4WCDA

Trypanosoma brucei ptr1 in complex with inhibitor 10
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
250
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 92
structure length 250
sequence length 267
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wcdA00
4XQ9A 3INRA 2IE0A 2R2GA 3CSDA 3HHPA 4AJPA 4MVJE 5ER6A 4ALIA 4ZA2A 2V6BA 1R15A 3MWEB 1E3LA 2C29D 2P2SA 3DMYA 4BQRA 3VDRA 5DP2A 2NACA 5CEEA 1SOVA 1W8DA 3EZLA 3PYMA 2RBEA 5BQFA 1H6BA 2YFHA 1R4MA 2ILTA 4I5EA 3SXPA 2EGHA 2IZZA 4XR4A 1TA4A 2WD7A 1BDMA 4XYMA 3UVEA 1T26A 1DIAA 4DPMA 4F3YA 1YB5A 2HUNA 2ET6A 3QVXA 3BXXA 2GERA 4PGFA 4Z9FA 1O6ZA 2PD6A 4JJIA 4PLCA 3NJ4A 1LEHA 1MFZA 1GCUA 5G4KB 2DTDA 4J1QA 2PFGA 2X0NA 1T4BA 3QV1A 5G0WA 3ICPA 3UUWA 4P22A 5DCYA 1LSSA 1XU9A 3ONEA 5TC4A 5I9LA 3RKUA 4YQZA 3OJLA 5EESA 2I6TA 4BKRA 2NWQA 3G3EA 3LT2A 3T4EA 1RM5A 1CQJA 4IDEA 1IY8A 1I2CA 1C0PA 2PR2A 1XELA 4RL6A 2V6MA 5JYDA 5KWEA 2BFPA 4HFRA 1KS9A 1YL5A 4OXKA 3ENNA 2HK7A 1MUUA 5B4VA 3QWAA 5EERA 4NZ9A 3D7LA 2X5JO 4I9HA 4A26A 3PDJA 4B7CA 4YT4A 4E2YA 1EDZA 4CLHA 4J9VA 3SJUA 2DU8A 1CYDA 3M1LA 3OETA 1ZCJA 4KOAA 2X7HA 5KVSA 2Y1CA 1K0UA 1ENZA 3FWZA 4ZICA 4RF2A 4FFLA 3L07A 3U0BA 4DXHA 5K6AA 1ZEMA 4DQXA 3KETA 1YBAA 3D4NA 4XGKA 1NM5A 2C82A 5IXYA 2FPGA 3JQAA 1ORRA 4R01A 1BRMA 5IZ4A 1H93A 1VM6A 1J0XO 2NTNA 1ZXLA 2DQ4A 4ITUA 4BNVA 3SC4A 4BO4A 3UF0A 1E3JA 3INTA 3ZHXA 4NH4A 3U5TA 1EVYA 1M67A 4O59O 3GRPA 4HFMA 5JC1A 2C2XA 2V6FA 3K2BA 1VL0A 1I3NA 4FFMA 4HADA 2I67A 1E92A 4QUKA 3ST7A 2ZB8A 3I4CA 3F1LA 3Q1LA 4CQMD 4RLSA 2GD1O 4BO6A 4D42A 3CZRA 2A9FA 3EYWA 1Y5MA 1PGNA 4IINA 5IJZA 3I6QA 2QRLA 4CM4A 5G0VA 4UULA 5I7SA 4R5MA 2VTEA 3F47A 1SMKA 3AFNA 4GPD1 4RCVA 1GUZA 1EEHA 3RUDA 2BF7A 4RF5A 4Q9NA 3OF2A 1E3WB 3GLQA 4U6QA 4BS9A 1DB3A 1NAIA 1VI2A 4ZVVA 2DUUA 3OIDA 3ROQA 3FN4A 3PP8A 3VZSA 2JFGA 4ALNA 2IEDA 1YBVA 1M76A 1PL6A 1WW8A 2ZCUA 2CSUA 3VTFA 3VVBA 4RF4A 5LDHA 2ZIZA 3DBHA 5FF9A 3G1TA 4P4LA 4YJGA 4N5LA 1TEHA 5JXWA 3O38A 1H6AA 1B3BA 4RVGA 3JQ7B 3NT4A 2ZJ0A 1Q2XA 3UCFA 3E9MA 2FPPA 4IMRA 4FD3A 1LLQA 4EITA 1EVZA 1CDOA 3NDIA 4J4BA 4BO9A 1G0OA 3LLSA 4QEDA 5BNTA 1P9LA 3GHHA 3ETGA 4YT8A 3MWDB 2QZZA 4UVDA 4BMNA 2P4HX 4MIYA 2GN8A 3ZV4A 3O8QA 3BMNB 2VHXA 3VH2A 5TS3A 1RYDA 4WLNA 3WICA 2QG4A 2EIHA 3K92A 1HT0A 3FNGA 2EF1A 1FDUA 7ADHA 4BGVA 4J0FA 3KEQA 5U1PA 1P1FA 1MG5A 2VYVD 4JROA 2OUIA 3QVOA 3BTUA 4FFNA 4I5DA 4GH5A 5KKAA 3JQFC 1LRLA 4OKNA 3BMOB 2BHLA 1OC2A 4GGOA 3H3FA 4WNCA 1Y5RA 3NT5A 1HETA 4E5NA 4L74A 4GX5A 3W8EA 2JHFA 1CWUA 4O6VA 4DMLA 2CF5A 3OIFA 4DQUA 5AXDA 4WE3A 3D3WA 1AHIA 4QX6A 3DOOA 3ROKA 1Q1NA 3VPHA 2YHIA 3BMQB 1X13A 2JHGA 1MFPA 4U7WA 1NPYA 5JC8A 2O2YA 3WGHA 3OHSX 2Q4BA 3CZMA 4B8ZA 4OJNA 1ZZEA 3DZFA 4IQGA 1OMOA 2DUWA 3WB9A 2IZ1A 4TZKA 2VYVA 4ESOA 4NG5A 3JYPA 5COBA 1HLPA 3RFXA 2RCYA 4BNHA 2W2LD 5ENVA 4Y6PA 1HXHA 3WGOA 3ZWNA 3F3SA 2YZ7A 5ICMA 4D41A 3CMCO 4BKQA 1LNQA 3QWHA 1SEVA 5JDCC 4HNHA 3LT1A 5LDGA 1EMDA 1NR1A 2V6GA 3M2PA 3DAGA 1Z73A 2AXQA 2DM6A 1UDAA 4NJMB 1YRLA 1P3DA 3SX2A 1DBVO 3V1YA 1HEUA 1MC5A 4YWJA 2JFHA 3UXYA 3VH1A 3DFUA 4ZQBA 5F21A 4WCDA 2C5EA 5TGDA 2AEJA 2BI8A 3KLMX 4IQ0A 1ADFA 4R16A 1DIRA 3FWNA 1F8FA 3VKUA 2EG9A 3BMCA 4AL4A 4BNZA 4Z0TA 3FTNA 1K6IA 4JLWA 4RPLA 4D7AA 2V65A 2XF8A 1PWZA 3WWYA 3ZV5A 2FHSA 3KLPX 1P33A 3G17A 2NV6A 3D0OA 2OFPA 3DDNA 1QYVA 4WK6A 3C1OA 4DREA 4YAJA 2BLLA 3DTYA 1YDEA 1BXKA 1Q0HA 2VRCD 3BZUA 5KJ1A 2C7VA 1Q0LA 3H7AA 1YL7A 1BVUA 4TRRA 1HF3A 2EXXA 2OHXA 4BB5A 5COQA 2C59A 3GFBA 4XDZA 4CM8A 1CEQA 3C85A 4ZU3A 4XDYA 4XGIA 3PIIA 4H16A 5JAMA 2QYSA 4EW6A 3OQ6A 4S1VA 4LISA 3U9LA 2P5YA 1R12A 3QY9A 1P1RA 5IAAA 2OP0A 1BXGB 3S55A 3ZNOA 1AXGA 1MV8A 3AFMA 5TIIA 4KUHA 2WWRA 4RPGA 4EDFA 3LC2O 4AICA 4AJJA 2OL4A 1BMDA 2AQKA 2EP7A 2J8ZA 4A2CA 2AE2A 4CV0A 2X22A 4RZHA 1WVGA 1X7DA 4CMIB 2E37A 4MVJM 4YR9A 1JKJA 1ZK0A 3FR7A 4CR8A 1VPDA 1WZIA 2DBZA 3F9IA 3RUEA 3JQ8B 3R3SA 3MOIA 8LDHA 4CL8A 3ETDA 4JP2A 4A7PA 3GMSA 1OFGA 1XYGA 3P2OA 4IGEA 4QTZA 3LVFO 5IN5A 1VE9A 3D4OA 5L4SA 1QV6A 1ZNQO 2PZMA 3PHJA 4GMGA 3JD0A 4KTVE 1E5LA 2EKLA 1W4ZA 1P77A 4GSLA 1TXGA 1E1MA 3KV3O 1YE3A 2A94A 2Q49A 3JD4A 1QSGA 5ENDA 3S2FA 3WBBA 4BVAA 9LDTA 4BGEA 1U4SA 3T7EA 5JW6A 4FFPA 3DBVO 2P4QA 2F1KA 4IJUA 1PR9A 1LRKA 1EDOA 1V3TA 4LCJA 4BNUA 2WTBA 2XAAA 7MDHA 2WE8A 4IJWA 4TVOA 3GT0A 1MC4A 4EUHA 4GQAA 3AY3A 4Y6SA 2ZTUA 2I99A 3GVCA 3WLEA 2CVZA 2Q1TA 1XWFA 3RJ9A 4PG5A 4PLFA 4KMSA 1DC3A 1E7MA 1BDBA 1KOLA 3FNEA 3HQ4O 3GC6A 4R5HA 2Q3EA 1JN0A 3JQDA 1WDKA 5CG1A 1AXEA 1E7YA 2IRWA 2YYYA 4TRJA 5AVOA 3S2GA 2FZWA 3LDHA 4XRRA 1T4DA 1YS4A 1FK8A 4PLTA 1V6AA 4YAKA 2Y93A 1C0KA 2B35A 4FN4A 2PD4A 4BNGA 2J3IA 1T25A 3WX0A 3PQEA 4A27A 4KQXA 5U4QA 4B4VA 1C3VA 4J0EA 3KYCA 3ANNA 3BTOA 1XCBA 2YDYA 3VZPA 2CDCA 4RDHA 3W6ZA 5HS4A 4WEQA 1H6CA 4EI2A 4A03A 4YT2A 3F46A 3AI3A 3ZWCA 1Q7CA 5TT1A 3E03A 3HDJA 5HWSA 1AGNA 1ZBQA 1ZMOA 3PHLA 3QRWA 4MP8A 3F6YA 1V9LA 4FFOA 3MTGA 4GWKA 3WSWA 4DC0A 3S8MA 4OOEA 3AU9A 4Q3BA 2EKPA 3OH8A 3U3XA 3ORFA 3PIDA 4TZTA 2QYTA 4J2OA 1UXKA 4XEHA 3HFSA 2JAPA 4UUMA 3TFOA 3GF4A 3H5NA 4FS3A 1XEAA 1N1GA 2ZCVA 3IOYA 4KTTE 