2FW6A

Structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) mutant h59n from the acidophilic bacterium acetobacter aceti, at ph 5.4
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
159
structure length
159
Chain Sequence
b'SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSANRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Biochemical and Structural Studies of N(5)-Carboxyaminoimidazole Ribonucleotide Mutase from the Acidophilic Bacterium Acetobacter aceti.
pubmed doi rcsb
source organism Acetobacter aceti
molecule tags Lyase
total genus 51
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 2fw6A00
5C5DA 3TRHA 2FW1A 2FW8A 2FW7A 5CLFA 2NSHA 5CLGA 4YCDA 2ATEA 2FW6A 4GRDA 4YCBA 2FWBA 1D7AA 3OPQA 3ORSA 1XMPA 5CLHA 4B4KA 2NSJA 5CLJA 5BOSB 4JA0A 2FWJA 3KUUA 1O4VA 2FW9A 4ZJYA 4AY4A 5BORA 4YCCA 5CTJA 4ZK2A 5BOSA 2H31A 1U11A 3OOWA 5CVTA 4ZC8A 4ZMBA 4AY3A 2FWAA 3RGGA 4Z7JA 1QCZA 2FWPA 2YWXA 3LP6A 3RG8A 4YCJA 2NSLA 5CLIA 2FWIA
chains in the Genus database with same CATH superfamily
2ZUFA 1DCKA 4P7FA 1LCIA 1TCAA 1E94E 2CZQA 3NANA 3RS7A 1Q1EA 1W5FA 5CG2A 1T4DA 2XT6A 5HR5A 1V4NA 4MULA 1LSUA 1LVUA 1QO7A 2KBEA 4G5GA 3U9SA 1ORRA 5ALJA 5LQJA 2MYPA 4IDQA 1EGMB 4NAHA 4QEDA 1QE5A 5EXXA 2D2EA 4JH0A 4F96A 4I5EA 4JI5B 1N3YA 3KKNA 4LXUA 2IC5A 3FCXA 1FFSA 3U7RA 4UTZA 4LF7B 3AEKB 1EA7A 5AM5A 2VYVA 5E38A 3LGSA 2WTAA 4EHIA 1JHQA 1KZ9A 1JLKA 2YCBA 5KYVA 2DT5A 1PF7E 2GN0A 2FZKA 2QVZX 4NCIA 4UVDA 4ZQCB 2HEGA 4CU2A 2AMJA 3U19A 1MENA 1R6UA 1W1WA 2MMGA 2Z1NA 3FMGA 3T4UA 5BWOA 1B6TA 2NZWA 1PVOA 4PNHA 1HNZB 1D2GA 4EKDA 1M0SA 3O31A 5LDDC 1JZSA 1L4NA 1QM5A 2NZUG 1N6KA 1TA9A 3DWGA 4OI1A 5LKAA 3KKZA 4H7JA 1HUQA 2G72A 5IC5A 1M1ZA 3UQYS 3F8WA 4JLVA 5UKDA 3CEPB 5K99A 1T8YA 3ANXA 4KYVA 4HYYA 4KITB 3REFA 4PYJA 1QQBA 2QR5A 2O8DB 2BMFA 5EJ8A 3E7XA 4NE2A 4WJLA 2PNFA 2HWYA 1JDNA 4YREA 1R5JA 3HJAA 3K1JA 5B2FA 2PH1A 3CRRA 3WGQA 2OHVA 4PFQA 1NN5A 3NJ4A 4JDUA 2PJUA 3ENQA 4YA6A 3JVDA 1U4NA 4HEQA 1ISPA 4XFKA 1NVFA 3DQPA 1TQDA 4HF7A 4OFWA 2ZBRA 4RMGA 2F1IA 3EZYA 3KAPA 1REQB 4L4YA 5FO0A 3ROFA 4A7PA 5A7FA 5DE3A 3W79A 3WYGA 4RJLA 5CGQB 1U4OA 3TBKA 5E3HA 3NNSA 2LTAA 2FETA 3EXEA 1IAVA 2JEZA 3LXMA 3WY9A 4DDVA 3AL0C 1STOA 2GHQA 4TZKA 1XRSB 3RWOA 4NTZA 3DBRA 4O4JF 2DU8A 4PAOA 3KSUA 5SZKB 3VZCA 1L3CA 3ISJA 1P75A 5DXAA 1MRNA 2W2PA 4GUAA 3IR6A 1HL7A 2E2WA 2WBLC 2X86A 3BE6A 1UP6A 4L3WA 3C0KA 3UA4A 3RSHA 4DDHA 3IP7A 4EOGA 2O5RA 4YO8A 1TJ4A 3VR3D 2BTQA 2WWFA 3OE1A 1NRWA 5BV7A 6PFKA 2ZETA 3UWPA 2R2GA 2AG0A 2AWNA 4ZOQI 4PYOA 3LQ2A 4J91A 1YNOA 5DBHX 5JLAA 1QH0A 5K6RA 1T9ZA 5JNVA 1YIAA 4HB0A 5IDYA 4C08A 5KC8A 2XYQA 2C4WA 4AP6A 5DN6A 4EMBA 1IU9A 3HHPA 5FI0B 1DG9A 3KU4A 3PICA 3RGWS 3SYLA 3EXAA 4PLHA 3BGOS 4HZUB 1ADYA 3EGIA 3ZCPA 3TIIA 1UXJA 2X7XA 4B3JA 4E5KA 5AVYA 5EUCA 1KI2A 1NQOA 4B6EA 4KN5A 5C4MA 3P7MA 2DPGA 1Q7GA 1JA1A 1LPAB 3TLGA 4DRXB 5H83A 3IVAA 4KXMA 1X1QA 3BEOA 5EYPA 1VG0B 1W5BA 2NSHA 3H9UA 1TE2A 3I1IA 1AB5A 3FDZB 2GHIA 4BMNA 5KWSA 1NLUA 2C5SA 3OTQA 3O93A 3O8BA 4YJ3A 3S8MA 1UT5A 5F1KA 2WWWA 4MQUA 3DC2A 4E94A 4ARCA 2GCOA 3KC2A 3JQBA 3A37A 5CDFE 5I5GA 4ZYWA 1PL0A 4CM8A 2AQIA 3TLEA 3ZLJA 2ZI4A 1WB4A 4OGGA 1OIWA 3Q0IA 1EESA 1DELA 2VZEA 1XCPA 4QECA 1A5BB 1ZKMA 3L4JA 4R0MA 2X40A 1O95A 4ZAFA 4HFMA 4LE0A 1SC9A 3ITNA 1QO9A 1MN6A 1VHQA 4O4JA 3JD4A 4JBGA 1P0IA 1PT5A 4V02A 5HNKA 1ZUNB 2WSMA 3HEMA 4H1TA 2FSHA 3BZUA 2WJHA 3GJXC 3T9BA 1UQRA 3AUJB 1CUXA 2GF2A 1GZVA 2FUEA 3A6EA 2RBEA 1EHCA 1ZQ9A 2TYSB 2D74A 4UDXX 3HUUA 5FO1A 4EL0A 1KZ7B 2IS2A 3BXXA 3OQ6A 1HE2A 1JQ3A 2ZROA 2AWOA 2YYAA 3AM4A 3FNRA 2VJKA 4Q3OA 4B5KA 4BXOA 2I4TA 4KPEC 3DOJA 3KYDB 4BLTA 1NR7A 4G0ZA 3ZTTA 2P1RA 5ANRB 3QEOA 1YCFA 5CHYA 3DL2A 5E1DA 3SXUA 1WZIA 1K5PA 1U2EA 3VC1A 4RY8A 2AZMA 4P3NA 1M8KA 1C0IA 1EB8A 1XBTA 2PUWA 4JX8A 3RIYA 1UAAA 4QBGB 3SMVA 1BGWA 2TMGA 3ACDA 1D5WA 3LO5A 1FOEB 3IXLA 2G36A 4KX5A 3VPDA 2XMDA 2AQ8A 4B82A 1GU1A 2OMEA 3BFJA 4AVYA 2IZ5A 4RMHA 4TQUS 2F2TA 3KJNA 2EKBA 1X8LA 4D8WA 1JJAA 3U5TA 5FPTA 1MJ5A 2HA7A 2VO1A 3QIAA 2GVDC 2VK2A 2VNJA 2H4JA 3CZQA 1PZNA 1YWGO 1QKKA 3KELA 2Q8QA 2LNDA 3FDIA 1Q3TA 2OXTA 3SBXA 2XCTB 3WIUA 1Q50A 5CFMA 4AICA 4CKBB 3I2JA 2NUBA 4KQWA 4D41A 3H19A 4MVWA 4UVIA 1K6MA 2HF9A 3RADC 1G9TA 1HT0A 1M83A 4OQQA 3CF4A 5DYNA 2IP4A 2IYPA 4D3FA 4WKGA 4PX2A 4TYMA 1P3DA 4ZYVA 3ZNNA 4KX3A 4MLCA 4MR9A 2CMFA 1FRQA 3CW9A 3NQ41 1IN7A 4DEYA 3FW1A 4GAEA 1OXBB 1UT6A 1I7SB 3MXTA 4FSDA 1SFRA 3VYSB 1TUEA 1POWA 3C3YA 1DVRA 3B3AA 2WF6A 1MP0A 3G2LA 1KPHA 2J9GA 1SQSA 4HVCA 3LNCA 3T4XA 3T7DA 4O1MA 2GDZA 3GJ8A 3LC1O 3MCTA 5EQFA 4WK2B 1X7ZA 2C8JA 5KDDA 3TQHA 5KNLA 2XTJA 1RAGA 3PCTA 2YMMA 4PLWA 2C99A 2P65A 3U62A 4QAJA 4RPIA 1GRRA 2B2XA 5GGXA 5TF4A 2EIXA 2GN4A 4YEDA 2EJCA 3AJDA 2ERYA 2QMZA 3IA2A 3JPWA 4QHTA 3V6MA 4GMGA 2POCA 2EVWX 3JQ9C 3ZOKA 1Z82A 1PFVA 3D6NB 3ZZ1A 2E4UA 3EXHC 1KDTA 1G1AA 4OAQA 4XW2A 1MW8X 2BY4A 1SC1A 5A5EA 2ZYWX 5JATA 4WKOA 4MV5A 4B84A 4JBNA 1GCOA 1NW4A 1OUMA 1L5MA 3B1XA 5AIAA 4RA6B 5KOYA 2B1JA 1YTUA 2CN1A 5JPDA 3GPIA 4JL6A 4L15A 2XCLA 4C3ZA 1A8UA 2JPDA 1BU8A 1S3SA 2XWBF 2Z58A 1IQRA 3E3AA 1HQYE 2JEOA 1UFVA 