1D07A

Hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis ut26 with 1,3-propanediol, a product of debromidation of dibrompropane, at 2.0a resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
293
structure length
293
Chain Sequence
GAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords HALOALKANE DEHALOGENASE
publication title Crystal structure of the haloalkane dehalogenase from Sphingomonas paucimobilis UT26.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
total genus 113
structure length 293
sequence length 293
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 1999-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1d07A00
3QMMA 2DHCA 3ICWA 4UFOA 3C87A 2PU5A 4IH9A 1LGYA 5HQ3A 2VA9A 3AILA 1XROA 1XRQA 1QTRA 1GKKA 1G42A 2XI4A 5DYTA 4U2EA 3RARA 4C4XA 3LCRA 1CUEA 1LBSA 5JANA 4B7ZA 4J0KA 4EZIA 4YK7A 2RAUA 3M83A 3S2ZA 5ALYA 2CBGA 2QMQA 2JEZA 3O0DA 2XE4A 4QDUA 4UFPA 1XRNA 1AC5A 1MO2A 1SCIA 4DMKA 2AJDA 5A7FA 5K5EA 1QTIA 4Q3LA 2PSDA 2GBCA 1NX9A 5HF5A 4GBGA 5FPQA 4OD0A 4V2IA 1EXWA 4HRYA 1QIEA 2XQFA 3HSSA 3H2KA 2XMCA 4ARBA 2XUFA 2Q0XA 4L9AA 2WG2A 4I19A 2WILA 5JD6A 1K4YA 5K3DA 1CUFA 2RHWA 3I6ZA 2Z3ZA 1FFAA 3OTQA 1IMJA 2WUFA 4KE6A 1QGED 3H2GA 4X95A 1Y7IA 4OSEA 1O6GA 3HEAA 4UBKA 4YPVA 1DTEA 1XLUA 3QBJA 3F9CA 5JALA 2OGSA 2XDWA 1CPYA 1H2WA 1AX9A 1L7AA 2K2QB 1AQLA 3IURA 1WB5A 4RPCA 4Y2RA 4KRXA 1QIFA 4QDTA 2C5GA 5CXXA 2I03A 1G5FA 5JD5A 3WK7A 3AJAA 3WK9A 3FVTA 4FNMA 2DSNA 3ZI7A 5KWJA 1CUAA 3UMJA 1XZFA 3G0GA 1ODCA 3KD2A 2OQIA 4Y2YA 1OXMA 3V48A 1IUPA 4IH1A 5A6VA 3AINA 1IUOA 4BTLA 2C0QA 3AIOA 4EA6A 3ZPXA 1ZIYA 5C7YA 2WHPA 4K6GA 3PDCA 1TK3A 5EIAA 1DWQA 4H0CA 3MUNA 4H18A 4PSDA 1BROA 4FFWA 4LIPD 2VJCA 2QOEA 1CUGA 4GXNA 4B6GA 2CUTA 2V98A 3R0VA 3VISA 3STTA 4QA9A 5K3CA 5AO9A 1QZ3A 3OC0A 2ECFA 1QIGA 1QE3A 1NU6A 3V1LA 1R9NA 5AM2A 4WJLA 4G4IA 4CCYB 3WWPA 2ZYSA 5JD4A 3DCNA 1XZKA 2ZJ7A 4H7JA 5AM0A 3FAKA 4B81A 4KR0A 2HU5A 5AKLA 3IUQA 2JBWA 4B85A 3IDAA 1JJFA 1EVQA 3DJYA 4U2CA 1EI9A 5ALRA 4BATA 5ALVA 4FFVA 1JMKC 4DIUA 5EHZA 4JEIA 4G8CA 1VKHA 1GQSA 4X00A 1AZWA 2HA4A 3FVRA 1VZ2A 2DHDA 5AKXA 3IB3A 1SOMA 4TVKA 3DKRA 2XUKA 4AO7A 4AQDA 2XUJA 2XMZA 3W9BA 3HXKA 3A2LA 2Z3WA 1QO9A 2WJ4A 5F4ZA 2J4FA 1EINA 5LZ2A 1MU0A 2PUJA 3GZJA 4CI9A 4X7BA 3UUEA 5ALWA 1DWPA 3I2FA 4AO8A 3I2KA 2WJ3A 1ACLA 3H2JA 2LIPA 4FHZA 4P08A 1VXOA 4LYDA 1BRTA 3WKBA 1UK9A 5HF8A 4GWLA 5AOCA 3ESBA 1Y37A 2OCKA 1BEZA 3OG9A 4UBIA 5IVKA 5ALHA 4B9EA 4K6KA 1KU6A 2W6CX 5EGNA 1LPOA 3I2IA 4DSZA 3W04A 3PE6A 4Q3KA 3ILSA 4MQMA 3PICA 3LP5A 4M0EA 4XWGA 5ALXA 3ESDA 5DNUA 5AIAA 2I78A 4X93A 3VKFA 2BUAA 4C87A 1X2BA 2HFKA 4X90A 5A7GA 3VJMA 4NVRA 5ALMA 4AX4A 2Z5GA 4DNOA 3MUOA 3R3WA 4HRXA 2DHEA 3A2NA 3PFBA 3FWHA 4H7FA 4O08A 5T4EA 3M3DA 2NW6A 4AO6A 5FKJA 4U2FA 5AH0A 3FYUC 4L72A 3LIIA 2JGIA 4HZGA 2HADA 1U65A 5HKBA 1WOMA 1KU0A 5E4YA 2H9YA 1THTA 2X8BA 2CMFA 2W22A 3C6ZA 1FFEA 4WDQA 4CIBA 1QFSA 3CN7A 1HQDA 2QJWA 5AI4A 3V1NA 3DOHA 2BKLA 3OOSA 1A8UA 3DYIA 1EB8A 1LZKA 3K2IA 2PSFA 3GBSA 3C6YA 3LLCA 4OPMA 3G0CA 4A16A 1XZGA 1XZIA 4WFIA 3D0KA 5AI9A 2WLSA 1QO7A 4XX1A 2XQGA 4G1FA 1XRPA 1LPPA 2WTMA 5AI0A 5FOQA 1P0QA 4NMWA 2IIVA 2WU3A 5HFNA 3OM8A 5AM5A 2HA7A 1PJAA 4W63A 7YASA 1LLFA 4B82A 1CUIA 2E3JA 3C6XA 4MYDA 2O2IA 5DTJA 3TRDA 5A7HA 1WHTA 1XRMA 4WFJA 1YASA 3WI7A 1CIJA 3DS8A 3BJRA 4G4GA 2OCIA 5HZGA 2AXEA 1CUHA 3DD5A 1GT6A 2PM8A 4BC1A 4UBNA 5J3JA 3G7NA 1DQZA 2AJBA 1T2NA 5CT5A 5FDFA 1K8QA 5SYMA 5ALUA 5EI5A 2PL5A 4IO0A 3DEAA 2BGNA 3B12A 4N5HX 5DLPA 5ALOA 3HC7A 5EIEA 2C58A 5AP9A 2DQYA 1CUXA 4QE3A 5AKYA 4RGYA 1ETHA 1LPAB 4QDXA 2ZSHA 3DDUA 1B41A 3RK4A 4XVCA 4UHCA 3AZQA 1X70A 5CRIA 2WHRA 1LBTA 5AI8A 1P0PA 1W6RA 4EY7A 1CUDA 4Y2TA 5LKRA 4QEKA 4EHBA 2WIFA 5IH7A 3N0TA 1K6EA 3R3ZA 3BIXA 1LNSA 1MT3A 1YA8A 4G8DA 5E2IA 1MAAA 4KACA 3W2TA 1BU8A 3ESCA 3GELA 4G9EA 5E4TA 4B84A 4C6HA 2O7VA 4ZV7A 3IULA 2X5XA 5EHNA 1QIJA 5JASA 3QITA 2AJLI 2WHQA 3WKEA 2CJPA 4C89A 3BF8A 2BAGA 1XLVA 4AN1A 1CUBA 3HABA 4X6UA 4BCCA 2XQIA 4BB0A 3WK5A 2ZYIA 2OGZA 5AM1A 4CG3A 2QR5A 2HM7A 2ORYA 4KAFA 5ALJA 1D07A 5BWBA 3ESAA 4C4ZA 4H7HA 2CZQA 4ARAA 3FSGD 1A8SA 2XLCA 4Z49A 2WIDA 1JFRA 1JI3A 1MJ5A 3G02A 1EK1A 1HKHA 4HXFB 3CXUA 1P0IA 1DINA 1QIKA 4B83A 3YASA 2PUHA 3VJLA 1BEEA 1VE7A 1C7IA 2OAGA 2ACEA 3D4LA 3L1IA 1MAHA 3C5VA 4FLMA 4ITVA 3IIIA 4GDMA 4UBOA 1L7RA 2PBLA 5HF6A 5C8XA 4RNCA 1GPKA 5HK9A 4S0XA 3W9UA 1WB4A 3IUNA 4H77A 3EQ9A 4UHFA 1G4HA 1CUYA 2VT6A 1VOTA 5ALIA 3O4JA 3R40A 1YR2A 4DMFA 3I6MA 4CCYA 3WYDA 4CG2A 1OILA 4UUQA 4C01A 3Q8WA 2PPLA 1HL7A 1ZIXA 5ALGA 3O9MA 2ZYRA 1A8QA 4J0GA 3WYNA 2CKMA 5LKAA 1ORWA 4DMCA 5T4FA 4FLFA 5ALTA 4J0IA 1E8DA 4X92A 5FRDA 1RP1A 4GEGA 3K6KA 4AZ0A 1BN7A 2RGUA 2WM2A 1MX9A 3LS2A 3WZMA 1SC9A 5I8PA 4BDSA 2V97A 4W1RA 5AICA 5JAOA 1ODSA 4N8DA 3WL7A 2H7XA 4PNZA 3AFIA 5IKXA 5AKJA 1M33A 1LPSA 1XZHA 1E5TA 2XMBA 3SK0A 1ZD4A 2V9ZA 2BUCA 3HJUA 1HLGA 3O4GA 3C43A 4KYVA 4W9RA 3QMVA 4K5QA 4EY6A 3ED1A 2C4HA 5HCUA 3WWCA 1Q84A 1TKRA 2OXEA 4BTVA 4H35A 4Y2QA 3L1HA 4ZRDA 2WJ6A 5DYYA 2HHAA 2J4CA 3EQ8A 2HDWA 4WFKA 3BDVA 5LLSA 3V1MA 3WJ1A 1BN6A 2DCMA 5CURA 2P8SA 1Q83A 4MYSA 3GA7A 3QH4A 