3ROFA

Crystal structure of the s. aureus protein tyrosine phosphatase ptpa
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
158
Chain Sequence
AYFQGMVDVAFVCLGNICRSPMAEAIMRQRLKDRNIHDIKVHSRGTGSWNLGEPPHEGTQKILNKHNIPFDGMISELFEATDDFDYIVAMDQSNVDNIKSINPNLKGQLFKLLEFSNMEESDVPDPYYTNNFEGVYDMVLSSCDNLIDYIVKDANLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight protein-tyrosine-phosphatase ptpA
publication title Structure and substrate recognition of the Staphylococcus aureus protein tyrosine phosphatase PtpA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 51
structure length 158
sequence length 158
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rofA00
3QX9A 3C3KA 3CLKA 5CNMA 4G86A 1Z2EA 3N8IA 3LUFA 2FVYA 1U2QA 3DLBA 1ZHHA 5C5EA 3UKJA 1A04A 2RDMA 5EWJB 4JP1A 2CHFA 1ZDMA 3HCWA 3QEMB 3LUGA 4OATA 4RK5A 5DLEA 5EWLB 4MR7A 4D6XA 3HUUA 3GA5A 1QKKA 4LRQA 8ABPA 5TPWB 1JLKA 3BRSA 5FWXB 4G0ZA 2LP4Y 4LX8A 4NQRA 2N9UA 3HS3A 3T38A 5B3JC 4MPTA 4EGSA 1EHCA 3F7NA 1GCAA 4RY9A 3QK7A 3OLYA 1VPWA 2F8SA 4RY8A 1Z2DA 3NNDA 3KHTA 5KC9A 2FQWA 3DLHA 4MQEA 2R4QA 1PEAA 5IEBA 3T6KA 3MYYA 1JF8A 2PJUA 3RVJA 1VLZA 1L5YA 2MSLA 4H3KB 2RJNA 1PNTA 1RNLA 3FFXA 4NICA 1M2FA 3OLXA 5KC8A 3GYBA 4ZYLA 1DRJA 1MIHA 5EWMA 4Z9AA 3F6CA 5KQGA 1QP7A 5TQ0B 2B1JA 5HM6A 1EWKA 3MMNA 3KSMA 3BREA 3CNBA 5GOTA 4MAAA 2JVJA 4MYRA 1AB6A 2F8TA 3TO5A 1MB3A 2HQOA 5HQJA 2QXYA 3RQIA 4G0QA 4IRXA 4ML3A 3A3KA 2O20A 1NXOA 2PE5A 4D74A 4N76A 2MSWA 2PUAA 1DBWA 1MAVA 4QYMA 3T95A 3GBPA 3OO1A 3CHYA 4MLCA 1A0OA 3RVPA 3B2NA 2FLKA 1W25A 3O2SB 4Z4EA 5IBQA 2E4YA 5IEJA 1JBEA 4RK6A 4P98A 4IGAA 4MQFB 1TMYA 3VNBA 5BR1A 4MGEA 1ZH4A 5TPZA 3VNAA 5T3YA 2LIVA 1KGSA 2NT4A 2CWDA 4RXMA 5FWYA 1YMVA 3M9WA 3LUKA 3OMXA 1KRWA 2HPHA 3Q7TA 3OQNA 5IUNC 1ABFA 4YV7A 2FKAA 2M1ZA 1JDNA 1Z26A 4LDZA 3UUGA 2X7XA 3E61A 4NCBA 1F4VA 1URPA 2GWRA 4LZLA 2JBAA 2R25B 3TB6A 4D6YA 4MRMA 1NXWA 1CHNA 1M5TA 1D1PA 2FMFA 2NUBA 1DZ3A 1YK0A 1WETA 4RXTA 3FDFA 5BRAA 3MQ4A 2FQYA 2IDMA 2OQRA 3MM4A 4F11A 5KWSA 1QQBA 5BRJA 2AYZA 1NXXA 5DTEA 4MS3B 3RVNA 1GUDA 1ZGGA 3EAFA 1ZGZA 1RZRD 2GKGA 2VYCA 4P1ZA 3ILYA 1NXVA 3GRCA 3JTEA 2L18A 4F12A 2IKSA 2JRLA 1JDPA 2GI4A 5CNIA 1D2AA 3H1EA 3LFTA 3GWGA 3C97A 4YP9A 2FEKA 4XFKA 3A10A 1U2PA 3LUHA 1GUBA 1Z13A 4Z0NA 1TM2A 3JPWA 1ISRA 2H3HA 2PUCA 1EWVA 5CNKA 3H6GA 3QLVA 1LK0A 4ETMA 2A9PA 3KG2A 1C0EA 1D4ZA 3GT7A 2DRIA 3MA0A 1YS6A 3O1IC 4M88A 2JCGA 4MR8B 4Z4GA 4RK4A 5FBKA 2FMIA 5C5CA 1P2FA 2MYNA 3IP6A 5B3JA 3H5WA 1RZRA 1MVOA 1U04A 3R0JA 3QELA 4Z99A 2FW0A 3ROTA 3SNKA 3DZDA 5EWJA 3QX8A 3H6HA 2PUFA 1Y1LA 1BAPA 1PUXA 5EWLA 2M98A 3GV0A 2MSKA 4HNQA 3SY8A 1NTRA 1ABEA 3RH0A 1P6UA 4RS3A 3URMA 4IMJB 5TPWA 1YK1A 3QLVC 1ZESA 3O1JC 2NT3A 4KQ9A 3EULA 4G97A 3RVLA 2XDYA 3FGZA 3C3MA 1P6QA 2FMKA 2PKXA 1QO0A 2KYRA 3DGEC 3LUAA 1T34A 3N0RA 4IMIB 2QSJA 1UDRA 1DG9A 3A0RB 4L4UA 3HSYA 3HJFA 2CD7A 1QPZA 4F8JA 2R47A 1SXHA 1VKRA 3HUTA 4Z4IA 1PEYA 4QPJC 1SXIA 4OLBA 3SQNA 4JASB 1SRRA 2NZVG 2PAFA 4DQDA 1LBHA 1QP4A 3LOPA 3HDGA 4N03A 5DGCA 4W5TA 1ZITA 3EQ2A 2FN8A 4CBVA 3HZHA 1JFVA 3W9SA 3Q9SA 4MR7B 6CHYA 2H0AA 4PE5B 3GBVA 2E4ZA 2P4UA 2YHAA 3JY6A 4Q7EA 1AB5A 4OTZA 3LUDA 1VRVA 5JNTA 1XHEA 3KCNA 2P9HA 3QLUA 4QYWA 4EYOA 3JS5A 1OXKB 2FXIA 2IYNA 3OM1A 4RV5A 3T8YA 3OMWA 4PZ0A 4WXEA 3ROFA 4ZMRA 4KREA 1ZAYA 1DBQA 1S8NA 3M9XA 3N75A 3H5IA 4MS1B 4MQEB 1JFTA 5JNRA 1H9CA 1D1QA 6ABPA 3HEBA 1DP4A 1A2OA 3P9YA 3CRNA 2FLWA 1Z18A 3NNSA 4Z4FA 3EGCA 3SM9A 4NCAA 4G0PA 2HQBA 4Z9BA 2VUIB 4LE2A 5IULC 5ABPA 3I45A 5KQPA 1SD5A 3Q7RA 5EWMB 4YWHA 3O75A 2FSPA 4KQCA 3RVSA 3QLUC 1JFSA 1KMIY 2QV0A 1FFSA 2L17A 4JB0A 3H5TA 4KVFA 5TQJA 2Q5CA 4TMYA 2WY2D 3DGFC 1J56A 3FFTA 3L49A 5ED4A 5JS2A 4B09A 3FFWA 4O5AA 2MYUA 4PYRA 4RZSA 2VK2A 3OLZA 2ID7A 1Z16A 2B4AA 2GBPA 3KLOA 4ETNA 4YS6A 4ZJPA 2IOYA 1YVUA 4H3HB 4WXMA 4MS4B 1Z25A 4GPAA 3EJWA 2WWVD 3RVOA 4ETIA 1JH9A 3LUJA 4EY3A 1LJLA 1QMPA 2OENG 3FMVA 3H5VA 3KYIB 4G0OA 1F51E 2QVCA 4DADA 4UHKA 4W5RA 5FWYB 4LE1A 4WUTA 1Z12A 3IPAA 2QVGA 4Q6BA 1USGA 5BQ3A 2QW1A 3OQMA 3HK2A 2TMYA 3EDCA 3CKMA 2JB9A 1JX6A 1RPJA 3G85A 1XWWA 2ID9A 3CS3A 1NY5A 3I5AA 3CU5A 3LUCA 4W5QA 3LMKA 4FE4A 1RXIA 5JNVA 3IP7A 1U0SY 3EODA 2RGYA 3MF4A 1BDHA 4MR9B 4LDAA 4MR8A 1ZN2A 3SAJA 5JNSA 2HSGA 2IPLA 3H5LA 3Q41A 5IX8A 3OQOA 1MB0A 2PLNA 3S99A 5TQ2A 4YGXB 2L2QA 3IDOA 1NXPA 4LE0A 2PUDA 1JHZA 3H1FA 4KZKA 5IUKC 1JWLA 4JAVC 3QEMA 2RJOA 4HNSA 4Z4CA 4OLAA 1HEYA 4RKRA 3DBIA 3H1GA 4FE7A 1LJUA 3NHMA 4WWHA 5FWXA 1DC7A 4L85A 3KJXA 4S04A 5E3JA 1JL3A 4YO7A 3EQZA 4MLDA 2QU7A 1LBIA 4EYKA 4ZMSA 3HV2A 1NXTA 3IP5A 3GL9A 3JVIA 4KV7A 2PUGA 1BDJA 1ZY2A 2LUOA 1DCKA 4XXHA 4N41A 1DC8A 4JA2A 4XASA 1APBA 4E7PA 2E4XA 4G0XA 5D2CA 3KLNA 4EVQA 2YHBA 4TLMB 2LPMA 2PMCA 3QELB 4KK4A 3L6UA 1M2EA 2IPNA 4YR7A 4Z4HA 1W9HA 4DN6A 1DJMA 5TE9A 2A9RA 4JB2A 9ABPA 2WB4A 3BRQA 4FB4A 5TQ0A 4PICA 3SG0A 4N0QA 2IPAB 4OG2A 1NATA 3QEKA 4HYEA 1C4WA 1E2BA 2FEPA 4G0MA 4QICA 4YCSA 3E3MA 1JYFA 3ILHA 4RK1A 3IPCA 3O21A 5CNJA 3D02A 4EUKA 2R48A 4RK7A 5KQLA 3HO1A 4MS1A 1BVHA 2ZAYA 3HDVA 1DCMA 3K4HA 1EWTA 4RDCA 1GCGA 3Q15C 1I3CA 3CZ5A 4N47A 3MIZA 4RXUA 1SXGA 5F64A 2PL1A 