1DFHA 1OOEA 2C20A 2X5KO 4JX8A 1YH3A 4WOKA 1PJTA 1UXGA 5JDCA 1EK5A 3HDQA 4BL5A 2JCYA 4U0KA 1H5QA 1D3AA 2RHCA 4ND4A 4R41A 1IPFA 5KNLA 1DRVA 4J9UE 1LSOA 5F1PA 1HDCA 3H5AA 4CR7A 3GFGA 3GUYA 1XQ1A 3RSHA 5BNIA 1TLTA 3N74A 4CLEA 1XG5A 1QRRA 3ZH2A 1K89A 4R1SA 2AQ8A 3ETEA 1BHSA 4NIMA 4D3DA 4BO3A 2AHRA 3GAFA 1F12A 4CM5A 4CM4B 3ITDA 2OXIA 1UJMA 1Z7EA 4E4YA 3HDYA 1B26A 1PZFA 3NGXA 3GAZA 4UREA 4A10A 4BGUA 4PZCA 2FZEA 3GGPA 4FOSA 4XCVA 2HO5A 3PWZA 2P68A 3KRTA 5CDUA 1R0LA 3AUAA 4RGBA 2B5VA 2X6TA 3DAPA 3DXFA 1A27A 4IXWA 1ZSNA 1M2WA 3IQDB 4BV9A 5H82A 2GLXA 1UDCA 3WMWA 4EUEA 1C1XA 2YJZA 4BHTA 4KUEA 1N1EA 4J1TA 2IYOA 3DBHB 3C3XA 3DZIA 2HMSA 2Q2QA 3I52A 3JD2A 3PXXA 1ADCA 1U9JA 4ALJA 4N7RA 4CR6A 3U4CA 4RV9A 3LK7A 1R0SA 2PZLA 1A7KA 5F3RA 5C7OO 1E6UA 5K6AC 3DZGA 4LSWA 3DWFA 1X7GA 1LC3A 3KZVA 3E5MA 4BNYA 5CDTA 2PY6A 4NU5A 4PFJA 3ENKA 4RVUA 1DJNA 5DZSA 1LUAA 1PS0A 4IDAA 1I24A 1KC3A 1R4NA 1ZMTA 2PGJA 4AJIA 3R6DA 4D45A 1EVIA 1GPDG 3W1VA 4UVHA 1JKFA 1M6WA 2C0CA 4CMBA 5L95A 4MO2A 3QWFA 4RVHA 3PJEA 1EUZA 2VWPA 1ISJA 4Z6KA 2FN7A 4WNIA 1JVBA 1DC4A 3JYOA 4NR0A 1GFSA 2B5WA 3GGGA 3DBLA 4HUJA 3ANLA 4CV3A 1DPGA 2IEBA 1I3MA 1YB1A 3DO5A 4FQ8A 1NXQA 2HMWA 2VWQA 4HX5A 5DNAA 4IIVA 1E3IA 1HYGA 4BNXA 1Y8QA 4TVBA 1LDMA 1N92A 1ADGA 1JU9A 4CM9D 3B20A 4QT0A 2HK9A 1GQYA 3CMMA 3Q9NA 5B37A 2BELA 5DP1A 1R16A 1N2SA 4CV1A 1J6UA 3RASA 2FPIA 1KY4A 1G1AA 1NP3A 1PJ3A 2D1YA 4ZQGA 3RBVA 3VOSA 2H5LA 2PH3A 1C14A 3OJ0A 3TRIA 1PQPA 3D3EA 4WCFA 5T57A 3TN7A 2LDBA 4MJLA 3T4XA 2PD3A 3CINA 2WSBA 4D0RA 4L4SA 1U3VA 1B15A 3WS7A 1X14A 3Q2IA 1FMCA 4B3IA 3K9QO 1DC5A 4HKTA 1KEWA 2FR1A 2VOEA 1NHGA 3EGOA 4DGSA 2GZ3A 3B1FA 3ZWAA 5GMOA 3TZCA 2ZKLA 4DYVA 2X0RA 5I9MA 3RI3A 1UAGA 1U3WA 5EQDA 2PGLA 4FJ0A 1H9BA 4ND3A 4CUZA 1PU2A 3PDUA 3PFWO 5THQA 5T5QA 5I8WA 4M54A 3RC7A 4RPHA 3NX4A 3QVWA 1B2LA 1LJ8A 3LF2A 4G81A 3GVHA 4YAIA 5GY7A 4JP3A 5K0ZA 3L4SO 1MXFA 1YJ8A 1ML3A 2XOXA 1N9GB 2HRZA 1U7HA 1DOHA 4UEKA 1ZK3A 4E33A 4U0JA 1WDMA 2EJWA 1VKNA 3K96A 1SNYA 1BG6A 3MJ4A 4L4RA 1DIGA 1YQGA 1I3LA 4II2A 2JD0A 5JE8A 2B37A 2D0IA 1Q7BA 4L0QA 3WGQA 2ZTLA 3GUCA 3LC7O 4M86A 1GZ6A 3JD1A 4L73A 3ZU5A 1E3EA 4WASA 3HB5X 4E5MA 4CLRA 4S3MA 3HSKA 1WZEA 3GOHA 4KDEA 5C5IA 3BYZA 4NBUA 3WR5A 4I9UA 5KJCA 4E12A 4N5MA 3TZHA 1YKFA 2X4GA 1M66A 1HSZA 2CNBA 4OXNA 2HQ1A 2UV8A 2EV9A 5A04A 3NTQA 4WLFA 3WGIA 3DFZA 3WFIA 1Z7BA 1WPQA 4BUCA 1ENYA 2AEMA 4NBRA 3QVTA 5IZCA 1WWKA 4BKUA 4AJNA 3WMXA 3RC9A 4R4JA 2HDHA 1XGKA 3L9XA 3RUHA 1CETA 3VPSA 3ICCA 4MVJI 3ZWPA 1SB9A 1HE4A 5COAA 2VOJA 3U4IA 4R69A 5CEJA 4CMKA 4TKMA 3VHRA 2Y67A 3AJRA 2FOIA 3OQ1A 2WE7A 1C1DB 1LLCA 2TMDA 3EW7A 4R54A 4IS3A 3KYDA 4YYZA 3JQAD 2ZK7A 5DDIP 4BO1A 3LLVA 5FI3A 1LTHR 4GVXA 3CIFA 5GZ1A 2VZ0A 2IXBA 4EZBA 3KTDA 4XZ3A 2BRUA 4XWYA 1HYHA 2I3GA 3EDMA 2VHWA 4CLDA 4FJ2A 4NFYA 3GR6A 5JAZA 2FSVA 1MB4A 1XSEA 4D46A 2VT2A 4EEZA 2C2YA 4CQLB 5AXAA 4ALMA 4BMVA 2C07A 3FPLA 3O03A 3DMTA 3OP4A 5JLAA 3L0DA 4E6PA 1BGVA 5A9SA 3K8ZA 1E1KA 2Y66A 2QHXA 3OEYA 5L7WA 4BNJA 2FWMX 2AQHA 1JQBA 5ILOA 4KQWA 2H63A 3FBTA 5JMPA 1DRUA 3OEWA 1ULUA 2VCYA 2YHUA 5G4LA 4IDCA 4PCVA 2VWGA 3FD8A 4BNIA 4MP3A 4D3FA 1HRDA 3WGZA 4D0SA 5IFLA 4Z0PA 3EAGA 1X0VA 4NBVA 5IXSA 1SPXA 3PHGA 3ZW8A 4W6ZA 4WECA 4WLOA 1RM0A 4MVJH 1HE2A 1QMGA 3GNQA 5FI5A 4JBIA 4XRGA 3VVCA 4AJ2A 5T8KA 1UZMA 3A28A 2O7QA 1X7HA 2OP1A 1U5AA 4BKPA 4DMMA 2ZB4A 3AU8A 4KUGA 1PJ2A 4YA6A 3DHNA 5CDYA 5ITWA 4OQYA 5AXCA 4UAGA 3HB4X 3ZW9A 5B1YA 4XQGA 1ZSVA 2OGUA 3OJOA 1PS8A 4F45A 1W73A 4CMCA 4AJ1A 4H3VA 5ER9A 4LCEA 5JFOA 4GX1A 1HDYA 2VHYA 1Y8RB 4TRNA 3STHA 3QP9A 2B4RO 3RFTA 2GO1A 3RUAA 2BGMA 4WPGA 4IJVA 3W4KA 3C1AA 4QQRA 1OAAA 3DB2A 5HTOA 1E77A 3BA1A 1VJ1A 4AJHA 3FSRA 3OJFA 3PZRA 1P1HA 1L7EA 5AQ1A 4FC6A 3JQGA 4INAA 4FC7A 1XU7A 4OHUA 1DSSG 2DBRA 3RUIA 3JYLA 3D1LA 3U4HA 4J7UA 3GRKA 4NPCA 3ZWYA 3G79A 5L51A 2I66A 4UVIA 3NTOA 4NBWA 1V3UA 5JCJA 4HNGA 1ENOA 3CEAA 3IJRA 4J43A 1NQOA 3H65A 3FNHA 4IDFA 4RZIA 2IODA 1JWAB 2Q46A 2VN8A 3WYBA 3I5MA 2NU6A 3U62A 2QRKA 4RQUA 1E6EA 2YDXA 3E1KA 4GBJA 1V35A 1LA2A 1CF2O 5I7VA 1FF9A 1PGQA 3KM0A 3OQBA 1BW9A 5A5EA 1DAPA 4IM7A 3NAQA 1T2EA 3D5QA 1MXHA 3DHYA 3QLJA 4EJ0A 5L40A 4BNWA 4JNKA 2H1SA 4EGFA 3VH4A 4Q3NA 2B36A 1NWHA 4GGPA 4LMRA 1Q0QA 4EYEA 1MLDA 4OKIA 4RLHA 4B79A 5BSHA 3LC1O 3L6EA 2HLPA 4YJHB 1LBEA 5TT0A 2PK3A 3PLRA 1SC6A 2HK8A 2G1UA 1JLLA 3H9JA 5TX7A 3S2EA 3H9GA 1EK6A 1GADO 3OICA 3DBRA 2JCXA 2X58A 5KTKA 1Q7GA 3GVPA 2CDBA 3IDSA 1A4UA 3CE6A 2D3TA 1PJ4A 3H4VA 4OQZA 1M6HA 2P9GA 4YRDA 4YT5A 5JAIA 3PGJA 3K2EA 2X23A 4BGIA 3I9LA 5ITVA 1HE5A 2VYNA 3UHAA 3Q2KA 4PLZA 4Y6RA 4PRKA 1R4NB 2JFFA 5TJHA 2HSDA 2QIOA 1T2FA 3ZWBA 3E9NA 5JY1A 3ZV3A 2WEKA 3I3OA 1GYRA 3SVTA 1Y6JA 1RJWA 4TRMA 3K5PA 3MJSA 4BNNA 3PYLA 1FJHA 4XGNA 1UAYA 1JWBB 1UH5A 4R51A 2I65A 3ZDFA 4PN3A 3BIOA 3AUTA 3B1KA 2Z1MA 3ADPA 4LRSB 1NHWA 2I76A 4JQCA 3ANMA 5G2OA 1JVSA 2X8LA 3RROA 4IPTA 4CM6A 1FXSA 2F00A 1X1TA 2EEZA 3WYEA 1PL8A 3F5SA 1XLTA 2B83A 4IZIA 2GZ2A 5LCXA 2P91A 3VDQA 1GR0A 2GN9A 3LF1A 1I2BA 4IGFA 4TKLA 4YJFA 4YAEA 4LMPA 1A72A 3D5TA 5CEFA 2OOSA 5K9ZA 2A92A 3ADOA 1EZ4A 2UVDA 