2FW6A

Structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) mutant h59n from the acidophilic bacterium acetobacter aceti, at ph 5.4
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
159
structure length
159
Chain Sequence
SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSANRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Studies of N(5)-Carboxyaminoimidazole Ribonucleotide Mutase from the Acidophilic Bacterium Acetobacter aceti.
pubmed doi rcsb
source organism Acetobacter aceti
molecule tags Lyase
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
total genus 51
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 2fw6A00
4ZC8A 3LP6A 5CLGA 1QCZA 3RG8A 4ZK2A 4AY3A 2FW6A 3KUUA 5CTJA 2FW1A 2H31A 4YCJA 4B4KA 2FWBA 3RGGA 1D7AA 5CLHA 4AY4A 2NSHA 4YCDA 5CLJA 5BOSB 3OPQA 2YWXA 4ZMBA 2NSLA 2ATEA 1U11A 5CVTA 2FW8A 2FW7A 4YCCA 2FW9A 3OOWA 5CLFA 5BOSA 4GRDA 2FWPA 4YCBA 4Z7JA 2FWAA 1XMPA 5C5DA 3ORSA 2FWJA 4JA0A 3TRHA 2FWIA 1O4VA 2NSJA 4ZJYA 5BORA 5CLIA
chains in the Genus database with same CATH superfamily
2YJZA 1OT5A 4DPKA 5JEEA 1OAOA 3CIFA 5KWIA 5JAQA 1C7FA 3VO9A 3IBFA 3GEMA 3W3AH 4EHHA 4X1IB 1R66A 1DAGA 2ZYGA 2Z8XA 4KIUA 3WIDA 4M1SA 2B7BA 4B6RA 1P0IA 1L5ZA 2AR7A 1ECFA 1MRZA 2C2OA 2M6SA 2QT1A 2Z56A 3LX8A 3NVAA 2C97A 3ON5A 4WA8A 1XQYA 4UDNA 2BFCB 2FDXA 1JWBB 3T6KA 4M8KA 3T5GA 4DLYA 1T91A 1AV7A 4IIEA 1T35A 4GVLA 2Q62A 3WGUA 1J42A 1HK7A 4L73A 3U19A 3AEQA 2PV0A 1EX9A 3WHLA 4B40A 1Y1RA 4FOOA 1CUHA 4JLNA 4BWFB 4GP9A 3GLFB 1EG7A 1EZ1A 1VI5A 4M9CA 3OKPA 4MVCA 1SKBA 3GT4A 1JHVA 1U4SA 3NC1C 5DASA 4LF4B 3B20A 1Q92A 1SIUA 3OLXA 1ST3A 1CC1S 2ERYA 3NT4A 4OQDA 5DM1A 5E2AA 4LDAA 3W90A 4ZZ0A 5CFOA 1CVLA 1SQFA 1KFJB 2Q1XA 4ZALA 2YHBA 2H08A 1E1YA 2CLSA 4G63A 4KRYA 1UL1X 4R9RA 5HE8A 3I53A 1Q2XA 1ZYUA 2AC2A 4ZMRA 5K3AA 3ESZA 2EZUA 3LY7A 3OM1A 2AKEA 1Y3HA 4DV0B 1E99A 2PA3A 3QXJA 1J21A 4C88A 1EK5A 3ZDRA 1PR3A 2OCGA 4WESB 3I8SA 1W0KD 3T9BA 3V8BA 4D25A 1DEKA 3G2PA 3VI4B 4RY9A 5A06A 4P7BA 1FFCA 1II0A 4JQCA 4WNIA 5L3QA 2YXPX 2G3YA 1MW9X 2WJHA 5L3SB 1EZZA 2Z8ZA 4NMHA 4YX9A 2V6FA 3MTAA 4CL8A 3B1YA 1VG1A 2DH5A 2HD4A 2W2LD 2OM2A 4P4LA 5EMKA 4FEAA 3T7KA 3KOYA 2GBLA 1RLOA 3IS3A 2WUFA 1QIGA 4TT3A 3AM4A 2FFAA 4OCZA 4R8LA 6REQA 1TFRA 3KEGA 3PWSA 3VPSA 1X2EA 5AI8A 5K4GA 1M8FA 2JCXA 5EVJA 4GI1A 4Q4JB 1NE2A 2HW8A 4CT4B 3W1VA 3GRAA 1Z15A 4KWCA 5EIHA 1EUYA 3A9UA 2HQ1A 5B3JC 4YRGA 3L8ZA 4UW9A 4RHEA 2WSSD 3RSSA 3T1VA 1KK3A 4XM2A 3BJMA 5LU9A 1TU4A 4R2HA 4Y2UA 9ABPA 2VBIA 2Z2KA 1TVEA 5CVUA 2FZWA 3I04A 4CKWB 4FMCB 3L0CA 3T0IA 3SHOA 4ZYWA 4LJ6A 2AW3A 2QG9A 5M34A 2CSXA 3LXRA 1QJ4A 2AFIB 4V0SA 4I50F 4EJ6A 1EAYA 4JU9A 5DJ5A 4CGZA 4DMMA 3QX8A 3NX4A 1YA4A 3OAAD 4JXZA 5A5DA 2NSDA 4DVJA 1DKOA 4YDQA 3QITA 1H22A 3LWDA 3PX2A 5F9MA 2I0FA 5CJ2A 2PUVA 5AJHA 3TRFA 1CDDA 4ZJPA 1EVJA 3FR7A 3GD7A 4MVJG 4UD6A 1DOHA 1NRWA 5K09A 1KJ8A 5CXXA 5G53C 1UIMA 4D0GA 2AJ8A 1O6ZA 1CSEE 3AB7A 2HNKA 1LD3A 2JFHA 4OPMA 4PBRA 4FCVA 4OH7A 4KLAA 4B3DA 3DLPX 2OBYA 1DTWB 5LJIA 4W5WA 3KSUA 1NN3A 4M0FA 4QBIA 1JG3A 1JJVA 1XDBA 1ZWKA 4JT4A 3W9SA 2VXYA 2QW1A 3T3MB 1H4QA 1VOTA 1YC2A 2B2CA 1KPHA 3E4DA 2PK3A 4RY0A 5P21A 1I36A 4KAAA 4NU6A 1G9TA 2WU3A 4LZWA 5D3ZA 1B6GA 3UC5A 2K2QB 4KR6A 3UCXA 2LW7A 3A4VA 5KTRA 1I1OA 4IGIA 4IIJF 3P0HA 1GPUA 4L74A 3RUIA 5HOQA 2V3WA 3H9EO 5EJEA 1C9NA 4JBXA 2BFOA 4R7ZA 5CVEA 3ZD9A 5JC8A 2P67A 1A71A 1ELOA 1P60A 1QQBA 1WO8A 2FMKA 1EDOA 1YR6A 3BH6A 4GIBA 2ZK7A 4XLLA 3A6JA 3D0KA 2D0IA 4H16A 4MPJA 3CA8A 2EFCB 4WZAB 5FFNA 4MVJF 4CG1A 5L8VA 2D8AA 1E59A 5AJTA 2V4MA 4XQGA 4TRJA 4CJXA 3D0OA 3KJHA 5HMMA 4S0XA 2OVFA 1N7GA 2XUGA 4G0XA 4H27A 4HFRA 5CH5A 3GFPA 4U6QA 3DFUA 3UATA 2RJ3A 4KQKA 3F0TA 3OHPA 1BHJA 1K89A 5E6UA 1HL3A 3ND7A 3GZNB 2ZUVA 3EY9A 5EJMA 1Y6RA 1GDTA 1QUEA 3EVAA 1N0VC 4ES6A 2FWPA 4DN6A 2F9MA 3FPEA 1MNQA 4LPKA 3O2NA 5B3AA 3R9KA 3M3DA 3WMXA 4LMBA 3MWEA 1EXVA 2BH9A 1JQBA 4GC5A 3QPDA 1GQRA 2XT0A 1PDOA 1K7SN 1QUFA 2B4RO 4KG7A 4LGYA 2Q3MA 4U9IS 3I9OA 2B9VA 3M34A 1O03A 1EMDA 4YJ2A 3AU8A 1ISHA 4L9RA 2R6FA 2QZ9A 5FJJA 2HV9A 2PZGA 1UKVY 1XVIA 2XYGA 3T0GA 5D5QA 1LX6A 1FFXB 2O2ZA 2BFDB 1NVBA 2EXXA 2HK6A 4MKFA 4Q1FA 4C0SA 3QPWA 4C2BA 4EBFA 4ZAXA 3V1TC 4ALIA 5BMVA 3DOFA 1HMYA 4I4TA 3V00A 1I14A 2XMQA 5JS6A 3DBLB 1K7XB 5C0OE 1G3MA 3AEQB 3A6KA 5JD5A 3IVAA 1UQRA 3GUUA 3DEZA 4Q1VA 2JATA 3WB9A 4DY4A 1CS0A 3E2MA 4NZPA 3W4IA 3F4BA 1RM3A 4JQZA 3ZY3A 3ZKAA 1H6AA 4IDQA 1N6HA 3H9QA 2VK2A 1GG2A 3LS2A 4NK4A 2PSJA 3ZNOA 3A4YA 4KFTA 3O4GA 4BHTA 2NTVA 4UUOA 1T5SA 4FYKA 5JDIC 2ZUFA 1EQAA 2Z3VA 4RIFA 2Z6VA 3KZCA 3M4JA 5C4MA 3WGVA 4BV9A 1EM8B 4J2OA 3UK2A 3TSOA 5JAHA 1F4VA 1M66A 3AVPA 3FNFA 5C32A 1CUYA 4J4BA 1Z0ZA 1AGNA 3NBXX 1YDFA 2ZTMA 4ITUA 1JFTA 5KX5B 4GPZA 1KMIY 1V7PC 1M6VA 2JRLA 2P6PA 3UMBA 3DAPA 1QP8A 1VJ1A 4G0OA 4QUEA 4ZVNA 1GKYA 3F9CA 3OJFA 3DPSA 3CUSA 2CV1A 5EEHA 1FU4A 2PUHA 4C7OB 3WIEA 5F7JA 3GQVA 5AESA 5CR9A 2HPVA 4NBNA 1BU5A 2WTAA 3JYLA 1UOQA 3FX2A 4S24A 2JLYA 1M0EA 4RE6A 1ZXXA 1KSHA 1R0XA 3DQQA 4KIGA 2B83A 3FRJA 1B14A 1QLJA 1Y48E 2C2MA 3HJNA 4F2HA 5SY9A 1HT0A 3GCXA 4JVOA 4DR4B 1Y1KE 3F2IA 2QV7A 1R37A 2GPNA 4LDZA 