4UBMA 4L0CA 4Y2UA 1E8NA 1N5MA 5AM3A 4QZVA 4YASA 4AMYA 1XZJA 1CFJA 4I3FA 5CT8A 3IBTA 3DNMA 3STUA 1UOOA 3A70A 3IA2A 1XRRA 3N2ZB 2QRUA 5T4BA 1DT5A 1YS2X 3AZOA 4Q82A 4BAGA 3EF3A 3DLTA 4WY8A 4WCVA 1MPXA 1ZD5A 1K5PA 5LIPA 3BWXA 3QMWA 3NOXA 3WJ2A 5JAUA 4P93A 5FPPA 1TQHA 3RKSA 2Y1KA 1UXOA 3G8YA 5I9IA 4ZV9A 3I1IA 2JGEA 2VJDA 1FJ2A 3C45A 4DM7A 2B61A 5ALKA 5LP1A 4X94A 1XQWA 4E14A 4A23A 2VF2A 4U2DA 3V9AA 3BE8A 2OGTA 4U2GA 2UZ0A 2WUGA 2JIDA 2VSQA 2VTVA 1SFRA 4DNFA 2RIPA 5CH3A 1YAJA 5D7BA 4F60A 1XZBA 2JGJA 3O4IA 1YS1X 2J3QA 1EK2A 4HTAA 3PUHA 3HRHA 3CN9A 2Z8XA 4OCZA 2HIHA 3G9ZA 1G66A 1ISPA 1XZDA 2B9VA 3WWDA 2VAXA 3WLAA 2PSHA 2ZJ6A 3FYUA 4BE9A 5FP0A 3M82A 4E46A 2BGRA 2XUIA 1QJ4A 1Y7HA 3TGLA 3WA6A 1AGYA 5I7UA 5BV7A 5AOAA 2XMSA 5FV4A 4LYEA 5HF9A 1IUNA 1ORVA 2XUOA 5DJ5A 4ZREA 1VA4A 3WKDA 3PF9A 2OG1A 2WG1A 2RI6A 1TIBA 4WY5A 2XT0A 5T4HA 5CXUA 3VXKA 4CCWA 5ESRA 4P92A 3IUMA 1UK6A 1A88A 3O9VA 5JZ9A 3BXPA 4KJXA 4Q3OA 2DR0A 3STVA 2R11A 3MVEA 3D2CA 3WKAA 1BCRA 3BF7A 1UOPA 4LXHA 3E1GA 2X76A 4J0JA 4FMPA 3FYTA 3WA7A 3NGMA 4X6YA 2WG0A 2BFNA 2WUEA 1VXRA 1O6FA 3VJKA 1Q0ZA 2RONA 5JAPA 3E4DA 1X2EA 4GHWA 1MX5A 3NWOA 4GLBA 1LPBB 5H3HA 4G8BA 4CFSA 3EIOA 1TAHA 1R9MA 3MGAA 1N8SA 2O7RA 5ALLA 3RM3A 5C8ZA 3SC2A 3ZLTA 4JH0A 4OB6A 3FLBA 1GXSA 4LHEA 5AM4A 1GPLA 3W05A 2G63A 3ANTA 4HVTA 1AURA 1QIIA 1QFMA 2XQJA 3BDIA 3I28A 4W1SA 4X97A 4PF1A 2GBFA 3QPDA 4GW3A 4BAUA 2H7YA 2XMGA 1S8OA 1FFBA 3STXA 1CUVA 3EBLA 2XQKA 4ETWA 4J0HA 5AKGA 2HL6A 4Y2XA 3WK4A 1E3QA 5E4JA 1XZMA 3C5WP 2YH2A 2VATA 3DL7A 3FYUB 3STYA 5JZBA 1CUWA 3H2IA 5K3EA 1ZJ5A 5HFAA 4KEAA 3GUUA 1VJ5A 1UZAA 3B3QA 4F21A 1EH5A 2QUBA 2JGLA 2VEOA 3VDXA 4BCDA 4UPDA 4D9JA 4CIAA 1UK8A 2ZYHA 5JYCA 5ALZA 3U0VA 1IVYA 2WIGA 4Y2PA 2QZPA 3DYVA 5C8VA 2O2GA 4BC0A 2WSLA 1R88A 1A7UA 5JADA 4EY5A 4INZA 5BOVA 3A2MA 1ZGBA 4RE6A 2Y6UA 5LZ8A 1XKLA 1ODTC 3HI4A 1U8EA 2JGFA 3EQ7A 2ZJFA 4FOLA 2HU7A 2Y2VA 2QTBA 2VQ6A 1HDEA 4DTCA 3ZLUA 3KXPA 3F97A 4L3WA 1WHSA 1UKCA 4AN0A 4QDZA 4F5ZA 4HXGA 5AK5A 4OYLA 5AIBA 4W1QA 1TRHA 3PI6A 4QNNA 5JZSA 4KE9A 1OCEA 5K3BA 4DGQA 4UBLA 2XB6A 1EA5A 5DWDA 2OCGA 3WZLA 1QIDA 1T4MA 4MJ3A 4FBLA 1FFCA 1H2YA 2DFPA 3G0IA 2ES4A 3U1TA 4EUSA 2QJRA 2R8BA 2VT7A 4IQ4A 5CT6A 5D3KA 3X3HA 3E3AA 4PO3X 3VVLA 1H2XA 4MXDA 2QXUA 1VA5A 1CR6A 1L7QA 3FLAA 2HRRA 4H7EA 1MN6A 4UHEA 5DTIA 2I3DA 4Y9SA 2ZSIA 4BVJA 3DL4A 3KWFA 2XUPA 2JGKA 2HA3A 2WQZA 2OCLA 4MEBA 4RE5A 1QIHA 3H1AA 3T52A 1YCDA 1XQVA 3E0XA 4OYYA 5JAHA 1LPMA 3H04A 4OUKX 3ICVA 3RLIA 4H7DA 1AKNA 2ACKA 2IITA 3D2BA 4C4YA 3I2JA 3IUJA 2H7CA 2XMRA 3WK6A 1XQYA 2BCEA 2QXTA 2D5LA 4MQLA 3I1YA 1EX9A 5A71A 4X3CA 2O2HA 4DSAA 3GFFA 1ZI6A 3R41A 1BCSA 1HBJA 4XJVA 5KWIA 3QYJA 4G9GA 1ZOIA 1E66A 3C70A 4DNQA 1XRLA 4E11A 1MX1A 1U4NA 1THGA 2IX9A 3WIOA 4UBJA 4BP9A 2PX6A 4LKOA 2WFMA 3WL5A 1EDDA 4UFNA 4B0PA 3WL8A 1XZEA 1GQRA 4QWMA 3BL8A 5FXMA 5ALDA 1UWCA 2QKYA 2EDCA 4NZZA 4BBZA 4NS4A 5DYWA 5DNVA 4DNPA 4FKBA 2VAVA 5D6OA 5CW2A 2EEPA 4BZWA 1BS9A 3ZLVA 4Q1VA 3Q0TA 4BRZA 5KREA 5HK8A 3K9BA 1CUZA 2OQVA 1USWA 3D59A 3H17A 2OPHA 4KE8A 2PU7A 4PW0A 4B9AA 2EDAA 3DQZA 1LPNA 1R3DA 2GYWA 1IZ7A 2DQZA 3FCYA 3W06A 5EIHA 5K3FA 3R3XA 4G4JA 5IVIA 2HU8A 4AXBA 4OB8A 3HACA 1E8MA 3ANSA 3QPCA 3FOBA 2GBGA 2JEYA 2ONCA 1YB6A 6YASA 2BUBA 4C88A 1ACJA 2WFLA 5AK6A 3GROA 1EVEA 3WQHA 1C7JA 1F0PA 2G5TA 1UKAA 2CEKA 5IVDA 1F0NA 4TGLA 3HLKA 2FX5A 4DLNA 4CG1A 5A2GA 1H2ZA 4H7KA 3KOOA 1F6WA 4IHAA 2XUDA 4FDMA 5AKEA 1RYYA 3O4HA 3WWEA 1NU8A 4BAZA 1IZ8A 1CUJA 1WCYA 2YYSA 4AB1A 3R3VA 1MNAA 4TPKA 3V1KA 2D0DA 5D3ZA 4HAIA 1CUSA 2HA0A 2GBIA 1QIMA 5A62A 3IVMA 1CUUA 3R3YA 3DOIA 4HS9A 5CMLA 5BWCA 1CRLA 4PQEA 1W76A 4KRYA 1JJIA 3CCCA 3WL6A 4FNGA 1R1DA 2WU4A 1WB6A 1WM1A 4FBMA 5HQ3B 3C8DA 5EFZA 4KAAA 5KBYA 1R50A 1W1IA 4ZWNA 4JYMA 3B5EA 1W75A 3NUZA 4KE7A 2GYUA 1QLWA 3BJMA 5IVHA 4MWTA 1CLEA 2WUDA 1FSSA 4J7AA 4X91A 3SX4A 4Y2JA 2C7BA 5AOBA 3PF8A 1W52X 2PVSA 3AIMA 1DT3A 1J1IA 2Y2UA 3FNBA 1JU4A 4LXGA 1VE6A 4N8SA 4ZXFA 2WTNA 1EDEA 4N5IX 1CVLA 4P9NA 4BCBA 4Y2SA 2HA5A 4EBBA 4H7IA 2C0PA 4K6HA 1BE0A 2FJ0A 4BDTA 1N1MA 4ROTA 3CCBA 5AHXA 5K3FB 1CQWA 5AKIA 5ALNA 3QVMA 2J3DA 5AI5A 1UK7A 3H1BA 4I4CA 1JU3A 2WFLB 1MNQA 5DNWA 4OU4A 3I2GA 4JYPA 1WPXA 4QWWA 3JYHA 3H0CA 3S8YA 4K2AA 4AZ3A 3D2AA 5CT9A 4PSUA 2G5PA 1SCQA 3A6ZA 4U2BA 1AUOA 4KAJA 4UHHA 3H18A 5LZ4A 1GZ7A 4X71A 1CV2A 4OB7A 4BYMA 1J07A 3H19A 3QZUA 3FCXA 1XZLA 3T4UA 1YAHA 1CUCA 2WKWA 1DX6A 1QONA 1TCAA 5LYYA 5AI6A 4FTWA 3O95A 3G9TA 1DX4A 3PUIA 2PSJA 1PV1A 4ZI5A 4BE4A 4MEAA 4G5XA 1UOQA 4FLEA 5FLKA 2V96A 4M0MA 3FLEA 1TCBA 4MWSA 1XZAA 2AJ8A 3PFCA 1H23A 2WHPB 3D3NA 5HKAA 1N5RA 4J0DA 1ZI9A 4DMHA 2YASA 3D7RA 4FWBA 4X85A 5CT4A 3F67A 4YX9A 1ZI8A 2Z8ZA 4BVLA 3WK8A 3G0DA 2XUQA 1LZLA 1XKTA 2FJPA 4BRSA 4J3JA 5YASA 1EHYA 1Z68A 2GZSA 1Q0RA 5CTAA 2CB9A 1XLWA 1J06A 5CH8A 3TEJA 2PKYX 5ALFA 3QPAA 4EY8A 1XFDA 1C4XA 2B20A 1I6WA 1GGVA 4QLOA 5AK3A 3P2MA 4M0FA 4B80A 1VLQA 1E89A 3DKKA 1CEXA 4QDOA 2QM0A 5EHXA 3WWOA 4Y7DA 4EB0A 3AZPA 2WFZA 1GKLA 2GYVA 2QVBA 3BIWA 5AKZA 2XUHA 5JATA 1EB9A 5EHQA 2H1IA 2XMDA 1UKBA 4AMZA 5JIBA 1JJBA 1KEZA 1SCKA 1GPNA 2Y6VA 4DYHA 3R3UA 3KDAA 4PV7A 5AJHA 