3ROFA

Crystal structure of the s. aureus protein tyrosine phosphatase ptpa
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
158
Chain Sequence
AYFQGMVDVAFVCLGNICRSPMAEAIMRQRLKDRNIHDIKVHSRGTGSWNLGEPPHEGTQKILNKHNIPFDGMISELFEATDDFDYIVAMDQSNVDNIKSINPNLKGQLFKLLEFSNMEESDVPDPYYTNNFEGVYDMVLSSCDNLIDYIVKDANLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Low molecular weight protein-tyrosine-phosphatase ptpA
publication title Structure and substrate recognition of the Staphylococcus aureus protein tyrosine phosphatase PtpA.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 51
structure length 158
sequence length 158
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rofA00
1DZ3A 5CNMA 2PJUA 3GBVA 4MLDA 1DG9A 2FXIA 4MRMB 1YK1A 1ZGZA 3MMNA 4L4UA 4JA2A 4JB0A 5KWSA 3SQNA 4MLCA 4EYGA 2P9HA 4N47A 1JDNA 1B00A 1TJYA 4GPAA 3CS3A 1USGA 4YCSA 2LIVA 2FQYA 3Q41A 2NZVG 4NCAA 5DTEA 2X7XA 4RK0A 3LUCA 1YMUA 3KYJB 1BDIA 4ETNA 4W5TA 4MGEA 4Z0NA 3H5OA 3NNNA 3LOPA 2PL1A 3GT7A 4E7OA 2CHFA 1MAVA 1EHCA 2FVYA 2A9OA 1ZVVA 1CHNA 1F51E 4XARA 1ISSA 2E4VA 4PE5B 1DP4A 2ID7A 1RZRD 1JFVA 4B09A 1PEAA 5TQ2B 4DADA 1NATA 3O1IC 3QELB 3OMXA 3KG2A 3GA5A 3HCWA 1NXTA 4MQEA 3H5LA 6CHYA 4RV5A 2MSLA 5DLEA 4WXMA 1JF8A 3HZHA 4M88A 4G0YA 2IPAB 5EWMB 3IP7A 2FMIA 5GOTA 4D6YA 4N03A 1LBIA 5IEJA 4H60A 1EFAA 1YIOA 3BRQA 2FTKE 1UDRA 3CFYA 5JNUA 3GRCA 4O1IA 4Z4HA 1FFSA 5BRJA 5JNWA 3H1FA 2WJWA 3QLUC 3EAFA 4JB2A 3O1JC 5FBHA 3DZDA 3JVIA 1JBEA 1U8TA 2MYUA 1A2OA 1Z18A 1U04A 5TPWA 2E4ZA 3CNBA 1LK0A 1NTRA 4Q6WA 2L2QA 4KFCA 3HJFA 3D8UA 1E6KA 1PEYA 1RXIA 1SRRA 3O2QB 4RKRA 4IF4A 1P6UA 2PUCA 1CEYA 3FDFA 1QNLA 4MAAA 3I45A 1KRWA 5T3YA 1QP4A 4Z4GA 1MB3A 3UK0A 2WB4A 5IUKC 1JHZA 4EYKA 3S99A 4YRZA 4ZMSA 3H6HA 5JNSA 2P4UA 2B1JA 4HNSA 1VPWA 3H6GA 1W9HA 1EWTA 4Z9BA 3QLVC 3LKVA 2L18A 1C4WA 3DGEC 3KCNA 1BA2A 3TO5A 3UUGA 4KREA 1OXBB 4KV7A 3OLZA 3FFTA 3SNKA 3E3MA 4G0MA 2E4XA 3QX9A 4RS3A 3CHYA 4OBBA 4YGXB 5BR1A 3HS3A 1GUDA 2FMKA 2XDYA 3N8IA 5TQ0A 4RK6A 3EQZA 3FFWA 3RVRA 2YHBA 3KLNA 3DLHA 3OQNA 4ML3A 3O2JA 2PUEA 1KMIY 3BBLA 1TM2A 1URPA 3CLKA 3HV2A 2PLNA 1DJMA 1VLZA 4LDAA 1VRVA 3P9YA 3IP5A 3N75A 3TMYA 4TN5A 4H3HB 4LDZA 2MYNA 1HEYA 2FLKA 3G1WA 2RJOA 5CNJA 4CBVA 3MYYA 3RVQA 4WT7A 5TPWB 1BAPA 1Y1LA 2R48A 5CNKA 1RPJA 3OLYA 5E3JA 1ZITA 3EQ2A 4YP9A 4G0PA 2HQOA 2WY2D 1PNRA 3VNBA 2MYTA 3LUKA 4N0QA 4F8JA 5D2CA 1AB6A 1YS6A 4WXEA 5EWJA 2AYXA 5TPZA 4ZJPA 4Z9AA 2JBAA 2F8SA 1SXHA 1JWLA 3KLOA 4G86A 4QYWA 5JNRA 3C3MA 3CZ5A 4P98A 5DKFA 1NXXA 5IULC 1FQWA 1QQBA 4MR8A 4EYOA 5IUNC 5HSGA 1YMVA 2NZUG 3RVMA 4KRFA 3RVNA 2JRLA 3KS9A 1R8JA 2FMFA 4KVFA 1K66A 2JCGA 4MR9B 2QVGA 3A0RB 4EVSA 2AYZA 4UHJA 5KI6A 4MS4A 1Z12A 3NHMA 3NNDA 2WMYA 5FWXA 3I42A 4XXHA 3T38A 5BQ3A 1I3CA 1P6QA 2GKGA 4EUKA 3N53A 1APBA 1JYEA 1MVOA 1SXGA 4EGSA 2JVJA 4N76A 2PAFA 1Z2EA 4KMRA 3HDVA 3KYIB 4KK4A 4D6XA 4S05A 4KNYA 2MSKA 2JB9A 3QEMB 4MQFB 2CHEA 4RXTA 2W42A 4WZZA 3SY8A 3URMA 3OQMA 1QKKA 1L5YA 1A04A 3BILA 4RK4A 3KSMA 5C5CA 1EWVA 1IIBA 1JX6A 3MF4A 4IILA 3D02A 3I09A 4FB4A 2F8TA 1A0OA 5IEBA 3NHZA 4LX8A 2I6FA 2FEWB 3HVRA 3NBMA 3LUGA 3T8YA 1DBWA 3ROFA 5TPZD 1D2AA 4EVQA 1P2FA 2CWDA 3R0JA 2NUBA 4QICA 2A9QA 2A9PA 4RK5A 1DC8A 3OM1A 4JOQA 3OQOA 1TLFA 1RXEA 2IPLA 3CG0A 3H1EA 3RVOA 5B3JA 3M9WA 1Z15A 2GI4A 4RSMA 1QPZA 3KJXA 4XAQA 2FKAA 5ED4A 1LJUA 3H5WA 3KTOA 2PUBA 1MIHA 1DCMA 1Z13A 3F73A 3TB6A 3ILHA 2IPNA 4KQ9A 1QMPA 1J56A 2E4UA 1M5TA 1ZGGA 2FEPA 3O1HB 4YWHA 1RNLA 2IDMA 3HSYA 3IDOA 3MA0A 3F6PA 3CTPA 1YS7A 1NXSA 3C97A 3O74A 5FWXB 5BRAA 4F06A 2QSJA 4NICA 1U2QA 1ZH4A 3LUAA 4PZ0A 1WETA 4NCBA 1JH9A 2VYCA 4N0PA 2VUHB 3SG0A 1DCFA 2PUDA 3RVLA 1E6MA 4Z4CA 2HQRA 5CNIA 2PMCA 3T6KA 3HK2A 2FN9A 2HQBA 1Z16A 2FN8A 3BREA 3GV0A 4F3TA 4ETIA 2TMYA 3Q9SA 2JVKA 3HUUA 3IP9A 2IKSA 4DQDA 4W5OA 4W5NA 3Q7RA 1JFSA 4KPYA 4Z4FA 5FWYA 4JP1A 5C5EA 1PNTA 3NNSA 2PUFA 1S8NA 4MQEB 2VK2A 3HDGA 4ZMRA 1FFGA 1Z17A 3O75A 4FE4A 2PKXA 4RDCA 1C0EA 4E7PA 3M6MD 3N0WA 4PEVA 2IPMA 1W25A 3IP6A 4KK3A 2YHAA 1QP7A 1GCAA 3Q15C 3EODA 2CD7A 2HSGA 4HNQA 3N0XA 5TE9A 1U2PA 5HKOA 4MRMA 1T34A 1TVMA 4IMJB 4YV7A 1GCGA 1VKRA 2M98A 3OLVA 4FE7A 4MS3A 1NXOA 1BDHA 3QEKA 4OLAA 3RH0A 3C3KA 4ZYLA 1YTUA 5HQJA 7ABPA 1AB5A 3FGZA 4PICA 3C3WA 3TX6A 1BVHA 3OMWA 2JVIA 1JLKA 1PUXA 3LKBA 4TLMB 3HO1A 1E2BA 1Z2DA 3HEBA 1DBPA 1JYFA 4OTZA 4YR7A 1LBHA 2FEKA 1DCKA 3CU5A 3IPAA 2DRIA 2NT3A 1ZESA 5JS2A 1ISRA 3LTEA 1JFTA 4LE0A 2A9RA 3SAJA 2NT4A 3HM9A 3JTEA 2LP4Y 1M2EA 5KQMA 5EWLA 2GWRA 3G85A 3QX8A 1K68A 3QELA 4MPTA 4Q6BA 1D1QA 3JPYA 4YO7A 5TQ0B 3KKEA 2QW1A 3GL9A 1M2FA 1GLGA 4G0XA 4LRQA 1FSPA 4EVRA 4IGAA 5EWMA 2R47A 2KYRA 5KQLA 1Z25A 1ZAYA 2QXYA 2FLWA 4MS1A 4F11A 4MYRA 4Y9TA 1QO0A 2RDMA 8ABPA 2OENG 1L5ZA 5DCLA 3L6UA 3MQ4A 4RZSA 4NV3A 4MS3B 4UHKA 4IMIB 2J48A 3QLUA 1E6LA 2IYNA 2QZJA 1SXIA 4LZLA 4XLTA 3OM0A 4OLBA 1CYEA 1XWWA 2HJ9A 3MM4A 3Q7SA 4RXMA 5T7BA 3QLTA 4L85A 2QU7A 5IX8A 2ID9A 1DRJA 3RQIA 1NXPA 4O1HA 2M1ZA 3F6CA 4G0QA 4D74A 2JK1A 4PYRA 3JPWA 4IRXA 4TMYA 5IBQA 5EWJB 2O20A 4EY3A 3TD9A 3ILYA 2H3HA 2JBAB 3LUHA 4TLLB 1QQAA 3DLBA 3SM9A 1GUBA 1ZDMA 1NXVA 4MR8B 4RKQA 3HXMA 4NQRA 