2FW6A

Structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) mutant h59n from the acidophilic bacterium acetobacter aceti, at ph 5.4
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
159
structure length
159
Chain Sequence
SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSANRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Biochemical and Structural Studies of N(5)-Carboxyaminoimidazole Ribonucleotide Mutase from the Acidophilic Bacterium Acetobacter aceti.
pubmed doi rcsb
source organism Acetobacter aceti
total genus 51
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 2fw6A00
5CLHA 4Z7JA 1D7AA 5CTJA 3ORSA 3RG8A 4ZK2A 5CVTA 2FWPA 5BORA 5CLJA 1U11A 2NSLA 1XMPA 3TRHA 3OOWA 1O4VA 4YCCA 2YWXA 4AY4A 2NSHA 4JA0A 4YCBA 3OPQA 2FW6A 2FWBA 2FW9A 2FW8A 2FWAA 2FW1A 5BOSB 2H31A 4YCDA 5CLFA 5C5DA 2FWJA 4GRDA 4ZJYA 2ATEA 4ZC8A 2FW7A 2NSJA 4AY3A 3KUUA 5CLGA 1QCZA 4B4KA 5CLIA 4YCJA 3RGGA 5BOSA 2FWIA 4ZMBA 3LP6A
chains in the Genus database with same CATH superfamily
4NVRA 3IHLA 3AY3A 2FW0A 4Y6RA 5AK4A 1XO1A 1UQTA 1IZ7A 4RGVA 3GQBB 3CKLA 1NVKA 1OV6A 3PPVA 2WMYA 2HSEA 2VF2A 3EMBA 1NUPA 3JZDA 1S2LA 1NOKA 2DGDA 3NHZA 3UJNA 2HU8A 2EYUA 4UHKA 1JXAA 1YR1A 1V1MA 3GT4A 1AQJA 5DSTA 2RG1A 2VJPA 3VDMA 1G4AE 2RGWA 2J4DA 4QYWA 3IDAA 4UVDA 2IIVA 3WK9A 1Z45A 2HQBA 1XRMA 4UTPA 2JVKA 2OG2A 1EHCA 3HJAA 3TQTA 3P8ZA 4D3XA 4DMCA 5KQMA 2PNFA 4E07A 3AFOA 4J0KA 3BMCA 4CRWB 1HG0A 2HSDA 2NQTA 1YB5A 4TZKA 3KO8A 5DHQA 3K9BA 2PBRA 5J5VA 4B6GA 2VF4X 2Y9PB 1XAGA 1IXKA 4EHIA 3Q9UA 2C7RA 3AEZA 1WZIA 5LBIA 2B4YA 1P80A 2PLRA 1T6NA 1NPDA 2BKAA 2BUCA 2FP4B 3AQIA 3B9QA 1RYFA 1LFAA 1VG8A 3I28A 5CK4A 2XSZA 3OFSA 1A9YA 1ECPA 2FW6A 1M34A 3LA6A 3TRJA 1E4VA 4BFXA 1YJ5A 2PMDA 1FLVA 4IH1A 2I29A 1PT7A 4D3DA 3EGWA 1N1MA 5C3MA 3FOAA 3MVEA 4IG4A 5G1NA 2C2ZA 3HCNA 3M3PA 4GZ5A 1V39A 2C20A 4TMXA 3WMRA 4AJKA 2IYRA 5BSVA 4YBZA 1JAXA 1EUCB 4H3KB 4FDVA 5GV7A 3KRTA 2WU0A 1OXXK 1Y1QA 4OG2A 3H1PA 3PSAA 1LK7A 3QY9A 4F56A 1D7AA 3VR2D 3EXIA 1NKSA 2JB9A 2QK4A 3K6KA 5FOTA 3TJRA 3QTBA 2XB8A 3MWJA 5JSZB 3IAHA 4UDXX 3ZY2A 5AHWA 1T9KA 3QVLA 1M2WA 1Z12A 3I23A 1KJZA 4RS4A 2Q1TA 2ZJ2A 4D4HA 1BXRA 2WJ4A 4MQMA 4PS0A 3PL5A 1C1XB 1J1ZA 2GD0A 2EEZA 1LW7A 4KLNA 3BG5A 4ZK6A 1FP7A 3MTEA 3B6ZA 4I4NA 3LFUA 4DR4B 1E3MA 1W581 1ZIYA 4KN5A 4OYHA 2YFKA 1RHKA 2RC5A 2MR5A 2RGEA 2ZRLA 3L1UA 3ILXA 4ND6A 5DLYA 1LSUA 2ACEA 2XB6A 5FNVB 1VE3A 2EL9A 2C2OA 4CFZA 4EFDA 3A1DA 1NVVR 1TADA 4FOOA 4E13A 5BYKA 5CLHA 4FT4A 1K6JA 1G16A 3AR6A 3HDQA 4WH0A 2H59A 3FWNA 1BGXT 1MC4A 1HURA 3R5KA 2I2DA 5CG2A 1H1TA 1VLVA 4D4JA 3BFPA 3LT4A 1JA0A 4X91A 3NHRA 3PXGA 5D51S 3BMOB 3T38A 1XRLA 2NO7A 2Q6IA 1E77A 4F9TA 3HJUA 1YXMA 4F60A 3W4JA 1UZUA 4DRXA 3O8OA 2OMKA 3F1KA 4KQ9A 5DASA 3V8PA 1VE5A 1W8IA 2KX7A 2X2EA 3K8OE 4Q1CA 4N9WA 1R4ZA 1YRYE 2ZR7A 1ESCA 4Y9TA 5A5FA 4KFRA 5EMLA 3G1WA 4H7DA 1LBHA 5D01A 3SJ7A 3J80A 1QYVA 4KRFA 2DKNA 3DDUA 2XZPA 4GEKA 4MSUA 1F7VA 4LJRA 1HYGA 5F9MA 1JLLB 3B6KA 3LDAA 3H75A 3M70A 1NTRA 3KQUA 3I6MA 3JQBC 4LGYA 3LRPA 3DDZX 4DNXA 1GFZA 1CEQA 2NSYA 2X8WA 3H2YA 2MHCA 3BMXA 3RGWS 2ZTUA 5HK8A 4DCUA 5ANRB 5FBRB 3HH8A 3HVKA 1QVWA 3PPIA 1Z2OX 1FS6A 3QHQA 3QI2A 3OLVA 4IXWA 2B2CA 4M8LA 4MEJA 4MW9A 4Y1FA 2EJUA 3ZJTA 2O0LA 4K81B 4NENB 4YH1A 1CQWA 4C0KA 2ZVDA 4BATA 1U8CB 4DG8A 1Q11A 4GPBA 3R0VA 1GPYA 1U0SY 3ECCA 5IDXA 1JVSA 2ZFUA 3F5MA 1C0PA 3SF8B 2Y93A 4S1TA 2ZT6A 1ZEJA 4F3TA 2O2GA 4JBNA 1PQUA 3KPUA 4ITUA 5JEDA 3WIDA 5JQGA 4JI7B 3ZD8A 5KHLB 1GZDA 1KC1A 1XB2A 2HK6A 3IXMA 4OHPA 1IEWA 2EWWA 3KQSA 1JVNA 3Q7PA 3OCCA 2I7XA 3A7DA 3G79A 3K8ZA 4YMWA 1DC7A 2FK8A 3ILVA 5AYVA 5JYEA 3FZNA 5ERGB 2H1LA 2WTEA 1YAHA 3W3AD 2R6HA 4OHZA 4CXMA 3JR7A 1CZNA 3QFCA 4IIXA 4X92A 2JD2A 1JIIA 4XVHA 2AI2A 4ITVA 4O0LA 2IZ5A 2DJIA 5EJ5A 4F6RA 3EBPA 3D8HA 1QCDA 4HDMB 1LDGA 2CXSA 4JX9A 1JA9A 4E5UA 5JJ5A 5JASA 3E8SA 2R1VA 4J6FA 4KPUB 4L0CA 4IIHA 2C83A 4S04A 3ZGYA 3GLFA 4IKPA 4NMHA 2IY9A 5E3HA 4YMLA 1PGJA 2IZ0A 1U3FA 1GUBA 3D6NB 3I42A 1AUQA 1TU4A 4NBSA 4XVRA 1V5GA 3AEQA 4DGSA 5FBQB 2XB2A 5IKPA 4ILKA 4ZAZA 1Q3KA 1JG4A 4QQFA 2JFXA 3MPOA 1E92A 1KOFA 3UMBA 2YWEA 4MDEA 4XCXA 1WP9A 4GSLA 4RPCA 1VJ1A 3N8DA 1R9MA 4BKUA 2WIGA 4BZZA 1IYZA 2CVZA 2PX3A 3CEHA 4PG5A 3GJRA 1M7GA 3ISJA 4V1CA 3FSJX 3P5BA 3SHOA 2ZS8A 3CZAA 4RE6A 3UTCA 4FFLA 3FBTA 3AR2A 4MV5A 4GQIA 1AJEA 2F90A 2PL9A 3EPRA 4OLJA 4F3NA 1R0LA 4MRMB 4R2HA 2ZDGA 2Q6TA 3SS9X 2R3SA 4JLUA 5IBPA 1OYWA 1MXHA 4LRWA 5I7OA 3GIWA 3G6WA 3HB0A 3W9YA 2C4VA 1IMJA 3W79A 5LJLA 1VSVA 2BR4A 5JUWA 2DHEA 2RGBA 4JLVA 3RIXA 4EVSA 1F14A 2I3AA 3CF4A 4CLOB 1E64A 3A0RB 1RPTA 2JLAA 1FJHA 4PW0A 3VPGA 1YS1X 2ON6A 4ZYTA 1CJVC 1Z62A 3AG5A 1J7KA 2FX5A 3CWQA 3F78A 1CULC 2OBYA 1VCMA 2Q3HA 3SHQA 1O03A 1UKYA 3GGDA 1WJGA 2P9EA 3IEUA 3VU8A 1EE2A 5GVRA 1JRLA 1ZW1A 3E1SA 2P9TA 3TLYA 4CW7A 5BSUA 4ZMBA 1BKSB 2WV7A 3G8DA 1DAKA 3O21A 4B3FX 4RZ2A 5I7SA 5AM5A 1AXRA 1RC0A 2ONZA 2G82A 1B93A 2BJWA 5K0SA 2BEUA 1VI6A 1MF7A 4JKOA 3ZE8A 4QVIA 2R1TA 2TMDA 4PXYA 3E9RA 4UM8B 4HYQA 1PEAA 4RIFA 3TECE 1CR1A 3P20A 1Z6AA 5TR9A 3TCXB 5HQ3B 2WQZA 1DJOA 1ZJ6A 4LXGA 3AXSA 4V0ME 1GYRA 1QE3A 