1QKIA 3BAZA 3LT0A 5EPOA 3OJEA 3UCXA 4MVJF 1EUDA 1P0CA 3CKYA 3ZGYA 3EZYA 1UP7A 2ZYGA 4R3WA 4XIYA 1D4FA 2VZ8A 2Y0EA 4KZPA 3IUPA 4YDRA 1KETA 3Q6IA 2CZCA 5KCZA 1ZJYA 2Z1NA 3NT2A 4I08A 4U8GA 3V2GA 5KJFA 1PS9A 1A7AA 4J4HA 1YQDA 4MVJA 5G0TA 4J3FA 3IJPA 3SLGA 1GU7A 3GH3A 4B4OA 1RM4A 4ZRMA 4QXMA 4CPDA 5BSEA 5GZ3A 1TT5A 3VZRA 2O4CA 1IULA 4HXYA 5CFZA 4RDIA 4YQYA 3VH3A 3QA9A 4OSOA 2GRAA 1ULSA 2IYPA 3AM5A 4Z3DA 2WMDA 3AY6A 3WIEA 3U09A 4I9NA 3P7MA 4NBTA 3GEMA 1O95A 3L4BC 3WGTA 1HZZA 5CP8A 1KYQA 3UKOA 1WMAA 4DLAA 1ISIA 2OORA 3K6JA 5A3VA 3GZNB 2UAGA 4BO7A 4CLOA 1LI4A 1XKQA 4HWKA 5G4KA 3TOZA 2H9IA 2HU2A 4UUNA 3FHLA 1O0SA 4XB1A 4PLGA 5ES3A 2J6IA 3DOJA 4GWGA 1ZVMA 1PZHA 2PKRA 2E4AA 5L45A 1S6YA 3RUCA 1YB4A 3D4PA 3RU9A 3ON5A 3PWKA 3GY0A 2JJYA 1T1SA 4XB2A 1K5HA 3C7CB 3Q9UA 4R9RA 1R4MB 1X15A 4B7XA 1JKIA 1PSDA 5EMHA 1H9AA 4CMEA 2WD7B 4JBHA 1VJ0A 1ZUD1 2NQTA 3LU1A 1B7GO 1NAHA 1TB4A 4NHEA 1ZKMA 5FYDA 2CY0A 2HMVA 1WDLA 5C7LO 4E2XA 3GHYA 3JQEA 1NFRA 1PGPA 4DL9A 4E0BA 4WCFC 5TNXA 3DZHA 4IJKA 1IB6A 1ZJZA 2X0JA 5HRUA 4RPJA 1G6KA 1NTOA 1VSVA 2GUGA 3GVIA 1NX6A 3H9QA 4GLOA 2ZYAA 1T2AA 1O9BA 2BFMA 5TQVA 3VPFA 3ZWWA 3QIVA 4FBGA 1IHYA 1PJQA 4UEJA 1LSJA 3KYDB 4F6LA 1SCUA 5T67A 4ALKA 2DLDA 1P1JA 3PGXA 1OBFO 5DBFA 2CF6A 1F8GA 4IZHA 4YACA 1NASA 3R0IA 1DLJA 1IHXA 3MJCA 4J7CA 2EGGA 2DBQA 1PEDA 4ZD6A 1ZK1A 1MGOA 5CDSA 2NVUA 5BR7A 1I32A 3WTCA 1JTVA 1KERA 2Z5LA 4PZEA 3LSYA 3RWBA 4BNLA 3FPCA 5A5FA 4CJXA 1YXMA 4M8SA 1ZK4A 4GI2A 3WOHA 1PZEA 5IN4A 1VLLA 3NDRA 3NV9A 1KVQA 3VZQA 1K2WA 2FSSA 4EJ6A 3EY4A 3PFFA 2GNAA 2UDPA 3FRJA 4FB5A 1FDWA 3JQAB 1N7GA 3QVSA 5A4DA 4ALLA 1E1NA 3JV7A 4K6CA 1ZFNA 4F46A 4L9RA 3JTMA 5IG2A 2Y1FA 4R1UA 1E3WA 1PQUA 4J1SA 5JO9A 2A35A 3VAZA 4W82A 5F1OA 1GZ4A 2YQ5A 3B1JA 3HZZA 3ULKA 3TZKA 4CUKA 2DFVA 1GYQA 5JPIA 3WIDA 4WLEA 5BSFA 3I9MA 3FI9A 3H2ZA 1I2ZA 4W4TA 2Y99A 4IIUA 3TQHA 1V0JA 4DRYA 5IZCC 1U28A 3SBOA 3P5SA 2BI7A 3G0OA 3ROMA 5L7TA 1PJBA 3JQ7A 3TNLA 4FSHA 2HJSA 3TL2A 2J5KA 3S2IA 5DOVA 2AE1A 3WWZA 1RM3A 2CDAA 2OBNA 2P9EA 1DHRA 4FIZA 4M55A 5F5NA 3KYBA 1NFQA 1YQXA 2VHVA 4QO7A 1ISFA 2DPGA 3OA2A 4OH1A 4U6SA 3ZU3A 6LDHA 4QO8A 1VL8A 4HY3A 3C8MA 1UXHA 3BMNA 2G76A 3E9QA 3JD3A 2NNLD 1ADBA 1ZXBA 3PI7A 3H2SA 5JYEA 3BTSA 5KKCA 2PZJA 4N18A 2X9VA 4R1TA 3UH1A 4ND2A 5T6BA 1PL7A 2PLAA 4W7HA 5KJEA 1AHHA 3OMLA 3O4RA 3NJ8A 1GPJA 4YJGB 1B8UA 3DC2A 1E7RA 3DMTC 2NTVA 2EJVA 3RBZA 1T2CA 2ZTVA 2G0TA 5F1KA 4HFNA 4AJEA 3FCOA 2RH4A 4PZDA 2WJPA 4L75A 1Y7TA 1PZGA 4NK5A 4ND5A 2YY7A 4Q3AA 4E30A 5JS6A 1HDZA 2D5CA 4DPKA 4TQGA 4R68A 5TF4A 1ISHA 4EUFA 1SO8A 5ICSA 1GV1A 2RAFA 5I7EA 2C5AA 2FMUA 3O8QB 1U1IA 4DIBA 3UOGA 1LSUA 3E8XA 1DFIA 3L4BA 1EQ2A 3PJGA 5GZ6A 3BMQA 3WTBA 5L9AA 5THKA 4GX0A 2OBYA 2ZATA 4XIJA 1VC2A 1U8FO 4UUOA 1J4AA 5DBIA 5H83A 4YBZA 1B8VA 1EQUA 5DN9A 5T8KC 1UXIA 5CPFA 4EBFA 2LDXA 1Z75A 2BFAA 3TL3A 2I5PO 4P4NA 3RIHA 2D8AA 2GN6A 2PGDA 3C1TA 4OIMA 4XJSA 4DUPA 1ARZA 3X2FA 4Y9DA 2H6EA 4JXKA 3GMDA 3GPDG 2XXJA 3WG9A 5FEUA 1SBYA 1CRWG 1G0NA 3AOGA 1H0KA 1HKUA 5EIOA 3C7AA 5FWNA 3D3WB 3IMFA 3GEGA 2YHIB 4URFA 3E48A 1O8CA 1HE3A 4FGWA 1Z6ZA 3PK0A 3KBOA 3KVOA 1PJCA 2O3QA 3AI2A 4WOJA 4BNTA 2Y1DA 2VNAA 4RVFA 1H2BA 5JAQA 3RKRA 3ASVA 1XQ6A 2O3JA 4YRBA 2X0IA 2PA3A 1YVEI 4GKVA 1EUCA 1U3UA 1XHLA 3MOGA 2GGSA 5KVQA 4Y98A 4PLHA 4DYDA 2WDZA 5A9RA 5IDWA 3I9NA 3M1AA 4NQZA 2Q2VA 1XIVA 3HN7A 3OA0A 3JYNA 5AOVA 5TRTA 2G17A 3WJ7A 1OI7A 1DHTA 1HDRA 4XYGA 2DFDA 4JBGA 1HDGO 2DTXA 2HKIA 1IL0A 3JQCA 2YQ4A 1LLUA 1HLDA 1NNUA 4NNJA 4E31A 2DT5A 3RCBA 1NPTO 4BOYA 4CM3A 1W0CA 3PQDA 2SCUA 5JO0A 1GCOA 3U49A 2O3SA 3NKLA 3BMCB 2NM0A 4BNKA 5I9NA 3V1UA 1I33A 2GPTA 1D7OA 4HP8A 1HL3A 3C7DB 1EBUA 1BXGA 1CJCA 1KC1A 1KVUA 3WXBA 3EC7A 3TSCA 1DIBA 4KWIA 2P9CA 5DF1A 4PG4A 4MIEA 2BGLA 2NSDA 1PGJA 2DBVO 2UYYA 2W90A 3FF4A 1NR7A 4Q3EA 1WP4A 2WYWA 3ZNPA 1B16A 4GSKA 3KHUA 4R3NA 3Q11A 2EP5A 3SEFA 4BNFA 3CPSA 4PLVA 1QV7A 3RFVA 1QYDA 2OMEA 4JIGA 4ID9A 5CPBA 4FGSA 3RUFA 1E7QA 2EKQA 3JQ8A 3RAJA 1H2HA 2J3JA 4BKOA 4CM8B 1IYZA 4Z9YA 3HE3A 3BHMA 4I5FA 3NTRA 3GVXA 2BMAA 2O3RA 2HRBA 2ZQZA 4J90A 1BTOA 3N7UA 2X1HA 4K6FA 1KVSA 1TT5B 4BQPA 3EUWA 3HUDA 5B12A 1I01A 3OM9A 3PTZA 4IBOA 3I23A 1IOLA 1PQWA 4TROA 2W98A 3MCVA 4YB8A 1LRJA 2O48X 1W6UA 3UICA 2Y0CA 3COSA 3P19A 1JAYA 2I3AA 3MJEA 1ZO8A 1ISGA 3S1LA 2DVMA 2NTJA 3T7CA 3HG7A 3WQSB 4DLLA 4BB6A 4CM7A 3ONDA 4K9DA 2HCTA 4J2HA 1N8KA 1OZAA 2QZ9A 5JCXA 3GEDA 4CLOB 3ZN2A 5MGBA 1P74A 2DPHA 4II3A 4AJOA 4BO0A 2CD9A 4JCOA 5EJ2A 1F14A 1K3TA 3RVDA 1GQ2A 1YBMA 3HN2A 4PRLA 4FFRA 5F5LA 3RD5A 3HDHA 1MA0A 4DIFA 2G82A 5A1TA 1I8TA 3X2EA 4KWHA 3IP3A 1DDOA 3NUGA 4DPLA 2NQ8A 3V2UA 2NU8A 4OMUA 2EERA 3IKVA 3KXDA 2JD1A 1GEEA 1Y81A 1GEGA 2WM3A 3TZQA 2O3TA 4WGGA 3A4VA 4PG8A 5EN4A 2B4QA 4E5YA 1YJQA 1WAMA 3KB6A 1UXJA 3ZHZA 4B8WA 4F6CA 5C7IO 3F1KA 3QQPA 3OBBA 4J49A 1BSVA 4E5PA 3IUSA 5IDQA 3Q0EA 2ZYDA 4BNMA 1QYWA 3W4IA 2Y68A 3UFXA 1QYCA 4L4XA 4WLVA 3W8DA 4NU6A 3K73O 1GY8A 4HV4A 1LX6A 4LVCA 1JAXA 4AJKA 1A4IA 2ZQYA 2HMTA 4Q3CA 1UP4A 4CM1A 3OFSA 4ZQEA 1V8BA 2YV3A 4W9NC 2DKNA 4DBZA 3I9OA 4LK3A 1KVRA 2PTGA 4WKGA 