4WCDA

Trypanosoma brucei ptr1 in complex with inhibitor 10
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
250
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 92
structure length 250
sequence length 267
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wcdA00
1XEAA 1ZSNA 1MUUA 3TDKA 5TT1A 5IZCC 3CXRA 3CMMA 3VKVA 1O5IA 3GVHA 4XR9A 2P4QA 1JAYA 2WJPA 2EERA 2WM3A 1EUZA 1XLTA 3ETEA 3IAHA 4GGOA 2PWZA 2NTVA 2QG4A 4JNKA 4DYDA 3ZHYA 3DFZA 5JYDA 1D1SA 3IOYA 4UAGA 4EUHA 4DIOA 4BGVA 5GY7A 3HN7A 5BT9A 1AUPA 1U3UA 2B5VA 3I3OA 5F5NA 3PQFA 4IS2A 1P1IA 4OKNA 4UEJA 4LCJA 3FD8A 4ZQGA 5A9TA 2QYSA 3DAPA 2VRCD 1UUFA 4BO7A 1GUZA 1W73A 2ZQYA 2CDAA 5GZ3A 3ZI0A 1T2CA 4Z3DA 3BZUA 4IGFA 1XHLA 2HRBA 5JDIC 4HP8A 3I5MA 3A9WA 3H65A 1HDOA 1ISJA 3JQ7B 3LC1O 4MP6A 4PG4A 5EINA 5LDGA 4NG5A 1VE9A 2PLAA 2YFHA 1P1HA 3F9IA 1M75A 4QQRA 4CLRB 4NFYA 2HJSA 4B3IA 2EJVA 3BTOA 4CMEA 2WSBA 4CMIB 4W6ZA 4JLWA 1X7GA 1KY5A 1NNUA 1VSVA 2GN8A 3JQBA 4AJNA 5T64A 2P4HX 4NQZA 3JQ9C 4DC0A 4Q3AA 5CG1A 5L51A 3STHA 4OSOA 3VDQA 1E1MA 2GN4A 4FOSA 3HB4X 5G0TA 4GMFA 5HS4A 4PLPA 3GHHA 3O38A 2NVWA 5IZCA 5JFOA 4J1NA 3OJOA 1T2AA 3D5TA 2TMGA 4RZHA 2JHFA 1EUCA 3JD1A 3ROKA 5I9MA 3VC7A 4LK3A 3MJEA 3T7EA 3ST7A 4MVJI 4YBZA 3L9XA 2Q2WA 1T2FA 1E3WB 4IBOA 3M1LA 4NIMA 2NTNA 3WTCA 5EL0A 4R51A 4NK5A 3I1JA 1G0OA 1DIBA 2GN9A 3E5RA 4ZQEA 3ZNQA 1RPNA 4UEKA 3PXXA 3QWIA 3QP9A 1NAHA 1YJQA 2YQ5A 3GNTA 3PHLA 4ZJUA 3KZVA 4BNFA 3H7AA 4ZRMA 1WP4A 4BMVA 1IPFA 1GZ6A 5BQFA 5CEFA 1NX6A 3FNFA 4PLFA 5DN9A 1KERA 4NZ9A 5JDIA 2P9CA 3UXYA 2I99A 3IDSA 4R68A 1CRWG 4ZU3A 4LVCA 1GDHA 1H6AA 2GD1O 3JYQA 3H4VA 2JKVA 4BUCA 3G79A 3QV1A 1P0CA 1HKUA 3Q11A 5ILGA 4IS3A 4IMPA 5EIOA 5U9CA 1YVEI 4I5FA 3CTMA 1DFHA 1H93A 3VZSA 1VI2A 5TGDA 1E7RA 4BB6A 1LA2A 4A10A 4R3NA 4MPDA 1NFFA 4OAQA 1JDJA 3B1KA 3GNSA 3IJPA 2HU2A 3H3JA 3JQ9A 4QX6A 4DQVA 1UDAA 3WIEA 4CM9D 2VTEA 1K6JA 5CPBA 2EP5A 2DC1A 2VUTA 1RWBA 1E7QA 4L4XA 1B8PA 3D4PA 3JQCA 4RPKA 3V1YA 4J43A 1LRLA 3DZJA 3H6KA 3JQ7A 2BD0A 3D4NA 1G1AA 1BVUA 5B4UA 3Q9UA 3DBHB 1EK6A 3ULKA 2DFDA 4QECA 4BNNA 2Q99A 1HE2A 3FBGA 2GZ2A 3OJLA 4R9RA 1GYQA 4PRKA 4CQLA 3NEPX 5G0WA 4CLRA 2XXBA 3RUHA 4RPGA 3ZGYA 1ULSA 4S3MA 4CMIA 2RCYA 1A4IA 2YV2A 4BNTA 4IDFA 3RJ9A 5I7SA 3KSUA 3PFFA 3TFQA 2WTBA 3OA2A 1KS9A 2P5UA 1U8XX 3EUWA 4WK6A 1TB4A 4P38A 4J7XA 4CUKA 1CERA 4IDEA 1LC3A 1Y5RA 2P9GA 3A28A 3OJEA 4D44A 5HTOA 1MV8A 1DXYA 1ZKMA 3B20A 4O6VA 3MWDB 5CEEA 1GTMA 2WYUA 1U7HA 3TOXA 2AG8A 2CDBA 2EKPA 2IE0A 2NWQA 4Z3KA 3JSAA 2WD8A 5L4LA 3HQ4O 4GX5A 2QZZA 5DULA 4AL4A 5F5LA 2ZYAA 1GCUA 1FXSA 1E3WA 3U4CA 2W2LA 4BNXA 4YAGA 4M55A 4I5DA 3GZ4A 5CHEA 3ZHZA 2VUUA 1I3LA 4X54A 5DZSA 5ENDA 3X2EA 5B4VA 5ICMA 4YT2A 1KEPA 4GX2A 1H2BA 3JV7A 5B1YA 1HE5A 4K6FA 1YBAA 1XQ6A 4MP8A 5DT9A 3CEAA 3PGJA 2Y0CA 4JN6B 4WCFB 2OUIA 2YYYA 5L7WA 1TT7A 3RUAA 2DQ4A 3EGOA 1NFQA 1YQDA 4QT0A 3NAQA 1NTOA 4TWRA 5JC1A 1QLJA 2GRAA 4BNUA 4CL8A 3PWSA 2B5WA 1NQTA 4FFNA 4D79A 2HLPA 4CM4A 2B0JA 5A02A 1GV1A 1LTHR 2BELA 1X1TA 1GUYA 1YRLA 2G76A 2IODA 2PKQO 4BO8A 4Q3EA 3RCBA 3WR5A 1I01A 2OZPA 2QQ5A 3K5PA 2O3JA 1LQTA 2FR1A 3WGIA 4AJLA 4RO0A 4OL9A 4E2ZA 1GZ4A 1L7DA 3AUAA 1Q0QA 2FZWA 3F1LA 5AOVA 5H83A 4BMSA 4L75A 4D3DA 1VRWA 3PIDA 3H5AA 2VQ3A 3PLRA 5KOIA 3RASA 3CPSA 4J9VA 5CFZA 3ASVA 4A0SA 4BIIA 1ZCJA 2W4QA 5G4KB 3ZHXA 4PFJA 3BHIA 3Q2KA 4YAEA 5F1PA 5C5IA 4MOWA 5FF9A 3GK3A 1B2LA 1FDUA 3GZNB 4XIJA 3N7UA 4TVBA 4C7JA 5JXWA 1PQPA 1IUKA 1U28A 4NMHA 3V1UA 2C2YA 2NLOA 3KV3O 3NT5A 4GSKA 3MOGA 4AJIA 4CLEA 1ISHA 2GN6A 2D5AA 1N9GB 1FMCA 4M1QA 5IAAA 3R3SA 2I5PO 2V7PA 1E6WA 2PR2A 3KSDO 2HMSA 4RCVA 3AUTA 4WLNA 3F1KA 3FNGA 3DZGA 3UHAA 1HL3A 2PZMA 3UH1A 2JCYA 4ALLA 1PS9A 5H81A 5DBIA 1B14A 1KETA 2Q46A 3CZRA 2OP1A 1O94A 1ZMOA 2A9FA 4YVFA 3PPIA 1GADO 1DJNA 3GVPA 4U0KA 1K2WA 1NVMB 4TRRA 1R0SA 2EV9A 1LSSA 3DZHA 2CY0A 5A9RA 4LSWA 7ADHA 5ITWA 5I9LA 1Z73A 3CH6A 5AVOA 4F46A 1PTJA 4OYRA 2DBVO 2H9IA 1R4MA 1V6AA 1U4OA 2NADA 4J4HA 2EEZA 2OFPA 3F47A 4IIVA 4N54A 4XDYA 1J5PA 4RLSA 3JQEA 3WJ7A 4MINA 3BA1A 1H0KA 4NFSA 4ALNA 4NHEA 5T8KA 1JKFA 4E31A 4QFDA 3JQFC 5FWNA 4PG8A 3D0OA 1T4DA 2NUAA 1MXHA 3NDJA 4EJ0A 4IDGA 2JCVA 3ZH2A 1P9LA 4U5QA 5JW6A 2HQ1A 1WDKA 5A4DA 1H6BA 3KETA 1Y9EA 4GAEA 6LDHA 4W9NC 3IJRA 1NPTO 4FB5A 1YL5A 5AYVA 1BG6A 4E5KA 1YDWA 2B83A 4K9DA 4PG7A 1LDMA 3VZQA 3H3FA 2OBNA 3LF2A 3PWKA 4YXFA 2X0RA 4PLTA 4YJFB 3ONEA 3RJ5A 4XEHA 2GR9A 1AGNA 3S2FA 1YB4A 4QXMA 4RF2A 3QVSA 3BAZA 4RQTA 1EFLA 3EW7A 1HRDA 5FI5A 4URFA 3C85A 3K73O 4AJ2A 3QRWA 2HCTA 2Q2QA 4MP3A 3S2IA 5KNLA 1A5ZA 1HLDA 2OXIA 1B15A 4ILKA 4XB2A 3FI9A 1UAGA 2DKNA 2ZB4A 4BNVA 3UW3A 2I3AA 2R2GA 2C07A 1OZAA 2QIOA 3K31A 5G4KA 3KSZO 3ZW8A 4CM8A 4XGKA 2X58A 3QA9A 1ZEMA 1ZH8A 3D64A 3GZNA 1ZK4A 4Z9XA 3PHGA 4PLGA 3ZU5A 4WEOA 2Q50A 3FTPA 3V2HA 3WLEA 3C1TA 1N9GA 4XZ3A 1KC3A 4INAA 1Y8QB 2VRCA 4UULA 2HAEA 1N7GA 2JFFA 3ANLA 4JJFA 4MIEA 3UF0A 3GRKA 3AI1A 3F46A 2F1KA 4QEDA 1KIFA 4FPXA 4IY1A 3RQSA 2D0IA 4BO5A 3ENKA 3R3JA 1KVRA 5JS6A 1DJQA 2GDZA 4DQUA 3VOSA 2FP4A 1I0ZA 2JD1A 3D1LA 1MFZA 1DDOA 3WS7A 3DTTA 4ZGWA 1IHYA 1Q2XA 1CJCA 4DRYA 