2J33A 3BIJA 2J3LA 1U0LA 1EJ0A 2CLHB 2QD3A 3A04A 1CUIA 3E3OA 2VBIA 1LPAB 4YAIA 2NN3C 4QRDA 1U80A 3RWBA 3UJBA 1OI2A 3QVWA 3WGJA 3IIKA 4YFYA 3WGZA 2P75A 4J7UA 2HN9A 2HUPA 3KT3A 2VHYA 4WLUA 5THXA 1H2AS 2XZDA 2HWXA 3AHGA 3IAM6 4BZQA 5LB4A 1ESDA 1EFVA 2P8SA 3QU9A 4C0JA 1TAGA 1XFDA 1Q6ZA 1SBHA 3EAGA 3ZWWA 4LF7B 2PLFA 3MMPA 4B3DA 1EFRD 2WHQA 4YCCA 1OZFA 2QP3A 2XTMA 3KCNA 2A0UA 3W3ZB 1WBBA 2ECKA 3KL4A 4I3HA 3RS8A 1SQ0A 3LQKA 4C2BA 4S1OA 3BH0A 4C06A 1CX9B 1QVAA 5TS2A 4LPSA 2A7XA 4DADA 4H7FA 1UMBA 5ED0A 4II3A 2DFVA 5FFMA 1XLTC 1M0SA 1PL6A 2RGUA 3HLYA 5DX8A 2QXYA 4EECA 5EQJB 1ZNXA 2GD1O 3LXRA 1CS0B 1S2OA 1H0KA 3D2BA 2AC2A 1A69A 4DA8A 3ND6A 3SYRA 1OOEA 4PC3A 2DUNA 1XBTA 3ZJ4A 2BEJA 1DG3A 1LBEA 4MV3A 3ZGOA 1EVKA 5CFQA 3PRJA 1MEOA 1XTKA 2JGNA 4UHFA 3V4PB 1F9EA 2B8WA 2ZIGA 3FFTA 3O90A 4Q4JB 3EIQA 1ATIA 1J09A 4UAUA 2PCLA 1W73A 1OIVA 1DTWA 2A1IA 2EEPA 2YNMD 3TR6A 3ZV4A 1L5HB 4NEGA 4EKDA 2HGZA 3R0QA 3M1AA 5C51B 3KZOA 1PJSA 3NOOA 4LGCA 2HM7A 5IVKA 4MDHA 1Y7IA 2W00A 5A2QA 4ATNA 4FILA 2QV0A 2X8BA 1WU8A 3ROEA 4AG3A 3O2JA 1RM4A 3RASA 3GT3A 4FQ8A 3EZ6A 2INGX 4E22A 1ZOOA 5H7XA 3F7OA 1B00A 2ZPUA 1Y4DE 3SQLA 4X7BA 5B2ZA 3BMQB 2C3MA 1WQ4A 1GCIA 5LBUA 3WISA 3KETA 4YAEA 5EZ6B 1TYBE 1UC4B 2VHXA 2YVQA 4XSHA 1AKYA 3PYMA 4RVOA 5EMJA 2JBWA 2EP7A 2XUIA 4M7RA 2BI8A 1BIFA 1A4IA 4TSRA 2V7QA 3OEEA 1CF9A 5F12A 2C61A 3HXKA 3K1JA 1P0MA 3L01A 3SHWA 1PG5A 3VVBA 4EH1A 2VPWA 5I4KA 2VFAA 5JMPA 1OQAA 5AI9A 3TLGB 1M6VA 2NP6A 1LDMA 3N0XA 3MRXA 4MVJP 4YCJA 1PF7E 4HWGA 2AOUB 3C74A 3IODA 3V8RA 2IHKA 1EFHA 4EPYA 2ZI5A 2VS1A 3O0DA 1BEUB 2G9UA 3RG2A 2X5NA 4U5QA 4I4TA 4W7SA 3WFZA 4G01B 3WSWA 3KSAC 3ON5A 2BFEA 3B3AA 5ERXA 3K0BA 1J1IA 3S5JA 3WWDA 4D0NA 4DCOA 2VHJA 1MVNA 4DWWA 2PO5A 1AXGA 2Q5IA 4TQAA 3VGJA 1CJTC 5ES3A 3GL9A 2WJYA 4LZOA 3TQFA 1PUJA 2O48X 3PGLA 2C5FA 4OUDB 4RH3A 4U8GA 1JSRA 1TT5B 5IARA 1E3EA 3AUAA 4Y67A 3TR0A 3VX3A 2O2IA 4Z3KA 1NRJB 2YXLA 1Y1SA 3DGEC 3FDFA 3HGTA 3I8SA 3NORA 4EIWA 2G09A 2M6RA 1TU0A 3DGFC 1G4HA 1SHKA 3LC2O 4RY9A 2D3WA 3WP0A 3AFMA 2QTWB 3GI1A 1GNPA 4JLMA 4YCLA 5FV7A 4X1KB 2IEGA 4XCVA 4ZT3A 3VSBA 3I12A 4I19A 5KNBD 3RR2A 3EFHA 4RXMA 2ZBDA 3ECAA 4RSMA 5EE9A 4O1MA 4WVLA 1C50A 1UINA 4EUNA 3EF0A 2J0QA 1IATA 5AVTA 1FSZA 4NIMA 3CF2A 5BNTA 4R5MA 1X77A 5EIFA 7AT1A 1IG3A 2OILA 3FSEA 3BMNB 1J2YA 3JWGA 1U3CA 3AZQA 1RI5A 4ID9A 1L8AA 2JDIA 3V7WA 4F0JA 4J29A 3ER8A 4RK7A 3KD3A 1T2VA 3S40A 4H60A 1V7QA 4QLBA 4JB2A 2P6MA 3Q3VA 5DDIP 1E32A 2QUKA 3OZIA 4JKYA 5JS2A 3WLLA 3HCFA 1XZDA 4CDGA 3FOZA 4CKZA 4OF4A 5DWDA 5FAXA 1NV9A 1UBHS 2NV6A 1JILA 1FYXA 3MJTA 4LJ5A 4IIEA 3E5NA 1HDZA 3BL5A 5C34B 4XFJA 2ZUFA 2V45A 4JI0B 1G1AA 3ZW7A 4ZVOA 2AZ4A 3AM4A 2I99A 3MTDA 3L6DA 1Y3HA 3SKVA 3ZXSA 4CKWB 1K3TA 1IJKA 5LB2A 4EX6A 4IXNA 5EYPA 2ZBQA 3GVHA 1RLOA 3AINA 1W29A 1E1KA 3V1YA 5KNDA 1OVGA 2XAUA 3NGMA 5FWXB 2VYNA 3PB3A 1N2BA 2YDYA 4Y6OA 1A8HA 4EW3A 2ZSJA 3WGNA 1THZA 3FLEA 1Q7GA 1XD2B 3ZHSA 2JLBA 3QKRB 3E15A 4QYSA 2OWDA 2OEPA 2QVCA 4PSKA 2QENA 3PFFA 3E27A 5EGSA 4LRSB 2PNJA 3DZ8A 1EMDA 4Q48A 4I50A 3QIAA 3KLOA 4H4CA 5E7IA 4C5BA 1GQQA 3VSDA 4NKRA 4B6OA 3L8ZA 3CPSA 4G4SP 1EXDA 2WY2D 2V6MA 3IYLW 4O4HB 3NAMA 1QQ7A 5D84A 3WLJA 3T4UA 1JTFA 3MJ4A 3P4YA 4UD6A 3H8VA 3AK4A 1K68A 4R40A 1V47A 2AEMA 5T8KA 4B33A 3O8CA 2FB9A 3RARA 1WSWA 4C05A 3AT1A 2ODPA 2KLHA 1SBYA 5FA5A 3ADDA 1WG8A 4MQEB 5JAPA 2EZ4A 1NUHA 4D3SA 1UH5A 4LY9A 4KODA 5B37A 3T4PA 3W2TA 5J23A 2GN4A 1ISIA 5TQ0A 3TRIA 4RVSA 4M60A 3A3YA 3UJ8A 3KTAB 2IW1A 1IVNA 3QG1A 4G8BA 4OEHA 4WN9A 1HLPA 1JLRA 3TZKA 2CDNA 3HNRA 4BAGA 3T3OA 1D4OA 1OLUA 3EGCA 1TYAE 4MV1A 4N41A 4DDTA 4TZ0A 3GLIA 2CNBA 4BX2A 4WIAA 2LCQA 1FW6A 1V35A 4MO9A 3OCYA 1YCGA 2FNAA 4R1NA 2QRNA 5EI5A 5K8CA 3L1KA 1TQ4A 2FE1A 3O6VA 4U4AA 1THGA 3QV2A 4YRFA 4BB9A 2EP5A 4HNTA 3KXPA 5FL7A 1YO6A 3LTNC 4TLEA 3H97A 4M9ZA 4BNKA 3B2EA 3LQYA 3P32A 2ZR9A 4IHAA 4PCAA 2C77A 4YFVA 2O59A 2Z6AA 2IS4A 4OAOA 3M3DA 1P7YA 1CUSA 3AMVA 1DQSA 1ZPDA 2D59A 5CURA 4JS0A 2ZYIA 5H3LA 2PU5A 4Q16A 4TRNA 5K4AA 3GJ5A 1M3SA 5AOCA 4ZQIA 2GKOA 3DLAA 3VOAA 5EJEA 1QQTA 4J91A 4TLBA 1FFAA 4LI3X 3A6GA 3UB3A 3SXJA 4EY6A 1DWUA 2NO4A 2JGDB 4TXHA 4BO1A 3MGBA 5F1KA 5JWRA 2QT9A 2EJCA 3HXLA 1GQRA 5A6VA 4MGEA 2C1XA 3OHPA 2YJ4A 3A6KA 4ZARA 2GAOA 3LF1A 1BGWA 1F4PA 1DXOA 1NE7A 1X15A 1U0NA 2PQMA 4WLNA 4XUEA 3GLFE 1YL5A 3BWDD 3P2YA 4OL0A 4BIIA 3FR7A 2ZRIA 5H16A 2ZR8A 1F3LA 3TXAA 3MT8A 3OX3A 1T4GA 4IF6A 3P2JA 2VP4A 2WZBA 1XI2A 4KKVA 4M54A 1SURA 1Z8NA 3UB4A 3ACBA 3VH3A 2OBBA 4N8DA 3GFQA 4MTLA 3F4LA 4PFJA 1BX3A 1M1XB 2Y0CA 3AP3A 1IK4A 4LHSA 5BUZA 3FUUA 1K92A 1OILA 5AVYA 1NLMA 1NU8A 1NJGA 2HIAA 4WXHA 3N2KA 1N6LA 4Z99A 4CKBA 2G88A 3JAKA 5A1JA 5A7FA 3KEOA 4BGVA 2VPIA 5BSHA 4ZAGA 5C8YF 2HA4A 4NULA 4JYMA 1QGDA 4NTZA 1IOVA 3CC8A 1Z39A 1Y4SA 4GXNA 5H3HA 5HA5A 4BWGA 3OQJA 2VQFB 4DRYA 2QA5A 2GZ2A 4OATA 3ZHQA 4DE5A 5IW8A 4TVOA 3AJRA 2X0DA 1X1DA 3PUZA 4DA6A 2JLUA 5C0OE 3LGAA 2VT3A 2YYZA 4C22A 4QL3A 1Q0ZA 3JQEA 4QWMA 1GJRA 1RJGA 4OHXA 4AJIA 3R9XA 1XC7A 3NWEA 3FCXA 4M9QA 4MQUA 2PZBA 5L6LB 3UXEA 1SH7A 5LKAA 2OLJA 1TD9A 1J2EA 4TT3D 3ZDBA 2XDQA 2HBYA 4YB8A 4E31A 2BBWA 4CTNA 1X0XA 3E3NA 4L5IA 