA 3MCWA 3BMNB 2NSLA 2PPLA 2W71A 2NO7A 1SKMA 1JSZA 4AJLA 3CNNA 4UTPA 2VP9A 5BWLA 1L8XA 4I1UA 4S12A 4MVXA 3DZHA 2V7BA 3HLTA 3ZR4B 3V7YA 4V0KA 1P1RA 1YJ8A 3H8SA 3UVEA 3OJEA 4B4OA 1TUEA 4YP1A 4LYHA 1PYDA 2P0YA 1G8HA 1R5BA 1X39A 1PT7A 4B4KA 4EJSA 5BVGA 1RXUA 3V1UA 2VWGA 1GARA 5ALIA 2NO9A 1O89A 2AOTA 1QH1B 3JQQA 2CE7A 5B1IA 4X6UA 3VISA 3PWSA 3U62A 3OT5A 3NRJA 4YAOA 3W7BA 3RWMB 4KNWA 3BTOA 3QFRA 1UAGA 2I2XB 3VPGA 5I7OA 1M6VB 3GGSA 4M6WB 2XWSA 5AK3A 5FNVB 3ROZA 1FXSA 1FLDA 2HN9A 2X40A 1YOBA 3CW2A 5IM4A 4QBKA 1G20A 4TXNA 3QVUA 4ARBA 4EVIA 4JXXA 1LLFA 1HI9A 5IPFA 2B7BA 3G7SA 1JZSA 1ECGA 4JFRA 4LY9A 4XH9B 3R9KA 2CDAA 1GKLA 5ILQA 3E48A 3CN7A 3MYYA 3DL4A 3EBOA 4M99A 2CDNA 3UMVA 1W2GA 1SBTA 3KO8A 4MVJP 2P8SA 1JFRA 4RL6A 5K0TA 1SRRA 5BWCA 3DEHA 4JLSA 5PGMA 3KLPX 1IB6A 4KWTA 1D9ZA 4CG1A 2ONYA 1TZCA 1JHQA 3PEYA 3RANA 1HRKA 3VR5D 1CRZA 4J49A 3CUUA 1RXEA 1FNCA 1YZUA 3EFEA 1BGVA 4CM7A 4D3SA 3Q8MA 3C43A 1DLIA 3AKCA 3IMCA 3A1FA 1YQGA 2VJDA 1E4OA 3NAGA 3UXYA 1A9TA 1SA0A 2GD1O 1NZJA 1G41A 2JFHA 5DX1A 2VH5R 1L8QA 4S1VA 4JYAB 2HXGA 4RIFA 4CW7A 1E2FA 2JFNA 3GRYA 1JPJA 3OSZA 4UTZA 3MK31 3TTYA 4M1TA 2CJWB 2P2ZA 2TMGA 2FFBA 2CVQA 3NNSA 4ZANA 1GAWA 2FPWA 1EVJA 2NUBA 1MRZA 3EPPA 4I2VA 4KO2S 1CJTC 1JHZA 1BYUA 2NQTA 4JD5A 4LHEA 1NUHA 2BFCA 2QQGA 2C99A 2G1UA 3WL7A 4XQEA 2JDID 1U63A 1FSZA 1RDFA 1ZD9A 1GVHA 1OX4A 4Y0NA 2QUHA 1P19A 2AC4A 2WTMA 4V38A 2I4RA 4BP1A 5IAAA 1D7OA 2V7TA 2GTIA 1VA4A 1CE8B 1BKYA 3BWEA 4OYHA 3W8FA 3WYBA 3IR7A 1EK2A 4UZEA 1XHFA 1W0KA 1AKVA 1R9NA 5EXSA 3F6PA 1S2DA 2RHJA 4MB6A 1KJJA 2P41A 3TD6A 1F4LA 1RP7A 1BFKA 4WBNF 1HE4A 4R7GA 3BN3A 3FUCA 4GQIA 5FWYA 3FF1A 1B16A 5IBCA 1HTTA 1CLEA 4X71A 4B80A 1KY4A 4F5YA 1RBQA 5FBHA 5GVSA 1NVTA 1DX6A 4UU0A 2WM9B 1HQKA 4V02A 5AM1A 4D0NA 2XCTB 4MQUA 3UJ7A 4KU4A 1ZMTA 2Q45A 4PYNA 4D8UA 4RA6A 4EFLA 4DJDC 3CZ9A 1HFKA 1SWVA 1FSFA 2JA1A 3PQ4A 4CU2A 4YRZA 5HGXA 1F9EA 1ZW6A 4RL4A 1GKIA 3LDFA 1J7KA 2WVAA 3OX4A 1M7BA 5HIJA 4A8HA 4I0WB 3L7OA 2NU8B 3GVCA 4GBMA 2H2AA 4IY1A 4KW7A 4M1EA 1FSSA 1U3UA 3R5XA 1OQAA 4F46A 4NOLA 4YRQA 1YT5A 3LL7A 2YW9A 4JB3A 3A8TA 3T7IA 2ZIZA 2UYOA 4MPTA 2BF7A 3WA6A 4A73A 7MDHA 4MCJA 1EA7A 4OKIA 4C0BA 1A8SA 3KXDA 4O5OA 4B47A 1Z83A 2OECA 4JJ6A 3I4CA 3OUTA 4PGAA 4EPVA 5CFQA 4TQAA 4DMRA 2I6XA 4HUJA 1CY0A 5EMMA 5CUQA 1B8PA 4YBRA 1CUGA 5A6SA 2F90A 2VCEA 5DLQC 4DQKA 2XA9A 5AM4A 2V7UA 2VWQA 3CNHA 1JEDA 2VZEA 3BPSA 4KACA 4YAWA 5ALUA 1I94B 4DIBA 2AKEA 3BEOA 3ETHA 4QOSA 1N3IA 1E7WA 5BUQA 3TOSA 1DIRA 1REQB 2QNBA 3UXHA 1NVEA 4AULA 1TJ5A 3EVGA 4B3JA 5JR3A 3IDAA 2VF5X 1QIMA 2ARKA 