2B4TO 2QRLA 3FWNA 4E32A 9LDTA 3WNQA 4IQ8A 1KVQA 1FDSA 4N5LA 4PLYA 1ENPA 1NR1A 2AEJA 4CM1A 1SPXA 4MO2A 1U5CA 4FJ2A 2CF5A 1LBEA 4L73A 4AJ4A 4ALIA 3RC2A 2EWMA 4DLAA 5ITVA 1Z74A 4LMPA 1LNQA 3RIHA 3JYOA 4ID9A 2X5KO 5F1KA 3INGA 4IJWA 1UZLA 3C1AA 3FBTA 4FOOA 1CETA 2E6UX 1SAYA 3MJVA 3VPHA 1L7EA 4DBZA 4DWVA 3L9WA 2LDBA 3AJRA 3Q6IA 4W4TA 2C7GA 4A26A 3O8QB 4IUYA 3DDNA 2OHXA 4CV1A 4DQXA 3ZZNA 5C7IO 3BMOA 4GX0A 5JAIA 1J49A 3OECA 8LDHA 4U0JA 4FW8A 3ZWAA 4MVJP 5ES3A 4CLXA 3TSCA 4YJFA 3QWBA 3HWRA 1R0LA 2ZTLA 3K92A 5BNFA 2CF6A 3PZRA 1XR3A 2OGUA 4CQMD 4W7HA 3ZV5A 5K0ZA 1AN9A 1BHSA 3CIFA 3TNLA 1LRKA 4NBVA 1Y81A 1VJ1A 5TC4A 3T7CA 2AE2A 1GPJA 1OBFO 4CM5A 2P2SA 3QY9A 3ZNOA 4FDAA 1I8TA 4OQZA 4OJNA 1YS4A 2GZ3A 2AXQA 1P44A 1PR9A 1SO8A 3QHAA 4Q3DA 3PHIA 1LI4A 3NTOA 4FFPA 4BMNA 3PP8A 4YQYA 4JP2A 3W4IA 3K6JA 1SCUA 3CMCO 4ND4A 5IN5A 2EXXA 3TZQA 4Y6RA 3HFSA 4NBWA 1JKJA 1PWXA 4XQGA 3TZ6A 4CMKA 4CM9A 3C7DB 3L77A 1ADCA 1ADGA 1ISMA 2LDXA 4YRDA 3PJDA 4EITA 4RF4A 2RHCA 2BFAA 3GDOA 4MIYA 1E3LA 3FNEA 3I9NA 4W82A 5DP2A 2HUNA 1P0FA 3GDGA 3DHEA 4EUEA 1H9BA 1X1EA 2PK3A 1CQIA 3PHHA 4CV2A 1H94A 2JAPA 5FI3A 4XYBA 2O48X 2AHRA 4LISA 5HS6A 2QRJA 4ALMA 4Y67A 1HT0A 3E6AA 1OFGA 2Q4EA 1AHIA 4BNMA 4QTZA 3JD4A 2VYNA 1U7TA 3VH1A 2PV7A 3MWEB 2C29D 4DGSA 4FC6A 2ZJ0A 3UCFA 3WJAA 4BNKA 3ZNPA 4NPCA 2P5YA 2VWGA 1UDBA 5MDHA 3KVOA 2IZ1A 4RQUA 4J91A 5GMOA 2BFMA 4J4TA 2VTDA 3UAGA 3H9QA 3QE3A 1M6WA 4HX5A 4BNIA 5BR7A 1E3SA 3GN2A 3MJTA 3GN1A 1HYHA 4G65A 4M86A 2YV1A 4JK3A 3UICA 4E2WA 5FFFA 2R6JA 2YHIB 3QWFA 4G2NA 3SX2A 3RBVA 5JYEA 3O8QA 3U3XA 3ZWVA 4CR6A 1E3EA 1YWGO 3FWZA 1TT5B 4PZEA 3GF4A 3F4LA 5H82A 4DPKA 1DHRA 1XU9A 2QX7A 4YJGB 1ONOA 4E13A 1ZUD1 3B6ZA 2R00A 4XJTA 1EDZA 1EE2A 3L0DA 3QSGA 5JNLA 2VYVD 3O9ZA 3FN4A 4IMRA 3OFSA 1MX3A 4EW6A 1PL7A 3IS3A 1F8FA 1FDWA 1I3MA 2E82A 4J7UA 1F0YA 1WDMA 4CUJA 3E48A 4KQWA 5GZ1A 3QW2A 2BGKA 1KEVA 1T1SA 4B3JA 3VAZA 3BTSA 3PEFA 3ZN2A 3LYLA 1JWAB 2AEFA 3SVTA 1PZGA 4XQCA 5TT0A 4IXWA 4AJJA 5I8WA 5MGBA 4Y6SA 3OJFA 1Q0HA 4TVOA 1BGVA 4KUHA 4TZKA 3G3EA 3FCOA 1EMDA 1YQXA 4J90A 3E9QA 4RLHA 4RGBA 3RC1A 3WX0A 4CLDA 4B7XA 5JMWA 1AHHA 1DBVO 3K2BA 1DEHA 2IEBA 3G17A 1UXJA 3RUDA 2OO5A 3MTJA 3OQ1A 2I76A 1PR3A 1LEHA 3QVTA 2DTEA 5JAMA 1DIGA 2EW2A 5KVSA 1I30A 1DRVA 2Q45A 3NDIA 3V5NA 2O3QA 3CINA 3ZWMA 2X8LA 3I52A 3GQVA 1QG6A 2PZKA 3BMCA 4P8RA 3PYXA 3V1TC 3H9EO 5L7TA 4ZQBA 4MJLA 4BNJA 3F3SA 4J7CA 4XWYA 1JW9B 1PS0A 1ZXLA 3ZWNA 1ARZA 3ZWCA 4NBUA 2OBYA 3I83A 1ZXBA 3BXXA 5IG2A 2I66A 4TRMA 4EEXA 1M67A 4JCOA 2PH3A 2AQKA 2WE7A 1NXQA 3VH2A 2UAGA 1SMKA 1JAXA 3RU7A 1T24A 4ZD6A 1GYRA 4XYLA 8ADHA 4HNGA 1R4NA 5K9ZA 2EHDA 1R12A 4DPMA 3RC9A 1C0KA 3ETDA 3HG7A 1MGOA 2QHXA 4RDIA 1Z6ZA 3D3WB 1LUAA 1HF3A 4HFMA 1F8GA 4LVUA 3JYNA 4KWIA 5L3ZA 1PGJA 2Q1SA 2Y1FA 4B4VA 1ZFNA 2YHIA 4CMAA 2Y66A 1S7CA 3DHYA 3RUFA 2PGLA 5KIAA 3S2GA 1E6EA 5EQFA 3ROQA 1MG0A 5JAQA 2OOSA 3P7MA 2NTJA 2RAFA 4II2A 5A5EA 3CKYA 2DBRA 3PGXA 3A4VA 1BW9B 2A35A 5DCUA 5CDTA 1HDRA 1TXGA 2I3GA 2X4GA 3LSYA 1QYDA 1Z82A 3DL2A 2ET6A 3NX4A 4UUOA 4BV8A 1PZFA 3ICPA 1PGOA 4A73A 2Y1OA 3LT4A 4ND5A 1EEHA 3ADPA 3HSKA 1B8VA 4J0EA 4RVHA 1N7HA 1R37A 4JBGA 3EVNA 5A03A 1ZK3A 4YAIA 3HZZA 3AM4A 2HJRA 3PLNA 3I9KA 4MVJD 1VL6A 1LDGA 5TX7A 4C7KA 1ZBQA 1JKIA 1ADBA 3VH3A 3IKTA 2JHGA 2O3TA 2ZYDA 4CQMB 4IDCA 3AM3A 1H2HA 2GSDA 3DOCA 1NASA 1P45A 1SNYA 1WMAA 3W4JA 3MJCA 3NTRA 1MP0A 3U4IA 5DP1A 4YT4A 4XCVA 1EVJA 3TOZA 4MKRA 2HMTA 2UV8A 1E6UA 1RM0A 4ZQHA 4UVHA 5JCXA 1PJSA 3OQBA 2UDPA 1N2SA 3RUIA 1LDYA 5KKCA 3ON5A 4WOKA 5JDCC 4WNIA 4QFCA 3O03A 5IDYA 1JQBA 1LU9A 2NVUB 2H63A 3CE6A 1V35A 1OAAA 5CDYA 1RYEA 1L1FA 3QWAA 1T4BA 2GPTA 4YDRA 3I9OA 4Q39A 1HYGA 3GVXA 2DAPA 3PWZA 1VC2A 4L76A 3GUYA 3ONFA 4NH4A 2AQIA 3ZCXA 3NUGA 2WMDA 4R41A 3IKVA 3PHJA 4H3VA 4E5YA 2J3KA 3D3WA 4DLBA 2G1UA 2I67A 1MA0A 1ZMTA 3WFIA 4CR8A 3WBFA 4BGIA 1BXZA 4NK4A 1YE3A 2DPGA 4IQ0A 3JD3A 3I6IA 4Z0PA 4HWKA 2E4AA 1DAPA 1XIVA 2WWRA 2ZJ1A 4BKOA 1NQ5A 4KOAA 4BNHA 3GPIA 5EERA 1GPDG 1BW9A 2PZJA 3JCZA 3QVOA 3G0OA 4D45A 5JBIA 3K9QO 4D0SA 4DIBA 1UDCA 2IYPA 5JY6A 4R3WA 4XRRA 2PD3A 2X5OA 5CG2A 3JQ8B 3VTFA 3AW9A 3WGZA 4JXKA 4B3HA 3AOEC 1BWSA 5KTKA 4TSKA 3ZV3A 1FK8A 4M8SA 1YGYA 5DBFA 4DA9A 4G81A 2J5KA 4PG6A 5JDCA 4J9UE 4O1MA 2NQTA 1KEWA 3GMDA 5KVVA 1O89A 1X14A 3W1VA 4OXYA 4OGWA 3ZWBA 5IJZA 3BHMA 1LSJA 3L4SO 3OHSX 1SB9A 2JAHA 1IZ0A 5JMPA 3SXPA 4KTTE 2ZTMA 1WAMA 1A7AA 4A27A 5JAZA 3LLSA 2BHLA 4HFJA 1A4UA 1V3TA 4PVDA 5EN4A 4TZTA 3HADA 4EJ6A 3SJUA 5IF3A 2GNAA 3OBBA 2V6MA 1IY8A 2DTDA 1V8BA 4PVCA 3GGPA 4KUGA 4NI5A 3WDSA 3FNHA 2ILTA 3MOIA 5L53A 2DBQA 2RBEA 2C5AA 3U62A 2IZZA 3NYWA 2D4AA 4TRNA 5KVCA 2W98A 2WD7B 3DAGA 1A72A 1BXGB 1LSOA 1XKQA 1UXGA 4KZPA 1P1FA 4HNHA 1UH5A 4LGVA 4XKJA 2VOJA 4A03A 3GR6A 4YT8A 4WLVA 4GSLA 3BMQB 3KYBA 1F12A 5LC1A 1W0CA 4XDZA 1DC3A 4YR9A 2VNSA 4Y8VA 2O7SA 4LRSB 2BI7A 5F21A 1WW8A 4IIUA 3RU9A 3VVBA 3JTMA 1RJWA 1XSEA 1IE3A 2Z1MA 3AI2A 1OC4A 1QLHA 1SZJG 3AOEA 4TRJA 1PEDA 3IMFA 3B1FA 3DBLB 2Y68A 4IJUA 2CMDA 1KYQA 3JD0A 3N74A 4RF3A 4Q3CA 4KP7A 4I5EA 1UAYA 5T8KC 4WCFC 4AVYA 4A7PA 1JN0A 4I08A 