1TJYA 4EVRA 4WZZA 5TPZD 4EVSA 4MQFA 4W5OA 3O1HB 3RVMA 4GNRA 3N0WA 1BA2A 1QNLA 2FEWB 5T7BA 2BGGA 4WT7A 3N53A 5I4CA 5JS1A 3RVKA 2I6FA 3NBMA 2E4UA 3QLTA 4G0YA 3UK0A 2E4WA 3OLWA 1CEYA 4ZPJA 5GQSA 1JYEA 1DCFA 2FN9A 2A9OA 2PUEA 3A0UA 3LKBA 1FSPA 2AYXA 3H5OA 5PNTA 2L19A 1YTUA 3I09A 4N0PA 2A9QA 4EYGA 2VUHB 3NHZA 1GLGA 4KNYA 1PHRA 3O2JA 1BDIA 4XAQA 1IIBA 5DCLA 5JNUA 4MS4A 3KTOA 2GX6A 3CZCA 1XHFA 1B00A 3BILA 3O74A 4IF4A 4MS3A 3F73A 4F3TA 4KRFA 1R8JA 3TD9A 5IUJC 3TX6A 1FFWA 2PL9A 3HM9A 1Z17A 4F06A 3CTPA 3JPYA 4TN5A 1OXBB 2JK1A 3H75A 4Y9TA 1QQAA 1FFGA 3N0XA 3OM0A 4NV3A 3CG4A 1KRXA 4UHJA 1Z15A 5CHYA 1RXEA 2WJAA 1FQWA 2WRZA 4IILA 2NZUG 2ZWMA 3HVRA 4O1HA 1CYEA 4YRZA 2JBAB 2V0NA 3KKEA 2FTKE 4MRMB 3TMYA 1USIA 4EYQA 4MR9A 2FMHA 1USKA 4RWEA 3IP9A 4KK3A 1YMUA 1L5ZA 4HNRA 1E6KA 4PEVA 2HJ9A 4RY0A 1DRKA 2LBPA 2JVKA 1ZVVA 3KS9A 2FQXA 3K9CA 2IPMA 3O2QB 1YIOA 2QZJA 4E7OA 4S05A 1TLFA 3RVRA 3HXMA 2WJWA 3G1WA 7ABPA 1ZH2A 4RK0A 2CHEA 2W42A 4RSMA 4XARA 3NNNA 1K66A 1E6LA 3KYJB 1D5WA 4JOQA 5HSGA 5JNWA 3F6PA 2HQRA 1NXSA 1U8TA 2E4VA 3CG0A 3LTEA 4W5NA 2JVIA 4KPYA 3C6QA 4RKQA 1ISSA 5IC5A 4KFCA 1P8AA 1QO0D 3Q7SA 1TVMA 4RU1A 3JVDA 2J48A 1YS7A 3LKVA 1E6MA 1M5UA 3N6VA 5KI6A 4TLLB 3M6MD 5HKOA 1EFAA 4KMRA 5KQMA 3RVQA 1EAYA 2MYTA 3CFYA 3I42A 3OLVA 4Q6WA 1K68A 1QP0A 2MYPA 4H60A 4OBBA 4XLTA 5DKFA 3D8UA 5TQ2B 2QR3A 1DBPA 4O1IA 1PNRA 3BBLA 3OO0A 2WMYA 2PUBA 4YLEA 3C3WA 5FBHA
chains in the Genus database with same CATH superfamily
1U5AA 3LF2A 4ESVA 3TM5A 4G86A 2VUTA 4NMMA 4S1WA 2I5PO 4EA8A 3DLBA 3OU6A 1PJ2A 1DV2A 2RDMA 3F6RA 2O2JA 3UJ7A 4YJHB 1YRQA 2C77A 1PNQA 2X13A 3O93A 1DARA 2WU3A 4JWKA 5DLEA 3ETCA 1NVGA 4IV0A 2R6FA 4P7KA 5EZ6B 1IHPA 3T61A 3UW1A 3A2KA 4XWWA 3F2VA 2JFFA 1IONA 4R68A 2BZGA 3A2NA 1G66A 4EMBA 2R6AA 2PX2A 2PVCA 5EQJB 1RWOA 3I5XA 4JUIA 1JVNA 1M34A 3QEAZ 1WZIA 5KYVA 1Q11A 1M1UA 3WB1A 1C8BA 1GITA 4KWTA 5LWHA 2CC2A 2N46A 1E2LA 4D8WA 3DH0A 5JUWA 4WH0A 3B6EA 3EZYA 3WKBA 3L1KA 1SY7A 1Q44A 1J9ZA 1VLZA 2EVWX 2MSLA 3PXCX 1E1CA 3COSA 5U4QA 1IM2A 2RJNA 4U2CA 2NO5A 4PO8A 5A3SA 3VC1A 1IY9A 1CDEA 3PGLA 4KR7A 2BOVA 3GYBA 3ZNQA 1BE0A 1KYVA 3OLCX 4TUYF 4HQ6A 1V35A 1CUCA 4YDRA 1UOPA 2X5OA 4ITRC 5FWDA 3WL4A 3RAFC 2VNSA 2X23A 1CRWG 1U94A 3MMNA 4JBGA 2NX2A 4ZN6A 4XJXA 5C8ZA 2OYRA 5DHPA 3RTAA 1RAGA 2OL4A 1GWNA 2IOFK 4DTCA 1YB1A 1KF0A 2NVBA 3KJHA 3AJEA 3R5KA 4LTMA 4Y67A 1V48A 2F1RA 1IHOA 1D2GA 3KFLA 5FB3A 1OXUA 3OE7A 2WHEA 1XZNA 2J3HA 1F9AA 3T1HB 4IIEA 3SZLA 2RIRA 4GW3A 1PAUA 3GBPA 1H2XA 1KAMA 3D59A 3FBTA 3Q11A 1SCDA 5AM4A 2YJGA 4YRKA 3RVPA 3T7CA 1QGOA 1EE9A 1OIXA 3O2SB 3PRHA 4XFJA 1NVBA 2J4DA 3JQGA 4UU1A 3WWDA 1JLSA 1N9ZA 5HFNA 3ZHUA 3L4JA 4RK6A 1MNAA 1WW2A 3LU1A 2X0DA 3HJBA 4YRNA 2PV7A 2V0CA 1PR5A 5KTNA 4FGKA 5COAA 5KO2A 2GK7A 1OU0A 3OKFA 2ZUUA 2HK9A 2O8BB 1TM4E 3N0VA 1WB5A 4MYTA 2O4UX 2OHFA 5HKKD 2IYEA 2JLWA 4C01A 3N59A 2Q6TA 1L5WA 1YH3A 3TW4A 2QENA 5EJAA 4D4HA 1BU5A 2ZJ3A 2UKDA 2BZ0A 5C9ZA 2XCQA 4LZLA 4MUNA 4L02A 2FFRA 5BP7A 4MRMA 4CT4B 1E2QA 3H5AA 4GBJA 4MVCA 5JMPA 2EWMA 2XB6A 5IASA 2JLSA 3E58A 2VT6A 1WETA 1ISJA 2P3LA 5BRAA 5DN9A 5GONA 1LDBA 1EJBA 1V6CA 1OPXA 3BN3A 4KFUA 4R7GA 3AQIA 3OUUA 2CHQA 3IKMB 4OJMX 2J0EA 2ZFUA 2QUJA 1HZZC 1J9GA 3HVKA 4YI5A 3K72B 2GPAA 2BF7A 5DM70 1JR2A 3HNOA 4XCXA 3SE0A 4Q16A 3K9BA 3EGXB 1NM5C 3U4MA 2UXCB 4KXMA 1RYZA 2ZT7A 1CRLA 3IBGA 5CT6A 3HR4A 3JASA 4J0HA 3RUDA 1DOAA 3TAUA 1J21A 4DJFC 3IXMA 1W36C 3W8FA 3C97A 3FWNA 3PX2A 1I14A 2IQIA 2OO5A 2P5SA 4FLFA 1MG5A 2CVZA 3HE3A 2UYQA 3E15A 5BVGB 1LDGA 1U6JA 2AFHA 2W4IA 3B89A 2G71A 2AGVA 3I1IA 1KDVA 5E0KB 1NY6A 2J3IA 3VPDA 5FOUA 3VVLA 2PUCA 1EWVA 2CKDA 4Q3KA 4ETMA 4Z7NB 1WZUA 4L22A 5EIAA 3MW8A 3PGVA 2W11A 1N32B 1KVSA 4D41A 2C5EA 2AOXA 1Z0IA 3JAMA 3KQKA 2DFVA 4GECA 2C2MA 1PR9A 3NHBA 3WHIA 3A1NA 3HEMA 3PC4A 4HLQB 5H3CA 2GCOB 4F04A 2BMWA 3OCXA 2WWGA 1PN3A 1TJNA 1X6VA 4MCIA 2R6ZA 2R96A 3HYLA 4AD8A 1ZK0A 1W8DA 3EFOB 2M98A 2DLNA 5DP1A 4NU5A 3BB1A 1DPFA 1PJLA 1F4PA 5DNUA 2R0QC 4W7SA 4DIUA 5AVKA 5AM2A 4HL6A 4YGYA 5CT8A 5GTDA 3THYB 1V2HE 4X7PA 2Z4TA 4URWR 2GZAA 4OQMA 4US2R 4R9SA 1YUMA 3R3WA 1GCUA 2HAEA 2QIPA 1V1RB 2WJ4A 4BV2A 4CKBB 5BMVB 4LKRA 1K97A 5CFOA 5I9SA 3ELWA 1IPHA 1I7PA 1YQDA 4L4UA 3DMTA 1G59A 2JBHA 3E9DA 1CUXA 1SCAA 2CD7A 5H02A 4A2PA 2KHZA 3FHOA 4PCAA 5KOHB 2ENWA 2W37A 3NKLA 4B35A 2HSEA 4DARA 5TVKA 4I4LA 1JA9A 3O8NA 1JPJA 1Z4QA 3SQNA 1K2VN 1JQKA 2GRAA 4AX8A 4MXDA 4Z0TA 4RANA 3AVTA 3R6GA 2OYCA 4JMPA 2KLHA 4XIGS 2WJJA 2FN8A 1E60A 3V1UA 3IBYA 1YKSA 4NI5A 4Q9DA 4CXMA 5FLYA 1P2UA 4UE3S 2YHAA 5DYYA 4YT2A 3NLLA 3VSBA 2IP4A 1ICEA 2WMOB 2AOTB 3C8HA 3R0VA 4Z9FA 2A0YA 4ZCMA 4QLBA 2O8DB 4U7JA 1MLDA 2QSUA 2HWWA 1ZXLA 3D6UA 3FPAA 4KAXA 4UDNA 3ZHRA 4DDHA 2P67A 1OCEA 2PPVA 4OAOA 5C37A 4RADA 4FHCA 1XDZA 2Q6LA 4DLRA 3KU1A 4L5AA 1QF6A 4LY0A 2DSNA 2GSWA 4P35A 5IH3A 3HJCA 3R0ZA 4QVIA 4M8KA 4W1RA 2Z3ZA 3AY6A 5LBIA 3PFFA 1KVRA 2YRWA 4BNXA 5JR3A 1JHVA 5L40A 4C7VA 3LFHA 4Z4FA 2OHIA 3KEGA 2BBTA 3P2MA 4QRHA 1PYDA 1W4BA 1SWVA 4LRUA 1R8XA 1KY3A 4C3UA 2VUIB 4BVBA 3SCZA 4JJ4A 4BWYA 4RAQA 3ZGVA 3T5PA 2H2WA 4YWHA 1KS2A 1CY8A 3E9EA 2XIQA 3O75A 4J9VA 3VAYA 3W2FA 