2PKQO 3ZCXA 4BO5A 4PLYA 4E3ZA 5BNFA 3KYCB 3H8VA 4KP7A 3PEFA 3RU7A 4OYRA 1ISMA 4KDFA 2NVUB 2FR0A 1ONPA 4DA9A 2B0JA 4IY1A 5JCJD 1R0KA 1SZJG 2J5QA 1SOWA 3AOEC 3HADA 3E82A 2PV7A 4G65A 4LW8A 4RVDA 1PTJA 3V5NA 4A73A 3KSDO 3GZ4A 2J3HA 1J5PA 1UZLA 4OO3A 1LQUA 1NBOA 3PHHA 3UW3A 1PX0A 2AW5A 3INGA 2C7GA 4LVUA 1OC4A 3PYXA 5EL0A 1KEPA 3DOCA 3UCEA 1IE3A 3L6DA 1LDNA 4GLLA 1F0YA 2ZTMA 4CMEC 4YRAA 1YO6A 3VTZA 3TFQA 3WGGA 1NQAO 2HAEA 3P2YA 2O7SA 4YEDA 3UN1A 1SB8A 3IS3A 1PJSA 2PH5A 3ZHBA 2BFOA 3A1NA 3O26A 3WNQA 2X5OA 4WJZA 1YDWA 4J16A 4D43A 1YOVA 5H81A 3A14A 2RH8A 4BIIA 2W2KA 1BVRA 4CQMA 1U4OA 2O2SA 3JQBA 5DCUA 4CUJA 5KJ6A 4IMPA 5JY6A 2Y1OA 3A9WA 2ZB3A 1R37A 5DBGA 4NI5A 3W6UA 5AXBA 3C24A 3GN1A 2D4AA 3ZNQA 1QG6A 2ZB7A 4P38A 4ZQFA 4ZJUA 3WQRA 2Q1WA 5JDIA 2E6UX 4Z3KA 3AUUA 2X9NA 1UR5A 4TSKA 4AJLA 4DWVA 4OAQA 3PJFA 5A03A 1FDVA 1S7CA 2CVQA 5C3MA 4RORA 2VYND 1ZH8A 1DJQA 3CTMA 4MKXA 4C7JA 4CV2A 2O4UX 3H6KA 1M75A 2FR8A 1P31A 2G5CA 3ZWXA 2B4TO 2CFCA 4IQ8A 3B70A 1LQTA 1RYEA 3LZ6A 4D79A 2R00C 4IXTA 3TF5A 1C1XB 3A06A 1WLYA 1ZEJA 2I9PA 5C37A 3PVZA 4E13A 4NJOA 4IS2A 4IDBA 1A71A 1PR3A 5TJ9A 3QWBA 3EMKA 1QORA 3BTVA 3SJ7A 4NK4A 1X1EA 1XR3A 2X86A 5U9CA 3MZ0A 3GDFA 2A4KA 2VNSA 1D8AA 1PGOA 4I1IA 4J4TA 2JCVA 4HBGA 4MKRA 1UUFA 2PWZA 3HWRA 3KUXA 3V8BA 4CMAA 2XXBA 4J1NA 4C4OA 1IZ9A 4EJMA 3RBXA 3LQFA 1PWXA 3EVTA 4Q3DA 3IIEA 4XQCA 5G0SA 4DTIA 5L4NA 4IUYA 3QE3A 4BV8A 5JMWA 3ZWOA 4ZN6A 5DCWA 4H7PA 3I9JA 3VC7A 3MJTA 1KVTA 3DBLB 1QLHA 3GNTA 1SEPA 1RKXA 1KBZA 4D3SA 5I7FA 5TLSA 1TI7A 1UP6A 4PVDA 1HZJA 1ZSYA 4U5QA 4HFJA 1XDWA 1NVMB 3KSZO 3GK3A 3ZZNA 2Z95A 2FRDA 1C0LA 1TVEA 1Y8QB 3ZU2A 3H9UA 2FY8A 4DVJA 5A9TA 2O50A 3BHJA 3K31A 4MVJD 2D59A 1O5IA 1IUKA 2BGKA 1KIFA 4FJ1A 1U7TA 1C0IA 1HTBA 1VKOA 3PHIA 4A5OA 3JQ6A 3QSGA 5IDYA 2AA3A 4E5KA 1NFFA 5EINA 3EHEA 2HJRA 4PLPA 4MP6A 4AVYA 3QHAA 2VQ3A 1KY5A 3M2TA 1TT7A 1EFKA 4I5GA 3HFGA 3FTPA 1N9GA 4YTEA 4WCFB 4Q39A 4E2WA 4AJ4A 4FR5A 2XPCA 4YXFA 5L53A 3KO8A 4TWRA 2QW8A 1LXCA 3VPXA 2W2LA 4LN1A 1AN9A 1QR6A 3PQFA 2BKAA 2V7PA 4YVFA 2VHZA 4G5HA 3W4JA 2OZPA 3O9ZA 3I1JA 4W9NA 4XKJA 2C54A 4UVGA 4E2ZA 4NFSA 2Q1UA 3ABIA 2GF2A 3IL2A 4B3JA 3DAFA 2VUSA 1LLDA 2B69A 4JJFA 4XYEA 3PRJA 2Q99A 3JCZA 1XA0A 1GD1O 1GUYA 3KOUA 3R1IA 4MVJG 4RPKA 1A9ZA 4ZGWA 2YV2A 1I0ZA 1E0DA 1T1RA 3NEPX 3HJAA 1L7DA 2NVWA 2QQ5A 4ZHSA 1DFGA 2AG5A 3D64A 2RIRA 1GQQA 3AOEA 4R9SA 4RO0A 4XYBA 4DQVA 4DIOA 3BHIA 1AE1A 1I5RA 2Y1GA 3PPIA 2Q45A 3TOXA 1YL6A 2IXAA 1DAOA 1ID1A 1HDXA 1QYXA 4LRTB 1GDHA 3NYWA 3ASUA 1MP0A 1VRWA 4L8VA 4LGVA 1P1IA 4W99A 4CMGA 4FOOA 3DZBA 1CERA 3ZU4A 4CLRB 3WGYA 1C1DA 4ILKA 4MOWA 3I83A 2VRCA 4MINA 1GTMA 2VTDA 3FR8A 1ONNA 4BO2A 1NQTA 1GV0A 3WLFA 4B3HA 5HM8A 2NUAA 3TWOA 2P5UA 1I3KA 1X0XA 2UUPA 4IDGA 4CMHA 2NU7A 3DHEA 2UUOA 1VL6A 2JD2A 1GZ3A 4R1NA 3I9KA 4GVLA 5KVVA 4J7XA 2D5AA 3K30A 2NU9A 3TDKA 2EHDA 4QFCA 3PZBA 4FPXA 2Q4EA 4CQLA 5G0UA 1KEUA 4O63O 3FNFA 3SC6A 1WNTA 2BD0A 2VUTA 4J91A 3DTTA 4JK3A 5HA5A 3QWIA 1YGYA 2VT3A 4PLWA 3AI1A 1K6JA 2IDZA 2OO5A 2YUTA 2NLOA 3DEYX 1U8XX 4L76A 2EWMA 3LT4A 1N7HA 1NVTA 4RQTA 1Y9EA 3ZI0A 4CL3A 4MPDA 1ZW1A 4WLUA 1D1TA 4J6FA 3IAHA 2R6JA 5B4TA 1VSUA 3RJ5A 1V3VA 1FDSA 1B8PA 1O94A 4I8XA 1UZNA 4XJTA 4QECA 5J23A 1EVJA 1BXZA 3PLNA 1R6DA 3KSUA 2R00A 2YFQA 3GDGA 5JNLA 1EE9A 2JL1A 3TZ6A 3U4DA 3WSVA 4ZRNA 1GYPA 1EBFA 2Y0DA 4YAGA 4FCCA 1LDEA 4JGBA 3SLKA 3RQSA 3ZWVA 3VKVA 4XQEA 4EEXA 3ZNNA 1LC0A 5KVCA 3GPIA 2GASA 1AUPA 2HMUA 5A9SB 3JQ9C 3JQFA 3JYQA 2W8ZA 1VJTA 3EVNA 4OL9A 2EW2A 3GG9A 4B4WA 5BSGA 2W4QA 3QW2A 4JN6B 3GQVA 3L6OO 2NVBA 3IP1A 1I10A 1DC6A 4H15A 4UEOA 4MVJP 2CVOA 4RVSA 3G1UA 2FP4A 5MDHA 1NWCA 4XX0A 2E82A 4X54A 5HS6A 3H9EO 1IPEA 1DO8A 3TPCA 5I8ZA 2RHRA 3L9WA 4B4UA 4OSPA 1LDYA 1RWBA 1P44A 1B3RA 1Y8RA 4DC1A 3ZV6A 5L4LA 4ONEA 2CUKA 2O3UA 3WDSA 4B7UA 3WQQA 1K6XA 3OSUA 4BO8A 1MG0A 2VWHA 4IDDA 5A02A 4NMHA 1HWYA 4GL4A 1QP8A 3R3JA 3MEQA 4P4GA 1GAEO 3ONFA 4GAEA 4O0LA 5ILGA 3GA0A 3MTJA 1PJLA 3NGLA 1P45A 5DULA 2X9GA 3ITKA 5JBIA 4K1LA 4K26A 4YJDA 3GG2A 5AYVA 1N5DA 4O5OA 1MX3A 1F17A 4MDHA 2BH9A 1YWGO 3AW9A 1ZK2A 3GGOA 5ADHA 3NRCA 4Z0HO 5CG2A 4P8RA 2E49A 3H5RA 4UUPA 1FDTA 5T64A 1KEVA 1JA9A 5KIAA 2QRJA 1U5CA 4Z9XA 3DL2A 5FFFA 1E3SA 4QFDA 1F06A 2VZ9A 4OGWA 1O89A 1L1FA 1H6DA 1HDOA 2PZKA 4OOFA 4ZQHA 1I30A 2GN4A 1E5QA 4XYLA 3I6IA 3W8FA 1ZIDA 2Q2WA 2PNFA 2E48A 4AG3A 1E6WA 3JQGB 1JDJA 1T2DA 2GYYA 3F4LA 3AM4A 4W7IA 2Y05A 3BMOA 1NQ5A 1U3TA 2YW9A 4E21A 4XA8A 1E7SA 4NFHA 4UVEA 4YJHA 1GUFA 1NVGA 3I4FA 5B4UA 1YOVB 5CHEA 1DXYA 1H94A 3UAGA 2WYUA 5L3ZA 2Q50A 2W2KB 1T24A 2AMFA 2ZJ1A 4CQMB 5DT9A 3AK4A 1D1SA 3PWSA 4PIVA 4OM8A 3G49A 5CAEA 3DQPA 1A9YA 1NYTA 4K28A 2GCGA 5L7YA 2DC1A 2GDZA 3L77A 1A5ZA 1Z45A 3F4BA 2WYVA 5HBRA 5A06A 2QX7A 2WD8A 1LDBA 2AQIA 3RC1A 3UGKA 1BW9B 5LC1A 4FDAA 3RC2A 1IZ0A 1Z82A 1E7WA 1DRWA 3VPGA 5IF3A 1CQIA 2J3KA 3DZJA 3M6IA 2D2IA 2EW8A 4RJTA 3NDJA 4C7KA 5JSFA 1U2GA 1NPDA 3N58A 5KOIA 1I36A 3KEOA 1RPNA 4M89A 1PIWA 3OIGA 1LU9A 1EFLA 2VRBA 3AWDA 4Y67A 3CH6A 4Y8VA 1DEHA 4LSMA 4XR9A 1JW9B 3WJAA 4DLBA 4AFNA 4BMSA 3IC5A 4NJMA 1Y9AA 3JSAA 