2OLJA 1QQTA 2ADMA 1KA9H 2F62A 3E9CA 2QW0X 5EQDA 1NBWB 1TGYA 2CVZA 2K5UA 3G9ZA 4OHKA 1LBSA 1NQTA 2ZJ7A 5IX8A 2UVPB 4JLNA 3AIMA 5AW5A 4C43A 2C3UA 2G6BA 3OA2A 1J49A 4J7UA 3JQGB 4UUAA 4F06A 3VNBA 1S2MA 4BQQA 1XT6A 4KH0A 4Y30A 4EB6B 2H2WA 3VPSA 4AB1A 4MDEA 1WMFA 5E4TA 4QXAA 2B0JA 2XNJA 4P32A 3L46A 5D3KA 2BUCA 5H3LA 5CB0A 4NCBA 3EXFB 1HYGA 3EGXB 4IO1A 4C2AA 5AW9A 4EO4A 1JLLA 1M54A 5DULA 5M2QA 4WASA 1J6UA 2R8ZA 3LS2A 1LV7A 1Z35A 2XTNA 3RGGA 5I3CA 4F5ZA 3M5CA 4RTLA 4M36A 2MDTA 3OU6A 4MKRA 1B0PA 2CXPA 3Q8LA 1FP4A 4BEJA 4FZ5A 4A5OA 3ZWAA 4Q7MB 3PTZA 3LX5A 3K5HA 5D51S 2IV7A 3BJZA 1SXJA 1J1IA 4IYRA 1ZIDA 1MTZA 2BJHA 4FHGA 2P3QA 4WLEA 4LBYA 5B6JA 1QV9A 1CG6A 2IW3A 2QW1A 2HXSA 3CX8A 3LLUA 3PYLA 5HF5A 3VVMA 5BV0A 1U0BB 3SMQA 2DHEA 1NULA 3UCXA 1WJGA 2DY0A 4RNDB 4LXYA 3VZQA 2PKEA 4ENQA 3GVIA 4YCCA 3I2KA 3GZNA 1VHDA 4ZMRA 2V7WA 4PIMA 3M33A 4N5MA 1KS9A 1PJLA 4NCHA 4Z0TA 4R2KA 5A3QA 1Z2OX 5DSXA 5ECWA 3HJFA 1RABA 2PSEA 3KUDA 5IBQA 1DQSA 1XRJA 1T2VA 2YRFA 1FX1A 4KVAA 3AKEA 4I9GA 3QMPA 3HWRA 3GARA 3GNSA 4IGKA 4E4YA 2XUOA 4U6QA 1CQZA 1IBRA 5ADVA 3FKSD 3NBMA 4K9NA 2YMPA 4L5AA 3TL2A 5AM2A 1F8UA 1UEIA 5J58A 1NJSA 3VSDA 1MAUA 1UUFA 2Y2UA 1OT3A 4J29A 1FS6A 2WQZA 2VOEA 1MHTA 2XW6A 1UZUA 2XKJE 4QXOA 3M1LA 4B3IA 3IIJA 4YQYA 7REQA 5AJWA 3HV0A 3IGFA 3H5WA 3NTOA 4QQFA 5HPYB 2Q29A 3BMQA 3LCVB 1DV2A 2FLKA 4Q9IA 5KVCA 1FNNA 3B82A 1UJ5A 5H9WA 1PK8A 4FZJA 1N34B 5GPBA 1AMOA 1M67A 3U4GA 4HB3A 3DHYA 3EG9B 3UMYA 1XYYA 3W7AA 4US0R 1UMCB 1VLMA 2NU8A 3UUFA 4CL2A 2FYTA 1EIWA 1XYGA 3ETHA 3LHSA 1CS0B 1IVNA 1BFKA 1HGXA 1ULHA 2WKWA 3B9PA 3UPDA 3DLCA 3FSGD 3ZIAD 5K3EA 4JYPA 5GJBA 2IUSA 3A6PC 4BQEA 9ABPA 3DUFB 4IVNA 5LIRA 1RCFA 4CLDA 4B3XA 3M81A 3S55A 3OIUA 5C80A 2X41A 4AFNA 4H16A 2VT6A 3VPBA 5B53A 2NO4A 1C9EA 1X0XA 1P1BA 2LXNA 3ZV7A 2Z09A 1DBSA 1MOPA 4BGVA 2OHGA 5EMHA 3KTAB 2IFTA 1CF4A 1VKNA 1ORVA 1U2RA 4Q66C 3H1AA 3S29A 5K3CA 2AS0A 3JY6A 4CM1A 1KRWA 2GNAA 1F4PA 1BDHA 3OZAA 1UMBA 4BMVA 2B4YA 4C22A 3HVHA 2P9GA 4CEHB 5CA1B 1IZZA 4BEVA 3EN0A 3C7KA 2HA3A 4FKMA 1W5EA 3GEBA 5FFNA 1THTA 3VC2A 3ED1A 5J47A 4I1PA 4I7EA 1XTVA 1Y8AA 1E3DA 5F78A 5LUBA 4YI5A 3WLIA 3OWOA 4Y1EA 3A9CA 4XUCA 3DDOA 2VDLB 2HPAA 1W581 5D5HA 3LHKA 2GF0A 2ZGVA 3PPWA 1BSVA 3QLVC 2A5FA 4ZT3A 1L7PA 3RRMA 3UJHA 3JXEA 4XQEA 2B4KA 2OENG 2PVSA 3CJQA 2VNAA 3PLRA 5EOVA 2PMDA 1Y9EA 2VJCA 4GQIA 2LDXA 2OECA 4PYQA 1VSVA 4ONEA 4G9BA 1K92A 3A32A 3E1GA 1X87A 2BM9A 1FX0B 2Q4EA 4DC9A 5JJIA 2YVUA 4BVFA 1PT6A 5D3QA 5EXPA 2MT9A 3LM8A 2BZSA 3O4FA 1S0UA 4ITVA 4QOJA 3KL2A 1V8PA 2IXDA 3L7BA 4G36A 1UQUA 4LF5B 3PVZA 4MIKA 4CXMA 1H9CA 4BN5A 4FLMA 3ZE7A 3MTEA 4DTCA 3PNQA 1A4UA 1G8YA 5GOTA 3ZHCA 3JRWA 3CPEA 2FJPA 2IVZA 1K66A 1L7OA 2JAOA 3E9MA 3ZDAA 4MVJM 3TRKA 4OXQA 1OGIA 3MWJA 3OMLA 4LOAA 5BQPA 3UTDA 5KVAA 1MO3A 1XRMA 1GNSA 3U61B 2IS1A 3NWOA 4J90A 3JWPA 5BWCA 5C8ZA 3BULA 2OK7A 2C7OA 4JITA 4Y18A 1RYFA 1YONA 5EHQA 1R0WA 3VR6H 2DYKA 3YASA 5ALNA 1U1EA 2WAMA 3QH4A 4LXHA 3T9AA 1N78A 4BMCA 1YQXA 1E99A 3MTDA 1UANA 4IUDS 3IDSA 4MZDA 4UU0A 4Q3EA 4GX1A 4ZTBA 1NT2A 3N59A 4MVJH 4TTJA 3JWJA 1Y37A 4X1IB 5DI9A 1QP4A 2JG3A 1WIWA 2O2ZA 1TAUA 2FPIA 1LV8A 3LGXA 4Q19A 4UTXA 5EXDA 2HQOA 5FOUA 3KLMX 4WOCA 1JIIA 3GGCA 3ANMA 1PR9A 4X94A 5H59A 3FNQA 1COWD 4FYIA 2R6AA 3PFIA 4GI3A 1B43A 4DNOA 3P32A 1CBUA 3IAS1 2GRJA 3BBLA 3C15C 2J7KA 2P2NA 2VBGA 3H5TA 4FFRA 2WWHA 5D5PA 4R84A 3CGGA 1R10A 1Y81A 2ZK7A 2JLXA 3RBXA 3BOSA 1WEKA 3W78A 1QAQA 1UDXA 3EVFA 1VIAA 1XKQA 2C59A 3OKCA 2VK8A 4R1LA 3N70A 4LQCA 2K4MA 5G4KB 4C6TB 3AVTA 4DLAA 2XVYA 1KH1A 4CF5A 1VA4A 3EC7A 1GWNA 3PQ7A 4HXGA 3K3PA 1AUXA 2AF4C 4JHXA 3R8FA 1E7MA 4GR5A 4TRNA 5I9TA 1VBFA 4ATNA 1WF6A 4RH0A 3VOBA 1Y82A 4CI9A 1K8ZB 2BGNA 4QLBA 4G0UA 1PGNA 3IKVA 1R0ZA 3ICEA 4UDOA 1DX6A 1XJCA 5H70A 5HZKA 3S4YA 2HCTA 1AUOA 3KOMA 1JB9A 4EJSB 1KEWA 3GEPA 2ALJA 1UP7A 4HL6A 1X92A 4RVCA 5K6AA 3PVSA 1L4GA 2YH2A 3QXJA 4HZGA 1Q0RA 1RE0A 1I3KA 2PQMA 1YFLA 3VNVA 4YDHB 1PX2A 1ISGA 2BKAA 1G6Q1 2PM8A 4IHAA 3V7YA 1XTQA 5G02A 4TWIA 4DWOA 1S2GA 5AESA 3OJOA 1A9QA 4TROA 1S2LA 2F6RA 3R6DA 4HLUC 2HQSA 1OKKA 2I78A 3C8ZA 4NBLA 2IPOA 5FPYA 5JRZA 2PS0A 2AB0A 2FHPA 3WGJA 4WBNA 3TFOA 3UBTA 2Z4RA 4IGEA 2HBRA 4Q39A 3L6EA 4PZUA 2GQ0A 1D3AA 4OB6A 4RZSA 5CB4B 2QLLA 2WKRA 5DIZA 5M5BA 3EGVA 4M46A 1FIUA 4MA4A 4EBBA 2G71A 4FT4A 4CUZA 1XMPA 3SQNA 4AS3A 1FUEA 4MIOA 2O4UX 3K9NA 4OQDA 3MAJA 4NZNA 4R7TA 4TSFA 1ZAYA 2DSNA 2IXGA 1WBJB 1E1MA 1MJGA 1Q1GA 1RW4A 1ZJ4A 5ALEA 1G21B 5F98A 5AJHA 1Z8HA 5J40A 4ZCTA 3C6ZA 3GQBA 4EI8A 4IMJB 2CLMB 2B69A 4I99A 5CVDA 1ELOA 2IEDA 3GDFA 3MVEA 1DS6A 2V98A 4FYPA 3JQAB 3NT5A 2WF5A 2FSGA 1W4RA 3GH1A 3IHTA 2IBMA 4N7BA 2BTOA 5E0OA 2O7QA 3GY0A 4DADA 1W49A 5T4BA 1MOSA 1QCYA 3I9V6 2FW7A 5C7LO 5IHPA 2PJDA 2FG6C 3RR2A 2R7LA 1JG6A 3CUWA 1FVHA 4X41A 1G8AA 3TR5A 4YJHA 1P4AA 5JNTA 3EY9A 4PO9A 1WSBA 1WLSA 1WPQA 3HJNA 1R12A 5AJXA 2A0UA 4H1HA 2VOJA 3WLTA 3NTUA 1ZMTA 1E1YA 4Y2JA 4HTAA 1H0RA 4UATA 4O2AF 5F3WB 4ND2A 2BFOA 4DUGA 2Y1DA 3VNSA 1RWWA 4LIPD 4QREA 3G6KA 3KB6A 1H4SA 2HY7A 4R98A 2A14A 3R5XA 4XQGA 4RANA 3IPLA 4HQOA 3FUUA 3N7TA 2PRIA 3OT1B 4PONA 1FL9A 1E1KA 3BERA 3OX1A 5EFZA 