4CKXA 4CLRA 3L7OA 3ICEA 4XWOA 1SULA 3OIDA 4MKHA 3GCDA 2UUAB 4LSMA 3EY4A 3FN4A 4C7OA 4QOSA 3H1PA 4IOMA 5A9RA 2XY4A 3GLGA 4AJHA 5ARBA 4UE2A 3M5WA 1GAWA 1E92A 3C24A 3TAXA 7REQA 1Z74A 2AOVA 1WLYA 4FOOA 5CD1A 3W4IA 1AMNA 4U2EA 1V8OA 3KR0A 1N0UA 3TL3A 4C22A 5DM0A 1B1CA 2JA2A 4A8TA 4M3NA 2JFXA 1B42A 3FYSA 3DWGA 2HXGA 3R41A 5J2TF 2ZJ5A 1LJLA 1Z45A 1AXEA 3DHNA 3NYQA 4IH9A 4DT1B 3L8DA 3G02A 3AKEA 1TKRA 2KMLA 1QG6A 3ZDEA 5EJ5A 1OTXA 4YPFA 1ETHA 3AT1A 3S8EA 1FRZA 2JAPA 3RJ9A 1VKOA 2CVQA 2JGKA 5FA8A 1GGHA 3EZNA 3CKMA 4CF4A 2JB9A 3NC4A 3SC2B 1KH1A 2P2NA 1G4UR 2GCGA 2HF7A 3VR5D 3PJFA 4RL6A 1NASA 4YRTA 4EAAA 1U0SY 4RE5A 3DTTA 4QECA 2V6FA 3RG2A 2R3SA 3A25A 2HO4A 1JEQB 3PD7A 1E3MA 2ZI9A 4KXUA 4LHYA 1LSOA 5ENDA 1T3SA 1MXFA 4Y2JA 3WMRA 5HZMA 5JNSA 5AKYA 1THZA 3NR2A 1DTWA 3Q7QA 4MPDA 1JU4A 3F7OA 1KI6B 2A0WA 3EXG1 3W5JA 1ZYUA 3O2NA 2ASEA 2FKNA 1LTQA 2HREA 1RI1A 2WU4A 3KX2A 2I62A 4PZ9A 3HZZA 4JI5B 2J8ZA 5JSHA 5KJCA 5MDHA 4C4PA 1EVJA 4R1SA 1UODA 4A82A 4UASA 1JAIA 4N0DA 2X5NA 2X86A 4RKRA 3BMXA 2B99A 4LVCA 2DQ4A 1AKUA 1RFLA 1FFBA 1IU9A 3EQ7A 4GSLA 2Y27A 3OP1A 4PR0A 5FWXA 4S04A 1QH1A 2YZ2A 3KXKA 4DANA 5E3JA 3D1VA 2XCOA 4QHTA 1PT6A 4F4CA 2F62A 1V5IA 3H2BA 3NGMA 2EZ8A 2CXSA 1YGPA 2AZ4A 3AUAA 4RPGA 5FKJA 3VR2D 4BMSA 1DKMA 1PLLA 1Y63A 4DSNA 5KYNA 2EWWA 1BDJA 2LUOA 2R00A 3KZCA 4O29A 3BB4A 5AW0A 1W76A 5G0SA 4CIYA 1XTJA 4FDAA 4V0OA 2PU5A 3NIFB 3KQMA 4GIBA 3BHIA 4KGVA 4R7TA 4EGQA 3HN2A 3RC8A 3N28A 3A3OA 4GE3A 4K46A 4KTTE 3CZMA 5KZMB 5KKCA 3PXUA 4TX1A 1JKJB 2RHOA 1MOZA 4ILEA 3UXMA 2XMCA 4ECAA 4Z86A 4NWIA 3N39C 3V8BA 4Z7QB 1G5IA 2OB2A 3C5WP 3G2OA 4H16A 2WAXA 3BRQA 2P0AA 4FB4A 2E37A 4NXMB 1R0KA 3C6KA 3HU3A 4HO1X 4CVNA 1U0FA 1JG4A 4NARA 4AM8A 1F6BA 4FK8A 3E03A 3RU3A 3SBOA 1ZIYA 4KTVE 1NHWA 1UXGA 3M1IA 4B3XA 3WGLA 4GEGA 5LZ4A 3F9RA 1SK9A 2PKQP 1NW9B 4XGQA 1Q7TA 2VYQA 4LYAA 3D3QA 1BVHA 3VZBA 5FEUA 1Z4MA 2GNPA 4EHHA 3NB0A 3Q15C 3GJ6A 5JCZA 4B3RB 4N7BA 3V8EA 3MIZA 1P3Y1 4RXUA 5BYBA 4C4RA 3U4QA 3WAJA 3NM5A 4EVRA 2J9YB 4CR7A 4EVSA 1QV6A 3W7BA 3CLRD 1H66A 1BW9B 1OFVA 5I9BA 2ZSEA 1C0KA 2QD4A 2OV2A 2XQKA 4Y8VA 1SKUA 1HT1E 2A7QA 3JWJA 1P1CA 2XWSA 1IZ9A 2QLTA 2XVYA 2YJTD 1W34A 5HOQA 3L7AA 3SVLA 4HNAA 1YB5A 4L8LA 2HF2A 4RDIA 1KO5A 2FN9A 4EITA 4I2VA 4QYTA 4XVRA 1KSGA 2ONKA 2CFRA 3JZAA 3K09A 4ZIRA 2JHGA 4NHOA 2HGZA 4JJ7A 4N0PA 3DBHB 2MHCA 2WV7A 3HYRA 1P0CA 1R3UA 3NO4A 2Q1TA 5F5LA 3OZFA 3RF6A 3TQIA 2B9VA 1EK0A 1KC3A 2X6RA 5KNDA 3LOUA 3NHRA 4MRRA 5BMVF 2PBZA 3OPQA 3NHFA 3R24A 2FK7A 4CHTA 2AQHA 3LL4A 2GX6A 3RWBA 2A67A 3EGIA 2EX0A 1TZJA 3UAWA 4QOHA 3ETGA 5LMZA 2GEBA 4FOPA 4JYMA 2BGKA 3VOBA 4R6WA 3CTPA 1SPBS 1U1FA 1UPTA 3T7JA 5BN5A 1RAAA 4DNOA 3IAS6 4HPWA 4NCIA 3OM0A 1PT7A 1BEUB 3QIAA 4MWGA 4UAUA 4YYEA 1KYXA 1R6AA 4IDGA 4P3OA 3X1MA 3VPCA 1E2DA 2FHPA 4RQBA 4PHFA 2YYSA 4M49A 5U1PA 4X64B 6GPBA 1HDCA 3B3QA 3KKEA 3SC4A 1PWYE 5BYJA 3ZIAA 3N2NA 2O8FA 1IUNA 1W36B 3R20A 2RI6A 1SBNE 2NU7B 4PEVA 5AK3A 2C0PA 1STOA 4K9LA 4TL8A 4UPEA 4CMIB 1UDCA 3QITA 1ZVVA 4V1CA 1JQ5A 2PGXA 1Y8RB 5IZCC 1Q7RA 4HXYA 2ZRAA 4W5HA 1MGOA 3I1JA 1YIOA 5AKHA 4MW7A 4EENA 1T6NA 1Z07A 1Z3CA 4AN4A 1XQYA 3O03A 4EJ2A 1N8NA 3P19A 1YJBA 3GN1A 3HXTA 3G1WA 4HGNA 4QYSA 5DI3B 3RFTA 4DC9A 5LQJA 2Q1SA 4YV2A 1P1IA 2I22A 4FC7A 1O58A 4DQ0A 1U6KA 2J3QA 3CNHA 3CZQA 1PV4A 2WMDA 4X1KB 2E1RA 3HKCB 2GD2A 3P2JA 5J43A 4FI3F 2Z95A 5JC8A 1JGTA 1LBQA 4LY6A 2FEMA 4FPXA 4EPXA 1OZFA 4GR4A 4FCWA 1NQWA 1LUAA 1TQ2A 3I2FA 4XSVA 3QWAA 1L5LA 1TC2A 2NVOA 2AB0A 3FCCA 3H1AA 5K3BA 3X1ZA 1HT3A 4JR2A 3OG9A 3JZDA 4P38A 1DJOA 5DYWA 3WMEA 3QVSA 3I42A 4QBHA 3QBTA 2Q1YA 2QD1A 3EWSA 2OZPA 1XVIA 3OY7A 5HJ5A 1QQTA 4ARCA 2D7CA 5JDCC 2V0GA 1I1NA 1SHJA 2W8ZA 4NJEA 2B34A 3A04A 4KITB 3ESXA 1BZYA 3LSTA 4HVAA 1CK4A 3DZJA 4HWGA 5CLIA 1EFDN 2W58A 2B3TA 1H8ED 4IFTA 3DT6A 1T29A 3NEAA 4F93B 4D45A 2IYYA 1M3SA 3URKA 1EIWA 4UMVA 1G4AE 3F9CA 4XUEA 4CMKA 5CFZA 1V8FA 1DX9A 3PX3A 5L3ZA 1EB8A 2QVBA 3AINA 3K3PA 3Q3CA 1X3LA 4GOOD 3NVDA 3UUWA 4WZBB 4QSHA 1EM6A 3GGGA 2CMDA 3CWQA 3HJNA 4C76A 1RP1A 3ANSA 3LKZA 1HUQA 1QE5A 1RKXA 1KQ3A 2RHWA 4AKGA 1DBIA 4YJFA 4TSRA 5L6LB 3MWJA 3EASA 1YRLA 1EVLA 3IESA 2WTNA 3OCCA 4JC4A 5CUQA 3DEJA 5IEBA 2BISA 4BVEA 4EABA 4EG6A 3CIFA 1OGIA 5DTMA 3FAKA 3Q9LA 1B43A 3U9LA 1MRNA 2I1VB 2R6JA 4KXFB 3HKEB 5BSKA 2OMKA 4F4DA 1U9CA 1G1MA 4XUDA 4YAJA 3A6GA 3M6AA 1R4NA 3KQVA 5TS3A 1FXUA 3WE7A 1IB0A 4V39A 3LP8A 1LRJA 2I2CA 4IAOA 4D92A 2ZCVA 2PZGA 2VHWA 4ZT6A 5A7GA 1XLTA 1N5RA 4II2A 3LY5A 5ALYA 3EX7C 1XU9A 4MAAA 5B3AA 2ZUFA 1WPXA 4I4TB 1IXYA 2C4KA 3MHTA 4D8VA 2O20A 621PA 3NEJA 3UFBA 1GV1A 1I0ZA 1B3RA 4ID3A 1XFAA 3ZVNA 3G79A 3CURA 3S44A 1RIIA 1AGPA 3C6ZA 3FJOA 3TZQA 2KSQA 3SKVA 3YASA 2VDKB 2COEA 3MJVA 2VXCA 4KQWA 3V8MA 3KB8A 6Q21A 3N9IA 5H16A 3I9LA 3U19A 3V4RA 4MTCA 3RU2A 3VNBA 4ALJA 2ZYTX 1BXRA 4O4HA 1ZH4A 3QNMA 3ROQA 3X3HA 5JU6A 1XDSA 4UHFA 3QPVA 3BAZA 1NJ8A 2D0DA 2DHRA 2OQVA 1EAMA 1V8DA 2QRLA 3UUEA 2NQ2C 3TGPA 3E9YA 1I8TA 4F9GA 4ZVVA 1KRWA 2M6KA 5ITZB 3W5HA 3TLCA 4MMYB 1IPFA 4M1ZA 1PFUA 4CEIB 2D62A 1PWXA 5C1OA 3PF8A 2C8VA 4L4ZA 3GELA 2AN5A 2JAHA 3NBXX 4D6YA 1A9QA 2WKPA 4M0KA 3L1UA 4D0SA 4ZU1X 2HDOA 