4HYEA 3DGFC 3QLVA 2WJAA 1YVUA 4RY8A 2FSPA 3EDCA 5EWLB 2HPHA 3FMVA 2B4AA 1DBQA 1OXKB 4RY9A 2H0AA 5KC9A 4MS4B 5PNTA 2RJNA 1FFWA 3LUJA 2QV0A 2VUIB 3EJWA 1ZY2A 4OATA 1YK0A 1DRKA 2BGGA 2L19A 3GYBA 4HNRA 9ABPA 4W5RA 5IUJC 2PUGA 4GNRA 3CZCA 3JVDA 3H75A 1QO0D 4RXUA 5TQJA 1D4ZA 1USIA 4S04A 3BRSA 3H5TA 4OG2A 3H5VA 2GX6A 2QR3A 3K9CA 1TMYA 4MS1B 2QVCA 4WUTA 4DN6A 3RVKA 3A3KA 4RK1A 3O21A 2LPMA 4QPJC 1ABFA 1KRXA 3RVSA 4Z4IA 4EYQA 1JL3A 2LUOA 5F64A 2IOYA 1LJLA 2MSWA 3O2SB 5KQPA 4H3KB 2GBPA 2R25B 1NXWA 1EWKA 5ABPA 2WWVD 5JS1A 4Z4EA 5KQGA 3B2NA 5HM6A 4JAVC 2V0NA 3H5IA 3ROTA 2ZWMA 3N0RA 4LE2A 5FBKA 2Q5CA 6ABPA 3A10A 3CG4A 5B3JC 3LFTA 2N9UA 4G0OA 3FFXA 1M5UA 2FMHA 3OLWA 3M9XA 5I4CA 2E4WA 1XHFA 1QP0A 4RU1A 3LUFA 4RWEA 4YS6A 4MR7A 1JDPA 3OLXA 1H9CA 4P1ZA 3GWGA 3T95A 1ZH2A 3LMKA 3F7NA 3A0UA 4O5AA 4MR9A 1U0SY 3GBPA 3VNAA 3W9SA 2E4YA 3Q7TA 1D5WA 5DGCA 5KC8A 1NY5A 1SD5A 3E61A 4WWHA 1USKA 1P8AA 4Z99A 1PHRA 3RVPA 2FQWA 4LE1A 3I5AA 3HUTA 2PUAA 1ZN2A 3N6VA 4W5QA 1DC7A 4QYMA 2WRZA 3UKJA 1F4VA 3CKMA 3LUDA 2RGYA 4KZKA 3EGCA 1MB0A 5IC5A 4RY0A 3DBIA 3QEMA 4JASB 4MQFA 4RK7A 4ETMA 4Q7EA 4XASA 4F12A 1EAYA 4G97A 5GQSA 3CRNA 1D1PA 3C6QA 2MYPA 3MIZA 2FW0A 3RVJA 5FWYB 3H1GA 4YLEA 5TQ2A 4ZPJA 5JNTA 2R4QA 3JS5A 2PE5A 1XHEA 1ZHHA 2FQXA 3OO1A 4XFKA 1RZRA 4KQCA 3K4HA 2PL9A 3L49A 3EULA 3OO0A 5CHYA 3JY6A 1ABEA 5JNVA 1Z26A 3QK7A 1KGSA 2OQRA 3KHTA 2LBPA 4N41A 2L17A 3IPCA 1BDJA 4G0ZA 2ZAYA 4MR7B
chains in the Genus database with same CATH superfamily
1EK5A 3B3JA 4G9EA 2JCBA 4OXXA 3HRIA 2ZR0A 3BBPA 4Q19A 4CMAA 4UOZA 3IMEA 2P9BA 1SC1A 3S1LA 5IZ4A 1HA3A 1YQXA 3W3ZB 3PSAA 1EA5A 3QKRA 1ZGAA 4EFMA 2JKZA 3H9EO 4ZGBA 4M87A 4UDOA 3QQ5A 4FQ5A 1XELA 1YE3A 2EL9A 4LTNA 4OQNA 1JG7A 2IS1A 3AZOA 4M46A 4DDMA 1MT3A 5IDWA 2O48X 1L5HB 4RK0A 2PMEA 5LPNA 2YYZA 3I2YX 4FGZA 5EJ8A 5DI3A 3MRSA 5DVZA 3D3EA 4C7JA 1T6NA 2ORYA 4FYXA 1L7MA 4G5XA 1KQPA 1T0IA 2R2GA 4GWLA 5K6TA 3K9NA 5ELXA 2Z1DA 2XYPA 4MWEA 5HRUA 2EX1A 3C3BA 3CPEA 1DZIA 1R64A 4ND6A 4RD4A 2C7PA 2ZJ4A 2D13A 2A9OA 2CLIB 3KKQA 3RC1A 2CYAA 3E1GA 4IYJA 1WCIB 3ZV5A 2E4VA 2AD5A 4D3DA 3NTOA 1I51A 1WDMA 2E21A 3ASZA 3B1YA 3PGVA 1Z34A 3PXEA 1E4YA 1YJXA 4PVDA 3T7TA 5JJCA 1DTSA 1OLUB 2XE6A 4E13A 1HRDA 1YZUA 2ILVA 3E7XA 3TFQA 5JATA 1NX6A 3G8YA 2C9ZA 4HWSA 2VAPA 3OTHA 3HVUA 3BTUA 1B2LA 1IY2A 1HNNA 1PR6A 2BI8A 5EYPB 1IHXA 1L4EA 3LP5A 1AKMA 2ZUUA 3KXLA 3LX4A 2RCNA 1T8WA 1O87A 5P8WA 3THSA 3H83A 3IQEA 1DOZA 2VTVA 1U28A 4FXPA 1MRSA 4H60A 1DC6A 4M89A 4YC7A 2Y1GA 2D5IA 1ZM3A 3A2NA 3LWBA 5BSWA 4NCJA 3EC2A 4ZRNA 5GPBA 4CF6A 4DMFA 2Q9UA 1ZLXA 2DPHA 3U4AA 3DZDA 4C21A 4ZN6A 3JVIA 3LXUX 2PMDA 4GNKA 3X1KA 3OOWA 1NR7A 3L4BA 3CNOA 3G5AA 3IQHX 1A8PA 3EHEA 4LKRA 4HWKA 1WW2A 3TBKA 2ZM6B 4KFCA 1PBNA 3AXTA 1O8BA 1PEYA 2D5CA 4GEKA 2OM2A 4H7KA 3RDPA 4UM9B 3HPQA 1I5EA 1R12A 1Z7EA 3M33A 4L9RA 3H8WA 5H82A 4E4TA 4A73A 2UUBB 5HDBB 2PUCA 3GEMA 1QNLA 3VYSB 2D4AA 4YRTA 3PE6A 2O3RA 4O4HF 2BMWA 4YRFA 1WZEA 5AI5A 5IMBA 3S81A 2PMWB 4K3VA 5CVTA 1NVAA 4WFIA 2B1JA 4I5IA 3K6KA 4PPGA 5EMNA 1W9HA 4EEXA 3NJ8A 2IGTA 2B7LA 4LX0A 3RR2A 1ATIA 2PRSA 1TMKA 4S3MA 5DYTA 3N2KA 2GF0A 3KWFA 2VDMB 1II0A 3JQAB 3QF7A 5FQNA 1VIYA 5BWMA 5F3RA 2ATXA 1KZ7B 3Q3CA 4ZODA 2CLEB 3FNBA 5BR1A 3IPYA 1KMQA 1VL0A 3AQ4A 4H7PA 5KYYB 2X4GA 1N2CE 5K0FA 3RYCB 4QBHA 3NR2A 2N1BA 5IHXA 3FKSD 3M4YA 4AP5A 1XTVA 3GRYA 1I2AA 4YP5A 1NW8A 3PX2A 4FDMA 3G8CA 4G8DA 4N7MA 1PR5A 3F3SA 2WV9A 3FCYA 3HV2A 4Q18A 1B74A 3H84A 4ARSA 1Y8QA 2ODAA 4L27A 3VKVA 3ZJUA 4MROA 3N75A 2ODTX 3QPCA 1NT4A 3HBJA 3BAZA 4MVJF 3KYCA 5AK0A 1ZWKA 5CW2A 3F5SA 3UJ3X 3L2OB 1S2GA 3NHPA 5HFJA 4EQ6A 4D98A 4LJ6A 4S0XA 4WT7A 3CCBA 4UXHA 4EBFA 3ENNA 4AYTA 5A6VA 4FOTA 5A5GA 1HKUA 1P31A 3LPAA 2ZIZA 4G5SA 4WLEA 3IV6A 4IG4A 3R0VA 4RHYA 3SQWA 3SZLA 3WJAA 4RULA 5BNZA 1QRAA 3O3OB 2QX8A 1HRKA 3O47A 2WICA 1QFZA 1R6XA 2HCRA 3AONB 5FOVA 4B32A 5F2EA 1XXHA 1EVZA 2F8SA 1KC1A 5DKFA 3RIMA 1VCNA 1ZGJA 1NI4A 1RWMA 1NV8A 1SIUA 2PSHA 2BDTA 2VDWB 2XBUA 3I0MA 3KSRA 1SUFA 1CQIB 1R8XA 1PGOA 4UHEA 3P2MA 3OCWA 3V6LA 4C9BA 3NVAA 4H1WA 4QDKA 1ZAYA 2WZCA 5ALGA 3VO9A 3TJRA 3Q7IA 3LXXA 2ZUCA 3L7LA 1C14A 2Q49A 1Y1RA 3I2IA 1YVDA 3G8AA 2QSUA 1ZJ4A 3DL0A 1XTUA 4EJ2A 5G4LA 1E1MA 2HGZA 2UUOA 5DEOA 3WKEA 1OB2A 1TF5A 3NDJA 4KR2A 2XNDD 1IY8A 3D6HA 3LPLA 3L1HA 2X8LA 5FFMA 2V0GA 2BISA 2HD4A 3I23A 1IE3A 1NN3A 1JDVA 4R9UC 5HQTA 4D6XA 1RTTA 1V16A 1K8QA 4YMGA 1RI5A 2B92A 4LDNA 1G60A 4K9QA 5AHKA 4JELA 2YS6A 2YJ4A 3GAAA 4LSWA 3DVAB 2XUZA 3ZWVA 4E51A 2FEXA 3LXMA 4NMWA 1QZTA 3UV7A 721PA 3ENZA 4G09A 2P2NA 4PHCA 1V4BA 5E38A 3O8QA 4OVKA 1T3GA 1L8QA 1W5BA 2B21A 4F96A 1D2MA 2FEWB 2ZUDA 2IYZA 4LEIA 3VZSA 3D2AA 3ROFA 5EVCA 1LC3A 1A76A 4QICA 1CRLA 1DC8A 1SVLA 4BGVA 4P7JA 1K97A 1FYDA 3HB5X 1V11B 1GNSA 4CMKA 1EDDA 1E18A 1QBGA 1XE3A 3M6WA 3THXB 1EDEA 1SB9A 2FKAA 4L5YA 4NXNB 4KPUB 1ZIDA 5DNEA 3KTOA 5I9BA 1MIHA 4FTWA 2ZQ5A 1YB5A 4FHDA 3ZLVA 2ZWPA 3G89A 3TG8A 4CTMA 2DETA 4DRYA 2FMUA 3DAPA 3BB4A 4QREA 4Q66C 3WOVA 1U1GA 2C77A 1FFYA 4N49A 4LVUA 2PWAA 5L9AA 3I05A 1P9LA 1WKCA 1KERA 1PK8A 2VHEA 3K1ZA 4HC4A 5J1SB 1V9LA 1LPBB 1ZW1A 2FGKA 1G8AA 3MWDA 4TRMA 4M6WB 5BRAA 1E7WA 