4WCDA

Trypanosoma brucei ptr1 in complex with inhibitor 10
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
250
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 92
structure length 250
sequence length 267
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wcdA00
1NAHA 1KC1A 2I76A 3WGYA 4Y6PA 4B4VA 1ISGA 4ZA2A 1C0PA 1E7WA 3GN2A 4J0FA 1X0VA 5CDSA 3ROMA 3AUAA 3H7AA 3IKTA 2IODA 2IXBA 2B5VA 2AE2A 1Z74A 3JD4A 4ZD6A 2FP4A 1QYVA 5L7WA 1GUYA 2OXIA 4C4OA 3VH1A 1K6XA 3ASVA 3GEMA 2V7PA 2PGLA 3LC2O 2BRUA 1NR1A 1PJTA 3NGLA 1DPGA 5DP2A 4OSOA 1W0CA 3OA0A 4BNXA 1ULUA 4J3FA 4OXNA 1DHRA 2B35A 1QLHA 2GO1A 1BVRA 3ZW8A 1TEHA 3WGOA 4KDEA 5EIOA 5TJ9A 5L7YA 4OAQA 2PD6A 4QXMA 2C82A 4UVDA 3ZZNA 1NX6A 3V1TC 1HDXA 2O7QA 3KSDO 4B4WA 3KYCB 4R1UA 1HF3A 1VL8A 3VPGA 1YWGO 5TSDA 1E3LA 4DMLA 2Y67A 5TQVA 1LXCA 4YAIA 4LCEA 4BHTA 1PJCA 5H83A 3DZIA 1FDSA 1UZNA 5JMWA 1KERA 1XLTA 3PGXA 4AJNA 1IZ9A 1PX0A 3JQBA 4DRYA 3LSYA 3UICA 4QEDA 3MJ4A 4RZIA 2BKAA 3C1AA 4CLRA 3KLMX 4B8ZA 3ROPA 3GFBA 4OKNA 4IJUA 5BSEA 3NAQA 4CLEA 4YACA 4D46A 4QT0A 3DAFA 5HA5A 1WAMA 3P2YA 2JFGA 3EGOA 3HNPA 1R0SA 1ISIA 1ADCA 2DM6A 2ZYGA 4I08A 3F47A 1LLCA 4RCVA 2HMVA 4NMHA 1YE3A 3QVTA 3I23A 4ALNA 5L4SA 1H9AA 1V3VA 1UZLA 3AFNA 3CZRA 4Y9DA 5L3ZA 3F4LA 3IUSA 3DBRA 1UUFA 5A9SA 3WJAA 3WSVA 3E8XA 3K73O 3ULKA 1I2CA 1JLLA 1XYGA 4CJXA 4PG4A 1HLPA 2H9IA 3E1KA 4DC0A 3IAHA 3EY4A 4KUHA 4L4SA 4U5QA 4E5PA 5A06A 5MDHA 1PJSA 4EJ0A 1U3UA 2GN9A 3OFSA 4ILKA 4GGPA 1B15A 4QQRA 3DAPA 2C2XA 3OJOA 4WK6A 5KIAA 1EFKA 1PWXA 3PHJA 5HTOA 5KJFA 5I7VA 1U1IA 3TZKA 5EERA 4Z6KA 1VLLA 3EC7A 4BMVA 4MP3A 2RBEA 3WNQA 1BRMA 4NIMA 1XIVA 1XWFA 2HU2A 4FQ8A 1KVRA 1YBMA 5ER6A 1K3TA 1DXYA 1MUUA 1RJWA 1HSOA 3ANMA 4Q39A 3PVZA 4DBVO 3TZHA 1R37A 4EYEA 3G17A 1WVGA 4JROA 2VTEA 5F1PA 1NPYA 2Z5LA 4G2NA 4KWHA 2VT2A 5F3RA 3MTGA 3SC4A 2EJWA 2JHGA 1PU2A 3AUTA 3GRKA 3PYLA 2VOEA 5F5NA 4YT2A 3AFMA 1Z82A 2C07A 2R6JA 3WWYA 3K9QO 1B0AA 4E3ZA 2BGMA 4CMEA 4UULA 4GKBA 1AE1A 2VYND 3O26A 4JBHA 4RL6A 3CMCO 1HYEA 2D1YA 1VL6A 1P1FA 4NBUA 3RUFA 3C8MA 3DONA 2UAGA 2WYWA 3RBZA 1N9GB 2EJVA 4DREA 1QKIA 3NT5A 4YRBA 1U7TA 3FNFA 3RASA 3O8QA 3FBGA 3ZNNA 1PJ3A 1ML3A 3V1YA 1CQJA 3RBVA 3U4IA 5KWEA 2G17A 2YQ5A 3H5RA 2ZCVA 1ULSA 4RPLA 4AL4A 1WDKA 4DIBA 2O3SA 3GZNA 4RGBA 3JQDA 2OO5A 5C7IO 1UXKA 3E9NA 2ZQYA 3ROQA 4WKGA 1GZ6A 5DDIP 5EMHA 5G0UA 4PLVA 1IUKA 1VPDA 5L45A 2X0JA 2PTGA 6ADHA 1DFHA 2R00A 2GZ1A 5B4UA 4LK3A 5EL0A 1E7QA 4FC7A 2A9FA 3H9EO 1LDMA 4KOAA 2G82A 1C0KA 1AUPA 1QYCA 2AQIA 3BHJA 1NAIA 1M66A 1TA4A 1CWUA 5JAZA 2P4QA 4U8GA 4UAGA 1R66A 1MC5A 3L77A 1HE2A 3ZWPA 2OP0A 3I5MA 1P1JA 3WG9A 4O1MA 5I8WA 1PZHA 1J49A 2EW2A 3GOHA 4ZJUA 4YT8A 3RD5A 3PDUA 4E2XA 4XZ3A 4EDFA 2BFOA 3PZRA 1O5IA 4CMAA 2D5CA 2YUTA 2WYVA 3DBHA 1R4NA 3E5MA 3WGQA 3CPSA 3ZWAA 2HSDA 4CR6A 3JQAA 1C1DB 2HDHA 1XEAA 4JP2A 3TQHA 3G3EA 2F1KA 1DRVA 2VWPA 4P4GA 3JD2A 5C5IA 1VSUA 3I9JA 2H63A 1K89A 1HYHA 1L7EA 4PG6A 1OMOA 3OIDA 5A5EA 3FNGA 1ZJZA 4OQYA 1SMKA 2I3AA 4RLHA 2IEDA 2RAFA 4S1VA 4CV2A 2P91A 4J9VA 3QWAA 4NPCA 4R51A 2GYYA 4RF3A 1PQUA 3I3OA 1ZBQA 2X1HA 5TJHA 4KTVE 1HZJA 4LGVA 2Q45A 4Y6SA 1JN0A 2Y1FA 1JVBA 4J2HA 4MVJF 4W9NA 2FZEA 1GEEA 4QUKA 4E2YA 2IYOA 1KY5A 2CSUA 2D5AA 3IOYA 4WJZA 3RAJA 4NJMB 5FYDA 4L0QA 1WWKA 3IJPA 5G2OA 3ADPA 5CHEA 3W1VA 3H9GA 1B26A 1UAYA 3QIVA 4IBOA 1ZO8A 3HDQA 2E37A 3ZI0A 5T57A 1SAYA 4DIFA 1C14A 2JJYA 3A4VA 3IP3A 2ZYDA 4JX8A 1WZEA 2TMGA 3WWZA 4WCFA 4BV8A 4AJLA 4CM8A 3ZWBA 4OM8A 2DTEA 5DP1A 1V8BA 2C5EA 1LI4A 2AHRA 3B1KA 1B8PA 3E6AA 5JXWA 5T5QA 3GNTA 4NBWA 4YVFA 3CINA 2AA3A 2VWGA 3C24A 3E48A 4KDFA 1Q7CA 1QYDA 4ND1A 5B12A 4XIJA 5L51A 4B7CA 4D41A 4JP3A 4UVGA 3QVOA 5JAMA 2E48A 3L6DA 3QJ5A 1LLUA 3U09A 3F3SA 4ONEA 3T4EA 1WDMA 3WQSB 1LBEA 1CDOA 5F21A 3U0BA 2EGHA 2XF8A 2Q1TA 3GVXA 1PR9A 4WCDA 2GDZA 1HE5A 3CH6A 2XPCA 3U4DA 1HT0A 1KIFA 3OJLA 3W4JA 3VAZA 4LSMA 3EYWA 3LT0A 1T1SA 3FI9A 3DZJA 4MO2A 4ALKA 4PVDA 4CLRB 2X7HA 3TZ6A 1Q0QA 3EHEA 3EUWA 1BW9A 1OBFO 1NQTA 4FOOA 5AXCA 4OOFA 4HY3A 4RPGA 3FWNA 3IJRA 3H2SA 1YQGA 3B1JA 1NWCA 3WFIA 3SBOA 1PEDA 4KQWA 1ZJYA 3RROA 2OMEA 4WPGA 4ALJA 1P1HA 1YB5A 3ETGA 1UR5A 4E5KA 2NSDA 3DBRB 5A9SB 3VVBA 3WBBA 2UV8A 3JQFA 1X13A 1LEHA 3BMCA 3C1TA 4EUHA 2I3GA 4JQCA 1CYDA 2GF2A 3RUIA 4GQAA 2C59A 3B70A 3BTUA 5DF1A 3VC7A 2YFHA 4P4NA 4PVCA 4ZVVA 5A3VA 4E33A 1XSEA 9LDBA 5K6AA 7ADHA 3H9QA 4RVHA 1F12A 1DC5A 1N7GA 1QG6A 2AQ8A 3IIEA 4IINA 3WSWA 2RHCA 4CQLA 1F0YA 4BNJA 2CMDA 3LDHA 1NPTO 2P9EA 3KUXA 1H5QA 4IM7A 4HFJA 2LDXA 2NUAA 5U1PA 1NHGA 2Y1EA 3LZ6A 2NQ8A 4BO9A 1ZSNA 1DSSG 3D3WA 1I8TA 5A4DA 4R4JA 2P2SA 2UYYA 2WEKA 3DZBA 5K9ZA 2RHRA 4W7HA 2ZB7A 1AXGA 2DFDA 2EKQA 1EBUA 3FNHA 4WLEA 2VWQA 3INRA 2D0IA 3BMQA 4HP8A 3QW2A 2O3RA 3GNQA 4MKRA 3DL2A 1KEVA 4KTTE 5TLSA 2W98A 2IEBA 1K5HA 1U8FO 1XU7A 5I7SA 4IZIA 3LQFA 2HMSA 5JDCC 4CLOA 1T25A 4XYGA 2BI8A 3KB6A 4A2CA 4EW6A 3M6IA 3OJ0A 3RUAA 1U9JA 1KEPA 1YL5A 1MC4A 5ITVA 3WMWA 1LDGA 1KC3A 2PZLA 3AW9A 4CPDA 1IB6A 1EUCA 4BKRA 5IDXA 4J91A 4DYDA 1XQ1A 2VYVD 2X4GA 2HMUA 5THQA 4XQCA 3WLEA 5IAAA 2O48X 2WJPA 3DMTC 1GYRA 1HWYA 3WICA 