4LCJA 2C97A 3HVJA 2LGJA 4IIBA 4QO7A 1YK0A 2FCAA 2J9FA 1KO4A 1T9AA 4AY4A 4CGYA 4MKXA 3CSSA 1H2ZA 1W0JA 1CQWA 2EIHA 3G13A 4JVLA 4YJ2A 4J0QA 3UK6A 1FNCA 2OQRA 4M2LA 5K2MA 3EEOA 1JLMA 4FR2A 1JKFA 5AI8A 2ISSD 1C7ZA 2V4MA 3R8XA 4DY4A 3EMBA 3KT6A 1ZSYA 4JBXA 4B83A 3RK0A 1YDHA 4GGPA 2JFYA 3A4YA 5CP8A 3KQNA 1S8AA 5FBWB 5BNZA 3HHEA 2VUSA 3A3YA 3LQ4A 3QW4B 3RODA 2GI4A 4KBYA 5KMGB 4EY7A 3G5TA 3T1OA 3ZI7A 5FCDA 2FEKA 4KOEC 1KDZA 3OJXA 4N18A 2H2DA 3MHPA 1JNYA 1ODSA 1S2IA 1TK2A 2XUOA 1NI3A 1AY0A 2OCAA 2ZQYA 4NENB 1T0HB 4GPIB 3DFMA 4TYMA 4LF9B 3NHKA 3PYXA 4N49A 5B7GA 1V71A 2PYZA 3C1UA 2Y93A 1RLMA 3O83A 5E6RA 4YREA 1U7PA 3OCVA 4PLZA 4BVGA 1W59A 2BFFB 5FT9A 5JCPA 2P2SA 4Z4GA 4O4JF 3UW3A 2OBFA 3KVOA 1QFXA 3DFIA 3ED1A 1R64A 4INJA 2FMIA 3D0QA 4J4BA 5FBKA 4ZV9A 2WPNA 1PWZA 2X15A 3I2YX 1U04A 1SRQA 4GKVA 4MQMA 1MO4A 4XYGA 1CR0A 4IHJF 1RE1A 5FBLB 4CTOA 3SMVA 1Q1GA 1R2QA 1CZRA 3T34A 4M1KA 4HNQA 2MSKA 2PMDA 2WFMA 4GPBA 1E3JA 1RYHA 4LX0A 2L42A 3CLTD 1OREA 1KEPA 3FKJA 2M6SA 3P8ZA 4B9EA 4QM7A 4LBVA 2H08A 3O1JC 8ATCA 4UQOA 3PF9A 4IDNA 3E7PA 3H86A 4C3ZA 3TIXB 2BFCA 4GQBA 4DIOA 1VSTA 3IFSA 2HNBA 1J22A 2BGMA 2W93A 3AIOA 3M8KA 2CLDX 3OOWA 3PUWA 1E6CA 2N75A 2AJ8A 3FVQA 4D8TA 4ENPA 3A0RB 3H9CA 3ENVA 1L5MA 1RQGA 3U4CA 1R27A 3AHGA 2C83A 1Y5RA 1Z6ZA 1ZZEA 3K9NA 1JB1A 3DQQA 2AHOA 3PHLA 4QPJC 4AMZA 2H18A 1J2YA 2VDWA 3N8DA 1ZI9A 3V97A 5KTPA 4LK2A 1DC3A 2NUAA 4TKUA 2LR0A 4DJTA 3AERA 4ARZA 2OAP1 3EEYA 4QJ3A 3BXEA 3CZAA 3ZI4A 1XROA 4PZPA 1UANA 5F7ZA 3M33A 1ZGJA 1BROA 5L7TA 2IY8A 4AJOA 3Q6NA 3TLMA 1XDUA 3F5FA 1C7FA 3GBVA 4MVJP 5KYYA 3WIVA 4K9OA 2XECA 2E4ZA 3NIGB 3AR5A 1ZCBA 2JL1A 5C2JB 1VRVA 3GNLA 2FVXA 1ZRHA 4JEUA 4MLPA 3O8OB 1QCYA 4EG7A 3ESDA 5F5XA 3IP1A 3T8YA 3MG9A 3AF2A 2H54A 2HA0A 4NIMA 2AI3A 1BGWA 3FR8A 4CIAA 1O08A 3IBFA 4Z3KA 1P0PA 1ZAYA 4S1NA 3M9XA 1S8NA 3EXG2 1ORWA 1MFZA 4OUKX 4KWCA 5FL7A 2DFDA 3ZHTA 1HTTA 2AZDA 4WVLA 1YVPA 3FUTA 4Y9RA 4CKCB 2ZSAA 2EEZA 3FMPB 1JQAA 5LQSA 4R8LA 3GCXA 1A9XB 5TDHA 1V5EA 2XVAA 4GWLA 3NNSA 5A4DA 4RMGA 5AOVA 5HHTA 1FLVA 1WVMA 3TNLA 5KQPA 5LZ2A 3B85A 4J94A 4R83A 3GP5A 2IHVA 5B4UA 2H6EA 3WMXA 1FB5A 2PRYA 3RKRA 4LXQA 3MUEA 5I48A 1QK4A 4INPA 1M1YB 4KVFA 2FRVA 2Q5CA 1FQOA 1UT6A 3DMYA 1C3LA 1JXOA 3BWBA 2EFCB 2ZI5A 3DZCA 2C7VA 4FEGA 2BFDA 4XGRA 2OKCA 5DEIA 3TZ6A 1DG3A 1ZHFA 4FDUA 1E2PA 1KFCB 2C2WA 1I51A 1T5BA 2E7ZA 2BEUB 2HB6A 2X0IA 3PFBA 3VTZA 4B33A 3ZD8A 4MOWA 3RUEA 1H9BA 1NBME 1XVVA 3RLFA 4C7XA 2Z9DA 4L5YA 3HA7A 2C7PA 1KOJA 5C3MA 3DBRB 1QLHA 3H2SA 4ETIA 1H0HA 1XL0A 3IHTA 1MEOA 3FMVA 1T3LA 4N3NA 4XUCA 2G88A 1PFWA 1AT1A 3EXHA 4LY3A 1WE2A 3Q9UA 4WN9B 3OESA 4P3PA 2BM8A 3BD9A 2FPUA 4LCEA 4JB3A 1YS1X 4KR9A 1U7OA 3A1WA 1ZLYA 2BGTA 4B7ZA 1RU3A 1UFQA 1MOQA 3JALA 5FBVB 1C3XA 3HV0A 2WIKA 3DAYA 1XAIA 2NTEA 2H48A 3QPCA 3I5AA 3IB3A 4Z3DA 1CQJB 4YJKA 4EDFA 4HH0A 3A6EA 3D6NB 4EHAA 2DUJA 4UM7A 2WQ6A 4MDFA 1I7QB 1V95A 1R37A 2Z2XA 1NYTA 3MF4A 1BDHA 1X70A 3PQ4A 2I2XB 3OI7A 1NXQA 4R4JA 2JNWA 4I4TF 1LDEA 3H5LA 1DAIA 1QYXA 5AI5A 5DPMA 1C30B 4ZVQA 3VPHA 2OCLA 2CNWA 3WJ7A 3J81k 5IPFA 3OTOB 2CXHA 1T5LA 3JD4A 5K0FA 4FSXA 5C8XA 3HB9A 4WJZA 3OQVA 4QPCA 1GNQA 1LPAB 2PS0A 3I2HA 1KVQA 2AXEA 4G3XA 1WUHS 3FKSD 2EOAA 4LXGA 1MW8X 1C9MA 1U2TA 2GVNA 2QQGA 2MSEB 2RK6A 3BICA 3DEAA 4XD7A 1PL8A 1XZMA 5CVVA 4XYEA 5CA0B 5C8VA 2A30A 3TSCA 2E48A 3TFOA 1LJUA 5K05A 3S5UA 3MCTA 3KE8A 4O4HF 4MGKR 4GM1A 4M38A 5EFOA 3H17A 3B3GA 5ISMA 1GZDA 2NU6A 4LS3A 4MUKA 1HWYA 1EUCB 1NIPA 3L01A 4ZMSA 3VR1A 1J0EA 3AB8A 4R98A 2ZWVA 1DCKA 4C78A 5E3HA 4CG1A 1MZPA 4HOYA 4MQLA 3HWSA 1JG1A 4IHKA 5KSYA 3ZGZA 2A94A 2QP9X 2AOUB 4PLGA 3DB1A 3G0IA 2CLCX 1AF4A 4DSTA 5IJWA 2GR9A 2ZBFA 4DWJA 4XD2A 5ESRA 3JVEA 3P4XA 4X20A 1LNQA 2RBGA 1HYEA 3HWRA 5JRZA 5EG5A 4B73A 1VOTA 1I3NA 2FW8A 3HMKA 4S2EA 4OOFA 3V4OA 4BLRA 1HC7A 1L5KA 3HP1A 1IEXA 2BGJA 2H57A 2FUG1 2YMQA 1NLYA 4N0MA 2JG3A 4CEHB 4BFUA 3DV2A 4G0MA 5ILGA 3U80A 4TWJA 5LQDA 3OZSA 3KB1A 1Q12A 2BONA 1USVA 5J4LA 1IJKA 4E2ZA 1ZONA 2PR2A 3AETA 4KQEA 3AHDA 3WBKA 4QNNA 3W5CA 4DV6B 5DBOA 4A26A 4JGIA 4B81A 4N01A 2I2BA 3DAHA 5CDHA 3AJ8A 5AW1A 1I3CA 2HQSA 2YHIA 4K8OA 2KI5A 5JDIC 2WVHA 4QARA 5ANRB 1GL3A 5A0TA 1JS1X 2LVBA 4FGWA 3AGPA 1QVWA 4PO9A 4JBIA 5L95A 4UFPA 4LSWA 4IG4A 4FZ3A 4TVKA 5LDGA 1X1QA 4WT7A 3N53A 3TCXB 3STHA 4U0KA 1E9EA 1F0NA 3L7LA 4LDQA 3HDHA 5K01A 4OHYA 3CKYA 4ZPJA 3OF3A 2GRUA 1IFXA 1Y48E 3BORA 5CGZA 1I4LD 3AHCA 4HPXB 1GVNB 3TD2A 4DQKA 1WUYA 5C1PA 4DLZA 5J40A 4S1OA 1JAHA 1WXEA 4BMZA 2C1XA 3QI2A 5J5CA 4ZYTA 3NCHA 2AJCA 3FKQA 2Q6OA 3BXHA 3IOBA 5EMMA 4UAVA 4MAMA 1DDIA 2H52A 4DIMA 5EINA 4E2YA 2UYHA 1WB6A 1XN1A 3BILA 3GT0A 3O74A 5F3RA 3UG7A 4DMKA 4KE8A 5JBNA 3WK7A 2YWXA 1K3UB 2BI4A 2WJVA 2Z08A 2Z2JA 3G5LA 3G2KA 4LHZA 4RIFA 4CUZA 2V65A 4EW6A 3CNLA 2P40A 2QI9F 1JN0A 2O5RA 4LNUA 4Y9TA 4BKRA 3H7IA 4EHBA 4JUCA 3OEED 1C1YA 2QXUA 5AK4A 2BVNA 4YI3A 2LIPA 1BCRA 3PWKA 1KEEB 3KSUA 1Z15A 2XLCA 3FSRA 4AJPA 2QZSA 1BQ3A 2RGCA 4AKTA 4Q03A 1KJIA 3EQ9A 3GEEA 1FY2A 3TUJC 3DB2A 2QV7A 3T52A 1NP6A 1X80A 3TI7A 2HPAA 2JBAB 4Q7JB 4MKFA 4RW0A 1FLAA 4Q05A 3DOOA 2P35A 2VJNA 4MR9A 2QG9A 3QPUA 1F7VA 4KKVA 5ALNA 1YJ8A 1GNPA 