4WCDA

Trypanosoma brucei ptr1 in complex with inhibitor 10
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
250
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
total genus 92
structure length 250
sequence length 267
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wcdA00
3FTNA 4CM8A 4EBFA 1SCUA 1EFLA 1K0UA 3R1IA 5I9MA 4RL6A 4BB5A 3VH1A 4FFPA 5G4KB 1WW8A 4OYRA 3PZBA 2C2YA 3BMCB 4EW6A 2G1UA 1E7SA 1EZ4A 2HMTA 2XPCA 5A5FA 1VSVA 3WGIA 4YJGA 3KYCA 2NQTA 4JK3A 3H9QA 1JDJA 2HDHA 1CEQA 2EGHA 3DOOA 4OSPA 5K6AA 1GEEA 4UVDA 4Y98A 5KWEA 1DC5A 2GN9A 3U9LA 5B4UA 3G1UA 1HF3A 4HY3A 4ILKA 3WNQA 1F17A 5COQA 1YS4A 5HA5A 3Q1LA 4J4BA 4NJMB 1XHLA 1HT0A 1QYCA 1PGNA 3DBRB 1BRMA 2PTGA 1GTMA 4IDAA 4OL9A 1T2DA 4AJOA 3ZWXA 1K6IA 4RPJA 2W2KB 3D7LA 1YB4A 4CM5A 1UXHA 4YWJA 4YCAA 3DFUA 2C5EA 2P4QA 4URFA 1Y81A 5C5IA 2CMDA 5JDCC 1KETA 2WJPA 3WDSA 2VHWA 3IP1A 1PWXA 3V8BA 5EESA 3E1KA 4DYDA 2QRJA 4NFYA 4BO1A 1P33A 3DZGA 1P1KA 2V6FA 2YJZA 2EERA 3D1LA 3ZWCA 3U4DA 1DAOA 4NU5A 4YRDA 1ZIDA 1OC2A 2PGDA 5TQVA 5JCJD 4IGFA 3FNEA 2PZJA 3T4EA 2A92A 2J3IA 4NBUA 3N74A 4F46A 4TRRA 4DLAA 4BUCA 4L0QA 4J3FA 2J5QA 3TDKA 3KRTA 4E2WA 3ONFA 1BTOA 4WCDA 5CFZA 1KOLA 4K6CA 5FFFA 2PZKA 3RJ5A 2VT3A 3RFXA 1X15A 4O5OA 1JQBA 2GR9A 4DIBA 4IMPA 3TZCA 4WLFA 3MJVA 4GWKA 3GZ4A 4XQCA 3X2FA 3ASVA 3H5AA 4G5HA 1N5DA 3ZV6A 4B8ZA 1W0CA 2FR8A 1ZSNA 1E3WA 2NVUA 1OFGA 3MJCA 4PLCA 3UUWA 4R9SA 3NT2A 3DBLA 4NG5A 4YT8A 4B8WA 1S6YA 2FN7A 3KB6A 2NM0A 4MVJG 1ZJZA 1LUAA 3U09A 2GCGA 2W4QA 4NBRA 4GX0A 3BIOA 4PLGA 2VYND 4OH1A 5THQA 3V1UA 4CLRB 1PS8A 5KKAA 1OMOA 4MKRA 2VOEA 4NQZA 4EUHA 1E6EA 2Y1DA 4U0KA 5JAQA 4QT0A 3PHHA 4W4TA 4DLLA 1NVMB 4Q3EA 5JY6A 4CM4A 1BHSA 1LRKA 3GY0A 4XQEA 1KERA 4N7RA 2BF7A 4ROSA 4CLEA 4D3FA 1WDKA 4A5OA 4IJKA 5HS4A 2XXBA 3JD4A 4CM1A 2JD2A 3VKUA 3VPFA 1KVSA 3K9QO 3P5SA 5TT1A 5B37A 4E5YA 3F4BA 1XU7A 3OF2A 2NNLD 1UXGA 4N5MA 2WYUA 1YJ8A 2QYTA 1B26A 1NQ5A 3AY7A 4CLOB 2WD7A 3I4FA 2O4CA 1DRWA 1EBFA 2V6BA 4BNVA 4CM7A 1YBAA 4JBIA 1VLLA 2AMFA 4B4VA 2IE0A 3FN4A 3QQPA 5K9ZA 3GDOA 4FSHA 5DBFA 1ENYA 3LLVA 4PG8A 2OO5A 1Y8QB 4GSLA 4FIZA 1RWBA 2WD8A 4C7KA 5ICMA 1ZEJA 1O94A 2YHIB 1NQTA 1R12A 1DPGA 4R1NA 3UAGA 2HCTA 5A9SB 1YDWA 4YAGA 3OJ0A 3Q9NA 1EK5A 1QYVA 4XKJA 1NR7A 2DBVO 4Z0PA 3F47A 1BMDA 3HB4X 2X5OA 3PK0A 1DFGA 3NV9A 5DOZA 1I24A 3C1TA 5CP8A 3TFQA 3FPCA 3DC2A 3GT0A 3V2UA 1TA4A 1YL5A 4IJUA 1YBVA 5L40A 2C7VA 1K5HA 1VJTA 1NHGA 1G0NA 3I9JA 3QHAA 1V6AA 1HZJA 3DBHA 3GDFA 4EYEA 1E0DA 1BGVA 2FRDA 1PGOA 3QWAA 3JQ9A 3MTGA 4NZ9A 1Y6JA 3U49A 3AW9A 4FGWA 5CG2A 3GG9A 5TX7A 3WYBA 3AOGA 1G6KA 4ZQGA 4IIUA 3H65A 5F21A 1U4SA 1EDOA 3IS3A 4B7XA 1HDCA 2O3UA 1CQJA 4XA8A 1BVUA 3B1FA 5JAZA 1BW9A 1B2LA 2NLOA 4FBGA 3L4BC 4GH5A 5AOVA 3RC1A 4KWIA 4BNKA 2Y99A 2WSBA 4K9DA 1B8UA 1C0KA 3K6JA 4NK4A 4DBZA 4KQXA 2B37A 3A06A 1PWZA 4E2XA 3KVOA 1HWYA 5HWSA 2VZ9A 5IZCA 4IJVA 2XOXA 4AL4A 1CETA 3H9UA 2EKPA 3D64A 2Y1OA 2DTDA 4LMRA 4W6ZA 2DM6A 3FTPA 2P9CA 1I01A 2ZB8A 5I7FA 3GAZA 2WTBA 1QKIA 4LSWA 4GKBA 2GGSA 4DC1A 1PS9A 2VWHA 3HJAA 1DLIA 2Z95A 3QW2A 1VJ1A 1PZHA 2ILTA 4B7UA 4F3YA 4J1QA 5U9CA 3B1KA 1NTOA 1EVJA 1D3AA 4Q3BA 3VH3A 3PLNA 4UUNA 4DPMA 2HAEA 2RH8A 3COSA 1AHIA 4DQXA 2VNAA 3OICA 4HUJA 4ND2A 4QECA 3ZWMA 3U62A 2DBQA 2O48X 2V6GA 4KOAA 3MJ4A 5A04A 2JD0A 5ES3A 4AVYA 1IUKA 1LLQA 3I9MA 1E1NA 2Y0DA 4XYBA 4YT4A 4RQTA 4WCFB 1KC3A 1VC2A 4TRJA 1EBUA 1LNQA 2PKQP 1KS9A 5A05A 3RI3A 1J0XO 4CQMA 4E21A 3BTUA 4HX5A 5GZ3A 4IXTA 5F1OA 5F3RA 3AUSA 3GFBA 3IIEA 1WVGA 4FW8A 3DBLB 3JQCA 4R68A 1E5QA 3CEAA 5LCXA 1X7DA 4RPGA 2GPTA 2DLDA 4H7PA 1GQQA 1T24A 3HN7A 3C1AA 2VYVA 2ZJ1A 2BI7A 4OOEA 2VOJA 1Y5MA 4YJFA 3HUDA 3NJ8A 3GRPA 4IBOA 4ALLA 4J7XA 2GSDA 1QG6A 3BHMA 4M89A 1R0LA 4YACA 1JKIA 2O3QA 4E32A 4EUEA 4GBJA 9LDBA 4U6QA 1RM3A 3VOSA 4PZCA 3LLSA 1BWSA 4MVJF 5C7IO 5A4DA 4YRAA 1BDBA 1QLJA 4INAA 1UP7A 2V6MA 1LC3A 2CNBA 5C3MA 4AJNA 3OP4A 1DXYA 3LU1A 3TF5A 3HN2A 3ZV4A 1FDTA 1OOEA 2EKQA 2G0TA 1GPJA 4FR5A 3EDMA 3VKVA 3I4CA 4ZRMA 4J9VA 3DBVO 5I9NA 3OH8A 4QXMA 1ZK2A 1EE2A 4RVFA 1GAEO 1YJQA 2Y68A 4PLHA 4U6SA 4AJ1A 3AUTA 3BMQA 4D3SA 4CUKA 3OJEA 5KTKA 2OP1A 5T64A 3ICPA 4PLFA 1Y8RA 2J3HA 3PWSA 4RPHA 1HYGA 4ND4A 2BGMA 2GNAA 4ZU3A 5J23A 4JJIA 5JPIA 1IPFA 1NFQA 2UAGA 3PJDA 4EITA 1JN0A 1NP3A 3OSUA 4BO7A 2VQ3A 4IDCA 4NR0A 1NYTA 1V3TA 1JKFA 1SZJG 1HE3A 3E82A 1PJCA 3MTJA 1TI7A 4QFDA 3JQ9C 1NNUA 2J8ZA 4BO2A 3C8MA 3BTSA 3Q2KA 4I5FA 5B12A 1NFRA 5FEUA 4MVJD 1CF2O 3DZHA 4CMJA 3PQEA 4M55A 3DAPA 1NM5A 1IPEA 1JTVA 1PGQA 3I83A 1M6WA 3DBHB 4CMKA 4CJXA 3PP8A 1QMGA 3I52A 1EQUA 3DMYA 4AJLA 5A02A 1ZO8A 4BB6A 3E9MA 4MVJM 4BNLA 3C7CB 4EUFA 1LRLA 1LSOA 5IN5A 4DUPA 4RV9A 2X0JA 1MLDA 3B70A 5TC4A 3T4XA 2D59A 2WDZA 5LDHA 1WZIA 3ZU5A 4Q3NA 5DDIP 4DRYA 4J0EA 5I7VA 1LLDA 3AFMA 2DBRA 1KYQA 2EP5A 2NSDA 3OMLA 4EZBA 3ENNA 1DIBA 2JAHA 1B16A 1E1MA 4K28A 2FWMX 4E5NA 3AUAA 4R1UA 1UDCA 5TS3A 4DIOA 1E3EA 2I99A 5BNFA 4XIJA 3D4NA 1B14A 2BI8A 3RJ9A 2J3JA 4MVJH 1LTHR 1QP8A 3ZCXA 4BVAA 1SO8A 5KJFA 1I10A 2VYNA 1R15A 2X0RA 1GUFA 3U4IA 5FWNA 1U3TA 1EUCA 2IYOA 2ZB4A 3E6AA 3HDYA 4AICA 5B4TA 5I7SA 