3VVCA 2B69A 2BRUA 1MC4A 3Q2IA 1BMDA 5AQ1A 3SC6A 1A27A 1QSGA 1E1KA 3DBHA 4EDFA 3R1IA 1ZK1A 1H6CA 2EP7A 1N1GA 3SLKA 1B7GO 5LCXA 5HM8A 3I9MA 3RAJA 3FF4A 1CIVA 1HZZA 1GL3A 1U9JA 1RKXA 5TS3A 5I9NA 3JQ8A 3OIFA 3W6UA 2V6BA 1XYGA 4NU6A 4YRAA 4R1NA 2DBZA 1YB1A 3AU8A 4GPD1 2QW8A 3ITKA 4FD3A 4ZHSA 2YDYA 2FY8A 4CUZA 2VHZA 5CEJA 4WLEA 5KWEA 1R15A 4FR5A 1ONPA 4HV4A 1E7MA 5C7LO 1PJ3A 1KVTA 4DL9A 4DLLA 3KEOA 1B3RA 4HXYA 5A3JA 1Z75A 3ZWYA 1F17A 5L7YA 1K3TA 4PCVA 1WNTA 3VDRA 2RH8A 3OEYA 2VYVA 3WSWA 1W4ZA 3WIDA 1QYCA 4RPJA 3QLJA 4LCEA 1EVZA 1WVGA 3DEYX 4JBIA 1IULA 4WPGA 2C5EA 2Y05A 1WLYA 4OM8A 3ZWOA 4BNWA 2FRDA 2G17A 2YHUA 4Z0HO 1U4SA 4CV0A 3AY6A 3L4BC 5CDSA 4IM7A 4YJHB 1T25A 2XF8A 1GD1O 1QKIA 1Q7BA 2J3HA 3PVZA 4B8ZA 3KHUA 1YOVB 2RH4A 2A92A 1GFSA 3KLMX 1ZIDA 4WCFA 1PIWA 4WOJA 1X0XA 1OC2A 4IXTA 3VZRA 4I9UA 3WFJA 2WD7A 1BXGA 3C7CB 3VHRA 4BNZA 5G2OA 4B7CA 1FJHA 9LDBA 4H7PA 3EC7A 1C1XB 4FFRA 4AJHA 3O4RA 3BMQA 4BKPA 1O0SA 4WECA 3BTUA 3OH8A 5T67A 4U6SA 4DUPA 2V6GA 4UUNA 3V2GA 3QJ5A 3ANMA 3JD2A 1K5HA 5EJ2A 5I7EA 4IQGA 4UUMA 3EZYA 2HRZA 2WYWA 5I8ZA 3AI3A 1PGNA 2DM6A 1QYVA 3DBLA 4S1VA 3GPDG 3VPFA 3OETA 4J1TA 1KY4A 4N7RA 1A7KA 1LRJA 1ML3A 2VOEA 4J3FA 5TSDA 2EW8A 4OH1A 4TKMA 2NVBA 3C1OA 4FGWA 4Y9DA 2IXBA 3DZBA 4ZVVA 5FYDA 3WQRA 4E3ZA 3ASUA 7MDHA 5G4LA 3U4HA 4B7UA 2BFOA 3DWFA 1Z7EA 3TWOA 2PTGA 3DMYA 3GG2A 4E4YA 2V65A 1PZHA 3PFWO 4UVIA 3WBBA 3WG9A 2NQ8A 3EVTA 4XQEA 1X7HA 2HO5A 1WXDA 4E30A 1IB6A 3L4BA 1NM5A 3WB9A 1QXSA 1D7OA 5U1PA 2NU9A 4XD2A 2GZ1A 4CM3A 3JQAD 3EYWA 4HY3A 2YQ4A 1R16A 3TJRA 1E77A 1UZMA 4ROSA 4OOFA 1TEHA 4L4SA 4QUKA 4FN4A 3F6YA 3DB2A 1K89A 3QVXA 2IZ0A 2AG5A 2FSVA 2WYVA 1I2BA 3A1NA 1KEUA 1X13A 1PL6A 1QV6A 3I9JA 4IJKA 1YBVA 3GUCA 2YW9A 3HFGA 4IINA 2FPIA 1AXEA 2Q1WA 2PA3A 5JC8A 5KVQA 3WMWA 4NFHA 5IDXA 3I23A 4AFNA 1ZSVA 4YJHA 3GRPA 4WASA 2GASA 2X7HA 4FSHA 4CV3A 4RVDA 5IDWA 4ND2A 1EVIA 1C1DB 3C3XA 1YOVA 3B70A 4FFMA 2AA3A 5THQA 2EJWA 4YEDA 5L45A 4MVJA 1DFIA 4H16A 3KOUA 1ULUA 3U5TA 1YDEA 4QO7A 3ZW9A 4EZBA 5TRTA 1C1XA 4LMRA 4FS3A 2POQX 3RC7A 6ADHA 3INRA 5DCYA 2B4QA 1HSOA 5GZ6A 3G1TA 1BSVA 1OMOA 2A94A 3PJFA 3I9LA 3BHJA 3T4EA 1NWCA 1N8KA 4U6QA 1P33A 3NGXA 1HETA 3KLPX 4B4WA 2VT2A 1PJTA 3EHEA 5L4SA 1YQGA 4J2HA 1N1EA 3X2FA 1R6DA 3DTYA 4NDNE 3LC7O 3RKUA 4EEZA 2A4KA 2VRBA 4IDAA 4RV9A 3IQDB 1YJ8A 5AXBA 2H6EA 2X23A 4G5HA 4OKIA 3ZDFA 5A1TA 1DSSG 2J6IA 3EZLA 3P2YA 2PKQP 1ENYA 1OOEA 3OIGA 2QZ9A 4CODB 3GEDA 3L07A 2R00C 1U3TA 1ZNQO 2GERA 4XX0A 1KC1A 1VKNA 2CD9A 2VHYA 4YT5A 1Y8QA 2B35A 2E49A 4BVAA 3ROPA 1LLUA 4GVXA 1UXIA 4GLOA 4ZN6A 1ENZA 4RVSA 2C20A 3G49A 1CWUA 1DIHA 4ITUA 2IEDA 3KYDB 2B36A 3WXBA 5THKA 1SOWA 4BQPA 1VJ0A 1LLDA 4XGNA 3H2SA 3WTBA 5C3MA 4HFRA 3P5SA 3LLVA 5ER6A 4E6PA 5JE8A 4BHTA 3DHNA 1I5RA 1LX6A 2PKRA 2F00A 1UR5A 2D5CA 2O2YA 4R16A 3WWYA 4FQ8A 4JX8A 4O5OA 2UYYA 5FEUA 2Z5LA 2PH5A 3AFMA 3D4OA 4Z9FA 2ZTUA 4GI2A 1AXGA 1ZO8A 3AUUA 5JLAA 3DOJA 1O95A 5L40A 1DC6A 3FPLA 1M2WA 4JGBA 4LRTB 4DIFA 2YJZA 4CM6A 1PGPA 3I4CA 5JO0A 2P68A 4XYEA 2YZ7A 3BMNB 2X6TA 4GKBA 2GUGA 1ISGA 4YB8A 1PJQA 5KJEA 4RORA 2FR0A 1IHXA 1I3KA 2XOXA 1I10A 2CZCA 1V9LA 1Y9AA 3NRCA 1E0DA 4JQCA 1GYPA 4F45A 1D3AA 2JL1A 3PTZA 3OICA 1GEGA 4YJDA 2BKAA 5IZ4A 2VZ0A 4ONEA 3C7AA 1YB5A 4J16A 2C59A 3GEMA 1P1RA 2G82A 3GH3A 3AY7A 2AMFA 4P4LA 4ZA2A 3D3EA 1DB3A 1F06A 1RYDA 4DVJA 3L6DA 2VHXA 5AXAA 3DZKA 3ZWWA 3GEGA 2H5LA 3RBZA 3OM9A 1KVSA 1P74A 4D3SA 2V6FA 1T1RA 3FR8A 1EQ2A 1DLJA 2CVQA 1E5LA 2W8ZA 2O3UA 2NU7A 4EYEA 3TFOA 2DT5A 3ICCA 1Z45A 1UP4A 5COQA 3PRJA 3RFTA 4BGUA 4M54A 3WYEA 3JQDA 1H6DA 4K6CA 3WYCA 3WMXA 1YO6A 3AU9A 4TROA 4YQZA 5KCZA 1UZNA 4E5PA 3GAZA 1Q0LA 4JJGA 2JFHA 3JYLA 4JROA 3OF2A 1RM4A 4P4NA 1N5DA 1YKFA 1MC5A 4W7IA 3AY3A 2PNFA 5JY1A 1IL0A 3HJAA 3DZIA 1NVGA 4BS9A 2CSUA 1T2DA 4E2YA 4DXHA 1B0AA 2SCUA 3WQQA 3V8BA 2D59A 3R6DA 3DBRB 4GMGA 1MXFA 1VSUA 2FWMX 4YAJA 2O2SA 3S1LA 4IZHA 1QV7A 4MVJG 1CEQA 1D4FA 1Q7CA 4ALJA 5I7VA 2GLXA 4CJXA 4GQAA 1J0XO 2NNLD 2ZQZA 1DLIA 4PLCA 3UFXA 5BSEA 2NSDA 3HDYA 2C0CA 3F4BA 3MCVA 1HSZA 3KEQA 3WGTA 1ISFA 1ORRA 4LSMA 2C82A 1P1KA 1T2EA 5LDHA 3JQAB 4HUJA 4FFOA 5F3RA 1J4AA 2CDCA 3EDMA 3WWZA 4PG5A 4UVGA 1ZVMA 4WNCA 3GGGA 3OP4A 2O4CA 3BMNA 4D43A 4UREA 1U3VA 1DO8A 1U1IA 5L95A 4BO4A 5EQDA 2FSSA 1LJ8A 3PQDA 1NQAO 4LN1A 5K6AC 1BDBA 1G0NA 2J5RA 3Q3CA 1YBMA 2Q2VA 2ZTVA 1BRMA 2B4RO 4FFLA 4OOEA 1E1NA 4R5MA 2Q1UA 2X0IA 4L0QA 4U8GA 3WQSB 1JTVA 3IP1A 1TT5A 1V0JA 1GCOA 1ID1A 2VNAA 3EK2A 2HSDA 3DXFA 4YJGA 5IDQA 4BNGA 2BF7A 3VPXA 3GDFA 2IXAA 5BSGA 3U49A 1DFGA 2FHSA 2H1SA 1NPYA 1UJMA 2CVZA 4AJPA 3M6IA 1Z7BA 4D42A 3PYMA 4L4RA 4AG3A 4RJTA 5DDIP 4RPHA 3HB5X 3RWBA 1G6KA 1AE1A 3K2EA 3RUCA 4GWKA 2XAAA 1ONNA 4BL5A 1NHWA 1GU7A 3FRJA 2OORA 2G0TA 5L4NA 4F3YA 1LQUA 5A04A 1JU9A 3WOHA 5CDUA 5ILOA 4F6CA 5CPFA 3SJ7A 4CL3A 3ZU3A 4DMLA 1V3VA 2Y1EA 5CP8A 5TJHA 4CQLB 2GO1A 4CR7A 4BNYA 4FJ1A 1HYEA 3JYPA 5ER9A 3HDHA 2TMDA 3LT0A 1PJ4A 2HKIA 2HMVA 5JSFA 2PGJA 3AFNA 2VN8A 1PX0A 1TI7A 2IDZA 1NHGA 4KQXA 2ZYGA 3ADOA 4R1TA 3GNQA 1TA4A 3OA0A 1DRWA 2JCXA 3DAFA 4CMBA 1W8DA 3K96A 1HDCA 5G0UA 3BTVA 