2JIBA 4HDSA 4HZUB 2GBIA 4P32A 3LTNC 1CD5A 1L4FA 3EGDA 4MUEA 4J1TA 4DF3A 4Y1FA 4WERA 4MI9A 1QHHA 4OMCA 1QJCA 1ZK2A 2QAGB 3CGWA 1GG5A 3GY0A 4Q1AA 1HNNA 1SCBA 3FTQA 3FSJX 5T4BA 4DGSA 1K4KA 5GIOE 3QTTA 5H8WA 4J1SA 4BKOA 5F98A 2NW6A 4I4IA 1GFZA 4O4LF 5EZ5A 1UXKA 3OJLA 4M54A 1G3RA 1W85B 1PQYA 1Z6PA 1TYBE 4FWBA 4X1OA 5DO9A 1KAHA 4FFNA 5EKXA 1R9NA 3SLKA 1DJQA 2QE7D 3TKYA 2OWEA 1MQ8B 3FNRA 3G5AA 4EIWA 3DE0X 3CB2A 4UBIA 2RGDA 3KTDA 4R16A 1BU8A 1L5NA 3A70A 1W46A 3BMCA 1E0JA 2Y1LA 4GYWA 3U7QA 1C8LA 1DEKA 3I6YA 3M6UA 2QMUA 2XEXA 4R0VA 1NNEA 2VHZA 1IAQA 4GZ6A 3PUYA 1JHAA 3EC1A 4Q18A 3GFQA 4BB6A 4CM9A 1KBOA 2BFEB 4US1R 1PNRA 1LFAA 2VYVA 4OIFA 1T0BA 4F45A 3O8CA 3TGLA 1M6VA 2G17A 3QX9A 3UK7A 4F2PA 4V0QA 2AN1A 1LPOA 4QDUA 3FCOA 1OXXK 1PJ4A 2AG0A 3A28A 2VH1A 4G25A 2CHFA 3QEMB 5DBFA 2HGSA 3GDGA 5B30A 3BIOA 1N9GB 1TW3A 2O1EA 2WTMA 2J4CA 1D2CA 4KMMA 5TPWB 3O26A 4UTNA 4CFYA 4LX8A 4Y3UA 6PFKA 3GROA 3QVUA 2HF9A 2W6NA 1PZGA 5DH9A 5GVSA 2CCGA 3DZFA 5LOVA 2GWHA 5AJWA 1MZVA 4NRDA 5ICFA 2G25A 1KGDA 3CUUA 3GDHA 3O8BA 4G23A 1N2JA 5FD8A 3H8WA 4JCCA 3O38A 3C3CA 3TDNA 4CTJA 3DLHA 3S8YA 2ZIAA 3EBLA 2CMFA 2FW7A 4A73A 1O94D 3JQBC 4GH5A 4MRVA 1SIOA 1TQDA 4BNLA 5EGNA 1A9TA 4DR3B 5K0LA 3QXGA 3DYBA 1F5SA 1I24A 2BIFA 3JATB 5KVSA 5BPHA 1U0JA 2HDNB 4HX2A 4INAA 4L8YA 2QTWB 4QG7A 4GI3A 2Z83A 4XOIA 1QP7A 1YBHA 2GPSA 2GHIA 4FSDA 3PPVA 4GX0A 3F2IA 4ZEWA 3FYDA 3ANMA 3IMEA 4DSUA 1QG2A 1GAQA 4XWTA 4ZALA 2EX1A 4NKRA 5HFJA 5CMLA 5BV8A 1K6XA 4PXAA 5D1NA 3L43A 3NXSA 3LUBA 2LE0A 3PFNA 1DFGA 3L0ZA 5CA0F 1GGEA 1WEHA 4OXIA 5JZMA 3H83A 1EM8A 3D54D 2F48A 2OWDA 4U63A 4AICA 1ZICA 2I7XA 3G1TA 1KH2A 5DHQA 2GK6A 3QUTA 4E33A 2DYKA 2GLXA 2QLFA 2B1QA 4N3AA 5EIBC 4LF7B 1T0PA 3NHJA 2P91A 3WK8A 4Z53A 4B0PA 3AUSA 5DM2A 2FLKA 2BRUA 4XDHA 1J5PA 1SKYE 2JIOA 2E4YA 4FIZA 4RD2A 3FNEA 1T5DX 1KQFA 2A5FA 2FXVA 1P62B 2AR9A 1HH4A 2D2XA 2RKOA 2WABA 2O2YA 1NVUQ 2R84A 2VCHA 2X5KO 3B13B 4ZI7A 2DLDA 2V97A 3KM0A 2ZE8A 1IUPA 3I72A 4EJSC 1M66A 4FDVA 2ORYA 1FU8A 3N86A 4RA6A 1CUFA 3N6XA 2ONZA 1C81A 4D44A 2PT5A 1GJRA 4DLVA 2ZQZA 3DM5A 3U4HA 3KD2A 3WKCA 5K0ZA 1Y6GA 3FPHA 2XZLA 2Q99A 2IXBA 4F7WA 2LTAA 4NDZA 2TECE 3ICVA 1SUFA 1HI9A 4DV7B 2D1YA 3MM4A 4JNKA 1I13A 2B5OA 3ZHQA 4BNJA 4MMXB 1L2TA 4Y1RA 4UJ5A 1XMIA 2BLNA 4BNDA 1ZK3A 4N48A 2Q4BA 2AZMA 4RENA 4AP6A 2NADA 4JBYA 4QD3A 2J67A 5K3SA 4CZ2A 1L5HA 2IKSA 2IUUA 1OFHA 1QYIA 1X74A 5CNIA 3SEFA 1NBIA 4XOUA 3ZKAA 2JFZA 5CLJA 1EFPA 1MDFA 2H1RA 2O1XA 4BUCA 1G17A 3N2KA 2DH6A 2NUPA 1BJRE 2D5CA 1GHTA 2FZCA 2C2YA 5H82A 1ZD9A 3D3EA 3TW8B 3GD7A 2VBIA 3O92A 5CNKA 1LK0A 1S89A 3L7YA 5JCJD 2A1TS 1HF3A 4YXWA 4TMTA 4R8KA 1EUYA 4DJJA 4PF1A 5JAHA 2YWGA 1USWA 4KO4S 2RIPA 3WLKX 1ZUIA 3DNFA 2YZNA 3NJ4A 1U8FO 4IJVA 1PR1A 3R3JA 4I9UA 4XCVA 5B3JA 4BPRA 4DLUA 5HTOA 1K7XB 3IAEA 4NPHA 3L18A 4NC9A 4D42A 3O95A 4GU5A 4KUGA 2ZAOA 2Y0BA 3DDSA 3FI9A 2FZ4A 2XCRB 3U3JA 1JI3A 1BAPA 3BMOB 2PMBA 3TXXA 3RC2A 2ILVA 4WLNA 3ZV5A 4DPLA 3CZ4A 1EK2A 5C5IA 5AW2A 4PLPA 1C80A 3SF8A 1WDMA 3A6LA 5DP2A 1AG9A 2J3JA 3C5CA 3KWFA 4UBMA 4B6PA 1L4HA 4U5QA 2J0QA 4WBSA 2XUPA 4BO0A 3L02A 2QSJA 2YV3A 3Q72A 4HDKA 4ASUD 4HAOA 2P3OA 5EE9A 2BHSA 1EVIA 4DLTA 4DZZA 3KYCA 2P2ZA 2ZWOA 1U5BA 1RXYA 1LEHA 4M87A 1RJFA 1RI5A 3IXQA 4U7DA 1HYHA 2FR0A 5TMDA 3BE6A 5ALSA 3EFEA 5LDDC 3UJCA 1TZBA 2ZTSA 4P0QB 1XQWA 5H81A 1S2OA 2Z3WA 1OFGA 1A9SA 3HCDA 4DQDA 4BXOA 3L5OA 4WKBA 2BHNA 4ABTA 1I10A 2PQ6A 1PTJA 1L4EA 2ZEJA 4OBEA 4D9GA 1J0XO 4RJ2A 3HN6A 1SZCA 3W9SA 3GJ5A 3X1WA 1JR3A 2PTGA 2R4UA 2ZBQA 3HLTA 4ZI3A 4PQRA 4AECA 3V1TC 4PPGA 5FQOA 3HBMA 4QIHA 3FSEA 2K2QB 3LUDA 1C9EA 2RAFA 4NBLA 3MGAA 4D0NA 1QS0B 3P2EA 3WGKA 2BL4A 4X71A 2BTEA 5D3KA 1NNSA 3AUKA 3AKYA 3OCWA 4KH1A 5AMXA 3TUZC 2YW2A 3HCEA 3WYCA 3G23A 2VG8A 5EUCA 4LRTB 2OT3B 4BLOA 3EC7A 2H1LA 4P31A 4HX9A 1KPIA 4IH1A 3EVCA 3KKLA 4F21A 4K40A 3ZV6A 1KMCA 2EX4A 4B4DA 5I7RA 3GLIE 2EQBA 1ST3A 1VCMA 4I6GA 4U7GA 2XUGA 5DRYA 4B3JA 4IQ4A 1NF2A 1G8MA 1VECA 4ND8B 1UBEA 1AKWA 1MPXA 2DUNA 3PC2A 3WDSA 2G06A 4CFZA 1F2DA 1C7RA 3DBLA 3VBCA 2QX9A 1ORVA 2RHLA 2FSPA 4KQCA 2GBGA 5AP9A 5JMOA 4IQ8A 1FP4A 2VA9A 2HBQA 4AY3A 1ATZA 1GGNA 3H2IA 5D84A 1PBTA 2OYSA 1AUXA 3GC6A 3OFJA 1UAGA 2VWPA 4X63A 5EP1A 3DE4X 4IMPA 3DMFA 3IAM1 2OPHA 3NJ8A 2AEEA 3E2MA 1MRZA 1Q6ZA 1YR9A 3M4ZA 4HAUA 1NP7A 5JSKA 3JCZA 4D5EA 1YUBA 1GZ5A 3M6IA 3ACBA 2OLEA 4WPGA 1LDYA 3TJMA 3TIGA 4BWFB 721PA 4I55F 3RT1A 4R0NA 3K73O 4LOIA 1R0SA 3RHSA 1G16A 4LIPD 1QHNA 2BI8A 2IF0A 1RMYA 2JBWA 3A6DA 3O8QA 5LQRA 2Z1NA 3UK2A 2PKYX 4RNCA 3N5KA 1EFKA 2AV6A 1IXSB 3DUWA 4GPAA 1L8XA 4IKOA 3RVOA 2VTBB 2C07A 3BD8A 3H5VA 1ZM7A 1ML3A 3WIDA 4F56A 2XCTB 1KJYA 3FRIA 2TS1A 1GNVA 5EJ2A 2OHVA 1Y5MA 2Y99A 1FMTA 4GPEA 4BJ6A 3ZY5A 4OU5A 3BFVA 1J39A 3G0DA 3AI7A 3ILSA 1G5PA 1G6HA 1Z35A 5DW3A 1NHGA 2AMFA 4LYHA 4PY2A 4UXHA 4OHKA 3DDCA 1N5JA 4DMMA 5J4VA 1XGKA 4XPZA 3ADDA 2FRDC 4RPCA 4Q4AA 4RAOA 5LA6B 4PZCA 1L1FA 1C3OB 1KORA 4Y0VA 1W1UA 3I37X 3JQ8A 1LK5A 3K16A 2HBRA 1DEOA 4M53A 5LKAA 3MMZA 1Q1QA 3E18A 1UZNA 4ZVOA 3QU4A 3PHCA 2HXSA 4D99A 1GGMA 1VE1A 1BHO1 3H04A 2D8MA 1GQFA 3S6JA 1XZFA 5HQ3B 2WVJA 3LL7A 3H6KA 3M4JA 5K0EA 2GILA 3MWEB 