3WOVA 4B3FX 5B6IA 4HC4A 1HZJA 3EMBA 2YN2A 3IEIA 3N6XA 5EVCA 3ZTWA 3D4NA 4D82A 4DT1B 5C8VA 3E2PA 4CDMA 3KG2A 2GO1A 2VHUA 1KIAA 1Z6XA 4TTVA 3G0CA 2CCJA 2QD3A 4PR0A 2ZOSA 1JUDA 5DBIA 5DWDA 5E7JA 3SI7A 4AYWA 5J4YA 3IOEA 1WDKA 2BFFB 1NVVQ 1SK8A 3J81k 2ZANA 1P1FA 4N3BA 1HNWB 3CY6A 1JMVA 1Z56C 2WPDD 4IFIA 4KIGA 1BE6A 1E3WB 1ZDMA 1I2CA 2MYNA 3KZVA 3OIYA 3G9XA 1JQAA 3DP7A 1HDOA 1B6RA 1P0CA 1TTQB 2BFCB 3L07A 4WZBB 3TH5A 1HMPA 2WMNB 5FA8A 3VJLA 1N5IA 3X1DA 3UB4A 4AX8A 1TLFA 4BZWA 4C1NA 4DQDA 2O06A 3KB8A 3G2JA 4DQ0A 3U6BA 1SQ6A 5HMMA 1EM8B 3LCJA 1TTHA 3AHCA 4HNRA 1JDBB 1CD5A 4Q05A 4NJMA 2VXYA 2WHPA 4UMEA 1NXTA 4OFZA 2ZXUA 1AV6A 1YZTA 2F8MA 3IERA 4EGQA 3RVJA 2G0AA 1T15A 1T6BY 3HDGA 4WINA 4F9TA 2BMEA 2VP0A 2I0FA 2D2VA 3A6FA 4K9MA 4NMLA 2G83A 1Z12A 1UDBA 3PC4A 4Q01A 3T3DA 1D07A 2WTXA 1NW8A 1RQLA 4S2UA 4PCVA 1YC5A 1MA0A 4WN9A 1LPNA 1WBDA 4N5DA 3ZWPA 4QBKA 1JSCA 3RHSA 1XEWX 5FL7D 2C3OA 4ZCSA 1U3DA 2C82A 4F21A 1NZDA 2XCQA 1V11B 2B4RO 2IQIA 3WX0A 4DUYB 4M37A 3TOZA 1E2HA 4H3KB 2NO9A 3UH1A 5BV2P 2G7ZA 2XNHA 2HQ1A 2Y1WA 3NHWA 2DPHA 3KLBA 4DEXA 1ORTA 2GLUA 4P0QB 3VRHA 1H6DA 1GO2A 3KHUA 2ZTVA 2QTFA 3EBLA 3AH8A 4ER6A 1NQUA 1OR8A 4OATA 1XA4A 3PL1A 3QKRB 4M9QA 1LLDA 2NADA 3QUSA 5B3JC 1SZCA 4DLRA 4HLNA 4RA9A 3MGBA 4M2LA 2X2OA 5EERA 1L5HA 4ACAA 4BP3A 4DQXA 4HMPA 2QGNA 3JTEA 1AS0A 1JAHA 3MINA 1J07A 4FJ1A 3HM2A 4RD3A 4XWAA 4TXLA 4E7PA 5IEJA 1CRZA 1ZC3A 4AKHA 3N75A 2BF7A 2LZ0A 4RWZA 3F5DA 4QTXA 3KYBA 3HKCB 4Y67A 1J99A 1Z26A 3EOBI 3GYBA 3TKYA 1NVWQ 3LT5A 3NTQA 1FDOA 1ZM3A 4Z8YA 4AO7A 1H5UA 2AC2A 2C7GA 1HYHA 1W36C 1OZAA 4AZTA 4J76A 3OLXA 5IVPA 4JP2A 1NNLA 1KP2A 2RJOA 2W5UA 3A6HA 4TMZA 3JD2A 3CVUA 2XXBA 2Z6UA 5HOEA 3IB3A 4BQOA 4DQVA 1U5BB 5DW0A 3VO1A 4JODA 5SYNA 4D97A 3F3SA 2VHWA 3ELUA 1WE2A 3W2IA 3TB4A 2KLHA 4AZ0B 4NJEA 2E5FA 1PFYA 2I2XB 2LDBA 1X13A 4NAVA 4OI4A 3V4PB 4WH0A 5INTA 4MVJE 5KOJB 3UFXA 1JDTA 2I6XA 5AW1A 2DBVO 3ZWWA 3PD0A 2QG9A 1JYSA 4FTWA 5KDLA 1DKMA 2QQEA 4CIYA 1PJBA 3G88A 4EUFA 4OAPA 2OOKA 4IH4A 3OTHA 4KB5A 3IDFA 1W59A 2SHKA 3RK0A 5BSKA 3DMYA 1MOZA 3ORHA 2QL5A 3DZJA 2IYLD 1L8XA 1O3YA 1YZGA 3P2EA 3QHAA 4QSHA 4UM8B 2QAGA 2ZT6A 5C8YB 4MPRA 2UXCB 3GPDG 4IM7A 2J3IA 3GJ6A 1R0SA 1X7YB 4RD0A 3MZ0A 3GJ7A 2YX1A 4AX4A 2RHBA 3WL3A 4PX5A 5J2UA 3TNLA 3ZUPA 5JAOA 5KWEA 3ECCA 5DTMA 3RC7A 3T7KA 1RQXA 5ALHA 4C7OA 4WZAB 2O3UA 1H4VB 2FZWA 2REOA 1DIHA 4PN7A 1WQ1R 3D81A 4O33A 1L4LA 5HF8A 1DJQA 1XPOA 5FNVB 2O1EA 1JYFA 2WUWE 3JQEA 3UAGA 4MDHA 3ZZTA 1E9RA 2AOWA 3FVRA 4F3RA 2RKWA 1GPJA 2DH5A 3GNTA 1IG0A 3H18A 2ECOA 1NV8A 2OHHA 2WD9A 3BRWA 4PSVA 4V0OA 4ITRC 4L9RA 5FHRA 1WMEA 5FYQA 4ZVOA 1LI4A 1TF7A 2QYTA 4ZQGA 3V97A 2Q45A 3HHEA 3ICPA 3VYWA 4GZMA 4UREA 1YRHA 1CE8B 4CM5A 4XIGS 2LV8A 4FR2A 3P19A 3ER8A 1EQAA 1M6EX 1NIPA 4CEIB 5K8VA 1FQJA 1W52X 1M34B 2B9EA 1NSTA 4Q16A 5MDHA 5GIPE 4N49A 3K6SA 2JJMA 2ILVA 3V8RA 1N1DA 4CCYB 3FVTA 4P4SB 3WISA 1XI2A 5JCPA 1ULAA 2V5AA 4TTPA 4WGGA 3SZRA 3B1WA 3B9QA 2R1TA 3U9TA 5EIWA 3HJTA 4O2BF 1E2JA 4KG7A 3TLYA 3ZS8A 1PHRA 4LZNA 2QIOA 3UV6A 1L4BA 4C4ZA 3S7ZA 4AWAA 4CMBA 1Z2PX 2CXTA 4G1VA 1YVPA 3PHCA 4YMGA 3U4MA 1U3FA 5DX1A 1E6UA 3NIWA 3UV3A 5H5JA 2C7QA 3FSJX 5ALZA 3FWPA 4NBVA 1NUAA 3ROMA 1M8GA 4I6JA 5THQA 4FYVA 4MCAA 3T7IA 3MLAA 1M6VA 1NC3A 4JVSB 1EVKA 1WU7A 4R2JA 3LCCA 5IJAA 1EFAA 1OLXB 3K72B 2A4MA 3SFZA 4RADA 5E6RA 1CY8A 1SUDA 4A0RA 3CZPA 2JFWA 2WVJA 2BJVA 4EY5A 1XLTA 3K0FA 1ECPA 1YQDA 2HTEA 4HAXA 2B2CA 3HCRA 2Q46A 1SHZA 3HA5A 3CN7A 4GI7A 4RFVA 1OXVA 1T4BA 1TDJA 5AK0A 4HZIA 2JGRA 1A4RA 2JH8A 3OP4A 2J4FA 1XP5A 4O02B 4ZCIA 5JRDS 1YB2A 4Z3DA 3PC8A 2D06A 3LPMA 2WK1A 3IKMB 4FD3A 3EHDA 4MX8A 1O54A 2ZEJA 2H2GA 3DE4X 3FWYA 4TWJA 5D01A 1KZHA 2L42A 3PD1A 1XDBA 3ESXA 3RVSA 5A1TA 1U3CA 3A3YA 4KO2S 2UUOA 1XAGA 3JWEA 2CJYA 2IXAA 4P83A 3M3PA 4P54A 3DV0A 3LRXA 2Z5VA 1U1DA 4D3YA 1MVNA 3I0NA 3T0FA 3PGXA 1IHDA 4FCVA 1BFDA 3Q5GA 1YI8A 5DIFA 3OE5A 1L7EA 3SJZA 4J9VA 3VOTA 2C88A 2Z08A 2ZRMA 2RK4A 3NKVA 1R50A 2ZJOA 1U2QA 1BN7A 1GPBA 1WXIA 2R8PA 1FFBA 2DH6A 2V1XA 3Q88A 5AVZA 3ZGZA 3P0JA 4LX8A 3RD5A 3QVGA 1ZL0A 3R7BA 1GY8A 1D09A 1I36A 1D0VA 3CU5A 3DA8A 4IX9A 2Q5JA 5PNTA 3P2YA 3Q9NA 1QGOA 1ZJYA 1JSLA 2ZJ1A 4TUYF 3ZDQA 1JG4A 3EF1A 5IN4A 1V71A 4M3NA 4ARAA 3UWSA 4KFCA 1GRCA 4UBIA 3QOXA 3K5WA 1C7JA 2HGZA 1AURA 1PG2A 4P86A 4M1WA 1RXCA 2P2GA 1PWHA 3EXEB 3BCHA 1IEWA 4NJOA 4Q18A 3SSOA 3TZQA 4CM3A 2E7ZA 3IPYA 4WXMA 3JRNA 4EA7A 3RT9A 1AF4A 3DBRB 3R7NA 4WEQA 3AK4A 1ID1A 5FUXA 2WHEA 2KBFA 2OZLA 3EYAA 3OBBA 4N6OA 4PAMA 3F3MA 3USCS 4BJ5A 4DJEC 3INYA 4CR6A 5EIXA 3L49A 1KBQA 3QA3E 5EPUA 1TT5A 3AKYA 2W58A 4ZK6A 1QTRA 3WTCA 4AMYA 3U7IA 1HFEL 2W2LA 2YHBA 5HJ7A 1USKA 3CLTC 4XVHA 4DDWA 2FOLA 2BTQB 3AQ4A 4HRVA 3WRVA 4BFCA 3MMZA 1RADA 2ZBEA 1KXJA 2VHYA 1ZHHA 3LE8A 3QWBA 2DBRA 3GFBA 3TSCA 4RHFA 4RNCA 4CLEA 5AW7A 3K9FC 1NYLA 2R62A 4BDSA 2HBQA 3DEZA 4A16A 4DZTA 3KR0A 1PLLA 2Z3ZA 1RSZA 4TXNA 1PG5A 1VM6A 1C5KA 4L0CA 4NECA 2C7RA 1XKTA 3LVRE 1EFTA 4P22A 2OGWA 1Y5MA 3L0CA 1SCIA 4D9GA 4NCXA 4EIWA 5EA2A 1JR3D 1ORWA 2IEAA 2XE7A 4MINA 2ZATA 2QWXA 2ZBQA 1DIGA 4KGXA 4S1NA 4WUTA 3W8DA 1O1YA 1GU7A 1OOEA 1THMA 3ENKA 4JSYA 3RVLA 