3G79A 4GGPA 3RAJA 1U7TA 3EVNA 1BDMA 2ZKLA 2P9EA 3R3SA 4BOYA 4XEHA 3H5NA 4GGOA 4UVIA 3JCZA 7ADHA 2FPGA 2EF1A 4BGIA 4LISA 4RZIA 3ROMA 3CKYA 3AOEC 4MIYA 4A73A 1YXMA 2HRZA 3WGZA 4OKIA 5F1KA 2RH4A 4LW8A 1UJMA 1PSDA 3ZWOA 4D45A 4JIGA 3F1LA 4K6FA 1BXZA 3VDQA 3AOEA 4BQPA 2JL1A 4XYMA 1TXGA 3BZUA 5JDIA 1MC4A 3JQ8B 1N1GA 1A72A 2FY8A 2D3TA 3S2FA 1SC6A 3PTZA 3PZRA 3GLQA 4YT5A 3NDIA 3WTCA 1FK8A 2DUWA 3PRJA 3AU9A 4AJPA 1I3KA 5CDSA 3JQAD 3L4BA 1GV1A 1IZ0A 1I3LA 2R2GA 1PU2A 5AVOA 3DOJA 4YAEA 4PLYA 3WB9A 3OA0A 1XLTA 3H2ZA 3U4CA 3SBOA 1E1KA 1R0SA 1GV0A 4GX5A 4QO8A 4BNHA 4W9NC 3ZW9A 4L74A 2AW5A 3ASUA 5JY1A 4YJHB 3OM9A 3WG9A 2X0NA 1ZXLA 1VM6A 3WYEA 1N92A 2HUNA 3TOXA 2UUPA 1PJ3A 1R4MA 4XJTA 2FPPA 4BKOA 4Z9YA 1EQ2A 5IXSA 1DO8A 2C54A 2TMGA 4XR4A 4TVOA 3ZGYA 4YYZA 2A35A 3QJ5A 4BKPA 3IC5A 1ZCJA 1ZH8A 1K6JA 1XEAA 4M54A 2A94A 3CZMA 1Y8RB 5JCXA 3GNQA 3DQPA 4GQAA 2J6IA 2OP0A 3EAGA 4PVCA 4PLZA 4IPTA 1GUYA 5IDWA 2D4AA 2B5VA 3WGTA 3AM3A 3QWFA 3WBBA 1C0IA 5A3JA 4I08A 1N7HA 3GG2A 4BKUA 1U5CA 4DVJA 4Q3AA 2QRLA 2VRCD 4XZ3A 2YHIA 3NGXA 4Z0HO 2C5AA 3RASA 4DTIA 1EEHA 4TVBA 1QYWA 4FPXA 3PHLA 1YH3A 2EJWA 3DO5A 3P2OA 3RQSA 4HP8A 1AXGA 5IN4A 1SAYA 2J3KA 2GZ2A 3I6QA 3RU7A 1ZBQA 5TF4A 3HFGA 4KMSA 3ST7A 4AJJA 4BGEA 3N7UA 3RBZA 4CQMD 5CEEA 5DT9A 1ULSA 3JTMA 1GYQA 1L1FA 1HDZA 1A4UA 3WMXA 2QZ9A 3GN2A 1PJ4A 1Z73A 2UDPA 4ZQHA 4Z0TA 5ER9A 4UEJA 4FN4A 4XB2A 3I9NA 3KLMX 4FFRA 2QYSA 1E7WA 2I65A 2B69A 1FDSA 3RVDA 1A9ZA 2D8AA 3PPIA 3RROA 4CMIA 5A03A 4Q3CA 3TN7A 3M1AA 2O3JA 4F6CA 1H6CA 1TLTA 5BSGA 1TEHA 2YYYA 2YQ4A 2W90A 2YDXA 3DTTA 2YY7A 4BL5A 3E9NA 5DF1A 4DQVA 5KJCA 4O1MA 4IQ0A 5JBIA 4K1LA 2ZQZA 1F8GA 1HDXA 2OZPA 3MEQA 3DTYA 4KUEA 3O9ZA 2W8ZA 1B3BA 2CY0A 4GLOA 3OJFA 2BLLA 3JQBC 4E30A 1PJ2A 2P2SA 3Q2IA 2ZJ0A 3WSWA 2EXXA 2I76A 4J1NA 5CDYA 1MGOA 4BMSA 5BNTA 4DMLA 3T7CA 4DLBA 4GVLA 4E13A 4Q9NA 2PKRA 4DQUA 4S3MA 1JWBB 4CQLA 1IHYA 2PV7A 5T57A 1W73A 5GZ6A 4LCEA 1U3VA 1TT5B 3CIFA 1HZZA 1AN9A 5TT0A 1XQ6A 4DIFA 2VHXA 2WE8A 2ZIZA 3IKVA 4R69A 1N9GA 1PTJA 2BD0A 2AEJA 1X14A 1B3RA 2OFPA 4NBWA 5TJ9A 1P1HA 2ZB3A 3TPCA 1BW9B 3NAQA 1A9YA 1IE3A 3IKTA 1H94A 2RIRA 1A7AA 2B4QA 4QEDA 5DBIA 3F4LA 3WGQA 1O89A 5ILGA 4PLPA 4JQCA 3R0IA 3OA2A 4ZD6A 3UFXA 4BNYA 2C2XA 4QSMA 4JGBA 1ENZA 3T7EA 3MOIA 1P0FA 2AQKA 1ZZEA 4MDHA 2CDAA 1CDOA 2CZCA 4BKQA 2FR0A 4ZJUA 1HSZA 3L0DA 3QVSA 5G2OA 3SXPA 5JO0A 3G49A 1XQ1A 4YJFB 4IIVA 3ZNNA 4BQRA 5LC1A 5IZ4A 1RYEA 4A03A 2EJVA 4O0LA 5JC8A 2VHVA 1HKUA 4GX2A 4N5LA 4QFCA 5G4KA 3SC6A 2FHSA 4YXFA 2R00C 4RORA 3OQBA 4YAKA 1Z45A 2NV6A 3INRA 4CMEA 1GY8A 3BMNA 2FSVA 1UUFA 4P4GA 3DAGA 1P1JA 1O8CA 2CDCA 3JQ7A 3TQHA 1C14A 4R41A 2ZYDA 2EWMA 1W8DA 1C1XA 1M66A 2C20A 4XQGA 1HETA 3TZHA 2QZZA 4RPKA 3PIDA 4CV0A 2BFMA 1SNYA 1QYXA 3IMFA 4AJKA 2EKLA 3LK7A 3NJ4A 1U3UA 1RYDA 3OBBA 1JVBA 2O23A 4PFJA 3H7AA 1KEUA 1H93A 2Q1TA 1I2CA 4A27A 2ZTVA 3DMTC 3D4OA 4CM3A 4DPKA 3ROPA 4JX8A 4IM7A 1PZGA 3ZU2A 1MA0A 3VTFA 2E4AA 2B35A 1E3JA 3AI2A 4HXYA 1MFPA 2F1KA 2YV2A 3L6EA 2ZYAA 4XDZA 3GGPA 5JMWA 3OQ6A 2UV8A 2HJSA 1IL0A 4ND5A 2DAPA 5G0VA 3ONDA 4PVDA 5KKCA 2P4HX 3H3FA 3CPSA 3KYDA 3TNLA 4CR6A 2C07A 1C0PA 2JFFA 3Q3CA 3LF2A 5CEFA 1Q0HA 4IS3A 1KVRA 3HZZA 3RFTA 3GVCA 3GGGA 5TSDA 3WS7A 3LC7O 3K2EA 3WYCA 3I23A 4JXKA 4RGBA 4RF5A 5L4NA 1Q2XA 3O38A 4C7JA 2OOSA 3A28A 3VZRA 1KEVA 1KIFA 3PQFA 1PQPA 3GEMA 2D2IA 3GGOA 1DAPA 2VRBA 3DBRA 4WOKA 1E3WB 2NVUB 2YV3A 2X9GA 1U1IA 2AA3A 5KVSA 3Q11A 3EUWA 1PZFA 1DSSG 4RZHA 3WGGA 4HNHA 4CV2A 5AYVA 4UUMA 2FZWA 5GY7A 3BMCA 3RUCA 4ONEA 1A7KA 1WP4A 2W98A 3BTVA 3EZLA 1LEHA 4RLSA 1LLCA 1RM4A 5DCYA 4UUPA 3UN1A 5DZSA 1YE3A 2A4KA 4HNGA 1E77A 2Q45A 5F1PA 2GERA 5T5QA 4CUZA 4J2HA 3W1VA 1O0SA 4MVJP 3VAZA 1U3WA 3AWDA 1OZAA 1ORRA 4L4RA 4YR9A 1QR6A 2VWQA 1D1TA 1LDNA 2VRCA 4OXNA 3TL2A 1UXJA 4LVUA 3WLFA 2YV1A 1DRUA 3HHPA 3NDJA 3TZKA 3NT5A 4GWGA 5IFLA 3AUUA 4U7WA 5BSFA 2VYVD 2W2KA 4MVJE 3W4KA 2O3TA 3LZ6A 4BMNA 2IEDA 3UH1A 4NMHA 3E9QA 2X23A 4E12A 3OIGA 1T4DA 3H9GA 3VPHA 1TT7A 5HRUA 4RQUA 3GPDG 2WD7B 2DKNA 2PLAA 3LT4A 5B1YA 1SB8A 4MIEA 1X1TA 4IDEA 3AY6A 1UP4A 1XGKA 4J90A 4PRKA 5AXDA 4BO0A 4FC7A 5EERA 2EEZA 5IDYA 2VWPA 4WLUA 1SPXA 3NDRA 4GL4A 1EUDA 4DXHA 5U1PA 1AGNA 1ISHA 3D4PA 3LQFA 4A7PA 4B4OA 4XD2A 4E31A 3O26A 3A4VA 4GAEA 2PGLA 1GCOA 4N5NA 4J2OA 3GNTA 3IJRA 1MX3A 5KVCA 3NTOA 1I0ZA 2H5LA 2O4UX 2ZTMA 5JC1A 1EVZA 4D7AA 1RPNA 3PEFA 1G1AA 1VPDA 2RCYA 5DOVA 1K6XA 1ZMOA 4MP6A 1F06A 2HU2A 2X22A 5EL0A 3VVBA 4J0FA 4RVSA 3QA9A 4CMBA 3ZDFA 4NHEA 4XRRA 3D3WB 2E6UX 4FQ8A 4BHTA 3BMOB 7MDHA 4WGGA 3KBOA 3TWOA 3DL2A 1PJBA 3CH6A 2BRUA 1NAIA 1T2FA 3ZZNA 5L45A 3L4SO 3QIVA 2HK8A 1A4IA 4Y6RA 3NRCA 4NBTA 2IXAA 3F5SA 3ADPA 2NACA 2HMUA 4R5HA 4LRTB 3KYDB 1A71A 2OMEA 5CDGA 1GU7A 3AI3A 3JQ6A 3M2TA 4MVJA 2E82A 1IOLA 3KTDA 5JAIA 4Y67A 1VE9A 4OIMA 1LDBA 3OFSA 2JHFA 3HNPA 4YEDA 2HMWA 2P68A 1P9LA 4QQRA 3DEYX 4R54A 4D0SA 2X8LA 4BO3A 1EVIA 4E0BA 2JHGA 2A9FA 2PGJA 2CF5A 4WPGA 1B15A 4CL3A 4PN3A 5IDQA 1UAYA 2GF2A 3TJRA 3ZWNA 1KY4A 1ISGA 4D42A 1P31A 1PR9A 1ISMA 1Q7GA 1ZFNA 3D3EA 3LSYA 3M2PA 4YA6A 1J6UA 1ADBA 3G0OA 5L3ZA 1UDBA 