4MB0A 1CRWG 1B93A 2AW5A 1P7YA 3IIMA 1V6AA 3L77A 3N87A 5CDTA 2BGMA 4DB2A 1YJCA 4MW6A 4YV2A 3J7TA 3IHTA 4M3NA 2PSDA 1N36B 2WF7A 1QK3A 2BGLA 4K86A 4NJOA 3ZCUA 1N8SA 1MPTA 3BF8A 2EP5A 1TB4A 2B4AA 2XB6A 2HMYB 4PRLA 1GGEA 2ZJ1A 4XR9A 1U3GA 3UBTA 4PIPA 5DGTA 4DG5A 3QEAZ 2WU1A 3KOWA 2ZR8A 2QTAA 5FJIA 1V2HE 2GRUA 5IZCA 5C8ZA 1KI8A 4XX0A 1SPBS 3AESB 1DIOB 2IHVA 1CJUC 3GFPA 1RYFA 2MSEB 1I51A 1X1DA 3KG2A 4L4ZA 3SD7A 1PL8A 2R65A 2D54A 2C97A 2UXCB 1RM5A 5MFZA 1F2TB 1GFIA 4TV8B 4FW9A 4MW2A 4B3FX 1FFCA 4BZZA 4EGCB 4CHGA 1JE1A 2VSNA 3Q11A 3TRDA 2UYQA 2V45A 3DLTA 1NXPA 3WNVA 4GVPA 2DQYA 2PQ6A 4GOXA 4IX9A 1IXKA 3WYDA 2AK2A 2HMWA 2JAWA 3BRCA 2W42A 4AY5A 2X0NA 2YJZA 1WW3A 3LY5A 2J3JA 2CFIA 2WV9A 1G19A 2FW6A 3H7AA 3Q9SA 2E48A 4R2WA 4Z0NA 4V3CA 4C0WA 4EDHA 3MGBA 2C95A 1ZK1A 4WW0A 1VE9A 2F17A 2NIPA 3AYXB 3DSRA 4MWTA 5FBKA 3CT4A 5B57C 1QVVA 3VHXB 5HQ3A 4FKBA 1PLLA 1PZNA 4G8JA 4KBFA 2E4ZA 4L4UA 4RC9A 5K3BA 2REOA 3ITEA 3JWEA 5A5VA 3ZDDA 2DCMA 3BG5A 2X9LA 1MCZA 2PVPA 2MSLA 1G5QA 2QJWA 2QLJA 2XGMA 2YMLA 1RWBA 3MLEA 2Z2JA 3GBSA 4HRYA 3L6UA 4JBIA 2QN3A 1OWLA 3KSMA 1Q74A 3DT8A 1CJBA 3GAAA 2Q4RA 3N86A 4O29A 3E5HA 3U1BA 1LSUA 2XXJA 1A5ZA 2B4TO 1D4FA 3FOBA 2WJVA 1GQSA 1VCHA 1L5QA 2MYNA 3AB7A 3ZTYA 3SJUA 4A0RA 3VO2A 1MOPA 1QHXA 2DBZA 4LJ9A 1BGXT 1GGMA 4WKGA 1Z63A 1PFGA 1SAYA 1E8DA 1R4MA 5FPPA 3E0XA 4R6XA 1O2DA 5E9WA 4MRMB 1OF1A 1FBTA 1DWOA 1L7DA 3ANXA 3H04A 3N0RA 4O59O 4Q4HB 3QLEA 4RS4A 3OKCA 3URKA 4E1AA 5J2UA 3L8FA 4FNMA 2LWIA 5CGZA 4EHLA 5J47A 3AFIA 3FZQA 1J22A 4Q9JA 3GLHE 1R74A 5FFMA 4UTVA 3ZV4A 1ZBQA 3R6GA 1NDQA 3AF5A 4HAOA 4MI9A 2OLJA 3ABSB 1N7IA 1QV6A 2LR0A 1UPFA 2P2SA 3IX7A 3NHSA 3OE7D 5DMHA 4BCCA 2D5AA 2H31A 2DWUA 3PEFA 3R76A 5H4HA 4IKEA 4D80A 5EJGA 5IJXA 5IKPA 1ZONA 3IE1A 3ASYA 3NTUA 1A50B 3IVXA 4C3UA 1NXSA 1KMQA 3IJ5A 4X6LA 3ZWQA 1ECBA 2G70A 1EK0A 2KI5A 4U4AA 3UK7A 2EJUA 3EBLA 3JD2A 1Z5VA 3OWXA 4G0UA 3HM9A 1ICIA 1NONA 3PVZA 5FAXA 4TSFA 5TMEA 3G8AA 4EJFA 1EFTA 2RGNA 4PHCA 4Q4LA 1II8A 1Y8RA 1RD4A 5TEVA 3OF3A 3UC5A 3GRKA 4G25A 1ILEA 2GAFA 3L8DA 2OO7A 1E60A 1S89A 4LDJA 4KQWA 4RABA 2HKIA 3OSUA 4M98A 3M9LA 1UM9B 2NU7B 4U0JA 1V71A 2ZE5A 5I4KA 3EZ7A 5I8ZA 5IVHA 5C8YF 1JF8A 3WB2A 3L7JA 2EKLA 2CZCA 2EWWA 3L7NA 4L74A 4P7KA 5C32A 1SBNE 2G9VA 1TECE 4GC9A 2FKNA 4PTZA 1LF0A 3ZLUA 4FONA 1K4MA 3AERA 4QHTA 2GESA 5YASA 3LM8A 4GXNA 5FPHA 5KU7A 1GG2A 1XQ9A 3QVMA 4MH0R 4QXQA 4CU5A 4X1KB 2ZE6A 3OFKA 4OFBA 1EDEA 2E18A 3MTEA 1W4CA 3RBXA 1SWWA 2MJLA 4F06A 1S5PA 1TADA 3OIGA 1RKVA 4QHSA 3ES9A 1TAHA 4DV7B 1HL7A 1KDRA 1QHHA 3H2GA 1XL1A 4EG4A 2B92A 