3DBRB 2AEFA 1DLIA 1LDGA 1Y1PA 3CUKA 1WMBA 1ENPA 4N54A 3TJRA 4MIOA 1Z74A 4CODB 4XD2A 5EQFA 4PG7A 3FBGA 3ZHYA 3OECA 1WXDA 4WEOA 4E32A 2Y1EA 1P0FA 4D44A 1J49A 1QLJA 2AG8A 4ROSA 4ND1A 3V2HA 1P1KA 4NDNE 5A05A 3WNVA 4FW8A 1GL3A 3DONA 3WFJA 4JJGA 4RF3A 3E6AA 4GX2A 2VUUA 4WUVA 1B14A 3ZWMA 2GZ1A 5IDXA 3EK2A 1E1LA 3GNSA 4A0SA 1ONOA 1BWSA 4M49A 4CLXA 3E18A 3Q3CA 3LYLA 3GDOA 1CIVA 4QSMA 2POQX 2O23A 3HNPA 2NADA 5A3JA 1QXSA 1SAYA 2PKQP 3JQBC 5BT9A 3MJVA 3DR3A 2JKVA 4GKBA 1DIHA 3V1TC 8ADHA 3F5QA 2CMDA 4TMFA 5TSDA 5CDGA 9LDBA 4CM9A 2GSDA 2JAHA 1HYEA 3AUSA 2DTEA 3B6ZA 6ADHA 4PVCA 1U2DA 3IKTA 4YJFB 4YPOA 4M87A 5JDIC 1EE2A 2IZ0A 3JQ9A 4N5NA 3AM3A 4OXYA 1R66A 4GMFA 4M1QA 2GR9A 3E5RA 1B0AA 4CMJA 4O1MA 3WYCA 1YONA 2DAPA 1HSOA 3H3JA 4G2NA 1UDBA 3AY7A 3GN2A 4YCAA 3WBFA 4CMIA 2Q1SA 4PG6A 3ROPA 3QJ5A 2TMGA 4MKZA 3DZKA 4DBVO 3CXRA 3GZNA 3PJDA 2YV1A 2J5RA 5DOZA
chains in the Genus database with same CATH superfamily
1GPKA 3FJ1A 2KLHA 2IE0A 3ILSA 4P84A 4XQ9A 4QU9A 4CF5A 5HHTA 4MVJE 2X0EA 4ALIA 2BTQB 2BDEA 3ET4A 3G8AA 3EGXB 2ZSEA 1PUJA 2P2SA 1X94A 2QAGA 2XHZA 3CKLA 5DP2A 2BIFA 3MN1A 1SOVA 1W8DA 3PYMA 1OPXA 3D81A 4DLUA 5KYNA 5JV5A 4YJ2A 2OFXA 2JIQA 3HJTA 3DE6X 5ECDA 3UZUA 2AMJA 3QXGA 2GCOB 2YASA 3PC8C 3C1UA 3KHSA 1WU8A 1Z15A 2HA3A 4R2JA 4XEUA 2O2JA 5A4JA 3BERA 1TA4A 1IOZA 2VBCA 3B9PA 5IC4A 4XYMA 3S1SA 2RG1A 4DPMA 1YR8A 5LLSA 5JNVA 5KC9A 1UBNA 5ED4A 3WLLA 5GADl 3QVXA 1IEWA 3K8YA 3KQPA 2JLUA 5C1BA 4PGFA 3BH6A 1T9HA 2R1UA 3IELA 3K8OE 3COJA 2ZKIA 1M2EA 2PD6A 3C14C 2ATXA 3AO0B 4JJIA 1CX9B 1ZIOA 4NY1A 2YIJA 1LEHA 1MFZA 1GCUA 1RLTA 2G4CA 3L1KA 1H3NA 4MQBA 5G4KB 4B76A 4J1QA 4JLAA 3PNMA 1LVHA 1SN7A 1T4BA 2O07A 2C9CA 2X0NA 2YWFA 3ICPA 3OT5A 3OD1A 1T9AA 4MLDA 4UJ5A 1VLQA 1JSXA 3UUWA 4B81A 3KQLA 2DPYA 2DFPA 1GN9A 1ZGJA 4K9LA 4PAMA 5ELMA 1M33A 1Q0ZA 1YRBA 1TMOA 3OJLA 5EESA 1PDOA 3FOZA 3A27A 3LT2A 3LLMA 1RTKA 3NVAA 1RM5A 4IDEA 1IY8A 4NATA 3KDSE 3AERB 4JCCA 1V3QE 3L7OA 3NQ41 1XELA 1RBZA 2V6MA 3HYRA 1E2MA 5DHQA 4C29A 4OXKA 2NXWA 2R7LA 5CXQA 3GRAA 4ZAXA 4NZ9A 3O90A 3O8DA 4HTFB 2IHUA 4I9HA 2C5LA 3AHFA 1GO2A 3P2EA 3RIGA 1TQ2A 3CE9A 2WFLA 3PDJA 4MRRA 3UWKA 1IEVA 3ZXXA 2I4RA 2G36A 2B8NA 2FUG6 1CYEA 1EDZA 5AW7A 4NOLA 5CNKA 4J9VA 1TU4A 2FB9A 1UM8A 1CYDA 1U3FA 3M1LA 4PSCA 1YCGA 2YBDA 5FNVB 2MYPA 1NZJA 2PUWA 2QG9A 4KOAA 3USCS 5HXAA 3HCPA 3OTOB 3QENA 1P2DA 3E3OA 4IX9A 4KHZA 4ZICA 4YRKA 4FZRA 4HEA6 4DXHA 1ZEMA 4UBKA 3KETA 5JSZB 1YBAA 1Z2NX 3I2GA 2TMYA 1GUDA 1Y8CA 2PGIA 2QSJA 3D4NA 3DVRX 4JOQA 2X5NA 3HC7A 4KYVA 4L6AA 4XGKA 3RSCA 2QPAA 5IXYA 2WOOA 2W6MA 3QOFA 5LQAA 1N2HA 1TLFA 4FYYA 2VYCA 5EJEA 5IZ4A 1QIFA 1U7PA 1VM6A 4MRAA 2GLUA 2F3PA 3C8ZA 1ZXLA 3QLUC 4TTQA 1Z9BA 5BV8A 1OXXK 2HHLA 3ZJ5A 3R7DA 1L8LA 3OPQA 3GLGB 3ZHXA 4WBNF 3F6CA 1GXSB 3ZDDA 3GRPA 4HFMA 5JC1A 2V6FA 3NJRA 1K5DA 4LXQA 5KHLB 1I3NA 2G40A 2JK0A 4A0HA 2BGGA 1I4TD 2I67A 1HEIA 3SZGA 4P4SB 1DVRA 1E60A 3TUZC 3SJAA 1E2FA 1NMQA 1ULHA 3RLFA 4ZIRB 2ZB8A 2SHKA 4ARUA 1QQ7A 4CQMD 3STUA 3Q6MA 3A6PC 4WA8A 2BM9A 1Z5OA 2Z8ZA 1SC4A 3L7LA 3PNVA 2IV3A 3A10A 4GKAA 4MPTA 4ZK2A 1PGNA 2ZBVA 1NNI1 3BGOS 4TMYA 4DLKA 4F8JA 3PDIB 1SKMA 1PFQA 3GB9A 3Q8LA 1V39A 4RY0A 2WWVD 5I7SA 3U4GA 2DZDA 1VPEA 4YO7A 1Z3CA 1TYBE 3C4JA 1FJXA 1W19A 4YAOA 2CLCX 2VPTA 5FO1A 3WFZA 4CGYA 2JLCA 3KTAB 2JLZA 5KEIA 1DXHA 4BS9A 4P7FA 3VR3D 3DWEX 2HMAA 1QIKA 1N25A 4KQMA 1DKOA 2XCRB 4UOEA 1GFZA 2DUUA 3D4LA 4BUZA 1NQWA 1V9CA 1RW4A 3FN4A 3UT5B 1E64A 2IEDA 2RGUA 4EKYA 3O4FA 1M76A 1RHKA 4PIPA 4W9MC 1A76A 4DDWA 2YY6A 5FQNA 2VPZA 3FYDA 2WBLC 3CBQA 3VVBA 4YUXA 4RF4A 4O25A 1C8LA 5DTIA 1RDFA 2GEKA 3U7QA 4BRSA 4YJGA 5KNBD 4IWXA 3FBWA 3OE7A 1B3BA 1M6NA 1SD5A 3EXEB 4Z4QA 3JQ7B 3I30X 1GITA 1Q2XA 1SELA 2B99A 4DMRA 1HFEL 3HCEA 1HQKA 2YKGA 4URYR 2OO5C 1ZJ5A 3KE8A 4JODA 4AWAA 4MVXA 1M1XB 3NDIA 1OXTA 5IC6A 2EHJA 1OBOA 4NV0A 3WDKA 1TCCA 4TQAA 4JJ6A 3UO8B 3KEGA 1TAGA 1KI9A 2IE8A 3CU5A 4KHPB 5FJIA 1OFTA 3EXG1 2QZZA 1UBOS 4MIYA 2NSJA 3CVJA 3E7XA 3O8QA 1JPUA 3BMNB 2VHXA 1E2LA 3ZJUA 4UOZA 1Z33A 2G9QA 3KJQA 5ESRA 3THXB 1VCOA 2G0AA 4RXTA 3QEAZ 4G84A 1Z2PX 4RNCA 4ZO4A 2QI9F 1RYDA 2AOTA 3W5DA 4GZ3A 4YBRA 5CLQA 5D85A 3G2LA 5DEOA 1HT0A 4G4SO 3FNGA 1PW5A 4DNXA 5IJ9B 1XV5A 4LRQA 3PV0A 1ELOA 4DSAA 3IUJA 1FTNA 1IAVA 2XRZA 2ZWAA 5JS8A 2FFJA 3BXGA 1YJ5A 1P1FA 2FEOA 3CLSD 5DCLA 2OUIA 3QVOA 3V8RA 2RGAA 1U8ZA 4DAOA 4ASUA 3GLIB 2OCLA 5HK9A 4RSGA 1H85A 3C15C 4N6OA 5BO5A 1UOQA 1WX1A 2RHJA 1EX9A 4OKNA 3AFHA 1PTKA 3L40A 5KMGA 1AB5A 4XD7A 4D25A 3LL4A 4RTOA 4KE9A 3HBFA 2XY4A 2SBTA 1HETA 3S70A 1X2EA 4GX5A 4A23A 3IQEA 3N7TA 4RKFA 3W8EA 2CF5A 2PKXA 2RHBA 3BD9A 4TKLA 3HACA 3WLHA 4K0RA 1VIVA 4Y6OA 4IVPA 1NY5A 3DOOA 1AUXA 4NCIA 1D1QA 3ROKA 3U1VA 2VK1A 2WSLA 2YHIA 4J76A 5CAEB 1A97A 4ZCSA 3NTUA 5EJFA 2GPBA 3G2OA 1U3GA 3EXFB 2R4TA 3LXRA 5HILA 5JC8A 2J9RA 2Q4BA 3CZMA 1RQGA 1QHNA 4E5SA 7REQB 3L0IB 1J2JA 3OEED 1X38A 2ZPUA 3M5DA 1VGVA 2JVIA 4JLKA 5EIEA 1EXNA 2VYVA 4JYMA 1J00A 4LHVA 4C3UA 1N2CE 3PDCA 1J0CA 4JAVC 1Z4IA 1AK9A 2W2LD 1LPPA 5ENVA 5EKUA 2RH5A 2JGDA 3UJCA 2G28A 5LJIA 4RK0A 3UAXA 3R20A 3ZWNA 5AJZA 