1QH1B 5EJ9A 4JDUA 3UXMA 1Y1TA 4H1TA 4FFDA 4KXUA 3GA7A 4A8HA 4FWBA 3OP1A 1P2GA 2PKWA 1FSZA 1R0CA 3A3NA 1C3OA 1H23A 5SY6A 1F14A 1Q44A 1BXRA 3IUYA 2XBMA 3HYRA 3CLHA 3KZNA 4LWQA 2HV9A 1P5JA 1FTQA 3NUGA 4YYEA 4WLNA 1PWEA 1HURA 4Y98A 3CF0A 4XH9B 5ALXA 3UQYS 4CM8B 5K20A 1SC9A 4UMDA 4WERA 3ML1A 1B1AA 1GR0A 3I92A 4UMEA 1P9RA 1VLQA 4ZVTA 4DMLA 1Y6GA 1E2GA 2JZCA 4YRRA 2XIJA 5KYNA 3K70C 3H2IA 3B1KA 1JTFA 4ER6A 1MO5A 1M0SA 1KIFA 4TRJA 2NO7A 3DPIA 3TDKA 5MN6A 1PNTA 4OXKA 5IC6A 5IJZA 4X20A 1G1MA 1NW4A 2PK3A 1DFHA 2Q4TA 4DIOA 3SBXA 3HDGA 4ZMRA 1UQRA 4R40A 4Y2UA 1EGQA 2NVUB 1B8UA 1UADA 1G7CA 3GVPA 4MO2A 2ZKIA 4QJIA 5CEEA 1R6TA 1EXMA 1U5BA 2JFYA 1C7EA 2R5NA 3UANA 2BFDB 4PEVA 5FRDA 3OZUA 4QTXA 2Z6QA 1YQDA 2AJ8A 1XBTA 1JEJA 2CY0A 2RKWA 1EINA 2WYIA 3ICWA 2IU0A 3ZKAA 3EODA 4DLXA 5MFZA 4K87A 2WKWA 3N1UA 3KQLA 4ZXFA 5HF6A 2H4JA 2ZAMA 5HPYB 1WF6A 5LZ9A 1U6KA 3BL5A 2M98A 3V8NA 1H2XA 4MS3A 2P75A 3DT8A 3L0PA 1VJTA 2NSHA 3II6X 4A36A 1I2CA 1K5HA 3V1TC 3MCWA 2VI5A 2DJ5A 1Z07A 2GPBA 4IOLA 4RPIA 1NVEA 4YO8A 4RPKA 5ILQA 1QVWA 3DHEA 1PR2A 5PGMA 1E63A 4EO4A 3AG5A 1RXVA 3QSYA 4RKWA 1M83A 3A27A 4WCFC 3RO7A 4ZEVA 1BFDA 4KGDA 3NFYA 1D09A 4AU1A 3T54A 4MWZA 3L93A 3QHAA 4CG0A 1FNCA 4IQGA 3V8EA 2OGTA 3QBTA 2OCKA 3M4NA 5IVDA 3T15A 4KXWA 2OP1A 4JR0A 3OIGA 2I1QA 4BNDA 4D9FA 4OQ4A 1VLHA 3UJ9A 1M8GA 4Y6QA 1CR1A 2YUTA 4DIDA 2PGJA 1CNMA 2GWRA 3GEGA 3O95A 1ZI8A 1IHYA 1VPDA 4JCOA 3M5DA 2C57A 4U2KA 4UNSA 2DPMA 2QRPA 1KDTA 1QOZA 3LZDA 1M3SA 2JLBA 4CT0A 1H4VB 4Q03A 2VDOB 3LVQE 2EW1A 3AOEC 4X5OA 1WAMA 2JHGA 1PKEA 2YNMA 3AB3A 4MI6A 1XVVA 4QQRA 5AW6A 1AXRA 1ZGHA 4A1OA 4KAAA 4ZEMA 2Y71A 3CNEA 2DR0A 4M9UA 2XUIA 3VJRA 1WDKA 3UMVA 3L0YA 2BHTA 4BZXA 3VR2A 4MJ7A 2LXNA 4LJ5A 1HMYA 1HYHA 5DXJA 2EWVA 4UE2A 4I7EA 4TRRA 4Y6SA 5FHQA 2IDZA 4JC5A 2WJHA 3QLUA 1CR0A 5A4DA 3TLEA 2QZJA 1BVUA 3DVSX 4EG8A 4HYTA 1ZOLA 4CLEA 1GGNA 1KETA 2I7TA 4IF6A 4KAXA 3DCIA 4MIOA 4F3NA 1DEXA 1JFLA 2BKLA 4ZEXA 3R5HA 4DR6B 3BRCA 4Q39A 5LU8A 2R6AA 3HFJA 2ENUA 1KAGA 2UVQA 4W5WA 6PFKA 2YIDA 3H9QA 5DCYA 3GP3A 3JCZA 5EIWA 5FUVA 4B8ZA 4FGWA 1K6XA 3RSSA 1J9EA 4NMMA 3IB3A 1ANKA 3JSAA 2LWIA 2PFGA 3AEQA 1NMZA 4EGQA 4KUGA 3HLKA 5U4QA 4LFBB 3B7PA 2MR6A 1ULTA 3IH5A 3IQGX 3SLKA 3PL5A 4C4PA 2D6FA 3PEYA 4I9UA 1YS9A 2QD1A 3N0VA 2QN2A 1L5OA 4KRXA 3QLVA 1RLOA 3T9FA 1QVVA 4ZGGA 2EKQA 3MGBA 2YHUA 4N8SA 1BN7A 1SKBA 4I1UA 4MCAA 1UC9A 1GN8A 4E1AA 1FDOA 1DRKA 1PNQA 3I6BA 4D6PA 1VPTA 3DFZA 2R0QC 1A97A 5JD5A 1X39A 1OZ0A 4RXUA 5TQJA 5KINB 3RFFA 6YASA 1KJNA 2NAFA 3E70C 3QBDA 4MGYR 5C52B 4GVXA 3RAFC 1VSBA 1LDMA 4WI1A 3QVXA 5GM2A 8AT1A 1KAOA 4ZYXA 1PFWA 4N40A 4I8DA 4G1FA 4EW1A 2MSWA 4ISBA 2GN9A 4D0RA 4YPVA 5JS6A 2RG7A 4UPDA 4ZQGA 4OOEA 1Z2OX 4FGJA 2ZBQA 2NYVA 3D8TA 4NEGA 4LV8B 1N0WA 1ZAKA 3LIIA 1T0BA 5AWFC 5G4KA 2VHWA 1KJWA 3SPXA 5A3JA 5KVAA 5AVSA 3JQPA 3A10A 4M98A 2UXBB 3IEKA 1OQAA 4AY6A 5A03A 5GTDA 4JJ8A 1OX6A 3M9XA 4C01A 4Z8YA 3FMOB 3JQBA 2JFHA 2F43B 3MB5A 2HRRA 2JFVA 4L5CA 3DDSA 3DG9A 5FLEX 1EFPB 2AN1A 2VDPB 2YCBA 3BMOA 1JQ5A 3JATA 4ZI7F 1NONA 4MMYB 1U80A 2COKA 4BCDA 2JLSA 4UEKA 3WMRA 3AVXA 1GN9A 2GOYA 4O5AA 3I9LA 3A6PC 3AEKB 3VNAA 3QYFA 4DCGA 1G5TA 1LWNA 4UFPA 3ZVKA 1QRRA 1SNYA 4Z99A 4BNWA 3OKAA 1MJNA 1V7QA 1VJRA 2VP6A 4GKVA 3IESA 2BR4A 5LR6A 2B5VA 3PIDA 3HUTA 4JQSA 2H4HA 2OL4A 4QU9A 2I6UA 3KPUA 1H4TA 3EMDA 2I03A 4DSUA 2X0DA 4QYIB 5A9SB 3G5MA 4RETA 4GC9A 4KEAA 4DREA 1CIVA 5ESDA 1TPYA 2GEJA 2CZGA 1TAHA 4M53A 5IYZB 1XU4A 1WKBA 3IP3A 4UUOA 5GQSA 2DC1A 4INOA 2OTCA 2PR2A 5FI5A 1GUFA 1TCBA 2HBQA 1Y8AA 3HB9A 2XUQA 1GUYA 3UQZA 4NYJR 1AU9A 4RHCA 5DNAA 3ZY3A 3R9XA 1TKBA 2BKAA 2CL7X 4Q24A 3HUEA 3IFSA 3CCFA 2Q99A 4NR0A 2JLCA 1BWQA 4RELA 2CLCX 3QPBA 4I4TA 1ADBA 3LW7A 4HTFB 3ROMA 5L3ZA 4MUGA 3PQFA 4MRMB 4U7PB 1UFRA 1KXJA 2D7CA 4Q7KA 4WFKA 4BO6A 1PQPA 2IZ5A 1NGSA 1E3JA 4D0GA 2B5OA 2RH4A 4WN9B 3GCGA 4XGIA 3SEZA 3H3FA 1OREA 4BQOA 5KSOA 1J8QA 2R3SA 2A3NA 3Q41A 2EFGA 5DTEA 4F7DA 4WNAB 3B9BA 4C0KA 3CONA 4DUGA 4MP8A 1VBFA 4NAUA 4BN0A 2J8ZA 1QANA 3QXCA 3KAJA 4C0QC 2IHVA 1UOEA 1D9ZA 3BCRA 3NVMB 3IUPA 3MUEA 2IBMA 2W8BA 3VMFA 3FB1A 2CV0A 1FCJA 2VT6A 1Y6RA 1MB4A 2R6CA 2EBWA 3U4HA 4YDQA 1I3KA 3LFUA 3NV9A 5EE1A 5IPFA 1Q7RA 1FNNA 4TSRA 2C2WA 1O3YA 2CUNA 2I4OA 3KIPA 1N2GA 3OT1A 3QXSA 4IIYA 1F51E 2Q7DA 1YUNA 2Q5QA 4U3JA 4KWHA 2WJVA 1UAGA 3DAGA 4Y0AA 4ZT2A 4XWYA 1N5LA 3D3WB 3RI3A 4ZAFA 4EMUA 2V6JA 3EYWA 3DONA 3QEJA 3GMTA 4LSMA 5HJ5A 2OMKA 4PG5A 5K8IA 3FTEA 3GA5A 3EA5A 4ZVNA 2ZDGA 3K32A 2FCAA 3AF1A 3R3VA 3VOSA 4BP3A 5AVUA 1XCLA 4X24A 3OTQA 3VRHA 2QBYA 4WOJA 1JEOA 4RO0A 4PC6A 1DLIA 3DS8A 3H6KA 4MW6A 5EWMB 1L4GA 4BJHB 1E2FA 4RPCA 4HFNA 3H65A 3KKKA 4YUZA 3R8CA 4C2BA 3P9QA 3R1IA 4TWJA 1KQNA 3ROZA 3E5RA 1XZDA 4WESA 3NC4A 4DMUB 4GI1A 4MQ6A 2KBEA 3D5EA 1A9YA 1H22A 2H2DA 1CVRA 1T6ZA 2IX9A 2WVAA 3SN6A 1BEEA 1UBLS 1GXSB 1MXHA 1W7AA 3IUJA 4DUGD 3SLGA 4AMBA 1Z18A 3E9YA 1CSEE 2QRJA 4PCUA 3UOAB 1KYXA 4EX6A 4OQXA 4Y8VA 1E6KA 4MXDA 2QTCA 3A6JA 4RMIA 2QLJA 1DJOA 3QKUA 1T9HA 1J21A 2MHCA 3GIWA 3K96A 2AG6A 3HCAA 3PFHA 3PG5A 4BFCA 2Q29A 4EPRA 5CCXA 1L7BA 1PDWA 2GFHA 4IHJF 4TTVA 3UK0A 4BQIA 4J9VA 4ES6A 3NEPX 3D4PA 1VYUA 