3CH6A 5A9SA 2WUVA 2Y6UA 1QWOA 3E8MA 5F73A 3IFSA 2W0SA 2BZSA 4V24A 1Q17A 2P79A 2SHKA 1AZWA 1T6YA 2BCEA 1OTHA 3CSDA 3JWPA 5DBIA 1RYDA 1WRBA 5T57A 4WCDA 5DKFA 1GPWB 2NVOA 4Z0TA 1TVMA 5AXBA 4Q9HA 4YCSA 1M2HA 2VJQA 3NT4A 4AJKA 4FQ7A 3HTXA 4MZDA 1U9IC 1WA5A 5AI4A 2EBFX 1YI8A 2VYNA 2FP4A 3SR0A 2UV8A 4QT0A 2HZBA 4BZPA 1Y6JA 1MN6A 3DO8A 3N6VA 3IT0A 4J75A 3WMGA 2FFAA 3ZHUA 3A7DA 4PVCA 3TMKA 1E2PA 1P9WA 2QTLA 3FCUB 4JLDA 3QXHA 2XF2A 1BE8A 2GPAA 4YQFA 2IX3A 1MTOA 3HJGA 3OOJA 1BIFA 2V6BA 3G0GA 2ZJAA 2JB9A 3QK7A 5JAIA 1NBEA 1YVEI 5CCDA 5CP8A 5AO9A 3EGOA 5ANRB 1JJAA 4HUQA 3WX0A 1AJEA 4HQNA 4M53A 1E5XA 1W85A 4M60A 3HDHA 4OK3A 1ENOA 3DLIA 1IMJA 2C3UA 3I1JA 1Z4IA 3M9WA 4RSMA 1WU7A 2TSYB 2ISQA 3D8UA 4GDMA 3U4HA 4D8VA 4JR1A 4ID9A 3I6BA 3Q9NA 4DSTA 2X9GA 4ZI7B 2YWGA 1UEXC 4UARA 3GCZA 3KZ1E 4YCLA 5ALKA 1MLDA 3GQVA 1H6DA 3KHSA 1CUDA 4BASA 2ADMA 3UXMA 4C4ZA 2H51A 4XIGS 1N5RA 4J43A 1MVLA 1ULUA 3SZ3A 1PLJA 1UADA 3SIPA 3GJ0A 3G0HA 3RHTA 1E2DA 4W7SA 1RHQA 1X70A 5SYMA 5KBYA 1EDDA 4BE9A 2QRQA 1D2RA 2Z57A 2PGAA 2NXNA 3E23A 5KYVA 4ZKDA 1P5RA 1PYOA 1L4BA 1HY3A 5FA8A 3DJYA 2A0UA 3OVMA 4CT4B 2XTZA 3N74A 5GV8A 1PUIA 3VR2A 2D2XA 1JG3A 3A11A 1GPKA 3SBEA 3S81A 4JHLA 1XTVA 4X1KA 1R9GA 4BFVA 4KMOA 3MAGA 1QAMA 3PL5A 3SIRA 2WAAA 2B1JA 4FZVA 4WVFA 4ESHA 4EKYA 3CVWA 3FROA 1ULZA 4ZYVA 2O7QA 1C1YA 3L04A 3UB4A 4WDQA 4LG1A 2UVDA 3C16C 4LCEA 3V8PA 5GIPE 2E6KA 1ZGBA 1G8AA 2OV2A 4JC5A 4MKZA 4P4GA 2BCJQ 3V1NA 4MPDA 2A1TS 2C7GA 1TTHA 3ZNOA 3NHZA 4YRAA 1H2WA 3P0HA 4QJIA 1ZOPA 1FDTA 2GXQA 1LX6A 2FDXA 2HBQA 2Q29A 3FY4A 2GEFA 3I2FA 3QUTA 3K2IA 4J0IA 4JEIA 3SY8A 2QWXA 4CKCA 5HRAA 4KCGA 2YC2C 3SX4A 2XQVA 1KOFA 1OVGA 1QYVA 3LDHA 1PK9A 3VPSA 3D8SA 1L5MA 2H7XA 2GHTA 2Y93A 1EXDA 1IEXA 3NPMA 1HC7A 3FDXA 1QUEA 1I3LA 3X0DA 1ZI9A 4MYTA 3MWEA 1IY1A 2OXTA 4AMVA 4B6RA 2JI7A 3FNEA 4DLXA 4RK6A 4BO9A 4QYMA 3UOWA 3GG9A 1P4HA 1PFKA 1W29A 1WSWA 2GTHA 2I76A 2OMKA 3PV0A 3ACDA 5TPWB 3LH5A 4F4FA 3P32A 1XRJA 1RXCA 1G6HA 4M0UA 1ISHA 3JQ6A 3MQFA 5F23A 4RH3A 4KSBA 4A7PA 1H42A 2Z4TA 1V45E 3L8YA 2Q6IA 1QAOA 4NABA 3TPZA 2UZAA 3KQLA 3O84A 1DTWA 5BNTA 2ZM6B 1Y80A 2PXHA 2YV2A 1YB6A 3VNBA 5EGNA 5JLAA 1JLLA 2DTXA 3KKZA 1T8RA 4R5HA 1GPDG 5AJXA 4C4XA 4HTFA 2QP9X 1A77A 2OVFA 2VRNA 2WWHA 4UEOA 2FUNB 4YLGA 5K3FB 4EB8A 1GRVA 1LC0A 1WCV1 5GPBA 2RC6A 1RQPA 1RQRA 2ID8A 2P9YA 3KUUA 3ONEA 3DFFA 5AXCA 1ENYA 4Z51A 4EP1A 1H6AA 4EQZA 2GN1A 1JSXA 1LB1B 1D4AA 2FWAA 3C3JA 5EJIA 3BXXA 1K27A 4ZA2A 3F1KA 4K46A 1Y6FA 2XYPA 3JARB 1UJCA 5LUAA 1LNZA 4XGKA 1P29A 2WICA 2X5JO 4LI3X 2OPHA 5AJHA 5MDHA 1YL6A 2AR0A 