4B2PA 2IYXA 1DG1G 1ICEA 1EE9A 2JVKA 1DWUA 2A7QA 3QEAZ 3UPTA 2C9ZA 3N8NA 4PC6A 3TLGB 3L1UA 4HB4A 5IJZA 4JJAA 2GAJA 1E6EA 4OB8A 5EYPB 2C4TA 3AR6A 2QTAA 1R5NA 2G6TA 3NXKA 2JGMA 1RJ9A 2I4LA 4LQLA 1I6KA 1LQTA 1H66A 1PQ4A 2OHIA 1UH5A 1DUIA 1ZGGA 2WTMA 1JSRA 1YVUA 4YJ3B 4U2KA 4EKEA 1FDIA 2ONYA 2PX8A 1NMZA 3G2NA 1RD4A 3D8SA 3OZUA 4KXYA 3HVUA 3TVTA 3BL6A 2GCOB 2BCJQ 4G5YA 1JR6A 1A5ZA 1M2HA 2VYQA 3LY8A 3U4IA 4HDMA 4RQTA 2QMQA 4CM8B 2YYSA 2P30A 4GI2A 2PR2A 3MTBA 4P80A 2YJ3A 1P0MA 1ZH0A 3AX6A 2WTNA 3GG2A 4NYJR 2OC9A 4QSMA 5AHXA 4EPYA 1NPYA 3LQYA 2PU5A 3R5JA 5HUJA 4UEJA 1VSBA 3HFSA 5KTPA 3LY9A 5LFAA 4TL8A 2JH9A 3F5MA 4O4JB 9GPBA 3MYYA 4MGZR 1C7IA 2CVHA 1U8CB 1SIWA 4NY1A 4YJFA 3FPAA 1QZXA 3LC7O 1RJFA 3ZZUA 5IBRA 1QSGA 1VXRA 1Z4LA 3NEAA 2O3RA 3PRYA 1I7DA 1TCBA 2Y9PB 1EWQA 1DXOA 4AM8A 1X38A 3VVCA 1KI6A 3PXGA 4FLFA 4QD3A 3UJ8A 1HORA 3FPFA 2AI3A 3QF4A 2D5AA 4D9JA 4J1NA 3TR6A 3B3QA 1PDOA 1IJFA 4LG1A 1P2UA 1UR5A 2C5BA 3UK2A 4BXOB 3TIXB 4TLLB 2BMAA 3U26A 2YY7A 3UGJA 2DWUA 1KH3A 1HTTA 3IJRA 1VPEA 4DSUA 3SXUB 5H9VA 1JTVA 2R25B 1NW9B 3GHHA 1C80A 1N9GB 3IKLA 4IMPA 1H23A 1EMDA 4Q48A 1D4ZA 4HXFB 1MC5A 5I01A 5J4LA 1SHUX 2W0SA 1P6XA 1Z37A 3WJ7A 1V7PC 1P2GA 1TMYA 2O0KA 1I30A 1TYAE 4G2NA 2H2HA 4UPDA 1NT4A 2AUNA 1YGPA 1GAQA 4ABYA 1I8TA 5SY9A 1E5TA 2OCIA 3WK8A 4B76A 3D1LA 1RXIA 1JBEA 1NE2A 3G8AA 5L3ZA 1FK8A 4JX9A 4DCVA 1R4MA 3C43A 1ZICA 2C5AA 1HQDA 2VPQA 2X6RA 3C5CA 4PSCA 4X1KB 1SKUA 1DRWA 1SD5A 3IS3A 2QM0A 4IQ0A 3AL2A 1QFSA 1WWKA 5TMDA 3SC6A 3MEQA 4RD1A 2BH2A 2VJQA 4EY4A 4MWCA 1VMDA 3D0OA 4C0JA 1SIUA 2II6A 5C5EA 4R3WA 4M0FA 4GM1A 4F97A 1HBJA 1TUGA 1RAAA 3MK31 2ZTSA 2AT1A 1J42A 4MR9B 1P45A 4QYWA 2Z9CA 1JHMA 3HJBA 1LJ8A 2AKYA 4Y9SA 4EYGA 2AFIB 2R87A 3IELA 3LOUA 4O6VA 4PSKA 1U9JA 5AK3A 1DNPA 4JKOA 3GEIA 1B8OA 4X85A 4LVCA 3WIEA 2VSNA 4CVNA 2XB9A 1GQYA 1M2GA 3RVBA 2I2BA 4Z6KA 1KR2A 4MUKA 3QKSA 4DQKA 3DD1A 1QIGA 2X3UA 4EZBA 4QFCA 1UK8A 2QMUA 2WC1A 3JQPA 2YASA 1RU3A 2VT7A 2AIRA 3WGVA 4ZKEA 4ZHQF 5FX2A 2GKOA 1YRAA 2FEXA 2ZRLA 3W5SA 5F5XA 3UICA 5KPJA 4LGYA 4QASA 1FUYB 1QHXA 1GKIA 3O2JA 3OLYA 3J81A 4YAJA 2NO7A 4LTMA 2M1XA 3I92A 2E4WA 3NHRA 2Z6AA 1G291 4LYFA 2JAUA 4LUCA 2O6HA 5CB8A 4QVGA 2WM8A 1RHRA 4BVGA 4DKXA 1WMAA 5BOVA 3VDRA 4AJEA 3UMSA 4NHEA 3AFGA 2IH4A 1OFIA 2R00C 3AVXA 1GAXA 2ZUEA 5AW3A 1YFZA 1C29B 3VGPA 4NSNA 3IXQA 2GAIA 2QRNA 4XGNA 3B1VA 3H04A 3I32A 4LRYA 4P4UA 1WS6A 3R2JA 3WNBA 3Q7TA 4NBNA 1TO1E 5H81A 4X7RA 4MJLA 4EFLA 3UG7A 3UW3A 3WKCA 3O4GA 5HM8A 4DMLA 2P6OA 1BGVA 4D9NA 1F3OA 4JT8A 2C9MA 4OHOA 5FF9A 2WWXA 3G0GA 3FGNA 3QY9A 4BX2A 3THRA 3EW7A 2AD1A 2OCPA 1Z83A 2DM6A 2C2YA 2G3YA 1H1LA 2C7PA 1IDN1 4JA2A 4B81A 5LUAA 4X97A 5ECYA 1R6TA 3TKLA 4MVCA 5LA6F 5MN5A 1DCMA 3FRJA 4L4UA 5G0WA 3TFWA 4AIIA 1JPJA 4LFBB 3PJDA 4ND1A 3QEJA 1GZHB 4MCIA 2AMYA 4MYRA 1Y1LA 3KKPA 3B6KA 3OTIA 1P7YA 2C57A 3SYKA 4YUVA 4Z4IA 4XWWA 1NN1A 2WU0A 4MV3A 3CLSC 5FPQA 2AR0A 1EJ2A 1TUIA 2BGUA 3P0RA 4UEWA 4NENB 4YMWA 4E30A 2VDUE 1U80A 1YNSA 2O2HA 2V6JA 4DDTA 4RCYA 1X3SA 1OI4A 2XCSB 4O59O 5K8LA 1FP4B 1LJLA 3LG2A 4MI6A 4B8WA 4FFVA 4CUJA 2ZXEA 2ZBVA 1PNOA 4ETIA 1UPCA 3M7IA 1SXJB 2NXJA 3A4VA 2YUTA 5EZSA 2IZOA 4JI3B 5G4LA 1LLQA 4ZHQA 5IPFA 2OESA 2PJZA 1I4WA 3CUYA 2KQUA 4L50A 2NIPA 3B13B 3IQFA 3LK6A 3QPDA 4RK5A 3DR5A 4L8LA 2PV7A 2QUAA 2WD7A 2BGIA 4F60A 3HL4A 4PLYA 5JARA 3F6SA 3DCYA 1Y1RA 4PGGA 2GYYA 2VCEA 3GK3A 3GZNB 3NH9A 4PHTA 5M3BA 1NQVA 3ELDA 4EELA 4KMSA 4I3FA 5HOQA 3ECAA 1U98A 3MRSA 1MAWA 3F47A 3KR9A 3LUKA 2X7HA 1U0FA 1V5FA 4WTOA 1XLUA 5EJ2A 4QEZA 3JQ9A 3NCHA 3CT4A 1P62B 3EXHA 1U3WA 1JEEA 3EGDB 3F98A 2R60A 4X7BA 4P35A 3IOMA 4LXTA 3GMTA 2R4TA 3PQ3A 4V1CI 3T3HA 5IF3A 4OO3A 1FSSA 5D87A 1QC5A 3KYCA 3UAWA 5B55A 1ZY2A 1TAHA 1NJ2A 2O0HA 1DHTA 2WA1A 2JVIA 1XDUA 2ZRHA 2C5GA 4QDZA 4TT3A 8ABPA 1SO8A 1M2KA 1YT5A 4ES6A 4UVGA 3QUTA 1RHKA 2XMZA 1C9YA 4GYWA 3ZDYB 7REQB 1KI4A 1JFVA 1L5FA 4ID9A 3H5RA 2PUTA 1DAKA 2YZMA 4BV3A 3MWKA 3BD8A 3BMQB 3OZ7A 5KCMA 5LA6A 1IH8A 2JGDA 4EEZA 4QG3A 4H7IA 4S1TA 4AN4A 2J9RA 2QGFA 3EY4A 2IT1A 3LT4A 3NEPX 2V6BA 1NJFA 1IIRA 1X1AA 4OSOA 1CUGA 3CLRD 3N3BC 3EOZA 2BGGA 2DFTA 2EYQA 3OQJA 4NG5A 4PZDA 1EFPA 4D0RA 1EQUA 2NU8B 1U0OC 3M1IA 4V38A 1ZBQA 2PUFA 1PDVA 3QE0A 4HJXA 4JWTA 2VAPA 4B31A 5G0TA 2JCVA 5HM6A 3CBGA 1KDVA 1Q22A 1DE0A 3LQRA 4ZHSA 1AOXA 1G5QA 3C7AA 4Q03A 1SU7A 3FPSA 4ZEWA 1KSGA 4ANFA 5GGYA 5JWRA 3BGWA 1ECLA 2IOFA 4DLTA 2O8FA 2DAPA 2I3ZA 5KMGA 5AHOA 3HRIA 4C6RA 1HOTA 2Q4TA 3ON5A 2VNIA 1VFNA 1NUHA 3L84A 2DULA 3A8TA 4CI0B 3OF3A 3HQ4O 4I4IA 3DGFC 3EGOA 4ECAA 5D7BA 5EINA 4JOQA 3M5PA 4HX5A 5JS2A 1T0BA 4CMAA 3FWZA 1P6UA 1UMBB 1X94A 3HN7A 1UK9A 5LIPA 1AHIA 4A36A 3GRAA 2BKLA 3IPXA 4MKHA 5HX7A 3EZ6A 3FPKA 4ZDIA 4BATA 1J25A 4A26A 3K20A 2EKLA 2Y0PA 2C2ZA 1XMOB 2Y1EA 3MPUA 1TJPB 1FFCA 2XWQA 1KDYA 4GPZA 2GEBA 5F5LA 4B47A 5AJUA 1CB7A 1XPRA 3H7IA 3QTBA 2OV3A 3GVPA 3U3DA 5LZ9A 1EK1A 5U9CA 3ILYA 1RYMA 2I3DA 1QRUA 4FIDA 2EYUA 2ZRBA 5A02A 3EAFA 1B3BA 2MSWA 3EULA 2AR7A 1PEYA 3HP1A 3P2JA 5MGNA 1CRPA 2NQ2C 5ALFA 1KJNA 1ZK4A 1U0NA 3FCEA 2ES4A 3IQDB 3PGKA 1YGYA 3BFXA 5EUMA 1UBFA 3UT5A 4KAAA 3OQOA 3QE9Y 3PJGA 1FDSA 2VJPA 