3W8EA 1WMBA 4E2XA 3ABIA 3DBRA 5COAA 2X22A 4OXNA 1HE4A 3IP3A 4CMCA 4CMGA 1GUFA 3D7LA 5KJFA 4AICA 2FMUA 5HRUA 1D8AA 1PJLA 1H9AA 2Q49A 1VM6A 4E5NA 4O0LA 5K6AA 1QORA 1E3JA 2XPCA 1B8UA 2ZCUA 3WGHA 2O23A 3PYLA 5DBGA 4D41A 2HMWA 5COBA 1JVBA 3KBOA 2HK8A 3KYCB 3RFVA 3GOHA 5BNTA 4KDFA 2NV6A 5KJ6A 3MJ4A 4W99A 1ZW1A 4Q3BA 4IDBA 3ZWPA 1E92A 4PLVA 3JQAA 2GCGA 3W8DA 1RM3A 3AWDA 4U7WA 5DNAA 2CNBA 4XIYA 2FPPA 1X7DA 1WZEA 1IOLA 4R4JA 4R54A 4AJ1A 2AQ8A 1Q7GA 5TF4A 3VPSA 1E7SA 3NKLA 1KBZA 4BKUA 3HDQA 1Y1PA 2VT3A 3HE3A 3LDHA 3IIEA 3PDJA 4RVGA 2UUOA 3WGGA 1ZZEA 4B4OA 1UP7A 1LC0A 3GC6A 3FSRA 3GGOA 4I1IA 4CM4B 1NYTA 1GQYA 2WEKA 1DRUA 4GH5A 3PDUA 4OIMA 4TMFA 1KOLA 1XQ1A 2EF1A 4GX1A 4O59O 4M87A 1QR6A 5I7FA 2HK9A 4H15A 1E7WA 1Y8RB 3HDJA 5DCWA 4M89A 1P3DA 1HEUA 1XGKA 2DVMA 4OMUA 5F1OA 4MVJE 1C0LA 1PQWA 1WPQA 3GG9A 1HDXA 2OL4A 3S2EA 1XWFA 3RSHA 1R66A 3K8ZA 3W8FA 3AOGA 3CZMA 1DPGA 2AE1A 3EMKA 2J5QA 1WDLA 3A06A 4PLHA 2EG9A 4CLOB 4D3FA 4YACA 2J3JA 4KMSA 2GYYA 3DQPA 2OMEA 2FN7A 1W6UA 3ZHBA 4WGGA 1H5QA 1U8FO 1KVUA 4DPLA 2VYND 2Z95A 4BV9A 1JA9A 5C7OO 1YXMA 2D8AA 2YY7A 4PLZA 4CQMA 4DBVO 1U3WA 1GV0A 1F14A 1T26A 1CDOA 2Y67A 3R0IA 3NT2A 4FCCA 5A3VA 3M1AA 1PSDA 4J0FA 4WJZA 4Z9YA 4XA8A 3H9UA 4UVEA 3RROA 4BB5A 2YUTA 3VKUA 3Q0EA 4MVJF 2Z1NA 4N5MA 2DFVA 2AQHA 3O26A 3TZKA 1IZ9A 1HWYA 3F5SA 2W90A 2FZEA 3VTZA 4XGIA 2BH9A 2EKLA 3UCXA 3IUSA 2EGHA 5IN4A 2JFGA 3KYCA 2NVUA 4R1SA 5TNXA 4NU5A 1WZIA 3IC5A 3ONDA 3WGYA 1R4MB 3U0BA 4QO8A 3LZ6A 3NTQA 1QYXA 5EMHA 3DR3A 3MZ0A 4TQGA 5A9SB 4CMHA 2J3IA 2ZK7A 2Y0EA 3OSUA 2CVOA 4BNLA 2YDXA 5B12A 1ZK2A 3MTGA 3FTNA 3RKRA 3H9JA 4QSMA 4GVLA 4NBTA 2QYTA 3H2ZA 4PN3A 1C14A 5JO9A 1I2ZA 1V3UA 3H9GA 3TQHA 3FR7A 3GY0A 1GQ2A 3KUXA 4YTEA 3OQ6A 5JPIA 4UEOA 1Y5MA 1BDMA 1I33A 2AEMA 4BGEA 3NJ8A 2VWHA 3WLFA 5TQVA 2P91A 3TF5A 4WUVA 4R5HA 1HXHA 3ETGA 5T57A 2QRKA 3RFXA 3ZNNA 1XU7A 2Y1GA 1Y8RA 1EE9A 1ADFA 2CFCA 4HFNA 4BO3A 3NGLA 5DF1A 4ALKA 5AXDA 3UGKA 2FPGA 1S6YA 4I9HA 5JCJD 1O8CA 3FPCA 1ZJYA 4NBRA 1EBUA 1ZJZA 2C54A 2X9NA 3PQEA 1LLCA 4MKZA 4YPOA 3N58A 4B8WA 4MVJM 2PD6A 3QWHA 1P31A 4ZRNA 2X9VA 4L8VA 4O63O 3WGOA 4CM7A 4CLOA 2DLDA 2Y93A 4R9SA 2G5CA 4CM8B 4KUEA 5TLSA 1ENOA 1WWKA 3COSA 4Q3NA 4ESOA 3PK0A 4E21A 3S8MA 4JIGA 1GZ3A 3FHLA 3QIVA 2WDZA 3AM5A 2PD4A 4BKQA 2AW5A 3LT2A 4BO0A 3QVWA 3CUKA 1CYDA 4Y98A 1PU2A 2RIRA 4RPLA 4N18A 1EDOA 1DAOA 1YL7A 4J1SA 4KTVE 4A5OA 1SBYA 1X0VA 1GQQA 1I24A 3B1JA 4XYGA 1DOHA 4GGPA 3M2PA 4GBJA 3HHPA 3SLGA 4BO9A 3HN2A 5T6BA 5A06A 3RBXA 2RHRA 5HWSA 1LXCA 2ZB7A 1GAEO 4EGFA 3OJ0A 3IUPA 3VZPA 1NVTA 2ZCVA 4I8XA 5AXCA 2DU8A 4EJMA 4WE3A 2EKQA 3OMLA 5BNIA 3U4DA 4MIOA 1LLQA 4I9NA 3SBOA 2W2KB 4E5MA 4EUFA 1VL8A 3E8XA 2NU6A 4Z6KA 3GLQA 1GY8A 5A9SA 3BIOA 1M66A 1EK5A 3L6OO 2Y1DA 1I3NA 5HA5A 4LW8A 2ZB3A 4E12A 2X5JO 4B4UA 5HBRA 2VUSA 3UKOA 1MG5A 3TL3A 3EAGA 4BOYA 3P19A 4PRLA 1LDEA 1XCBA 1DIRA 4NNJA 3LK7A 4IGEA 3ZU2A 3BMOB 4BO1A 1BTOA 3ITDA 3GVIA 1P77A 3E1KA 1MFPA 2BLLA 1OI7A 3K30A 2FR8A 4F6LA 3AUSA 4WKGA 1EBFA 1EFKA 1PZEA 3LT1A 3DFUA 1GR0A 3U9LA 4RZIA 1IPEA 4FIZA 2FOIA 3GFBA 4UVDA 1E7YA 4YWJA 4R69A 2J8ZA 4OO3A 2C2XA 3WSVA 4FBGA 2VWPA 1BXKA 2HK7A 4NJMB 1C0IA 1HE3A 1MB4A 3JQGB 4L74A 4P22A 4II3A 4RDHA 3JQ6A 1QRRA 3I6QA 4KWHA 5A05A 1U2DA 1HDGO 4J6FA 2Q3EA 4FC7A 4YA6A 1DIAA 4IDDA 2B37A 3NDRA 2E37A 3W6ZA 2VHVA 2PY6A 3Q1LA 4EI2A 5EESA 4DYVA 1PJ2A 1PJBA 2X1HA 1C0PA 3ORFA 1CF2O 2DTXA 4JJIA 1FF9A 4D7AA 1U5AA 4CLHA 3MJSA 3DZFA 3KTDA 3PZBA 4BKRA 4ZQFA 2I6TA 3E5MA 3JQFA 1J6UA 4J49A 1XELA 4IPTA 2X86A 1YH3A 3E03A 3NJ4A 2Q4BA 1A9YA 2O50A 1EZ4A 2ZKLA 3GT0A 3DOOA 3MEQA 2X0NA 4W9NA 3WNVA 1K0UA 1LDBA 1NR7A 3KO8A 4HADA 4D0RA 1PQUA 3L6EA 3TN7A 1BVRA 3KB6A 4HKTA 4MDHA 5L9AA 4IJVA 2W2KA 4FJ0A 4WLOA 3HUDA 1E5QA 5ICSA 3I4FA 4K28A 3TPCA 4L9RA 2CUKA 4TKLA 4YRBA 2P9EA 4B79A 3LQFA 4JP3A 4KDEA 1HDZA 1XDWA 3DBVO 1EUDA 4WLUA 3PJEA 2VHWA 4FGSA 1QYWA 1N92A 4PZCA 5EPOA 3F5QA 3UOGA 1PJCA 1HZJA 2BMAA 3HNPA 4OXKA 3TL2A 4DTIA 4GLLA 4YAKA 1ISIA 4Y6PA 3PIIA 3ROMA 1UXHA 5DOZA 1GEEA 1MLDA 3AK4A 3NV9A 4PIVA 1PWZA 1B16A 1IYZA 5ADHA 2O7QA 2HMUA 4PZDA 4IZIA 1E1LA 3DMTC 2X0JA 3UVEA 2VWQA 3GAFA 3TRIA 2UUPA 4NJOA 4PLWA 1I36A 5B4TA 2D3TA 1NP3A 3T4XA 4E0BA 1NWHA 2BI8A 2ZIZA 4JBHA 2W2LD 5KKAA 4NJMA 1YONA 3VH4A 3JQGA 4BQRA 4EBFA 2X9GA 4GKVA 5T5QA 1VLLA 4I5GA 3VPGA 3DC2A 3ZWXA 4C4OA 1HTBA 1M76A 1SEVA 3SEFA 3WYBA 1PS8A 1D1TA 2JD0A 3INTA 1ZK0A 1K6IA 1A9ZA 2YV3A 2GGSA 1I32A 1O6ZA 4Q9NA 4E33A 1O9BA 2PZLA 1XA0A 1FDTA 3EY4A 4BO6A 2EIHA 4P4GA 4GL4A 1X15A 1PGQA 1R0KA 3E18A 4ND1A 3IL2A 4A2CA 1HLPA 3C24A 3QQPA 2VCYA 3PI7A 3ZV6A 4J1QA 2BGMA 3UUWA 3W4KA 2DUWA 3C8MA 5G0SA 3V2UA 4AJOA 5CAEA 3DONA 1DC5A 3RD5A 1SEPA 2OP0A 3TZCA 5KJ1A 3BMCB 1TVEA 4YCAA 3OEWA 4HBGA 4WLFA 3BYZA 2IRWA 4DMMA 5CDGA 1C1DA 4R1UA 3M2TA 5A5FA 5ENVA 1M6HA 3S55A 2NACA 1ZSYA 3UCEA 4GWGA 5KJCA 4XR4A 3PJGA 5G0VA 5BSFA 5TIIA 4DREA 2JD2A 1PL8A 4N5NA 1K6XA 1NPDA 4K1LA 2C7VA 3DMTA 3NT4A 1JWBB 3LC2O 4K26A 2D1YA 4DC1A 1Y7TA 2O3RA 3UN1A 1JVSA 1R4NB 2PGDA 3H5NA 4OSPA 1LSUA 1VPDA 3H5RA 1P1JA 1CQJA 1SB8A 1E3IA 2UVDA 2ZB8A 1C3VA 1UXKA 