2D59A 5CLHA 2EGUA 2IPXA 4JU8A 1L0BA 4KXUA 1MT0A 1U3DA 3GU3A 4AKEA 5K0LA 4IIDA 4L7QA 1ZJYA 2DYKA 3S28A 4AF8A 4E2ZA 3TZKA 4P84A 2Q4EA 4KMOA 4DCSA 1FU7A 3NWBA 3TOXA 5FWXA 3PZRA 1E9BA 4M8NE 3JD4A 2IX9A 4LC0A 3K35A 4IVRA 4QUHA 3MOSA 4QFCA 2QX7A 3WYCA 3KWMA 3P0RA 1OROA 2NOAA 3GVXA 3DT9A 5EJ8A 1KDPA 2EIXA 5G3YA 1OJ7A 4D3FA 5JNLA 4N0PA 4QODA 1NIPA 2O3SA 4X1OA 2ZTUA 3BXHA 3E23A 4HZUA 1NXQA 3QF4B 4XYGA 1CZKA 3OTGA 4MIYA 3SC3A 2B7LA 2P9EA 5JASA 2HKIA 3ESBA 4EQ6A 4DM7A 4L5YA 2OZPA 3L7MA 3OVMA 5I7RA 3VKHA 1K3UB 5F9HA 4JAVC 4AUEA 1GSHA 3IRUA 5SZIA 1VGVA 2ZYVX 3CLHA 4JLVA 4KXYA 1W1UA 2DJIA 5A3RA 2X8JA 2V03A 2AR9A 1E2MA 3LIPA 5KYXA 1G64A 4MR9A 4P0PB 4BFLA 1CY1A 3RE1A 2GRAA 4BIIA 2GJKA 4GE3A 3JYPA 1KBZA 2IYVA 4O2BA 3AJ8A 3LBYA 4L1KA 1TQDA 2HX1A 2ZBPA 5DX1A 5GAJA 3PQDA 3R9XA 1P44A 1YK0A 1IMJA 1RM5A 1UF9A 2JGKA 3HFJA 3VR4A 1H3EA 3LBFA 2XMPA 3TFQA 3ZLJA 3IDOA 4BBZA 3DJYA 2EBUA 4G1CA 5KEIA 1U7OA 4KO8A 2HR1A 4FN4A 2WIDA 2GDZA 2YYAA 4EECA 4B3SB 4AKSA 4NATA 2CJFA 2CXHA 3TS1A 4AJPA 4HYQA 3HUUA 1SXJB 2WJGA 4DCJA 1LSUA 1NAIA 2CXXA 3C6KA 2F67A 4AAYA 1YTUA 4EKIA 4F4UA 4S04A 3C1UA 3V8PA 2H6EA 4LX8A 1CPYA 1ILEA 2QQGA 1P9NA 3TOZA 3UHJA 3L4SO 4KE7A 4BWVA 5FNZA 4EBBA 4ZYXA 4CL3A 4QT0A 3OBBA 1R8SA 1ISSA 1CFJA 1LVUA 2IP1A 3LDGA 2FEAA 4IDHA 2O23A 3Q3HA 4JOCA 4FNMA 2VRCD 3KWFA 1LSJA 1DL5A 5KUTA 4NZNA 1UXKA 2QRGA 3GRKA 1QGZA 1TVKB 5J4YA 3D4IA 4HEA1 3M6XA 3GPCA 4GYYA 2XNSA 4I9FA 4R1UA 3TRKA 3KEMA 2Q1UA 3FOZA 4O3MA 2YVKA 3GJQA 1FPQA 1WG8A 1X7YA 2NSYA 3NTRA 1CUDA 4G0PA 1TF7A 2ZUUA 1LDYA 4Z4CA 3L7JA 3FTCA 5IJ0B 4LZAA 2A0YA 4F93B 1JFFB 3AVXA 1YS9A 4MYDA 4WOKA 3EPRA 3RI3A 4CUJA 1WZEA 1LPAB 1QKIA 3LQ4A 4NOKA 1XC7A 2XMSA 5BSMA 1FDRA 3VPFA 1RKVA 4JC8A 2I3BA 3GZTB 2BCJQ 3HJTA 1FNMA 1TLTA 1ZNZA 2C5FA 4H0CA 4KSYA 5A4AA 5BR4A 2P6OA 2POCA 2VSNA 1N57A 4LXGA 5THXA 1Z16A 4BUZA 5JQGB 3CG0A 5HJ5A 2A5GA 3VV3A 2ACEA 4UHDA 1E2HA 2BSXA 2C92A 3CIOA 2XIQA 5AQ1A 2W4QA 3LLVA 4K28A 4PRZA 3A9SA 5DRTA 4OHMA 4V3CA 4OX9Y 3PHLA 3A05A 3OD1A 3KEOA 1AK1A 1HM5A 3TXAA 4TZKA 1AO3A 2JCYA 4D3DA 3SBDA 3VSEA 3PKJA 2LVBA 3WNDA 3RWBA 2AN3A 3IO5A 1U0OC 2IYUA 3DEYX 4Z4QA 4F3TA 2F9FA 1BE1A 2G07A 4IHKA 3IJPA 1ZOIA 4NFSA 1MO4A 1C1DA 1GADO 4OAOA 3IESA 1U7PA 4HWPA 5L3QB 3NTLA 2ZAIA 2HJGA 4R9UC 3BDVA 3FSEA 2H4HA 3KG2A 4U2GA 3ZGYA 2BHSA 1ESZA 2YXLA 3L1IA 3LMKA 3ZK7A 4A2QA 2WVJA 4BV3A 4Z3KA 1IJBA 3ESYA 4CM4A 5FUBA 1J8MF 4XJVA 5DVZA 3NFYA 4MLPA 4IDCA 4ZMBA 2R8OA 1M10A 1JR4A 3I9FA 4LBYA 4MJXA 3BF7A 3L1VA 4UHHA 1PW5A 4KLZA 1HKHA 1RCFA 2AUTA 4MHSA 2G83A 3CRQA 5ECYA 3ZZ0A 4C3UA 2VJAA 2X2OA 2FPIA 1RAGA 4P86A 3N1UA 4ML3A 1EZ4A 1QIJA 2D06A 2FQYA 1DWQA 1TIPA 4FWIB 3U3OA 2ZWPA 5J4LA 5DTEA 4XSGA 2FPPA 3WSWA 3R74A 4MRVA 4GM1A 3K30A 3ZZTA 2QXUA 3WA6A 3GJSA 2IYOA 3GFQA 3O8DA 2D1QA 5EUQB 1TTHA 4YUWA 2X22A 4ZGWA 1JBKA 2LBPA 2PJUA 3G7NA 3QVSA 4L2IA 4UQOA 3B82A 4N3CA 5IUNC 4YMSA 3UGJA 16PKA 3OF5A 4TMFA 5M29A 5CX4A 2LWIA 1JSLA 2EFGA 3OCWA 1KAGA 1VPDA 3C3AA 5IT0A 1UBRS 5JAZA 1KO4A 3OT1A 2PGLA 3LC0A 4HN4B 4PTZA 4DGSA 1U11A 2F3UA 2OCYC 3UWMA 1GFSA 4BLWA 2AJBA 1TOAA 3IHKA 3HB1A 1D8TA 1WMSA 2P90A 1FJ2A 5C4IA 1XRSB 2PIAA 4O3FA 2VJDA 1P2BA 1WHTA 2W43A 3RV3A 2SECE 1DRJA 2ES4A 3ORSA 5J59A 4A36A 1N8KA 1YL6A 4UM8B 2JCGA 3OMXA 3GDOA 3MCVA 2HF2A 1RKBA 1XNHA 3PICA 4MUKA 3GJ0A 4E32A 4EF4A 5JTTA 5IC6A 3M3HA 2J9ZB 1XA4A 4MP3A 4B7CA 1D7OA 1BOFA 4ZEVA 2YH2A 1L5SA 4KE6A 1Q57A 4PBTA 3N8HA 1E2GA 1UK7A 3BDIA 4ZFNA 2WTXA 3DCYA 2H1VA 2CNNA 4NEGA 5K99A 4LXYA 1CUAA 2G72A 1R9NA 3H2BA 2XR1A 2TSYB 2VP6A 1M72A 1V96A 3EPPA 1Q14A 1Z6XA 1L7PA 2GPSA 1U2TA 1GZ5A 4R2JA 4O4HF 3QELA 4XQEA 1Q74A 5BQPA 1TT5B 3ZW8A 2D54A 1Z7GA 1T2CA 2JI8A 4RTRA 3DZ8A 2Y6VA 1ZGJA 2PGDA 1B6TA 3BGOS 4KIJA 3SS9X 3UMMA 4AQDA 2W2MA 4ARZA 2VP9A 1MO2A 2JJQA 2XSZD 2XYVA 4H1UA 1JILA 1FSZA 1WMBA 2PG3A 3OICA 4NBRA 1I3LA 4QDZA 4Q7QA 5HKOA 4KR7A 5IDWA 2EL7A 1JEDA 2O8CA 1T1GA 1Z74A 2G80A 3NYQA 2Z0MA 2ZJ1A 3VYVA 5JYCA 3INYA 3TCXB 1ZM3A 1LUAA 1Y5IA 2WAMA 3CUEF 2CXUA 5C8YA 1L8OA 3KCNA 4DMGA 3RUHA 1ZONA 2PH3A 2HEGA 4Q5IA 1PQPA 5LXTF 5A9SA 2J9FB 1EAMA 4MV9A 3HB0A 1DDGA 4A82A 4RJLA 2H65A 1ZQ1A 1VCHA 3K7EA 2R87A 3CNOA 2QB5A 1KI6A 3K72B 3WK6A 4UTVA 3CX3A 1N3YA 3FWZA 2I1LA 5DIZA 3M2TA 2O7QA 5F5NA 1T5LA 2GX6A 1LWNA 1Z38A 4POAA 2D62A 5KBYA 4UVDA 3R24A 4KXQA 1SO8A 1RQ7A 2GQ0A 2YMPA 3H1EA 3HRHA 3T9FA 4Q3KA 3TNLA 3X1MA 4M7PA 3RVQA 2BFBB 3JRNA 4BUCA 2BRUC 1GNSA 2ATCA 2OECA 3ROTA 1KEUA 1MAUA 1SXHA 4F84A 1B76A 1DV2A 3AKDA 4ZOQI 1W36D 2NXJA 1O9GA 3MJTA 1CJTC 2QJTA 1Q17A 2QE6A 2XSZA 1Z0DA 1FLAA 4FLFA 1JR3E 4QA9A 5DISB 3CVOA 4QTUB 3VMMA 3ZWVA 2PTHA 1U7UA 2VJYA 2ZSKA 1HE2A 3Q12A 4ID9A 3UMYA 3E22B 2W22A 2LXNA 1AE1A 4MYSA 1OFHA 4XLZA 2ZETA 3KEQA 3SOPA 3S2SA 3DGEC 5JO9A 3WICA 2GA8A 2EJTA 1DIGA 2FYTA 4JT9A 4YAFA 1JYSA 4CMJA 4QKQA 1IZ7A 2QXTA 2XB9A 2GJSA 3ANYB 2XZPA 5JQWA 2C4TA 1NMZA 2EG9A 1JLLA 4NABA 4BDSA 3IEXA 5TMEA 3SYLA 3FTEA 5F76A 1E96A 5KNDH 3LIIA 5C80A 3I1JA 1MHTA 1UBFA 5FBRB 5DE3A 4GI2A 3INNA 3S44A 4AU1A 3K71B 1VSQA 1K6XA 4HLNA 3C3KA 2B1GA 5LP6F 2P5SA 3EQ6A 3BRCA 3EAQA 1ZQ9A 3HB5X 5EPOA 4DMRA 2XHEA 4FQ8A 2F64A 1MR3F 4R1QA 4PZAA 1M73E 2XWBF 