1R4NB 1A27A 1T2EA 3OEWA 3QP9A 3BA1A 4YJHA 2TMDA 1YL6A 1ZMTA 1ISIA 3GPIA 5B4VA 1RM5A 4RVGA 2X9NA 2Q49A 3DDNA 2JD1A 4ZQEA 2PA3A 4TRNA 1Y8QA 4BNZA 4CMEC 1HLPA 3G3EA 2YFHA 3C3XA 1JLLA 1Z82A 1H2BA 2IDZA 3SEFA 1X7GA 4I9HA 5JO9A 1VKOA 3RKUA 4CLDA 2VCYA 3FWNA 2H63A 2JAPA 1P45A 3PWZA 3V2HA 3D3WA 4JBHA 4BNTA 2GN4A 2OGUA 1NBOA 1Q0LA 2HJRA 2ZTLA 3SVTA 2IYPA 1EK6A 3ZNPA 4QX6A 4J1SA 2NU8A 5MDHA 2Y1EA 3VPGA 3KO8A 1GQ2A 1Y1PA 4TQGA 5A5EA 4FCCA 1LXCA 3VVCA 3WQQA 1HE4A 4LMPA 1GZ6A 4E5PA 3OETA 2Y93A 4NU6A 2AXQA 4BMVA 1U8FO 2CD9A 3ABIA 3EYWA 5AQ1A 4L8VA 4BO9A 1XELA 2Q3EA 3Q6IA 3PJEA 2BHLA 1F12A 3ZHZA 4TWRA 4M86A 1JA9A 1R0KA 1I2BA 3G1TA 2FP4A 3X2EA 2X58A 3ZV3A 1HDOA 2B4TO 3W8EA 1OAAA 1DFIA 1I32A 3F5QA 4PG5A 1H6AA 1KEPA 3PFFA 2VUSA 4I5GA 2DQ4A 3JYQA 1XR3A 1GQYA 3KM0A 1ZW1A 4GMGA 1RM0A 1CJCA 4UVEA 2EG9A 4A0SA 2DFVA 3K96A 5ILOA 1BXKA 2VT2A 5HBRA 4KTVE 1UH5A 4QTZA 1V9LA 2W2LA 1CIVA 2X1HA 4J49A 2CVZA 3I3OA 4BNWA 5JXWA 3L9WA 4U0JA 4CPDA 3CZRA 4GKVA 3C85A 4D79A 4DBVO 4TKLA 4F6LA 4GSKA 3SLGA 3B6ZA 4M49A 1LQUA 2GLXA 4J43A 1VL0A 1FXSA 2BGLA 4CQLB 1EFKA 1VSUA 3GFGA 5KJEA 3UW3A 4YJDA 1C1DA 1E1LA 4EJMA 3JQFA 3NKLA 5DULA 4QO7A 1M75A 5ENVA 1BXGA 3TSCA 3U3XA 1NPDA 4D41A 4LK3A 5KJ1A 4JP3A 1NVGA 4YAJA 2NWQA 3RC9A 5IJZA 1Z6ZA 5EN4A 2OBNA 1LDMA 3N58A 4K26A 4FOSA 1D7OA 3FNFA 1E3SA 5KCZA 1ZK3A 3U4HA 1C3VA 4BO6A 3LVFO 3U5TA 1V3UA 3GZNA 4CLXA 1ISFA 3MOGA 4PG7A 2GZ3A 3MJEA 3GVXA 2PK3A 4Y9DA 2B0JA 3BMQB 2DTXA 4J4TA 4CL8A 1H5QA 1LLUA 2X6TA 2VHZA 2O50A 3EGOA 4LCJA 2ZTUA 3ANLA 4U8GA 4HFJA 2GYYA 2OHXA 4P8RA 1QXSA 2QIOA 3BHIA 4PLWA 3ZN2A 1H6BA 1HEUA 4BNIA 1V8BA 2X9VA 1AUPA 4G2NA 4ITUA 1OBFO 4FFNA 2ZCVA 3Q0EA 2RBEA 3DZJA 1H6DA 3IUSA 1GCUA 3VPXA 3RCBA 1YKFA 5HS6A 3AM4A 1SB9A 2I6TA 3MCVA 1KVTA 1LDEA 3NTRA 3BMNB 4EI2A 5A9SA 1U4OA 4H16A 4RVUA 3EK2A 4IXWA 1Q7CA 1PGPA 1O95A 3GF4A 5L9AA 1PJQA 3WGYA 3S2GA 1KEWA 1T26A 3LT0A 1Z7BA 3H2SA 3DB2A 3ORFA 4DREA 4MINA 5TNXA 3WMWA 1I3NA 4BNFA 3KSUA 3DR3A 3CMMA 3E5RA 4ALJA 2PH3A 4CV3A 4XGNA 3LT1A 5GMOA 2Q2WA 2X5JO 4G81A 3AI1A 1E7RA 1PJLA 3QVWA 1ADFA 3BHJA 1Y9AA 4D0RA 3JQGB 3WBFA 2PR2A 2Q1WA 1BG6A 5BSEA 3JQ8A 5TGDA 3KV3O 2RAFA 3PVZA 4HFNA 3WGHA 3V5NA 2HQ1A 5DCWA 2B83A 1LX6A 1DFHA 1K2WA 3K73O 3QVTA 1E92A 3OEYA 4P22A 4YAIA 4W7HA 2UVDA 1SMKA 3W6ZA 1NXQA 3SJ7A 1HRDA 1FF9A 3JQAA 4MP8A 4PLVA 5L4LA 1FJHA 5JYDA 2BFOA 4TZKA 4FC6A 4OMUA 1J49A 3ON5A 5FYDA 3WJ7A 4ID9A 4ZHSA 3PJGA 1C1DB 5BR7A 3AY3A 2B36A 1GZ4A 2G82A 1HTBA 1PL6A 5JE8A 5JSFA 4GI2A 1BXGB 1NASA 5IDXA 3VZSA 1P1IA 3TFOA 1Z75A 3RUIA 1EVYA 2UUOA 2GN8A 4TZTA 4BIIA 4J6FA 3I1JA 1SEPA 3WQRA 2AQHA 3OIDA 6ADHA 3BTOA 3K2BA 5MGBA 2PZMA 4F45A 5A3VA 1QV7A 4CMGA 4XRGA 4Z9XA 5L53A 5KNLA 1VRWA 3GA0A 4DMMA 5COBA 4J16A 1G0OA 4WEQA 1NQAO 2X7HA 1VL8A 3KHUA 1QYDA 3PYXA 4AJ4A 1WNTA 1F0YA 4KTTE 3DONA 1CRWG 2DBZA 4N54A 5ITWA 1LQTA 2VZ0A 4KDFA 4BGUA 1JVSA 4D44A 2PNFA 3H3JA 4BV9A 3GZNB 5KIAA 5L51A 4TMFA 1WMAA 2JKVA 4ZA2A 4C4OA 2WM3A 3MZ0A 4KWHA 4CR8A 1ADGA 3KXDA 5FI3A 3PXXA 1DEHA 3RC2A 5I8WA 5JDIC 1ZXBA 3L9XA 3QLJA 2LDBA 2BKAA 2JFHA 3ETDA 5H81A 4MVJI 2Z1MA 1UXKA 3D0OA 3PYLA 1KVQA 1T2CA 4NFSA 1X13A 4BNXA 3HDHA 3PFWO 1PQWA 1SBYA 4QUKA 4EDFA 3K8ZA 3GOHA 3JYPA 4Q39A 4XGIA 3WLEA 3WICA 1Y7TA 2CVOA 2Y67A 3NGLA 1D1SA 4MKXA 2CSUA 1HYEA 1S7CA 2G76A 3ZHYA 3EMKA 4XYEA 3O8QA 4FJ1A 5ICSA 3WGOA 9LDTA 4KUHA 1Q0QA 3HG7A 3KYCB 4R3WA 5T67A 4DC0A 4BNUA 2YHUA 2Z1NA 3H9EO 4E33A 3PGXA 5T8KA 1D4FA 4ALKA 4JCOA 4CM8B 5G0UA 5A06A 5JNLA 1JKJA 4WOJA 1LRJA 4E5KA 1HE2A 1R16A 3QE3A 3GN1A 1Q1NA 1MG5A 3TRIA 3QRWA 4IZHA 1E7MA 4WEOA 3DZFA 4WLEA 5AXCA 3GC6A 3FNGA 2G17A 4CM9A 2AEFA 2O7QA 3LF1A 2BFAA 2QRKA 1GADO 3DMTA 4AJIA 5DNAA 4EEZA 2H1SA 3F46A 3GUYA 4CMIB 4UUOA 3L07A 4UREA 4NJMA 5CEJA 5IF3A 4I8XA 3UKOA 3SJUA 2AHRA 1T1RA 4NFHA 4OQYA 3TL3A 3DZKA 3PHGA 3QVOA 1I36A 3RUAA 3GAFA 1YQDA 3P7MA 5CAEA 3HWRA 4ALMA 1L7EA 1GDHA 4H15A 2GO1A 3MJTA 3PGJA 4ZVVA 1O6ZA 4J4HA 2IRWA 1ZVMA 3S2EA 2DU8A 1A5ZA 2E49A 4BS9A 3DXFA 4B7CA 2VWGA 3ZU3A 2NVWA 5TLSA 1PL8A 1ENOA 4E6PA 3IAHA 3JYNA 4AJ2A 1NVTA 3H9JA 1ONPA 4U5QA 4UVHA 4YVFA 3DHNA 2HMSA 2OORA 1EE9A 4ND1A 4BNGA 3LT2A 2Y66A 4ND3A 1DDOA 1JAYA 2UYYA 4B4UA 3FSRA 1BSVA 3UICA 3LDHA 1HXHA 2EV9A 3STHA 5C37A 2BGKA 1N9GB 1DJNA 2VZ8A 2GUGA 1UP6A 4S1VA 2NU9A 1MG0A 3BMOA 5EQFA 3W4IA 4CQMB 3I9LA 4RDHA 1TT5A 3UXYA 8ADHA 1MP0A 3ONEA 1N7GA 2NTJA 3EC7A 2X0IA 3ZWWA 4TSKA 5L7WA 4R1SA 3LYLA 4L75A 2DTEA 3V1YA 2JCXA 1T1SA 1GUZA 3JQFC 3WJAA 1JW9B 1XSEA 2P9GA 3NEPX 3ZHXA 2Y1CA 1ONNA 3GEGA 2QW8A 3KEQA 4PG4A 3DHEA 1FDWA 3JV7A 3ZWBA 1DIGA 1NWCA 1I3MA 4OXKA 3FPLA 3RIHA 3OHSX 1QLHA 4IDGA 1I33A 4P4LA 1OC4A 3K31A 4L4SA 1X7HA 3DHYA 3OJOA 8LDHA 3VZPA 3ZWVA 2XAAA 1PL7A 1T4BA 2AE1A 3CINA 2YW9A 2O3RA 5CPBA 1WWKA 3GK3A 1M2WA 4UEKA 1ARZA 5ENDA 5CDTA 2E48A 1YO6A 4BNMA 4J91A 2EIHA 1I5RA 4L73A 4NH4A 3JQ7B 3VDRA 3HB5X 1GPDG 2NADA 5F5LA 2G5CA 5KVQA 5AXAA 4FFLA 3V2GA 3I9OA 5DBGA 3A14A 3GUCA 4PRLA 4BGVA 5FF9A 2V7PA 3SX2A 1ZKMA 1RKXA 1CYDA 5A9TA 2HK9A 5ADHA 1V35A 1MFZA 1QSGA 2ET6A 4A26A 5A1TA 4I5EA 3D5QA 3WR5A 4EGFA 3S8MA 3RKRA 4BO8A 3H6KA 3UVEA 4X54A 