1T9ZA 5ICMA 3AEUB 3LJKA 2E4VA 4BKQA 2PLNA 3VR6D 4N9QA 5FNZA 5JDCC 5BXYA 1DBSA 2H7YA 2PRYA 5LDGA 1N4AA 4YCSA 3PC7A 3JVEA 3O4HA 4TT8A 2V6GA 4UD2A 4IFIA 4G5FA 3C2QA 2PXHA 1AK1A 3A9SA 2YV5A 1KK1A 4I81A 3P5BA 1NSFA 4OQMA 3N9IA 2AMYA 3GLHE 5D51S 3SAJA 5IKEA 4NJMB 4B6PA 3S3TA 1G64A 2QM0A 3I45A 1VMKA 1DJOA 4D1YA 2W6NA 3KX2A 4LDPA 3A6JA 1V48A 1P4RA 3NXKA 3UATA 3CNOA 5IJ0B 2BI8A 1U0FA 3UGTA 1FE8A 3O2QB 3HK2A 1L4NA 4G0XA 1XDSA 5DX0A 2EG9A 3DBIA 1E69A 1X6VA 2F8MA 3BH0A 2ODBA 1K6IA 3FTNA 4CIDA 4UM8B 1BKYA 4LXYA 2CXSA 5DVZA 5AJYA 2ADFA 4JENA 3WWYA 3INYA 3ZZUA 3LKVA 2AG6A 3R3HA 2ZYWX 4HWTA 3HYSA 3TKYA 1BE0A 3ZV5A 3LPNA 3D0OA 4A92A 2WK1A 3JQRA 2XT0A 4WK6A 1G5HA 2XNJA 3J80A 4QICA 2ZB2A 2QVLA 2BLLA 3CO5A 2XDQB 1Q0HA 1RVDA 5JBIA 3HO6A 5KJ1A 3E2PA 4FMDF 1Z12A 5KB3A 2BOVA 3NETA 4AWXA 1DU4A 1YL7A 4B1FA 3ZH9B 4TRRA 5EE3A 1SU6A 2OHXA 3S7TA 3ACCA 3RK1A 2JJMA 3GFBA 3U3KA 2QMEA 1GZUA 2WQ6A 4CF3A 2YIVX 1QQTA 3A4TA 1QTNA 5F52A 4C88A 3DOIA 2XKKA 2QRUA 3OQHA 3PIIA 1FQJA 4H16A 1KWKA 1FVOA 2V74B 1YS1X 2REQB 2YVQA 1E2KA 4HNSA 4LISA 4CEHB 1BXGB 2NYVA 1CZHA 5LMUB 4Y2SA 1ETHA 1P5RA 1RRGA 4KUHA 4GPIB 3CF4A 4OK3A 4F4DA 2JNWA 2WWRA 4MWBA 1RLMA 2KPOA 4E03A 5J4KA 1BMDA 3UAZA 1BC5A 3MRVA 2N46A 2J8ZA 3UV6A 4CV0A 2OXCA 4C89A 1VA5A 2PQ6A 2OLEA 2X22A 1B43A 2YNMA 3IGFA 1X7DA 3UA4A 3WB2A 4CMIB 2E37A 3EIHA 4P33A 2C94A 4WVFA 3UG6A 3UB4A 2DP4E 2JFUA 1VPDA 2B9VA 3RGGA 5I51A 1KI7A 4JDPA 2DPLA 2VP0A 2WG0A 1XRPA 3MOIA 3QU2A 4OQ4A 4UFOA 1O94D 3S1AB 5TDHA 4CL8A 2G09A 2IIQA 3BJZA 3K8QA 4JP2A 3KDAA 1C3OA 4Z4FA 1EVLA 5IN5A 2D8MA 2ZIEA 3D4OA 5EVJA 1RS0A 2H5JA 2Z1DA 5K3DA 4PHGA 3D6MA 3H2KA 3L04A 4HAXA 3AI7A 3P9QA 4IIFA 5FFNA 1GILA 4TMZA 3VKWA 1O58A 2FSFA 3AZPA 4C4XA 2G08A 3PHJA 4GMGA 1UC9A 1G55A 2YRXA 3ISVA 3JD0A 1E5LA 1EFVA 1CDEA 3Q8WA 1SQGA 1P77A 3UWSA 1PP4A 2PYIA 1JZTA 3ED5A 3QELA 5EIWA 3ZY4A 3ZE6A 3JD4A 4ZT6A 1JXQA 1E5TA 4OGFA 1FZQA 1U4SA 5JW6A 3RS4A 2F1KA 1PKEA 3P20A 1PR9A 1L5HA 1LRKA 1EDOA 1EXWA 2FFRA 2P2CA 3Q3HA 4NYJR 4C0LA 2WTBA 7MDHA 5HSGA 1EI9A 3C8UA 1II8B 2FWJA 2P35A 4XLLA 2WE8A 3LW8A 5LZ5A 1NU6A 1UOPA 3HEMA 4X24A 4HYQA 2RI6A 3GT0A 2WJGA 4KPGA 2CHUA 4DANA 1MC4A 3OEHD 4EUHA 3K70B 4UCFA 3PF9A 2BR3A 2ZTUA 3AG5A 2UYOA 3IP6A 5FO0A 2PR7A 2CVZA 4X44A 4K9OA 2AW3A 1IIRA 2FJPA 4GXNA 4QJBA 2CXRA 3TW8B 2AZXA 4QG7A 3FLMA 1JR6A 4BVEA 1T6ZA 1FU4A 4GF5A 4YUAA 4Q7MB 5JZMA 1BDBA 4RPCA 3W5JA 1QZTA 4DY4A 2EKZA 2JIZA 1NYLA 3V48A 3IEVA 1Z8NA 1UBKS 2Q3EA 3JQDA 3QVMA 1AXEA 1M7HA 2IRWA 1UBHS 2YYYA 3EH2A 3IR6A 1U2DC 3P9PA 5AVOA 4A82A 4FQ5A 3L93A 1RXCA 4XRRA 1YS4A 4UC0A 3PLAE 1E1RA 2Y93A 3DMHA 3LFHA 1C0KA 2B35A 4BNGA 2QKYA 4D8VA 1T25A 3RYHB 2NV0A 4HGNA 1TKAA 2XGSA 5U4QA 3WIBA 3KYCA 3ANNA 4QUJA 1XCBA 4OJKA 3S7ZA 3HU1A 5HUJA 3FVVA 4M1SA 3IBSA 1CD5A 4EI2A 4HDAA 3F46A 3ZWCA 3EFEA 1NMZA 2ZLBA 3UFXB 1VPTA 3WBKA 3E03A 3HDJA 4BV3A 1OH8A 4AKIA 1XNJA 5EQJB 3PHLA 1ZMOA 1U5BA 2WKQA 1P18A 1FP1D 1BX3A 4GWKA 1TM7E 4BCCA 1JLRA 3Q0TA 4V0ME 2VDMB 1WF6A 1RWNA 2UVPA 3GP3A 3O7WA 4WFQA 1ESCA 2Q8NA 2EKPA 3CZQA 4PWZA 2Y1LA 1DG1G 4Q3BA 3RAEC 3JAWB 4TZTA 4WH0A 1LKZA 2J48A 2JAPA 4P7GA 1E20A 1QB7A 3TFOA 4FFVA 4NYJQ 3REFA 1FQWA 3V1NA 3E8MA 3IOYA 4PHTA 4CNBA 1OOEA 3FI0A 1GGEA 4F12A 2EFDB 1T6YA 3TTUA 3QKRA 1EK5A 3OPVA 3BRSA 1V6CA 3EQZA 4OB8A 4UPDA 4BL5A 2ZTHA 2VPXA 1MO4A 2O8FB 1CHDA 1H5QA 3O8OB 4ND4A 5KNLA 3CLRD 1V5GA 4DLRA 3H5AA 2I2AA 4WESA 3GUYA 1KJNA 3SGLA 4P7BA 4QGFA 1S3IA 3NPMA 1VMAA 5B57C 3GJ4A 3F2IA 3QEOA 4P4UA 4TLMB 2O0KA 1Z5GA 3JTEA 2NYRA 4HVAA 4EHHA 2AXPA 2NW6A 4KK4A 2Q9AA 1ZESA 1IRIA 1SKAA 1BHSA 2HZBA 4MITA 3GJRA 4BO3A 4D3DA 4CTOA 1H23A 2X2OA 1XZFA 1F12A 1CJUC 2C7BA 2JARA 3IHTA 1GAQA 1TU3A 2OXIA 4PR3A 2OKGA 1RWKA 3DFMA 3QG1A 1Z7EA 4E4YA 4G9BA 2XSZD 4EGQA 3MS7A 3HV2A 3FTEA 4UREA 2BM1A 1NJ2A 4FGLA 5DFAA 4V0NA 3FCYA 3U3JA 4EHJA 2HO5A 2BGJA 2P68A 4M99A 4UD6A 1YSCA 4TWZA 3ICQB 3NHFA 1KO7A 1PFKA 1A27A 2BKEA 4NENB 2JFOA 2ZR8A 4C4ZA 1I14A 1NMYA 1SUPA 4MXDA 1M2WA 1OHHA 2QTLA 1Z25A 3IQDB 4B80A 4FXOA 4FEEA 2QL9A 4MCIA 1G9XA 1MEJA 1ESEA 3IURA 5B7NA 1T6NA 3SIPA 4KUEA 1N1EA 4IFEA 4MW4A 4TTAA 4ZVTA 5T7BA 2HMSA 4Y0NA 1CFZA 1ADCA 3KPVA 3PE6A 1CBUA 3I76A 1FFXB 4U2GA 5C8ZA 5EZQA 2EZUA 3UANA 4YUZA 2G5GX 1E6UA 2WF6A 3SYTA 3DZGA 1HRKA 2NAPA 1CV2A 3SZRA 5CDTA 3EXG2 2UYHA 2Z2JA 4NE9A 5CK4A 5LQJA 4RVUA 4TL7A 1T8PA 2G4VA 1KDYA 4LYDA 1E4EA 2GEUA 1KC3A 3HBLA 3EXHA 1ZMTA 2H06A 2PGJA 2XI4A 3KKPA 4D45A 2WNSA 1GPDG 3W1VA 4B9EA 4JT8A 5L95A 4ESHA 3UUFA 3QWFA 2VWPA 4FWBA 4LBZA 5DGHA 2FN7A 1U2ZA 1N2EA 3HYCA 1GFSA 1T43A 5TS2A 4CKWB 3IKJA 2H1WA 1V26A 3ANLA 1YB1A 4LOJA 5K0LA 3GJ0A 5HKOA 1ITZA 5EXEA 3E2IA 3NHZA 4I6EA 1Y82A 2ZSDA 1B6SA 2HMWA 2XYVA 5AKXA 5DNAA 4DT1A 4OATA 3IDFA 4KWTA 2K7ZA 4Z1MD 3FDZB 5JTTA 1I5OA 3JWHA 1QG4A 1S9HA 1MBZA 1U90A 1PG0A 1N92A 2I78A 1K8RA 1PV1A 2RHMA 1HR0B 2IUFA 3O0DA 4OHBA 4CM9D 4GEGA 2YN2A 4DCPA 4YJ3F 3ETHA 2IZ6A 3OPMA 1AMOA 1OYOA 3V7NA 1N2SA 3EVFA 2O7RA 1F8UA 1GQRA 1P72A 3AVQA 5FTWA 1TF5A 4QPPA 4AAYA 1JQ5A 4QUAA 2CV0A 1G8SA 4Z99A 2QRHA 5C4GB 1Y1KE 1K0FA 1BEUB 2H5LA 2PH3A 1C14A 3MT7A 4IUDS 3TRIA 1FJGB 