1D07A

Hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis ut26 with 1,3-propanediol, a product of debromidation of dibrompropane, at 2.0a resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
293
structure length
293
Chain Sequence
GAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HALOALKANE DEHALOGENASE
publication title Crystal structure of the haloalkane dehalogenase from Sphingomonas paucimobilis UT26.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
total genus 113
structure length 293
sequence length 293
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 1999-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1d07A00
2XUKA 5LZ9A 4J0IA 4DNPA 1GXSA 2OCKA 2XQIA 3JW8A 1XZJA 4ZV7A 2DHEA 4PSDA 4UHFA 1EDEA 1BRTA 4UBKA 3R0VA 3WZMA 1ODTC 2XMBA 3PDCA 2HA0A 1T4MA 4DSAA 3H17A 1XZAA 1VA4A 4GXNA 4PSUA 3B5EA 2HA2A 2XT0A 3KD2A 3E1GA 4BCCA 1KU0A 1AC5A 3GFFA 2JGKA 2XUFA 3QVMA 3W9UA 2QUBA 1H2XA 3FLEA 1YSCA 1ZIYA 4UHCA 3CCBA 3QMVA 1R50A 4DMHA 3E0XA 5A7GA 3AZOA 3DDUA 1XZKA 3PE6A 4MWTA 4F5ZA 1U8EA 3EQ8A 1QFMA 4KACA 2W6CX 3QZUA 1J06A 5ALLA 4LYEA 3NWOA 2QTBA 3R41A 4DTCA 5A62A 3G0GA 4CG2A 5FOQA 1DWQA 1R1DA 4FFWA 2BJHA 5I9IA 5CRIA 3HACA 4BDTA 2VJAA 4B80A 3M81A 4E15A 4UBMA 3IA2A 2XMGA 3WA7A 4NMWA 1XRRA 3QH4A 2OCGA 1OCEA 4L72A 2QR5A 1DX6A 3DYIA 2CBGA 2CUTA 4IHAA 3ZLTA 1VXOA 2I78A 2AJCA 1TAHA 1H2WA 5D7BA 4FBMA 5AJHA 1PJAA 3F98A 5CT9A 1OILA 4B85A 4GLBA 3W9BA 4MEAA 5ISMA 2O7VA 3WKAA 1U4NA 4Y2TA 1CUEA 5LKRA 2P8SA 1QO7A 1H2ZA 3O0DA 1LPPA 3G7NA 1LPOA 2XQKA 2WIKA 1LLFA 4XWGA 4OSEA 5EGNA 5AI9A 5D3KA 5K3FB 4J7AA 3VDXA 5CH8A 4BZWA 4C87A 4LXIA 4QDTA 3NOXA 5IVKA 3DLTA 3DCNA 4G5XA 2WG0A 4FOLA 3IBTA 2GZSA 5CT8A 5EIEA 1A7UA 1W75A 2XUQA 5D6OA 1ZIXA 3H0CA 3FSGA 1DX4A 1ODCA 4E46A 5JD6A 1S8OA 3HLKA 1DWOA 1ISPA 4QLAA 4FNMA 2PUJA 3VVMA 4EY5A 2BGRA 5D3ZA 3V1LA 4CG3A 1XZBA 2J3QA 2Z5GA 2QS9A 1C7IA 3V1NA 2OAEA 2NW6A 1BN7A 4GI1A 2XDWA 2XMRA 3DOIA 4PV7A 2RONA 3H1AA 3K2IA 4Y9SA 3FYUA 3G0DA 4IH4A 2PX6A 2HRQA 2WJ4A 3MVEA 1EVQA 4NS4A 4JUIA 2QVBA 3I2KA 3H18A 3QITA 3C5WP 1MJ5A 4DIUA 4WY8A 3JWEA 2Y1KA 3TRDA 4BAGA 3R3ZA 4ZWNA 1FFDA 4UBJA 1LZKA 1CIJA 1UT6A 5LLSA 1Q84A 1WPXA 2ES4A 4G4IA 2RAUA 1CUFA 3YASA 3WK8A 3KOOA 3AZQA 3D2AA 1YCDA 1GT6A 1ZGBA 2HL6A 2HIHA 5JARA 3UUEA 1XZIA 3O4HA 4GECA 3WA6A 4F60A 2RGUA 5AH0A 4KE7A 1CFJA 4L3WA 2PSJA 2XI4A 1CUVA 3GUUA 4BCDA 5ALUA 5ALJA 1Q0RA 1ZI9A 3VVLA 3HJUA 1CUWA 1VE7A 1AX9A 4X7BA 3G9UA 5LZ2A 6YASA 1W6RA 1CPYA 2XMCA 2WUFA 2WG1A 3SX4A 1CUJA 2PKYX 3IUQA 2WHPA 5ALIA 1QIFA 5T4HA 1G66A 4LXGA 2CEKA 3KWFA 1CLEA 2QT9A 2PPLA 3F67A 2OGSA 5AI5A 1Y7IA 2WHRA 5FXMA 5EHNA 4TPKA 5CT4A 2ZYSA 2GBGA 1JKMA 4U2EA 2GBIA 1NU8A 4TVKA 2JIDA 3QPCA 4CCYB 4W1PA 5EIHA 2O2IA 2QKYA 3PF8A 4UBLA 3WK4A 4BRZA 3ICWA 5CT6A 5AKHA 1HPLA 2C0PA 4K6KA 3WK5A 4U2FA 1N8SA 4UBNA 1O6FA 4UHDA 1MAHA 3LLCA 3Q8WA 2WFZA 3WL6A 1K6EA 3OOSA 3W05A 3H04A 4GWLA 1WB4A 4A5SA 2PM8A 4E11A 3O9VA 4BATA 1VE6A 2BFNA 1R3DA 2WG2A 2EDAA 2JGLA 4I4CA 3W2TA 3C6ZA 1IUOA 1N5MA 2XMSA 3AUKA 5ALPA 2WUEA 1MX5A 1G5FA 2J4CA 2VT7A 3PI6A 4CIAA 4Q3OA 4IQ4A 5FP0A 4HXEB 3G02A 4FTWA 5JANA 3H2KA 5A71A 1FFAA 3GA7A 5FPPA 4KAAA 5HK9A 1XRLA 2RHTA 3ED1A 3JYHA 1LPNA 1XZDA 4BTLA 1ZJ4A 1XZGA 1ZD4A 4EY4A 3MUNA 4YASA 3WKEA 4OB8A 5JAHA 3F8SA 2X5XA 3GELA 2PU7A 1SCKA 1BEZA 4HRXA 4W1SA 3EQ7A 5DYTA 3WI7A 4H7EA 5H3HA 4G9GA 2EEPA 1XRMA 1EA5A 5FLKA 1EVEA 2ACKA 2FJPA 4EY6A 3PICA 4BTVA 2WIJA 1DTEA 1AUOA 1RP1A 3DD5A 4N8SA 2Y6UA 4MYSA 1A8QA 3DL7A 5ALSA 4OUKX 3STVA 4KRYA 2BUCA 4OU5A 2HFKA 1JI3A 2QXTA 1VLQA 1QJ4A 1E3QA 1SCIA 4WJLA 4OB7A 4LXHA 4B6GA 4KEAA 1XRPA 4I19A 4UBOA 2JGIA 4Q1VA 3EQ9A 3R3XA 5HKAA 3HZOA 5FRDA 4BVJA 5KWJA 4BC1A 2HU7A 3WWPA 3N2ZB 4HTAA 4XVCA 2QJRA 2WLSA 1ZD2P 5AKEA 5AOAA 3I1IA 1CQWA 4W9RA 1F6WA 4DMFA 1SC9A 2PVSA 1P0IA 4XIIA 3G9XA 4X94A 3M3DA 4ZGBA 2C5GA 3WL7A 1CUUA 4DYHA 1IZ8A 4BB0A 1P0MA 4IH9A 5A2GA 3O9MA 1M33A 2OG1A 5CH3A 3DKRA 1CUHA 2G5PA 2QMQA 3PFCA 1VKHA 1YS2X 1JJFA 1R4ZA 4H18A 1EDBA 2V96A 4WDQA 5BWBA 5C8VA 1ZD5A 3IURA 1R9NA 4J0HA 1BCSA 4BBZA 4N8DA 2HADA 3ILSA 2VJCA 3W04A 2BAGA 4QLOA 2DQZA 1JMKC 2GBFA 4J0GA 5ALFA 1EB9A 1FSSA 2ACEA 4DGQA 1ACLA 2XLCA 2PUHA 4C4XA 3PF9A 1FJ2A 2BGNA 1E5TA 1KU6A 5ALYA 2B20A 4OPMA 3VJLA 3WWDA 2WU3A 1G42A 4KAFA 3RLIA 2DQYA 2QM0A 1E8DA 2CMFA 3OURA 2IIVA 2XMZA 3BXPA 1CVLA 4BYMA 3BJMA 3OG9A 1QIHA 2QRUA 3MUOA 2WTNA 4ZRDA 1GQRA 4Y2SA 2V9ZA 1JJBA 3D2BA 4AX4A 4X97A 1QO9A 2PSEA 4B82A 3BF7A 1QOZA 3A6ZA 5BWCA 4Z49A 1HQDA 3G0CA 4XX1A 1BCRA 1GPKA 4K6GA 5AKJA 2ZSHA 2FUKA 1TCAA 5DNWA 4BVLA 5AKXA 5JIBA 1MNAA 3FBWA 4QA9A 5HF6A 1IMJA 4B83A 4JH0A 5DTJA 4X00A 1ZI6A 2JGEA 3HABA 3C87A 2OGZA 3TJMA 3DKKA 3O4IA 1O6GA 2HU8A 1CR6A 4QZVA 2DHDA 3BIWA 3U0VA 4BP8A 4FFVA 3ZV7A 5EI5A 2XQGA 2V98A 4QDZA 4FWBA 4QDUA 1ZICA 2JGFA 1U2EA 2ROQA 4QEKA 3OTQA 1YASA 4KE8A 4B0PA 3M82A 3F97A 2JF0A 1JU3A 2DR0A 2WILA 5IVIA 4YX9A 4H0CA 1TQHA 3VKFA 4AN0A 3QMMA 3VISA 1XFDA 3I6YA 1R88A 5AKLA 4G8DA 4B7ZA 3RK4A 3Q0TA 3H2GA 4QDOA 4OU4A 4KYVA 4Y2QA 4KAJA 1AGYA 1WB5A 4DM7A 1B6GA 3O4GA 5IVDA 2HU5A 3BE8A 3D59A 4WFJA 4ZI5A 3PUIA 2DFPA 2VATA 5A6VA 2GYUA 4QNNA 