5C81A 1VZ3A 2WIJA 4BP8A 4J03A 4EY4A 3UUFA 4HXEB 1YB7A 2QS9A 1W4LA 3ZV7A 3OPMA 3KWJA 1DQYA 1F8UA 4N8EA 4WDRA 3FSGA 1EDBA 4A5SA 2JF0A 4JNCA 3FBWA 3L1JA 1FFDA 3G0BA 2BJHA 1AMNA 4QLAA 3ZWQA 5SYNA 2HA2A 3HYSA 4XIIA 2QUAA 2RHTA 4E15A 5ALQA 1DWOA 3D5EA 1JMYA 5LZ7A 2ROQA 4OU5A 3OURA 1ZJ4A 4GI1A 3WKCA 5LZ9A 4JUIA 5ALEA 1ZD2P 3F98A 1JT2A 2XUGA 1UFOA 2XUAA 1JKMA 4F0JA 5ISMA 2HA6A 1QOZA 1ZICA 4LXIA 2FUKA 3VVMA 5CBKA 2VJBA 1YSCA 2G4LA 3AUKA 5JARA 1MTZA 2XLBA 2OAEA 5AK4A 3C6BA 2C5FA 1ZGCA 3H2HA 5CH5A 2HFJA 4Q34A 1RWQA 1TCCA 3JWEA 3WIBA 3TJMA 1UT6A 2XMQA 3HZOA 5ALPA 3SWWA 5ALSA 1U2EA 1P0MA 3JW8A 5AKHA 2YXPX 4BZZA 2JGMA 1CQZA 1J2EA 1K63A 4BVKA 2ZVDA 4UHBA 2GZRA 3KSRA 1HPLA 3F96A 4J0CA 1YA4A 2AJCA 1H22A 1XZCA 4UHDA 3QM1A 5K3AA 3STWA 1B6GA 4X6XA 3M81A 4Y2VA 1DU4A 4W1PA 4B0OA 2I3ZA 4Q05A 2PSEA 3WMRA 5FUMA 5AKKA 4GECA 2HRQA 3I6YA 1R4ZA 2QT9A 1WPRA 3G9XA 1PFQA 3AIKA 3LIPA 1XQXA 2B4KA 4IH4A 3I2HA 3C8HA 4ZGBA 2OLEA 3G9UA 2WIKA 2VJAA 5LZ5A 3F8SA 4PSCA 1ZD3A
chains in the Genus database with same CATH superfamily
2ZJBA 1BWRA 5BV0A 2QQ0A 4P5PA 2YIVX 3H4IA 1HFWA 4S1PA 5K1ZA 2P68A 3HGQA 4IH9A 4GKJB 1LGYA 1X15A 4OGWA 4MLDA 3C3DA 4RLFA 1F12A 3PT5A 1RXYA 3V55A 1MXHA 1WP4A 2C3PA 5TARA 4M46A 5IH7A 3NGLA 1AIPA 1GCIA 1PL0A 3WP0A 3B9QA 4YJDA 1RPJA 1VG0B 5F7XA 3FGPA 1BA2A 1AKQA 1TO1E 1G42A 3ILYA 2O57A 3DMHA 1HV8A 2XI4A 2ZJOA 5CVCA 5D01A 4KFSA 1CQXA 1YB4A 2VDKB 4GF5A 1GZ6A 2OK7A 1GAXA 3OZRA 3GL9A 3MTIA 3RTBA 4N6NA 3RARA 1XAHA 1KL7A 2A7XA 2I6SA 2CBXA 2SKCA 3VPXA 4AIIA 4AN4A 3M3HA 2CHUA 3LC2O 1LBSA 2IZZA 5D86A 2JGDB 5L9AA 1XDWA 4KIWA 4PU0A 4F3YA 5JH7F 1J99A 1R0WA 2G0TA 5G4KB 2VWPA 1DRKA 3ETCA 1J56A 5BSRA 2RAUA 4WXEA 3IEIA 3L9XA 3SFTA 1DUIA 3M83A 1DIAA 1SUAA 1TW3A 3G5AA 5ALYA 3M4YA 1HURA 4Q9JA 1NMEA 3G5TA 3X2EA 2E5FA 2FWIA 5FHQA 1HQCA 4YXWA 4DEVA 1DEXA 2MDTA 2XE4A 2B5OA 2CXRA 5EG5A 4DARA 3WGZA 4RYLA 4M1QA 1S5PA 4MINA 4NU0A 5IC4A 4BJ1A 3GRUA 4EGQA 3G7UA 1MO2A 1SCIA 4DRXB 1OAKA 4BQOA 2NACA 4FGUA 1A9TA 1FDUA 1QO0D 1TVKA 5A7FA 3I4CA 2PUBA 1PSWA 2X0RA 4HGNA 2Q46A 4MI3A 4D8XA 2PSDA 3LGSA 2DFNA 4OFWA 2GBCA 3TTWA 4P7FA 1V7QA 1Q0SA 1UM9A 2OXIA 4AG6A 1VMIA 5IVPA 3P9IA 1XZPA 3PQDA 4JGIA 2XRFA 4N3BA 1ZM7A 4G1BA 4GBGA 4BNYA 1L7XA 1X8KA 3EAQA 1HMYA 1OE0A 1PU2A 3IP1A 1OLUA 4V2IA 4ND1A 4BFSA 4HRYA 4HV4A 5THKA 5AXCA 4JYAB 7GPBA 3OA0A 1U1EA 4HTFB 1FPQA 4NNOA 3SBEA 3SIRA 3HSSA 2VR1A 2ZUBA 3RS8A 2NU6A 2XMCA 4E07A 1QH0A 1P8AA 2PR2A 2Q0XA 3HNPA 3FG9A 4L9AA 5JZMA 4NTZA 3CNHA 5TPZA 1S2GA 1IXSB 2WG2A 3D6NB 5LSAA 3IKMB 2WILA 5JD6A 5J2UA 1PTJC 5K3DA 3ZJ4A 2RHWA 3ADKA 1Z0KA 1GTMA 2PZLA 1EJ0A 2XDAA 2Z3ZA 5AJZA 5C1DA 1GG9A 4PS1A 1H5NA 1GZHB 5EEHA 4TT3A 4INJA 3WLLA 1KI6B 1H0SA 3OTQA 3QUQA 4LXYA 4WOBA 2I4LA 4G6ZA 4EPYA 2WUFA 2H31A 2O2XA 4GKVA 2B6HA 4KL8S 3DAPA 4PCVA 2BDUA 5DNCA 1A8PA 3D0RA 3EZNA 5A05A 5I7SA 3WP1B 3NPMA 4BX2A 5HR5A 2GN9A 2QG6A 1Y7IA 3IT2A 1VPEA 1NJ2A 4JX9A 4LHYA 4Z0HO 1JJAA 1UPBA 3FX2A 3GEDA 3QEMB 1NRJB 3HEAA 5LBTA 1SA0B 4FFDA 3LDHA 5T8KC 2FDRA 1X7YA 2ZUCA 4YPVA 1PR0A 2H00A 1JG3A 2XIJA 4PN7A 2ZR0A 1A04A 1ZCAA 2JAHA 4QAJA 4LSWA 2BE7A 5JBIA 2C5SA 5EJFA 5AVKA 2CFOA 3F9CA 3I37X 4DPKA 5TIIA 1OYVA 1P7VA 4H3KB 2RGXA 2QD3A 2H1FA 1H2WA 3DT9A 4IGKA 4PXSA 9ABPA 5LA6B 3A6KA 2PXCA 4NPCA 3BL6A 2QORA 3HVKA 2JB9A 1IIRA 4MIEA 2GD0A 4PQYA 3RVBA 4KGZA 4E33A 3KQUA 3W3ZB 1YS4A 4QFBA 2FCRA 4FCWA 3ZXSA 3KEMA 3Q88A 2J07A 2VDMB 3IQDB 3R6WA 1M3SA 5ILQA 3RVSA 4MWDA 4QNRA 4WOCA 4YMTA 1QIFA 3S8EA 1VL8A 2ZRLA 3UFXA 2BEVB 5CX1A 3EVZA 3R77A 1E6EA 3G49A 4KTVE 1VHDA 4CIWA 3EMKA 1PF7E 3IESA 3PUJA 1G59A 1YXMA 2DWCA 1KNQA 3D3KA 1A95A 1SELA 3RIMA 1IPEA 3HCWA 4ZO7A 3RUEA 1G1AA 5CVTA 3IEKA 4BU1A 5KWJA 1NNSA 4R8RA 2C77A 3K9HA 1GGKA 4M54A 1NHGA 1CUAA 4FCVA 1JG1A 3RRYA 2RD2A 3GP8A 1OTHA 2XVZA 4CJXA 2ZVJA 2GN0A 2NUPB 5BN1A 2NYRA 1DB3A 1FNSA 1NXXA 1ZL2A 3V48A 4GPBA 4BB9A 1EFRA 4GOXA 4IOMA 4IH1A 2WTUA 1Q1BA 2W00A 3WGGA 5F9FA 3V34A 3IERA 2UUAB 1IUOA 2O1SA 3O90A 1FW6A 2VCYA 2C0QA 2AOTA 2XVMA 2Y0EA 3R1IA 1SXJA 4IWXA 3ZPXA 1ZIYA 1ID1A 4HX5A 3N8NA 4ZFNA 2KM1A 3EULA 5H81A 5JW6A 1H8HD 2NV6A 2XODA 2PTGA 2WHPA 1F3LA 2EP5A 2P40A 4DBZA 3AJRA 7AT1A 4N5MA 2FZVA 5EIAA 4Q4AB 5K99A 1QGAA 1L6RA 3DQQA 5LU9A 3IT0A 1C2TA 1XBTA 3NBQA 4O5AA 3HYLA 1JAHA 3G5LA 4ZQIA 2ZIXB 5E9AA 4CV1A 6PFKA 2H0QA 2VJCA 3AWDA 4Y67A 4B71A 1EUCA 3CVJA 4PC6A 2DBQA 2BEWA 3NNSA 4Z4QA 3NH9A 3EVGA 5J43A 1UP4A 3N8GA 4NU5A 3VISA 4W5WA 2GPBA 2VHXA 3QU4A 4QA9A 2UZ1A 5K3CA 2WHEA 4GRDA 4P4TA 3WB2A 3EVCA 3RWMB 2B99A 5K0CA 4QTXA 4LJ6A 2C2OA 3OC0A 1TCVA 5LN1A 4RH0A 5DV9A 2Q6TA 1NU6A 2LUOA 3L0CA 1R9NA 2F43A 1Z4KA 3OECA 1T4DA 4NE7A 3ZKWB 3L7IA 3VHXB 3KFVA 4WJLA 1UJ5A 4G4IA 1AXRA 5LXTF 2QTVA 2KS6A 2Z6UA 2DRIA 3CE9A 1G16A 3LPAA 2COUA 3BAZA 4I4TF 1Z7YA 2ZYSA 1ZH0A 1XZKA 4F71A 1GRVA 2E37A 1MA0A 1NBMD 1U94A 2ISQA 4ISBA 1JPNA 4RHEA 1CR2A 5AM0A 4RTRA 3LT1A 1RRKA 4DIMA 5AKLA 1TZCA 2OZLA 1JKIA 4P82A 1U3TA 4X60A 3FTNA 3EDMA 3IDAA 3ZLJA 4FS3A 1JJFA 3HKCA 3N9IA 4QU5A 3DJYA 4KWHA 4OV6B 3NH6A 1U81A 3MINB 2J9FA 2NT4A 2J9ZB 1E0SA 1EI9A 3CUUA 4F91B 4G56A 4FFVA 4XUGB 4CKWB 1WXDA 2FXVA 4LNAA 4G8CA 1GNPA 2Q5EA 5HSGA 1CULC 