1RLOA 2Y68A 2D0DA 4TRMA 4RESA 4XJSA 3HVIA 5D00A 4EB3A 4G1UC 4WJKB 3A6KA 4CCSA 5AUPB 4ZYWA 2H4YA 3D54D 5A9TA 3STUA 2HREA 3WWZA 3U09A 3O73A 5K0FA 4DM4A 4ZTUB 2VHZA 2ZRMA 3OIWA 2J4DA 3KDPA 2XEXA 4XGRA 5FBZA 3RHSA 2H92A 1GGFA 2DWPA 2JGJA 1G8MA 1TEXA 2VJMB 4H17A 2ZWAA 3VBCA 5HRCA 4YRCA 2VIIA 2AFVA 2QT1A 4PAWA 2CF6A 2R84A 3HDTA 4AD8A 2XKAA 3DDUA 4WVLA 2LD4A 3UJ3X 4RM2A 2VRCD 2VDWA 4R8SA 2Z2XA 3RUEA 3PQ5A 2O0LA 3RK4A 3HDQA 2H1SA 1Q15A 1Q95A 4XRRA 1VG8A 1VKNA 2QEQA 121PA 2IEGA 3OE4A 1DS6A 2VN8A 3M3HA 3T1NA 1T4GA 1MA3A 2GZAA 1XQVA 1L0BA 3MWJA 3T7EA 2NUTB 4L85A 3HKBB 1RYEA 1GRRA 1AGYA 1K8ZB 2P5TB 2R6DA 2VHVA 2XQJA 4BLPA 8LDHA 3RC9A 1FJ2A 3UKJA 3SKVA 4YS6A 2WHYA 5LP6C 3JAMA 3HLKA 3BXOA 3LC7O 3K6JA 3LJKA 3CE6A 4G4IA 3AW9A 2PGNA 3QFHA 5DGIA 2IOHA 4PFJA 4B4UA 3CVYA 3OZIA 1YRYE 5I7HA 1J0BA 1G1MA 4DMLA 3WDKA 1SBCA 4L9WA 3K0CC 4MJ7A 4CKWB 3PGA1 1Y1SA 4P80A 3UOGA 1ZXBA 5DX0A 1HM5A 3MRSA 2V65A 1R0KA 3ESZA 1M5UA 4GM1A 4NR0A 3NASA 4Q7JB 4Y7DA 4UXHA 1VE1A 1M2WA 5IHXA 1YQDA 2FN3A 2GD0A 2C83A 1L9XA 2PZAA 1CEXA 4XE5A 3DM5A 5CA0F 5EXXA 1I3MA 4LHZA 5DOVA 3GRCA 2YN0A 3TXAA 3I5XA 1MB0A 3CLTD 5AKJA 3WYAA 3UAOA 6GPBA 1XZDA 5KWEA 5JPDA 4BLUA 1ESNA 1SKQA 3OJCA 2C92A 2YWHA 3VXKA 4OSOA 4PG7A 2JAPA 5IN4A 2ZITA 1D3AA 4Q3OA 5EQTA 4FSHA 4QTUB 3UHJA 1DG9A 1A4IA 3I6IA 1P3DA 3LWBA 5J43A 4JI8B 3DMYA 2NZXA 3F3SA 3ZE8A 2PZMA 1K7SN 2PJRA 3FYUA 4B7XA 1YQXA 2O07A 1KTIA 4GR4A 1CR1A 1T15A 1VJ5A 1R8QA 1I30A 1YRHA 2H54A 2JJMA 4W6ZA 4FFNA 3V5NA 5HQTA 3OCJA 1YL5A 2EC5A 4JUDX 2ET6A 1KJYA 2VDVE 2B4KA 1WDLA 3M2TA 1Y6ZA 3GC6A 4ECEA 1XJ0A 5KQPA 4C0HA 1HQYE 3R3ZA 1Q22A 1NX9A 3NIGB 4NZYA 1ZDMA 2J3EA 3V80A 4NOKA 1Z4MA 3I58A 3SVLA 2DHEA 2GEJA 3L79A 1NE2A 1UCFA 2FA9A 2J6BA 4P7FA 3L7AA 3TUJC 1H1LA 1QHFA 2CF5A 1NRJB 1NSFA 3E3MA 4GI1A 4QDUA 3DDNA 5ERXA 1P6QA 3KKLA 4LYDA 2GZDA 2ONKA 1F8UA 2FSVA 2QR3A 4M76B 2ODAA 4IIGA 4YROA 3AF1A 5EA2A 2IYZA 4EH1A 1FFSA 2H2IA 5K0JA 3Q8XB 4DR6B 4IUCS 3W5UA 1ZH6A 2FZVA 2VQEB 1LSSA 3FJ1A 2B2NA 2IPMA 4OUDA 2QRPA 2PWYA 3H99A 4JDPA 4KVAA 3USCS 4C0QC 1H2AS 2IW3A 2OM6A 5AM0A 4GGMX 4KPYA 2PLWA 3DMGA 4D3YA 3GWGA 1SVOA 2Q6TA 4NNPA 3H42B 1DELA 5FCDA 1O8BA 2HFKA 1WUKS 2B25A 3AR7A 1A7AA 3WBBA 1GUYA 1UKEA 1CNFA 5E0KB 3EAFA 5CW1A 5KPJA 1HR0B 3KKEA 4MUNA 1EUQA 3I0NA 4G2NA 1BMDA 4B4DA 4LDNA 2HCFA 4I4TB 1D5WA 4ID3A 1NJGA 3BEDA 3BE6A 4G5GA 3L8CA 2YZ2A 2ZBFA 4P4SA 4WXHA 3ZTWA 3LLUA 9ATCA 4KRYA 4MUMA 1DGQA 3IE0A 3PHCA 1T2CA 3WXBA 5FWNA 1GEEA 1J6UA 2WYIA 3A2NA 4QO8A 1PI3A 3ESYA 1E3LA 2H1VA 3LX8A 1RAEA 4F8JA 3GA5A 3RIMA 2PWAA 2XIQA 4BCDA 5CYPA 1JTFA 1T9HA 