3ROFA

Crystal structure of the s. aureus protein tyrosine phosphatase ptpa
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
158
Chain Sequence
AYFQGMVDVAFVCLGNICRSPMAEAIMRQRLKDRNIHDIKVHSRGTGSWNLGEPPHEGTQKILNKHNIPFDGMISELFEATDDFDYIVAMDQSNVDNIKSINPNLKGQLFKLLEFSNMEESDVPDPYYTNNFEGVYDMVLSSCDNLIDYIVKDANLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and substrate recognition of the Staphylococcus aureus protein tyrosine phosphatase PtpA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Low molecular weight protein-tyrosine-phosphatase ptpA
total genus 51
structure length 158
sequence length 158
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rofA00
2O20A 5IULC 4OATA 3JY6A 4MRMB 4WZZA 3L6UA 3C3WA 1Z17A 3H6HA 3MMNA 2H0AA 2VUHB 3HDVA 3N0RA 3QLUA 5TQJA 5TQ2A 3SQNA 1BAPA 2PUGA 4MPTA 4TLMB 4RKQA 3JPYA 5EWLB 2PUBA 4GPAA 3SM9A 2FTKE 4EVQA 3KJXA 4Y9TA 5JNSA 3FGZA 1FFGA 1K68A 1SRRA 1DCFA 1DG9A 3T8YA 3ROTA 3KYJB 3O2SB 3NBMA 3EDCA 5JNTA 2OENG 3MQ4A 4MR7B 4OBBA 1RXEA 5B3JC 2R4QA 2B1JA 4H3KB 4WUTA 2OQRA 3F73A 2IKSA 3D8UA 3OQMA 4OTZA 4EYOA 1D2AA 3HDGA 1Z2EA 1NY5A 1FSPA 1TMYA 2HQBA 1CHNA 4TMYA 3HO1A 2QXYA 3I09A 4WWHA 1ZAYA 3NNDA 4G86A 1YK1A 4CBVA 2YHBA 3GL9A 3ROFA 1QQBA 2FMHA 4UHKA 5FBKA 4EGSA 4E7OA 2WJAA 1ZGGA 3K9CA 5CNJA 3EGCA 3ILYA 1JDPA 4MS4A 4IILA 2GWRA 3O2JA 5IUKC 2DRIA 3TB6A 1JX6A 2BGGA 1YS6A 4JAVC 4G97A 1XHFA 4IMJB 2LP4Y 3BBLA 3CRNA 5TPWA 3LUCA 1QKKA 4HNSA 1MAVA 3C3KA 3EAFA 2WY2D 4EYQA 1SD5A 1VRVA 2E4ZA 3H1GA 3Q7TA 3OO0A 3MYYA 3A0UA 4O5AA 2QVCA 1ZHHA 2GBPA 4MGEA 1NXVA 1NXTA 1LJLA 2W42A 5KQGA 4WXEA 5IBQA 1TM2A 3UKJA 2PE5A 4EY3A 3BREA 1USIA 3W9SA 5JNVA 5EWJA 5BRAA 4DN6A 1GCGA 4RY9A 1J56A 2FEKA 1EAYA 1EHCA 2GI4A 2FW0A 4RV5A 2FKAA 1AB5A 1JBEA 5KQMA 2MSWA 4N41A 4MR8B 2QSJA 1PEAA 5CHYA 3VNBA 3HCWA 3HM9A 3OM0A 3Q9SA 5KWSA 2NZUG 3GWGA 4QICA 4NCAA 4W5RA 1SXGA 4ZPJA 1H9CA 3FFTA 3OLWA 1E6KA 4MRMA 4H3HB 4EYGA 1U04A 3GT7A 2JCGA 4Q6BA 5D2CA 1NXPA 1NXOA 3O74A 4G0ZA 4MQFB 5KQPA 1LBIA 4W5OA 3CS3A 3IP7A 3OLVA 2WWVD 1JH9A 2JK1A 3OMXA 1ZVVA 1ZY2A 3QLVC 3B2NA 4YP9A 3N75A 2R25B 4DQDA 1P2FA 1USGA 3E61A 1W9HA 3H5TA 1MVOA 1YK0A 1PHRA 1DCMA 2IPAB 1NXWA 4B09A 2E4XA 3LTEA 3QELB 4FE4A 2MYPA 3OLZA 1JWLA 3RVLA 3NNSA 1GCAA 3SNKA 4KZKA 2FSPA 4O1IA 1ZDMA 4G0QA 4YV7A 3CZCA 1ABFA 3P9YA 4N0QA 4YWHA 2R48A 2P4UA 3RVRA 1S8NA 3FDFA 3RQIA 1YMVA 5CNKA 3KLNA 1KGSA 3JPWA 5FBHA 4Z9BA 1MB3A 1BVHA 1RPJA 4QPJC 3LUAA 1BDHA 2PL9A 3M9WA 1WETA 2MYUA 1Z26A 3RVSA 2E4YA 5HQJA 2RJOA 4ML3A 4OLBA 1M5UA 1TLFA 1JDNA 5GQSA 1URPA 2FQYA 3TX6A 1SXHA 3CHYA 5B3JA 1BDJA 2FEPA 2FQWA 1NXSA 3G85A 3OM1A 4RDCA 4MS1A 2FEWB 4MYRA 5C5EA 3HEBA 4JOQA 4RY8A 2PUCA 4MQEB 2VYCA 3S99A 3F7NA 3QEMA 4EUKA 1E6MA 1ABEA 1M2EA 3H5OA 4EVSA 1DP4A 3LUHA 2PUDA 2GKGA 2ZAYA 1JFSA 4KQ9A 2MYTA 4EVRA 4F12A 1YIOA 3GBPA 3BRSA 5JS1A 2FLWA 8ABPA 1U2QA 1QQAA 4KREA 9ABPA 1RXIA 4LRQA 4S04A 2IYNA 4HYEA 2M98A 3NHZA 3NNNA 4Z4HA 1VKRA 4ZJPA 3CNBA 2QZJA 3Q7SA 2WJWA 1D5WA 1USKA 1VLZA 4RWEA 1GUBA 4WT7A 1C4WA 4MS4B 4XFKA 5IUNC 1QP4A 2PUAA 2GX6A 1DBPA 2H3HA 3EJWA 1DBWA 3LOPA 5IEJA 3EULA 3GRCA 1Y1LA 2N9UA 3KLOA 1P6UA 2LPMA 2J48A 4H60A 4P98A 4LZLA 1Z18A 4XAQA 5TPZD 2F8SA 1PNTA 4QYWA 4D6YA 3HVRA 2FMFA 4G0PA 4NCBA 1QPZA 2PJUA 1Z2DA 2ID9A 3C3MA 4RS3A 3UK0A 4D6XA 1IIBA 5IUJC 7ABPA 5BRJA 4NICA 4Z9AA 3LUFA 3HSYA 3MM4A 5DTEA 3CKMA 4RU1A 3CU5A 4D74A 4YS6A 5DGCA 5FWXB 3Q41A 5T7BA 3KCNA 4MR9B 4E7PA 4XXHA 1CYEA 2PL1A 4MAAA 4MQFA 4Z0NA 1ZITA 1JFTA 1T34A 2M1ZA 3CFYA 3CLKA 3OMWA 2L19A 3QX9A 1APBA 2WMYA 3LUGA 3N0WA 3OLYA 3FFXA 4W5QA 3RH0A 4Z4GA 5IEBA 1YMUA 2AYXA 4L85A 1JF8A 5DLEA 1JL3A 4F8JA 4RXUA 1D4ZA 2LIVA 3FFWA 1U2PA 3GBVA 3OO1A 1UDRA 2VK2A 3H5VA 2JVJA 4F11A 4LDZA 5TPWB 3QLTA 3JVIA 1MIHA 4KMRA 2FMKA 3TO5A 3M9XA 4OG2A 3I42A 1M5TA 4YCSA 5JNWA 3IPCA 2IPMA 1CEYA 1U8TA 5PNTA 4RXMA 4OLAA 3HJFA 4N03A 2CHFA 3CZ5A 3DGFC 1YVUA 2PMCA 3KG2A 4MS1B 3RVPA 3DGEC 3G1WA 2JVKA 4Z4FA 1K66A 2L17A 4W5TA 2TMYA 1PUXA 2B4AA 1QP0A 3CG0A 1ZN2A 2ID7A 4HNQA 4JA2A 4N47A 2HJ9A 4ETNA 1XHEA 4KVFA 2IPNA 5IC5A 5HKOA 2QV0A 4TN5A 1W25A 1FQWA 4MR8A 3NHMA 4MQEA 3IP5A 3LMKA 1RZRD 2LBPA 1EFAA 5KC9A 2PLNA 3TD9A 4F3TA 3TMYA 4FB4A 5E3JA 3LUKA 3LKVA 1P6QA 3KTOA 4M88A 2F8TA 5FWXA 3O21A 4YRZA 2I6FA 1LK0A 5TQ2B 2JBAB 3IPAA 3LKBA 2HQRA 4YGXB 4W5NA 1QO0D 3HUUA 4WXMA 1KMIY 1OXKB 2HQOA 2V0NA 5KI6A 5JNRA 4FE7A 4P1ZA 3T95A 1JFVA 5HM6A 3RVKA 1EWVA 4PICA 2ZWMA 3H6GA 2FXIA 4RZSA 1L5ZA 4UHJA 2JVIA 2KYRA 2NUBA 3O1HB 3OQNA 2FMIA 4LE2A 3H1EA 1JYEA 2JB9A 2LUOA 4KRFA 4KV7A 1JHZA 2RGYA 1LBHA 3H1FA 4L4UA 2RJNA 2P9HA 2RDMA 3Q7RA 4MR9A 5EWMA 1PNRA 3IDOA 4RKRA 1NTRA 1QP7A 5JS2A 1YS7A 3L49A 5CNMA 6CHYA 4KK4A 1FFWA 1DRKA 5FWYA 5TQ0A 2IPLA 4IMIB 1D1PA 3N8IA 4Z99A 3MF4A 4Z4IA 2HPHA 1U0SY 3EQZA 4G0YA 4MS3A 1JYFA 4NQRA 4PZ0A 4HNRA 1YTUA 1QNLA 4JP1A 3T38A 3LFTA 3MIZA 4IRXA 2FQXA 2FVYA 1Z16A 1ZH4A 2PAFA 1B00A 3I5AA 3JTEA 1DJMA 1ZH2A 4KPYA 5ED4A 2FN9A 1BA2A 1LJUA 3GYBA 4IGAA 1RZRA 3HK2A 4MR7A 2PUEA 2FLKA 3QK7A 3QEMB 4O1HA 4ZMSA 2X7XA 2FN8A 3DZDA 2AYZA 3IP9A 3LUDA 1EWTA 4RK4A 1GLGA 1ZESA 1E2BA 1ISSA 2WB4A 2R47A 2VUIB 4RK1A 1A2OA 4ETMA 1BDIA 