1EK1A 1EI9A 4FBLA 1RWQA 3M83A 4CI9A 4FLEA 5SYMA 5BV7A 4HS9A 2PSDA 3C45A 3S8YA 1VZ2A 3AINA 3AFIA 4UHBA 1TCCA 2G63A 3G9ZA 2ZYIA 3VXKA 5AM4A 2PSFA 5AM2A 1L7RA 5K3CA 5DLPA 1WHTA 1GPLA 4Y2JA 3WJ1A 3DS8A 2WUDA 4AMYA 2RHWA 5I8PA 4H7JA 5AKZA 2OQVA 4RE6A 3C70A 1XZMA 1UKCA 4Y7DA 1N1MA 1LBTA 5DTIA 1DQYA 4OD0A 4QDXA 2DSNA 2JGMA 1QLWA 1G4HA 3I28A 1AMNA 1QGED 3L1JA 1N5RA 3ZLVA 3A2NA 4X90A 5AKIA 3WIBA 1QFSA 5JATA 4C88A 4J0DA 1GKKA 4ZXFA 3AIKA 2AJLI 3G0IA 4MWSA 4BDSA 4X95A 2WHQA 1LPSA 2R8BA 1QTRA 4ITVA 2Z3WA 2WUGA 1F8UA 3IB3A 4I3FA 4S0XA 4MEBA 1Q0ZA 4BE4A 1XZEA 4M0EA 2FX5A 1A88A 2VTVA 5LYYA 3STWA 1X2EA 3A2LA 3BJRA 1I6WA 4ROTA 4RGYA 3ESCA 1JT2A 1C7JA 4P93A 1CUXA 3HI4A 2WIFA 1JMYA 2ECFA 3ZWQA 4P92A 1UK8A 2OQIA 5ALNA 2HA7A 5FV4A 3QMWA 5AK3A 4B84A 2WU4A 2WFLB 2OGTA 1TK3A 1E8NA 1A8UA 4G8BA 3FVTA 3PFBA 1F0PA 1UK9A 4GBGA 5LZ8A 1H2YA 1K63A 4GW3A 5ALMA 4KR0A 1ODSA 4AN1A 1YA4A 3G9TA 3R3UA 4X71A 2HA3A 4U2BA 4HRYA 1CQZA 5AOBA 1BEEA 3LIIA 3R3VA 1W1IA 4F0JA 2QXUA 5FPQA 3WL8A 4Q82A 3WL5A 5HQ3A 1QIGA 3V1MA 1WM1A 2HA6A 3BDIA 2YH2A 1UK7A 5C81A 4WY5A 5HKBA 3ESBA 5AM0A 3IVMA 4UFNA 3WKDA 2VF2A 2HM7A 4KJXA 1CEXA 3WZLA 4C4ZA 1HLGA 2EDCA 3STXA 3E3AA 2QUAA 1CUZA 4K2AA 5EHZA 3ANSA 5A7HA 4ARAA 5HFAA 1H23A 3QBJA 4EZIA 4IO0A 4L9AA 3I2JA 5AI0A 3WYNA 1PV1A 3D2CA 1JFRA 3ESAA 1UK6A 5K3DA 4GEGA 4DLNA 1J1IA 3C6YA 4B9AA 4HXGA 1X70A 4UPDA 1B41A 1QIMA 2WKWA 3QYJA 4PO3X 5JADA 2H9YA 3G0BA 3I2IA 4CG1A 1WPRA 4MQMA 4P9NA 3DQZA 1XQWA 5HF8A 4MJ3A 4B0OA 3G8YA 4HXFB 1IVYA 4MXDA 2HRRA 2ZYRA 1UOOA 1DINA 1VZ3A 5ALKA 1CUDA 1KEZA 3WLAA 3MGAA 4M0MA 5LKAA 4FLFA 2I3DA 2X8BA 3A70A 4FDMA 3WK9A 5EFZA 4QWWA 5KWIA 2QOEA 4DMKA 4DSZA 4HVTA 4X92A 4GHWA 1YR2A 4UBIA 1MX1A 5CXXA 4N5HX 2BKLA 1W76A 3AZPA 2ORYA 5AOCA 3DOHA 4Q3LA 2OCLA 3L1HA 1VJ5A 3BF8A 2XMQA 4X3CA 4KE9A 2C7BA 4RE5A 5EIAA 4U2DA 1EX9A 2H7XA 3FYUC 4CIBA 4M0FA 3WJ2A 3X3HA 4EHBA 1TRHA 1YS1X 3DJYA 5AI6A 5LZ4A 1MU0A 1UZAA 2Y2VA 2B4KA 4AXBA 2DHCA 3DNMA 3OPMA 5DYYA 5EHXA 3ZI7A 2CKMA 2WTMA 1EB8A 3AJAA 2XUPA 5AKGA 2FJ0A 1LPMA 5JZBA 1QIEA 5AIAA 2WM2A 2WFMA 4JYPA 2WIGA 2AJBA 1ZD3A 1HBJA 5A7FA 1LNSA 2ZJ7A 4LKOA 1WCYA 4RNCA 1PFQA 1HL7A 3FNBA 2OLEA 1WOMA 2Z3ZA 5E4JA 1OXMA 4C01A 3FSGD 5ALEA 5LP1A 1K5PA 2YYSA 1WB6A 1LPAB 4EUSA 4TGLA 5HK8A 1E89A 4PQEA 3D3NA 2ZVDA 1BN6A 2CZQA 5ALGA 4JEIA 2J3DA 5EHQA 5AK6A 2J4FA 5DWDA 2QJWA 4ARBA 2WSLA 3P2MA 3STTA 3D5EA 1AKNA 2BUBA 2XUJA 4G9EA 5C8XA 2O7RA 2VEOA 3HEAA 2H1IA 4G1FA 1YB7A 3FWHA 3D4LA 1W4LA 4H77A 2XQJA 3H2JA 1XLWA 4FNGA 4PSCA 1NU6A 1HKHA 1UKBA 1MN6A 4XJVA 5BOVA 1QIDA 5CH5A 4HZGA 1MPXA 3V9AA 4EY7A 3C6BA 4V2IA 2JBWA 5AM3A 3VJKA 5JALA 3I2FA 4JNCA 1THTA 4N8EA 4AZ3A 5HCUA 4X6XA 4G4GA 4UFOA 1D07A 4CFSA 3VJMA 5AI8A 1QZ3A 3FAKA 3RM3A 4AQDA 1SCQA 1ZGCA 4NVRA 4AO7A 3R3YA 3GBSA 2RIPA 3PUHA 2PL5A 3ICVA 4UHHA 4BAUA 2GBCA 3KWJA 1AURA 5JD5A 1BE0A 3ANTA 3NUZA 2WQZA 1IUNA 2OXEA 5DNVA 4INZA 2ZJFA 5T4FA 5AO9A 3QPDA 4L0CA 4K6HA 2D0DA 4W63A 5ALXA 2OPHA 4EBBA 4PW0A 1MX9A 3WQHA 1CV2A 3HSSA 1XRQA 1YA8A 2XUDA 4B9EA 2O2GA 5HZGA 3H19A 2Z8XA 1VXRA 5YASA 4DMCA 5IH7A 2JEYA 5JYCA 3HYSA 1GZ7A 1MAAA 3WWEA 5ESRA 1Z68A 3B12A 3DL4A 3I1YA 3R40A 5JAOA 1BU8A 1ORWA 1SOMA 2RI6A 4BVKA 4HAIA 1VOTA 2GYWA 1XQXA 1XZFA 1UKAA 1ORVA 1Q83A 5T4BA 3FVRA 3F9CA 3SC2A 2YASA 5AKYA 4AZ0A 3WWOA 3U1TA 2B9VA 4BZZA 3WK7A 5C7YA 1YAHA 3BL8A 3T52A 1P0PA 4U2GA 2AXEA 5K3FA 1YAJA 1L7QA 4H7DA 4X93A 3WWCA 3KXPA 3FCYA 1W52X 4FMPA 3D0KA 3HXKA 3C43A 2XLBA 5ALTA 1R9MA 1GPNA 2HA4A 4K5QA 1XKTA 5ALQA 5LZ5A 2GYVA 4H7KA 1JJIA 5AICA 3NGMA 4GDMA 3N0TA 5T4EA 1LZLA 1UOQA 4Q05A 1HDEA 2Y2UA 3EIOA 5C8ZA 4C89A 4U2CA 4NZZA 5JD4A 4J0JA 1UXOA 4ETWA 1CUGA 1P0QA 3KSRA 1ETHA 1ACJA 4EA6A 3SWWA 3CXUA 2H7YA 5ALWA 5AP9A 4YPVA 2VJDA 1MNQA 1XZCA 3K9BA 1BROA 5AHXA 2XMDA 5JZ9A 4BRSA 2WJ6A 2I03A 1DU4A 4N5IX 4X85A 4PF1A 2C0QA 1CUBA 5ALRA 1ZJ5A 1EDDA 3FOBA 1QONA 3E4DA 1FFCA 4WFIA 3R3WA 2PU5A 4W1RA 3WMRA 1H22A 5AKKA 5E4YA 2R11A 1USWA 2C4HA 2CB9A 5HF5A 1CUYA 4ZV9A 1TCBA 3B3QA 4B81A 3W06A 4OB6A 2D5LA 3IDAA 4JYMA 5DYWA 1TIBA 2XUOA 3C8DA 3TEJA 2VAVA 4UFPA 2WIDA 3FYUB 2Z8ZA 3S2ZA 1X2BA 4OCZA 5E2IA 2OAGA 1CUCA 4DNQA 1WHSA 1TKRA 1IZ7A 1THGA 2E3JA 3ZPXA 3GZJA 4G8CA 4G4JA 3I2GA 3UUFA 4H35A 4AO8A 2AJ8A 4DNOA 5FUMA 4QE3A 4W1QA 3CN7A 4P08A 2WFLA 3I2HA 4C4YA 5JAPA 3IUMA 1XLVA 4ZREA 3T4UA 4AB1A 3O95A 2XB6A 3STYA 3IIIA 3GROA 5SYNA 1Y7HA 5KREA 1E8MA 1J2EA 3HRHA 1GQSA 4Y2RA 2JEZA 4OYLA 2Y6VA 4E14A 5HF9A 3AIOA 4EY8A 4LYDA 4KRXA 3AIMA 3C8HA 3WKCA 2HHAA 1YB6A 5K3EA 1EK2A 5I7UA 1UFOA 5JAUA 4J0KA 1XROA 3IUJA 4CCYA 2XUHA 2ONCA 1U65A 4Y2VA 4QWMA 5ALHA 5CT5A 4C6HA 1RYYA 4X91A 2HA5A 3H2HA 4LIPD 2OCIA 4WDRA 2ZJ6A 3I6ZA 4OYYA 2WHPB 3H1BA 4LHEA 3AILA 1MT3A 1AZWA 1BS9A 5AM5A 4AMZA 1DT5A 2HDWA 1EH5A 3EBLA 5DJ5A 5HQ3B 5LIPA 1IUPA 4BAZA 5J3JA 4Y2XA 1E66A 5CW2A 2XQFA 1XQVA 4Q3KA 5DNUA 2HFJA 2XE4A 1QIJA 2IITA 5ALOA 2VJBA 1NX9A 4MYDA 3HC7A 1GGVA 4YK7A 2W22A 1MO2A 4H7FA 4O08A 2B61A 3FYTA 3ZLUA 5AK5A 1LBSA 1LPBB 4H7IA 3WKBA 5IKXA 5ALZA 2IX9A 1FFEA 2VT6A 4UHEA 1QIIA 5AK4A 4J0CA 1Y37A 4H7HA 2YXPX 5FDFA 1ZI8A 3CCCA 3L1IA 5K3BA 2ZSIA 3TGLA 5LZ7A 5FKJA 3LP5A 3DEAA 4PNZA 1C4XA 1FFBA 