5DOVA 1YHYA 3U80A 3KUXA 2K7ZA 4YAUA 4H3VA 4IIFA 1DTEA 3MB8A 4OGLA 1T9ZA 4OQPA 1L4HA 1QAMA 1XU7A 5A7FA 3R8FA 2CW5A 4OBWA 5D5PA 2OLJA 2A9PA 2B8EA 3QI7A 3W8NA 2YWCA 1JDSA 2CK3D 1GTZA 4ZT4A 3OEWA 4Z3DA 4F96A 5AI6A 1G6OA 3ENKA 4ALJA 3LDFA 4M54A 4P3YA 1IHPA 3L0ZA 4ZN6A 2IQ5A 3VOTA 3ZG6A 1ABBA 4BEWA 1GPAA 1S9DA 4H3HB 3M0EA 2CYCA 1EWVA 1OT3A 2GEKA 4TLCA 5FD8A 2RHJA 1ZD8A 2C31A 3CT4A 3TINA 4XIGS 1V3UA 2OGSA 3CONA 4NQZA 5EOVA 5FPSA 3HC7A 1UOEA 1LGYA 4TSFD 1TZBA 2OO7A 5FBWB 3WJ7A 5JOQA 1UDBA 5CBKA 1FEZA 2P5UA 3IUQA 4EHNA 4QC2A 2ANBA 3EDOA 3O2QB 3THOA 5IKXA 2IE0A 1F60A 4O4LB 3E81A 1G6KA 2WPDA 4IKEA 4E5UA 1HGXA 3HABA 5IJAA 1YIAA 4M38A 4M9UA 3PXDA 3UPDA 1ZH6A 3AFHA 3ZWNA 1A97A 1Q1GA 5CEFA 2YWRA 3OU6A 3HM2A 4IIJB 2Q46A 2J4DA 3UUEA 1Y6ZA 4LZLA 2Y1XA 2PHZA 3IHTA 2RG1A 2P6MA 5F9FA 1DC7A 5JCOC 1IB0A 3K8YA 5B1IA 2BHLA 1GUAA 2EZ4A 1YB2A 3HVKA 4X6YA 1KH2A 3SS7X 4YMVA 5FH9A 4ITVA 3T3NA 3B5EA 1Z6QA 3BX1A 3H97A 1HQYE 3IDAA 2BW0A 4HG2A 4Y6RA 1P77A 1Z7BA 2N0SA 1G8AA 1Q3HA 3VA7A 1L7XA 3EH1A 3FYCA 3D6UA 4S3MA 2XXAA 4C0HA 4YRIA 2I6XA 1EGVB 1ZIYA 2QX8A 4BC0A 1WQ3A 1LDNA 3VNSA 4LSGA 2OSVA 7GPBA 1OPXA 4Q9KA 5BT9A 4BVAA 2G0NA 2VNKA 4NZZA 4PLTA 3NATA 4BO0A 4PFQA 2JLWA 3PJGA 1FUEA 4N9QA 5DLYA 2ZS7A 3WMEA 2Z5LA 3O1IC 3O4RA 5IJ9B 1YQQA 3OO1A 5DYTA 1O3YA 2TMDA 2VDNB 3E9ZA 5KINB 2H1IA 4NLLA 3O0TA 3L6BA 4BLUA 4AP9A 3E2IA 3KK0A 4OQYA 1C8BA 1PV2A 3DG9A 3L8FA 3E0XA 3P9XA 1E3DA 1Z4QA 1LS1A 5EPUA 2JFOA 2RHRA 3LWBA 1Q19A 5JBNA 5CP8A 2R9VA 4G2NA 4CCSA 2PKRA 4TTSA 5AD1A 5KWJA 4OHUA 1PGJA 2FSGA 2UXDB 4K6GA 5T4BA 1PNOA 5KDDA 3U4QA 1P7PA 1EP1B 2W2PA 3EJWA 4E1AA 4WQMA 3ZDBA 2IEYA 1GCAA 3R6DA 1ENZA 3OIGA 2CVOA 4RZ3A 1GNQA 4UVHA 4ENVA 1NUSA 1ONSA 1Y1PA 5CGQB 1PE0A 1SG0A 1HDZA 1N2CB 1U0SY 1V39A 3TR0A 3UMVA 4YAKA 4NNPA 2CNOA 3KQMA 3RC8A 3JU3A 3CSDA 3SE7A 1Y1SA 1OZHA 1UP7A 1EFCA 1ADGA 1LW7A 3THXA 3WLNA 4O63O 3FN4A 3WFJA 2UYQA 3RSFA 4TTVA 4DSAA 1EM6A 1N4DA 5EMLA 1ZJWA 5GJCA 2WKPA 2BM9A 1FJGB 1MVLA 4QDJA 1EE2A 2JCVA 1M2OB 2WOJA 2NQ2C 2VRWA 3MW8A 1VG9B 1IWPB 2FMXA 3DE5X 4TUYF 4KV9A 1ML4A 1XKLA 4KIFA 4Y6OA 3NWOA 3HCFA 2PWAA 3MWFA 5CNMA 3D6TB 4Z9AA 4EELA 4YGXB 1R0ZA 1XQ6A 1CY8A 1SCAA 4RULA 4B0PA 1QQ6A 1I7SB 3WXMA 2JHGA 5F7XA 3PXEA 1F20A 4M9XA 3W77A 3WO1A 3ZWOA 2O7VA 1G20E 2J46A 3EYAA 1R9JA 2FSVA 4FR0A 3ZEAA 3HSKA 4A23A 3CURA 4MV6A 3TF5A 2N42A 3GAZA 2I4NA 4JCCA 1P17A 2PRIA 1DRVA 4MEJA 5FEUA 2FUG6 1CZRA 3FRHA 2AEFA 1K1EA 1R6VA 1AQIA 3KR1A 2JGAA 5B3JA 4BLRA 1YO6A 4D9CA 3A6PC 2YY6A 1Z34A 3DOOA 3DL0A 3MC1A 2NZYA 3VOAA 3ZOZA 3OIFA 1LCIA 3HDJA 2C4VA 2HWYA 1OIWA 2H2GA 4BNHA 4BZPA 4LHZA 3MK31 4Q24A 4QBTA 1ZH2A 4OXYA 3TI7A 5AUQA 3RFXA 5AKXA 4DIKA 2EFHB 4RJKA 3MBKA 3PUIA 2ECOA 5ITSA 2QN1A 3OETA 4ZYYA 4FQ5A 3HK2A 3DV9A 2H4FA 3QNUA 1HQKA 2OLEA 1O4WA 4HTAA 4WZBA 3TLGB 2OAP1 3TMAA 3KVVA 3KPJA 2FWRA 4GS5A 3G2LA 1YULA 4QRIA 4KI7A 3RVOA 2HPHA 3SYTA 2DUMA 5HEKA 4X1KA 3VR1A 1T5HX 3D3WA 3E61A 2VDLB 4LRXA 1PN3A 3VYSB 3FYUB 2FWAA 2C9DA 2WWIA 3VC7A 2QTGA 3E58A 1EXNA 2VDUE 4WWHA 3LH5A 4P3NA 2PUDA 3GDGA 1XTVA 1MOQA 2UVPA 5KVVA 2WIAA 1TK9A 3S0JA 3WXBA 5AJVB 3RG8A 4DV2B 3LNTA 4G5OA 4OBBA 1B00A 5A5VA 1H8EA 4MP8A 2X7XA 5EI5A 2RGNA 5KNCH 2WJZB 1AVTA 5U4XA 4F8JA 2J5BA 3QU5A 5AKKA 2NVBA 4N41A 3B5IA 3ORYA 3V4VB 4YJDA 4PRYA 2ZOSA 3B60A 1TZJA 1VKRA 1ITZA 3NETA 2DLDA 4HGOA 3J81k 4EGSA 3MTBA 3BSSA 4NE9A 4OAPA 4UVEA 4X45A 5DMHA 3IR5A 5T4HA 5JS2A 5AVRA 1HE1C 2CB9A 1P1IA 2YNMD 2EZ8A 1HDEA 4MGHA 2FX2A 2VKTA 1SVSA 2AT1A 3E27A 3JQDA 3KR2A 2CF6A 4XVUA 4HWTA 2Q6IA 3M5WA 3H42B 1ORHA 3LQQA 3JARA 4JBGA 4YAOA 2XD9A 3T95A 4OH1A 4JBLA 4KWEA 2CHGA 3NIBA 1M2GA 1RMTA 2B3TA 4GNKA 3GT0A 1GHTA 3GBSA 1AX9A 3AGPA 1B4DA 1ICEA 1XJ0A 4Q66C 4TTAA 1Z18A 4GYJA 5B1HA 1EGMB 5TQ2B 1ZD1A 1A27A 1DINA 3HP4A 3HJBA 3L02A 3OWOA 2YV4A 3AJAA 3QX9A 4GSYA 4A8JC 4DTIA 1RW4A 4R2IA 2DMRA 4P3OA 4ETWA 1R8XA 1J33A 3E1SA 5K3SA 2E89A 1JAXA 4JR2A 3DT6A 2LKDA 3D2CA 3W5HA 5B7PA 4HC4A 4CQMA 3KHTA 5JZMA 2DEUA 1J5EB 2QZPA 1N6NA 2ZT5A 3NIWA 3TR6A 1T0UA 3GR6A 1PFVA 3TO5A 3T9EA 4EI7A 1JLMA 2CMDA 3L93A 3G2IA 4U4AA 2QRKA 3SJ7A 3ZVRA 3CKYA 1L4NA 2P2SA 4BFTA 2BFBA 3L4JA 1US8A 1GM5A 5CVCA 3SZ3A 1WPXA 1LW6E 2J32A 4KMSA 1SWWA 4W6ZA 3RVLA 2YOGA 4EOGA 2C77A 3BIXA 4ZVOA 5EG5A 4UM5A 3HCNA 1XEFA 2PS9A 4LJ7A 3BD6A 5TY0A 1YB1A 2ZJ6A 3MHPA 2QGNA 1Z2AA 5BSKA 3P0FA 4KN5A 3HKDA 1J0XO 2IWHA 1UBNA 2HJWA 3PNSA 3SZLA 1CF9A 2CCKA 2GVDC 4YFVA 5AJYA 4CLOA 3IV9A 4M0EA 1KO1A 2G9ZA 2OXFA 4N8DA 4RKWA 3GFTA 7YASA 2WSBA 1MBZA 3DHNA 2TECE 1Z17A 2PS3A 2E2WA 4Q34A 1ADBA 5DWQA 3B51X 1T29A 2BEJA 1CS0B 1Y4UA 1YRYE 4LUCA 5E8JA 4E21A 1NVVQ 1XYGA 3OE5A 4TWJA 1Z36A 3D3EA 4QXAA 2MR6A 1VE3A 4WEOA 1ZZEA 2ZRKA 2ZXFA 4PLHA 1VTKA 4K2HA 3CN7A 3VR2A 3DP9A 5T41A 3OWXA 2V7WA 2QTNA 4F12A 1XZMA 3HPRA 1WXIA 1PD1A 2P2YA 3OQPA 5EJIA 2OD7A 3TAXA 1P91A 1GNVA 2DM6A 3X1JA 4PN3A 1DCTA 2IX3A 4XX0B 2PUTA 3H05A 1WU8A 2RE8A 5BV7A 4AJJA 1KOJA 3IELA 1PD0A 1ZI8A 2OCKA 3CG4A 3OUUA 4NIMA 3WJ1A 3U6BA 2JKVA 2L2QA 4NFHA 4YY3B 1O8CA 3RYFB 5G4LA 1DUVG 1NUPA 2H9IA 5AOBA 1CY4A 4KZKA 5CDYA 1EXWA 1U5BB 3ODPA 5I7HA 3GA0A 4I9UA 2ZSUA 4H59A 4F38A 4IDFA 3HEBA 1Q7GA 3PA8A 3JR7A 