5DKFA 1L5YA 4Q7EA 3C6QA 3H5IA 5F64A 4Z4EA 3D02A 3R0JA 1FFSA 4YR7A 4ZYLA 1TJYA 1ZGZA 2A9PA 2CD7A 1OXBB 3O75A 4G0OA 2A9RA 3HS3A 4RK0A 1NXXA 2YHAA 5HSGA 5C5CA 4PEVA 3JVDA 3OLXA 3KKEA 4F06A 4JB0A 3Q15C 5T3YA 2IOYA 4JB2A 3UUGA 1I3CA 4RSMA 2E4WA 4NV3A 4Z4CA 2CWDA 5IX8A 1NATA 3QLUC 3C97A 1M2FA 3A10A 2NT3A 5ABPA 2PKXA 3K4HA 4KFCA 3EQ2A 3HXMA 3HZHA 4MLDA 3GA5A 3HV2A 5JNUA 3EODA 2QW1A 5BR1A 2Q5CA 4LE1A 5DCLA 5TQ0B 1Z13A 4KQCA 3F6CA 3MA0A 4MLCA 3GV0A 1RNLA 3N0XA 3O2QB 3DLHA 3RVJA 4ZMRA 5EWJB 3KYIB 1VPWA 2CHEA 1Z12A 1QMPA 4LX8A 4LE0A 1C0EA 1AB6A 1DC8A 3T6KA 2A9QA 3M6MD 4KNYA 1MB0A 3A0RB 3KHTA 3DBIA 1JLKA 5EWLA 1EWKA 3O1JC 3A3KA 2NT4A 4RK6A 1DC7A 3QEKA 3O1IC 4S05A 3QLVA 3RVNA 4QYMA 5GOTA 5KC8A 1DRJA 4TLLB 3QX8A 4ETIA 4IF4A 2QVGA 1DBQA 1E6LA 3DLBA 1F4VA 1HEYA 4N76A 6ABPA 4EYKA 4LDAA 5FWYB 4KK3A 5CNIA 2E4VA 3CTPA 3SAJA 5TE9A 2JRLA 3IP6A 1R8JA 4RXTA 3N6VA 5EWMB 3SY8A 3OQOA 2JBAA 2IDMA 1Z25A 1DCKA 1DZ3A 2NZVG 3QELA 4RK7A 3RVQA 4Q6WA 2MYNA 3I45A 2HSGA 3CG4A 4G0MA 2E4UA 4YO7A 4XARA 4DADA 1GUDA 2WRZA 4JASB 2QU7A 4XLTA 4RK5A 3E3MA 3H5WA 2L2QA 5BQ3A 1PEYA 4MS3B 4XASA 3URMA 3BRQA 2MSKA 1QO0A 1SXIA 3VNAA 2PUFA 4PE5B 1KRWA 3RVOA 2A9OA 5TPZA 1F51E 5KQLA 3BILA 4YLEA 1TVMA 3HUTA 1D1QA 3F6PA 2MSLA 3N53A 1XWWA 4N0PA 4PYRA 3RVMA 1P8AA 2L18A 1ISRA 1A04A 2QR3A 3H75A 3KSMA 1Z15A 4GNRA 4RY0A 2XDYA 3H5LA 3KS9A 3SG0A 5I4CA 3FMVA 1KRXA 1A0OA 3ILHA 4G0XA 3LUJA 3JS5A
chains in the Genus database with same CATH superfamily
1NLMA 2H4FA 4Q1CA 3U37A 3WNDA 3GJSA 1E5QA 4H1VA 4LG1A 3C3WA 3OD5A 4TQ9A 5HRAA 3SX0A 3EBLA 5EKDA 4DY4A 1CV2A 3DC7A 5L40A 4MPTA 1G5IA 5EWLB 3F6YA 3LWZA 4KYIB 4B17A 5BMOA 4KVAA 4M99A 4RHUA 3UWKA 1AKEA 3HY4A 4EVQA 3PGXA 2IS2A 4EFNA 1D9XA 4CT5A 4DYVA 3RAJA 2PZEA 3HDYA 3W5VA 1FFGA 3RFTA 2QX8A 1FSSA 1Q0RA 4ZFNA 1NC1A 5T3UA 4DZZA 2J3JA 2PKRA 3NBMA 4FS3A 4JI3B 4Y6QA 5K51A 5C18A 3OHMA 4HLDA 2VO1A 3DL4A 1LTHR 4YPVA 1UJ6A 5A03A 2DUUA 3RGGA 3T4EA 2W2TA 3X1MA 1BGVA 4UM9B 4Y2GA 3VH3A 5K9ZA 4GOMD 2RC5A 3IKLA 4TT3D 4XIGS 2W11A 1H4VB 1Y4UA 3M0EA 3ZIAA 1UOPA 4BJ6A 3DEFA 2YXDA 3NNDA 4V3BA 1W36D 2Q5HA 3AVOA 4B0PA 1QTQA 4GPD1 3UGJA 1QWSA 4L5YA 4O6VA 4DMKA 4IJ6A 5DSXA 3E7PA 1Y1RA 5I9BA 4EY8A 1ZGGA 2P3LA 3C8MA 4UASA 3W2GA 3ADOA 3O2JA 4I1OA 3MBIA 1P4JA 5ELMA 4QJ3A 1KC1A 1NYQA 4R9SA 4EMBA 1D07A 3RSOA 5FPYA 3TI9A 3MAJA 4ENVA 3OTOB 2FU5C 1TLLA 1EGMB 1V0JA 1MOPA 1OHHD 4NS1A 3GRUA 4KO2S 4KKVA 2J0UA 1ECLA 1NU6A 3DE0X 1WPXA 1JIVA 4OH1A 5ERXA 3OO0A 3GGJA 4HH0A 4X6YA 1T1GA 2PR7A 3D2LA 2YWCA 2ZUWA 2FK8A 4MARA 5FOTA 5K03A 3CVJA 3ORRA 1M8KA 1OI3A 3KHSA 1M6HA 1YBVA 4NDZA 2W42A 1KI2A 1VDMA 2D4HA 1GU0A 3B7PA 4OQQA 1YL6A 3RC3A 3W6UA 4B83A 2PU5A 1Q3KA 4UEQA 4MV3A 2PRKA 4URHA 1E7MA 2H5IA 4J49A 4A3SA 3PRKE 4FKBA 3GT0A 3RJ5A 1YUMA 3ZX5A 3I8XA 1B42A 4N39A 5DI9A 3B38A 1EQAA 2PKQO 1BMFD 2XYQA 1EHCA 3VKFA 1JDJA 1KDPA 1DAOA 2PWBA 1I13A 2QLLA 3OH8A 3FTEA 2D2EA 3FF1A 5ALIA 2OCGA 1AB5A 1R4NB 2ZE8A 3FM9A 2CNNA 1KYXA 2PIAA 2XNDD 4LZZA 5TB5A 3U9LA 1RWMA 4CKBA 4YRIA 3WYCA 4GZ5A 3EXEA 4MO2A 3O7WA 3W9UA 5CHYA 1QGUA 3IDFA 5BVGB 2AD5A 4OX9B 4D0SA 1Q0LA 1T8UA 1Z7YA 4JGBA 4ZO7A 4H7FA 4GYKA 1IXSB 3DMHA 5DHTA 4MHOA 2C04A 3QBJA 1BFKA 4R3WA 1JBQA 4ZPJA 1KPIA 2YFYA 4D9BA 4ZZ0A 2O0KA 4BXOB 4OP3A 4XWGA 2WT9A 3SZRA 4EG1A 3ZHXA 1NU8A 1O97C 1OT3A 5JBIA 2I99A 4YRBA 1OLXB 1MQSA 2PANA 2OT3B 1XPRA 3X1DA 1GCUA 4KXUA 1XR3A 2CLMB 3EN0A 5DYYA 4HEJA 1NJ1A 3G68A 5CA1F 3FKQA 1W85B 4HLUC 4XYMA 1EESA 4QUJA 4YO8A 3LXRA 5JSFA 1NF9A 2A0XA 3GEMA 2W6IA 1P44A 5JC8A 2J07A 4UHHA 1NXWA 2AMFA 1VG8A 3C7DB 3ND5A 1IYZA 4FFRA 4A2WA 4IINA 4AWAA 4B73A 3UHAA 3E8SA 1HDCA 3P9YA 2C7RA 4CZ2A 3BK1A 3LJKA 1Z4MA 4N0QA 3ZWOA 1BFUA 3HJTA 3TEJA 1S8NA 1SXQA 1BROA 4AUEA 1XTPA 2CDAA 1IWBB 3LP8A 4KWTA 1J0BA 1F06A 3A9VA 1ULZA 3IDZA 1TCVA 1X9HA 3TKLA 4Y0VA 2YV4A 1XPUA 1B14A 4A5OA 3EVCA 1FFYA 1G3QA 1GKUB 1JKJA 2WQ7A 5EIXA 3ESXA 1TM5E 2V59A 1FJHA 2E4YA 4QTXA 5SY6A 5C7LO 2BGKA 2XWBF 3WMFA 2X0NA 4E70A 4ML3A 1IEQA 1M5UA 2ZT6A 5ICMA 1O8BA 1U28C 2VG8A 3G1TA 1DJNA 2PRJA 3CR8A 4LJ7A 4MWZA 4NJEA 2QJRA 4TSFD 1A8QA 1J1ZA 3QX3A 2D8MA 1VCMA 2G7ZA 1NXSA 1JG2A 3EG5A 4RC9A 2JLWA 5A7FA 1ZCFA 3DZGA 3MJRA 3T5MA 3X43A 2DCUA 4KIWA 2BMFA 1JMYA 2D00A 4FYKA 3WLIA 3S7TA 5CB6A 4X3CA 1HFWA 2VL7A 2XTJA 5EY5B 3RIMA 1TFRA 1CJMA 3BEOA 4IVRA 1H2EA 3A9RA 4FD3A 4XR9A 3F0TA 1D2RA 3HSSA 3L40A 1NURA 4IIFA 4U7JA 2E87A 1K8YB 1Z6XA 1YIOA 4H7DA 3TZQA 2BHTA 3IVRA 3IDQA 3PQ8A 2MOKA 1FX0B 3JQ6A 4IWXA 4AI6A 1J25A 2OXIA 1OI7A 2VOJA 2D4AA 2YMQA 2OQIA 3AF2A 1U7ZA 2GF9A 3TYXA 5F78A 1DUIA 2G1JA 1CQZA 1SXJA 3IO3A 3NNNA 1A95A 3KU4A 1JDSA 3I3OA 3Q7SA 3SJBA 4ENUA 3QBDA 4BNXA 1GUBA 3ZDCA 4AUMA 1E99A 3K09C 3FI9A 3C3YA 3WK8A 4LDRA 4OXYA 1CUWA 3AR7A 1IQRA 1FYDA 5IEJA 1SQ0A 4REQB 2N9UA 1LNQA 2AG6A 4IH4A 1LB1B 4QSHA 2F1HA 2QJTA 5DNWA 5BQPA 3U6KA 3PDCA 1KJNA 3OPYA 1WQ4A 2WAXA 2IDKA 3TIFA 2UKDA 3ZY5A 5JDCA 4HAYA 4RE6A 3IQXA 1OB2A 3AILA 2W2XA 2GTIA 4TMFA 4TZKA 2X9LA 2YZ7A 2QW0X 3P20A 4UD6A 2VZ9A 4IPTA 1XZMA 5KKNB 3GEGA 5JEDA 1E6EA 1F0YA 1SA0A 2QZSA 1E96A 3TMAA 2P9ZA 3R8XA 3LP6A 1R5OA 4HEA1 4DFDA 3AWDA 4DUYB 3OJCA 2BZGA 1OI4A 2OV1A 2R5WA 3KLBA 