3VTAA 3VZCA 1ZUHA 4XASA 5CIWA 5B3AA 1HYHA 3LZ6A 4HEHA 4M7WA 2AW5A 1Z26A 5EMNA 2A9KA 4XYEA 3WGVA 3HA5A 3PTLA 3KYIB 4EEKA 3QQ5A 3NHMA 3H2SA 1V1JA 1SOMA 2NUBA 5B64A 4A0QA 3CF0A 1XCGB 2PZJA 5BN1A 1OB2A 3A6PC 1ISFA 2Q6VA 3CVOA 2YCBA 3OJFA 3QEMA 4NE9A 2FOLA 3GU3A 3HR4A 5NLLA 4IIVA 1A5ZA 3SEZA 1MG5A 1CSEE 1EFCA 1V25A 3VHLB 3L0CA 1VKOA 5L3RA 2HMVA 5KIAA 5L95A 3FE2A 4FDUA 3UPTA 3WL7A 3HU3A 4UVEA 1ZD8A 1ENYA 3BRCA 3QJYA 2K5UA 1VOTA 4REQB 4X7PA 3W2GA 4BN0A 2JCBA 4PHFA 4AL4A 4FSXA 4YJHB 3FDZB 2ECFA 4EJSA 2QSZA 4FYMA 1SGWA 1YIAA 1VHWA 2IPLA 3NTRA 5E8RA 4MIYA 2HH9A 2WJIA 1LCIA 3I6YA 3EC2A 4YT8A 5KSZA 5K7SA 3WWOA 5IJZA 2Y2UA 4OHMA 1P0IA 4OXYA 2WJZB 3GD7A 3MCTA 3OU7A 4MUFA 4F85A 2W37A 1U9IC 4Y7DA 1FXWF 3GP8A 2HBQA 3BHIA 3NVMB 4CQNA 2XE4A 2OHJA 1R16A 1KYXA 3B53X 1UP7A 3K9GA 3NBYC 5I3ZA 1ZRSA 3ZGVA 1AN9A 2ZITA 4GH5A 4EI7A 1M2OB 1S89A 4NYIR 1J7JA 2VAVA 3SC2B 1U2EA 1NT2A 2Q9BA 4QJIA 5U1PA 3D1LA 1Y8CA 2WG2A 2NNWB 1YHZA 4YIKA 2VA9A 1BMDA 2P77A 2B21A 4G67A 2M9MA 1BH6A 5AOAA 5F51A 3NWBA 5KDLA 5JVDA 1ZJ4A 5A4DA 2GN8A 1B3BA 3WYEA 5AD1A 2I4OA 2RGNA 4A36A 2ZBEA 1KH1A 1YH3A 4QVGA 4RCYA 1OLSA 4XTRA 5E2BA 4CN9A 5JNUA 2WF7A 2NNLD 1JLKA 2OFWA 2WM9B 3KS9A 1DAEA 2GN0A 2AS0A 1ZZGA 2QVZX 4L76A 2KYRA 4N3AA 3WXBA 1U1DA 1S3FA 3DZFA 3HGMA 4P35A 2GK7A 1QGOA 3QX3A 2A5LA 4BZWA 2X14A 4EI8A 1KJIA 2O7SA 1M72A 4MP8A 3PICA 3DPIA 1IJEA 1DCMA 1NVTA 4C3VA 5J4HA 1C4XA 1QHFA 1QYIA 1X14A 1SUSA 1KY2A 2E4AA 2KPOA 1IHXA 1BZYA 3MK31 4H16A 4NV3A 4QVKA 4OBBA 4A91A 2F9MA 3TK1A 1H5QA 4U7WA 1V11A 3DQPA 4H1HA 4RCVA 5CUQA 1C7FA 4GXRA 1ZBDA 4LQLA 1YRAA 3GB9A 2QTZA 2Q6OA 4RW0A 3KAKA 4NJEA 4LBYA 5LYJF 1VIVA 2CLIB 4EY5A 3GN2A 4O2BF 1NVGA 4R6XA 5EXTA 1UODA 3ABRB 2SCUB 2GXQA 4PEVA 3MWFA 4CIAA 1T6BY 1YC5A 4HYYA 3CZMA 4UDYX 2Q45A 3KQMA 4UHBA 4WFIA 2RGRA 3O4JA 3QLUA 4QASA 3MIIA 5JRZA 4PZ0A 1CZUA 5FNZA 3DO5A 2YZKA 3ESAA 4YRJA 4E0BA 1OYVA 2PY6A 2IZ6A 3HP7A 4P81A 1T8UA 4HAXA 3R5TA 1UBEA 4Q9LA 4M2LA 5INTA 2X2PA 1OWOA 2GVDC 1TO2E 4EARA 2W5UA 4XQCA 4B80A 1EVIA 3KELA 4C0BA 3A1TA 4LS3A 3H9EO 4GBGA 3JSAA 1JLSA 1P2VA 5EWLB 1MA3A 3GGPA 2OTCA 3M6FA 3IDOA 4S24A 3L4SO 1YI1A 1EJ2A 2BSAA 1W0CA 2FZKA 2FSHA 4Q47A 2IZ1A 4KI0A 2G4CA 2P2CA 3ROMA 3A32A 2FSPA 2X9VA 3LPLA 2DTXA 3BN3A 3V4VB 1G19A 2GESA 1D2CA 2ZJOA 4OM8A 1KQNA 5YASA 1I3NA 1CUFA 1TA0A 1IQRA 1WCYA 3OTWA 3JYNA 3HN2A 4MW2A 1Q2UA 4MIEA 4RCZA 3UGKA 3ULKA 1IB6A 5JMOA 3IDZA 1KGSA 3AF1A 1Q1GA 3G9ZA 4TSKA 3D8TA 5AK3A 1SKBA 2BFPA 4N40A 2G76A 3O8OB 3WLIA 4BMYA 5KYWB 3IQZA 4L5AA 4MQBA 4DOMA 4DLVA 4NEHB 4TMWA 4BE7B 1XROA 5LMCA 4ZFNA 1IXSB 1HMPA 3EFEA 2X40A 2PAAA 1ZOLA 3G0HA 1GNLA 4B44A 2PSJA 3CRMA 3ZY6A 4HGNA 4B8YA 1KEKA 3ASVA 3JYOA 1GVHA 4PSDA 5K2OA 3HQ4O 1WOMA 3ZVKA 1O0BA 6GPBA 1FFDA 1JKFA 1VPWA 3F6YA 4CEJA 1TQ2A 1KP9A 1WTCA 1XMVA 1JEJA 3GC6A 4HAVA 4RV4A 3JARA 1C30A 1MN6A 2IUFA 2J7PA 4S0ZA 5LA6B 1ZN8A 5MN6A 2PD4A 4G85A 4BNTA 2BZSA 1LLFA 4QHYA 3I0NA 1MNQA 4Q15A 4LW8A 2IPMA 5G0SA 1OWLA 1AY0A 1QHYA 1W4CA 5MFZA 1FB5A 3A9UA 4K0KB 3LHFA 1KO8A 1EINA 1JSCA 2XF8A 3S6JA 4HZGA 3IKMB 4Q34A 4DUGA 4WFJA 3Q98A 2VAPA 2JCSA 2VK8A 3D1JA 4CIXA 3WA7A 5CDYA 4FB5A 4LSZA 4XWWA 5AKLA 1Y6FA 2BELA 3KJXA 2GM5A 1SEPA 1ZJ5A 1QQ6A 2ZT7A 3R7BA 1FJ2A 2XMCA 3E6AA 3VTKA 2B1RA 2CDBA 3U61B 5F5LA 1A50B 4PG8A 2A14A 1R4NB 2H4YA 1C9MA 3AI1A 3G0OA 5CA0A 2WNHA 3LFTA 2Y92A 1OX4B 3EVZA 4HB2A 1X3LA 1M1YB 4CTMA 4IDAA 3P2EA 2OO5A 2HY7A 3TOCA 3ZE2B 1P33A 5IAJA 3RFVA 1P45A 3ZNOA 2Y0DA 1W36D 1QB7A 5DBFA 3TRDA 1XJ0A 2ZM5A 3EA0A 3IR6A 1JTVA 1BC5A 1OVMA 4FIZA 1RI3A 1Y48E 3I09A 4B73A 2ZG6A 3NEYA 4KMSA 4NG4A 1SHJA 4ZALA 2XT9A 3W9BA 1W36C 4FD2A 1E66A 1Z88A 5LP6C 1VB3A 1C4WA 5DHUA 1FC0A 2C7QA 2XCLA 1ATZA 4PWYA 4TUYB 4BFCA 1T2CA 3ROZA 2RSLA 4F2WA 3IEPA 3GLFB 2ZLBA 2IOYA 1FP4A 2J5RA 5C7OO 5HRUA 3LHKA 2P0EA 2PT6A 3LPNA 4PQRA 3AUTA 2NTYC 1T4CA 4ERNA 3GN1A 2C97A 2GFHA 5KC8A 4YMSA 1ND5A 3RV3A 4UUQA 1YU6A 4IW3B 5TEVA 1I7NA 4CKCA 2WJJA 5B1SA 3BWEA 3VHRA 4JENA 2VLIA 4KHZA 2QT1A 4DR1B 4TL8A 5EZYF 4RIEA 5EOVA 3L6RA 4X00A 2QZPA 1J99A 3IQHX 4XQ0A 1YZGA 4C5AA 2V7PA 4YA6A 3Q6NA 3SVTA 3K70D 4AZTA 4BRWA 2VUIB 4DJAA 1VPVA 3RO7A 1FVOA 5EAIA 3VJLA 1ZD4A 4UW9A 3WYFA 4D02A 1A0OA 4JUAA 1I1NA 2CHFA 5CT9A 2CNOA 4OYYA 2BF4A 4MZDA 4LJYA 5LOVF 1T5SA 4K1LA 1XDSA 1Q0LA 4XE5A 3T3MB 3K70C 3HBFA 1FUUA 3AR8A 1J06A 4DIOA 2PG3A 1JR3D 2R8YA 2YMMA 5DJ5A 2Y1LA 4DR3B 3BXZA 3WK4A 2RHTA 4HN9A 2H2WA 4RO0A 5JSUA 2NU9A 1FXUA 3D6TB 3HRKA 3UKDA 3TS1A 1X1AA 1JR6A 1CJUC 4B6PA 2AGVA 2VPXA 2FEWB 3RWOA 1N2IA 1LD3A 1JEEA 4FMDB 4C2TA 4C9BA 4W6ZA 5J5CA 2OB2A 1AA9A 1JDNA 2VATA 1WXIA 3EEYA 4RV5A 3SK0A 4B3MB 1Q57A 3FPHA 2XMBA 1E7YA 1U28C 2PMEA 4EJ6A 2FPUA 4RKWA 2WT4A 2PSFA 1QR6A 3KJIA 4RA6A 3H5OA 1H5NA 2GJ4A 4ND2A 2E82A 2XA1A 1N5DA 1ULSA 1F5SA 1EM6A 3QF7A 4GQBA 3G2IA 3BK7A 5DBOA 4R3NA 4CT5A 2F00A 1A9XB 3HB5X 1BMFD 3T99A 2OZPA 2XMPA 3WNVA 2QM8A 1E8MA 1G9XA 1PZMA 4BO3A 1OU0A 5AQ1A 1P6QA 4BNJA 2PMFA 4GS5A 1MDFA 3MAAC 2ID9A 3TG8A 4OX9Y 2ZYGA 2O52A 1H3EA 1UC9A 2FSVC 4BLSA 2XQJA 1DB3A 1C9JA 2B5WA 1GZUA 4DIMA 4Z53A 4DNOA 1XDGA 1GADO 4EY3A 1D04A 2VH5R 1RHJA 4B47A 1FFGA 1CQXA 1VJDA 3H7AA 4KYIB 2X42A 