4WFKA 4FKBA 3RARA 4MQLA 4F21A 3DYVA 1EINA 1L7AA 3RKSA 2CJPA 1DWPA 2H7CA 5CMLA 5ALVA 1UWCA 2VSQA 4RPCA 1K4YA 1LGYA 3QPAA 3V48A 4IH1A 3STUA 5AIBA 2PSHA 1JU4A 4A23A 5JZSA 2UZ0A 4BE9A 4Y2YA 3D7RA 3QM1A 2K2QB 3LIPA 2V97A 4Y2PA 3V1KA 1XLUA 3LCRA 3UMJA 2WJ3A 5F4ZA 4AO6A 4Q34A 2LIPA 1VA5A 2XUGA 1QIKA 4J03A 3FLBA 3IUNA 1GKLA 2XUIA 1EXWA 1XQYA 4X6YA 5K5EA 2G5TA 3OC0A 5CBKA 5AI4A 2AJDA 2I3ZA 5E4TA 5KBYA 3FCXA 3H2IA 1XKLA 3WYDA 3K6KA 3FLAA 3KDAA 4BCBA 1MTZA 3OM8A 5ALDA 1CUIA 1ZOIA 5CURA 5IVHA 1SFRA 3SK0A 4UUQA 1J07A 1DQZA 1EHYA 4J3JA 4DNFA 5CXUA 1DT3A 2JGJA 3WK6A 3WIOA 1XZLA 4WCVA 3EF3A 1T2NA 1CUSA 2DCMA 2ZYHA 5CTAA 2BUAA 1K8QA 1UOPA 3LS2A 4Y2UA 3ESDA 3CN9A 3BDVA 3C6XA 2XUAA 7YASA 4CCWA 1XZHA 1CUAA 2G4LA 3BIXA 2C58A 2Q0XA 5JASA 1CRLA 2X76A 4KE6A 4FLMA 5HFNA 3C5VA 1QE3A 1F0NA 2GZRA 3I6MA 2O2HA 1XRNA 4BP9A 4A16A 1A8SA 5K3AA 3BWXA 4BC0A 1AQLA 2VA9A 3F96A 2QZPA 3O4JA 3A2MA 4FHZA 2VQ6A 4D9JA 3IULA 1QTIA 4EB0A 2PBLA 2BCEA 5AM1A 2C5FA 2VAXA 4X6UA
chains in the Genus database with same CATH superfamily
5IBQA 1BNCA 2YTZA 1N33B 2RAFA 4Q12A 4G23A 1JA1A 4JC5A 1U5BA 1C5KA 1GXSA 3Q3IA 5DP2A 3DOEA 3DCIA 4D9NA 1HGXA 1RU3A 1QH8B 4ZV7A 5F2NA 4JI7B 2C4NA 3X1YA 1USUA 1I0IA 1Q6ZA 5LB2A 4DAEA 3LPLA 5K8LA 3A9TA 1F2VA 3FCSB 1FSZA 3W5BA 1HFEL 2NUTB 2OTCA 2WYIA 3MPUA 4LRWA 4DLRA 2Q6KA 2AFRA 4DBZA 5LMZA 1KP2A 4KODA 6ABPA 5TMDA 5DNCA 2VDQB 3K0FA 3PQ8A 4GX0A 2EIXA 1Z2EA 4DLXA 4OXIA 3CKKA 1WOYA 4CRWB 1UH5A 2XMBA 3QBTA 3L9WA 1UZLA 3PDCA 4JL8A 1T4MA 2QE6A 1OXUA 1GKUB 3N0XA 4MTCA 3H17A 5DGIA 3M4XA 2UZ1A 3EA5A 4JVMA 3S28A 4NYIQ 3UJNA 3OTOB 3WYFA 4GLFA 3N70A 4MHSA 4PSUA 2DCUA 2ZE7A 3B5EA 2HWWA 5ENZA 2CLHB 1B1AA 4L3VA 1QRSA 3Q2KA 3E1GA 4BGVA 1N8NA 3FPCA 2Z6QA 4DARA 4W8GA 4UCWA 3JVEA 2CXXA 3FRIA 4QUGA 4YLEA 4O4JF 4FM9A 4ENWA 2Q3EA 1RIIA 2XB4A 2Z83A 2XUFA 3QVMA 2PUEA 2I76A 2D1RA 2EOAA 3A7EA 4A9AA 3TVTA 2QUBA 2O2EA 4WLFA 2NO7A 4G65A 2IPAB 3B8EA 1H2XA 1UFKA 4FD3A 3ZE9A 5EHGA 4C7JA 1IG0A 1YSCA 3EZGA 4AUKA 5K0BA 3KQMA 3FNHA 4RSRA 3TIXB 4UUPA 4IWXA 3HN2A 1G5QA 2CJYA 3BH7A 3CCBA 4N03A 4KUEA 4URUR 5K8CA 1OC4A 1KIFA 1XL1A 3TMAA 3BGSA 2X13A 3IO3A 1IBRA 4MRAA 1HOXA 3TSCA 3E0XA 5COBA 3AZOA 4AK9A 4UDOA 2JBAA 1IAQA 3GUZA 3OE5A 1QHFA 1MHTA 2A6PA 1GU7A 3PGXA 4MWTA 4F5ZA 1QHXA 1QVWA 2ZE5A 4G5SA 2XE6A 3W7BA 1QFMA 1P1BA 2QRVA 3PPVA 4RZUA 4K9PA 8ABPA 2AV6A 3TKLA 1X87A 1J06A 4FYXA 2QI9F 5ALLA 1KFCB 5M3BA 1KJNA 3ENZA 2A5JA 3VAAA 1XMQB 1NTOA 4S0ZA 4MUKA 3TOVA 5TC4A 2QTBA 2ZUBA 4K6CA 3C1TA 1LI7A 3VTFA 2ZR7A 2XTAA 1VL1A 4WRRA 2J9XB 1JSRA 4ZICA 1SVIA 3M49A 4EWLA 3DDNA 1M6NA 3REOA 4KQGA 4MYTA 2AQKA 2W58A 3OM1A 1SGWA 3N75A 4ND2A 1OYYA 2VEDA 3USZA 5I9IA 2NU7B 3M2PA 4OK6A 4IGEA 4BJ3A 4AKIA 4K3VA 1S8FA 4R0NA 2MMCA 4JA2A 2Z8YM 4NHOA 3SLKA 3BT7A 3IPYA 5LQDA 4FNOA 3U7QA 3EW9A 4D0LB 3FPKA 2YY5A 3PR2B 3V3TA 3PWSA 5B6JA 1B14A 4U6SA 1JSCA 1TZBA 2VJAA 4B80A 3M81A 4S04A 4E15A 4UBMA 2BLNA 4W99A 3EZ7A 3GP5A 1A8IA 3WA7A 1TD9A 3PGVA 3ZOKA 2OCGA 4DG5A 4IP0A 4P5EA 4E4TA 2VHCA 3UXHA 3I58A 4XQGA 4HNSA 3MTAA 3DXYA 4QJBA 2GEBA 5CBPA 2TMKA 3EHDA 3VR6A 1XPOA 3GNLA 3PRHA 4F6RA 1LUAA 5LQJA 3EDOA 2AIRA 1V35A 1RXVA 2QUKA 2AJCA 3GLSA 2G9RA 4DC0A 2PZLA 1FTNA 1W0KD 4F92B 1BOOA 3HQ4O 1E6EA 2YS7A 4KQCA 5BT8A 3U49A 4ZI2A 1WZ2A 1XXHA 5F9FA 1S2IA 4KR3A 4OLHA 5AJTA 1WMFA 5FBHA 3QEAZ 1PJLA 4RXTA 4YRDA 2FF5A 3M1LA 4OHYA 2Y9MB 4AJHA 1DEXA 4FGWA 2H4XA 5L3QB 4X8OA 3VNAA 1EVZA 1OV6A 1VRWA 4LVCA 2FFHA 2O7VA 3WKAA 1EWTA 7REQB 2GCOB 2WWGA 1SIBE 1YZGA 2A9FA 2Z0MA 4Z6KA 2FPKA 3TW0A 3QK7A 2ID7A 3HVUA 3HKBA 4RO0A 5LKRA 1FU4A 3TW8A 4PLZA 1WW3A 2X9VA 4I36A 4EJSB 4AZ0B 1NAIA 1Z5UA 2ONZA 4R1OA 4UNNA 1G8SA 1Y3FE 2WIKA 3HWWA 3BSYA 3KFXA 3O8DA 4JBWA 5DXFA 2IF2A 3ZWMA 2BEWA 4GAEA 1DC3A 2ZIZA 3LGAA 4FI3C 1Z5ZA 4LPKA 4XWGA 4AG5A 1GVNB 4YCCA 2PXCA 4TTIA 4XLTA 1UXJA 3EXG1 4LOJA 5D3KA 2O8EA 2H11A 3NI2A 4IIGA 5K3FB 2K87A 5CH8A 4B44A 4RWZA 4LXIA 3EC2A 4QDTA 1BMQA 2OV3A 3NOXA 4D5GA 3MAGA 1VGVA 5AW1A 5JS1A 1KBOA 1OLOA 1T8YA 3DCNA 2EFDB 3BA6A 3DV0B 3ZY6A 4E94A 1GY8A 4G5XA 4UEKA 4J6FA 3MK31 1RAGA 3H9QA 5JAZA 3JASB 1XD2A 2WF5A 2GZSA 3EXIB 4DUGA 1SZDA 5F78A 5J2UB 5KOIA 1WDKA 1KZ7B 3ONVA 4PZUA 5EIEA 4QU9A 3REFA 3ST7A 1OT5A 2QV7A 1W75A 1R27A 3BAFA 3F3KA 3O5AA 2I6XA 3PYMA 4DN6A 1OYOA 2ZBEA 4B8ZA 1JEDA 4BGEA 3ONNA 3RIEA 4HMQA 3U56A 1L5YA 3WHKA 1K7FB 3FG9A 2PWPA 5HWSA 2FPWA 2ZRIA 3FH0A 4JBNA 4B6FA 2J6IA 3HLKA 2X58A 1GARA 1PLKA 4W6ZA 1ISPA 2AXNA 4F1KA 5FHRA 4HAVA 5GOZA 4YAOA 2GCPA 2CL5A 2PUJA 3ETGA 3H42B 4M49A 4EY5A 5CB4A 2GB4A 3CEAA 1IJKA 3JQ7A 5D3ZA 3VAYA 5IMBA 2Q29A 5C5EA 5ED0A 1PIWA 3T3HA 4QLBA 1L4UA 4KQHA 5IN5A 1T6YA 1KDRA 4D6YA 1CCWA 2VHUA 5E6SB 3FROA 1K5HA 3DKPA 2Z5GA 1T4GA 3IVCA 3L0DA 3DFMA 4LGMA 4LC0A 2Q6TA 3T9BA 2OZKA 2WC1A 1LK7A 2CHVA 2JGNA 1NMYA 2NW6A 3BH0A 1P7VA 4JC0A 4PFJA 5DASA 1D2GA 2VP0A 5HKLA 1T35A 1W8IA 3H1GA 5IJZA 3JARA 2IEGA 2ZUDA 3AUUA 2QLLA 3UGJA 4LBWA 1DKNA 1WCXA 5LDDC 2XDWA 5I4KA 4YO8A 5KSZA 1PWYE 1U3TA 2XADA 2WM8A 1NL3A 4MS1B 3FOFC 1OZ0A 2WAMA 4O4IA 2RONA 2ORVA 3HJNA 4CTNA 1YS7A 1THMA 3H5LA 1OWPA 2OUIA 3DUFB 3R1IA 3ESQA 3G0DA 4IH4A 2PX6A 3AHGA 2HRQA 2OT3B 1U9CA 