2Q1XA 3EGDB 1GRNA 4RESA 4BNTA 4CE6A 3G8CA 3T3MB 3WQBA 5BWLA 3CLTD 4W5RA 4GLOA 1FLNA 1KHTA 4YECA 5DE3A 4NNJA 3FCUB 3CLRC 3MRXA 5TX7A 2FUNB 3E2IA 3S0JA 1BWQA 2CYAA 2PANA 3H9BA 4PBSA 1T2DA 3X1ZA 4KUEA 2HA4A 2H08A 1DKRA 2O14A 4UHKA 2I67A 3ZZUA 1RLUA 1W5EA 1VZ2A 3EQZA 4DLTA 1HI9A 3C4VA 3U7RA 3AQIA 3O84A 2RGEA 1QC5A 1QGZA 2XUKA 3DKRA 2G70A 4G26A 3ZZNA 2JLUA 1C50A 1VBMA 2PAFA 5FD8A 3DKPA 3WMFA 2QR2A 1LF0A 2Z6QA 3HCAA 4WASA 1J8DA 2XUJA 2F1RA 3OF5A 3UG6A 1TM2A 3L6BA 3FRHA 1QZUA 1NJ8A 2P6RA 4Q1AA 4PSAA 1PKXA 2ETVA 4G41A 4C9BA 2GILA 2ZIAA 1G60A 3LLVA 1L8XA 1FX0A 4DA4A 1MHPA 3GN2A 1RRGA 4HLUC 1KJYA 1EINA 1LU9A 1EWTA 1GU0A 3GGOA 1PWYE 3KOZA 4UNNA 1I7NA 3DLCA 3DZDA 1MU0A 2HCFA 2IPNA 3P5SA 4OYRA 2IZ0A 6NULA 3E9YA 4EFNA 3VNVA 5JXJA 1QH8B 2FN3A 3WTBA 4AG3A 2QUKA 4BLPA 3S1SA 3D5QA 2AN5A 3DMTC 4W5TA 1E0DA 1W59A 2JG3A 4X7BA 2A57A 1QGOA 2QU8A 2XNJA 4JELA 2C84A 5EUBA 3UKOA 4AO8A 1MC5A 1FW8A 2QSJA 4LF4B 1NQWA 3DCJA 4DBVO 3RU7A 1N2CB 2LIPA 4M8KA 2QD1A 3QFCA 3UICA 1WU8A 5PGMA 2AF4C 3JQFC 1BRTA 3PXEA 1GR1A 2QX8A 3HP7A 4KNYA 4AROA 3WKBA 2XAUA 2OCBA 5F3DA 1NA5A 1QE5A 5SICE 3PCTA 1QKJA 1UMBA 1Y63A 4XOIA 3KQQA 4F5YA 1U9IC 3EEQA 2BDTA 3P96A 3ESBA 4WZZA 3EZ7A 3X1YA 2ZEJA 2WWRA 3NXSA 4MHSA 4UMEA 5IP5A 5IJZA 2OCKA 5M29A 3N6VA 3ZK8A 1GZSA 2ZJ2A 2A5FA 2OYRA 3EC7A 3DVAB 5JQGB 4R1UA 2XITA 4I81A 3L2OB 1XU4A 2WR8A 5F7JA 4I5GA 2JHFA 4XSGA 3VDNB 2DTDA 4DUYB 2FEAA 2FMIA 4BLUA 5CCBA 4W9NA 4V24A 3SHOA 2I7XA 3W1EA 3O1JC 3LL4A 4NZMA 4GC5A 2IV7A 3LBYA 2NUTB 4ZKEA 5EKSA 4BEJA 4UCWA 2A5GA 4U8GA 3FCCA 1ZNZA 2PUAA 1E3LA 2W6PA 5EGNA 2P2DA 3HBMA 3KT0A 1LPOA 4IDQA 5HA5A 3V7NA 2F8LA 4C0XA 4CM9D 4GL2A 3PE6A 2IPAB 5IM4A 1CDOA 4QGFA 4IRXA 4WD3A 1QQ5A 2J3KA 2OCYC 4JFAA 4PC2A 4EKYA 2I78A 3FXAA 4FYVA 3PWSA 3VKFA 4C87A 1KEPA 2OESA 4FFOA 4OLBA 2F59A 1G8FA 4LTMA 4TS9A 5HM6A 5CHEA 4PHHA 4IVRA 3M49A 1GQYA 3OSZA 4MYRA 1BMTA 1COWD 1G8MA 3HCBA 5J40A 3SM3A 1P29A 4BGIA 1G21A 4KHPB 4PAGA 1Y42X 3PPVA 4GEKA 1W93A 2AEMA 3LHDA 4Q6WA 1OFGA 1NXTA 1S9DA 4NVRA 4RO0A 1T3TA 4CIYA 5JPDA 2AN9A 3VTFA 2JAWA 2VSXA 1ZK4A 1RAAA 4AX4A 4MW6A 5KTNA 2XKBA 3E22A 3DW3X 2PD3A 1ZEJA 4HRXA 1FNDA 2GVNA 3A2NA 2HK8A 2D4AA 3CNQS 3FWHA 4H7FA 3IEVA 4RKYA 2FR8A 3P2KA 1P77A 4BX9A 4WCDA 2EOAA 1MB4A 2WM8A 3NHWA 3OTGA 4BV3A 5HPYB 3OPXA 1ZN8A 5I48A 1JFLA 4R0VA 5CNMA 2CF5A 1AMUA 3FMIA 3AERB 4R54A 3QKSB 5BW6B 1VI2A 2ZBPA 1R27A 4LZWA 4S1OA 3GCZA 1IHUA 2GEBA 3QLEA 2DY0A 2VDRB 4ENSA 5E1MA 3KIPA 2ZB3A 4O59O 1T1IA 4WLFA 4ZC8A 1UFRA 3OM1A 3PGMA 1VJRA 3CUKA 5EA2A 1U0FA 3BZWA 4LWZA 2W22A 3DMDA 1NVEA 2QAJA 4Y18A 3VJRA 4WDQA 1ZA2A 3ETLA 3W5DA 3CCFA 4CIBA 1QFSA 3QKRA 4YJFA 3V1NA 3PA8A 5BN5A 4LQ4A 4AKHA 3OOSA 3TTSA 2FZEA 2HDHA 2XECA 5JSKA 1GCUA 1GPBA 2YWXA 4P83A 2UXBB 3A14A 1D04A 2H07A 4U6NA 4IIJB 1H2BA 2Z0MA 1JWLA 4GX1A 3WRVA 2PEZA 3W8FA 1VL2A 2P1DA 4OGFA 4AG5A 1PGJA 1ZW6A 4QREA 4L2IA 1V0JA 10MHA 1XZIA 4R1TA 1UQUA 4ZYXA 2BOVA 3IXLA 4AVYA 5B4TA 2ZREA 5TMEA 3KBBA 1R66A 2FOIA 2H4JA 5KAPA 3E5MA 3T94A 4A91A 1TT5A 2AOUA 1LK5A 2VK1A 4JY7A 4E31A 2WC1A 4DV2B 3THXB 3FUXA 4BO2A 3BERA 3X43A 2ZW9A 4ZYZA 4W9NC 1HDZA 1OX4A 3BMNB 4C0SA 2XQGA 1B0ZA 2GA9A 3FUVA 3MFYA 4LWOA 3ETGA 2FEPA 1LDMA 3G2KA 2D1SA 2M6RA 4DM3A 1A69A 1LPPA 3H6GA 2ACWA 4QDKA 2TSYB 1E7MA 1Z4MA 5FOQA 1J4AA 5BSUA 2YXLA 2AR9A 1YR6A 1HY3A 3IAAA 3IP8A 3IYLW 3RK0A 2P6PA 4CQMB 4ZP1A 4G0QA 2WU3A 3MWDB 3JQBA 3BD8A 4X64B 1M76A 3W6OA 1K5DA 1UPTA 2B35A 3ENWA 3OY2A 3M9XA 2HA7A 2CHEA 1X92A 1V25A 2A0KA 1PJAA 3BILA 4RHUA 4UPVA 2PRKA 2JH3A 1IBMB 1LH0A 2O19A 3ZX5A 3DFMA 3GA5A 1M2VB 1RZVA 2R8ZA 2G6BA 5BY2A 3KZKA 5B64A 4MYDA 4OHWA 3AL0C 3RYFB 2O2IA 1ULBA 4QUKA 1YK0A 5HWSA 4G5SA 4CETA 3PEWA 1N0WA 4GYWA 2QAIA 4HYEA 2RE8A 2REOA 4WFJA 1E2PA 3B1JA 2WWIA 5KOHB 1KYTA 3KLBA 1NC1A 1G38A 3QHQA 3R0IA 2LCIA 3MIIA 2OCIA 4JJ4A 8MHTA 3TKAA 2PJUA 4XM1A 1FMCA 4N5DA 5JLJA 2IWHA 2MOKA 2CLKB 4GXTA 2PM8A 3PNMA 3GG2A 1WXGA 5EUMA 2VQFB 1SK9A 4A8JB 3IC5A 4F93B 2D1YA 4G67A 1F4PA 5E3JA 1T2EA 2XE7A 3UKDA 2AJBA 3OZXA 3OFNA 3MUFA 3PBKA 3QXHA 5AUPB 4X1IB 5LFAA 1V41E 4H1TA 4MP6A 5GIOE 4FS8A 4KPUA 1RI5A 1AUPA 2ECQA 4JX8A 1ST3A 2EBWA 3QXSA 1XDUA 5ALUA 4CMJA 3AKCA 3QGMA 4JZYA 2J67A 4CF6A 3HGMA 3OTIA 5J5AA 3MTJA 4IO0A 2BGNA 1RTTA 3OUZA 5ALOA 3JQAD 2HN9A 1C3JA 3HC7A 3KJXA 3WE7A 2R4TA 3WLEA 3ZE1B 4UAJA 4Y2HA 5KKNB 2C58A 1EGMB 2RG7A 5AP9A 3Q8KA 5EHGA 1BCRB 1IJFA 1CUXA 2QT0A 4OQZA 1PZMA 3KLOA 4YP0A 3DBVO 1L8AA 3IV6A 3GLIE 3HDYA 2PJRA 3ZWWA 4F85A 3UUWA 3A9SA 4IMJB 1EZZA 1T3ZA 2ASEA 3ISTA 2P4QA 1FJGB 5DLDA 4F11A 1B41A 4R8MA 2YZ7A 2GRJA 2FQXA 4RPLA 1DC5A 3FWZA 4UW9A 1VCMA 1RRVA 4I4NA 3EQ2A 4CDMA 4ZA2A 1USIA 4XVCA 1UKVY 1J21A 2LIVA 3G82C 2C2YA 3OLVA 4LFAB 2OORA 1PGQA 5SV2A 1ORIA 3TQIA 1J0EA 3ENKA 4RY2A 3C1OA 2O2EA 3UJDA 3I5YA 3RC3A 4MJLA 4J1NA 2GSWA 3V2UA 1LBTA 2CHGA 3KEGA 2YHAA 1EM6A 1P0PA 2AOXA 2NXJA 3VVCA 4E51A 1M0TA 1W6RA 4EY7A 1DAKA 3IBSA 4Q03A 1U7HA 2CNWD 4CTOA 2HBRA 4GLJA 2F8TA 3O74A 2ODEA 3M1LA 1GL9B 1M6WA 1RQPA 3IIJA 1YIDA 3MWFA 4ZQGA 3P4UA 3QNWA 3Q7QA 2EZ4A 4NK5A 4QVIA 1Q3KA 1QNFA 2EZTA 1T36A 1MAAA 4DB2A 4L5CA 1MO3A 1V71A 2V4UA 3MCUA 4G9EA 4B84A 3IBGA 3QA3E 2AQKA 