3CCBA 1TA9A 5EIBD 3VR0A 1SUPA 3SXPA 5B3KA 4KAFA 1EFVB 4OGKA 5HFNA 4DUPA 5BV1A 4UTVA 1KIFA 1FNMA 4AZ3A 5A06A 4MAAA 2Z95A 4MS4B 2A9OA 1PR5A 5EIBC 2VK1A 2W2TA 3AW8A 1SIOA 3B9PA 3MELA 2DH5A 3PENA 4LECA 3WWCA 2PS1A 1UJMA 4MA5A 2WDPA 1FVHA 1G7TA 1P4AA 4TYWA 3HKDB 3H7IA 4PLCA 1Q3HA 4O2LA 5FQNA 7REQA 3TCKA 1F06A 4MRVA 4X6LA 1ODFA 1S1MA 1TO6A 2L19A 3PHHA 3OJCA 5JPIA 4BNYA 4C6HA 1G6KA 5LMNB 2I33A 5A2GA 1I4EB 6LDHA 2CXNA 1RHQA 3AB3A 3ZLUA 1CY0A 2I34A 1RYBA 1UXGA 2N3ZA 2ZBFA 2OCGA 3DAYA 2P5TB 5D1HA 4MYTA 4YUWA 2XCTB 1GL9B 5HKLA 2EFEB 2QXUA 2Y6UA 1RYDA 2V3WA 3CMMA 5J4KA 1CUHA 3IL2A 2EZUA 4NV1A 5BVGB 1PSZA 5HGJA 1IUOA 3VHXA 4YRRA 4ECEA 1HY3A 4GSYA 2QUBA 2XOEA 3E5MA 2BSQA 2BMAA 3OY7A 2GN1A 4MGZR 1U2TA 1KQOA 3EJWA 5FPQA 5K8UA 2EX1A 3UYLA 2WUDA 4D25A 2WT9A 2I7TA 2Q21A 3AYZB 3IULA 2RK4A 2FMFA 2VC2B 2ZE5A 2FQXA 3RBVA 3MXOA 2H6EA 5KWJA 1XAHA 5IYZF 4BDTA 2FGKA 2VRWA 2AN1A 3DPSA 3JX9A 5G02A 5EEGA 1FSGA 4CEHA 4ZO6A 5BXYA 2CZCA 4BRSA 5H4GA 3IEXA 5JH7F 2QGNA 3B8HA 2AUMA 1EFUA 2BMDA 1E2IA 2Y77A 4EVIA 5ELMA 3J7TA 4W5OA 3AR3A 4B85A 3H84A 4Z9BA 5C3UA 1X92A 1DAIA 2QX7A 2NZVG 3RE1A 1NXXA 2HAEA 4RVFA 1F2DA 2DR0A 3BE6A 5JW6A 3N8IA 3GDOA 4I1VA 4QQ8A 3Q6IA 3MWGA 3NASA 2BJHA 4MWZA 4CV0A 4M1YA 2QM3A 2V97A 2YJ3A 4EKGA 3V4FA 2K2QB 1U94A 3IPCA 2VTBA 1W44A 5FPSA 3U4GA 1XNRB 1ZIOA 2P9BA 2O3SA 1N1EA 2I9PA 4HGRA 4UOQA 4S05A 1DKUA 3SR3A 3A0UA 2AMFA 1PV4A 2C9YA 2WSLA 2P6RA 2Z83A 2Z98A 1DC4A 1NFFA 2DQSA 4GWKA 4BLOA 3VVLA 4M4SA 1N5MA 3P9NA 3Q72A 1GO2A 4AD8A 5T3YA 1CNFA 2QLBA 2B0JA 5AK5A 5LN1A 3W78A 5BSTA 4DT1B 4GYJA 1QYXA 5AIAA 2YV5A 2QG4A 5A3RA 3CLRC 5BOVA 3COPA 3PNQA 2JGRA 1MAWA 3Q4GA 1XVVA 2R6CA 2BHLA 1DAOA 5HTKA 2GEFA 3LVRE 2CUNA 1JKJB 3ERCA 3LX4A 3EVDA 5AJVB 3VMFA 4Y2JA 3R0XA 1H9AA 4BX3A 1L4EA 5JQWA 3EX7C 3L41A 2MSCB 1AXEA 1OJLA 4R51A 4HDKA 3SGLA 4O4IF 3USZA 5IF3A 1QQBA 4Y3UA 2MINB 4JX8A 1JFFB 1ZD5A 2OBLA 3LYHA 3OFND 3PEEA 4E08A 3ROQA 1WO8A 2JC3A 2HI0A 1AD2A 3D7RA 4Z7OB 1PL8A 4NBVA 4OB7A 1I5RA 2B69A 1UAAA 2V8OA 3PITA 1JYEA 4Z8XA 2DTEA 4Y9DA 4HNAB 2IOFK 3VR4D 5MDHA 3YASA 3KZ1E 3T94A 4EGCB 3QE9Y 4C07A 4UHCA 2BKLA 1GGFA 1YOVA 5DWVA 4HUTA 4R9NA 1Z6QA 3LW7A 2VJOA 5IAGA 4BNHA 3UPUA 1JPNA 2ZCUA 1DGQA 3EDCA 2O4CA 4CFSA 4WZAA 1F0YA 4JNCA 2BBTA 3FPJA 3KZNA 4DZZA 4G8DA 3T7KA 1XZ8A 3NQ41 1E1QD 2DFNA 3DT6A 4QBTA 4CM4B 5FOQA 3R20A 4OX9B 1EG7A 3VH2A 4CEIB 2VBCA 4RIHA 4KSBA 3IDFA 1DO0A 4OJNA 3WSVA 1DS6A 4MW6A 4ER3A 1OXBB 4I6GA 4JYAB 3RGGA 4N12A 3S8YA 2WTNA 2QXTA 1D2EA 1OAAA 4HRVA 3QU7A 1Q15A 4I5EA 3LX8A 3I76A 2B0CA 2JNWA 3QPAA 3U0BA 3U6KA 3DTVA 3WMXA 2RHBA 1PAUA 3CGGA 6REQB 2HQOA 4FZ5A 1MO5A 4F5ZA 2PXCA 2HQSA 4QECA 1K7EB 1LBSA 1J07A 1KK3A 1PTJC 3Q7SA 3SICE 2UZ3A 2VLBA 4MYDA 3A9WA 3ZQ6A 3LA8A 1DL5A 3LM8A 1H1LA 3IVMA 5J40A 2OGZA 4PZAA 4MIKA 4EHFA 5L9AA 4UEQA 3G5UA 2XJ9A 1SXJE 1Y6ZA 2F6RA 1YUNA 2A0KA 5E4FA 4RESA 2Q7DA 5G0VA 1RWMA 3FNQA 4WKCA 4EA9A 4MUBA 4BV3A 5HOQA 1D2NA 2O06A 4QXAA 4OUKX 4I4CA 4M1MA 3NYIA 1A8IA 3TLEA 2DWUA 2FCAA 3KEQA 2J7KA 4PAGA 1F6BA 4GRIA 3K9WA 1OBCA 3I2GA 3A26A 4G0NA 1VHQA 3IVRA 1T25A 3VMMA 4GZ6A 3OH8A 3D6HA 1ZGCA 4QDZA 3TL2A 2P9HA 4ZVPA 4QBGB 4ZZ0A 2AB0A 3IV6A 3TQHA 1LBIA 1GPH1 2HWWA 3H3FA 4PG4A 3PHJA 4JP3A 1X74A 2OQIA 3HCDA 3QBEA 4G63A 4AC9A 1HA3A 4FGJA 3ZVNA 5DEOA 5KNCH 1SU7A 1KXZA 4GE3A 2J1LA 2AV6A 1SIWA 4NNOA 3T5MA 3T8YA 1YCHA 3KUUA 1PEKE 1U4OA 3ANMA 1Q0TA 2PCJA 4WKGA 4FFNA 1PJCA 3EFBA 4YJGA 3TKAA 4PIVA 2ZULA 4YRTA 1Y1LA 5FI3A 3JD1A 3HN6A 4GX2A 3EIOA 4MQFB 4LOLA 4U02A 2GZ3A 4BAUA 4NZOA 3ZW8A 4F9GA 4XJTA 3L4EA 4CV2A 3UK2A 2FI1A 2GKSA 2NM0A 3FSGD 3NPMA 3U3RA 1VYUA 4BTVA 5C37A 4UTXA 4F4CA 2CFIA 1DC5A 2BGRA 1M0EA 2PUEA 1BJKA 3BGOS 1SCBA 1VI2A 4EVQA 1WULS 4IIUA 3MJCA 3F6EX 4LUCA 2FRVA 4M8KA 4D41A 3KOMA 3K6SA 1WPGA 2CK3D 2TRSB 2WOOA 1PZFA 3T0FA 3FB1A 3ZCVA 1ACMA 4I99A 4COOA 3U60B 4G1BA 5AK6A 3GPLA 3H2HA 3F6PA 1E2JA 4ZV9A 1IHUA 4RGBA 2ZSIA 3NHYA 1JIUA 4OHWA 4QUKA 5AJWA 1YBHA 4Z4CA 4CT4B 1T1EA 1E0JA 5DI3A 1Z68A 2MMGA 2C5LA 2X5XA 3ITNA 1MC1A 3ZWAA 4ZOLF 1NJ8A 1NNUA 1XZHA 5A3SA 1A88A 3INNA 4ARSA 1QFSA 2N42A 3AF4A 3CYFA 2P6PA 3TRHA 1OE0A 3ZR4B 2PUAA 2XWQA 2PANA 2GCNA 4FLMA 4KXXA 2FLWA 3EBLA 3F96A 4AMVA 4CGYA 4LDJA 1JHUA 1XCOA 1G21A 3AFNA 4HQ6A 4IFIA 4JQOA 2IFTA 1XSEA 2IP1A 3NC0C 1KMIY 3K2BA 3NNNA 2JFNA 2C2GA 5C5CA 2PGAA 4G36A 1TAQA 3EXEB 2CXUA 3M6VA 4UNNA 1QH8A 4V39A 3AKDA 2CV0A 4YIHA 8MHTA 1DKOA 2WP0A 3CH7A 3STVA 4CNQA 3IERA 4FIDA 1NW5A 5KYKA 3GGJA 5B1YA 1X1CA 1JG6A 5JJKA 2ZYHA 1T2EA 1MPXA 1X1BA 2QW8A 3VSEA 3X44A 1E3WB 1HFWA 3LPDA 3HUUA 5T67A 2XAAA 4GZMA 4GXQA 2EIHA 2NZJA 4MUHA 5FJIA 5J2TF 1YHNA 4GLLA 5BXQC 2ZRPA 4KGXA 3COJA 1V8DA 4J94A 4Z7QB 3GHYA 1XWFA 1A9ZA 2F1KA 2Q3LA 3D6MA 2BKEA 1AQ6A 4P7KA 4WCDA 3S1LA 4FXPA 2J32A 5AJHA 2QW0X 5CDFE 3REQB 4UU8A 4TKVB 2NV0A 4M89A 1F6WA 2FPRA 2VJNA 3I01M 4MR8B 3ZCQA 2XXBA 1L4YA 4KX5A 4MCJA 1NURA 2WIAA 2VDKB 2QYTA 2EZ8A 4R2XA 3FCUB 2REQB 4PLPA 3QE2A 1VGRA 4EQ6A 5IJ0B 4HDSB 2PA0A 4B3XA 1UZMA 4ZIRB 4A0SA 4GBJA 1NI4A 1IEXA 4YV0A 9MHTA 3TE6A 3ESRA 1LW6E 1PJBA 1TIBA 5H80A 1Y37A 2CY0A 4JUFA 4HH0A 1ZGZA 1U5AA 4HRYA 4JP1A 4NP6A 4H6PA 4Q4HB 2PUHA 4NHOA 