3ESXA 4EM6A 2LVBA 4B44A 2NSJA 4R0NA 2NPFA 5B6PA 1Q0TA 4YCNA 2QRLA 3DDUA 1NVXQ 4Q0MA 4YCDA 1LLDA 2L18A 2FW6A 3KALA 4KV7A 3U4DA 4MUHA 2F1RA 3I76A 4JUDX 2Y9PB 3FCUB 1SXJC 1DO2A 1C2TA 1Z0KA 2CBGA 5KNBH 4KBYA 1XZGA 3WAJA 2QTTA 2XDYA 3HFGA 3KXPA 3N7UA 4L57A 3SJBA 4DCJA 1CJMA 2B1GA 2H92A 4M8KA 5CHEA 5IH3A 5DRYA 2BEWA 2O2GA 4I5FA 1FRNA 2BHSA 2X5OA 5I7EA 3OQNA 4DW8A 3FSJX 2PS3A 4IJUA 1ZJWA 1XZAA 1UP4A 4AJJA 4YRGA 1U5CA 4CQLA 5F1OA 3IAEA 4Y0VA 1VLZA 4A16A 1AXEA 2ZVQX 1JQAA 1E5TA 5KTMA 3ET4A 4DV5B 2XGSA 4KPFC 1FUIA 1O6ZA 4Q4DA 3RF7A 3UBMA 3JRXA 2VN8A 5EXSA 4PIMA 3RVQA 5LD2B 4LCBA 4MGIR 5T4BA 1YC2A 3GGSA 5AI9A 2TMDA 1T36A 2BDEA 1SBIA 4L8VA 4DCSA 4DQLA 1LDBA 4W8OA 3EFBA 4OMFG 3ZD6A 1WPQA 3GFTA 1PNRA 2CE2X 3RF6A 1VLLA 4PCVA 1VMIA 3AC0A 1KORA 2ZYTX 4LXIA 4OGGA 1YNSA 1F12A 4UUBA 4EPTA 1FUEA 4MP6A 2XUJA 2HK7A 5CLIA 2HIAA 2ZYHA 3HNPA 1ENYA 2A1IA 5JHHB 1HSOA 2ZATA 1XVLA 2Q4BA 2N47A 4MR8A 5IUNC 2C4KA 2EEPA 2QLNA 3ASYA 4KGVA 3IJ5A 1AUPA 2ZTHA 3ZR4B 4MR9B 5G1OA 4XQCA 3NG1A 1ZU4A 2AYZA 1OX4B 1NWHA 1NPYA 4Z9XA 3NHMA 4NE7A 3VR5A 4RKEA 2J6HA 3K9WA 4E0BA 1E2NA 3E0QA 3JQRA 3SSOA 4HDKB 1CY6A 1LX7A 4TLEA 1JYEA 1Z5UA 5DHSA 1P81A 5LUBA 2PAFA 1V5FA 4Y9SA 5IS2A 5CA0A 5HX7A 1EUCB 1SMKA 2B25A 3B1VA 4XUGB 3SHFA 4N5HX 4K6KA 4BEVA 2R6ZA 4KR9A 1GQRA 2FJPA 1SURA 4QOJA 1X2BA 5LQCA 3CYFA 3F6RA 2H1CA 2I78A 4ABTA 1MQ9A 1N6PA 1QKKA 3U3RA 1FP1D 2Q6IA 4AN4A 2FXVA 4E5MA 4QM7A 2XXAA 4QVKA 1XTTA 3FW1A 4IICA 2W9XA 4P34A 3PNYA 3O84A 4LMPA 4ZTBA 4DSNA 2P9QA 1SQ6A 1PAUA 4AURA 5JBNA 2IWHA 3FZGA 3HNOA 1P4AA 1JT9A 1S1CA 1JG3A 4MX8A 4C03A 1WP4A 2WHPB 3H1EA 2JLAA 3RYIA 3W5VA 4GPTA 3FLAA 5F7ZA 3PU6A 1KYWA 3A05A 3H4TA 5B1SA 5BW6B 1FDSA 4CIXA 5JS8A 4X8HA 3G5LA 5FA5A 3PTAA 3KBBA 4NCIA 3UGQA 5LP1A 2EQ5A 1ZI9A 2C9OA 3COYA 3UJ7A 2ZRMA 1HL3A 2ILTA 2IPNA 3ABSB 4LK3A 2B78A 2VVTA 1QONA 1J56A 5HFNA 5IVIA 4L3OA 3PPYA 2QR5A 4RANA 5FHRA 4K28A 4JJEA 1ONSA 3LBYA 4KOAA 2BTEA 2X0FA 3GLVA 4P33A 1ETHA 3OU6A 4PR0A 4O4LB 2GK7A 2YN2A 4HHEA 2IT1A 1SKYE 3ZLTA 1K7FB 5BW4A 5JDCC 4NRDA 4S12A 3WGMA 1QOPB 4YRLA 2PRKA 2VUHB 1WNTA 3DV0B 1H0SA 2FPUA 2GTIA 2GS9A 2ZI5A 3AXSA 3ESAA 3SYLA 1XN1A 2AF3C 3WLRA 2DM6A 2HQRA 5I6DA 4YT5A 2HQBA 1OW3B 4YJHB 5LXTB 1V8FA 4YV1A 2X13A 5U9CA 2FHSA 4MQ5A 2DY1A 2H48A 1TZJA 1HTWA 5IC4A 1LSUA 5B37A 2X2EA 3SJ7A 3VH2A 4ZIRB 1QJCA 2AI2A 3DDWA 3A11A 3HACA 4D2IA 1F60A 1FNSA 2VDKB 3X1MA 3NNSA 3QEOA 1FYXA 2BYTA 2ECFA 2O2IA 3DUFB 2QZ9A 2ADMA 2ATVA 3Q40A 4JBNA 5J9FA 4YB8A 3GQVA 4D57A 4ZI2A 2VQEB 2HJRA 1C30B 3TE7A 2C5HA 4C76A 5LU9A 3U6KA 1U28C 4NS1A 2PSEA 3P9CA 1VL1A 2QSYA 2G1PA 2ZT5A 4U00A 4E7PA 1MABB 4B46A 1B73A 4BYMA 1TAQA 3BWYA 1Z0DA 1CR2A 5GJWC 1UAAA 5KYKA 5JQGB 3RIYA 1KPHA 1L5QA 1X7HA 3GNLA 3I8XA 3B48A 1Q2UA 4BATA 4U7DA 1H5NA 3A4TA 5TR9A 1KU6A 2AOVA 1GCGA 3G2MA 4E30A 4TQUS 2G82A 2IQIA 3H5RA 3ZXUB 1N1MA 2B4YA 4HLQB 2CWWA 5WRFA 3DHYA 3RH0A 1X1SA 2F4NA 3R9IA 2NV2B 2RB4A 4OHFA 5L7TA 1WB5A 3HV0A 1HNZB 2P7IA 4XYMA 3EG9B 4GDMA 5C31A 3SHQA 9GPBA 1A8QA 2XQGA 1GKLA 1M76A 1XRPA 4ZCMA 5AW1A 4DRZA 1P4SA 3IE0A 4MARA 5DYIA 3BK7A 5LUAA 5AHRA 1H42A 1WRBA 1E20A 1WV1A 4C7OB 4II7A 4O2RA 1PT9A 4QBIA 1OZFA 3GPDG 1VL2A 1SN7A 3JTEA 1HDZA 2H4WA 3INNA 4H59A 4MCHA 4MV4A 4QHTA 2XDWA 3ZIUA 2ZYGA 1RLTA 1CCWA 4F6RA 1KKUA 4FMDF 4MPTA 4IZIA 5TQ0B 4KXQA 1B8VA 2V7TA 2OFXA 3HU5A 3L82B 3L77A 4TZ0A 4N12A 1TTPB 3PUJA 1C3EA 2QM8A 4UTZA 1LBEA 4WY8A 5AI6A 2ZJ2A 2OILA 2KYRA 5DHTA 1TTTA 4CTNA 2WMNB 1REQA 1U0TA 5I7OA 1F8GA 2XLCA 2CVHA 2NZXA 3E48A 1LQ2A 2DLNA 4MYRA 1JW9B 3B7GA 3EEYA 1IXRC 2GAFA 3RFCA 3T5TA 3UXYA 3WLSA 3P0EA 2O8NA 1Z73A 3CX4A 3HXLA 3RTCA 4Q05A 3SIXA 3SZ3A 1U7DA 4W7SA 3D2CA 3H1AA 4KB5A 3A1CA 3WA7A 4ARIA 4PG8A 4S2UA 4UEJA 1GEEA 1N2CB 2QUBA 3QYPA 4JJAA 2QA5A 1Q1EA 3Q9NA 4MUYA 4HXYA 5KOJB 2PYZA 5J4KA 4C4YA 4OHKA 1QE3A 1S01A 4ZO7A 2EP5A 4B4DA 2DFLA 2FZEA 2M1ZA 4Q4HA 3MWEA 3ZWCA 2D0PB 1YVEI 2NU6A 4PYRA 4YDSA 5IBQA 1W93A 5HYVA 4DR1B 1L3BA 4NENB 2V3VA 1QC5A 1HO3A 5AK3A 1YFLA 4OGWA 3LUHA 3QH4A 4JS0A 4R16A 4CM3A 2XNHA 3FPEA 2VQDA 3BEDA 3OQJA 3M2TA 4QECA 4YIKA 5JSKA 2BFWA 2CZQA 4V0OA 3SM9A 3CN7A 5JJBA 2IU4A 3BFPA 1P39A 3K0FB 1SVOA 3I6IA 3DD1A 1Y7TA 2JCXA 4FDLA 4XIYA 4CFSA 1QGED 2B82A 4YV0A 2H0AA 2NZJA 5JBQA 1Y9EA 2C98A 3DQZA 1FFWA 2WQ7A 1CJTC 2VJYA 3O3CA 3U3ZA 4QVGA 2BGGA 1Q17A 4JOSA 1KDRA 5E4YA 3DEAA 3RODA 4PZPA 5DWDA 4HUTA 2E3JA 4UEOA 1WXWA 4Z7QB 1EK0A 3GT3A 3NONA 3BRSA 4H1HA 3H5TA 4DV4B 2PCLA 4OQPA 2AF4C 3GUYA 3AX6A 4BKMA 2ZS8A 3SFTA 2BGKA 4FZ5A 2CFIA 4NFSA 3EBOA 2J1LA 2YIVX 5FDFA 1ABFA 2AHRA 5BSTA 4RPJA 5BP7A 1S4QA 2PSFA 2ZR7A 3B5EA 4GHWA 3SYKA 4HQRA 3Q8MA 3M82A 1GG8A 1NZFA 2EDCA 3GJ3A 3LP6A 5JS1A 1IWBB 4U9IS 4MQUA 2BLLA 1RYZA 2OSBA 1ISHA 2JGNA 3ROTA 5DBEX 2YZ7A 3TTWA 2EIHA 1UPXA 4IQ4A 4RZ2A 3VR1A 1WLSA 3KEGA 1AS0A 2I4RA 1M1XB 3IPLA 1V1RB 3A6FA 1EFKA 3PXUA 4PV7A 4RA9A 3RUCA 5A2QA 1G0OA 3RSGA 3K6SB 1L3CA 2PZAA 4MRSA 1KYVA 4KZPA 1P17A 3NIWA 3FVWA 4NI5A 1JDPA 5IABA 3HRKA 4HQOA 4XLZA 4XX0B 3WYBA 4EGJA 5TB5A 2XB4A 1Q5PA 3FDIA 1Y8ZA 1CQXA 5F9FA 2P7HA 4FNAA 4HX2A 3EJ6A 1JQBA 2PZKA 3JTMA 4IM7A 4D56A 2WNHA 3RREA 4PS0A 1I3NA 1E1KA 3DMYA 3N74A 4FFRA 4WWHA 4GD3Q 