5JSKA 1Q6YA 3I6BA 3PEYA 5T57A 1WSWA 2OVFA 3L18A 4HQNA 2LDBA 2AEEA 1XJQA 5HBGA 5LXTF 3TN7A 1UT8A 3CINA 5AI8A 5EJGA 3LUKA 1U3VA 4WERA 3PDHA 1FP4A 2ARKA 2VDUE 1JHPA 1OXMA 4KLRA 3PPXA 1KEWA 1JR2A 3M7IA 3EGOA 3NV7A 5BSHA 5GMOA 3TXAA 3KJGA 4M2LA 5CU7A 1VQ1A 4Y1GA 2DJIA 1PDWA 5DHSA 2X8AA 3RI3A 3TD2A 5JT1A 2J0QA 1WE2A 5F7JA 4MR8B 1KNQA 4D99A 2OZLA 4ND3A 4EG1A 1J7KA 1PU2A 4DR3B 3LQKA 1N0UA 3PFWO 3OMWA 3IRVA 4Q9HA 5T5QA 5CGQB 5ALVA 5I8WA 3F6SA 2O8EA 3ABRB 1KSFX 1ACMA 1B2LA 2ZP1A 2C78A 2ZWOA 4HJXA 4LWPA 5DHAA 3WL7A 2YVKA 1YI0A 4G41A 4RZXA 4JUBA 1CB7A 1D2MA 2FGJA 2O1XA 3KU1A 5GY7A 1AGXA 2BMDA 1V11A 3CY6A 3AGPA 2Z3VA 2XOXA 4D6YA 2A5LA 1Q22A 1D6JA 3TRDA 2HA6A 4N5IX 4U0JA 2VL7A 1WDMA 1T8UA 4FLFA 1XP8A 3R9XB 1EJ2A 3UGJA 1K88A 1SNYA 4PRZA 4DSZA 1Y3HA 1F1BA 2NO5A 4Q1BA 4II2A 5A4MS 4LJ5A 2AN5A 3PQ2A 2B37A 1Q2UA 4L0QA 3WGQA 1NTRA 1GZ6A 2NUTB 2VEOA 2XUDA 3AKCA 4L73A 1E3EA 2P2DA 4WASA 3UMBA 3QEKA 4CIAA 4S3MA 5LQMA 1N1DA 2JGLA 1J33A 2QI9C 3HSKA 3KKLA 4AZWA 3AB7A 4KXWA 4B4DA 1XNHA 3RK4A 4KR2A 3WR5A 4I9UA 5C5DA 5FBHA 3FFXA 4MVCA 4G86A 5EZ6B 2Z43A 4NZNA 2I62A 1QGUA 1E9SA 4R1LA 1VSBA 5ALIA 3WWEA 1HSZA 5IBRA 1OF1A 1NKTA 2GCEA 2HQ1A 3EB9A 1WD7A 2MTBA 2VDOB 2UV8A 1CR0A 4OBBA 3R7WB 3FJYA 2O8CB 4AP5A 3AFGA 1EAYA 4G0MA 2HNKA 5BPFA 4P82A 3P32A 1Z7BA 4INPA 3CR3C 1F60A 1ZAKA 3GGSA 3H8SA 1ENYA 4CCYB 1DC8A 3QVTA 1QV9A 1X1RA 4J0IA 5IZCA 2QX8A 2R44A 1E2JA 4IEIA 1AKVA 3N2LA 3P9YA 3RUHA 3L9XA 1FRZA 1YRQA 4MW6A 3SIWA 4NS4A 4JC4A 4RIHA 3ZWPA 1ZLXA 1AMUA 3IIJA 3G2QA 2P27A 2XUIA 4QGHA 2ID7A 4QBIA 4ZCIA 5IH7A 4YDQA 1M0EA 1J42A 2IUUA 3UMVA 3JU3A 1R18A 2HUPA 2JA1A 3EW7A 4MV6A 5DYIA 1OKKD 4FOLA 4DRXB 3L8ZA 1FFGA 1PJRA 3I01A 1YULA 1P0MA 1ZG3A 4P2BA 1J21A 1QH8B 2W6OA 3N0XA 4L27A 4LE0A 5GZ1A 4U6NA 1NIPA 1DUIA 3L01A 5HKBA 4XZ3A 3PHBE 1W6RA 4DSOA 2BRUA 5EMLA 1WPXA 2QQGA 2CC2A 3T94A 4PPFA 3IA2A 2FQWA 2I3GA 3EDMA 3M6MD 5FR2A 5HDBB 1MJGM 2OBLA 3GMIA 4NFYA 2ZJ3A 1JLKA 1IDOA 3K09A 1JH9A 1LX7A 4D46A 3W2HA 2JRLA 4OY3A 1WV0A 1Y80A 1P91A 2JJ1D 3DMTA 3FPLA 1N3BA 3N3AC 3OP4A 5EY5B 4BATA 4IJQA 4DVGA 2Z09A 3L0DA 4LXTA 3VHQA 3MVEA 5A9SA 1YQEA 1Y89A 3DUWA 4GT1A 3RTDA 2QHXA 2ODTX 1G2IA 1ZNWA 1BE1A 1ZCZA 4O4HF 2R0QC 2FWMX 4AF8A 2AQHA 1RKUA 3GFTA 3TB6A 4PBTA 4KQWA 1V47A 1ZVJA 1HC7A 1VBMA 5JMPA 4AT1A 4UTPA 5GIOE 2YYSA 3OEWA 2GB4A 3IO5A 5DTRA 3VOTA 2D7CA 3WV4A 4PYQA 2YHUA 4Z86A 5I01A 2QTWB 2R96A 2WAYA 2ZR0A 4FIDA 4JXZA 5PGMA 2IJGX 4OP2A 4UM9D 1QZXA 3Q40A 4JI3B 2VH1A 1HRDA 3VRHA 2P62A 4BNIA 5J2TA 2E9SA 2JDIA 4D0SA 5KYWA 4ATNA 2PBFA 4LZOA 3N39C 4W6ZA 4DMHA 5AHRA 4MGHA 3EE6A 1OW3B 1I1NA 5E4JA 2RBKA 5B6PA 5KYYA 1FX0A 1NN0A 4GRAA 3FY4A 1FQOA 4WLOA 5EP1A 4Q6WA 5FI5A 3N7AA 1FSZA 2UXBB 3TRFA 3BX1A 3FCXA 2PSEA 3Q15C 3BFKA 3E22A 2ETXA 4BKPA 1T0UA 4F5ZA 1DXOA 1JHXA 1WUHS 1WOMA 3VX4A 1HX7A 1Y3FE 1YRHA 4HDMB 3DHNA 3R9KA 3FPSA 4J0CA 4OQYA 2WSIA 4UAGA 1MIOA 2J6HA 5LLDA 3DDOA 3MJFA 5JVDF 4XQGA 5J9FA 4S1NA 1ZSVA 1DQNA 3OX2A 1P62B 1RI5A 4YI3A 3AUFA 5IT4A 5ALKA 3L4JA 4PX2A 3ZZTA 1XMSA 4DUGD 2OB2A 4YMLA 4XWWA 1NZFA 2C9MA 3S4YA 4BN4A 5ICFA 4PHCA 4R05A 2G0NA 5BWOA 3N2ZB 2ORIA 4NC9A 1Z5WA 1GLNA 4LCEA 2B4KA 5JFOA 3T3DA 2VHYA 3ZWKA 3THYA 2VHEA 1GRVA 3LDFA 5EWMB 5F7ZA 1M34B 2ACEA 3RFTA 1MVNA 1CF9A 2I1WA 4KQFA 1SIWA 4PYRA 4RNDB 4PY2A 1TJPB 4LQLA 4QQRA 1O2DA 2G1PA 3IPRA 3A2LA 2BHTA 2ZJ6A 1E77A 3FRIA 4G5XA 5FV4A 4GS5A 3FSRA 3AR6A 3LS2A 3OJFA 3PZRA 1JSZA 1DMSA 1G5QA 2JBAA 2RCNA 1SHUX 5DYNA 4G9GA 3FVQA 3KPUA 1NSYA 2XMZA 4FC7A 1KJ8A 4OHUA 2VF4X 3GD7A 3JYLA 4Q9KA 3D1LA 2ES4A 1FRFS 3BK2A 4NPCA 4EPRA 3EZ2A 3OM1A 2F8SA 4UVIA 4W5HA 3L7CA 3R4VA 1V3UA 3LP5A 1U0JA 2XLCA 3V7FA 3SQXA 1RHMA 5AJHA 1NNEA 3AVTA 2IIVA 2ZUSA 2QUHA 3DA8A 4PZ0A 5DASA 4J43A 4ZEMA 2WLSA 2QTCA 4A0RA 2NPFA 1ZX1A 2FWNA 3LMKA 4EJFA 4H2DA 4ILEA 2V5AA 3L7YA 2BT4A 5FJJA 1IQRA 1V35A 1LA2A 2BY4A 1Q14A 3KTFA 3OQBA 4JEHA 3FPEA 3ND5A 1BW9A 3E61A 5A5EA 1AF7A 1FXWF 3IYLW 4G1FA 4IGKA 4IM7A 2CFRA 2B8JA 3NHMA 1SXJD 5TEWA 3VR5A 2CBGA 3PS9A 1T2EA 1MXHA 3DHYA 2ZI9A 4J2TA 2ZRDA 3IEMA 3GLKA 4Q3NA 1R0RE 2EATA 5B3JC 1XTSA 1ZCBA 4F4IA 4LMRA 1O57A 2BEWB 1YVUA 4X85A 3DLCA 1AS3A 4RLHA 5KOJB 1I4EB 4WY5A 3LC1O 3LX5A 3L6EA 2WINI 5BSEA 2HLPA 4HQ0A 4YY3B 5LQUA 2IBTA 1LBEA 3DV2A 5EI5A 1RZRD 2AOWA 2DSTA 1GTG1 3P2KA 3UK0A 3I1YA 4QNNA 3PQ3A 5CDFA 1JLLA 4JJKA 3WKCA 4QJ3A 3I61A 2W5UA 2HNBA 3OICA 2OWEA 1FL9A 2JCXA 1MGPA 3PU6A 4LWOA 3UKJA 1SM4A 4RTRA 1WF3A 1WB6A 1UFVA 1CEYA 2Y2UA 2CDBA 2EKDA 3IDSA 4GE0A 4CTJA 2HWKA 3CE6A 5A6SA 4DHWA 1BQ4A 1GG5A 1PJ4A 1QHYA 2D3TA 3H4VA 1IK4A 2KJQA 1M6HA 2V3VA 4Y3UA 3VHLB 2ZM6B 2YMPA 3OCXA 5JAIA 3G0HA 1UIRA 2X23A 1H8ED 2PX4A 3I9LA 3V9AA 4RZUA 1DIOB 1HE5A 3OKAA 1A5AB 2I4LA 5MF6A 3UHAA 4Y6RA 4PRKA 1R4NB 3D8NA 2JGMA 5FR1A 2HQOA 1S2MA 5D2CA 1VG9B 3WL4A 4ZVPA 4AIIA 1T2FA 4KI7A 4M7PA 5JY1A 1JEAA 3LNTA 1EA7A 3M81A 3URMA 3ZV3A 3I3OA 3MT9A 4EQ6A 1FB5A 5CGZA 5A3SA 1KAGA 2G06A 1RJWA 1JFRA 1G7TA 1I7PA 1UBUS 4TRMA 5IRCD 4BNNA 4PX9A 1XUOA 4WL0A 4RWZA 3NIGB 4R51A 2I65A 4WK0B 3ZDFA 3BIOA 1FA9A 3B1KA 5BQOA 2G72A 3SIRA 2R8PA 1QHHB 3OHPA 4JQCA 3TQRA 4S05A 1GSIA 2X8LA 