3HZHA 4HLNA 1IXRC 1N2CE 3LHSA 3PCRB 4LC1A 1X9HA 4K9OA 5LMUB 2BE9A 1A2OA 2WR8A 3PBKA 3QEMB 4CLHA 2CB9A 2R8OA 2ZIXA 3C3YA 2NX2A 1FTWA 1T9HA 1W5BA 3G2QA 3DOEA 1QGAA 2IDMA 3BORA 3PHBE 2WWIA 1BD4A 1RC1A 4HPWA 3FRJA 3NONA 3R1IA 4FWTA 4EVRA 5FOWA 4Q66C 2C42A 1E0DA 3UO8B 1DX9A 5KOIA 2ZREA 2NO6A 3TL3A 3TW4A 2J0SA 3VXKA 1F48A 2XZTA 2WWVD 3PI6A 1H2ZA 2QQGA 1DBPA 1ZKMA 1PNRA 3TX6A 1NF8A 2G80A 1NVDA 1PQWA 3R4CA 5LZ4A 2DFKB 4LWZA 3SSMA 5U9CA 1KERA 1TZKA 2W2KB 1DZ3A 4NI5A 4BXOB 1QAQA 3ASZA 2XY4A 2ZXEA 3R9IA 4P0QB 2NWQA 3LBAA 4TX1A 4ESVA 3V1LA 5KU7A 4FX2A 2W2MA 2IWHA 2A5JA 3IA7A 4WESA 4WXPA 3VAYA 2IS2A 1NW6A 3QXCA 1OLOA 2Q27A 3W2HA 1PTKA 4NEQA 1AOXA 4DNPA 5ITVA 1JIJA 4IINA 1Y33E 4K9PA 1HV8A 4PPYA 2VP0A 4WXYB 3RHSA 1TVCA 3PRYA 4Q82A 3OTGA 4P58A 1Z2PX 2NZ8A 2RGDA 3LOQA 4V0OA 1BX0A 4XPIB 1DAMA 1QKJA 3ABOB 3N07A 3R8CA 1HNZB 1PV2A 5K1ZA 1L7RA 4JUDX 1ZM7A 5KPJA 4PR0A 1ML4A 4CQMB 3GDWA 4MJ3A 2VQ6A 2ZBGA 2HLNA 2AN4A 2ORYA 1NW4A 4NFYA 4F86A 2W8ZA 3DCIA 4NS4A 4PYMA 3TAUA 3WIOA 4ZI7B 1EWKA 3EYWA 4CMIA 2QF7A 3PXEA 1Z63A 1F2TA 1MORA 1QCZA 3DB1A 1CHDA 4FHDA 3M6AA 721PA 1PEDA 2F1IA 4HDNB 1VI5A 2X13A 1DXYA 5TLSA 1E2HA 1L5NA 2AXPA 2QL7A 4YROA 2CHVA 4GEGA 4AZSA 1B76A 4K2AA 1H6AA 1GGNA 2WKPA 2V54A 5KREA 2OPBA 5ADWA 5L3VA 3M34A 1UFOA 1IQUA 3AEUA 2NW6A 1MP0A 2O8EA 1WSDA 2YWHA 4HNGA 5EESA 3ZX5A 2E4VA 4R0NA 1BU8A 1YL7A 1LX6A 3G17A 4OHKA 4DBVO 2VXOA 2D0OB 4G0YA 2IYTA 5KQRA 3DP7A 2IX3A 1UDAA 3DZJA 3WHPA 3G9QA 4G89A 1UBMS 3EW9A 1V11B 1W85A 4MV0A 1N5KA 1V0JA 3AP1A 2FSSA 1EFPB 4Y0VA 4O4LA 3QVSA 2QUAA 1N3BA 4Q00A 1YB4A 4MUYA 4GKJB 2EP8A 2R96A 2RBGA 4NJEB 1BA2A 3EA4A 4I1UA 3MGKA 4Q9JA 1KU6A 1E9VA 3NATA 4NH4A 5B12A 4BQFA 5KI6A 2FRDA 3DKKA 2V0CA 3GFGA 5DN6A 5A9TA 4A6XA 3H4TA 3GNLA 1B43A 4DL9A 1CRZA 1RJ9B 2H3EA 5ALSA 3LBIA 2CJFA 1S2IA 2J9ZB 5AUQA 4XR9A 2WF5A 3PQ5A 5G0WA 5IXJA 1SBZA 4KYVA 4AKSA 4RD2A 5JC1A 1HX7A 3ZKAA 2G1KA 2ZRHA 3FRHA 3O5AA 3VOTA 4JLWA 2BZGA 3MYYA 1QKKA 2R8PA 5BYJA 5C5DA 1Y3BE 2Q8PA 2PMWB 1J5XA 3WKAA 3ZU5A 3QEAZ 5L4LA 3TLKA 2ACKA 2AG5A 1X8XA 1DJLA 3HWX1 4AMGA 4C08A 4D0LB 1ZFNA 4A1OA 2IH5A 1F8UA 3EIXA 5D00A 1IZYA 1EYZA 1U0FA 1G2PA 3GG2A 3GZ4A 3B12A 2JFWA 3O4RA 2G67A 3V8QA 2B4RO 4RK5A 1BDBA 1LDBA 4AO8A 5H02A 4DDMA 2EW2A 3PXBA 4P4SB 5SY9A 4FOTA 4KXLA 1SXJB 2C98A 1SCJA 1AURA 3LTEA 3QMPA 2FEPA 1DOHA 1EIZA 3PJEA 4YJFA 4KLZA 2H48A 5P8WA 4U6NA 2Z5FA 2GH1A 3BXEA 1EB8A 1L8LA 3BCSA 1M2VB 1T5HX 3IVAA 3CINA 2A9JA 3MHTA 3GOHA 1LV7A 3BQ9A 5CB4F 3FHTA 4RZQA 1HF3A 2MU1A 4YASA 1MW8X 3OSZA 4YAFA 1FFXA 4BN5A 2X23A 5FLYA 3FPFA 1WUHS 3G2KA 3MZ0A 4UXIA 2WYOA 3KYDB 1I10A 1N0HA 4KIJA 3WGIA 1Y7PA 4GUAA 4L0DA 3OE7A 1VJGA 3R7DA 4HXFB 1N5IA 4HTAA 4DWJA 4N5NA 4QEZA 2VHVA 2ORED 4J0FA 4MULA 1PFQA 1LU9A 4W5JA 4WZAE 5BR7A 1NLYA 4OQFA 1YR9A 3LXMA 3NDJA 3N7UA 2GZHA 2F62A 1M67A 3MMSA 1G60A 5COAA 5IT4A 2H1IA 4YONB 4QYIB 1VDMA 2JLCA 1NKVA 4BN4A 2I2CA 1AGXA 2OORC 1E8NA 1BWSA 3IX7A 1L7XA 3L7NA 4HR7A 3DHNA 1G0NA 2UV8A 4GX1A 1N8SA 5DB4A 4JB3A 3S5UA 3LPMA 3T7JA 1SRRA 4CKYA 1FYEA 1L9KA 2BH9A 2H17A 4RVUA 3HP4A 4UBOA 2QRQA 5BN3B 1I9CA 5IC6A 4AUNA 4AT1A 4FVTA 4JT8A 5TGTA 4DLTA 5JANA 2FPPA 1O95D 1P5FA 1AH2A 5KVSA 4MAFA 1T34A 4DA7A 1XMSA 2W90A 2AA3A 1XU7A 4NZNA 5HIJA 3LWNA 2Q9UA 4D4KA 3HDGA 4U7JA 5IN4A 1GGMA 2VNIA 4D82A 3TLZA 4EF6A 3ZGZA 1I0ZA 1MA0A 1P0PA 4NMLA 4C7OA 1DO2A 3BE8A 2MTBA 3UK7A 1BQ3A 4HAUA 3H83A 4NH0A 4DMLA 1KBQA 2Q0XA 2F8SA 2BGJA 1PR6A 1PNQA 4JR2A 4R2LA 4AY6A 4L75A 1U02A 4K7JA 4QDXA 4AJOA 5ALKA 4I55A 2C1ZA 5IFKA 1BVUA 4LY6A 4ACAA 1R6AA 4H0NA 5BT8A 4PVCA 4HG2A 3BE4A 3D3QA 4OXXA 1LLCA 1U8FO 1BHQ1 3D59A 4UUBA 1MV5A 1CRWG 2VTKA 3G0GA 1H2RS 1RM0A 3LUHA 3KJEA 4WKNA 1XXHA 3U56A 2QMHA 2RAPA 3ZS9A 1KETA 2BJVA 3D02A 3WIVA 4BEJA 3CNEA 3RVSA 1X1QA 2UVPB 4QODA 2FFAA 3QU2A 4P8RA 1F0NA 2VJMA 3QELA 1FP4B 3EWAA 3I6QA 4IJ5A 3I1FA 4YP0A 4LJLA 3RLFA 4BRZA 2J08A 3ID6C 3MWDB 1IUNA 1VMKA 2IDZA 2ZUUA 3ZIUA 3KPJA 1B1CA 1E9AA 2B78A 3B7WA 3JASB 1DBSA 1N1DA 3PJDA 2WEKA 2AZTA 4EA7A 4IIFA 4CMJA 1XZMA 1PWHA 2ZJ1A 4D44A 4JCOA 5K5EA 4AY2A 2WKWA 1ACLA 1QO0A 2JFZA 4IWNA 5JAMA 3A10A 4OHYA 3ZW9A 3T06B 5K0FA 3M2PA 3O4VA 4Q3BA 3NEJA 5AW3A 1SK9A 4X45A 5F78A 1T2DA 4TWZA 4A03A 4TLMB 1NNLA 4MKGA 4OU4A 2IS1A 1MABB 3JATB 1JWLA 1CIPA 2RARA 1RADA 5ALIA 4BMVA 1E2BA 4QOIA 5C4GB 4K3VA 4UATA 1C9NA 3RFUA 3A6FA 5CDHA 4KOEC 1IDOA 5AM3A 5FF9A 4PX5A 4P38A 4L6IA 3FY4A 1PSWA 4AP5A 4FMCF 3FBWA 2D7DA 3SLKA 3BL8A 4BLVA 1GPKA 2FFJA 1KJQA 1MAVA 4J3FA 1DVRA 1HNXB 1G9SA 1W1IA 3FTNA 4CODB 3GY0A 4L50A 3KSRA 4TYQA 5LU9A 1A9RA 3OZXA 4RKYA 4KQGA 1YCFA 5JU6A 4IY1A 4ZT2A 3KLMX 2I6FA 5SY6A 1WETA 3BTUA 3F7MA 3DAPA 5IJ9B 3I0ZA 4W9RA 1H3FA 1O4VA 1N2CB 1M7BA 3ND5A 2PX5A 1G21E 1J0CA 1RZRA 3HLTA 2QT0A 3LY5A 2CE7A 3T7RA 4UM7A 4BKRA 2BBOA 2J4CA 1F20A 5KS2A 3P19A 4GP7A 1G66A 1GU7A 3M5CA 4ZGGA 3HCCA 3NRJA 3A4VA 3BA1A 1KY4A 4ZWNA 3I9FA 5HM8A 2IE8A 2XQKA 3HXOA 3OQOA 1VMDA 3OO0A 1OWPA 3FGNA 5CLIA 1YKSA 1JL3A 2B7BA 2PD6A 3C4JA 2H1VA 4C6SA 3I37X 1SKYE 2OPHA 4OP3A 1YRQA 2A0YA 5EN4A 3PFGA 1FUKA 1GGHA 4MR7B 1CDDA 4JI1B 4OA5A 3R7FA 4FDMA 1V8OA 4JNKA 1DP4A 1UC5B 2O2SA 4U7GA 1Z38A 3GOQA 4N8EA 1C9EA 