4MKXA 4WCDA 2BFPA 3Q9NA 1FDVA 3E82A 3ANNA 3ENNA 1TLTA 4CMJA 1UP6A 4RL6A 2BGLA 2I9PA 3RUEA 3ZU4A 3A14A 1SC6A 2O4UX 4XB1A 3WGQA 4ND3A 3RVDA 4MVJH 2EGGA 4Z0TA 2PFGA 1B3BA 2JJYA 4OHUA 1SOVA 4XYMA 3U09A 2Y99A 1DHTA 2DPHA 1NAIA 5BSHA 2Q1TA 1EVYA 2HDHA 4AJKA 5C37A 4RVUA 2VZ9A 3D5QA 1Q1NA 4PGFA 4M49A 1B26A 4J4BA 3TZHA 3GA0A 4D46A 3H8VA 1U2GA 2DUUA 4RF5A 3WICA 3LVFO 5IXSA 4XJSA 3KXDA 2I65A 5DOVA 1RM5A 2GF2A 1I2CA 2Y0DA 1ZEJA 2NM0A 4ZICA 3P2OA 1VJTA 1NBOA 4R01A 5TJ9A 3GHYA 4YYZA 1HDYA 1LDNA 4OQYA 4XQ9A 2WE8A 3KYDA 1EQUA 4BO2A 3LF1A 1JLLA 2O3SA 2E48A 2XXJA 4UUPA 4CPDA 1VL0A 3GMSA 3SC4A 3LU1A 2ZATA 2Y1CA 5IXYA 2VZ8A 4J2OA 5U4QA 3ZV4A 2YFQA 1VKOA 3DO5A 1NFRA 5JCJA 3GVCA 3CSDA 4WEQA 4CMEC 4AJEA 1YL6A 3OIDA 1A71A 3GFGA 2NU8A 3G1UA 4XRGA 1QP8A 5J23A 4RVFA 3JQBC 1QMGA 2D2IA 5IFLA 3RI3A 1XG5A 3E9NA 1Y6JA 3KM0A 2IYOA 3KRTA 3E9MA 4NR0A 1NQOA 5B37A 1DC4A
chains in the Genus database with same CATH superfamily
2WUWE 2AHOA 3EZ7A 3I39X 1MUUA 4GM4A 1II8B 3TDKA 5JVDA 2H2HA 4Q1DA 3CXRA 2BFEB 4YJ3F 5FA5A 4A91A 1U2EA 4BVKA 5B5SA 1ODSA 6GPBA 4MUFA 3GVHA 4V2UA 2P4QA 1JAYA 1N6HA 2H4HA 2O2IA 2EERA 1EK2A 2WJPA 2OA0A 4HB2A 5CCEA 1I14A 2OT3B 2Z5VA 2A5DA 4DA4A 3SZRA 2PWZA 4JH0A 3I64A 2CV0A 3KKKA 2UZAA 4MEBA 1ZCBA 1BQEA 3CKKA 4ZT7A 4DYDA 4F7DA 3IOYA 1GZUA 2RGAA 3W1WA 1IRXA 2NO7A 2RK3A 1STOA 3MCAA 4ZEVA 1GCGA 2JJMA 4FQ7A 4GRIA 4GRAA 1AUPA 5ALRA 1SXJD 2C2GA 1PL0A 2EZ4A 3EQ9A 3BRSA 3OLVA 1GZDA 4OKNA 5F78A 4BCBA 3IX7A 4LCJA 2V9PA 4CIWA 4PICA 2VRCD 4BO7A 5DU2A 3W8RA 4AG5A 1CZUA 2CDAA 3ILHA 5EGSA 5KYTA 5LVAA 1MRSA 3NYRA 1IOZA 1T2CA 4M1OA 1BMQA 5JDIC 2R86A 4PG4A 3BJMA 5EINA 1ZGAA 2JIOA 4W5NA 3ZZMA 4HGNA 1TQ8A 1YT5A 1SUBA 1P6UA 1T5LA 3IJ5A 1N6LA 5TMEA 3W6NA 1M75A 4QQRA 4UBOA 2XD4A 2JJ1D 3K5WA 5DTEA 5ESXA 3NBZC 2HJSA 4B3IA 1P0IA 3BTOA 1EX1A 4BV2A 3HEMA 3N8DA 1EIWA 2HI0A 4DV5B 4FE7A 4QXAA 4W6ZA 3ZUPA 2VBCA 2P4HX 3GNLA 2O8DA 1SA0A 5HW0A 3EA5A 2FMTA 1BA2A 2OUKA 1O6BA 2W2VA 3EUFA 3BHNA 5JFGA 5L51A 2B1GA 4DBLC 2CSXA 4OSOA 2ATEA 4NLLA 3ELUA 4IOMA 4FOSA 1TF7A 2X1VA 3HB4X 2XCOA 2NNWB 5KDOA 3L1JA 2ZSBA 3H1AA 3ZTWA 1DP4A 3T35A 2XT0A 2AFVA 4WXHA 3D5TA 2TMGA 4HDKA 3LIIA 1R2QA 3CTPA 4RKEA 2HU8A 3SE7A 3ZGNA 1ECGA 3B1WA 3L8MA 2A88A 1Y1RA 5ERGB 2ODTX 2XGMA 4MVJI 1O8BA 4EPVA 1IJBA 4YBZA 1NDQA 2Q2WA 4L9AA 2D1SA 1KO5A 1GTVA 1E3WB 3CRVA 1P5JA 4EA8A 5IAGA 5TMPA 3H0CA 3OM8A 3WTCA 1OH5A 4B3FX 1Z5PA 5EL0A 1QQTA 2OFXA 1QAQA 3VNVA 3P9SA 2OCGA 3E5RA 1TIKA 1TTHA 3K09C 3LY9A 2I2BA 3M6VA 4JQOA 4OQXA 4XB6B 2F9MA 3ZNQA 2VQDA 1X1SA 3PXXA 3EODA 3QNUA 4HH4A 3QP9A 3GNTA 4ZJUA 3WLRA 4BNFA 4N39A 1B0PA 1G3MA 1AY0A 3DMRA 3H7AA 3ZDCA 5KQLA 1JB1A 4IDOA 1WP4A 2PEYA 1VSQA 2XQVA 2PLFA 3O91A 2JI8A 1II8A 2BFEA 3OQVA 4EENA 4M83A 4R68A 4FMCB 2PCJA 4NAUA 1NVVR 5G1OA 1GDHA 1YDFA 1DUIA 3JYQA 3C6BA 5DKFA 5LJIA 3QVMA 1ZH4A 3CLRD 1RCFA 3D8HA 1P0CA 3GEHA 3Q11A 5ILGA 1EUYA 4IS3A 4OGKA 3EF0A 4IMPA 5LQMA 1MAUA 4I5FA 4Z8XA 3UJAA 3GUZA 4P7GA 3VZSA 1E9CA 1NDHA 1VI2A 4FEYA 4JENA 5ALTA 5TGDA 1D0SA 5A0TA 1LA2A 2J3DA 3CV3A 1EFTA 3MYYA 1XXHE 3GNSA 1YRQA 1KAQA 2P40A 4LG1A 4RAOA 3TNFA 4QDTA 3UJHA 4M0EA 1T0BA 5JSYA 3WIEA 2P2NA 4EG7A 5IXJA 2VTEA 1K6JA 2Y27A 4NS4A 2DC1A 2CNKA 4MR8B 2XB8A 3O95A 3QBEA 1RWBA 2PTHA 2J5XA 5HSGA 3ZU6A 3VSEA 3CGGA 1QHGA 1NONA 3IERA 1B76A 3M70A 3QKIA 4ML3A 2J48A 3OKPA 1KYIA 3H6KA 4LYJA 3GPLA 4V0LA 1PG5A 2ENWA 2QYHA 3OEED 2YJ5A 4NP6A 2VPQA 3ULKA 3TJMA 2DFDA 4DEYA 4CEJB 1LBSA 1L8QA 4TV8F 1HE2A 5GM2A 2GZ2A 2R7MA 1Y4UA 4R9RA 2V97A 3L0YA 4CQLA 2M6KA 1K8ZB 1RLJA 1RYHA 3NEPX 5AVUA 5CLIA 4KRXA 3ZGYA 3G85A 5E7MA 2RCYA 2ACEA 4LWOA 1OSNA 2BM9A 3KSUA 3I6MA 1E2IA 3L0CA 3G9QA 2CXPA 2WTBA 1EYZA 1E2GA 3SHOA 3PXAA 5BT8A 4O4JB 3LBIA 5FUWA 3GO4A 1BQ4A 2IEZA 3ZQ4A 2YHSA 1UJBA 1JPNA 4J7XA 4IDEA 4ZCRA 3IRVA 1XEXB 3S0JA 1ZDMA 2O2JA 3I8XA 1O6FA 3MWDB 2WYUA 3EVAA 1PHRA 1HURA 1BGXT 5HE8A 3FDXA 2XA2A 2SBTA 2NWQA 2LIPA 4EJFA 4Z3KA 4IX1A 1PE0A 4HRXA 5EOVA 3HQ4O 3DEIA 1Q0TA 4GX5A 3LHSA 2WFLA 4GICA 5F5LA 4IMJB 4PXAA 5JPDA 4GNRA 2PUEA 2ZSHA 1E3WA 3ADDA 2A84A 2B8EA 1K63A 2ZSFA 2W2LA 4G5OA 4H9GA 4LWPA 4M55A 1U28C 4KE6A 4FW9A 4TMYA 1I3LA 3LX6A 2ROQA 4MHOA 1TJPB 5CW2A 1I2DA 5DZSA 5IVIA 4HGPA 3FSGA 5B4VA 5K5EA 2Q4OA 4YT2A 4V02A 5DEOA 2BEUB 2FH5B 4GX2A 1H2BA 1N5OX 1HE5A 2R48A 2ZSJA 1Z63A 2IHNA 2JGKA 3AL0C 2R8XA 2FUG1 1XQ6A 4MP8A 4REOA 1U3CA 3PGJA 1USKA 4JN6B 2ZJBA 2V7GA 2YYYA 3CCFA 5J2TF 2FX5A 2DQ4A 3E9EA 1YQDA 4QT0A 1XTZA 4HWRA 1EWTA 1FPQA 4J0KA 3E7WA 3AFGA 4AKHA 1RHJA 1NQTA 2B5WA 3C7KA 4W1PA 4EVRA 1UPXA 1XTRA 3DGEC 1P7CA 5FOXA 5GONB 3U4MA 1YRLA 1G7RA 3HZHA 3OCJA 1ZY2A 5JLJA 1TJ3A 2HLDD 5EIEA 1JYSA 4F2HA 4MCJA 1WABA 4D4KA 1SQGA 3HVRA 1VP3A 4L78A 1PTJC 2ZS8A 1Q95A 1TAHA 3H3XA 3LFUA 3G88A 1NXOA 1W581 5J5VA 4C5CA 3WGIA 2PUBA 4V0OA 3RE1A 3B13B 5KCMA 2JIPA 2Z30A 3F1LA 4TS4A 4AQ7A 2CXXA 4U7PB 3TZLA 5H83A 5EZ6B 4DDWA 2ZI9A 2Z4RA 4BMSA 4MR8A 2IYEA 4L75A 1W5FA 5F98A 1NBIA 1GXSB 2IYRA 2O1EA 3H5AA 3SSMA 4TWBA 3A4MA 1UWLA 3OQNA 3DLPX 1WCXA 1YOBA 4LF5B 2P4UA 4LRQA 4A0SA 4AWBA 4J75A 3WK9A 3OTGA 2W4QA 5G4KB 2GJ9A 3SS8A 1SVUA 3GK3A 2BJHA 