3W8FA 1CWUA 1R37A 1KY5A 4ZICA 4PZDA 1GR0A 2EP7A 4LVCA 4CLOA 3WIDA 1M76A 1R6DA 1DBVO 1DRVA 3GVPA 4GX1A 1WZEA 1JWAB 1K89A 3L6OO 2VUTA 1NWHA 4D3DA 1ZK0A 4JROA 4ZQFA 2R6JA 3ZWYA 3V1TC 2GRAA 3UCFA 1AE1A 3PDJA 1PIWA 4Y6SA 1WAMA 3UOGA 2OUIA 1U9JA 3NTQA 3O03A 2RHCA 3G17A 4IJWA 4RVHA 4NI5A 3JD2A 1JAXA 2YZ7A 4TRMA 3S55A 4ALIA 1VL6A 2GN6A 3KEOA 4CLRA 1MUUA 3VHRA 1YWGO 2PD6A 4N18A 3GHHA 1VJ0A 3ZH2A 1Z74A 2FMUA 1UDAA 3C7DB 4EEXA 3IP3A 3RU9A 2AG5A 3UCXA 1B0AA 2JJYA 3RUDA 5EMHA 1IYZA 4OQZA 1PX0A 3RBVA 2Y05A 1MB4A 4WECA 3DFZA 4WUVA 2JCYA 3MWDB 2QHXA 3ZWPA 3ANNA 4UULA 3VTZA 3ZI0A 1LSSA 3GRKA 1XYGA 1J4AA 4ZQBA 3ENKA 4O63O 4NBVA 3NX4A 5JMPA 4LRSB 3PJFA 4IY1A 4XQ9A 2Y1GA 3AM5A 4IS2A 1O5IA 3ANMA 3Q9UA 4RCVA 1YVEI 2DPGA 4OGWA 4IMRA 5ER6A 1CQIA 1HLDA 1IB6A 1V3VA 5GZ1A 1R4MB 3I9KA 3E18A 3IQDB 5T6BA 1NFFA 5G0WA 1T2AA 3RD5A 1NHWA 1ZK1A 4IZIA 1YB5A 4R3NA 3PWKA 3M1LA 4W9NA 5JFOA 5HM8A 3E03A 3GMSA 4I5DA 4CUJA 4II3A 4IUYA 3NUGA 4J7CA 4D43A 1E6UA 3FI9A 3PI7A 5G0SA 4J9UE 2B4RO 4RLHA 4NIMA 4Y6PA 4Z3DA 4KP7A 1AXEA 1NQOA 4P4NA 1Y9EA 3HE3A 2WWRA 2Q46A 3B20A 3LC2O 3IUPA 4RF3A 1IZ9A 5H82A 4DGSA 2QG4A 4XIYA 3RUFA 3GEDA 5BSHA 1LBEA 5C7OO 4FOOA 1DHRA 4JN6B 3ITDA 5L7YA 2D5CA 4YTEA 3QVXA 5KOIA 4WKGA 2YUTA 4RVDA 1DLJA 3OJLA 1U7HA 2CFCA 2I3GA 4FGSA 3W8DA 3ZV5A 2HLPA 2Q50A 2PH5A 4YPOA 4ESOA 3TZQA 1ZUD1 1GYPA 1HE5A 1ZNQO 4J1TA 3TOZA 3ZNQA 5IG2A 1ULUA 2FOIA 2O2SA 4XWYA 4D46A 4DYVA 2FR1A 1U8XX 3INTA 4TKMA 5AXBA 5L95A 5IXYA 2CDBA 3IL2A 3KETA 1YBMA 1F14A 3QSGA 4WLVA 5JYEA 1U5AA 2YQ5A 5JCJA 4DPLA 5A9RA 4OAQA 2Y0CA 3JD0A 3GH3A 1YONA 5ITVA 3S2IA 5COAA 3WX0A 2AG8A 1D8AA 4CR7A 4YQYA 2OBYA 2GZ1A 1HYHA 2ZQYA 3DZBA 4OSOA 3OECA 4XGKA 1IULA 1DC6A 5CHEA 4GMFA 4DA9A 4LN1A 2Q4EA 1MV8A 2BELA 3UCEA 4PZEA 2VUUA 4R01A 3VH4A 1GEGA 4E5MA 3K5PA 3I5MA 1U2GA 3BYZA 4IGEA 2HO5A 1N1EA 1PEDA 4ZGWA 1ZJYA 2Z5LA 5DP2A 2H6EA 3H4VA 1ZEMA 2I3AA 1LC0A 3INGA 5BNIA 5JAMA 4KQWA 4WK6A 4DWVA 1IY8A 3JD3A 3ICCA 4R4JA 3AU8A 2PD4A 1P1RA 4A2CA 3F1KA 1PJSA 3F9IA 4YQZA 1L7DA 5LDGA 2OL4A 4FJ0A 1E3IA 4CMAA 4IDFA 1LDGA 5EPOA 3WSVA 2XXJA 4MJLA 4TROA 3VZQA 3C7AA 4HWKA 4CLHA 1E6WA 1EMDA 3PIIA 4E3ZA 4MOWA 1UR5A 3CUKA 1YB1A 1XG5A 4CMCA 2O7SA 4EJ0A 4M87A 2I67A 3EW7A 4NJOA 5JDCA 3ZW8A 4EJ6A 1YGYA 4W82A 1F8FA 1P74A 2Q1UA 3F6YA 1X0XA 4L9RA 4WJZA 1NX6A 4RF2A 3W6UA 1M6HA 5KJ6A 4YBZA 3H8VA 4PLTA 2RHRA 3E48A 1K3TA 2X5KO 4GVXA 5DCUA 3WFJA 3PHJA 4Y8VA 3SLKA 2EW2A 3CTMA 1E3LA 5FI5A 5CPFA 1ONOA 3OIFA 4AJHA 1P1FA 1GZ3A 1I8TA 4RDIA 4NK5A 2NUAA 3QWBA 4HBGA 5IZCC 4Z9FA 3RUEA 2DFDA 3PYMA 2O2YA 1LJ8A 1PR3A 1UXIA 2JCVA 5EJ2A 4WE3A 3EY4A 4DL9A 3GQVA 4HKTA 1ZK4A 3U0BA 3FNHA 3JQEA 1XWFA 4RF4A 4HADA 2BH9A 2GD1O 4IINA 4HV4A 1WDLA 1O9BA 3UGKA 4B3IA 2NVBA 1B8VA 1H9BA 3FR8A 4B3HA 1WXDA 4MO2A 4BO4A 4IDBA 4BNNA 3CXRA 3MJSA 4WASA 3K30A 3QV1A 2CF6A 2HK7A 3EVTA 2HMVA 1GL3A 5I8ZA 2Y0EA 1GFSA 4Q3DA 3QWHA 4Z3KA 1W6UA 2EW8A 2Q4BA 3RFVA 2DC1A 4CM4B 1YQGA 1DIHA 4I1IA 3L77A 4OO3A 3GVIA 4XJSA 3WQSB 1MXHA 2XF8A 2AQ8A 1LI4A 3JD1A 2POQX 3BAZA 2WMDA 4UEOA 2IZ0A 2VNSA 2DVMA 3PLRA 1PJTA 3RUHA 4CM6A 3AJRA 1GYRA 4AFNA 3CMCO 3E8XA 3I6IA 3WTBA 3GVHA 4R9RA 3ITKA 2W2LD 1FDVA 1ENPA 4E2ZA 1X0VA 2WYVA 3ETEA 3WWZA 2AEMA 1ZSYA 5IAAA 5C7LO 4JLWA 4XDYA 3KSZO 4KZPA 4NNJA 4B4WA 4M1QA 3IDSA 1MXFA 1FDUA 2C0CA 1R66A 4JJGA 3IJPA 4XYGA 2VTDA 3NT4A 5G4LA 1SOWA 3PDUA 2NQ8A 3EZYA 1C1XB 2WEKA 2ZATA 3F3SA 3R3JA 2D5AA 1U2DA 2HSDA 3W4JA 2Y1FA 4RPLA 1LSJA 3FCOA 2I9PA 4UVGA 5EIOA 4ZN6A 1NAHA 4JBGA 3WXBA 4WNIA 2I66A 1E7YA 3C1OA 3RWBA 2PZLA 4I9UA 3VC7A 3A9WA 1I30A 1YOVA 5TIIA 1DC4A 4I9NA 3ZNOA 5G0TA 3WFIA 1B7GO 4WCFA 3VPSA 3ULKA 1KVUA 3FF4A 1WLYA 1WPQA 3E5MA 1RJWA 5BQFA 1QORA 2C59A 3KOUA 1SEVA 4OJNA 4HFMA 2BMAA 4E2YA 4GLLA 4OXYA 5DN9A 1M67A 3A1NA 4B79A 1HDGO 1PGJA 3PHIA 1XIVA 1PS0A 2IODA 5EINA 1ML3A 4MKZA 4YRBA 3EHEA 4PIVA 3FRJA 3ROKA 1JU9A 1MC5A 1DJQA 2ZK7A 3UHAA 2IXBA 3HDJA 2QX7A 5L4SA 1ZSVA 3QY9A 2H9IA 1Z7EA 4XCVA 4BO5A 4YT2A 2EGGA 3FWZA 1C0LA 3GHYA 1QV6A 4RJTA 2X4GA 4FFMA 1DB3A 1N8KA 2FSSA 3JQGA 3ZHBA 1T25A 3CE6A 4HFRA 4OM8A 4XX0A 3P19A 4L76A 1TVEA 4O59O 4IDDA 4YJGB 1U28A 1YRLA 3B1JA 4FDAA 5T8KC 3VH2A 2D0IA 2EHDA 5I7EA 1DIAA 3KLPX 5K0ZA 4IQGA 2JFGA 4CODB 1TB4A 3P2YA 5H83A 1ID1A 2AQIA 4NPCA 4BV8A 2GDZA 3HSKA 5BT9A 3H5RA 1OI7A 3FR7A 1N2SA 4Z6KA 1B8PA 3BXXA 4JNKA 2P91A 4JJFA 3ADOA 3HADA 1P77A 1XCBA 4JP2A 2PD3A 1HSOA 3RBXA 2B5WA 1W4ZA 1Y5RA 1YOVB 4ZRNA 5EQDA 5F5NA 3UF0A 1UZMA 3GR6A 1AHHA 1NPYA 3KYBA 3WOHA 2Q99A 3FHLA 2FZEA 3D5TA 4H3VA 4YB8A 3KSDO 4XYLA 4LGVA 1HL3A 1H9AA 2WYWA 2F00A 1V0JA 1P44A 4RO0A 2YDYA 4R5MA 2C7GA 2BFPA 1BVRA 2DT5A 1EUZA 3RC7A 3PQDA 4ALNA 3JQDA 4KUGA 1QRRA 2V65A 3JQAB 2X86A 3JQBA 3C24A 4OHUA 4OKNA 1DHTA 2P5YA 1J5PA 1ISJA 1FMCA 3DAFA 2NTNA 2NU7A 1LDYA 2PWZA 1E5LA 3HFSA 3SC4A 3ZWAA 2PY6A 2ZB7A 1GD1O 2ZCUA 2ZYGA 5TJHA 5JW6A 2IEBA 6LDHA 2R00A 5HTOA 1H2HA 3K92A 3WIEA 1E7QA 1H0KA 4L4XA 3QWIA 1UZLA 4UAGA 1LSUA 4CMHA 1XU9A 3RSHA 1IHXA 4KDEA 1ADCA 1LU9A 3FBTA 3AFNA 3GDGA 3OQ1A 1XKQA 1X1EA 4MPDA 4FB5A 2LDXA 2PFGA 1PZEA 4BNJA 2OXIA 3WNVA 2VTEA 4PGFA 2D1YA 4LSMA 3CSDA 