5EQTA 1TJ3A 4ZV7A 2RHJA 4FFNA 1RI4A 3IULA 2X5XA 4GRAA 4MSUA 5EHNA 1OAAA 1M8GA 4YJ2F 2FWNA 2M1ZA 4EUKA 1L3IA 2BGUA 2AJLI 3FMGA 4QOEA 3UK6A 1N5OX 4YBRA 3L93A 4EPXA 4BNVA 3M7IA 2ZBEA 1D5CA 4MS4B 2I6XA 5CB4A 2JFOA 1BZYA 1XLVA 2HWWA 2BZ1A 1QRUA 2JZOA 1JQKA 1W36D 4EGJA 5JSZA 2BMWA 2HYIC 3F5MA 3ROPA 1NVGA 3D6VA 2VAMA 4L5YA 3RRJA 2Q8PA 1IPFA 4D79A 5AVUA 5D84A 4BB0A 2VZLA 2GASA 3QJGA 2NUAB 1IG3A 1U9JA 2CEAA 3HXQA 1RRCA 5HS6A 3O8OB 3JD3A 1SCNE 2OMEA 4Z9FA 3GLFE 3B6MA 4CG3A 3P2EA 4E5UA 2HM7A 2VDWB 3ABZA 4R83A 2EKZA 2XIQA 1NW9B 1YC2A 2JFWA 1SWVA 3PA6A 4AJEA 3LUCA 4D3FA 2XCRB 1M2KA 2HBZA 3T5BA 1RFGE 1D07A 4BS9A 3CRRA 2ZRQA 2Z5VA 3EPJA 1V1RB 3F71A 3X1XA 1OLXB 4MPTA 4LECA 2BGJA 2VXYA 2ZTLA 1NE7A 3HA7A 5DU2A 3VNUA 3B2EA 1PFGA 1EJBA 4P3XA 2VNSA 1NWCA 3MPOA 4Z49A 4BN0A 4EJSB 2PTHA 2YJ5A 4AZTA 3GWGA 1GRQA 1JFRA 1HLPA 4Z1MD 1WTCA 3F49S 3ZKAA 1M2OB 4R1LA 3BD7A 2ZANA 4JODA 3SHWA 4TKVA 1YMUA 1P0IA 3L7KA 3O26A 3VOBA 4TYNA 3TECE 5BNIA 2GDZA 1QIKA 4MVJI 4LGYA 1IWBB 1WZNA 3GRZA 4WHMA 3R9XB 5J2TA 1Y1PA 3IODA 3P0RA 3L8EA 1YNOA 4FMCB 3S3TA 3VJLA 4OGKA 1VE7A 2OMKA 3EGOA 3KKNA 1WHTB 3Q2IA 1SQSA 1VL5A 3NEJA 1DAMA 3IOBA 4QG3A 5K9ZA 5K45A 2GKGA 3PITA 3PKZA 4D6YA 3X1WA 2ACEA 5AUOB 4NABA 3K31A 3L1IA 3PGA1 1ZXLA 1EJ6A 3AP1A 1P9LA 1PJ3A 2NPFA 3S8MA 2FPIA 4QUDA 1GTL1 3D6MA 3NDJA 4UBOA 2IXTA 3RNOA 1SIOA 3AL3A 5F2OA 4DVJA 4I2VA 4MYHA 1M9NA 2CXSA 4V02A 5KYXB 3UWPA 3IIMA 1ZMRA 4WK6A 3KDPA 5U1PA 1BVRA 2QL9A 2QYSA 3UT6A 2ET6A 5JRDS 3TZEA 3OCUA 4HBZA 4KV7A 3W9SA 1DX9A 3OWXA 1Z63A 3W9UA 4RTMA 2IYVA 3KELA 3E7XA 5DLQC 2GTPA 5KSPA 1C7ZA 3SYKA 5ILOA 1WUYA 3PIIA 1SQ5A 3RHSA 1HDRA 4UMDA 1P1HA 1E4EA 2FEMA 3U7IA 1SMKA 4MPPA 3VPSA 5AW6A 2X7JA 2EEZA 5FH9A 2HJSA 3RJ5A 1VOTA 2YBEA 1ZUNB 2H52A 1RRFA 3L1VA 1IL0A 3C85A 2O6LA 5BN4A 1QKIA 1W73A 1T6YA 4WKGA 5AWFC 1V7PC 2Z83A 4L8GA 3WYDA 5C5IA 1V37A 3K71B 3QFHA 5KTKA 4L7VA 2DQ4A 1TECE 2GZAA 2L2QA 3F7OA 1OILA 1KP2A 4KYTA 2WZCA 3E9DA 4UXIA 2PMWB 3TX6A 4E09A 1N78A 2YNMD 5T7BA 4I9UA 1S1CA 1E1DA 1LB1B 2IGTA 2QTLA 5L3QA 4RY9A 1RHUA 2QHXA 3M5PA 2ZYRA 1A8QA 1C30B 2IUTA 3CZ9A 3DGFC 5U4XA 2X14A 2CKMA 5LKAA 1ORWA 2ZIZA 4N0PA 4E2WA 3KQMA 2ONYA 5CLHA 1U3UA 2PDAA 4I36A 1IONA 4FLFA 4J0IA 3BE4A 4TTVA 5TS2A 3HUTA 1NPTO 1PWXA 1OAOA 1VRCA 1FFXA 4IIDA 4HDQB 1E3MA 3L0ZA 2GCIA 5E8RA 3GNLA 3T3PB 1Z29A 1OBOA 3U4IA 4GMDA 4RMGA 1HO3A 1ZN2A 1P8JA 1KYXA 4E70A 4OLHA 2ZSJA 2F3TA 4JB3A 3WZMA 1JEAA 1H2EA 3HV2A 5AVYA 1ZYUA 2VJPA 2V97A 3I6IA 2MMCA 5B7PA 1RRPA 4F92B 3SR0A 3GQBB 3ZS9A 4N9QA 3DA8A 5JRZA 1USVA 1JQLB 5JAOA 2ZZNA 3CRW1 1E96A 4ZTZB 2G40A 3DP9A 4MB0A 1T29A 2X7HA 2FMKA 4PX5A 4MB2A 4D0SA 1RT9A 1X86B 3FTDA 4QTTB 1M34A 1XTQA 2B8EA 1IQ0A 2ZI5A 2YRWA 1FIUA 4TVOA 2C78A 3AFIA 3AUJB 3GB9A 3OQIA 1DTWA 4RSMA 4D56A 4TMVA 1O2DA 1QBKC 2QI9F 2V7BA 2Z43A 1CY4A 3TKLA 5BOSA 1R8YA 3N3AC 2MT9A 2Y4NA 4FHGA 1E5TA 3EF1A 2XMBA 1V8BA 2Y1XA 1U9ZA 3AWIA 5HIIA 1T9KA 2H2HA 2C3UA 2A5JA 3EQ6A 1LRJA 3CKMA 1PR5A 4CMCA 1GGHA 3B3JA 3B20A 2MSLA 5IAEA 1FTQA 1UXGA 3Q85A 4KYVA 2YV3A 4Q4DA 5IBQA 4EMTA 4L8WB 3EFHA 3IP5A 4AF6A 3R7WA 2W2VA 5EUQB 4ZZ1A 1NI5A 3CZ4A 4ZZ0A 3ED1A 1Y6QA 5LB4A 4WBNA 1G2PA 1W8IA 3DE4X 2XGSA 2OHXA 3NORA 2JASA 2C4HA 3WWCA 4DCUA 2KX7A 5KYVA 3ZU4A 1KQOA 4WXMA 2OXEA 3T7TA 1W85B 2IP1A 5LBIA 4OREX 1Z6AA 3RAEC 1EAYA 4BTVA 4MIKA 3ESRA 1DLIA 3L1HA 3N2KB 3FF4A 4S2UA 4MRAA 5BR8B 3LF2A 2C1EA 3IAM6 4TYMA 3KJIA 5JSUA 1DIOB 1X77A 2A9QA 3OJFA 3W0LB 2PNJA 2QM8A 3IR6A 3WJ1A 3ZWNA 1XF9A 4D74A 3GOHA 5MFPA 2CWDA 2D1FA 1BN6A 3AVXA 4Q3EA 5A4AA 1NW8A 2ZRAA 3BIJA 4MYSA 5LJIA 1VYHA 2C1XA 1GR0A 2AK2A 4J94A 1YVEI 3MS2A 1X8XA 2FOLA 3LBAA 3CZMA 1FUEA 2ZUFA 4B4VA 5AM3A 1T15A 5JR3A 4YASA 1Z6GA 1NYLA 1XZJA 2VG8A 3NV7A 5KYWB 2FSPA 4I3FA 4MP8A 4WA8A 13PKA 3K0FB 5CT8A 3RVLA 3TQHA 1F2UB 2E1PA 4JOQA 2PWZA 5AW9A 4R8SA 3TQQA 4KO8A 3A70A 3ZY4A 4PCAA 3SSMA 3GLTA 3KYCA 1Q3HA 3GO4A 2NX2A 4B4OA 2NVBA 3C8MA 1N8TA 3I2YX 1BCSB 3SS8A 4KOAA 4KREA 1CR1A 4BAGA 2YN0A 5G0UA 4L8VA 4DTIA 4EPVA 2B82A 3CGGA 1OA1A 1CZLA 2D7JA 3EIEA 3I04A 1N34B 1N0IA 5JSQA 2Y27A 4E5DA 4WCVA 4PYJA 3C3CA 1GSOA 3VC2A 2CL5A 3HU3A 4OHXA 2OD2A 2P3SA 5DCWA 5FADA 3SEQA 1LW7A 2CDCA 2C57A 3CLVA 4BNDB 1K5PA 4YIHA 2EV9A 1KYZA 2BF4A 2I8AA 4YXWD 3QMWA 4URUR 1SVSA 2VNAA 1FSFA 2W6NA 4BYGA 1G8YA 1TQHA 2JKYA 2XGGA 3GVCA 3WMGA 4OKNA 1GU1A 2ERYA 5DW0A 1XUOA 2ZI9A 5GOZA 5F52A 3QPWA 1CT9A 3D7NA 4O4JB 2FI1A 3S6JA 1Q2XA 1UMDB 3DAYA 3MJVA 3OMLA 3SMVA 3TZKA 4BASA 5EJMA 2H8GA 2OFPA 5FNVF 2YYYA 4TV9F 4WKPA 5JAMA 2WAXA 1G64A 1Q1ZA 4RS3A 2GEFA 5FPYA 3RJTA 5TVGA 2QE7A 2B61A 4TZ6A 2FRVA 5LP1A 2Y1DA 4EIWA 2AFIE 1O03A 4BMCA 2YICA 3THYA 4B74A 3LQFA 2RKOA 3T5GA 1C7FA 1O94A 1R12A 5HJEA 1AK2A 2NGRA 2VF2A 2HU2A 3KZVA 3QE0A 3UYKA 1GARA 5JAIA 1S0UA 3GQVA 4I3GA 2E87A 3FRIA 4IL5A 2UZ0A 1E3WB 4LE0A 1SUFA 4QPCA 2ZUSA 1K88A 2WUGA 5TPZD 3SFVA 5C18A 4AZ0B 3IE1A 5ILGA 3R4CA 3BE5A 4AY6A 3R2JA 5CCXA 3B3FA 2XXBA 2Q9AA 3OZWA 4Q5IA 5ERXA 5I51A 3HM9A 2REQB 2Q4EA 4U4AA 4XI9A 4DNFA 1UJNA 3RC7A 4TT3D 4KNWA 1ZK3A 2GVZC 5HIJA 5TPWB 4F4UA 4G89A 1W25A 2V9CA 1TVEA 4AY3A 3G79A 3QTTA 1Y8CA 2C4MA 4X1YB 2QD4A 4HKTA 3BTOA 4DHWA 2IYTA 5E8JA 2OO5C 