1WBDA 4PO9A 2H4HA 2L82A 3GJ0A 2IPOA 2CXXA 2H16A 2IYVA 4MVJP 1LWOA 1W94A 3FNFA 4Y1GA 5AVYA 4JLSA 2J3IA 2VDJA 1BS9A 5B5SA 1W9MA 1N2CA 4E1VA 1EBFA 3NO4A 3GH3A 4NU8X 3K94A 1P2SA 3MTIA 3N0WA 1IATA 3QKTA 5HEKA 3WLQA 3AKDA 1CVRA 4L85A 3CH5A 3D8BA 4AO7A 2FN7A 1UM9B 1V7QA 2V7EA 3FFWA 2KPOA 1IOVA 1TADA 1TF7A 4OHKA 1LD3A 1S7GA 3TCKA 1QRAA 4PHFA 2JCBA 1TYEB 2LE0A 2ZTMA 4XDZA 2FPOA 2A5DA 3CXRA 4MRRA 3EXHB 4DILA 5AI6A 5FV7A 2FMKA 4KN9S 2AS0A 1ZNXA 3JQEA 4HK4A 1EWQA 4GZLA 4J6EA 2WB2A 1OJ7A 1RPZA 2XXAB 3A3NA 2ZXFA 1TDJA 3L1JA 1LKZA 2PZJA 4RBNA 4KX3A 1HTTA 4O0MA 4OHVA 4DMCA 3QUQA 1Q57A 2VDPB 3KYCA 5GMOA 5A0VA 4C7OA 1GCOA 1GXSB 3OHSX 4E08A 1HSZA 1PZGA 3O1LA 1E61A 3DVSX 3OOYA 4NARA 3NUQA 4P83A 4V03A 4A9AA 3S28A 4J9UE 4D9IA 1GSHA 3LNTA 4C4OA 2HU8A 4QVGA 1R4ZA 1IM2A 4EA7A 3JXEA 3V2GA 1GARA 1K5DA 4KVFA 5BSWA 1PSWA 3QKWA 4ZODA 3ITDA 3ABSB 2HO4A 3X2SA 2GILA 4NOMA 3SVTA 1J0EA 1DC5A 2IOFK 2V6JA 3A4TA 4OQPA 4P3OA 1G1MA 1Q6YA 4UBLA 3OT1A 1F6BA 1Z8HA 5F5NA 1PSDA 1XVLA 3LUKA 1I9GA 4MUGA 4NMMA 2NU7B 3C2QA 2ZIGA 2FPLA 2MCFA 4ZVPA 4DIFA 2ZAGA 5FT9A 3NC0C 4XFJA 4IQGA 3IPAA 4C2TA 4URVR 2GKSA 1QV6A 2WYOA 4M1TA 2BH9A 4X8OA 1DE0A 1QO0D 2IXAA 2XGOA 3OJLA 1L6IA 4PLVA 1GTZA 2XQKA 4TUYB 2RGUA 1QFZA 3UKDA 3HY6A 3EMVA 2YJ3A 3RS8A 1OAKA 3QKRB 4Q39A 1BWQA 4BO4A 1AS3A 4YJ2F 3N0TA 2ADOA 2PBRA 4QDKA 5CM9C 2XBUA 4GMDA 2PLAA 3TSZA 3TVTA 2GAFA 1XZBA 5C1IA 3BB4A 3VYTB 1EWRA 1XZKA 1Y5MA 1C8KA 1QR6A 2HYDA 3LW8A 1V96A 4GYWA 4MICA 2I3AA 4O2BF 1UKEA 2JLVA 5JAMA 2WTMA 4UC0A 3SQDA 5F9HA 2VPIA 4QBKA 2D1TA 4F2DA 1AHIA 2I5PO 4KGDA 1H8EA 1KA9H 1N3BA 1R7RA 1RYMA 1XC7A 3MRVA 3CE6A 3PK0A 2MU1A 5SYNA 5KYUB 1PNRA 1BE6A 2C4UA 3FHTA 2D2FA 2ECOA 3OA0A 5CYOA 4BUZA 3OT4A 4KPGA 1I1QB 1XXHB 5JS2A 4FGSA 2D1YA 3LY5A 4IHQA 3PENA 4RIHA 1TW3A 1GZ7A 2KB0A 2P9FA 3S1AB 1RJGA 4KK4A 5FWYA 1IN7A 1CZNA 1L9XA 2CSUA 3GQVA 3A1EA 3OF2A 1TA0A 1F12A 1FF9A 5IVDA 2D8AA 4EQ6B 1HNNA 1NE2A 2VK1A 3DOIA 3TNLA 3IUNA 3OQPA 4M46A 1EI9A 4IRXA 2DCMA 2PN1A 1SM4A 2R751 2ZR8A 5KS2A 2C77A 5ED0A 4PC2A 3ZWCA 3UCEA 1TZMA 4L6AA 1NYLA 3PKJA 2XGSA 4MHTA 4BB9A 7REQA 2Q21A 2WFMA 1ZH2A 1YKSA 5A9TA 2A7QA 4KQHA 5LA6F 2VYQA 3VFDA 1YS4A 3ESYA 3U7HB 3JATA 4E3WA 3TMKA 2FLKA 3VOSA 4JL6A 2I62A 5AVJA 3CUKA 4WDQA 1GLGA 1NYTA 3NV9A 3PQ7A 4FXOA 1JSCA 3ILVA 4J16C 1PR2A 4J0HA 4X90A 4EDHA 2DMRA 3ZC3A 1G17A 1R6BX 3NJRA 4JJAA 1EP1B 1L5YA 2RGDA 4J7AA 4MV1A 5DKFA 5DO9A 1WOMA 3ZHBA 4ZGWA 4ZMBA 4A0SA 1HR0B 4EO7A 5FLYA 5HR5A 3E53A 3ZWYA 3P45A 4R2WA 3RJMA 2GCPA 1TJYA 3M83A 4CMGA 4GXRA 1VJCA 2VJBA 2L0XA 4UNIA 3BTUA 4WLFA 5DTJA 2CYCA 2FUNB 2YHAA 3OTWA 3H1BA 4PSCA 3B3GA 4NH0A 4HVLA 4WDRA 2H4YA 3JVDA 5HSGA 5IC4A 3OP1A 1UIRA 1DOZA 1WMSA 3ENNA 3L0YA 1V16B 4MUFA 3TL3A 1U8ZA 2IZ6A 4CRWB 4DHWA 1PIWA 4IEIA 4RH0A 4ZCTA 7MHTA 2ZI6A 2PKEA 1BMQA 1KYWA 4FKMA 4G07A 5IX8A 2CHGA 3Q3IA 3STVA 2RGRA 3PWZA 2EKPA 3WGJA 4RD1A 1TMOA 2QRKA 2EFDB 2P0YA 4D0GA 3RHSA 2ZIAA 2GJ8A 1H3NA 3TLMA 1H8HA 5KYWB 3PKZA 5LUAA 3DT8A 3GB9A 4R5HA 1Y98A 4L0QA 4ZVRA 1FVOA 1MRSA 5KX5B 4UZFA 1MIOB 4TWZA 5FA6A 1S3IA 1HDGO 5FUYA 4PPYA 1OFGA 1KAOA 1LBTA 3GP5A 2B25A 2VN8A 4FYVA 1U3DA 1P5FA 4M7WA 4JI4B 2Q3LA 4AF8A 3EVAA 4F4IA 5J59A 4YAWA 1VJGA 3P8ZA 4H7HA 3GO4A 1W4AA 1RJFA 4CL0A 5H70A 5LXTA 2CVHA 4AYWA 1VYUA 4NY1A 3PGJA 4R6XA 1S4MA 3U62A 1R4NA 2NT4A 1G0NA 1S5PA 4DBVO 2WF7A 3GW8A 4BIIA 3R5FA 2CBZA 4JZYA 4CDMA 4QYSA 3QTTA 5C8ZA 1JG6A 4B1FA 1P0MA 3PPVA 4LGCA 5D85A 1L6RA 4E5MA 2ZYTX 1FXUA 4P2BA 2DYKA 4PAGA 4GLBA 1MO3A 2CLLB 4N5DA 4PO8A 4PPFA 3BMXA 3CMMA 1WXXA 3AM3A 1CF9A 3CN9A 2X2EA 3OIGA 1VPVA 1G2IA 4QARA 2Y9PB 5DCYA 5A5EA 3ROXA 2GHTA 1GJRA 5CLHA 2D0OB 4F2WA 2Z30A 1YZLA 3ETHA 2EATA 3L06A 4EZBA 1NHGA 3RLFA 1GAWA 2I91A 1PE0A 4QEZA 3S68A 2O3RA 1IN1A 4PF1A 3HFGA 5IM4A 1VCIA 4CFZA 3VC2A 4QUIA 4RDHA 5T5QA 4AJ2A 2OXTA 5CFPA 3URMA 3IOEA 3ZV3A 5LQKA 3IUSA 3V55A 1MJHA 2HI0A 4RM3A 2ZDHA 3QYFA 1QM5A 4EJSA 3FYUB 5EERA 1F51E 2RFLA 3F7OA 2H1WA 3H0KA 3TLGA 5AI4A 3X1YA 1NE7A 1XWFA 2WJGA 3ABZA 3E9QA 5DOVA 3FDJA 1RRPA 1SZPA 3G8AA 4J90A 4XQ0A 1Z6TA 4OH7A 1J23A 4KFSA 1TQ8A 3ZZ1A 2L18A 3QVXA 2I2CA 3ZU5A 3K2BA 2HMWA 3TLCA 3WHIA 2N1MA 5IAEA 1KIAA 4FXPA 3TQOA 1X42A 4N12A 2QD2A 2W00A 3HH8A 2ETXA 1ND6A 2ZRNA 4IJWA 2O20A 4KMRA 4QDTA 1QFXA 2R00A 2XV1A 2C4VA 4LCJA 4J7XA 2HJGA 2VHCA 4BO5A 3WV4A 5B7PA 2C0QA 1Q0ZA 3GVHA 5GV7A 5JJKA 3VR6D 2R4UA 4X41A 5JALA 4TLMB 4L07A 4RKQA 1FFHA 2PPVA 4AURA 4YT8A 3OEED 3SM9A 4KPFC 1GTMA 3HJBA 1D0SA 3TDKA 3UV3A 3N6XA 1QG4A 2QTTA 3ND7A 4J16A 1T3LA 2GM9A 4QDXA 4Y2QA 5A71A 1A5AB 4LXHA 1XRJA 2DWQA 5LZ5A 3CSDA 1N3IA 1GPBA 3W2HA 2XCTB 2DGDA 3B5IA 5A02A 4QPZA 1S2IA 4AKEA 3N2NA 1O9GA 3G9UA 1T1SA 2ZSEA 1CSEE 4O4LF 1IRIA 4RIFA 1SBHA 5GGYA 1I9CA 3D8UA 4WUVA 3U13A 2O23A 3W5IA 2ZE7A 3SEZA 1EDOA 5SZHB 2HDWA 3HB1A 3TRHA 3NIDB 3IE2A 4KKXB 2GFHA 1NN5A 3CPHA 4G89A 1ZVMA 4NBTA 5D84A 5JJLA 4GKJB 2PGNA 1Z4KA 4OSOA 2YCBA 1JRLA 3U26A 2CLIB 2YVAA 5D3ZA 4MCIA 1GYRA 2CUNA 3NR2A 4HDKB 5FBKA 1NFQA 5IAGA 3W8RA 4I3HA 1N2SA 1G1AA 1PL6A 3NTVA 1UOEA 3DQPA 2JK0A 2RHLA 3HE3A 4BGVA 3BDVA 3QG5A 3HLKA 2XUDA 5GGXA 3AKYA 4V2UA 4G97A 1TUEA 3IHTA 4LDNA 4F5DA 3MXOA 2WWGA 3WA7A 2X77A 