3ZU4A 3JYOA 4R51A 3M6IA 4YDRA 1LA2A 4P38A 3WWYA 3HDQA 1DC3A 4J7UA 4WLOA 5JLAA 1XDWA 3DOCA 3DWFA 3GNSA 4PCVA 1HDRA 2QQ5A 2GASA 5I9LA 1UZNA 3LC1O 2VHYA 4PG6A 2I5PO 3FD8A 1KC1A 1UAGA 2PKQO 2AE2A 1WDMA 4A10A 5THKA 1I2ZA 3NYWA 1P0CA 2P5UA 4R1TA 1NR1A 2Q2VA 3R6DA 2C82A 1VKNA 1YDEA 5U4QA 5CDUA 3KUXA 2O3SA 2Q2QA 3IOYA 3ROQA 1DIRA 2YFQA 1Q7BA 3S1LA 2VN8A 3O4RA 5L7TA 4M8SA 5JS6A 5K6AC 3JSAA 2J5KA 4OOFA 4B3JA 1VI2A 2DUUA 1XA0A 4FJ2A 2E37A 4XB1A 2HRBA 4W7IA 3MWEB 4FFOA 3FBGA 2NU6A 2Q1SA 3L6DA 3JYLA 2NTVA 4W99A 2J5RA 4NDNE 4BKRA 3O8QB 4CM9D 4WLNA 4O6VA 5KVVA 2IZZA 3DZIA 1HDYA 5CG1A 4E4YA 3GMDA 2WE7A 5TRTA 3KZVA 1YL7A 4MP3A 4WNCA 1EDZA 1DOHA 3ETGA 1WMBA 4FD3A 4WCFC 1R4NA 2CVQA 2SCUA 3AK4A 1NPTO 1KBZA 4AJEA 2C29D 1SOVA 5DP1A 4GPD1 4IQ8A 2HKIA 2IZ1A 1P3DA 4MIOA 1YQXA 4XR9A 1PQUA 2FPIA 3HQ4O 4II2A 4AG3A 3TZ6A 4CV1A 2DPHA 4G65A 2CUKA 4R16A 1CERA 4FS3A
chains in the Genus database with same CATH superfamily
4CM8A 4EBFA 1RE0A 4D82A 4NS4A 4ZHQA 1R6AA 4BB5A 3S1AA 1OXTA 4U39A 4MUYA 4KKXB 1YC5A 4S1OA 3E3LA 1I4WA 3COJA 2WZQA 1O2DA 2I1WA 3BMCB 3NXKA 1R9GA 2I9KA 5A7HA 1ZOLA 4F84A 2XPCA 4XM2A 1QFYA 2CXUA 3AP1A 4YJGA 5AKJA 4JFRA 5C52B 4EL5A 1OAOC 2NQTA 4ZQCB 3OTWA 3Q1KA 5K6AA 3O3MB 3SHWA 4GNKA 5KWEA 2GN9A 3U9LA 1PG2A 3GEIA 5J59A 1QK3A 1D2GA 2SBTA 2C98A 2QVGA 1R3UA 3QXHA 3DZ8A 1XJCA 5AK0A 1YS9A 2ZAIA 4O8CA 1YS4A 4TTIA 3KJGA 1MOZA 2IP4A 1G9XA 2OPBA 3LKVA 1COZA 4J4BA 4YGYA 5H3LA 3VMMA 1I5OA 1W8IA 4BN0A 4Z51A 2ARKA 3L0BA 4AG5A 3TTVA 3ZKWA 3V8VA 3IPRA 1BRMA 3AP3A 2I7VA 5ALPA 1SVMA 3FVWA 2VSNA 1FSPA 1YB4A 4CM5A 1UXHA 4LGCA 3DFUA 2C5EA 2P4QA 5J5VA 2ZSUA 5HK8A 3ADCA 3AEUA 3OUZA 3K71B 1U3CA 1OZGA 3KLBA 1ZGHA 1KF0A 3AHIA 4PC2A 3LE8A 1BS2A 1VKHA 4LQ4A 4X1IB 2QN2A 1UKAA 4GLFA 1NMYA 5EESA 3E1KA 4MGHA 4BO1A 1XT6A 2EF0A 3E9EA 4W1SA 2RJ3A 4WADA 1P33A 3H1AA 4Q93A 2BCEA 5F73A 5ALDA 2V6FA 3CF4A 3VO8A 2EERA 3BSWA 3PNMA 1XZQA 3I53A 3QPWA 3U4DA 3A4NA 5C1BA 3FNIA 3RG8A 2C58A 2ZYWX 1T1EA 2QMOA 2PGDA 4WKOA 4DV3B 1P1CA 5BWBA 3GU3A 2PZJA 1GT6A 4P32A 5EUQB 3SKYA 2J3IA 1USUA 2F67A 1H5NA 3MLBA 4BUCA 1GSHA 1UM9B 1IRIA 3TDKA 5AT1A 2FPUA 3ONFA 1EXNA 2HBQA 2IBTA 4EFMA 1NJ6A 5CT8A 3I9FA 3LUPA 5CA0F 1R8QA 1NLFA 1ZICA 1GGEA 2Q5CA 3I5UA 4DSUA 4GLBA 2GR9A 2DPYA 1P5ZB 3LBFA 3NG1A 4GWLA 4DSZA 5I3ZA 5DM70 4HCJA 3TZCA 4WLFA 4GWKA 3OT5A 3GZ4A 4IDNA 1KMHB 2RGYA 2PANA 3ASVA 3H5AA 4NYJR 3EVFA 3RK1A 3ZXXA 4B8ZA 5IASA 4F3RA 4EY3A 5BW6B 2UZ3A 1F7VA 3B52X 3TLEA 3TPFA 2XA9A 4JEIA 4PYRA 1I1OA 1T2VA 1VXOA 3UNXA 3VR4A 4NG5A 5HKAA 5LN1A 4S0XA 4O8ZA 3UB3A 1EM8A 2NM0A 2KHZA 3IRVA 2GBGA 2P2NA 1GGKA 3O1LA 4NULA 3U56A 1Z6QA 3GLTA 2OPHA 2OAEA 3AEKA 4P54A 4KSBA 1XD9A 1VPVA 4XCXA 2XBUA 1PS8A 1GU1A 4G01B 4C4AA 3WA6A 5BN5A 3QTBA 3DOHA 4GICA 1HT3A 4Y1RB 2Y1DA 4U0KA 2NXEA 4UD6A 3VZBA 3K0AB 2LWIA 4P35A 1LRKA 2HFJA 4QOJA 2QI9C 2GNPA 4XQEA 4N7RA 1FMTA 4KO3S 2P41A 2BF7A 1T1JA 2H00A 2ZVJA 3R6TA 3TLYA 2CLSA 1GNQA 4G1EB 4UZEA 1WDKA 1VJ5A 4TL7A 4QOHA 5E8RA 4QG7A 5HS4A 4AKGA 4NLLA 2WAMA 4CM1A 2R6ZA 3N0VA 4RWZA 3VKUA 5ADVA 2XF2A 3VBCA 2C8JA 2VK2A 2HSEA 5T7BA 3G89A 1WCYA 2GK4A 1SN7A 1O96A 4N5MA 3VU0A 4EW3A 5IABA 3UM9A 2ZIVB 5FO0A 5C8DA 4IIEA 1HK7A 4NTZA 3MHTA 3NRJA 2O4CA 4RV5A 3U81A 1Z5GA 2HHLA 5EJAA 1K6EA 3DOEA 3SX0A 1T5LA 3I28A 4INPA 4CM7A 2CJWB 1YBAA 2ZUTA 4OBEA 4WERA 3MWDA 2HIAA 2AMFA 2O07A 2VPPA 3JU3A 1N3IA 2VS1A 1RADA 2J7KA 4OXXA 4BFXA 3UEOA 2ZE7A 5L6LB 3OCUA 2A1TR 1T9GS 1E2DA 1TX4B 4NESA 1TUEA 1JHUA 2V98A 2YHIB 5REQA 1AMUA 3C16C 1KH3A 2ZULA 5FNVB 4TS3A 2HCTA 3MJFA 5A9SB 3RVNA 4B6QA 3KFXA 2RK4A 3OJ0A 4LZAA 3QVLA 2ZRNA 1QYVA 1H2XA 1W0KA 3BWXA 4XKJA 1I6LA 1VL5A 4MVCA 1KZGB 4ZDWA 5C4IA 1M0SA 2JGNA 2WJAA 3NQ41 2EYUA 4Q24A 3F47A 2IHZA 2YN4A 3TNJA 3HB4X 3R6WA 1Y4DE 4NYMQ 3AUFA 1WXQA 1DFGA 3DWIA 4LDPA 1USWA 1OWPA 4BQNA 3FPCA 2CHGA 3IURA 4IJUA 3PEYA 5D7NA 1YDHA 1MABA 1K5HA 3I9JA 3EVBA 3VV3A 1HZJA 1VCNA 2A5FA 3DBHA 3GDFA 4MAMA 1UJ2A 1U5BA 2FRDA 3RQIA 1Y9DA 3AW9A 1U8UA 3Q0TA 4CDNA 3C5WP 4UBIA 1W5EA 3GG9A 1CJVC 1GGMA 1TAQA 3IKJA 3HRIA 5AOBA 5F9HA 1TO2E 1G6KA 2BZ0A 1EHCA 3RYCA 5D8DA 4RANA 2C4HA 2OCAA 4ZJUA 1LPNA 5ERXA 5CJPA 3D6UA 2O3UA 4B7XA 1S4MA 2XDQA 4XA8A 3QBVA 1EBBA 5JAZA 2RAUA 2HHHB 2AKYA 3PGA1 4Z86A 3OQIB 5KQLA 2Y99A 1YVUA 2A0KA 1B8UA 2WSBA 1XVIA 5DASA 3PHBE 4NK4A 4KQXA 4V0ME 1PWZA 1HWYA 1NBHA 3LY9A 4WK0B 3WLLA 2CNOA 1ZYUA 1SCNE 4DMKA 3VNSA 3MG9A 4TL6A 4F3TA 4TYYA 3OZTA 4EKDA 1ULAA 2CLLB 3IEVA 4FEAA 1CUGA 2C7PA 5HF5A 1I1NA 1GG9A 1W29A 3QPDA 4W6ZA 5H80A 2B30A 2PX6A 1I01A 1NF9A 1JLSA 1PFKA 4F2HA 3UO8B 5F78A 4KYTA 2GGSA 3B2EA 4QRIA 1Q17A 4NEGA 1CFJA 4LAFA 2Z95A 2VXYA 1KK0A 5H4GA 2KSQA 4J1QA 1T91A 3LSTA 1NTOA 4HAUA 3ZIAA 2AI2A 3PR2B 3PU6A 4BFLA 4Q3BA 5BRJA 3E1SA 2Q1XA 1KOGA 3W5SA 1H8HA 3JR3A 3L02A 4L8WB 4TM8A 1AHIA 4AF8A 5DHFA 4HUJA 3D8UA 3OICA 2KM1A 3DVSX 4MW2A 4BGDA 3LKBA 4GOLD 1NMEA 1P7WA 5HRCA 4JUDX 2QRVB 4D5GA 2D4HA 4RHUA 5B7NA 1A69A 2X2OA 4UTZA 2OBLA 2GK6A 4L9SA 5JXHA 2JD0A 1E98A 2PLFA 1Z18A 5DEOA 4M9CA 4JMPA 2NU8B 4QEZA 3G9XA 3SE0A 1ECPA 2ECOA 4GS5A 1IUKA 2ZWAA 2AL7A 2XZTA 3CUYA 1E1NA 2PLWA 2Y0DA 