3WB1A 4UJ5A 2ZJYA 1BXZA 2Q2OA 2QVGA 2R47A 2X19A 3CH4B 3IQGX 3DE1X 4Q3DA 4WFJA 4JWTA 4DABA 1T3GA 5B2FA 2XJ4A 5L95A 4M87A 4BO8A 5AVSA 4LW8A 2G71A 2IUFA 4DLNA 3OQJA 3GN2A 4A0FA 4CKZA 2W6OA 2REQA 3I6MA 4MWCA 4ZJUA 4K9OA 1L5KA 3IAFA 5IVHA 4KRFA 4Q3OA 3AG5A 3SDSA 1JDPA 3FUCA 4DV4B 3V8NA 4PGMA 4EH1A 5KAMA 4GMKA 4KNVA 2QIOA 4M8IA 1NYQA 1PL0A 2G5PA 2YZNA 3DMHA 1X1RA 4FKMA 4B4KA 2YVAA 5BSEA 4Z3OA 4LN1A 2O6LA 1FBTA 4XFDA 4L5IA 2OWEA 1TAQA 3FMIA 1GZ4A 3HUDA 4TQAA 3BIWA 4WBNA 4BO7A 1LBSA 1N2HA 3LW7A 4GGOA 5DGTA 2KMLA 1SBCA 2WRZA 2BZGA 3BEOA 1XJ5A 4PC6A 4UUAA 2ZWAA 2IDMA 5BW6B 4NBVA 4C89A 1TA4A 1M7HA 3IP5A 3D6FA 1GPNA 2OE2A 3DMTC 3KOMA 1FP6A 3B9QA 4OQNA 4RSRA 4ZO6A 4ZZ1A 3HVRA 4EJSC 2IT1A 3KALA 3BTOA 4TOIA 4JI1B 4AP5A 2ZXUA 2NZWA 3CPHA 4BBAA 3NBKA 2YJ4A 2A7XA 4H7EA 5DXJA 1YUBA 1UCFA 4RK5A 4M9SA 4C6HA 2JANA 4WN9B 1WUKS 2CUTA 3N28A 4JUDX 4FJ1A 4F7WA 3CWCA 3OCXA 4Q7JB 3TDNA 4MQUA 3KT3A 3ZIUA 4G3XA 4JVLA 1W49A 5DGCA 5AXDA 1IYZA 2G6TA 4F9EA 4NESA 4YP7A 2PXXA 3NM5A 2J3LA 3E84A 5EUCA 3T15A 4UTPA 5L45A 2ZZMA 3NRBA 3K9CA 3U7QA 1BG6A 1QFYA 1L5MA 3CR3C 3LUBA 4KR0A 3QIVA 1L7AA 3QEMA 4S1TA 3GLHB 4CKWA 5JRJA 4AUNA 1YD7A 2G67A 3REQB 4HDAA 4K6MA 4I1PA 1IC6A 1M1YE 1KP9A 1Z8FA 3H2ZA 1G8YA 2C9MA 2VNIA 3BIFA 4LVNA 4DEVA 2PKXA 1EUZA 3KU4A 2AWNA 2WF7A 3OX3A 1KAEA 5DEIA 1XA3A 3I28A 3I1YA 5FWAA 5BXQC 2ZYTX 2QVBA 4PPFA 3V1MA 2Q3BA 2DLNA 4J6FA 4UHEA 2DUJA 5E38A 1XFAA 3MD9A 2AUNA 1KEPA 5CT8A 2J5XA 3G2JA 1QM5A 4RACA 3BHJA 3T5DA 1OX6A 4AZTA 4I1YA 3H18A 4ZYTA 4INPA 2R6JA 4FEYA 4GZ6A 3QSGA 4MP6A 1M34E 4KQFA 2VUTA 3IOBA 5J3JA 2QAGC 1O87A 3W9BA 3V1KA 4O4IB 4A6EA 2AF4C 1QB7A 4QUIA 1EJ6A 2VL7A 4IJVA 4HTFB 1DLJA 1NWHA 2HRQA 1YQ9A 3AUTA 3AVVA 3ZDCA 4NRDA 2LIVA 4RJTA 4WCFA 4NZ9A 3GFOA 1IONA 3DP7A 2W6CX 1SVMA 1QF9A 5T8KA 5BUQA 3HV0A 4NYJR 4BO4A 1AHHA 3VR4H 3L9WA 3UICA 1HRKA 4HCJA 4RKYA 5AKYA 1UFQA 1RAEA 1ILWA 2IK8A 1VL2A 1CRZA 2W37A 1X7WA 1MT3A 2ZYAA 4WXHA 4Q93A 1HUQA 4J16A 2L82A 3CNHA 1KTVA 1QOQB 1UKCA 5DTQA 2WFAA 4FUTA 4QYIB 2YYYA 1N8NA 1NVAA 3MMXA 3FOAA 3N2EA 3N74A 4DNXA 3QMMA 2XOXA 2FLWA 2BM0A 3R20A 1O89A 4H15A 4H3KB 3TMKA 2HIHA 2VXCA 4P7FA 5JPDA 1RP1A 4XPIB 2A0FA 5F1YA 2OG2A 5B30A 1BYIA 1ZRNA 1UC5B 4L0CA 3E3MA 3OLQA 1I7QB 1CWUA 2Z1DA 4FKBA 2GARA 2VDVE 5I7AA 3RQIA 3W9YA 2ZYSA 4E2XA 1CDEA 2KJQA 5H9WA 3LVRE 1T13A 4XWKA 3WGZA 3B7PA 1MB3A 3E05A 4LMAA 3ST7A 1EFRD 3I6YA 4K9PA 1RU3A 2Z6QA 4NFLA 3R4CA 3X2SA 1NLFA 2XUZA 2HK7A 1YDWA 2FKAA 4I2NA 1JECA 1LQ2A 3OTWA 1OWPA 3ETCA 4INOA 5G1PA 5JXJA 1HV8A 3MTIA 3GLGA 4JGGA 4PYIA 2RGEA 4FWBA 3H9UA 4IV5A 3RC9A 2W2NA 4TKLA 2HOQA 3UN1A 3UOGA 3ZIAD 4DWVA 2XKAA 3ZBPA 3G3EA 3LZDA 4NCXA 2VUIB 4MLZA 4M3NA 5E3HA 1IRIA 4D56A 2I54A 4IF4A 4US0R 4U9UA 4BRZA 2QRJA 1EM8A 4Y1FA 1GSOA 4I5FA 5JG7A 2WG2A 5C8DA 1PJZA 3DAFA 1JHAA 2PD4A 1FCJA 4WW0A 1P19A 4DBLC 5GMOA 2ZRMA 4Y2QA 3VZRA 4MW0A 4R2LA 4PZUA 4AMGA 2M6KA 4JASB 2QS9A 3QE2A 2IZ5A 4KR2A 4M7WA 1E1CB 3ANTA 2DUUA 4U5XA 1G4AE 1W2HA 4RA9A 1C1YA 2VNSA 5BV2P 5AO9A 3RYCB 1J97A 1M5RA 1QRDA 2OV3A 4JI5B 4OL0A 3JWIA 2R8XA 1F14A 1RI3A 4WA7A 1JEYA 3KJQA 3HI4A 3H9BA 2WU1A 3TGWA 2K2WA 4HAIA 1NVXQ 1U4NA 2FQWA 2JKZA 2ETVA 3VU0A 3WQQA 1RJWA 3O8CA 1JLLB 3RSZA 2YKGA 3JALA 3DZGA 3G68A 4MQBA 5AM2A 1IXYA 3LKDA 1O9BA 1VKZA 2R66A 4Y0AA 4W9MC 4G4JA 4K8OA 1KGSA 4MYUA 9LDTA 2HF7A 1IPFA 3BHNA 2OFXA 1WMFA 4EFDA 2DT8A 4F4FA 2AZDA 4J3JA 3VPHA 5ADWA 1JQAA 2CC2A 2D1SA 1COWA 1IAQA 1N6RA 4MKZA 1NN5A 1E6UA 1VG8A 2QUAA 2E48A 3L7YA 4CMEA 5EZ6B 1Q95A 4YR9A 3HXLA 1E63A 1NYLA 1Z13A 3A9TA 1XCLA 1D2MA 3H0EA 2CCGA 1S7CA 1QVVA 1J07A 3H1AA 2P0EA 2I7TA 5J43A 4BO6A 4BQQA 1T5OA 2FPOA 2ARKA 3LQ2A 3CU5A 4BIMA 3FOFC 1XLWA 3AYXB 1ND5A 4CKYA 4NPHA 5T57A 5LQNA 2GZ3A 3BWMA 2GM4A 1Q0UA 4KLNA 3PVCA 4NYMR 1GTSA 4I1VA 1I6KA 3LLCA 3NHFA 1DGQA 4N5HX 4DCOA 3IMKA 1RPTA 4Z7QB 1NUUA 5E6UB 4I0WB 3TTXA 4DCMA 1U9ZA 2XUDA 2QX6A 1C4KA 4WY2A 3VNUA 2AWOA 3K9HA 1VB5A 2J9XB 2JHAA 2H3HA 1B26A 3DZFA 1LSOA 4HYEA 1GYPA 2XQFA 3I2FA 5LU8A 1GFZA 4RF5A 1OLSB 2G5GX 5LDGA 1Y4AE 1LZLA 2FHSA 2WWHA 4TQUS 2QK4A 4JC5A 4OSEA 5AW6A 5IDXA 3GBVA 1ZU4A 3S81A 1IM5A 3TNDA 5DLEA 1U9IC 3GBPA 2IITA 2R97A 3BA1A 4N6OA 1X15A 2FR1A 3ANXA 4A2CA 2YINC 4M60A 4LJ5A 4Z2YA 3UT5A 1GARA 2H54A 5HDBB 2ECFA 3N75A 2IY8A 2V4UA 4RKQA 3AW9A 3W5JA 4LJRA 1ZN8A 3MYYA 2O14A 4ER3A 3A7DA 3G5LA 1GFWA 3VTFA 4COKA 4F2DA 5KPDA 1N75A 2B5VA 5CA0A 1S8OA 1IN8A 3CMCO 1B2LA 3EEFA 1KSFX 3EVCA 3Q9LA 4ZVTA 1Z08A 2YDYA 3GRCA 2WMYA 3O75A 5KREA 4HH1A 4DMCA 1MNAA 5CDGA 1RQ2A 3JZFA 1CEQA 1GLVA 4ZDJA 1AMNA 2CFSA 2VSOA 3JAKB 1H0SA 3HR7A 1DV1A 1SXJE 2HA7A 2OG1A 3K0SA 2PL3A 5KSWB 2Z4SA 4X63A 5K45A 3EISA 4ZCTA 5EXDA 1FSPA 3NP9A 1EWYA 2JIBA 1QMGA 3HDYA 5CUQA 4RGYA 3LRPA 3K6SB 1CB7A 2NYUA 3L7BA 4BMVA 1WZUA 1EX7A 2KBFA 5FR1A 3G1WA 3QE3A 3NWPA 4G56A 1OZAA 1AQYA 3C7CB 2XNJA 1W48A 4GQBA 2DPHA 3AUFA 4KN6A 3VO8A 2AC7A 1M33A 4BQNA 4F92B 2XDQA 4DDTA 1AO0A 1JHRA 4QU8A 4IG9A 1U9YA 3LKVA 2HSZA 4NMMA 2XVXA 3ICPA 1WDWB 5CM8B 3VYWA 2WAAA 3M5DA 4R01A 3BJIC 5FPPA 5K8TA 3IPAA 1CJKC 1P5FA 2AKYA 2HA3A 2I71A 2EV9A 3V5NA 3KSZO 4C4RA 3PLAE 4QATA 1TF5A 2RGDA 4TT8A 1G41A 1XCOA 3BQNB 2X58A 3I1FA 4AXXA 