4TXHA 2EF0A 3AL0C 4NCBA 2YZGA 1DOAA 3CKMA 3GJSA 3BKWA 5HIIA 1KIMA 4DIFA 3VNSA 2ZTSA 1CETA 5FTKA 1NP7A 1UBTS 3TLEA 4ZXPA 4BKUA 3F67A 1U1EA 4QBHA 2I4TA 3RU2A 5JY6A 1ZIXA 1RLMA 4XWOA 1M7GA 3NV9A 4Z7NB 1RJ9A 2HT1A 3MMSA 1PO7A 4CWAA 5ADUS 4I99A 5EL0A 3BFJA 3RI3A 2F4NA 2CT8A 4LVUA 1KR5A 3NRCA 3B7WA 1IDOA 4Q9IA 2NZ2A 2VAXA 3MLAA 4KRGA 5AJYA 3FFAA 3WJ7A 1R0YA 2G9UA 5LMNB 1F20A 3UANA 1GG9A 1X1RA 3C5VA 5M5BA 1OUMA 3DDSA 1RC8A 3O93A 1IYZA 3TNJA 3ANTA 1CULC 1HQCA 2BZGA 2XZLA 3ABIA 2JI4A 1JVNA 2OV3A 3C3BA 2LE0A 2REQB 3NZEA 4GXRA 4B73A 3BXHA 1YH3A 4D81A 3E7XA 3C3PA 1RZ3A 2GD2A 3IAM6 4IOJA 4WPGA 3RTBA 2CMFA 2GKSA 4OJTA 2FOXA 1YA6A 1X7XA 3AFHA 2CNBA 4G0WA 3EXFB 3PUXA 1KETA 3KFXA 4E4YA 1BQ3A 1MABB 2I80A 4IVRA 1ZGGA 2QAGC 3KJFA 4CLOB 2OEPA 3ZCQA 1U3DA 1FRQA 2QNIA 4HDKA 1C4XA 1HEYA 4YJGB 3QU5A 2H1RA 4AZ0B 5JATA 2AZMA 1I1QB 1N0IA 1NJ5A 2FWJA 3R3XA 3VPBA 2PS1A 2GX6A 3TTTA 4X60A 3FMGA 2Y1LA 4BKMA 5I6DA 4CMAA 4IHJF 1Y6QA 4TGLA 1L7XA 2PD4A 4D41A 2QLTA 3A7EA 4HLDA 3NKFA 1IUPA 1Z17A 2HF8A 1GR0A 2W5UA 4P7JA 1J0AA 2COEA 5HKBA 4S2UA 1Y9EA 1XG5A 2YHAA 4W63A 4O2BF 2YASA 4OXXA 4FILA 3D6NB 5H70A 1UPCA 4HGOA 1TIPA 4LDQA 1X92A 4HAXA 3WJ2A 5HNKA 5KSPA 2GTPA 3OHPA 4F0JA 4II3A 2A5GA 2V7XA 2E4VA 2ZT6A 1W8IA 3KOOA 5HKKA 4G89A 3ABOB 1E1DA 1E2JA 4BLRA 5LLTA 2FPGB 1G63A 3ZXXA 1HLDA 2FUKA 2QX7A 4FFRA 4OI4A 4RPKA 3K6SB 3FJOA 3QVWA 2WU4A 4D8TA 5HKOA 5HIKA 1L4EA 2JLQA 3UB2A 1Q0RA 1YU9A 2XODA 2G80A 2HJSA 2JA2A 3WLJA 4EW1A 3S2ZA 2WU3A 5JAZA 1EGAA 2PKCA 4FD2A 1OIXA 2BGNA 1T9CA 5EGSA 4AKGA 4O4IB 3UJNA 1DKQA 2YHSA 5BT9A 2VPTA 4UCWA 4WXMA 3VR5H 3PE4A 3E9QA 1SUEA 2AE1A 1REQA 3RT7A 5TJ9A 1S7GA 4W8OA 3MN1A 5CYOA 1ECPA 4NE2A 4NWIA 1QOQB 3RV3A 2FZWA 2V7VA 3W2FA 4N6NA 3L05A 1CY7A 1NN0A 2FVYA 2WMNB 5BN4A 4AU1A 3I1YA 2IXBA 2OGUA 3CLRC 4FDAA 3ZOKA 3HB1A 2XCIA 3QEOA 5BNWA 4FIZA 2J3HA 1PW7A 1U98A 2P9FA 5JV5A 1QPZA 1VLJA 4ZI5A 3JPYA 3KZXA 3TM4A 1PF7E 4BDSA 1XDGA 5JASA 2BHRA 3BFPA 1U8YA 2ZIWB 4QATA 1VSUA 2CLLB 4UOZA 4MUYA 2AR7A 3GJQA 1ZHFA 1J8MF 1KMMA 3B2NA 4KR6A 1X1BA 2UUCB 3N05A 4BLWA 5HWSA 1YGPA 3EH2A 2D1RA 4Q34A 2VHTA 1TOAA 1DC4A 4QD3A 4RF4A 3UKOA 3IAM1 4DILA 2B69A 2ZRDA 1WUJS 1DEAA 3U3OA 2MSDB 3NHLA 1AZTA 1M76A 3LCMA 2CC2A 5K8LA 1B0PA 4R8VA 1Y8CA 2PH5A 2IXTA 2OXFA 5EJ5A 3U44A 3UA3A 1YB7A 4YJKA 3OZRA 3E81A 3PR2B 1XRQA 4Z9FA 1JDUA 4H6XA 1ZITA 2MMGA 1ZVJA 3AI3A 2O8DB 1X1CA 1P1HA 4KN5A 3TLBA 2ZI5A 1YCHA 1Q14A 3C8DA 1TZMA 1GZVA 3GZNA 4KQHA 1XVUA 2P9TA 3LHIA 5EZYB 4NZNA 1UWLA 2Q5CA 2FR8C 3QEMB 2DSTA 4CXMA 1M1UA 1EE2A 4YI3A 2WF8A 3H2KA 3HSKA 4ZXFA 1A9PA 5E6UA 