3EWSA 4DR7B 2NIPA 4UCWA 4XYBA 1YBHA 5AVXA 3QX3A 2GILA 3HA5A 1G41A 3OZEA 4N76A 3GRUA 1DCTA 1FTSA 2SNIE 3I6ZA 3REFA 3D3KA 3T1NA 3ZGVA 1QCDA 3RI3A 4F2WA 2AFRA 4RMJA 2P1DA 3QMMA 1U0GA 1YUMA 4CCYB 4E21A 4J94A 3AMVA 1LZLA 3T5TA 1G63A 3H9CA 5GZ3A 4IXTA 5F3RA 3AUSA 3GFBA 3IIEA 4DCNA 4G0UA 3RABA 3TLBA 1ODTC 1XXHB 4OMCA 4CIVA 1ULBA 2YYSA 2J6CA 1AQIA 2ZJBA 5T3YA 3F6PA 3B85A 4B34A 3UJPA 1X7DA 1TA9A 3HDTA 4Q9AA 4DDVA 1Z4IA 4EKIA 5FNZA 5K0EA 1SUSA 1Y3BE 1VBNA 2WBLC 3AKCA 3HN7A 1C9KA 4F7WA 5IEBA 2BI7A 4TQ9A 3DLTA 1ZHHA 4HVLA 3HUDA 5D5PA 3GRPA 1YK0A 2QTFA 1EIWA 3FY4A 4ALLA 4DANA 4QD3A 4AY4A 3A37A 1WLSA 4TL8A 3LQ2A 3BHMA 1MDFA 4M89A 2QGNA 1R0LA 1LLFA 4A0QA 4EUEA 3V32A 1CF9A 4GBJA 3L6CA 3FLEA 1MEOA 1R8JA 2OXTA 3D8SA 1P2BA 2BEJA 4O08A 1Z6GA 3I39X 1Y33E 1E58A 3K0HA 3KOMA 1QLJA 3A9VA 4INAA 2VJYA 1KNXA 5CW2A 5HIMA 5C3MA 3S2ZA 4RSRA 4OBXA 1RHMA 1H2ZA 2I29A 1YCHA 1W48A 3T3MB 1FDTA 3DTVA 5AJTA 1BHJA 1EWRA 2CLMB 3QE0A 5BURA 3NEYA 1HX7A 1E1RA 2JLZA 4R6XA 4EHNA 3WK8A 1NUPA 4B47A 4WXRA 4HSGA 2W2TA 3GJRA 3TQOA 1XP5A 3K72B 1GAEO 1YJQA 2OESA 2Y68A 4PLHA 4AJ1A 3VAAA 2JEYA 5KTKA 1IY2A 4C3UA 2OZEA 1UMKA 2GH1A 2YXEA 2FRVA 1IM2A 4OG2A 4PLFA 1YQQA 3GCGA 4C6TA 2IU6A 2J3HA 3OP1A 4RKYA 1EGHA 1PG0A 4RPHA 2GXUA 2OO3A 4KAAA 3CLHA 1ZGJA 2GNAA 2VBFA 2Q0HA 3AV0B 3H2HA 3CVYA 2P0YA 2VT6A 4LXIA 4RIHA 2FZ5A 1R74A 5JPIA 2UAGA 1V7PC 7ABPA 3OLWA 1BOOA 1FFSA 1GZSA 1U7PA 5LR6A 1NP3A 4M37A 2WWYA 2PV0A 4ZKDA 2VQ3A 4JXXA 3GUUA 4IDCA 3KQUA 1MQ9A 1JKFA 1SZJG 1LH0A 1U1EA 1Z2PX 3E82A 1PJCA 2BEVB 3FAKA 5GJVC 1TI7A 2HQSA 1O97D 4Q4DA 1EA5A 2ZUDA 3L1VA 4QFDA 1RCFA 4QWWA 3W9YA 3BTSA 4O4HA 3AEZA 2CEAA 1WXFA 1NFRA 1NRXA 4KYVA 3A05A 3DE2X 5CUQA 3EVEA 3LC0A 5DBEX 3Q12A 3PQEA 4M55A 5FUBA 5BMVF 1EFRA 1Q83A 3QYAA 1JTVA 3G6KA 5ELMA 1GWNA 1PGQA 3DBHB 1RWPA 3HBMA 2J0VA 4ENPA 1QMGA 5TQ0B 4AUNA 2ID7A 1EQUA 3CF0A 3I52A 3I4LA 1GGHA 1ZO8A 2ZUBA 4KK4A 1OA0A 2WB4A 2QLTA 4MVJM 4RDXA 1V7CA 4BNLA 5SY9A 2PSFA 3VR3D 4QODA 3DE3X 4C4OA 3KPWA 2XY4A 3WRYA 4N03A 1W1UA 3IUQA 3NBXX 5TC4A 2WDZA 4D74A 4JVOA 4DRYA 3QEBZ 2Y8EA 3EVZA 4PYIA 4ZTBA 1C4OA 2O5RA 3TCKA 2J9ZB 1LLDA 1Z07A 3DS8A 4FOLA 5I7VA 3C6XA 1IOWA 3R9XA 4KX3A 4H6WA 3LX5A 2NSDA 3GGJA 4EZBA 3FTQA 3O92A 2JAHA 1DZ3A 2C00A 3OG9A 3Q3IA 4CCSA 4E5NA 1YDFA 2FWMX 4K28A 4YV7A 2ZI7A 1ZH4A 2I99A 3HJHA 5FBZA 1YR3A 2ORED 1XXLA 1V3QE 5HQTA 4G56A 4Q4AB 5IAEA 2RHMA 5K4GA 4LGMA 2RFLA 4G1BA 2FWBA 1PRYA 3ROXA 2FN9A 1KP3A 1GNTA 3MUFA 3U4IA 3D8NA 3E6AA 3OTQA 4OI4A 3VR6A 2REQB 1WM1A 3HDYA 4YR7A 5FWNA 4GGPA 2C0QA 4QYTA 1U2SA 1IEQA 1U7TA 2QW0X 4MS4B 4F2DA 5KYWA 3OI7A 1BDMA 4IH4A 3P4UA 4DLXA 1RVDA 1Y5NA 4E5DA 1KEZA 3LXRA 1RP7A 4GGOA 2XCSB 2BBOA 3GI1A 2ODAA 1FTWA 2MYUA 4CIWA 1WXGA 2G3YA 3R24A 1R0ZA 1A8SA 1EVEA 4HXFB 4R8KA 3ROMA 1EWQA 3AOEC 4MIYA 4PYKA 5BORA 3DXYA 4ZGBA 5B6PA 4J0CA 1TECE 1EIZA 4AQ7A 3NH9A 3BDVA 3GLKA 5J3JA 2IY9A 3N8GA 3L79A 3N1UA 4LW8A 1QE0A 3MS7A 4KRYA 3ZIUA 4H4EA 1SBHA 1R9NA 1UK6A 3MWEA 3UOAB 1UOQA 1TXGA 3BZUA 3P52A 2RGAA 3EGCA 4L3WA 5IH7A 1RVV1 3VUFA 5JDIA 1UODA 2FY8A 2PFKA 3SYRA 2IYLD 4U4AA 2FZKA 3KELA 1FRFS 3ANYB 3ADKA 3H2YA 3AU9A 3LO5A 3PRJA 4L5IA 3WKBA 1ZVVA 4BEVA 5JFGA 3EIEA 4FT4A 2J46A 2V7TA 2ZR0A 1J9ZA 1XYVA 2EQ5A 2Q21A 1GV1A 1K8ZB 1ZKDA 4LHEA 4MJXA 5DV9A 3REGA 5I6DA 2GJAA 4M1ZA 3M8KA 3OA0A 3WB9A 3BL6A 4ZU1X 4DLUA 4N5HX 1KL7A 1QHSA 2PL3A 1ZY2A 3ECCA 1X94A 3SBOA 1GV0A 4BNHA 1XRSB 2RK3A 3QEOA 3EAQA 4BP8A 4QPDA 3FB4A 3TZBA 5IAJA 5FPYA 2VF7A 2YH2A 4M7PA 1ZR2A 2GARA 2JJQA 1N77A 4L08A 4QJBA 3TOXA 2UUPA 2ZIEA 3QVVA 3OOJA 2NO5A 3VOTA 1V41E 5KTYA 3FOBA 1W4RA 2C3MA 3E1GA 4TQUS 1DAGA 4W7SA 4AKEA 2C54A 5J1SB 1YZHA 2VAPA 5JZMA 3ZGYA 4YYZA 1KFKB 2A35A 3KZXA 1XVTA 4L7VA 1RXWA 1ZH8A 2H9AA 1H1TA 3CLTC 2A94A 1U7XA 4H27A 3CZMA 4XVQA 1EFVA 2JGDB 3OEHA 3GNQA 1SUWA 1N6PA 1T5IA 4PVCA 5DHUA 2L42A 4IPTA 3UV7A 2IUFA 4J2TA 1FNDA 1QO0A 1NOJA 1WV0A 3K9GA 3E27A 4PO1A 1PFVA 3WGTA 1VFPA 1R50A 4NPAA 4ZCIA 1N7HA 1UBFA 1QGDA 2AD5A 2ENUA 2WWTA 4OJQA 4BKUA 1G20A 3HKDB 4TPKA 2VRCD 4XZ3A 5DGXA 4Z0HO 4B4KA 1YAJA 2C5AA 3UIEA 1EEHA 4TVBA 4BFVA 5JWOA 4R83A 1YH3A 2ZP1A 4LQCA 4EJSA 1B8NA 1E9BA 3P2OA 1SVOA 2X3FA 1PFYA 3F6CA 4LWPA 1D6NA 3RQSA 1V16B 3M5PA 1RIIA 3CXUA 3IT1A 2X0EA 4NMLA 1RBQA 3CKKA 3I6QA 3O74A 3OCCA 3R76A 2HN9A 2C1ZA 4IWYA 1K5PA 3DG9A 5JXIA 4FZ3A 1RJGA 1RTTA 3N2EA 1ULSA 3JTMA 4MXDA 4Q1FA 2Q7OE 2XJ4A 3OQVA 5FJJA 4OA5A 1KK2A 3I5AA 3GN2A 4TS4A 3AVYA 4ED9A 2UDPA 4C01A 5ER9A 5AVUA 4JI4B 2X8WA 4YJ2A 2GTPA 3R23A 1JP7A 1E99A 1RMQA 5HOQA 1EFUA 5CT4A 1JEQA 2IU0A 4EUKA 3PPIA 1RXIA 3A9UA 1G5RA 4MDYA 3RROA 4DT1B 4EAAA 4Q3CA 5DYTA 5EMNA 1B1AA 3THXA 2HXGA 3M1AA 3DPUA 3C1UA 3VKWA 1H6CA 4F6CA 4IIBA 4MQEB 3RB8A 2X2EA 2IXGA 1KAOA 2B8EA 3ROEA 3WMFA 1KAEA 5J47A 2BP7A 5LMZA 2JIQA 3DDCA 2WTNA 2GPJA 4DQVA 5KYNA 1VPLA 2XMCA 2H2FA 4HNVA 1FNBA 3FCAA 4K1LA 1XVUA 4O2BB 3RT9A 1QG2A 2AG1A 1N2ZA 2HWXA 5CK4A 1F8GA 1HDXA 1MRSA 2VF2A 3GAAA 3URMA 1MPXA 4QREA 2W8ZA 2Q5IA 5FPTA 5KYWB 1HDEA 1B3BA 3CC8A 2ZBFA 3STUA 4Q3LA 5B2ZA 1YAHA 1U2GC 6YASA 5HVNA 1AHNA 1RAHA 4X20B 3WSWA 3O8RA 4Z2AA 4J1NA 1MGOA 3K0FA 3WE7A 