3D6TB 3O4IA 1T5DX 1NP7A 2OAQ1 3AT1A 3BGVA 3MJHA 1DSSG 5KNLA 4HTAA 4QJ4A 4R6XA 3BMQB 2HHHB 4OQMA 1DAPA 2JHCA 5KZMB 2AN3A 2Z8XA 1I4WA 3DFZA 5L3SA 1DAHA 2D5CA 1N7GA 3IDZA 4URFA 1I3KA 3R4VA 7REQA 3WBJA 4DR3B 3E61A 3THRA 3FNEA 1KI1A 5FA8A 4TQAA 1NWHA 4CFZA 5KO2A 4I50F 3S27A 5EE5B 1QVZA 3R8FA 1C80A 3EOAI 1CQJA 1M8PA 1R7RA 1SVIA 1L7OA 3GHHA 5CVEA 4XOUA 4B17A 4EJ2A 1XTZA 1GNQA 1W29A 3AR8A 1M6VA 3VNQA 5DNAA 3ASZA 2C54A 3HR7A 5GJBA 2RC5A 2XUIA 1NVUQ 2PGIA 2GEDA 4ONEA 3TGLA 1U04A 2PS3A 5ULLA 1J24A 1GRRA 4ER0A 1AGYA 3AF2A 1CY2A 5BV7A 2XMSA 5FV4A 2ZJ1A 4HDNA 3NC1C 2CVPA 4MR9A 1OJLA 2P4UA 2Y66A 2HYDA 1M8KA 3KLMX 4Q3CA 3JQ6A 4NBKA 1YDFA 3LY9A 3AXTA 2C2HA 1UT8A 1IUNA 5JH7A 2FPGA 2GN2A 4QHSA 1EP3B 1O97C 4AJ2A 3G3EA 4CUJA 1ZVVA 1L4LA 4OFXA 1QYCA 3E3LA 3TQFA 2V7QA 4CN9A 5NLLA 3HYRA 1ONBA 3H8JA 4ZREA 4F6RB 2P3OA 1BRMA 2ZGVA 3ZGZA 1R3UA 3DC7A 5JNTA 1P62B 1DKPA 3IXQA 2O9JA 1U2SA 4XB2A 1EFRD 2R00C 2RI6A 3VR5A 4Q6BA 3K1ZA 4FIDA 4G5GA 4XIJA 4EB3A 1H42A 3U9LA 2I3GA 2LDXA 3LPDA 3O8NA 3VKWA 1L5QA 1SXJD 2ZB8A 3R8CA 3V00A 4Q48A 5ESRA 4ER3A 4P92A 3UHPA 3KTFA 5EWMA 2OC4A 2GN8A 5ESXA 5K0BA 2RHCA 4DQLA 5DMHA 1MG5A 3RHFA 1FYXA 4RA6B 3KFLA 4H1VA 2B1RA 2I2AA 2RK4A 3TW6A 1OX5A 3L8GA 1VRVA 2ZIGA 4LYJA 2CE7A 4KQXA 5I9BA 4M7WA 1XOIA 5I8ZA 1ZVJA 4EZEA 2AD1A 1RJDA 3STVA 3MVEA 1UZMA 2NVOA 4JB2A 4URWR 2YWDA 4IGEA 2EG9A 4U8HA 3RHZA 2ENUA 3OQ6A 5GMOA 3LHFA 3GFGA 1D4FA 3HUDA 3P9PA 4Y6SA 3T9CA 2EQ5A 2QMZA 3U3RA 1JLMA 4R7GA 5ESDA 4RVNA 2RK3A 3A4TA 3F7MA 3OKCA 4ND4A 3AHDA 3EHEA 4ALIA 2DULA 3ZDXB 2Y3IA 1OWPA 1Z5OA 3OIDA 3QRWA 3ADCA 4PAOA 3FYTA 4ALKA 3WA7A 4X7PA 1P19A 3BM5A 5MGNA 1MZPA 4DIOA 4H15A 4BNXA 1P61B 3LRXA 2H4FA 1KY3A 5DISB 4B73A 4EENA 4EW3A 1NRWA 4JJEA 3TRKA 3WSWA 4EF6A 1GG5A 4EJ6A 1XQ9A 2BFNA 2P2GA 4A4DA 4FGJA 2WUEA 5CFPA 3IEXA 3MWLA 2YV4A 3PJGA 1QCYA 1H85A 4N18A 1P7WA 3GT0A 4GD3Q 2YXDA 3F6RA 3VR6A 2AQ8A 1W5SA 3Q3CA 3QXCA 3GDOA 3WGTA 4KBYA 1PJQA 4C0BA 1D0IA 2HXGA 4TV8F 3NWOA 1YJBA 4UD6A 3H13A 5CGZA 5C4GB 4IMIB 1UP7A 2TMDA 3HJAA 4PLWA 2PFKA 3PZBA 4G8BA 4V0ME 3DVLA 1VHLA 4Y1RB 2BGIA 4O4HB 2A1IA 3Q9UA 1NXOA 3IAM1 4Q1FA 5KMGA 1I3CA 4R9SA 1OFVA 4KQHA 3RVKA 1GM5A 1HEIA 4DYVA 5HIKA 1ZZGA 4MWEA 2WB4A 4ARZB 3B1XA 1T0PA 3IE2A 3WB1A 4RZIA 3EJ6A 4G2NA 1XA3A 1A50B 1PR2A 5AM4A 1GPLA 1V11A 4FT4A 1ZW1A 2G63A 2NTVA 4GP7A 5KC9A 4KO2S 2PLWA 1U8ZA 2XQJA 1QIIA 3BDIA 3EXFB 3I28A 1YZGA 4W1SA 1ILWA 3SR4A 5LQNA 1FU8A 3G2NA 3QPDA 1B23P 1QHIA 1B2RA 1Z0FA 1OWLA 1U3VA 1XX6A 5DM70 1Q95A 1KBZA 4BAUA 2XMGA 3KSMA 4PPYA 3I32A 3MS4A 1CZRA 2FFRA 1I3OA 1WL8A 3MBIA 4RQTA 3ZI4A 6REQA 4L5BA 3CUSA 2PKXA 3TEMA 3IA7A 4GPD1 4HB3A 5H8WA 2QYTA 4OMUA 1ESDA 2J85A 2PG3A 1Q50A 1L1RA 4NBLA 2G1KA 3EBLA 3WDSA 4E5PA 1F48A 5G1NA 4PZZA 1VM6A 1SRRA 3ZHQA 3AEKA 5AKGA 2BZGA 4YMSA 2GNAA 3EPRA 2ZRMA 1DO8A 3BTUA 5TQ0A 3DE1X 1EWKA 1MAUA 4I1IA 3FIUA 1IG0A 5EJGA 4DREA 1IYZA 3CUVA 1V6SA 3JTMA 4G3XA 3OEWA 4LNUA 1OZHA 4Q1DA 4QICA 2II6A 4QTYA 3C5WP 1T9GR 2PZAA 4D3SA 5SY9A 2CSXA 1YVRA 2ZQYA 3WOHA 1T9BA 3FYUB 3ODPA 5JZBA 4Z8YA 5EXXA 1CYDA 2ZB7A 3Q9NA 5EJ4A 4RSGA 1HNZB 1LDYA 2IYLD 3TWOA 3T9DA 3SG0A 2UUPA 5KDLA 5C8DA 4MHTA 2NXWA 4KPGA 4BP3A 1VJ5A 2H51A 2ODPA 2H2DA 3GG9A 1UZAA 1VIYA 4GS5A 4PX2A 1D6JA 2O5CA 3RTDA 3V46A 2CJWA 3KBOA 1TFUA 4HH3C 3Q0EA 1Z6ZA 2ZRFA 1O0CA 1T9CA 2C3OA 3LBFA 3B3QA 3S70A 1TU3A 3MJTA 1Z37A 2W4MA 1EH5A 5A5VA 3O03A 2BJVA 1KPIA 3BN3A 3IV7A 2JGLA 3JATB 3VDXA 4EY3A 4UPDA 3EPPA 1H2FA 4AKEA 5EJ6A 1QHHA 4RXTA 2F3SA 4AAYA 4FD2A 4G84A 3UGQA 1LSOA 2Q7XA 3GJSA 3TVYA 1TIPA 1G6OA 3EW7A 4WCFB 1OVMA 4D9EA 1ORDA 4MDYA 2Y76A 1C0LA 3A0RB 1IVYA 1CIPA 2WIGA 1GVNB 3TUZC 4P3OA 3VGJA 4ZT2A 4G4SO 4BC0A 4HT3B 1WW8A 1T3HA 2C3MA 3AUYA 4IM7A 1PUJA 4UCQA 2WSLA 4NZYA 1R88A 3ZDZB 2QAGB 3QG5A 4NFYA 4CEHA 2E48A 1SVLA 4L0DA 4YWJA 5BOVA 3U44A 2O54A 5JECA 2ZS8A 1JSRA 2E1RA 2ZRPA 3R24A 2RJNA 2Y6UA 4CIDA 3P45A 2XHEA 2IXAA 1I3LA 3HVUA 5M5BA 3GY0A 1P9RA 1U8EA 2XSZA 1PT6A 2M2IA 2Z2JA 3L7AA 2ZJFA 2VDPB 1KDPA 2X22A 1KMCA 4RY8A 1FFGA 4CMHA 4CLHA 3UJ9A 1AHHA 2H2FA 2Y2VA 4K8OA 2L0XA 3EIXA 4L22A 4XE5A 2OBBA 5EPUA 3AKDA 4UM9D 4ZVRA 2A35A 5A4MS 3AMVA 1EHCA 1HDEA 2J3HA 3PPIA 4DTCA 2C9YA 1LBIA 3ZLUA 5B6PA 4G0UA 4F38A 5JAQA 3P0HA 3KXPA 2XADA 3Q8XB 1G3IA 3ZK9A 3GJ6A 2P77A 3RAPR 4DQXA 2R1VB 1NPDA 1X0XA 1E4YA 1K7YA 3DVRX 3NVMB 5FFNA 3A9UA 3I3SR 5BMVB 4LQDA 1TX4B 4NFSA 3B48A 3GLUA 4QUGA 1WB9A 1TRHA 4X8HA 3UOWA 3HJTA 1Q0UA 3U4MA 3OMXA 1KYWA 4EFKA 3TZBA 2ZROA 3U7HB 1K7FB 1KDVA 5FBVB 3SF8B 1QGYA 5ECWA 3OIVA 2W2KB 5EHIA 3SIPA 3IRVA 1EA5A 2AMLA 3H65A 1JU9A 1ZXBA 4B6FA 3LOQA 5CVVA 1XL1A 4EMUA 4ZODA 4HFMA 3T54A 3WV5A 1KA9H 1CX9B 3V33A 3CSUA 1NZFA 1UPFA 1FU7A 4XCVA 1FFCA 1I01A 1KFEB 3RIHA 4ZO8A 3TL3A 2Q3CA 2PO7A 4MS1A 1OXVA 2BP7A 4XYLA 2A67A 4Z7JA 3CVXA 1EK5A 3G0HA 3NDRA 2Q3HA 1CNMA 2OHVA 1P5HA 3GNSA 3HCCA 1KJJA 1YCHA 2R8BA 3IMEA 3LC1O 3MGKA 4KAXA 4QJBA 2WP8J 4YRCA 5D3KA 3E3AA 1UJBA 3LW8A 5IT0A 4PO3X 2WVJA 4MVWA 3VVLA 3DAGA 3ZEIA 1EFUA 1TMYA 2ICAA 4Q3DA 3SVLA 1VYUA 1XO1A 4MW7A 4B6JA 3LTNC 1E7RA 1CR6A 4Q9AA 3B5IA 4KVAA 3FLAA 2HRRA 2Q21A 1MG0A 3ORFA 3RS3A 3TPFA 4KXNA 1MN6A 4JQZA 2G28A 3PQ6A 1JVSA 