4BHTA 4U7PB 5HS4A 5BQPA 3L0OA 5DXJA 3ES9A 1U7TA 4A8JA 4CT0A 4P54A 4IM7A 2O19A 2CD7A 4W7IA 3U5TA 4D8YA 4AZ3B 4ZRDA 1M76A 2Q3BA 1GM5A 1L3CA 4U9HS 3ODPA 5KNLA 4WERA 5BRJA 4P3NA 1D03A 4RTRA 2NXJA 1P4SA 3MTGA 1RABA 1H8EA 1K98A 1TF7A 3Q5EA 4Q1BA 5HW0A 1QFYA 1G3IA 2QHXA 1X7ZA 5FTKA 3EQ7A 5JYBA 3ZNNA 4C30A 1OY1A 1G64A 2CZQA 3RUDA 1Q1ZA 3OZCA 4FFPA 3EPKA 2C92A 2GN6A 2OT3B 2OZLB 2PL1A 1HQDA 1X7WA 1CUWA 2JGMA 2PEYA 2YN2A 3JQGA 4IDDA 4CLRB 1MPTA 1EGAA 2FFBA 3B20A 3E8XA 1LTHR 4BJ3A 4ZDWA 3INTA 4I1SA 1QIJA 2EBUA 1QC5A 2X4GA 2XQVA 3NHJA 2HMYB 3C7CB 2SNIE 1J22A 3RTCA 1M1ZA 4LBVA 4LOIA 5DOVA 3ENQA 5TGDA 4B3BA 4QGSA 4DXAA 4EKYA 1UXJA 1UM9A 4LQDA 1JU9A 2EQ5A 4KMOA 3WDSA 4NCHA 4OJYA 1RVV1 1V7ZA 4PBTA 4ZEMA 1GY8A 4X1IB 1CQPA 4NBTA 4GI7A 4FHEA 1XEFA 4LFCB 4RFSB 1E9EA 2I7DA 3AF6A 4AQ7A 1HPLA 1B8NA 1WPRA 2IYZA 2IY7A 1Q20A 5E8JA 4QXPA 4D9IA 1CIJA 2ZS7A 5KINB 2ZE7A 1D2RA 3P2IA 3NBAA 3HZRA 4J43A 4JZKA 4QU9A 4BPRA 2GM9A 1OGIA 2CSUA 3BC1A 3L0SA 4OCZA 4ZI2A 1TEXA 2GK3A 3E23A 2AXNA 5FCDA 3T7EA 4D9FA 3CZ9A 3VPHA 5IS2A 1JIVA 4RLQA 4IDGA 5GONF 1RNLA 3FYSA 4AUMA 4IDEA 4XX0A 5DCWA 2ZYUX 1Q6YA 4BB6A 3KTFA 1KEEA 3ZKWB 2EBFX 1KARA 1KU0A 2C7BA 2ZAOA 3FUWA 3GVXA 3LOPA 4JBGA 1UZNA 5TPWB 2VTBB 2AOTB 3I6BA 4OIMA 1QTRA 1ZDMA 4PTZA 4V0KA 3NO4A 1CE8B 2KE5A 1XCMA 2XNSA 5F7ZA 1B73A 3DBHA 2IV3A 2JAHA 2UVDA 5JIBA 4JZYA 1VKHA 2JIPA 3JAWB 1FE8A 4ARVA 3X1JA 2JFFA 1J90A 1R7RA 2CMDA 1RXVA 3ILSA 4DY6A 1PR2A 4BFTA 4FWBA 4GC5A 1EK1A 1R0CA 1TQ8A 2GM3A 3ONVA 3RFXA 1KSFX 2MSEB 5JS6A 5JSHA 1DBIA 1DIAA 3RYFB 1E6LA 1XRJA 5KJ1A 3SAJA 3KPYA 4I14A 4WZBB 1KOGA 3RVMA 2D8MA 3N5KA 3LUDA 3QJGA 3H11B 1X7YB 4REMA 5JO0A 1FDIA 1POWA 3PC4A 1TK9A 2Y4OA 1OPRA 3IQIX 2PGNA 4OQEA 1QTIA 2Q4RA 1LPSA 3U7QA 5IABA 1SC3A 2PUTA 1RCFA 3WL8A 2XODA 3V2IA 4EPWA 1FNSA 1DDGA 2RH8A 4FONA 4D2IA 3FA2A 1XNQB 3HSSA 4FE4A 5ALLA 3BAFA 4Z8YA 1DSSG 1S7CA 1RJWA 3TZEA 3UAOA 3OQIB 2WKQA 2VZ9A 2HR1A 3KR1A 1TYEB 4XB6B 3H5WA 3D8NA 2B2NA 1E4EB 3K9QO 1Z0ZA 4TV9F 5HBRA 1BX1A 3CCFA 3A1SA 4L5BA 4HWPA 3LK7A 3W8FA 4X84A 1Z0FA 4ZCRA 5TMPA 3HFJA 1D9XA 4TV8A 2JLQA 1PBTA 1JHPA 2EG9A 1NMEA 4Q4AB 1FA9A 4H2DA 1RJFA 1UZLA 4MICA 3UMCA 1SKMA 4MXDA 1WS6A 1MRZA 3WQHA 2RG7A 4JVSB 3D3EA 2IK8A 3A1UA 4OBEA 5JJLA 4WZAB 2V59A 1XR3A 4EAQA 1N2XA 4DQDA 2PSHA 3KHSA 2VUTA 4KDCA 4WLVA 5LYJB 3VR2A 3N6XA 4L8VA 3PPXA 1OH5A 5HMLA 2RONA 3CS3A 4O2BB 3M81A 1VSQA 4PR3A 1VYTA 3RC7A 3UFXA 3AFGA 4D7AA 3GT0A 1ZVVA 2R6ZA 4ZVVA 1SA0A 3W7AA 2A30A 4O33A 3WNQA 4Q7KA 4G1UC 5BOSB 3ZVLA 1GEGA 4QD3A 4RSHA 2CKDA 3ORQA 1DAHA 5CR9A 5CU7A 5GMOA 3ZQKA 4BVBA 4JJKA 2YTZA 3LO5A 2F48A 2D5AA 4IVNA 3FPKA 5ALJA 3LI2A 4W1QA 2R1ZA 2B30A 2NVWA 4CL2A 4RS3A 4CLXA 2FDCA 2OYCA 4ARZA 4AI6A 2CC2A 2JA1A 1VL2A 1ST2A 1HRDA 1H1LB 4HBZA 5ALFA 2FWPA 4BVFA 4QJ3A 3GAMA 1N8KA 4UOZA 3TW8B 4MRAA 2K7FA 3CO5A 3CZ4A 1TMGE 3CBGA 2OLKA 2QX9A 4ENVA 4CVNA 1K4MA 4KR3A 1AGPA 1DIOB 1M6EX 3FUXA 4F4FA 2O8BA 1QONA 4KQXA 2Z1NA 4GAEA 1JDBB 1P1HA 2DSNA 2FLKA 1Z08A 5HJ7A 3DOCA 1XXLA 3R0IA 4R69A 2PZGA 1WCV1 4GP6A 3V1UA 1HEYA 2F1HA 2RB4A 2D13A 2PLAA 2R65A 3H2KA 4LYAA 5CVDA 4F45A 1LA2A 4R71A 3AVVA 1TKCA 3F1LA 3DA8A 1NJ2A 1IOZA 1GPBA 4DSUA 1G5PA 121PA 4KXQA 1I1HA 5EA2A 3PT9A 3DV0B 3GPIA 4HWSA 2P4SA 2Y1DA 3H99A 5AH0A 3SPXA 3CTMA 5U4XA 2QRVA 3BYZA 2VDLB 5DEIA 2HW8A 2XNDD 1WD7A 3JRXA 3ZWPA 2R4UA 1VYHA 3LUPA 4WNAB 3FTQA 4R1PA 1EQUA 3CNOA 3WIEA 1GN8A 3KZKA 5FQOA 3I6ZA 2WHPA 4ZOAA 3V34A 3FBGA 5JRDS 3FNIA 4ZVTA 3TEMA 2YN4A 4OQMA 2X22A 3HI6A 3AOEA 1YI0A 1E5QA 2WMOB 3FPAA 3Q7IA 3UJDA 4DCGA 5CDSA 1CLEA 2PH3A 1VXRA 2ZTVA 2DFDA 1D6MA 2GEDA 3GA7A 2X58A 3QMVA 1QKIA 2PZMA 4GMFA 4M9RA 4IDBA 4M0EA 3L6UA 2FN3A 5DTEA 3S0JA 1VSTA 1ZJWA 3EPHA 4RIGA 1KMQA 1G3UA 4JR0A 3WZ2A 2XI4A 3O4FA 2GDZA 3EVBA 1FU7A 1O2DA 3PLRA 4FE7A 4G2TA 4GZLA 4I9NA 3HS3A 5KQLA 1DCTA 1PG0A 3SKXA 3EGXB 2O8DA 1XAIA 2YC4C 1I2ZA 1QWOA 1T8YA 2XWSA 1I32A 1KYWA 2ATVA 2O3UA 2JF0A 1LSJA 2QRLA 3PI7A 4EW6A 1M8GA 4EJ2A 3EZLA 1F2UA 4OK3A 1W34A 4H1VA 4B9AA 4I2NA 1BHJA 1BXKA 3VSCA 4DSNA 4I8IA 1QS0B 4KQHA 1ZLXA 1K89A 1YK0A 1N78A 3DLCA 2D7CA 2ZUDA 3M1IA 2IITA 3W3AA 4X8LA 4JI3B 4F4HA 1C1DA 3PUWA 2PE5A 1XOIA 5AKYA 5F3RA 1E8DA 1L7QA 4H3HB 1OLXB 4C7XA 4W5WA 1XXHE 2HA0A 4LJ7A 3GUCA 5DYYA 3AVQA 4UNSA 1BG6A 2WD9A 2X86A 2D2VA 3SDBA 3NFYA 3RI3A 4XWOA 2X4IA 5HCNA 4RTNA 2IS6A 4RH1A 4PE5B 8ADHA 4OPMA 3NW9A 2IYEA 3CH4B 3T5DA 2BY4A 1I5EA 2UYHA 3Q9LA 2DRIA 1YUMA 1VZ3A 3F5FA 1XU4A 4YCDA 2QTMA 5FBZA 1NP7A 3TXYA 3VPAA 3GJ7A 4KAXA 4HB0A 2G06A 4A6EA 2WT8A 2FN4A 4B17A 2I1VB 3FZEA 1SKYB 2VSFA 4DMUB 4US2R 5ED4A 1ES9A 3LJKA 1H94A 3QPBA 2V4MA 5JLAA 3SM9A 3IUYA 3GFBA 3S70A 2J5BA 3ZDXB 2IYYA 4QU0A 3OIDA 4OGFA 1OFIA 2O5VA 4HZIA 3ONFA 5DTJA 2BHTA 1YASA 3EFOB 5EZYB 2GCOB 4OK6A 1EFAA 2P2NA 4EB3A 3QA3E 3GJTA 3OX2A 1H05A 4M0CA 2Y3IA 5EXSA 4B45A 2WU3A 1OFTA 3S27A 4TSFA 1XZGA 4RKQA 4D3FA 4IYJA 3VUEA 3V8NA 3N8NA 1PFKA 3WFJA 4C6RA 1WEHA 4X95A 4E5SA 3DAFA 2C4HA 2JIQA 4C20A 2IE0A 1UAGA 3M82A 4PGMA 4BMZA 3THWA 3F90A 3S2IA 3Q9SA 4F21A 1EAMA 4XI9A 3OJOA 3DFIA 3AHFA 1PT6A 3ODGA 1ZUIA 1G8PA 3OZGA 1DXQA 4IV5A 4P5DA 3GJYA 3FPGA 5EMHA 1G8YA 1D4FA 3T12A 3LUKA 