5GVRA 2A5JA 2B3TA 1TMOA 4WV3A 1C1XB 1N9GB 2QM3A 5G4KA 3VPCA 4E2FA 2IP2A 3ELDA 1PNOA 2YZNA 5ICFA 4I55B 4ZT4A 3Q7PA 1HYEA 1N0VC 2E4XA 3HV2A 3A27A 1JDZA 3ESXA 2C0QA 3EULA 3FH0A 4CIVA 5BNIA 5CBPA 5K0NA 1XKLA 1QQBA 2IY9A 4IVPA 4O4LA 4GAEA 4PVDA 3IUEA 3BIFA 4J0CA 2EKBA 1E99A 1W52X 2I22A 3MXOA 1G16A 1TIBA 3OZEA 5FOQA 1OASA 2A9PA 3HKEA 1CHNA 1V5IA 4AZSA 3OZWA 4RD0A 2Q3LA 5SZKB 3N58A 2C7VA 2ETVA 2C04A 4B5KA 2CNWD 3HJHA 3TRKA 2WSYB 3E35A 3PXCX 4YMSA 1J20A 4DADA 1SHZA 3WGKA 2FZGA 1YU6A 3E1KA 1XDUA 2I87A 4QEZA 5EKUA 1QS0B 1XPUA 1RC1A 4Q9DA 2IV2X 1C9KA 2R9VA 1DFGA 4YJFA 3S1LA 4EPTA 5FTLA 1S96A 1H22A 2Q3DA 4QE3A 5AVKA 3TW0A 1V7QA 2B6HA 1QFXA 3IALA 5AI6A 7YASA 3HZZA 2J30A 1W5AA 1C7FA 2ZJZA 1XZCA 3WNCA 4JI7B 3U3KA 4Q7EA 4ZTZB 3CKLA 1AH2A 3UO8B 4JN6B 2QS9A 2WF5A 2X19A 1WWKA 3LC1O 3OJLA 4QXRA 3VR4A 4AFNA 2CLOB 1HT0A 3I9LA 3PQFA 3B6MA 1UXOA 3RSLA 1MFPA 3S2IA 4C1NA 3LY7A 5DNCA 3WRXA 4DNOA 2Q2WA 3DCNA 3KQTA 2VFAA 1B15A 1D1PA 1SB8A 3DE5X 1MKYA 3COSA 4FJ2A 5AIAA 3M3DA 3TRFA 1ID1A 4DDHA 2YICA 1EEXB 2WT4A 4NS4A 1XGKA 2XE4A 1OZGA 3SHTA 5LP1A 3O7WA 5HCUA 4ES6A 1U5CA 5JD3A 1K3TA 3QBJA 3PHJA 1KZYC 2AC7A 1TF2A 1DX4A 2MINB 4WK4B 4S1OA 4YRBA 1EK1A 3HFRA 1RPAA 5BR1A 1WZNA 4ECAA 1SZPA 5F3RA 4OLHA 2WTEA 3WB9A 4OX9Y 1WVGA 4EVSA 2LZ0A 3MJRA 5KQSA 3M0EA 2WZQA 1NHWA 4E7OA 2W2LA 4US2R 3VKGA 1CY8A 1JDTA 1YZKA 2B99A 3EGXA 3QVTA 4LQDA 5BN5B 3T34A 4GXQA 4KN9S 1TTQB 3AUAA 4GLOA 3OIUA 4KRXA 4WBNA 4RTQA 3V4PB 3I9V6 3F71A 3P19A 4LJSA 2AFIE 3WSVA 2EW8A 2GEBA 4AP6A 1XEFA 3BILA 5L45A 3CF0A 3ID6C 1JIVA 1ZK4A 3NJ8A 1KVTA 1QH8A 2J85A 1HE8B 3MCZA 4WNCA 4FFOA 3T6KA 1ABBA 3PR3A 4O1HA 1BHJA 4GQBA 4TYNA 2HK7A 1C7EA 2H08A 4FDVA 3JZAA 2IDKA 3HCNA 4AJPA 1TDJA 4BO1A 2QU8A 3ZVMA 1JIUA 4W1QA 2P6RA 3FRIA 1LY1A 3LG2A 4P4NA 4XTCS 3QVLA 1TF7A 2UUOA 3X2SA 2GBIA 3DGFC 4K2AA 2RAPA 2R87A 3RC3A 2PU7A 4IIJB 4QM6A 1V35A 1X80A 4UAJA 5ENVA 2R8PA 2J9FB 3LLCA 4IV0A 3RRYA 4ETNA 1MORA 1SXQA 2BH2A 2HD4A 4TMVA 5JQGA 2NU6A 1SVMA 2ASVA 3CMMA 1IM5A 1W0KD 2Y71A 2POQX 3OOHA 4TT8A 5B2FA 3JYQA 4ZO9A 5CCXA 9MHTA 4UHHA 4YJHA 1GNRA 3TH5A 2QD1A 1C7IA 2ZQZA 5BV8A 1IJFA 3DBHB 3MS4A 2WIBA 3N0XA 3TAUA 3WK4A 1W36D 5DYNA 3B13B 3FKSA 3HFGA 3C3CA 3LLSA 5CPFA 4DOMA 1JHDA 5HSGA 3ZXYA 3IDFA 1G8SA 3O8QB 2I67A 4PLVA 2VOEA 4F91B 4Q39A 5DXJA 3O26A 3NM4A 3KT8A 421PA 4LBWA 3TX6A 3QF4B 2OHJA 1THTA 2SECE 3KHTA 2P1ZA 3Q9UA 3P2OA 5DCYA 1IZ7A 4DEYA 4EEXA 3SFTA 4W5WA 1GSIA 1W5SA 1CJSA 2JGRA 3TM5A 1JQEA 1KH1A 1DUVG 1FFAA 3MTQA 3PDIB 4CIYA 4X93A 3RYCB 1XP8A 3NWPA 1GLGA 1PNRA 4P35A 2C84A 2IIVA 3RODA 3WLAA 1F8GA 