4AJLA 2PX0A 3LQQA 3KKLA 1M6HA 1ZEMA 2BZ1A 4PAOA 2Q3FA 3I5AA 1W88A 3EXIA 5DYGA 1I4WA 2PCJA 2QPTA 1CP3A 2QT9A 3BIFA 4A0FA 1QQTA 1PEKE 1YRYE 2J67A 3MN1A 2Q5JA 4WKCA 5DW3A 1L4BA 1H0HA 4CTJA 3H9BA 4KQHA 4JA0A 1OH5A 1EQAA 3Q0IA 2OT3B 3B2EA 4RHEA 4LFCB 3WGYA 4XVRA 3OOSA 4B4UA 1QP8A 2Y0EA 5FORA 2PT7A 2NXCA 5K3BA 2IV3A 2WU8A 2LIPA 5D01A 1HX7A 5JJIA 4HX9A 3AY3A 4GS5A 4IIUA 2IIPA 2MCFA 3QJ5A 4IFIA 4YUYA 3ANSA 1WOMA 1H8EA 3GGDA 2JC3A 1VE9A 1X74A 4PQYA 3RVJA 3H1GA 5C8VA 2WG1A 4FCCA 1KZ4A 3ETNA 4R0VA 5SV2A 4MMXB 2IY8A 3F98A 1YHZA 3LUPA 3RT9A 4CKCB 5JNTA 3JS5A 4NU6A 1ZNYA 1XHEA 1C9JA 2BM8A 5AJXA 2EFHB 1CV2A 3I6YA 1KSGA 1Y1SA 2BAGA 4M0FA 4L0MA 1D1TA 1XAJA 3TQSA 1JU3A 2WIBA 4NFHA 4MDFA 2NP7A 3MHPA 3KJHA 4L51A 2DPLA 1RM3A 4NONA 3HZRA 3BZWA 4QTZA 3CEJA 4B4OA 4L9SA 5CUQA 4YEDA 1XEXA 2QY6A 4R1LA 3DKIA 1HQYE 4WY2A 4R7TA 3DE0X 1SUCA 3BA1A 2Y1LA 3FYUB 5F7OA 4DC9A 2ZJ6A 1QV9A 4MV8A 2FZVA 4C7XA 4CLDA 1TW3A 2D4HA 2IEAA 1MAWA 1ZCAA 1K89A 2Z5GA 3LL7A 5HFAA 2JAWA 3TIIA 3HZOA 1FNMA 1H1DA 3TRDA 5CJJA 1N0IA 3C5EA 2GWHA 4EHIA 4S1PA 3LDUA 1IN5A 4KXMA 3P32A 4LI3X 4O4HB 1YCFA 2Z8XA 3A2LA 1RXUA 3WK4A 3JZFA 3TS1A 4B74A 4ZFNA 1Z8HA 2BI4A 2XCTB 1K2WA 4WXPA 2V4UA 3ONVA 5FLXA 1G5FA 1BDIA 1NVVQ 2PH7A 3DOCA 4IQ8A 4Z5XA 5COBA 1CUYA 1QB7A 1HOXA 5K3SA 5GWXA 4EWLA 1CY7A 3KFXA 1XCJA 1JE0A 3UHJA 4LI0A 1MLDA 4D8UA 1AF4A 1SHJA 2I34A 4A0QA 4YNBA 2RGNA 4L16A 3T7EA 1JYSA 3P2JA 2CC2A 3QXHA 1AGPA 1YC5A 3U31A 4DARA 3CWQA 5EXDA 2XE7A 3V2IA 4JYPA 4DEYA 3EUWA 3SYNA 1FJGB 1GCIA 1U02A 2WJPA 3AVQA 3MTIA 4YCJA 1PL8A 2QP3A 3HWSA 1UPCA 3LLCA 3JX9A 2YNMC 2CBZA 3FM9A 3H0EA 3L4SO 2GZSA 2VS1A 3QMVA 4RV5A 4U7GA 4BQNA 3ZGNA 1ZZEA 2HF8A 3BC1A 3K15A 1UKAA 2FPIA 3TQIA 3UKDA 4Z86A 3WL7A 5IXJA 3DLAA 4LTDA 4NZ9A 3QU5A 4UNNA 2QTZA 3HYCA 1C0KA 1LDYA 2EZ9A 1Z35A 1UDRA 3CW8X 2DSNA 4E2XA 5C4GB 1ZPDA 3QLUC 2DWCA 4J94A 4X92A 5FBLB 3WHLA 1B0PA 1KSHA 1N0HA 2I2XB 4GR5A 2OXTA 3AIOA 3KOWA 2JANA 5LZ5A 2G77B 3HB7A 3M9LA 3HVJA 4HATA 2WKSA 3OCZA 1N3LA 1M1NA 4GX0A 4ZO4A 5TSDA 4DKXA 1UM9B 3DVLA 1TUEA 5HCNA 3V7FA 2GJ4A 3VNRA 2YQ5A 1DELA 2W70A 3E0XA 3FKJA 1ABBA 5JJKA 1G8YA 2NQTA 1C0LA 2W22A 1I6MA 2VPQA 3C1OA 5CGZA 4HLNA 5IYZA 2NIPA 5LMZA 5I7UA 1CBUA 2I76A 1GPLA 4JHLA 1OWOA 1QK3A 1QHGA 1A1SA 1UOOA 5CAEB 5BR7A 1SC3A 2GPNA 4YQEA 1PYDA 2G8NA 3ELYA 1IBRA 3L0DA 2XOEA 4Y2SA 3G2QA 2ZIGA 1EWTA 4TV9A 3A1VA 3QLVC 5IXSA 4QPZA 1X42A 1DS6A 5CRIA 3PFNA 4J0FA 4X8OA 1IUKA 2WMDA 5EPEA 1HDXA 4BNFA 2IHUA 1HE5A 4J0DA 1IN1A 2IEYA 4LZOA 1YDHA 2FZLA 3QX9A 5HGXA 2BGLA 3V33A 4BO5A 3IV9A 1N2EA 4KACA 2MSDB 1D2HA 5EZYA 4M8LA 1ULBA 1W4BA 2DTXA 2FMKA 1JT2A 3ESZA 5L4LA 3EH2A 2OM6A 1MBZA 1RMYA 1HDGO 5CBPA 3KLNA 5T64A 1K7XB 1WZCA 2UYYA 5ITWA 1R0LA 2X4LA 2ZXFA 3EDMA 3FGNA 2WC1A 3WB0A 4JI0B 4EI9A 2UVPB 3HJUA 3P8ZA 1R10A 3OU2A 2NNLD 2PBRA 1G8GA 1VRVA 1SU6A 4FFNA 5HEKA 2W6JA 2Z1NA 3LCCA 1A9QA 2ZRBA 4MVXA 3RNOA 1HFJA 3TM4A 4TLDA 5AUPB 5BMOA 1XAHA 2ZBRA 3EMBA 4WSOA 2HK9A 5KIAA 1ZN7A 3R7NA 5CCEA 3AKEA 4AF7A 4I4TF 3ZHYA 3N70A 2X0EA 3H5AA 4KDRA 2OFFA 4DUYB 2R48A 2XYHA 4R4JA 1GYRA 2IUTA 3HXOA 3UA3A 4OXQA 1GFZA 3E7WA 4GOJA 4QTTB 1HETA 3AJRA 3QG1A 4YP9A 1DEOA 1CDOA 1GAJA 2JCVA 4Q9LA 3T94A 1B6TA 2XTAA 3JQBC 4GWGA 2FE4A 4J03A 4WXEA 2B7BA 1BEZA 1RE1A 4IZHA 1NMEA 4E22A 4CLOA 1ID8A 4MI9A 1QR2A 4I4NA 4H7JA 3S44A 2I2BA 5EESA 3E8XA 3ZE7A 2OR3A 2DFDA 4S2EA 2FRXA 3OP4A 1VB5A 1K4MA 4RQUA 2IV7A 1GADO 2JF0A 3IAS6 3QFCA 2GNAA 4A8JB 2Z30A 3QWHA 1J1UA 3GGPA 3AGQA 1R8JA 2VOEA 3L8MA 4PSDA 4RHTA 5CFQA 1USVA 2QQGA 3F6SA 4EVSA 1WQ4A 2JIQA 4J6FA 5KI6A 1YQTA 2EW8A 3TTTA 2DCMA 4B3DA 4CKWB 2DJIA 2RH5A 3EIHA 1ZUIA 1Q0UA 2HMWA 2WM9B 2FPGB 1K8RA 2P5SA 4IJ6A 2PA3A 3UJNA 1TPZA 2DQYA 1O6BA 2Q5EA 1XOIA 1OWMA 2ROQA 2V58A 2KLHA 2W6JD 1JKJA 5TEWA 1APBA 2X4IA 1A2QA 1ML3A 2GHRA 3W4KA 5C0OE 1O0CA 1MGPA 1RWWA 3MVEA 3W4IA 3SVTA 1OYYA 2XJ4A 3LI2A 1QRSA 1OOEA 3PQ8A 4B2YA 2FVXA 3F5DA 2WWGA 3MJFA 4NX2A 4Q9DA 2CHEA 4B48A 4GPD1 3PSHA 3B6EA 1T24A 5CIQA 3PDCA 2H07A 3SY8A 4ED9A 1Y48E 3IEXA 1O7JA 2NUPB 1WLYA 1XTIA 3T7KA 5JROA 2C5LA 3S40A 2QGNA 1DKRA 3GEHA 1IVNA 3UWSA 2W98A 4PHFA 2QVXX 2V7XA 1IBSA 4RVFA 4WZBB 1JIJA 1I2ZA 2KI5A 3NTQA 3T5DA 4OBXA 2H5JA 2VHQA 3EZ9A 3HWWA 1CW2B 2JIMA 1RQRA 2QXTA 3ITNA 2LZ0A 3PC6A 4J3NA 3OQOA 4WKOA 1L4KA 3ORHA 3GELA 3Q1KA 1YZLA 2G76A 2QX9A 4PAGA 4XA8A 2P90A 2HPAA 3IBYA 4HFRA 3VBCA 3U17A 1K6IA 4JJGA 2VUUA 4GRAA 4X93A 1DIAA 5DN9A 5KSWB 2WU0A 4UU8A 1WTCA 3PDUA 3JQCA 5EKTA 2H5EA 5DHUA 3GNSA 4WECA 3TYXA 2HHJA 3AFGA 3HKBB 3T34A 4DEXA 2PJRA 3CH4B 4QOHA 1TYEB 1M5TA 1T0PA 3CSDA 4OKNA 2WJ3A 3MA0A 4OLJA 3OZFA 1KVTA 3WYNA 5EE5B 1P7VA 3GDHA 1WW8A 2JFUA 3L40A 4HQ6A 1DIBA 1DRVA 4O2AA 2PMBA 2R79A 2QVYX 3RC8A 1U0GA 4F3KA 2GK6A 5CTAA 3QVJA 4YASA 1XP8A 2BC9A 4I99A 1UFKA 5ELLA 3WOHA 4B3CA 3R7BA 2ZYIA 3DLTA 1R0XA 1DKNA 3K0CA 4IIHA 1EDZA 4K9MA 1D2NA 4X3CA 2R6DA 1VIMA 3BREA 3D7MA 4LYEA 4D80A 2O8EB 3DMHA 3OE7A 3UFXA 3WFZA 5TF0A 3D81A 3KJGA 1E2LA 5BOSB 3IP9A 3P9RA 1Z08A 1GCOA 3WBKA 1FLDA 1IM2A 4WE3A 1QIDA 3AKDA 2OUIA 3FUCA 4L78A 4Z4FA 1C9DB 5IJXA 1RXYA 2HB6A 2VHJA 3RFUA 4YT8A 4OKSA 2AVNA 2QE7D 2H7CA 4JT9A 3K53A 4KI0A 1NA5A 2Q6OA 1GPDG 4YROA 