1CY6A 1JECA 3G7NA 3M6VA 4PFJA 3S70A 3ZDZB 4TKVA 3AEYA 1HRDA 1QGED 2YV2A 1H2HA 2AQHA 5CVEA 1R3UA 2YWRA 3I6QA 3WLHA 2NXNA 2PL1A 2TS1A 1UBEA 2VYFA 3OPMA 4B6PA 1KMHA 2I2DA 2VP2A 1DG3A 2I29A 4OVKA 1QE3A 2JRLA 3V3TA 1ZLXA 2OTCA 2QD2A 4R1QA 1WDTA 1ZUHA 3O26A 4FEAA 2ORED 4A91A 1PQPA 3K30A 4MR8A 3GLFA 1FFDA 4IIXA 4LJ9A 4BKQA 5JROA 2GX6A 1KS2A 4FFBA 3WGUA 1ZGZA 4X5OA 1HDZA 4RKWA 3LL7A 4O29A 5DK6A 1LTQA 2BGLA 2D1SA 1ZGBA 2VI5A 3F78A 4ISCA 3QTLA 2IZ0A 2QTTA 2GN8A 3BHIA 4S1VA 2HJHA 5EZYF 1G16A 1I7NA 1T1IA 3IVCA 5SZJA 1PK9A 4US2R 1VA5A 3T1HB 2CF5A 3I30X 1TFUA 3DMTC 3GLHE 1PNTA 2Z6VA 1ZR4A 4BJ3A 5L7WA 2AVNA 1A9PA 2AOTA 1GZ4A 2FPIB 3M6FA 3RFVA 2OHOA 2CSXA 1AGRA 5JR3A 3K70C 3LDAA 4KLZA 2ZSBA 3W8RA 2Z4SA 3OLZA 4JS0A 4GDMA 4B3CA 1A8IA 1U1CA 3PFFA 2HSJA 2H7XA 5D2CA 3FVQA 3OPVA 2Q99A 4B3BA 1XA3A 4KEAA 3KOYA 4N18A 3RPEA 2HCFA 3COWA 4JR1A 3GLTA 4LGVA 4JI0B 3HXTA 1H8HA 1H65A 2YXEA 1MB4A 4KE9A 1THZA 4PLVA 5DTEA 5F9MA 2EFEB 4RVOA 3H9QA 3OJFA 4WOPA 3NPMA 5JZ9A 4MV0A 5FTLA 1PZGA 3FYUC 3B3FA 2ZR9A 3FH0A 2NZ8A 3JD0A 3B1JA 1XXHA 3VPXA 1S5PA 2DG2A 1KZ6A 1U3UA 3AILA 2OV6A 3N2YA 3ZHYA 2D4AA 1XZBA 3QPAA 4RWEA 4HMOA 3KT8A 1W76A 3IPCA 4K88A 3ADBA 4GKJB 4MKFA 1XVLA 2FSSA 4NP6A 4UM9D 3VFDA 5JBIA 3QLVA 2YXLA 1GLVA 3CUEF 1DJLA 2R8XA 1KF0A 1XELA 1CY2A 2BVNA 2EFJA 2WT9A 1ZVMA 2WAYA 1KYQA 3Q6NA 4I0WB 4LWPA 3KQKA 1UPTA 2FPPA 1W8DA 4KHZA 4ROSA 4X3OA 1B6GA 2ZCVA 4OMCA 1EWRA 2R8BA 1UXHA 2ENUA 4E15A 3B5IA 3P9SA 1QRAA 1CEEA 4GMHA 1WKVA 4B4UA 2GRUA 3L1VA 4Q9JA 3OUUA 1RWVA 1U81A 4HDKA 4RQUA 2O59A 3ZNQA 2LKDA 1QPZA 5KNCH 1D1SA 4KRFA 4YRNA 4E6PA 4PHHA 1MR3F 2FMFA 1TJNA 2PNJA 1E9FA 1NXOA 1PS8A 5EZYA 1YIDA 2YVLA 4P34A 4AG5A 1BYIA 5HG0A 1U2ZA 2QG4A 4X7MA 1Q14A 1FZQA 1N0IA 4X20A 3UK6A 5JD6A 4D7AA 5BMVF 1QRSA 4XWOA 1NR5A 2WIDA 2D5BA 3DEJA 3LOQA 3I39X 1YXMA 5FH9A 3M6IA 1X1TA 4HDSA 1YJBA 1JHOA 5KKAA 2WJ6A 1HDXA 3PRKE 2AX3A 2SICE 3QX7A 1QIFA 2WYHA 1E59A 1XZEA 3ZQ4A 2PA3A 3GF4A 3ITKA 2OXCA 4IR7A 3UJPA 1L4FA 3CFYA 1IRXA 4CM4A 4W4TA 1OC4A 4WKBA 4KPFC 3F96A 1LSOA 1Y33E 2ZFUA 2NO0A 2P9HA 3H0EA 1T2DA 3L1KA 4FD2A 4OBWA 4TMFA 4KO4S 1Y6RA 2DMRA 4S1OA 4YXWD 1S96A 1VECA 3GQBB 3ZDBA 3UMJA 2V6IA 2XUQA 1ECJA 1XEXB 5JXWA 4LXQA 4OM7A 4XWTA 3R1IA 1CNEA 1RWKA 2HF7A 4MS3A 5CG1A 3K2QA 2BELA 3MIZA 5EL0A 4FR5A 4RD4A 5AJTA 1YA6A 4B85A 2IYVA 3RCBA 2Q5CA 2JJ1D 3SK0A 4EF6A 3TNYA 1MG0A 2YZ2A 2GJ9A 3AXTA 2Z2JA 5CR9A 4MA5A 1O5IA 5CIWA 4L4ZA 2B20A 3IUNA 2BI4A 5JI3E 4YJHB 1QYRA 1DBRA 2O2GA 1JHPA 2H4FA 1VE1A 3VPAA 4H17A 3NRJA 5AHRA 1LI5A 3JZIA 2GERA 3R9XA 4R69A 2AN9A 1NRIA 2OQ2A 2O8NA 5A4KA 1USIA 1EXVA 3N2NA 5CLHA 4II3A 2XEXA 2JLUA 4MAFA 2ACVA 4HYTA 4LV5B 4TL9A 5HRCA 4BX3A 3ILVA 5KTTA 3PG5A 4FYYA 3DE2X 2ZRDA 4WNCA 2JBWA 1QAOA 3GMIA 1NJ8A 2NZXA 4ZDWA 1RI3A 4HH1A 3TTUA 4NYMQ 1U02A 4BNLA 3KQNA 1N5RA 2FMHA 2OUKA 2XNDD 1IZ9A 1UODA 2PAFA 2Z4TA 2IPXA 3D0QA 2DUJA 2GT1A 3T0GA 1OZFA 3RO7A 5JUWA 3WK5A 4JL5A 4M9SA 4B8ZA 3LT1A 2FRXA 2GVZC 4H0NA 3F6EX 4IWYA 1DZIA 3DEYX 3GLSA 2HB6A 4DMHA 5KTNA 4R51A 2CHUA 2FW1A 1V3UA 4M7WA 5CDUA 2PGOA 1SOAA 4KFSA 2PN1A 3AHFA 4QUJA 3LKDA 3VBEA 3VGJA 5KSOA 1KE1A 2IVFA 3FB4A 2I6FA 4DIKA 1WP9A 1AO0A 2FX3A 4FGLA 4HLUA 4X6YA 3B38A 4G3XA 4N0PA 1KE2A 3ZQUA 3ID6C 4M89A 4MCJA 4R2HA 1UBJS 1YBVA 2JK1A 2O50A 4X9XA 2ZSAA 4Y6QA 5DCLA 3RJTA 3RTGA 4EHBA 2G9VA 2OFPA 1V37A 4F38A 5AKIA 3L6RA 5L53A 3KLPX 1F2TA 1OPRA 2GXSA 2XAAA 2OFWA 3IEXA 4OJYA 4M9ZA 5TJHA 4NJMB 1PL7A 2AJTA 4DLYA 2WHPB 4EL5A 4GMFA 4WKCA 4TMVA 4F6CA 4JD5A 1K63A 3D5QA 3WDLA 3RYCB 1OU4A 2P5UA 2FMTA 2JKZA 2KLBA 4M1EA 1RM5A 1QDLB 2PL5A 2XH8A 2RGEA 2W70A 1JZQA 3FUCA 3O5AA 3GVCA 2A1TS 3CVOA 4N03A 5EY5B 2ADOA 3HYLA 1BMTA 3D7RA 1DFIA 3QJGA 4HP8A 4RV9A 3IUPA 4K1LA 1GPAA 1QZUA 2O1WA 2ZYIA 3O0TA 4M76B 3UANA 1OZGA 1E3EA 1XDZA 2C58A 4Q6WA 2VYVD 4BNMA 1PV2A 2OCYC 1YB4A 5BW5A 1BC5A 1YR8A 2CKMA 2JCXA 5GVRA 4LTNA 1E1CB 3U3RA 4QTYA 4O2AB 4TQ9A 2ZPUA 5FPPA 3SYRA 2VH5R 4MMYB 3P2KA 3V8MA 1ZM4A 4IDNA 3WHIA 4IRUB 4D81A 5L95A 4JC5A 3U4CA 4RA9B 2VF2A 1L5HB 5C52B 2EHDA 4QZVA 3VZBA 3BAZA 3V7NA 2YYYA 3UJ3X 1YOVA 3VU0A 3K0EA 4MI9A 2PUHA 3X1ZA 1CJSA 4A3SA 1GL9B 1X14A 2HYIC 1E2MA 3EEBA 4RQAA 3SHOA 3DDSA 4C9BA 5BR1A 1O4VA 4FWTA 5ALYA 4CT5A 3ZG6A 1OJLA 1P3JA 4JB3A 2CLHB 4I3GA 3WAJA 1VYUA 1Z0UA 1Z22A 1BHO1 4CYMA 3V32A 1J5PA 3CPJB 2JCBA 4EY6A 1HG0A 1JG1A 1LPPA 2A94A 3GJ4A 3IMKA 3OCJA 3TNJA 3UB3A 4DIDA 5KCZA 4NG4A 1EIZA 5THXA 1MLDA 2FZVA 3VDNB 3D6JA 4X64B 3D8BA 2JD1A 5CJPA 3II6X 5E2AA 4EX7A 3O74A 4EFDA 4C4TA 5TR9A 4U2EA 2H48A 4LRUA 4QWWA 4F12A 2A5JA 1KJYA 3QOWA 2Q3DA 4NJEB 4MHTA 5B1HA 1G4HA 2RCNA 4DLUA 1JFFA 4D42A 1II8A 3TGPA 2H1RA 3UFXB 4CPDA 4XYEA 4Q4CA 1L7RA 2OV2A 1CQJA 3Q3CA 4Q00A 1GYPA 5K0ZA 2VZ0A 4L07A 5CYPA 3GJYA 4BMOB 4E21A 2RB4A 2Q5OA 1GFSA 2FU5C 2I99A 2FQ1A 1M6NA 3DZ8A 2GAOA 4Z9XA 1VL2A 2KX7A 1FSGA 2GK7A 2P69A 3OQHA 4MUBA 2GCGA 2ZWMA 3TKAA 5K09A 3HB1A 3H2BA 1YU9A 2Q28A 2JLVA 4KGVA 2I65A 4KK4A 4D8VA 1ATIA 4XTRA 2CGEA 2QAGB 4OSPA 5GVSA 3H75A 5KYGA 4MUHA 5JECA 1HM5A 3K71B 3TE6A 3NMUF 1JR4A 1OFUX 5DN6D 3Q1LA 2VH2A 5JD3A 1CY7A 1IIBA 2M1ZA 5T4HA 4R71A 3BXFA 4RZ2A 3E27A 1XZAA 3H2JA 2XGOA 3G9UA 