1AQLA 3O83A 1ZH4A 3W8RA 1CY8A 2VYFA 2ZI3A 3BXZA 4UUAA 5B5SA 1O8BA 5E9JA 1NBHA 5DHRA 3TSWA 3VZDA 1YE5A 1U7DA 1L7AA 2E5WA 3K2QA 5LCXA 1NVVR 5ES4B 4KSBA 1V8FA 4BTLA 1WB5A 3NAGA 4YJFA 2V4MA 5DYGA 1A72A 3ABQB 5CEFA 2A92A 5H7XA 4IIGA 5E1OA 1EZ4A 2UVDA 4ARZA 3M6FA 3O8CA 1U98A 1XKTA 1QKIA 5KHAA 1QYIA 4Q7LA 1X9HA 3PKIA 4NULA 2JEYA 2EYUA 3DKPA 1G6Q1 1NI5A 3JWPA 3LRPA 3L4KA 2O7VA 4F5DA 3LT0A 5EPOA 2W2TA 2FN3A 1C4OA 1J8VA 1EUDA 2PDAA 4KW7A 1V5FA 3HYTA 1P0CA 4HLCA 2J4DA 1LVUA 5LR6A 4RTMA 3MJHA 1PWYE 1D4FA 1Q0PA 1ZWLA 2DKFA 2VZ8A 4M88A 2Y0EA 1GL6A 1PR1A 2Y0BA 3ZPXA 2F43A 3EIOA 3MLBA 3Q6IA 4J1TC 4JBLA 5IKOA 1LQ2A 3S5JA 3TTTA 5A3RA 2Z1NA 3LSTA 5AUPB 2DBYA 4LJSA 1A7AA 1W29A 3HLTA 1WBBA 1KQFA 4HWRA 1D2HA 4ZC8A 3PTAA 3IJPA 2V7EA 4R83A 3R0JA 3QBJA 3G0GA 4FKMA 4KODA 1F6BA 1RM4A 1LCIA 1I6MA 1QM5A 2PXXA 3C7KA 4CPDA 4EG8A 1TT5A 4GSYA 1MAHA 3A70A 3AEQA 1CT9A 1GHTA 2X7XA 4LYFA 1EM6A 1AKYA 1GG2A 4IGAA 2CXPA 2OUKA 4AK9A 4YQYA 4N3BA 3R2JA 5DHFA 2XUZA 5CNIA 2V0NA 3ENVA 2GRAA 1V95A 2OFOA 4OSOA 5CYFA 1UBCA 3AM5A 5BT8A 5C51B 2PUDA 1JHRA 4PCLA 3HRHA 3LVRE 4RENA 1NULA 2WAXA 3GEMA 1EXVA 1LV7A 3AETA 1EM8B 1HZZA 1HO3A 4RY8A 5CP8A 2BZ1A 2E5LB 3UKOA 2FPLA 2O0MA 2OORA 3K6JA 2W2XA 1YR2A 3D3NA 1XKQA 2AI3A 3BHNA 3I28A 4KGZA 1NBMD 2HU2A 3U61B 1WKCA 1G3RA 1NVVQ 2R6AA 4FCVA 1YA8A 1NG1A 5ES3A 2BMWA 2J6IA 3R7SA 2P9ZA 4JB0A 4Q66C 3CEHA 4P5DA 2PKRA 2E4AA 3RUCA 2BGUA 5BW4A 4V0QA 3GY0A 4WOCA 5BN1A 1AQJA 3RANA 2MYUA 3I42A 4M1TA 3VUFA 1R4MB 1AKQA 1X15A 5D3ZA 3SICE 2GEDA 3ER6A 1Z4OA 1H9AA 2FP3A 4TV9F 4UCXA 2WJHA 5CIWA 2R7AA 1DTSA 4CMEA 4B3MB 2OCXA 1F2DA 2WTNA 5F2OA 4GL2A 3ILHA 1V4VA 4NHEA 3FHCB 2AOVA 3TEJA 1G5TA 1MA3A 4Y0AA 4LJLA 5K51A 4F2HA 2HMVA 2C04A 3D0KA 4GC9A 4LXIA 2MSDB 3KJIA 3UWMA 3SM9A 1R7RA 1UKAA 1Z4KA 3JQEA 3ZDRA 4C3ZA 1OASA 3OIVA 4J0DA 3A8TA 3QYFA 1YRYE 3E23A 4E0BA 1FYWA 4KK3A 3IBFA 1TCVA 3DZHA 2ETVA 4QELA 3UAWA 3WVNA 4PSVA 1DTWA 2JI4A 4PINA 3KQWA 4JLUA 1OXUA 5E6SB 1Z36A 4OTZA 3P97A 4RPJA 5HF9A 1FNDA 1G6KA 3MMPA 3ZDQA 5BNZA 4DJJA 2P0AA 4HNAA 1S8FA 3HUUA 1VJCA 3TLXA 4V0LA 1O9BA 2HCBA 3C6QA 5FHQA 1QU3A 2ZJZA 2F64A 4Q12A 4YYEA 2PZBA 4DN6A 2BGRA 2R60A 3VPFA 3P9CA 3Q7PA 4R2MA 4UEJA 3KYDB 1Z39A 4RWEA 3RTEA 3LECA 2RGRA 4WZBA 3G2JA 3A6HA 2DLDA 3RUPA 5K99A 1QOPB 2IYFA 1T2UA 2A0UA 4Q00A 1SXHA 3W9SA 1NASA 3R0IA 2J33A 3UAVA 3RHFA 3MS2A 3CCFA 3FWKA 3VC2A 3BXFA 1X74A 2OMKA 4QGGA 3ZS8A 4BVGA 1ZK1A 1MGOA 3LUGA 3P9SA 4AYXA 1I32A 3CQ9A 3KB8A 5JBNA 3WL6A 3RWBA 3TGPA 2F48A 3SBEA 2V0GA 4CJXA 1YXMA 3ZTYA 2QMOA 4LHWA 1KK3A 1DO2A 1T5LA 1RLJA 2C98A 2G70A 2HV8A 2KI5A 3TOCA 3KELA 3TSYA 2LVBA 4Y9RA 1E9DA 5EAIA 5JNSA 4MCAA 4OVKA 3VZQA 4YCBA 2FSSA 3B2NA 1C9NA 1ECPA 3GROA 4L08A 2EWVA 3PFFA 4EJ6A 1EWQA 3ZD9A 4C4YA 1K7YA 1OFUX 3JQAB 3UIEA 1NLUA 3JV7A 4F46A 4L9RA 2BM0A 2Y1FA 1L4LA 4RE5A 1E3WA 3N2NA 1NJ5A 2EAUA 2HSEA 4J1SA 2HT1A 4FINA 3HGMA 3JRXA 3CJTA 3LY8A 2ZIVB 3OHMA 2A35A 4H17A 4L1KA 5CK5A 3AF6A 1GZ4A 4GI5A 3QOYA 2CLEB 1P5JA 3E1GA 2LV8A 4G1VA 3ULKA 4BFYA 4BLVA 3UAYA 1UWVA 2LPMA 4CUKA 2DFVA 1DKPA 1CUBA 1F2TB 1U0EA 1W2HA 1EPUA 2CWDA 2NZYA 3L0SA 3I9MA 2IHTA 3JVVA 3FI9A 3LUCA 3H2ZA 1I2ZA 3N5CA 5DXFA 2HF7A 2Y99A 2VTBB 5EVCA 4R8MA 5HG0A 3U37A 1N78A 4XTCS 1EQAA 1JQKA 1RYZA 1U28A 2QQFA 4KIJA 3T0IA 3P5SA 2E85A 4XVCA 1USVA 1JUDA 2ZUDA 3KZNA 4OGKA 4WBNB 3ECAA 3PSHA 3TNLA 4FSHA 3ZBTA 4OUKX 3R8CA 4PIMA 1KAEA 1H2YA 2PX3A 1JU3A 1KY2A 2QX9A 1E1QD 5EWJA 4TSFD 5TGTA 2OBNA 2P9EA 2RK6A 4FIZA 1A7JA 2WF8A 4BWGA 1QAMA 4MUKA 3NC0C 3KVRA 3W8NA 2XKBA 1N1MA 2QTFA 2G6TA 2VHVA 5KQMA 5KDDA 3BT7A 2OD2A 4R0NA 2DPGA 1VG8A 1UMCA 1E1CA 2FQ1A 3U4AA 1N57A 4EYSA 4HY3A 3C8MA 1UXHA 1N2JA 3E9QA 4B7AA 4LDQA 4HRYA 2GSWA 2WHRA 1M1UA 3BXPA 4EK9A 1R3DA 5K3FB 1ABEA 1P9RA 5KWJA 1AO0A 1PNRA 3RVLA 4L72A 3EF3A 1V71A 3PI7A 1UKEA 3MYRA 3H2SA 2J7KA 5BY2A 3CUWA 5DEIA 5JYEA 5KKCA 1YTLA 4B74A 5KNCA 2JLYA 2X9VA 4ND2A 3KYIB 5T6BA 1PL7A 1QK4A 2CHFA 3HBNA 2FSVC 2WUVA 2XHEA 4D4LA 1WCIB 3OFKA 3WJ2A 3CNBA 5HIAA 3TNDA 3WAKA 4CCSA 3NS7A 1H3EA 2Z08A 4ZOLB 2X19A 3CVYA 5E7IA 2PMCA 3ZUGA 2VPQA 2I87A 2FPPB 3FCOA 5KQGA 3Q8XB 3UPDA 5LIPA 4L75A 2PUEA 3I62A 1NUTA 5BW6B 1PZGA 1SVWA 2IZ7A 3F78A 5AKGA 3V46A 4GKJB 5EIBD 4OLAA 5IUNC 3U7JA 4UOQA 2F9FA 3IO3A 1TECE 2I7XA 2EBFX 5EHQA 3OQNA 2OBBA 1REQB 1RXUA 3I5AA 4FGUA 4KFTA 1W59A 4B3FX 1US8A 5BN5B 5BMVF 3CCCA 5I7EA 4MPJA 4U7JA 2AFIA 2NUPA 2FMUA 2EFJA 2KYRA 3GYBA 3HEBA 4DIBA 3UOGA 4A8JA 4K6KA 2C2MA 5AJXA 5GOTA 2P6NA 1W2GA 2AJTA 2EBWA 1JEQB 1VP9A 2W00A 2J9ZB 3BMQA 3H83A 2JCSA 3N75A 2Q7OE 2UUCB 5AVKA 5THKA 2RMKA 1M8PA 2XTAA 3L0BA 2OBYA 3QTLA 4WDRA 1U8FO 3A3NA 3HABA 3ITEA 2Q3FA 1TTHA 3KQVA 4H3HB 4N01A 4UUOA 4ZMRA 5BORA 1W4CA 1EUQA 4OBWA 5DN9A 1Z0IA 5A1JA 1JFVA 4EBFA 2OLJA 4KXMA 1X3LA 3FFAA 4Y2UA 5TF0A 4EYOA 2XBMA 3OPYA 1E9EA 2H1IA 1BQ3A 2HJGA 3AEKB 4MEJA 1R6TA 3Q3EA 2D8AA 3RIHA 5AVVA 2PGDA 4Q18A 3BA6A 1T91A 1C7IA 2HDWA 1EDBA 1KU0A 4ZYVA 3R09A 4JXKA 1NT2A 4IWNA 3SP1A 1YVRA 4UHDA 2IH5A 3HXLA 3GMDA 2MMGA 3GLRA 3GPDG 1VDZA 3Q88A 4P0TA 5FEUA 1QG0A 1QUFA 4A3SA 1OXBB 1H0KA 1HKUA 2KSQA 3D3WB 3IHWA 5D87A 4TOIA