4PSVA 1DNPA 2EJBA 2X42A 4MH0R 1AKUA 3GFTA 3GZNB 4XIJA 3N7UA 1CUFA 2F1HA 1IZ8A 1N57A 1PQPA 4NX2A 2YVUA 4JKIA 2ZZKA 4EYQA 4RMNA 4CLEA 1ISHA 4FGLA 5I01A 1UQUA 1BS1A 1UWCA 2NO4A 2V9CA 3EA0A 3JWEA 4MAMA 3C5EA 1I1HA 1FMCA 4IHAA 5HG0A 4M1QA 4O4JA 2XUHA 5IAAA 1M1XB 5KTPA 2J0QA 4JBLA 2J59A 3S68A 3VAYA 3AUTA 2OY0A 2XOKA 3F1KA 5ETJA 1CKEA 2ZI5A 2D5IA 4URHA 3FMVA 2ZT6A 3NHFA 1NJFA 2QXTA 3AF1A 3MWDA 2PZMA 1J20A 4AIRA 5A0FA 2O6HA 3GMIA 5H81A 1LB1B 2Z2ZA 4IW3B 4N5HX 2ON6A 2AC7A 3QVVA 1IN4A 1N0UA 1SUDA 3BX1A 4WZBB 2BR3A 1O94A 1VECA 1XVTA 2CUTA 2OP1A 3PPIA 5FRDA 1GADO 4GU5A 1DJNA 4U0KA 1R0SA 2EV9A 3GFRA 1IEQA 3P0RA 5B2ZA 3DZHA 5DM70 2MSNA 4LSWA 1DKMA 5TPWB 5BWOA 7ADHA 3TOVA 5AW7A 1G3QA 4DDKA 2E4YA 4HWOA 3AO0B 2IP4A 5EZSA 2DBVO 5DI9A 4RMIA 1CHDA 1CXZA 3FYUB 1V6AA 1Z2AA 1U4OA 3TVYA 4ZZIA 5CDHA 3SZ3A 3K2QA 4KH1A 3F47A 3DBIA 3IT1A 2BEUA 4N54A 4TS3A 1TO2E 3O94A 4RLSA 5F4ZA 3PENA 2XYRA 3VSDA 3WJ7A 5EXDA 2YVLA 3A1EA 1QGDA 1F20A 2GT1A 2X4DA 3BL6A 4NFSA 3K71B 3HP1A 4NHEA 4CYMA 1G2IA 3D6JA 3O93A 4KXXA 4GR4A 3JWJA 5CVVA 4E31A 2CB0A 1VBNA 3ZX4A 1JPJA 3PNOA 3TLMA 1IHDA 2JCVA 1QFJA 2EFGA 4MV8A 4U5QA 2RHTA 1WDKA 5JW6A 1H6BA 4Z3OA 1E2QA 2ISSD 1G8PA 2Z1DA 4GAEA 4LBVA 5JAHA 3IP9A 4L0CA 4K05A 3QENA 4M0KA 3WK4A 3MGGA 4IKOA 5GONA 3IJRA 1O9GA 3WWDA 1LKZA 1NPTO 3NTLA 4KZPA 4M9XA 4JB3A 5AYVA 4C30A 2ODEA 4B83A 1EB9A 4LKOA 3LQ4A 4P1ZA 1WCIB 3VZQA 4HZUB 3MTEA 3UO8B 4NAVA 3LF2A 1DRKA 3UC5A 3KR0A 1N7IA 2X0RA 5I7AA 1P7ZA 2W4MA 3U7JA 3FUCA 4XEHA 1AGNA 1YB4A 3AFOA 2R8RA 4RSGA 2JFVA 4QXMA 5JXGA 3QVSA 4W1SA 5CFLA 4RQTA 4A6XA 3DNPA 5ES4B 1HRDA 3B36A 4URFA 3C85A 3DEFA 1UJ5A 3K73O 4AJ2A 4BX9A 1HTWA 1ZM2A 2FW9A 2F4NA 3GGDA 4P3NA 5M2QA 3BXHA 1GXSA 3C14C 3X1WA 4WVLA 3TSOA 2XE4A 4X20A 1MGPA 4XB2A 1UAGA 2DKNA 5KHLB 4OLBA 2B82A 2JK0A 3CA8A 4PGAA 5K0FA 2I3AA 2O2GA 4X61A 5G4KA 3K31A 4C2AA 4CN9A 5JTTA 4UOEA 1B0UA 2VSYA 8AT1A 4M6WB 1CCWA 4XGKA 2X58A 2DFKB 3GZNA 2JGFA 1BYUA 3PGLA 4HLUC 4LRUA 3VNAA 4YMUA 3D7RA 3S2ZA 4RXTA 3ZU5A 1EK0A 2G1JA 3V2HA 3CC8A 5A4JA 4HGZA 5J2UB 3C1TA 2IPNA 3HUEA 3MT0A 1GAWA 2N47A 2IT1A 4C4ZA 4DZTA 5LQDA 1T2VA 2J9ZB 1E2LA 5CLFA 1NRWA 1QVRA 2PL3A 3C5HA 3VR3A 1KSFX 5DGCA 4AUMA 5DNYB 4JJFA 3BE6A 3K9GA 3H2BA 3R7NA 3SSOA 3TQCA 4G9BA 5B30A 3LXXA 4QEDA 1KIFA 2BN4A 4M53A 5ULLA 3B51X 3VSAA 4LXUA 3VV2A 1PDOA 4WZBA 1L4MA 3V4LA 5K0SA 4DQUA 3R9KA 3VOSA 4BGDA 2V96A 4JHXA 1U2PA 2ADOA 2WIFA 4OHMA 1MFZA 5SY9A 1G6HA 1KYXA 3FCAA 4GBGA 1L7MA 2GOYA 4WIAA 3WK6A 1CJCA 5TPWA 1UKBA 4CHTA 3U48A 2JVKA 3PSHA 5LL6P 1ZONA 4LNHA 2E4VA 1MQ9A 5JWOA 3WNQA 1RYNA 5KSYA 4N48A 4B5KA 1XCLA 4ZOQI 2X7XA 4JC8A 2XMBA 4JC0A 1T9GR 2ARKA 3FYUA 4YLYA 3C41J 1NR1A 3D81A 4EGSA 3B3AA 4DAEA 4AX8A 1U5CA 2PMEA 4KQ1A 2J4DA 2JGLA 1ZNZA 4IO0A 3FGZA 1ULAA 2ZRIA 3G0CA 4RFSB 4XASA 4CT5A 5FUMA 3A7DA 5NLLA 2JFYA 3BSFA 4NOMA 5AVSA 5K4HA 4K7JA 3INGA 4JT4A 1SK8A 3C1AA 3FBTA 4FT4A 1II0A 1RXUA 1COZA 2IYZA 1QQ6A 1SAYA 4HNQA 2QA5A 1B00A 4YP0A 3TK1A 1L7EA 3VPHA 5CA1B 5K8CA 1MJGM 4Q47A 3L9WA 5H02A 2LDBA 3RYCB 1LPBB 3Q6IA 1I94B 3H0KA 1KMNA 4YN3A 4IUYA 1BFKA 1SC4A 4J7AA 3UMVA 4W63A 5C7IO 1Y6GA 2B1JA 2G67A 1KSGA 3V7FA 3FVWA 3ZWAA 1WCIA 3KZKA 4HZUA 1K66A 1TUEA 3TLEA 4D8WA 3LW8A 4Z86A 4N49A 4RCYA 3WFZA 1G8KA 3TSCA 3L46A 3NHJA 2ZTLA 3K92A 4F93B 4RIIA 3HKBB 1ZPDA 1WL8A 1LF5A 3JXEA 2JFQA 4W7HA 3WV4A 3ZV5A 4CQMD 1AN9A 1BHSA 2C96A 2YZMA 1GGJA 1VJ1A 2FQ1A 5KX5F 2VJNA 4E15A 2ZBUA 1V41E 1LTQA 3AVYA 2DWQA 2P2SA 1WKCA 2CBGA 3ZNOA 5B7PA 1LS6A 3OLYA 4OQZA 3AVWA 1YS4A 1CD5A 2C92A 1PJRA 4UASA 4CEIB 2PRIA 3K9NA 4PSCA 4M6WA 1JA1A 1UQRA 1WDWB 2Q7OE 4B9EA 1YGPA 1OF1A 2I78A 4K6MA 1JXQA 2R85A 1MPXA 4P3XA 3EOBI 3QHPA 4ILEA 4YQYA 3W4IA 2P27A 3V8MA 3UJBA 4EVQA 3SHVA 2EXXA 2DWOA 3HFSA 4MVCA 4EMTA 2AR7A 2OECA 4CM9A 2G07A 5SZJA 3L77A 1KA9H 1ADCA 1ADGA 1QK3A 4RK0A 1IU9A 2OG2A 5GIPE 1KP2A 1UBUS 3L8YA 5B7GA 5ALUA 2XRYA 2BFAA 4QGGA 1AQJA 3FNEA 4W82A 3WYNA 2WMNB 3OJXA 1IM5A 1P0FA 1QK4A 2QUHA 3GDGA 1FSGA 1H9BA 1X1EA 3ZBUA 4B73A 1YK1A 4YMHA 1VG9B 1U2GC 4Q4CA 4EHDA 2VJYA 2JBAB 5B6PA 2PYDA 2I71A 1W36B 2BEJA 2EZUA 5HS6A 3O5AA 1RMTA 2Z9DA 2Y0BA 3HKCB 1TKBA 2A5YB 4F4FA 5I8PA 4C0LA 3UTDA 4BNMA 4FGZA 1AHIA 4DMUB 2XZLA 3EDRA 3K9WA 2H00A 1S9DA 2WY2D 2FG6C 3LUDA 4DNQA 5KTYA 4TWIA 2NXEA 1UPFA 3OZFA 3C5VA 2PV7A 2DCUA 2QQFA 2RH9B 2EL9A 4DGSA 5L3SB 1FP7A 2ZJ0A 4DR7B 4GG1A 2JIRA 4M0LA 4RIHA 1PEKE 3FPKA 1T1EA 3HCWA 4NPCA 4KXLA 2HV8A 2OO5C 3L4JA 1CY8A 1YHNA 2ZIVB 4TWJA 2J3EA 4RTSA 2FMIA 4RFSA 1RKVA 1JG2A 5H70A 3M6LA 5TARA 1KJZA 1Y1QA 5DXAA 4W9MC 1B42A 1QKJA 2D1RA 4H6XA 4TQ9A 3GN2A 3MJTA 3PITA 3O3CA 4R84A 4XM2A 3T7TA 4A2QA 2YWRA 3M89A 3L7DA 5EJIA 4E2WA 5CA1A 5FFFA 1NUAA 3FAZA 1U8AA 2PYIA 5IHPA 2REBA 4EHKA 3QWFA 3U3OA 2P69A 2EZTA 5JYEA 2HSGA 1FFEA 1TT5B 1EINA 3F4LA 1XDUA 3AFIA 4DPKA 1ADYA 1QDLB 2BMDA 1XU9A 1K88A 2P0EA 2VA9A 3X1ZA 4E13A 3SYNA 3U3JA 4YP1A 3U4QB 2HH9A 3W04A 5BORA 2XUQA 2C0PA 1T3GA 2E4UA 3L0DA 4NXNB 1SKUA 1YCDA 3O9ZA 2AFHB 3FN4A 5HBGA 3A6LA 5BSTA 3HKBA 4WK0B 1PL7A 4FSXA 4R31A 3C87A 4INPA 4EW6A 2BPOA 4MW5A 5ADVA 3D8BA 1R0CA 4J7UA 4D0GA 3IB3A 3WV5A 