4IZOA 5KVQA 4B2LA 4C7OB 4AG6A 4Q34A 2DUMA 2D62A 1N7HA 3TRFA 4LHXA 5F3RA 3DLTA 1JJFA 1R8XA 3MS7A 4GPIB 1MNAA 3ETLA 3IEUA 1GPDG 4XCXA 1LGYA 2HHHB 2JIZD 5KC9A 4UASA 4MRAA 2Q8PA 5CX1B 4D99A 4PZ9A 1QYVA 2CE7A 2VWQA 3OEHD 4FSXA 2AJLI 2E82A 4P3XA 4UAJA 3ZKWA 5L3QA 1YTLA 5G41A 4GQAA 3VNQA 1CRWG 3NOVA 2XMGA 4OUDA 2GM4A 4YRAA 3MT9A 3MT8A 4PG4A 2QTLA 3FYCA 3GROA 2OZVA 3FLAA 5B3JA 2X0FA 5JHHB 2DY1A 1QF6A 3AP2A 4RGVA 1J9ZA 1P4GA 1ZM2A 1JPVA 4LHYA 4BAUA 2VSXA 4I4CA 5CLLA 1NF8A 4PPQA 3K6SB 3TUZC 3PEYA 5D7NA 1JDUA 1ORHA 1PS0A 1Z2AA 3KVRA 4JA0A 3WK9A 4NK5A 3VYRB 5AXBA 2NUAB 3E3NA 3JSXA 4XZ3A 2EZ4A 3GDWA 1LX7A 2R1TB 4EYQA 1DCTA 5BN4A 1XRNA 2J7PA 2XA2A 3AYXB 1O95D 3IRUA 1MUUA 2GZMA 1Z13A 5IC6A 3TL6A 4AY3A 3LP6A 1Z4PX 2OR3A 2Z8XA 1HT1E 4LJ8A 4B3RB 1Q21A 5CT4A 1PDWA 4O3MA 2XXAA 4UHFA 5JFGA 2W4MA 5KYXA 5C34B 2C4UA 5DBOA 2DBZA 1Q74A 3U0VA 2X3YA 1BH6A 3HVIA 3PEWA 3NOQA 3UW1A 5FOQA 2JGIA 1NW3A 4GMDA 3RUIA 3S8YA 3WLJA 2QQFA 5DT2A 1X0VA 3BRCA 2Y1LA 2FEKA 2CDBA 1EXNA 4JQCA 4U0JA 4UPEA 1M6VB 1T9DA 3ZV6A 3U3OA 2E9SA 3O4IA 4UHEA 5HJEA 2HIMA 4IJQA 5IT0A 1IL0A 4PIPA 2CJPA 1PN3A 2XGSA 1Q1NA 3HDJA 1F14A 1TD9A 2I22A 4BMDA 4C88A 2D0DA 5B36A 3MB5A 3K0FB 3WGGA 4KYIB 4EI9A 3TQIA 4XPIA 4YCAA 2WZQA 1BWSA 4MWGA 1R64A 3N58A 5CM8B 1HE4A 3BMNA 4KK3A 2ZLBA 4ZVNA 5CLIA 1BCSA 4KMMA 5JADA 2P4QA 4RL4A 1N3IA 4QGHA 4ESHA 1GAJA 3AY6A 1K75A 4GOJA 2ZRJA 4WLVA 5YASA 4NV1A 4ZDKA 2UYYA 5EIEA 4LJ7A 2F4NA 1NBMA 3LXRA 1MX3A 4PTYA 2O1XA 1SB9A 4A27A 3WV4A 3TRJA 3NGLA 1EE2A 3WB9A 2PO5A 3A4IA 3W2HA 3U09A 2Q3JA 1AGXA 4LKRA 4U1RA 3H16A 4K9QA 5L7YA 4QBFA 2YIJA 3KM0A 4KZPA 5I7OA 1UOQA 1X7XA 3DV0B 5FUVA 1AXEA 1NA5A 1QIHA 3K09C 3L7LA 2HLNA 2YOGA 3IBFA 1PYDA 2QMHA 3GFFA 5AXCA 4BO1A 5A0TA 2BN4A 1WMDA 2LVBA 2HR1A 2FWAA 3C6XA 1XD8A 3GPCA 4ETNA 1TYEB 5E2IA 3AR4A 4HGRA 4LHVA 2FFJA 2NZVG 5GJVC 1DO2A 1CR4A 2QI9C 3A31A 2EP7A 3GBSA 5DK4A 1CTQA 1BKYA 1MPXA 2I2CA 2L0XA 2B8NA 3QVGB 2Q3BA 1G7SA 5LZ7A 1UJCA 2QTVA 4KODA 4O2BB 3RWBA 1L7QA 1K3FA 5KREA 3NASA 4RYLA 5AJYA 4CIDA 3SNKA 1UBKS 3MGAA 3PTLA 2MSLA 2PX2A 1L4UA 1N4DA 1NC1A 2VTVA 3L8MA 1A95A 4H77A 2W6IA 2CK3A 1ZN8A 4W6QA 1VQ1A 1TGVA 3QVVA 5FUBA 2EJVA 4BO5A 3AVYA 1JHVA 5LOVA 1DAIA 2YWJA 2YMLA 4HN9A 3UB2A 3BJEA 3ELYA 3W3AH 5KUTA 5JSUA 3A1NA 3SR0A 1I01A 4UQPA 4CFSA 3U1VA 4QPDA 3DMFA 2DC1A 4D6PA 4LJAA 2OZLB 4U7PB 5FTMA 4AMVA 2QE7A 4AMUA 2MYUA 5CHEA 1TT5B 3BTSA 1DTEA 2QS9A 1FZTA 3EH2A 3F97A 3EVGA 3GMSA 5D85A 5DMHA 3WSVA 1KO8A 1NTOA 2YN0A 3IP6A 5THKA 2HU8A 3QBEA 3VH2A 4A8PA 2DT8A 2HL6A 1GQSA 1UEXC 2W90A 3FFAA 1OXXK 3PR1A 4OP1A 3T5MA 5CFNA 1HLGA 1ZW1A 5KYYA 1KNQA 3QGMA 1U1GA 2HHAA 4NARA 5AIBA 1R9GA 3L5OA 1JR2A 3B2NA 3SJBA 3M1YA 2JC3A 3DKRA 1E1NA 3ONEA 3FWHA 5JSKA 4EECA 4IIFA 5BV1A 3AERB 1U0GA 3HS3A 3N87A 1YZHA 4IEEA 3G2OA 4WZZA 4DJ5X 4OV6B 2NPOA 3C4VA 4M21A 1DAPA 5FR1A 4UFPA 5IJ9B 4FFMA 2IEGA 4RKEA 1YA8A 1RTTA 3SLKA 4DG8A 4E6EA 4JQSA 2FWMX 3E53A 3GRVA 5FBQB 4F56A 2PT6A 4TMTA 1EFHA 2E49A 5JQGA 3FI9A 1V41E 3OE7A 1YV9A 2EKDA 3LWBA 1OTYA 3VNRA 3R7AA 3RAGA 2CJXA 2AE2A 4JMLA 3SHWA 2EF1A 4D80A 4XGKA 3SIXA 5T7BA 4HT3B 3ZD6A 4AJOA 4EGAA 2QPAA 1ANKA 4Q9NA 4YRDA 5FFMA 4URHA 1Y4AE 2PG3A 1SXJD 2W71A 3W1EA 4MW1A 4HDMB 4TUYB 3T54A 2JLQA 3RSGA 3EUFA 5C7IO 3ASYA 2PLWA 3H2HA 4UAVA 3UAZA 1FBNA 3EJWA 3RC9A 3UPUA 5MN6A 2GD0A 1KOFA 1ZNZA 4G4IA 3NX4A 3UJ6A 1I7QB 2GFHA 4ZV4A 3CVVA 1GG5A 2WU3A 2XMQA 3RC2A 3GUYA 4HPXB 2ZYTX 4JC8A 2OSBA 4GU5A 3COYA 2ZB3A 2JCYA 3OZSA 1ZD4A 3QU7A 4UCXA 4YJFB 3ZKAA 4F4HA 4PVCA 4XGRA 4H4DA 3UXEA 5JAHA 1FFWA 3TX6A 1P0FA 4DNPA 4YMLA 1EFRD 3RI3A 5CBKA 1OLSA 1KI6B 4HDRA 1ND6A 4C87A 1WA5A 3HMQA 4Q3CA 1KJQA 3CQ9A 4NS4A 5ITWA 2MINA 5DN9A 5TVKA 3TL3A 1TAQA 2QA5A 3FRIA 4EA9A 2XKKA 3ANNA 1EBFA 3CUTA 3R20A 4PHGA 2GCNA 3JR7A 1X2EA 3T3NA 4AUEA 2ZU6A 1VI2A 3CKKA 4DCGA 3KJQA 4XE5A 1G8JA 1VCNA 5LMNB 1SQFA 1ONOA 3L7IA 4LISA 4YAGA 5FOVA 1G20E 4Z9YA 3OZRA 4MV4A 4KQ6A 4U2FA 3UTCA 4BLWA 3BDIA 3ZXSA 4Y7CA 4BRSA 3RU9A 1MO2A 1ZUD1 1Q95A 2BEVA 3DFZA 4RL6A 3UM9A 4ACBA 1VL5A 1KPGA 2CMKA 1XQ9A 3PIIA 1KK2A 1YCGA 4DLWA 1GGHA 4ZREA 4HSEA 3BKWA 1I1NA 3OPYI 3GPBA 2ZIFA 5D84A 1RC0A 1XZGA 1RWQA 1G60A 3NH6A 4Z4FA 3CKMA 4U5QA 3ABQB 4FGZA 4H4EA 2HA5A 3PZBA 5EWLB 1SELA 2AF3C 3ANSA 3ZWMA 3BH7A 3JZAA 4KJZA 3R7DA 4QJ5A 2PUEA 2QJFA 4B7XA 2Q9BA 4MJ7A 4CM9A 4F5YA 2JIPA 2OHFA 5FI3A 2XD4A 4F7WA 1J0CA 4ZVPA 5TC4A 4DLNA 3WMRA 3RQIA 3S81A 2AFVA 5JJCA 3IAFA 2DR3A 3ICOA 3BWCA 2HWUA 1QIDA 4QYSA 1BVHA 3RREA 3HYNA 4N6NA 4TMKA 1TVMA 3QKSB 3NHSA 1AN9A 3GOQA 1A2QA 2AN5A 5TIIA 4B3MB 2G06A 4MYCA 4OP3A 1QHSA 3RNOA 4MW4A 2M32A 1E79A 2QRZA 4H27A 1ZESA 2XUJA 4JJ8A 3WJ2A 3LZ6A 1YZNA 3FMOB 1BMFD 2OILA 2ZP1A 4GRAA 4RK6A 4D4KA 2PVCA 2CHEA 4M8KA 2GEJA 3HRHA 1FYWA 3QKWA 4GZ6A 3D6AA 3T3GA 2NO1A 2Q5LA 1QGDA 3G49A 2OQRA 3R5SA 1XRQA 4MGIR 3C6KA 2PTGA 4NMMA 4RHCA 5CVVA 4XA8A 1I14A 5DNDA 2Y0DA 5AVJA 4ZP1A 5JIBA 3GLGE 3AUFA 2IJGX 1U7ZA 2RDMA 1WV0A 4DIOA 1NZJA 5JS7A 1BRTA 1KMNA 1WB6A 3MW8A 1YQTA 2ZYRA 5HRAA 3HU1A 2AJDA 2IEYA 2YFKA 2ZWVA 3ONVA 4R6XA 1RLUA 3BSYA 4WD3A 2NOAA 3B1YA 4L0DA 3NBXX 5J2TA 5E8RA 3M9LA 2JA2A 1ABBA 3W5AA 1M8PA 2OM6A 3AR7A 5IN5A 4CTKA 