4K46A 4ZV7A 1M5RA 3DXXA 4BNLA 2BFPA 4IJQA 4AKGA 3CVUA 2YQZA 5SZKB 4P4GA 3OFNA 1W1IA 1RP7A 3IP6A 2ZROA 4ZRDA 3L8YA 3R7AA 3R9KA 4NFYA 3H3JA 2O1EA 3RBXA 5LNK1 1Q14A 3QUBA 1R4NA 5A0FA 2ZQYA 3I12A 4OUDB 2P9TA 4CEJA 2ET6A 4PU0A 3B5IA 1Z0UA 2QN7A 4LXQA 4C78A 1E3IA 3VPBA 3I28A 1AV6A 5LJIA 1T0HB 3CLUD 4BO9A 3ZWKA 5B4VA 3F46A 4AZ0A 2B8JA 2W6OA 1NR5A 2OQ2A 1KEKA 1MPXA 4N3AA 5ALMA 1PWHA 2XRFA 1Z28A 2Q62A 4MWSA 1ONOA 1L9XA 1EXNA 1ZR2A 2WZDA 1PUXA 2UZ1B 2XRMA 5TT1A 3SF8B 1QYWA 4Y2TA 5H68A 5J63A 3UICA 5D84A 1CULC 5IKPA 3WIBA 3L4JA 3GN1A 5DYYA 2RI6A 4H4DA 1U2ZA 3EPLA 1QU3A 3UHAA 2FEKA 4CV3A 3QNMA 2P6OA 4AZTA 3NTVA 1UK6A 1Q83A 4ND7A 3LCUA 3EPHA 3V1NA 2F6RA 2A9RA 1KVQA 3HCBA 1XTSA 2D5BA 1KZYC 3VYUB 3O8OB 2FJUA 3LT5A 2BSQA 2QDKA 1XFAA 5HVNA 4HB2A 2RHTA 3QX8A 4JLBA 1ULHA 4ZYUA 2GPWA 1ODKA 4DT1A 1H3NA 4I08A 4R1QA 3DZJA 3FPFA 4NPAA 1RRFA 2D0IA 1GG2A 3L4EA 1FSPA 2IC5A 1FDVA 4I46A 7REQA 3UAVA 3TN7A 3AVOA 2IYOA 1ECJA 3V4SA 3WQBA 2AG5A 4MS1A 1NNI1 4JUBA 1UBKS 4NY1A 2CL6X 1PR3A 1QPGA 4B7AA 1ZKMA 2VUTA 4URXR 3F8SA 4AQ7A 2IKQA 2C5EA 4IH4A 4UHKA 5A1JA 1NOKA 1R50A 2IS2A 4G41A 4OB8A 4X41A 2Y3IA 1UM8A 1P1JA 1XZFA 2DBQA 3DE1X 3PEFA 3EUAA 3R44A 4QYTA 2ZB7A 4I8IA 3TJZA 5CVUA 1NBEA 5CFRA 1EVJA 5T41A 1ZNXA 4ZCLA 3GY0A 3IUEA 1I9GA 4ESVA 2B3TA 2P11A 3BD8A 3TEFA 3OEHD 1MUUA 3G8DA 1V2HE 2DFKB 1NXPA 4ZI7B 1G8HA 5FBWB 1WEKA 1IJFA 2H5LA 4PAMA 3WB2A 2FW9A 4L4ZA 1AXGA 5K0GA 4CFYA 4HPWA 5AUNB 4QD3A 1Z4PX 4IJ5A 1E1DA 2JDID 3PKZA 4XQ9A 1VLMA 3ZBQA 2WIAA 4ZKEA 3X2FA 4DIUA 4B6FA 3DULA 2J30A 4DTCA 4LZAA 3O82A 3AM3A 1SEPA 4HYEA 4M9QA 2PGLA 3PJDA 1R1DA 4O3MA 3OLQA 3LOUA 4KCGA 5ALZA 5ES3A 5TJHA 3UJ8A 5KS2A 5ISMA 2XPCA 4WA8A 1ZISA 1LB1B 1CF9A 1T2FA 2A5YB 2YRWA 3M89A 5KYWB 2J3QA 3PNPA 4PAQA 3GHHA 4V38A 3LUJA 1WL8A 1ZS9A 4KAJA 1GNLA 4PYQA 1YI0A 1Z36A 1BU5A 4GNRA 2OPBA 4CNBA 2CUTA 1T1GA 1RAFA 3L7MA 1KO8A 3LM8A 3MT9A 4NAHA 3WIVA 3DM9B 3UA4A 3ETLA 3ZGZA 2ZUSA 1TEVA 3GUCA 2GYVA 3K9CA 4LCJA 1LW7A 4BAZA 2OQIA 1B76A 1ESMA 1GPWB 1PJ8A 4I14A 4RCYA 4Q3LA 1QG4A 2BRUA 4HGYA 3C4QA 1NP6A 3RVSA 2KMLA 4KHZA 3TLKA 3AVVA 2IOYA 1NE2A 3FXAA 3HKCB 3O2SB 1C1HA 2OFPA 4H3KB 2A8YA 2PRZA 1P1CA 4MULA 4EZEA 2JEOA 1EWKA 2I1VB 5FH9A 4DE5A 3PNSA 2OLJA 5MF6A 4H7HA 3ZYCA 3FMGA 1VMEA 3B2NA 4NYIQ 5DEIA 1TMGE 1X1QA 3I4FA 2DT5A 3WZ2A 5JXHA 1N92A 1PP4A 3PHIA 4PHGA 5K99A 1M5UA 2GK3A 1R2QA 1W2WB 2VRNA 4KXXA 4CW7A 3AVWA 2QK4A 1OE0A 3UUFA 1QVAA 4F2DA 5K05A 2VRWA 3W2TA 5K4HA 1BWPA 1T3TA 4RZQA 5BSRA 4EKGA 4FFMA 1P72A 3OLXA 1V4NA 1JU4A 3DTVB 2C1ZA 4MKIA 3Q87B 1ZH2A 2AFHA 3F7NA 2Q3MA 4DLAA 1RADA 3O9VA 4OXNA 4TZKA 5CK5A 3COWA 3HA2A 1RRCA 1T4CB 2EX0A 1V8ZA 3ANTA 3LY5A 2GB4A 4YHBA 4E32A 3VKGA 4DWWA 1XC7A 1XZJA 2GKOA 4JODA 3RBVA 3W6NA 1U2GA 2PXHA 4TTSA 5COAA 3V97A 4LIPD 1GSOA 5TF4A 2H29A 3F4KA 4DSTA 1SOAA 2IIBA 3DXFA 2RGYA 3L41A 1D0SA 4K9KA 1O2DA 4UKDA 4C14A 3OD5A 2Q0QA 3KVYA 1VIAA 3PVSA 4I4IA 2RKOA 4MSUA 4LOJA 1I8TA 5HM8A 1U7TA 4J0HA 4XASA 4F12A 2HPVA 5ECGC 1UMKA 1H2AS 1KHHA 2FLVA 3CJQA 3EXHA 4K9NA 3HCCA 1OXUA 4Q9IA 5FPPA 3ZD7A 3QE4A 3L7OA 5LP6F 3BRWA 3RFXA 3ZIAD 4NBTA 3ZJVA 1N6KA 2HCFA 3L7IA 3ZE9A 4ESEA 1ZHHA 2DXIA 4D5GA 1NW3A 3OUZA 4KQCA 3WR5A 1YB4A 4YRMA 1Z26A 3AVPA 2I3BA 3IT2A 3HM2A 4RGQA 4EZIA 2QI9F 3KHTA 2ES4A 3ZW9A 4I55F 4XWWA 3RYFA 3WAKA 2XODA 3QVSA 2IUUA 3MXTA 4L0QA 2XQFA 5ER9A 3G9ZA 1XDZA 4FFWA 2C84A 3RS2A 4LWPA 4JLAA 4E70A 2FXIA 1ZUHA 3AHIA 4QGFA 3K2BA 4NFLA 3RS0A 1T6YA 1NQVA 4RY2A 3I0ZA 4FSDA 1GRNA 3Q2OA 1N4AA 1KNXA 2ZJ5A 3H7IA 2WPNA 3C87A 4NE2A 4DKJA 3WJ2A 1JG1A 1YT5A 4IHJB 4KE7A 2H0QA 2P2YA 1CUSA 3JVEA 3MJTA 4LXXA 1FMFA 1KBOA 5D3QA 3JQ7A 4Q15A 1YTLA 4BB9A 1J23A 1NTOA 2QRKA 1Z83A 3LQYA 1DMSA 2O2JA 3L01A 4OHRA 3CEHA 2VF5X 4BJ5A 3PWKA 5CX1A 4UTXA 2KSQA 3H9CA 1ZD8A 4PCAA 3AILA 1YS1X 3EGXB 4F1KA 1OY1A 4GOKA 5FBVB 4D4MA 3AKZA 2AEEA 2CHFA 4MJXA 1KFEB 4CV2A 5JSUA 4LYDA 1KAMA 5DV9A 5KTYA 2P6RA 1QRTA 1P7YA 1CHNA 3FA2A 2HU7A 4H3SA 5H59A 5JE8A 3AR9A 1GQFA 3JASA 3AH8A 2EC5A 3TLCA 4AIRA 4UOQA 2K7FA 2JI8A 1UBHS 1ZUNB 2PYIA 2YHIA 3CURA 2JJ1D 1MVNA 4HEHA 2QTFA 4JLKA 1RBYA 4FNGA 1JPUA 1POWA 2DBZA 1EK2A 4MQEA 4QU5A 4XIJA 4DSOA 1OLSA 2Y27A 3DQPA 4F1JA 1U0EA 1JSLA 1S2OA 2R87A 3EVAA 6CHYA 3COJA 1Y80A 3M1IA 2ASEA 3LK7A 4JYBA 1U8FO 1I14A 4DSZA 5KOYA 1Z0FA 5DBOA 2ECPA 2VP2A 3Q1LA 1U3VA 1FRQA 1VYTA 4TYYA 2WF8A 4HAYA 1EA7A 2OKGA 3LOQA 2Q3DA 5ENZA 2FQQA 3WWYA 1BS9A 1PS9A 1FYEA 2R7KA 1H3FA 3MCUA 3MTAA 3OIUA 5CR9A 1SB8A 4ZCQA 1AKRA 1FX1A 1TJPB 2CFSA 4Q7LA 3O1JC 1TFUA 3WGIA 2B98A 3QKRB 1NSFA 4PPFA 1CLUA 4JOBA 1U8TA 4DR4B 1BX3A 2APJA 1Z0JA 5DMHA 1LV7A 1C8VB 2AC2A 4MWBA 2OD7A 5TPWA 4YXWD 5K0JA 1HTTA 2A30A 2B7CA 4R9RA 1XYVA 3HJFA 3BXHA 3VGJA 1PFGA 3ZNNA 3D6UA 4UBNA 1JB1A 2OQVA 1A2KC 5BRNA 5FJJA 4YMUA 5DI3B 3G5UA 5CDSA 4LRWA 5ADUS 5JT1A 1G4AE 1WKVA 3RLFA 1Z2CA 4ESOA 3ZH9B 5FULA 2VBGA 5KSPA 5TV2A 3B5JA 3UMRA 2XVZA 4BWYA 4Z9BA 3RRJA 4B1FA 3VNVA 3CXRA 4Y1RA 2VQ3A 1NJ6A 5C1IA 5IRCD 1SUSA 5CIWA 7YASA 3E3LA 3DEJA 3H04A 1PX0A 3V7WA 2XVMA 4XDYA 4PAWA 1HYEA 2ZLBA 3VSCA 4G0MA 3VOBA 2Z2YA 2FUG1 1K6MA 4Y30A 1UJ6A 1PL7A 3HS3A 3E82A 4I5GA 4ACBA 1N77A 1NJ8A 1CDZA 1C9KA 5FL3A 3MCTA 4K40A 