4EG7A 1KKLA 1CRQA 1BXRB 3Q3IA 3KR2A 3P71T 3UATA 5LP6F 4Y9SA 5C8YB 2B7LA 1YO6A 2D7CA 2HA3A 2WQZA 4BJ5A 3HBNA 3EC2A 1JA9A 3AUSA 4MEBA 5IULC 4JT4A 2IHYA 3KUCA 3QIVA 3KSUA 4JC4A 5EZQA 3ANYB 1I9CA 4IXWA 1OYYA 4JS0A 3BXOA 3RVDA 1ZHOA 3N05A 1CQPA 3ZWDA 4NE9A 3AIIA 3C7TA 3QLVA 2AG0A 3E0XA 1KF0A 3OKPA 5JAHA 1T5SA 3IELA 4NBUA 4V1CI 1ZZEA 3NGXA 5CNIA 1NP6A 4BVFA 4ENPA 3FM9A 3HCNA 4HDKA 4A2WA 1DKNA 2BY4A 5K0NA 1MP0A 1P91A 5EP4A 2ZTUA 5TQ2A 4H7DA 1M10A 3P9ZA 2ACKA 2P1ZA 1SUWA 1JKJB 3NHMA 3PQ7A 3QY9A 1R8XA 4QARA 4F4DA 5G4LA 4C4YA 2YW9A 3TBFA 3V4OA 5K0EA 2VPQA 1QYXA 3GK3A 3U7GA 3HWWA 2ZT7A 4LOKA 2B94A 2C4NA 2M9MA 3CSDA 4EG1A 3O3NB 1QOPB 3WK6A 3CNEA 3Q5EA 5A3SA 3VMFA 2B98A 5C0OE 3X0DA 4BMXA 4QYTA 2GR9A 1JXAA 4EFDA 1XDDA 2BCEA 3VZQA 2FVYA 1U5BA 2UVPA 3CZQA 3BB4A 1Q7EA 4UE3S 2JARA 3IAUA 1Y6FA 1CFZA 1O96B 2D74A 3JQGA 4LMRA 2Q6OA 4OQ4A 4TMYA 5ERYA 4QLBA 1GFIA 3G8AA 1HZJA 3C6KA 3SIWA 3UTDA 2ZIEA 5DHSA 1D2RA 4DSAA 3DTYA 3DHYA 1DJOA 3GFFA 4IUDS 4ARUA 4RANA 3J80A 5HBGA 3R41A 3WB0A 4BEBA 1PZEA 2I2XB 1NLYA 4PBTA 1QV7A 3AEZA 4XJVA 3GXOA 3OFND 3TOZA 4IS3A 1E66A 3SYLA 1ZRMA 2L42A 3Q15C 4DUZB 2ONKA 2PUDA 1BHQ1 2QRHA 3FUWA 1MJGA 2JD2A 2WMOB 2O0MA 4MQUA 2FNAA 1UEIA 3GD5A 4Q19A 1U4NA 1THGA 2R25B 2RCNA 4OYHA 1MB2A 1K6XA 2IX9A 3FSEA 3ONDA 5JMWA 5TMPA 3ITNA 3L7OA 3MT8A 4FN5A 3TAXA 4BP9A 1J1UA 1BQ3A 1CP3A 2WSYB 2C2MA 2VUUA 4LJ5A 2BFCB 2HXSA 1T5BA 1WUTA 4WEQA 3BXFA 3BMCB 1T4CA 3WL5A 4Z3OA 4GI5A 2ORIA 3WL8A 1M2GA 1AV7A 1N2CE 4GT1A 2DQKA 1AA6A 1MR3F 4PQFA 2FEOA 3T5PA 3BL8A 3SGLA 3V1UA 1P9OA 1G9TA 5IDVA 1S4QA 1T2UA 3HP4A 4WMLA 4CUKA 4P4GA 2X42A 4ROSA 1UWCA 1Q2UA 4MITA 4JJ8A 2QKYA 4BBZA 4LRXA 3E5NA 4P5EA 2QN9A 4UNQA 3CPJB 2IHJA 4QSMA 5DYWA 4CR7A 4HNRA 5KDOA 4DNPA 1NW3A 3A7DA 5D6OA 1OYOA 1XHEA 2CMHA 5L6LB 3CR3C 1MJNA 1AF4A 2EEPA 4OP3A 1B0PA 1WHSB 4D3DA 4C4PA 3K9LA 4B48A 4EAQA 5ICEA 2NO9A 3R7LA 1ZC3A 1FDOA 5KREA 3E8MA 3O3CA 1FB5A 1QH9A 1UFKA 1CUZA 4WNAA 2OQVA 3VUFA 1NVFA 1Z12A 2IBTA 1C29B 3NKLA 2J5XA 1R0BA 2JCBA 3U31A 2ZKIA 5K2MA 5KOJB 1JR3A 1UBFA 4NBTA 4O2AB 1GSHA 3X2SA 5EN4A 3O38A 1CRWG 4KE8A 1H1LB 5K2OA 4K9DA 3MHPA 5LQSA 3DQZA 1JEDA 2UU9B 4F56A 3KRTA 2NU7A 1R3DA 2ZAMA 3IPAA 4UU0A 1ECGA 3ZDBA 3INNA 3QNMA 3ZD6A 3FCYA 1D9ZA 5EIHA 3C39A 3JTEA 1OSNA 4GQAA 3M70A 1WXWA 3BFVA 2YQ4A 2UDPA 4DILA 3EHDA 3HACA 2P6UA 2Y0BA 1F8FA 4MV9A 2ONCA 5M04A 3O92A 1G5TA 1S3SA 1EFDN 4W5JA 3OH8A 1B26A 1ULSA 3HG7A 4H3VA 3OWOA 4IIXA 4NDNE 4H3SA 5B1YA 4MARA 3EISA 3ZR4B 1ESZA 3DEYX 4HLCA 4KQMA 4TWAA 2XRMA 5G1OA 2WFLA 2C59A 4EX6A 2YMPA 3GROA 5K51A 4HVLA 5BMVF 1YZFA 3EMDA 2CZGA 4UEKA 2XCTB 2IY9A 1EE9A 4YI3A 3DBRA 2MMGA 2XX3A 3SLRA 2X0KA 5HRAA 1C7JA 2BN4A 2HTEA 4MKRA 3AETA 4XM0A 1VPLA 1SOUA 3FH0A 4X1KA 1T24A 2GTHA 4ZOEA 2CEKA 4CDNA 1F0NA 4LMPA 4ZOAA 3FOAA 4HNUA 2QW1A 2CK3A 1N9KA 4CM1A 2NSLA 4RAQA 3NAZA 2BF7A 2AE1A 1KIFA 2EKBA 3Q40A 5IK2A 4AWAA 1JHPA 1P17A 1E6CA 3N07A 4K6FA 4XWTA 1W34A 1V3UA 2IZ6A 4YLGA 5JI2E 2JIRA 1J0BA 4GVPA 1P9NA 1VECA 1GEGA 1VI6A 1JLKA 2GCNA 4QYSA 5FI0B 4D9CA 2EFJA 1N25A 3K6JA 1KDTA 4RIFA 1DAFA 1OV6A 3GC6A 4O4IA 1P18A 8OHMA 4YJ3B 4YAFA 4MGKR 3E23A 4JZKA 4XDGA 4RZ2A 1SIBE 3IDOA 3DD1A 3TQRA 1O9GA 2YFHA 2C5LA 3BIFA 4KQWA 1NU8A 2CV0A 4BAZA 1AKTA 1DEOA 1SULA 1VSTA 1ZRNA 3ETNA 3H6KA 5EJ2A 2YYSA 1KE1A 4AB1A 1SIUA 3IBYA 1ENOA 3IPLA 3SKYA 4RDIA 1RPAA 3AESA 3TFOA 3GUCA 3VH4A 1NIJA 1AXGA 1ZPDA 4C4RA 2P78A 4YRGA 1N6KA 3FNIA 4ZMBA 2QRNA 4AK9A 4FCCA 3TTUA 1IEQA 1RPNA 4DCGA 4A0RA 3NX4A 4ENQA 5BWMA 4HG2A 3HS3A 4NU8X 2GBIA 3Q4GA 5D00A 4CM4B 5C8YF 2MR5A 4B7AA 3PNVA 3T5AA 1ZU5A 3LLUA 4GNKA 3CMCO 3I0MA 3KHUA 3PD1A 1YHZA 2XKAA 1IN8A 2W2TA 2XT6A 3GLGB 3D02A 3IJRA 4R40A 5BSMA 1J8VA 2BZSA 4PQEA 3WLIA 1W76A 4MVYA 1G3QA 1W0CA 3ZU5A 3ND6A 1T1GA 3MCWA 1SUSA 2IPOA 5JDIA 2R2AA 1AE1A 3WL6A 3GA0A 1WCWA 3A26A 3TRHA 4FNGA 1R1DA 2EGGA 2ZYVX 2P2CA 4KLCA 4OH7A 1RXSA 1YCGA 2HHCA 5B2ZA 3OZCA 2XNSA 3E9CA 4FBMA 5KKAA 3LZ6A 3JPWA 2A0XA 4NJEA 4GP9A 5HQ3B 3E3MA 1Q74A 5LUAA 3SDSA 4X3OA 5EFZA 1EWYA 3M8KA 4KAAA 1XRSB 1SHLA 5CTJA 2VQEB 4LSMA 4BVGA 2P65A 3B5EA 1W75A 5BRAA 5CA0B 4B6RA 5A9RA 3BGOS 2WF6A 3CF0A 2IHKA 1VMAA 1C4OA 4EVQA 1G8GA 2VSFA 3P97A 3HZZA 1Y3AA 3INRA 3QVLA 1BTOA 3BJMA 2BFFB 1IXKA 3UOAB 5A5DA 4B3JA 2WF9A 3AV3A 3MGGA 2W2LA 3L4EA 3ZQJA 4KFUA 4RMIA 4TSFA 2Q9BA 3SX4A 2C7BA 1CJUC 5EZYA 5J63A 4IVNA 5AOBA 2H1LA 1JI0A 2FQ1A 1ECCA 4PAWA 1W52X 3ML1A 1YBVA 2O7SA 3B89A 3KEFA 1EXMA 1VTKA 1LBEA 4HUTA 1EQAA 1J90A 4OK3A 3AH8A 1NF2A 1KPGA 2OLKA 2RGGA 1R16A 4D4LA 4B3TB 1RJ9A 3JASB 2JCGA 3EBPA 4G0YA 3GRYA 1TE2A 4RJLA 4X9XA 1CNFA 4CMKA 4UDYX 3OZEA 1HF3A 4N41A 1BHO1 4OXKA 3OKFA 1J25A 4EL5A 2WTAA 3CF2A 3BCRA 1S3GA 3UXYA 4UTOA 1EDEA 3HJFA 2KYRA 2WAAA 1LTKA 1CVLA 4JDUA 4BCBA 1X1QA 3MBOA 4Y2SA 2YUTA 5HUQA 2QSUA 4J7XA 3QHAA 3RAJA 4H08A 5GJCA 3UAVA 5L8VA 1XPRA 4NEQA 5T41A 4BKOA 1C81A 3FTQA 1MC8A 2AR7A 2FJ0A 2QZJA 2VUIB 4ND2A 1YFJA 1N5IA 1TF7A 1EJ2A 1MB9A 1XEFA 4V03A 4ROTA 3HB5X 2O3QA 2AN4A 3R0JA 4C6RA 5AKIA 2I2DA 3KNZA 2AS0A 4GR9A 4E32A 4U1RA 4DXDA 1SG9A 1XDGA 2J45A 2WPDA 3B52X 4V38A 1XXHB 4CMIA 4IEFB 1UDRA 4AL4A 2H4WA 4RVHA 1L5FA 3W9YA 1QPZA 4WLNA 1SEPA 