4BBAA 1K8YB 5I7VA 1EEXB 1C2YA 1H1LB 3K0SA 3KXKA 1S9DA 3QG1A 2X8LA 2QVCA 4AKTA 3RS3A 3U40A 3GIDA 1W4ZA 3I3SR 1NU8A 3P27A 4EITA 5TRTA 1BS9A 2I3AA 4QICA 5FTJA 1N0VC 3RG2A 5T67A 1SEVA 1I4EB 1TJ3A 1Z25A 2PK3A 2XDWA 3MD0A 2QENA 3PCRB 4IP0A 2Z5LA 4NCNA 1E5LA 3V4FA 1DTSA 3P4XA 3VO2A 4QO7A 3W9BA 1T91A 4ZI7F 2QP9X 1XDWA 3NHZA 1Z2EA 1X1DA 1CHDA 1K3UB 1X7WA 2YW9A 3D31A 4GLOA 3RRNA 2FN7A 2JLWA 3K15A 3GI1A 1U2DC 5IJWA 3IHWA 1RWMA 2AFHA 4CEHA 1C3XA 4EO7A 1M8JA 2QTZA 5F12A 3Q3IA 5DLEA 5FA6A 4YACA 4M1MA 1PO7A 3NHFA 4KXXA 1SBCA 3V9PA 4Q15A 3R8CA 3IBGA 1MC8A 3FOZA 4WFKA 4N47A 4UVHA 1CJKC 4ZHQB 1MDBA 5H4GA 4LKOA 4FFOA 2Q0QA 1T8UA 4HFRA 3UJAA 3ER6A 3OZGA 4ZU6X 4J1QA 3ZX5A 2WD7B 1FB5A 3VM6A 1Q2UA 4X1IA 3H84A 5ALTA 3MJRA 3DOHA 1T24A 3WIDA 3RNLA 2Z43A 3AVOA 1ISFA 3THXA 4QX6A 1JG7A 1E63A 2VP4A 3LX8A 2O2DA 3WL7A 4OM8A 2G82A 3OFKA 4FONA 3OQMA 4ZZIA 3DE5X 2V0GA 3DQQA 2CUNA 3EXHB 5IC4A 2PZMA 2UZ4A 1NN0A 4MUEA 1XFDA 2E21A 3KSRA 4CN9A 4LYHA 5AKYA 3EFHA 2PPLA 4PAWA 5IKEA 3EWSA 3KSBC 2CXHA 2QNIA 4J16C 1RE1A 2X8WA 4HQKA 1QC5B 1Y6ZA 3KYCB 4MQLA 3L7KA 2OT3B 2R00A 2ZJ0A 1QB8A 3QWFA 4P2GA 3V8BA 3SOZA 4DANA 2AOXA 4AT1A 3BD9A 2D8AA 1WSAA 3KV3O 3TWOA 2NZ2A 5JYEA 1WW8A 1DO0A 5DHUA 2X5JO 3X44A 3ZU4A 1YVRA 2XQFA 5BT8A 3IBCA 2JANA 2JDID 5LA6B 2CL5A 3E58A 5DM60 3ND7A 4BFVA 2H57A 2JGDB 4R01A 3RFXA 5LMZA 1P8JA 1OKKD 4OFBA 1WQ4A 2TRSB 4KACA 2QX8A 1SCUA 4RM3A 4JK3A 2B8TA 2ODPA 3ZZ0A 2K7ZA 1EP2B 1EFUA 4XKJA 1JW9B 4ZI7A 1N1GA 5JH7F 2FMIA 4BFZA 3HSYA 3AI7A 4F2GA 5JAMA 2XBLA 1SH7A 4QO8A 1JJBA 4PVDA 4OHUA 5IZCC 3R6WA 3C8HA 4OU4A 1QGAA 1CF9A 1TADA 4Y9RA 3TW0A 1HURA 3UGKA 3USES 1B42A 1E61A 2FPOA 4GIBA 4H7KA 4N9WA 2XB6A 5KMGB 2P11A 2JNWA 5KNBH 1LDNA 2EC5A 2RHLA 3AY7A 3Q7RA 3G79A 3O8CA 2P6MA 1CUDA 3CISA 1V1JA 4KLRA 2ZT7A 4L3OA 1YS4A 3U2QA 4YAUA 5IU6A 1ZVVA 3KDPA 3TDNA 1BNCA 2BMJA 1RMTA 5DCWA 3M82A 3QOYA 3Q4GA 4ML3A 3LLCA 1GTJ1 1E32A 1XMJA 2FK7A 3PQ2A 1U4SA 4QLAA 4UBKA 4TYQA 4UOEA 2LR0A 1IAQA 2ZTLA 1Z18A 5JLJA 1WPGA 2XCOA 4PE5B 5CFLA 3EA4A 3VSAA 3WK6A 4DBLE 2O8CA 1CR1A 2R6HA 1YHZA 4HAVA 1NURA 4MRNA 4Q9HA 3VX3A 1GM5A 3MQ4A 1BX3A 2D13A 1QYIA 5K01A 2QRQA 2FZEA 5KJ1A 2VDWB 4NPAA 5IYZF 1G8KA 1ZI8A 1WZEA 2PH3A 2QTRA 4H0FA 1WRBA 1DJNA 4RGYA 4KCGA 4R5MA 1FUIA 3CC8A 1MABA 1MEJA 3GYGA 3PFHA 5E7MA 3X2SA 1MIOA 221PA 1X1RA 4GMKA 5AKJA 1XTTA 4ZZ0A 3UT5B 5COBA 3PDIA 1DC8A 1II0A 2FRVA 3CKYA 3PX3A 4TKVB 3ND8A 3AKDA 2FOIA 4OYYA 1PFKA 3HCBA 4XM0A 4L16A 3SDBA 5EJ7A 3MMSA 1H6BA 2WAXA 3LWNA 5I47A 3GFTA 2CF6A 3IKJA 1NMSA 3GBPA 3INRA 4HLDA 3WRXC 4E5NA 2FLVA 1T8RA 4JI1B 1ZCFA 3B1KA 7AT1A 4HTFA 2DCMA 3RSCA 3VR5H 2POQX 2FN3A 4IDCA 1Z5VA 3HUTA 4IGAA 5EQTA 5JH7A 4JT9A 3RK4A 3GLFB 3PGVA 4Y2PA 1L1EA 1UDAA 3O95A 5EEGA 2Q5HA 3EASA 5ESWA 4FFBB 5A1JA 3CLRC 2Q3FA 4H1UA 3RSOA 2X3FA 2RJ3A 4KW7A 4X3PA 2NU9A 1VYTA 2R2AA 2HO5A 4EY3A 1SVNA 1G18A 3DM9B 3IJ5A 2IE0A 4BKPA 1N75A 4DAEA 3QE2A 3H2YA 5EE5B 1FUUA 1RI4A 3ESBA 4FGWA 5BRNA 5BUSA 3P5SA 1LWOA 4HX2A 4YPVA 1GR1A 3CX4A 2FW0A 2GA9A 4JLAA 1W9MA 4K40A 3IT0A 5H3HA 4E07A 2AOTB 4J7CA 5ALKA 1J56A 1FTYA 4X8HA 4RHTA 3OSUA 1JDJA 2RSLA 1KYXA 2HX1A 2IZ6A 1O57A 1XZNA 4KQIA 2ZS9A 3MHPA 5I8PA 1RAHA 5FOSA 3ESZA 3I64A 4JVMA 4D45A 1JXOA 1LWNA 4N01A 1IK4A 2NTNA 2BDUA 4DXHA 1W2HA 4Y2VA 2P2CA 3AEUB 4LSWA 6NULA 3TK1A 5IYZA 1FMLA 4NESA 4YRJA 1JFSA 5MHTA 5H7XA 5AVSA 4U02A 2GCIA 3C85A 1NVGA 4DIMA 3LQQA 1F5SA 3AL3A 1JG2A 4G86A 4JU9A 1AKQA 4G07A 2O8VA 2NO6A 4MLDA 2HBYA 5FTKA 3WMGA 4EPVA 4E88A 1IBKB 3UMVA 13PKA 4UMFA 4H0CA 5DNCA 1PTJC 1XQ6A 3PFWO 4KTTE 1VP9A 3GA7A 2PH5A 4PNPA 5BN3A 2FWBA 2I2WA 2BHNA 5IJ0A 2EBWA 3HCCA 3EEYA 3FHTA 3E9DA 2YZ7A 4HJRA 3WAGA 1NVUQ 1AZSC 4ME6A 3WBFA 1Y9DA 2VDRB 1GPH1 2O2EA 1T4CA 3FKSA 1C0EA 2C8KA 2OCLA 3TEFA 2PXXA 4WMLA 2JFNA 2R5WA 1G38A 1E18A 2P2YA 2A5GA 3I8OA 1ZAKA 4NH0A 1YI1A 3WQHA 3IBTA 4WXHA 5JASA 3H05A 3VR5D 1M76A 4UOQA 5L51A 1W5TA 4DR5B 4DLLA 2I6QA 1CZOA 3ML1A 4DR3B 2NZYA 3SBOA 4M8IA 3FGOA 4M7OA 4RGBA 5TQ2A 2JH3A 4Z49A 3QA9A 1ZOOA 2Q1TA 2RG1A 4BNJA 5EZYB 1LPBB 4JUCA 4QJBA 4OK5A 4AZ3A 3ROXA 2EJUA 4W7HA 1JU3A 1V6CA 1Y3IA 3E5HA 4EKGA 1RQRA 2W6OA 3G89A 3P9KA 4X20B 4A0FA 4P3PA 2LPMA 2W6JA 3ZY5A 1E0DA 2HXGA 4HRXA 3RVPA 4HDSB 2I34A 1E69A 5IH7A 4UEQA 1JFRA 4LMPA 2JI9A 4U9IS 1N5LA 1QK4A 2BEWA 2D2IA 3KQPA 4DV4B 1DPFA 1UP4A 2BFNA 1ZNWA 2ZYGA 4XM1A 2ZJ6A 3JQFC 3DMTA 4CM4B 4LPSA 2GBCA 2PRYA 3I6BA 1L5YA 1IULA 3BAFA 4KDCA 4OXXA 5A9TA 3M4NA 4DSOA 4YCLA 4DM3A 4LBZA 3TR0A 2H1FA 1IN1A 3R9WA 3DC7A 3ZY6A 4NYJQ 2XIQA 5K3AA 2VPTA 1UZLA 2HHJA 4MS4B 1L7MA 2E87A 3QY0A 3ELBA 1JEOA 3FOWA 2DPXA 4CL3A 3D02A 2RAPA 1U5AA 3G5TA 4HEHA 3IIMA 2F8LA 3BCSA 4RFLA 3INNA 4U5XA 2JJ2A 1WUTA 5AKZA 3OUTA 1I0LA 1FW6A 2CUTA 4IV0A 4RVHA 1R74A 4PWZA 4FOPA 3FYUA 3F7MA 4N6GA 1BTOA 3TQRA 4NF2A 2CLEB 2JCSA 1SKBA 2VHVA 4OB7A 4FB5A 4M98A 4Z8XA 1JKJA 3AFHA 4NE9A 4LK3A 3IR7A 3OO1A 3NEJA 2HF2A 1W29A 1BYUA 2F3QA 3TQCA 3CEAA 4OU5A 3EH1A 1XRLA 3GLIA 4RTOA 1J9EA 2J59A 1PKXA 4YRBA 1M1YE 3T7TA 3HFGA 1P5RA 2J9ZB 2E3JA 3AW8A 3E23A 3EFEA 3OCVA 3PSHA 4HYQA 1U04A 2VNKA 4XR9A 1QG4A 1XUOA 4S24A 4EHAA 4X90A 2PRSA 4ZO8A 1G17A 1JWAB 3AM5A 3SICE 3RU2A 3E9RA 