3LLSA 3VZSA 1VM6A 4GMFA 1LDYA 1LRLA 2AMFA 4CM1A 3W4IA 2FOIA 2YV1A 3VTZA 4BO1A 3MWEB 4QECA 3FPLA 1QV6A 2ZYAA 2IDZA 3MTJA 3O8QB 1DC3A 4EUFA 1I10A 2J3KA 4J0EA 1VKOA 1R6DA 3W8FA 4AJ4A 5IJZA 4BGUA 4XX0A 1TT7A 4MKZA 1M2WA 2Y05A 3EAGA 3PTZA 4GLOA 3O4RA 3WXBA 1EVIA 2X0IA 3GQVA 2YDXA 1B8VA 5KKAA 5BQFA 5I7EA 3JD3A 4BMNA 1LSOA 1UJMA 1MG5A 2VOJA 3K96A 3C7DB 4DQXA 1UAGA 2AQKA 3BTOA 3GA0A 4N5MA 3D1LA 3U62A 1GUFA 3H6KA 4BO2A 4ZGWA 3Q9UA 4IS3A 2X58A 5H81A 5CEEA 4R3WA 1VJ1A 1KEWA 1R4MA 4AJPA 3M1AA 1DJNA 2O2SA 1PS0A 2E6UX 5A9TA 4E2WA 4BO3A 3FSRA 4YJFA 1Q0LA 5KNLA 1NM5A 4PLHA 3PXXA 1GV0A 5CDUA 2JCXA 4RF5A 3GAZA 1IZ0A 1J4AA 3ETDA 4FFMA 2ZATA 1G0NA 1RPNA 1U8XX 4U0JA 3NX4A 3QQPA 5ICMA 2C20A 3U9LA 3DBHB 1R4NB 3S2FA 1KVSA 5A03A 5CP8A 4CM6A 3JQAB 3NV9A 4TSKA 4TVOA 1A9ZA 5CPFA 1DFGA 2HAEA 4R3NA 4CMGA 3I4FA 3NGXA 4PN3A 2DFVA 4J1QA 2J3IA 1W8DA 2VHZA 5ICSA 2DLDA 2W2LA 1KEUA 3A28A 5AXBA 2ILTA 2E49A 2BLLA 2FMUA 2ZTMA 4P8RA 1VKNA 3MJSA 4FIZA 4MVJA 1NP3A 2P5UA 1A27A 2VTDA 4DGSA 3WOHA 3RCBA 2X8LA 1IL0A 2DBVO 3OP4A 4GI2A 4ROSA 2P5YA 1H94A 1EVYA 3CMMA 3FPCA 3L0DA 3VDRA 2HCTA 3ZW9A 2I5PO 5JCXA 4Y98A 4GX5A 3F5SA 3RQSA 3Q6IA 5B4TA 3RC1A 5BR7A 1WPQA 2DAPA 2IXAA 1RYEA 2JD1A 3DHNA 3AM4A 1MP0A 4BNLA 3T7CA 2C7VA 4RDHA 2G0TA 1H6DA 3QRWA 1A72A 2HKIA 5DOVA 1I3NA 2OOSA 5EPOA 5HWSA 3RBXA 3OIFA 2LDBA 3GVHA 2PKQP 3V2GA 3CSDA 1W6UA 4RORA 5F5LA 3ST7A 3F1LA 3HFGA 2W4QA 4IDEA 4MVJM 1WZIA 3KEOA 3PEFA 4WCFB 4CM8B 4PZEA 1SZJG 1KVQA 1JKFA 4QO7A 1R0LA 1P74A 3CTMA 3G79A 3A1NA 3B1FA 4J1TA 1I2ZA 4NR0A 4JJFA 3GGPA 1ZEMA 4FFNA 3W6UA 3UW3A 1EVJA 3OQ6A 3KHUA 4EGFA 1PJQA 4NG5A 4EJMA 2NADA 4Q3BA 2Y1CA 4BVAA 4GMGA 2PH5A 4GX2A 4E2ZA 5I9LA 3ANLA 4EUEA 2RH8A 1OAAA 3BYZA 4FFLA 1SEPA 1X14A 2NWQA 1LRKA 3HZZA 4BGIA 2V6BA 1X7DA 3ZWVA 1XR3A 1DRUA 2EGGA 1ONNA 5F1KA 1NTOA 4E13A 5JAIA 3LF2A 4GBJA 5TT1A 4CMJA 2QRJA 2BF7A 4CMIA 5A3JA 1K0UA 2BI7A 3D5TA 2BD0A 4FGSA 3WIEA 2VZ0A 1O6ZA 3TZQA 1VE9A 3IDSA 2Z1MA 5ILOA 3AOGA 3PZBA 4IMRA 5KJEA 3BHMA 5GZ1A 1PL6A 1LTHR 3FR8A 4KUGA 4J7UA 3ZN2A 2VUSA 1BW9B 5IN5A 5IF3A 4J4TA 3DZFA 4I9HA 2CD9A 2IYPA 3GN1A 5A9RA 3N7UA 4N7RA 1YDEA 1VSVA 1P9LA 5BNTA 1H6CA 4BMSA 4LVCA 4CODB 2CDAA 3RU9A 1ISMA 4XKJA 1DIAA 1ENPA 3QHAA 3ZWYA 2V6MA 5G0SA 4ZU3A 2Z1NA 4O59O 2VWHA 4DXHA 3JQEA 3ZCXA 4MIOA 1TLTA 3WQQA 1SNYA 1SB9A 4L74A 3BMCB 1C1XA 2Q49A 1SB8A 3K2EA 3KLPX 4RF2A 1HRDA 1HZZA 2G1UA 3M1LA 3ZU4A 3TFOA 1A4UA 3EDMA 3BTVA 3R3JA 4KZPA 3EZYA 4XYMA 3GDFA 1BG6A 4CQLB 1IULA 1MV8A 3GH3A 3WR5A 4D42A 5ITWA 4DLAA 4J7CA 3OJEA 3TSCA 2PLAA 2Y1DA 3BMOA 3D3WB 5IDWA 3PHHA 4WEQA 4FSHA 4R1NA 3H9JA 3OHSX 3ZU2A 1EUZA 2EWMA 3E03A 4O0LA 1P33A 1HKUA 1ZUD1 1UXGA 2VQ3A 4AJOA 1FK8A 5FF9A 4ZQEA 3GY0A 1FXSA 2AEMA 3PJGA 1HSZA 2PFGA 1A7KA 3AI3A 3DEYX 3JQAD 4JGBA 5DBIA 2ZB3A 4CM3A 5JC1A 2E82A 5IZCC 1KETA 3D4PA 1U28A 3BMQB 3FTNA 3IKVA 4F3YA 3PQFA 3LVFO 2GNAA 4MPDA 1H2BA 4HXYA 4CLOB 4CMHA 1E92A 4BKOA 4LRTB 3JQ9C 2PKRA 2XXBA 2X9NA 4RPKA 3E82A 5FFFA 1XGKA 3RSHA 1ZXBA 5C7LO 3RUCA 4CV3A 1NYTA 3Q2KA 2FR0A 1LDNA 2O3QA 1QMGA 3AWDA 5A1TA 4L76A 4IDGA 1YO6A 4RDIA 4XEHA 2FPGA 3GK3A 2Y68A 3CE6A 2B36A 4NJOA 2OHXA 4CUZA 4BO4A 4PFJA 2B37A 3EW7A 3QVWA 4NQZA 3K30A 3PWZA 5ENVA 4YB8A 3HWRA 1GDHA 1SPXA 1E3SA 2HMTA 3S1LA 4PIVA 4XDZA 3WB9A 2OFPA 4BO8A 5KCZA 1NNUA 1UXIA 4UEOA 4XIYA 5JY1A 2HRBA 4B4UA 1Y8QA 1O9BA 3GGGA 4Z0TA 1NASA 8ADHA 1LQUA 4II2A 1A4IA 4B8WA 1T2CA 4FDAA 1QLJA 2Q46A 3IMFA 4JXKA 3VZQA 2BFAA 1YS4A 5JDCA 4FOSA 4MIEA 1XDWA 3JQ7A 4ALIA 2DPHA 2VRCA 5JS6A 2DVMA 3NTOA 1S6YA 1C3VA 4P38A 2YDYA 5IXSA 2JD2A 3MJVA 3JYNA 5JYEA 3IQDB 1XKQA 2FPIA 3ONFA 5CG1A 1JKJA 3S8MA 4BNUA 4YAJA 2CUKA 4AJKA 4MKXA 4U7WA 2Q2QA 4IUYA 2YZ7A 1RM4A 3M2TA 3RI3A 4CMBA 1WDLA 3GUCA 1JDJA 1R4MB 1DAOA 3ZH2A 3PHIA 1U2DA 3X2EA 1E3IA 2ZJ1A 3ZDFA 4XGNA 4E0BA 4A27A 4DIOA 5L40A 4YJFB 1B8UA 3WDSA 2EV9A 1GUZA 3VPFA 4D45A 5TF4A 1AGNA 5HS6A 2BELA 4NI5A 4CQMA 1P1KA 2P4HX 4RF4A 1F17A 4RVGA 3KZVA 1EZ4A 4R16A 4K28A 1LLDA 2QHXA 3DZGA 4HWKA 2IZ0A 3AY7A 4OGWA 1TI7A 2CF5A 4FS3A 4BL5A 4NFYA 1P0FA 4QSMA 1ZK1A 2X0RA 5B37A 3AU8A 4B4OA 2DBZA 1YQXA 3I52A 5I9MA 1NFFA 4FBGA 2X5KO 4E5YA 3JD1A 4CV0A 2UDPA 4D44A 2EERA 4J1NA 2Y66A 4M8SA 4J90A 1E5LA 1HTBA 2JAHA 1PJ2A 3ORFA 1E3EA 1GPJA 2B69A 4DMMA 4TQGA 4XYLA 2OUIA 1X7HA 4J6FA 1RM0A 4GVLA 2EG9A 1J6UA 1WMBA 2PV7A 3DOCA 3WIDA 4DYVA 1EQ2A 2GN8A 1O89A 2D4AA 4BNWA 3ZV5A 2I67A 4W7IA 5I9NA 1ZVMA 3DAGA 1ZK0A 4S3MA 3F9IA 1JWAB 4BO7A 1EBFA 4YCAA 2NVWA 3DZHA 3QY9A 3VPSA 4YRDA 3DQPA 4XR9A 4I1IA 5TNXA 3I6QA 2GRAA 2GZ3A 4XJSA 4Z0HO 4YPOA 4Q3AA 1DO8A 3EVNA 4CM9A 1QORA 4PLFA 4PLYA 4A5OA 3HADA 3GT0A 1HDRA 4DA9A 4BO5A 5L95A 3IUPA 3RC7A 3RU7A 1FDWA 1AN9A 4PG5A 3HHPA 1OC4A 3RC9A 3R1IA 2AW5A 1XELA 5C7OO 4GX1A 3ZV4A 3FBTA 3MEQA 1ENZA 3KRTA 4XWYA 2OZPA 4J4BA 1I0ZA 1LSSA 4KWIA 4HV4A 4TWRA 1LQTA 4WOKA 4EZBA 2EEZA 2J6IA 4CUJA 5TIIA 5EINA 3A14A 3UGKA 3ZWXA 4WUVA 4O6VA 3PPIA 4H15A 1AXEA 4L73A 4WGGA 1GY8A 2PD4A 3OF2A 2YFQA 2PD3A 5KVVA 4CMIB 1N5DA 2FN7A 2ZTLA 2YY7A 3G0OA 4ND2A 1LUAA 1NBOA 2HK8A 4Q9NA 1E1LA 3O03A 1SO8A 4CLXA 4IDBA 3ZGYA 1PZEA 2W2KA 4D7AA 2WD8A 