1QIIA 4OLJA 3V32A 3SGLA 4YJ3A 1SVLA 3EF0A 5IJZA 5K6AC 5KIAA 2Z0MA 1B6TA 4JU9A 3IKJA 1LJ8A 1CP3A 1XMPA 2F1JA 3BH7A 4NLLA 4RHYA 4AXBA 4R1UA 2PWBA 4YJHA 1LPMA 1HEYA 1AS2A 2FG7C 2PT9A 4GYJA 5F77A 2FSUA 3B1VA 4DB2A 3LP6A 2FPIB 2HIHA 4NYIQ 1FP2A 2ZDHA 3FTFA 1NQVA 2X3UA 2Q8PA 1ODTC 1NOKA 2P8SA 4MLDA 4BAZA 3DR5A 3U60B 2C3UA 1PE0A 2B1GA 3IP5A 3BFXA 2EDAA 4A6DA 1DXHA 2BCGY 3PC3A 1N5OX 1FUUA 2ZJAA 2A6PA 4H35A 1G6KA 1YNSA 1HDYA 2AE1A 4PZYA 4EF6A 3FSGD 2FSVC 1UFVA 1HURA 2O2EA 1QGYA 2PWZA 5A4KA 2LPMA 4DLYA 2O5CA 3OJWA 3QW2A 4GLLA 2QQEA 1ZSVA 3I2KA 4EHIA 3PNYA 2DECA 3QELB 4I08A 1S0UA 3QIVA 3U3MA 2CLSA 1A82A 2VWQA 1LSSA 3I8SA 4W6ZA 3IAS1 1M73E 4JB2A 3RBVA 1KEWA 5B4TA 4E5YA 4KLCA 4LAFA 3OZAA 3PHBE 3QTLA 4MQUA 4PTYA 2JIZA 2BBSA 2Z4SA 3PPXA 3UOAB 1Q1ZA 5KB3A 1RHRA 5ERGB 1W5SA 2P9BA 4JOBA 4B4OA 2BC9A 3E3MA 4HUJA 3PEYA 1RE0A 1LCIA 1JG3A 1P1BA 2EYUA 2XF8A 4UAJA 4XLZA 3UTDA 3ER8A 2IYAA 1ZWLA 3UV3A 5LQMA 4QOGA 3FM9A 1YZNA 2XV1A 3RIEA 3A4VA 2E3JA 3K5HA 1ZOSA 1JU3A 1OAKA 3KUDA 3P9SA 5E2BA 4WLVA 1WSDA 5AM0A 2OEPA 4MWOA 4DIDA 3G7SA 4UVIA 5F64A 3JSXA 2VI5A 2VTVA 5AKKA 5TPZD 3TEFA 3ZE6A 1J06A 3TTWA 2BI7A 4PTLA 3UATA 5JXHA 2YDXA 3OPYI 2J6CA 4C0LA 2WP0A 5DBEX 2O8BA 4I9FA 3G9XA 4Z8XA 3HQ4O 1QK5A 2P7HA 2GSDA 3OPMA 4BVJA 1CZHA 1J8DA 1U7UA 1HDOA 3IBTA 3QMMA 3FOZA 4J0JA 3EH2A 3S7ZA 1H22A 4H1WA 1KWKA 2WF9A 3O4HA 2R6CA 1KFEB 3WDKA 3JQ6A 2VRNA 4DHWA 1JBKA 4DZTA 1HR0B 1Q92A 1YZQA 2QD3A 3S1AA 2H7XA 1WL8A 4EJSB 3L7NA 2W22A 1AKTA 4KXWA 4UZEA 4OYHA 3EC2A 1ADCA 2OXFA 4BZWA 4MS4A 1BRTA 3ESRA 1KK3A 3N0TA 4YUVA 3IKTA 1RJWA 3C5EA 1XHFA 3L07A 4YVFA 5IS2A 3ZXYA 4KXLA 4NE9A 2BELA 1RDFA 3C8ZA 3GPDG 4AW9A 4TZ6A 1O4WA 4G9EA 3EW9A 2MTBA 2HU8A 1KARA 4Y6QA 5CD9A 2C8JA 5HIMA 4NV0A 3T4XA 2DFKB 3TRHA 1RWWA 4BFLA 1GUZA 1D07A 3EGXA 4OP3A 4Y6GB 1LV7A 3BD7A 1W4LA 2RB4A 3L9WA 3KEOA 4C43A 1OGJA 3HYSA 3VJMA 2A92A 4JVMA 1FQWA 1IIRA 4GQIA 1GUYA 1WU8A 2C84A 3A9UA 2ZWMA 1PGNA 4A1OA 5BVGA 1Q0PA 3KQLA 2YHSA 3VAAA 1NJ5A 3WYGA 3TSWA 2YZGA 4P3KA 4UMFA 5K99A 4EYQA 1XVLA 1UBLS 2Y0PA 3PT5A 2IHJA 4PBRA 2R2GA 3D6HA 2WYUA 2Y1XA 4TQAA 3S8MA 4Y30A 1OW3B 4LQ4A 3TYXA 2FWBA 3E9QA 1JJVA 1MIOB 1ZUWA 2ZVDA 4CQLA 4EVIA 1Y6FA 2IPMA 1WMBA 4CM9D 2JD2A 4DMHA 4AO8A 3E3NA 4A5SA 2NIPA 3JXEA 1YS9A 4Y2SA 4FHFA 4H6XA 3ONVA 4OHWA 2CHEA 2W42A 3TNYA 3EFOA 2P5UA 1FTWA 1LC0A 2WE7A 4TLEA 5AVZA 4BCCA 1U8TA 2NZWA 2XWQA 3E48A 3B60A 5BW5A 4OQFA 2FN3A 1WU7A 2XA1A 4G4JA 3VDXA 1M2GA 3DC7A 4FR0A 4EY5A 3USCS 3LYLA 3OEYA 1YB2A 3B1XA 1M0TA 1VIDA 2WILA 1C3VA 4C2UA 1QHXA 2PUHA 2X4DA 3MMSA 1V1RA 5FR1A 2XGMA 4HAIA 1LTKA 2JARA 3NCTA 3PC8C 4UNRA 5EZYB 4QEZA 1WMSA 1VCHA 1E5DA 2XKBA 3HRHA 4LBYA 1HFWA 5H5JA 2XSZA 2MINB 1MQSA 3L0DA 2D4HA 2QSZA 2C9BA 3HSSA 4QZVA 5BT9A 3HXQA 3RUAA 1JAYA 1YTLA 3OWXA 4ZVUA 3UMBA 3RTCA 4O4IB 3PQ6A 3IHWA 4M8SA 4HAYA 5KC8A 1CJVC 1SEVA 2I33A 4D81A 4GMGA 5KKAA 5ILOA 3MBIA 4HQLA 4BVFA 1Z4IA 3D8HA 3NGLA 4BPBA 5KREA 4QXAA 4LPSA 5G4LA 5LQUA 2G9NA 8ABPA 1JDBC 4GI1A 3C45A 1J00A 1FMCA 1REQA 2LP4Y 2Q50A 5EP3A 4CUKA 3ZK9A 4CCSA 3T38A 3WWCA 1HTBA 2JCSA 3SSMA 1JT2A 3K70C 4XVQA 3A7EA 3OLYA 2O8DA 1OBFO 2W6QA 3HBJA 4OJNA 2OFFA 3M0EA 2R8OA 4BO5A 4EPYA 3P9PA 1JPNA 3ESQA 1HNXB 1XA3A 3KHTA 5LA6F 2EL9A 3R8FA 3KOWA 4YQEA 1PEAA 4QVKA 2ZR9A 1F8XA 2QGZA 5FX2A 3PHIA 1KERA 1NX6A 1AJEA 1OASA 3FD8A 5E9JA 1PNTA 3PUVA 4NICA 1B41A 1Q0ZA 2CJPA 3ELBA 2BUAA 2GAJA 3WWPA 2EF1A 4FFBB 2ZIXB 1UJ2A 3CJTA 3ROXA 5JJBA 2XBUA 3BGOS 1RAFA 3V46A 4BV9A 4E1BA 1MIHA 1JLHA 2WIBA 3IQXA 4DA8A 2OOSA 3DBOB 3UQYS 1N2GA 2P68A 4B3BA 4PPFA 4X1IB 5EIXA 4RD6A 2NUTB 2F3PA 2UUPA 2EGUA 3L7IA 5J5AA 1CUAA 1BEEA 1W5FA 2OO3A 3O4IA 4YAUA 3ZYCA 2QSYA 4EFMA 2PH7A 5HQJA 2QXYA 2ZSHA 1CS4C 3NG1A 4G0QA 4G4GA 3A3KA 3SSNA 3R0QA 1J1UA 2GJSA 9LDTA 3SHFA 3AJ9A 4M0MA 4AP5A 4PGMA 1C3JA 1NIJA 1ID1A 2C04A 2IP1A 2WE8A 1T2FA 3CHYA 3FTDA 3OO1A 3OTGA 3PIIA 1OHHD 4Y6RA 4FYIA 4MV0A 4DNPA 5CVUA 4LTNA 4MKZA 2HRRA 3R6WA 1XTBA 3UJ3X 4ZQHA 4RWZA 1V3VA 5IEJA 3PA6A 3QVMA 4R8VA 1JDVA 3OA2A 1LF0A 3LBIA 3KC2A 4WW0A 3TRIA 4I4NA 4DT1A 3U49A 2NT4A 3LLVA 4YFYA 4AJ4A 1EHIA 3QP9A 3C16C 1W4RA 1E9DA 2IE8A 2GPBA 3AOEA 4JROA 4DTIA 4I8XA 2X8LA 1MO6A 2FWPA 3LPMA 4GQAA 3A4LA 2M1ZA 3CH7A 4MJXA 4QO8A 3A4IA 1CQXA 1X7WB 1A7UA 4URXR 2I8LA 5SY4A 3V8QA 5IZ4A 4JBHA 4FYWA 4QAJA 2DQKA 1KP9A 2NUBA 2Y66A 1MA3A 4NZOA 5K1ZA 3I3SR 4CDRA 4EG3A 5ADUS 2LKCA 1DWQA 1P2SA 2ZGVA 3VO8A 5COBA 3ZXXA 1QYCA 3IIEA 1NTOA 4OHFA 4Y2RA 3T1NA 1EUDB 3FPEA 3R7AA 1RP7A 2GTHA 1TO6A 4BGVA 3F8WA 4F2WA 5CFPA 1U7XA 3QVJA 3AGQA 4HRAA 1E32A 4KXXA 1EQ2A 1QQ6A 1Z4NA 1MPTA 2ZATA 1KI6A 2BJWA 5G53C 2QMEA 4XW2A 2VJOA 3V6LA 4K28A 5FULA 2EFYA 3U7FB 4PX3A 2ZUBA 2F90A 4JVNA 1NZJA 1Z4LA 3USZA 4EG4A 4QRIA 1LPSA 4ZK2A 2QUIA 3KOUA 2JRLA 1M8FA 3DAPA 4J9UE 1CG6A 1L4LA 4K81B 1TOAA 4XJVA 3TVDA 4J0FA 4DBZA 1W0KA 4FN4A 4G2TA 1B2LA 4P84A 1U2PA 3TKAA 4F71A 1PV1A 4WN3A 2X5JO 1Z62A 3R7WB 4RHFA 3BHJA 2F8MA 2NO6A 5LZ7A 3QVGA 4OB8A 4OBWA 3P1JA 3U17A 1YL7A 2B61A 2Z5GA 3L6CA 5KYWB 1UFKA 3D0KA 3LSYA 5H1YA 4OL0A 3UT6A 1DJLA 3ZWYA 3EK2A 3GT7A 1TA0A 4IQ0A 1M5RA 4LRYA 1FDRA 4ZARA 2GA8A 3VYTB 4WMLA 3TZHA 4IO1A 1EEXB 1ULBA 1H2YA 