1XZPA 4FQ5A 4KQWA 5ALKA 1PBTA 1WPRA 2TYSB 3KOMA 1KEVA 3QW2A 2JEOA 4O25A 1EXNA 4C9BA 4B3JA 2PGIA 4JY7A 5FOSA 3DMPA 4N47A 4K6OA 3QTLA 2X3UA 1PZGA 5KWSA 3RSSA 4XQCA 2J9FB 1YJ5A 2I2DA 2JH8A 4IXWA 2IIVA 4Y6SA 4LJ7A 3H99A 3OJFA 1FFAA 1T8YA 1U7UA 3HCCA 3LQKA 1Q0HA 4GPZA 5H3CA 2C00A 1EAYA 4M1YA 4MICA 4CE6A 4LF9B 1FCJA 1MRZA 4J90A 3V7YA 3E9QA 1AS2A 3D7MA 4CLDA 3WL5A 4D8TA 4DB2A 2AD1A 2IEBA 4U7DA 4JVNA 5E3JA 2ATXA 1HGXA 3OQ1A 2B2CA 4P6VF 1PR3A 1JR3A 5EKXA 1QZZA 2QJWA 2JLCA 5LPNA 2IXDA 2ATIA 1I30A 2Y8EA 3TDMA 1ZXXA 2WPDA 4G56A 3CINA 3PICA 4Y1RA 2BFCB 3ZWMA 4OLJA 1MORA 3WGLA 3PUKA 2M9MA 2VVTA 1F8XA 1XRMA 2JBAA 1COWD 3PYXA 4HAXA 3H9EO 3I34X 2WJ6A 4MR9A 4ZQBA 2J3QA 5KAPA 2UYHA 4MJLA 2VP5A 1DPFA 3MSCA 2FGJA 4PHGA 4BNJA 4MA4A 4WH0A 4XWYA 1BXRB 3HKCA 2Q6OA 2JEYA 3WA6A 3ZWNA 3NBFA 2R87A 4QYWA 4R9VA 3RADC 3R20A 2VPZA 3DDWA 4EB6B 3O4JA 1KIMA 1M6EX 2OKCA 1ZGBA 4RA6B 1TFRA 3WKAA 1AA6A 4C0HA 2XF2A 1E2DA 2Z6QA 5L3SA 5AKEA 4R05A 3DE0X 1W2HA 1UFQA 2IK8A 4B5LA 1SMKA 1R9NA 1E64A 3I42A 2D5BA 4BVJA 8ADHA 5JSKA 1YE5A 3SP1A 4G0NA 4LDJA 2AXNA 1R88A 1Y6ZA 4DPMA 2B7LA 1ZJ4A 4RDIA 1MGOA 2QHXA 5AFSA 2XDWA 2OV1A 3FE2A 1YQWA 2BFWA 3HVJA 2ZI6A 3P52A 3IVCA 2NZ8A 2G8NA 3ROGA 3JYNA 2EQAA 2VP3A 1JAIA 2Q1YA 2Y1FA 2VRNA 3OCYA 4FDVA 4B6RA 2HWXA 4GOND 4JJ7A 1S7CA 5KKNB 3CNBA 1TM2A 3KU4A 5MF6A 4LDPA 1VIVA 1W30A 2VH2A 1E6EA 3I30X 4MWEA 5EQFA 5FBRB 1J9GA 4CRWB 2KQUA 1VRVA 2WV7A 2ZAMA 2NTJA 3E9YA 3PR2B 2IZ6A 4II2A 4U9HS 3UBMA 1HFEL 4D5GA 2MMCA 2KHZA 3A6JA 1SVMA 4FKBA 4IIBA 3U4QA 4RQAA 1H4VB 4FYYA 5AUQA 1CDDA 4F4UA 1YRYE 2A35A 5DYTA 1GTZA 3LDFA 1DOZA 4AKEA 1JHVA 2I3GA 2XT9A 4MITA 3HLYA 1N2JA 5ELXA 2AZDA 3NX4A 3TRJA 4ZU6X 2D7DA 1PZFA 1TLFA 4PCAA 4PTZA 2QVBA 3ZHSA 1KMHB 3E8SA 1PGOA 3PDCA 2PX0A 3QQ5A 5IKPA 1I80A 5ICGA 2I91A 4MW1A 3DCIA 1C4WA 3L01A 4G25A 3ADPA 1A88A 1XWWA 3PHBE 4J0EA 1M1YE 4ZXFA 4JBGA 1SUSA 2C2ZA 3QZUA 4ROTA 2N75A 3RBAA 2NUTB 5FUQA 1XXLA 4A6EA 2HJRA 3PNYA 3BD6A 3HLTA 5HUJA 3GPBA 2QD5A 4TYQA 3MLBA 2VL7A 1E1QA 2CYBA 2H2DA 4M38A 5FPSA 1JKIA 1GSHA 1LY1A 3DL0A 1GSAA 4Q66C 3W9UA 1JJIA 1XRSB 4D5EA 2ZLBA 1R4ZA 4GYWA 1P45A 1WMAA 5EEGA 2DSNA 1WBDA 1C9KA 3W4JA 3NTRA 1YR6A 3PVSA 3U5TA 1UPUA 2PUAA 3U4IA 3W2GA 3NAMA 2ZSUA 3EVDA 5DP1A 2BFCA 3MK31 1GOTA 2I34A 2H08A 2HOQA 3ER6A 1QFMA 2WIBA 1P91A 2UV8A 1YB7A 5GV8A 1QG0A 4NYIR 4ZQHA 4F9TA 4ZK2A 2DWPA 1PJSA 1PZNA 2QR5A 2DFPA 2UDPA 2ZSIA 1N2SA 4MA0A 3EXG2 4TTSA 4OQ4A 3T3PB 4UQLA 2CNWA 5IJ0B 1RCUA 2PMKA 1IJEA 2YWBA 1EVEA 1NLFA 3ON5A 4OHWA 3RIGA 1QBGA 2YS7A 3ZLBA 4QFCA 3LHIA 5IDYA 5TPZD 1JQBA 1NIPA 2FJ0A 2HLHA 1B8OA 2H63A 1F2DA 1SKYE 1V35A 4RA6A 5EVJA 4RK5A 4DFDA 4H4EA 3A6ZA 4PRYA 4RY2A 4Y0AA 3T0FA 5CDYA 1PK9A 3BE8A 4I36A 5DASA 4BKMA 1R64A 3BGOS 3LUJA 4K0KB 3HNRA 1T4BA 4GM1A 1L8LA 1KJNA 3BILA 4Q39A 4KOEC 5DHPA 1HYGA 2CLLB 2CDRA 2GX6A 2PT5A 4J03A 2BM0A 5IABA 2PAFA 4QXRA 2WRZA 5TDHA 2JB9A 3ONFA 4V0MA 3SIXA 3ZCPA 1RPAA 3R0VA 1HMYA 2VDLB 3NUGA 3WYAA 4E5YA 3EZ9A 5HM6A 4PR0A 2WA2A 1P3JA 4I9FA 4OCZA 1TQ2A 1MA0A 5D3QA 3LKVA 3WBFA 2HD4A 5C80A 1BO6A 3TRKA 3ZXYA 3T9AA 1YE3A 3U61B 2ZTHA 4Z0PA 1W19A 2V3CC 2OE2A 3NO4A 3GD7A 4C7OB 4A6PA 4WDQA 4P35A 3S28A 4INZA 1L6RA 3M1IA 2O52A 4OQMA 5A3RA 3FZGA 3WJ2A 3A1FA 1J0BA 3WQBA 4IH9A 2RBGA 2HJHA 2AB0A 1NQ5A 1QMPA 4JEMA 4KOAA 4DG8A 2V7TA 1POXA 1KTIA 3S40A 2AF4C 5EERA 1XWIA 4KVAA 3SDZA 3SS7X 5I4IA 3EIQA 1BHJA 1DBRA 2PZJA 2W43A 3L8FA 3NB0A 3QVOA 3NEAA 4LE1A 5CFNA 3ETCA 3FZEA 4GQBA 4YMTA 1G59A 3K9QO 4WKBA 1OR8A 1VTKA 4Q7MB 1LZKA 4HHEA 2ZJ7A 4L08A 2FTKE 2YASA 1NZJA 3JQ8B 4FMBB 3ODGA 3ZWKA 1E9EA 2P2ZA 1BWQA 4FYVA 1RI5A 3WK8A 4A0HA 1RWVA 3TBFA 1JJAA 3U4AA 2QN3A 4DWOA 3U37A 2QZJA 1EFCA 4M8SA 3IT0A 2PRYA 1UPAA 1V7PC 4I3HA 2D2FA 3B8EA 1QIEA 2DWUA 3ORHA 4YRMA 2J5KA 5G1NA 2NUTA 3A9SA 4TLCA 2BRUC 5AK3A 4ZEMA 1VPEA 1YZTA 4BX2A 2HSJA 1VE7A 3AI7A 3NCHA 3C6MA 4MYDA 1UIMA 2NUPA 3PB3A 1JVNA 1CZNA 4NU0A 1UOEA 3DH0A 1U0RA 4AY4A 3L4SO 3JQRA 2A7QA 3M8KA 1SB9A 2YWHA 3L0BA 3ZE6A 4CBVA 3FTCA 1UXOA 5JMPA 4KTTE 1YZGA 1RBMA 5JAZA 1NVXQ 5D5QA 2AWOA 2BHLA 1J0AA 4ZEXA 4HFJA 3VNRA 4DSZA 4I1PA 1V3TA 2Z6UA 4YV2A 4L28A 4LY9A 4EI9A 2CLOB 3GRFA 4DR6B 3SJUA 3MVEA 3T5CA 3RYHA 2XMPA 2V6MA 1IY8A 1J2UA 2DTDA 4BQNA 1JEEA 4EHHA 5C8YF 3MS2A 4KUGA 4NI5A 5FORA 4GC9A 2VDVE 1XI2A 3WY9A 1IQ0A 1VLQA 3N59A 5BW8A 2Q9CA 4B3MB 2YFYA 4TRNA 5KVCA 3DAGA 4CCYB 3WKBA 1BXGB 3AW8A 1ZGJA 1P1FA 4LGVA 4F60A 1VLZA 4GMXA 4A03A 4KYTA 1Y80A 4QUEA 4LECA 4P9NA 5CLLA 5FHRA 1J33A 3EZGA 3ZD9A 4GKAA 5HUHA 1XNGA 3KYBA 1NNI1 3IA2A 3W2EA 5JSQA 1Z38A 1FU8A 1DC3A 2ZRFA 3P2MA 2Q3FA 4HGOA 3TQIA 2C9CA 1UEIA 2O7SA 4LRSB 1KU6A 1R00A 5DB4A 5U4XA 1G4HA 4IIUA 3QU2A 5DGXA 3RU9A 3JTMA 8MHTA 2BFNA 2GH1A 1IE3A 3KQLA 1OC4A 1QLHA 3AOEA 4UBLA 3D0QA 5CCDA 3O75A 2XD9A 3EG5A 5FLKA 1CR4A 3Q8WA 4YUVA 4C21A 4Q12A 3AF2A 4Q3CA 2G1PA 1G20A 4I5EA 5EI5A 1G21E 1WUJS 2IDJA 1ZICA 2WT9A 3BERA 1ECBA 1JN0A 1XZIA 4FLFA 1MF7A 3DEKA 1X1QA 2XQGA 1O96B 4FXPA 4Q9AA 5D6OA 1T2NA 1QTRA 1R6VA 5IC5A 4A5SA 4EX7A 3KVRA 2NAFA 5HYVA 1BMDA 4QTUB 3SC6A 221PA 1A27A 1QSGA 1VSTA 1E1KA 1AQ6A 2EWVA 3DBHA 3R1IA 4LY0A 