2BGKA 1WLYA 2O7SA 3KYDA 3U4CA 3EK2A 2AE1A 3P19A 5IDYA 1JVSA 1GQQA 2Q3EA 1PGJA 1N2SA 4OXYA 4I9NA 1K6IA 1X1EA 3OA2A 3BA1A 3Q0EA 4I5DA 3G49A 4YAGA 2VHWA 1R0KA 3C7AA 4BKUA 3ZNPA 2NLOA 4YA6A 4KP7A 2CFCA 5KJ6A 3T7EA 3FF4A 2DPGA 3KOUA 1A7AA 1M67A 2FZWA 1ISJA 3WYCA 1SOWA 4ALLA 2WDZA 3GVCA 3I83A 3BXXA 2O4UX 1ADGA 3C7CB 5DCUA 5EJ2A 4DPLA 1DC6A 4DVJA 5JY6A 3NTRA 1VI2A 3AOEC 1DEHA 1ONOA 3AU9A 3P5SA 1FDVA 1KBZA 4CL8A 1I3MA 1BXKA 2B0JA 5B4VA 5CG2A 1GQYA 2TMDA 4UVEA 3ASUA 4L75A 4NK5A 3TZCA 2VHYA 3EMKA 4GX0A 1Y7TA 1I01A 1ZW1A 4ID9A 5HBRA 5HRUA 3AY3A 4IIUA 1A71A 2P9GA 5TX7A 4H16A 1PQPA 4UEKA 4WLNA 4XQ9A 4OOEA 3G1UA 2AEFA 1ZK4A 3BMOB 5K0ZA 2AEJA 4GLLA 4A03A 2H1SA 4TROA 4BO6A 4IJVA 4NBTA 3PJDA 2VZ9A 4L4RA 1G0OA 2I99A 3OQBA 4NJMA 3CEAA 4WLOA 3JTMA 3BIOA 1UP4A 5T8KC 3GF4A 4PRKA 1P1RA 1A5ZA 2AG5A 2C2YA 1S7CA 5JW6A 2UVDA 3NEPX 4RVUA 4XGIA 4HFNA 3W4KA 2W2LD 3AK4A 2YW9A 2PH3A 3PQEA 2VNAA 4M89A 3G1TA 4MVJD 2HQ1A 5KVQA 4UVIA 3TF5A 3T4XA 4EJ6A 5FEUA 4R9RA 1XG5A 4OSPA 3QVXA 1N1GA 3GDOA 2NU8A 4F45A 1U3WA 1NXQA 1V3UA 2HJRA 2X22A 3GFGA 3HDJA 4R1SA 4DPMA 2GN6A 4H3VA 1NVTA 2PZMA 4BNTA 3N58A 4B7UA 1L7DA 3PDJA 5HM8A 4K6FA 4UUPA 2WSBA 1VRWA 1F8FA 4OQZA 4QTZA 4AICA 2VRBA 3RKUA 3PI7A 3BTSA 3UHAA 1E1NA 1P44A 1M75A 3IL2A 3K5PA 2VUUA 2Q1UA 4IGEA 3UN1A 4NBRA 2D8AA 4BNVA 3LLVA 1Y8QB 3ONDA 4XR4A 4DC1A 2J5KA 1ZK3A 4CR7A 2X5JO 3AM3A 1XU9A 3QP9A 1H93A 2JHFA 3DMYA 3INTA 4IJWA 4J7XA 1HETA 3JQ9A 4HNGA 3JQ7B 4YJHA 3F4BA 1OOEA 3PLRA 1P45A 1CEQA 3DDNA 3W8EA 2WMDA 3D64A 4R01A 1U3TA 3JYOA 4PCVA 4CLDA 4DBZA 5IFLA 1V9LA 4FPXA 3WLFA 1PIWA 2I9PA 1DC4A 3WS7A 4CM4A 3OJFA 9LDTA 1D4FA 4Y8VA 3HQ4O 1T2EA 1E7MA 1PZFA 3DBLA 3JQBC 4J2OA 4E4YA 5HS4A 2Q4EA 3GPIA 2GGSA 3I9LA 4DL9A 4IDDA 1EVZA 4GH5A 3SLKA 2NU6A 3B20A 4R69A 4H7PA 4BB6A 1KVTA 2DTXA 2IE0A 3OEYA 3GHYA 1RYDA 4LRSB 1DJQA 1ZZEA 2I6TA 3GG2A 4RV9A 1WP4A 4FFOA 4MVJH 2VZ8A 4CQMB 3AUUA 4R1TA 2FY8A 4JN6B 2NQTA 2P68A 1X7GA 2WM3A 5DULA 1D7OA 3JQCA 2B4TO 4ZQHA 1QYXA 2ZJ0A 3LC7O 4IY1A 2BHLA 1LNQA 4HX5A 3DBVO 4I5GA 2HJSA 3L9WA 3SX2A 2QRLA 1I5RA 2WE7A 2WTBA 3L4BC 4OJNA 1H9BA 4PRLA 3OETA 5AXAA 1Y1PA 4D3FA 3Q2IA 5BSHA 3FHLA 4D0SA 4OMUA 3FRJA 3MOGA 3COSA 1DHTA 5DNAA 1SC6A 4FD3A 2V6GA 1E6EA 1FMCA 4P4LA 4WLVA 5AQ1A 4W6ZA 5KJCA 4ZRMA 5F1OA 1D8AA 4XDYA 5KVSA 5U4QA 3V1UA 4BGEA 3QWFA 3ENKA 3GMSA 4ALMA 5A04A 3H3JA 4WE3A 3VKVA 5L53A 3P2OA 2W8ZA 2QG4A 3GZNB 3INGA 3K6JA 5IG2A 4TKMA 2HMWA 3OM9A 1P3DA 2AXQA 4NHEA 3VPHA 1DFIA 1F14A 2GZ2A 4I5FA 4GAEA 4XA8A 3BZUA 1HDCA 1ZMOA 3DOJA 4OKIA 1U5AA 4NFSA 5C37A 5COBA 5ER9A 3PJFA 4IIVA 3ICPA 3RFVA 4F46A 2ZKLA 4X54A 4II3A 4G5HA 3ICCA 4IZHA 4ND3A 2Q4BA 1DBVO 4A26A 1I3KA 1RM5A 2V65A 4UREA 3VZPA 3ON5A 2CVZA 4CMEC 1PQWA 1G6KA 1BXGA 3TDKA 4EITA 1PZGA 1BSVA 1Y9EA 2JFHA 2X5OA 3A9WA 4CMKA 5MGBA 4PZDA 3RIHA 1HDOA 1V3TA 1GTMA 4B3IA 3H4VA 1Z7EA 4OO3A 4M49A 5JNLA 1HLDA 1MXHA 3ITDA 4FR5A 2GCGA 2Q2VA 4UVHA 3H3FA 3FTPA 5ENDA 1JTVA 3DTTA 4EEZA 4W4TA 1WW8A 1UP6A 2C7GA 1D3AA 3GG9A 3LT4A 4M87A 1YDWA 1GV1A 3ITKA 2Q2WA 1HXHA 4DLLA 3R3SA 4OL9A 1NQOA 1MGOA 3FNEA 3PQDA 1GEGA 1PS9A 1B3RA 4LMRA 5U9CA 5ILGA 5CEFA 5BT9A 1M6WA 2EP5A 3PJEA 1I32A 2YYYA 1L1FA 2BGLA 3K92A 1VJTA 4FGWA 4YQZA 5A02A 1YBVA 3RUHA 1XHLA 3GRPA 3L07A 2R00C 4LCJA 2W2KB 3GNSA 2ZTUA 3KYDB 3KBOA 3QSGA 5JO0A 1SBYA 1O0SA 4N18A 3DTYA 4DQUA 1HL3A 2FR1A 3UF0A 3TL3A 3WYBA 4OYRA 3OBBA 3SJUA 3AUSA 3DOOA 2WD7A 2XOXA 4ZQFA 4IXTA 1OI7A 3E9QA 3VTFA 1IPEA 4YJGA 1KY4A 4L4XA 2A4KA 4OHUA 2EKLA 4JBGA 4HNHA 2WYUA 1ZSYA 4URFA 4RLSA 3MJTA 2JD0A 4AJJA 3QLJA 3K31A 4JNKA 3VPXA 1JQBA 1SCUA 1FDTA 1PTJA 3C1OA 4IDCA 2QIOA 1GADO 4MVJE 3D0OA 2IRWA 3NDIA 3KO8A 3JQGA 1T4BA 1FJHA 1H6AA 4HFRA 3NDJA 1PL8A 4R68A 3RKRA 4E30A 1PJ4A 1GPDG 4CQMD 1N7HA 4YJDA 1QRRA 2NVUA 3CIFA 2VNSA 4J4HA 3RUDA 3I4CA 2YJZA 4GWKA 1LRJA 4Z0PA 3NDRA 2W90A 4MDHA 4BNMA 1IHYA 3GDGA 3FD8A 1E77A 1R12A 3PHGA 2VN8A 1J5PA 3PFWO 3W6ZA 4MJLA 3NTQA 4W9NC 4GSLA 1D1SA 1P0CA 1NFRA 3FN4A 4LVUA 3TN7A 3TFQA 3D4OA 1QP8A 2NU9A 4IJKA 4ZQGA 4N5NA 2QYSA 4OIMA 4TZTA 4J43A 5TC4A 3AOEA 5CAEA 2QX7A 3NT2A 3H8VA 5A5FA 1LA2A 2FPPA 1ISFA 2GLXA 3F6YA 4Z9YA 3ABIA 4YTEA 4RQTA 3GEGA 3SLGA 3UFXA 3F1KA 5T67A 4YT5A 3KTDA 3ZWOA 1VC2A 2AG8A 4BNGA 3GAFA 5JAQA 5JPIA 3GVIA 4WCFC 1SEVA 3WGIA 1NQAO 3DB2A 5A05A 1DLJA 1V35A 4J1SA 3TOZA 1EK6A 3PYXA 2SCUA 1TT5A 3GMDA 3VKUA 3RFTA 4K26A 2YV3A 2DTDA 3PWSA 1YGYA 3WJ7A 5BNIA 2J8ZA 2I65A 1GCUA 2CZCA 4NNJA 4R54A 2ZB8A 1JAXA 3D4NA 5T8KA 5FI3A 5CDTA 1U4OA 2DBRA 1IOLA 1BMDA 3LU1A 2HK9A 3RJ9A 3CKYA 1DIGA 3ZWWA 4CM9D 1ZXLA 4Q3EA 4A10A 5LDHA 4YJHB 3W8DA 1JWBB 2VUTA 4A73A 4YXFA 1T2DA 1I33A 1IPFA 1GR0A 3F5QA 1YH3A 4CM5A 5DBFA 4NZ9A 1NVMB 4PG7A 4CM4B 4D3SA 2HLPA 2NVBA 2O3UA 4YT4A 4YAKA 1W4ZA 1PGNA 5L4NA 4NDNE 4WNCA 4LMPA 3DBLB 2B83A 4R5HA 5G4KA 3TOXA 3KYBA 2QRKA 3PLNA 1HE4A 3HFSA 1Y5RA 4XQEA 4FJ2A 2CF6A 3WGGA 2X9VA 1EUDA 4E5NA 1E7RA 1ZCJA 4IS2A 2HUNA 1EDOA 1ZNQO 4NU6A 4JLWA 2WWRA 3H5NA 4R9SA 2FR8A 4E6PA 4PG8A 8LDHA 1AHIA 2GR9A 5KTKA 5JO9A 1MXFA 1EEHA 4D43A 1AHHA 5CEJA 2YHIA 4I8XA 3HSKA 2X9GA 4TRRA 5LDGA 1NVGA 2PY6A 4LISA 4R5MA 