5DRYA 2BP7A 1NN1A 2MSNA 1K3FA 2GK6A 1QDEA 4QWWA 2RG7A 2VYVA 4YHBA 4E51A 1Q22A 3EFHA 3LOQA 1Y3IA 1FRQA 2VYNA 4FEAA 3KQYA 4O4HB 3TIVA 4Z4QA 1H1DA 2RH9B 4NZ9A 1OC2A 2YXLA 1P9RA 2RSLA 1U0LA 2R9VA 4GYJA 1WMAA 2QVCA 1DFHA 3MT8A 5AVKA 4X45A 2V96A 3OTGA 4A6DA 4D8TA 4PPQA 3RFCA 5LWQA 4IXWA 5KQGA 3FNQA 2VSYA 2YJGA 5ALUA 2XADA 2WZCA 3UKJA 3V1NA 3R4CA 1E2QA 4YXWA 1RWQA 5JTTA 2RAVA 5BRAA 2WLSA 4D4IA 1YUNA 1VKOA 5E2BA 2XECA 4XPIA 1J06A 5F3DA 3ZHZA 1EXMA 5L8VA 1PT7A 3AXSA 1PQYA 3RF6A 2WM8A 2XOXA 1A4UA 3H2KA 3VV2A 4ZCSA 5JXWA 4B35A 4RY2A 2OCYC 1H2HA 4M86A 4D8XA 1OH8A 4MUEA 8GPBA 4H7JA 1PEAA 4JJKA 2LIPA 4F9GA 4WCFA 5CPBA 4DBZA 2VNHA 1S8FA 4RA9B 4OGGA 2JG3A 2ZVQX 2BIFA 3WHPA 4DUGA 4L5JA 1CX9B 1RKBA 4PZYA 4TKVA 1DEOA 3BVPA 1E6KA 4MUJA 3VU1A 1II8A 5T8KC 4PYOA 4CFYA 1VLQA 2VJNA 1JKMA 3QBTA 4AVYA 2P9GA 3G1UA 5KQPA 1T0BA 3IAUA 4MQFB 4R2LA 1AUQA 2GAAA 1ZR4A 3IP7A 5AJWA 4IJMA 1MG0A 1P7WA 3QLVC 4UUOA 1E4EB 1II0A 1V37A 4PAQA 1P2FA 3I9FA 3H5TA 3SEQA 3D7RA 2NUPA 1Y9ZA 2AEMA 4WCFB 2A5JA 3FTNA 3BWVA 3D4OA 1XKQA 5DB4A 5A6SA 3ZDAA 3D6FA 3QSYA 2IUYA 4HAZA 4R3NA 4P33A 1BXKA 5K0SA 2JFBA 1KMNA 3CA8A 2WYHA 1TECE 1Z0SA 4INOA 4R2JA 5KHAA 3U4AA 3F2IA 2HWKA 2KE5A 4NYIQ 3B36A 3ONWA 3D8RA 3QU2A 4KITB 1HT3A 5C0OE 3RS4A 4Q21A 3R5HA 1KTIA 3UHPA 3UGKA 2QAGA 5HTKA 3UJHA 2Q07A 4HPWA 4HTFB 1C81A 1UZAA 3CJQA 2PU7A 4PYKA 2JD0A 2IZOA 1QV7A 5BSTA 2WKQA 3MN1A 5CNKA 1KGSA 2UUAB 2C00A 3K72B 1PX2A 4D56A 1RM4A 2I67A 4ZO6A 1UQUA 2JHAA 3V80A 2B8EA 2Y99A 2OFWA 1U1CA 4K2AA 5HQJA 2ONJA 2C83A 4D96A 2ZAMA 2QYOA 4FYYA 2WHXA 4WMLA 3PHIA 5ER9A 1CXZA 4XM1A 5L3ZA 1Y8QA 1V5FA 2PT5A 4MTLA 4Y2HA 1OVMA 1DLJA 1BU5A 3CX7A 3I8SA 3Q3EA 4V2IA 1VKHA 4PZPA 5I7UA 4U7DA 3NAGA 1N0IA 4MQEB 4C3UA 4EUKA 5ECYA 1Z2AA 3ADKA 4GRIA 1VE1A 1M2EA 1E2JA 2ANCA 2BFBA 1G8YA 3BDAA 3DHYA 1XU9A 5F3RA 3ZWXA 1ISMA 3GRKA 1K06A 4Z7NB 4OMCA 4WTOA 3EXG2 1IU9A 3GJ8A 3QWIA 2CVZA 3CRW1 4NOKA 2NSYA 2UZIR 4YUVA 1GG5A 1J00A 2PD4A 4KE6A 3WICA 1RQNA 4Y2SA 4KPUA 4BX0A 1MAAA 2O7SA 1L4MA 4B3RB 1WSAA 3HHPA 4IZOA 2BGLA 2J33A 3CKLA 4D8VA 4TRMA 1K8QA 1PYGA 1VJTA 3DM9B 1CB7A 2JGDA 1QIDA 4G2TA 2QDXA 4UBKA 4HWOA 4JCCA 1DBWA 2IL1A 2P41A 2RG1A 2RCYA 5T8KA 1MGOA 1H22A 3IJ5A 3NAMA 4LWOA 2QHXA 4F5WA 3DHVA 3WWZA 3KOUA 4ALMA 2PKYX 5A4JA 5TPZD 1PNTA 1JNYA 3T3IA 1AQLA 1QVRA 2XZPA 2XIJA 3LY8A 3UV6A 1YCHA 2WFLB 3SR0A 1NFRA 1VPLA 3F4KA 4JQZA 3C7TA 2CZQA 3S70A 1L4EA 2P3SA 4EJ2A 1Z2NX 2NWQA 1FNSA 4RPKA 2ISQA 3F3YA 4YS6A 5EIWA 5T7BA 2JCXA 4GGMX 1CYEA 3DW1X 4HATA 4OQ4A 3GGGA 3A1DA 3P0RA 3ZE8A 2WAYA 1T34A 2M1ZA 2FMXA 3H2SA 3JR3A 5CM2Z 3N58A 2EAUA 4XIYA 1PL0A 4QOEA 1ZSNA 5I7VA 1ZOOA 4L3VA 3NMUF 1B16A 5GADl 4X6UA 3D4LA 1ZJYA 3EEOA 1NVGA 2ZBPA 2UV8A 3E1SA 1GAQA 5DCUA 3V48A 1GTL1 2RGBA 4BUJA 4XIJA 3UAZA 4B6OA 3GBVA 2ZBUA 4FCTA 2NVWA 2BF4A 3Q3VA 1BO6A 2DE0X 1UDRA 4G25A 3ZCQA 2DBYA 1B23P 3SGLA 4WY5A 3UHFA 3B6IA 4R1MA 3PCRB 1Q95A 5LIPA 5IXSA 3BWDD 3FCSB 4TKUA 2ERCA 2Y27A 3M9XA 4EATA 3QVGA 3FMPB 3TQQA 3PFBA 4OIFA 4WN9A 2C94A 4IYRA 3UUEA 5KTKA 3MB8A 4D9MA 3S2EA 4LTMA 2H9IA 4DCPA 3FUTA 5LLTA 3OOSA 4LJKA 4TZ0A 3EH1A 4N03A 4RZ3A 2VNJA 4MAFA 4EI2A 1OX4B 3S5JA 1RM3A 4EG5A 4R71A 3IE1A 4DA6A 2JKYA 3F6RA 3DGEC 3PQ2A 1C30A 1G8AA 1R12A 1MRNA 2Z0MA 4IJ5A 3VKVA 4RTLA 3COWA 2P9JA 4Q05A 1H2BA 3FCUB 1AN9A 4IDAA 3CVYA 2GRAA 4DIBA 4JA2A 3WRXC 2HIAA 1NUHA 1R0CA 1POWA 4R84A 4RPCA 1YRLA 3CGGA 3CUWA 3U3XA 2XQJA 1W85A 3G8DA 3OUZA 3ESQA 3O38A 1MH9A 5AH0A 3HZOA 2BHRA 3M82A 4BGEA 2BCEA 4KXMA 1KHTA 1MQAA 2EKQA 3JW8A 3C7KA 4QELA 4ZAGA 4Z9FA 1CEQA 2D1RA 1GGKA 5IK2D 2C8LA 1XAIA 2QNRA 1XMOB 4WGFA 2HLDD 2QL5A 3HCPA 3N2ZB 4YV0A 1X1CA 4PFQA 1C1YA 4IIJF 2YV5A 1RQ7A 4ILEA 1XOIA 2X13A 1T8SA 3EZ6A 2IV7A 2BWJA 2Z4TA 1KEPA 5HILA 5HMLA 3RBAA 4E07A 4DDTA 1D6JA 2AI1A 3FYDA 5K0BA 2IF0A 5GM2A 3RS3A 4XZ3A 3LBIA 4C0XA 1ENZA 3BCUA 1DTWB 2CNBA 4L3WA 5CT5A 4YR9A 4IJVA 2A2ZA 3EDOA 1E9FA 1C7FA 3H1EA 4KCGA 4DWVA 1J9EA 5CVVA 2O5RA 1P0IA 2V4ZA 3MD9A 4RHFA 3BMCA 4YRRA 2BFNA 2QJWA 3K5HA 3PJFA 2A0KA 3ETJA 1E8DA 3EDMA 3UFXA 2DTXA 4KODA 1GQOA 4KWEA 2J9ZB 2MMCA 3CUYA 3BD7A 3Q7RA 1IPFA 2CB9A 1AT1A 2QXUA 1IEXA 1P7YA 4B76A 4AQ7A 1QHXA 4ZOLB 5LP1A 3DTVD 5B7QA 3P2MA 4RJTA 2B99A 5KYXB 5ISMA 1X8LA 3BH6A 1ORIA 1XMIA 1L4YA 4YJHA 5KVCA 2DH6A 3ONFA 4IKPA 3IKJA 1JYFA 5FNVB 3KYDA 4E5SA 2OCLA 4WY2A 2Y8EA 1IBKB 1QH0A 1Z2OX 1UMCB 4NFYA 5ICEA 5E95A 3UH0A 3QOFA 3ER8A 1E7RA 2PUHA 1XUOA 3C1UA 3C8UA 1DJMA 4P35A 2RBKA 4UE3S 3VR5D 2BH2A 1KH1A 4CUKA 4B6SA 4HXGA 1U2ZA 2EP7A 2XW6A 3A8TA 3A31A 3HKDA 1LJUA 1GP2A 5AW5A 1VJ1A 4KLAA 2NAFA 5B36A 1GPMA 2X23A 4MEJA 1IHUA 1O6ZA 3BEDA 3RGWS 4HS9A 4ZMSA 2FN8A 3VPAA 3JSAA 5BN5A 4P5DA 3CISA 4XH9B 1SH7A 3AJAA 4L8GA 4LHXA 3BMOA 4JI6B 5AJYA 4G6ZA 3BL6A 4DR1B 3HP1A 1CJTC 2QUKA 3W2FA 1R10A 3OUUA 3T0GA 1DAIA 3QOYA 3H1PA 3M4XA 1M7HA 3BWCA 4R1TA 2IODA 3GLIE 1O8CA 3I9NA 4TSKA 2BONA 3DBLB 4ARAA 2AZXA 3R0VA 3SR3A 1GGHA 1TM1E 3WYBA 1FTYA 1KO8A 1MA0A 5EHZA 3M1IA 1PJCA 2AA3A 4W5JA 4AG3A 2CCJA 1YKFA 1ZH6A 1ZGCA 2VBFA 3UMJA 1XA0A 4GHWA 2DP4E 3L0IB 4OFZA 5IM5A 4EKIA 1WNTA 3HO8A 4MW7A 5HGXA 1F7VA 1NTOA 3ICOA 4IIVA 1QCDA 4OKSA 2CMHA 4B4VA 4RL4A 4IQ0A 4CN9A 2W70A 