4EKYA 4Z49A 1KI1A 4BJ6A 1GZ7A 4GFDA 4Q1VA 2Q5OA 2L69A 2Q4DA 1DJQA 3FROA 4HWOA 5HMLA 5J43A 1EI9A 1PFQA 2M2IA 3BBLA 3CLKA 3TIGA 1J0DA 3DEZA 5K1ZA 1HYBA 4LDQA 2I62A 3ZJTA 3AGPA 3TSAA 2C8LA 4TN5A 2AHOA 4CM7A 1KQGA 2NUTA 3OCXA 4DDTA 4YQFA 4KIFA 3RG2A 2VDUE 1HEYA 2P0EA 1P0MA 1T9DA 2WD7A 3BWCA 4M1YA 1CQZA 1CIPA 3ZI7A 3SE0A 5KYVA 5FPKA 1W36B 5HXAA 1SU7A 2CK3A 3OLCX 1ZR4A 1FY2A 4TQ9A 5AESA 2WJ6A 1VSUA 2V7QA 3NBXX 3VTFA 1NN5A 2VZ8A 4H0NA 3Q8KA 1V47A 4RLSA 3WP1B 2J3HA 3SJUA 4P2GA 2ERCA 1BG6A 2P67A 3AV3A 4Q4AA 3FFBA 5DTRA 3RIEA 1QLHA 2OCDA 3ZHUA 3Q5EA 2FJ0A 1KI3A 1JVBA 3SU8A 3PV0A 1HNXB 4PCLA 4FE3A 3A1DA 3F47A 3EEIA 2O14A 2J0UA 2Q50A 3EVTA 1NXXA 3WWEA 4UASA 2AJTA 3MMXA 4P4SB 3BL6A 4HXEB 2H51A 1AHNA 4EYOA 5KYGA 1M7BA 4B45A 1XLVA 1RJEA 1Z7GA 1DGQA 3R7SA 1G66A 1W1UA 3KJZA 5DLDA 4ZT6A 5FPYA 2C58A 4PLFA 1Y7HA 3U4CA 1RC0A 1Z12A 4PGFA 5JLAA 1V1JA 4ZDWA 2WMYA 3IV7A 2RHGB 4NNJA 2IHNA 4IRMA 1I7PA 1L7DA 4M1SA 3IB6A 2X9VA 2HUNA 2VDQB 5K6RA 4DJFC 1BSVA 1VM6A 2PZMA 1AH2A 3S2YA 2GQ0A 5BVHB 1Y4AE 5DULA 3BYZA 2ST1A 1V95A 1Y8QB 3OCJA 3MRVA 1H6AA 4FINA 1Z7YA 4KNYA 3IKJA 3KYCB 1X80B 4G81A 1WOYA 4ZVUA 1XZQA 3JQGA 2GT1A 4NDZA 4EQ6B 3URMA 1N9KA 1B42A 1ZH8A 1NUUA 3DBHA 2R8OA 1OXTA 1UBJS 1YU9A 4IW3B 3K35A 4GPEA 3H9UA 2YWXA 3FYDA 3RRNA 2X2OA 3C4VA 3KPJA 1LRLA 1V41E 1ZU5A 3KYDA 4BBAA 2QQ0A 4CL3A 2NXWA 2C9BA 1F0NA 4C4OA 5HQ3A 1HYQA 2IYYA 1JRLA 1YRHA 2X9GA 3MW8A 1P2FA 4WTOA 1OBHA 3CH7A 4XX1A 1UBFA 3H3XA 5CGQB 5H80A 1MOQA 1G1AA 2IZOA 2OORA 2WKQA 2WTXA 4G07A 2BF7A 4N3NA 3WE7A 1ODFA 4W1SA 4M7OA 1Z15A 1AVTA 3VA7A 2FWPA 2VHVA 5AOAA 4B4VA 4K9LA 1PFVA 4GAEA 3VPXA 3ZZ1A 4CKXA 4DBLC 3ZNQA 4OJTA 3PHLA 5C7IO 2R9VA 5AJZA 3TB6A 1ULAA 1G3MA 2IYQA 2E4UA 1F8UA 1FC0A 2ZI3A 4P5EA 2NU8A 5L8VA 4JC0A 3CO0S 5A02A 3IDOA 1EVLA 2R1TA 3IQZA 3P4XA 2C0QA 4V1CI 1ZA1A 2AK2A 4KLRA 4UARA 4QJ3A 1YL5A 5JSZB 3IGFA 4QRIA 4DBVO 1ODCA 3JQFA 2VWGA 1JR3A 4LSZA 4QA9A 4TXMA 2JBHA 2QMHA 1P29A 5TMDA 5A3QA 2HSDA 3LX8A 1XD8A 1ZJ6A 4HAUA 5EZYF 4OU5A 3K8ZA 2GA8A 3N2EA 4JI5B 5FV4A 5B64A 5KNLA 3QU4A 1V16B 1GU1A 1F6WA 3E5NA 3UPDA 2TMYA 1RWKA 4FJ0A 3W8DA 2HADA 4OFBA 5DM70 4FMDB 3DFMA 1MFPA 3G88A 4AQDA 4CLRA 4MW7A 2GUGA 4IIEA 4G0NA 5A4IS 5BSFA 1JFSA 3RJ9A 2IUYA 4V1CA 2NAPA 2P79A 1DAMA 4NMHA 1XALA 1RS0A 4PYOA 4E5KA 2BMAA 4QFCA 4AUKA 4IYRA 4D9MA 3HN2A 3IT0A 3FNIA 1WA5A 4C5AA 1PZGA 5A3VA 4MUJA 6REQA 2QLTA 1HQKA 4LRTB 1CUGA 3ZNPA 2AW3A 2WINI 2FZ4A 5G53C 1KEVA 3D2BA 1GZDA 1LVGA 4YJ2A 3KWLA 1V9SA 3IIJA 1QDLB 2Y0DA 1C0EA 1QLJA 1ACMA 1JEDA 2Y2VA 4N5DA 2X5XA 4MRAA 5AT1A 3ZOKA 4HXFB 5LLDA 2RE8A 1IVSA 3OZWA 1WUIS 4PYIA 4HJXA 4OIMA 2H00A 4WY5A 3KE8A 3RKRA 3BPSA 2M6SA 2PBLA 4HNQA 2B9VA 1T34A 3R77A 2VWQA 3KQYA 4B6PA 2DYKA 5MDHA 2WOOA 5F4ZA 1VKRA 2IA5A 4LJ7A 2V9PA 1NQUA 4DPKA 5T4HA 4BJ1A 2YXEA 4LQCA 3NMUF 3F97A 4KXVA 4A27A 3G2HA 3OKFA 4EZBA 4FEYA 7ABPA 4DTIA 5C3MA 3KZVA 4G1CA 1X7WB 4L8YA 3BSFA 3FPLA 3GFSA 4GLBA 3N59A 4MYSA 1K75A 4TKVB 5CX4A 1NUQA 3WGTA 2AFRA 5IK2A 3LKBA 4TLMB 1ZCZA 1BXRB 1T2CA 3DR5A 4W1RA 4N7RA 1P73A 3ZE8A 1JYFA 1YDEA 1QTQA 4UUMA 4X63A 4YRPA 3Q0TA 2RD2A 1V3UA 1PR0A 1EFCA 1P91A 5FEUA 4DBLE 4WNCA 1WCIA 1SOMA 4B3XA 4AKSA 2AG1A 4BV9A 1YD7A 4HB4A 4LY0A 4HP8A 1DE0A 2BCJQ 3QOFA 1OLUA 3HXPA 4WDQA 4TROA 3Q12A 4BY9E 2UZ4A 4YO7A 3E9RA 4RD2A 2C3YA 3MCAA 4XD2A 3IP8A 5B2FA 1XTJA 1DDIA 4NWIA 1GLGA 3O8NA 5CYPA 1U5BB 3OX2A 1K0FA 1P3DA 3KPYA 4AVYA 4DZTA 2NQ2C 4URWR 2JJYA 2XNKA 4XLLA 1Y9DA 3PGA1 1MRZA 2ABWA 3E81A 1XA0A 4GZ5A 5EHQA 1L5NA 4RQAA 2AV6A 1GZHB 1LTHR 1R5NA 3RC7A 1KFCB 1Q1NA 2MINA 2W6QA 4R5MA 2FG5A 4MKZA 5DOVA 4LN1A 4MS3B 3GT0A 5AHOA 1YNOA 4KQ6A 4O59O 4ZT7A 3RHTA 1JIVA 1Y7LA 2SBTA 1MD9A 2RHLA 1C9NA 3B8EA 3OWXA 3TL6A 2CNWD 1GO2A 2QW8A 3DHVA 5IK2D 1WR8A 3UV6A 5DB4A 4WHMA 4KQ1A 1RVV1 2BFOA 1A9OA 4ZJYA 3EIWA 1SD1A 2FOXA 1E6EA 2PV0A 3I37X 1YJBA 1X1DA 1EGAA 4KKVA 3RYTC 4EY3A 2RGBA 5DZSA 3TI7A 1KS9A 2QN6A 2XA2A 3SEQA 3TMAA 2H3HA 1O4VA 4G4SO 2QJTA 3ROPA 1LDNA 2CXQA 5JPIA 3RVBA 1QQAA 1P0QA 3DLBA 1ECGA 2CSXA 1E3EA 4BNDB 3DGFC 1WSAA 3LT0A 3TSYA 2AC7A 1IZZA 4G25A 1TZKA 4YRBA 2HPHA 2Z8ZA 5EJMA 5DT9A 1Z8NA 5KYYA 4AG6A 5DI9A 3RJZA 3KPVA 2JI4A 1FSSA 4L72A 4PXSA 1HYGA 1JSCA 3LG2A 5PNTA 4PFKA 5I9NA 2C5FA 1YR9A 3RYCA 2VUIB 5A5FA 3DD5A 1JJIA 2JJ2A 4QGHA 3WGNA 9ABPA 1OA0A 1YFJA 3RAEC 4HMOA 1YBVA 2B6NA 4RKFA 1VKJA 2PQ2A 1TAUA 5FNVA 1J0CA 4PGGA 4MW9A 1EVIA 2P9GA 3EDYA 3C3EA 2WLSA 2TECE 4DN6A 3ZG6A 3TECE 1YA6A 1N5OX 2O0JA 5EMLA 3UIEA 2XWSA 2LPMA 5HHTA 3EG5A 3R6WA 4WCDA 3GJQA 4A9AA 1GTG1 1B1CA 1U1IA 1OLXA 1XLUA 2QNBA 2LUOA 1OHHA 1T8SA 5JC1A 3VC1A 2ZFUA 2ZSHA 4UM9D 4PBSA 3TE6A 2FWNA 3SIWA 3NTRA 4NC9A 4QWMA 2W2LD 3K30A 1Q7GA 1I0ZA 1PR4A 5JAMA 4MIEA 3H5IA 5FBKA 2Q5CA 5LIPA 3CW9A 3ZZTA 3KFLA 4LGYA 1F4PA 1M33A 3P9SA 1NM5A 3SX2A 5ECDA 1G7RA 3U4IA 2B0CA 3PVCA 1EM8B 2O2XA 3O9MA 4AULA 4HK4A 3JQAD 2ZTUA 1VGVA 4MR7A 2K2QB 4Z7JA 1RXCA 4P1ZA 3AP1A 4B83A 4DJ5X 5JY1A 4QQ8A 1ADCA 4KO3S 4KQXA 4CDRA 1G4HA 1IZ9A 2VLBA 2H1IA 3OEWA 3IIEA 3GUVA 2JJ2D 4BU1A 4J0KA 1X7YA 3HP4A 4Y6PA 1D5WA 1RDFA 2PWYA 2DKOA 2XAAA 2FQWA 3QKSA 2ECOA 5K01A 1R9NA 1LI4A 4HJRA 1C7ZA 2G06A 3IHLA 4PLYA 4XWTA 2ERXA 4A10A 