1GYQA 2NTVA 1ZFNA 3MCVA 3JQFC 1A9YA 4RPJA 1T2AA 1ZIDA 2DBQA 4WNIA 1ZH8A 4YEDA 3HB4X 4C7JA 4BOYA 5JC8A 2JCVA 4PLGA 1V0JA 4BQPA 5K6AC 4Q3CA 1LC0A 3NYWA 4HKTA 1X1TA 5JE8A 3VH3A 3ONEA 4BNFA 2UUPA 1YOVA 3I9OA 4RO0A 1YJQA 3PFFA 4ZRNA 5JCJA 1N8KA 3UXYA 3D3EA 1E1MA 3QA9A 1JKIA 1PS8A 3LT2A 2QW8A 4UUNA 1YONA 3MJEA 3U49A 4J16A 2NM0A 2CVQA 2D59A 4KUEA 2GN4A 2VT3A 1E3JA 4XD2A 1Z73A 4ITUA 4IXWA 3ZHYA 2EP7A 3DHEA 4HBGA 1F06A 1Y5MA 1D1TA 4MVJI 3L4BA 5BNFA 2VHXA 1GZ4A 2QYTA 4J49A 1T2FA 5GZ6A 1PR3A 2OL4A 2GUGA 3JQ8A 3DMTA 3HN7A 3X2FA 2HO5A 3MOIA 2PA3A 3I1JA 4G81A 2GASA 3AM5A 3Q3CA 4IMPA 4IQ0A 4Q3DA 1OC2A 1FDUA 2X86A 4IDAA 4O5OA 1LX6A 1BXGB 2A35A 2O3JA 2DKNA 4R41A 4RVSA 5IZ4A 4Z3KA 1UP7A 3ZHZA 3K8ZA 4B79A 1E3WA 4MVJG 2DC1A 3WBFA 4DUPA 3GLQA 1YJ8A 2BH9A 4BQRA 4XB2A 1DIHA 1IE3A 1O8CA 1VL0A 3HG7A 3L9XA 4EBFA 1MFZA 4TKLA 2GPTA 2JKVA 1B2LA 2CDBA 4XJTA 1GCOA 1IYZA 1Z6ZA 2X23A 3B6ZA 4PGFA 2IZZA 4XB1A 2IZ1A 4NBVA 2O50A 2Y1GA 3ZV3A 5JYDA 2Y93A 3E18A 4FJ1A 1N92A 4PLCA 3AY6A 3P7MA 1TB4A 3QWBA 1EDZA 1DAPA 3WQRA 2G76A 4NH4A 1MX3A 1PGPA 2R2GA 2FSSA 2PK3A 3M2PA 3BMNA 1P1IA 4I9UA 4JK3A 4PLZA 1YB4A 2QZZA 2GSDA 1I2BA 1JU9A 3S2GA 4XGKA 2PWZA 3NRCA 3S55A 2G5CA 3DWFA 1XQ6A 2QZ9A 3HN2A 4DLBA 5TT0A 1C0IA 2UUOA 3LK7A 4BS9A 3RFXA 1BVUA 3JYLA 5CDGA 4B3JA 3DFUA 4MP6A 4F6LA 4OXKA 1LSJA 4LN1A 2WD7B 3JQ6A 1ISHA 4CMCA 4INAA 5JFOA 3WX0A 1YXMA 3Q9NA 2O2YA 1ID1A 2EF1A 1NQ5A 2X0NA 3TL2A 3IC5A 4YJGB 3SJ7A 3AJRA 1ENOA 5GZ3A 4RVDA 3KXDA 5BSGA 1U2GA 3LC1O 1GQ2A 5TS3A 3C85A 1NR7A 4Z3DA 4NU5A 2B5WA 2C0CA 1W73A 4RQUA 1P31A 5CDYA 4DQVA 4XYEA 2H5LA 2OGUA 3JQGB 4WLUA 3VH2A 4WOJA 3DO5A 2EIHA 2Q50A 4WLFA 3L6OO 1ZKMA 2NVUB 3H9UA 3WFJA 1PGOA 4ESOA 3SEFA 3UVEA 4BNZA 4DTIA 1SOVA 5KOIA 3ZWNA 4MOWA 5JSFA 5KKCA 1P77A 4Z9XA 4CV1A 1H6BA 4Q3NA 1B14A 1LDBA 1X15A 3UUWA 4DWVA 3V5NA 3FWZA 4MVJP 4GPD1 3JD0A 2NACA 3KEQA 3V2HA 1BHSA 4DPKA 1UDCA 4QFDA 4BKPA 1ZSVA 4AJHA 4MIYA 5G0WA 1LLQA 3VVCA 3STHA 5C3MA 2V6FA 1E7SA 4K9DA 2J3HA 4XQGA 5G0VA 5I8ZA 1MA0A 3QV1A 4WECA 5L4LA 5THKA 4PLWA 4JIGA 2Y0CA 3H2ZA 4U0KA 4GGOA 3ZHBA 3OECA 3MJCA 1TT5B 3R6DA 1CQIA 4JCOA 1EFLA 3ZWMA 2ZTVA 1BWSA 3S2IA 4CUKA 4N5LA 3WGHA 2Y0EA 1DLIA 3UAGA 5EN4A 4BB5A 3CUKA 3GUYA 1LJ8A 5EQDA 2PZJA 1C1XB 2JL1A 3BAZA 4ND5A 4BNIA 2JCYA 1Y8RA 2XAAA 5KJ1A 1PSDA 3BHIA 4ZQBA 1E5QA 1B3BA 4M54A 3N74A 5KVCA 1J0XO 5DCYA 2X6TA 4K1LA 1QR6A 5CFZA 4YRAA 3UKOA 1QYWA 2F00A 1HDZA 3GPDG 5IDQA 1MG0A 2J3JA 4BV9A 2JAPA 5FI5A 3RC2A 1YVEI 3VZRA 3DR3A 5G4KB 1G1AA 1U4SA 4TRMA 5BSFA 4CM7A 3SVTA 3PK0A 2J5RA 4IQGA 3KV3O 5JDIC 4GKVA 3D5QA 1OFGA 1HYGA 1Z45A 1IHXA 1MFPA 3ANNA 2HRZA 2FWMX 3I6IA 3Q11A 4F6CA 1LDEA 1T1RA 4TRNA 4L8VA 4ZICA 5EESA 2NTJA 3QVSA 4FB5A 4AJEA 7MDHA 4BNHA 3LF1A 1IY8A 5DZSA 4C7KA 5GY7A 4W82A 2Y99A 3TRIA 3ZU3A 1DRWA 3IS3A 1EQUA 1ADFA 2PGJA 2YHIB 3OICA 3RUEA 4E21A 3GGOA 1PJLA 1GU7A 3ZV6A 4AJ2A 4JBIA 1HEUA 2CY0A 2YHUA 4FFRA 4XRGA 1NPDA 2WE8A 1U7HA 4IPTA 5LC1A 4QFCA 4QX6A 3K2BA 2B4QA 2Y1OA 1PWZA 2EW8A 3ZU5A 4LSWA 1BGVA 3GVPA 1YBAA 4UEJA 2EHDA 2VYNA 3S2EA 5L7TA 5JMPA 2OBNA 1YOVB 3F46A 5IZCA 4EI2A 1E6WA 4E32A 3EVTA 3TPCA 4MINA 3WTBA 5LCXA 4CL3A 4K6CA 2YV2A 1X0XA 3H65A 4AJIA 3RVDA 3R0IA 5DT9A 1GL3A 3KETA 4AG3A 2Z95A 1ARZA 2Y0DA 1BDMA 4RZHA 1KS9A 3GHHA 3GZ4A 2Q1SA 1Q2XA 3QWHA 2GD1O 3AI2A 1YL6A 1UXHA 5TGDA 4YYZA 2PGDA 4I5EA 1CF2O 1XA0A 5DN9A 3H5AA 1JA9A 3WYEA 2H6EA 1UXJA 1B7GO 1GYPA 2QQ5A 2D3TA 1EE9A 3ETEA 4IGFA 2O4CA 1Q7BA 3JQ8B 1O94A 4LW8A 1MB4A 3OMLA 1CRWG 1LSUA 1GFSA 1JAYA 2VHVA 3O9ZA 4BKQA 4YBZA 1HDYA 3JCZA 3WTCA 1E1KA 3LT1A 4CR8A 3UCEA 1M76A 3KSUA 2FHSA 4N54A 4P22A 1KOLA 3OQ1A 1E3WB 3OSUA 3NUGA 4GWGA 4O63O 1RWBA 2P9CA 3HDYA 1PL7A 4HUJA 5DBGA 3KYCA 1GD1O 1NFQA 4FJ0A 3VOSA 1ORRA 4KQXA 2ZQZA 3MZ0A 5L9AA 5IN4A 1LU9A 1QSGA 1E7YA 3KVOA 3AI1A 1YRLA 3FR7A 3RWBA 1TVEA 3I9NA 3SXPA 4B3HA 3JV7A 3PYMA 2HK7A 2OP1A 1WMAA 3PWKA 4JJGA 4M55A 5AOVA 3QWIA 3SC6A 1LC3A 3PP8A 2POQX 5DOZA 2ZIZA 1U5CA 1ZMTA 5J23A 1EK5A 4FFPA 4B7XA 1WNTA 1BTOA 3LYLA 2E4AA 3O38A 3BMNB 3PIIA 4KMSA 4ND4A 5ADHA 3E5RA 1ENYA 3TNLA 3PGJA 2CDCA 2NTNA 2DU8A 2DUWA 2RCYA 1KVUA 2Q1WA 4D79A 2EXXA 3ZHXA 1F8GA 4IDFA 3GEDA 5COAA 3ZWCA 2ET6A 3D7LA 5TRTA 5GMOA 1Q1NA 3PIDA 2FRDA 2ZB4A 1Q7GA 1I36A 1U3VA 1ZK2A 1EE2A 1CJCA 4U6QA 4NFHA 1K6JA 2CNBA 4E5MA 4U6SA 3NJ4A 1BDBA 1T26A 1PGQA 1C0LA 3A06A 4YDRA 4BNYA 5H82A 2PZKA 3HDHA 4TMFA 3DC2A 1YB1A 3UOGA 2ZK7A 1Y81A 1HE3A 4Y6RA 1B16A 3RJ5A 3TJRA 5G0TA 3NKLA 5G4LA 3GR6A 1PJBA 3U4HA 3OIGA 3CXRA 2YQ4A 5DCWA 5T6BA 1Z7BA 4YR9A 4YAEA 4M1QA 5JLAA 4JJIA 2C5AA 3WMXA 3UCFA 3PRJA 2DUUA 1HDGO 3IP1A 3VHRA 2DQ4A 2OORA 3I9KA 4NK4A 3V2UA 2PKQO 3KM0A 4M86A 3NJ8A 5CPBA 4GSKA 2C54A 1I3LA 5B1YA 4J9UE 5IXYA 4YQYA 1E0DA 1Z75A 3ADOA 4TVBA 4PLTA 1FF9A 1I24A 2VCYA 5ES3A 3Q1LA 4G65A 1DDOA 1NHWA 4GL4A 5AXDA 2PNFA 1JW9B 4GVXA 2BFPA 1BXZA 1DIBA 2PR2A 1YQDA 4D3DA 4RVFA 4WASA 1QXSA 1V6AA 2ZCUA 3EZLA 2B4RO 4AVYA 5JCJD 4TZKA 3GC6A 2O3TA 2JFFA 4TRJA 4PZCA 2CVOA 4RPHA 3ZNQA 4Z9FA 1UDBA 4XCVA 2C29D 4UUOA 1N9GA 2OBYA 3V8BA 2Q99A 3ROKA 4PLPA 2VRCD 1DB3A 2NV6A 3UCXA 4W99A 3HUDA 1Y9AA 3HE3A 