1FJXA 1CUFA 2OHOA 2X0DA 3RE1A 4MUKA 2YXBA 2UZ0A 4Q00A 1T4BA 3QMPA 2GDZA 4UUAA 1ZYUA 3MCAA 1K2VN 1Q74A 2J32A 1ZS9A 4YP5A 1K3UB 3Q3HA 4Y98A 5CW2A 3NCHA 2Z57A 5TS3A 3ZCPA 1YDEA 2ERXA 1DBIA 3EOAI 1OHHA 4TVOA 2EQBA 3WFIA 3Q8MA 4TSRA 4XTCS 4WEQA 2KWIA 4FW8A 4LE1A 4Q47A 4XE5A 4I1PA 1FJ2A 1KAHA 2J67A 3HCOA 4FFLA 1R50A 1BS2A 3CLUC 3N0XA 4Q4DA 4RVNA 3VR4H 2I3DA 5JVDA 1W7AA 1QONA 3FOBA 2QM8A 3SEFA 2SICE 3T6KA 1GQ2A 1NLZA 1KEUA 1DO2A 5EWLA 1W59A 1U1EA 2PYDA 5K01A 5EPUA 4GSYA 4TL6A 2A58A 2CCKA 4X9XA 1NA5A 4YDHB 5JLAA 3K6SB 4YJKA 3UA4A 4S05A 1PJZA 4RZXA 4NESA 4QYMA 3DF7A 1PK7A 2JIRA 3CCFA 4HN9A 4IF4A 4ISBA 2PJZA 3REGA 4WBNF 3DLBA 3FCEA 4B7CA 4CFSA 4N76A 4C05A 2OECA 3F3KA 2X1HA 4FFOA 1A9QA 5FWYB 4D57A 1LDBA 5CEJA 1E2MA 1IBLB 3IMGA 2IGBA 3H18A 5I48A 4OGKA 3IUQA 3NQ41 3B1YA 2WIJA 4RXTA 4YB8A 2C58A 3KP1A 4J7UA 3RVQA 1RRVA 3EIQA 2MYNA 2HB6A 2HSGA 4KQ2A 3IURA 2H07A 2C5HA 4AXXA 4D8UA 5JLJA 1M7GA 3AUKA 4UATA 1GO2A 3ICCA 4UNSA 1YR2A 3SC3A 3U60B 2NU6A 4R69A 4XCXA 1XIVA 2PHZA 3SE0A 5DMXA 2V7QD 1P72A 2P9QA 4XASA 3K0CC 1XJ0A 3AIOA 3X1KA 5JS8A 1DAGA 2ET6A 1G38A 1QQ7A 3AERA 4UVHA 2IHUA 3HSKA 3RVOA 1B6GA 3NM6B 3T3DA 2F1OA 3CLSC 4MVJI 3X2EA 4DLRA 4B2YA 4D3XA 1MPTA 2PH5A 2H2DA 1OXMA 5E7QA 3K96A 2VHEA 3RO7A 1X3LA 5H81A 2E6KA 4BASA 2HMSA 3B9RA 3R7SA 2PUTA 1V4VA 4NZNA 2JGLA 1Z4NA 5JAQA 2OYCA 4CM4B 5LKRA 5EOVA 1Q0SA 2DPMA 4O29A 4KHZA 3HU5A 5LLDA 1NI4B 3RRXA 2ZS9A 3PS9A 3EUFA 2GF2A 1MTZA 2RHHA 3OESA 4IJQA 1W5BA 3KQHA 1DKNA 2Z98A 1B3RA 3R5XA 3BB1A 3HXLA 1SCBA 3K0EA 4DC1A 5DYWA 4ZJUA 3K5PA 5DMHA 5EUMA 4M1SA 2WWFA 1BTOA 2V58A 4TL8A 5CXSA 2OHVA 2XA1A 3CZAA 3IR5A 3DTYA 1AOXA 4QVIA 1L8LA 1OV6A 1UAYA 1BHQ1 2C4TA 2JEYA 3KYJB 4FHDA 4MCAA 3EQ8A 2JI6A 4MUBA 3ZHQA 3PUIA 2XDAA 1EJ2A 1LSUA 1QHHB 2V0CA 3OX3A 3D0RA 1O4WA 1TK2A 2J6CA 3VKWA 1PVOA 2XRYA 3AIMA 5A4KA 1JDZA 5CFQA 2PWYA 1U2DA 4FVTA 4Z9XA 4KQKA 3C87A 1RYBA 2HFJA 3QE3A 4NPCA 5PGMA 2QYHA 2GM3A 1AN0A 1TAGA 3EXFB 2E89A 4K81B 4J0JA 4QDJA 1FSPA 3TD2A 2WG0A 3TNDA 3SDBA 1KDRA 2BDEA 4IMRA 3HO1A 1NKSA 4GDFA 5D5QA 2IP1A 1OLSA 1YQGA 2JGRA 4P7KA 2VPWA 3L4BC 3RHTA 1YHYA 2GETA 1ONSA 3K32A 1ONPA 1OI2A 1NPYA 1KP3A 2BBSA 1YZYA 3ILYA 3MOGA 3PEEA 4WXPA 4ZVSA 4UKDA 5ALKA 3TB6A 1P75A 4BE9A 2A7XA 4QXPA 3AU8A 2E5FA 3AHGA 4ND4A 5F7ZA 5C1PA 4V3CA 5TGZA 4HNVA 4K9KA 3DEAA 2NO7A 2G09A 2Q3DA 1QBKC 1V45E 2QZ4A 1MAVA 4XW2A 3GZ4A 4RH3A 2YL2A 3QVGB 1HYQA 5KVVA 2CD9A 4LISA 2EWWA 3OLQA 2AE2A 4F4HA 3Q9LA 2V4UA 4LHEA 3TSYA 5AW1A 4L4SA 3KKNA 3A0UA 3QVVA 3SMQA 4HNAB 2QN7A 1PCXA 3LRTA 3W06A 4E03A 3MWFA 2INGX 1X86B 1LQ2A 4F4JA 1QZXA 3JRXA 3HJCA 4AROA 3UAOA 3L84A 2GCOB 3VXKA 4UTZA 5JNVA 1YI1A 5K8VA 5EWJA 3WTCA 4E46A 2EOAA 1ZH0A 2HTEA 4WCFC 1DAPA 1YNSA 2FEKA 3C6YA 2QYSA 2YWRA 1T4MA 1JHYA 3AB7A 3G2QA 4GI2A 3ED1A 2FKAA 5KNBD 3P4XA 1UXHA 4GM4A 2CL0X 4BKQA 3E9EA 5IAKA 1KI7A 1IG3A 4KI7A 4TLEA 3PA6A 3QU7A 4CMJA 2ZTSA 2QW8A 3UK7A 3VNBA 1NOIA 1QE5A 2HA4A 2G9RA 1C0PA 3NZEA 1VI2A 1WW2A 5C8YA 5CBPB 1CKEA 5DHAA 3GWGA 3SBOA 3MS2A 3Q5EA 5CLFA 1G8KA 1P1RA 2C7QA 2QTMA 3Q7IA 1HTWA 2OUKA 1NPDA 4R2KA 4QTZA 1N5LA 3TJZA 1Q0UA 2CNWA 2JCSA 1B8PA 3MOSA 3ZU4A 5C34B 1NNEA 3PU6A 2XVAA 3I30X 3BJMA 3C1AA 2GEFA 2DVMA 1CU1A 4RVSA 4FEYA 5TR9A 1DX6A 1WDKA 1RCFA 1XRRA 3HYTA 1KPGA 4PRKA 4CQMA 4GZ3A 3OLVA 4WOPA 3EG9B 3KV3O 5CM8B 4ZAFA 1RAFA 3FDZA 2YZMA 2Z04A 3HYRA 4D3SA 1BVYF 3NUGA 1ZGAA 5FNZA 1MU0A 2VHQA 1PHRA 4J91A 2VJDA 2C42A 1IC6A 2IPAB 3W4KA 1M0TA 2I2BA 2IU4A 1M0WA 3EA5A 3PGA1 1YRHA 4HADA 4I55A 5FBWB 1GAJA 1KP2A 3GFQA 3D81A 3IUJA 2BEUB 1YHZA 3OY7A 5D8DA 2F64A 3S0JA 2NQTA 2PMDA 3JX9A 1D04A 4M7PA 1CR6A 3WYDA 2BZSA 2FR1A 2Y77A 4UEOA 4YWHA 5F2EA 1TYAE 2NSLA 2AYYA 3K6RA 1JGTA 3P7MA 2F90A 1N9ZA 2AOTB 1ZL2A 3RRMA 3WGTA 1YJXA 3DKRA 3COJA 4L8WB 2CVQA 3SYNA 5B58C 2EJWA 4HDKA 4WJZA 3VU9A 2XWSA 1QO9A 1L7AA 2BN4A 3O9MA 4M0CA 4QPJC 1Q7RA 1OZGA 3VUFA 4EKNB 2YVLA 2VWPA 5D01A 3CEHA 3GPIA 5K20A 3PYMA 1PF7E 1H2XA 1MX3A 1PQWA 1J4AA 1QF9A 2X15A 4ND7A 3T4PA 2BTEA 4HYTA 3DCYA 1Q0TA 4L22A 2VRWA 2JFNA 2HF8A 4PAMA 5B3JA 5IF9A 1BDJA 3IT0A 3JQ7A 5EAIA 3RBXA 2FQWA 1JZTA 3P52A 3RSLA 2J4FA 1U0HC 4NATA 1MPXA 1LZKA 1T4CB 4QUHA 1SBNE 1QZ3A 3O92A 4CIBA 1DG1G 2FEWB 4DKXA 1QHGA 2QMHA 2IXEA 2Y93A 2FPUA 2VYCA 4M55A 2V5AA 4I81A 3VHRA 3R0IA 1MQ9A 3H2IA 2RGAA 4E2ZA 3UPTA 3ORFA 2R00C 3D1LA 1BWSA 2AF3C 1QB8A 4U2FA 2P6RA 5EIBC 4EVRA 3HUFA 2RHWA 5I9TA 1LLCA 4F12A 1V41E 1M2VB 1PJQA 2B37A 2EFYA 5DNVA 2C3YA 5A3JA 8ABPA 1AK9A 1K75A 1E4VA 4QX6A 5ESXA 5ENVA 3VR6A 3CVVA 2PSEA 1FY2A 1R00A 2D5CA 2EYUA 4S2EA 1NXQA 4RESA 3QPAA 4M0UA 1VYHA 5HG0A 1SB8A 4AF7A 2QZJA 1WZCA 4EGFA 2OOSA 5JYBA 5KOIA 5J5CA 1C4WA 3FPAA 2W2QA 4MS4B 4QUKA 4P84A 3ZE2B 3I5MA 4AJ9A 5FAKA 2PZAA 1DBVO 4GVXA 4ZZ2A 3RT9A 1KTVA 3AR9A 3RR2A 5FO1A 4PGGA 4D2IA 2LDBA 4HQLA 4EKYA 1T9GS 1DXOA 2WSBA 3II6X 5AKKA 3ZXIA 2HDOA 4XAQA 4CF4A 3L1KA 2PFGA 4JOBA 4I9HA 1RTTA 3ZQJA 4FK8A 2ID9A 4KXFB 3IEXA 1QYCA 4D9HA 1GTSA 2IDJA 5M7EA 4WZAE 1VMDA 3H84A 3L7JA 1GYQA 3KT3A 3LUFA 5BP7A 3O3OB 4BFLA 2HHCA 4BRWA 1R4AA 2WMOB 2CDRA 1BQ4A 1E7YA 2JBHA 5BN4B 2M6RA 4MX8A 1WMDA 4MQFA 1GL3A 2WABA 4ZQBA 2QQGA 2IH4A 1RI2A 3GQBB 4F3NA 4D4JA 