3I4LA 3MVEA 1Z37A 4FDAA 4MPJA 1B93A 1JBEA 1ZNXA 3DT8A 4WOBA 3WXMA 4K86A 2HPZA 2P6UA 4PZZA 4TSKA 4LE1A 2NSDA 1RWXA 3RUHA 1ADCA 2HREA 1NF8A 2VJPA 3JVIA 4NS4A 4FOPA 4OBBA 1GZ5A 3I2KA 4O1MA 4C4PA 4IOKA 2PIDA 3AOEA 1ZUIA 3C5WP 3FMOB 4R01A 4ACAA 1SN7A 4AFNA 3D3KA 5K8UA 3MCTA 3MTIA 4DIUA 1FRQA 1Q14A 2XVYA 4P35A 5EKXA 1P8AA 2VRNA 2C07A 5JXHA 2G0TA 2Y3IA 1ZVQA 1X7GA 4LOLA 4P32A 3TRDA 3RJTA 2JFHA 5BSRA 4R41A 1FFDA 3SU8A 1J8VA 2JFQA 5LLSA 2WYHA 3JYLA 2C2ZA 4MR8B 1II8A 1KZHA 4NJMB 4BLOA 5GVSA 3GLIB 2HJGA 2PKEA 4NZPA 4NIMA 4O59O 3YASA 1BRMA 4DR3B 2C84A 5LD2C 2MSKA 1AIPA 3O2JA 4EF5A 3KOOA 1ZHHA 1NF2A 2C1EA 3P2KA 2ZUSA 2B25A 3B9BA 4CMIA 1V2GA 3URMA 1YCDA 1GUDA 4NG5A 4OMCA 2A1IA 4NLLA 5KQPA 1AF4A 2BTQB 4EEZA 3LXMA 2IP4A 1A9PA 1T1IA 1IIBA 3FE2A 3TB4A 2HIHA 3AG6A 4NAHA 4ZO8A 3ACCA 1NXQA 2EWVA 4S1WA 3T7RA 4F60A 3WA6A 4DT1B 2Q1WA 3I52A 2XNSA 4QD3A 3EIFA 2A4MA 1ULZA 4ER0A 1V2HE 3FAZA 1JDUA 5I7AA 1E2LA 1PG5A 3IS3A 3QPWA 3E8XA 4IFBA 5G0VA 2M6LA 3EYAA 4L3WA 5JI2E 1IHOA 1G4AE 4BZXA 3WIEA 2CLKB 1YI0A 3RTAA 1U7HA 1ZRMA 2GNPA 1C4OA 4LJLA 1EHCA 1RJWA 3F3YA 1OJLA 1YQDA 2E4XA 1V0JA 1FDUA 1P4AA 1TUGA 2M98A 1EGHA 4XUCA 5ARBA 4DR4B 4TLEA 1PKXA 2ZPAA 3EDCA 5K01A 2FOXA 3PU6A 2QBYB 3HJUA 4FCVA 3AJ9A 2HHJA 5KVCA 2NTVA 4A3SA 2VWHA 2Q2OA 3A6EA 3A4NA 3ORFA 1SKAA 2IPNA 3BCRA 4JROA 1HE2A 3VR4A 1U3VA 3G13A 3LWDA 1J9GA 3IVAA 1EUDA 2PR7A 4OP1A 1TYEB 3RSLA 3W5HA 1CPYA 3EZ9A 3HB1A 3RAFC 3ZZ1A 2LR0A 4EJMA 4KR7A 2B1IA 3I9V6 4G24A 1YIOA 1I33A 3E7FA 2QZZA 4TRRA 4DIKA 3AUJB 4M0KA 2FG7C 4M76B 4W82A 5U4QA 2D7DA 1AZSC 1R9GA 5BQFA 3N6XA 1CZRA 1L4MA 2QYSA 2WHPA 1Q7BA 4QREA 2H1HA 5I47A 1G66A 1T9GS 2BJVA 3E1KA 3NIGB 4UUBA 3GBPA 3NBMA 4LXGA 1ZA2A 2YHAA 1HQKA 4X3PA 5JVDA 2PFGA 4PHCA 5KTKA 2R87A 1ZAYA 3DW1X 2PZFA 3KZVA 4WE3A 1JHRA 1E3EA 1E61A 2GK3A 2R6R1 2RDMA 1C3EA 5EKDA 4LBVA 2VZLA 3H9GA 3R5HA 1ZEJA 4QGBA 3HUFA 3IALA 1G21E 4LJ5A 2ZYSA 3W78A 2DUJA 4ZRMA 1YXMA 2XNDD 3F49S 4IG4A 4IHQA 1XCPA 4NPCA 4Z4HA 5AVQA 3QPCA 3F9IA 3T3NA 4CCYB 3T5GA 3GDGA 2O8DA 5EIHA 3ZN2A 2X86A 4GF5A 3RYHA 2Y76A 4BB6A 3C7KA 2VYFA 1AB6A 5ILOA 4E5KA 3BJZA 4FEEA 1L4YA 3A36A 3D3JA 1P1IA 2JASA 1VIMA 3RRMA 2GBLA 3SE0A 3VPHA 1M2HA 1P0CA 3L6EA 3SI7A 3WK4A 1JILA 1S7CA 1HNNA 2I80A 4WNAB 3ICWA 3TKAA 1KI9A 1BTOA 5HHTA 4JL5A 2XXAA 3GUYA 1D1QA 4YWJA 1F5SA 5KJ6A 2GHRA 1SU6A 2C0PA 1JLLB 5CIQA 3VSAA 5EMJA 4U2FA 2J9YB 3W5IA 3T34A 3GJ0A 4DREA 4BNDB 2FDRA 4MUBA 2IYSA 1N8SA 3QG5A 3UT5B 2I6TA 4BIMA 4UHDA 1T2VA 3TUJC 3NHPA 5DYIA 3MMNA 3ESYA 3OE7A 1MAHA 2UZIR 3E8MA 4MKIA 3CG0A 1IONA 3LLCA 4G8JA 1DE0A 4XVUA 1RE1A 2Q5JA 3WGOA 2F3SA 1NHGA 2JVJA 2RGNA 3IR6A 3OOSA 4HDQB 3BIOA 3FKQA 4M1SA 2J41A 4DCNA 3H97A 4BX0A 1T6ZA 4JB8A 5IH3A 2C97A 2HI0A 2Q5LA 3GFPA 4H0NA 4TVSA 2X19A 1Z38A 1OGYA 4MO2A 4R5HA 4XJTA 1UMKA 1OASA 1VE6A 2BFNA 1E58A 1TO2E 4RENA 3T12A 1R3DA 5IEJA 3H1EA 3TINA 2GF0A 1Z63A 1G4UR 3C6ZA 3HY4A 1KBZA 1N5MA 1ZC3A 1J0AA 3Q3GE 3BULA 2EQBA 3C4JA 3QVXA 4KLAA 3RJ5A 3SZRA 3ASYA 3AUKA 1BFUA 3VC3A 2ADMA 2PKQP 2V9CA 1G5FA 1V3UA 2J4CA 2OHVA 1P1HA 1AD2A 3DZJA 4Q3OA 4CEHB 4XB1A 4ESOA 1JB9A 5FP0A 3CUYA 1FVHA 2YUIA 5FYDA 2PX0A 1VLHA 5ED4A 4PC3A 4QXQA 1G19A 3R24A 2FEAA 1Z3CA 3NASA 1BYUA 4OXNA 3NB0A 4YFYA 5DRYA 2GFHA 3PDUA 4JVOA 5FB3A 1C9JA 1WUKS 1ZUNA 4L4XA 2ZP1A 3NVMB 4AKTA 1OTXA 2MJLA 4CM8A 3K5HA 2H08A 3OU2A 4RYDA 5JOQA 2Q1YA 3OQBA 1BIFA 3LUFA 2HMSA 1UBMS 3TXAA 4L3OA 1D0IA 3MT0A 3FMFA 1XRLA 3R74A 2RHTA 5IJ9B 3JYHA 4L4YA 2ZPUA 2ZVJA 4JLAA 2UUCB 4TV9A 1EP3B 1UWLA 1A96A 2XNHA 4H1HA 4DZRA 3CTMA 3QIAA 4TTQA 5I7HA 1BGWA 3A6HA 5BSMA 4RZIA 3RU7A 4U6NA 3HUUA 1QS0A 1OLSA 5DV9A 4ZYZA 1N5IA 2BDUA 1U7ZA 1WSAA 1NQXA 4Q93A 5EZ6B 2V1UA 3VZSA 3FXAA 1TKBA 2H57A 1ZCFA 2EBFX 1IY8A 3H3XA 4NFLA 5CLHA 3DE1X 3HB4X 3WNBA 1LEHA 3EFHA 3ZTWA 5KX5A 1CYEA 2O2JA 4M8NE 4F4IA 2PU7A 3QX7A 1XNHA 4Q3DA 1BEZA 1V41E 1JKJB 4J91A 5J5VA 4HRXA 5LQSA 3EQ7A 5DYTA 1ODKA 4JIGA 1Y8AA 3FVQA 4H7EA 1MDFA 5H3HA 3WQHA 2M9MA 1RAFA 2JLZA 3I5YA 3ELUA 5DSXA 3U3KA 1GTJ1 4A6EA 1KI6B 4DA8A 1XRMA 3TRFA 4ESVA 4UZEA 3WB2A 1M67A 2B94A 4B35A 1FRNA 2RGEA 3TRKA 2GZ2A 3AY7A 1RKUA 4BO0A 1HSOA 1R6VA 2NU6B 5HXAA 2FJPA 1W85B 2HSWA 1P4JA 5KTYA 3ORSA 3SBOA 4BTVA 1TIPA 3AW9A 1DV1A 5B4UA 2WSIA 1DTEA 2R4UA 3ZYZA 1HZZA 1RAAA 1FX1A 3N58A 1SUAA 4V0OA 3PE4A 3ZHVA 4E51A 1J0BA 4M9SA 1JE1A 1B23P 5ICFA 1A8QA 4NFSA 2D6FA 3ZZUA 1PI3A 3NHFA 1VHLA 1TFUA 3PFKA 4EP1A 2GRAA 3GVPA 1YBFA 2NVUB 4DCJA 4G09A 1V8ZA 1G8FA 1E2HA 4NE9A 1VMAA 2QXTA 3M6IA 1PO7A 3L7YA 3CLKA 4ISBA 1JJVA 4QICA 4DDWA 4R2LA 5L4LA 4JP3A 1N2HA 3S2FA 4WJLA 5JAIA 2FZGA 1QWOA 3W0LB 2HK9A 5EJ2A 2KWIA 1PG0A 4M6WA 3ZU5A 4KEAA 4LJ8A 3TXYA 2Q0HA 2Q8NA 3E9YA 2YC4C 1J00A 1XRPA 2EHDA 5IC5A 3WGZA 3EPRA 1Y8ZA 4AY6A 3UJ3X 3AHCA 3KLMX 2YNMA 4JJEA 1SXHA 2CXRA 1NUSA 2RGYA 4U6QA 5C31A 3WGJA 1YMUA 3X2EA 4DLBA 2ID4A 1TXGA 4Q1VA 4ECAA 3Q9UA 3VR1A 2P9ZA 3B9QA 3OKCA 1C29B 1WAMA 1GIAA 1X92A 2ZSKA 3HZOA 4UTNA 3UY4A 4L78A 1CSEE 4JU8A 4RJJA 2JD1A 3BILA 4BVJA 4NAVA 4DJTA 1KMIY 2NUPB 3GZNA 3DC7A 3EPLA 3PC2A 4CKCA 2HU7A 5DYGA 4XVCA 1WE2A 3SYRA 1G7RA 2BZGA 2TMYA 4OXXA 4URHA 3C3JA 1ACMA 5D86A 3GPIA 4PCLA 4ZVKA 5B57C 5JNSA 4E1AA 