3M33A 1HFEL 3TLBA 1Y4SA 1NKSA 1IBRA 2VHCA 5ERYA 5H8WA 2XWPA 5FTNA 3OCVA 5B1SA 4R68A 4BKRA 1PQUA 1D6NA 1NVFA 5FO1A 1ADJA 2XE7A 1A7KA 5DNYB 4QUKA 5IVPA 5HTOA 4Q7KA 4K6KA 4DUYB 4JC4A 1F4LA 3SIPA 4D0NA 1BQ4A 1IY8A 1FNCA 1H5QA 1TADA 1NUTA 2XEDA 1YI0A 4HDQB 5CHEA 4EF6A 1TUBA 4QEDA 5C7LO 3L8GA 4MS4B 4ENPA 3FZNA 2HRBA 4JUFA 1DAKA 2VK4A 3LDHA 2PWPA 5CTJA 2C61A 2XQIA 3DWGA 4QASA 4U1RA 2XQJA 5ADHA 1U7XA 5IPFA 1W5BA 1JG6A 2PSDA 3GJ7A 4ZV7A 1JQKA 3NJRA 5C1PA 5MFPA 5F12A 5H68A 4YBRA 3DOHA 1CBUA 3GGDA 3M8KA 2IPNA 2WHPA 3EZ7A 3QVMA 4HH0A 2YQZA 3PA6A 4LBWA 4Q6BA 3QBTA 2WVHA 2YWGA 4H17A 5LNK6 5J2UB 2JLCA 2R1VB 3PYLA 4G5GA 4R41A 4X41A 1I0LA 5FUXA 1R0YA 4BASA 1SK8A 3TSAA 4CMGA 2X9QA 2CJYA 4D3ZA 2QMUA 2UYCA 2JZCA 2EP8A 3KKKA 3CB2A 4MRSA 2X0FA 2HI0A 2D2VA 2RHCA 3DFZA 4OUKX 5E9JA 5KNDD 4DV6B 4CFZA 5FORA 1IH8A 4CI0B 5IU6A 3W05A 5LSAA 1QNLA 4NYIQ 2B92A 1L1FA 1I5OA 4M22A 2W8ZA 4D46A 4TL7A 4D57A 1JKXA 2IXFA 3SC4A 4K1LA 4IJ5A 1TC2A 1DQZA 1FRVA 1F0YA 1GV0A 1XU9A 2DWPA 3OZAA 4HP8A 5EZSA 3ETLA 3IVCA 2FFRA 4OP2A 4GQAA 3R5JA 4RNCA 3K9GA 2XVYA 1PHPA 4XCXA 2E87A 4J2HA 3CUTA 2GKOA 3A25A 2H1LA 2ZR7A 3K2IA 1B43A 1F9EA 2DC1A 2Q27A 2OAEA 3G0GA 4MA5A 3PEEA 2O2IA 2IU0A 2WAOA 3RNOA 3KVYA 3V1YA 3UGKA 3KKOA 4OXKA 5H80A 1ISMA 3LWNA 3E5NA 3N2GA 5C7IO 2FTKE 4UULA 5DYWA 3S2YA 1XZKA 1K7FB 2XBUA 3CW8X 1Y3BE 4ROTA 1OI2A 4CKBB 4F2GA 2IXEA 4HL6A 4IINA 3WDMA 4QO7A 1RIIA 1TKBA 4WSOA 4I3HA 1JPJA 2PN1A 1ZISA 2RB5A 4TYNA 5KX5A 4P38A 4TTIA 1ETHA 4LYGA 2FZ5A 5IT9A 1E5XA 3D6VA 1YE8A 4QTZA 4IRUB 1B1AA 2OHXA 5DP1A 3U48A 1WETA 4FEGA 2ZUSA 1TA0A 3EH2A 3K2QA 4OHWA 3HVIA 3USZA 2Z2JA 4JI4B 3PQ5A 4B3HA 1M6WA 2BIFA 3PUJA 1C3XA 2ET6A 4RWZA 3V33A 3NHAA 4WKPA 5IYZA 1U28C 1S3IA 4AQYB 2Q1WA 4GR9A 4JP8A 4JXJA 1B0UA 1EUCA 1L7BA 2FPKA 4QXMA 1MUUA 5BYBA 3VJMA 3W8EA 3WAKA 4QM7A 1G63A 1KKMA 3DDWA 5ECGC 2G7ZA 4Z0HO 1LDGA 2G1JA 4IO1A 3NDIA 3Q88A 5AKHA 5DHRA 5J63A 4CZ2A 1LI4A 5FR2A 1DKMA 3HO6A 1M8JA 1IN1A 4EI2A 1N6IA 3AILA 4ZOLA 2PR2A 3NNSA 4MR8B 2Y1FA 5IBRA 3KUDA 3STXA 4BFYA 5A6VA 1ISJA 3KVOA 4F3KA 2C4KA 4FHZA 4GOXA 4M9ZA 2GEDA 4QJBA 4JI3B 1E2JA 1GJRA 1WW8A 2R7MA 5LP6A 1TU3A 2C42A 4OJTA 4CG3A 2DR2A 4YRQA 4HBGA 3GUYA 5AK0A 3CZCA 1LC0A 4FX5A 4ON9A 4K6FA 1AA9A 4D2IA 4F4HA 4V1CB 1CDOA 4MX8A 5L4LA 3I39X 4IEFB 2XF2A 3LTEA 4B4DA 3CEPB 3ET4A 3JAMA 1SPBS 4N76A 3ORFA 4UCWA 1GCGA 2PUJA 1IM2A 4QBHA 1H9AA 1EFTA 1SIWA 3KL2A 2V7BA 4Z86A 1U0BB 1G0NA 2XDAA 3NHZA 4FGJA 3CRRA 1E3EA 1FY2A 4ZO7A 2DXIA 4JS0A 5JSZA 5K7SA 5TPZD 2NVUB 5DN6D 1HY3A 2W5UA 4EG6A 1J5XA 3OG9A 4EA7A 1LY1A 4I6EA 2DT5A 1Z8HA 3E9NA 4A92A 2NZ8A 3IT1A 2IYFA 4JVNA 2BLLA 4WI1A 4JOBA 5CEEA 5KSZA 1AHNA 2WG1A 4F71A 4O8ZA 5EIFA 3SJBA 2BHTA 3GXOA 3KFXA 1JG2A 1NULA 1HNNA 2OTCA 3GLHE 4XD2A 1WSAA 1RXUA 2GAFA 3D81A 5D3MA 2W70A 2X86A 1V7CA 3AUAA 3GLQA 3DDHA 1Z39A 5ARCA 4OP1A 1FMJA 3EGDB 4C4SA 3D5QA 5A62A 3T7CA 3U40A 1QG4A 3IQIX 4PWZA 2JH3A 4D0SA 3HS3A 1YAJA 1X13A 2JFXA 4Z9XA 2P0AA 4MMXB 4MAFA 4RZUA 1JEEA 3NNNA 4V0LA 1OTHA 5AOVA 2D3TA 3IE2A 4DR7B 4Q21A 1F8YA 1UZUA 2DTDA 5C3MA 2H1SA 2UZ0A 1P1FA 4IS3A 2QPOA 2GCGA 2H2WA 1XZBA 1P2VA 3KJIA 4I9HA 1YS7A 2H11A 1UDAA 3HDTA 4QX6A 3DFKA 3MINA 3EHDA 4NNJA 4PZ9A 1KYYA 2AHOA 4WCVA 1YRLA 3PFCA 2ORED 3SX4A 4NHOA 2CUNA 1N1DA 3I9V1 1MO5A 2Q21A 3KKNA 4PO9A 5EKTA 3OTOB 5JISA 3U26A 5CB6A 1KU6A 4QIHA 4AULA 4LRYA 1H6CA 1HT2E 1O95D 4G1EB 2IEIA 1ZMTA 4D9MA 3EMDA 2BKEA 3MS2A 4BO9A 1PZFA 4I6JA 5KPJA 2Q2VA 3EXHC 1QE0A 1FP7A 4RO0A 4PC2A 2GN8A 2ZCVA 5BRNA 5TQ2A 3TEFA 5HPYB 2ZROA 1IVSA 5AVXA 1MX5A 1RACA 1MQ8B 2HSDA 2ZYHA 1YZGA 2EAUA 5HK8A 5LM3A 4ZXPA 4F8EA 3DVAA 5IN5A 1L4LA 1G20B 4V39A 1CQIB 1RHRA 4KJZA 3UXEA 3EBLA 4MRNA 4WGGA 1E7SA 5AKEA 3ETGA 1TPYA 4FPXA 5EWMA 3NEJA 3UB4A 1DJPA 1YOBA 4UCQA 5FB3A 1YRWA 3U9TA 3BRSA 3DE4X 4DIBA 3KKPA 2YIDA 3AKYA 1Y9ZA 4BMNA 1QPBA 1XDGA 2Z43A 3SHWA 2O4CA 5DHFA 1PSZA 1RI4A 3U6KA 1MXFA 4BO1A 2ZSHA 1UEIA 1E9RA 3DBHB 4PINA 1XRMA 5DLPA 4NECA 5HIMA 2Q7OE 4ABYA 5E4YA 5IUKC 2C5HA 2Z4RA 3THXB 5KNCA 3AP3A 1BVRA 4HDNA 3ND8A 3NR2A 3VNAA 5FBQB 4MIOA 3UWPA 2RG7A 1FZQA 1SH7A 1Y98A 5EXPA 3E35A 1WNFA 3D4NA 2QD5A 4BNZA 3W2GA 1JB9A 2ZBVA 3QSYA 2WZBA 4A15A 5HILA 3BH7A 4B3BA 2QN6A 1TECE 4BNKA 2JJ2D 4XSVA 1RQNA 2JAQA 2ORWA 4TTJA 4RQTA 5M2QA 4B6OA 3ZE9A 2AFHA 3G0DA 3S6JA 1JI3A 1UK9A 4D74A 5A04A 1RRCA 3L8MA 3SPXA 3U4CA 1XDUA 5BOVA 3OM0A 1EJ2A 2BGTA 2O05A 3CWZA 3KNZA 4GG1A 3I9V6 2H1RA 5B58T 4CMCA 4XR4A 1SBIA 2A33A 3WKAA 3PC2A 4LCJA 2QZZA 3EGXA 1VLZA 3GMTA 3TZHA 4J76A 1JAIA 1UAYA 3R0QA 5GOZA 2FZGA 4X8MA 2Y66A 3L6UA 4CEHA 1F5NA 1Z73A 4N4AA 5E1MA 3TB6A 1P61B 1TK2A 2H2IA 2XH8A 4OMDA 1ZM9A 1QQ5A 1YE3A 2ECPA 1GWNA 3C3XA 2CLEB 1QHSA 1MOSA 3P45A 4MXDA 1DLIA 1AKQA 1YOVB 4YFYA 4IDEA 1LDMA 2XKBA 1DJQA 3CTPA 3D4BA 4CN8A 5AVTA 1V1MA 4JZKA 4CM8A 4ACBA 1P2TA 3QPCA 1U04A 5DULA 4N5MA 4P5PA 2N1MA 4HDKB 1SEPA 4QO8A 4DBLE 4LV6A 1C9EA 2K5UA 4K8RB 1GT91 4PXSA 1YUMA 3EZXA 1IY2A 3HQ4O 3WSTA 1UZLA 1A88A 3EGOA 5J2UF 1DAEA 2LGJA 2PTGA 3LE8A 1EGQA 3G0HA 4NE7A 3QVGA 4ECEA 4NJEB 2HIAA 3DNFA 1Q20A 1UBHS 1U2ZA 1I7PA 3AIMA 1M6VB 4Q15A 4UEJA 4ZQEA 3QF4A 4XE5A 2Q29A 3DWEX 4RANA 1C0IA 3GVCA 5JECA 