4YAOA 4HAIA 1OH7A 1H6CA 3GBVA 2IUFA 4X6YA 4P82A 3NVDA 3RJTA 1B7GO 1C7QA 1WXEA 2OG1A 2ZIEA 1IY1A 1T0JB 2ZRCA 1HZZA 1GL3A 1WMEA 2AI3A 3C3JA 4TYWA 3JQ8A 3BGDA 3MM4A 2V6BA 5FLYA 5FXMA 1WX1A 3U16A 4R1NA 2E2WA 1M8KA 3T5BA 3U40A 6NULA 3CLVA 4IRMA 2XUGA 1IQRA 2YDYA 4G4JA 2FY8A 4FR5A 3MMZA 5LBIA 2DERA 5C7LO 1PJ3A 2RI6A 3FDFA 4CGYA 1PFVA 2O1XA 2YZGA 3BWXA 2I8CA 1PUJA 2V45A 1Z75A 5A3JA 1K8RA 3P96A 1F17A 1WVIA 1K3TA 4S12A 2GJ4A 2WOJA 2GJSA 3IPCA 4PCVA 1VL5A 1WNTA 1E9FA 2P4SA 3VDRA 3OEYA 4U9UA 2VYVA 4RKWA 1W4ZA 3WIDA 3IAM6 1QYCA 4BX3A 1XTTA 4XYLA 4ERNA 2G5PA 4JBIA 4BCDA 4H77A 5D86A 4XFKA 1V8PA 1E2EA 3KELA 3FCCA 3P8ZA 1JPVA 4G0QA 4TTAA 2FRDA 2G17A 2YHUA 4AZ3A 4E5DA 4LV6A 3HI4A 3RTBA 4IM7A 4BAUA 4YJHB 2CHQA 2XF8A 3TXXA 4MUAA 1ODTC 2A9QA 3A9TA 4HX9A 1EPUA 2BUBA 4FTWA 1N77A 2Z4TA 1W47A 1QDUA 2RH4A 3P5BA 2A92A 3F8WA 4FX2A 4X24A 1ZIDA 2XMQA 1T8RA 1X0XA 4BFZA 3VZRA 5CVUA 3U1TA 2CYCA 2P9BA 5HK8A 4CCYA 1BXGA 2ZEJA 1KMCA 4B7CA 1TMKA 1ACLA 1J2TA 2P9HA 5AI0A 2Z5FA 3ILXA 3EC7A 3MUEA 1C1XB 3UHOA 3ZDXB 4E5UA 1M2NA 2A9OA 1OD6A 3DHVA 5E0KB 4C2TA 1XKXA 3IUEA 3VHLB 3GP5A 3TMKA 2QL5A 3U60B 1GKIA 2V6GA 2ZIXB 1GVHA 3D7SA 3V2GA 3ANMA 5DI3B 5FR2A 2DB3A 3IULA 3JD2A 1FU7A 5J5AA 3WRYC 2Z83A 5I7EA 3TLYA 4IQGA 2WYWA 1ACMA 1YUMA 1Y89A 4JJEA 3N2EA 4F4HA 2JAXA 1RBQA 4S1VA 3H1PA 2WB4A 3E9ZA 3R3HA 4FWBA 4L5IA 3WXMA 3FDIA 3HS3A 5CYGA 1U0OC 2C8KA 3CO5A 3B52X 1ZMBA 1A7KA 1XZEA 3GYGA 4N7RA 2C2WA 5EE3A 3VGJA 4ASUD 4NXMB 2VOEA 2XYVA 4J3FA 2EW8A 4JEUA 5JALA 1O96A 1AO3A 4AAYA 2QD2A 1Z12A 3KD3A 1M0TA 1W25A 5FYDA 1VE1A 3RV3A 2B1RA 3VUFA 1CY4A 4P0TA 7MDHA 2AG6A 3O9VA 1D8TA 1R10A 1L4UA 2RAUA 4K3UA 1SWWA 4RHXA 5IYZB 1T9CA 4OUDB 1SXJA 1C7RA 5K0JA 3LA8A 2CHEA 5H9VA 4WZAB 2O2ZA 3Q7SA 3W5SA 1X7HA 4HAVA 2AFIE 4E30A 5AW2A 5ECWA 5HKLA 1BDJA 4US2R 1J0EA 1XB2A 1WSDA 2V5VA 2C9YA 1D2NA 1Y4ZA 1EP1B 3R7DA 2GZ1A 5D87A 4C6TB 4CM3A 4DW8A 4Y1EA 3PX7A 1L5HB 3TJRA 1Y3CE 1GL7A 2X2FA 1GGKA 4L4SA 3IXMA 4FN4A 3CNQS 4W1QA 2LCQA 2UZ3A 4PX3A 4OHOA 4KN9S 5KUTA 1GN8A 1ZVQA 3ETNA 2JJ1A 1QONA 1UF9A 2O0KA 1FTGA 1U7DA 3I9JA 4BMYA 1F4VA 4IJKA 2YW9A 1Z22A 3R5JA 5T7BA 1QIMA 3BRWD 1EJBA 3C45A 3H87A 3O4GA 2V7WA 1VMDA 3OFNA 4QNRA 2WG0A 1IN5A 3I23A 4AFNA 4L7QA 4YJHA 4IIXA 5DGDA 3ZCRA 4WASA 2GASA 2MT9A 1YRWA 3LYAA 3P9XA 4FSHA 1Z35A 4KWCA 1TM5E 4MRPA 4GP9A 4CV3A 1HX7A 4X3OA 1EVIA 1C1DB 1JT9A 2OCLA 2WK1A 4F3RA 1CQWA 2V7EA 2EIXA 1D2EA 3H9CA 3LP8A 2AA3A 3IR7A 5AI9A 3SYMA 1TPZA 4A8PA 3IVMA 3ADBA 2XH8A 4ZI5A 3N28A 3HJRA 4YEDA 3EPRA 5G1PA 1YBFA 3RVPA 1R5NA 2RGGA 3V1MA 3QJYA 3HXQA 1ZW6A 3OI7A 3EXEB 1WSWA 4QO7A 3L82B 4EZBA 3KP1A 1C1XA 1UDXA 1V8ZA 4O2AB 4FS3A 2QORA 3RC7A 2PG3A 1TKCA 1DKNA 2Q8PA 4L27A 3ZY6A 1YB6A 3BWEA 3O2NA 3SIPA 4EH1A 1Z26A 4FGKA 1X86B 3AERB 4A2PA 5MHTA 3HL4A 2C58A 3TECE 3UQZA 4C14A 4QUAA 1OBVA 3GXBA 3QKWA 2J46A 4BQFA 1RADA 4M98A 3ZD6A 1WCYA 3WZMA 3RRBA 2Y4OA 3NGXA 1XPUA 1HETA 1YZQA 4QRHA 2X6QA 1Z34A 1N4AA 3TJZA 4HH3C 1C80A 4J29A 1FMTA 1TJYA 3ZBTA 4DXAA 3X1MA 3A25A 1YC2A 2FXVA 3CLTC 4J2HA 4X8HA 1R6DA 3ZIAA 2GEJA 1KYTA 4MAAA 1UPCA 3G6KA 2LP4Y 3LS2A 5AK4A 1BN6A 4NDNE 2A4KA 5AVYA 1ZJJA 4QM7A 1F3OA 5H0IA 2VRBA 4KX5A 3WLNA 4PHHA 4LEIA 1X77A 3QFHA 2H0RA 2PUJA 4KQCA 2Q3MA 1CDEA 3I62A 3NWJA 3AP3A 4EARA 3ZDFA 4OKIA 4MWGA 3LRPA 1JSLA 2QSJA 1S2GA 5IH7A 4YX9A 4OUDA 5FFMA 4AX4A 1OOEA 4Q4DA 4Z4EA 4CODB 2CJWB 1E2HA 3CUWA 4G1BA 4WZAA 1XP8A 3GEDA 3GJ8A 3VR2D 2GERA 2IV3A 3NH6A 2FEXA 1ICEA 2GHIA 1KC1A 2HTFA 1M34E 4GZ3A 4JLMA 4YT5A 4MRAA 2LPMA 4NBKA 1WUIS 5ECGC 4JJAA 4KSCA 4Q1VA 3LHKA 4EYGA 2PQMA 5GGXA 4OXQA 4PPFA 3H5IA 1T1GA 4RVSA 1E2JA 1MT3A 2P5SA 1E0JA 3ZG6A 2JCBA 2ZR9A 3MERA 2Y71A 3OEEA 1CWUA 4KO4S 4DIDA 1N3YA 2IEDA 1DS6A 3KYDB 2B36A 4LYDA 5BWBA 3CRQA 2QUKA 4BQPA 1NSTA 1GNRA 1LLDA 1TZMA 4XGNA 1Y7IA 1Q16A 2OB1A 3P5SA 4QA9A 4RHFA 4FOTA 3EWNA 5JE8A 3NOXA 1T2UA 5CJJA 1CZHA 1JJBA 3A6FA 4Q6BA 1A50B 2G6TA 3V7UA 1THGA 1KAMA 2QTZA 2XY4A 2HIHA 3VXKA 2QLBA 2R62A 1UK9A 3QVJA 2F00A 1UR5A 3SX0A 4DABA 2Q28A 4MS1B 4P4UA 3RC1A 2I7VA 2YJNA 2Z5LA 4Z9FA 3TNJA 2CWDA 2ECOA 1Z4QA 4U1RA 2Y1WA 3TQTA 2OHHA 3FPLA 4LRTB 4DIFA 1VHJA 3MXTA 4PC1A 4V1CB 1AZWA 3FPGA 2FUG6 1EB8A 3GYBA 4R7GA 4YWHA 4XYEA 2IH5A 2QAGB 3AJEA 1JMKC 4X44A 2X6TA 4GKBA 3DO6A 2ID7A 1GGMA 3QI2A 4MKGA 4RORA 2KM1A 5IARA 3BF8A 1IHXA 3EXEA 1I10A 4H0NA 5HFAA 1Y9AA 1E0DA 4QELA 4JQCA 4O2AA 1G5PA 1MJFA 4RZ2A 5KSZA 2XYGA 2ZIWB 3A1WA 2IU0A 2CLIB 2HNAA 3L7YA 3AERA 4ONEA 3T7AA 5IZ4A 1BX0A 1U3GA 4JJKA 5KTSA 2ZCJA 1Z29A 5FTWA 1P1RA 3N2ZB 3E15A 3AY7A 4IL5A 4GBMA 1DEXA 1ESEA 1OCEA 1B1CA 1UBOS 3B6KA 2BSXA 3OBIA 4MR7B 3DZKA 4F4IA 2XBLA 4KFRA 1D4AA 1SQ5A 3K9LA 5HKKD 3Q7EA 4JCCA 1Q14A 4YRTA 4D3SA 2L2QA 1ZOPA 1W5EA 1PJ8A 3B48A 5K8TA 2BSAA 1VPWA 2MYTA 2VH5R 3LC0A 3ORSA 1E5LA 4UNNA 4EFLA 1KARA 1BOFA 3OKAA 4PAQA 4YECA 5HGJA 4LC0A 1O2DA 3GCWA 4D9HA 1CJSA 4L57A 2IYNA 1EGMB 4RLQA 1Z45A 5I7WA 4BQIA 1UP4A 3CRZA 3IPAA 3PFCA 5COQA 3TM5A 2COEA 1G9SA 3RFTA 1AF7A 1P7VA 4YRJA 5KX5A 2HLDA 1PKEA 5C8DA 2PHZA 4X00A 4K9SA 4KBYA 5EYPB 3WNCA 1YR7A 1JIKA 3CJQA 3AU9A 4H7FA 4LXYA 4NV3A 1KY3A 4S0XA 4YQZA