2I87A 4TL9A 4YAOA 2YY7A 2AYXA 1YVEI 3GJQA 3R8CA 1A9RA 1CPYA 2ADMA 1Y1QA 5H4HA 5I7RA 4GPBA 1YJAA 5BXQC 4M60A 1E1NA 4HH4A 1Q19A 2BUBA 2O7NA 4IQFA 4MQ6A 4ZCLA 5AIAA 5FNVF 4EY6A 1LW7A 5K6AA 2NUTA 2AFHE 4NNJA 4R9UC 2HJRA 1U6KA 3WIUA 2EV9A 4DL9A 1HGXA 4CIDA 4BNJA 2QGNA 2G9NA 1Y3FE 1Q1AA 5KTYA 2NXNA 3T7AA 1MIHA 3DKVA 2BVNA 4I14A 4C7XA 3URKA 3LPAA 2X5OA 1XE3A 5CCEA 4G0VA 2W7TA 2Z5FA 3UIEA 4A8TA 4OBWA 4CMIA 5EJ7A 2VCEA 1QTNA 1B0AA 1UP4A 1XXHA 3TG8A 5CD9A 4JSYA 1GGFA 1CUJA 1CVIA 2EIXA 2CE7A 1XVVA 4B3MB 3OJXA 4LQLA 1XP8A 1HDIA 2VBIA 4TLDA 1GY8A 1U2GA 1KI9A 1LPAB 2QM0A 3EGIA 4IDDA 3A4MA 1VYTA 3B20A 4FGWA 4HWGA 3SOZA 1SVOA 5FLEX 3GLQA 1PUXA 5T4FA 5CAEA 2ZRBA 4OHBA 1CCWA 1E7WA 2QRQA 3D6NB 3S8MA 4D4GA 2XGJA 1U98A 4OB6A 2X5JO 2JFUA 3EXAA 1QG6A 5HKOA 5FO0A 1W46A 1T4GA 2VRCD 4ROTA 5IT4A 3Q10A 2LBPA 3BFXA 3J7TA 4R1SA 2XKJE 4RAQA 3PD1A 5KC9A 3MLBA 2XY4A 1L5MA 5G40A 4ZDKA 4A16A 4FB4A 1CQPA 2OD9A 3KK0A 1UJMA 3I2IA 3I6MA 3NIFB 5CEEA 3ERCA 4M88A 2JGMA 1I1OA 4Q3KA 3DE1X 1NBOA 1PJLA 1GKKA 5FWXA 4BC1A 1J5EB 3K05A 2IH5A 1LC3A 3NDRA 4CDGA 2G8NA 2WAMA 1EXWA 2REQB 5KWEA 3HUUA 5AK3A 5BV8A 1E4YA 2FOIA 1OXKB 2HQOA 2WA1A 2JFYA 3ASUA 1I3LA 3HFSA 2H85A 2VSFA 3WGQA 3FDIA 4D0NA 3D59A 4YRCA 1M10A 2DHQA 2P9YA 2XJ9A 3L02A 1NIJA 1TU0A 5FX2A 3D5TA 2XMSA 3M2TA 3IULA 4JVLA 4MW9A 3I9V6 5KCMA 1NRIA 3RWMB 3BM5A 3TR0A 2QMZA 3ZGYA 4I8IA 3AH8A 1JTVA 2M6SA 4QRDA 3NGLA 1FS6A 1RLMA 3RYFB 4X94A 1LBHA 5EI5A 2GTPA 3SBDA 4B8YA 4EENA 1L8QA 3ZEAA 4D44A 4NK4A 2G5CA 2GN0A 4WZBE 2H1OA 2RHJA 3KQUA 1K7FB 1QGUB 4NLLA 1RAAA 2WKSA 2XITA 4U7GA 4UUQA 3FKJA 5BQFA 4CV3A 1CUSA 4LNUB 3MCTA 1TCAA 1XCMA 3OOEA 4B0OA 5AW3A 3NWJA 3N8IA 1G21A 4O4JA 2OL4A 5D6NA 3ESCA 3RC2A 1EG7A 1U7UA 4DR4B 4ZU1X 2ETVA 1D6NA 3PYXA 5E9JA 4YJ3A 5K99A 2O8FA 2W2OA 2WINI 1WHSA 3KEQA 3GLHE 1TAUA 3K1AA 5JRZA 4AUKA 1LRJA 3GRRA 4IO0A 3M6VA 3VTFA 3Q8KA 2QG4A 1TCUA 2IW1A 4K5QA 2PS9A 4MR7A 3E7XA 1Y1TA 1MABA 2BDUA 3QKIA 3MB5A 4I4TB 3AG5A 4O02B 2A67A 2IU3A 2JH8A 2IQ5A 2O2YA 1EWTA 1OR8A 2H31A 2YQ5A 4OHZA 3DVAA 3I5YA 1XDUA 1U0OC 2EW1A 2VUIB 2WU4A 2RHBA 1Q50A 3OPXA 4GDMA 4MA5A 3A1UA 2P75A 4FCWA 1AQ6A 4IIXA 2V55B 3FG9A 1FFSA 1ZJ4A 2W5UA 2ATIA 5KJ6A 2CNLA 1K0UA 2VKTA 3NTUA 3R7WB 4JZKA 4N54A 4RANA 2WOJA 1SHLA 3DEZA 3R7DA 2J0EA 3LVQE 3NVAA 1IM5A 3OLXA 4F06A 5ELXA 3KC2A 1UC5B 1TVKB 1OBCA 1SKBA 3C3CA 3FUCA 4WXYB 1VE3A 3N7TA 3I61A 2YRXA 3G3EA 4E5DA 1RRCA 5JVDF 4EA9A 3BRWA 1INLA 3QFHA 4QBFA 3IEVA 4F6CA 3M5CA 3DMTC 3QLUC 3AW9A 4EHIA 3D4BA 2GA9A 2NU9A 3N2KA 3ZV7A 4NJMB 1P1CA 3FVVA 4AY4A 2XAUA 4PG8A 2AN1A 1JT2A 1V71A 4OL9A 5EZYA 1Q16A 3BS4A 1XRSB 4ER7A 3QFFA 4WINA 4C76A 4IDQA 1YB7A 4CCAA 3LG2A 3ZXYA 1JLLA 3QEOA 2R79A 1T8RA 2ZPUA 4EHFA 3GMSA 2KI5A 2JLCA 2PNJA 1FXWA 2BAGA 2PGIA 3HB0A 2H0QA 3FTFA 5EWJB 1YA8A 2CL5A 2EBWA 2MDTA 4LY3A 4ALNA 4DLLA 4ER5A 1XZIA 3ACCA 1VL0A 3RLIA 2XCLA 4C6TA 4BP8A 1X0VA 1SHTX 5BQ5A 2I8LA 4LJ8A 4O4IA 5AKZA 3T0FA 3LW7A 1X1AA 1EFRD 1ZINA 1CE8B 1RRKA 1A2QA 1AUOA 3HWRA 5B4TA 4M3NA 2DJIA 1PW5A 2JAPA 2QE7D 2YASA 4JR0A 4RA6A 5C5DA 1FP4B 2AR0A 1WG8A 2FHSA 3CV3A 4NI5A 4TTSA 4J4HA 3VZRA 5IXYA 1L4NA 2AT1A 3FGOA 1BU8A 3O82A 4M8SA 4GMKA 3V32A 3LPLA 5C1OA 1OBVA 3EQ9A 1KEVA 3H2GA 4BQFA 1R37A 3TECE 3AZQA 1YRBA 1X80A 1UZMA 3WOVA 4G8BA 4TV9B 3UQYS 1V2GA 5HNKA 4F56A 3ZQUA 4KBFA 1R8SA 4GZMA 3AP2A 2D5IA 3A36A 1XQ6A 4MAMA 4XB1A 3OHPA 5C2JB 1KAMA 2XLBA 4AP9A 5K7SA 4L5CA 3C7CB 3WLNA 4HAIA 1U0GA 5LWHA 3GK3A 4NKRA 3S7ZA 4YCLA 1KZ1A 1LW6E 2Z6UA 4GU5A 3HJFA 2R1TA 1X6VA 3AEUB 5KQLA 5DNCA 2PZLA 4OYRA 3QF4B 2NXJA 1V35A 3JQAB 3E18A 4LBZA 1D2EA 4I9FA 5JFOA 3UBMA 3N5CA 5FXMA 4ZO9A 2IU6A 3ES9A 3WLFA 5FV4A 1JILA 4DM3A 4Y2XA 5EHIA 4CIVA 4YP7A 3RABA 1VIDA 4CF5A 3OU6A 4GC9A 3ETNA 3I52A 3AKEA 5JE8A 1EFPB 5BN5B 5J2TB 1WDMA 2V6IA 4UTNA 3KR9A 4F4CA 1O9HA 3GDWA 3PXBA 2YBDA 1A7KA 1DAHA 2EZUA 2J85A 2QS9A 2X8AA 2V7TA 1OT5A 1TTHA 5H3HA 1U7XA 3ZOZA 4M0KA 4CPDA 2UZ1A 5JS7A 1O5OA 4O2AA 3PFCA 1UFQA 2CNKA 3WO0A 3TR6A 4MRSA 1UFKA 1R27A 1B6TA 2GM5A 2W4IA 4BLTA 4ZZ3A 5JNSA 3OJ0A 4V0ME 5FFFA 3VPDA 1P5ZB 4PZ9A 2ODBA 2NG1A 3UB3A 2OXRA 1ZOLA 1ZD1A 2HPAA 1TU4A 4WLEA 3D54D 1UBHS 3CO0S 3IBYA 3I64A 2WJ6A 3O9VA 2R6HA 3LX4A 3T7EA 5ILGA 5TEVA 3TFQA 3K0BA 5DU2A 4QJ5A 2YW9A 1RXEA 5B3JC 2R4QA 2NSDA 2V7XA 3EVZA 2I1WA 3DFIA 1PG2A 3CPSA 1X87A 5T64A 4BV3A 2H2WA 1UFOA 1VCHA 2G77B 4RADA 2XWQA 1F14A 1EDBA 3IRVA 2KBEA 4MMZB 1CHNA 3MRSA 3RC9A 1X7DA 4HRVA 2JFZA 3OSZA 3QIVA 4Q34A 4E15A 2QTZA 5MDHA 1G20E 2A9JA 2FMHA 5KJEA 3ZHCA 2PSSA 3JAKA 3PHGA 3C5CA 3JD2A 3VPGA 4B48A 3CNHA 4XWWA 1N4DA 1M2OB 2DRIA 1JS1X 2JI4A 1JX6A 4K9NA 3SLGA 4X65B 1T6NA 1PR3A 4WACA 2WD7A 4Q24A 1CY6A 1V39A 1W6RA 2PGDA 5TVKA 3ORSA 1O94D 4IX9A 4P86A 4YUAA 5J3JA 2FZEA 5JZSA 1WULS 4IJKA 4K87A 4HNSA 3VSEA 1E1KA 3U3RA 3D1VA 3PXXA 4R51A 3GWZA 4F91B 5H9WA 3EX7C 4P08A 4JX9A 1WDWB 1UOOA 2AGVA 4HFMA 4TUYA 3TNJA 5JISA 2FA9A 5KNCA 5JJIA 1ECFA 4OFBA 4E22A 2GBGA 1C41A 1O1YA 4Z0PA 5AIBA 3ZR4B 1U0RA 1KVTA 2IH2A 4KR3A 2XYVA 1BH2A 1HDXA 3BREA 3FIJA 4M87A 4BMVA 4DG9A 2Q3EA 3PEYA 2EP8A 1K7EB 4KG7A 2IXGA 1PZEA 2HLHA 2HMUA 1I6LA 2FW0A 3IQWA 4FT2A 1UKBA 1QJ4A 2Q7OE 4DTIA 5BW4A 