1XD2B 3HY6A 2JATA 3NS7A 5K0CA 3B78A 2NP7A 2J45A 1SG0A 1MVOA 2B8EA 2FI1A 2BCJQ 4OHBA 5FR2A 4ZAVA 4XB1A 2BGNA 1JH8A 2IZ5A 3L7CA 1T3TA 1KL7A 3UT5A 5KOHA 2ZRQA 2A1TR 5EE3A 3WRXC 3G89A 3SXUB 4NTZA 3USES 4CIDA 1U63A 3BL5A 1ABEA 4N6GA 2XIJA 5IMBA 3BGIA 1JR3D 1R15A 3QMWA 3OU2A 1HLFA 1FYDA 1QF7A 3B9QA 4C30A 3R7NA 3SS8A 3CEPB 4ZEOA 4BTLA 5SV2A 5A5DA 5AVQA 5L3QA 3EG5A 4RD0A 2G83A 3RVLA 1A97A 1GTVA 2XRYA 4QOIA 1RFGE 2PG3A 2QTRA 3FPKA 4EZIA 1QO0A 2QJTA 1UDRA 1VP9A 3X43A 1JQDA 1NJSA 4CV0A 5KWVA 3K8OE 5KU1A 4EARA 1E3TA 3ZV7A 3HJFA 3K9QO 1N3BA 4LW8A 2Y9PB 3PSHA 3NP9A 4LOKA 1FVXA 3GUZA 3OZGA 4P53A 2AVNA 3TIIA 2OQ2A 5JSQA 4GZ3A 1IAVA 1WPGA 1CCWA 3T12A 4J16C 5LJLA 3V80A 1HQDA 2C59A 1CDDA 1BXKA 2P9TA 2V4UA 4QUDA 4G0WA 3FLAA 4C89A 3ZVRA 5CCBA 1SRRA 2I34A 3QUCA 4N03A 3F96A 1BW9A 2PKEA 4OJTA 3STTA 1FL9A 1RRVA 3CH5A 1RWMA 1V47A 3BSSA 2IBSA 2G36A 2JEOA 5AIAA 1Z06A 4IKEA 2O3JA 4AZVA 4DCJA 2EQ5A 3BFKA 3MAGA 4UUPA 3KOMA 4WY2A 4Q3AA 2PUWA 4Q1BA 1GTRA 4Q7EA 3H2JA 4PHHA 4P5DA 1M2OB 1JW9B 2XUAA 4P4UA 3QLUA 5AKLA 4ZAYA 4FHEA 3CVOA 4H7EA 1J9EA 3FUWA 4FYYA 2HMUA 4WNCA 3DBHA 4PIVA 3QNWA 4KREA 2IITA 1QVRA 4NMLA 4ESHA 3D8BA 3E4CA 4UHBA 4I50B 1RYEA 4KQHA 3IMCA 3FPGA 1JR4A 2CK3D 4YAEA 4A6EA 3EPHA 1DP4A 1FXWA 2NZ2A 4WDRA 4LJRA 3CRNA 3AFNA 4L4YA 3DYVA 1IYZA 3TW0A 5LZ5A 1T8RA 2UYCA 3UO8B 2XT0A 1P3JA 1K3TA 5IM4F 3RE1A 3L92A 3UKDA 2EBHX 2VJBA 2ODNA 3A8TA 2MCFA 4RO0A 1Y1QA 1DJNA 5EWMB 2YWDA 1L7BA 3OEHD 4O4IF 3RVSA 5H9WA 1R0XA 2BUBA 4OJYA 2VQSA 4EWLA 3V4VB 4LWPA 1KTVA 2AEFA 2CJFA 2CXXA 4QDKA 5KTOA 2BH9A 5BO5A 2PCLA 5TIIA 3WLIA 4PAWA 3JD0A 1CR6A 4X91A 2E5LB 5SYMA 1Y5NA 1TMOA 5D00A 4QTTB 2C88A 5GM2A 1T4DA 4ID9A 1VMAA 3LGSA 1G21E 4I5GA 4DMRA 5LSAA 3MPOA 4AO7A 1ZK4A 4L8VA 3RK1A 4YS6A 5HS6A 1A9PA 4H3HB 2OGWA 2Q4DA 4CMIA 5CBPA 2QK4A 3NJRA 3VR3A 2WHPB 1E7QA 3OX3A 3RK4A 4X6XA 5DNEA 3WDLA 3KSRA 5A0FA 4KVZA 2VTEA 3INGA 1LH0A 3F5QA 3NPAA 4UDYX 4DADA 1F51E 1GQYA 1THMA 5EE1A 1XZDA 5DI3A 2GT1A 4BKQA 2PGLA 5KNCD 1FBTA 2O4CA 5H83A 1LDNA 2UV8A 4C0AC 4UHHA 2VL7A 3B9BA 2O3QA 1USGA 3KR9A 4TXHA 2EBUA 2B8NA 2B8TA 5KQRA 3HK2A 4X1KA 4MP8A 1PGQA 3HKCA 5IT9A 2CZGA 2VHYA 4MQ5A 1ZI8A 2ZBRA 4K6FA 1EP2B 1XELA 3ORQA 2DBQA 3CS3A 3I1FA 4NMWA 5CHEA 1Y6JA 1T9GR 2AR7A 1UC8A 2O1SA 3LMKA 2OLKA 2C2ZA 4CM4B 2PVSA 3FHJA 2PR7A 2HA4A 1J6UA 3BEOA 4JHLA 3GEMA 4JFRA 3QE3A 1EBBA 3HO8A 1TAUA 3KSZO 1IQUA 2VNIA 2XTJA 4O8ZA 1ZH0A 1MB9A 2NP6A 3OQOA 1XTRA 3RTBA 2PLNA 1AURA 3ER6A 3FIUA 3NH9A 4IM7A 4R2XA 1NULA 5I7OA 4K2HA 3RT9A 2Y71A 1ITZA 4OK6A 4OPMA 3I0NA 5HBRA 2WJHA 3NHSA 4LTDA 2B25A 1IH8A 1WOMA 2F1KA 1KA9H 4DUGA 1NPYA 3KJNA 4Y6PA 3RRZA 1DAOA 1KHTA 1ECLA 1JQJC 5C7LO 1UBCA 3DBIA 1L8AA 2CXPA 3GEBA 1WR8A 2B7CA 4QRDA 1XQVA 4LXYA 2DFPA 1UK7A 3U7HB 5A9TA 1V1MB 4O2AA 1OBCA 3PENA 4WZAB 4D9MA 5EHZA 4DRXB 3OURA 2IYVA 5BURA 1TCUA 1SBCA 3C4QA 2WUDA 4NPAA 3WYFA 1PL6A 4HG2A 3PLNA 3ODGA 3BA6A 3QPAA 1JDBB 4G0XA 1UBJS 3GWZA 3KFVA 3LJKA 3VTFA 5KHOC 2EW2A 2NU9A 4M9ZA 3UCEA 4YMHA 3K70B 3L04A 5EIBD 3RQSA 4L0CA 5C80A 3IVCA 2AG6A 1XO1A 2FR8A 5F7OA 4D9EA 4QTYA 5YASA 5K4HA 1BE6A 1F3LA 2N1BA 1AQYA 5B6PA 1FZTA 3BK1A 3KAPA 2J7PD 1VL5A 3I9OA 4YDSA 3TZEA 2JLQA 4MVJG 1YRHA 4E07A 4ZVMA 3PDIB 3MWLA 3HXLA 1YA4A 2YVKA 3AF5A 3JAKB 3K32A 1Q21A 3KJFA 1BRMA 1FDIA 3RS4A 3K9GA 5IMSA 1SA0A 3A2LA 1GPJA 1G41A 4EUHA 2ORIA 3PFKA 1Y82A 5JRJA 1DFHA 1E77A 2AF3C 1VCIA 1GKYA 1U1EA 2PIDA 3WMWA 2LD4A 5G4KA 1UMBB 2QEQA 1IATA 1VKNA 2WT9A 3ZGXA 5FPKA 5JJ5A 2ZAIA 4Z3OA 1RW4A 5B53A 3UMVA 2FF7A 3JU3A 1UMKA 4HADA 1O0CA 1X1TA 5CG2A 2XYRA 3QLEA 3FHLA 1BD4A 3I76A 1NR7A 3E23A 3OTQA 3SFTA 3TW6A 3VXKA 4DXDA 4EBBA 1NBWB 4GNRA 4C21A 1QNLA 1NLUA 3PJDA 3PUZA 4MGIR 2ZRGA 3KSBC 4ZC1A 3PGXA 2B78A 4U00A 1NDQA 4WBNA 5ITZA 4CM6A 3HB5X 3RVKA 3UK0A 2KLBA 3CRVA 4CEIA 3KELA 4EPTA 1KE2A 1M0SA 1N9KA 2QZ9A 3WYNA 4CKEB 1VMIA 1ZIPA 1U3FA 1FSPA 3AEQB 3OM9A 2DEUA 1ZFNA 1C1XB 2L19A 2G08A 2IUYA 3WLQA 2PUJA 1ZXXA 2D5AA 2W2LA 3FNBA 3PDCA 1M75A 5ALLA 2HUNA 2PZLA 1XRLA 1CX9B 2CVPA 4BV8A 4E22A 3D6FA 1DCTA 4Z1OA 3DXXA 5IABA 3DMGA 1DB3A 3LX6A 4IF4A 4A6XA 4ZGWA 3F73A 1SAYA 1CUEA 1I7SB 5DZSA 4ZTUB 2PBFA 1S2LA 3SR0A 4ZVPA 3FPBA 3TRKA 2Q5LA 2RC6A 1FRNA 2DLCX 3H75A 1NVDA 3F97A 4I1RA 1E4EB 3N0XA 4FMBB 5IBCA 1WV0A 4ZYVA 1O8BA 3CG4A 4GHWA 4MUYA 1MCZA 2VJLA 4KE6A 4FHZA 2IRWA 3ASZA 2WJAA 1R4ZA 1SBZA 1T2UA 4KXNA 5P21A 4D9FA 4EI2A 4RZIA 4S0ZA 3IUNA 3P5SA 4IEFB 3HVRA 2QXTA 1CYEA 1N3YA 2HA2A 3WBFA 1QOPB 5AM1A 5AVRA 3MTJA 1NSYA 2B92A 5JD5A 4KN9S 4LMPA 2J0UB 3IP9A 1VZ2A 3KT3A 4PLVA 5G0UA 4KR3A 4HNRA 3JR7A 1W47A 1E6KA 3BAFA 1Z5OA 1TAQA 1LSJA 3EYAA 2BFFA 3D5EA 3NORA 3SJBA 2XSZD 1VPTA 2OZVA 2CFTA 3RS5A 3IJPA 5C46F 5I7EA 2BEWB 3RUFA 3VMFA 3C14C 4EX7A 5BVHB 3WAKA 3ZDYB 4I50F 4ARSA 1QX3A 4S05A 4DLBA 4OQNA 1FYWA 2H2HA 4JIGA 4JR1A 2IY7A 2OGTA 4MW6A 4WOBA 3I23A 1OE0A 3JVVA 1ZRSA 3C6MA 3QU5A 1BCSA 3IELA 4HS9A 3IIIA 2BE7A 1VSUA 4KYIB 1ANKA 1JJBA 8OHMA 1DAFA 4H1HA 3EYWA 3WC4A 1L8LA 5LBTA 1P6XA 4MYHA 3KVYA 4MHOA 2CXQA 5LIRA 4ZQGA 2P27A 5LU8A 1Z63A 3GQVA 2VATA 1YSCA 3KJQA 2Q3MA 2CLEB 1A5AB 3NHUA 4FWIB 4Q24A 3K96A 2WJ6A 3DMHA 4LYFA 3W6ZA 7MHTA 4ATNA 1RKVA 3GZTB 1UF9A 