4RX1A 4ZEXA 4IEFB 1GYPA 3O90A 2WLSA 1ML4A 1WTCA 5E3HA 1ZD2P 4PX3A 4EGCB 3EPKA 1GPDG 4FT2A 5FTWA 1FOEB 4DXAA 1F6WA 3O4FA 2UXDB 1JPNA 4QBHA 4B7CA 3UG7A 2PVSA 3Q0IA 4L9WA 2F1IA 3KWLA 3SJCA 2C4WA 5JZMA 4DUGD 5EYPA 3VPSA 2EW8A 2JIQA 2Y67A 2C5GA 1R10A 2IQ5A 2HO5A 2VPTA 4GG1A 3O2NA 4NRDA 3ZY2A 4ZIRB 5HMMA 1TQ8A 5IHXA 3GQBB 4KOAA 1NC3A 3NPAA 4ZEOA 3S27A 3AY3A 3AL2A 1YZTA 2PNFA 3A3PA 4DVGA 4XWWA 1M33A 5IUNC 5FI1B 4PANA 4C20A 3HU1A 1ZWLA 3ZNQA 3V1YA 4Q03A 3MB5A 2LUOA 3HYLA 1H5UA 1A50B 2VUHB 5JJ5A 2WB2A 3PBKA 3MA0A 1CVIA 2PGIA 3QENA 4ER3A 4POAA 2DF8A 5GAJA 3T6KA 2G5PA 2DYKA 2A94A 2BFDA 2A59A 4DR2B 3HP7A 2IWHA 3VH3A 4C0XA 3A9SA 4C22A 1XZPA 4H18A 4N1AA 1Z33A 2F6RA 2OA0A 3SXUB 5IPFA 1EDBA 2OCDA 4H1WA 2R65A 2V96A 3M1YA 1NR5A 4IHJA 1QQ6A 1C1DA 2W2KA 5BWBA 1Y1KE 5HE8A 4BNVA 1CJBA 4ZALA 3ZGVA 1S2LA 4FUQA 5IAEA 1Y4DE 5M04A 4BBZA 3Q7QA 3L8GA 3RVSA 4KDCA 1J5XA 1G2IA 2KSQA 5LOVB 1I7DA 4XEUA 3ILSA 1JU9A 3LUAA 4WOCA 1OH7A 3EZ2A 1LBIA 5K8VA 4Y6QA 4QPPA 3W04A 1M34E 5H59A 1NUTA 3EMBA 1COZA 1X7HA 2NADA 1GO2A 4Q1CA 4TV9F 1O9BA 2X3UA 4CJXA 1UQRA 4NOMA 2ZBPA 1XAJA 1DZ3A 5CXQA 1FSSA 3ZU3A 3GJYA 2BGMA 4URZR 1NF9A 2ACWA 5BVGA 3M4JA 5AJUA 2OL4A 2EU8A 3M4YA 2ACEA 2QYOA 2IY8A 2FRDA 3N2LA 3VMFA 4CL0A 3GNSA 1CU1A 2BSQA 4GZMA 3KUDA 4XR9A 1G21A 1E2BA 2XD4A 4HDAA 2WSSA 4MRSA 4L85A 1ZBDA 4PLTA 2BKVA 2M1ZA 4C4XA 2BGNA 3D4OA 2X2PA 1KU6A 2GR9A 3EIQA 3IHTA 3VC1A 3WMFA 1I6LA 1TU4A 1IY0A 3RRFA 4OPMA 5L4SA 2BFWA 3AF3A 3N2EA 5HE9A 5FTLA 3IV7A 3GLRA 1X13A 3FPJA 4R0VA 4MI9A 4MVJP 4DJEC 1E2JA 3CJTA 3B3FA 3VJLA 2WU3A 4MUFA 1Y3DE 4GP6A 2PX5A 3C39A 3PR3A 4YGXB 2QM0A 2YDYA 2MOKA 1E8DA 3C7DB 4ERNA 4BB9A 1F14A 3F1LA 5E3IA 3T3GA 3KO8A 2B7LA 3GT0A 4IO1A 1RVV1 1U5BB 2YXBA 1GXSB 1KJ8A 2BIFA 1AS3A 2FSVC 2RD2A 3AF2A 4FZ5A 4ME6A 1F3OA 3FGOA 2GDZA 4TMVA 4KW7A 3DBLA 4XYMA 5BNWA 2RHBA 3IUYA 3OSUA 1QQBA 1VL8A 5JQGB 3GW8A 2CK3A 3MUOA 3R3SA 1AK9A 3K0FB 5K0TA 1Q1BA 1DBWA 1M5RA 2V9ZA 1JJBA 3D2BA 4PYOA 3IRUA 1XHEA 4PONA 3VH1A 1QO9A 2FWAA 4B43A 1CJSA 3GHYA 3JVUA 1QORA 4WNCA 2ON6A 1QFYA 4JJFA 1V4BA 4L50A 5DT2A 4WBNA 3EXFB 4BBAA 5CLJA 1BCRA 5CD1A 1R74A 4R51A 2GPAA 5ER6A 2Q4TA 1LLUA 2X23A 4G86A 4GQIA 4BFWA 2B1RA 1G20E 1PEDA 1MHPA 2ZANA 3SHVA 1Z5NA 5AKXA 4L1KA 4C0KA 2J6BA 4XB6B 5FULA 1PN3A 1UL1X 1ZN7A 3OCWA 3VR4D 1T24A 5HF6A 2GHIA 1QHIA 2IE8A 3I53A 5CLLA 5LUBA 1IMJA 3WLLA 4B83A 1Q50A 1S96A 2AZ4A 1Y81A 4W7HA 5KQRA 4TKUA 3OZBA 4I0WB 4HNVA 3N74A 1G17A 5DW0A 4BWVA 2F62A 1JQDA 5K4AA 2JGEA 5AJVB 1RR6A 3C87A 1JEJA 1CR4A 2HF8A 4HH3C 2CGEA 4FILA 5C5CA 5KYWB 2H1VA 3KQQA 2YJ6A 4KBYA 4YO7A 3KYDA 2X9GA 4KVZA 4QXPA 2DHDA 4Z1OA 5LFAA 4K2HA 2ID9A 2JBAB 5EIXA 1ZJWA 3LT4A 3ZZ0A 5IAGA 4U3JA 1NBIA 4G5GA 5ELMA 1G59A 5EI5A 5HTKA 1L4LA 1P62B 2XQGA 3L6CA 4WCDA 1ZICA 2JGFA 4DCSA 2QRVB 2LPMA 4RUKA 4M1KA 3WLHA 5BN5B 3LBYA 3MXOA 4QEKA 4CWAA 3FOEC 1IY1A 1W4AA 4RFSA 5ABPA 3OTQA 4RL4A 5GY7A 4GE3A 4KLZA 2YQ4A 2Q5FA 2CXOA 4KWHA 4PLHA 2Q62A 5G40A 1KI7A 2OK7A 2E82A 4K9QA 5JV5A 4CGZA 1W47A 2QN6A 4NK5A 1MJGM 1Z56C 3JD3A 3MGKA 4AN4A 2BR3A 2D8MA 1VHTA 4ER6A 3A2KA 2P4EA 3GUHA 3PA6A 4A6XA 5KNLA 4C5BA 3LKDA 1BZYA 1WPGA 4OI1A 2PN1A 3E3LA 1CQIA 5DHPA 1SUSA 1CQJA 5GONA 3AUAA 3SVZA 3WFZA 4DSUA 5JJBA 2Q07A 3N6RA 3VISA 3FUTA 1PLJA 3U7QB 2WF7A 4FYIA 1ABFA 2GA8A 1R88A 2OHIA 3I6YA 3NHWA 2CLFB 2EP5A 5AKLA 1I7LA 5E9QA 4EHJA 5IG2A 2QSJA 3EYWA 4J07A 4IHJF 4MPTA 3DBRB 3GG2A 4LF8B 1S6YA 3CRNA 1V7CA 3I76A 3MINA 4QDOA 5EJ7A 4K0RA 3MWLA 4Y3UA 1SQGA 1YJXA 4KAJA 1WO8A 5A06A 4I5GA 1NW4A 1QGOA 1PX2A 2AFIE 1B6GA 1PNQA 4HD8A 1CWUA 3OP1A 3LDHA 3I4FA 1RZUA 4NEGA 3D59A 5DXJA 2PMEA 2I1WA 4WFJA 3C1AA 4XYEA 3QF4B 3ZUGA 2Z6AA 1NJSA 4IFTA 1R5BA 1ZA1A 1XXHB 3KLBA 1YVUA 3T0FA 4ZI5A 3U7JA 1I24A 3VAZA 1WMBA 2CJFA 3BIJA 4UQOA 4D8VA 2H1OA 1GNQA 4J2TA 1P9LA 4B4KA 4CTKA 5JWOA 1EK1A 2J30A 1E6UA 2D59A 2PTHA 4NPAA 3SHTA 2IHYA 3FGNA 5JFTA 4AYTA 3TF5A 1GLNA 2J5BA 3EEBA 2RBEA 3DR5A 1J8FA 3DAPA 3GA5A 2ZRHA 3RHSA 4EVRA 1YRLA 2PSDA 4HS9A 3ROZA 1ECFA 1OX4A 2RK6A 4PS1A 3SR4A 4PNEA 1OFHA 1JEEA 4Q5IA 5GJWC 4Z7OB 3G85A 1EFHA 1TCCA 1C1HA 1TQDA 2G63A 2RCYA 4PGMA 4UHBA 4TS1A 5JD3A 3TW8B 2I66A 2V7BA 1BWPA 1JW9B 4P58A 3VSBA 3VXKA 4F84A 3GLGE 5AM4A 2DAPA 2FJUA 4NQZA 2CNBA 4BVFA 3R5KA 3NOVA 5LP6F 1S01A 3AFMA 5FO0A 3ZWPA 2BEWB 2H3EA 5AM2A 1GG9A 3L6UA 2YWEA 3ONWA 4N3AA 1L7RA 2WJPA 3MNFA 5K3CA 2O8EB 1T15A 3CB2A 2D0OB 5DLPA 4QO8A 1WHTA 1IM2A 1GPLA 4Y2JA 5E1MA 4FN4A 1LDGA 1P6UA 2XVAA 2ZWPA 3DS8A 3MELA 4M54A 4J75A 3LLVA 1YUBA 4UU8A 4XGKA 4BBJA 2CHFA 1PNRA 4KDFA 5A1TA 4FW9A 1WXGA 4OYHA 5F2EA 2GK4A 2RHWA 3IAAA 4C76A 2VNHA 4H7JA 1ICIA 2CVFA 4KZKA 3ZJVA 3BMCB 4ZAYA 1JIVA 3C70A 3LGSA 4LA4A 5EP3A 5TPWA 3ZD8A 3TQCA 4FFBA 5IAAA 4W5NA 4JLBA 3BORA 3I83A 1SVWA 2W6PA 3OQPA 1ZNYA 1JHXA 2DBZA 3Q7SA 1E3WB 3VNUA 3WYAA 3BKWA 4OD0A 1U4SA 4EKNB 2AE1A 4KXVA 1FTSA 2CV2A 2WKRA 4KN6A 5B2ZA 3LK6A 4LOAA 1G4HA 4O4HA 4DLTA 1WDTA 3I28A 4Z9AA 2LDBA 1YVDA 3FZYA 1YBAA 1AMNA 1U2RA 1CS0A 1YULA 1K5GA 3E03A 3EVBA 3O3CA 4Q4CA 2PCJA 4FMDF 4E03A 4LNUB 3AEKA 1OFUA 3K8ZA 5ECYA 3JQ7B 821PA 1E32A 4HB0A 2V6JA 4PC1A 2JI4A 4GI2A 4E3WA 4RY2A 2V5UA 4R40A 2ATVA 4XCVA 4U7WA 