2OBLA 3UOAB 3G0CA 3KB2A 2YCLA 4PQFA 1KK1A 1C1XB 1ZH8A 2XCOA 2QSJA 4JJFA 2F3SA 4ZHQB 1QWOA 1RKQA 2BEWB 3HM9A 1EP9A 3ZN2A 1RXCA 3KLMX 4FUTA 4M98A 1QRTA 3AVPA 4M6WA 3T7KA 2ZWOA 1T0IA 2HAEA 3CR7A 4J1TA 2P2NA 1GCIA 3VTKA 2ORVA 5FR1A 5FPKA 2EL9A 3DHNA 2UXCB 5BYKA 1R8XA 5MGBA 3ACBA 1M67A 5C80A 5CA0B 1YL5A 2JH9A 1RLIA 4JIMA 1NKVA 3CF6R 1O58A 3B85A 3M6UA 2OG1A 1OJLA 4XUDA 4D92A 5KNDH 1G3UA 3BKWA 4GXTA 4L4RA 5DT9A 3F3MA 2A14A 1J39A 4H59A 4LZJA 1ZVVA 2QNBA 3ICPA 4MEAA 4IZHA 3G0OA 3U4QB 3B2NA 2Y76A 1I0IA 3Q3CA 5JCXA 1EGHA 2GN2A 3RANA 2QP9X 1W9HA 2JC3A 4N3CA 2F3PA 4OXNA 4RVHA 2HXSA 4NRDA 4JT8A 1NRWA 1M8PA 1VP3A 1ZD5A 4PSUA 3TVDA 1CY0A 4TVKA 5D1NA 3DDOA 1DIRA 2C82A 2XCIA 5HVNA 3PFNA 1P1FA 2C9MA 3H2BA 2Z4SA 4CEIA 1FFXA 4IUBS 2FSPA 3Q2IA 5I9SA 3Q5DA 5DHPA 5T6MA 4OHCA 2FDXA 5FI5A 3SR4A 4KYVA 2R7NA 5EMJA 4EJFA 3B5EA 5BVHB 2Q0SA 1CLUA 2XOKA 1V5GA 3QMVA 1DT3A 4F21A 2RHOA 2BFEA 2ZSJA 3O7MA 2BCGY 1OLXA 5E38A 4JLJA 3FDFA 2AZ4A 4OX9Y 2HJVA 1FXSA 2MIIA 4UM9D 1MFPA 1QHHA 1XMXA 2H29A 2QMEA 3FDXA 2BELA 3QU4A 3W5UA 2V9ZA 4ZAWA 1GSIA 5CHEA 3LUAA 3HP4A 2V7PA 3U7RA 1ZAKA 1JZQA 3TIXB 4BAUA 2ZSAA 2WFAA 2OV6A 4ESOA 1E2GA 4JVMA 2R6JA 2JGEA 5TMDA 2NV2B 2R66A 4EUEA 2FB9A 1GPYA 1I2AA 1YOBA 2QRZA 3DO6A 4HBZA 3L8HA 1GR1A 2BSAA 2VDMB 1WUKS 1FMCA 4DLTA 4BX8A 4YMHA 5IW8A 1UZUA 2HSDA 3IDSA 2ZJFA 4RDCA 1T15A 2FPIB 3UOGA 1E3DA 1NI4A 5BT8A 3HEBA 4HDMB 2DTEA 4JJ4A 3KJIA 2EVWX 3N7AA 5D5HA 4WK2B 2FV8A 2BKAA 4NPHA 2SKEA 2J3MA 4D4KA 1KQPA 5HPYB 3PNOA 1W96A 3T3PB 3LX5A 2CEKA 1DPFA 1F9AA 1G9XA 3RC1A 1OH5A 4LECA 2D7DA 2H52A 2NIPA 3P2IA 1N2JA 4K26A 4LDQA 1JXAA 1S9DA 3L7BA 3NBFA 1OILA 4ZICA 3HACA 3AM4A 1A5ZA 2HCBA 3LU1A 5HHTA 1NSTA 4HQNA 4WN9B 5GPBA 2PH1A 1CBUA 2DC1A 2BOVA 2B34A 2H5EA 2D1QA 3IUMA 1RACA 1VYVA 1SXPA 3NDBB 4ID3A 2DF8A 2ZI9A 3PNVA 4ZVUA 3A6HA 3WGMA 4P4SB 5CYFA 1IHYA 3LE8A 5TY0A 1V7ZA 3EJWA 3CUSA 3ZGLA 1NDHA 4M54A 3CX8A 3TNFA 4BS9A 2LPMA 1ZJ5A 4Q9LA 2ILTA 4ZT5A 1NIPA 1CZLA 3V8MA 5B2FA 2F8SA 1XCLA 2BKEA 4ZYTA 1F4LA 3AEKB 3WB9A 3T34A 3V1YA 1S2LA 3C3MA 1F60A 4QFCA 3UK0A 4A6XA 4BC0A 4DLUA 4JBIA 2PZBA 5BRJA 3S2FA 3VBCA 4BMNA 1N8NA 1BNCA 1V7PC 3THYB 1NSYA 3LGAA 2AFIE 1V1MB 3E03A 1FDUA 3CKMA 3PRJA 4UTOA 1E63A 3WYAA 4UCXA 3JD1A 2W43A 2XUFA 3CJRA 3G0BA 4MR9B 4QKQA 3VR2D 4IEFB 2PL1A 4LSZA 4W4TA 1NP6A 3AR3A 5EFOA 4ARVA 4BU0A 2HR1A 1GPJA 3GUUA 3TK1A 1KK0A 4Q4JB 4RENA 1REQA 5KOHB 3WGYA 3SXPA 1A7JA 4JUAA 3RH0A 3SDSA 1G21E 4GAEA 5IANA 5E8JA 2QSZA 4IW3B 3KQOA 1LVHA 5DLEA 4BNNA 1R18A 1VI5A 3LHKA 1WMFA 3LNCA 2RKBA 1LY1A 2G1KA 3DW3X 4R1LA 3A06A 1G8PA 1DMRA 1RWNA 3PICA 2ECQA 4X1IA 2JFXA 4DRXA 1CULC 5BMVF 2F2TA 3FPCA 3OZIA 2GMWA 4G41A 4YIKA 3B6KA 3ZW8A 4WKPA 5EUBA 1E8MA 1K4KA 3PJGA 5BR4A 5AQEA 5EG5A 2UYOA 3IA7A 2REBA 2CLDX 4B3JA 3UNXA 2Q2WA 1AGRA 4XGNA 1I01A 2Q6OA 2GNPA 1OIVA 2ANBA 5ELLA 4CIYA 1GA4A 2QP4A 1SQ5A 1ADYA 3WYFA 2UVPA 3N70A 1T2CA 4HX9A 4TQGA 3FVWA 2OHGA 4N9WA 1NYRA 2C1ZA 3GLFE 1E9SA 4FSXA 4YV1A 2OGUA 2WSLA 2NOAA 3QXCA 4OI1A 4ZDIA 1QSGA 4AS1A 5LQUA 2JVKA 4FYJA 2PWPA 2YTZA 2P2ZA 4QOHA 5DM4A 1P0CA 2GZ2A 4FHFA 2PGXA 1W36C 2W0MA 3PQFA 3EXIA 1EHYA 2BEVA 2I8CA 3O8BA 1RE1A 2CWWA 1VMKA 2HJ9A 3JQPA 3SQWA 2OFOA 2IPNA 2ZYSA 3NAQA 3GPLA 4PR0A 4NE7A 1CE8A 5FJJA 1Y37A 4OHOA 1NZJA 1OFHA 4NZZA 1GPLA 2VDUE 3OE4A 1H0SA 1S3SA 4XJTA 1C14A 4ND1A 2ZCJA 2DWOA 5BUSA 2UYYA 3U39A 1I33A 3TIGA 2PS1A 1JHUA 2FLVA 2HO5A 4HLCA 2QRGA 3KDAA 4H0NA 5ALOA 3KSAC 1P4SA 5ALZA 1SHZA 3WRWA 4MGYR 4MQ5A 1U9IC 2ZRFA 5JSZA 3WJ7A 4WY8A 5FL3A 3LOUA 3N2GB 4QGHA 1S3FA 2ZVPX 5KJCA 3KTDA 3HJHA 1R6DA 3M4ZA 4EGAA 4DOMA 3VDNB 3QTLA 3RVKA 4PICA 4RZSA 3FTPA 1FTGA 3QFCA 3E7DA 3QXHA 1T2UA 4BVLA 1FK8A 3JALA 1XL1A 3O1HB 3ODPA 5CURA 5KMGA 3W2IA 1VDZA 1PLKA 4DEYA 1V7CA 2WU0A 4KDFA 1AV7A 1JDBC 4Z3OA 3I2KA 3KTAB 4WNYA 3IPLA 4A8JC 4Z54A 1PZFA 1X7YA 3IHWA 5BN4A 1WPQA 3H9UA 1IEVA 3K8YA 5BN3B 3CTMA 1ZG3A 1CEEA 2ZGVA 1PK8A 1J5PA 1M6VA 2ZZMA 1ZXBA 4DEXA 2Q6KA 3AQ4A 1RC0A 2KLBA 3KVOA 3L49A 4FFBA 2QX7A 3BGDA 3IUBA 3BH7A 1GPDG 1QMGA 2O14A 2O3TA 2OHFA 3E22A 3SF8A 4KJXA 2G17A 1UMBA 4IIDA 4M9UA 2D2VA 3MF4A 2VTKA 4Z99A 5GVRA 3WLAA 5JDCC 4B7AA 1N2OA 4H1WA 4AKHA 3NB0A 2RHTA 3NHAA 5TC4A 4JP1A 4C9BA 3LFTA 3FNHA 1GNRA 4FYIA 1AA6A 5AP9A 4JXZA 2NXEA 1QLHA 1TF5A 1Y7IA 3JTEA 5AHXA 4N8DA 3JQBC 2WF8A 1P62B 3OPVA 4PXYA 1BE1A 2LXNA 1DIGA 3C5HA 2NVBA 3ESDA 3V6LA 3IQIX 2GESA 3DHEA 3EVNA 4KP7A 4QDZA 5L6MB 2ZYUX 4LHZA 1N7IA 2QTLA 1UBSB 2PMBA 1V6AA 5CA1A 1GSAA 3A4VA 1SBYA 2X19A 2ZZKA 4FWIB 4D7AA 2ZT7A 1I7PA 2IFTA 4X92A 2QAJA 3UUFA 1ZIXA 5AW4A 3QE2A 2R47A 3HYNA 4R7TA 4J8PA 4WESA 2P67A 1KOFA 3HBAA 5HIMA 2YC2C 3H9EO 4G5HA 1GNQA 1PGJA 5AVSA 4OFWA 1G9SA 1AHHA 2J3LA 1SU8A 5CDFE 4FFPA 1ST3A 5BR7A 2PLWA 1KMMA 1F20A 4BV9A 3FVQA 2G36A 1NW8A 2A78A 4R16A 3E4DA 4XM2A 2JZNA 1OGJA 4N65A 4JHXA 3ANSA 4CMKA 3DMYA 4HDAA 4UHFA 4INZA 3UUGA 2BLNA 1OU4A 3BFKA 2E4WA 2Q5JA 2H1HA 3AC0A 3K0FB 3OOWA 5EKUA 2ZWPA 3FSEA 3C8ZA 1EEXB 3GFBA 4HWSA 5MFZA 4ARIA 3AB3A 3G2OA 3L0OA 1JV2B 2P7HA 1XTBA 3GQBA 5LMUB 4DCGA 1OWOA 4AO8A 1HQCA 1TTPB 4OREX 4AP6A 2EEZA 4B3XA 3A2LA 1XL0A 2QDKA 3A10A 4J1QA 5ABPA 5BV1A 5KTSA 1T3HA 3EW9A 3W8DA 1BFDA 