4RLFA 2D5LA 4W1RA 4Y0AA 1UJ6A 1E6CA 3VU8A 4E5VA 4WFIA 3C5CA 3S99A 2GSWA 2AYYA 3Q3VA 4AN1A 4GW3A 1RXYA 4MAMA 1OC2A 4IJMA 3REFA 1WETA 2Q5QA 4LX0A 1L5OA 4XFJA 4YMWA 1P2VA 3FCYA 1SK8A 3KQQA 4QGAA 2GZHA 2HLDD 2R1VA 3NV7A 1B76A 4FMDF 1CRPA 3F6RA 3C70A 3FNIA 3NAQA 1T2AA 4BB6A 1CPYA 1LDEA 2WJAA 3D6MA 3GPBA 1IUNA 2LW7A 4MYCA 5IBRA 2QTHA 3AG5A 3SG0A 3T7AA 3H1BA 2DPLA 3DOEA 5M2QA 1RKXA 1HE1C 3U7QA 3ESCA 1RWPA 4AY4A 1OBOA 3BK2A 2JJ2D 2CLDX 3PUVA 3RVKA 3ZLVA 4Y2RA 2Z9BA 2YWEA 4JY7A 1E89A 3JD1A 2RCYA 3PDJA 4MQFA 2WT9A 2W8BA 2XV1A 2ACEA 1M0TA 2GJSA 3HU5A 5DLEA 4QGFA 3C97A 4E2YA 4G24A 4LC9A 1XEWX 3IT3A 5ECGC 4YRLA 1SKBA 1EJBA 1PJ4A 4BAZA 5FV7A 4ALIA 2G76A 3R9XA 1RRCA 3FTFA 1QGYA 1XPJA 3TUZC 1PJCA 4YA6A 4B3MB 2GMWA 3IIKA 1FW6A 3ISJA 2ZM5A 4MKIA 4OHFA 3OLYA 3OMXA 3F6EX 5IF9A 3K92A 4M9XA 4MPRA 1CF9A 4XI9A 1YGYA 4MR8B 3PENA 4AW9A 3PWZA 4DMMA 4ZCTA 2KM1A 3JZDA 3FHTA 2GHQA 4YQYA 5A5DA 3PTAA 1SVLA 3DVLA 3C7KA 2CBXA 4XCVA 3HXQA 4LKOA 1KO5A 4LYEA 4B3DA 4BB5A 3EXEB 1OA1A 3EY9A 3VO9A 4NC9A 3HXPA 2W2KB 4I19A 3FMPB 3T4PA 4AYXA 3OOYA 1N2EA 4NPAA 5ELXA 4GIBA 1M67A 2GBFA 2Q1WA 2VYVD 1RVV1 5EHNA 2XT6A 5B1SA 1L5LA 3W1EA 1RWOA 4HPXB 1DBIA 2K2QB 4M9CA 4GX2A 1BXGB 5JDCA 3TEMA 2O5CA 3TFWA 2E9SA 2OM2A 1I5RA 1QCYA 2P2NA 3PT5A 4YFVA 2PGLA 1K9VF 4LYGA 4LFBB 2C5BA 2J6IA 5LDDC 3HR7A 3C6MA 4D9EA 3GJRA 1FEZA 4FEYA 5EEGA 3HP4A 3TBFA 3IPXA 1OWOA 1POXA 1NI4B 2BHTA 5EP1A 2YJ6A 3HXKA 1LPPA 1I2DA 3BJZA 1Y7LA 3CBGA 4U7FA 3B3AA 4YT2A 3UCXA 1ZESA 4IAOA 4CL8A 1K5GA 4Q93A 3RV4A 3UTCA 2DPXA 2BTQB 1JU3A 3K5IA 1FS4A 3KAJA 1T0HB 3QY9A 4YV0A 1DKPA 4ZAYA 3ETJA 4A27A 4HPJB 5LZ4A 2DUJA 3DZFA 5JD4A 3NTQA 1FMCA 1QPGA 1UJNA 2W70A 3PLAE 2NUAB 1F2VA 4QXOA 4BGIA 4HV4A 4G0VA 2W6ZA 1E6KA 4L8LA 1DAPA 1MXFA 1DC3A 2BKVA 2VKTA 3KQPA 4YWHA 3U7RA 1F6BA 4C89A 2R44A 3GGGA 2WINI 1WZCA 3AUFA 5IXJA 1G8PA 1RACA 1V6SA 3NDIA 1ELOA 1QE3A 4RMNA 3WJAA 1R0XA 3BM5A 4UBLA 3TG8A 1QE0A 2Z9CA 2BMEA 9LDTA 2E82A 1Z75A 3KVRA 3N2GB 4MGYR 4UW9A 1XNQB 3EQ2A 3ADPA 2GZ2A 1VL5A 2AN3A 4O4JB 3LLVA 3OQOA 2HSWA 5JNUA 2MU1A 2GILA 3TQFA 3VMMA 3GX1A 4GVLA 1QBGA 4IDCA 4WLUA 3CW9A 3E9ZA 3FKJA 2DHCA 3LGSA 4RY9A 2YDXA 3NYWA 1A2OA 1L8OA 3K9LA 3GQBB 4NYMR 4OP1A 2D5IA 3WG9A 1D9XA 3T1HB 3A1DA 1B6RA 1TA9A 3D7SA 2BGTA 3GFRA 2EBWA 3F6SA 3KXIA 4K7JA 4MA0A 3LL4A 3IILA 1JTEA 1TQ8A 1HE3A 1P62B 2I6TA 1V95A 1VRCA 3SZMA 1Z8FA 3UV7A 1QIDA 1PNVA 3TE6A 4ER3A 1ONNA 3KB1A 2XUJA 3OZ7A 3Q0TA 3T5DA 2LDBA 2PGDA 5E9QA 3L43A 4V0OA 1SOUA 3RROA 2NOAA 3PCXA 4RHUA 3VTFA 5BSEA 3Q7IA 4CR6A 1NDHA 1VIDA 5LUBA 4K03A 2R62A 1E4VA 3H1GA 4MV6A 1L8LA 