4BIIA 2I66A 4BNNA 3FCOA 4E12A 1O95A 4FC6A 3I9MA 1K2WA 2NNLD 1GZ3A 1M6HA 4IQ8A 1ADBA 5T64A 3U3XA 4XYBA 3VDQA 4BO0A 4Y67A 5AYVA 3HJAA 1Y8RB 1DOHA 2BFMA 4EEXA 2J5QA 1T24A 2A92A 4FW8A 1TXGA 4E31A 6LDHA 1CERA 4MP8A 5AVOA 2FSVA 4HADA 3OH8A 1XCBA 2RIRA 4AFNA 1UDAA 1RKXA 5EQFA 3JYQA 1UH5A 4L9RA 1VJ0A 1GAEO 4BNKA 4FN4A 4RJTA 2DT5A 2EKPA 3CZMA 1Q0HA 3HB5X 1ONPA 1MLDA 3PHLA 1R15A 3ENNA 5JBIA 1I30A 4AJ1A 1EMDA 2D2IA 4HFMA 3DXFA 2NU7A 4FCCA 1OZAA 1ZEJA 1C1DA 4YWJA 3DZKA 2XXJA 4ZHSA 2RH4A 4OH1A 3DFZA 1DIRA 3L4SO 4A7PA 3WGTA 5I7FA 3JYPA 1KYQA 4BGVA 4D0RA 1YL7A 1QV7A 3TWOA 3C3XA 2BMAA 3NT4A 1Y6JA 3L6EA 2A94A 1WXDA 5COQA 3WNVA 4QO8A 3VH4A 1E6UA 2O23A 4XRRA 4CLHA 3OEWA 2GERA 1R16A 3DHYA 4ZN6A 1NWHA 5FWNA 3U5TA 1RM3A 4WEOA 1H2HA 4BUCA 3WGZA 2VYVA 3E9MA 3UH1A 3MWDB 1CETA 2AQHA 3QE3A 4UUMA 5JDIA 4A0SA 1YKFA 1H0KA 3JSAA 3ZNOA 1N1EA 1CIVA 3KSZO 1T4DA 1UZMA
chains in the Genus database with same CATH superfamily
4LQLA 4MWDA 4S2UA 4X8OA 4JKYA 1UDWA 2I76A 3T4UA 3PRKE 4IJMA 1T0PA 1GPMA 2AMLA 1ISGA 3U13A 3TLYA 3UJ3X 3TUJC 4Z7NB 1YZUA 1BDIA 4J0FA 2K87A 3AUAA 3J7TA 1B1CA 2AHOA 2W6ZA 3KJHA 5HJ2A 3MILA 1HI9A 1SU8A 1YUMA 4CG1A 5CYFA 2AE2A 1Z74A 2QB5A 2OVBA 4EVRA 1T0HB 2OXIA 5L7WA 1AKNA 4H1HA 3THRA 1I7NA 5EC8A 2FMIA 1KNQA 1VBFA 2V7PA 3NWOA 4JV5B 3R7WA 2BRUA 1O6CA 3HBMA 4L5IA 3D2LA 3PFCA 1K8QA 1DPGA 5CVJA 1PG2A 5T4BA 1ULUA 3AJ8A 4H4DA 3PCTA 2YXLA 2C4HA 2R7MA 2RI1A 2QY9A 3LKZA 3QK7A 1QM5A 1ESZA 1DKRA 5ALOA 3HNOA 2C7RA 3O8LA 2FMTA 1NBME 2NP7A 1TK9A 3U3DA 1NX6A 5KDOA 2OKCA 3KYCB 4R1UA 2J4CA 1VL8A 3GH1A 4JGIA 3VPGA 4C22A 2YMQA 4Y2XA 3ZW7A 1RDFA 5TQVA 1LXCA 2B30A 3E0XA 4C89A 1HG1A 1OREA 4J0IA 3E3LA 3LY9A 1EVQA 3DAYA 1ECFA 1CQWA 3AT1A 3U1TA 5FTLA 2OXTA 1D2EA 1SQ6A 3DZIA 4KQJA 5HNKA 1OXXK 1IDN1 3E9RA 5BMVA 4JLAA 1Z6YA 2A5JA 3QLEA 1IOWA 1T9GR 1MPXA 5K8TA 4R8MA 3AETA 4AJNA 1IZ9A 4JOBA 7YASA 1AC5A 3KJFA 3CLUD 2QQEA 4UCQA 3LGAA 2DFKB 3LSYA 2WQ6A 2P79A 4LJRA 3MJ4A 5F73A 3C1AA 1VA4A 3DMDA 3KLMX 2QI9C 2AZDA 4PCUA 3BA6A 2QRVA 4CLEA 2QE7A 1J07A 1HKHA 3L01A 5HA5A 3GEIA 5K3FB 1TF7A 2QV7A 4Z99A 4Q7KA 4WSOA 1TF2A 1RADA 3GO4A 5ALUA 2VHQA 4WXYB 4IUCS 5KMGB 1EK2A 3EWSA 1ADCA 2DM6A 1JSXA 2JFZA 3A6HA 4ZZ0A 4F2WA 4RKRA 1PJZA 4XUDA 4YAFA 3C74A 1FTNA 3IBSA 2BI4A 1NN5A 3QVTA 3EPHA 2XTJA 2YN2A 2FJPA 4MSUA 1MABA 5B3LA 4I2NA 2BMVA 1ESMA 3AFNA 3CZRA 1RXSA 1UMBA 1TRKA 1AN0A 1J97A 1J21A 1C4OA 2OHVA 3DBRA 2ZB2A 3F6SA 3IUSA 4OJYA 4RHFA 2JI8A 2G4VA 5EYPA 4ZVMA 1I4LD 3DP9A 2Q4TA 4D99A 4CCAA 3CBQA 4B5KA 5BYKA 3E8XA 3C16C 2ZR9A 4ZAZA 3W0LB 5M2QA 3ULKA 2ZAGA 3HFRA 4CIWA 2ONKA 3GLTA 4W1SA 1T34A 2XUZA 2EX1A 4X8MA 3WJ2A 1M5TA 3VISA 3TJMA 4Y1RA 1GGMA 4TSRA 3EY4A 4KUHA 1E8DA 2VH1A 4L4SA 3L4EA 1PJSA 2QLFA 4C9BA 2FX5A 1U7OA 3UJ8A 3QF4A 1B15A 4GGPA 3DAPA 4U7HA 2HD4A 1UBOS 3OJOA 3P0RA 5KIAA 1VBKA 3FPFA 3RYCA 5DGTA 5FBHA 4ZEOA 3QBEA 5I7VA 1HGXA 3SK0A 1U1IA 3TZKA 1MRSA 1T9HA 1X3SA 1ZR2A 1VLLA 4Q9HA 2RBEA 2HLNA 1BRMA 2AH5A 2V3WA 1XTQA 4AZTA 1K7CA 1OLXB 4UQPA 5FPYA 1RS0A 3ER6A 2QUBA 5K3CA 1AS3A 3H6HA 2BEVB 2DLNA 2PIAA 2VHCA 2WR8A 3D7RA 3MQFA 5ER6A 4TV9A 2YIJA 3ENVA 4Q39A 1F60A 2LTAA 3PVZA 1UM9B 3ELUA 5EZSA 3TBKA 1PL0A 3G17A 4A1FA 4BAUA 3OQIA 4MAFA 3AVPA 3IEXA 5F1PA 4EO7A 1NPYA 3QU5A 4G2NA 2A5YB 3REQB 1OX4B 1JHMA 1Y3BE 3FJYA 3AVXA 2EJWA 3HY3A 1PU2A 3PYLA 2VOEA 4YT2A 3DLIA 2YFYA 5CW2A 3WLRA 2C07A 5DX8A 1GQOA 2X2FA 2FVXA 3WWYA 1IHPA 2D5BA 4KR3A 1RJFA 2BGMA 4CMEA 4GKBA 1XCPA 3B6IA 3O26A 5H02A 3UM9A 3E22B 4Y2PA 1OZGA 4DCSA 4XOIA 4DQDA 2GTIA 3CGGA 3VYWA 4KNWA 4MQ6A 4FWBA 1P18A 3RUFA 5K8IA 3NTVA 4G09A 1T10A 2ZUVA 4OHWA 1P4GA 3S40A 4HLQB 1BJRE 5K0TA 5FBWB 2QRGA 1U7TA 3JYHA 3H0KA 3FNFA 4DDKA 1FS6A 3LX8A 5AK6A 3C5CA 3TVTA 1PJ3A 3P9NA 4LOHA 3V1YA 2VJAA 4DUGD 3EF0A 1OB2A 4ZCRA 2C0QA 5P8WA 2ZCVA 4ZK2A 3V6MA 4KPYA 4RHXA 4AL4A 2HBQA 2Q6KA 3CT4A 2HHHB 4C7OB 4Y30A 4F2HA 4MEAA 4Q05A 3VKFA 4LFBB 2AFIB 3ICWA 5G0UA 4PX3A 4RLFA 1TZKA 2UUBB 3KCQA 4HUQB 2X0JA 1U31A 1O97C 3OMXA 4IOKA 2R00A 2GZ1A 3FPSA 3G2NA 4DMKA 4UPDA 4FHCA 5EL0A 1E7QA 4IJ5A 1XDBA 2JJ1A 5GM1A 5ECGC 3ZK7A 3HB1A 1HNXB 1A97A 3KXKA 2SECE 2CCKA 2J7PD 2OV2A 4YJ3A 1CWUA 2YQZA 5J4HA 4TN1A 4UAGA 4AF7A 1R66A 1Y8ZA 3U60B 2H06A 2OP0A 2A1UA 5AKGA 5AKLA 1D0SA 1KU6A 2HM7A 1P1JA 3I5MA 2UXDB 4O1MA 4G4JA 2FP3A 3HJUA 3ONNA 1WEKA 1UC9A 1V8OA 3E3OA 3HKBA 3ILXA 1MO2A 4G37A 5HX7A 2P2GA 3HVJA 2B7LA 3I0MA 1IZZA 4MQ5A 3F3MA 2P90A 5TQ2B 4XWKA 3RS2A 4JFAA 1COZA 4UNNA 3DKVA 1USIA 5DM2A 3TLJA 4CL0A 2DR3A 1NW8A 1RXUA 1T5IA 3E5MA 3PKIA 2NU7B 5IC4A 1QR2A 4YMUA 1ONBA 3N6RA 1UMDA 5CX4A 3C70A 1SVUA 5IANA 3TKLA 3H2BA 1C50A 1XJ5A 3SM3A 3KQMA 1SA0A 1TFRA 1BMFD 1QFSA 3DFFA 2VWPA 3PT9A 3QVMA 2XBUA 2XKJE 4U2KA 1G8SA 5H68A 2JI4A 3B3QA 3KS9A 1K89A 5C5IA 2E5WA 1L7EA 5A5EA 2HRRA 1OMOA 1GQFA 4MV9A 4N76A 3FNGA 4RLHA 2AC2A 2IEDA 1E0KA 3PFGA 1GRRA 1XVVA 4YDQA 5HZHA 3QWAA 3O4HA 1UJ4A 1VL5A 4RF3A 2GYYA 1PQUA 1VSQA 2J33A 4RABA 1ZBQA 2RGEA 3JR7A 4JR2A 1AZTA 3WY9A 4D9KA 3MAGA 4RD2A 4Y6SA 4O2LA 3TLMA 2XMRA 1WDWB 3A04A 4ZYXA 4XWAA 3LGSA 1FLDA 3UOWA 4B85A 1GEEA 2QBYA 2QPAA 2VL7A 4XCQA 5E1BA 2IYOA 