3N6VA 4D02A 3IP1A 5GINE 3WLMA 2HXYA 3K0CC 3NKVA 1F4VA 3CINA 4RBNA 4A92A 3IL2A 3LC1O 3HVIA 1K86A 2ZBPA 1JE1A 1TC1A 4XTRA 1OHHD 1MB0A 2XDQB 4G85A 2V74B 4YAOA 4TXHA 4DMHA 1L4LA 1WXHA 4LRXA 2VF4X 1UIRA 1IOLA 1E62A 1T8TA 1LJ8A 1EAYA 4OI0A 2ZIVB 3K1YA 4AKIA 4LNHA 4DVJA 1GITA 3TXYA 1E9EA 3AESB 3HHEA 1XJ5A 3H18A 1RRKA 5F52A 3A28A 1XRRA 2G5PA 1ZOIA 1YVRA 2WM2A 4K9PA 1X15A 2WT4A 3GJ5A 3LVFO 4JITA 4BTVA 2CL0X 1YXMA 1PZMA 1TF7A 4CR8A 1S1MA 3H2JA 2JGFA 1ABEA 4JBYA 1WV0A 3OBIA 1V11A 1E98A 1J5PA 3ETEA 4C4RA 4JI8B 2NSDA 1E2UA 3CWCA 3ME5A 4KPUA 1BCRA 3JATB 3BMOB 5TGTA 2J6CA 3CX3A 4PGHA 3T52A 1Y4DE 1Z6AA 1I36A 2BTOA 2JH3A 4NU5A 2VTBB 4H1UA 1R0KA 1TUBB 1IN8A 1ZWLA 2B1RA 3DTYA 3PQDA 3V4OA 1CNFA 1IY1A 3NTXA 2WJ4A 1VXRA 4G1EB 2J3DA 4RMNA 1QGAA 2ONZA 1SUBA 3GOQA 3MBOA 2BWJA 5AVTA 3M1LA 2Q9AA 5A5EA 2BFAA 2NZVG 1JHQA 3EC1A 4G1BA 4M6WA 4E21A 2GCOA 3PNQA 1ZFNA 1QK5A 4P4TA 1MH1A 3N58A 3TVTA 4D8TA 4H7EA 5ALRA 3E9NA 4PYKA 5BT8A 2GBIA 4OJNA 2FKNA 2AC4A 3H5OA 5AJTA 4CVNA 4B3RB 4X7MA 4PZEA 4TVOA 5CFZA 3IR6A 2H0RA 2PT9A 2KLBA 2O1XA 1X70A 4KSYA 4E7OA 2VA9A 1ISPA 3R41A 3NHLA 1C80A 1BE1A 1LY1A 4JJ4A 2X5JO 1E60A 5AW4A 4FYJA 4CUKA 2R1VB 1BXZA 2OPHA 4EH1A 1NLUA 3ODGA 2NWQA 5DDIP 3REOA 1KU0A 1LF5A 1B0ZA 1TVCA 2GM9A 4LY6A 1CB0A 1Q6YA 2F8MA 4BMVA 4UZFA 5E9WA 1YMQA 2W6MA 1CJKC 4YCLA 3FETA 4HEA6 5TLSA 1KVRA 4FW8A 5KNBA 1Y98A 3TAUA 3KX2A 2XYGA 1E58A 1GFSA 1JF8A 4JBXA 2IPAB 2RC6A 3NWPA 3H42B 2VJBA 4LCEA 3H11B 3N2GB 2BFDA 3I6MA 4IY1A 1VCOA 1J24A 4XRRA 4I4TB 3GFGA 3SSNA 3U9TA 1MZPA 2VPZA 4DXAA 2Y8EA 1EFAA 4P0TA 2GJAA 1ZRNA 1F1BA 1UFOA 3RK1A 1HFEL 2CXRA 2J7PA 2ZRNA 3IDZA 4GMDA 2WJWA 4QDOA 5IN4A 4FLFA 2PLRA 2W5UA 4ALIA 1XVIA 4BZQA 4WNYA 1Q0RA 1YBAA 3N2ZB 1DV2A 5EL0A 3TTYA 1IONA 2AG0A 3WDMA 4YT2A 1XEFA 3D8UA 3MTBA 1XZIA 4GQAA 2X0KA 5DO9A 1ISGA 5CXXA 3BZBA 5EGSA 3UAGA 1E3WA 4TL8A 1SHZA 4B34A 4RKRA 2G8LA 4HWGA 3BXFA 3V55A 4UM7A 5A71A 2X7HA 1W2GA 2DQ4A 2ZRCA 2ZS9A 1MX9A 2GRAA 2ZRJA 3A32A 4KMSA 3HL4A 2BF4A 3K1JA 3H6HA 3M83A 3BTOA 4PLPA 2F3RA 4JMLA 1H2ZA 1UEXC 2CVFA 4GQIA 4OH1A 4TOIA 4ZT3A 1YB7A 1KEZA 4JOCA 3TZCA 1D04A 3EE6A 1FVXA 1HNWB 1W8IA 3FCOA 3DB1A 4DA0A 4HVCA 2D2FA 3BJIC 5KNBD 2DBRA 1K5GA 1RQ7A 1W6UA 4F46A 3SR3A 1QF6A 4HV4A 3WLOA 4W7IA 4KQEA 1GZ3A 5LOVA 4AMYA 3ABOB 4EHNA 5IWCA 4CUZA 1MOSA 3BVPA 3ZV4A 3MJEA 4ARAA 2FFBA 2QBYB 1LW6E 3DLHA 4KUEA 3HY3A 2J5KA 1ZEJA 1JDJA 1R74A 1G3IA 4IXDA 1EVEA 3NUZA 3PRJA 2D2VA 2BRUC 2D2EA 4HAVA 3FHLA 3OPYI 4NK4A 3SHOA 1Z63A 1SIBE 4BHTA 4EFDA 3FAZA 3P26A 3ROQA 3B1XA 2AMVA 3PITA 4UCXA 1WQ1R 4AYWA 4CBVA 5JI3E 3DNPA 1KAEA 1LI5A 3TSOA 3V9AA 2C1XA 2VOJA 5KX5F 1BTOA 4HGNA 5FOSA 1VBNA 3BFXA 3LZ6A 3TBFA 3N6XA 1U9IA 5AOCA 5ER6A 1L0BA 4LHYA 2CLOB 3URKA 1S7CA 3DWIA 3VHRA 3A36A 4F3CA 3OLYA 3T7IA 4P35A 5KYXA 2YICA 3NJ4A 5IAJA 4QG3A 1NUPA 4OYRA 3SHVA 4D9BA 1AQ6A 1OFUX 2ZSIA 3A4MA 3CLVA 1BS1A 4BFZA 5JXGA 3KTFA 1T5LA 2P77A 2YZ2A 1AMNA 3CB2A 4YONB 4GUAA 3W8EA 3U4MA 3WDKA 5IULC 3CZ5A 3NHBA 4L1KA 4P98A 4O4JF 2QN8A 2NV0A 5EQDA 5B3AA 1YMVA 2F90A 4RCZA 1U99A 3E9DA 4HB3A 3OTGA 1ZKDA 4P84A 4R8SA 3AVYA 2ORVA 1OF1A 5UKDA 3M1YA 3NT4A 3OZGA 3GLHE 3VR3A 2XWBF 3WX0A 5IWAB 2GEKA 2JEZA 1KO5A 1WIWA 3NNDA 4U2EA 4HGPA 4W6QA 3OQPA 3M6VA 3LY9A 3ICPA 4UJ5A 3G9XA 1T5HX 5TEVA 2XZDA 1MVOA 4RS4A 3LA6A 4I9NA 3ROXA 1DL5A 5HUJA 4MQMA 2RK3A 2UXCB 5H9WA 5FOTA 3C3DA 3PL1A 1NRXA 1T8YA 3LV8A 4KMRA 2X0NA 1G6HA 3OAAA 1F0PA 1B8NA 2ASVA 4NYMR 1M73E 5MFPA 1GGEA 2HCBA 3M5WA 3EXHC 4YLGA 5JRZA 2JGKA 2P4HX 1UQUA 4UNRA 1DKUA 5C46F 2HWUA 5C5CA 2JK0A 3TVYA 3U3OA 5C3UA 2GBFA 2IUSA 1E64A 3K5IA 4J3JA 5KWJA 4LX8A 3GDFA 4INPA 5EJ5A 3FOAA 2C07A 2OA0A 4FWIB 2JLUA 2YMPA 5EPUA 5JAUA 3U5ZB 3IR7A 4ND8B 5CB0A 3LYHA 1UKVY 4JOQA 4I2NA 2IGBA 1LEHA 2J08A 5FEMA 2A6PA 3H4MA 5K8LA 1P75A 3CR3C 2F43A 4RSMA 3TR6A 2J9ZB 3PPIA 3OCVA 1Q0SA 2G88A 4D9CA 1EFPA 2H8KA 3GX1A 2Q27A 2AUTA 3G7UA 1D6NA 3LQ1A 3GA0A 3QPUA 3S2ZA 4BMPB 4R71A 5HKKA 3EC7A 2QPLA 1ZGGA 3QVUA 4D82A 1NVGA 1DX6A 3AEKA 4NLLA 3SBEA 4DILA 3WMGA 3KE9A 1U0BB 2FEAA 1NV9A 1FMCA 2AMYA 2ZRDA 3AUYA 1Y9AA 1U2QA 3BXPA 3FCEA 1KH2A 1W0KA 2VEOA 3VAAA 1DCFA 2ZCJA 3SX4A 3C6ZA 3RVLA 1GEGA 2OAQ1 4LXTA 3OX4A 2CVQA 4YFYA 5E8RA 4B2LA 5LMCA 2P6PA 3TQTA 2FN8A 3K4QA 1XMJA 2NZ2A 5FTJA 4ENPA 3EY4A 2P41A 3I9V1 3T1NA 3CVYA 3SLRA 5KOIA 4EVIA 1C7QA 5EIFA 3ZXYA 3F2IA 2IKSA 3OOHA 2AFHE 2BH9A 1FW8A 3DBLB 3CISA 4PNZA 4HT3B 3IQFA 2OGZA 4PX9A 4YMSA 1E8NA 2XXAB 3W79A 1MZVA 1BE8A 5LQMA 1IOVA 4MVWA 5EQJB 1ZRSA 1N2OA 5HMMA 2ZRGA 3ISTA 1BH6A 2C2MA 2QTWB 2C7OA 5B7PA 3FCAA 2I6QA 2BZSA 2F9FA 1YA8A 1YCDA 4JIGA 1WXXA 4C4TA 5EEGA 1BS2A 1QX4A 1N25A 1LBQA 1SZJG 1L5RA 5IM5A 4ZARA 3WSVA 4EG3A 3NQ41 4HH4A 4HNGA 1GNQA 4N7BA 5DSXA 1W25A 1JEEA 3T41A 1EBBA 2UUAB 4YHHB 4W9RA 5I7FA 1GTMA 2G09A 4NZZA 2Q4RA 4Z3OA 1J8FA 2HSGA 2RHCA 1PJAA 4KTTE 3IOMA 4MRMA 2KS6A 5TS2A 1XJCA 4XDZA 1HPLA 1C1YA 1UANA 1EVYA 2ON6A 3TRFA 2C88A 1G6Q1 1NMSA 2B6HA 1M8PA 3P45A 4FE7A 4EPWA 2X0RA 1YRBA 4CM1A 1JBKA 1RM0A 1ZK0A 3R40A 4WN9A 4Q9NA 3RSHA 5K3EA 1AZTA 3C3KA 4ZYLA 2R6HA 4DDVA 5JZSA 4MGKR 3LT4A 1YTUA 4ZHSA 2VRBA 3DEHA 4WNAA 4CN9A 3EFOB 4LMBA 5G1PA 4P3PA 3H8SA 3OMWA 3PGXA