2HLPA 1B6SA 1ZC3A 3NFYA 1K88A 3LCRA 3S2ZA 4G5SA 3EODA 4X1OA 3GDOA 1W35A 4XIFA 5J2TF 1O95D 3ZXUB 1L3CA 5B12A 2E3JA 4RTJA 2HUPA 1B73A 1BMDA 3IC5A 1UZLA 3DMDA 1KR5A 5IJ0A 2CMKA 3OIWA 3UJ3X 2X5NA 3DAOA 2IUSA 4TXMA 3CZQA 1RFGE 1Z08A 3MINA 4CG3A 4I2NA 1T8YA 2BFBB 4HFNA 3ZD8A 4KNYA 4ZDWA 1PVDA 3FAKA 3ZGZA 4DMGA 1L7DA 2A35A 4AL4A 5JWOA 2O7RA 4LYEA 4RQAA 2ZETA 1ZUIA 3CF0A 3U3MA 3KZKA 1M1XB 2FW7A 2GHRA 4BNYA 3B48A 3L2OB 3EWNA 4H1TA 4ETIA 1Z63A 3RWOA 4ZARA 1G8SA 4F2PA 2Z09A 2OYRA 1AE1A 4CKZA 4LY0A 1J7JA 1C3OA 1RQXA 3L6EA 4MKXA 4RKEA 2XNKA 1WY7A 4S0ZA 5CLIA 4B6PA 1EZ1A 1LSOA 1ITZA 3H04A 3OQOA 4TRRA 3WLPA 3R0QA 1KY2A 2DERA 3F46A 1I3OA 3UT6A 3H87A 3OU2A 1J8FA 4NG4A 3VOAA 1E3IA 3T61A 2WUEA 1PLLA 4UHBA 4RTPA 4M37A 4Q3EA 2QY6A 3EC2A 4AZSA 4LRYA 4B43A 4MS3B 3TL6A 2B1IA 5NLLA 3SFVA 2BEJA 4KGVA 2PZGA 3ZD6A 3HKEB 1KRWA 5BXYA 3ZBQA 4TQUS 4LAFA 4AJLA 3JWPA 1Z5UA 2SNIE 1P4HA 1RXWA 2WYVA 1O6BA 2QMOA 2KLHA 2MSLA 2FN4A 4P7BA 5IK2A 3VZSA 3CN7A 4AF6A 2CN1A 4TXLA 3PFFA 5P21A 4EHLA 1FTSA 4J07A 4WVLA 1DQNA 2LV8A 1LPPA 4GI3A 3RVMA 4A26A 4ARUA 1GD1O 3LLUA 1Y0BA 4RX1A 3UGQA 4CM1A 3UMFA 1JJIA 3IAHA 3O3CA 3VX4A 4AJEA 3Q88A 1ULAA 2QOEA 3D3WB 4G0XA 1JU4A 1EUCA 1C9EA 1CS4C 5CT8A 1JKJB 2VWGA 4XB6B 4YRLA 4A03A 5HM8A 1NN3A 2A4KA 3MMNA 3MUOA 4Y2JA 3SQNA 3HDVA 4BWFB 4DSAA 5BUZA 1WVGA 2I6SA 1QZUA 3H3FA 2X2PA 4OJKA 4W8OA 4YP0A 1PV2A 3C8DA 4IKEA 5EL0A 2F4NA 5G1OA 3SHVA 2NO0A 1RDFA 4DDVA 1Z82A 3FGZA 3WNBA 4KR9A 4L57A 2P6NA 1X8JA 2VHZA 4N3GA 5AI9A 5JMPA 1ADGA 4D42A 1A82A 2B36A 3AHCA 3OG9A 2ZXUA 2BR5A 4DDUA 4ZAXA 4A2CA 1E59A 1I32A 2HUNA 1Y5IA 3PHJA 1A8UA 3VHQA 4CTJA 4DY6A 3OQMA 1TD1A 2VJOA 4R0NA 3CGWA 3K6KA 3PNPA 1ZJWA 3IV7A 4KHPB 2CMDA 4YJFB 5ILOA 3VR0A 3HWWA 1M0EA 1KDYA 1E98A 1MV8A 1DT5A 1NOJA 2EW8A 3KPUA 1XEAA 1QZZA 1WP9A 4H0FA 5DWQA 1CJKC 4B2PA 4KLRA 2Z9CA 4C29A 2E2WA 1MOQA 4ALJA 2QMQA 4OKNA 5AJHA 4LA4A 3UH1A 1JEOA 1H6BA 1R0KA 1GL7A 2I76A 1WXQA 3LFHA 1G3IA 4GLJA 2J7PA 4IHAA 2C9DA 2G3YA 4QASA 2J4DA 4JWTA 5IG2A 3FPBA 2P3OA 1OYVA 4N7JA 3ZQ4A 1GTVA 4PG5A 1WKCA 3LLVA 1HLFA 1WXDA 1ZICA 4TWJA 3UWOA 1IFXA 1O9BA 2DBQA 3UJ6A 2WAAA 3DLTA 3FSRA 2EGGA 1SOWA 4XWYA 1OA1A 2J9RA 4ZTBA 4EYQA 1M54A 1Y4AE 1KOGA 4ZI7B 1A4IA 4Z5XA 4PN7A 5BORA 3LPNA 5JZMA 3HCEA 4MGEA 5C4IA 5LL6P 1U0FA 1WCYA 2I6XA 3GUZA 1ESDA 4U6SA 1YC2A 4E5UA 1RIFA 1M1UA 5KSYA 3G02A 4C89A 5B6PA 3BIFA 1DJPA 1VE7A 2NX2A 2X1MA 4UU1A 1EIWA 2P90A 4US0R 3L4KA 4NEQA 1UEJA 5HA5A 3IESA 1MUUA 1LS1A 4IS3A 4D3ZA 1REQB 5EA2A 4WI1A 4EARA 1I7SB 4W8GA 3DBLA 1Y6JA 4Q7KA 4WK0B 4LK3A 4CL3A 4LGYA 3TPZA 5ADVA 1U8FO 1HV8A 1DAEA 1A69A 3JAWB 3BJEA 4IDFA 4GO1A 4Q19A 5H7XA 4CW7A 1NONA 2O52A 3EIXA 2H18A 4AJKA 3LLCA 4ENSA 1QIHA 2N42A 5DEIA 2VATA 4BBPA 2GM4A 2O4CA 4AICA 1EFLA 5JOQA 2W6OA 1IJFA 2P30A 2JLAA 1A1SA 1CUGA 1E4OA 4MGKR 5K0EA 1Z2PX 5JZOA 3GT7A 4ZOAA 4M83A 1W30A 1N57A 3BSYA 1LBIA 1C1DA 1MO4A 4O5OA 2WWVD 4JODA 3RDPA 4GKBA 5DLDA 3D1JA 1FUYB 2ZBEA 2C0CA 3NHKA 2DXIA 1XK7A 1WUYA 3H4IA 2WNIA 1OPRA 1M0SA 3CYFA 3TH5A 4E12A 5B1EA 1LPBB 4UQOA 5TSDA 2C92A 2ZWIA 4HZIA 5HZGA 4DUZB 2ZSIA 5JECA 3WWPA 4JEHA 4GR5A 3LYUA 4LMBA 2WYUA 3R6WA 2AG1A 3QELB 4OHXA 3B51X 3EXIB 4DM7A 3OKPA 5JXJA 3R5KA 1IVSA 2ZKIA 5TLSA 5CXXA 5F4ZA 2QD5A 1RAEA 5KYGA 2FW8A 4KN6A 4L8YA 2P4EA 2ZRAA 3EK2A 1W0JD 2JFGA 1WZEA 3GIDA 3EXG1 5H9VA 1SULA 3RUAA 2IYSA 1NMYA 3AY0A 3VYRB 2H5JA 3AEQA 3E5RA 4X00A 1XDBA 5KKAA 4G9BA 2O6HA 2QTBA 5IYZF 2Q1TA 2C7VA 1XZNA 3A1VA 4HWPA 4KWCA 4ROSA 3UVEA 3CWZA 3RVSA 5A5FA 4QWMA 5LU9A 1LFDB 1D2MA 5FFNA 4UOZA 4ODIA 1Z6PA 1OVGA 4FMBB 4YAUA 3L8MA 3IDAA 3T9DA 3PGMA 5LXTF 4HGRA 1CJBA 3SLRA 1XX6A 4I0WB 4W1PA 5E2IA 3O4GA 2IS1A 3JVUA 1Y8RB 3RFXA 2Y68A 1E69A 3DOHA 3OM1A 1KOLA 1U1GA 3ZW7A 1CFZA 1RYNA 1JG4A 1ESMA 2D1SA 3KSDO 5FBLB 2AHRA 3I28A 3UWPA 1JQBA 3S99A 1XHLA 1J0DA 2XHEA 1ABEA 1C8LA 1U80A 5JAUA 2D6FA 3NKVA 1H66A 3LUHA 4HWKA 1QKIA 3FLAA 2QK4A 1RBQA 1YQ9A 2MYTA 3KOWA 2H0RA 2F00A 1HUQA 1TM4E 3BZUA 3Q7QA 4HEQA 2VP4A 3UAXA 2A1UB 2ZS7A 3LH5A 3FRJA 5CFMA 1KBZA 5K6AC 5AM3A 2RI1A 1M6WA 4CE6A 4RGBA 5EEGA 4CMIB 4N4AA 9ABPA 1M8GA 1SBCA 3B1JA 3MS7A 2XNSA 3UMRA 4Y9RA 4OLHA 3N76A 1V1JA 1DTSA 3DE7X 4YNBA 4YASA 3UMGA 2YHIA 1X3SA 3G8CA 1QK3A 1T1EA 1VLZA 2FZKA 3DD5A 4B7UA 3AVWA 4XFKA 4CHTA 3W3AA 5AVOA 2BLLA 2OV4A 4JBWA 2YOHA 4Y2UA 5LYYA 5LYJB 1PR4A 3CVXA 4IGIA 2B1RA 1TRHA 1U2DC 2OV2A 4FFMA 2O3UA 1BRMA 2Y9MB 3BIXA 1GZ3A 1H2RS 1RD4A 1YZGA 2BE7A 1L4HA 3M7IA 5CT4A 5EP3A 5JTUA 5EXTA 1U1DA 1YS1X 3FOZA 3SS9X 1Z18A 3DE4X 1QH1B 1E3SA 1HE8B 4UM8B 4CYMA 5EXSA 5CFLA 3JAKB 4IGKA 2A9FA 2VT2A 1KY3A 4Y1RA 5ALHA 5EHXA 2OKCA 3DKKA 4EWLA 1QPZA 3UPDA 1LQUA 3S44A 4X91A 3P5BA 1J97A 1IIBA 2C1XA 2ZYDA 4PQRA 4QQKA 4D82A 2AXPA 3TTXA 3ZGVA 4A7PA 2VHWA 2VYND 2GOYA 3AY6A 2VPTA 4L7QA 1LNZA 2DKOA 2R44A 2ZLBA 3CU5A 5L3SB 1G4AE 2FX3A 3KCNA 2FZLA 2VI5A 4ND8B 5IHXA 1GTG1 1NOKA 4JELA 3EA0A 3O4VA 1E18A 4US1R 4C0JA 3EGOA 3CLKA 2EFCB 2WSIA 3VH1A 3OLYA 5FTMA 3TDMA 3BTOA 3FZNA 3LVBA 4NCJA 4QNMA 4X97A 2GWHA 4EW6A 3GJ4A 1JW9B 1YMUA 5E4JA 2N47A 1N9GA 3QITA 1JQAA 5K0TA 3ER6A 1D4ZA 3OX1A 1ODSA 4ACAA 2EG9A 3DZCA 4H7KA 2YFHA 2IUUA 4R8RA 4QE3A 4EHHA 2C31A 5K4AA