5LUBA 4B0OA 4TUYF 5BSVA 2XT6A 1WU8A 1KY5A 2D5AA 1V5WA 3T1NA 1KI8A 3RAJA 3J80A 3LHIA 3TQSA 2RK4A 5TEWA 2I6QA 5AI9A 5UKDA 2O05A 3FETA 1X38A 3IJPA 5G2OA 1VHWA 3Q40A 3W1VA 3SD7A 4ZMBA 3WLPA 1F48A 1IQRA 4IBOA 2J9RA 3ZPXA 4A6XA 2RGRA 3CUSA 3HDQA 2E37A 4ZPXA 1K9SA 1P6QA 2XI4A 2GO7A 4K87A 4DIFA 4ME6A 5KSWB 2JJYA 2ZYDA 3H2JA 4JX8A 4DLSA 2VDMB 4FZRA 1WIWA 2TMGA 2YWXA 1AKYA 2P75A 2PFKA 3SYKA 4OM8A 1V8BA 1VZ2A 3HJTA 4BUZA 1XNHA 5DXAA 1NVXQ 4F3YA 2WJYA 2NXEA 3R5TA 1LI4A 1UK8A 4HN9A 2AHRA 2XGJA 1NP6A 2RB5A 1N33B 1QCYA 2P0EA 5SY4A 3WGKA 1TCAA 3Q3JB 2VWGA 3RLIA 4JDUA 4CFZA 3T3HA 4AYXA 2EKZA 3QPDA 1QYDA 2VI5A 4G0XA 4WDRA 3G8BA 4OQMA 4XIJA 1FX1A 1QC5A 1JBKA 4UVGA 3BL6A 4Y2QA 2C97A 4ARIA 1H1LB 3U09A 3F3SA 4KAAA 2I91A 4Q6BA 1CDOA 3DG9A 4OM7A 1LPMA 1VXOA 3CHYA 3LUDA 5D3QA 1K4MA 2ZJYA 4FNMA 4UXJA 4AXXA 1GNQA 4NEHB 1Q50A 1EVEA 3GVXA 3N3AC 4XJVA 1UBGA 2VJKA 3QE0A 5DJ5A 3SP1A 1GTL1 5CIWA 1FLAA 2R1VB 3OJLA 4FGKA 2ZRMA 3VAZA 1UOEA 1CTQA 3DO8A 1L4NA 1H1TA 1N57A 1S96A 3AFOA 3DZJA 3DZCA 3FI9A 4KKVA 5FUQA 1BFUA 2VDOB 2GAOA 4ALKA 5JXIA 3SWWA 2GVDC 1HURA 3EUWA 1XK6A 1BW9A 1OBFO 3VKWA 3MB8A 3R0QA 3EF1A 3AONB 2UUCB 2B20A 2DFNA 2ZRGA 3KVVA 4Z4HA 1QIGA 2IYVA 1KP2A 4RPGA 4KREA 2J4DA 3JALB 5E0OA 4POOA 3MELA 5MN6A 2SKCA 4A92A 4JUIA 4L6CA 1FSSA 3F5MA 4BQOA 1R0ZA 4QRHA 1ZOPA 1P1HA 2EZ4A 3K8OE 4RH3A 4WPGA 2B4AA 2FYTA 3ETGA 1CVLA 2VIIA 3DL0A 4RMHA 4HVTA 4KVAA 2Z9BA 1Z56C 1WNFA 3VVBA 1T8PA 3JQFA 2FR8C 3CLRD 4BBAA 1LEHA 3BMCA 3FCXA 3HUEA 3PNYA 4EUHA 5CT4A 1I9GA 4KAFA 2GA8A 3RUIA 1KI7A 3S1SA 4GQAA 1Y1LA 4B45A 4DG9A 5BW5A 2YFHA 3BXPA 1UANA 1JPNA 3LDAA 3OHMA 4PS1A 3GLFB 4W8GA 3IURA 3WSWA 2FX2A 2A14A 2JIQA 1E58A 4EMTA 2FDRA 4IX9A 4CQLA 2O57A 1F0YA 1AHPA 3UPUA 2JLBA 1NPTO 3ORRA 3KUXA 2A3RA 5JOQA 2C5GA 2WLTA 3LZ6A 5GQSA 4AZ3B 5AW3A 2JHAA 5LBTA 2BSQA 3R20A 3JZMA 3MT8A 1DEOA 2GVNA 2AXEA 1T15A 2UYYA 2WV7A 3DZBA 3GT4A 3MT7A 5HCIA 4F72A 5HJEA 3REOA 2ZIGA 5EP1A 5DLYA 1EBUA 1QTIA 3QNWA 4D9CA 1FTGA 4AG5A 2C2HA 2IF2A 1XAHA 4R1MA 4HP8A 2O3RA 3GNQA 4ZHQF 4KTTE 1KEVA 4F3RA 3FI0A 1G9TA 3OTWA 1E2NA 4RK5A 2GBLA 1YBFA 4IZIA 2YJNA 1T1JA 4LC1A 1N0VC 4CKEA 3RW9A 4DCMA 3PPWA 4EW6A 2A9PA 5CJPA 5E4FA 3M6IA 3MQ4A 4BVLA 1KEPA 1OHHD 1UIMA 1V5EA 2FJ0A 3EIWA 1LDGA 1S8FA 2PZLA 4MKIA 3WMWA 4UNRA 5A4FS 1N9ZA 5CVCA 5AW7A 4IV8A 4CCWA 4JVOA 1RWMA 1J0BA 1NW7A 2ZI4A 4MCJA 2WHPA 3UA3A 1Z4IA 3O21A 2TECE 2GESA 3LC0A 5M34A 2FF7A 3PQ6A 3ZVKA 3AB7A 3EFEA 4BLWA 2ODAA 2FVYA 5HCNA 1NBMD 3GLGB 2O48X 3JAKA 3B48A 5LP6A 4TL7A 5EWLA 4AKGA 1PDOA 1RHUA 4K9QA 4H4EA 1VM6A 4GMFA 1QS0A 1LDYA 1JZSA 4PBRA 1K27A 4BO1A 4PFKA 4QECA 3P45A 4Y2GA 3TLGB 1GPUA 3QG5A 1KQOA 1ZN2A 2DMRA 4XWOA 3TSZA 4CTMA 1R6DA 2IY7A 2D0PB 2FQXA 2HJ9A 5H9VA 4CFSA 4LV8B 3EE6A 4P1ZA 1EWTA 2P2NA 2Y77A 3COPA 2RG1A 3FFTA 4KH1A 3RTEA 3EAGA 1J8QA 1T6NA 3DCYA 2UVPA 1EVIA 4UBOA 3GQVA 2NSLA 4XLZA 4M9RA 4N65A 2ZXUA 2JGIA 5I7EA 5BQFA 5DK4A 3KZNA 3JD3A 2XYVA 4P5EA 2QVCA 3ES9A 4HJRA 5AK4A 3C7DB 3HDGA 8OHMA 1WKCA 3BTOA 2W70A 3N59A 2BZSA 2PRJA 4HH4A 4TWBA 3TPZA 3HGTA 3W5BA 1ZQ9A 2IYZA 3PGLA 3EZ2A 2YWEA 4B32A 1G8KA 2QL9A 3ZD7A 2ZI9A 2X58A 4R3WA 4Y1EA 2BAGA 1QNFA 4LOJA 4BCCA 5HIKA 3M1AA 3SHTA 4Y9UA 1NF3A 5A9TA 3B13B 4E2WA 4BO3A 2V0GA 3FSRA 2WU1A 1D2RA 4YJFA 1NNEA 4YJ2A 3MNFA 1NM5A 4PLHA 4DC9A 1O6BA 1GV0A 2Z2JA 3PQ7A 1NVEA 5CLIA 1TJ5A 4FDUA 2F1IA 5GAJA 1IZ0A 2BEWB 4B6PA 4ZXFA 1NUSA 3EW9A 1NI4B 1BH2A 2QM3A 2ZI5A 1AMUA 4M99A 2KQUA 3D6AA 2CLCX 4LBYA 2IEAA 3KLOA 4G6ZA 5J4YA 1JGTA 1RAEA 5IYZA 4TZ0A 1ISPA 2H5JA 3HEBA 2PFSA 1WOMA 3GW8A 2AFHB 3KLNA 4JXJA 5K7SA 1UMCB 1CF9A 3JQAB 3RGGA 1W0JD 4TVOA 4DZZA 3EVFA 3K1AB 3NALA 1M34E 1DFGA 3E4CA 2HAEA 4GI1A 4I1SA 1QK3A 4WD3A 2FUEA 3IP6A 4DMCA 4PN3A 1A69A 1H2XA 1R8XA 2Z3WA 3FHTA 1E89A 1Z8FA 1Z5GA 1D04A 3LLUA 1YA4A 2QAIA 4RVNA 5AXBA 2E49A 2FMUA 2Z1DA 4UW9A 4F06A 1CRPA 1UIRA 5K6RA 3CGWA 3UUGA 2MHCA 2XUQA 2VTDA 2JAOA 3RCBA 1L7MA 1V2GA 4E1VA 4GI2A 3HXPA 3V4VB 2RK3A 4GPIB 2P5YA 4KSBA 1EVYA 3FPCA 3H9CA 4EO9A 3T99A 4Z54A 1CDZA 1GFWA 2VO1A 2HO4A 2N1BA 3BB1A 3NUZA 1DAIA 3QPUA 1DEAA 5LWQA 3RQSA 3TRJA 4ZVLA 2MR5A 2DAPA 2IXAA 4ARZA 1A96A 3DW3X 4P86A 3OCVA 1FFBA 2HBRA 4JP8A 4F4DA 3AM4A 3KUKA 3OT1B 5HTKA 4G01B 4D0NA 4PSKA 4WXRA 4CCYB 4RDHA 2O1SA 3GGDA 3TD9A 5KHOC 3ZGZA 5DOVA 3IOCA 4TSFA 4US2R 4YP0A 1EDBA 1L5FA 1TAGA 2XECA 4ZOQI 2AKYA 5I7HA 1GPNA 2W11A 1I5EA 4QQ8A 2NZ8A 3DCNA 4N47A 2BGWA 3GLUA 2J6BA 2FB9A 2GK3A 3TW4A 4DCNA 1WBJB 1ORWA 3LUBA 4YPVA 2Q3MA 1GPAA 2QTLA 4IDEA 4WCFB 4CM8B 2EVWX 4TMXA 3K35A 2O8VA 2X8JA 4QO7A 2ZSEA 3RS4A 4TVSA 4Q12A 2P62A 3A1NA 2VH2A 3HMQA 1EWKA 4MS4B 1SCBA 4J1TA 1I2ZA 4JJEA 4D9GA 2C3OA 2DJ5A 2I6XA 2D2XA 1Q1ZA 1XPJA 3FWPA 2CJPA 3NJRA 3O73A 4FFNA 4LBZA 4TWAA 1L1QA 3RS9A 2F3PA 3W6UA 3MWYW 3OAAA 3LV8A 4F9TA 1E4EB 2Y1CA 4E2ZA 4HG2A 2Q7DA 5F3WB 5SY9A 1B00A 2Q29A 3LL7A 1OAAA 3S5UA 4FFLA 1X14A 3ZZ1A 3DQZA 4HEQA 1LRKA 3HZZA 3P9IA 5I4BA 3V3KA 4MI6A 4OL0A 1ONNA 2OM6A 4E13A 5JAIA 2LIPA 1G6HA 1G21A 2H0RA 1XYVA 3CNNA 4X1YB 3IVCA 1LZLA 4CMJA 3JZIA 2BF7A 2UYGA 1RQPA 1K0UA 2RJNA 4EQZA 5CFPA 1JSLA 5CUQA 1ZHOA 4MVYA 1V6SA 