4M38A 1N2SA 1T6NA 1W8IA 3W5BA 1RCTE 3KQSA 5BMVB 1T3GA 2MWMA 1T9GS 1UPFA 4YGXB 4DLZA 4Q3NA 1GGKA 3K53A 2IYYA 3NNDA 5D1HA 4NVRA 2V03A 5B7NA 1C81A 4QDJA 2R1VA 2FW6A 4J7AA 4C6SA 5IXJA 1TEZA 1ZIYA 5B58T 1SHTX 3TVYA 5DNUA 1OIVA 3OIGA 1RYBA 1EWKA 3A25A 1F2TB 1Y7IA 1VI6A 2PXCA 1L2TA 2WG1A 2WHYA 1D0IA 5LJIA 2X77A 1YU6A 4Y0AA 4EFMA 1P7ZA 1XGKA 2DBYA 4ZU1X 1YMQA 1XAHA 1JKIA 1KY2A 3DEFA 2R6JA 3MGKA 4H7DA 2RI1A 1GZDA 4Z54A 4TRRA 4Z2YA 3R6GA 3RJZA 5AI5A 5SYMA 4DCCA 1A5TA 2CDAA 3IAUA 3N1UA 3ODGA 3D7LA 4TV9F 1J2JA 3QBVA 1F1JA 3OH8A 3GW8A 1QIEA 3K1TA 3QPVA 4GZ5A 3PYXA 3SCZA 5H4HA 2BH9A 1NX9A 1Z5NA 5HILA 3K7EA 3EZLA 1V1MA 3RBAA 1GN8A 5LXTF 1DO8A 4HYEA 1N33B 1QVRA 1SVOA 4G5OA 3BMOB 1X86B 4NOKA 4LYEA 2J41A 2CJFA 1B93A 1EDEA 2ISCA 4M9XA 5LYJF 2PGJA 2I7CA 3G0BA 1OGYA 1VG9B 2PD6A 4FCTA 4IX1A 4DDUA 1H4QA 1ESMA 4AKSA 4EGJA 3AHEA 4JYMA 2R97A 4KQXA 4C07A 4YV0A 2GK4A 4MDYA 4ALJA 3ZC3A 2WHXA 2R47A 1T36B 2QUBA 3QE4A 2WHRA 1YOVB 2HGSA 4GP7A 3SS7X 3GCZA 3JWGA 4QU5A 3GUZA 3WKEA 4FC6A 2AYYA 1BEUB 3MLEA 3KXLA 1LKZA 2XV1A 2IYTA 4F3YA 1QHHB 3Q7EA 1F2UA 1DKNA 4BRWA 1IY8A 1OILA 1Q57A 4BB9A 2Y66A 2J07A 3C74A 2ZI7A 1VZ3A 3L0YA 1P80A 4JP5A 2ASEA 1QTQA 2H9YA 4BTLA 5KDOA 1E7YA 2RGBA 3N53A 2F3RA 1J5XA 2QVBA 4EJ0A 2H8KA 5HQTA 5A3RA 4RLHA 2ZRCA 1IMOA 4P33A 1V9SA 3PRJA 4HRYA 3B5JA 1C8KA 1G9SA 1RR6A 2D3WA 1TW2A 1G55A 2WE7A 4ZQFA 3WNZA 2ONZA 4B17A 4YMTA 1SBIA 5CW2A 1JFFB 3G1UA 4MUXA 2FPXA 1II8B 4PZYA 4DSZA 3JVUA 2XOXA 1YR1A 2V3CC 1CQJB 1NRXA 3ZK8A 3ZPXA 2BFWA 3VR6A 4OLAA 3RKSA 3PR3A 4PQYA 5F64A 2ZIVB 1SCKA 2W2LD 1UBRS 3AFNA 2V45A 3HBFA 1P2BA 2VS1A 2HTFA 4JXJA 5H68A 1H22A 1AE1A 1E9BA 1P3Y1 1PR5A 2OCBA 3LC2O 2IDZA 3I58A 4H59A 1T35A 1ZMRA 2XTAA 1ISJA 1UXKA 3BHNA 3QK7A 4H4CA 5I45A 2OLEA 4HNTA 2JFOA 2JGFA 5ALMA 4F11A 5LKRA 1QS0A 3ONDA 4K8RB 4LOLA 4F4DA 3AYZB 3OO0A 2G09A 3O92A 1ZCJA 4AI6A 2H92A 3DW1X 2BSXA 4I5IA 1G42A 2GK3A 3VR2D 1Q7BA 1QQ5A 2C2GA 2IE8A 1KAGA 5LYJA 1NSFA 2QEQA 1K7FB 2ET6A 3NC1C 4RMIA 5EMNA 3U3JA 2B37A 2QN8A 1P60A 3VR1A 5HZMA 5FEMA 2B1RA 1IPHA 5L3QB 3BTUA 3ZKWB 5AFSA 3BD7A 4L76A 1EDBA 4OUDB 3KAQA 3PJRA 1WCWA 4IG9A 1M72A 4MUYA 5FEUA 1U65A 1NWCA 1FNDA 3KQQA 2MSCB 2VPXA 2VYNA 4FGUA 4MP6A 5TF0A 4W9NC 2V8BA 1PE0A 2ICAA 3BK7A 4IQ8A 4KN8A 1Y8RB 4P93A 2P4UA 5D3MB 3CURA 2CKDA 2WVHA 1J24A 3V8NA 2FGKA 1NBIA 2Y1FA 4O4IF 3GB9A 3GP5A 4LDRA 4NQRA 3O3MB 1KVQA 2D7CA 4NS1A 2PFGA 4LI3X 1WCIA 3QQPA 5KYWA 3I2HA 3W5DA 4KPUA 2C29D 3OHMA 2BL4A 1ND5A 1FY2A 2FEAA 2OUIA 1AKMA 1ZI9A 4QUIA 4GDFA 4MH0R 4M1QA 1V45E 1YZLA 4PG6A 3ETEA 1XD2B 4URUR 5AKLA 1RXVA 2R86A 1RRMA 1W36B 4O1IA 1PFGA 2IPLA 3ZDEA 4KNYA 3GT4A 1G7CA 2XXAB 5BSTA 3SYNA 3QVTA 4KXVA 2J32A 4P3KA 5KYXB 2AJCA 2RD2A 5DXFA 3AIOA 2WPDA 2ZRGA 1FQOA 4U9UA 1KYZA 3FFWA 4DIEA 4LY9A 1W7AA 1YDHA 4D3XA 2JLZA 3F90A 4QOFA 1DL5A 4PG5A 2W2KA 3KCNA 4TMXA 1VL0A 16PKA 3V4LA 4IHQA 3GZJA 5F2OA 4PYLA 3FGZA 4V2IA 1M2OA 2LP4Y 5JAUA 3H8WA 1G3QA 1T3LA 4FFLA 4QVIA 4UMDA 4O08A 1KZGB 2J9XB 2W37A 3KWFA 3L7MA 2QTWB 4KWEA 4XYGA 3AETA 1Q1ZA 4B6FA 1LRJA 1FXSA 2M9MA 3B7WA 1HX7A 1TT7A 3WYBA 4URXR 1JA0A 1N2HA 4AW9A 5JZSA 2AI1A 3GLHB 3KS9A 3BMNB 5C8XA 1BCSB 2QT0A 4Q1FA 2J67A 4PGFA 2ZIUB 3DKKA 4YQEA 2FJUA 1BWQA 1M1UA 1SA0A 3LV8A 3QEMA 4G5SA 4OG2A 1TO6A 4S3MA 1EUZA 1KKMA 4UHCA 4Y2SA 1BXGA 1H8EA 2PUJA 1VSTA 4EPWA 5LWHA 5FL7A 3FYDA 5KQRA 3PGMA 2HRCA 1S6YA 2C3YA 1R8YA 4KSBA 4LSMA 3SOPA 1QCDA 2C2MA 3CONA 1KHHA 3DTVA 3TEJA 2HA6A 2ECKA 2AVDA 5SZHB 1N9ZA 5FOWA 3H5AA 1JLSA 2BSAA 3L7AA 1P29A 4LSZA 4IH1A 1LBQA 4YN3A 1P7VA 3C16C 4MQFA 4EO9A 1Z45A 5EIOA 1DKRA 1RZRA 1JE1A 2I71A 2Y71A 5EJ5A 5J43A 1HSOA 1ZX1A 1ISRA 4P82A 4ZXPA 3AFMA 3VKHA 4O4IA 2ST1A 4HSGA 4CUKA 5J63A 2Z2ZA 2RONA 4DV2B 2Q50A 5CDHA 2HWKA 3PXUA 2WIGA 3OG9A 1Z63A 2ZRAA 4TM7A 2PXAA 4YYEA 1QG2A 2QTVB 1XMIA 2JZNA 1PU2A 4DVJA 3E22B 1SHKA 1W96A 2Q5QA 2FY8A 3A04A 3P9XA 4O2RA 4RH1A 5H0IA 4AJJA 3K0HA 4Q9DA 1GR0A 2QI9F 3A1DA 3QTTA 1ZH6A 4BZQA 3DAPA 1OGJA 3OZTA 3T38A 5DLQC 1T4GA 4B7UA 1TKRA 1P5JA 1ZW6A 4NC9A 4H6XA 4JJ7A 4UZSA 3ROQA 1KTVA 1CUUA 1IBSA 5HW0A 4DR2B 3FR8A 2F90A 3PVCA 4REQB 3JQRA 5LN1A 4WY5A 4BV9A 1YR3A 4IBOA 2SBTA 3E03A 5CPFA 3ZD8A 2E48A 3RABA 2DKFA 4R2MA 1IHOA 5AQEA 3F8SA 1HYEA 2NT3A 3T12A 1QFYA 3MBKA 2AKEA 3E5NA 1RM3A 4J3JA 3A1EA 3BA6A 4FQ7A 3SGLA 1EX6A 4RVGA 2A0YA 3CYFA 3GJZA 2WFLA 5EP3A 1C3OB 5B58C 1U63A 4IDOA 1CP3A 2J5RA 2OBLA 5JS6A 5KWJA 5DYIA 1V8ZA 2CHQA 3TOCA 4PHFA 3OOYA 4C0LA 5KYYB 5IJ9A 4WNAA 5HF9A 5F52A 1CUJA 4UKDA 1SJ9A 4OSEA 4ESVA 2OBMA 1QNFA 5LMUB 1QKJA 4D1YA 4TQAA 1I2MA 4BPRA 5FV4A 2ZR8A 3BYZA 4UE2A 3N6VA 3R41A 4QYTA 2H7YA 3THOA 5CEJA 5AKKA 3S99A 3C7CB 1NF3A 1V43A 4GGMX 2I54A 4X54A 4ETWA 5LVAA 3HXPA 1JHXA 2AN4A 3BWEA 1IM2A 4P84A 4LHSA 4EX6A 2A0KA 2VQ6A 3VKGA 1Z5GA 1XCJA 5DSZA 4QOGA 3EEIA 2QRPA 3EVCA 4CLOA 5JQGB 3W1VA 3MT0A 2QYSA 3BMXA 1L7VC 1RFGE 4L1KA 4HNAA 3NI2A 3SC3A 4D44A 4D4GA 3KHTA 1E20A 1X39A 4NDZA 2CL0X 2PDAA 3K09A 4A92A 5E4FA 3MJSA 1LH0A 2F3PA 1FLNA 4UUBA 2Q6IA 4O4LF 3V7FA 4IV5A 1V1RA 2EQ5A 3DM5A 3I28A 4FLEA 3R09A 4CCAA 1B6SA 2GBFA 3HJGA 4RW0A 2VSQA 4HMQA 2DPLA 3VDMA 3ZYCA 1DEXA 5JSZA 4HNQA 2G9NA 5ERYA 1E6CA 3DWIA