5I7OA 3KWJA 4XUEA 1TKRA 4QREA 2V7VA 1EB8A 1P0PA 3SFZA 4DLWA 1FXWF 4GH5A 2X6QA 2QUBA 1E2DA 3IRVA 5IT4A 1VI6A 4DBZA 1G6Q1 4P4GA 4F60A 3A06A 5AW0A 5EJ5A 5JT1A 1QKKA 2NWQA 2BKUA 2AG5A 3T8YA 2ID4A 2JFYA 4PANA 3T1NA 3QHQA 1IPHA 2W11A 4N3AA 3E3OA 4BYMA 1QRUA 1CQPA 2H1HA 4AYTA 1YJCA 1L7QA 3R9XB 1RYNA 5DPMA 3WKCA 1ECLA 1X39A 4MYHA 2IYSA 5DCYA 3WGNA 4PFKA 4AC9A 4IUCS 5JS8A 1ONOA 3OIUA 2WFLA 3MPOA 1MJGM 3JTEA 2C20A 1E61A 4HXEB 4ISBA 3NKVA 3ND9A 3SQMA 2FFHA 4CCYB 3ZJTA 1I4OA 2IRWA 1EYZA 3TOCA 3FRIA 1QYVA 1CP3A 1SNYA 3UW3A 4AKIA 1QB8A 3DBRB 3I52A 3U56A 1Z4MA 2MSNA 3RLIA 2JH8A 4RCZA 1SY7A 4LOJA 4OI0A 2BDEA 2OT3B 4L27A 1QIHA 2JFQA 4P81A 1WD5A 4U0JA 1BXRA 1VJGA 2IU4A 2ZJ7A 4ZV4A 4ESHA 3BVPA 1NJ1A 5BWLA 3KJXA 3O9ZA 3CLSC 4GLLA 1P3DA 4A2PA 2D7JA 3SQLA 1PU2A 1XMVA 1Y89A 4GXTA 4C5AA 3KTAA 3QWHA 1NL3A 3DW3X 1C81A 4N18A 5D7BA 3RARA 1LDBA 2FNAA 1WXWA 4UM9B 3GLFA 3UAGA 4GBJA 1G1AA 3PGMA 2A1UA 2FUKA 1KA9H 3PHCA 5CXSA 3BPSA 2P8SA 2YYZA 3EQ7A 4WY8A 2BBTA 1A95A 4HH3C 2M2IA 2Q28A 3SQOA 1KQGA 2ZJZA 4BB6A 2X0NA 4MQEB 4IDDA 3R76A 1FQKA 2I3ZA 1P3JA 2YJ6A 4GYKA 1H1TA 1H2WA 3FDIA 3QFTA 1JLHA 2VYVD 1QP7A 1J4AA 1KPIA 3B9PA 1LV7A 3RVPA 1L3BA 2V97A 2VQSA 5AH0A 2ZUEA 1HE4A 2GEFA 4BQEA 3QWIA 2P2NA 4PGGA 3C14C 4J1QA 1AB6A 1HO3A 4HATA 5ECWA 3DHEA 2D4AA 2KQUA 3LPLA 4IWNA 1U0RA 2ZS8A 4PS0A 4N0DA 3TRJA 3VVMA 3WYNA 4IMIB 1TRHA 3RBXA 3O8QB 5LQKA 4FSXA 2I2WA 3EVEA 3LYUA 2HWKA 4MK4A 1CUXA 2GI4A 1L5GB 3WLSA 3F1KA 3TIXB 4HB2A 1IWOA 4R1OA 2ZUDA 1I80A 3QNWA 2V7TA 2HLDD 4QDKA 2RCNA 5EJ6A 4MRRA 1C0PA 3PGA1 5LP6B 2F8TA 1J8QA 4ZO4A 4DZRA 2RIRA 2I1WA 1YK1A 4UCXA 4OXIA 4JI8B 1O7JA 4XGKA 4XIYA 4EYSA 3HLYA 2BEUA 2WHRA 2C7QA 4F5ZA 1S2DA 5K8VA 2CHFA 5DTIA 3H8SA 3PXXA 4X54A 2XUIA 3N87A 4H3SA 1PDVA 5L9AA 3PDCA 3AZQA 3SWWA 5AP9A 4RAOA 1T9CA 4G5RA 2COUA 5DGXA 3NDPA 3ICWA 1GOTA 2WWGA 1EVEA 1GR1A 1DKRA 3LFTA 2QA5A 3OIVA 4Q3AA 1T6BY 1NBMA 2YWBA 4AYXA 2CMHA 3F96A 2HWUA 2JD1A 2JVJA 2VAXA 3BS4A 3FCCA 1DX6A 5KJ1A 2HJVA 1I9CA 3C1OA 2O0KA 1UUFA 3JWGA 5K4HA 3CRMA 2I2AA 2Y93A 1HTBA 4BJHB 1IUPA 3URMA 2WABA 5U9CA 1XRJA 2PL5A 3JQGB 3NYWA 1RZUA 1I3OA 4MV3A 1DC8A 5TT0A 5LDDC 1FFGA 2PBLA 4KQ2A 5M3BA 5JAIA 2WJ3A 4RTNA 3NMUF 1H0HA 3U44B 2A8YA 1YOVA 3BK2A 1BXKA 2FUCA 4N0EA 5EVCA 1OFUA 3VNBA 3UENA 2R8BA 3NU1A 2QR2A 1VQ1A 3EB9A 1E60A 4YT5A 5IAKA 3S1LA 3PFBA 5FQOA 3IAM6 4FBLA 4D42A 2OBBA 2XOKD 4PGFA 1I5EA 4AKGA 1WB9A 4DLSA 4P4NA 3RU3A 4QSMA 1PR0A 3U81A 5LXTB 2BZSA 3DGFC 1VXRA 1OX4A 1PNTA 2AJDA 2QPTA 3K0AB 4OMFG 4YP1A 1X38A 2IHJA 1CR1A 3DAOA 3L6EA 1U8EA 3PC7A 4YTEA 1WXDA 1NU6A 2J0UA 3UTCA 3DV2A 2OILA 2I4IA 2AS0A 2C58A 2Y1EA 3SX0A 3ND5A 4BQIA 3NBZC 5ALYA 5C9ZA 4I99A 3ZV7A 3QFRA 1GQSA 1T3HA 3EIEA 3FCYA 3I2GA 2FQXA 2E4WA 3QPBA 4OHXA 1JKIA 1UZNA 1BKSB 2AG8A 3DCJA 4K2AA 1R15A 2ZXEA 3GC6A 4MROA 3JQFA 2AFHB 1PR1A 4PM4A 2PZ8A 3Q6IA 4EHJA 4RD0A 3EVDA 4CMAA 3A27A 2IXDA 3GGCA 1BDJA 3O3MB 4PCVA 5EJAA 4IQ4A 5HFNA 3T06B 5LQUA 1YDGA 1FB5A 1RM0A 4Z4IA 2QMZA 1ZZGA 5A0FA 5H4GA 4NOJA 4ZCIA 2QUZA 2AMFA 1DTSA 4IJMA 5AUPB 5DI3A 3FPBA 1E5TA 3DR3A 5LIRA 1U3FA 1IXSB 4TZTA 1XNJA 4IGAA 2WV7A 1W4LA 4RZXA 3U7EB 4G85A 3CH7A 5B2EA 1CP2A 2O8CB 3QG1A 3P2IA 4REQB 3TUJC 1H8HA 4MB6A 2C03A 5DHPA 2O8DA 4YR7A 1SWVA 2G09A 2B7CA 4B6SA 3HMKA 4IAOA 2ERXA 3KTFA 3Q7IA 4XUCA 3D59A 4KL8S 3JXEA 1F2TB 1NI4A 5EWMB 2YV1A 1KYVA 5FA6A 4ND6A 5CT4A 5FO0A 1G16A 5FUVA 3Q8MA 1MC1A 2Z2XA 1U3TA 2P3QA 3L0IB 2HNAA 1L1EA 3GQBA 4W6QA 3BCSA 3E7WA 3OQ6A 4E5PA 3I9MA 3W5CA 3RK1A 4YRZA 1AQLA 1PJ8A 4XCVA 3WMGA 5EN4A 4GMXA 2JA1A 1NONA 4U7GA 1O96A 1PT6A 3CR7A 4JLSA 2QY6A 4K9QA 4PX3A 4WAUA 1PQYA 1THZA 1MV8A 1RPAA 4FTWA 3RC1A 2EWMA 3TTWA 2CNWD 4LSZA 3B7GA 4TS4A 1T4CA 1A7UA 3GCWA 5K8JB 3CVXA 3X44A 1LA2A 2P1RA 3TW6A 3FTDA 1BX0A 1S4QA 1JMKC 1PZGA 2IWRA 3H13A 1L6RA 1KL7A 2LDXA 2WF5A 3TPFA 3OFVA 3LO5A 1J49A 4G5YA 1GXSA 1Q7CA 1WULS 3KDAA 4BNDA 2NQ8A 1FL9A 4EKNB 3HNRA 3KVRA 2HBRA 3IKMB 2B9EA 1DIAA 1DMRA 4O0MA 1E2BA 2XOKA 4M37A 3I9JA 1JA9A 3C8DA 5KOHA 1Y7PA 2XUQA 3R7DA 3WWDA 2GD0A 3AUUA 1DIBA 4AZ3B 3PX7A 4WECA 1QTIA 3ZUPA 1IUKA 3U4IA 4C7KA 4K1XA 1O6CA 4RV4A 4EJFA 1E66A 1TEHA 3FMVA 3HA7A 1WLSA 2DBRA 1X77A 1V47A 3U60B 1PHRA 4EAAA 4H6WA 1ADCA 3BXZA 4MYRA 2IYZA 1AQJA 1AKUA 3ED5A 3EVFA 5FJIA 2BFMA 5ICCA 3FR8A 5KU1A 3RRMA 2CEAA 4QDOA 5DNCA 4CQNA 1JEOA 2VYFA 5H3HA 4B7AA 3I8XA 4HRXA 1GGHA 3EZ9A 1W8IA 1DWUA 2NU7B 2VDWB 4ARAA 3ZHXA 1C0EA 1DP4A 1MZVA 3CF2A 1EVQA 5CB4F 1ULZA 3DDCA 3PLRA 3Q2IA 4DADA 1X9HA 1XN1A 4UHKA 3U61B 4XCQA 4LZOA 4URZR 5FWNA 4QHYA 1INLA 4D02A 3MGGA 1USKA 3REFA 4RVFA 3V2HA 4WFKA 1E2FA 4WFIA 5FPKA 1HT1E 3ZI0A 1SZDA 4FW8A 3ABSB 3BXPA 1YSCA 1Q2UA 4U2BA 4MLDA 4B3GA 1XX6A 4JL6A 4C4PA 1Z2NX 3UUWA 3CCFA 2B5WA 3G5TA 1MH1A 4P22A 3ITDA 2ZQ5A 3PJEA 3DE7X 3QWAA 3JWPA 1VGQA 3F6RA 4HNHA 2HQSA 3GOQA 3GEPA 1XHLA 4Q00A 2FR8A 5LLTA 1QAOA 2B37A 4LTNA 2HHHB 4B6PA 2CJPA 1EE9A 3GCZA 4YAIA 3UKDA 1JIQA 2W93A 1B8OA 1A5TA 2PX5A 3O38A 1QQAA 2HUNA 4DC1A 2B1RA 2O1EA 1RJ9A 1MXHA 1OFTA 2PQ6A 1YBHA 3F97A 4JNKA 3OMWA 4X60A 5AR1A 3ZCUA 1E1QD 1FMLA 3QVOA 3R9WA 4DDHA 1PYOA 3DPIA 2ZM6B 1CETA 1D2EA 3T1HB 4E09A 2VAMA 5IYZB 4UAJA 1DJLA 3DDUA 