3B3FA 3DLPX 2VZ0A 4XQ0A 1DAMA 4C6HA 3QKRA 3OUTA 5CNIA 2C99A 3RC3A 3TZQA 4M1WA 3IRUA 3LI2A 4MIKA 1HK7A 3IDSA 4G9EA 3IE1A 1Z4LA 2ZIVB 1X39A 1FS4A 1XRJA 2H8GA 2M6SA 5IXJA 3DPUA 3FR8A 4KUGA 4ZTBA 5I3ZA 3EMVA 3A1DA 4JENA 4QDXA 4XD7D 3T1YB 1U9IA 4B8YA 1L5YA 3CVJA 5IF3A 2XUDA 4Z4CA 3FVRA 2CD9A 4ISBA 2ZRQA 2ZE6A 2XT9A 4ETNA 1YS2X 5FL7A 2I2FA 4AMVA 1YVDA 3RFUA 4BMSA 4R71A 1U8AA 5SY6A 2XYHA 4ZVNA 4I6EA 3E8MA 3KTAB 4UMVA 2AN3A 4TPKA 3AUKA 3IPCA 3KZXA 4RXUA 3WHLA 4EFNA 2LWIA 1G8PA 1ENPA 3OQJA 3A3YA 2QVBA 4ZU3A 2HLHA 1T0UA 3D4BA 4BVKA 1KO4A 3T8YA 2WSSA 4C6TB 4X66B 5AI4A 3O95A 3PNKA 2EFGA 4MIOA 3TRHA 4HYTA 1RSZA 1OI4A 4NENB 1GZHB 4HYQA 4RELA 5E4YA 4ARAA 3DVLA 1TMKA 1SNYA 1SB9A 4CXMA 3H86A 1C1XA 4F3KA 4WA7A 4PIPA 1U0BB 2HXSA 1X80A 2IQIA 1X9HA 1NVUQ 2YS7A 3NHRA 3QGMA 3RG2A 3TFOA 1A4UA 2V03A 4ERXA 1CQPA 2HEGA 5DRYA 5IUJC 3FHCB 3P9YA 4F4CA 3LIIA 2CB0A 4KO8A 4KN5A 2W6JA 4XYMA 3GDFA 1P1BA 3R4CA 3MGGA 3HBJA 3K0AA 3DB1A 2C9OA 4MYUA 1MV8A 2M1XA 1F2UA 3GH3A 4RNDB 5H4HA 5REQB 5ITWA 1F6WA 2IPAB 4O4LF 5JBNA 2FAXA 3HY6A 1EE1A 2PLAA 2NUAB 3QPBA 4AULA 1TCBA 3D3WB 5HRCA 4KE7A 1Q6ZA 3E70C 4R1NA 3OHSX 1PDWA 1R9NA 3E5NA 3ZU2A 2WWWA 1P33A 3ORHA 1ZUD1 2VG8A 3QKWA 2P4SA 5FWXA 4NSNA 1SZDA 1FK8A 3F98A 3PEUA 3ZI4A 5I7UA 2P2ZA 1CUYA 2GN1A 4JGBA 1EIZA 4J3JA 3LBIA 5HVNA 2PPLA 5JS1A 4YREA 3D4LA 1Z0KA 4LDRA 4B3XA 1G7TA 3NHZA 1U28A 4HH0A 4ZZIA 5AVRA 3AVOA 5TS2A 1K7XB 2GNAA 1H2BA 1T35A 2D5LA 1CQXA 4X62B 1E92A 4XWTA 1MO6A 4BN5A 3IQZA 1K68A 1G20A 2BFNA 3P0EA 2NZXA 3MQ2A 1KYZA 4Q16A 1ZGHA 3BRWA 4LXTA 4AP9A 1JR3E 2XIJA 2ZEJA 3Q2KA 1UKEA 4ZDJA 3E15A 2O3QA 2PQ2A 5A1TA 4OXQA 1KGDA 3IKLA 4P4SB 4QYXA 5KAMA 3RSSA 1T9DA 3TM5A 2GZSA 2X6RA 4XEHA 3GK3A 3H17A 1R0RE 3FLEA 3K72B 4CUZA 3MVEA 1UFKA 1KEZA 3PWZA 3WYGA 3HWRA 1NMEA 5DEOA 3L49A 3LQ2A 4DCJA 2HL6A 1PQYA 1GDHA 2HMTA 4PIVA 1R0CA 5E4TA 4ZT6A 2Z09A 4I1YA 1XMOB 2JAQA 3R6TA 4UEOA 4YRFA 5BMOA 5LQRA 2Y1WA 2Z8YM 1MIHA 1EFVB 4WN3A 3E1GA 1HQCA 3CRQA 5AI5A 3LZDA 3HJCA 2FW8A 1F0KA 4NYIR 4B8WA 3ME5A 2OYRA 2Q46A 3IMFA 5IMBA 3VZQA 2BFAA 4XX0B 1I3CA 5BN1A 3L5OA 4KG7A 3TW0A 5JDCA 1RZRD 3LDGA 1XDWA 2OAP1 2DPHA 3X1KA 1UC8A 2C5LA 3ROZA 4Z4GA 3M4ZA 4QGHA 2X77A 4IUDS 3GLIA 5ALEA 1CUXA 1K7SN 3ONFA 1Z2EA 1DWPA 2JGKA 4RTLA 3SI7A 4IWNA 4AJKA 5IBQA 2PXXA 3D31A 2DEUA 5E2BA 2Q2QA 5CJ2A 1T9ZA 2CNOA 3N2KA 1NN0A 2C83A 5JSYA 3VDXA 2N1MA 2O0HA 3HKDB 3M6VA 4B73A 1KZ9A 1Z0ZA 5EQJB 1JDJA 1R4MB 2GJ4A 1V25A 4FNOA 4NCNA 1Z0IA 1OFVA 1U2DA 4OU4A 1E3IA 4KNYA 4XGNA 1F20A 1PR1A 3AJAA 3MA0A 4RK4A 4A27A 1W6RA 4DJTA 2H1VA 3WDSA 1GUZA 2GTPA 5ESRA 1GRNA 3OF5A 1IN1A 3ENQA 4IYJA 3PPYA 3PUWA 4ZDWA 5B2FA 5MHTA 4Q9DA 4B2PA 4QATA 3LHKA 3QKSA 4KX5A 4RVGA 3KZVA 2ZJOA 4L6IA 3VX3A 1ODJA 2VDWB 3NHLA 3OTIA 3P0IA 5JATA 2HT1A 1GNRA 3AY7A 2ADFA 2E4WA 2ZETA 4G1VA 2FA9A 3ND8A 3EDOA 3SSNA 1ZN9A 5JMOA 4RANA 2P8SA 4CKWB 4JEHA 4QSMA 2X0RA 1M2JA 1WE2A 3EZGA 4B4OA 3N2NA 1OX5A 3IIIA 3I52A 2D5IA 2VATA 2BFWA 2X5KO 1GZDA 4FBGA 4KRXA 4O0MA 3KZKA 1RYHA 1SUCA 4MA5A 1LV8A 4UNQA 1BJTA 1F1JA 1WMSA 4JWTA 1FJGB 1I7LA 4EFDA 1QE5A 1Z7GA 2EERA 2WQZA 4R1PA 4UBMA 1Z83A 2P9TA 2QR2A 4CYMA 1KNXA 3OQMA 2XA1A 4K9NA 5BSKA 1E5LA 3GLHB 1YZFA 4IIGA 2L18A 3FROA 3T1OA 3GRZA 3HB9A 4FFBA 1P7WA 4AT1A 5J2TB 1PJ2A 4J0KA 4L27A 2R1ZA 3ORFA 4L0MA 3LCVB 2R65A 4ZDKA 4NXNB 4NYMQ 4GQIA 4DMMA 4GOND 1CZOA 1QCCA 4J6FA 1UWKA 1VKHA 3N8GA 2ATEA 2QSUA 2WJWA 4GVLA 4ND8A 1JXMA 1SHKA 4QJ5A 2I1LA 1ATZA 1G8FA 2PV7A 3DOCA 3A6PC 4DYVA 3T1HB 2GN8A 1O89A 4BNWA 5HKKD 1DQZA 1BS1A 3V4PB 5I9NA 2BE7A 5DRTA 1CB7A 3INNA 4O1IA 2HCFA 4QVGA 3F9IA 3WB0A 3ORQA 3LE8A 1QYRA 3CEJA 1JLHA 4YCAA 2IU0A 2NVWA 4D6YA 8AT1A 4B3MB 1ITZA 1Z2NX 2RC6A 4X8HA 3VR4D 1WVMA 4DNXA 4DQKA 2EFHB 4E15A 3WGLA 3VPSA 3DQPA 2PSHA 2INGX 5EAIA 1H3EA 1L5MA 4BYGA 3LTNC 1BYIA 4QG3A 2G9ZA 1DO8A 3EVNA 3O2QB 3VR6A 5BR8B 3SQMA 3THYB 3IDAA 3B1VA 1T6XA 4JB0A 5HR5A 4GMDA 1CUUA 2DHCA 1SBZA 2OPHA 1PE0A 3DCJA 4QC2A 2I6UA 1I14A 1S2DA 3DEHA 1YCGA 2WMOB 4BZWA 1FXWA 5KQPA 3OQPA 3SBXA 3IJEB 3JWJA 2AI2A 3PRHA 5C7OO 1XELA 3OCWA 4JB3A 2ZKIA 1IY1A 2YOGA 1KI9A 2MDTA 3KRTA 2VQDA 4G0PA 1DQNA 1VL2A 1FNCA 1RQGA 2CXNA 3G68A 3I12A 3KPYA 3RREA 1LSSA 4FEAA 1XBTA 2P6NA 4KWIA 3P71T 5BPHA 4KE9A 1VBMA 5SYMA 3K5HA 4EZBA 5CXXA 4MYDA 2PL5A 4YYEA 2JIZD 4RH0A 5KUTA 3QSYA 2ZZNA 1BXRB 4J3NA 4EY6A 1JXAA 1WQ3A 4O6VA 1JQ3A 4WUVA 1LBTA 1TO2E 3C97A 1Z0SA 3C3CA 2W6NA 4G4IA 1AXEA 4ENWA 1Y6ZA 2J3EA 5FQOA 5HJ5A 2LGJA 3BK2A 1R6TA 1GTRA 3CRRA 2WZBA 4QOIA 1J70A 3QHPA 1SFRA 3LZCA 1E32A 1U3FA 2VPQA 3OCCA 1PYDA 2PUGA 2FN7A 4OMDA 1QH8A 4I19A 1CNEA 5JXGA 2YBDA 5T4FA 4Y2HA 2HWWA 3KU1A 3U81A 2EBWA 3GNLA 4N5DA 3HZOA 2AJBA 3FXAA 2FWNA 5F9HA 5GIOE 1E1LA 4Q7LA 1ORIA 1G6Q1 3WZMA 1DKUA 5A62A 4E3WA 1XRPA 4D7AA 4DNPA 1WLYA 3IQXA 4DWJA 3RVJA 1TE2A 5IJXA 3U4CA 1JSRA 1R6UA 5D8DA 2XITA 5L3VA 1CEYA 1RMQA 2UZ0A 1JVSA 5DI9A 3ZY6A 2J0UA 3VJKA 5JADA 1PGJA 1N2SA 2FSVC 3OLXA 3PQ8A 2YYZA 4PZ9A 2QVGA 1U0RA 1TC2A 4HQOA 2YIMA 1X1EA 5B3JA 1QPZA 4E11A 2CHGA 2EFJA 2FPXA 2Q3LA 5ECWA 1AU9A 4JZKA 4B5LA 4KIFA 1R0KA 1EWYA 4IICA 2NLOA 2QTRA 3N2GA 2X8AA 3F2VA 1MA3A 