1NXXA 3VSCA 7GPBA 2JAPA 2A9JA 4MMYB 4OHKA 5C51B 4I1UA 1RLTA 2C4VA 4GICA 3HUTA 3LLMA 4RHTA 1DKMA 5FPTA 5CHEA 4ZXFA 4MR7A 5B58C 2I99A 4EF6A 1B2LA 2ET6A 2QUJA 3PL5A 3T5CA 2GJSA 2OO5A 4IIHA 4NBRA 5DLEA 1A4XA 1Q19A 3CR7A 3QEJA 1NUUA 4KMRA 3M5WA 1G7CA 4O4IB 2QG4A 1EQ2A 2O07A 2WHQA 1RYZA 2YX1A 3OQ6A 4NE7A 2R8BA 3WVNA 3P9IA 5MN6A 2WUGA 4OHZA 5C3MA 3BMNA 4LJ9A 2C4TA 4WX2B 5KQMA 1DFIA 4PHHA 4Q3BA 1WKCA 2FSIA 2ZRBA 3E7DA 3IV6A 3VPXA 3ZE6A 3IELA 4FCWA 2WVHA 4HX9A 2IZ0A 4MEBA 1M34A 3FMPB 4NV0A 3KETA 5C8DA 2Q9UA 1VL2A 4M0EA 2Q7DA 3ELBA 5BN3B 2E9SA 1SVOA 5DHSA 5LYJF 2GEKA 5DFAA 1WZCA 2VR1A 3HCNA 1DAMA 2C2YA 2YWJA 4PRLA 4TM7A 3CW8X 2ZLBA 1HLFA 1EXNA 4OL9A 5IF9A 5DN6D 5KYTA 1EK5A 1TA0A 3BHMA 4LAFA 4R8VA 4UULA 4X8LA 3OU6A 5EMLA 2QTVB 3LCMA 4JQYA 4V24A 3TH5A 2YNMD 4P0QB 5GIPE 2Y4OA 5GONF 1OD6A 3D4IA 3RFCA 3COYA 2GXAA 4XGQA 2BBTA 1WHSB 3LA6A 4C1BA 1DDIA 1XYVA 5J4YA 1KDYA 3Q8KA 3KXIA 1OAKA 1JMYA 1KORA 3X1ZA 2QT0A 4AJKA 4IR7A 2CL7X 4Z4EA 1F4LA 2PNJA 2CFTA 1T2FA 2VBIA 3TR0A 2VPXA 4D8YA 2CNDA 1T9DA 5DBOA 1X8JA 4P92A 3WYCA 1YBVA 3PRYA 4KRFA 4PEVA 4JY7A 1UPBA 3P20A 3OCJA 1XEXB 1Q5PA 1TECE 3RNOA 3V7FA 3QMWA 1N1DA 1EFDN 4A8JA 5TX7A 4B84A 1EFUA 4EHIA 2B99A 4YQFA 4YBZA 2BFCB 3VOBA 1DO0A 3JQGA 2V3CC 1TF2A 2Q50A 3OU7A 4CIWA 3T3IA 5KKNB 1YOVA 4G8BA 1CTQA 1Y1RA 2FZ4A 1R5NA 2GZDA 2PBRA 2QTMA 1A8PA 2FZVA 1UK9A 4ZVRA 3L5OA 4KGVA 5HDQA 3GGPA 2HK7A 3OPQA 3QQPA 2NV0A 4XWYA 3B1KA 2Y1WA 5CHYA 1XDGA 4HB4A 3UXYA 1CE8A 1JDPA 4CT4B 1EFPA 1TZMA 3HWRA 2GH1A 4JN6B 4II2A 1GTG1 4KR0A 1Z0UA 4TS9A 4BV3A 1RCFA 1O7JA 1HTWA 4JL6A 4EECA 1PUIA 1KQ3A 1YA4A 4PQGA 2VPWA 3OWXA 1W93A 2HA3A 2AOUA 4JUBA 4S1PA 1GA4A 3AEQA 5JNTA 1CQZA 1FL9A 5AOBA 3RW9A 3T4XA 4AF8A 4OVKA 3LIIA 4KMOA 5FBKA 3R3VA 4WT7A 5GM2A 1G20A 2OENG 4ZI7A 2XOKA 1CY2A 5DHQA 4R8KA 5FPQA 4IDNA 3EX7C 1KYQA 3I45A 4Q82A 1NC1A 1H5QA 2PZGA 1K7CA 1EUDB 5B7GA 2JHGA 1P19A 5DOZA 3FIJA 4DW8A 4JI8B 2IDJA 5BSUA 2G28A 3M6FA 4DV3B 2ZK7A 4TRMA 3V1MA 1WM1A 3ON5A 2F3TA 3VPAA 4JI3B 1W46A 2CLEB 2Z5VA 4K6FA 2JA1A 5JDCA 1YZKA 3CB4A 4HMPA 3UC5A 1U3UA 2HYIC 4DWWA 2J5KA 1G8MA 2JJ8A 4WY5A 4TMZA 3TLJA 3IVRA 5T6BA 5IU6A 4DNOA 3KQHA 3GN1A 1JAZA 4E5DA 4FOTA 3RWMB 4KI7A 2XCRB 4J1TA 3GMTA 1F4PA 4JENA 3MT9A 3THOA 2HM7A 1CEXA 4FPXA 2R0QC 2OUKA 4FKZA 1LSJA 4ZCIA 5DMXA 2EDCA 4BKPA 1YS4A 1UT8A 3N8DA 2X4DA 3FFBA 3OEWA 4K8RB 1EFVA 1LNZA 2I6QA 4MUJA 5ECDA 5FOSA 3TTXA 1E9EA 3U60B 3G2OA 1U1DA 3TTSA 2ODNA 2QV0A 2VC2B 4O4HF 1KYWA 4WKBA 3WB0A 4CR7A 4MVJM 5KNBH 3ZCVA 4CEIB 3E0QA 3KT6A 4ARAA 1GJRA 3O1JC 2WSSD 4XM1A 4B17A 5BNFA 3FJ1A 1TYCA 3DDCA 3FDZB 1A76A 3R3HA 5EWMA 4FSXA 2ZROA 4WN3A 5DX8A 3ZE0B 4PN3A 1YD7A 1M2KA 1MF7A 1U7XA 3GYGA 3IMGA 1BXGA 2BE7A 1Y6FA 4LZWA 3QYAA 4C5AA 7MDHA 4HAXA 3OOHA 3T54A 3S2IA 3CZRA 5I5GA 5BYBA 2F64A 3HBNA 3OZEA 5FT9A 1Y6GA 3GLFB 2A33A 1ZL0A 4DLNA 3O8OB 4Q7JB 1EMDA 5MGBA 4HEA1 1TUBB 4KWTA 5BYKA 4MPDA 4KZPA 3OLWA 4MIEA 2B5OA 1XPJA 4GZ3A 4KN5A 4YV7A 4AS2A 4BEJA 3TL2A 2ZIAA 1L4FA 2A1UA 2NAPA 4X1YB 4YJ3A 1GGMA 1KF0A 2Z09A 4P83A 1TMGE 1VQ1A 1YC5A 1QIMA 2SKEA 2WKWA 5J5CA 4C9BA 5EUQB 1J70A 3QYJA 4CDGA 2XBUA 2O19A 1J2TA 4M8IA 4GC5A 4JA0A 4X61A 2CK3D 3I3SR 1J9EA 1WCV1 4CTJA 5LUAA 4JI0B 5ARCA 2QAGC 3G0BA 3Q98A 1FTGA 4LXTA 4XH9B 5KCZA 4CG1A 4AULA 4YT5A 1BXKA 3KR1A 1NG9A 1NLMA 2GCGA 5JRDS 1YRAA 5LPNA 4NJEA 4MJ3A 4NYJR 4Q6BA 4B0OA 4RSHA 5KYKA 5DCWA 4MZDA 3DXXA 2ZDHA 1HQYE 1V5GA 2ZQ5A 1UOOA 4KUGA 5ALKA 5C7IO 4U7HA 4LKRA 1H8EA 2Q7XA 4GUAA 1E1DA 3D3QA 4QVKA 4F45A 4PXYA 4GQBA 2WW8A 4PWYA 1I4EB 5L7TA 1JPJA 4EPRA 1Z5GA 4M0MA 2OXFA 1ESCA 4UAJA 1NUHA 4DLZA 4F3NA 4PG8A 3GLGA 2ECQA 4WERA 4OFWA 2X8BA 2JCGA 2OFPA 1QRAA 1ZIOA 5F7JA 3W1WA 2K4MA 4HQOA 4TS3A 1L7XA 3A05A 3GJ6A 4KG7A 3RNLA 3RIXA 3SCZA 3WV4A 2BJWA 1WV0A 3CUEF 3VZRA 2VZ0A 4QWWA 1ZUNB 2YXNA 3BMQA 4Q39A 1KSGA 4DMKA 2I4OA 4FE3A 4KDRA 1P4RA 3G17A 4X92A 3O6VA 5DTQA 3TLXA 1E2DA 4CM8B 5JHGB 1KYYA 1A27A 4RZHA 1KSJA 1MX1A 1P2VA 1VJGA 3DC2A 3BDAA 3ZS9A 2I55A 4Q9IA 3R2JA 1HEUA 2AOVA 3PK0A 3RJZA 2BKLA 4D99A 1HNZB 1J99A 4WXRA 1W76A 4F9FA 2P3OA 2PMDA 3FBTA 4B75A 4QKQA 4B3DA 4MUNA 1R0CA 5ESWA 3TQIA 1VJ5A 3DONA 3RASA 1QS0B 5LU8A 4DV6B 2VHQA 3CU5A 3UOWA 2XGMA 4BLSA 1I32A 4QXMA 2YMLA 3GDOA 4YAJA 4C2AA 1RRPA 1YFZA 3V2HA 4EUHA 1RXEA 5EIAA 1F12A 2O2ZA 3AVPA 4GXQA 4U2DA 4ZI7F 1A82A 2C95A 2W4MA 1DG3A 1YCHA 2W2NA 4N5DA 4M0FA 4CIBA 4JVLA 1T8UA 1EZZA 2I3BA 2I4LA 1F9AA 1XTRA 3NV7A 2IDZA 3WMGA 1GOTA 2O59A 4J16C 1XCGB 1TRHA 1U5AA 2Q4RA 3RBXA 4BFTA 5HJEA 5EKUA 5AI6A 5LZ4A 2GZMA 3ZCTA 1RWNA 4P54A 1E77A 5M29A 4OQPA 2X0KA 3I1FA 1R0RE 3CNEA 3NTXA 4AXBA 5CCBA 2A30A 4PYIA 4ZC8A 1H2FA 1FSFA 1NPYA 2PKQO 3HUDA 3DMYA 1U98A 1DDGA 1UBFA 2GAOA 3DNMA 5EHXA 3OF5A 3PNPA 4JP1A 3ZI7A 2FX2A 1YB1A 2HF7A 1T8PA 3DLCA 1EB8A 1S0UA 1S4MA 3CV3A 3EFEA 4PBTA 1HUQA 4QEDA 3VHXB 4LV6A 2HUNA 1OB2A 2FJ0A 4W5QA 1E2FA 3P96A 1L5FA 3I32A 3NDBB 2FNAA 4MS3A 4TV8A 1HDOA 1KH1A 1LPMA 2BBSA 4BN4A 1SPBS 4OREX 1KPGA 3DMTC 4LJRA 4V0ME 4A8TA 4UU7A 4LY9A 4DCMA 1I3LA 2WFMA 4YY3B 3U3JA 4LECA 2WIGA 2I33A 4BNMA 2AJBA 1FUYB 1OBVA 4YYZA 4Q0MA 2FR8A 1HBJA 3Q2IA 4FWTA 2FQWA 1KS9A 1M54A 1LNSA 1KK2A 2WQ6A 5KTPA 