3BFXA 4ZD6A 3LCMA 1KOLA 1DO8A 2LD4A 1E1RD 2MU1A 2XUOA 4FFBA 2B8NA 4B7XA 1B1CA 2EC5A 1JUDA 2E18A 3E1KA 1XELA 3IYLW 5EMNA 1GQQA 1C9MA 1KVQA 1Z7WA 4KTVE 1U0EA 3CEAA 1XXHB 3I32A 3P8ZA 3LW8A 3EIWA 1K68A 3DA8A 4GPAA 3VTKA 3WRYC 1D1QA 5IBCA 4O1HA 3KB8A 3NOVA 1UODA 2WMNB 4QVGA 5B53A 3A1UA 5CDFA 3K8QA 3I45A 2GILA 3V48A 1YH3A 3TQHA 3KDSE 1EXMA 1U1DA 2I3GA 2YZMA 4UUMA 2HO5A 2J9GA 1QH8B 1QCZA 3QQ5A 3GEGA 3NTUA 2XDYA 3PCTA 1PL7A 1KY2A 2IDJA 2J6HA 3K1JA 4C7VA 3EBPA 4YV2A 1B0ZA 1CDZA 1K8RA 1LF0A 3PUZA 1CZNA 1J56A 1X9IA 3Q0IA 4GZ3A 4QBKA 4AJHA 2XYQA 5CA0F 2WNHA 3QY9A 1A4IA 4BCBA 3NTOA 3L1KA 1LSSA 1Z2EA 2O2HA 4XEUA 5G2OA 2H4ZA 2BP7A 4YDSA 3GNQA 4IX1A 2AFVA 4UOEA 2PPVA 1P75A 1W5SA 4TWAA 1DAPA 1U3UA 4E4YA 2PH5A 2F4VB 3F5SA 5NULA 3JZDA 3PXAA 4GRDA 3LL7A 3KV1A 2GEUA 2XA9A 1E3WA 5KOJB 1JU3A 1ZOPA 2BFEA 2GVZC 2NV0A 2X2PA 3PFIA 3GLRA 4N7MA 5GGYA 4E13A 5CG2A 3CVYA 4L5BA 4QNRA 3HO1A 2SCUA 4Q1EA 5JNVA 3BXXA 3F4KA 3T52A 4B73A 3FAZA 2Z1MA 4B83A 3DTNA 1V2HE 4B2LA 1SU8A 1YAHA 4F6LA 1DIOB 1MU0A 1M7GA 1D2HA 2Q2QA 1Z0UA 4K26A 3VZBA 3ZJUA 3OAAA 3PWTA 3KTDA 3TQTA 2JIZA 1D0VA 1OKKD 5EP4A 3V34A 3ONFA 2E1RA 2O0MA 2L18A 1FTGA 4FOPA 4OYRA 1NG9A 5BVHA 5ICEA 3H6HA 4IEIA 1NBME 1CF4A 3RQSA 1XALA 1LRJA 4YECA 5IJZA 3OJWA 3D4LA 2I2FA 3W2FA 3D6MA 4B9EA 5FPHA 2LPMA 1G9XA 4YLEA 1PWHA 2FKNA 1FNDA 1KARA 1Z06A 3QKWA 4CMIA 3P52A 2PE5A 1BXGA 3ICVA 4Q3NA 1UZMA 1JLKA 3ORRA 1P2GA 4MZXA 4IFTA 4WK6A 3AF3A 1QHHB 3LHIA 5EERA 4ZDIA 1GTL1 1JPNA 1QNFA 3PXBA 2VPWA 3PDJA 3ZWMA 2QHXA 1SR8A 4O8CA 4LHWA 3HJUA 2JJYA 3A14A 3P2JA 5IAGA 1GY8A 1JFRA 5AW4A 1I3CA 3R5TA 4N01A 1TO6A 4BFZA 4BO3A 3S29A 1OI3A 1U02A 3AI2A 4MUBA 3BD8A 2AOWA 4EB0A 1S1CA 1U3VA 4JI7B 5BY2A 5D1NA 2E55A 4YXWD 2Y05A 2OZVA 2Y68A 3JYOA 1KAOA 2VP5A 4IICA 4H08A 3H4VA 4RIIA 4A7PA 2NPFA 3N0VA 4ZCSA 2JJ8A 3PC3A 4RL4A 4G8JA 3AXTA 5EIOA 3UF0A 4AMYA 2CVQA 2AYXA 1VHJA 4YT8A 4BJ5A 1J70A 4X3CA 2B1QA 1Z4NA 3KX2A 2OD2A 3LP8A 3R6TA 4KV7A 3TIIA 1R0SA 3F71A 3L0BA 3QLTA 5SZHB 5HF9A 1ZVVA 1KZHA 1JSCA 1Q77A 2O57A 1M5TA 4I1OA 5LQMA 1EJBA 4ZTUB 4AIIA 4DRXA 1XMIA 1EFPA 3H9CA 4NCJA 4YRSA 1WXEA 3FSGD 2AL7A 2UV8A 1D9XA 3VZPA 1T26A 3ZJ4A 3FYUA 2BI8A 1TMOA 2VF5X 3U31A 3SC6A 5CA1F 2BC9A 3JVDA 4IVPA 3H65A 3WYGA 4R8SA 2VP3A 3B3JA 1MPTA 2AK3A 4Y2RA 1P74A 1U3WA 1XMSA 1IY1A 2H5LA 4KVFA 2HIMA 4WZAE 1FRNA 2VPTA 3HJAA 4CDRA 3P0EA 5KYNA 1DRKA 2B69A 2G70A 2QR5A 4JLPA 5CPBA 3ILXA 2VSXA 4JJAA 4S1NA 5CFMA 1NTOA 1KEVA 4O59O 2ZJ5A 1BX1A 3Q7QA 1C7JA 1GQOA 2AEMA 4GGPA 1O97C 2RKOA 1ZNYA 1USVA 4UNPA 3JASB 1AUPA 4BNLA 4JI2B 3CUVA 3GFBA 5ALNA 3W6NA 2XQGA 2AMLA 4LSWA 3T35A 4C1BA 4HGQA 3B48A 1Y9EA 3L46A 1I4WA 1NQUA 3X3HA 1JLSA 1ZNXA 4B3MB 2D3WA 1QIFA 3I9NA 4MB0A 4HDRA 4UZSA 3B9BA 3HRIA 1ZH8A 3RO7A 3MAAC 5IG2A 1K0FA 2HL6A 1DT5A 3AJDA 3ER9A 1FX0A 1K7EB 1NMXA 1NVDA 2W9XA 3AIIA 1T9AA 3O93A 3VR4D 1HBJA 1ECBA 3L92A 4GMGA 1JDBC 1FS5A 1WUHS 2JFUA 2ZTSA 3GY0A 3QKIA 3REQA 1UPBA 3AGQA 4LJYA 3AB3A 1BTOA 4TGLA 1G59A 3WYDA 1JHYA 4KX3A 1T9DA 4MQ5A 4I4TF 5JAMA 2C98A 1TTTA 3AEUA 3T3PB 1FJXA 3VU1A 2GH1A 5CK4A 1XMOB 3CBQA 1Q1AA 2H1CA 3K32A 3UHFA 3I58A 4G26A 4QUJA 3EF3A 3KE8A 4GI3A 3II6X 4RVDA 2V55B 1RYHA 1NN1A 1T5TA 4HGNA 1J2RA 1MG0A 2R7KA 3OZGA 3QUQA 4QGAA 1MAWA 4IBOA 4E30A 3AJ9A 4PQRA 3F6SA 2FEPA 4JB3A 1A9XB 1EFLA 3MRXA 1M8PA 4YRNA 2V0GA 2CBXA 1E3JA 4HRYA 2H92A 4LJ4A 1H05A 3ASUA 1P9RA 4XXHA 5KAPA 2XAUA 4D4JA 2QL6A 1GPYA 2P41A 2QQEA 2X5XA 5KZMB 3K8OE 3VDMA 2HNBA 1SCBA 1DT3A 1IBKB 2LCFA 1Z29A 4GXRA 1Y1LA 5DT9A 1JEAA 3RT9A 4W5QA 2W8BA 2EHJA 4D8UA 1B8PA 2E5WA 3BL8A 2BFCA 3FDJA 3ZEIA 3TZLA 3T3HA 2WTBA 2F3PA 4B2PA 5H59A 2FW1A 3DVSX 1XN4A 4XR9A 1V43A 1T43A 3MWDB 1LBIA 4J0QA 1W4BA 2E6UX 1E6CA 2IS4A 4FVTA 4QTTB 3CF0A 2YVQA 1GL3A 1WCIA 5LIPA 1Y7HA 1P2UA 4YT4A 2PRJA 5JAPA 1NQVA 1ZEMA 4R4JA 5LCXA 3UB3A 1EIWA 3KYDB 5CH8A 3CB4A 1YR9A 1FUYB 1F1JA 1S89A 5IC5A 3T3GA 1V2GA 1IY0A 3WKEA 3RYHB 3R3UA 1GPJA 1W46A 2RGUA 3R7WB 5HGXA 2NTJA 4WOJA 3D1VA 1YGYA 4XDGA 3BCHA 1RHUA 1QF7A 1N5RA 3HKCB 1LLCA 4D81A 3DMFA 3P0JA 4JSTA 1S8NA 4X0EA 4A26A 2UZ1A 1KI2A 5EINA 3JQBC 3W8RA 5KSYA 4F3RA 1FXSA 3EAGA 3PSAA 4MZDA 1JF8A 3H2JA 1XZ8A 4FSHA 4QU5A 4LNAA 3EUEA 5EJ2A 5FCDA 4XA8A 1T36B 4BGEA 5FPYA 1AUVA 4P9NA 4RGBA 3ICQB 2XBLA 3FSRA 4IZIA 5D3QA 2OQIA 3IDQA 1XD8A 2W4MA 4MV8A 4RY2A 3GEBA 4R2MA 3H2SA 2YMLA 3WMFA 2R5NA 1EWRA 2OMKA 3BMOB 3I34X 4JP3A 4MS1B 1WSBA 2G9NA 3SI7A 4BJ1A 2AMJA 1Q5PA 1YQDA 4A0GA 4L8LA 4KH0A 3GG9A 3AUYA 2AE2A 2WJVA 1LDEA 3EA5A 5DTMA 2GN1A 2Z4TA 2FFQA 2RHHA 4JR1A 3RAJA 3ZIAA 3VPCA 3TM4A 3MOIA 4DT1A 3QX7A 5BRJA 4DXDA 4ZQCB 1G7RA 1UBSB 1N2GA 2C8VA 2NM0A 1MC5A 2A5YB 2IEDA 2ZJBA 3AHIA 4IGKA 4O25A 4Q4JA 5ALHA 5ALIA 2V9ZA 1JFSA 4GPTA 3U37A 3WHIA 1KXJA 1PTKA 1A9ZA 1BHQ1 1G7TA 1T6YA 5KDLA 4J0CA 3WVNA 1R8QA 1RHJA 2WHEA 3FGOA 1HLGA 1BMQA 3B1VA 4G1VA 5JFOA 3D8UA 3ZU5A 3I05A 1UPTA 5GIPE 2X0JA 3NCTA 3BJZA 4CM8B 4B45A 3IR6A 3ZVNA 1JFFA 3LLMA 1ACLA 4JI6B 4E2FA 4C7JA 1M1ZA 4NY1A 4AWXA 1IJEA 1JH8A 2IYNA 4RDCA 1TD9A 2DPMA 1TB4A 1JMYA 3F5MA 3JQCA 3L4BA 4R5HA 4PYRA 1FTNA 3X1YA 1PO7A 1PS0A 4ESVA 4HQFA 2XYRA 1W2GA 1I6LA 2WLTA 3F7OA 5DGHA 1TI7A 1NN0A 3C24A 4I4TB 3TZQA 