3O93A 4POAA 1FZQA 1RKVA 3AJ8A 3L7NA 5BW8A 4BOYA 3UPTA 4F1JA 2A59A 1JBEA 4FFPA 2G77B 4P31A 2QX6A 3SR3A 1NBOA 2FEXA 1M2HA 4ZRMA 1VBNA 2W43A 2JI7A 3PJRA 3HK2A 2IW1A 4QM6A 1QRRA 5JMPA 1JHZA 4JYPA 1B2LA 4K9RA 4Z4CA 1WPQA 4FYJA 4W6ZA 4I55B 1R5NA 2PGLA 4YRQA 3ILVA 3UCEA 3JAMA 4KN9S 3I23A 1GEEA 1KAMA 4C2AA 1F2DA 5HX7A 4K2AA 3DF7A 5JJCA 3D2AA 5FBKA 1E9SA 1PRYA 2ZUDA 3IUPA 1JIUA 3MXOA 3GU3A 4GAEA 5I4CA 4DIEA 2DTEA 1IFXA 2GEKA 2QLNA 4D7AA 1MA3A 3NUQA 3QVJA 4K6MA 5A3RA 2G67A 4QQFA 4X63A 4S1WA 3O1HB 3UIEA 4C20A 3I9V6 2DGDA 2ZRBA 5LMCA 4R51A 4UQOA 4TMWA 4UHHA 3T3GA 1BDMA 2IOFA 4D41A 1G6Q1 1KZHA 1YOVA 4X71A 3KKOA 4OB7A 1LKZA 4WJZA 4PIMA 4HNAB 4YRAA 4BYMA 3L0OA 4YA6A 2VLIA 5LM3A 4AS2A 3UMCA 2BV3A 1TU0A 3K09A 1J07A 1O58A 1P3DA 3JR3A 3Q1KA 3ZHRA 1OFUA 4XAQA 5BSVA 1KP3A 3EZ9A 3FCXA 1XZLA 3C14C 3T4UA 2JJ8A 1CR4A 2LXNA 5A5EA 2O5RA 1BDJA 4YONB 2BEUA 1EHIA 1JFFB 1G2IA 2E0IA 1IEWA 3DTTA 4JLNA 1TCAA 2EF0A 3L7YA 3VPDA 1IY2A 4FTWA 4YRZA 4ZZ2A 3EZLA 2B37A 3G9TA 5EYPB 3CJTA 1B1AA 1DXHA 1YZHA 3I8SA 2PLRA 5EE1A 2HJGA 4NOKA 4O2BB 1F20A 3BYZA 2P0AA 2GWRA 5H3CA 2W8ZA 2XB4A 4BE4A 1NVVQ 2VT2A 1SPXA 2G72A 1A9PA 4PNPA 1XVAA 4G5XA 4E6PA 1NQAO 1UOQA 2ENWA 2VT3A 4MCAA 1NI3A 1Z6YA 4PLGA 1JHQA 2OL4A 5FBRB 1OXKB 4DLXA 3ECSA 1Z6QA 4CV3A 5FNZA 1EQUA 1Z3IX 4FLEA 3DB1A 3K16A 4QAQA 2XJ9A 5FLKA 2V96A 1TUIA 5H4HA 4RQAA 3TLGA 3FKSA 1SOWA 2XEDA 3LKDA 1UBSB 3WLTA 1NVBA 3ZHSA 1QVVA 2IP4A 2PKQP 1KIMA 3PSAA 3GLHE 4OMDA 2W4IA 2X9NA 3ZWAA 1F14A 3PFCA 1GUZA 2QMEA 3DBHA 4N49A 2VK8A 2VWQA 3D3NA 5HKAA 1KI7A 4J0DA 3CZPA 3EEYA 3OPYA 1ORRA 5EIWA 4ZEVA 1A8IA 4WPGA 3QX8A 1VPDA 1F9AA 5CB8A 2DLNA 2QE7D 2MSDB 1G0OA 4HMOA 1UM8A 3H9UA 1KMNA 4MV0A 5JCXA 2DE0X 3EYAA 4RX1A 2BGWA 2GB4A 2JGNA 3CVYA 5CK5A 3NAMA 4YMHA 1KBQA 1O94D 2F90A 2R2GA 3DNFA 3I9LA 5H59A 1RXIA 3D1VA 5ECYA 1K0FA 1HETA 1V35A 1OI7A 1BMDA 3ICPA 1H65A 4PFJA 4BE7B 5EJEA 3VI3B 5G41A 3Q8LA 2IOHA 3PNQA 4FXPA 2OHJA 3ULKA 3RC9A 1XKTA 2Y1GA 4UUMA 1MDBA 3PXUA 2Y71A 2DQSA 4OJTA 4J3JA 4B2IA 4BRSA 5YASA 4OQFA 3N39C 3LUDA 2VP2A 2D59A 1E3DA 2GBLC 4MOWA 1BVHA 1JIJA 4HATA 4P53A 4S1TA 4DDHA 2MYUA 3K0AB 3T1YB 4AMVA 2V9PA 2VHYA 3TRIA 3IKVA 1FLAA 5B6IA 2WWWA 2AG5A 2Q3LA 3QPAA 2GWHA 1XFDA 2WEKA 3KZ1E 3I4FA 1NM5A 2XDQB 1XQ6A 1P31A 3RUHA 3TO5A 4DQVA 4DZZA 1I1OA 4MICA 3ZWMA 5JZOA 2PGAA 1GCAA 3FPCA 3A1WA 5EWJA 5AXDA 3ZXXA 4Y0AA 4GMXA 4B6SA 4QHTA 3ADDA 3Q5DA 4WT7A 4BJHB 2XYVA 3A10A 4RKWA 1G17A 2PQMA 1C4KA 3MTQA 4L57A 1E89A 1CEXA 4MRNA 4JBHA 4XQ0A 4RV9A 4M9SA 2IJGX 2CJXA 3CVOA 4IEIA 3HVHA 3GLRA 4HI0E 3AZPA 3GNQA 3RSHA 5GGXA 1GKLA 2GYVA 3JYNA 4ZAGA 3TLYA 3TR6A 1IOWA 2WTBA 1PV4A 5EUCA 1SC3A 4UUNA 1FDIA 1UBKS 2BCGY 3S2YA 2TS1A 1VE3A 1EB9A 3KYDB 1EWVA 2ATXA 4AJ4A 3C5CA 4UZFA 3X1KA 2VRWA 4CF7A 2QNBA 2E4WA 3I6BA 1OWMA 3A4IA 3IHWA 3L6CA 4OM8A 3B6KA 1DDOA 4CKBB 3AHCA 4ZQCB 1BXZA 4IWNA 4TUYF 1KI3A 2Y6VA 5EXSA 3FFAA 4MAMA 3KQWA 3OOYA 6CHYA 1Z7WA 5AJHA 3CG4A 3GEIA 2H57A 5KTPA 1VPTA 3VR1A 3M33A 5FWAA 5GM2A 4A2QA 1P7CA 1HZZC 2C31A 4I99A 3LFTA 1L5NA 2ZE8A 1T6XA 3UK2A 1AKUA 3NI2A 3PFWO 4A0HA 5JS6A 2V7QD 3LY7A 4I8XA 2IA5A 3JSAA 4LJLA 4P2BA 4QPDA 4Q9LA 4JL5A 5DX1A 3UUFA 5IHXA 1GLVA 3CLUD 4ZIRA 2C5HA 4A6DA 1W4LA 1L4MA 4L8LA 3ZV7A 1ADFA 2PMDA 3OETA 3VR5D 2W2XA 4DCTA 1VHWA 2XYPA 1L0BA 1DQYA 4MUGA 5BWNA 3QHPA 1ISJA 2DVMA 1PJLA 2OBYA 2QI9C 1K4KA 1SZJG 1T3GA 2Z30A 4PCLA 3CRVA 5EMLA 3V8PA 4C2BA 1XZ8A 5A9SA 2AZ4A 3CT4A 4IXTA 1V16A 1DCKA 4XCQA 2X3UA 2ON6A 3A6FA 3V8VA 4AUNA 4ZN6A 1R5OA 1SBZA 4DG5A 5CBPA 1LUAA 3CINA 3LCCA 4RVCA 1IQRA 2ZAIA 2OXFA 1I2ZA 4J0EA 3TD6A 4Q15A 3G2MA 1ZS9A 2LRHA 4JP5A 3IVGA 3A3NA 3COPA 1FFDA 1AU9A 4C06A 4IHJB 5A3QA 1V3QE 2GJSA 1Z5VA 3C3BA 2M98A 3PC8C 3S1AB 3ES9A 3TIIA 4DJEC 2ZTHA 3AJDA 4BEWA 1W0KA 2O0KA 2V7EA 2YY5A 2P11A 1O5OA 1ONPA 2EHDA 3JQCA 4ZAYA 5D5PA 3TXAA 4KH1A 2COEA 5SYNA 3BWCA 4BNMA 3FJOA 1I7DA 2HSJA 1XYGA 4COKA 1W96A 5JNRA 2C4WA 4ZI7F 4GUAA 4EKGA 2ZVQX 3D31A 1N8KA 2K6GA 1TM7E 1FQWA 2H1SA 1QGUA 4AD8A 4Z9XA 3RWBA 1TK2A 2GI4A 1M1NB 3ZJUA 1D6SA 2JIZD 1AQYA 1G8AA 2RGWA 3RANA 1I36A 4D0NA 4Z4IA 1QMPA 2QR3A 4XSHA 5IEBA 3T0IA 2R8PA 2WSBA 4ES6A 5KJEA 1OTYA 5DM2A 2CB0A 4FKMA 3ORRA 4HQ6A 1SBIA 4WESA 5CVDA 1T35A 4KCGA 2JFXA 3NBYC 3OE7A 5IJAA 1MABA 3P26A 3PP8A 1Y80A 4EA7A 2QQGA 4HNTA 2XA2A 1Q7CA 3MNFA 3NEYA 4K9MA 3VR6D 5DM4A 4IIVA 4XWOA 1YR9A 3A58B 3DE6X 5KNDA 3CIOA 4EYGA 1DXQA 1N2SA 3GLKA 4YACA 4I5EA 4OO3A 2JL1A 4TLBA 4ZRNA 2HDOA 4XZ3A 1JTFA 1JT2A 3NYIA 2XUGA 4L16A 3WIUA 2JAQA 3NPAA 2E89A 4WGGA 4CHGA 1JKMA 4XKJA 1L5HA 4F0JA 2FZCA 2HPVA 4L6CA 4NBWA 1L3BA 5DK6A 3PVSA 5IH3A 4E4TA 4CKEA 2HIGA 1QOZA 4Y6QA 2DYKA 3DDOA 1IK4A 1JE0A 2P6NA 5LYJF 2HWYA 3EIHA 1PVVA 3QWBA 1TIKA 3VVMA 5CBKA 4LOJA 1YJXA 4JLMA 1F6BA 4PFKA 3P32A 4H60A 1A5ZA 2JCYA 3QELB 4G5RA 1CYEA 3ENVA 1K75A 2XLBA 1QQ6A 2OAEA 3DOCA 4WL0A 4LISA 4KVGA 4QBHA 3ZXYA 2YWGA 2OGWA 2AXNA 2F1HA 1QWOA 2HUPA 3U7QB 1ZGCA 1IAVA 3NYQA 3TDMA 4E7OA 4QG7A 4EJSC 3E9NA 2IHUA 2XYGA 1DRJA 1WMDA 1H8EA 1UC8A 1DZIA 1XF1A 3B36A 3UJCA 1TCCA 4PTLA 5ADWA 1DUVG 3NYWA 1E6LA 5EERA 1DOHA 3TJZA 1T2VA 2FZLA 2PZBA 2XMQA 1W4RA 2FDXA 2I33A 2YWCA 4NU6A 4U2KA 5TT1A 4EDFA 1VSVA