2PQ0A 3H1TA 4FEAA 4GI5A 5AVXA 2BGTA 4NXNB 4C7OB 5C53B 3ROPA 5KC8A 2DPYA 2CNLA 3GVIA 4YJFB 2OLEA 2QGNA 3P2IA 4ZDIA 1E96A 5I45A 1VIAA 2Z3ZA 3GJSA 4RK6A 5E4JA 5T41A 2A2ZA 3SYTA 1IYZA 1O95D 1QGAA 2P69A 3AGQA 5JCXA 3LF2A 1JIJA 2ZR0A 4N82A 4RDCA 5HMLA 1CJUC 1OAOA 2C5AA 2RAVA 3QOWA 4NU0A 3PPIA 2CXNA 1XE3A 1I3KA 3HU3A 2NACA 5IHPA 1T9AA 5CNKA 5KU1A 1JLRA 4BV2A 1HA3A 2HJVA 1NDHA 2QSYA 2WJWA 1JEQB 4INJA 4K8OA 1HSZA 2JLRA 5JNVA 5F7OA 5HK8A 2I62A 4UNSA 1Q21A 2Q27A 4ZZ2A 4BO8A 2B5VA 1FTWA 3QE4A 1E89A 3IEVA 4NENA 3O7WA 4WZAE 3PENA 4QOSA 4RTNA 2J3IA 1DQRA 4C6TA 2CV0A 2O06A 5DBIA 3V1TC 4L5YA 4MW5A 4EYKA 4YQZA 3DEIA 1M2EA 1LDEA 1LRLA 1QQTA 4Y30A 5EYPB 4JEIA 1TCVA 4I6JA 4CV1A 4YHHB 4UDXX 2IPLA 3MC1A 2BRUA 2QM7A 4YFVA 3EARA 4WLEA 4C4AA 4QGAA 2GVNA 1ZU5A 5DWDA 3FI0A 1AJEA 3IHWA 1U0GA 2REQA 2YINC 1E1NA 3MJ4A 4ARIA 4DLUA 3D5EA 1AKNA 3I01M 5EWLA 5IT4A 3C8ZA 1ZJJA 4MQUA 5AW0A 2WNIA 5C8XA 3D6MA 2V6GA 2VEOA 1T9GR 4JT9A 4HWRA 3F78A 2G9QA 4CMCA 3VJRA 3RK0A 3HNPA 2PLAA 3D4LA 4ENTA 1DCFA 2EJBA 4O2BF 4RAOA 4URVR 4MGYR 4CFZA 2AH5A 5K6AA 1J09A 2YXEA 4LF6B 4C08A 3PD0A 1Y7TA 3IIMA 1UMCA 3GARA 1T8RA 4PC6A 4KITB 4FNGA 1GNTA 2ISQA 4NZOA 2R2GA 1NU6A 1WEKA 3O4VA 1SCDA 1BWRA 2CVQA 2V7TA 2VF8A 2CDCA 4YI3A 4BN5A 3PSHA 2I91A 5BOVA 2AN5A 4JB0A 3U7GA 4HZGA 3ND6A 5F7ZA 5B12A 4V2IA 3MFYA 1C0EA 5AM3A 1Z2OX 3L0OA 3VJKA 4RDHA 3I2FA 1EE1A 1MDBA 3W8DA 2QRGA 2RHGB 1XTQA 3G5UA 4ZVPA 5J1SB 1OR8A 2CLMB 5AK0A 5HCUA 3V8VA 1Q0LA 3AVWA 1O96A 5A9SA 3K1TA 4UFOA 1D07A 4CFSA 1BX1A 1U02A 1E2KA 5B1HA 1W581 1P4HA 3ISVA 3SYKA 5BVGB 1GQ2A 2AMJA 2H51A 2BEJA 1JGTA 2IYFA 3OQJA 3VU9A 1TKAA 3O4RA 1KARA 3PYLA 3QUBA 3FD8A 4AO7A 3DOCA 2VYNA 3TPZA 1DKPA 1VLLA 1FS5A 2Z5LA 2BEUA 3R3YA 4PWZA 2YYYA 3F2VA 4IXWA 4R98A 3ZXXA 3EN0A 2W6NA 3PS9A 5EERA 4HYYA 4DDMA 1Y9JA 1X1TA 4UZSA 1QYDA 4UHHA 3ICVA 3EEIA 2V7VA 1UEIA 3P5BA 1E9BA 1DIRA 2YMQA 4FI3F 5FOXA 2OO7A 3PQ3A 1BE0A 4HGPA 1IEWA 4MKHA 3P0RA 3ANTA 3NYRA 3ZDRA 2WQZA 3CW9A 3B85A 1I9CA 4CUZA 3EUFA 3BOSA 3T5PA 3C3MA 3FGZA 4TL6A 5EMMA 1G55A 1CS4C 2ZIFA 4EI2A 3QBVA 4O0MA 1NVKA 3QPDA 1JG2A 3WTCA 4K6HA 5KNDD 2Y1DA 5EQDA 1Z2NX 3KXKA 1KEKA 3SFZA 4EYGA 2ZZNA 3TLZA 1IZ0A 1NQOA 2O54A 3ZHXA 5A5EA 3DBLB 2I7CA 3EXHC 1JVNA 4MGIR 2Y71A 2B1JA 2DLCX 2ASVA 4ICIA 2CVHA 1NVDA 2O05A 1WMDA 5AUNB 1FX0A 3WMXA 1AUXA 4NZYA 5IWAB 4L7VA 3TGWA 5CAEB 2XUDA 2O2GA 3H19A 3C3YA 3SR3A 3CLUD 1VXRA 5YASA 1OLXA 2F43A 1RQNA 2O6HA 2F9MA 1YF3A 3ABQB 1BHQ1 3ZK9A 2X7JA 2YC2C 2WYUA 3HYSA 3U9SA 4B6RA 3H8SA 4E4RA 1H2AS 1V45E 2ZIWB 1XDSA 1MJHA 2O20A 4ZVLA 2H0RA 1IN8A 2QN8A 2P30A 3HXTA 1QYXA 3ZEAA 4B5LA 3UF0A 3T38A 3GP3A 4N39A 1PJTA 3I1YA 2DWCA 4OJYA 4E5SA 1BU8A 3D7SA 2RI6A 4HAIA 1KNXA 2H2IA 4HYQA 2BI8A 1VOTA 4L0DA 2GYWA 5G4LA 1TW2A 1W6UA 4YR7A 1SVKA 3OF3A 5JSQA 4CQMB 1NQVA 4X20A 4WIAA 4CE6A 4JDPA 1V6SA 4J1SA 3Q7IA 4HO1X 3H7AA 1NDQA 2CCGA 1AMUA 2P68A 2ZRMA 2G8NA 3GJ3A 5BVHA 1UKAA 4F5EA 3SQOA 5JSHA 2NNWB 3THXB 2XKBA 1Y42X 3FVRA 3QGMA 1BAPA 3F9CA 1BDMA 2YASA 3SC2A 5SZHB 1Z4MA 4DCPA 3KYDB 4GOXA 4PYKA 4WNYA 3PR1A 2KLHA 3OAAA 1QCYA 4YQEA 3WK7A 2ZRGA 4TKMA 4ON9A 1KE1A 3CVJA 3VU0A 3UFBA 3ZHCA 1I6MA 4MWBA 2IF0A 2NM0A 5EE1A 3KQOA 4KNVA 4MVJH 3FSJX 5B30A 2LBPA 4U2GA 3CZ9A 1RI5A 1HT1E 4D4GA 3H11A 4H7DA 1G5TA 3BJIC 3TTYA 4L8VA 4RFSB 3BB4A 1DCMA 1RLMA 3TDMA 3KSBC 5K8JB 2RHOA 3FDFA 4ZAZA 5K6RA 5EQTA 2VTBA 3H4IA 4D8WA 4TX1A 1NRXA 1KS2A 2JAHA 3C43A 5DDIP 4ZK6A 1OA1A 2A7QA 1H94A 2CYCA 2YJZA 2P35A 3A0UA 3F8TA 3SN6A 1QCDA 1YJQA 1KJQA 1J49A 2HA4A 1SY7A 3ANYB 3BQMB 3TNLA 4UM8B 4JWTA 1J2JA 2C8VA 3T0IA 1NWHA 2JKZA 2IYPA 1XKTA 4D3XA 3H1FA 1CQIB 3F4LA 3EMKA 3K9HA 4MV1A 4H27A 5LZ5A 3TRHA 3VO8A 2GYVA 2ZZKA 5CB0A 1UC8A 3HDVA 4CMEC 2P3QA 3H3FA 3KB8A 4TQ9A 3NGMA 5AICA 4CM9A 2HLNA 4GDMA 1BKYA 4OHOA 3PEFA 5IJAA 2OZPA 1UOQA 4Q05A 3QVGB 4FR2A 1HDEA 1UAGA 2Y2UA 4LVOA 1OVGA 2XAUA 3EIOA 4AJIA 4JP2A 3RRXA 721PA 2I71A 3H65A 1WRBA 3EIXA 3LECA 3MWFA 3KHUA 2AUTA 1AS0A 4J0JA 4FP9A 5JD4A 1N5KA 2R1UA 1NFFA 4X66B 2KJQA 2PTGA 4OHPA 1P0QA 3U13A 1ETHA 3AOGA 4LOIA 5JPDA 4G1VA 5JSZB 3AB3A 4NZNA 5JJCA 1ZNWA 2C2GA 4YDHB 4QM6A 4LPSA 3LDGA 2QMEA 1MNQA 3FOZA 1Y1PA 2MTBA 2HZ7A 2PRYA 4IIJF 3K70D 2A8YA 1V16A 2XRYA 2ZB7A 4ETIA 4PZAA 4HNTA 5LJIA 1MD9A 4NBTA 3NJRA 3NTOA 1BROA 2WJVA 1CDZA 4V0MA 4BQQA 4RHFA 3BBLA 1GPBA 5MN5A 3L8CA 3RJ9A 3WLSA 1IRIA 1L3IA 2W2TA 3KPUA 2YV2A 2I03A 3ILVA 3SF8A 3TMKA 4QPDA 1C9MA 4B4OA 3I8OA 4D8XA 2GA9A 4X85A 2F8TA 4PF1A 2AGVA 4OQLA 2I4IA 4HEQA 3V9PA 2G7ZA 4FFSA 5DYNA 3UMCA 1UKEA 1H8ED 2EIHA 1W96A 3GH1A 1KI4A 2KYRA 5A1JA 1DAOA 1MB9A 3QVLA 5T57A 1JG6A 3TZQA 3G8DA 3PUWA 1NYRA 2EL7A 3X1MA 5GPBA 1ONPA 5IWCA 1GLGA 3KS9A 4C1NA 2V74B 3DE5X 2Q2VA 1FFCA 1GL6A 3DKVA 3GRPA 1TYDE 1ZK1A 4CQLB 3AETB 5L4NA 4OJTA 1QG0A 2CL0X 3R3WA 2A7XA 1DSSG 1DIGA 1NSYA 1JKIA 1HMPA 1OHHA 1WHTB 2XDYA 3E9DA 3L7JA 4JLKA 2AQHA 2FCRA 2IPOA 3CONA 3RRJA 3MWKA 3PB3A 2ZJ8A 1X80B 4GPBA 3DPSA 1QZXA 1SA0B 3VYWA 2OKGA 4O25A 3QEMA 1H0HA 1CUYA 1OAAA 3HR7A 1V95A 2ZUVA 4WZAA 2WD7B 3WLQA 4F6CA 1Z18A 2NTJA 4FFBB 3CX7A 2R8RA 5CJJA 3ZX5A 1Q92A 4MIOA 4RKRA 1TTQB 3PEWA 1RZRD 1ISSA 4BX8A 1Z82A 5D1NA 1B6RA 4JYMA 5BV1A 5CDHA 