4M1YA 1YNSA 2QW8A 2Q6VA 1A27A 6REQA 3R8CA 3UUGA 4QNMA 4AO8A 2C5SA 5CNJA 4I3FA 3FMOB 3WFZA 3HU2A 1RMTA 2VTDA 1FSPA 4JJ8A 1XD8A 2IXAA 1IWPB 4M46A 4RY8A 3T5TA 1U5AA 2GCOA 3T3HA 4JBYA 5DCLA 1EVYA 3R8FA 1YQUA 1DWPA 5FFFA 5M34A 3PC7A 2EXXA 2VAMA 4OJNA 3CX3A 4OU5A 3H18A 1KYQA 4GGOA 5IYZB 4AZVA 5JWRA 3CVUA 1JT9A 4Q02A 4D4GA 2OV8A 4V03A 2IZ1A 2ZRLA 2FPOA 1CR6A 3W9BA 4UEWA 5BRJA 4UC0A 1KFBB 2O8NA 4ACBA 4QUJA 4R2MA 4TQ9A 1M2KA 1PDOA 2FUEA 1C8VB 2F3QA 2Z1MA 2QYOA 3DUWA 3C3KA 4WCFB 1QV9A 5KJ1A 4J29A 1TRHA 4KQKA 1FP2A 2XT9A 4A5SA 3RARA 3ZHQA 1FRNA 4HWOA 5LP6F 1C0PA 1ONPA 3LQ2A 4KDEA 5A06A 4QKQA 1NVUQ 4D92A 3JATA 5IJ9B 3U2QA 3A6PC 3D4BA 3MQ4A 3MB8A 4Q7LA 2HGSA 1L5NA 1U8ZA 4C0LA 1KU6A 2B37A 3A6GA 1RJFA 2A30A 3AI2A 3RU3A 4CI9A 1OX4B 1PJQA 3S68A 2I3BA 1RHMA 2GK3A 2YYZA 2MSCB 2ZJ8A 3EPRA 3GJ7A 4HYQA 5J63A 2ATIA 5E7MA 4AWBA 2XDYA 1IZYA 3DVSX 3BE8A 2VHYA 2DFTA 3E61A 4GMKA 1NPDA 3R77A 4K3UA 3LSYA 4CM6A 2UUAB 2CFOA 3OPYB 4EAAA 2CNWA 1CY6A 2G06A 1JKIA 3GVHA 2ZJYA 4DCMA 4OXRA 4RF5A 3TXYA 5A4AA 4CM1A 2O23A 1TLTA 4CKBB 1SUDA 3ZG6A 4X95A 1E58A 4KFSA 1CS4C 5K3OA 1TA0A 3LWDA 2QPLA 3DEIA 3E9EA 1DAGA 1KI9A 1TYCA 1QP0A 3QSGA 3FDZB 1H9AA 3AXTA 2ORYA 3V3KA 4C1BA 4LHYA 1OXTA 5LA6B 1KHHA 1UDXA 1Z3IX 4EYSA 1TIKA 4L57A 5B7PA 1YKGA 3G5MA 3KHKA 5EE5B 3T12A 4WOBA 1JEYA 1SQSA 5F35A 4JITA 5JU6A 2RI0A 2C07A 3LX5A 1YZTA 3IUQA 3DAYA 3ZY6A 3ANYB 3D6AA 3A32A 3A6FA 3CZMA 2PUAA 1GDTA 3VH2A 2J1LA 2QPOA 4PQGA 2P6NA 4A10A 2V3VA 3EFOB 3TKLA 1CQJA 2Z8XA 4QFDA 4EI9A 1Z0KA 2X2EA 4V0LA 3QBEA 4UZFA 3ZD7A 4PNEA 1YRAA 3GFQA 3E18A 3RYFB 4MUEA 5EN4A 3QI7A 1ADJA 3VKUA 2RE8A 5GADl 2Z83A 2ZVDA 2W93A 2WMOB 2HA6A 5LZ7A 1LH0A 1JWLA 4MUKA 2VBGA 3PF9A 3JZMA 4E5UA 2N1BA 3HVUA 4LOKA 1ZM7A 4GPD1 4EG8A 5CDSA 5K5EA 4H4EA 1FZTA 5CFLA 3CZ5A 4RD2A 4OQLA 5CFZA 5HW0A 1PQWA 3WK7A 4G9BA 4FCTA 3HYSA 4W1PA 1NZDA 1Q2UA 1Z4JA 4IFIA 2FLWA 2YNMC 5JSYA 3QPCA 3NIBA 4ZV4A 3VOSA 1PGQA 5AHWA 5JNSA 4DHWA 1ZUNA 1L7RA 2IIPA 3RQSA 5BWOA 1E20A 2RK6A 3O4HA 4UNSA 4DT1B 4JMPA 3QYPA 4NBSA 2QAGB 4MCHA 5EKTA 4CUZA 3C8MA 2EGGA 3H1EA 2UXBB 3ZPXA 3ZY2A 2ZJ7A 3KLMX 3I2HA 4F04A 4CIBA 2RGBA 4E5YA 5HKKD 1YZNA 2XGSA 3PDHA 3QITA 1IAVA 1QG2A 1BX1A 4ZOEA 3TR5A 3VV2A 2I65A 4DWJA 3S40A 3VC1A 4TLDA 3CUTA 2HHAA 3QJGA 4DNXA 1RIFA 3CH4B 2JH3A 1NW3A 2WEKA 4OA5A 5HM8A 3HGQA 4AS3A 1TMGE 1DIAA 4EDFA 5L4NA 1QGOA 1JB9A 1JFFA 1SVUA 1T9GR 1FTWA 3KQVA 2HRZA 2J3LA 3GEDA 3B7PA 4L27A 3ZWNA 3GFTA 4OHZA 4JVSB 3A3KA 3RO7A 4WASA 2Z09A 1PSDA 1R6BX 3PU6A 2WNSA 3NG1A 1G60A 1DKNA 3RRJA 2QRJA 2HA4A 5A1JA 1I36A 1Q83A 1QVZA 2B20A 4WMLA