4LJ4A 3ONEA 4DNFA 1B8OA 1RAAA 3PNBA 4NECA 3COYA 1GLVA 4BNWA 4ZK2A 4YJKA 3D7SA 1Z2EA 3KLBA 4I0WB 3CM0A 1DOZA 3W5SA 4EP1A 3KR9A 2GF0A 4N1AA 2G83A 5E0OA 3V2UA 2I2AA 3B13B 3I58A 4X64B 3ZHVA 4BZPA 5EQTA 1O94D 4Q9HA 1CVIA 3LKDA 1UT6A 2FFRA 1GIAA 3OEHD 5CH8A 2W43A 1ZC4A 4CV3A 5BWLA 4UUPA 4MHTA 1P8JA 4E32A 3IT0A 4R3UC 4HZUA 3LSTA 3L1VA 2GXSA 5JAQA 3STWA 5HUJA 3FVRA 3EEFA 4JOQA 1TQ6A 3V4SA 1JQEA 4C4XA 1L5YA 1KY3A 3ADPA 5K3BA 4BNMA 4BCDA 2H4WA 3NIDB 2QRJA 1CRLA 1TUBB 4IZIA 5IUKC 4K9QA 4QYTA 5CIQA 2GFQA 1RQ2A 1SQ5A 1BWQA 4IX9A 3STHA 3WLKX 2GK6A 2C9BA 2K7ZA 5ILOA 5LNK1 1P2DA 2OD9A 1Y1PA 3VOSA 1JQ3A 2H08A 3IURA 1C7JA 2ATIA 2XUKA 2C94A 3OEWA 4OQZA 4LSWA 1CPYA 5KTMA 4MJLA 1EFRA 4HNQA 5DM60 1U0RA 5HIKA 4HUJA 2N9UA 4RC9A 4P92A 2L82A 3DUFA 2N1MA 3OX1A 2ZK7A 3PDUA 1XLTA 4L95C 5FUBA 1X8KA 1V3TA 2HK8A 3M1LA 4DSTA 2WTBA 2NG1A 1QF7A 4QUEA 6YASA 3KD2A 5DM4A 3QVKA 5BN4A 3C14C 4HAOA 5GAJA 3OCXA 3RKSA 5EE0A 1F1JA 1LZKA 2WJAA 1O1YA 1V5WA 1ECGA 1RBYA 4LMRA 1MD9A 4LN1A 1PG2A 3P9PA 2NU8B 1LPOA 5B7PA 1U04A 1F9AA 1PKXA 2J3KA 4J4TA 1TW3A 4P3PA 4UVHA 4ZEXA 2WQ7A 2WTUA 2PLNA 2YHIA 3QVOA 3IOCA 1BS9A 5K0EA 1H2WA 1ZU4A 2MWMA 4EDFA 1V6AA 2Z8ZA 4UKDA 2E89A 4FINA 3P0RA 4F1WA 3F3SA 3OQVA 1KO4A 1UOPA 4WOJA 1T13A 3L7AA 1DCFA 3E2MA 4CG3A 3ZHYA 2OV6A 1CQJB 3GWZA 2PJRA 5H0IA 1OMOA 2DC1A 3KZVA 3AL2A 1K88A 3L1JA 1JI0A 1KRHA 1JG3A 3A6ZA 5EL0A 4DV2B 2YNMA 3ZGNA 2GLTA 3N8KA 1KI9A 3MHPA 3AF3A 2O0HA 2D4HA 5TY0A 2IELA 4TKUA 2HJWA 3ICVA 1DLJA 1CT9A 1ISSA 1HYBA 1WW3A 3DDCA 2JCXA 4RMJA 5JSYA 2XW6A 1EVEA 4X6XA 4MCHA 2CL6X 2Q4DA 3AEUB 3RSLA 4HV4A 1DBWA 1RFGE 1UMCB 3GLVA 2QL6A 1HQCA 3CZQA 5EJ6A 5I7WA 1JAYA 1L8QA 1P5ZB 4BQPA 1YWGO 4LWOA 2BM8A 3DBOB 3NHFA 1TK2A 5LZ9A 2PM8A 2M98A 3QM1A 4ER5A 5FB3A 4TMFA 2DOKA 5JH7B 1T3HA 3K9NA 4JB8A 5DX1A 2OGTA 2XHEA 3G23A 4R54A 2RGAA 3E7XA 3ETDA 4W7HA 4R2JA 4BMSA 1CY1A 1MFPA 4OOEA 1IVSA 4ARCA 2WKSA 2P6NA 4TMTA 1O5IA 3RTAA 5LR6A 1ZUNA 4RK1A 3WIBA 1HE1C 3GFSA 3AP2A 5DOZA 4O2RA 4XW2A 4NBKA 4TT8A 2EC5A 4W1RA 1NVVQ 2DTDA 4GWLA 2II6A 4BP3A 2PT7A 2ZIZA 5CB8A 3FTFA 3EEQA 4CTJA 3OOJA 5BMVA 2UXDB 3S2ZA 4PFSA 1TVMA 4DPKA 1N77A 4YJDA 1CUJA 2G8LA 2I4TA 2P35A 13PKA 2VTVA 3IOEA 4LMAA 5DW3A 3ZBUA 4W5RA 2BTQA 4BV9A 4B81A 4XIIA 4Z1MD 1VYVA 3LBFA 2VJQA 1DV1A 1NXSA 3KQVA 3BREA 4EPTA 4MB0A 2A3RA 3QVUA 2Z8XA 4OQ4A 2L17A 5A5VA 1K66A 4I08A 3DFMA 3D2LA 2ZDHA 3P52A 4G07A 2XKBA 1OASA 3HUDA 4OSOA 3WB1A 5A4AA 1O87A 2NO9A 3HACA 1IRXA 4ZCMA 5FPTA 1MOPA 2MMCA 3LXXA 4DLUA 5A4MS 5T8KC 5CFMA 3FMFA 5T64A 5K3OA 5KQSA 2R2GA 1MJ5A 2F3PA 1NSYA 4YO8A 1O89A 2IYAA 2VSQA 4IMIB 3TFWA 3DW1X 4MUMA 3UJHA 3ZWXA 2XCRB 2QBYA 3GGSA 1HWYA 3WGLA 3GJ3A 5KNBA 3UK6A 1U1GA 4U3JA 3RS0A 2PN1A 2FXIA 3RNOA 1MRSA 2C9CA 1BSVA 3VBEA 1E3SA 5KOJA 3KKMA 4TS4A 1OA0A 3COZA 5K9ZA 3IMEA 3RVKA 1BVHA 2V7GA 4JMPA 4XEUA 4A82A 4H6WA 1NG1A 3AEYA 4L8GA 1QRTA 2VDNB 1PU2A 1WXXA 5B58C 3LYAA 2PV7A 3QP9A 4IICA 4RA9A 3ETEA 3DEYX 1TI7A 2FY8A 4UZFA 3TSYA 1KIAA 2WWHA 1RTTA 1MFZA 2C78A 2IW3A 2YOHA 2OOSA 2ZJBA 1TUGA 4QPZA 2WWWA 3A06A 5GADl 1CVRA 2C9MA 3G0CA 5CM8B 4OMDA 5H83A 5HQJA 4FR5A 4Q12A 5K2MA 3T0GA 4J7XA 1U0GA 4B34A 4MVJA 1XZIA 2IPOA 1VL6A 1LS1A 1TAHA 1DV2A 3O8NA 3ZBQA 4RL6A 4YHBA 4BO2A 2FVYA 4FW9A 5JZVA 1EAYA 2FSUA 4UBIA 4OH7A 4KP7A 3WLOA 3FPSA 4FZRA 3ZU2A 1QX3A 1XLVA 3AF0A 4L4RA 3HJGA 1DKPA 1NY6A 1TEVA 5FFNA 2XDWA 4Y7CA 4XM1A 4RY8A 5LQMA 4OFXA 3MS4A 3PEWA 4NCAA 1PBNA 2P90A 1BXGA 2WJVA 1TT7A 4WZ6A 1KWKA 2R8BA 4KFSA 4N5DA 4MJ7A 2CXXA 5FX2A 4ROTA 3NKVA 3RG8A 1BOFA 5D86A 1RCTE 5FOUA 1ABEA 3RU2A 3ZE6A 4IJUA 4CG0A 4F06A 2DUUA 5FTMA 5BW5A 1Z5WA 1QOQB 3I39X 4EMTA 1WVMA 5L7WA 1Y4UA 1EP9A 2AL7A 2I6TA 4AU1A 3FTEA 3B1FA 3LBNA 4NONA 4RBNA 1SCUB 5A9SB 3DFKA 1DAPA 3ZDRA 5IZCA 3G2LA 5HPYB 3Q7RA 1X94A 4XGIA 3TIIA 5JCOC 1UP6A 1O5TA 1FUEA 1ORVA 1NF2A 2MYTA 3GVCA 5B1DA 4NCIA 5I8ZA 5SYAA 3VAAA 4RHUA 3CVXA 3S28A 2YZGA 1A9PA 4MP6A 4UE3S 1L5VA 3UKJA 4JOBA 1VMIA 3PGA1 4ENUA 2P11A 4JVMA 2VJMB 3WHIA 2W6QA 4K6KA 2PUDA 3DOFA 3KAQA 5LDGA 5IM4F 2QTFA 2XBMA 3MJHA 4MQLA 4X66B 2XMZA 3PNOA 4RD6A 3SN6A 4D9KA 1WM1A 2EF0A 2OV3A 1I4OA 1ZHHA 4YLYA 3GNQA 3LDFA 1BTOA 3T34A 4BWVA 3R3WA 4E1BA 1KJWA 4TZ6A 3HB9A 4F1JA 2QM0A 1HGXA 4PHGA 2QLNA 1SCDA 3O3OB 1JEAA 2HF8A 3GAZA 3MMZA 5AW8A 5FIUA 4UCWA 5TNXA 3A27A 4AZ0A 3CZPA 4E46A 2H8GA 2EW1A 4TN1A 2HZBA 3CSSA 3KTOA 4EM6A 1IBMB 4IUDS 1NXTA 1POXA 2ZPAA 2CBXA 2CN1A 4Y9UA 1IHDA 4R8RA 5LSAA 1LLDA 3OFVA 3WLEA 2ZSKA 4RFVA 4DCNA 1PVVA 3L7YA 4PONA 3RUEA 3EUEA 2XZOA 3AZPA 1UOEA 3WQBA 5TF0A 2Q5HA 3AY6A 2UYYA 2HD4A 1ZEMA 4LVNA 2BCJQ 3GFRA 3H6KA 3N3BC 1FP1D 1RAEA 2GD6A 1XDBA 2QJOA 1KJ9A 2CVQA 3QBTA 3SWWA 1G1MA 4BKQA 4YXWD 1HDCA 2VK4A 1KYQA 1UF9A 1P9OA 5DK4A 2W4MA 4JVLA 4Z0NA 2X3UA 4FFWA 4A2CA 3PHLA 2QDKA 1X0VA 2R2AA 3HYCA 4E5NA 4ZANA 4UEOA 3EH2A 1KSJA 4L2IB 1Q1NA 1X1SA 4ND1A 4MWTA 1AZLA 1SD2A 2BC9A 4JI5B 1A2KC 2JCGA 5C8YA 3PGVA 4MAMA 4RJTA 3ONNA 3OT1B 4FMBB 5BT9A 5T57A 2XUOA 4YPVA 3D0QA 3RHZA 1VXOA 3GEMA 2FJUA 2L69A 3TNYA 3FCAA 3HKBA 3L7KA 3QE4A 2G6BA 2XUJA 1K63A 4NMWA 2XUAA 3HKCA 2RC6A 4RKFA 3G1UA 1N57A 2YVKA 1IFXA 4O4JA 1H2HA 2GRAA 8ABPA 2GOYA 1OYOA 3B6IA 