2P9CA 3GRRA 3J81k 1TIBA 2AB0A 2NXCA 3FZEA 1OF1A 2VAVA 3PYXA 1XN4A 3HA2A 3R76A 2J1LA 3RKUA 4DDVA 5IZ4A 4RHCA 3U44B 1P3DA 4LOKA 3OHMA 3U37A 2PZBA 3W5UA 4BNIA 4KXYA 5BUZA 1CS0B 1WNFA 1QYWA 2A0UA 4QFMA 1R4AA 4XFJA 2W48A 4Z9BA 2OAGA 3WTBA 4DNQA 3O75A 4V38A 3EH1A 4HBZA 4QTUB 5GZ6A 3UJ9A 2EGHA 4MK4A 5AQ1A 5DBFA 1CG6A 1THGA 4UCXA 1F2TA 1UP6A 2BT4A 3ZPXA 3J80A 4UOQA 3WBKA 2E4AA 1WCIB 4G4JA 4X7RA 4ENPA 2PUWA 5CA0A 3UUFA 5KVSA 3NBYC 1HL3A 4MR7B 2AJ8A 4QE3A 3RHFA 1XF9A 4CKEB 3BTVA 3GR6A 4W1QA 5CDYA 2WFLA 3I2HA 4C4YA 5JAPA 3W5JA 4KXWA 3IUMA 3Q6NA 1EK6A 1XLVA 1ZH8A 3EVZA 3IEPA 4M60A 1RPAA 1V39A 3FNQA 3NTRA 4M0PA 2NU8A 3EVDA 1TVMA 5CDGA 2XB6A 3QTTA 3G8AA 3STYA 3IIIA 4N49A 3UO8B 1E8MA 3TTWA 2VWQA 3M33A 1B0ZA 1J2EA 1RTTA 3HRHA 2W6OA 3OQIA 4XZ3A 5H4GA 5KWSA 1M34B 1U8CB 1K86A 1F06A 3PQ2A 5K4GA 2Y6VA 2V7EA 4JX8A 3TLAA 3OM9A 4C0HA 4DV1B 1RDFA 2ZQYA 4OAQA 4PAWA 5AXAA 4OAPA 1AXGA 4V3BA 1NBME 3OKPA 3AIMA 3HPQA 4G26A 1UANA 2HWXA 4RVUA 3G1UA 1ZN2A 3WKCA 2R2AA 3WGGA 1YRBA 5TVKA 2HHAA 2W8BB 2CLDX 3WR5A 3ER9A 2Y1XA 5EJAA 3F5FA 3PFGA 5K3EA 1X38A 3G88A 2BD0A 2M6KA 3VKUA 1Q77A 1N4AA 1XWWA 3UTCA 5JAUA 1BJKA 1CZNA 2HMAA 3IUJA 1K6XA 1P7WA 4HNRA 5BNIA 3CE9A 4JC8A 1ULAA 3PQEA 3FUCA 1JS1X 1U65A 3N7TA 1H9AA 4KIGA 3GU3A 1WNTA 5B6PA 4Q37A 2HBQA 3SFTA 5B55A 1N3LA 2H7VA 3I9KA 4Q4HA 5FR1A 1E2IA 3ANMA 3KQNA 1E7WA 5C1PA 1PRYA 3N07A 4OQNA 1QRTA 4A8JB 2EXXA 2OHGA 3ETNA 4DMUB 2V7GA 2I7DA 3PVSA 3OFNA 4ZO4A 2Z58A 1L6RA 3Q3CA 4GZ6A 4PZPA 4P3OA 2Z4RA 4CIXA 4JOQA 3K94A 5MHTA 1RQPA 1E2PA 4OBEA 2R7LA 1K1EA 2OCIA 1YOVB 2B1QA 2FW9A 4F1JA 3D9QX 3LPNA 3NHYA 4AXXA 3BFPA 2ZJ6A 3R77A 4J29A 1OXSC 3AERA 3R8CA 4OYYA 2CL6X 4IINA 3MSCA 4D9HA 1M6HA 2JD0A 2PLNA 2X5JO 4I14A 4D9GA 1KDPA 4NDNE 1EFPB 4I8XA 1R5OA 4GBJA 1L7DA 2H2WA 2PXAA 3E2IA 4TYPA 4KOEC 3AG5A 3R7DA 4LXQA 2FHPA 3U7IA 4CM3A 3F5MA 1FBTA 2AOUB 1GCOA 3DLBA 2VUUA 2CJXA 1LSOA 3SXJA 2QLMA 3SOZA 3FSEA 3VHQA 2QW1A 2Y1GA 4GGPA 5HGXA 3IA7A 3RRBA 1HOTA 1DT5A 1G20B 1R7RA 1UBGA 3HMKA 2BOVA 4EW1A 2GVZC 1FFSA 4JSTA 3LL7A 5DJ5A 1EUCA 3GD7A 3K15A 4LMPA 3UMSA 5CVTA 2GLUA 3N59A 2XWSA 3O74A 1TF5A 1JZTA 3WNDA 4DJFC 5LIPA 2WTXA 1QKJA 4BAZA 5DSZA 4Y2XA 2DHRA 4L73A 1R2QA 4E2WA 5K0SA 1EA7A 1EPUA 1DC5A 1QTNA 3BB3A 3EY9A 1OXVA 3WIUA 1AKMA 4KQEA 4IX1A 1HDYA 3RVRA 3D0RA 1QIJA 2FUG6 3O21A 1TZCA 3EGVA 3WLNA 2VL7A 3JV7A 1W4CA 3N87A 4IICA 5ALOA 2BR4A 3OPYI 3WL3A 1NX9A 3C4QA 4AY3A 1QP7A 2RARA 1Y80A 4EJSC 2HTEA 2BI7A 1GGVA 1N75A 2QL5A 2PD4A 2A9KA 4OA5A 1LFAA 4YREA 1LY1A 3TE7A 2W22A 3NOQA 4YP7A 2P9GA 4RK4A 4IGIA 4X3OA 2X2FA 2NX2A 1T5SA 1UBNA 3GEPA 2QENA 2YL2A 4H7FA 4S2UA 4YRTA 1H3EA 2IELA 1U2DC 3VYSB 3X1DA 3PXGA 1W7AA 2W43A 1LBSA 5CW1A 1YE5A 2C7OA 3T7JA 2SCUA 1C8LA 2QB5A 3HCEA 3MN1A 1R6TA 3ELWA 5IJ0A 1N6RA 1KVTA 2IIBA 3JSAA 2A92A 1F38A 2PRSA 3B1VA 1UJNA 3FCCA 1DO2A 1R15A 3PKJA 2C03A 3RB8A 4ILKA 4EJ2A 2CLSA 1Z45A 2VF4X 4UHEA 4BU1A 2H59A 2JIOA 1M2OB 1BXGB 2DKNA 2VDMB 4J0CA 1RWBA 1Y37A 4JHLA 4H15A 5FDFA 1KMQA 4MGZR 4MYHA 5ADVA 4PX9A 2I6GA 5K3BA 3G2QA 1WW8A 3NKVA 1N7HA 3AHIA 2FG6C 1OREA 2G6BA 4L16A 3Q0EA 3QV1A 3G59A 4B6JA 3PC3A 4YN3A 3QHQA 3E9NA 1EZ4A 1QMPA 2E37A 3DHNA 4R69A 4URFA 4GM0A 4RTOA 4Z4IA 4HTFA 3AV0B 4LDRA 1ULTA 5DTMA 3KKNA 2AXQA 1K6JA 2XUZA 2R85A 3JQBC 3SJUA 3V2IA 3K1AA 3OQVA 1JYEA 4YJ3B 2COUA 3KSUA 4G0YA 2PUCA 1NFRA 2DY1A 1BOFA 2Q6OA 3QUQA 2BFMA 4JQZA 5JBIA 3DVSX 3K2QA 3QQ5A 3K70B 2AFIB 1GN9A 3MEQA 2ATEA 2QMZA 2CJPA 3AKEA 1DWPA 1LK0A 4DPMA 1YHYA 4MRVA 3GRFA 4KH1A 2D2FA 3ZGOA 1UBSB 4N7RA 4E2FA 5C3UA 2LNDA 5EXEA 2VBFA 3EEOA 3SQXA 1JRLA 5TT1A 4DR5B 2VQ3A 2XF8A 4MB6A 3IHKA 1LRKA 5B53A 3SJ7A 5IYZB 4FJ1A 5FWDA 4YCMA 4BJHB 4YWHA 3V2GA 5IKPA 1JQLB 1U3FA 3R6GA 1JHYA 4MJLA 4S1VA 1BS2A 4U7PB 4MQEA 2HBYA 3OQ1A 4WQMA 4JLDA 2UZ0A 4BLWA 5KJ1A 2GI4A 3QLJA 4H1UA 4BE9A 3H5TA 3KQUA 2OD2A 1Q0UA 4YNBA 3BC1A 2ZEJA 1E5XA 1WSBA 2K2QB 3WGHA 3K09A 1EVLA 2V97A 3JD2A 4H6WA 5GINE 1WMEA 1NRJB 1N8KA 2QRHA 4H1VA 2ZKIA 3GLGB 1XNRB 4EENA 3Q40A 5DCUA 1W5BA 3KT3A 4KLCA 4LFBB 1YR6A 1OXTA 3NV9A 3CUTA 2V4UA 1GAJA 3CF0A 3H16A 4K6OA 3ZWOA 4DIOA 1E79A 3BMQB 4LZJA 4RXMA 3BH6A 1VA5A 4WBSA 4XCQA 4JZKA 1CR2A 4J03A 4M0LA 4WOJA 4I8DA 4W4TA 4XDGA 5FWYB 5IUJC 2LD4A 3OAAD 1GKLA 4B3MB 4MW6A 3D3WA 3ZCUA 4X6YA 2O1WA 4UZFA 2G5TA 5L9AA 3K31A 3SYMA 5IT5A 1PYGA 3Q8LA 1IXYA 1K88A 4YJ2A 4FYJA 4TLAA 2I3ZA 1JXAA 3C16C 4ARUA 4BKUA 4BQPA 2XSZD 4CIVA 5A3SA 3DBHA 1N0HA 3HDTA 1F2UA 3VDMA 4JGBA 3FSRA 3LO5A 2E55A 3CWCA 3L7AA 1A9XB 4YCAA 3K6KA 3DAGA 4I99A 1FUKA 3COJA 1TA4A 1Q15A 3KJNA 3LBAA 1XJ5A 2XVXA 5GJVC 1BQ3A 3U62A 4QOJA 5DM60 5EXSA 1UM8A 3HKCB 3NYIA 4A92A 3BRCA 1MG5A 2SKDA 4DNXA 1JH8A 1MTZA 3DD1A 2IUTA 3OM8A 3IEUA 3CZCA 3QLUC 3HCWA 5IVHA 3SK0A 1U2TA 3LAWA 1GQFA 3FTQA 1DQZA 4XDYA 4XUDA 4HDSB 1YQTA 2CXUA 1AK1A 4WGFA 4CM9D 3B1ZA 1E20A 4Q18A 4IDBA 3T3PB 3T1QA 2BI4A 4FC6A 3P9QA 3EF1A 1K8RA 2IYQA 2KPOA 4PICA 3VH2A 3WK6A 3WIOA 5CTJA 2WYOA 4J90A 2A0YA 3QEKA 1T2NA 1P0FA 3QPUA 2FZKA 4XR4A 1SCAA 1BX3A 4QG7A 1CUSA 1GUAA 1PLLA 2I2WA 3HYRA 3PHIA 4GP7A 2FSPA 3FF4A 1UOPA 2CMGA 4JLUA 5EEHA 3T4EA 2Z6UA 4Y2UA 2I7TA 3GNTA 1VSUA 4N0EA 2RJOA 1XVIA 3BDVA 4Q9AA