1RAGA 1KDYA 1W87A 3T61A 4FUTA 3QKWA 2PKRA 3G0CA 4DQUA 10MHA 4RQBA 1JWBB 4S3MA 4RHEA 3FTFA 4O25A 2LPMA 2OVFA 3GJ4A 3GYGA 5GZ6A 4LCEA 1VI6A 3SZOA 5LQDA 1U3VA 4C2UA 2XEXA 1QH8A 1QF6A 3A9RA 2G72A 1LPOA 3BXHA 3I04M 2ZYSA 1H1LA 5KTTA 4R69A 5D6OA 2I80A 3GLIB 1X14A 2OFPA 2GHQA 3URKA 2P9HA 1JR3A 1GXSB 2ZB3A 1NATA 4H7EA 3RNLA 1A9YA 3IKTA 1QCCA 2RIRA 5DBIA 3K6SB 3F4LA 2YZMA 1O89A 3RC3A 4FWTA 4PGHA 2WT9A 1OLUB 2XQIA 4HUTA 2RH9B 3NM5A 3EGXB 4PE5B 1QIMA 1P6QA 3ZXIA 3O4JA 4AT1A 1ENZA 3NANA 3MOIA 4B8YA 1EUDB 3NWJA 1U0FA 1OTHA 2OY0A 1V9SA 5BT8A 4WWHA 1K7YA 3AVTA 2CZCA 5T41A 1FS4A 2PVSA 3HACA 2JJMA 4PGMA 1HSZA 3L3BA 4EFKA 3C98A 3UB2A 2ZUFA 1AKNA 2XUQA 3G49A 4OLJA 1WX1A 2DFNA 1XQ1A 2I22A 2KWIA 4PQEA 4UU0A 2IUTA 4YJFB 3ZTWA 4ACBA 5MFZA 4K1XA 1NW4A 5JC8A 5AVZA 1HKUA 4F92B 3ZIDA 1KI7A 2FUNB 4N5LA 4K2AA 1IH8A 1X7YA 5DYNA 4YXFA 3HBJA 4MHOA 5A2QA 2NZWA 3OQBA 4PZYA 1REQB 1Z45A 3K5HA 3WJ1A 1SJ9A 2P3OA 3W2FA 4PSDA 1ZL2A 2ZAMA 4RHFA 4D5EA 1CY6A 5EKTA 3KHTA 4QXRA 4IMJB 4MMYB 3R3HA 2EZUA 2CDCA 2OHHA 3OMXA 3GAMA 3TQHA 1H5UA 2XV1A 2NTEA 1HGXA 3UJBA 1GQRA 2X4LA 2YXDA 3H5WA 3VKHA 3KL2A 2DXIA 1JFRA 4R41A 2ZYDA 1MNAA 2C94A 1W8DA 4NZPA 1HOXA 2JLCA 2WFMA 2YRXA 4K5QA 4PHGA 4LOAA 1EFVB 2JGDA 3F3KA 5AM4A 2ZSJA 1SNYA 2NZUG 3BXEA 1DAMA 1JDVA 3H0KA 3LFUA 4IQ4A 4WFQA 4FFWA 4AJKA 2Y0BA 4JLSA 3EULA 4JDUA 5AW5A 4IIXA 2FDCA 2NT4A 3WIBA 1J06A 1U3UA 3OBBA 1NI5A 1JVBA 1NT4A 2VK8A 1BYUA 1H93A 3ICWA 3OHPA 1PKXA 3QNUA 3TCXB 1L5FA 1TU3A 1BH6A 2NZ8A 4MJ3A 3GOQA 3NGMA 4PR0A 4ETIA 4DPKA 1DBSA 1PTKA 1XZPA 4JX8A 4DV5B 2CXPA 4IM7A 5KAPA 3ASZA 3CZ5A 3GEBA 4U02A 4DSNA 4OQFA 3AI2A 2F1KA 3U39A 1S2IA 3VR5A 3EB9A 4AULA 5MHTA 4I1YA 4ZAZA 3GGPA 4X45A 2AOTA 2X40A 4QGHA 4MPPA 3EZXA 5JD6A 1Q7EA 1T5DX 2RB5A 4NE9A 4YP5A 1IVNA 3LCRA 5IDVA 3GIWA 5AUPB 3GP5A 2WVJA 4IG4A 2A84A 2PMEA 5KKCA 2QBYB 3GCWA 5KYTA 3S44A 3TNLA 4CR6A 1C0PA 1YZKA 2JFFA 3Q3CA 4IV5A 4IZ6A 2I6SA 3LF2A 3AHFA 4YALA 3SD7A 4YUXA 1BCRA 3RFTA 1KVRA 1XROA 3QFSA 1CKEA 1I14A 5IVIA 3VXKA 4YRPA 3AB7A 2VDMB 5I9TA 3SKVA 3V4FA 3BEOA 4MUMA 3FDZB 3EVCA 4WZBE 1C3EA 1PFUA 2D54A 4XUEA 4A9AA 5HQJA 2CYBA 2G4LA 1YZGA 3A6EA 3WYCA 1Z39A 1QOPB 1E6KA 3G2IA 3I23A 4JXKA 2WSLA 6AT1A 5JMTA 5L4NA 4ZYUA 3O38A 1OXXK 1Z15A 5ALZA 3LGXA 4DT1A 1IU9A 4DBLE 4PZ9A 3LUHA 4G0VA 1DAPA 5HF8A 2CKMA 3MAGA 1SQ6A 1PK7A 1E3WB 1X7XA 4ZOLA 1L3BA 3L8HA 1X1AA 4X44A 5KVSA 3Q11A 1PZFA 1DSSG 2P78A 4OYYA 5DHRA 2C8LA 3WGGA 4ESHA 4CV2A 3VSDA 4JLJA 2CDRA 5GY7A 5EXSA 5KYVA 3WMGA 1CNEA 1KI6B 1WHTB 1WP4A 2A3RA 2W98A 1SVIA 1LEHA 3EFOA 5AK5A 5AM1A 5EAIA 5KYXA 5K99A 3TZLA 1BS9A 4HNGA 1L7OA 3NNDA 4KXFB 4AYXA 4CUZA 1XVAA 1OXUA 3GFOA 3LL4A 4W1PA 3BFVA 1LS1A 1SU8A 1NNSA 4ZDKA 3VAZA 5JS1A 5GPBA 5LU9A 2D2XA 5FP0A 1OVGA 3ACBA 4DM4A 3AWDA 4BU1A 4L4RA 2VWQA 3WRXC 4IILA 3ZCPA 1IY1A 1SQSA 2X9QA 4ZPXA 1A5AB 3ZV7A 5JQGA 3SHTA 3AR9A 3OE5A 2RONA 2J0QA 4B3SB 2KYRA 3A1VA 4R9UC 2WQZA 3NT5A 1UOOA 3TZKA 3AUUA 3U7QB 4AUMA 4EH1A 3W2HA 5HUQA 4WTOA 3I2HA 1U8TA 4MVJE 4X93A 3LZ6A 4NWIA 5TPZD 1J7KA 1XF1A 4NMHA 2W6ID 4UNQA 3RFFA 4PAOA 2ZRPA 3GPDG 4MV0A 2EC5A 4B6FA 4HH3C 2AZDA 1SB8A 2Y1KA 3IIMA 4EG1A 1X1TA 3IJEB 2WINI 4XI9A 3L4KA 3AY6A 3TOVA 3LWDA 4F4CA 1KQFA 4HEHA 1DP4A 1E2PA 4PX9A 5EERA 1SQ0A 2EEZA 4FQ7A 5DLDA 4F91B 4DXHA 1EUDA 1G5PA 1QTNA 3RVMA 4DLWA 1V45E 4AY6A 1KMMA 3DMDA 1WEKA 3LQFA 3MW8A 4E31A 1OFHA 3U60B 3O26A 3A4VA 4KQ9A 5D85A 3QU4A 1HDIA 3IJRA 3E9CA 5FUWA 1UADA 2PX8A 5ESRA 4MUBA 5KVCA 1JNYA 1TC2A 4D7AA 1IOZA 3NRBA 2HLDA 4O4IA 2QA5A 2Q29A 3PUHA 1RR6A 5DOVA 3RS5A 4WRRA 3KPUA 1TIPA 1PEAA 3RIMA 4DJFC 4FI3F 2D0DA 1FY2A 4V03A 3BJMA 3VGPA 4RTRA 4P82A 1DJMA 1KRXA 1J1IA 6NULA 4XWTA 3B38A 3BCRA 2R6FA 1P19A 2B7LA 2E6UX 3D3WB 4FQ8A 4DG9A 1SCIA 1X7ZB 3BMOB 4DQDA 4ZTZB 3LYAA 1PQYA 1N0WA 3QKRB 4WGGA 3KQVA 4M8KA 1WTAA 1M1YB 3RO7A 3R3YA 5ALNA 2EBHX 1B43A 1IZ8A 5L45A 1YV9A 5TF0A 2PH1A 3IJ5A 1A4IA 3L8GA 1ABBA 2GBFA 1CRQA 2BZGA 2IXAA 4IWXA 1XNRB 4C2AA 4XDGA 3C74A 2QQ0A 3OPXA 4BWGA 2OMEA 2X15A 3F6EX 2CXQA 5IC5A 3AI3A 2RARA 1KY3A 5KDOA 1Z0ZA 4OEHA 1PQ4A 1IOLA 2BKXA 4M38A 5DYGA 1Q0PA 2POCA 3HYRA 1LDBA 3G0BA 2AOTB 4YEDA 2P68A 3H8SA 3LD9A 3AERA 3PNQA 3TE7A 5TPZA 3ZDXB 5J2TA 4GI7A 1JDNA 1NQVA 1VIAA 2WB2A 3FCCA 1UT8A 3RPEA 2UYQA 3FKJA 4QXQA 1NZDA 1U98A 4PCLA 2JLYA 2B4KA 3ZQ6A 2IZ6A 4KFCA 4PN3A 2WNHA 4FOTA 2C9CA 2GF2A 1OU0A 1RLOA 1TUGA 4EJ2A 3T99A 2R9VA 4M8IA 3TKAA 4I8DA 2J41A 4K9QA 4DVGA 3D3EA 2JLVA 5A5GA 4Q00A 4IOMA 3NV7A 1QVZA 4B35A 1FOEB 2BC9A 5JASA 4C4RA 2IHYA 2QL9A 1K92A 1ZG3A 2I87A 3OEWA 1M8JA 3QP9A 1QAMA 2JIZD 3BA1A 2J87A 4RPCA 3T6KA 4Y2JA 3UATA 4YCCA 1FZTA 3VR6D 1ISIA 3TTYA 2MDTA 1P2GA 5IW8A 2DSTA 16PKA 3WB2A 1DTWB 1RM5A 4RS4A 4Y1FA 2AHOA 1J1UA 1E9FA 2JD1A 3K4QA 2B92A 2PA3A 1CFZA 3LDUA 5GAJA 5CXSA 1MF7A 5CFQA 3FNBA 1EJ2A 2NVOA 2QVLA 1TGYA 3C3XA 4WI1A 4B6SA 1WUYA 2ATIA 1C7ZA 1Z22A 1H2BA 5KSZA 2IDZA 4UE6A 1KI6A 5UKDA 5H1YA 4YMVA 4COKA 4L3VA 5C3UA 3WNZA 1IRXA 1Y3IA 2JRLA 4OPMA 1O5TA 4I50A 3CLUC 1GL6A 2R87A 2ZTLA 3TSWA 2WDPA 2Y4OA 3P0RA 3ZCTA 2HEIA 1A04A 5B1IA 4FS8A 3STTA 1ZH6A 3N75A 2PSHA 2Y1EA 4H60A 3KHKA 