3OE4A 1RPZA 2P7IA 2XUPA 4J9VA 4MLCA 5ELLA 5GJWC 3MLEA 2BFNA 1J20A 5F4ZA 2XB2A 2OHVA 4TSRA 2WB2A 4FYVA 4HMOA 5B6IA 1XKTA 4BVGA 3FMGA 3MM4A 4FQ7A 1AF4A 4C29A 4EDHA 2HPZA 1I13A 4F4JA 1UEXC 3NONA 5F5XA 1ZLYA 3O1JC 4MS4A 2DFPA 3HCWA 1WKVA 4AMUA 1H9BA 3AR5A 5HX7A 2IS6A 1HC7A 1PV1A 3JW8A 3M2PA 1FQWA 1YVRA 5AK6A 3ZDYB 2OMEA 3ZW9A 4ZAYA 1VDMA 3INRA 5IK2A 4GE0A 3O21A 4NV3A 1KMHB 1D04A 4UTOA 1G5TA 3AEKB 4MPTA 4P7GA 3DE2X 4WK2B 3V6LA 4FYJA 1OBFO 4DMLA 1GGFA 5KS2A 3H3FA 3WQBA 1RYMA 4PNZA 4TL8A 3GLHA 4UM7A 1SN7A 1RVV1 3A9VA 3AR3A 3GO4A 3V4PB 4A0SA 2PL9A 5FYDA 3S2UA 3SS8A 5KTTA 2ODPA 3P2YA 1WF6A 2FY8A 1QJCA 2O07A 5FOWA 2WIBA 3AI1A 2V5VA 2O3TA 1FMCA 1PNQA 2OV8A 2XTAA 1VA5A 3ENWA 4QDTA 2PX0A 3P26A 5IF9A 5JVDF 5LZ9A 4D8YA 1VMDA 3FPSA 4XX0A 1D0IA 3EEYA 3HLTA 3JD0A 3NHLA 4PZLA 4UZEA 1KY3A 2FWBA 2ORYA 3I1IA 5DNUA 3OHSX 1I24A 2Q4TA 2JNWA 1E3WB 2FRDC 3G23A 3OZSA 4IKOA 4MV5A 5EHIA 4KQXA 1NR7A 2HBQA 1W5AA 2A4MA 3COPA 1MG5A 3NRCA 4WXPA 3T5AA 2ZJ3A 4CFSA 1VSVA 3LL4A 5IHXA 1W35A 3MUEA 4I36A 2QYOA 1HE8B 2F1RA 3O2JA 1T0HB 3RYIB 1EGAA 2PNFA 2XZDA 2H57A 3QLJA 4RELA 1Y7TA 4MO2A 5F23A 4KWTA 3IEKA 1N77A 1D0SA 4KGVA 5BORA 5HIAA 4WJLA 3NHYA 2IPAB 3H2IA 5ILQA 2ZPTX 1D8AA 1ZOOA 3A4TA 2LKCA 2WF8A 1GA1A 1G8KA 3K09A 3OLVA 3R6WA 1AURA 4I9GA 4WKBA 4NBKA 4QXRA 4J7CA 2X1MA 1MV5A 3M1IA 4XWAA 3EXHB 2ZRHA 1KS2A 2PMFA 3TKLA 4BNFA 1LX7A 4B71A 4C78A 5TEWA 2R7LA 3HCEA 4MRMA 5HMLA 3O9MA 4MW2A 2BDTA 1M7BA 3KETA 1JNXX 4KFCA 2ZRNA 3B6ZA 4QSHA 1NDQA 3STVA 5K3EA 4N5NA 3MGKA 3LBIA 2NXWA 3G85A 4Y1GA 1TCAA 1YQGA 1ZJ6A 3BBPA 4MCIA 1NYRA 1WP4A 5EHXA 1FVHA 3I4LA 2XHZA 5EFZA 5FI5A 4U0KA 1M1YB 2Y0EA 1ECJA 4D96A 2IIPA 1UBTS 1EK6A 4JD5A 3ZIDA 3FNHA 3IAUA 4BVFA 1J2JA 1ZL2A 3HFSA 1QHEA 1VC2A 3I2IA 4QEKA 1XZQA 2IW3A 3MCWA 4UEQA 2DHCA 3DC2A 5CVJA 5MN6A 1KQPA 3ENQA 4RVOA 2ZRJA 5ESDA 4NBWA 4I55B 1QHFA 2OSBA 4F97A 4HLQB 4CQLA 4DHWA 3CGGA 3AM5A 3Q2KA 5DYIA 3DVQX 2EP5A 2FCRA 1CE8B 3EXFB 3LT0A 3T5BA 2EX0A 4C14A 1NVEA 5AI4A 1R10A 4WLEA 2AFIE 4EP1A 4GOMD 1WUJS 3RF6A 4R1PA 2CHUA 2ZIZA 2FP4A 3BMOA 3CMMA 3AJRA 4MS1A 2VYND 2D7DA 2Z9BA 2C00A 2D0PB 1KJJA 1YZTA 2XB4A 3RBAA 3TLGA 3WWEA 1C7ZA 1LRKA 3QM1A 4Q1AA 2HO4A 4M9QA 1P6UA 1TF2A 4H4DA 4X94A 5TS3A 1V5FA 1YZKA 4MW7A 2IHKA 3DOEA 1O08A 3RLFA 2JBHA 4JJ8A 2G9QA 1PZHA 4GFDA 3RSLA 2CEKA 3AY6A 5JYDA 2AG0A 3CLRC 4CEJB 1JE0A 5AVVA 4PYMA 4C6SA 4I4NA 4O4HA 4CE6A 3J81A 1GG8A 3WX0A 2CCJA 2PX3A 2BUAA 1LV8A 4DCTA 1QZZA 1MB4A 4XIJA 4TYMA 2IYAA 3LGAA 3RVMA 4CETA 2XNDD 2CWWA 5BN3B 3IAM1 1CJBA 3ZVMA 1OSNA 1NNI1 1VE1A 1HA3A 3BOSA 2WHXA 3FPKA 3NGLA 2CWDA 5ITWA 2F4NA 2Q5JA 3FKQA 1HURA 1UFVA 1ZBDA 3PXUA 4NYIR 3DAHA 3C7KA 2EERA 3I04M 1E6KA 2O8EB 1K7CA 4RPLA 5FIUA 3WC4A 3C4JA 2AFRA 3PUWA 2BONA 4ASUD 2BGKA 1OX4B 4J16C 5ENDA 1JKJB 1P5HA 1U7ZA 1TMYA 2HTFA 5EYPB 3WWOA 4C05A 2BGUA 4PZZA 3WKDA 3DB1A 3GT7A 3HU5A 1XTRA 1DJNA 1JP7A 4LDRA 4ZOCA 2I6SA 5AM4A 4XQCA 4IP0A 4MW6A 4C7BA 1IVYA 2J31A 1FMFA 3ZCVA 5LYJF 4Z5XA 4CR6A 4RSMA 3CNEA 3OIWA 3NHRA 5DV9A 5BVGA 2ODAA 6CHYA 4HEJA 1O0BA 1JZQA 2DFDA 5AKLA 3FPCA 3EN0A 4IQ0A 2R4UA 1U2PA 1L8LA 2FPWA 2J3KA 3D6HA 3F1LA 2WJYA 4WADA 4F11A 4LFAB 3DKKA 2ZSEA 2OK7A 4GPBA 1C29B 2Z2IA 1QAQA 3TZCA 2QN7A 4XJTA 1TCVA 5JC1A 2Z83A 3LKBA 4P4SA 4E08A 1TVKA 3GP3A 1WM1A 4UEOA 3BXFA 5G41A 4AWBA 4DWJA 2P2LA 1MW8X 3V7UA 2ZIWB 4EW1A 4Z49A 1CUEA 5KYUA 3QI2A 4YASA 2OFPA 5KVQA 3DYBA 5K3FA 4NPAA 1DNPA 1BX3A 1R8JA 3RVJA 5JDIA 3KYIB 2G7MC 1BJTA 2DKNA 4IX9A 2JLZA 1KKUA 4OQXA 5K0NA 3VR5H 1VL5A 1BFDA 2GN2A 3AOEC 1C1HA 3BGIA 3N6XA 3QXCA 1UADA 2XVAA 3CPSA 4M0KA 4MV1A 2CLOB 5CFNA 2Q8PA 1KWGA 1T2NA 3HU1A 1XV5A 2PKQP 2Y0DA 4KFRA 1DEOA 1MCZA 1P6XA 1K08A 2ZVPX 3ADKA 1I2DA 4J94A 2WKQA 2ZVJA 1SUBA 4PR0A 1P7CA 1MIOB 2FZ4A 5CLGA 5G1OA 2WYOA 4GT1A 5I9LA 3K6KA 3W5IA 2RI0A 1EQUA 4LF9B 5ALSA 1NU8A 4PYNA 4RVHA 4DREA 2PBRA 4DCPA 1AK9A 1XZCA 4DJFC 2Z08A 1SIBE 2P2ZA 3ILVA 5ADVA 1NSFA 1R3DA 5KI6A 4D3XA 3OX2A 5JO0A 1YRQA 1U3GA 2FJPA 5EWJA 2J33A 3UJ7A 1P0CA 2XECA 2PGIA 3DR5A 8OHMA 4Y30A 4MJLA 2E82A 1G9SA 2C94A 5IZCA 2IBSA 3ZHZA 4A8TA 3BWXA 4CV1A 5KKNB 3A0UA 4R83A 4ND1A 1QTRA 4EY4A 3TVTA 2XJ9A 1WQ1R 2Q0QA 4MDYA 4O4JB 4QNNA 2ZB3A 3RRJA 3U0BA 4AO6A 1Y81A 2CL0X 4IWYA 5G4KA 4AY5A 4ZOEA 3VGJA 1O0SA 1TO1E 1YQXA 1TJNA 5HA5A 2X4LA 4HFMA 1EVYA 2D2XA 3JQ8A 1QTNA 4JFAA 3UOWA 2XGGA 4MV0A 3RRBA 1FFAA 2GN4A 4ZYUA 4H0FA 2GCOB 3JQ9A 7REQA 2EFEB 2HMUA 4EMBA 2Q45A 3SHFA 1ENOA 3MGBA 2K7FA 4D8VA 1DI0A 1PFUA 5FWYB 1V5IA 2GXQA 4L50A 3A6DA 3FOBA 3VTAA 2QJFA 2H4WA 3FLAA 3Q7PA 1G5HA 4AN0A 4D8TA 2I99A 3RIEA 5K8CA 3S8EA 2PYZA 1A77A 1PJCA 1TGVA 3Q8XB 2YNMA 1PFGA 3DH0A 1C3LA 1XRPA 3BRWD 3EF0A 2EJWA 3GRYA 3HCAA 1JIIA 4FGZA 4JENA 3SNHA 5NLLA 4DFDA 3FDZB 3LSTA 4CMKA 3RAGA 4KQIA 4WOCA 4WX2B 1H1DA 3SOZA 3PS9A 1O95C 3HXMA 1XMQB 4ZJZA 4CKEB 1WDTA 1TZMA 1YR2A 3VR6D 3FFWA 2C1XA 4UBIA 3O26A 4QOFA 2PFKA 3N2KB 1LPOA 3E3AA 1VA4A 1RYYA 2ZI6A 5C8YB 1LPMA 4JDPA 3QMPA 4EARA 3BHMA 3IIIA 2HMAA 4LEIA 3D5EA 2FP4B 4JK3A 5EP3A 2R48A 2GF0A 4ZICA 5IP5A 1W94A 1IN4A 1YIDA 4UMVA 3LBAA 4JJ7A 2IJGX 2O2YA 1GA6A 1F2UA 1YB6A 1LI5A 2MJLA 2YJTD 4GRAA 3FTPA 4YA6A 3SK0A 3EG5A 3NI2A 1DMSA