2PVPA 4Q6WA 1G8FA 3T54A 1VBKA 5FL3A 1FX0A 4BU1A 4XLTA 1XYYA 2WQZA 5DKFA 3WYAA 1WXIA 5TQ2B 3SHQA 3BPSA 2UZ3A 4WNYA 3LKDA 3U4AA 1NF3A 1Z2AA 5CJJA 4XE5A 4FMCF 3DOHA 3TS1A 2WVAA 4R8SA 3VPGA 3EG9A 1X7ZB 3DNMA 5FBHA 4Z2YA 3UVEA 2YY6A 3N8IA 1UUFA 1NVTA 1U2QA 5LUAA 2QP4A 3OOHA 2AXPA 2Q5HA 3PNBA 4MPJA 5EWJB 3UKJA 1KZHA 3E22B 5IWCA 1JFRA 4HGPA 1OLSA 3K94A 5I51A 1CFJA 2ZTLA 4IPTA 1JDZA 2B7BA 3BULA 3HLKA 5LPNA 2YYAA 3G5MA 1XTIA 1EI9A 4QKQA 5IKPA 3A3NA 1GG2A 3O8OA 4K87A 2ZJFA 1LZLA 2WMNB 4HR7A 4HKTA 4XJSA 2YIVX 1DAPA 3HB1A 4PQEA 1V9CA 4CUJA 5B3LA 1XSEA 1KFJB 3L8MA 3HA5A 4Q7LA 3I2GA 3ZVKA 3HHPA 1L7XA 1QQ7A 1CTQA 3H42B 4TXNA 4CKCA 3SYLA 2JH9A 1H0RA 2IYOA 1L5YA 3AUJB 1A9XA 1J20A 2QRJA 1MJGM 2QYOA 1G60A 2CBGA 4MVYA 4PG5A 1GTL1 3GAMA 3NT5A 4QXQA 4V24A 3T9DA 1XFDA 3ZHSA 1IE3A 2PGDA 4DQVA 1EUQA 1KPGA 2NQTA 2PY6A 4NBVA 5BWLA 2R5WA 3DEYX 3MTGA 5AOAA 5CBKA 5JH7A 3VBEA 2OV6A 3OIGA 5KQGA 3E05A 4EHLA 1QO7A 3GCZA 5TQ0B 2R5NA 4BX9A 1O96B 2NAFA 4FOTA 4OHRA 3WS7A 2J07A 3EIWA 1Z7EA 3HCOA 4L6AA 4RTPA 4LZWA 3NANA 4J49A 1MB3A 2HRBA 2HQOA 1OLXB 2HTEA 3A9CA 2XD9A 4ZEMA 1NXOA 3EVEA 1JP7A 2GN2A 4MCJA 3FIJA 4H4EA 4RM3A 5REQA 5ICSA 2BEUA 1PFYA 2ATEA 1F9EA 1GPNA 5D5QA 4EH1A 4H3SA 2QLBA 4EGCB 2FN7A 4MLCA 5BNWA 2OB1A 3U44B 1UOQA 1V16A 2WU1A 4TSFD 4YAOA 2PRKA 3SIRA 4CRWB 5EMLA 1DS6A 2V45A 2X0KA 4KIJA 4B6QA 3DBRA 3PUKA 3K0EA 5JSFA 1EDDA 1KDRA 1ULTA 2E5FA 2OA0A 3UHAA 5LYJB 4DIKA 3CVYA 4QXMA 3KJZA 4FKBA 1SCJA 5T3YA 3WGQA 3ZE8A 4UMDA 2OGUA 4U9HS 3P2OA 4RVDA 5BSFA 5IANA 4E2XA 1TUEA 3UF0A 5H4GA 3QA9A 3CVXA 1XJ0A 5IUNC 1TB4A 3NUGA 4NVRA 4BEJA 4G63A 2ZJ0A 3PVSA 1DWPA 2P65A 3CPJB 3LYUA 2V55B 4GFDA 2DOKA 3UUGA 1RPTA 2XI4A 1F4VA 2DPHA 2RJ3A 1WCWA 2V7EA 3H11B 3C39A 3LX5A 4RH0A 3MT0A 4UOQA 3VISA 5BN1A 2YTZA 3SYKA 2IQ5A 4NOLA 1JEDA 1R8SA 2OBBA 2WZCA 5AH0A 5I7FA 1C50A 2YMPA 2OD9A 1TZKA 1RTKA 2FHSA 2GARA 1LW7A 5IYZA 2F55A 1SELA 3GGOA 4RKEA 3DD5A 4PLTA 1ONSA 3UPDA 2PNJA 3RYCB 4V0KA 4DA4A 5DI9A 1UCFA 3B2EA 3MGBA 2AWOA 4MS3B 2VAMA 3BTVA 3V4PB 1AUQA 1MW9X 4AJEA 2B4KA 1JWAB 4BASA 1HT0A 1GTZA 1KJ9A 3F90A 5JZBA 3K8QA 4KHPB 2G1PA 1NLFA 4LHXA 4AUKA 1ZO8A 4KP7A 2ORED 1DV1A 3AVQA 2G1AA 3OU7A 4OY3A 3FUVA 1EFTA 3R7LA 4FSHA 5TGZA 3MJEA 5IWAB 1AGNA 3UM9A 2Q6VA 4LJSA 4HJXA 1G55A 5IF9A 3OOEA 3Q0TA 1AGYA 2ZBVA 4XPIB 3E0QA 4ZO4A 4Z0NA 5IHPA 1E9RA 4MHTA 4JNCA 1QRTA 1ZJ5A 2OP0A 2POQX 4ZC8A 4N6OA 2P6MA 1F8YA 2WBLC 4G01B 4G8BA 3SEAA 4BX0A 4EL0A 4ZEVA 5L4NA 1VXOA 3KZ1E 5C7IO 3EPKA 1EJ6A 3EIXA 2WW8A 4B3HA 4OQYA 4GYYA 2WYVA 5JJLA 1E9CA 3OPVA 4ZQBA 2WB2A 1XV5A 4PINA 1SXQA 3BMQA 1EDOA 5B55A 4M99A 1EE2A 4EFLA 4L5IA 4ISBA 1MABB 5BV1A 4IDAA 3H0EA 4TTQA 1VCNA 3KFXA 3M9LA 4LXIA 4BNTA 4BE7B 2BMDA 4E5SA 3C0KA 1ZVQA 1ZJ6A 2I2AA 4MAFA 1F14A 1L5VA 3UBTA 2Q0QA 3PQ5A 2P11A 1X1EA 5ALDA 4RFSB 5DYTA 1X9GA 4QBTA 2ET6A 3OT1B 5IRCD 3QLVC 2CNBA 1TC1A 4NP6A 1K89A 4RX1A 2XXAB 2F59A 2QL5A 3DMNA 3EEQA 2WSSA 2V6IA 4ZI5A 4ALNA 3C3MA 3DONA 1AV7A 4HHEA 4KLZA 3QI7A 5DIZA 2PKXA 3LCUA 2WQ7A 4KR0A 1QV9A 4LHEA 4MRSA 1AQUA 2O2CA 2QRGA 4EY4A 5CH5A 1DG9A 3R75A 3AC0A 1XZ8A 3U31A 1K6JA 4Q19A 2GLTA 1YA6A 1G3MA 1D6SA 4RGBA 3A9VA 4WECA 4RETA 4F8JA 1T25A 1DOHA 4QBIA 4U7PB 1PR4A 1RKBA 1RS0A 3AX6A 3QOYA 3QBJA 4AMUA 1Q22A 1Y1PA 3RM3A 4PVCA 3WGOA 3RFVA 3VM6A 2FQQA 5F4ZA 1RXUA 4JASB 2Q6KA 4HRVA 2GXAA 4BN4A 4KDCA 1M8KA 3GBSA 2FEOA 2DPYA 3NBKA 3ZDFA 3QOWA 5EZSA 2VPIA 3IB6A 5L6MB 4KMOA 2A5GA 4UEJA 4URZR 2C2XA 4HUTA 2GHTA 2HCBA 3UV6A 5JAIA 4L9AA 3JWPA 5DHRA 1VBNA 2XQIA 1P73A 1S2DA 3JRXA 1IWOA 3G8AA 2PGAA 4FX5A 4D0GA 5B64A 2ZJ4A 1WB4A 2G1UA 1X1RA 4ZK6A 3O3OB 5FV7A 3W5BA 1ZG3A 3IV6A 3OIFA 3RR2A 3IEVA 1RT9A 1DT5A 4BYMA 1JFTA 4EF4A 1O0SA 3DXYA 2Z5LA 3OC0A 1JJIA 2AN4A 2UZAA 2BKUA 4N1AA 4LYDA 5CK4A 1QIGA 5DSTA 3NT2A 3P4YA 2JEYA 1YONA 1SB8A 4B5KA 3AW9A 4LQLA 5FHQA 5JZ9A 1GPH1 1G2QA 3SI7A 3EGCA 3LVBA 4G0PA 3ILXA 4UBJA 4HDMA 2X40A 1E2GA 1ZNWA 3GRKA 3QBDA 2P4QA 3L1VA 3R74A 3PXBA 1FSGA 3JYPA 2JJ1A 5EJ9A 3L6DA 4FU0A 1KEEA 3BTOA 5JO9A 1NDHA 1I0LA 4QYIA 1CY7A 2G07A 3TEJA 4CIBA 3B82A 4JB0A 2FSHA 5THQA 2VZEA 1JBQA 4C2AA 1OIWA 2I1LA 5B1HA 1XBTA 3ZNNA 4PIPA 2QIOA 5A9SB 5IDXA 2WT8A 4R3UC 5HXAA 4G36A 1G64A 1VLVA 2CMHA 4HQNA 4J91A 3MJ4A 3RU9A 4A0GA 1DNPA 2J87A 3EZXA 4N7RA 5I9LA 4WXMA 2ZRKA 4FOSA 4B45A 1PZMA 1XTUA 1P19A 2GAFA 1EGQA 1UT8A 4OMDA 3FOWA 2RH9B 1PYGA 3LLSA 5CLHA 1ZVKA 1HE4A 2CV0A 1SQ5A 2IOFA 3LZ6A 4KXVA 1SOWA 2VSYA 4GVPA 1JAXA 4LOLA 3GLFA 5FWYB 3WLEA 1A5BB 2VRCA 3M5DA 1U0NA 3U81A 2FGKA 1Z3IX 3VU9A 5KX5F 3BQ9A 5HJEA 2CNLA 4BTVA 2AWNA 3KEFA 3P0JA 1W85A 2BMFA 3LT2A 4RVFA 4R1QA 1UXJA 3VR6A 3VH1A 1VRWA 3AVYA 5FPPA 4MRNA 1GNTA 4PG7A 2JCBA 3BK7A 3LUCA 1CY0A 1I6MA 1SCUB 4GT1A 4MUXA 1GLNA 1WKVA 1D03A 2NSDA 4INOA 3Q7IA 3ZHCA 4KQJA 5IK2D 1PJ3A 2YNMC 1NW4A 5CM9C 4PZDA 4RNDB 3UEOA 1GU7A 2XZPA 4RJTA 1WVIA 3UBMA 3VH3A 5K9ZA 1T0UA 1SHUX 3SYTA 1MB0A 1UJ6A 4ZDJA 1NWHA 3RS3A 4Y98A 2I8CA 2WTAA 4KIGA 2BFEA 3R9XB 4LISA 3UAYA 2VPTA 4RH1A 3T7SA 3JYHA 2WVGA 3ESZA 4B71A 3AILA 3GO4A 3SDSA 2VDUE 421PA 1PKXA 5E6UB 2JJ8A 3CUKA 4E3ZA 4MVJA 4YT4A 1Y1RA 2J3EA 3ZZ0A 1CJUC 2FEAA 3QEMA 4L51A 4RABA 1B1AA 1SBQA 3H1GA 1N6NA 2XCIA