2ZPUA 5BRNA 2NU7B 2BFDB 4CIDA 3K1AB 4NDZA 2BGRA 4TQGA 3FYUC 4FCCA 4LHSA 2Y1WA 2GCOA 3WQQA 1HE4A 2AN4A 5BSMA 4JI0B 3LQQA 2OWDA 1X77A 1YJXA 2KMLA 1RAAA 2Y93A 2VZEA 4B4DA 4BMVA 1K0FA 3ZTTA 2ATVA 2VJKA 2HB6A 2TMKA 3RSSA 3ABIA 1GNSA 3HCOA 1QS0A 3HCRA 3HKCA 3HCFA 1EJBA 3PFHA 4H4CA 2Q3EA 4L8VA 4P3XA 5D84A 3Q6IA 4BO9A 4WBNF 2H7CA 3I5XA 2A5LA 1SUDA 2PIDA 4I4CA 2HZBA 1PEYA 1JA9A 3G1TA 2FP4A 3ZV3A 4HAOA 1QONA 3MINA 4UHCA 4XIIA 4I81A 1JIKA 2H1LA 2O1XA 4YRIA 1OH6A 3F5QA 2P65A 4LNUA 4WA7A 5FAKA 5KNBA 1P0MA 3B7PA 1JI0A 1GN8A 1A8PA 2XT6A 4MV7A 4V0KA 2C5BA 2VJPA 5D3MA 1LD3A 1GQYA 1KI8A 4ZHQB 1RM0A 4UW9A 5C5CA 1CJCA 5LMUB 2PUGA 2EG9A 4M0LA 2DFVA 2YFYA 3K96A 4Y9TA 1BXKA 2ZRQA 3TE6A 4FHEA 4DJ5X 4RK7A 4FNAA 4OI2A 4BLRA 2WR8A 2CD7A 1P3JA 4Q1EA 4B43A 1XMJA 4L3OA 3D02A 4JSTA 5JXWA 3L9WA 4U0JA 1X8JA 3JSXA 2FSVC 1U1DA 2X1VA 5TVKA 3GGDA 3OEHD 5SZHB 4DBVO 3B1XA 3CZQA 1QHFA 5KOJB 3OPYB 3G2OA 3OJXA 3SLGA 1E2LA 3RHSA 4RUKA 3DAHA 5J2UA 4M49A 2GLXA 1UKVY 4J43A 1JAHA 2PX4A 1FXSA 2REBA 2J0EA 1GAJA 2EZ9A 3CZ4A 3R2JA 3UW3A 4DV4B 5GGXA 5AW6A 1NUHA 2D7DA 2H7VA 5K8VA 1JHZA 1QP0A 2H5JA 1A2KC 3ZE0B 2CV1A 1OBOA 1Z26A 4HATA 2XE8A 1M75A 2Q07A 1BXGA 4QO7A 5KJ1A 1NPDA 1E0AA 4AUEA 1GZVA 4YPFA 3IB3A 2Q9BA 1NVGA 4NYIR 4YAJA 3WWEA 4CZ2A 5IJZA 2YVLA 4FGUA 3LHKA 4A16A 3HXMA 2QPAA 5DSXA 3C3AA 3WQHA 3N58A 2ZJOA 1YRHA 4BJ1A 2CVHA 3CRMA 2JEZA 3BCHA 3CLUD 1KPGA 3VC2A 5JBQA 3LVFO 4ZU6X 1FYWA 3PUYA 3Q7EA 3TM4A 2JFYA 3F2VA 4HTAA 4JGGA 2NSYA 3R7DA 4TS1A 1GAXA 3OQNA 1N2CA 3HJGA 3MOGA 4PW0A 4O4HB 1FP2A 2GZ3A 1VMEA 4C0AC 1D4AA 2PK3A 5B3JA 1N1MA 3AVQA 3BORA 3MPOA 4GSYA 2C4KA 5JAUA 2DTXA 1KI1A 4R1PA 4G24A 4JC5A 3R09A 4UMDA 3PS9A 1PSWA 4B6JA 2KB0A 5JNTA 2O50A 4HPJB 5FOWA 1W93A 2ZTUA 3EASA 3EQ2A 4LHVA 2WUDA 2OHXA 1QXSA 4OHWA 5G02A 1GG2A 2A0XA 4Y7DA 1H6BA 2ES4A 1TE2A 1I1HA 1QMPA 1TK3A 2ADFA 3FPSA 4BNIA 2VI5A 5EJ8A 4EO4A 3E9RA 4G2NA 1DQNA 1J8YF 1ZIOA 1NNEA 5K0BA 3SIXA 3NYRA 3V6MA 2GD6A 1A4XA 1JQDA 1ODJA 2R85A 3DZJA 3M6FA 2OOKA 1IZYA 2XUJA 3B89A 4IEFB 3VPXA 3RU3A 3T54A 1H3EA 3MCVA 4Y0VA 1LDEA 2W93A 2X4DA 2G9NA 2QN6A 2QJRA 3D6VA 3TS1A 2MSLA 5CA0B 5IU6A 4MDFA 3N0TA 4MWCA 1Z4QA 3OAAA 4IIHA 4BPBA 4GT1A 4RVUA 3O8BA 4JBLA 3OIVA 4RMGA 1KQPA 2PUTA 3A6DA 1PW5A 2Z43A 4ZV9A 2V7UA 2PJRA 2WICA 3Q72A 3S2GA 2VJQA 2WPNA 2DHCA 5L3RA 1T26A 4CFYA 3LT0A 1Z7BA 4L7QA 4GKKB 1DEOA 3PCTA 5CNIA 1QM5A 4A92A 1HR0B 1MDBA 4W9RA 3E5RA 2PH3A 1WF6A 2JI9A 3LDFA 821PA 5FA5A 5HE8A 4BRWA 3LT1A 4HNSA 2QAIA 2WMNB 1PJZA 2X5JO 2Z4RA 4JT8A 1D9XA 4G81A 5FB3A 3AI1A 1Q21A 1E7RA 4MS1B 4F1KA 1M34A 1B42A 3KDAA 1R0XA 2SICE 3EBOA 3QVWA 2FUKA 2ZITA 1ADFA 3ESQA 4XFKA 1IQPA 3HBNA 1DO2A 1RMTA 2Q1WA 5FI1B 2PRIA 1KSGA 3IUBA 2QMHA 1JKXA 3SFVA 3D7KA 1ZD1A 4B40A 2WWVD 2WJVA 4S05A 1AURA 5A0VA 4ZYLA 1NXVA 1ONSA 2G9VA 5C9ZA 4JGIA 1JXOA 3N0WA 4YLEA 5CNMA 4B33A 4RSGA 3DO6A 3O7WA 4FYPA 2B83A 3MB5A 2FWPA 1YTLA 2VPZA 3K73O 2RGDA 4IP0A 4YAIA 1SMKA 3FMPB 3UH0A 1RHQA 2Q27A 1RXEA 3F0TA 3JQAA 4JMLA 4PLVA 5HE9A 5JYDA 2BFOA 3L06A 4HDSB 4X1KA 3R9XB 3KKNA 4FC6A 4R7TA 1Q0UA 4KL8S 2WHYA 4C08A 2J4DA 3ON5A 4TTTS 3T7TA 1V26A 1BQEA 4PQRA 4F5EA 1K68A 1JEDA 4ID9A 1HV8A 1YA6A 1GFZA 2IT1A 4B5KA 5MFPA 4C7VA 1JQAA 4YUVA 1PL6A 2W22A 2ZIUB 4NVRA 5JE8A 1AU9A 2TS1A 3FWPA 3HWX1 3OKPA 3NP7A 3I8XA 721PA 1P1IA 3PT5A 1Z75A 2H1RA 1ZMBA 2CK3A 2J1LA 2NZVG 2UVPB 3RUIA 1GRQA 4I6EA 4HGOA 3WQRA 1BE6A 1E8NA 4E0BA 1NVBA 1XAHA 4DMHA 3BTOA 3UV3A 4D8WA 2WC1A 4CKXA 1WABA 1IN7A 5DHPA 1B0PA 2YICA 4X6YA 5A3VA 4JBYA 4XRGA 3N2GA 2ZR8A 5EHIA 2J59A 2WILA 5KNLA 3GA0A 1BCSA 1IATA 5ADWA 1IZZA 3GCDA 3L8ZA 1GSIA 3OPYA 4TX1A 3L7MA 4WEQA 3RS8A 4MYHA 2M6KA 5EP2A 2IV2X 2VDPB 4D02A 4WNYA 5I5GA 4IEIA 3O4FA 4PYNA 5E2AA 3KR2A 4GECA 3RHZA 1CB7A 2DBZA 1CCWA 2VLBA 4EF6A 4YPVA 1LQTA 1G5QA 5ITWA 1ZRMA 4CFZA 1JVSA 3FOAA 4G0MA 4D44A 3H3JA 2IU3A 3PXCX 4UTNA 2I34A 3L41A 4FKBA 5A0TA 2JKVA 4H3HB 4U8HA 1J21A 3QU2A 4RETA 1CIJA 4Q3KA 4ZA2A 2JI6A 4XX1A 2V3WA 4HJXA 3S1SA 3CX3A 2P7IA 1F5NA 3SNKA 3PXBA 1G98A 2VQFB 3PXXA 3V97A 1E5TA 3IPLA 3M34A 4BLWA 5C8YF 3P26A 3QLJA 2PUDA 2BKAA 2JFHA 2UVQA 1BVYF 3O8LA 3UA3A 2FEKA 2RGNC 2Z1MA 4MVJI 3RYHB 3TI7A 1O58A 2WP0A 1C7QA 1X13A 3W8NA 4U9UA 2RKBA 3HDHA 1JG1A 3PFWO 1PQWA 3DHWC 2E5LB 4JDPA 4Q39A 4XGIA 2BFFB 2H29A 4KIFA 4O2RA 3EMBA 3F5DA 3TJMA 4MKXA 2W6NA 1U11A 2QMEA 2NYUA 4XYEA 4FJ1A 4P86A 5C1IA 2V4MA 1Z4OA 1E2NA 1PBNA 4TZ6A 2BR3A 4Z2YA 2FUEA 4R3WA 1IBLB 4BNUA 4YP9A 3IBYA 1VMKA 4H1HA 4E33A 4MWGA 4LRXA 5JBNA 4CM8B 1J0EA 4GYYA 1E18A 4EARA 4LXHA 2C31A 4RADA 4WOJA 4Z1OA 1GRCA 4HF7A 1XDZA 2DCMA 4E5KA 2YV5A 4WBNA 3QXCA 5C53B 3OEED 4FIDA 1Q1NA 1P17A 3WLMA 1IJEA 1F2TB 3CX4A 4RVNA 4ZOAA 1KZ6A 1E7MA 4MR9A 2VTBA 3DZFA 4CT4B 3BRCA 4UTXA 2Q5OA 2V58A 1T4GA 1YIDA 3TIIA 2AEFA 1IJBA 1A50B 5JWRA 5FRDA 3ES9A 1O8BA 2QRKA 4R8SA 2FXVA 2OFOA 1H66A 1JSLA 1GADO 1UM8A 3QEKA 4PSCA 4Q7EA 4AJIA 5J4VA 2QTAA 1Z34A 3F46A 4CMIB 4EG6A 2IH5A 1JL3A 1WY7A 4UREA 1G5HA 4WXPA 5CEJA 1EB9A 1VKRA 3FYUB 1SPBS 1M8PA 3RT1A 1Z5WA 2IS6A 1QIHA 3CG0A 2AHRA 5AESA 2ORIA 1T1RA 3TL3A 3BVPA 1O5OA 3DZKA 1U94A 1MQSA 1GO2A 2X7XA 4GYJA