5F1YA 4DZRA 5CFNA 3P0IA 3K4HA 5FL3A 3LCMA 3QXGA 4H1TA 1O57A 1TZJA 5F52A 3T9CA 5KTSA 2WD7B 3RIYA 1G2IA 4N7MA 1UJ2A 4J1QA 3UJ3X 1F8FA 3A4TA 1HE5A 1FIUA 3NM4A 5C8ZA 1SBIA 3QV1A 4PSVA 3UJCA 3AVUA 1NNSA 3AXTA 4NSNA 3GMSA 2PUGA 2P9FA 3A9SA 4K6GA 3WVNA 5C9ZA 4A8PA 1IRIA 3MERA 1D0SA 4FOPA 5EE5B 3S2EA 3HB4X 4J03A 2ISCA 2RGNC 3KSMA 4WEOA 1FNDA 1KL7A 2BT4A 1PR4A 3QX7A 3L0PA 4MYCA 4DKJA 4EPRA 4IDFA 3RC1A 4JJGA 1N3YA 2EX4A 1VLZA 4Y2QA 3RVRA 2JGKA 2EQBA 1W46A 3E22B 4PGAA 4TT3A 4U39A 2WYVA 3AVTA 1M10A 3OMLA 4YTEA 1T5DX 3HDJA 1ID8A 2BFWA 4MS3A 4M22A 4UTRA 1Q16A 1Y0BA 1G5TA 4UXJA 5E1OA 1XTIA 3IQDB 3NWJA 1SZJG 4ILEA 3X1MA 2NXNA 2P6OA 2JIBA 4NMXB 1BQ4A 3UWPA 4FNMA 1ZRHA 1BE0A 3HBLA 2NZXA 3QKSA 4MH0R 2REBA 4EZEA 1D8AA 3U7FB 1CUYA 3ZV7A 3HJFA 4TYNA 2ZKIA 1ONNA 4JOCA 1GSIA 3MCUA 4KIWA 2RAVA 1NAHA 5SV2A 3HVHA 4YX9A 1FXWA 4N7RA 2PX4A 2YWDA 4JB0A 1DARA 1UBUS 3DE2X 3VNBA 2IEBA 3DKVA 4RTSA 1T36A 1E2EA 3VC3A 6PFKA 3JTEA 1RPJA 1P1JA 1EGVB 3BXGA 4GPZA 1PQPA 1Z2NX 2VN8A 4KO4S 4ZVQA 1IAVA 3NXKA 5M3BA 3ABIA 3AJEA 1Z35A 3HA3A 4Z3DA 1Z74A 1E3LA 4I9GA 2YN0A 2VWGA 4MMYB 4UCFA 5CX1A 4HT3B 2WM8A 2O5CA 1N7IA 5EJFA 3ZU3A 3BWYA 3V2HA 3LC0A 5JJCA 5E38A 3INRA 4JGIA 2BFDA 3HRHA 4F38A 5CRIA 2VP9A 4PX9A 3SSOA 1SPBS 1KOJA 1HDEA 4TYPA 3WY9A 4D8VA 5ESXA 3OTHA 3IE1A 1II9A 5K3FA 5D8DA 1AZSC 4IDCA 4NOLA 1JT9A 2ACWA 3DBHB 3N0TA 3OIYA 4I66A 3S4YA 3HY4A 3A14A 2RHHA 3RUFA 1OR8A 1NVAA 3PHGA 4Y6SA 1M66A 3C48A 3WJ7A 1CY8A 3ELDA 2PUFA 2G7MC 3I53A 2FMHA 4J90A 4K0RA 1FNNA 4MJXA 1ZNWA 4YGYA 2GN9A 2HHJA 4ENQA 1RSZA 1YQGA 2G8NA 1XA4A 1FTYA 2WAMA 1DBRA 4NBRA 5EHGA 5CBPA 1B6GA 2A9VA 2BP7B 3LVBA 2EDAA 4FBMA 3MTJA 1Z7GA 4U6SA 4ZV7A 1SELA 1SHZA 1UCFA 3BDVA 2DY0A 2AFIB 2R6R1 3UCEA 4FOSA 1Z22A 2PYZA 4CDRA 4QUDA 3QUQA 4D9NA 4HGZA 5KTRA 1XCPA 1X86B 5A5DA 3KQNA 2LIPA 4OYRA 3ZS8A 1I14A 2XBLA 3U7QB 2PTGA 2CMGA 3EA5A 1P7PA 1R1DA 4CNBA 5EFOA 2LKDA 3SX4A 5BSWA 2AF4C 4TRJA 2F8MA 3D2AA 1PWZA 3RAGA 4RULA 1TEZA 1XPUA 2WILA 3BFKA 1J24A 1JPVA 1X3SA 3IAUA 4OHUA 4QTYA 1HKUA 4WHMA 5JXHA 2DQ4A 2YQ4A 4MWCA 2HDOA 4MV7A 4R9RA 5FADA 5AIBA 1H0RA 3AI7A 1GTZA 3RJ9A 2UUCB 4KQIA 3M49A 2NTVA 4KV9A 5LQAA 2VNHA 1B7GO 1ZUD1 3E61A 3GEPA 3ZLBA 2X9QA 4RJJA 1NBEA 3L7LA 4HO1X 3EGDB 3H04A 5CFZA 1L7BA 3VH1A 3KLNA 3LUCA 5DX0A 5JWHA 2XVAA 5IASA 3SFZA 4TTRA 1F4VA 1MU0A 2ZUWA 1KRWA 4WJKB 3CT6A 5DGDA 2BRUC 4UMVA 4HADA 3EE6A 1L5QA 1XTVA 3RIGA 1R5NA 2CHGA 3CVJA 3T7CA 2H8KA 4PAMA 3UMMA 4CBVA 4XFKA 5TC4A 4B4UA 2DHQA 4YC7A 3Q3CA 5TMBA 3EPLA 1TAUA 1TKAA 2P1DA 1IN5A 2I6GA 3D3JA 4HKTA 2OKGA 4IO1A 4IOMA 1E6MA 2X19A 2YV2A 3BCRA 4CF3A 1ODSA 1PEYA 1R8XA 2PGIA 4PLGA 3HXQA 1G4UR 1Z0IA 2NYUA 4HAIA 2HF9A 3ZX4A 3O31A 3GO4A 4WK4B 2VRBA 5EKSA 3R0JA 3U3ZA 5IAEA 2QN1A 4YRQA 1V37A 4JT4A 3STYA 5M5BA 2AC7A 4NLLA 4U5XA 5BUSA 2J4FA 1Q95A 4OREX 5BV8A 3I52A 1I0IA 1SVWA 3L7MA 2QRZA 5F7OA 2J0UA 2XGMA 3LLCA 3NBKA 3BAZA 2OK7A 2IUYA 2R6DA 3LG2A 1GGVA 5FFFA 1JB9A 3BGWA 5FR2A 2RJOA 2PWZA 4LV6A 3M5PA 5FUXA 4KNWA 2XKJE 1YR6A 3SF0A 1AK2A 2O8BB 2PQ2A 3GLSA 4JXXA 2CB0A 1NV8A 3NTXA 3UENA 4P80A 4OXKA 3WDKA 3WHKA 2QTCA 4B09A 4LYHA 1F0KA 2FHPA 2X4LA 2LGJA 3NP9A 4GNRA 2B8NA 3RAEC 1TF2A 2H1CA 3PKIA 2F43B 1S2MA 1ZQ1A 2DUJA 3TNJA 3AHEA 2WAYA 4EMSA 3I9OA 1KYTA 1NUSA 1XKXA 3PFNA 4LZLA 5DGCA 1ILWA 2AYXA 4YMGA 3ELYA 2EFCB 2QTVB 3I8OA 3QHAA 4KZPA 2W48A 3LWZA 2QRVB 2W4IA 4F3KA 4PZZA 2JLXA 3SNHA 5HE8A 3BXFA 1V4VA 4KTTE 3HHPA 4KDEA 3OWXA 2CLEB 4EA6A 3O9ZA 1VPDA 1ZU5A 4JBYA 1ZD3A 1DKQA 2HIGA 3LUGA 3PHCA 4LZNA 1XMQB 4EGSA 2Y4NA 4FU0A 4MVJE 5KSPA 3W5IA 1G17A 1WUTA 3VKFA 2I9KA 1HYQA 3JQPA 4WBNB 1KS9A 1QIKA 1MT3A 3IE2A 4J7AA 4NPCA 1A8PA 3C3CA 3HCWA 4YS6A 2W9XA 5BW6B 2CT8A 4P53A 3SXUA 1MIOA 4L85A 2LVBA 4UTNA 3L9XA 4HQNA 3NJ4A 3ZLVA 3OF5A 1T91A 1G8MA 4BB5A 2P4EA 5SYMA 4ZQEA 4UM9B 3B9RA 2OBXA 1ZXXA 1IL0A 2HRCA 1X39A 2ODQA 2W6ID 3QW2A 1NW3A 3CUKA 3HVJA 2FF5A 3CU5A 3LUFA 4P93A 4QBFA 4RF5A 1HDRA 3K2IA 3ESQA 3RVDA 3V8BA 5I9NA 4NYJR 3BL6A 4KG7A 2WM2A 2Q0HA 3OLWA 3RTBA 2XECA 1KI1A 3R9KA 5D6OA 5BORA 1Y34E 1UK9A 2QPAA 2EIXA 5BWMA 3UMYA 1D6JA 4CM9D 3BJMA 1IWPB 1DWQA 4LXIA 4CM5A 3EB9A 3NWPA 3NB0A 2A4MA 2XTZA 4AB1A 4QUBA 1C1DB 3UV6A 4G0OA 1YDEA 2J6BA 2X0EA 3E4DA 1G8JA 4X60A 1FPQA 1KJJA 3DTNA 1OBVA 5AHRA 1XMOB 5CAEB 3BERA 4XYMA 1IZ9A 2PMCA 2H5JA 3MLAA 4N5HX 2FPGA 3IP5A 2J5KA 1TJ5A 4WK6A 4CMHA 5IJ9A 5K0BA 1QJCA 1YZQA 2X76A 5REQB 4LRXA 1RWVA 1CJKC 4J2HA 4O02B 2AX3A 4QULA 2HHHB 3RIEA 2VQ3A 4K6OA 2SKCA 4WK2B 5LOVA 4U2FA 3JALB 4X44A 2GILA 2QORA 4PHCA 2W2NA 5ECGC 1D4ZA 4RXUA 3LDUA 5F1PA 4RETA 4G97A 2O8FA 3SJZA 3GV0A 1EEXB 1XEWY 3C1UA 2R9VA 1NVUQ 3GJ8A 5DBGA 2WUVA 2H1SA 2QL5A 1KRXA 5COBA 4H7KA 2H57A 3RVOA 4GMHA 4QXOA 1BMTA 1YQXA 2DT8A 3CEJA 2Y1EA 3QVXA 3UV7A 1ZD2P 3SQWA 2ET6A 4LHVA 3HJBA 1FYDA 3PKZA 4LWQA 3DM9B 3OI7A 1S2NA 1R8QA 1Z06A 1ZWKA 1ECLA 2XQFA 4MMZB 4N65A 4UQPA 1JEYA 2VR1A 3AUSA 1C8VB 2YZMA 1TM1E 4MA0A 2XWPA 2GSDA 3PYXA 1VRWA 3JWIA 3AVOA 4RPHA 3L92A 1JR3A 1KAQA 5CHYA 2GTHA 3BDAA 3FNRA 4F7DA 4ZAXA 1UEIA 1AN0A 1XZEA 2C31A 3DAHA 1C9DB 4K6CA 4NDZA 4FC6A 1YZVA 3O82A 5KCMA 2ALJA 2DLNA 2GNAA 4K88A 3P94A 2V58A 4L6CA 4FFMA 1MB9A 3QYPA