1SC3A 4QM6A 3FF4A 3W34A 5JIBA 2JFOA 2P6PA 2J9FB 1ISJA 2E4VA 2HV8A 2C9BA 4J0DA 5ADVA 5ALXA 1NYLA 1YK0A 3BBLA 3I83A 4QJIA 2O4UX 1ADGA 4TOIA 3SS9X 2O8CA 4WXPA 2PQ0A 2HH9A 3LUKA 4NCIA 2H00A 4DVJA 2QE6A 4EARA 3HWSA 1FDVA 4N12A 1XMQB 1RAFA 1EFUA 5JZMA 1BXKA 3LX5A 4RUKA 4DE5A 5CG2A 2C4MA 4JBLA 1K7EB 1TPYA 2TMDA 2ZDGA 3NTLA 4RACA 2PX6A 3TZCA 4LSZA 1GARA 2QT0A 2VHYA 3EMKA 4I1VA 3V4RA 5J4KA 1HM5A 1ZW1A 4QBGB 3ND6A 3PG5A 3HR4A 4IIUA 4N0MA 2FZLA 1NVVQ 5HBRA 4JD5A 1J1UA 1LH0A 4JI6B 2O1XA 3BKXA 1FRNA 4QUHA 5JALA 4WLNA 4XQ9A 2HNBA 1ZK4A 2O2CA 2PX4A 3BMOB 4MRAA 4BXOB 1E4OA 4FHFA 3KLBA 4UXIA 4D8WA 4YY3B 2LUOA 2WBLC 4MR8B 5DX1A 4BO6A 2VZ9A 2PVCA 2NO5A 2V4MA 1H8EA 3OQBA 5KO2A 3CEAA 5HUHA 2E87A 3N0WA 2EWVA 3Q10A 3ML1A 2OHGA 4PRKA 1RCUA 1A5BB 1TA9A 2BDTA 2WG1A 4G89A 5FUBA 1S7CA 4HAXA 3UB3A 4RVUA 3B36A 4JT9A 3W4KA 4ZOLF 4M2LA 2YW9A 4M7PA 5JAUA 2VNAA 3EH1A 4M89A 2BKLA 3G1TA 1MV5A 5DN6A 1OYVA 2GAIA 4C0LA 1YBHA 3AL3A 3H6GA 4EKEA 4RMIA 2E18A 3R0JA 1XG5A 4GRDA 5FEUA 5C31A 1MPTA 1OFHA 1USWA 2FN8A 1V3UA 2YINC 3HDJA 2VKQA 4LOAA 4ZVTA 1NVTA 1TK2A 2VXBA 3N58A 4Q02A 3GFSA 5JG7A 5HM8A 5JSQA 4PR0A 1TRHA 2WSBA 3DPIA 1VRWA 3SBEA 5EHGA 3SXJA 4QTZA 2F3RA 3KQPA 4WKNA 1W36B 5AW4A 3PI7A 3PKJA 5GONA 1RPTA 1PBNA 1Y9JA 3IOEA 1OH7A 4YV7A 1AV7A 5IVDA 2BH2A 2Q1UA 2R6GA 4O2AB 2O8DA 2B1QA 1TZBA 4BNVA 3S2UA 4FGJA 5FLEX 1FEZA 1RE1A 2BFFA 2J5KA 1SGWA 1ZK3A 3WDLA 1AS2A 4CR7A 2O1WA 3PUYA 5T6BA 4UHBA 4EY7A 2AR7A 1VL1A 3AHJA 4X44A 3SDBA 4IJWA 5F4BA 4B47A 3QEKA 3ACCA 4BB0A 3JQ7B 3ZCTA 4JWKA 4R8SA 1GAWA 3TMKA 2NZUG 1P45A 1ZMXA 1VG9B 3D64A 2R1TB 4CKWA 4XM2A 3RODA 1JKJB 2IC5A 4JUFA 2TMYA 4FPXA 3WLFA 1PIWA 1PWHA 2I9PA 3DLAA 3QJYA 3WS7A 3RK1A 2BEJA 1ZMBA 1WD7A 2VZEA 3HQ4O 3O4VA 5FOSA 3U2QA 3LCMA 1E7MA 2IZ6A 2Q8PA 4E4YA 1Q0TA 5HS4A 3MJRA 3BN3A 4C2UA 3R3HA 4NF2A 2CW5A 4NCAA 4R69A 5AHOA 3I1YA 4BB6A 3OE5A 2DTXA 3OEYA 1AA6A 3N2LA 2O7RA 3L92A 4LRSB 4QGGA 4KOEC 5KOHB 1ZZEA 4WV3A 1MEJA 3F3KA 2D0OB 1WP4A 4FFOA 4MVJH 2VZ8A 2B7CA 4UU8A 5EKSA 4IFEA 5JHGB 3AUUA 2FY8A 3T7TA 3LX4A 3PFNA 1X7GA 3ROEA 2WM3A 3ZEIA 5LD2B 1QUFA 4TL9A 5ALPA 1VLVA 3JVDA 4JL5A 2B4TO 3DE7X 4ZQHA 2GF0A 1YAHA 4KV9A 3ZY3A 4EENA 2BHLA 5HZKA 1LNQA 3DBVO 4EX6A 4I5GA 1X7YA 3L9WA 4OP1A 4D3FA 3IEKA 2V7XA 3TOSA 1H9BA 3OTHA 3OD1A 1E9EA 1L7XA 1YOBA 2IOFK 3FHOA 4P4TA 3M3HA 4WZ6A 4BP9A 2P9BA 2WUEA 1SQ0A 1C7ZA 1C3OA 3FRJA 3MOGA 1EHCA 4KQIA 4EEKA 5C53B 4EELA 2ZWOA 3GUVA 5CVTA 2XMGA 2P8JA 3N53A 2V6GA 4JYMA 4N0DA 1E6EA 5B64A 3FCYA 4MDEA 2AD1A 1QO9A 3AVWA 1NKVA 1RI3A 5KJCA 4D3YA 3VBEA 3CX7A 1YJAA 1EX6A 3JAWA 1QHFA 1GAQA 2JGDB 3A4MA 2BM1A 3HPQA 3MMXA 4U9IS 4XLTA 1BMFA 4HEHA 5FUMA 2ZJ5A 5KVSA 5U4QA 1GN9A 2Q4RA 2GHIA 2GPAA 2ZBRA 5GJBA 3QWFA 3GMSA 4FQ5A 2WOOA 3V8PA 1K3UB 2X1LA 4H6XA 2OLKA 1UJCA 3NOOA 4Z9BA 1H2WA 3KYJB 3WLMA 5BR1A 4KGVA 3NHMA 5CB4F 4XWWA 3IUBA 1LVGA 2W8ZA 5TGZA 1TIPA 1W96A 3RIMA 3VPHA 1P3DA 2AXQA 2FLVA 5IJ9A 2E7ZA 2QPOA 1J5EB 2DGDA 5KTYA 4TMTA 2Z5FA 1JLSA 3LXMA 4TTRA 4XA8A 1JDUA 3CVWA 1HDCA 5FOVA 1PEAA 1UJ6A 2I2AA 2NUPA 2PUTA 3H8JA 4OKIA 1U5AA 1TZJA 1QDEA 5COBA 3RDPA 1RCFA 3MSXA 3R7DA 3VPCA 2WTXA 2H7XA 4UNPA 3PJFA 4M1EA 1EGMB 4CWAA 1TKRA 2ZKLA 3PXEA 4NOJA 4II3A 3FMOB 2ZWPA 4O3MA 3A6FA 3ND9A 4G5HA 4LYYA 4RGQA 2P5TB 3H04A 3HVHA 3W79A 5MFPA 3ICCA 1ZVKA 1ORDA 1GCGA 1MAUA 3OFND 4X6XA 5CT6A 5BRAA 3F7OA 3G5TA 5KYKA 2IHYA 4XSGA 5E7JA 1WKVA 3LUFA 3A9VA 3ON5A 1SXJE 1G6KA 3OIYA 4FGLA 4TXJA 1PZGA 1BSVA 2IELA 1JJAA 4DR7B 3ZJTA 1KPHA 1K8ZB 2OHHA 1RPJA 3WYFA 1E64A 3ZLTA 5AJTA 4WZBE 2VP3A 5MGBA 2IUEA 5I4KA 1YU9A 3X1WA 1NI3A 5FWDA 5JSZA 4GOOD 4WBNB 3OEHA 4FDTA 4QQNA 4V2UA 2HHAA 3L0IB 4R84A 3QF7A 5FHRA 3H42B 5JNLA 3ITDA 1J33A 2JIRA 2XAUA 3HUFA 4FR5A 3ZHCA 5A6SA 3LHSA 2GCGA 4ML3A 4UCWA 4PXSA 2YV4A 3CCFA 4UVHA 1EXVA 1L7BA 4E4TA 2V0NA 3PXAA 4G1UC 5D3ZA 1JTVA 4EEZA 3G9UA 2QN6A 2DULA 2M2IA 4HB0A 2X4DA 2GCEA 5AJZA 2C8VA 4F38A 1KZ7B 1RLMA 1HXHA 2UXCB 4OL9A 1NQOA 1PFQA 5DI3B 1GEGA 1PS9A 5IAEA 5H4GA 4WK0B 1XXHB 5HF6A 3AHIA 5BT9A 1IN4A 1SC9A 4KXYA 3ZZMA 1U2GC 3ETNA 5ALSA 3PJEA 1I32A 4P5DA 3FCAA 4FZJA 1UKCA 4KQ6A 4WI1A 1L1FA 3T0GA 3WYAA 1CEEA 4YQZA 1VJTA 4DRXA 2R6FA 1WW2A 3N9IA 2QZPA 4OB7A 3GRPA 5EE5B 4BKMA 4DMHA 5LQDA 3O82A 2W2PA 2IFTA 3GNSA 2ZTUA 2J7KA 3HLTA 3MUOA 4HWTA 3UBMA 4C05A 5F78A 4OA5A 4BFVA 1KJJA 1XTTA 2FFHA 2VH5R 3GPLA 2WJ3A 3KE9A 2AG6A 3AG5A 2ORED 5EJMA 2HFJA 3N75A 1B6TA 4TLDA 1EGHA 3R3WA 5K8LA 3FOFC 5K4GA 1OI3A 2H2GA 5DASA 5KNBD 3N6XA 4J0HA 4NU0A 3W7AA 4MXDA 1KMQA 2M6RA 3F74A 3DZ8A 4PQRA 5EMNA 3TL3A 3VX4A 2F6RA 2XRMA 3SJUA 3ABOB 3H2GA 4KFTA 2P1DA 2XOXA 3EYAA 1LS6A 2HJHA 4YPFA 2YX1A 1NRJB 3QI2A 2FXIA 5EKDA 3ZHQA 4EG3A 3DO6A 1TUBB 1OI7A 5EHZA 4IIHA 3AHEA 5LXTF 1KY4A 4L4XA 3VPBA 2A4KA 4OHUA 1I7SB 3DOFA 1A1SA 3G9TA 3RARA 5BXQC 4URFA 3NBFA 1SIOA 2OFWA 4RLSA 2RE8A 1DJOA 1H4VB 3EZXA 2F8MA 4JQZA 1U6IA 1FDTA 2O9JA 3JVUA 1MAWA 3DFIA 3I30X 2RGBA 3D0OA 1TM4E 3OTGA 3MHPA 2HBYA 3KO8A 1QIMA 3NKVA 4G0MA 2XDWA 3VO2A 3AZPA 1CF4A 1B41A 2PUWA 4E30A 1NATA 3T1QA 3V1KA 4CQMD 1S1CA 4WKOA 1QRRA 3CIFA 4J4HA 5LQMA 2OWDA 4GHWA 3I4CA 1VQ1A 3RUDA